3D1VA

Crystal structure of human pnp complexed with 2-mercapto(3h) quinazolinone
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
288
Chain Sequence
ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Structural studies of human purine nucleoside phosphorylase: towards a new specific empirical scoring function
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d1vA00
1U1GA 1JDUA 5EFOA 5F73A 4QEZA 1PKEA 3KHSA 1SD2A 1U1CA 4QARA 1PW7A 5FAKA 5C80A 4GLFA 1VHJA 1RSZA 1A69A 4F3CA 5DK6A 1Z35A 2OC9A 1V48A 2A0WA 3FB1A 1ODJA 2I8AA 4D8XA 1FXUA 1Z36A 4TS9A 5CCDA 5CYFA 2QPLA 1Y1RA 5IFKA 4TTIA 3BSFA 3KVYA 1Y1TA 1SD1A 3P0FA 1ODKA 4X24A 3U40A 4TXLA 2HRDA 4LZWA 4OJTA 1Z5OA 3E0QA 5CCEA 4M1EA 4TXMA 1RYZA 1TGYA 2XRFA 1B8OA 4FFSA 1V2HE 4MCHA 4P54A 1Z5PA 4BN0A 2ON6A 3MB8A 1YQQA 4QATA 4DANA 5KB3A 1T8SA 1Z33A 1V4NA 3K8QA 4TTAA 1RCTE 1V3QE 3UAZA 4IP0A 1A9TA 3DF9A 1V45E 4M3NA 4F2WA 1ODLA 1T8YA 1JPVA 4LNHA 1RT9A 1Z37A 4QASA 1U1EA 1Z39A 4TXJA 4GLJA 4NS1A 1Z38A 1ZL2A 5B7QA 4LNAA 4DA8A 4QAQA 5EUBA 2Q7OE 4R2XA 1JDTA 5K1ZA 3ONVA 1LX7A 3NBQA 2QSUA 5CXSA 2OECA 2QDKA 1I80A 1NC1A 2AI3A 4TS3A 1ULBA 4R31A 1ECPA 1TD1A 4OGKA 1T8RA 3QPBA 4LKRA 1A9OA 4TXNA 1OU4A 3INYA 1JDVA 3DDOA 4EARA 4F1WA 1M73E 1OV6A 3KVVA 4YO8A 3NM5A 2IQ5A 1ZOSA 4F3KA 1LVUA 4LDNA 2ISCA 4PR3A 1XE3A 4K6OA 2B94A 4WKBA 4JWTA 4OF4A 1PBNA 1PR5A 3EUEA 3F8WA 4OY3A 3MMSA 1ULAA 4D9HA 4MCIA 1YR3A 1V41E 1PR1A 1RXSA 3D1VA 5F7JA 4L0MA 5F76A 5B7NA 4WKNA 1RXCA 2A0XA 4BMXA 3GGSA 4GMHA 5JPCA 4TTJA 2QTTA 4D8VA 1K3FA 3OZBA 1NW4A 2HWUA 3NM6B 4BMZA 1RXUA 4DARA 1PK7A 4E1VA 1PR6A 3OF3A 3KVRA 1Y1SA 1JE1A 1WTAA 4PNPA 5B7GA 5IU6A 3NM4A 5ETJA 1YBFA 1Y1QA 2A0YA 1A9PA 1JP7A 3C74A 1TCVA 3PNSA 3UAYA 1VMKA 4TXHA 3FNQA 3E9RA 1Z34A 3OZDA 1Y6QA 2I4TA 4YJKA 4GKAA 4G8JA 4DA7A 4MARA 1NC3A 1YRYE 4D98A 4YMLA 3UAXA 1PR4A 3FOWA 4G41A 3GB9A 1JDZA 3P0EA 4WKPA 1TCUA 2P4SA 1SJ9A 5F78A 3OOEA 1Q1GA 4R2WA 2OC4A 2GUWA 1VFNA 4L5AA 3SCZA 1PR2A 4NY1A 3PHCA 2BSXA 1OVGA 3BGSA 3FUCA 1JDSA 3KU4A 4EB8A 2H8GA 4I2VA 1PR0A 3ENZA 3TL6A 5B7PA 4DA0A 5F7ZA 1B8NA 1K9SA 3E9ZA 3FWPA 3IEXA 3EMVA 2RJ3A 4WKCA 3BJEA 3O6VA 1T8WA 3DJFA 2AC7A 3UAVA 2AI1A 1OUMA 1TGVA 3K8OE 1T0UA 5I3CA 1OTXA 5CYGA 3OCCA 1U1FA 1A9RA 3ODGA 1LV8A 1CB0A 1QE5A 4ECEA 3O4VA 1PWYE 1VHWA 3IOMA 1YQUA 1PK9A 4D8YA 3PNPA 3LA8A 4L6IA 4UC0A 5CXQA 2PGAA 4OEHA 3UAWA 4NSNA 4DAOA 4H1TA 5F77A 1CG6A 4JP5A 1U1DA 1G2OA 4QFBA 3EUFA 4DABA 4TYMA 2A8YA 1RFGE 4RJ2A 1A9SA 3LBAA 1PF7E 5EPUA 1RXYA 3LGSA 1RR6A 2AI2A 3BL6A 3OZEA 1JYSA 1Z5NA 3DP9A 4G89A 1A9QA 4YNBA 3UT6A 4U2KA 1Y6RA 2HN9A 3EEIA 4F2PA 1JE0A 4DAEA 3OOHA 4DA6A 3FAZA 2OXFA 4JOSA 3KUKA 1ODIA 5F7XA 3T94A 4L5CA 1C3XA 3OPVA 3PHBE 1K27A 2HSWA 3DPSA 4OGLA 4BMYA 1SQ6A 5F7OA 1N3IA 4KN5A 4L5YA 3OZCA 4WKOA 1OTYA 2QTGA 4M7WA
chains in the Genus database with same CATH superfamily
4LE2A 3AVYA 4JJKA 3RVSA 2FEAA 4Q1VA 4R8MA 1R8SA 4IFTA 1XTZA 3FNRA 1PKEA 1QVWA 5EIWA 4ACAA 4QGFA 4GBED 4AZSA 2J0SA 2C3MA 2OXCA 1H4QA 1MEEA 1O95D 2AEJA 2LTAA 4Z7NB 2JFHA 4TT3A 3I42A 2RGCA 2XJ9A 2VF4X 2OXIA 1XZFA 5CT5A 3X3HA 8AT1A 4HSGA 4TOIA 4BATA 3C7AA 4FKBA 3UPUA 1YC2A 1E3WB 1GARA 2AF3C 3A14A 3F5FA 5ER9A 4TUYF 1JKMA 2JK1A 1PR9A 3WJ1A 1PJQA 2DX7A 1NVTA 1NZDA 2NV0A 4J94A 1FSSA 4BYMA 2H92A 1XGKA 2N1BA 4H7JA 5IDXA 3QOXA 4JYAB 1C3EA 2Y6UA 2Q46A 2X1MA 1K5GA 5HKLA 1G20B 1V8FA 2PX4A 3QXSA 1CPYA 3QEBZ 1LJUA 3BWDD 2P5YA 3ZIAD 5I6DA 3U4CA 2H2HA 2BRUA 1LZKA 3U62A 1CUIA 1K88A 1Z36A 1ZH2A 2J3HA 2VIIA 4HXGA 4L4XA 4D81A 3PLNA 4JNKA 2WJIA 2XBUA 3UQYS 5LD2C 1GPKA 1KYVA 1Q3KA 1RM4A 2DP4E 2WYUA 5LQMA 1ICIA 2XYHA 4RA6B 3SYRA 1NURA 2WICA 2VYFA 4CKZA 3LUAA 3WMGA 4IHKA 4DIMA 3KRTA 4D2IA 2QUKA 5B1YA 2QZSA 4C30A 3PUKA 1WTCA 2FP4B 1NWHA 4JA2A 2FW1A 3T8YA 2JLXA 4HVLA 2SICE 1D1QA 3ZPXA 3AI3A 2CL0X 2FWNA 3FOCA 3ENVA 3JYHA 4CLDA 1Z6PA 4CL3A 1E3SA 4EPTA 1V7CA 2IPLA 1NYLA 2CZCA 2DJIA 3DBHA 3UBMA 1V9CA 3UCEA 2NN3C 3CRW1 4EFDA 1O94A 2IPOA 4QYWA 2QVBA 4RZ2A 1E5DA 3MWGA 1FS4A 2KMLA 3DBLA 2IXTA 2V7UA 1BEEA 1VJCA 5HS6A 3G85A 3UK0A 2PEYA 3P4YA 5T4HA 3IAXA 4D4GA 5C3MA 2OGSA 2ON6A 4JITA 1Q1EA 1B43A 2G4CA 4KXQA 3MB8A 1RJ9B 4A0GA 2WC1A 3SI7A 1NMXA 2R8EA 1HG1A 4FOPA 4YALA 3TS1A 4WZAE 2NTNA 5LC1A 4AS2A 1OXTA 4Y9UA 4RYLA 1XTPA 5LA6B 1EFUA 2W2KB 4BWYA 4P0PB 5I4CA 2L19A 2VO1A 4LZNA 1D04A 3AESA 4XX0A 4POAA 1RBQA 4C03A 1LLCA 2CXRA 3GUUA 4XASA 3DR5A 1JG2A 3GD7A 3A26A 3H1TA 3C5HA 3DXZA 4C22A 5JMTA 1E64A 2C4VA 3H9BA 2FPPB 1QAMA 5B1HA 2AG5A 2YWGA 3EXG1 4G9GA 3LTEA 3QPDA 4I08A 4QRDA 3C1TA 3PVCA 5A9TA 3K6RA 5EXEA 3VO1A 3UNXA 4LJKA 4MP3A 5JCOC 3CZ9A 1PVOA 1P3Y1 3DQQA 3JZIA 2BTEA 3CNOA 1YZQA 5DNEA 6GPBA 5DRTA 2VDMB 4HAOA 4FLMA 4CUZA 3AI2A 4OJQA 3LT1A 4D74A 5IKOA 1V5GA 3L4BC 5IJ0B 3DEZA 5CT9A 5FPYA 4YQZA 4UEOA 1T5TA 1UWKA 2B4RO 4GI3A 3P5SA 1AS3A 1OV4A 4MRAA 4R1MA 1PZMA 1A04A 3WHPA 4LRTB 1EXWA 2OQ2A 3NT2A 4GPZA 1I9CA 1G63A 1MGOA 1JQ3A 1NM5A 1PQWA 4UBLA 1Q7TA 2VPXA 5HF8A 4NYMR 4C21A 2PJZA 4P7FA 1GCIA 4YH1A 1BFKA 3A36A 5LXTB 1ZNWA 2QZJA 1ND5A 3AEQA 2JIZD 2QLLA 3IAM6 1TDJA 2M6LA 3LQFA 2W0SA 4R9RA 1MAUA 3D0OA 2P62A 1DVRA 2VF5X 2IYLD 3HO8A 1E1YA 3N2KA 1KSGA 3I9LA 4MROA 4L4SA 4X93A 1KFEB 2A59A 1NC1A 3CSDA 5ELMA 1BKSB 1HYEA 5LQSA 3RW9A 4Q05A 3AG6A 1UP4A 1XCPA 1ECPA 3CY6A 2QI9C 1C4KA 3FPLA 3HHEA 4HN4B 3EPKA 3UKJA 1GTG1 1A9OA 2VXOA 2BISA 3AQ4A 3B3QA 2GYUA 3P9YA 4AJIA 3K09A 4N54A 1GUDA 3SSAA 5L95A 3S5UA 3UOGA 4LN1A 1ZSVA 2WUFA 2IXAA 2FN9A 3CNQS 2CV0A 2BFNA 2IBMA 4Q12A 3B8EA 1BH2A 4G5FA 2BBOA 4TSKA 5LLTA 3TM5A 4FFBB 3BICA 3ISVA 4C7OB 4L08A 4OF4A 4F4HA 1YGYA 2EZUA 1GA6A 5KYVA 2ORYA 5CGQB 3TLGA 3WGIA 4R1UA 2HADA 3VYUB 1HYGA 1NJGA 2IUYA 2PAFA 4KXYA 4HT3B 1JALA 1Q0UA 2VOEA 2ETXA 5CEFA 2OPBA 3GBPA 3N86A 2EZ4A 5FFMA 2P91A 4XQGA 4E21A 4EKDA 4IEEA 4PPGA 4GQAA 5AVWA 3VA7A 2GD6A 4YJ2F 4JB8A 3QA9A 3WFIA 4M4SA 1NBOA 4D41A 2CBXA 2KW5A 2PL5A 3LD9A 2ERYA 1E61A 4B33A 4M8IA 1V3VA 1SC9A 4R5MA 4BLUA 3GIDA 1D2RA 3ORFA 4IMIB 5ARCA 2CBGA 4E5VA 3LL4A 4CBVA 3ON5A 2J7PA 2Q9AA 1ZM4A 2VDPB 3SFVA 2I80A 3QEJA 2P69A 4WLVA 2NM0A 4IJQA 1TYDE 1VKZA 2DLNA 3ASUA 3D1VA 4NABA 2H59A 1KJWA 5FDFA 2CDRA 1J9EA 3NDRA 3T5AA 1D2HA 2R7NA 1RXCA 1J8QA 1MOZA 4PSVA 4QPNA 4BJ3A 4BUCA 1N7HA 1Z0DA 1U90A 2WKSA 4TVOA 2PWAA 4G0PA 5K2MA 4PLCA 2AMJA 3FOEC 2QQGA 2VBCA 5EPEA 2ZZMA 2A9VA 2ZVPX 4LJYA 3NTRA 2TMYA 4HO1X 3DTYA 3UGKA 2OHXA 4Q7KA 4PGAA 3DT8A 4MVWA 4Q66C 2ATCA 2HI0A 3K9HA 1TYAE 2PD3A 1S7CA 1TT7A 1ZA2A 1CWUA 5BQ3A 3LU1A 1RXUA 1TUGA 4KPUB 3IAM1 5H0IA 2C7PA 3RVPA 1YKFA 4DCNA 4E4TA 1N2ZA 2WAMA 2ZI6A 1KE1A 1Q0TA 4PZUA 1VDMA 3KVRA 2MDTA 3FUVA 1G20A 4DN6A 4CF4A 1TO1E 2F9LA 4TRJA 4ZCIA 5CA1F 5J4HA 4ND1A 3CINA 2Q3HA 2E4WA 3KCQA 1O9BA 3V6LA 3LLSA 5A7HA 3L1UA 1X19A 4A8JC 4OKIA 3DA8A 1CZLA 1Q44A 1QVAA 3GJ7A 4IL5A 3GLQA 10MHA 4UQPA 5DX0A 3SN6A 1XMIA 4PFJA 2JLRA 2LIPA 2R8RA 3I3SR 3GJTA 1W0KA 4CMAA 3HCFA 1QE3A 3PFWO 3PUWA 3RRMA 3BC1A 2E6UX 4RA6A 5E1MA 1QWOA 2OAGA 1L7AA 1YZFA 1KXZA 3Q5GA 1SUEA 4HATA 2P9FA 5JI3E 1KJQA 5G41A 1NQXA 2FP4A 4AAYA 1NOKA 4M55A 4Z7JA 2WJHA 1MO2A 1BWPA 4Z5XA 4PO8A 4V0MA 4IHJB 3JSAA 5C2JB 3C7DB 2AJDA 4JYBA 4BFUA 1L7RA 3HRKA 4DLLA 3CVVA 1NC3A 2AOXA 3T41A 1QTQA 1Y37A 4ZYVA 1YHYA 1C7FA 4N48A 4JELA 2F3RA 4UE2A 5JY1A 1H1DA 3OJLA 3BSSA 1DPFA 4QBTA 5F1PA 5AXDA 3C3EA 3VZPA 1G21E 3ZU2A 6CHYA 4E5DA 1SBCA 4KQ2A 4DLYA 1X39A 2D1FA 3GZTB 5FV4A 2C9CA 3JPWA 4EYQA 1KPGA 2WRZA 3ABRB 4FIZA 2FZLA 2QD2A 1L7DA 3OOEA 4RULA 1RJ9A 1L5YA 4W1SA 3JQAD 1TLFA 4BKQA 1T1GA 1PG2A 4ZAGA 3QU7A 2QRKA 2GAJA 1RIIA 1CE8B 2JZCA 2W2KA 4IKEA 1G0NA 1VFNA 3OIDA 4HUQB 2YMMA 1TMKA 2EWMA 4XGQA 4ZARA 4TV9B 4HDAA 1QM5A 1BKDR 3R5TA 4MMYB 2YYSA 2NQ2C 5JS8A 1EGHA 2FFJA 2OHVA 1XU9A 2ST1A 4XWGA 3ZWAA 3EYWA 4G24A 3WWDA 3C4JA 3EUWA 2FPPA 3S44A 5JXWA 1CIJA 2E5WA 3JRWA 2AGVA 2DU8A 1V6AA 1C81A 4UVGA 4BS9A 4EGSA 3R3UA 1YE3A 3DL7A 2N75A 1UBKS 3I34X 5EUQB 1MC8A 5CLLA 3W2EA 8ADHA 3RYIB 1FB5A 2AOTA 2PKQO 5AJUA 1D1PA 2O7SA 3EBPA 2E82A 4UREA 1OH5A 2ECFA 2XMZA 4U2GA 3TLXA 1BXKA 4EEZA 1ONPA 4QLAA 4IIJB 4BNMA 2Q07A 4NPAA 1ELOA 2IGTA 1W36B 1NNSA 4LRYA 3E9CA 4LJ5A 5ALOA 1T0IA 4ENQA 1YSCA 3W5DA 3ZEIA 1U7OA 2Z83A 4BXOB 5F52A 4L9RA 3E58A 4RGVA 4Z3KA 2UDPA 3QLVA 3W8DA 4UXHA 3KQWA 2WWTA 2I6TA 1T91A 5D7BA 1YKGA 2ZULA 2R4QA 3DT9A 3P20A 3HVHA 4IQGA 3F90A 2XMBA 3ZS8A 5JJLA 4OXNA 4AM8A 4FFDA 2BZGA 4W5OA 1A82A 3FYUC 3I5XA 4NZOA 1AF7A 3KEQA 4MV6A 2PN1A 3B2NA 5I3CA 4UE6A 5LXTA 2HQOA 5JPIA 2VUSA 3JVUA 4E94A 1T6YA 3ONFA 4KDEA 1WUYA 1XZQA 2AEFA 2HIGA 1XTIA 3GFGA 3P9XA 4QICA 4DSUA 1SPXA 3L7CA 2WV7A 3QTLA 3BB1A 2Q4BA 4J1QA 1YTLA 4MUJA 4D8YA 4KN9S 2EWVA 2VPPA 4J7AA 2YJZA 4FWBA 1D0SA 1EK1A 4M36A 2PGAA 2IEZA 1UFRA 2O9JA 1MP0A 2R8XA 3VTFA 3GFPA 4HB4A 2UZIR 3IUBA 4ENPA 4MYSA 4CQNA 3H2JA 2ES4A 1WUJS 1ZH6A 4NSNA 4FKMA 3B1WA 1E98A 3E35A 5E4JA 3PXDA 3ZDEA 3D43A 1T9CA 2OV6A 1D6NA 4FFBA 3VZCA 3UG7A 4MGKR 4N7RA 4C7OA 3AT1A 1LC3A 4LJLA 1SURA 2XLBA 1GG8A 3DVLA 3I5UA 4I66A 3VBEA 4B31A 1CUDA 4MQBA 1JR4A 1CFZA 2C3OA 4K6GA 1RM5A 1G8HA 3RRBA 2IZ1A 3I8XA 2WSLA 4LJSA 5I01A 2H4WA 3SR3A 1UJ6A 3HYLA 3SZGA 4O29A 2MYNA 4LX0A 2W11A 2II6A 2FPXA 2RJNA 2C5BA 3D8TA 1M6WA 3ABZA 2C83A 5ALDA 3WG9A 3AC0A 5C8DA 4HNTA 1NBWB 4MGHA 2XMQA 4QJ4A 1B42A 2ICAA 4R9SA 2V3CC 3L0DA 3HR4A 2VK1A 3HJHA 2GWHA 4MS3B 3NORA 2QDXA 3DAGA 3OKCA 1JIVA 2BP7A 2C04A 3PCRB 1EP3B 4Y6PA 2NAPA 4N8EA 2PJDA 4HK4A 3TH5A 1CY4A 1MJHA 1IB6A 4P4TA 3CKLA 1MPXA 2FLWA 1PT7A 1CHNA 2Q5LA 3BL6A 3MNFA 4FHFA 4KQGA 4LE1A 4MP8A 5KOHB 4YC7A 4BQNA 3MELA 3U4IA 3MTIA 3KLPX 4LJ6A 4Q4JB 3WOVA 2GK7A 4BKOA 1MQAA 1DOAA 4P32A 2W83A 4C7JA 2IDJA 2YICA 5JFTA 4CKWB 4OREX 2ATXA 3CGGA 3OSZA 3CLVA 3PNOA 3R3VA 1ZVJA 1W6UA 3GDWA 1F14A 4QVGA 1Z0IA 5G2OA 1PYOA 3H5NA 1I13A 1E1QA 3D4BA 2GYWA 2C2HA 1GNVA 3DTTA 4G1BA 4IO1A 4Z4GA 1RWVA 2AG8A 1ACJA 2K5UA 1NPYA 3BWEA 4RF3A 2DJ5A 3UW1A 3ZNQA 4KPUA 4KO2S 2HHAA 3AY3A 2G25A 4EG1A 1KO7A 5LIRA 4MHTA 1YDFA 2JH9A 2Y1FA 1LFDB 4O0MA 2I1VB 1VBFA 1PJ4A 3HLKA 5CLQA 5BOSB 5A06A 2O05A 1C3XA 1J0XO 3DAFA 3OPVA 3PHBE 2BC9A 2ZK7A 2J1LA 4MAMA 4J0IA 3UB3A 1DC3A 4PAGA 4WE3A 2RAPA 2BM9A 4G65A 3EDOA 3OURA 4U9IS 5E9WA 1E2DA 2UYGA 2XOEA 1JLLB 4C05A 4QBHA 1YA4A 3B6IA 3FCXA 3H8JA 1GV1A 2BEVB 1J00A 1OBFO 3OQHA 4YAWA 3WNZA 1X1QA 4CLXA 4REMA 5I45A 2D6FA 4MLCA 1P4GA 3N8HA 1KAGA 3W8NA 3C16C 6AT1A 1OX4B 1XV5A 1CF9A 1RJEA 5L45A 2A5GA 1UT6A 4CNQA 1K6EA 2YX1A 2ZP1A 3P0RA 4UDXX 1VJRA 1NUPA 3NYIA 1N6NA 3EXEB 5B3JC 1SD5A 1MB4A 5CR9A 2ZUBA 4DJFC 1ZKDA 1JFSA 4IHJA 3ZZMA 2DECA 3V4VB 3JWIA 4FE3A 4B80A 3INRA 4EHDA 1F4LA 5TT1A 4KYUA 2EKZA 4K6CA 2XZOA 4AUMA 5LBTA 3RTAA 2VDWB 1P0PA 3AV3A 4M21A 4CM9D 5IT5A 1EX1A 2HHJA 4QULA 3WP0A 2VRWA 1SC4A 2O8BB 4LAFA 3X2SA 4B35A 2HV8A 1RC0A 1USGA 2NUPB 2YZNA 3PNVA 3S70A 2Y93A 5MGNA 1RSZA 3PJDA 3TLYA 1CF2O 4XB1A 1UOPA 3OECA 3PC8C 4LC0A 1BX0A 5BSMA 3CVUA 5JG7A 1L0BA 4AG5A 4IDQA 5B58T 4OVKA 4XWWA 1JN0A 3EMDA 1NY5A 4V38A 2PXCA 2F1RA 3S0JA 1EUCB 1KAOA 1U4OA 1QQAA 1CE8A 3MILA 4HUQA 3ZIDA 4KSYA 1MV8A 2A0WA 4TV9A 5CLIA 3TIFA 1GRQA 1XP8A 4J0GA 2PZLA 1VA5A 1ZI8A 1P1FA 1TF7A 4I1VA 4IFIA 4KN8A 5BSWA 1LGYA 2PSEA 1SXHA 2GXQA 3D81A 1HFKA 4HDSB 5B1IA 5EE0A 4NDAA 4DC1A 1D8TA 4MKZA 5INTA 4Q4DA 2QUZA 1QQ5A 1TQHA 1Z5WA 4IVQA 5KQRA 4NK4A 3NHBA 1U7DA 2OZLA 2YIVX 3GFVA 2W5UA 3R5FA 2N0SA 3ND5A 3RADC 1QLWA 4BNDB 3ZV7A 1E5QA 4B75A 2EC5A 4PE5B 4I46A 5AJXA 4IIJA 4MQ4A 3LBYA 4O1HA 4GVXA 2JFZA 1HH4A 2IIQA 3A9UA 2JCXA 4M38A 3O83A 4YP7A 5FNVB 3U3ZA 1DKUA 2H2DA 3R3YA 1WF3A 1VL5A 2F3QA 3LPNA 4BXOA 4JSYA 1P1HA 3MEQA 4RS4A 4PAQA 2PV7A 3H99A 4CWAA 4OJTA 2ODNA 4MDHA 1ZU4A 3V4SA 3QWIA 3LC7O 4Q7QA 1DDOA 4YRJA 1RYZA 1WPRA 4JUIA 4Z86A 5AO9A 4Y1EA 3OTGA 1OFUA 2IZ6A 2Q50A 2XCUA 2AFIB 4HWKA 1FMLA 4PO3X 1E6EA 5GOZA 3W6PA 1NXQA 2MMGA 1Z12A 1IHYA 1KFKB 3R3XA 4ZDWA 4RETA 4CUJA 3ZJTA 4BN0A 1A8UA 1EE9A 5T4EA 3I6YA 3TOSA 1BH6A 2CUNA 2EG9A 2V55B 3Q8XB 1DJPA 3B9PA 3KT3A 4K87A 3JAMA 2RHWA 2ZRIA 3B36A 5DEOA 4F91B 3ZGOA 3ZQ6A 1P1KA 3ABQB 2ZJ5A 4PQGA 4MVJD 2F3PA 3U3JA 1JIIA 5DYIA 1BGWA 1CS4C 3N0RA 1QFSA 4I5IA 2XWQA 5AQEA 4E2YA 4E51A 3ZGZA 1DADA 4DZRA 2R6FA 4M9XA 4CODB 1Z08A 1Z33A 4AUKA 6ADHA 2M9MA 3DEFA 3NWEA 4Y30A 2FZWA 2AN4A 1RJDA 1V4NA 4OUKX 2AKAB 3BDVA 1WCV1 4JFRA 5IVIA 3HVIA 2PWPA 3H4MA 2V3WA 4RW0A 3WLPA 4EA6A 3EOZA 4ZGWA 2NTJA 3D6VA 4RE6A 4XJVA 2BBWA 1WSDA 1Z17A 3TTSA 1UDBA 3O31A 4Q4CA 2GAIA 4KXMA 1B76A 1L4KA 1P7CA 1EX7A 2Y8EA 1E3JA 5DHFA 4Y0VA 5CVTA 1UANA 4O3FA 4C4XA 2GSWA 5DWQA 3KKKA 2P5UA 2QG4A 1JSLA 4FS8A 1Z8NA 4PAOA 3NIFB 5LZ7A 4INZA 2QRHA 3TJMA 4EAAA 1SC3A 4RK6A 1Z4JA 4DA9A 1PRYA 3DD1A 4NQRA 2C61A 2QW8A 1HSOA 2EW1A 1VJTA 3A4VA 1F6DA 3L77A 5K0GA 5LMUB 1RT9A 4EB6B 1Z37A 3OOSA 4FX5A 1MOQA 1KETA 3ESRA 2VJCA 1D5WA 1TUEA 2GB4A 4HS4A 4MS3A 2QGNA 3GRUA 3RBZA 1QYDA 2XUHA 3S2YA 2PSHA 1QHIA 3LLCA 1MTZA 1HSZA 3CPJB 1W94A 3NTLA 4U2FA 4DC9A 2QE7A 4XD7A 5IKMA 5L4NA 4KKXB 2GK3A 2O0LA 4ZEWA 2JA1A 5K8UA 3GLIE 3SFZA 3UK6A 5K8TA 1TO6A 5AKKA 4YJGB 4HEA6 5DMHA 1ZGJA 1TRKA 2O2SA 4KTVE 3GBVA 2GXAA 2VPWA 5AVTA 3OM9A 3BEDA 3L9WA 1H0KA 2OGWA 2VTVA 3MYYA 4CKWA 3K0HA 3OTWA 1C8KA 1NBEA 4CG2A 1KL7A 3HFGA 1ZR2A 4L3WA 1JAYA 5JH7F 5KI6A 4RK4A 1PWEA 5IVKA 3W8FA 3U4QB 1FMFA 3CH4B 5TVGA 2W6OA 3NTUA 2C1XA 3J7TA 4QDKA 3ZV5A 1RQXA 4C0AC 1ECFA 3IP5A 3K1TA 4JOCA 5HIJA 3U4DA 1JDVA 1N9KA 2FVXA 4ABTA 3HH8A 2QE7D 4XD7D 2FPLA 4ZREA 3F46A 2C5EA 2FQQA 1T2DA 1YZYA 4IIBA 3VX3A 3WSWA 1L4GA 2A7QA 1MIOB 2W6MA 2HIAA 2IPAB 5BOSA 4PR3A 3CF4A 4AY2A 1T0JB 4K6OA 2YJGA 2HXYA 2B9VA 4JWTA 4WKBA 2OA0A 2FEKA 4GPD1 1P9NA 3EUEA 4S05A 1JLLA 1N8KA 4ILEA 3TB4A 2V7QA 1MC5A 1YIAA 2BEVA 2NV6A 1UKAA 1GOTA 3DL0A 1YZKA 3DFKA 2Q7XA 1TE2A 5KHLB 5FLYA 5DN9A 5LUAA 2Z98A 3FPFA 2J3DA 5ISMA 1N1DA 1OX4A 2I62A 3ESZA 3G5LA 1PT5A 1L8OA 2UUPA 1VPEA 2XYVA 4NZPA 3VR4D 4DMGA 1JR3D 1Y7HA 3KVOA 1UM8A 1PDWA 2J6HA 1C9KA 4NECA 4G8BA 4PU0A 3PS9A 2HRZA 3X2FA 4LA4A 1YI1A 2XF8A 3QKUA 3GAMA 4IUDS 5TARA 2C2KA 1NV9A 2AJ8A 4HQNA 1DARA 4FXOA 1WXWA 3NHRA 3NQ41 3D4LA 3VR3D 1RBZA 5MDHA 2VHZA 2P4HX 2ZB4A 4LXIA 4MR8B 1S01A 3AB8A 3FHLA 2VDWA 2QTAA 3SLKA 2A2ZA 2PUHA 2QHXA 2FKNA 3V42A 4BMXA 4BO3A 2O1XA 2Y0DA 3HEMA 2RH8A 1G8JA 1JEEA 2VBIA 1T43A 3NI2A 3IDSA 4HADA 4HGQA 4ND3A 5EKXA 4CN9A 5HFNA 2H1OA 1GRNA 2NUPA 4UNNA 3PKJA 1IEWA 3WGVA 3ONEA 3D2LA 2JIBA 3TIXB 2HJGA 1WOMA 4MITA 4OXIA 4QUGA 1NW4A 2PUVA 1XNRB 3ZQJA 1NOIA 3DE3X 1YT5A 1LSSA 3GA0A 1EUCA 3VZRA 4BNGA 4NYIQ 2KM1A 1G3RA 4HEA1 1L4UA 3A4TA 4D25A 3WQHA 4NE9A 1E2FA 3G8BA 4A6PA 2V4UA 3LYAA 4JLNA 2AD1A 2B61A 3E48A 4ESHA 2QRJA 4G25A 2YBEA 5K0JA 4D8TA 3EZ6A 4C3ZA 4KFTA 5IWAB 1VP9A 1E20A 1DAKA 4HDSA 5IASA 2VF2A 2JLVA 1ESMA 4J0DA 2QTBA 4U7DA 4BECA 1LQ2A 4O63O 4RL6A 1YL5A 3NFRA 1XZGA 3ESCA 4XRGA 1CUVA 5C7OO 1FEZA 2PD4A 3OAAA 1Z5UA 2EIXA 2Z56A 4KW7A 4OP1A 3K71B 3DEAA 4J2HA 3WRWA 4BNDA 1T0BA 1W46A 3NHSA 3UAYA 1MW8X 1XRSB 1VMKA 5LBIA 4E6PA 4F4FA 3QTBA 3R5JA 2I8CA 1VLLA 4YFVA 2RC6A 1NLFA 6Q21A 4HAUA 1H6AA 1FX0B 5FNVA 1W76A 1DUSA 3STVA 2RGNA 1UPUA 1Z3CA 1M9NA 1NASA 3OTIA 2X8JB 4IF6A 1KMIY 4YJKA 3HFSA 5E6RB 5AJHA 2ZKIA 2LKCA 1M8PA 3NDJA 3SYLA 3L6BA 2A30A 1KZ4A 4HBGA 3K4PA 1LW6E 1YD7A 3G82C 4LXXA 3KTFA 1NXPA 2ISQA 3WGQA 4ZVMA 5C5DA 2BBSA 2PZKA 1WP4A 2AFIA 2HMUA 1F0YA 4KUGA 4JLBA 2QNBA 2JJ1D 4KNVA 3RT7A 3K73O 2D5CA 3FTNA 1M1YB 4FEAA 4FHZA 4TPKA 3WWPA 2XB8A 1QCZA 4OKNA 5FXMA 3ZS9A 5J58A 1Q1GA 5HILA 2CHEA 3KT0A 1CR1A 2D2IA 2GO1A 3A04A 4JDUA 5AXBA 3UAOA 1T2AA 3IHKA 4V2UA 2GM5A 4AXXA 1P2TA 3Q2OA 2WSBA 2W9XA 2GUWA 1O9HA 3HYNA 5DHTA 1ULSA 3QVSA 3ZWOA 1Y98A 3HN2A 3NHMA 4UTOA 3WQRA 4F6RB 3CZ5A 3V33A 4PZZA 1AGPA 2GZAA 3FGPA 1Z4LA 2X5KO 2RGUA 1QSGA 3COPA 5FTJA 1V9LA 4ZV9A 4BNFA 5BRAA 1A9ZA 1ORTA 1UPCA 1I6LA 1EUYA 1UK6A 5KVVA 3PI7A 2NTVA 3PHCA 2I1WA 4K3VA 2DTEA 4B48A 5ICEA 5KTOA 4BNWA 2AJLI 1Y8ZA 2HT6A 4YWHA 4FW9A 1GU7A 3NKVA 4EB8A 3K0CC 1Z6YA 1IG0A 2O6HA 1WSBA 1L3BA 2D3TA 4ZI7F 2YMLA 3EF3A 4FSHA 5LA6F 2R7AA 3TL6A 1UBSB 1Y1LA 4DCPA 1H3EA 3NAQA 4C04A 5AUNB 1ISFA 5GM2A 4FDLA 3UMMA 5IT9A 4UFOA 4ARIA 1QRRA 1G42A 3N6RA 1R74A 4OB8A 4Y1GA 1N8TA 3IQEA 4UNIA 3T5MA 5ICCA 3UKOA 1LSJA 5CDFE 3E9QA 4WXRA 4KO3S 1JG3A 4Q9LA 1N2CB 4ZJYA 1W581 4PC2A 5DH9A 5AW1A 2O0JA 1NQWA 3UATA 2A9RA 3VH3A 5K6AC 3NU1A 4M54A 3G0OA 4J3NA 4EB6A 4HPWA 2W00A 1B6SA 3B3AA 4KXXA 1YZ3A 2AC7A 4J4TA 2GRJA 2GSDA 2ZR7A 1GZSA 1L1EA 2QXUA 4J0CA 4RK5A 2R97A 1VLVA 3IE2A 1R0BA 2DBVO 1FUYB 3QEMB 3H5TA 3WLNA 5A5GA 1YFLA 4EKYA 1EFCA 3UB2A 4U4AA 1PJ2A 1EVZA 4M7PA 5CYGA 1KERA 2H2FA 3PPIA 1P9RA 2P9EA 1KO5A 3ONDA 4YJGA 4K8RB 1SKYE 3O4VA 5DO9A 4ENVA 2FZVA 2VBFA 4PGFA 4A6EA 3LBNA 1CUBA 2X40A 3VU9A 2GM3A 3K3PA 3ER8A 4OQQA 1HNNA 1XHFA 4BP1A 4J3FA 3ZEAA 3PQ8A 4ZC8A 3F78A 3NIGB 1NF3A 2IHNA 4Q15A 2CHQA 3LA8A 3EDQA 1S3SA 3U4QA 4BY9E 2HA2A 4YYZA 4KBGA 3H42B 2I2XB 2R62A 2IXGA 3ICCA 1K1EA 2QMUA 3UAWA 1ABFA 1GPNA 3EGCA 4HVCA 1R64A 1PAUA 3WI7A 2OUKA 2IELA 1AQNA 2GCGA 4UVEA 4YVFA 2X1VA 2VJQA 3DDUA 2Y92A 3GZNB 3PXXA 3S40A 4XTRA 1S9DA 4QDXA 4FFLA 4MNTA 4HN9A 2JD1A 1XAIA 3HDVA 1MIOA 2X1HA 3PQ7A 4NCXA 1WMEA 2H7CA 2IK8A 2ZBUA 1GZ3A 3BZBA 2L2QA 4N9WA 4KR6A 3O94A 3Q9UA 2CK3A 2XUPA 1V2GA 4L22A 1R18A 1SVMA 4GOLD 3FZGA 2E5LB 3PXEA 4PTLA 1E66A 4G86A 3HNRA 4LMAA 4ND5A 4KIUA 1N32B 5B57C 3H84A 4DV1B 2B3TA 2BFAA 1FFXB 3NIWA 3WWEA 1Z06A 3LK7A 5BSTA 2W6PA 3I4LA 4BQIA 5HIAA 2WA2A 3MN1A 4LDZA 3LBAA 4GH5A 1I7LA 2MSDB 1SG0A 4MLDA 3VTKA 4JIGA 4JBLA 3M3PA 3ZE2B 2VXCA 4XDGA 2Z8YA 4ARSA 3GCGA 3E2MA 2BKEA 3VZBA 4GX0A 4MR7A 4R8SA 1OI7A 2C2WA 1I3CA 3GRZA 2AOUB 1NTRA 3F6PA 3G9ZA 4MR8A 4X41A 3E1SA 1T9GR 4G3XA 1ZGBA 2HQSA 4I1OA 2CVQA 1XTBA 3ANLA 3F5MA 3OVMA 3RVRA 4GR9A 5EHGA 2EG5A 3DOUA 2WY2D 3W5HA 3ZWBA 3CW8X 4EO9A 3T9BA 5KNBA 2O2GA 1BX1A 3AEYA 4FFMA 2DR2A 4BJ5A 2JI9A 2VQDA 3MJEA 1QRSA 3NW9A 3RU9A 4RY8A 3UJAA 4E88A 3MINB 1GSOA 1W6RA 3EC2A 4BAZA 2VDUE 1P3JA 4X1OA 3SK0A 2L17A 3UENA 2LZ0A 2BGIA 3A3NA 2IKSA 1UZMA 3PTLA 3FKJA 4DT1B 3OPQA 1E60A 2HCBA 3ZWKA 1SU8A 5BNZA 5CDYA 1CRQA 3ZY3A 2CB9A 3IO5A 1CY6A 1KIAA 1S2MA 3EIHA 3TD2A 1M6NA 4F86A 1P39A 1PZNA 2WF7A 4LX8A 1OH6A 4QO8A 1CEXA 5IBRA 1THZA 3GPBA 4OUDB 1KZYC 2PD6A 4PAMA 2GX6A 2MYUA 1ZN8A 2PRJA 2PLRA 1FFCA 2P9ZA 4PGHA 1ENPA 4MDFA 1U2QA 4F46A 1IONA 1YB5A 4QOIA 2PLWA 1YZHA 4C0LA 5JSUA 3BL8A 5JCJD 3WMWA 5EY5B 1XFDA 2V98A 2QYOA 4G1MB 3R24A 4ZHSA 3HYSA 4W1RA 2H4YA 3SP1A 3LM8A 4X44A 2JGLA 3EOBI 3WC4A 1PT8A 2FWAA 5HRUA 2PKEA 1H85A 3FUUA 4KI0A 2O3QA 3B8HA 4M7WA 1IQPA 3RI3A 2J46A 3PKIA 2X8JA 3DP7A 2Z95A 1K7FB 1H1TA 5EUMA 1A88A 3D0RA 4GO1A 4MW0A 3WWZA 5J4VA 4RVDA 3S4YA 3OZGA 1F0NA 5IAAA 4PHGA 4J1NA 1TTQB 4XM2A 2DQSA 1GIAA 4IV0A 3ZQKA 1OXVA 4EHHA 1O6BA 1M10A 1RI2A 3DZIA 4TLDA 2BM0A 3HHPA 3K5HA 3I2HA 3QE9Y 1U3WA 1GGMA 3AB3A 4Q9AA 4TMFA 2O2YA 3RTDA 2HW8A 1XN4A 3Q8WA 3F2VA 3ETGA 1BU5A 1LV7A 1XNHA 1N1MA 2VUIB 2F8SA 3C3BA 4RPGA 2Y1GA 2ZATA 1M1YA 2I7VA 3R23A 4XGRA 3RU3A 4NMXB 3CLUC 4IAOA 1G5HA 4KQHA 1I2BA 4NZZA 4OK3A 4PLYA 2AN1A 1VA4A 2V03A 3AGPA 4HJRA 1TEXA 2AFVA 4K88A 4RHXA 1NBMD 5KCZA 1NU8A 5M34A 5HWSA 1VBKA 4HUTA 4GWLA 1QO9A 2IXDA 2J9RA 3PF9A 4WK4B 4Z51A 13PKA 5JCXA 2YWJA 1P62B 1ZM9A 3Q3JB 1NA5A 2AJCA 5A4IS 3FB1A 4EJ2A 2HKIA 3O38A 4F6RA 1EDOA 1JLHA 4BMVA 3VO9A 3ZC3A 3OSUA 1OY1A 3L7DA 3NWBA 4M60A 3SAJA 4FMCF 3U9SA 2OO5C 3DULA 3HADA 1OYOA 3BJZA 1JYFA 1C7JA 1E9RA 3LOUA 2HJSA 4G8CA 3RVKA 3ZE7A 3PUIA 4ZDJA 5KO2A 1I6WA 3PIDA 3DO6A 3LX8A 2WB2A 2YHIB 3I2YX 4S3MA 4A5SA 1Z47A 4C7KA 2VNAA 3M0EA 4UCFA 1BRTA 1Y1RA 1B3BA 3R6LA 1XL1A 4TV9F 3FFXA 2QL5A 4C7BA 2O1SA 3GGPA 2YUTA 4RFLA 3TRDA 4XOIA 1R3UA 1B0ZA 4JYPA 5DYYA 1ZN9A 3UGTA 1LTKA 4WXPA 5FTKA 3L07A 4HWRA 2XAUA 4EOGA 1N2CA 1QV7A 2VH5R 3L01A 4J8PA 1XO1A 3PC4A 4MRRA 5IAOA 1AUQA 1KQGA 1G8MA 2Q49A 3G0CA 1E5VA 3WYGA 4DCTA 1QAOA 5JYDA 4NCJA 2JBAB 3HDHA 1XSEA 2AFHE 4KR2A 1VHLA 1C0IA 1K7CA 1RACA 3IHLA 2OBYA 2WOJA 3QEMA 3U9LA 3KDAA 2O1EA 2CXTA 2OAEA 4RQAA 1F51E 1QIJA 2XUFA 1GT6A 4EKIA 3WTCA 4URZR 1E4OA 1MTOA 1QB7A 2HXSA 1ZGGA 4XDHA 1DP4A 1VI5A 4MQFB 1H9AA 3ADOA 1SEVA 4CF6A 3B2QA 5GWXA 3LZCA 2HAEA 5HSGA 2GD0A 5ALTA 4ITUA 2CKMA 2PWYA 4NJOA 2Q2OA 3PG5A 4KRXA 2BTOA 2REQB 3E3OA 1HOXA 3GJSA 2YVAA 4YRMA 3WSVA 3O3CA 4MB2A 2GS9A 2NSHA 1U02A 2ZE7A 4ZGGA 4B76A 1EHIA 2VPQA 1J99A 1TC2A 5LDHA 3Q0IA 1NMQA 2ANCA 3Q9NA 1D4OA 1RU3A 1N5KA 2D2FA 2RHTA 3ZZTA 3DONA 4BFSA 4AUEA 3EZLA 2OKCA 2XRYA 1N2EA 4BP3A 3GJRA 1KYYA 1U6IA 1U8AA 3I2IA 5BSRA 4ATNA 2HIMA 4UU0A 2ODTX 3EDRA 5B5SA 3U81A 4F4UA 4J6EA 1JH8A 3R20A 4GXTA 3T61A 4CDGA 3HXQA 2M6SA 1N2HA 1P6UA 2F67A 4NFSA 1DBIA 5H02A 3PEUA 4AZ0A 5AI4A 1SKUA 4DS3A 2FN3A 4XD2A 1HM5A 4QODA 3JQCA 3UPDA 3PC3A 1Q21A 3OE4A 4RVFA 2X9GA 2I6SA 4LNHA 3T7KA 3U56A 3DEHA 4BLVA 5C1BA 3JR7A 4AJEA 1RMYA 2XA1A 3B5JA 5FBKA 3UMVA 1JYEA 2ZAOA 1DAPA 2XCLA 3DSRA 4M7RA 2R86A 4QNNA 4XSVA 1M0TA 4BMSA 4I1SA 4QTTB 5MHTA 2WF6A 3RF6A 3ORRA 2PWBA 3D8RA 1WAMA 1F5SA 1DXHA 1LLFA 3GAFA 4KK3A 1NRXA 2ZG6A 3C48A 3K0KA 3QPUA 5EEHA 5FBZA 5B37A 3BIWA 4DA8A 1Z45A 3MBIA 1DAMA 1R0ZA 2O06A 4U6QA 3H1EA 4EYOA 1JIXA 5KJ1A 1FE8A 2I0FA 1UMKA 3IKTA 4HH3C 4BPBA 1Z62A 5BNFA 2AOUA 3HB1A 3NBQA 4HNQA 3JR3A 4RD0A 4PLWA 4X1YB 4V0QA 5CXSA 3R7AA 4TVKA 3RRXA 5LNK6 3HTXA 3JAWB 4MUKA 5KQMA 3GL9A 5FJIA 2JAOA 5NLLA 3IP6A 1LX6A 1WKVA 1ZUD1 1HEIA 4J1SA 4XE5A 4FGZA 1X7HA 3S68A 4RTJA 4W4TA 3LW7A 1PUIA 4X63A 4BGDA 1GGHA 4R31A 2P2NA 1XLTC 2C4HA 1GQSA 2O5VA 1XI2A 1B8VA 3MINA 1TU4A 5BYBA 2DWPA 2OD9A 1HNXB 4B4DA 3G7SA 3I72A 4JZKA 3MPUA 2JATA 3OX1A 3RSGA 5I9LA 1D5CA 3GN1A 1SA0B 16PKA 1QTRA 2CDBA 1IWPB 4A5OA 4DT1A 1P18A 2YW9A 3LX4A 4FI3C 3V8NA 2UKDA 1WHSB 3MUFA 2FUNB 4JC8A 4DZZA 3HA3A 4EJSC 1EVIA 3NX4A 4LDNA 1M34E 1PTKA 2MSKA 4Y18A 4EGFA 1R8XA 3AKEA 3F5DA 2B94A 4PXYA 3FKQA 5AWFC 2V54A 3C3DA 4A8PA 1FNNA 4RVHA 2XE6A 3QW2A 1A27A 1YR2A 1PEYA 2WMNB 3OFKA 4O0LA 3DMNA 4XLZA 5TT0A 1PFUA 2MT9A 3WGZA 2CW5A 2N42A 2OILA 5CM2Z 3CVWA 1ZIPA 3PGXA 5DSTA 1FF9A 1U9JA 5KTKA 4DUYB 5TLSA 2ZWAA 2C7GA 2OHFA 2H00A 5C4IA 5ES3A 4PC3A 4LY6A 5CTJA 5A3RA 2IV7A 1U3DA 4GNRA 1VKJA 2BR5A 3N7UA 1M0EA 1ORHA 1P7VA 3RUIA 1E4EB 2IIPA 5IUNC 3T3DA 1P3DA 1W4AA 2C5GA 3H6KA 3PFHA 5JS6A 3E05A 4LXGA 4RVGA 4NCAA 3FYTA 1E9DA 1MVOA 3BS4A 3W7BA 3E81A 5FUQA 1SUBA 1FBNA 2JLQA 5IWCA 3MF4A 7ADHA 1UPBA 3LNCA 4MHOA 3RRJA 4E7OA 1XBTA 1QYRA 5DW0A 2AMLA 4F9FA 4ZFNA 1JLKA 1OCEA 3MJ4A 2PCJA 2DQ4A 1W1IA 4BBAA 2O2XA 2CF6A 3T4PA 4DFDA 1HRDA 3ZQUA 4F2HA 5A0TA 5DFAA 3ASZA 821PA 3ER9A 1P2DA 1QVRA 2Q29A 2GFQA 4YCBA 4CQMD 4Z4QA 4MHSA 2HOQA 1RRFA 1EAYA 3TI9A 1QQ7A 4I2NA 4J2TA 5IUKC 1TM7E 5IMBA 1AT1A 2BFEB 1YZNA 2ZSFA 2EJCA 2TSYB 4GP7A 3L7AA 3KSDO 2C94A 1EKXA 3P0HA 1U0JA 4H7DA 5AM1A 3K9GA 4B4WA 4R54A 4DRYA 3JCZA 2D0DA 3LHFA 1HE2A 2OFPA 5GIPE 3EXAA 3L8CA 2CFOA 3B9QA 2ZI9A 2Q6KA 3GGJA 2PUAA 3DWFA 5CU7A 2O2CA 3UUFA 1XMPA 5MN4A 4NKRA 4Z7OB 2FKAA 2UUOA 3G2HA 1A9PA 3C74A 3QZUA 2YHIA 4JLWA 4LMBA 3A06A 3BG5A 4RSHA 2EQAA 4U2EA 2DBQA 2H7YA 1VDZA 3QG5A 4OU5A 2JFFA 3EXHB 2OEPA 3PNSA 3RFTA 3SBOA 4PPFA 3T35A 2ZRPA 2WAAA 3KBOA 2HSJA 1A98A 4KPYA 4DDHA 2H17A 1YS1X 5H4HA 1A5AB 4Q1BA 3I9MA 1K8QA 4OH7A 4X84A 5AJYA 4EW2A 2QGZA 1WXHA 3WDKA 3RHSA 4JOBA 3OIFA 3OO1A 2FEMA 1TZJA 8LDHA 4CEIA 3OT5A 3PNBA 3ROPA 4RY9A 4EMBA 2NG1A 1QHYA 2WYVA 4G8JA 4LW8A 4E5UA 1JMKC 2JBAA 1G1MA 3ITDA 4QWMA 4LE0A 1QTNA 5H1YA 2OHOA 3AKDA 1T0PA 2HRQA 5BQOA 1U9IA 2EFJA 2QAGB 4B43A 4RZIA 4C6TB 3AOGA 2YV2A 5T64A 1N9GB 1ZR4A 2G5PA 1VXOA 1ATZA 3N2YA 4R1NA 1NJFA 5FNVF 2C9YA 3FG9A 4G1VA 1QAQA 1KFBB 3HNPA 2ZWMA 3L6OO 2B2XA 3HB9A 4H7IA 4YJHB 2ZUDA 3GUYA 1QR2A 2X4DA 4MQFA 3GJXC 3BTSA 4B32A 1SQFA 3KSBC 1KY2A 3GZJA 2V0NA 1LH0A 5IVHA 1T1JA 3HM9A 5T3YA 1JB9A 4AMBA 3LY5A 2RGBA 1E79D 3GGGA 4H6VA 2H4HA 2REQA 1JSZA 1I94B 4R9NA 3OZIA 5LOVB 2W2LA 2HCFA 1HEUA 3SCZA 4F5WA 3OX4A 4FYVA 3TZBA 3GEMA 3ZU5A 4OU4A 4WLOA 2WTEA 4YP9A 2Y1EA 3BFXA 3GRAA 3HKEB 3J80A 4QG3A 4BNUA 2QVXX 1PZFA 2Q0HA 3AWIA 4S0XA 4HZUB 1N75A 1F8YA 4QDTA 4ED9A 1TAHA 4D7AA 2QGFA 4MVJH 3LW8A 5EGNA 4RIHA 5EIBD 3WYDA 3BHIA 1GTVA 3TLCA 1HTWA 1PUJA 2OLJA 4CZ2A 5K3OA 2R2GA 4LVUA 4CNBA 2WZBA 3HGQA 5F7ZA 4A15A 3NLLA 2P3OA 1QXSA 1TIBA 1SFRA 3QELB 3QY9A 4ALJA 3JQ9A 4A0HA 1IATA 1K4KA 1YULA 2O4UX 2QD4A 4FN4A 5C1OA 2F8LA 1Y6GA 1CQPA 3E9EA 5BYAA 1YCFA 1HDYA 3OTHA 3SKXA 2G09A 3PIIA 4F1KA 3RYCA 1ZAYA 3AHDA 2QROA 3PCXA 1CF4A 2ZIWB 1URPA 3AUTA 1II9A 3HWSA 1M5TA 1TCCA 2PU5A 3ZBPA 4O33A 3UAVA 3ZBTA 3ZZUA 5IPFA 3KOZA 3BXGA 1L5RA 1UFOA 3KK0A 2ONKA 1A8PA 3R3WA 2GARA 1NW6A 4RU1A 3K8OE 4PLHA 3NTOA 4YCCA 1G60A 2BIFA 1W88B 2A14A 4X5OA 4A1OA 4X1YA 3TXXA 1NLUA 2RBEA 5JBIA 1CJTC 1R9JA 3TMYA 4OBBA 1SXQA 3LWNA 4D4IA 1QHHB 2DWQA 4M0FA 1HMYA 4EY3A 2XTNA 3IAUA 1JV2B 3IR7A 1XTSA 1YBMA 3ESQA 2OXEA 3D7MA 2WYIA 3E9DA 2Y1CA 3HA2A 3A6LA 5EIAA 4OQZA 1WUTA 1I6KA 3P2MA 4WASA 4MRVA 2RIPA 2CN1A 2YR0A 1DQYA 1PG5A 1F2VA 3LV8A 2XECA 1D0VA 2NZ2A 2DY1A 1SA0A 3QOFA 2J45A 4ARVA 2E89A 5BMVB 1V8ZA 3NRCA 1JR2A 3S28A 1WHSA 3PJRA 4K0KB 2HGSA 2D5BA 1ZH4A 4Q16A 2F2TA 2ZJZA 4KOAA 2R6ZA 1NBAA 2GJ8A 2R1ZA 1W0JA 2FWJA 5SICE 1Z9BA 1FVXA 1K6MA 3L8DA 3V2GA 4CCAA 4DABA 2EP5A 3L43A 4OYYA 1DC7A 1NL3A 4XOUA 3IPAA 1E6CA 1REQB 3FE2A 4DE5A 3CH7A 3GX1A 1YR7A 2FPGB 1KJJA 3EEOA 1VIDA 1XCOA 3GMDA 4UU8A 1A71A 1V7PC 2PFGA 4LZOA 5J47A 1LVGA 1UZAA 1HQKA 2GOYA 4RJ2A 1U63A 3CUTA 3D0QA 3DOFA 3MPOA 4XGNA 1STOA 1CFJA 3UMGA 4EUNA 3I73A 1P2FA 1E4EA 3EZXA 1UEIA 1RAEA 4IJ5A 2IOQA 4L0CA 3KV1A 4JI5B 2G4VA 5CJJA 5E2AA 1KZ7B 2YXPX 1L1FA 3FX2A 4FM9A 2COEA 2GNPA 4R0NA 4FWTA 4HYEA 1G17A 2FEPA 1Y6ZA 1OFGA 3KJQA 3CKKA 5KZMB 2NOAA 2Z5GA 2IZ0A 5TB5A 1CYEA 2ARKA 2IPMA 3U1TA 1J1IA 2IEBA 1IN5A 521PA 3FSJX 3VR4H 1UMBB 4BO8A 1QC5A 2R7KA 3H2YA 4O08A 3FTPA 5K05A 4HGNA 1PE0A 1C2TA 2X0FA 1NPTO 2ZBPA 3FOBA 1Z4QA 3CNHA 1U2PA 4K7JA 4WMLA 4YRZA 3VV2A 1D2AA 4M1KA 2QRLA 3CX6A 2BFEA 3HI6A 4OSOA 2OXFA 3IP1A 4YJDA 2ZANA 4P5DA 2WHRA 4HNGA 3CLRC 3NR2A 3AMVA 4JB2A 4FNAA 4N5IX 2C0QA 1VMIA 4MW6A 5F9MA 5LZ9A 2NT4A 1S2NA 1WPGA 2FNAA 2Q4DA 2VHTA 4EF5A 1FMCA 1AO0A 2AQKA 1HYHA 3NUQA 2ZYDA 5EYPB 1R50A 7ABPA 1DQZA 1M54A 4NONA 4LYFA 2XVAA 2V6MA 1RM3A 2YOHA 4Q37A 1HORA 5FV7A 2B25A 3A9VA 3T34A 3UMYA 1N3IA 2O2ZA 3EXHA 1YJXA 1YKSA 1C1DB 4NL4H 4RDCA 4XWYA 5A62A 3PD0A 4I14A 2BYTA 5GADl 1DKQA 3HU1A 1ARZA 1AG9A 3RHZA 3W3AD 2E4XA 1WULS 3HWWA 3UC5A 1E3TA 4H08A 1OFUX 3KFVA 3NWOA 4CG3A 4Z4IA 2HJHA 4IDBA 3E2IA 3BB4A 3EYAA 1N34B 4QEZA 1VCHA 3LA6A 4E3ZA 5JYBA 3IV6A 3LRXA 3IXLA 4J0FA 2WTXA 2QAGA 3HO6A 5ER6A 3C41J 3TG8A 4MRSA 3NBKA 4C6TA 2Q3DA 4DMHA 1N9GA 4JHLA 4UXIA 1EVKA 4TSFA 4E2ZA 1USVA 4E5MA 5KWVA 1VFPA 2Q27A 4OA8A 1U3GA 2F6RA 3ZBQA 3REFA 1KSHA 3FYCA 1J22A 1PGNA 3GH3A 4XFKA 2WU8A 5C80A 5HXAA 2NSYA 2VQEB 2P78A 4YJHA 2ZRFA 4MW5A 1SXJA 1XELA 4WAUA 4ZIRB 1RHKA 2OOSA 5FI3A 5GVRA 1P33A 1ZW6A 1KRWA 3MWEB 1JHYA 3T54A 2VP5A 3AYXB 1U0BB 1GGKA 3M6UA 4FWIB 4O3MA 3NHLA 3PX2A 4CV3A 4A2WA 1DHTA 1X6VA 2FSIA 2VF7A 2PXXA 4FUTA 1PJ3A 1V35A 3AHFA 4G0QA 4INOA 4XW2A 2K6GA 5LCXA 5LOVA 4LFAB 2ZLBA 3FY4A 1QFZA 3L7LA 2B3DA 4NZ9A 4QYIB 4V3BA 4MPTA 1EGAA 4CCSA 3SJAA 4TS4A 1QH1B 2D62A 1ZM7A 1JWBB 1DTEA 3FH0A 1YDEA 1ZD5A 1OT3A 2WSMA 4KMRA 3MIIA 4KNWA 2OHJA 5CCDA 1P2GA 4AMVA 3DR3A 1SXJD 3IOYA 3MJCA 2FK7A 5AKEA 3ECSA 4PN7A 1J70A 4KUHA 4DDKA 5LQNA 4DDWA 1WZ2A 2PANA 1IUNA 3TTWA 2O8DA 3LKVA 1R5OA 1SHZA 3QELA 1NP7A 5I47A 4AYTA 5FHRA 1P5HA 3PUYA 1V96A 2QXTA 1TMOA 4X00A 4LBZA 4WJZA 3VR6A 2XGJA 2BMVA 1UBEA 3NNDA 3F3YA 2XB9A 5E4FA 4LZWA 4B82A 5KVSA 4ZI5A 2FRDA 3QQPA 1N6PA 2Y0PA 1NXXA 5K6TA 3LVQE 3EPJA 4D9JA 4C43A 4FGUA 2FJ0A 2I2CA 2V0CA 4CMEA 1GITA 3PQ6A 1V2HE 1ZHHA 2GCPA 3U4HA 3VNRA 1KI7A 1Z5PA 2JIDA 2XUAA 3WX0A 2BLLA 1D8AA 4PV7A 1DWOA 1KDZA 1KS9A 4HEJA 1QHHA 1EFDN 3C45A 5TJHA 1KR2A 2YDXA 4QUDA 1X1TA 4J49A 1H2HA 2OT3B 3VAZA 3B78A 3BILA 3IULA 5FWDA 3ZVMA 2YZ2A 3CNBA 3L7IA 1T3LA 2AT1A 4WLEA 5CH5A 5K3SA 5T41A 1EK6A 1L7QA 1QX3A 1YRAA 1Z0FA 2H31A 2ORIA 2BW0A 2ZJ8A 1P31A 3H2SA 4KQEA 2B20A 1EX9A 3FNGA 2PU7A 1BS9A 2JFPA 1EE1A 2K2WA 2ZOSA 4NP6A 4MKRA 4U9HS 4LFBB 2JLUA 4HVTA 1KMCA 5BMVA 1C14A 3QMWA 1F17A 2VDJA 3ND8A 1W73A 1EIZA 3ESBA 4RH0A 2XPCA 3RAJA 3FHTA 2J07A 5KKCA 4P1ZA 5AHWA 4CTNA 1FP2A 1TM5E 2XMCA 4MW4A 4NAHA 5EJ2A 1GNRA 1Z7GA 1BWSA 1KEEB 1T3HA 2CFRA 1YJ8A 3G2IA 1SCKA 3LY8A 4LQDA 2TS1A 1REQA 5AICA 5T5QA 3TSYA 5JALA 1T8YA 3ZK8A 1VJGA 2FPGA 3S55A 3NYWA 4WXMA 4U2BA 4DCJA 1WBJB 5TRTA 4MUGA 2NLOA 3H2KA 3TTUA 1OT5A 3EG5A 1XYGA 4LYAA 3RVNA 1XZIA 4YAFA 2I7XA 3HDYA 4COKA 4D4MA 1OHHA 1NUUA 3BK2A 4HGYA 3WJAA 5K8LA 4AY4A 4UNRA 4X91A 4EFMA 1BAPA 5CXUA 5BUSA 3FDFA 4I8XA 2CVPA 2W2OA 3FPGA 3SQNA 1XF9A 2WFLB 5ESXA 4G1FA 4B46A 5FL7A 3L1KA 3RKUA 4HLUA 2P6NA 4JHXA 4ASUA 5IULC 2VK8A 3EG9B 1KKLA 1TIKA 4H4EA 5KOJB 3RC3A 4P3XA 3URMA 3BX1A 4G5OA 4YRPA 1XALA 2WHQA 5G0SA 4CF3A 4AS1A 4OQDA 4A0QA 1ZGAA 1ZIXA 1UMBA 4MAFA 4TM8A 1MRZA 3R8FA 4WX2B 5FX2A 1TO2E 3DCIA 2PVPA 4M6WB 1E0JA 4HDNB 1EXNA 3E3NA 4I1YA 4LY3A 4PZYA 1G5QA 4RF2A 5ENVA 2R96A 4L6CA 4FEYA 4Q03A 3H13A 2XF2A 1D6JA 3SQMA 2WHPB 4F9TA 4YCNA 3GLSA 2HF8A 1DJLA 1RHQA 2LDXA 1CY1A 4DWWA 1X80B 2Q4TA 2OO3A 4UAUA 4HLQB 2RGXA 3OE5A 3PWKA 3T7EA 4ZCSA 4UW9A 3ZNPA 4GS5A 2ZT5A 1LI7A 3GUVA 3RSFA 5HYVA 2QU7A 4AWBA 3KZKA 5TQ2B 2CVZA 2HMWA 1NAHA 1OQAA 1V5IA 3H7AA 5CYOA 4B85A 4C01A 3KQHA 3GG2A 2HDOA 3DLCA 3FM9A 5EAIA 2YZMA 4MWCA 1L4LA 5EOVA 5EYPA 5BW6B 2GK6A 4KWHA 1ZP6A 1IJBA 2F4VB 5AI9A 5JNWA 2XQGA 4GLOA 2J4DA 3AF1A 3TW8B 4NFLA 3IRUA 5BN4B 5TMBA 5ALVA 6LDHA 1UWLA 4D97A 1C1DA 1S7GA 1VP3A 1ZCFA 3SS7X 3TB6A 4RKFA 1U2RA 1U99A 1ZONA 3LC0A 1FSPA 2QR5A 4JMPA 4LTNA 4IOJA 4RTMA 4QDZA 5JVDB 3KWLA 2CUKA 3UVEA 1ONSA 3FXAA 1YR3A 2AN3A 4JX8A 2YWDA 1CR4A 4HBZA 4TWZA 3QUAA 2H7XA 2C8LA 3PZRA 1YIDA 2Q3BA 2QRVB 5CIQA 1Z3IX 4CCYB 4Y2TA 1U28A 1H9BA 4P8RA 1K92A 1FTSA 3GRFA 4JI2B 3W8EA 4C0HA 1EBUA 1IY2A 4YB8A 3G13A 3ZHUA 1K8YB 2KHZA 2B7LA 3SS9X 2AQ8A 2R47A 1TIPA 1KOJA 3UJ8A 1ZSNA 1C7EA 1QH8B 3AW9A 1UAGA 1Y1PA 2G3YA 2XD4A 3Q2KA 3GAZA 2Q5EA 3MRXA 5DIFA 3GR6A 4ZIRA 2GD1O 3CYFA 5HCUA 3MWEA 2NXJA 3N0TA 4S2UA 5ITVA 2GDJA 3Q7PA 4Y98A 3S29A 5DHQA 2PQ6A 4GPEA 4WFJA 5F9HA 3AVVA 2B82A 4IDFA 4GEKA 3TR6A 2K7ZA 4N6OA 5DHRA 2XCRB 1PSDA 3IJEB 2CY0A 5ALQA 1G4HA 2WKRA 1WTAA 4NE2A 4JVOA 2BV3A 2I2WA 4CE6A 1OIWA 1PNOA 2A88A 4QYIA 4RHYA 4B6QA 1QH1A 2VZ8A 2XGMA 3K0FB 3RF7A 3ZI0A 1DKLA 3IDFA 1OD6A 4NESA 3ENQA 5ETJA 4ZTBA 4NCKA 3C8ZA 3ZY5A 1R15A 4WADA 3RAPR 3DUWA 1WXIA 1WQ3A 2W71A 3RYTC 1HV8A 3NETA 3BRSA 1UDRA 3PD1A 2A92A 1OKKA 1DX4A 1WVGA 1ZUHA 3JZAA 2FR8C 4JJAA 1H2ZA 3P8ZA 4Q1DA 5G0WA 3WRYA 4ZYWA 4BNIA 4YEDA 2O52A 2PM8A 4OI2A 3TSWA 3UMRA 2UZ4A 1GQQA 5E8RA 4ZDKA 3AFGA 4G26A 3IJPA 1FL9A 3FYHA 2PR2A 4IHAA 1T9DA 3RSCA 3WFZA 2YHAA 1W25A 2V45A 5FOTA 2I4TA 4FE4A 1EDBA 3RHFA 3V8RA 2FV8A 4GKAA 4PX5A 2DQYA 4UU1A 3QFRA 4YXFA 4V1CB 3JQGB 1DMSA 1MFPA 2CVOA 3JS5A 1E0SA 3DGFC 1FZQA 3UHPA 1LPSA 3KQTA 1DXQA 5AK5A 1ZVMA 1BGXT 4LV6A 3F4LA 3Q41A 1ILWA 2V58A 2ADMA 3IESA 2A9QA 3M6AA 1QDUA 2GBLC 4XIJA 1RPJA 1R6DA 3A6FA 1G2QA 2YFYA 5COAA 5TEVA 2F48A 2FW8A 3WKCA 4HY3A 2VQFB 3AIIA 1EDZA 5CFOA 1TUIA 4QDUA 2BONA 1ZH0A 2AG1A 1FMTA 3ZU3A 3ELWA 4GSKA 5FBVB 1N2IA 1OBCA 3N3BC 1Z88A 4W63A 3S3TA 1UP6A 3KYJB 4PZPA 1LBQA 1QYVA 2QUBA 4AP5A 3VOTA 5D01A 4QGHA 3QH4A 1K75A 2QD3A 4OM8A 2G76A 3BGOS 3OPMA 1S8FA 4EY7A 1XQ1A 4LYDA 1YONA 2O2EA 3IKJA 4RD4A 1JDBC 4YACA 4B71A 4OLBA 4DSTA 1PEAA 4HQ0A 2EYUA 5ALEA 5IC6A 3AF0A 4JT8A 2D1QA 4INPA 3LF2A 3LWBA 5J4LA 1NP6A 2XUIA 5JARA 1PR0A 1SUFA 1Z4PX 2WJWA 1AXGA 2A3NA 4UOZA 4JI3B 3QM1A 2IUUA 5DXFA 2EL9A 3GPDG 4INAA 4Y6LA 1GPJA 1CJVC 1LB1B 1YU9A 3VC1A 1NJ5A 2YN0A 1KEEA 4F8JA 5B53A 5C4MA 1YE5A 2GHIA 5SZJA 1RAAA 1ZZEA 1BGVA 1UBUS 3FWPA 4WOKA 3HYCA 5J23A 4N3CA 5T3UA 1C29B 2WJYA 3VHXB 9GPBA 5LQCA 1J42A 5CT8A 2YYYA 1QHEA 4URUR 4YJ3B 2BGMA 4ME6A 2GA9A 4ZVVA 1FUEA 2GCNA 3R09A 2YCLA 4BV2A 1U11A 5HIKA 2A0FA 5BWCA 3O5AA 1KEKA 3BPSA 3MGGA 3MMZA 1GYPA 2J3KA 2CLIB 2GN0A 2WIGA 4X8MA 2AI1A 5D1NA 4EBFA 5L7WA 2EKBA 3RJZA 3G2MA 2EW8A 2P40A 3NP7A 2WFLA 4ZCTA 4ZCQA 3Q88A 3G0GA 1GG9A 3AHHA 5EWMB 3U09A 3EG9A 4J6FA 4S2EA 3HB7A 3OWXA 5C8VA 5KOJA 4N01A 1W5SA 5EWJB 4ECEA 1NVFA 1KGDA 1IY8A 3RSSA 3VGJA 4LCJA 5P8WA 4RAQA 2AR7A 2UAGA 3F67A 5HQ3B 5I7UA 3AVPA 4HYQA 1DG3A 3GA7A 2P6RA 1JXOA 1ZNYA 3IAS1 1YVPA 4JXKA 3GFSA 2WPDD 3CMCO 3OZWA 4M6WA 2J0UB 3HNOA 1XA0A 3MTDA 1JL3A 4L6IA 4NI5A 4Z49A 1IPHA 5L7YA 3RUFA 2Z8XA 3GD5A 1S8AA 2WM9B 3QXXA 2A4MA 3R77A 5HE8A 1PQ4A 5AUPB 2RHLA 3AL3A 1VCMA 4RWZA 1Y3FE 3VDNB 2WHPA 4WNAA 1GADO 3VYSB 3HY4A 3I0MA 4GPBA 3EVGA 3ZK7A 5HKOA 4BRZA 1X80A 2GPBA 2XDQA 4BVEA 3HKDB 1UC4B 3LPLA 3STYA 1XTQA 3ZWWA 5D85A 1QX4A 2BFFB 1L1RA 3I2FA 3UMFA 3A3PA 3ZCSA 5IJZA 3E5NA 4H7KA 1NRWA 4KO4S 2OBMA 4LS3A 5TQ2A 4B4OA 4BFLA 2Z6VA 4PR0A 5HX7A 3E7WA 1DQPA 4ZT6A 4TYMA 5IJWA 4EH1A 2Y1WA 2QP9X 4FINA 4PC7A 3HM2A 2OMKA 3N53A 5BN4A 2IZZA 1QIHA 1IOVA 4QOFA 2O7QA 1UXIA 5AM0A 2PTHA 5CTAA 4LXYA 2WB4A 1ZD9A 1CIVA 3FGZA 1BE8A 1ID1A 4JSRA 4ZODA 4ZK2A 5JVDA 1EFAA 3IPCA 1SU6A 2FUKA 4W9NA 4FJ1A 2QLTA 4JLDA 4CG1A 1LPPA 2F00A 5WRFA 2JJ2A 2D5AA 4QL3A 1RR6A 2MSCB 2QRVA 3I30X 4UUMA 2XVZA 2WWWA 3ZJYA 1KXJA 3CSUA 1EFVB 1JYSA 4KSBA 4CCYA 3ZD6A 2ZR0A 1R8YA 2PZMA 4OB6A 4RY0A 4CQJA 1F48A 1KDTA 4EHFA 2VPYA 3LT5A 3NEAA 5CDSA 2V9PA 2XB6A 5E1OA 4B3JA 3T3IA 3PZBA 4R7ZA 4G1CA 3S8YA 5J2TB 1QH8A 3G0IA 2Q1TA 5A4JA 3TIIA 5GM1A 5FUBA 4QO7A 1SG9A 2G70A 5LZ8A 3MCAA 5IF3A 5DT2A 4IHQA 1XPUA 2W90A 4JK3A 3WQSB 4EPXA 3O03A 3KQMA 2H5EA 3FAZA 1Y48E 2JJ2D 1VGRA 2ZAMA 3EHEA 4U6NA 2ZUTA 4DEXA 1EGMB 2I5PO 4ZVRA 2HCRA 4LBYA 1AHHA 1DZ3A 3KUKA 5T57A 1B73A 2GVZC 4KV9A 3TQFA 1U0GA 2ET6A 4UUOA 1QK5A 2HR1A 5IAGA 4B40A 1SIBE 4D9EA 3PQ5A 2NXWA 3FNIA 4TMWA 2IUFA 3ZVLA 3K0FA 2I22A 2GH1A 4P3OA 1U98A 3KPVA 3OC6A 4M1OA 3MQFA 3AM3A 4OGLA 5DU2A 2D0IA 2WPNA 5DWVA 3RB8A 5F21A 4YQEA 1E2LA 3CISA 4RNDB 4BB9A 1U8CB 3QNWA 4H0CA 3NBAA 4DLTA 2RGDA 3KE9A 3SHQA 4YCDA 4A26A 5BYKA 2PGXA 1JU9A 3C5VA 1SCQA 1A3CA 1XK7A 3RPEA 3WK5A 1R10A 4OLHA 5A1JA 5TJ9A 3ZGXA 5LQDA 1JDUA 1S4MA 2XNDA 4DIKA 1NVEA 4P6VF 4V1CA 2JIQA 4KO8A 4H31A 1W85A 4Q39A 1T2NA 3JQGA 1GPDG 2R6DA 4MEAA 4EGJA 3F4KA 5COQA 4KU4A 1NV8A 3OH8A 1Q11A 1K08A 1B26A 2C59A 1U1CA 1OJ7A 2WP0A 3OO0A 4K9OA 3G89A 2ZRJA 2GN6A 1I6MA 3CM0A 1I01A 3MJSA 3KOMA 3K0EA 5HCIA 5TQJA 1GQOA 3TPFA 5FTWA 1TYZA 1T36A 4MV0A 1H0HA 1XIVA 2R8ZA 4ZOQI 4KODA 3PQ3A 4KLZA 3CSSA 5JAZA 3A1DA 1Q3TA 1ZCBA 1LNZA 2CGEA 3IQIX 3HXKA 4JOQA 2XXJA 4X66B 1CULC 1ZGZA 2ZE5A 1FNMA 5DBHX 1GL3A 5G1PA 3TJRA 1XRLA 2KX7A 3WLSA 4XPZA 4DPLA 4B6SA 4IFBA 2XB2A 1GTJ1 2IZ7A 4PYKA 2YN4A 4ABYA 4MO2A 4W8OA 3MUNA 2XT9A 1SWVA 4IIVA 1KNQA 4B6GA 3A31A 4HQKA 3TW4A 4YV1A 2WG1A 2N9UA 4MQMA 3C3AA 4WZBB 2BGJA 3RLIA 2B7CA 2QD5A 3I52A 1LNQA 2BHSA 3KBBA 3NWJA 2ZRQA 1ZU5A 4MYDA 1NU6A 1ZG3A 5EHNA 4KWEA 5K4AA 3PCTA 5ALRA 4OSEA 3VSAA 4CKBB 4F97A 5EKSA 5LOVF 5FTNA 1GSHA 1H3FA 1XXLA 1ICEA 3KYCB 4YUZA 3A9TA 1DKRA 2GUGA 1FFDA 1XZLA 2RGYA 3UZUA 2Y0EA 4LYGA 4YJ3A 1B00A 5I51A 3OFJA 1KAHA 2N1MA 4E15A 4DXAA 2XEXA 4KX5A 1N5DA 2NPFA 5CCEA 3VJLA 2PKCA 1HMPA 3QLEA 3Q85A 3HBNA 3K6SB 1G3MA 1Z6AA 4KQ6A 4W1QA 5KPJA 2JI8A 1OXSC 2M98A 3OCZA 4C0WA 1O54A 1IL0A 3CB4A 1WWKA 3DLPX 3QPCA 4NBSA 5L53A 5EWMA 2VCYA 4G9BA 4EITA 2F4NA 4OHXA 5KYWB 3AI1A 1DEOA 1KKMA 4LIPD 4PQYA 5EWJA 2PX3A 2HXGA 2R8YA 3FYDA 4ZU3A 3NH9A 1I7DA 4NZNA 1S2DA 3WBFA 1CUSA 2GEDA 4F06A 5HQ3A 5T67A 4U00A 3I6ZA 1GCGA 1W4BA 1LTQA 3FETA 3KOWA 1H42A 3B60A 4ZVLA 3L93A 5TXGA 2HQRA 5ED0A 3HDGA 1LUAA 2CVHA 1P0IA 2J0UA 1UDWA 4G0NA 4GZLA 3T4EA 3ZR4B 2AH5A 4LOKA 1V3QE 3V80A 1PQUA 1JT2A 2PHZA 1O94C 3DLTA 3T1YB 4F85A 4J2OA 3BE4A 1A96A 3MD0A 3W9SA 3HKDA 2REBA 1IBRA 3CF6R 3M7IA 4B3XA 1W96A 1Y5MA 2BFFA 1U94A 4W7SA 1FFYA 4ZOAA 3I5YA 4I3HA 3U61B 1YDHA 4KLAA 4UD2A 1UIRA 4JGBA 1S3FA 4CVNA 5IC4A 3QRWA 5K0ZA 4RENA 3KQPA 5BMVF 4Y2GA 3GFQA 5J2UB 3FWKA 1FTWA 3IEIA 1DKMA 4Y2SA 3RAFC 1J0BA 4ZZ3A 2NNWB 1B7GO 4G23A 4M9RA 4ZO7A 2GPJA 4KQWA 2DR3A 1OYWA 4OA5A 3GT4A 2CXUA 5DBEX 5DTIA 3SJUA 3OX3A 4TXJA 4UASA 4BP8A 5CFMA 5LU9A 1Z2EA 4MZDA 3AVXA 3F7OA 4URXR 3NJRA 1M6EX 2WE8A 4MS1B 4IIXA 2QTMA 4R2XA 3I09A 4R0VA 2WHYA 4V0ME 1ZK3A 2GAAA 1EFKA 1YA6A 2L18A 1EFVA 1IN7A 4JASB 1KPIA 4EAQA 3OJ0A 1UINA 3GJ4A 3E8SA 1SUPA 1CX9B 3MVEA 1FQKA 4LDQA 2JCSA 2BOVA 2WF8A 4MUFA 3AI7A 2JPDA 3KUDA 2BGTA 1YB7A 2OUIA 2IIVA 4XUEA 4WBNB 2PRZA 1H2YA 3A2MA 3PDWA 1F2UA 1GJRA 4ZAZA 1SBZA 3EEQA 5AW8A 3INGA 2A9PA 2BDUA 4CMGA 5CFQA 1QCCA 3K5WA 2E21A 1BJRE 4TRNA 4YUAA 2HMVA 1RKQA 2ZRCA 3K05A 4RZ3A 3D8NA 3IAFA 5T8KA 3VNVA 2GBGA 1JSXA 1DTWB 2QTRA 1V37A 4IJWA 4BQEA 4TX1A 1OV6A 3IA7A 3IUMA 3OQPA 4LC1A 1G9SA 1NM5C 5DM1A 1M1UA 5A1TA 2NP7A 1JBQA 2VYQA 4XWKA 3N87A 4XSHA 1NW5A 2EJBA 4UAGA 3G2NA 5GZ3A 4HAIA 3QJGA 1YB1A 3JVIA 3IJRA 1BCRB 2FCRA 1XWIA 2Q5IA 1QP8A 3DKRA 2MIIA 3FROA 2XUJA 3GGDA 3GLRA 2FX2A 5EMNA 3BQMB 3SSNA 3NHUA 3BE6A 3PHGA 2PYIA 4R3WA 4UJ3A 5ENDA 1ULAA 3HFJA 5FA6A 4RK7A 1IZZA 5DGXA 2E7ZA 4KRFA 5JNTA 2PMDA 3Q6IA 1KORA 2HBRA 4YPFA 3FSEA 1GCAA 5IZCA 4YLGA 1Q92A 4W6ZA 4TVSA 2X4GA 3O8QB 3K09C 4X8HA 4PRYA 5JJKA 2W0MA 2YIDA 4LZLA 2OZVA 3D6HA 2VHCA 3I1IA 3OT1B 3RM3A 3UJ6A 4YT5A 2QOEA 3H83A 1G7CA 3BH7A 3OQVA 4UCQA 3NHZA 4ISBA 1CY8A 1U8XX 4BZXA 1KYXA 3H8SA 4PINA 3U1BA 1XJQA 3O4IA 4Z4FA 4QGGA 4XGKA 1CS0A 5CK4A 4GE0A 2NTYC 2CJWB 3TZQA 1ZMOA 2QZ9A 4OQMA 5IAEA 4EP1A 1XNGA 2COKA 2XGSA 3KQOA 1NR1A 3NBZC 1K3FA 2RHMA 1K0UA 1T0HB 2E0IA 2EX1A 3A6DA 5FO1A 3GQVA 3OZBA 3W3AH 2AXEA 3JAKA 1Z6QA 4YRQA 3LUBA 3RJ9A 4RO0A 3F5QA 2FA9A 3HSKA 3AIMA 5UKDA 4J1TC 2IYWA 4FKZA 3V7NA 1BC5A 1R8QA 1KI9A 1XVTA 2J5RA 3N5CA 4H3SA 1W4ZA 1D4ZA 3E8MA 5HDBB 2LGJA 3BTUA 5KWEA 1YCGA 1G19A 1JEQB 1H8HD 2KLHA 3F9IA 3NHFA 4JBHA 5T6MA 3UUGA 1XJ5A 3DBOB 3KZNA 1PL8A 4CM4B 1FJ2A 4KWCA 4Y3UA 3ZOZA 3MWKA 4G4GA 4DC0A 1E9EA 1U7PA 4GL4A 5AH0A 2E6KA 4TWIA 3KXLA 3DVRX 3K92A 4OK6A 4WZBA 4UTRA 2B8TA 4O2LA 3AZPA 4TYYA 5C1IA 1XTUA 1SUCA 2BH2A 2Q99A 1DRUA 1NVWQ 1EFLA 3N28A 1UAYA 4LVCA 3FPAA 4O5OA 4RLSA 4WESB 1INLA 2H4ZA 4CKBA 4GDFA 4D3YA 1K06A 3NIDB 4K9SA 4YCAA 3KYCA 1RADA 4OJKA 4Q82A 2JANA 1KO1A 4A92A 2H5IA 1R4NB 2Z3WA 5L4LA 1E1CB 1WKBA 1KO8A 3KKLA 3GHHA 4RHTA 5IMSA 2V6JA 3GEGA 2PQ2A 3EISA 4R81A 1K8RA 3DFIA 2A9JA 3ZHOA 5FPKA 4KREA 3V8PA 3ESDA 3IIEA 3A58B 3K6SA 1OIXA 3V55A 4UHJA 1IRIA 2ZBQA 5AJWA 1AGYA 4KAJA 4MPDA 4UPVA 5LU8A 3B82A 2BLNA 4W99A 4ZTZB 4IIGA 2GDZA 1SJ9A 1FTGA 4B6FA 5KVCA 3PDUA 4YQYA 3OOWA 1E92A 2J9FB 1VPTA 1ZK2A 2ALJA 2EFGA 5BPFA 5PNTA 1X77A 2YFQA 2F3UA 4UU7A 2VZEA 5HKKD 3AHIA 1C1HA 1AZLA 1DO2A 3OHPA 4C4YA 2GCOB 3LLVA 4JLSA 4DY4A 4GEGA 3O90A 1NXTA 1E2PA 1NQ5A 1SAYA 1SUDA 1JKXA 1WBBA 3ROTA 3GEPA 5DGDA 1I1OA 2QG6A 3QNUA 1ODTC 1GTMA 1T10A 1QCDA 4PHTA 5DGIA 3LDHA 1PWHA 2O57A 3REGA 2OV8A 4BVKA 2CLDX 5K0LA 1BWRA 4MV3A 1FCJA 3BGSA 2C92A 3PC7A 4FGLA 1JDSA 5FUWA 4ID3A 1LF5A 3GEEA 1OREA 3JWJA 3R5KA 3WKBA 4A10A 4ZDIA 1QG4A 1QV9A 4WNIA 1H94A 2V9ZA 2GPTA 2CVFA 3CZRA 1TQ8A 4JUFA 2POCA 4KQIA 4M49A 1Q1QA 2ZR9A 4BNJA 1ORRA 2P1RA 3GU3A 4MRNA 4QA9A 2AXQA 2QWXA 2BM8A 1MJFA 4H3VA 5BN1A 2VT7A 1J97A 3HR8A 1SEPA 3Q9LA 2ZSHA 3CF2A 4TGLA 4X62B 4W5QA 3PTAA 2O8EA 3LYHA 3EMVA 1HFJA 2HZ7A 2RJ3A 3QW4B 3SX2A 2D2EA 4ZJUA 4IF4A 4JMLA 4DADA 4BX0A 2C00A 1JQKA 3I2KA 4CXMA 2DBYA 1ZOLA 3LO8A 3VYTB 1C3LA 2IOFK 5DWDA 5LN1A 5HJ5A 2PIDA 2ZGVA 3FI0A 3B6EA 4AJOA 1EH5A 1JH9A 2ZBDA 2LUOA 4AXBA 1X9HA 2YHSA 4MS1A 4A73A 1T0UA 1WDLA 4XLLA 2W2PA 4NBRA 2JJ8A 5GZ6A 1USUA 4TQGA 1XA4A 2GPYA 1DAEA 2J09A 3DMTC 1XMVA 5AI0A 1KI6B 5HM6A 5EIEA 5LDDC 4IZ6A 5AW2A 1XZJA 1W87A 3QU2A 4WK6A 5FEMA 4ER5A 3OQMA 4FHGA 5A4KA 2G88A 1FUKA 3HL0A 3AM4A 3B13B 4WBNA 1OBHA 3TN7A 5DV9A 2DTDA 1UJ2A 2BKXA 4DUGD 4Q9DA 5ICGA 3E15A 4Q1EA 4JL6A 2QAJA 2DHDA 5J63A 3A32A 3VYVA 1AK1A 5I5GA 4DM7A 5FPHA 4DDVA 3R3HA 4LHVA 3KJHA 3I6QA 5JZVA 4Q34A 3QKRA 2WIAA 3WGGA 2ORWA 5TF0A 1WW3A 2O14A 2ATVA 3DHWC 1DTWA 4G5GA 5FORA 1G4UR 1Q1NA 2IHZA 1WXDA 3OD5A 5EC8A 3DL4A 3DZGA 5HF6A 3S5JA 3QF7A 4YP0A 1KH2A 2WFMA 3M9XA 3KJGA 2G71A 3WK9A 2HWXA 4C14A 2W8ZA 3GCXA 4GXNA 4Q9JA 3U6KA 4IV5A 3R5HA 1CUUA 4HWOA 1BCRA 3C5CA 4DG8A 3M1AA 1V3TA 4IO0A 2ILTA 4MO9A 1CJSA 4US1R 4ZVQA 4CMIB 3DOIA 3WKEA 2FSGA 3A2NA 3DQPA 3G6KA 5DVZA 4DJTA 1XWFA 3I9OA 4F3TA 2IYUA 2J31A 4Y9DA 2PUGA 3A1NA 3Q10A 4V03A 1GL6A 4YAEA 2ZT7A 3HJGA 1AKYA 3OU6A 3FD8A 2VQSA 2AX3A 3FGOA 3BCSA 2VSNA 2DEUA 1Y7TA 4R7GA 2AG0A 3K9NA 2J5KA 3PK0A 5LR6A 1C3OB 4W1PA 3ZK9A 3O8QA 3S6JA 4Y2HA 3NB0A 5BSFA 3UHJA 1KTIA 2GHTA 4MVJE 1H2WA 5KAMA 4DNFA 4MWZA 3OT1A 4PTYA 3FNEA 4UBOA 5DDIP 5FR1A 3D3EA 2I9KA 1N7IA 1VPLA 4PSKA 3ETNA 2AHOA 3OZEA 2FUEA 5LIPA 4KR9A 2WWVD 3RROA 3D6TB 5ALWA 2IA5A 3TOCA 4WDRA 5HKAA 2EDAA 3IAAA 4Y9SA 3DP9A 3TDNA 4M0EA 2I54A 4MMZB 3V4LA 5EXSA 1PGPA 3NTXA 4PLFA 4NFYA 4AMUA 4X94A 1JJVA 2CJWA 4PZ0A 3AP3A 3D7SA 3NYRA 1KDOA 1NKTA 3M4JA 3V8VA 3HUFA 5E0KB 2D7DA 1G38A 1VYHA 3QXJA 4JJEA 3VHQA 3SC2A 1WBDA 3M6LA 2EERA 2UYOA 1DG1G 2V7TA 2WLTA 4YDHB 4Q7EA 2JS7A 5D2CA 1E6MA 1Z29A 4MI6A 5B6PA 2WF5A 1J09A 1NHGA 2RONA 3O0DA 4UVDA 2D1TA 3BFKA 5F7XA 4GWKA 5KCMA 1JEQA 5B2FA 3VR0A 3S8MA 2QZ4A 1BXGB 1KP9A 1P8JA 3U3RA 4CM4A 3FJOA 5BWLA 2YC2C 1NNUA 4AN1A 2XRZA 2AQHA 3L6DA 1HFWA 3DDHA 4B8ZA 1KY4A 4G6ZA 2KS6A 3GFBA 1XHLA 1OI4A 3MWFA 4NMLA 4XVHA 3FFTA 1U1IA 3X1MA 2DCMA 4G5RA 4TKMA 1Y9DA