3K9LA

Allosteric modulation of h-ras gtpase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
159
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEFDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oncoprotein
molecule keywords GTPase HRas
publication title Allosteric modulation of H-Ras GTPase
rcsb
source organism Homo sapiens
total genus 58
structure length 159
sequence length 166
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3k9lA00
2B21A 2W6ID 3X2SA 1DG3A 5J4LA 2NZJA 3EZ7A 5HE9A 1RVDA 3SJBA 5AUNB 4QGGA 3AM1A 2ZSBA 3QF4B 4TMZA 4C3ZA 3T15A 1AQYA 1DOAA 1SVSA 1NRJB 3GLHB 4GI7A 3B1WA 2F43B 5EXXA 1DO0A 2AKYA 1A1VA 4YMTA 1LV7A 4LOAA 2QMHA 3LD9A 2ZRLA 4K8OA 1Z47A 4HUQA 4JVSB 4PO9A 4NYIQ 3OE7D 5JI3E 2PCJA 2G6BA 4B3GA 2QENA 2R9VA 5CIWA 2EVWX 1T9HA 4HDCA 3B85A 2JLZA 1E1RA 4MYHA 5L3QA 4C7OB 3JZAA 3LBIA 2QN6A 2CVFA 3B1YA 4TL6A 4U5XA 2QGNA 3QKUA 5LD2B 3QPVA 2OM2A 3QPWA 4IHQA 3HU3A 2Y8EA 4NH0A 4BLOA 2VP6A 1GRRA 2QP3A 1X8KA 3DVLA 3K0AA 3OIWA 3CF0A 2ZI7A 1E2LA 4M1KA 3W3AA 2AD1A 2A7QA 4I1VA 2CHGA 1ZM7A 4F93B 1ZIOA 3BK7A 4JVMA 3ONWA 3T5DA 1E0SA 3I92A 5BXQC 1UKYA 1G41A 3GJ4A 2FX3A 5JRZA 2XXAB 3AGQA 4V03A 5F98A 3NEYA 2HLDD 1D6JA 4URUR 2HF9A 2IBMA 4D26A 4MRRA 3BH6A 4I81A 2R44A 1MABA 3OFND 4AY2A 3RS3A 3BBPA 2IW3A 4M8NE 4Q4HA 1SXJE 4RD1A 1GTVA 3WP0A 5KU1A 3CF6R 4GMDA 3KTAB 4ZIRA 2GBLC 2AXNA 3OESA 4GPTA 4QHSA 4URXR 2FSFA 2WKRA 2PT7A 1NN3A 1OXVA 3PUZA 3K9NA 1ZUHA 4H1UA 4O2LA 2ZXUA 2O8EB 3A8TA 1UADA 2GZAA 4FCWA 5DIFA 3Q5EA 2GCOA 4MDEA 2ZU0C 2ZRKA 4M53A 4UQOA 4UXJA 2AL7A 3R8CA 1DAIA 1M8PA 1NN0A 221PA 3AQ4A 1OFIA 1VG9B 1M1YE 1PZNA 1ZNXA 2C03A 2OFOA 4ZKEA 4CEJB 1KO4A 4POAA 1NMZA 4L15A 421PA 2DWPA 2FZ4A 1HY3A 3DZ8A 4DDTA 1RKBA 3T1VA 3MD0A 5DLQC 4QKQA 4GFDA 4OJKA 4R98A 4WIAA 4FCTA 3KX2A 1XXHA 3K0CC 1GITA 3L0IB 1OXXK 1G7TA 2IYRA 3REGA 2REBA 1G17A 1XPRA 3RRYA 1E2QA 1XF9A 2QPOA 5EE3A 3UXMA 4QBGB 2B8WA 4PHTA 2WWFA 2B92A 2VP2A 2CCGA 4PTLA 3LXRA 4H1VA 4Q1CA 1BMFA 4A15A 1NIJA 3A4MA 4LBVA 4M22A 3IKJA 4PHGA 4X8OA 3TIFA 3VU9B 4CZ2A 2IYLD 1F60A 2IF2A 2BC9A 2ZSEA 3OE7A 3KXKA 1EX6A 4OHVA 5IRCD 2EFDB 2GF9A 3K09C 3OF5A 3NH6A 1K8RA 4IVPA 2QY9A 4FMCF 3NEJA 2JIZD 2W00A 4DLWA 2ZQ5A 2JGNA 4JMPA 3PXGA 1NLFA 2JDID 2IEYA 4D25A 4ZDWA 1NY5A 1XTIA 3BB3A 5JZVA 1FUUA 2BDTA 1N3BA 2V9PA 1JALA 5BQ5A 1S9HA 3IGFA 3IILA 3IIKA 1UKVY 1R7RA 3QEOA 4DWJA 4X8HA 2IYUA 3VR4A 5E7JA 4L4UA 3TGPA 2CJWA 2H17A 1E2GA 2UZ3A 3NDBB 2CNWD 3EWAA 4PQRA 2ZYVX 2HLDA 3REFA 3MMPA 4JLKA 3C15C 2FPMA 4US2R 2NOAA 5JWHA 4LPKA 1RPZA 1EX7A 2O8CB 4Q1BA 3K70D 2GILA 1KO1A 2C2HA 2VRWA 2XTZA 2AXPA 4KODA 1GKIA 1SVWA 3T1OA 4HZUA 4ARZA 4Z54A 1KJYA 1YR9A 3EIQA 1TTTA 4A8JC 1YR6A 2ZI3A 3I73A 4B48A 1Z07A 4GOXA 4NBSA 1M7GA 2XZPA 4FIDA 4DBLC 1W49A 1JEDA 4GSYA 4MKGA 4RCZA 2A9KA 1A2KC 1XD2B 2X2FA 4HDQB 4Q4AA 5FI0B 1COWD 3W3ZB 3ND9A 3GFPA 4V0MA 3WNDA 4B3DA 4TN1A 4N1AA 3RNLA 4DLXA 1G7RA 4KI0A 2V55B 1CULC 2F6RA 4LHZA 4IFEA 3D7MA 2GKSA 5AJYA 2JLRA 3ZJYA 2YC2C 3VR5A 4WAUA 3B78A 4HLDA 3UWOA 4G0NA 1XCMA 1Z3IX 2ECKA 1HTWA 1ZNZA 1YZNA 3IO5A 3IQXA 3OAAD 3W6OA 4MRNA 5DH9A 4PPNA 3L43A 5DI9A 1PUIA 1UFQA 3B1ZA 3MLEA 1RJ9B 4D2IA 1AK2A 1W1WA 2C9OA 2GXQA 2GF0A 4BGDA 2AKAB 1Z22A 2ZYUX 4PO1A 5FTNA 2WWXA 1QZXA 4CGZA 3EAQA 3QKSB 3THYB 3HPRA 4KAXA 1DO2A 5EXPA 3SN6A 2NIPA 5CB8A 4TYQA 4P4TA 1BO6A 1QG4A 5TMPA 1G8FA 1H8ED 4D80A 4B2LA 3GJ7A 5F9FA 4PXAA 4Q4LA 2JIZA 5LB2A 2QM7A 3RRMA 4LJYA 4LYJA 2G1JA 3SFVA 2JDIA 5IHPA 2IF0A 2V6JA 3U5ZB 4QM6A 4JBXA 1KDOA 4LJ5A 3LX5A 3C14C 3PG5A 4RD2A 4A8JB 2QA5A 4URYR 3NC1C 4Q9IA 2WWYA 4IOJA 4DUGD 2WOOA 2JLVA 1RRPA 5JSZB 1KI3A 4JLJA 4KFSA 1YE8A 1DADA 4B6EA 3F8TA 1CR1A 2JJ2D 4NE2A 1GM5A 4Q1AA 4M9SA 1XMIA 2EFHB 5EP1A 3ZVLA 3BXZA 2QRZA 1KTVA 3QG1A 1XEXA 4KCGA 1MV5A 3LQRA 3LBNA 2JLUA 4M1YA 1EWQA 1W46A 3I72A 3CUEF 3ICQB 1US8B 2DFNA 3BB1A 2RMKA 4OHYA 4YC7A 2GHIA 3R7WB 2ONJA 1F5NA 2A30A 4ZI2A 2J7PA 4AURA 2ZI5A 1FUKA 3QUSA 3VNUA 4ITRC 2P3SA 2IS2A 2GAAA 3FMOB 3AVPA 3QQ5A 2KBEA 2P2LA 2ZR0A 3LLUA 2ZJAA 3K9GA 3AVOA 2MSEB 1XZQA 2QSZA 4GNKA 4RY2A 3B6EA 3GJ6A 1DEKA 3LVQE 3WHLA 3GCGA 1GNRA 3WMFA 2J3EA 1XJ0A 3PUXA 4LWZA 3SYKA 2C95A 2PJRA 1KJZA 3W8NA 3E1SA 3CW2A 2IYTA 2F3RA 3EC2A 1N6NA 5B2ZA 4Q03A 2BKEA 3HU1A 4BLPA 2QTVB 3OAAA 4QRHA 3DO6A 2GJSA 3GEIA 3FOZA 3A4NA 2F1JA 4DEYA 2ANBA 2ZANA 3ZS8A 2NGRA 1FP6A 3WP1B 1KKLA 2ZIAA 1HT2E 4DC9A 2BMEA 3KKNA 2BBSA 2F1RA 4LHXA 4DDVA 4WW0A 4XSHA 1G5TA 2HV8A 4M9QA 3SFZA 3VNVA 1QHHA 4TMKA 1T0JB 2GK6A 5KOYA 1BIFA 1LB1B 3GFOA 4IJMA 4XVQA 4TQAA 3FB4A 3FE2A 4GOKA 521PA 1XTSA 4PQFA 2JEOA 4XD7A 1J8YF 4NONA 2WMOB 1S4QA 1S8FA 1H8EA 1R2QA 4KBGA 5D3MA 1XU4A 3GLHE 3A1UA 3A1SA 5CJPA 3UWKA 4A36A 1Z0FA 4URZR 3D31A 4EPXA 1HQYE 2QTFA 5J4KA 3HPQA 2BHRA 1CRPA 4L16A 2WSSD 4E03A 2FF7A 4Q19A 3SOPA 3SBDA 1EFRD 3A1VA 5EUMA 5FTMA 1W4CA 5KPJA 1NVVR 2F43A 2GA8A 1L4YA 3WHKA 4CEIB 2PEYA 3TAHA 4B76A 2JA1A 1GILA 1ETUA 4LHWA 4RD3A 4NCNA 3VKWA 4W7SA 2H5EA 2WJJA 1UPTA 2JJ2A 1W36B 4M2LA 1H65A 3FHOA 1VECA 3HU2A 3SR0A 4C7OA 1KYIA 1MT0A 5EP2A 3R8FA 2ZAMA 4OI4A 4HYYA 2WM9B 1AGPA 3PEWA 4QL3A 4DCVA 5AWFC 2DR3A 2J0UA 1OLOA 4K81B 4MRPA 1R6BX 1W0JD 2H1LA 3K0EA 4RZUA 4CRWB 4E5UA 621PA 4OKSA 5DN6D 3W90A 4JLVA 2CLDX 4OHXA 3EIEA 3EIHA 3ECCA 1WBDA 2YHSA 1NG9A 4XWOA 1UKEA 4BFXA 2ZRNA 4BFTA 1FTSA 1Z2AA 4PC6A 1V5WA 2BKUA 3LH5A 2REXB 1X8JA 1A82A 2XXAA 2OUKA 5JWRA 1D9XA 1JAHA 4PSKA 2C9CA 4OQFA 3CX7A 1HUQA 1Z06A 1S96A 3FMPB 1YJ5A 1E4VA 1S0UA 2J5XA 5JLJA 3AEZA 1I4DD 2OCBA 3VR6A 4FMDB 2QL6A 3DEFA 4NCHA 1QHIA 1J99A 1KOFA 1W44A 2J59A 1MRNA 3KKOA 3PEVA 4B74A 4PSAA 2QM8A 3CRMA 4AYXA 6Q21A 2R6DA 2WBLC 1T91A 4YDSA 3I8SA 4IOKA 2XOKD 1RC8A 2NMVA 1G3RA 4TTPA 3IHWA 2D62A 3U44A 4HB0A 1FQKA 2OFWA 2WSMA 4HEJA 4PO8A 5FOVA 2HEIA 2W6JD 1Q1BA 2VLIA 2W2XA 4Q5IA 2PMKA 5E95A 1LF0A 1N0VC 3KJEA 1Z0AA 1T8TA 1KI7A 3SJZA 5FOXA 1E6CA 2QT0A 4Q1EA 3L0PA 3AP1A 3H2YA 1W7AA 1U0JA 2C8VA 4KFRA 4AG5A 2HCJB 3NHAA 1RYFA 1L7VC 2ODEA 3CB4A 4C0LA 1QVRA 1KNXA 3AP2A 1II0A 2Z6VA 2CDNA 1G4UR 1EFRA 1E9EA 4TSFD 3QXSA 1GFIA 5ANRB 4MKIA 5JS8A 4QNMA 1PUJA 3DMNA 4CDGA 3VU9A 1JI0A 4F38A 4DLTA 2Q3FA 3TH5A 2IL1A 4XVUA 3TUJC 4GDFA 5FBLB 3CR7A 4QGHA 1T4GA 2XX3A 1NL3A 2ZPTX 2GETA 2GCNA 1Z0KA 2JLSA 1G5PA 5FH9A 3CZPA 4Q48A 1JNYA 1G64A 1KI4A 3QIAA 3T06B 5L3SA 2QROA 3IHLA 1W0JA 5HR5A 5AJVB 2CHVA 5DN6A 2ZS9A 2ZTSA 4HLUA 4BWYA 4A92A 1U8ZA 1IJFA 5A5GA 2FGJA 3P26A 3AVQA 1N6IA 4Q01A 4A2WA 1SULA 2KJQA 4BLSA 2OHFA 2Q3HA 1GUAA 2WPDD 4LYAA 4DCNA 3L0SA 4W5HA 2CCJA 1KMHB 1ZUNB 1N6KA 2CHQA 4KLZA 4JKYA 4KSBA 2QE7A 4OK6A 4V02A 3TJZA 1MRSA 1S2MA 3JZMA 4LV8B 3VHXA 3BERA 1D2EA 2ZUBA 2V6IA 5H68A 2F1HA 2BM1A 1SZPA 4E22A 4ASUD 5B64A 2C5LA 4HB4A 2C99A 4KVGA 2MSCB 3T35A 4B44A 4L9SA 3UK6A 2WWGA 1KI6B 1Y3AA 1KY2A 1MH1A 1RFLA 4NTZA 5DI3B 3AH8A 1Q3TA 3W34A 3KQLA 3QBTA 1Z63A 3AVUA 4B6FA 2GEVA 1XEWY 2GRJA 2XOKA 4Q1FA 1KI8A 3DM5A 3EASA 1TQ4A 1XD2A 4D0NA 1K5DA 1E9DA 1R4AA 1ZC4A 4Z51A 2PBRA 1KO8A 4FW9A 1YRAA 3UKDA 3DHWC 2W6JA 4UNRA 4C0BA 5FPHA 1JQJC 2IYVA 3LFUA 5J4VA 5KUTA 4EJSC 5JHGB 3U61B 3V00A 3CX6A 4M9ZA 2C96A 1VCOA 3KKMA 2B7CA 5L8VA 3IEVA 1UDWA 1SKQA 4IEIA 1Q1EA 4FCVA 1MO6A 4B73A 4G1UC 3P1JA 1OYWA 2XITA 1MR3F 3L0OA 5HE8A 1KIMA 1IONA 2HT6A 2ZETA 1Z2CA 3W6NA 5JWOA 3KQNA 2H16A 3UATA 4KXFB 3TVTA 1J70A 2QAGA 2QQ0A 2B8TA 1JR6A 4OHZA 1KSFX 2YV5A 4LDJA 5CJ2A 1NIPA 1QVAA 5FPYA 4PHFA 2D74A 1SVKA 2AK3A 1R0ZA 4TSFA 2HJGA 4TTQA 4DT1B 1VG8A 3QKSA 3ZIAD 1KO5A 4JS0A 1WB9A 2R62A 4CW7A 1G3MA 2OXCA 3AKEA 3P20A 4TWZA 2D06A 4A2PA 5EUQB 4Z1MD 5KDOA 2QMOA 1JPJA 2AWOA 5FBWB 4C4PA 1OIXA 4JLOA 3WYAA 1ZP6A 2CL0X 3LWNA 1XPUA 2ZYWX 2AD5A 1Z6AA 3C7KA 5JCPA 2HXSA 1VDZA 3WRYC 4LSGA 3SJAA 1J8MF 1OXTA 3ETLA 3MSXA 4Q66C 5AJZA 4RFVA 3IEUA 5KDLA 3QXJA 1TPZA 3RAPR 4TTRA 2PJZA 3P4XA 4M1OA 4B2IA 2QT1A 4AC9A 4HAUA 3ZZTA 2FFBA 2C04A 2V7QA 4TQUS 2YWFA 5FOUA 5DHFA 2WKPA 4EPVA 4Q02A 1XB2A 5LDDC 3TK1A 1CJTC 2AX4A 4PSVA 1W36D 4Q9LA 1O3YA 2IEZA 1EFHA 1W47A 1ZD9A 2OAP1 2QBYA 3IO3A 3EARA 3IQWA 2G83A 4IOMA 2OFXA 3QVVA 4BEJA 4GBMA 3RDPA 1UEIA 1U94A 1YR8A 2JJ1A 2WJVA 1IHUA 3BWDD 2NPIA 4G5SA 5FBQB 1US8A 3U7FB 1WQ1R 1Z0JA 4DSNA 1XP8A 2IUUA 4S2EA 4E07A 1T3HA 4GRAA 1KHTA 1W4AA 1KGDA 3QE0A 1NLZA 4OQXA 3U3KA 1Z0IA 2O8FA 3WYFA 1ZRHA 3PIRA 4JBYA 5B58C 3VR2A 5CITA 1M34E 1OYYA 3BRWD 4JLNA 1RRCA 2CK3D 1SVIA 1XNJA 4OI1A 3OEHA 4JJKA 4HATA 1G8HA 4NZYA 3JVVA 1UAAA 3WBJA 4B43A 4GL2A 4LV5B 5KSYA 4W5WA 2BVNA 3EXAA 4ZDJA 3I32A 1JEEA 3U60B 3SZRA 2UKDA 4LYFA 1KMQA 1N2CE 4QJ3A 3FKSD 1S9DA 3P4YA 1G8YA 3Q8XB 2G88A 3C41J 4ZDIA 3AVVA 1M2OB 3G5UA 1IQPA 2WKQA 3VAAA 4MYUA 3QXHA 2WJYA 3WRXC 2H92A 3KJHA 3PEYA 1P2UA 3Q9LA 4TL9A 2F55A 1NG1A 2Q6TA 3FTQA 1NN5A 1GKUB 4LBYA 4JKIA 4WBSA 2FSHA 2GAOA 5FBVB 4JLAA 3P27A 1MO4A 3NTUA 3VX3A 2XB4A 1SXJA 4XH9B 4C0HA 2F1IA 3AV0B 3OEEA 4URWR 4Z1MA 3MJHA 1XD8A 2B7BA 2VHTA 3W6PA 4PHHA 3OZXA 2A5YB 4Y0AA 1I4LD 5EZ5A 1CTQA 2W2TA 2GZHA 4EQ6B 4LJ8A 1TNDA 3UANA 4YQFA 4DLRA 4KO8A 2VHCA 1ZAKA 3BJIC 2ZE7A 2ZRGA 1U99A 4PC7A 3GLFB 3PUWA 3BGWA 3RVBA 3DOFA 2A2ZA 1Q44A 1E2KA 5HCNA 2ZE6A 4HLUC 1G4AE 4CEIA 2RGXA 2D3WA 1P2SA 4MRSA 1G19A 3PEUA 5CYPA 3E70C 2YWHA 2XGJA 3T12A 1C4OA 2W6IA 4LZZA 2OLJA 2O0HA 1DAHA 4BFWA 3CX8A 3GMTA 4HUTA 3THWB 2R6AA 3I4LA 3A6PC 1SVLA 4TZ6A 3Q5DA 5FUXA 3TRFA 1ELOA 3L82B 1XJCA 2JAQA 2AFIE 4W5JA 4B33A 1E1QD 4BFVA 5F2EA 3ZS9A 4C0JA 2VSXA 1P60A 1R0YA 4XIGS 5BN5A 3P32A 4M1WA 3THXA 1JPNA 4CYMA 4MKFA 4GP6A 1Q22A 3NDPA 1XEFA 2QPTA 4I1SA 1IN5A 3M6AA 4PPQA 1U8YA 4S35A 3QJYA 3FMIA 3LW7A 4D6PA 2F3TA 5G40A 1AJEA 1U98A 2ZS7A 4Q7LA 1HE1C 1P3JA 4PZZA 5BN4A 4M1TA 4QHTA 1E79D 1II8B 4RD4A 5DSZA 4GZLA 3IDQA 4UNPA 5DO9A 5HCIA 2G9NA 1I2DA 5FI1B 3ZDQA 3KL4A 2P6RA 1QHGA 4FXPA 1HH4A 4LJ4A 1XMVA 2DB3A 2H7VA 1OFTA 1CJMA 2P6UA 5EJEA 5KSPA 1X1SA 4A9AA 1KK1A 5HPYB 3FKSA 4TLCA 3B1XA 3TW4A 2X19A 5BWMA 5GJWC 4KFTA 1RZ3A 1DAFA 2WHXA 3OFNA 3AUXA 4A2QA 3FFAA 4FI3C 3U3MA 4V0OA 4HAYA 3QG5A 4UKDA 4JYCA 3VR1A 3DDCA 1E94E 4PANA 2QEQA 3PUYA 4KFUA 3Q7PA 1G1MA 1E2PA 3LRPA 2G0TA 2YKGA 1XJQA 2GVZC 3WMGA 1M7BA 1EG7A 1NVVQ 3TLXA 4E09A 1F2TB 1FNMA 5AJWA 3S1AA 4BEBA 4Q9HA 4MA4A 2GVDC 1AS2A 5FFMA 1AZTA 2IYYA 4WXPA 4Z8XA 5JEDA 1Q3HA 1JXOA 2OBLA 3EWSA 2QU8A 2XTNA 1BKDR 1OH5A 1OPXA 3DL0A 1LTQA 1OB5A 1ZVQA 1E2HA 4OI0A 3C4JA 4F7WA 3CH4B 1G6HA 5LBIA 4GOJA 4IDNA 2BM0A 2R6GA 1QF9A 4TLEA 2O0KA 2EWWA 3PUVA 2IYWA 1XCPA 4LJ7A 4BZXA 5SZKB 3SYNA 3GJ8A 2WIBA 4DEXA 4BRWA 4XWAA 1P62B 2XNDD 2N46A 2ONKA 3EC1A 1WBBA 3TE6A 2CVHA 3GQBA 3PITA 2BEJA 1ZYUA 4CIDA 1W5TA 4LK2A 4P3YA 3K0FB 1E4YA 1GOTA 2ZEJA 4F4CA 5GADl 2C9YA 1KDTA 1R0XA 1RW4A 2RB4A 2H18A 1IBRA 2JLYA 3B13B 3L8YA 3PVSA 5EE0A 2HF8A 2QPAA 1OHHD 2YJTD 2ZR7A 3CIOA 4B32A 1R5OA 1Z28A 2CL6X 5UKDA 5K8IA 4IVRA 5E4FA 1LY1A 1CRQA 1T8UA 2VA8A 4JLDA 4US0R 3KJIA 2ERYA 4DXAA 1Q1ZA 2A78A 4ZI3A 1IXRC 4CVNA 2OG2A 3QBVA 2GTPA 5EZ6B 5FTLA 2NPFA 2Z0MA 1I2MA 4RVCA 4XTRA 1KMHA 3MG9A 4DCTA 3KQUA 3TKLA 4M21A 3B2EA 4RSGA 4Q9KA 1VG0B 2IT1A 2VF7A 3QI2A 2VEDA 2ZJ2A 4MQBA 4BFYA 4F92B 3BFVA 1JXMA 2OESA 1M74A 1CF4A 2VPPA 1DELA 1P5ZB 4YXWD 4U7DA 3BAFA 2O5VA 1CU1A 3B82A 2VHUA 3FKQA 3HDTA 2ZSDA 2ZJ5A 2WJGA 1CR2A 3EZ9A 5CIQA 2CNWA 2DHRA 2FFAA 4OL0A 5EE5B 1X3SA 2HDNB 3BS4A 4N3NA 1KI6A 5CLLA 4BFSA 3GEEA 2RGBA 1AGRA 2FPKA 4NU0A 2DFTA 4P32A 4Q4JA 4IXNA 4K46A 3QKRB 1AZSC 3UMRA 4RFSB 4QHYA 4ZCLA 2ZU6A 3AP3A 2J45A 2VP4A 4I1OA 1TF7A 2W2VA 3TUZC 1ONBA 2ZSAA 3ASYA 4TL7A 4DB2A 5JECA 2BBTA 4ZCIA 4D4LA 1K6MA 3VR3A 4P4SB 1COWA 1J2JA 4PAMA 2ZJYA 3THOA 1S1CA 3GEHA 3HR8A 2RGNA 2ZI6A 4D0GA 1XD9A 3U6BA 3TBKA 4HUQB 1G9XA 3C5HA 2OZEA 3SDZA 2O8DB 1EWRA 1E2NA 2OV2A 1CBUA 2MMCA 4JVLA 1OIWA 1EFUA 5L3QB 4DT1A 4B2PA 1E0JA 5AR1A 4UXHA 3MCAA 3AF0A 1R0WA 2X77A 3PFIA 1R8SA 3A1WA 2WJIA 4RJLA 2LCFA 2BEKA 1XWIA 4WZ6A 3U3RA 2GJKA 1IXZA 3OIYA 4IDHA 4TLBA 2I1QA 3LW8A 2FOLA 2V54A 5IT5A 5AUOB 2J87A 4KYIB 4X8MA 1QDEA 1HA3A 1U0LA 1T0HB 5KO2A 1E0AA 5IK2D 2QZ4A 4OBEA 4LJ6A 3DKVA 4BLRA 4MGYR 4D4MA 1Q12A 3I5XA 2QUZA 1OF1A 3SEAA 1XBTA 4OK5A 1OHHA 3GLIE 2IXGA 4RCYA 3W9YA 4NDZA 1ZW6A 2QP4A 1MABB 4IFBA 4QBHA 2ZREA 1OSNA 4KYUA 4Q4HB 5EE1A 1P9NA 3RC3A 5C4MA 4II7A 1OKKD 4G3XA 4ZIRB 3HYTA 3NH9A 2RGEA 1E2MA 4BUJA 3AKDA 4DCSA 2IS1A 4IDOA 1E0KA 3QF4A 3K1JA 3GLHA 1WA5A 2A5GA 4LGMA 1ZCAA 4DCUA 3QENA 4DUGA 4YXWA 5JHHB 1II9A 2YWEA 3KB1A 2GCOB 1CS4C 2JJ8A 2R65A 2W0MA 4HAWA 3W8RA 2OAQ1 3B7GA 4Z8YA 5SZIA 3TMKA 3VTKA 3ZVMA 4LRWA 3FYHA 4ZPXA 1GIAA 3B60A 4V0NA 1U9IA 1KK2A 4B35A 2G3YA 2WZQA 2PZEA 2G77B 3NBYC 1VCNA 3AVYA 2OBNA 2NO1A 1J90A 4JBWA 2WAYA 4TQ9A 2AN9A 4TMWA 1GL7A 4TYYA 5D3QA 1KI9A 5KNCA 1G3QA 1X1RA 2QNRA 1VCIA 1DE0A 3VX4A 2J9RA 2ZRHA 3X1DA 1GL9B 4G5RA 1XXHB 2O0JA 1YRBA 2IUTA 2KI5A 1ZINA 1EESA 2GCPA 3CRW1 1E2FA 1FNNA 2EQBA 2MMGA 2ZVQX 2IYXA 3KFVA 4GMXA 4DLSA 1FW6A 4BPBA 1TX4B 1OH6A 2IS4A 1WCV1 4HZIA 5CDFE 1Z6TA 4JSYA 5B30A 3RHFA 3CNLA 3ZQ6A 1LS6A 3GP8A 2GXUA 1S1MA 1P9WA 2Z83A 3CONA 2ZRBA 4A6PA 3KTAA 3KKPA 1RRFA 1WXQA 2XAUA 3ND8A 3T1TA 1EGAA 1E9SA 3PENA 4RKFA 3BH0A 4HAZA 5FUWA 1DPFA 3W5JA 5LPNA 4EKDA 1A2BA 5F3WB 5GJCA 1E9CA 4MGKR 2O8EA 721PA 3GLFE 1VIAA 4AKEA 1ZNYA 5JRJA 2VBCA 3TR5A 2A3RA 1SHKA 1KAGA 1EFTA 1OH7A 1M6NA 1SVOA 1N6PA 3SNHA 4QFMA 1LW7A 3CZQA 3R20A 3X1ZA 4AG6A 3TSOA 2LWIA 1N0WA 5AK0A 5IK2A 1W2HA 1CJKC 1Z83A 5C2JB 4ILEA 1UBFA 2CJWB 2GZDA 3IPXA 2EWVA 4XSGA 2V3CC 4CEJA 4ZCMA 2QQEA 3KJGA 4YMSA 2PLFA 4DLZA 4MKHA 3ZH9B 2VSFA 3CWQA 3PR1A 4LJAA 5CB6A 4XJXA 4TT3D 3KUDA 1ZM4A 4WVFA 1OKKA 1QBKC 3N5CA 1GAJA 3Q3JB 1NNEA 4ARZB 4HZUB 3R9IA 2WSSA 5JBQA 4BLTA 3ADBA 2R6FA 4LV6A 2D2EA 1E9AA 3SYLA 3A37A 3THWA 2BMDA 1YKSA 2DBYA 2MSDB 2JCSA 5FOSA 1G8GA 3O8DA 1V43A 1NJFA 4TYNA 3LA6A 1IXSB 1GZSA 1P7CA 4C2UA 2C77A 3D3QA 2LKCA 3PJRA 1CJVC 1CR0A 2BJVA 5FUVA 3ZGXA 1IY1A 4W9MC 2R6CA 3TQCA 3X1YA 1BH2A 3BIFA 4Q7MB 3WY9A 1P61B 3EPHA 1EK0A 2FNAA 3SHWA 1VPLA 3DKPA 3MWKA 1Q57A 5SZJA 1E69A 2PL3A 2GDJA 3CPHA 2GBLA 4XOIA 5AUPB 2AK2A 5J40A 4DSTA 1BOFA 2BBOA 2FA9A 2KB0A 1E3MA 1HEIA 3T34A 4D0LB 3AF3A 1TL7C 2FFHA 3CRQA 4TZ0A 1NVUQ 2XSZD 4AYWA 1AA9A 3KXIA 4MDFA 1KZGB 1KJWA 1T3SA 3GJ3A 4KBFA 1P72A 3CNOA 4PC1A 4O3MA 1ZUIA 4IKEA 2ZVPX 3BORA 1N6LA 4JZKA 2O8BB 3EG5A 3L2OB 1C9KA 1NMXA 2P67A 1NN1A 2WAXA 1TUIA 4LPSA 3U2QA 2VF8A 2J41A 1C1YA 2O8CA 1T6NA 2QG6A 5A0FA 3RYTC 3EZ2A 1XTRA 3MUFA 2Q9AA 4JL6A 4EPRA 5FL3A 3AF1A 1UJ2A 4AKIA 4TMTA 3TQFA 4X8LA 2DPXA 2DYKA 2FGKA 3K0CA 3UIEA 2ZS8A 3DMDA 4JL5A 4B3XA 3CPJB 1ZM2A 1YZKA 2FZLA 2O52A 2RKOA 1S3SA 2CBZA 1XX6A 1DTSA 2OBMA 1LVGA 4NL4H 2H57A 1D2NA 3FFBA 5JJIA 2ZYTX 4IRUB 1TQDA 3VFDA 1CEEA 4EFNA 1ZCBA 5JJKA 1VIYA 4PR0A 5DNYB 2AHOA 2ZRIA 4DHEA 3K09A 4ABYA 2R8RA 3EZ6A 4URVR 5TXGA 3PQCA 5BYKA 1CP2A 1YZLA 4DZZA 1B23P 4BFUA 3D8BA 3UPUA 3FHCB 4IVQA 1P4SA 4NPHA 2EFCB 3VQTA 1QHSA 1TU4A 2FH5B 4PC3A 2I3BA 4TT3A 3KQHA 1UKZA 2KSQA 2CE2X 1Q0UA 2YOFA 3AUYA 1X86B 3K0SA 1E98A 2QMUA 1XMJA 4A82A 1Q21A 4AKGA 1RJ9A 5IF9A 3MRSA 1GP2A 3BC1A 2ZI4A 2YOGA 1P9RA 3K0FA 1XCGB 1HT1E 2D4HA 4DRZA 4FN5A 2JLXA 1KDRA 3THYA 2HXYA 1U81A 4R71A 2AR7A 1Z6XA 1KKMA 1G291 3FMFA 2CCKA 1AQUA 1F2UB 1RE0A 3E2IA 2X8AA 5L3VA 2ZRMA 2JLQA 1FQJA 1E99A 1K5GA 4NP6A 2P65A 4CF7A 4FWTA 1U9IC 2VP0A 2Z4SA 1Z8FA 3HWSA 4O2RA 1EFCA 2W0SA 2ODWA 1A4RA 4QJ5A 4C0KA 4EAQA 4B75A 3ZVRA 1CJUC 2JLWA 4UNNA 4EPTA 4A8JA 2HJVA 2P6NA 5SZHB 1T5LA 3ZYCA 2V4ZA 2XSZA 4B71A 3WBKA 4CT4B 4Q7JB 1SHZA 2QAJA 1A7JA 3AKCA 3H0KA 3VKGA 5AUQA 4Q47A 3ASZA 5JSZA 3V9PA 4P4UA 2FWRA 2WPDA 2YC4C 2VQSA 3GLIB 2XJ4A 3H86A 1KI1A 3LQQA 1E9BA 2Q21A 4NYMR 4EJSB 4M1MA 4WXRA 1T5IA 3EX7C 2DWOA 4OQLA 5FUYA 3K9LA 3K9HA 2C78A 1VYVA 1JB1A 4BECA 2WOJA 2IWHA 3FVQA 3GJ5A 2G1KA 3G82C 4MYTA 3TVDA 3V4FA 5JCZA 1DARA 2VSOA 4ASUA 4RFSA 5D3MB 4YMUA 3SQXA 1IY2A 3CM0A 5GVSA 2NO7A 2PH1A 2EFEB 3R7WA 5DGXA 3SHFA 3DZDA 2HYDA 4KVAA 1ZBDA 3M4YA 1NY6A 1B0UA 1JAIA 1N5KA 1OW3B 3T5GA 1N6OA 4FMDF 5J4YA 1FP7A 4Y0VA 4P4SA 1HURA 5H8WA 3HR7A 1E9FA 4G5OA 3ADDA 2JASA 1W4RA 3QSYA 1MO3A 1BMFD 5BW8A 4A0HA 4QC2A 3TW8B 1N0UA 1ZJ6A 1TEVA 3D6TB 3FWYA 3BB4A 2NO9A 4DVGA 3RRZA 1YZUA 3V4RA 2ZJOA 2TMKA 1DS6A 1Z6YA 1WMSA 2J1LA 1YZGA 1JJ7A 2Q9CA 1IN4A 2QTHA 1S3GA 2X2EA 2BV3A 2ZM5A 2J0UB 3KQKA 3U7HB 1NKSA 5JJLA 1H8HD 2J0QA 2QSYA 1FTNA 1HV8A 4R2IA 1GSIA 1XEWX 3AF2A 1A5TA 5L3RA 2J46A 1TQ2A 1MO5A 4LBWA 4MRVA 1ZD1A 3WMEA 3ZIAA 4EDHA 1DAKA 1F3OA 5TY0A 5G3YA 1NF3A 4EPYA 2PT5A 1NMYA 1ZU4A 2VYFA 3ADKA 4KHZA 2RGCA 3K8YA 4M4SA 3LBHA 1OT3A 1DG1G 2FSIA 4A0FA 1UF9A 2BCGY 1FZQA 3CKLA 2YZ2A 4NHOA 4AWXA 3U4QB 4M0LA 2EU8A 5KHOC 2GEDA 4F4IA 1U8AA 2YNMA 3EA5A 4M1SA 2OT3B 5EQTA 1G20E 2FE4A 3LAWA 3NIBA 4DIDA 1IN6A 1SQ5A 2FG5A 4EFMA 3O8RA 2RHMA 2Q3MA 3C8UA 2Z43A 1D2MA 5CK5A 1IAQA 1PVOA 3FHTA 3UMFA 5DYGA 3TNFA 2GWHA 2IXFA 2DFKB 5KNDA 3U44B 5K8TA 2VIIA 2BCJQ 1DAGA 3CWZA 4KU4A 4KJZA 1PLLA 3I1FA 4Q1DA 1EXMA 1HE8B 3NBFA 1TEXA 1XXHE 3GLGB 2QORA 2V1UA 1YZTA 5EE9A 3WNBA 2RAPA 2IHYA 2GK7A 2OILA 1W0KD 1N6HA 1LF5A 4O25A 2N42A 2LKDA 5B57C 1Q20A 5CM8B 1XRJA 3BFXA 3ZZ0A 3CH5A 5JMTA 5DYIA 1NSFA 4Q21A 2ZAOA 1Z0DA 3NWJA 1QHXA 4RZXA 3FPAA 3LXXA 4NYJR 3IPYA 4LC0A 4NCKA 1UM8A 4EPWA 3CF2A 2NTYC 2QP9X 3EPKA 4ACAA 2IX3A 2FU5C 5J47A 1Y63A 2CK3A 4HI0E 1SKYB 3TR0A 4C0QC 4AD8A 2D7DA 4OHWA 4PC2A 2DY1A 1P6XA 1CR4A 1Z08A 3NKVA 2HUPA 5LB4A 4B3FX 1Z29A 2ZRJA 2GJAA 3PV0A 4LUCA 4PAOA 4ZKDA 1VG1A 3M0EA 3ZLJA 2EW1A 2ZROA 2GEUA 3CRVA 3AF4A 5J5CA 1P73A 1LFDB 4BLQA 5L3SB 2OLKA 2VH5R 2EFGA 1H8HA 2QAGC 3BFKA 2PZGA 4PFSA 4PPFA 4QOSA 4QG7A 2ZSFA 2K5UA 4KSCA 5H1YA 4QNRA 1OB2A 1KAOA 5G53C 1ZMXA 4OYHA 4PPGA 3AVXA 4FINA 2FN4A 3GPLA 2XZOA 5K8LA 5K8UA 3ZVNA 5ELXA 1RIFA 2CMKA 4IDQA 4N0DA 3BD9A 1AKYA 3KFXA 1HYQA 4JVNA 2VO1A 3MWLA 2ZI9A 1TQ6A 2FPLA 3U3JA 2P0EA 3BOSA 121PA 3LVRE 3DOEA 4HAXA 2YVUA 3AKYA 4U02A 2KBFA 4A6XA 4V0ME 2V8OA 2FDCA 3N2EA 3AVWA 3NC0C 4JLPA 3IIJA 2J7PD 2OCPA 4PZYA 1N25A 4P33A 2P5SA 4B34A 2DWQA 1Z6GA 2VHJA 5E7IA 1ZU5A 4AIIA 4D81A 4DKXA 3LO5A 3NXSA 4I99A 2ZUDA 3SE0A 1TMKA 1CIPA 3NVAA 5CM9C 5P21A 1JECA 4DSOA 4CEHB 4AK9A 4LX0A 4BZPA 3C5CA 2WJHA 4IW3B 1P2VA 3TUIC 2KE5A 4NYIR 1IN8A 1GWNA 2IUSA 3VMFA 3Q7QA 5KPDA 1E1QA 3SU8A 3RS0A 4EUNA 1TUEA 5KSZA 3QKTA 2RHDA 4BRUA 1W0KA 2ERXA 3MJRA 2R2AA 4ACBA 2ODBA 1R5BA 2V1XA 4NCIA 3X1WA 2ATXA 1E2IA 3IIMA 4L9WA 1E2EA 3J81k 3VKHA 2QAGB 1BYIA 1WF3A 4DB4A 1VYUA 3K53A 1NJGA 4C0SA 3A58B 5C46F 4GP7A 3F3YA 3DPUA 2ANCA 1KI2A 1SVMA 3OIUA 4I1UA 4RZ2A 1GVNB 821PA 1AM4D 3QF7A 5JEEA 2O8BA 1E79A 1OE0A 3FDIA 1GG2A 4F91B 2AWNA 3CRRA 4ESHA 3F5FA 5EXSA 2B6HA 3B8HA 4B47A 2OSBA 2D7CA 3LY5A 2W58A 5C18A 3H4MA 4XD7D 1L8QA 4US1R 2YYZA 3HP1A 2ZRDA 3B5JA 4TYPA 2BMJA 3RLFA 4Q00A 2WIAA 4FMBB 1QG2A 2BWJA 4C9BA 5KSOA 5TVKA 4J0QA 2VHQA 2O8DA 1VYTA 1FX0B 5TDHA 5DI3A 4AYTA 1P75A 1U2RA 4KITB 1X8LA 2ZE8A 1N6RA 1R5NA 3UMSA 2AFHE 4YONB 1GNQA 1XTQA 3QOFA 4YDHB 3N2IA 4WZAE 1D9ZA 3KDSE 3A4LA 3Q72A 4TL8A 4FD2A 1E32A 4R7ZA 2J7KA 3WXMA 2PX0A 2RGGA 2GNOA 4EIWA 3TSZA 2IYQA 1BYUA 3SBEA 2C98A 2I1VB 3H1TA 4RKEA 5BYJA 4JT2A 1SXJC 1NVXQ 1RYHA 3LDAA 1DBSA 2DCUA 4KLNA 1G7SA 1PLKA 2FSGA 3QNUA 3U6KA 2QBYB 4ON9A 4DIEA 3QXXA 1N5LA 2OCAA 2FEOA 3IUYA 4QBFA 1XZPA 2IXEA 3GFTA 4G01B 4NKRA 4L5BA 4EFLA 3U7EB 4YMWA 4OK3A 1NKTA 1IJEA 4DLUA 3MGCA 4DLYA 1PLJA 1D5CA 1YU9A 1L2TA 2QMEA 4AI6A 5HZHA 1E2JA 2O8FB 4OI2A 5FR2A 1D8TA 5BN3A 5M04A 3RSLA 3UG7A 1F2UA 1IM2A 2XNDA 4U00A 3K0AB 3SI7A 1W48A 3KUCA 2KWIA 2E1RA 3LV8A 1W36C 2D2FA 2NO0A 3CNNA 4XWKA 2VP5A 1XMSA 3O47A 5KYKA 1F48A 1VCMA 2ORWA 1FPMA 5AJXA 3ZD6A 3R9WA 4HB3A 4B3CA 3SC3A 1ZM9A 1TF2A 1VMAA 2GJ8A 4QM7A 4BZQA 2NG1A 1JJVA 3AGPA 5FL7D 3QXCA 5IDVA 1N5IA 1NSTA 2CE7A 3MWYW 2NO6A 4C30A 1IOZA 1OV4A 2J0VA 1G16A 2ZRAA 1FFHA 3GLIA 2HCBA 3U7GA 3U3OA 1E9RA 2IWRA 5FTJA 2XB2A 4EJSA 2XJ9A 4MGIR 4LI0A 5EP4A 1SXJB 1M7HA 4DDUA 1BS1A 1W4BA 2ASEA 3SQWA 4P31A 2WV9A 4JL8A 1GRNA 3RS4A 2CL7X 2BOVA 2WWWA 2N1BA 1T3LA 1E96A 1ZNWA 4PAQA 1XTKA 1I4TD 3NBZC 5HKKD 4DJTA 2WTUA 4R2HA 2WICA 4BFZA 5FBRB 4HAVA 2RH5A 4HDOB 4MUBA 1IY0A 1YVDA 4QGFA 3ZZUA 4ERNA 4C0AC 1OIVA 1U90A 2ZR9A 4NCJA 3A36A 2GJ9A 4IEEA 5FOTA 1GRQA 1ESMA 4F4JA 2Z4RA 2CXXA 2UZIR 3RSOA 4ESVA 4V0KA 3SJCA 3M1IA 1DVRA 3Q85A 4GZMA 1NP6A 2L0XA 1ZC3A 1ZD8A 3VHLB 2XZLA 2IK8A 2G0NA 4AKHA 2QI9C 1UBGA 5TV2A 3CO5A 3RS7A 5A4JA 4G5GA 8OHMA 3HJNA 1GKYA 4JIMA 5FPTA 1AS3A 4HB2A 5DE3A 4R9UC 5G3ZA 3MAAC 2WWHA 4HSEA 4TYWA 1TF5A 4JSTA 1YHNA 5JFGA 2A5JA 1YR7A 5E7MA 2YOHA 5EXTA 3THXB 4BQSA 2CLCX 3AB3A 2F9LA 3RC8A 2P5TB 2IA5A 3ADCA 4LYHA 5GJVC 5CDFA 4L8GA 2DFLA 2ZE5A 3H84A 2ZRCA 4JT4A 5GJBA 2XEXA 4DSUA 4PX9A 5F9HA 1KSJA 4B3BA 1KNQA 4WZBE 1G8PA 5J4HA 1E2DA 2ORIA 1UDXA 2EYUA 2QRNA 4XVRA 3I5YA 3G0HA 3TSWA 2HYIC 1U0HC 1GDDA 2GXSA 2OE2A 2I4IA 2QE7D 4MUAA 3O8CA 3HYRA 1UEJA 1FOEB 1Z5ZA 3O8BA 1CXZA 4EQ6A 3T61A 2OO7A 1KZ7B 4I4LA 4UJ3A 1NI3A 2XTMA 4H9GA 3U4QA 4OJQA 3LNCA 4NYMQ 1G18A 4PQYA 4UNSA 2EYQA 1PV4A 3GLFA 1XDBA 2QGZA 3I8XA 4D4JA 1G21E 1TU3A 4FWIB 3E5HA 5G41A 1GNPA 2BJWA 5FL7A 1NBMD 1HQCA 2OEPA 4WOPA 1F6BA 5TARA 5TB5A 3W5IA 4UXIA 1JQLB 3B1VA 4Q7KA 4QXAA 4A0GA 4LHYA 3GLGE 1L4UA 1ODFA 1MKYA 3CPEA 5DISB 2IHBA 3GJXC 1KSHA 1YZQA 1XTJA 3CR8A 2J0SA 2F9MA 3S1AB 3GLGA 2OCYC 1WDTA 3EPJA 5JI2E 4Q4AB 2OXRA 5CYOA 3ZQJA 3EPLA 3I62A 4DLVA 2RGAA 4QJ4A 1J7KA 3RS5A 5HKKA 1Q1QA 4LY6A 4MYCA 1SKYE 4NMMA 3KKQA 1ESNA 1JR3D 3IBYA 2ZUCA 5CLQA 3LLMA 5C1BA 1TAGA 3IBGA 2NZ8A 4ZV4A 4OQMA 2PX3A 3TAUA 4O0MA 1IN7A 1NLYA 3BH7A 3K70C 4TLDA 4P0TA 5FR1A 2BBWA 2W83A 1II8A 4LBZA 2F7SA 4A1FA 1UBCA 3ICEA 1OXUA 1WRBA 2YWGA 2ZJ8A 4IOLA 4ZO4A 4RD6A 5JS7A 2FMXA 3MFYA 2IYSA 2REOA 2JATA 2ZITA 1G5RA 3KB2A 3QPUA 5H70A 1ANKA 3L8ZA 3LX8A 2BIFA 1G3IA 4YMVA 1KK3A 5C4GB 3N70A 1PJRA 2FEMA 3X1XA 4UJ5A 2Z5FA 1FMLA 3PCRB 2CLSA 2RGNC 1KO7A 1KDPA 4MGZR 2IS6A 1G3UA 5GVRA 3A1TA 3CLVA 4HLQB 1ZIPA 4TLAA 3EA0A 2IC5A 4MH0R 1XFAA 3WYGA 1QHYA 4V0LA 2V7QD 5HZKA 3NHBA 1F2TA 2PMDA 4TMXA 2FV8A 3NG1A 3RS2A 4IXMA 2WMNB 2NQ2C 4PZLA 4UNQA 2YINC 4TMVA 5E3HA 1NBME 4G5QA 1G6OA 4WA7A 1JBKA 1CLUA 2BMFA 3RWMB 3UG6A 4FMCB 1OFHA 1GL6A 3RWOA 2ATVA 2SHKA 1AS0A 1OFUX 4GT1A 4OQNA 4LHVA 2JJ1D 1KSGA 4BE7B 4JYBA 2PLRA 1FL9A 3DM9B 3NBXX 4YLGA 2VP9A 1LNZA 1R8QA 3GJ0A 2Q0HA 5KDDA 1XPOA 1NBMA 1E1RD 4N0EA 1AN0A 1OJLA 4HLCA 1N5JA 2VTKA 5CK4A 3ZD7A 1CKEA 4Q4JB 3K70B 1XEXB 1RRGA 2RGDA 3KZ1E 1VKJA 2VL7A 1QHNA 5KTYA 4NYJQ 3B9QA 3OEHD 3EZFA 1TADA 5EP3A 1ZM3A 4CEHA 1OH8A 3GD7A 3RABA 4QBIA 4LCBA 1AIPA 2XNSA 1JR3E 1DAMA 2GESA 4CT5A 3SS8A 3EW9A 1WP9A 2ODNA 1KY3A 1NVWQ 3B9PA 3I3SR 4JLMA 4D82A 1G7CA 4C2TA 3QEJA 4BASA 3RRNA 1YQTA 1P2TA 4D4KA 2GXAA 2A5FA 2ZRPA 2E87A 4DDWA 2UVQA 1JR3A 3QVUA 2RCNA 3KXLA 4JJZA 4QGAA 5FOWA 1VHLA 5LD2C 2A5DA 4M9XA 3F0TA 3JVUA 2ZRFA 1UBEA 2WWIA 4RD0A 4KV9A 3RANA 2FJUA 5FTKA 5HTKA 1W5SA 1LS1A 4ZDKA 2E9SA 1SXJD 4Q18A 3OEED 3MWJA 1W2GA 4IDPA 1FMJA 5DHAA 2Q9BA 1QRAA 3R9XA 3T1QA 1SGWA 2WVJA 2FFQA 4Q9JA 3CBQA 1MOZA 3WNCA 4XTCS 2PCLA 1VHTA 1X6VA 1QHHB 1FX0A 3OIVA 1AKEA 2H8KA 2ZJBA 2PZFA 4MITA 5KNBA 1R10A 2CEAA 2X1VA 3QY0A 1O87A 2HT1A 3QKRA 2IYZA 4RZ3A 3I61A 5FPSA 1DAEA 3BE4A 3C16C 3FGNA 2PEZA 2ZJZA 1VTKA 3AVTA 1OXSC 3OHMA 4A4DA 1WE2A 4LJ9A 1KK0A 4A0RA 5FPKA 4LC1A 2ORVA 4JLBA
chains in the Genus database with same CATH superfamily
1YTUA 3ESAA 5CPFA 2GH1A 2B21A 2NUBA 2PDAA 2W6ID 1QV6A 1Y1LA 2X2OA 4RGBA 4W6QA 3OO1A 5J4LA 3K3PA 4UVEA 3KWJA 3PQDA 4TN5A 3SJBA 3WLIA 4F9TA 1FIUA 1SMKA 4QGGA 3LRXA 2ZYAA 1CVLA 3QF4B 1M76A 3OSZA 4TMZA 5HOEA 1R0RE 1D1SA 3B1WA 1DO0A 1OVGA 1NUUA 1I3NA 3IALA 4MSUA 5KYUB 4GOND 4YMTA 1R27A 1LV7A 3CNHA 3LD9A 3NUZA 4XR9A 1XA3A 4NE7A 4ZWNA 4E2XA 3G23A 1PJSA 1R4NA 4EG0A 2JKVA 5JI3E 4B3GA 2G6BA 1PZMA 1MP0A 2QENA 2YDYA 3P7MA 3PUKA 4KNWA 5CIYA 1J8FA 4BO6A 3CKMA 1I36A 3B85A 3Q1LA 4NZNA 4Q16A 4MYHA 3GIDA 4QJIA 5ALNA 1ZJZA 1O5OA 4QTXA 4MQLA 3RYIB 4ENVA 5FUBA 1NVFA 3W2HA 2QGNA 1MA3A 3QKUA 2HCFA 4E94A 3ZY3A 5DRYA 2VAWA 4NH0A 4XFDA 4RJTA 3QHQA 1MQ9A 2HJ9A 2KS6A 3HO6A 2Y67A 5L7TA 3RJMA 2I7CA 5GVSA 3K0AA 3ZWPA 1XMQB 3CF0A 1OGIA 2X5KO 4DBZA 4MO2A 4BMSA 2ZZNA 1MU0A 1SBNE 4D8TA 1OZFA 3VHQA 3JVDA 1Y7IA 4I1VA 1RWOA 1THZA 1ZM7A 1QKIA 3DOIA 1PR1A 3FX2A 7MDHA 4C6HA 1P31A 3T5DA 2MINB 5JAIA 1QSGA 1A4XA 3N0TA 2LCIA 3P2OA 3V4ZA 1DPGA 4DNQA 4DA4A 5BSKA 3SXJA 1UM9A 3FSGD 3NEYA 3NT4A 3WV4A 4CBVA 2HRZA 2Y3IA 4MAAA 5CA0A 5K01A 4DSZA 1ZY2A 3MNFA 3V3KA 2R44A 3RS3A 3BBPA 3CZMA 2INGX 1NW6A 5E2BA 4AZSA 1GTVA 4G0VA 4IS3A 5LA6F 4PM4A 4R31A 1ODKA 2GO1A 2ZGVA 3TLGA 4JQZA 4O33A 4QHSA 1RAHA 5EN4A 1GPMA 1NLMA 3BFPA 3GHYA 3O1IC 1K3UB 1C9MA 3P5BA 4QOEA 3DZKA 1OXVA 1DOHA 3PNPA 5BMVA 3WK7A 4H1UA 4O2LA 4UHCA 7MHTA 2ATCA 1B73A 3JVEA 4L3WA 3DD1A 2D7JA 4CKXA 1LPSA 5AT1A 5K09A 2GCOA 1AKWA 1NVGA 2X76A 2ZRKA 1YWGO 2A8YA 2ZU0C 4MS3B 1F9AA 1EYZA 2FK8A 3CB2A 4U7FA 1M9NA 2Z6UA 3LQYA 3BXHA 1FUYB 5EA2A 3R8CA 4DMFA 1NN0A 4F3NA 1NNSA 3FOAA 4R1MA 2AEJA 1KF0A 2JS7A 1VG9B 2WTAA 1PZNA 1ZNXA 2C03A 3RBAA 4DXDA 1U3TA 5I5GA 3I64A 1H0SA 2MSLA 1NMZA 4YIHA 5L4SA 5DNEA 421PA 2DWPA 3G02A 4I5GA 2X40A 4HOYA 1QGOA 2ZJ6A 3DZ8A 3ABOB 2K87A 3T1VA 2E1PA 4PGAA 5DLQC 2HSZA 4XKJA 1G60A 3DTVB 4J94A 1ESCA 4WXMA 4XPZA 4QKQA 1W1UA 2OO5A 4OJKA 4YGYA 4I4TA 1S3FA 5CNMA 3K0CC 1GITA 3O8QA 4KEAA 3OX2A 3H75A 1P0IA 4YCAA 4BUCA 2I66A 1O97D 2IYRA 3OZAA 2REBA 4TKUB 5JASA 1E1NA 2HK9A 4FE7A 1XF9A 1XTVA 3AEUA 2ZBEA 1TKRA 1Y9JA 5A6VA 3LA8A 2BY4A 2O2CA 2CCGA 2IGTA 2VP2A 3IE1A 2C7QA 4A15A 4LBVA 1VMKA 3A4MA 4X1KB 3IKJA 3ROMA 4QEDA 1NQOA 3LYLA 3UTDA 2FDRA 4IM7A 5LQNA 3AR9A 2IF2A 3C3MA 2ZSEA 4RIEA 1Z4IA 2IP1A 3C85A 3VZCA 3KXKA 3LBYA 1GHTA 2ZXFA 5JVDF 5IRCD 5AI8A 4KR7A 4WNIA 3I1IA 3PR2B 3PLRA 1NXXA 4FMCF 1JSXA 1CERA 2ZQ5A 5BVGA 3AY0A 5JC8A 1R3UA 1ZGAA 4WESA 2UXBB 3PNYA 3QPBA 4H7EA 2WU0A 5GONF 1RKUA 1WTCA 4ZDWA 3LRTA 1MIOA 3HDYA 5IAEA 4ZK6A 2RGRA 1JDJA 5JZVA 4UUPA 1GLNA 1VRWA 3C6YA 3HKDA 4IGIA 3TZLA 2V9PA 1ZW1A 4D9BA 2YICA 4EFKA 1TCAA 5EKTA 4RTPA 1ZGGA 2IHJA 2FVYA 1UKVY 2P8JA 4S1VA 5J3JA 3E7FA 5DW3A 2IYUA 4NENB 5AHWA 4WLVA 4CKEA 3D4BA 2H17A 2ZJ7A 3MT9A 3K9QO 1JHUA 4UCWA 3REFA 1M1NB 4R1OA 1RJWA 4NFYA 2B4TO 4MIEA 1MJGA 2PZLA 4B8WA 2FPMA 3Q6MA 4XUGB 2AJTA 1SZJG 3UCFA 4US2R 4I1PA 5EG5A 4AB1A 3R3ZA 5EHNA 1IZ0A 3NO4A 4EY5A 3K70D 3T9BA 2GILA 1PSWA 1YXMA 3S4YA 3LBAA 2O2EA 4L3OA 5EZSA 1BHSA 1KJYA 3RTEA 1PL6A 4CI0B 1NU6A 4AY6A 4D56A 1TK2A 2L17A 1MB2A 4D43A 4WY5A 4ZV7A 3I73A 1XU7A 5EIAA 1WZEA 3TI9A 1SCQA 1HWYA 3SPXA 4G09A 4G1EB 1HEYA 1TI7A 1K7YA 2B37A 2PVSA 2XZPA 4FIDA 3ZHVA 2EC5A 4DBLC 1HYHA 5FI0B 3OC6A 2X2FA 4BLRA 4YRQA 1LPNA 2FJ0A 1BXGB 2JZNA 3VYVA 4TN1A 3PXBA 3RNLA 1XV5A 4HFMA 1G8AA 3T9FA 1HKUA 2V55B 1TK3A 2F6RA 4OP2A 4RDCA 5LKAA 3JR3A 3B3JA 2QRMA 1R4ZA 1X7ZA 2BDUA 4IFEA 2E55A 2IDZA 1U9CA 2VSQA 3CE9A 3D8HA 2GKSA 3W1WA 4EY4A 1HFWA 4UTPA 3ZJYA 5DTEA 2LDXA 2YC2C 1FP4B 3H6HA 4WAUA 3B78A 4HLDA 1VM6A 2F00A 1Z3IX 3DMTC 2ECKA 3UQYS 1AHPA 1EFPA 1HTWA 1WZNA 2NU9A 4DMMA 4DW8A 1Q0RA 1G9TA 4BATA 1YZNA 3IQXA 3G9XA 1SU6A 1TLTA 4YGXB 4PPNA 5BW6B 3WGNA 3WBFA 5H3HA 1RJ9B 4GYYA 3Q8MA 4B4WA 4BGDA 2NQTA 1TPYA 2AKAB 3O4FA 2YUTA 5FTNA 4JAVC 3HA2A 3KOZA 1VLMA 3EAQA 2CMFA 4MVYA 3QKSB 5CX1A 1OGYA 2WJWA 3PQ5A 2QN1A 4RO0A 4F38A 4KAXA 1B43A 5I7AA 4H27A 5F73A 1I3OA 4XPIB 4FFPA 1TYEB 5ALSA 1FS5A 5T6MA 3IUSA 1TJPB 4DCOA 1XTTA 4P4TA 5TMPA 2IU6A 3E9EA 3EZGA 2DFPA 4NZPA 3GFGA 2Z95A 5HF9A 2DKOA 2VTBB 2I0FA 3HA7A 4D80A 2BTEA 1ONNA 5FWYA 2JIZA 5T8KA 5FUQA 4CL2A 3RRMA 3FDFA 1JWLA 4KIUA 4B80A 4YJ2A 4ZFNA 2IF0A 3I2GA 1WV0A 3B3QA 3U5ZB 3A3NA 4MIOA 1KDOA 3HCNA 4HNSA 3B6ZA 4W5QA 3NC1C 1EZ4A 2XRZA 3F90A 1ST2A 1Y42X 1V1JA 4DUGD 4AZWA 4TUYB 1KH2A 1T6BY 3O91A 2O7QA 5JSZB 1KI3A 4JLJA 2AFHA 2JG3A 4KFSA 1XAGA 1YE8A 3NTOA 3H9BA 4GZ3A 5C8XA 2OKGA 2HQSA 3FRHA 3KDPA 3N2GB 4U8HA 2HJRA 5AKEA 3IVCA 3D4IA 2G40A 1VPDA 3DDUA 1XAIA 2FEAA 2W6PA 4M9SA 4P08A 1PJ2A 4C0XA 3AETA 3ORYA 3P2KA 5AM0A 3ZVLA 5DXAA 2C3OA 4Y1RA 5IW8A 1M83A 2Q1UA 2QRZA 3BXZA 3KKLA 3AFHA 5IT0A 3D1LA 1V1RB 1XEXA 3S2SA 3UAVA 3FTCA 4CGYA 2FRVA 4RPCA 3LBNA 1OAOC 4PSCA 1EWQA 3WIDA 4GIBA 4C2BA 4NV0A 2IU4A 2DFNA 2FR0A 2ICAA 1ATZA 3STTA 1WUIS 3R7WB 2GHIA 3VYSB 2ONJA 2CKMA 3HCRA 4ZVPA 3FZYA 4ZI2A 1U7OA 3GA7A 3TG2A 3WGVA 2ZI5A 4ND2A 4ITRC 3FMOB 3RF6A 3PQ2A 1PT6A 3TCNA 1FFYA 3UMBA 4ZGBA 3LLUA 2P2LA 1GLGA 3CF4G 4D0SA 2YY6A 4PGHA 2MSEB 4LVOA 1Y6GA 4QYXA 4E1BA 2QSZA 2E5FA 4BNYA 3GJ6A 1DEKA 3JQ9C 3P94A 4M6WA 4A03A 5KOHB 2AT1A 4K9LA 4Q05A 3WMFA 5J43A 2HBYA 3KOXA 1CHDA 1I0LA 1UINA 3IAM1 2C95A 4R69A 5ILGA 3ZWWA 3WX0A 3WK6A 3IEMA 2YN4A 3EMKA 4M98A 3EXHA 4MVJP 1JX6A 4R1UA 1KC1A 2B1IA 2VYQA 1C14A 4JFAA 4L4SA 5E7QA 3ABRB 3PKJA 5B2ZA 1N6NA 5E1OA 2J6BA 2G08A 1VLQA 2VPZA 4RVFA 3QW4B 1VMIA 2QTVB 3KNZA 3OICA 1AQNA 3OAAA 1V11B 2Q28A 3DO6A 3GEIA 3NM5A 2WYWA 2DWUA 3FOEC 1E1CA 2NGRA 3WP1B 1TW3A 1I5OA 1QR6A 2L19A 4K6HA 5IAGA 1CRWG 2BBSA 5GAJA 4WW0A 1B26A 2ASVA 4M9QA 1AD2A 4Z9FA 4GKKB 1QHHA 1YB7A 4YFYA 5JCOC 4CLOB 4WT7A 2C5AA 3WSTA 3FE2A 3FI9A 4KN5A 4TRMA 1XTSA 1VP9A 3ZBPA 1RXCA 2DQKA 4Q15A 4C3OB 4IIBA 2QLJA 3Q98A 1AZWA 5JDCC 1S4QA 4KBGA 1MRZA 2Q0SA 5J2UB 4J1NA 3USZA 4BQFA 4EPXA 2J32A 3HGTA 4HWOA 2O20A 4UUMA 4N54A 1CRPA 4BO4A 1GUBA 4UU7A 3AJDA 3AO0B 2DRIA 4QDJA 1LH0A 3UC9A 2ZCVA 1J24A 4CL8A 4PNEA 3J7TA 1EFRD 1K88A 1CUVA 1TE2A 4NNPA 5EUMA 1KE2A 1OX4A 1SCJA 1LUAA 1UL1X 4PO3X 2EJCA 1L4YA 2XVXA 4B76A 3DR3A 3CNQS 3Q8KA 3B6KA 2CB0A 1M1YB 4CDMA 4RD3A 2WR8A 3VKWA 4X3CA 3WWZA 5JV5A 4YNBA 3PHJA 3RYCA 1FJ2A 2ZQZA 4W7SA 1NT4A 2H5EA 4H6PA 3M8KA 4W9NA 5I9SA 4DIBA 3N0XA 1W36B 2OCDA 3FHOA 3R5TA 1VECA 2VPTA 4JNCA 4KX3A 1YOVA 2ZWIA 3LSTA 2G70A 1L9KA 3IDFA 5E1BA 4HYYA 3OTOB 3FH0A 3OPQA 4Q3NA 1H6DA 2R00A 3URKA 3ESDA 4YASA 1NR1A 2DR3A 2J0UA 4E5UA 2H1LA 3DNFA 5I51A 3F46A 1EX1A 3LCCA 5KMGB 2QYHA 3L7OA 4OHXA 5HDBB 1CY7A 1UT6A 1POXA 3W2EA 1GU7A 3ECCA 1EP9A 3W5SA 5TS2A 4XWOA 2FF5A 1KPHA 3OKPA 1IWPB 3VDQA 2AZXA 2MINA 4S1NA 3EG9B 1Z2AA 3ZNPA 2E5LB 3LH5A 2REXB 1M8FA 4MW6A 4D1YA 1C4WA 4U6QA 2CLIB 2BEWB 4M0CA 4PSKA 2RH9B 4L4ZA 3WTCA 2C9CA 2RK3A 5LYYA 4ZVMA 3BKXA 3K9WA 3B7WA 4R2LA 2V7VA 1ZAYA 2TMDA 1Z06A 1SIWA 1WPQA 1MJ5A 3FMPB 1U0GA 3TD2A 3HB0A 5H4HA 5KNBH 3FN4A 1TJ5A 1CYEA 1M1ZA 2H1VA 2CEKA 3AEZA 3EMBA 4MQ6A 4QQKA 3NJ4A 5A1TA 1SQ0A 2A84A 4MGEA 4N5MA 1LK0A 4FMDB 2QL6A 4HJXA 4W7IA 1T13A 4NCHA 2ZT5A 1QHIA 4MJ7A 3LUFA 4XCQA 4UBKA 3GRFA 1PJQA 3JQ8A 4B74A 4IIGA 5AM5A 2QM8A 3KTOA 4P9NA 5MHTA 1I94B 2Y1WA 2XOKD 2X6TA 4LSWA 1BCRA 3GZNB 4EW6A 2NMVA 4LAFA 2QX9A 2PUWA 2OTCA 4MS3A 3IHWA 3QVJA 2F3SA 4TZTA 2O2XA 2E49A 4ZQIA 5BWBA 1VL6A 3WLJA 3B9BA 3R7NA 1N9ZA 3G8DA 3UJ6A 2O4UX 4Q5IA 2W2XA 2X22A 1DAOA 2PMKA 4HHEA 5DK4A 1RZRA 1VXOA 3PVZA 4QPJC 1OILA 1KU0A 3LQKA 3SJZA 1JN0A 5C5EA 4BNZA 5JZMA 1ZGHA 3GW8A 1U0OC 4MK4A 2BGJA 4Q1EA 3WWYA 2GPBA 3PQFA 4G0UA 3Q9NA 3H2YA 1JR4A 4QGBA 1E62A 1W7AA 3QLUA 3DTVA 4KFRA 1RI4A 2G25A 3IUPA 3CB4A 1ACJA 4UCQA 5B37A 3H1AA 1II0A 2J33A 2Z6VA 4KHPB 1ES9A 1O5TA 3WB9A 1G4UR 4AJLA 1LBEA 1EDDA 4Z7NB 1QM5A 4TWAA 1E9EA 2W2OA 4TSFD 1RHMA 3B1KA 5ANRB 2JPDA 1O94A 5MDHA 3W9BA 1HSOA 1CDEA 1N4DA 2HHLA 3I9V1 3ZU3A 4IIHA 4D3DA 4PZUA 2AF4C 1JI0A 4X1KA 3R7FA 3VTZA 4P7FA 4ED9A 1TM5E 4RS4A 1WQ4A 2MWMA 1RXIA 1JYFA 3KEFA 4OIFA 3UXHA 1B74A 3TUJC 5IC6A 4GDFA 4RTJA 1IC6A 2O23A 2V7TA 2XX3A 4S0ZA 1NL3A 3NDRA 2G17A 2OZVA 2GCNA 1QVVA 3A70A 2JFFA 2NWQA 2JLSA 2QTMA 3A05A 4OGLA 1F20A 4HVCA 2R8BA 5L3SA 2KM1A 3SICE 1X39A 3IAHA 1TVKB 3A9WA 5BYAA 4M8KA 5B3JC 5EIBC 4PSUA 3UB3A 5BV0A 5K0ZA 4HLUA 1IAVA 4E21A 1VLLA 4RVDA 1GPUA 1IJFA 3Q5GA 5A5GA 4Q01A 3NONA 3MCVA 4LOKA 3EXEA 4QYWA 2OAGA 4ZEWA 3MT0A 2WJZB 4BP9A 4NENA 1TCBA 3HHEA 2OHFA 3R0XA 2ODAA 4MROA 1DWUA 4NCBA 4DCGA 2DBQA 1DDIA 2EG9A 4RS3A 1M1NA 3DXXA 1UJBA 3IBCA 1AQLA 1ZUNB 2WHPB 4ZO8A 1BXRB 2JVJA 1E2UA 1NNLA 3WLFA 5KX5F 2QE7A 4WH0A 4X60A 1U2PA 3CF4A 3JZMA 4LV8B 3N7AA 2BI8A 3BERA 3O8OB 3OE4A 1UBRS 4IZHA 2RAUA 4RM3A 5H68A 2D8AA 2Y0BA 4PRKA 4YCDA 5ITWA 1SZPA 4BNLA 3ANSA 3DT8A 1NATA 4NMWA 4OKIA 4B6QA 1JE1A 3OJOA 4LSMA 1KEEA 4YQYA 1P5RA 1U2SA 2EGGA 1YK0A 4KN9S 4DJFC 3T35A 3UK6A 3K2BA 4R54A 1MH1A 2VDLB 3WQHA 3AH8A 3KT6A 3KZMA 1Z63A 4UCXA 3AVUA 1U0EA 3BRSA 1NYQA 4B6FA 2GEVA 1V37A 1XEWY 4RMJA 5IXYA 3DM5A 5C8YA 3EASA 3NOQA 5CPBA 1TQ4A 4D0NA 1K5DA 1E9DA 1TUBA 2QRGA 1BXGA 4BC0A 2MYPA 3NIGB 1NQTA 3UKDA 3GA0A 3IXQA 3DHWC 3IQIX 4E2YA 5LMZA 3DZGA 3S6JA 3VNQA 3LFUA 1THGA 3MAJA 4GPEA 4EJSC 3U61B 3AESB 4M9ZA 1KEZA 5DWDA 1QIEA 3N6RA 5L8VA 1UDWA 1SKQA 1Q6YA 4UAUA 3RC7A 5KOIA 3IQFA 3N87A 4G1UC 3K1TA 3P1JA 4PLCA 4XGKA 5C1IA 2CLEB 3PCXA 2ZETA 3RU3A 3W6NA 4XLLA 4HN2A 5IN4A 1J70A 1FDSA 2QAGA 2Z5VA 3CQ9A 2WP8J 3LHFA 4BLUA 4Y2GA 1NIPA 5FPYA 3STHA 1AE1A 1YI1A 1SVKA 4B82A 4F04A 3HTXA 2W2QA 2W2LD 2FQQA 1I80A 4BMPB 1KRHA 3QKSA 3ZIAD 3VPXA 5JNVA 4UHJA 2BFBA 3S5JA 4B7CA 1G3MA 1NBIA 5IM4A 2OXCA 2VWGA 5BN3B 1Y3FE 4W5TA 1I6LA 5FJJA 5LOVA 2N47A 4L9AA 4I36A 5FAXA 1IWOA 2I2WA 5D6NA 3MF4A 2AWOA 3BHMA 4C5AA 3KKZA 2IUYA 3OI7A 3WAKA 1BCSB 3EOBI 1FXWF 3NRBA 1XPUA 2AD5A 2VG8A 3OBIA 5EHXA 4L5YA 5JCPA 1XU9A 2J4FA 1VDZA 4G5XA 3WRYC 1V3UA 3R5FA 1Z34A 2I1WA 2HRDA 2YHBA 4RFVA 4M1QA 1G8KA 3QXJA 1JLLB 8GPBA 1T43A 2PQMA 4TTRA 4WNAA 3QV2A 3P4XA 1PD0A 4GLFA 4YROA 2GASA 3W5UA 5K3EA 2PBZA 3ZWKA 1EZZA 3ECAA 4MVWA 3HCWA 3ZZTA 1ZVJA 2X6QA 5HJ2A 1F8UA 2G0AA 3SEQA 2I4LA 5DHFA 4EPVA 2IDKA 3OPYI 2WT9A 2BEUB 4Q02A 5LDDC 4BEVA 3N2GA 1O7JA 1CJTC 4FFNA 3RLIA 4WUTA 1EKXA 3TK1A 5COAA 4AJ4A 1O3YA 5U1PA 5I8PA 3WQQA 3IQWA 4KTTE 1WBJB 1KC3A 2OFXA 4URHA 3WMXA 4KK4A 2I8CA 1ADJA 3A27A 4N6GA 3B6IA 1U94A 1YR8A 1N32B 2C5BA 1BJTA 4ZP1A 1T8WA 3MYYA 4DSNA 1IZ9A 3WLAA 4FT2A 4Y2SA 2F1KA 3BXOA 3TVYA 5KQLA 5EIXA 1U8XX 2HIHA 4RVGA 2UZ1A 5LP6C 2ZT7A 1IEVA 3ON5A 3QE0A 5LQSA 1NLZA 3ZXIA 4Q3DA 3DMRA 4OLFA 3WYFA 3PIRA 2XYGA 3E22B 4J0EA 5B58C 3WIVA 5CITA 4A5SA 4Y9TA 3WGJA 4MPRA 1KYTA 3HGMA 1TCVA 3M4JA 2AOUB 5AW3A 1RRCA 1SVIA 5AW0A 3M6VA 1SBTA 2QX4A 4QDKA 1T36B 4HATA 2QRUA 3COJA 2MCFA 4LJRA 1UAAA 4GL2A 2OBXA 4LV5B 4EKNB 3GEBA 2JFZA 4PLHA 2VQ6A 2J5RA 1ZH8A 3CLTC 4G23A 1JHOA 4Q34A 1K75A 1NW9B 3FCOA 4DV6B 4HTFB 1O95C 3O9VA 2H06A 5AXBA 3LFHA 5F5LA 4UAGA 4NV3A 3C6BA 5HSGA 4Z0NA 2G80A 2AQIA 2QTVA 2PRJA 1G8YA 4Z5XA 4TXHA 1V11A 1WLYA 2QI9F 1XHEA 1M2OB 1J09A 1IQPA 2EEPA 1W6RA 3G5UA 4HD8A 5DB4A 3WRXC 1XVAA 1VB3A 1HGXA 1SXIA 2H92A 4CPDA 1NLUA 1R50A 3HJAA 2ISQA 4UTNA 4F45A 3KLPX 2F55A 2QE6A 5KI6A 2Q6TA 2Z2XA 3KSDO 4JI1B 1KYYA 1J0CA 2I71A 4Q39A 3D81A 4MV1A 2GAOA 2A35A 4P4NA 4JJAA 5A7GA 5FBVB 1Y1QA 5C5DA 4W6ZA 4RULA 4H3VA 3NP9A 2AE2A 2NV6A 3PU6A 3IP3A 4XH9B 3A1FA 2BGTA 5DX8A 1VBNA 4C0HA 3UC5A 5EUCA 4ZYWA 3FUUA 3AEYA 1JDSA 2GGSA 1XD8A 2VHTA 4L5JA 5KJFA 4EYQA 1YI0A 2GLTA 4RYDA 1YS9A 2CY0A 3RS9A 4IIUA 1O08A 3PHGA 2J07A 3HP4A 1R66A 1L8OA 1X1DA 2YVQA 3UANA 2ZTHA 5ITSA 5KKNB 1RIIA 3U1BA 3NBAA 4KO8A 1W75A 4MCJA 1PEAA 3AV3A 4I1IA 4MA0A 1ZAKA 3BJIC 5D01A 4UBMA 3LF2A 2ZRGA 1U99A 1TQHA 5KTSA 3GLFB 2DE0X 5DVZA 3DOFA 4K3VA 1J1IA 1OX6A 3CUVA 3RRXA 5ALQA 3CN9A 1T5OA 2JKYA 2YL2A 2ZE6A 3X44A 4JI2B 1Q17A 3CA8A 3U81A 1U1EA 1TJ3A 2OGUA 1UBSB 3FJ1A 5EMLA 4DIMA 2D3WA 3Q6NA 1G19A 3T7SA 3PXUA 4JJIA 2DUNA 1M1YA 4C1NA 1R5JA 1Z2PX 3T5AA 2XGJA 1ZR4A 2W6IA 3K9BA 3OZWA 2O0HA 3NWEA 4RA6B 3GFBA 1P5JA 1L7XA 3CX8A 3V33A 3D8NA 5IWAB 3THWB 2UUPA 5D1NA 1XO1A 5ALOA 1QPBA 3OM1A 2HCRA 4B3RB 2JAQA 3P4UA 1CUEA 1E1QD 1WU8A 5F2EA 1GN9A 1KQOA 4MR8B 4U2CA 2VSXA 3UFBA 3O3CA 3DKRA 4OQZA 3DDOA 1L8XA 1NF2A 1R15A 3UGQA 3PUIA 3VC3A 3P32A 4KQ9A 2W6NA 5AXDA 2WTXA 3DBOB 3G17A 2P40A 4GP6A 3IAAA 1GZ6A 5IP5A 1X15A 2Q5CA 1B6SA 3BTVA 4U7HA 1XZGA 4PPQA 3ZCVA 4HNQA 4YCSA 3EG9A 5WRFA 3SYRA 1XPJA 3EA4A 3L7IA 2Z3VA 3VPCA 5A5EA 4PCAA 1D6NA 3F47A 2HV9A 2ZS7A 1BA2A 4M89A 3EYAA 2RHRA 1Z5NA 1XMXA 3U0VA 4F7DA 1BNCA 3QFFA 1VHDA 5E3JA 1MJFA 1II8B 2JRLA 4RD4A 4YRTA 1L3IA 3KYCA 1KXJA 4GZLA 1BJRE 2YR0A 3UJNA 5F4ZA 3IDQA 4RK1A 4PRZA 2EG5A 4LDRA 2G07A 1USGA 5DO9A 1OZGA 1VL2A 1QWOA 1AU9A 1CUDA 3KL4A 3L18A 2HWUA 3L4SO 4LJ4A 5ERYA 4YP1A 5H16A 1B14A 5BR4A 1QVWA 1OFTA 1X1SA 3WYDA 3IAS1 4C05A 2BZGA 2CV2A 1KK1A 1JDNA 1H4VB 2CF6A 1P9LA 3FIUA 3IXMA 4WV3A 4IQ4A 1ZD5A 5BWMA 1N2EA 3FPBA 1UXIA 1YC2A 3D6MA 3JWGA 3BXFA 1RZ3A 2F8MA 4KFTA 4QPCA 4F71A 1DRUA 1YCGA 1FJGB 2P5YA 4PN7A 3NC4A 3VBEA 3KD3A 4Y6RA 1B15A 1E94E 1FP2A 1X7YB 3IR6A 4OL9A 4RAQA 3UT5A 1Z5GA 3EWNA 5B4VA 5TSDA 4CKCB 1HFEL 4L7QA 3ILXA 5EFZA 4JV5B 3HSKA 3QUBA 4OFZA 2YKGA 1TK9A 2BPOA 2G67A 1LJUA 3VU1A 4F5WA 5KWVA 1T5DX 2NTEA 1U7DA 3TLXA 3ONVA 1FNMA 4ZK2A 1SXQA 4UD2A 4MA4A 4MOWA 3G0DA 10MHA 3VR3D 2EP8A 4HY3A 4J9VA 3RIXA 5LA6A 1N9GA 1Q3HA 2QRJA 3LUKA 1Z4LA 4CG3A 5AW4A 1EUCB 5JBIA 3M6WA 2HRCA 2QU8A 4OP1A 3SLRA 1UIRA 4DC0A 3CG0A 3VV2A 2P9BA 5A4FS 3E3NA 3SQDA 4EG8A 2CXTA 3K15A 1RWXA 4UEKA 4UUQA 4UHKA 1T3GA 5EIBD 4C2AA 4EG4A 1E2HA 1O57A 4HAOA 1PFQA 4WBNB 4F7WA 1F8YA 4ND1A 2P27A 2P3QA 5LBIA 2CUKA 4GOJA 3IDZA 3IP6A 1XQ9A 3RT1A 1DJMA 4TV9F 1QF9A 2HHAA 2JRCA 4TLEA 2TMGA 3UPTA 2C2OA 1ZONA 3PUVA 1ECJA 1UDBA 4S2UA 3C1UA 5SZKB 1BN7A 4P38A 1REQB 1JFVA 2WIBA 3E84A 4BRWA 1YJ8A 7ADHA 1DX4A 5JT1A 4XWAA 4G4JA 1P62B 2X4IA 4JU8A 1V39A 1QQ6A 4YJGA 4I6GA 1ZRNA 3PITA 1FYEA 1N5DA 4H31A 4BO0A 3ER8A 1W5TA 4LK2A 4P3YA 1V1MB 3K0FB 2ZEJA 4F4CA 2IVFA 1KP9A 5GADl 1Z5VA 2VBGA 4M1EA 3ROPA 1SNYA 2PSEA 1UT5A 1IBRA 3L8YA 4H1HA 1SXHA 3PGJA 4MV6A 4GWKA 1YAJA 4X20B 3VR6H 4F8JA 4C7KA 2GSDA 1NBOA 3Q2OA 4UFNA 5BXYA 5TLSA 2CL6X 5UKDA 4IVRA 3HA3A 3HEBA 5I7WA 2I7TA 1CRQA 3H3XA 3VPAA 2BFCB 2FRDA 3BUSA 1IXRC 2WG1A 3OCUA 1DU4A 3QBVA 5FTLA 3SLGA 3GT4A 1UBKS 3VNRA 4DDMA 3C1TA 1XK6A 1ZUNA 2WHPA 1BXRA 1YS4A 3MG9A 1P0QA 1SB8A 2I6SA 3OY2A 4RWEA 5EQDA 4DCTA 3B2EA 5JVDA 1AK1A 3T3NA 2WUEA 1GYQA 3C39A 3ZXXA 1IJKA 3O8OA 2HMAA 5EIWA 4BFYA 1QCYA 3CGWA 3BFVA 1JXMA 2OESA 3GUHA 4GPZA 4ROTA 3U9LA 4COOA 5CAEA 4RWZA 3RU7A 4RGVA 3BAFA 3PE3A 5AW7A 1J4AA 2WJGA 1Y7PA 1CR2A 1U3FA 1EE2A 3GRUA 1B42A 1L5MA 2DHRA 2KPOA 4JR1A 2DBRA 5GONA 3KPYA 1IBSA 3QWFA 3RFUA 3U16A 3BS4A 3A0RB 3D0KA 4HDRB 2PUFA 2NLOA 3L92A 1B93A 2WAAA 2XQIA 4MULA 3QX7A 1YFJA 9LDBA 2OQ2A 3Q40A 2Q1WA 3SF8B 1J22A 3OLXA 4RFSB 3CH7A 4QHYA 3VYTB 3ZTWA 5FCDA 4CCWA 2A0XA 3AP3A 3HXOA 4J8PA 3BULA 3IJEB 1QQBA 4RPJA 2P4HX 4I1OA 4L73A 2W2VA 3ANTA 3AFMA 3BFJA 4BO8A 3CE6A 1LQUA 3TUZC 1HR0B 3AESA 4CQLB 1ZN7A 4FJ0A 4J0IA 4LYDA 4TL7A 2BFAA 1H9CA 5JECA 3CKKA 4JU9A 2B1QA 4YJHA 5GPBA 4D4LA 3QVLA 5CUQA 1K6MA 3WJAA 3FWPA 5I01A 3IR5A 4P81A 3T4PA 2Q3EA 1J2JA 2Y9PB 1U9JA 3LZCA 1IHYA 2BP7B 4LMRA 3WLQA 4E12A 4E2WA 3T38A 2AI1A 3LP6A 4E13A 2NYAA 4EVSA 5JROA 1U4SA 4D0GA 2G9UA 5CD1A 2QTRA 3L7LA 3TB4A 2BL4A 2JIOA 3GAZA 1YQUA 2W48A 3SDZA 1B8VA 1PX0A 4B7UA 3N8GA 5JAPA 1BA3A 2MMCA 1G2QA 3VV3A 4YT4A 3GBPA 1N2ZA 5CU7A 3RTDA 5I5EA 4P58A 5BQOA 4BNXA 3LQFA 3HB5X 3AF0A 4B6SA 2X77A 1UPFA 1R8SA 4X85A 4AY5A 5H0IA 4N82A 1GTG1 5EPUA 3U3RA 1IXZA 3OIYA 4IDHA 1UJMA 4TLBA 2I1QA 3LW8A 1U0BB 4LZOA 2ALJA 2NXNA 4IGEA 4UOEA 1ZWKA 4KYIB 4X8MA 3L4KA 3FCXA 1N2CB 1S8AA 1U0LA 4RVHA 2G8LA 1ZSVA 4PX2A 4UMFA 3L7MA 1NVAA 3T99A 5JY6A 5LIRA 3ISTA 4OBEA 2FEWB 4HBGA 3CZ4A 4N65A 4F2HA 4LF5B 4MGYR 3DOOA 1Q12A 3IH5A 4O2AB 4WE3A 3V8RA 1XA0A 1FB5A 3NYWA 3SEAA 1C8LA 3DBRB 1VP3A 3NIFB 4NBWA 1T9AA 1V8ZA 1JLLA 2IXGA 5I4BA 1JFFB 1IZ7A 2IUFA 3K2IA 4M37A 3W9YA 2E7ZA 3P71T 2QP4A 1K7CA 1FFBA 1SUIA 3F7TA 4FGWA 1GU0A 4QBHA 1L5VA 4XOUA 5EE1A 4Q4HB 4KR9A 3RC3A 4XX1A 4RQAA 2PO5A 3D3WB 2OENG 3L1KA 2K7FA 4LKOA 3KZXA 2FPUA 1NFFA 1RQRA 1YDGA 2EJVA 2WSLA 3HYTA 3NH9A 4G3XA 1ORVA 1E2MA 4RMGA 2B1JA 2ZB4A 1MUUA 3AKDA 4ZAWA 5THQA 5LQRA 2IS1A 1YQDA 2E37A 2BZ0A 1Y9EA 3QVGA 4BVHA 1XRMA 3CLTD 3K1JA 1M1UA 1Z3CA 3I2YX 3MTJA 2AW5A 1ZCAA 3M81A 4DUGA 4LYGA 4EELA 2J3JA 3H4IA 5JHHB 2YWEA 4IDCA 1DC3A 2R65A 2JJ8A 2WYOA 3QE3A 5FO0A 1AF4A 2R8ZA 4XLTA 5FLEX 2E18A 3B7GA 2H59A 4J0GA 3W8RA 1KOGA 3VTKA 3QVXA 3CVJA 3W78A 1DIRA 1D1TA 4BN0A 4WN9A 4L8FA 1GIAA 1LK7A 4ZPXA 3B60A 3H9GA 2WI8A 2FZVA 4ZRNA 5HG0A 3RVRA 3V7FA 2RIRA 2WZQA 3NBYC 1VCHA 3DVQX 2NU8B 3LECA 1VCNA 5EIFA 4Q3CA 1UDCA 2BFWA 4JBWA 4OXYA 1E5DA 2WAYA 1P1JA 3DQZA 5FO1A 2AOUA 3M6IA 1GL7A 4TYYA 1KI9A 4WKCA 2FZWA 1X1RA 1YUBA 2QNRA 4TVBA 2HJHA 3AM4A 1DE0A 4WNYA 3VX4A 4DYDA 5EGNA 4WJLA 3AERA 2FWBA 1XXHB 1YRBA 3M5WA 2IUTA 2QTWB 3CRW1 3GEMA 3KFVA 4GMXA 4DA8A 4S1TA 2HK7A 4DLSA 1SELA 1FW6A 4BPBA 4MKRA 2FX2A 3L41A 4Q93A 3ND7A 3AINA 1U63A 4Q37A 4L02A 1UJNA 2VNJA 3F7NA 3GDOA 3OH8A 3ZHCA 4JSYA 4LZNA 5B30A 1FLAA 4I3FA 4MAMA 4ETNA 2CVPA 1M2OA 2P4EA 3FETA 3HCOA 1W8DA 3IAEA 1QONA 2D5AA 1G6Q1 1GNLA 1JFTA 2ZRBA 3X0DA 1DC5A 4AX4A 4Z7OB 1TAUA 2OPBA 1RRFA 1FRVA 1OC2A 2XAUA 4FFOA 4R3UC 3ZZMA 3T1TA 4FSDA 2VJYA 3VAZA 1BS2A 3WLHA 3W5JA 4DCMA 4LXTA 4KOEC 5LPNA 2IBSA 1Z5UA 5F3WB 2O3UA 3KEOA 2SNIE 5GJCA 1E9CA 4NARA 3Q8WA 4EQZA 721PA 1VIAA 3K1YA 2NTNA 2OYSA 2VBCA 3TR5A 5AVRA 3I2FA 1GO2A 1BE8A 1N6PA 1W88A 1X19A 3ZGZA 4H4CA 4YPOA 4FBMA 1Z37A 4AG6A 5A3RA 1RLJA 1JSZA 1JSRA 1N0WA 3L0BA 2WV7A 4I6EA 5IK2A 1EB8A 1OPRA 1P1KA 2DPHA 1SA0B 1IHDA 3SC2A 2PSDA 3IPXA 4XSGA 4CEJA 4YI3A 2Y0EA 3DT6A 4D9NA 3IPAA 5CXXA 4MCHA 4KFCA 2HO5A 1BTOA 5IBQA 4DLZA 4TOIA 4MKHA 4QTZA 3CC8A 3I34X 4JENA 1XJWA 2CVQA 4BO3A 3EFOB 3CWQA 3AOEC 5G4KB 4PW0A 4BQPA 3VSBA 4XJXA 4ZOAA 1ZM4A 3OWOA 3QYAA 4MVJM 3N5CA 4V0QA 2IZOA 1X2EA 4RA6A 2Z58A 4BC1A 1CUYA 2QYOA 2XD9A 3NEPX 1NNEA 2W93A 3A37A 3PVCA 3THWA 4IG4A 1AV7A 1YT5A 1V0JA 2JCSA 5FOSA 5KYWB 1G8GA 4G85A 3RASA 1NJFA 3E5MA 3G2QA<