3D1VA

Crystal structure of human pnp complexed with 2-mercapto(3h) quinazolinone
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
288
Chain Sequence
b'ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Structural studies of human purine nucleoside phosphorylase: towards a new specific empirical scoring function
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d1vA00
4U2KA 1ZOSA 1VFNA 1YR3A 2XRFA 3TL6A 4F1WA 4RJ2A 4D8VA 1RCTE 4FFSA 4OGLA 1U1EA 1JDZA 4LZWA 3BL6A 3UAWA 1I80A 2QDKA 3NBQA 3UAYA 1YRYE 4EB8A 4DA6A 4KN5A 1V45E 3OF3A 1Z33A 2OC9A 1V48A 4D98A 1RR6A 4BN0A 4D8XA 5CCDA 2QPLA 1RT9A 3GB9A 3E9RA 2OECA 4QASA 4TXNA 2A8YA 4L5YA 1OTXA 1QE5A 3KUKA 1RXYA 3FNQA 5CXSA 4YNBA 5I3CA 1T8YA 3NM5A 1PR5A 3NM4A 1OU4A 2ON6A 4DAEA 1PK7A 4QATA 4DA7A 3LA8A 4WKNA 5F76A 2AC7A 4D8YA 3O6VA 1K3FA 4MARA 2HN9A 4TXJA 1ULAA 4QARA 3BGSA 4YJKA 1SQ6A 5B7PA 4WKPA 4I2VA 1C3XA 1VMKA 1SD2A 2H8GA 1Y1RA 4G8JA 5IFKA 1WTAA 1G2OA 5C80A 1V4NA 1Y1SA 1LX7A 1RYZA 1A9TA 1NC3A 5FAKA 4JWTA 4L5AA 3ENZA 3OZEA 3T94A 1PR4A 4L5CA 4DABA 2PGAA 4TYMA 1LVUA 4R2XA 4X24A 1OTYA 1OV6A 1VHJA 4QAQA 4TTAA 4M3NA 3EEIA 5F7XA 3ONVA 1B8OA 3OZBA 4BMYA 5B7GA 1ODLA 1Z36A 1PF7E 5JPCA 1PR2A 1A9OA 1Z38A 3PHBE 4WKCA 1JDTA 3U40A 3BSFA 2A0XA 1ODKA 1JPVA 3UAXA 4G89A 3K8OE 2QSUA 1XE3A 3O4VA 5B7NA 3KVVA 3E0QA 1Y1QA 4F3KA 3PNPA 1PBNA 1TGVA 4G41A 2AI1A 4TXLA 1U1DA 1YQQA 3KVYA 1Z5NA 2HSWA 4GMHA 4TTIA 1B8NA 4TS3A 4ECEA 1Z5OA 1JDVA 3DF9A 5F73A 2QTTA 4QFBA 1U1GA 1Z34A 3KU4A 3P0FA 4LDNA 1TD1A 5CCEA 3OOHA 4BMZA 3DP9A 1ODJA 2B94A 3P0EA 1RXSA 2AI3A 5CYFA 2I8AA 1YQUA 1JDSA 2OC4A 1CB0A 1VHWA 4MCIA 1V2HE 1Y6QA 4JP5A 1JDUA 4LNHA 1PWYE 1A9QA 4JOSA 5EFOA 5CYGA 4PNPA 3IEXA 4NSNA 4EARA 4D9HA 3DDOA 1RFGE 3KVRA 5DK6A 5KB3A 2HWUA 3DPSA 1RSZA 5F78A 3UAVA 4R31A 4YMLA 3EUFA 3KHSA 4OEHA 2RJ3A 3IOMA 3FOWA 4GLFA 1U1FA 3BJEA 2OXFA 4F2PA 3DJFA 4NY1A 1SJ9A 1RXUA 3OPVA 4WKBA 4R2WA 3FB1A 4H1TA 3C74A 5EPUA 1V41E 3MB8A 4DA0A 2I4TA 1U1CA 2A0WA 3D1VA 1PR0A 1PR1A 2HRDA 4OJTA 4LKRA 4L6IA 4OGKA 4GKAA 3FWPA 4OF4A 1K27A 1Y6RA 4UC0A 4MCHA 3K8QA 3PNSA 3LGSA 5F77A 4DAOA 3GGSA 1PK9A 4OY3A 4YO8A 1A9PA 3QPBA 1OVGA 3OOEA 5ETJA 1OUMA 3FUCA 1T8WA 1SD1A 2AI2A 4F2WA 1PR6A 1NW4A 1Z35A 3ODGA 4TS9A 2GUWA 3OZCA 4DANA 1T8RA 4K6OA 3OZDA 3EMVA 1M73E 1RXCA 2P4SA 2QTGA 4M1EA 1Q1GA 2ISCA 2A0YA 1Y1TA 1ULBA 1CG6A 1K9SA 1PKEA 1ODIA 1V3QE 3LBAA 3OCCA 3F8WA 4DARA 5F7JA 4TXHA 5EUBA 1FXUA 5F7OA 1TCUA 2Q7OE 4GLJA 4WKOA 4BMXA 4P54A 2BSXA 4QEZA 5CXQA 1Z39A 3UT6A 3E9ZA 3SCZA 5F7ZA 4PR3A 1A9RA 3NM6B 1JYSA 1T8SA 5K1ZA 1A69A 5B7QA 3PHCA 1T0UA 5IU6A 1A9SA 1N3IA 1JP7A 4DA8A 4IP0A 4M7WA 1YBFA 1JE1A 3EUEA 4E1VA 1PW7A 1LV8A 1Z5PA 4LNAA 4NS1A 3MMSA 1JE0A 4TXMA 3INYA 1NC1A 4TTJA 1TGYA 1TCVA 3FAZA 1Z37A 4F3CA 3UAZA 4L0MA 1ECPA 2IQ5A 1ZL2A
chains in the Genus database with same CATH superfamily
3IP9A 3QELB 3OTHA 3LHDA 4BX2A 3VOTA 4CLOB 4FMBB 5IEBA 2O1SA 2SKEA 3CZPA 4G5YA 2ZB4A 2P2YA 2RHJA 2EJTA 2NYAA 4B79A 3OU7A 3UGJA 3PV0A 3L40A 2FMXA 3QYPA 4Z2AA 1T4CB 4G1MB 5EE9A 2WE8A 5HBGA 4D8UA 2DWCA 4ZDKA 3O91A 2N1BA 3SHOA 1XMIA 2CE7A 1CZUA 1JW9B 1N8NA 1AXRA 4DNPA 2X6QA 1IY1A 1I80A 1K7SN 3C5WP 1CF4A 2W6NA 3GBVA 1KDTA 1S4MA 2X86A 2WLTA 2R751 3HRIA 1Q2XA 5AHOA 4A3SA 4QJ4A 3ZEAA 2HSJA 3M9XA 1PQYA 2XMDA 4JB8A 4KN5A 4EPXA 1V45E 2O7SA 4TT3A 1ZM9A 3STTA 1ACJA 2PD3A 1RM3A 3D7KA 2FN4A 3HXLA 1ZZEA 2W98A 4NG5A 1O96B 4MQ4A 3FRHA 3QEOA 2C0PA 2XRZA 2VO1A 5JCPA 1DWUA 3M1LA 4PLFA 3R0VA 5HJ5A 4UQPA 2QPLA 3R6TA 3K8ZA 1LC3A 3Q0EA 5AESA 5M29A 2FH5B 1K68A 4RV9A 1NBIA 2QE7D 3KC2A 3OQJA 5HMMA 4D3ZA 1RWKA 3ROQA 3H6HA 1K63A 1E79D 3S2YA 2PS1A 4WXYB 4B2YA 2O8BA 4NCHA 6PFKA 1N0IA 1K6MA 3G23A 3LY9A 2KYRA 1FW8A 3U7IA 4DKJA 3HU1A 4U8GA 1MZVA 3V1MA 3AY7A 3P27A 4PAMA 5JECA 2DECA 1ZVVA 2UXDB 3W2GA 3WYNA 1HSOA 4ZA2A 4ARZB 5L3ZA 5B6PA 4L4YA 4L72A 1GG9A 4E12A 3LU1A 3I01M 4JQSA 5DNDA 3CWCA 3K2BA 4HZIA 4AN1A 2PUBA 4IJWA 4KFSA 3ZTTA 1W9HA 4EFNA 3VVBA 2Q5IA 1KI6B 1EBBA 3ZOZA 1F2TB 5IDQA 5L3QA 1ADBA 2NO6A 2PTGA 1SXPA 2QE6A 4AO8A 1AJEA 4PG5A 4NMWA 1NUUA 1RRKA 2Q3FA 3EWNA 4S0XA 3FROA 4TSFD 2PIAA 1G7TA 1DGQA 2HNKA 2CLIB 4TYYA 1C1HA 2OYSA 5EWMA 3TBKA 4XVQA 2ZI3A 5H9WA 3WAGA 2YHAA 4BECA 1EUCA 2PPVA 4BNFA 3UXHA 4H2DA 3WGJA 2O8NA 2XGGA 3QVUA 5AJZA 1P4JA 1X0XA 5IZ4A 4NE7A 2YWRA 4KR0A 4ND5A 3SSOA 4S1TA 3ENVA 2XT9A 4GX1A 1YZUA 1B0ZA 4LQDA 2QMHA 3W04A 3AR2A 3FOFC 1YA6A 1V8ZA 3FHCB 4MKZA 1SD2A 1PJQA 1GV1A 1XZFA 2PTHA 1U1IA 2VRCD 3EMDA 4J29A 3IAEA 4XYBA 4F4CA 1CF9A 4OJNA 2VN8A 1NE7A 3STYA 1W7AA 4EG8A 1AHIA 3D5EA 3I9OA 1G2OA 4AIRA 4XIGS 1FUYB 2B98A 3MJSA 3GFGA 5TEVA 5HKOA 3ASZA 3KWLA 3M1YA 4R05A 2XA1A 1R15A 2RKBA 2YMLA 3B85A 5AW8A 4C20A 4HDRB 3GLHA 1BS2A 1MORA 1V35A 2OCIA 3ACDA 2V3WA 2Z43A 1QK5A 3G8AA 3U4MA 1MAWA 3COJA 4UBNA 3C3XA 2JGEA 4LZNA 4EM6A 2G25A 1DADA 3FLBA 2WJPA 3CFYA 3DUWA 4S1OA 3CKLA 5DO9A 3U4HA 5FOXA 2VJKA 1NLFA 2QLNA 2ARKA 3RIGA 2AG1A 4OV6B 2BKLA 4D9JA 1E69A 4OYLA 3A6KA 2YWFA 2I66A 3QQ5A 3ITNA 2QYHA 4OXQA 5ALUA 1JEQA 3I09A 2QIPA 1KGSA 2UZAA 1DC7A 2R8XA 1E1CB 2VPZA 3FYUC 3NHKA 4KIFA 5LA6A 3SKYA 3I5XA 2FVYA 3UWOA 3IAAA 3SX4A 4DR3B 4GP6A 3E70C 4K6CA 5E38A 4FB5A 1KEVA 2NO5A 3GLFE 4XR4A 2MTBA 4UFPA 2KI5A 3NNDA 4J07A 1OA0A 3RIHA 1F4LA 2FSUA 3LE8A 4KXFB 3OLYA 5FL7D 4CKWB 2J4DA 2UYCA 3VSEA 4C7MA 1BGVA 4EGFA 4MWTA 1V3UA 1I3KA 4X66B 3JTMA 1A9OA 1TUEA 5LQJA 2FW7A 2CD7A 4NDAA 3KUCA 2ISSD 3NASA 5BWNA 4C2TA 1S3SA 1Q84A 3PGVA 1SN7A 3SFZA 1EFLA 2O2HA 3L79A 3F78A 1OAOA 5BRAA 3R9XB 1WXWA 2QX9A 3BTOA 4N39A 3RB8A 4HUTA 5D5QA 4NATA 2CJWA 2Y68A 5E3HA 1AA6A 5KSWB 4BJ6A 4BP1A 2JGDB 1T34A 1KHHA 1KZ6A 3JASB 3LW7A 3PC8C 1SCDA 4UVHA 2WU1A 3I2JA 3QA9A 2VJCA 3P2IA 4P3PA 4P31A 4WZBE 3OZUA 3GWGA 1ORRA 4XQGA 1P62B 3L8DA 3PXXA 4GI2A 1WETA 3QVSA 3AESA 4IXWA 5F1YA 3AEXA 1D6MA 1M1NA 1W87A 2I3DA 3HNOA 3P0RA 4GZMA 4MUBA 2AE2A 4UUOA 3K31A 1RAAA 4GFDA 5CEFA 2C88A 4EMBA 3Q3EA 5FRDA 3P32A 3ZJYA 1ARZA 1FXWF 1Y4ZA 3CBQA 4BAZA 4F71A 5IM4F 5IP5A 4HLNA 1CVLA 1X7XA 4UBIA 3EFHA 2N9UA 4WXEA 3KYJB 3DJYA 4YAGA 3V4FA 2SCUA 2ERXA 2J32A 2PL5A 3GGPA 2ZIFA 4NULA 1XQ1A 3R1IA 2JATA 2QENA 3KE9A 4OXRA 4ROSA 5FHQA 1DRJA 3O83A 1FDIA 1HT2E 3H2BA 5GWXA 3T15A 4B46A 2GILA 1L7QA 2IEAA 2NZVG 1E8DA 4P4TA 3ZCSA 3ZZ1A 1U2GC 1JPNA 2Q4OA 1ZNWA 3V1YA 2EFDB 3W90A 3N3BC 4JP1A 4K5QA 2C03A 3N8IA 1TJNA 1MO3A 2H51A 2EQAA 2W6MA 4P98A 4C06A 3IEVA 2NP6A 4I0WB 4MROA 2IK8A 3RTBA 3ASUA 3FNEA 3V97A 3JALB 4KFCA 1EP1B 4MJLA 2I67A 5A2GA 4MI6A 3M6MD 2Q3CA 3JS5A 4QOSA 1I33A 2B6HA 2IPAB 1JLLB 5ICMA 2B99A 3LHKA 2IUYA 3SX2A 2Z83A 2I99A 4E15A 5BSKA 3I0MA 3LH5A 3LUAA 1KQGA 1POXA 3O8OA 3QWFA 4MLZA 1ST2A 4NXMB 4PO8A 1C8BA 1T1JA 3F7NA 3DT9A 1RAFA 3L18A 2A1UB 4FNGA 1OIVA 1UPUA 1JGTA 1NLUA 3AI7A 4N0QA 1L4LA 3QV2A 5T4BA 3ZEIA 5BV1A 4PG8A 1G8JA 1G4HA 2GAFA 3CGWA 2XQIA 5JZVA 5CVJA 2OHIA 5BR7A 1YTUA 4K3VA 3PUXA 2XGJA 4FGJA 3TWOA 1MB3A 4EO4A 2OHFA 4HUJA 2O8FB 4KX5A 4XOIA 5EXDA 1GV0A 1QVZA 5D01A 2IZZA 4MQMA 3EGXA 5SY9A 1KFKB 3V4LA 3ROZA 2DHRA 5D7NA 1N8KA 1NBMD 1P5RA 5LP6A 1T9ZA 3AV3A 5AHKA 3VH4A 1AXEA 3E23A 4B34A 1JLRA 1QHEA 3DPSA 3NOOA 2HT1A 2R4TA 2ASEA 2QD5A 2V45A 2WHXA 3CO5A 3GWZA 4QECA 2JLRA 3VKVA 4V38A 1SHTX 3WRWA 1O6BA 2YVAA 2HHCA 2QR5A 3H9EO 1EFRA 1LGYA 4QRHA 2K2QB 3ZWDA 5D85A 4R1SA 4DC0A 5IZCC 2QRPA 1JNYA 2C82A 3K1YA 2DUMA 1KBZA 5LYJA 2FE4A 5A3QA 1JHRA 1M10A 2MDTA 4M9CA 2FZEA 3UGQA 3V42A 2ETXA 1LRKA 3EQ2A 4PVDA 4RQAA 1YU6A 4LWQA 2R7LA 3MYYA 3HK2A 3HGTA 3ULKA 2C2GA 4L7VA 4CL0A 3KYIB 2XKJE 2VPPA 5EJ5A 4TLLB 5JCOA 1DCKA 2IYOA 3DJFA 5HILA 4U5QA 1BVRA 1S2MA 1F6DA 4ZIRB 4L02A 5ALXA 3ZDAA 2QY6A 1RMTA 3FTDA 4MV4A 3UJCA 4EA7A 4YIHA 1J2YA 5KYXB 1RMQA 5J9FA 3WIBA 3AKCA 1G20B 3FDZA 5EP3A 5C1IA 2PR2A 3PC4A 4GBJA 1KVRA 1ZKDA 4FINA 1JDBC 5ELXA 2Q1TA 3LCVB 1VKNA 2IYUA 1P7YA 2FWBA 5TQVA 2GJAA 1CHNA 1ISMA 2FY8A 1MGPA 2TRSB 4CPDA 2GXSA 3H19A 3N05A 4LHVA 2NZ8A 2HRDA 2F67A 1TK2A 3EIFA 3ITEA 3JY6A 4GKAA 2CWWA 3F5SA 1MX9A 1UKAA 2JCYA 2PGXA 3HCAA 4G2TA 4LZPA 1TM3E 5BSRA 4F5YA 2JGLA 3EZ7A 3UK2A 1QIEA 1C3JA 2ODNA 2VAWA 4I9HA 3AJEA 4KQWA 4B3DA 5BMVF 1V6AA 5K0FA 3WA7A 3I9LA 1QLWA 2R25B 4A0QA 4AY5A 3GN2A 1USUA 3IBYA 1DKPA 1J8QA 4FE4A 2ZBRA 1A9XB 1D2EA 2H11A 4JVLA 4X1IB 2AKAB 2XWBF 1I8TA 3H6GA 4Y3UA 1P9RA 4YWHA 4ZT3A 2M6LA 3KHUA 3UJ6A 1FRQA 3LUKA 2I1QA 4YCDA 4Q34A 4YO8A 1GZUA 1KYVA 2NU6A 3I76A 1A9PA 1VYVA 1HV8A 2OMKA 2PGDA 4FGSA 4GT1A 3IAXA 3OOEA 4UCFA 3ZN2A 1MXFA 4D41A 3LZDA 1HO3A 2DUUA 3HLKA 3IBTA 2POQX 2HRZA 2ZRPA 1EBFA 4Q7QA 2PV0A 1ENZA 3NAMA 4G5HA 5JR3A 1RBYA 1R5BA 1P1KA 1WY5A 1E7WA 1M76A 1JAXA 4MIKA 1A88A 4JGGA 2ZI5A 1X70A 1OBFO 1PR3A 2FK8A 3GT3A 5FPPA 3RW9A 4BNYA 1Q1QA 5E4JA 3C6KA 3CF4G 1U5AA 2BR5A 2Z57A 3CEAA 1WBBA 3ZD7A 5J4VA 5U1PA 1GGKA 2ZG6A 4BTLA 1YF3A 5FWXB 3E7FA 4MWZA 3D8SA 3CNLA 3HEAA 3H3FA 4D97A 4QLOA 1H9AA 3ZNNA 1AKVA 1PRYA 4RUKA 2VBFA 5KVSA 2XUOA 4PPYA 3K0SA 3WA6A 1XZKA 3MTJA 2WPDA 4ILKA 4D9CA 2I7TA 1NURA 4RENA 5FUWA 1NTRA 1JEEA 5LC1A 1YI1A 5L8VA 3I61A 1R18A 5K0LA 1O6ZA 1WDMA 1VL0A 1IY9A 3RH0A 421PA 4D43A 1Q1GA 2RCYA 3L6EA 3NCHA 4UNIA 3SY8A 2BEKA 1P9OA 1KMMA 2B4KA 5ALJA 3D59A 5HM8A 2VP4A 4KK3A 1ZUNA 4ZVVA 3UATA 1W85A 4LY3A 1J8MF 3BWBA 1U28C 2Y1DA 5H70A 4DWVA 3GLRA 4XGKA 3K0FB 2NUPB 2CJPA 1PT8A 2O23A 3CF4A 3QEJA 4GX2A 4UPVA 2VHTA 4IS2A 3L8GA 5FTMA 3HVIA 2Y3IA 2GOYA 2IOHA 3FWNA 1LNQA 1SC1A 2A57A 3IAFA 5ALTA 3VYRB 3FPEA 4OOFA 3C3WA 3MA0A 4P54A 2Q7DA 2V97A 1J0AA 2FE1A 1YWGO 4UASA 4R16A 5AIAA 2R4QA 2WJ6A 3TOXA 4EY8A 8MHTA 3PC6A 3AGQA 1EGVB 3V34A 5BYAA 5BXYA 3V8QA 1FQJA 4E2WA 1KSFX 2AHRA 5BR4A 4L6AA 2WSBA 4WFKA 3F5FA 3NBXX 1XIVA 4M1WA 1G9TA 4N3AA 1F9EA 2ZJFA 4TV8A 4N76A 1VP9A 1FP4B 2B82A 1MFZA 2XQGA 4IRXA 2C1EA 4CR7A 3L07A 3TQHA 1JQ5A 2IYAA 2D2EA 3ETJA 3JD4A 3DTVD 3P0IA 2PX8A 3BE5A 1U2DA 1BG6A 4E03A 5HOEA 5CGZA 1GAEO 1J39A 4IF4A 3QXXA 5BPHA 3U5TA 1D2GA 2Z30A 3LC2O 3IUPA 3SZ3A 3AZOA 4XIYA 5AKEA 3FOZA 4G4SP 1HQYE 5EEHA 2RFLA 3DLTA 1QO9A 4N5NA 3T7SA 3WMXA 4DDHA 3IEUA 2XF2A 3E22A 5JMWA 3ZDZB 4LJYA 1ISGA 3F96A 3E05A 4P7GA 3K9QO 3EW9A 1PWXA 4QOHA 4REQB 3MCTA 5JPIA 2EJBA 1E3MA 1SK9A 2NO9A 2ZT5A 1ZIPA 2BM1A 5JC8A 4A03A 5JLAA 4GXNA 3GJ4A 3CX3A 1G8FA 2R87A 4RETA 4BRSA 1JEOA 1G2QA 1TAHA 4WRRA 4DCVA 1J0XO 4C08A 5MFPA 4Y9RA 3W8RA 4F6CA 2FSIA 4CIYA 1V11B 1VE9A 3D6UA 3I64A 4H7JA 5A6SB 2M6KA 4N47A 4BFZA 1YK1A 3SVLA 4DB2A 4FOSA 4ROTA 1XNGA 4YP0A 4LC1A 2WWYA 3B7PA 3E9QA 3ZU5A 3TINA 2GVZC 2H54A 2VPWA 4F9GA 2WJHA 1Q74A 5AWFC 1KPHA 3B52X 5KYVA 1CQJA 4MGYR 4IH1A 3ZCPA 1CRWG 5EHIA 4BU1A 2R1TA 1K0UA 3HEMA 1E5VA 4U2KA 3WVNA 2O0HA 1NAHA 2H4FA 3TVDA 3UV7A 2DE0X 3R8XA 5CBPA 2O1XA 3R8FA 3TL6A 3G2QA 4E22A 2D7DA 1R00A 3T06B 3D02A 1ZRMA 3N2IA 1RCTE 4LYFA 1N6RA 4XB6B 3WI7A 3NGLA 4D8VA 5JROA 2AOWA 4ENTA 3LF2A 3RBVA 3UG7A 1MR3F 1FMCA 1H3NA 1LTKA 2RHTA 3CXUA 4U2DA 2LBPA 2Z95A 3AILA 4FZJA 3FSGA 3JVEA 5L4SA 1JF8A 2J9FA 2PRZA 4IVRA 3RODA 1VYTA 5EMLA 3IELA 1MG5A 3T52A 4L8YA 2F1IA 4LIPD 1ZICA 3VC7A 3KXPA 5F3WB 1TL7C 1S96A 2P65A 3OOJA 5TV2A 3L7AA 2IYFA 4L9RA 4Z99A 2ZSAA 1CEYA 3ZVKA 3U9LA 2RAUA 1PZNA 4C29A 4KP7A 3IALA 4I1RA 2I4RA 2AJLI 1TQHA 3UHJA 2PYZA 2REOA 2WF9A 2YWBA 4IUBS 2H18A 1YRHA 2IS2A 5AYVA 2F3UA 3JQBA 1X15A 1N92A 2O2IA 3DAPA 3PF9A 2FWMX 1LVGA 1N7HA 3OZXA 4NE9A 5JYBA 1H0HA 4PQEA 3V7YA 3WNVA 1FL9A 2ZIVB 2YNMA 3PVCA 4FYMA 4FHZA 1ZXLA 4A5OA 1LWOA 1CTQA 2DPGA 2P11A 4NZMA 4OXXA 5T7BA 3KOOA 2R65A 2I2WA 4BMCA 2HWXA 4O2RA 2PS3A 1N36B 4PYJA 3EFOB 1BGXT 4FEGA 1EM8A 2YUIA 3IP5A 1GN8A 1GPDG 1UEXC 1Z22A 3AVOA 4O4LF 1QJ4A 3MGKA 4NRDA 1KBOA 5T64A 3TRIA 1M0SA 4WE3A 1V96A 3OLZA 2PQMA 4FMCF 3CU5A 5KU1A 2OGZA 4BKOA 2VQ6A 1OLSB 1T6ZA 2WUWE 2W2MA 4KBGA 3DZGA 3P94A 2EDAA 2Z8ZA 2ZS9A 4GMXA 4NNOA 2E4YA 3P8ZA 3WBBA 4I5IA 1XHFA 2ON6A 4NK4A 5DCLA 3FMIA 3K6JA 1Q3TA 2IXBA 2ZM5A 4O33A 3HP4A 4J16A 3AOEA 3KYCA 3T54A 4EJSA 1IBCA 1VJ5A 2I5PO 4M36A 1PL8A 1X7YB 3A1UA 2JFXA 1ZVQA 4DCJA 4DCPA 4MQEA 3RSGA 2UVQA 4COOA 3I4FA 1OB2A 2X9NA 4YT4A 4TYNA 1YMUA 5F1KA 1A77A 1UDAA 2H52A 3KJQA 4KQ2A 4QQRA 1GT91 2X7HA 5REQA 3T3MB 5AUOB 1SVIA 2CL7X 1MHTA 4FBMA 2OBLA 4E6EA 4RDHA 2WY2D 1ZH8A 1TA4A 3N1UA 1NVKA 4GXQA 1E2UA 1BN6A 1U04A 3HR7A 1PP4A 4JMLA 4CTNA 4CM8A 1RC8A 2XGSA 2R1VA 4EYSA 1N0VC 5FO0A 4EUSA 1FMTA 3JQRA 2JJQA 3SDZA 3N9IA 1YB2A 2RBGA 2ZRLA 1E3IA 1NVTA 1ZQ1A 2W2NA 1FSPA 3MUNA 2FG6C 3NXKA 4BV8A 4RGVA 5HGXA 2Q6IA 1DZ3A 3GEPA 2F1OA 2WFLB 1MRZA 4ZRNA 2YICA 3QPUA 4DLSA 4MEJA 1SKMA 1W0JA 3PFWO 4HTAA 5LPNA 3S1SA 1EG2A 4B3IA 1FMLA 1L4BA 2VF2A 2R7AA 3E1KA 2WKQA 3ADDA 3QF7A 1C7QA 1IFXA 1GSOA 1YI8A 3V1LA 3IMCA 2PGIA 1E32A 3KSDO 3T1OA 3ZV3A 1H1LA 5ITVA 4IDBA 4HLCA 1N5IA 3KPWA 3UENA 1UBEA 2ZRDA 4NFYA 4ZI7B 1Z2NX 4B3HA 3LUHA 4XSHA 3N6RA 1Z0ZA 5I8PA 2CNNA 2P9CA 3GLSA 4AT1A 4P82A 3O0TA 3ABSB 3CW2A 2YQ5A 1WW2A 2WYVA 1LVUA 2IUFA 1IZZA 2QI9F 3D2LA 1NQTA 3R3XA 2RHWA 2MCFA 2GAOA 4F92B 5KTNA 3UH0A 1G20E 2B4QA 2JLUA 1FW6A 1REQB 1W0CA 3ZHOA 4KYUA 2NZJA 5B64A 1XTUA 2FPGB 3FD8A 3BRWD 1TAQA 2VP9A 3PTZA 3IVGA 3GQBB 1G7CA 1QIFA 3RKUA 3UYLA 3RYCA 1IONA 4LX8A 2Z9CA 4BNNA 4EYGA 1JQKA 2R9VA 2FVXA 3MQ4A 3S7TA 1NUTA 2A9FA 2JI8A 2OZPA 4HZUA 3N0XA 3ZDEA 4B47A 3VKGA 4F1KA 1A0OA 1EFDN 3AJ9A 3TI9A 3DLHA 5EPEA 1JLMA 1PFYA 1XA0A 3F9RA 3IXLA 4D8TA 1SIWA 3L49A 5HMLA 3K5PA 4GM1A 1YZKA 3GD7A 3EBLA 2PMEA 1EESA 4L08A 4R98A 2VF5X 3B3JA 5ERYA 1U5BA 2JPDA 4AICA 3IEMA 1T3HA 4EYQA 2PX2A 2AQIA 4HDAA 4DCOA 5A4IS 3D7LA 2QXUA 4FCWA 5EIHA 3EDMA 4IS3A 4ZGGA 4F4UA 3EEFA 1GFWA 3W3AA 2J67A 3UCFA 4FFVA 4OMCA 5C5CA 1L3BA 2EDCA 4C7OA 1E8MA 1U3CA 2VG8A 3HPQA 1D0SA 1AMUA 4EHFA 1U90A 1FUKA 1LPMA 3G02A 5HF8A 3TLGA 1ZGJA 3T1NA 5CVTA 3RUDA 1KMCA 4QX6A 4W9RA 4RIGA 3SHWA 4AAYA 2YZ7A 4JQCA 1CP2A 2OORC 3EA0A 4RVNA 4GR9A 1I0LA 4RH0A 1XJ0A 2EW1A 2GZSA 2GM9A 3FYHA 1H4SA 2ES4A 1Q50A 3HCCA 2HIGA 1DIHA 3ECSA 4NYIQ 1R0YA 2I62A 2OFXA 2GVDC 2QW1A 3E7PA 4KXUA 4FNMA 5CAEB 4B6FA 2J33A 4PIVA 3PZBA 2D2VA 5JS7A 2PFKA 2XCSB 4X84A 3RYIA 4RTLA 5D87A 1FFBA 5FNZA 1E1QD 1UZUA 3QLUC 1CCWA 4Q1CA 4TTTS 1WCXA 3I34X 5JZOA 1YRQA 1YDFA 5ERXA 3ANTA 4YXWA 5THXA 3T7DA 2GTHA 1XLUA 3NWJA 5CB4F 3R5KA 5FI3A 1GNVA 3PG5A 2AOUA 5CT8A 3REOA 1Z7EA 2VH2A 2AK3A 3BH6A 4U9UA 3RRJA 1A95A 4GZ6A 3TW8B 4C3ZA 2ZJBA 1WXEA 4HEA1 2CNBA 4I55F 1MC5A 3OWXA 4FDLA 3SN6A 4M38A 5KTKA 2O0LA 4N6OA 3OT1B 4HV4A 2J4CA 1SXJD 3NG1A 1RXSA 1YCHA 4PCVA 5DN9A 1TU4A 3LDGA 5IH3A 2FX5A 4GWLA 4W4TA 1PJ2A 5AJXA 4HGYA 3VU1A 1FX0B 5U9CA 1MAUA 1BDMA 3E82A 4C5BA 2VSFA 2P5UA 4P58A 5FOWA 2CLHB 2P35A 1DUIA 2BFPA 3CNHA 3RS9A 1JDUA 1BD3A 1VE6A 2HK9A 3SJCA 5AW6A 3FX2A 1EFPA 3IDQA 4OHWA 3BGOS 4I1OA 2YOFA 1VL5A 4JEMA 4C1NA 1JPJA 4P7BA 4YRLA 4HAOA 3JD3A 3WJ1A 5L9AA 3UJBA 3AVVA 4PX9A 1EPUA 1TO2E 1ZNYA 1UXGA 4LS3A 4QQ8A 3UWMA 2AV6A 4CF4A 3QMVA 1T1RA 1R16A 2JGAA 1G9SA 2FA9A 2XJ4A 2VHXA 2F1HA 4B44A 3AM5A 1IZ8A 3PZRA 4LGVA 1YCFA 1BCSB 1G59A 1F60A 4YRJA 4II7A 2R00C 3KJGA 4ALMA 1XDBA 3IOCA 3Q40A 3TMAA 3X1WA 4AG5A 5BNIA 3S2ZA 3E2MA 1WHSB 1A96A 1QS0A 2FSVC 3AR6A 3KU1A 4RXMA 4WUVA 5K7SA 3KEMA 3MTBA 4EW3A 2J0VA 4UU8A 5IX8A 2JC3A 1QK4A 2QGFA 4FM9A 3IXMA 3OUUA 2HI0A 3GA0A 4IZIA 2CLOB 5KINB 4K9KA 2C83A 5K4AA 1SBHA 1OLUB 2JH3A 3IJEB 4I14A 2YY5A 3VZCA 1IVSA 3FCUB 3C1UA 3SJZA 1EK0A 3OG9A 1FFAA 4N3BA 4ZPXA 4B45A 1OX4A 1ISPA 4BQOA 3F7TA 5BNZA 1NRJB 4JYMA 3D8HA 2DSNA 4UHJA 1CYEA 4PZAA 4RZQA 1FTYA 3WJAA 1SG9A 3WIDA 4KAFA 4PSDA 4BV2A 1S5PA 3OPVA 5BN3B 3DD5A 2FOXA 2YDYA 5CX1A 4K2AA 3F7MA 3PDCA 1J7JA 1COWA 5KCZA 3N2KB 2ILVA 3USZA 3PFNA 2LKDA 5DTMA 4CIVA 2D4AA 3C3AA 3WLTA 1F4VA 4UNPA 5AI4A 5A0VA 1UQUA 2FQ1A 3TGPA 1UXOA 2QPOA 4QU9A 4C87A 1IAQA 2BFMA 3B89A 5JNWA 3EQ9A 2G9ZA 2PUTA 4RVFA 1CYDA 5DLYA 1UK8A 2JCBA 3W8NA 4YR7A 4ZGWA 5EGSA 1E9RA 3RK1A 4EX7A 4LKRA 3P2KA 5CT5A 1F48A 2YV3A 4URVR 3BL8A 2P4QA 4B32A 4AZ0A 2D2FA 2IXAA 4EEXA 3N53A 1TTTA 3R9WA 1CUZA 1VBFA 2FEWB 1KJNA 1K27A 4DRYA 3ZLTA 4TRMA 2G06A 3WR5A 4F11A 4F5DA 2AFHE 3LY8A 2Q9AA 2JNWA 1FSGA 3KIPA 4NLLA 4B3TB 2Y93A 2QRKA 3A1CA 1KFEB 1I94B 1PGOA 2ZYUX 3GGSA 5TGTA 1UKEA 3HCBA 2ZKIA 5DI9A 3NNSA 5K8IA 3ZLJA 1NOJA 1U8FO 3QKRB 5FBWB 5KKNB 1RJFA 1GLVA 3EEBA 3BEDA 5LOVF 1L4KA 3C3DA 4IY1A 3ZGYA 1TT5B 4X3PA 3AG6A 1PJ3A 4EH1A 2GKSA 4Y9TA 1CNEA 1SD1A 2CL6X 2FUG1 3P9RA 1P29A 4KOEC 3SHQA 4EPTA 2CV2A 1M2OA 4YEDA 3INNA 2G7MC 4HFJA 3ODGA 3JVDA 2R48A 3B12A 5KYUB 3E4DA 2C7RA 1E9EA 3H9GA 1U0HC 2X0FA 3OP1A 4UTPA 4KO3S 1OWNA 2C5AA 5F33A 2NSLA 4MMZB 3VMMA 3T4EA 1DEXA 2CWDA 1KEZA 2AFRA 2OM6A 3AT1A 3ZUPA 4I6GA 3ZV6A 4C0QC 3KT8A 1GZ6A 4PS1A 5LBTA 4N8EA 2BPOA 4BNZA 5FTKA 1XEAA 4KGZA 4R8RA 3SS8A 3WIVA 5LNK1 1K6JA 2QBYA 5FYQA 5IAOA 5LZ2A 2H31A 2CZQA 4J1NA 2B1IA 2IUSA 1XL1A 3MK31 1SCUA 5AM3A 3E8MA 1NVWQ 1UEIA 1W52X 4QRIA 3M82A 1ZA1A 3ZKAA 3NB0A 2Q50A 1I4LD 5F2EA 2C29D 4GLLA 4EHJA 3KG2A 1QP4A 3MUOA 4WXHA 2NSDA 3HRHA 3OECA 4ESVA 1HYGA 1LBSA 2VIIA 5IAKA 2B2XA 5JALA 1Y89A 2XB4A 3FCAA 3UB2A 3IPXA 1W2HA 3EB9A 1T5HX 5F7JA 1FTQA 1P5HA 1KAMA 2P9BA 1Q7TA 1DU4A 1GG8A 3RV3A 4KBFA 3A9WA 2RGAA 2OZVA 3NJ4A 2H16A 4QT0A 4HQLA 1PYGA 1JXMA 1BX0A 2WU4A 3GGDA 4M53A 1NAIA 3A11A 4HDSA 3GP8A 2H1IA 4A82A 5LXTB 3AEYA 3EZFA 1EGQA 4GPBA 1MGOA 4CKYA 1BXGB 1HSZA 1WKCA 2IYRA 3OZVA 3QJYA 2PJUA 3GPLA 5THQA 2IXFA 3N76A 2BEVB 2XF8A 2YJTD 4UHBA 1RAIA 4L5JA 3CG0A 3LBYA 1DXYA 4XLLA 4A2QA 4QJBA 1NW8A 4E4RA 4OXKA 1LPNA 1WUYA 3I6MA 4RDIA 3T5BA 2F43A 3S1AA 3ZGOA 4KVGA 2XYQA 2XIQA 2XADA 1QG0A 2OCBA 2M32A 2ZWPA 3DLIA 4P53A 4PYRA 1P1CA 4MVJF 4ENUA 2OSVA 4N03A 3PHCA 3RS0A 3E3MA 2CLCX 2XUGA 2ODBA 5DASA 4I6EA 4RY2A 2VF8A 4BB5A 4O5AA 3HUFA 4MRVA 1W2GA 3VYTB 1R88A 2ZQYA 5FD8A 2XVXA 4K87A 4Z4CA 2P5TB 3C3JA 4OYRA 2AL7A 5JAOA 1DCTA 4H9GA 1RQGA 4L4XA 3U3ZA 2H2GA 5B2ZA 5E7QA 1TF7A 5FQOA 3AKDA 1OMOA 4NS1A 4CG1A 3FZQA 3HVRA 1I4OA 2WE7A 2WQZA 3JATB 4RORA 4TKUA 3D54D 3GDFA 2E87A 2IHJA 4YAWA 1N3YA 1NC1A 2ZPTX 1H6DA 5DT2A 3I6QA 4JC4A 4HYTA 1S6YA 1HDCA 4YDSA 1HZJA 3IV9A 4DMKA 3H3JA 4EENA 4F3CA 1DP4A 1GQOA 3EHDA 1XVUA 4MICA 4M1MA 2DLCX 4AROA 1KGDA 4ENPA 5IT5A 4Y7DA 1E2BA 2PCLA 3V2GA 2YW2A 1EVLA 3NRCA 2K7FA 3I9NA 3L7NA 5HCIA 1XSEA 4RD0A 1PSZA 3OZGA 4M46A 1VFNA 1K8RA 4R5MA 1E9FA 3RKSA 5CFZA 5J2TB 2Z6QA 4BUJA 1SULA 4HAYA 2FZ4A 2HLDD 3ZY3A 4I4TA 1CULC 4EI9A 2GK4A 4DA4A 2P6NA 5EIFA 2WA2A 2BP7A 4XPZA 2NG1A 2LWIA 5PGMA 2A58A 2R7NA 2YW9A 3DNFA 3QPVA 5JBQA 3GCZA 1EP9A 5JH7A 3BE4A 4DSTA 3EXIB 5GOTA 3VPXA 1WBJB 1ZAKA 3BS4A 2RGEA 4XI9A 4Z4GA 4J7AA 1THMA 4JLWA 5ALYA 4TLAA 5SZHB 4MS1A 2H1FA 2PZGA 3AR5A 1DVRA 1DOAA 5LQAA 3TECE 4IWNA 3J7AC 5DSXA 1G5TA 1NU6A 4H6XA 4MR7B 2PG3A 3T4PA 1PD1A 2VJYA 4BCBA 1ZISA 6YASA 2BKEA 3DKKA 1OI2A 1QB8A 5HHTA 4WN9A 3U62A 4JNKA 1XYYA 4DG5A 2B7BA 2XCUA 4EY3A 3DZKA 5E7MA 2NUAB 4Z5XA 2QSYA 4BN0A 3BXFA 1J5PA 1UMBB 2QMEA 4DMLA 2PUVA 3LYAA 3IR7A 4M1KA 2OBMA 4F3TA 3G0OA 3TZQA 4KQXA 3K6SB 1YVPA 5IJ9B 4XYGA 2ZYDA 4EL0A 5C9ZA 4PSVA 3LPDA 5L40A 3SWWA 2HO4A 2WJZB 2XKBA 1I01A 3NUZA 5E7IA 3D4NA 4MVCA 1T26A 1U2QA 3ZVLA 4CMCA 1YFZA 1L6RA 1PIWA 3AUJB 1KDZA 3LVRE 2ZS7A 1TVMA 3HB1A 2JLSA 4INOA 4TMXA 3V4PB 4ASUD 5GV8A 4GKKB 4MQFB 3T61A 4JJFA 1UFOA 3DTYA 2RHHA 2WJYA 3IRVA 1PUJA 5GVRA 5F51A 4IIUA 1ADCA 1E1RA 2AN9A 1X14A 4JQZA 2XNJA 2B8NA 1B15A 2ZJ6A 5EHQA 3WIOA 5LIRA 4HLUA 4W1QA 4X20A 3F49S 5IMBA 5AK0A 1SKYB 3B5IA 3IA7A 1XRSB 1DV2A 1SUCA 3RC3A 4ZJPA 3HSYA 5JYEA 4FB4A 1B6RA 1GHTA 4W8OA 2HBYA 5TDHA 2YR0A 4GI3A 4DA7A 2W9XA 4ZV9A 5E6UB 4PTLA 4E2ZA 3JXEA 5ARBA 1QGED 4MDFA 3TUIC 1KI4A 5DSZA 1RWNA 2NV0A 1OFGA 2ZUWA 2EIXA 2ENWA 3KWJA 1M1YA 4L8GA 4PFKA 5BYJA 3N87A 3TTUA 3J80A 4Y6GB 4TYPA 1EVJA 1PEKE 1ULAA 1W0KA 4NJOA 2BRUA 3F6CA 4OP3A 3ZPXA 4KE9A 5TMBA 1FCJA 1J00A 2E21A 3ZU3A 1G3MA 3BM5A 1NBHA 4S1NA 2PL1A 5B7PA 2CJYA 1SUWA 3N8GA 3KZXA 2WDPA 3O1JC 1NV9A 2EFYA 3OJLA 4AO6A 1T9KA 3TQIA 5IT0A 5DGXA 4XGIA 2HM7A 2GXUA 2IHNA 1LVHA 3F3SA 3B36A 4AZ3B 3FGPA 3RS4A 1G8AA 5DYGA 4G8JA 3SJUA 1HBJA 2DOKA 3U4CA 4KLAA 4JVMA 5G1NA 4AQ7A 2GZ1A 2PL3A 3ANLA 5ER6A 1FDSA 1ZJWA 1DWOA 1E66A 4EY4A 4V39A 5CP8A 3EDOA 2H1WA 3FDXA 1RYZA 3BIFA 5ESXA 2R1UA 2WJIA 4WLOA 2IS1A 1EK2A 4E5KA 1KTVA 3L0IB 4HYYA 3VDXA 3ENZA 3OZEA 4C7JA 1JA1A 1Y9ZA 4HDMB 4ND8A 4EYOA 3LT5A 5BW8A 4LYYA 3OLVA 1L5GB 1Z3IX 2FP4A 4IOJA 1R6TA 3JQ8A 2BEJA 4UBMA 221PA 1H93A 3MTDA 1IDOA 2E5FA 4D0GA 2XRYA 3CPEA 4LRTB 1IQUA 1ITZA 4IKPA 2D0IA 3E1SA 3TH5A 5I7RA 3EXEA 5G53C 4C6TB 1OX5A 4BNIA 4AS2A 2F8TA 4B4UA 2NTEA 4N5DA 4UHDA 4AKIA 2OFWA 1SZDA 3SSNA 1M1UA 3QVWA 3W0LB 3T3NA 5HA5A 4I9GA 4QOIA 4X7RA 3M4JA 2B0JA 4RSHA 3NGXA 2N75A 2GFHA 4BFUA 2MINB 1RHKA 2Z8YM 3QEAZ 4G56A 1RWQA 1WABA 2Q6TA 3DXZA 3PD7A 4B6RA 4IKEA 5F2NA 5ELMA 2X7XA 4QWWA 2YWEA 1J25A 2FFJA 3A3PA 3QEMA 1WOYA 2P0EA 3E15A 4WKCA 2VVTA 4A0RA 5ICEA 4TRNA 5IRCD 2JGRA 1OASA 4DG9A 2RGBA 5HM6A 3URKA 3VBCA 4MEBA 2POCA 3ACCA 4DRZA 2VCEA 5DM70 2PZLA 3KKNA 4IX9A 4WNAB 1OJ7A 4KACA 2C8JA 1ZNZA 2AC4A 1Y5NA 2J9XB 3KLNA 4KQ1A 4XVHA 1EU1A 3IPYA 1AD2A 2Q5CA 4MAAA 1VL2A 2JLZA 2I2BA 3EGDB 3F71A 1VBMA 3E3OA 4X44A 2IU0A 3AJRA 4P3NA 4RJLA 3OCJA 3WO1A 1OBVA 4BO9A 2XI4A 4WK6A 5DU2A 1U3WA 2A5DA 3HCDA 3O90A 4QNRA 4LJLA 2JARA 1ULTA 4NOKA 1NBWB 2WC1A 4R7GA 1FDTA 2GNPA 3H4IA 4H7EA 4M0PA 1G0NA 1ZDMA 2ZRMA 1GZHB 1SURA 1SQGA 2WD9A 4L6CA 4R1NA 3IPLA 3R41A 3FKQA 1N0HA 1JHQA 3N59A 4AB1A 2GM5A 4QUHA 4BAGA 5GVSA 3BGWA 3WZMA 4QGHA 3ADKA 3GO4A 3JQFC 4RY8A 4C2BA 5BY2A 2GAJA 2QRGA 5EJIA 2OZEA 2KJQA 3C15C 1YFKA 2ZR8A 2D59A 3NHWA 2WLSA 3OU2A 4HZGA 4KE6A 1RPTA 1LPPA 1RD4A 4J7XA 4PSKA 4C43A 3TW6A 3AY3A 4KWTA 4YJGB 3IAS6 1X8XA 3S2GA 3W4JA 4HAIA 5L7TA 2BHSA 4JXKA 4Q3LA 1RWPA 2RGDA 4OXIA 1B26A 3PPWA 4KKXB 2BFCA 2OP0A 1IPFA 2X0JA 4N12A 2ZAOA 1ODTC 1UJCA 3HO6A 3TO5A 4I50B 4L2IB 3IHLA 5CH3A 4Z49A 2HCTA 1HRKA 1FA9A 2BLNA 2NADA 2IXGA 3Q3HA 2ZE6A 4DJEC 3DGFC 4W5RA 5HE9A 3CVJA 1N25A 5SYMA 1VE7A 5EIEA 3UC5A 3K70B 1U31A 3MRVA 3Q7IA 3TSZA 1FZQA 1IHUA 2FX2A 5JRJA 2WP8J 3HV0A 2P9QA 2X8LA 4GEGA 4W7SA 4ZU3A 3HJBA 4E70A 1BDHA 5CXUA 1G41A 4GOND 1II0A 4YT5A 3WGTA 1WP9A 3QSYA 1C7EA 1HLGA 4ZTBA 3TNYA 4BN5A 1BYUA 4QGAA 2C00A 4Q5IA 3C3KA 3RJ9A 3PGMA 3VVCA 3RVPA 2LDBA 4KLRA 4AJOA 4RELA 4BZPA 3H5NA 1HE2A 5EJ2A 2YJ3A 2A5YB 2I6XA 2ZDGA 4IIXA 1QYRA 2IY8A 2BE7A 2Q1UA 4U7WA 3B3FA 2EJVA 5KQLA 3C6QA 1Y81A 1ZIDA 2X0RA 3T6KA 1VP3A 1U80A 1MENA 4MEAA 2FLWA 3KBOA 3TQFA 7MHTA 3I39X 3U7EB 2ASVA 2AUTA 1PGNA 5KB3A 3C43A 2FDCA 3KHTA 4KRXA 2FLKA 3QRWA 1GL7A 1AQUA 5JATA 3FR8A 1RAHA 4OQ4A 1I32A 3EEQA 1F7VA 1KIFA 2BDTA 2CXQA 5L51A 2C1ZA 2Z2KA 2A0KA 2I4MA 4B85A 2WSSD 1JG7A 3GEMA 4OEHA 2NZXA 2VBIA 3IAUA 5E9JA 3WGUA 2RBKA 3C3BA 1EVEA 4TTQA 5FWNA 4LUCA 1XTQA 3T4XA 4QM6A 1W76A 5EHGA 3R44A 3BORA 4UUMA 1G16A 5BSUA 3B9QA 3WDSA 2VWPA 3DZJA 4ZAVA 5BSMA 5AI0A 4CG2A 3JWGA 3UH1A 4DLVA 3FMFA 3ETLA 1KQOA 4YMHA 5FNVA 1TQ4A 5LFAA 3GLIA 3LY7A 2HMTA 1SG0A 4TQUS 3FJOA 3CNOA 1X1SA 5DCUA 3H4TA 4HSGA 3U3XA 3VH3A 4F97A 1U2GA 2PIDA 3HG7A 1LSSA 4OKIA 2WI8A 4QHSA 4N7MA 3ZVMA 1C81A 4EB0A 3HGQA 4C3OB 1V41E 3WLHA 3AYXB 4R68A 1JR3A 1AVTA 2WUDA 2PUJA 2ZATA 5AI9A 3H86A 4WZZA 5EG5A 5KTTA 3K1AA 1M6WA 5CFMA 5FP0A 3O7WA 3Q15C 4PO3X 4AX4A 4X71A 1JH9A 4EI7A 3ON5A 1PVVA 2PSJA 5JNSA 1QZUA 4O2BA 3OAAD 1OGYA 4WNIA 5JYDA 3ZW9A 4DQVA 5EKXA 5ALVA 4YUXA 2GCEA 4ZMRA 1ZN8A 5IJZA 1GDTA 1VLQA 3AIIA 4ID3A 4LQLA 1DBVO 5LKAA 3ZVNA 1N7JA 1GA4A 4B75A 4OX9Y 1QM5A 1R0RE 5JSQA 1KIAA 1ZX1A 1ZM3A 2ZETA 5FPHA 3WMGA 3I1FA 1U9ZA 3CCFA 1C9JA 3OLCX 3UKJA 1PZFA 3ZWVA 4JYZA 1TQ2A 1LBIA 1Y6ZA 2ZYGA 4URFA 3ISVA 3L2OB 4Y9SA 1DT3A 3U56A 4WNCA 1JJFA 2J6CA 3P0JA 4YQEA 3FSEA 3VXKA 5F5XA 5A05A 1IN8A 3RJMA 1S3GA 1N1EA 2FGKA 4L15A 3FPSA 3RARA 5LMUB 3KAJA 1KQPA 3AI3A 4FKBA 3TTYA 2EX1A 1Z35A 3F4LA 2UVDA 5LD2B 1CFJA 1ENOA 4JUCA 1ZCZA 1CY1A 1MA0A 3GFRA 3PNOA 5TS3A 3HDGA 4RWZA 3OM1A 1GPNA 4ZT4A 4RTRA 1EP2B 2Q5JA 5IKXA 2D2XA 4DZRA 1O3YA 1ODFA 1NY5A 3ZQ4A 3T1HB 2BYTA 3FN4A 3PPIA 3PGA1 1QCCA 1ZIXA 3L6BA 1XZJA 4B6QA 1DRVA 1VJCA 1GT6A 1LS6A 5JG7A 2HIMA 2P4SA 3VA7A 1OXBB 2JFFA 4CR8A 1HFJA 2AEEA 4MQLA 1NVMB 3THYA 4JYPA 2CLSA 3LT2A 1SKYE 3BMNA 3MMPA 3TD9A 5L3QB 4OQYA 1VSVA 1UADA 4N3CA 1TEXA 5JANA 4XRRA 4Q4LA 4J0QA 5I7AA 4E5UA 4NNPA 2B35A 2NYUA 4OU4A 4X7BA 5EWMB 4D9GA 1RHJA 4FXOA 1Q12A 3OCCA 4G1BA 1EUCB 3CB2A 3F5DA 2VDPB 4DNQA 5C8VA 3DDNA 3LT0A 3HU2A 2C99A 5ESWA 4FILA 5C51B 2PMFA 3CX6A 2BMFA 3PP8A 2ZUSA 8ADHA 5H1YA 4Q6BA 3DH0A 2VAPA 3SIPA 4C4OA 2JAOA 4D46A 3GHHA 1L5ZA 1QZ3A 3U0VA 2P67A 2FRXA 2CY0A 2F62A 5I4BA 2CDBA 1XPJA 3N5CA 5TJHA 1TW2A 4NEGA 3RROA 3H5AA 1CR2A 4LRSB 2BEUA 3H4VA 2QJFA 3L4BA 4RHYA 4Y2GA 3ZZNA 1EZ1A 3U3MA 4EG3A 4OAPA 3OX1A 1PJ8A 3GLUA 4M0LA 3C1OA 4EVRA 2ZT6A 3RASA 1TUBA 1A5ZA 5L7WA 1Y34E 2OCDA 3WQRA 1YQEA 2JH8A 1CFZA 2PKRA 3CIFA 3GLHB 2RMKA 3HMKA 1JYSA 1YRWA 2ONCA 1YB4A 5CA1F 3AHIA 5CVCA 1N3LA 4DF3A 5E9QA 3AZPA 4MA5A 2VCYA 5C0OE 2IBTA 2CNLA 1LTHR 2EKBA 1VYHA 4PTYA 2W6ID 4PZZA 1RPAA 5K99A 4YMTA 4HP8A 4JA2A 1IVYA 3IURA 4Z8YA 1KRHA 3ZI0A 5BT8A 1PJLA 2HBZA 1DEKA 1G18A 2EJCA 2GGSA 2QTFA 1N5DA 1JEQB 1ZGCA 2OPBA 2RGCA 3FA2A 4KZPA 4AO7A 1QTNA 1QH9A 3HCPA 1UP6A 4BB6A 2XKAA 5LA6B 3BIXA 2GPTA 4CL3A 1US8A 2CXXA 1RI5A 2ZSDA 3C98A 2NPIA 3LQYA 3WJ7A 2YRXA 2YBEA 4MRPA 5JSFA 4AQDA 3A9UA 2JF0A 4HEQA 1JQJC 2FQQA 3RVNA 2GPYA 3BB1A 3P2EA 4ARUA 1JIVA 4ZYUA 2OXIA 4O63O 3O8QA 4D5EA 1UPFA 4K7JA 1XJCA 2HV9A 3DEHA 2X3UA 3ROKA 3LP5A 1Y7TA 4GI5A 1RLJA 4J0JA 5IASA 3F73A 3DBRA 1RTKA 3GA5A 4ITVA 1T0BA 2UUCB 2RC6A 3LQ2A 3LFHA 3O8NA 1D09A 4EITA 3CX8A 4PY2A 3QTLA 2QWXA 3QU9A 4G5QA 3G2NA 4DPKA 2CC2A 3M33A 1V9SA 3ROFA 1U98A 3IIJA 4OFBA 4WLNA 1K7FB 5DX1A 4C5AA 4B7AA 1OLXB 4HGZA 3GROA 4LEIA 4RMHA 2MIIA 1TVEA 1RWMA 3ZI7A 2HCBA 4EG0A 1G3QA 4MJXA 3DR3A 4D0NA 1KA9H 2ZWOA 3DYVA 3G0CA 4YRKA 4HHEA 4J2OA 2JA1A 1FYVA 4QD3A 4EATA 1J99A 1SOVA 2AWNA 1WP4A 2X7JA 3AX6A 5CLGA 2IQIA 3UMVA 1Q0SA 1Q0LA 1DAOA 1V4VA 3AESB 3FVWA 4JEHA 1U0TA 5F64A 1M1NB 1LW6E 2CFSA 2OP1A 3NU1A 3OMWA 4D4JA 5BUCA 1WXGA 2LGJA 1WZ2A 1Z82A 1Z5UA 3KFLA 4J90A 3TUJC 1Z33A 1YMVA 2H1HA 2ZI6A 2YFHA 1XRJA 1E58A 1Z47A 4D98A 4IDGA 1X7XB 1YS2X 4BZXA 2XOKA 4F0JA 2SCUB 2O8VA 3EZYA 4LRWA 3VYSB 1FFXB 3ASVA 2HIAA 3U80A 2JGKA 1NKVA 3JQ9A 4X9XA 1PO7A 3ZWNA 5DDIP 3STXA 5KWJA 4K46A 1Z4IA 1O6FA 2CLDX 5EMKA 4CKCA 2WJ4A 3W2IA 3ICCA 5G0UA 1YUMA 1Q83A 3JVVA 3X44A 1EB9A 1X39A 3QHQA 2I4IA 3WL3A 2AF4C 2AYZA 3WISA 3OUTA 4I5FA 5C4MA 1UKZA 2OFOA 4YRMA 1QE5A 4D9BA 3FNQA 2F1KA 2QRVB 3EXAA 1IJKA 4D0SA 4QBFA 1D2HA 1JG1A 1PT6A 3EH1A 2ZP1A 3CKKA 3FPJA 3LS2A 1X77A 3OOYA 4Z0HO 1H2EA 3KAKA 1H6CA 1U0GA 1L7AA 2DKNA 3QGMA 2PMWB 2B9VA 3NETA 5KCMA 1J0DA 2P7HA 2QAIA 4MW4A 4ZAXA 4ZVSA 3O8OB 1HXHA 4MRMA 5HW0A 1R5NA 1XRQA 1EX9A 1JQEA 1XEFA 2EQ5A 1PK7A 2FDRA 3HWWA 1FLDA 1IWBB 3IYLW 4WJKB 3K4HA 2L82A 1JLSA 1HGXA 3C3PA 3I2GA 3OTQA 5E6RA 1V1RB 4AG6A 3KAQA 4EQ6A 3TX6A 4JKYA 2JVIA 1PFKA 3BFXA 4NH4A 3WJ2A 4D8YA 5K0ZA 1L2TA 2HA7A 4OBWA 2ZJ3A 4PHTA 2C04A 4NPCA 3FHTA 1RIIA 4TSKA 3H87A 3SEZA 1NQVA 1NIPA 1DQSA 3K20A 5D3ZA 3ZBTA 2G36A 2HSEA 3FW1A 4B3GA 1FFGA 2ZVQX 2P9TA 2R96A 1YB5A 3B2QA 3TDKA 5LP6B 2P0YA 4BNHA 1ISRA 1QMPA 2C95A 1LXCA 3HY3A 1RRVA 4PLGA 5JISA 5IWAB 4MS3B 3CRMA 2C2ZA 2E6UX 2F7SA 1VL8A 5FEMA 5IFKA 2OHHA 1HDOA 2ZULA 3AEUA 3NW9A 1WUHS 1CERA 1SA0B 1V4NA 3SVZA 2IZ5A 4P3KA 1DEOA 3OWOA 3DV0B 3E81A 5KYYA 3TIIA 5LYJB 2Q0QA 1JKJB 1PUIA 1ZSVA 5D3KA 3LXUX 4RTKA 2H2FA 1QO0D 4ZFNA 3D7SA 3MTGA 4ZAGA 1RIFA 2VZLA 1JHYA 3BTSA 1O54A 3V8MA 2WMOB 3A3OA 3AQIA 3QWBA 4NV0A 4Q7KA 4BNJA 5FCDA 2C5GA 3E84A 1UFRA 4PS0A 2DPXA 1DJQA 3JWIA 1SB8A 3KBBA 1I36A 3HE3A 1M2GA 1B42A 2GYYA 4JWKA 2YVUA 4M1TA 4DHEA 3OJFA 3OFKA 3LXXA 1DHTA 1JYEA 3H8VA 1G60A 2EWVA 2EEPA 3I05A 3KX2A 3BREA 5AICA 5A3VA 2X1MA 3OU6A 3DVQX 5ENDA 7YASA 2E55A 3O4RA 2JHCA 1R4NA 2IHZA 3BG5A 3RPEA 2O06A 2G9NA 3P20A 3EWIA 5CT4A 5IARA 3ZD8A 1PJRA 1GTG1 4JLVA 4BQRA 5CDYA 2BTEA 2H7VA 1T36A 1WMBA 3ROGA 4R40A 3JYNA 1N7GA 5AI8A 2GEKA 3F5MA 1T1IA 4KLCA 1MNQA 5DI3A 1QGZA 4E5VA 5KOHA 3AB8A 1J49A 2IFTA 4RM2A 1ORIA 2JZNA 1G4UR 1R2QA 2XBMA 3CC8A 4GKBA 4LOLA 4MCJA 4Z86A 2PWBA 1TTHA 2DTXA 1Z36A 1Q11A 3R0QA 4GPAA 2P2NA 1LJLA 4LXTA 4OB8A 3U40A 4D82A 4ZEVA 3VOBA 1P2FA 1Y3IA 2HCJB 3QG5A 4MGKR 3HXQA 2YS6A 2HJWA 1QKJA 4E5DA 5HUHA 2GSWA 2Z6UA 1F2VA 2FPIA 4G0QA 4YFVA 3PRJA 2MHCA 4QHYA 4FR0A 1FRZA 4TV9A 3HN7A 2JEZA 1PL0A 2EBWA 2ODWA 3E7XA 3NYRA 1XZIA 4HF7A 4Y9DA 5DRYA 1CEQA 1KS2A 3WNZA 4U2BA 4PC2A 4LF7B 4GSLA 1TZCA 3L8MA 3LJKA 1JG2A 1G2IA 1PDWA 1UQTA 4KMOA 4B3CA 2EBFX 3A7EA 4DV7B 2V6FA 2ZU0C 4MI1A 2F3SA 3DB2A 1XXHB 2BGJA 2WAAA 2VQ3A 3HI6A 3AF2A 2BEWA 2VHWA 3VR6D 1KYWA 1EUDB 4WESB 1I7QB 1M0WA 2RAFA 2WABA 3CZ4A 3FCOA 1XMPA 2Y66A 3MWDA 3FNBA 2WM3A 4MWBA 1NMQA 2JJ1A 3L92A 1EVYA 1LD3A 4N82A 4NFLA 3V9AA 3KZMA 2XXAA 2FSFA 4JSYA 3TIXB 3PLAE 4BP3A 1PDOA 2OWDA 2GN1A 3A1SA 4HKTA 1XD9A 1UZAA 3T3PB 1SAYA 3ECAA 5KQPA 2SBTA 2ZRAA 1ZNQO 3MW8A 4RV4A 4YMGA 3CCCA 4HAWA 4TMTA 4BWFB 5JC1A 3BERA 2O2ZA 4W8GA 5F73A 3ABIA 4EAQA 2ZRCA 1XB2A 3I04M 3KQVA 4C03A 1V3VA 4Q0MA 5CVVA 5H3LA 3LT4A 3P9SA 1V1MA 5SY4A 1ZUNB 4QHTA 1W85B 4KPYA 4IUCS 4ZOLA 2WICA 3H75A 1DIOB 3LUGA 2L69A 2R44A 4NOLA 4W5HA 2O2EA 5FTLA 4HGOA 4ACAA 2FV8A 3O03A 2W4IA 1SHLA 3GN1A 3R7SA 4D26A 2VUUA 2H4HA 1ODSA 2XCRB 3QXJA 2C59A 3DCYA 4CYMA 3W2HA 1ML3A 3AIOA 1KO5A 2D8MA 3VR5H 3OT4A 4WFJA 3QF4B 3WK5A 1BMDA 3AL0C 3FZYA 3NO4A 1EGHA 5M7EA 3S27A 1JDPA 4LVCA 4LJ9A 3EYAA 2CVPA 4U5XA 1PSWA 1SXHA 1PKXA 1KJIA 3H7AA 4P33A 1CIVA 1FYFA 1O0SA 3I9KA 3NPMA 2OCGA 4CU2A 1FNMA 1TZBA 4ZO7A 4EUHA 3SAJA 4NV3A 1NI3A 4UM8B 5IBRA 4TV8B 3TW0A 5CIWA 2PZAA 2JGNA 2ATEA 2BUBA 4ZTZB 2DBYA 2XWSA 2JD1A 3PHHA 4DLNA 2ZS8A 1DXOA 1MAHA 2P90A 4PHFA 4B09A 4EARA 1H23A 4FXPA 2ZJ7A 4OHPA 3AL3A 1K2WA 1SNYA 3T5MA 3ICOA 1RU3A 1UZNA 2X13A 2AUNA 1G6OA 3GLHE 3M70A 3ONFA 4GVPA 4PINA 1QR2A 1UM9A 2J5KA 1O4WA 4GM4A 2WD8A 1SBIA 1YL7A 5HJ2A 3O3CA 2J09A 4GXTA 2J5BA 3GAZA 3RIMA 2HJHA 4IV8A 2JRLA 3S8YA 2OBFA 3H1FA 3Q3VA 5CH5A 1Y5MA 4GX0A 4ESHA 3KHSA 4L8VA 2DR2A 2PMCA 2OORA 3U19A 2CFIA 4PX5A 3DO5A 1U4SA 3MCUA 5JD5A 1Z13A 3FOWA 4C0LA 1DI0A 3UVEA 2EP7A 2WF5A 4BMDA 4X65B 1A8HA 2RARA 2VK1A 4D3XA 5IVKA 3N2LA 3IE2A 2UDPA 4ARAA 4WECA 3TAUA 4XPIA 4ENWA 3MJFA 3FVQA 5DIFA 1EAMA 1T8UA 2X2FA 1F1JA 3E9CA 3CS3A 1XP5A 1QOZA 1VPVA 2DH5A 3QLUA 1OI3A 4Y0NA 4O4JF 3H6KA 4OFWA 4XD7D 1IHDA 5ALNA 3SC3A 4TZ0A 2UYGA 5EIWA 1D1PA 3KQSA 2OAQ1 3PE3A 3MB5A 1CQJB 3QVKA 1EM6A 1E8NA 3RLIA 3UG6A 2H4ZA 4BU0A 4RDXA 2IL1A 3C74A 4KVZA 2BCGY 3TPZA 5BQFA 1AF7A 1QU3A 2WTUA 4JU8A 4I66A 2YIVX 4FFMA 4IH9A 2PKWA 4LGYA 3VSBA 1NMXA 3PUVA 3W79A 3MS7A 2QVXX 1YI0A 3EIXA 2ZPAA 2W2KA 4UW9A 3ZHXA 1LF0A 1KERA 3PYLA 5IF3A 3ENKA 3TN7A 1ZS9A 2VNSA 1XALA 2CUNA 4MKRA 3P97A 4ZU1X 2BGKA 2NO0A 3NTOA 1EXMA 3DONA 2ZT7A 4DJDC 4HWKA 4B4OA 4KR3A 1Y4DE 3KK0A 3NGMA 1YFJA 1YACA 4QSMA 3BUSA 3F3YA 3FYCA 2DQYA 4HQRA 1NHWA 3TVYA 5DBIA 1XMXA 3BT7A 2ZJ8A 5HDBB 2JFPA 4Q3KA 5C5DA 4UHFA 4CKEA 2JBAB 4BEJA 3P9QA 3NVMB 1MX1A 3C5CA 2VHCA 2HRCA 3OJWA 1T0JB 1V8FA 2J4FA 4U39A 4BYMA 1QC5B 4XWAA 5DHRA 2X8JB 2R6R1 3R0JA 5ETJA 3W5HA 2VDUE 1Q7RA 3DBLA 4ZD6A 2B4TO 3AO0B 3PFFA 3K16A 4NEHB 5JXJA 3HA3A 1ZOLA 2NTYC 2A9PA 3AUFA 1KNQA 2XAAA 3LDHA 2GRAA 4J1TC 3WC4A 2D0DA 2NO1A 2YN4A 2R00A 1PT9A 3MNFA 1KJZA 2ZQZA 3PJEA 3IUBA 1M2JA 1AQ6A 1N75A 2QV7A 3QLTA 3PQ4A 1NNUA 2AJDA 2FSVA 4RKWA 4E4YA 2BH9A 4TM8A 2E4XA 4RF2A 4TS9A 1EM8B 5CD9A 1X13A 1FDRA 1KIMA 3NVKI 1DQYA 4JXZA 2X19A 3EFEA 2JAHA 5DKFA 2YXBA 4NICA 3ESXA 1GTJ1 4HY3A 1RTTA 1HR0B 3HUUA 3U60B 3BFVA 2M2IA 3KZVA 1A8PA 2XDQA 2FETA 1SIUA 2QTGA 4G1VA 2ZBFA 3O4IA 5F3RA 2A5JA 3M5PA 4GZLA 4CM6A 4QOGA 1IZ7A 4XTCS 3PGXA 1XLTC 4REMA 3CW9A 4R7TA 4EJSB 3SM3A 4BC1A 5IVDA 1ZR4A 2WHEA 4OHXA 2GK7A 8ABPA 3PJDA 1JQLB 3MLEA 3QLEA 5JMPA 5HXAA 5H9VA 1S9DA 2GRUA 2PMBA 3JWPA 2JI6A 1AHPA 5ICSA 1BFUA 3GFOA 3Q72A 5G4LA 5REQB 2HYIC 4FIDA 2XXBA 3WB2A 2VS1A 2KS6A 4PLYA 5EUBA 2AF3C 3D0QA 1I2CA 2JAPA 1ZP6A 4CM8B 5GJVC 4E46A 1YSCA 2R1VB 2OMEA 1LLQA 2R86A 3E5MA 2VLBA 4G0YA 4N9WA 5GPBA 4BOYA 4QU0A 3EPJA 2F4VB 5HK9A 3CPHA 5T3YA 1BWPA 1B8PA 3WNQA 2GN6A 1OREA 1DC6A 1M8JA 5JSZB 1YB6A 4ZKEA 3ELYA 1K7YA 2E0IA 3LX5A 3UUEA 1IN6A 2ANCA 2R1ZA 5EKDA 4Z54A 3UXMA 1XLWA 3FMPB 1TNDA 4N7BA 1PNVA 4Q15A 2YJ5A 2ZR0A 2XJ9A 4Q1AA 1O94D 1RE0A 2DQSA 2EKDA 3CHYA 1NUQA 2W6JD 1L7NA 1ISHA 1FFDA 2Z2XA 2FOLA 1LBHA 2ZYIA 2WVGA 1SFRA 4EG4A 5EUCA 3RS5A 2EVWX 2BC9A 3OPYA 1OXTA 3LZCA 4R8LA 1NX9A 3K0KA 1G3IA 1UWCA 2CDAA 2I33A 1ATIA 3DOIA 1TDJA 5CLHA 3WKAA 3D2BA 2Z4SA 2R79A 1PBTA 4LISA 4U9IS 3X3HA 4AMUA 5IHPA 4OI1A 3FCEA 4G1EB 4MV5A 5HR5A 3ANXA 2O0MA 1NQUA 3AEQA 4PGMA 4FZ5A 2HKIA 2WB4A 4ZO4A 4GYYA 1N34B 1IMOA 2HT6A 1CS4C 4DUGA 1Y7IA 2X58A 5BORA 4GLBA 4NAVA 4A8TA 1T4DA 2XMZA 3WGGA 1DELA 2EP5A 3OY2A 1EE2A 3BZWA 3EUEA 4QBHA 1XNHA 3ROMA 2H0QA 1H2XA 2WV7A 4WN3A 3UGTA 3RYCB 4D42A 4K6HA 3I12A 1OV4A 3PC2A 4HZUB 1ZVJA 3RI3A 4J9UE 1C1DA 1KVQA 1ZQ9A 1ZW1A 1QHNA 3NYIA 4OH1A 4TTJA 5AVOA 1ABEA 2FWIA 3C4QA 5IPFA 4WERA 2GZMA 3U37A 1NXSA 2OBBA 5IJ0A 1JL3A 4FDVA 4FCTA 4JZKA 4A8JB 1AN9A 2V7TA 5EERA 5ITWA 2Z5VA 3VDRA 3GAMA 4BE7B 2IRWA 3NIDB 4PC1A 2DRIA 3ZWWA 1JJVA 5ULLA 1UOQA 2ENUA 5ARDA 1CX9B 3NV7A 5LIPA 2TMDA 2D2IA 4NAHA 2A33A 1HDRA 4BE9A 1V47A 1MX3A 3DV2A 3WYBA 4LDJA 3DM9B 5EP4A 5C5EA 4OLHA 4C7OB 2BIFA 3R7DA 1IPHA 1YS7A 2WKRA 3E18A 1SXJC 5HWSA 4LZWA 3E5HA 3TLGB 2ZAGA 1V6SA 4MIOA 3WDLA 5KWEA 3UAWA 3D6FA 5F9FA 3C3CA 3ZHYA 2OENG 1M2VA 1F12A 5TT1A 1OH6A 3AYZB 3E9EA 3T5TA 2FAXA 3QE2A 1AQIA 1UMKA 2OXRA 4M21A 3HKDB 3BCRA 4Q3AA 2TMGA 1KSJA 2SKDA 4R41A 2FPRA 4HN4B 2GMWA 3DKVA 4QXRA 3BWMA 4X7PA 4OBEA 3WQHA 1C14A 5LQKA 1VTKA 1GZ5A 5A2QA 1IZ0A 1EK1A 1WNFA 1XU9A 2NU9A 1Z74A 3NRBA 4NBLA 4M0UA 3RYIB 2RKOA 2JAUA 3DTTA 2O6HA 1FU8A 4G85A 5E8JA 2V6BA 2I3ZA 2RD2A 5EZYB 4QNMA 5KNCA 4ARIA 3N7UA 3MT9A 2JFHA 4IIJA 3Q4GA 2A9JA 4RVHA 4RTJA 1KO8A 2AOUB 3MQFA 2PZEA 3R6DA 5DMXA 4ZEXA 3L6RA 1UKYA 1SEVA 2XH8A 1IY8A 1O96A 3JVUA 4P4SB 1UXKA 2HUPA 2PAAA 5E2AA 5H4HA 1NG9A 1BDIA 3DDWA 4G25A 1GNRA 4JT4A 3PUKA 1I4EB 1IN5A 2H8KA 3KTDA 1ATZA 1IQPA 3K0CC 3R7LA 5CEEA 3MGGA 3W6UA 3I62A 2ZQ5A 3O1IC 4RPKA 1RM5A 3IIEA 2Z08A 3PQDA 4FP9A 2ZBPA 1NXQA 4L3OA 4UARA 2JRCA 5JXHA 4JIGA 4JBWA 4ZWNA 2WWRA 3M5CA 3IO5A 4FDAA 3TNJA 2OO5C 3PU6A 1E2LA 1V37A 3FE2A 1A7AA 1C3OA 2ZJAA 4G5OA 4KXYA 4R2KA 5AW1A 4CEHA 3U4DA 4ND2A 4LDZA 1EFPB 3LA8A 4M0EA 3BTVA 3ORFA 4NECA 3ADBA 1XKLA 2R6AA 2XT0A 1EFAA 3CYFA 4FONA 4LTDA 1H2YA 1AV7A 4M9RA 4UNSA 2BHNA 4YMIA 4ZAWA 1C30A 3SQLA 1RKBA 2QDXA 3ZS8A 5LDHA 4CTKA 3D8UA 2IYQA 3EEYA 1DB3A 4B81A 3J81A 3A3KA 2I8LA 1I7PA 4EW1A 3FWKA 2PWPA 3VYWA 2FEKA 1M1ZA 5KOYA 1IOWA 4HNVA 1DQPA 1P61B 3BGDA 1E6WA 4KFUA 2XTMA 3DW1X 4FD3A 4GBED 5JUWA 3C2QA 1P45A 2FPSA 5H59A 1JFTA 2K4MA 2ORIA 3ENQA 1UC8A 5KAPA 2ZPUA 4CQMD 5K4GA 5IT9A 2Q7XA 3GUHA 3GFFA 1WTAA 2XB9A 1F2UA 3PR3A 4KUGA 1QVVA 3LGXA 2AJTA 3NAGA 4KXNA 5IN5A 4RX1A 1BMQA 1F0KA 2LUOA 2QX8A 1DZIA 1G3UA 5DLQC 1LRLA 4B3MB 2D7CA 1BOFA 3T9BA 1XRPA 1RXVA 3OLXA 4HNSA 5FTJA 5IDWA 4A27A 4XFDA 4L78A 3D43A 3M6IA 4H4DA 4DUYB 3R9IA 3AKYA 3BE8A 4EGCB 1OX4B 2G71A 3KV1A 4GP7A 3VR3A 4ZCRA 3T94A 5JNTA 4H7HA 4G0VA 5A9RA 4E94A 2QUHA 1CUUA 3OH8A 5JEEA 1OZGA 2OYCA 1GUBA 2HOQA 4BNXA 1P39A 2IBSA 2B36A 1SOUA 1YIAA 3FFBA 3IVMA 4YAKA 1AMOA 4C14A 4F9FA 1M6VB 4HDRA 2HJGA 2AN5A 4CT5A 3UQZA 1T3TA 1VHQA 1FXSA 4CV3A 4FOPA 4JJ8A 4H6WA 4AUNA 4Z3KA 4BLSA 1R8XA 5IVPA 3GLGE 2CJFA 4LE0A 4AJLA 2C61A 4QAQA 2FTKE 4OJKA 3CRZA 3ZLBA 4Z4QA 1DJNA 3UICA 4TLEA 4NCAA 1A4IA 1G98A 1WF3A 2OD7A 3JAWA 3IILA 1ZN2A 1JPUA 3MD0A 3M6LA 4TS1A 4AMBA 4F8YA 4TM7A 4F5EA 2FW6A 4TLDA 3ONVA 4V2IA 5KMGA 3WP0A 4FQ7A 4DLKA 2GJ4A 3QKTA 4I1UA 1TPYA 3DW3X 3LNTA 1WXHA 4HNUA 2R0QC 4E51A 1Z0AA 1ZWKA 3NI2A 4AZ0B 4OQEA 3R24A 2J5RA 4GBMA 3WV4A 3PHBE 2I55A 1OB5A 3L43A 4Q9DA 3P96A 1CUDA 2P75A 3DE1X 3VRHA 5CDGA 1BE6A 1EZZA 3WLSA 5K8CA 2JBWA 4ALLA 5IANA 2FUKA 1MVLA 4DSZA 3MZ0A 4CKWA 3IIIA 3BXXA 4QDXA 3VZQA 4OIFA 1EMDA 3YASA 4R8SA 4RXUA 1P1HA 3HJTA 4MV7A 4NU5A 3RCBA 1IRXA 1C9KA 3LPMA 1Y1QA 1VXRA 3C7AA 1HE8B 3NHSA 4JLUA 4KE7A 5E0OA 1ZUD1 5CLFA 1VLVA 4L73A 4AYXA 2QR3A 2PYIA 4CNQA 1M2FA 3LL7A 3VNQA 4EPRA 1ZU4A 1SVKA 2QI9C 2AI1A 2JLAA 1ILEA 3LWDA 4ERNA 3EMKA 4WH0A 3FUWA 3MWFA 1FTGA 2GEFA 5EMHA 2B2NA 1MC4A 1X1QA 1K1EA 2CVFA 2J48A 3DUFA 5LBUA 3NFRA 3S4YA 3WWCA 1IN1A 1CQXA 4MUXA 3OPMA 4FLFA 4H7PA 5A03A 4U2CA 3MCWA 2QL9A 1KORA 3JASA 3EZ9A 1BZYA 1YONA 4ZVRA 3WYAA 1N77A 4X3CA 4QL3A 3SEFA 1PEDA 3TFWA 2OG1A 1C9MA 1V0JA 1ZEJA 4PWZA 3B82A 4R54A 1T2FA 5AHWA 3NC1C 3TLBA 3D8BA 3UA3A 1P2SA 3RNOA 3WWDA 2QBYB 4Y1FA 3KXKA 5IAJA 5KYWA 5FA5A 5JARA 2VUSA 3V7UA 5K8VA 2FN3A 1MEJA 2QTTA 1C5KA 3HA2A 4FFLA 2Z56A 5C5IA 4CCWA 5FBHA 4MUEA 3LG2A 3UAOA 3VHXB 3B5EA 2HXYA 4WACA 5HRUA 4QG3A 1WMSA 1KE2A 1KEWA 3FBGA 3ZWQA 4PC3A 1KE1A 3AF5A 5LZ8A 1JFVA 1VRVA 2IEIA 4V02A 5L4LA 3GU3A 3CUSA 2XDYA 1EDDA 1W6RA 2Q21A 4TWJA 4ZO8A 4KDCA 2OC4A 5JT1A 1JDSA 3WGYA 5JRZA 2DXIA 4CV2A 2XLBA 4P1ZA 1W5BA 5ADWA 1O6GA 4F3YA 2Q49A 1XL0A 4XX0A 4ND7A 1Y3CE 3ZDXB 1GEGA 3V8NA 4DUZB 2H7YA 4LJRA 3GYBA 2ZANA 4HDSB 4P5PA 1YC2A 1QFYA 2LZ0A 4UTZA 3RADC 2QF7A 1AHNA 1I7NA 1PS9A 4FFNA 2L42A 3OESA 2FDXA 2ZIAA 3KEFA 1KH3A 3OHPA 4UU1A 5HP4A 2BT4A 1F7UA 5E1MA 2H5JA 4HADA 4OPMA 4MVXA 2WYHA 4WSOA 5E4FA 5IYZF 1QG6A 3TQCA 6NULA 2XNSA 3HVUA 4EGQA 4HPXB 1YE3A 4MHOA 1K5DA 2I6SA 3AUAA 3I92A 3ZHQA 3WLQA 2A1UA 2V0CA 3G17A 1SHJA 4XR9A 3ICVA 4YLGA 3THSA 1IM8A 4DEYA 2HWKA 2F43B 1ND5A 4OUDA 2QD1A 3S1AB 2FJPA 3LHSA 4Q18A 1MJHA 3IAS1 3CVXA 1P1BA 1VKOA 4BGIA 3GL9A 3X1ZA 4Q9IA 4UU7A 3B6JA 1CT9A 1ACLA 4UDOA 2ZUUA 3ZBUA 4BLTA 5CDTA 4UM7A 3PL1A 2XUQA 3WB9A 4AMGA 2O5EA 4HAVA 3W5JA 2V65A 3Q2IA 2XR1A 2C57A 5TE9A 1OBHA 3CX4A 1HQCA 1QGYA 1T2VA 1YR1A 2A67A 3DHNA 5DISB 4Z9YA 3BXPA 3F90A 4RVGA 3SZOA 1L4YA 3UA4A 5JRDS 1U1FA 3PRHA 3CMCO 2BGUA 4QEKA 2IUEA 3BDAA 1MF7A 1BMFA 4Y98A 5EVCA 1EQ2A 1SUSA 1WMFA 1XR3A 2QJTA 3RU3A 3TQSA 3JQFA 1X0VA 4DUPA 4HATA 1GPLA 3T1YB 1VCOA 3P2JA 2NIPA 1WW8A 2HLNA 4WKBA 3TXAA 4HI0E 3TK1A 1PD0A 3IJRA 4PTZA 4Q1VA 4BC0A 2ZBVA 3CUTA 2AW5A 2RGYA 1XO1A 2RGGA 3B2EA 1NFFA 4R2WA 2HF8A 3NOVA 3IVAA 3R3ZA 1D0VA 4MV0A 3QY0A 4HG2A 1R12A 5LB2A 4TT3D 1J09A 3RYHB 4FZ3A 3NP9A 5FBLB 3IULA 4UQLA 1XNJA 4UBOA 5EMMA 1Z2CA 2P0AA 5DP1A 2MSNA 1AKQA 3K96A 2FQWA 5FUBA 7ABPA 2P6RA 3FCXA 5KYXA 4IMIB 1D03A 2FF7A 4CT4B 3V4VB 1LLFA 4I4TB 1CWUA 1UKCA 1N2CA 1J07A 1OD6A 4TMZA 1LBEA 1QHFA 3MBKA 1D9XA 2EF1A 1BROA 1J0EA 1NXPA 2BP7B 3M34A 3OCYA 3OHSX 4RAQA 4XCQA 3U3OA 4OMUA 4D9MA 1WMEA 1Z4MA 1QYIA 3V4RA 1OXKB 3RK4A 1XZHA 3QXSA 4MLDA 4FLMA 1Q19A 1U6JA 3OZFA 4ABTA 1Y6RA 5ALDA 1FJXA 9MHTA 3EVTA 1FRVA 1Z8FA 3TUZC 3L46A 1QP0A 1IB6A 2NVWA 3CURA 4MS1B 4YCCA 3VKWA 5IFLA 1UIMA 2H5EA 2RHBA 3TXYA 2QQ0A 1ZK1A 1CD5A 2CDNA 4YA6A 2X6TA 1T0PA 3AF4A 4WN9B 2JI7A 4GE0A 2Y1GA 3TPFA 2DUJA 2GSDA 3SQDA 1EWRA 4IX1A 1Z6XA 5E4TA 4BUCA 1KJ9A 2Z1NA 3KQYA 1PU2A 3SYLA 4FYJA 4DE5A 4JYAB 1WSBA 4H6VA 4XQEA 3GDGA 5INTA 1BO6A 4DC9A 5TC4A 1MNAA 2JZOA 4W5JA 1WHTA 4UHEA 2YQ4A 4KNWA 4R3NA 3SLKA 1RRFA 2PN1A 4H4CA 1T8RA 4MOWA 1BQEA 3L8YA 3DEAA 2XNHA 4WINA 3JSAA 1NN3A 5J5CA 4ZZ3A 3WYFA 1DRWA 3VHQA 3C7CB 3K9NA 2VSNA 4XWOA 1SZPA 3ZZ0A 2GZAA 4P5DA 2UUBB 4RVCA 4MW9A 1E61A 5KVQA 3EMVA 4X20B 2VC2B 1GITA 3Q2KA 4FVTA 4QLAA 1BHSA 1NP3A 4HB3A 1X8KA 5D5HA 1WZUA 1ID1A 4JLSA 3I32A 1SIOA 1DEHA 4QWMA 3RTAA 5B4TA 4L1KA 1XEXB 1M1YB 3IKMB 4C07A 3IXQA 4FFRA 3ZYZA 4DHWA 3F8WA 3H84A 5KYKA 3GT0A 1E3WB 4CLRB 2QKYA 1HDEA 2DAPA 1QIGA 2XSZA 3CF6R 5I5GA 3GD5A 4R9VA 1TCUA 4R0VA 2Y1EA 1DDIA 1FYEA 2OESA 4KWEA 5J1SB 3E9YA 4BDTA 3RQIA 3ZI4A 5HIMA 2VJPA 2TECE 3K0EA 4QYIA 4A6EA 2FN8A 1YO6A 4DR1B 3K0FA 2IYVA 1PT7A 3ABQB 3KP1A 4ZALA 2W6CX 4I3FA 2WWFA 4QREA 2PCJA 2ORVA 1CS0A 3RIEA 4MGZR 1JHXA 3BRCA 5J2UA 1GXSA 2B61A 3TBHA 1GAXA 2C9BA 2L18A 1R6DA 5TF4A 3H2YA 1M66A 3H97A 2QVLA 4LF5B 1QAMA 3C5HA 4A7PA 1YS9A 2RGNC 5H0IA 3LA6A 2C4VA 4G5GA 2ZIXA 4P4NA 1GNTA 4TSFA 2B7CA 2UZ3A 4G6ZA 5FLYA 1SVUA 1NX6A 1M3SA 1PFGA 3A25A 1YZGA 4ND8B 4D57A 4YXFA 1XCMA 4YRTA 5B7QA 1M6NA 5FBRB 3WK4A 1FP4A 2J9ZB 3WLAA 2FP4B 1NJ5A 3HM9A 2UYOA 3RRBA 3JQ8B 7GPBA 1QANA 5A3JA 6REQB 5JU6A 2V9PA 4OL9A 2C7BA 3MGAA 1ANKA 1MW9X 3O73A 1WUJS 2OQRA 4XJXA 1DJLA 2AG6A 2ZRGA 3DAFA 3EXEB 3GP3A 2ZRHA 1GUFA 3Q85A 4JVOA 2RK4A 1BHJA 1E5LA 3RBAA 4E1VA 5A6VA 4BE4A 1DLIA 3DNMA 3H13A 1GA6A 3E3AA 1T9HA 2VDVE 4IMJB 5TS2A 3V8RA 4C05A 2DFTA 3WFZA 1VRWA 1GTMA 2YJNA 4NPHA 1VCIA 4RFLA 4QG7A 1EWVA 2Y8EA 4QYSA 3RUCA 1CZKA 1O9BA 3KPUA 4RZ2A 1KC3A 3REQB 3X1YA 1LZLA 1XRNA 4DV4B 3CO0S 3GFPA 4Z3DA 2Z3ZA 3ICWA 4NU6A 3TG2A 1RNLA 1DCFA 1T9BA 3JRNA 8AT1A 1IXKA 2HO5A 1Z37A 3MT8A 3DXFA 4V0KA 3UT5A 3LQ1A 1U9IC 1ICEA 4K9QA 4XX1A 1QX4A 3G0DA 3NWPA 1WWKA 1G5IA 1V43A 4ZK6A 3ER6A 1ECPA 4U9HS 1USGA 1ZL2A 4AECA 5A6SA 3LOQA 4JBLA 2PD6A 5E1DA 1DBSA 5EHZA 2P68A 4PYMA 2O7RA 2QTBA 4QLBA 4LBZA 1RI1A 3EOZA 5D1NA 1ONSA 3RR2A 1TX4B 1TMYA 3PI6A 5A5VA 2ORWA 2VT7A 2XQVA 3AI1A 4C2AA 3FFXA 3P4UA 2GD0A 4MYTA 4UDXX 4RLFA 1QXSA 1GNQA 1P9WA 3LD9A 2ODAA 2QTAA 1DHRA 1WEKA 4L07A 4J1QA 2WWVD 3VR2A 721PA 4ISCA 1PS0A 1WMDA 3FFTA 1ZD1A 2Y92A 4YCAA 4OQZA 3ZZMA 4WI1A 4EB8A 5JPDA 2AKEA 2P9GA 4MWDA 4NWIA 3RIYA 2Y0PA 1PR9A 1XDDA 4J0CA 5B3JC 1YJQA 5KDDA 4NHEA 3B60A 2JI9A 4NK5A 4BYGA 3EPLA 3ADPA 4QDTA 4QUEA 1U3DA 2XTZA 1Z28A