3D1VA

Crystal structure of human pnp complexed with 2-mercapto(3h) quinazolinone
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
288
Chain Sequence
ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
publication title Structural studies of human purine nucleoside phosphorylase: towards a new specific empirical scoring function
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d1vA00
4TXNA 4PNPA 5CYGA 1V41E 3E0QA 4NSNA 4WKBA 1OTXA 1LX7A 4QARA 5B7QA 3OF3A 1Z36A 4OJTA 5DK6A 1B8NA 5F7XA 1T8YA 5F77A 1U1CA 5F73A 1PK7A 4GKAA 3KUKA 3OPVA 3UAVA 1K9SA 3MB8A 4YJKA 1K3FA 4LKRA 1A69A 1V4NA 1K27A 5ETJA 1TGYA 4L5AA 5B7NA 1NW4A 3P0EA 4YNBA 4DA7A 3KU4A 4NS1A 3UAXA 1A9QA 1XE3A 1PW7A 4F2WA 4L5YA 3GB9A 1ZL2A 3K8QA 3SCZA 2OXFA 3OCCA 1ULAA 1JE1A 1B8OA 5F76A 2HRDA 4JWTA 1A9SA 3D1VA 2A0YA 5EUBA 1ULBA 4OGLA 4DA0A 5K1ZA 3NM5A 3FAZA 2ISCA 4TTIA 1CG6A 3KHSA 2QDKA 3EMVA 3UAWA 4GLFA 3QPBA 3FB1A 1RXCA 5B7PA 2HWUA 1NC1A 1Y1QA 2IQ5A 4X24A 3ONVA 1T0UA 5CCEA 3MMSA 3DF9A 1NC3A 4EARA 3UAYA 4OF4A 4D98A 4QAQA 3ENZA 5CXQA 3IEXA 3O4VA 3DPSA 1JDVA 4LNHA 4R31A 1SD1A 1YQQA 1JDTA 1JPVA 2OC4A 1RT9A 1Q1GA 4LZWA 2A8YA 1Y1TA 1RYZA 3LA8A 1OTYA 3C74A 1ECPA 1Y1SA 4IP0A 1YR3A 5F7ZA 1ODKA 3LBAA 4QFBA 4M3NA 1Y6RA 5F78A 5F7JA 4I2VA 4DAEA 4WKPA 2AI2A 4BN0A 1JDUA 5JPCA 1YBFA 2HN9A 2I8AA 1ZOSA 1JDSA 1CB0A 1QE5A 4DA8A 1WTAA 2HSWA 1PR2A 1Y1RA 1SJ9A 2Q7OE 4D8XA 3OZCA 4MCHA 1T8SA 4TXLA 4LDNA 2AI1A 2A0XA 1VHWA 3BL6A 1PF7E 5FAKA 4D9HA 1V45E 2QSUA 2AI3A 4YO8A 3IOMA 1T8WA 1A9TA 5C80A 1I80A 3O6VA 3OZDA 1Z39A 1T8RA 4WKCA 2AC7A 3NBQA 2A0WA 3OZBA 4QASA 1TGVA 1SD2A 1PK9A 1ODLA 3E9ZA 4WKNA 1PR1A 1OV6A 4OEHA 3PNPA 1RXYA 4TTJA 1LV8A 3PHCA 1JP7A 4WKOA 1TCUA 4TXMA 3GGSA 4E1VA 4BMZA 4U2KA 4M7WA 4JP5A 4KN5A 4G41A 1VFNA 4DAOA 2B94A 4D8YA 4F2PA 2QPLA 3LGSA 3INYA 1U1GA 3BSFA 3BGSA 1PR4A 1Z5NA 3OOEA 3NM6B 3EUFA 2OC9A 4MARA 4QATA 4YMLA 5KB3A 4OY3A 4L0MA 3P0FA 4L5CA 1LVUA 5F7OA 5CXSA 1A9RA 1PR0A 1RCTE 1OU4A 4F3KA 4D8VA 3T94A 2PGAA 4QEZA 1YRYE 1Z35A 1VHJA 4BMXA 1JDZA 1U1FA 5IFKA 2P4SA 3OZEA 5CCDA 1RSZA 4FFSA 1PWYE 4GMHA 4ECEA 3KVVA 2QTGA 1OVGA 3PHBE 1Z38A 1G2OA 2GUWA 3E9RA 4TTAA 3U40A 1N3IA 1RR6A 1A9PA 1PKEA 1FXUA 3FUCA 1TD1A 2RJ3A 4F1WA 4BMYA 1A9OA 4K6OA 1Y6QA 2XRFA 4R2WA 1PR5A 4G89A 1V2HE 3KVRA 3UAZA 3DP9A 1PBNA 1OUMA 3DDOA 5I3CA 3DJFA 2OECA 4OGKA 3TL6A 3KVYA 4TS3A 2I4TA 5IU6A 4EB8A 5CYFA 3FOWA 4TXJA 1Z5OA 2H8GA 1M73E 1ODJA 4TXHA 4DANA 1Z34A 4TS9A 3FNQA 3OOHA 3UT6A 4L6IA 4TYMA 1U1EA 1RXUA 1Z33A 4H1TA 1SQ6A 3FWPA 1RXSA 4R2XA 3PNSA 4DA6A 3EUEA 1TCVA 4NY1A 4GLJA 4DABA 4JOSA 4DARA 1ODIA 3NM4A 4UC0A 3K8OE 5B7GA 4PR3A 1Z5PA 4P54A 1C3XA 2QTTA 4MCIA 1PR6A 5EPUA 1Z37A 1JYSA 1V48A 1V3QE 4F3CA 3BJEA 3ODGA 5EFOA 3F8WA 2ON6A 3EEIA 1YQUA 1VMKA 1RFGE 4LNAA 1JE0A 4G8JA 2BSXA 4M1EA 1U1DA 4RJ2A
chains in the Genus database with same CATH superfamily
4P3PA 4Y2XA 2B7BA 5FULA 4W5QA 1LPPA 3EODA 4G0PA 3IAEA 1UBHS 4IDHA 1OA0A 2HWKA 2B4AA 3EVEA 2Q6LA 1QH8A 2PQ0A 1T3LA 2FLVA 1SOAA 1FZTA 1F8UA 2FGKA 2GCOB 4MV5A 2JEYA 2GF2A 1C7ZA 2YASA 4HTFB 4FKBA 4QX6A 2H48A 2WIGA 3NBZC 4G65A 4Y2SA 3ZV5A 4BGUA 4ISCA 5F7XA 4ZODA 1T8YA 1K6EA 1RQLA 4QPPA 2NO1A 4ZIRB 3M9XA 4YRIA 1AB5A 3F0TA 1POXA 4JVMA 3MLEA 1PK7A 3E0XA 1PJCA 2XB2A 4PG7A 4EATA 2HA0A 4AUNA 4JHXA 3SJZA 5E7IA 3NJRA 3L6CA 4M1KA 5KVAA 4G36A 4TV8A 2FMUA 5FT9A 3TFWA 1ADJA 5CFOA 2ZAGA 2SKCA 1OFGA 3UBMA 4W82A 3W2EA 5EXEA 5B2FA 3C48A 4DB2A 4M0UA 3RTDA 1R0WA 1T15A 1T9KA 4NC9A 1A69A 1P7ZA 1WO8A 3H16A 1EIZA 2QI9C 2BI7A 2VOJA 3USZA 2R8EA 1DCKA 4AJ4A 1E1QA 3LDAA 3AW9A 1WKVA 3NIDB 2WIJA 3GU3A 5FI0B 3FNGA 1U0SY 821PA 5JD6A 4ARZA 2Q4OA 1PSDA 5AICA 2QTCA 4P7KA 4QUBA 2RG1A 1MGOA 4D6PA 1EUYA 4HWGA 1N3YA 4OMDA 3R23A 5K8LA 4QTZA 2X8JA 3KYIB 4D81A 4CNBA 4DLXA 1GGMA 5FQOA 4RF2A 1B4DA 2WTXA 3RANA 4YFYA 3GB9A 3RR2A 4W8GA 1X2EA 2P69A 3K9NA 3L1VA 3UJ9A 2BM0A 2IYTA 1GNTA 4TMYA 5AVVA 1OW3B 4DVJA 1OWOA 4C14A 4C08A 5LNK6 3HY6A 2XUIA 4Z51A 4EG5A 1GL9B 3RUCA 1EHCA 4PZUA 1XTTA 3DQPA 1BU5A 3H9EO 4PHGA 1YCFA 4OI2A 2NZUG 4RYLA 5EZYF 1L5HA 1M7GA 4DLKA 1D7AA 2O2YA 3OQNA 4RESA 2D2VA 2ERXA 1K6JA 4FMDF 4NYMQ 4BLWA 4Y6OA 1OF1A 5TR9A 4JWTA 2DGDA 1O6FA 3VC7A 1W49A 1X1DA 2RMKA 1QG4A 4TUYB 4NZYA 1W46A 2JIRA 3FJ1A 5EUBA 4LOJA 2FLWA 2HT6A 4GGOA 2IIBA 3PGLA 1ZJ5A 3IBFA 2C2OA 3O3NB 3IT0A 2ZUUA 2P6UA 1NUHA 2YFQA 2WHEA 4HTFA 4INPA 4BJ5A 1WF3A 3NC4A 3CRZA 5EVJA 4BLUA 2VSQA 4XJXA 4MITA 4BUJA 1O4VA 1H85A 2W2VA 3QLVA 4JEMA 3Q41A 2XCQA 3U62A 5KNDH 1GKKA 4ZIRA 3NT2A 2FUG1 1Y1QA 5JFTA 1Z7GA 4K0KB 4HFMA 5CVJA 3PPWA 3P2OA 5CCEA 1PDWA 1YR1A 2YVUA 2YY6A 2ZSBA 3NANA 1RVDA 1ZVKA 2PTHA 2CNKA 3C5VA 3MSXA 1P18A 2JLUA 4R2MA 5JWOA 2COKA 4LJKA 5C8XA 3ND7A 1K5PA 2GJKA 3NP7A 4JLNA 3WP1B 3RAJA 1GTMA 1W9HA 2XWQA 1RAHA 4EP1A 1QPZA 4I08A 5T64A 2OUKA 3V1NA 5LZ7A 2YOGA 5T3YA 4QL3A 3O4VA 4BGDA 3RNLA 1EDBA 4XR4A 4W7HA 5JMTA 5EHNA 4B82A 4RETA 5DTIA 1EDOA 4MPTA 3M3DA 3TSZA 2ZJBA 4ZQFA 2XUGA 1X7WB 1JDTA 5E1MA 5HILA 2JFVA 1KDOA 1O6BA 4ZPXA 2BUBA 3V1KA 5IYZB 3PKZA 4R3NA 4CM5A 1PNQA 3ZHVA 1M2OB 2X0JA 3F4BA 4J7UA 3SX4A 1HSOA 1AGXA 3LA8A 1U28C 4MLPA 1BDBA 1ZDMA 4Y2QA 5A9SA 5EL0A 1IEQA 5K51A 1OTYA 1VYHA 2IJGX 2W2OA 1LU9A 2IX3A 3ADCA 3Q8MA 3GJ0A 1HUQA 2I6SA 4RQTA 4YQYA 3RRZA 2UAGA 5LIRA 1HTBA 1ECPA 3I2FA 4H3VA 5F7ZA 1I8TA 1YR3A 3LA6A 5DLPA 1Y34E 4JL8A 4TMVA 2PIAA 3DULA 5BV0A 5JVDF 3G0DA 3S55A 4I6GA 2JLAA 3RUDA 3NORA 4RE6A 2OUIA 4TUYA 4P4TA 2EWVA 3L9WA 4DCSA 3OF2A 4GHWA 5DYWA 3RODA 5HTOA 1QNLA 2YV2A 1L5SA 4NDAA 5CB6A 3FWHA 1GZUA 1I6LA 3KUUA 5CVEA 3RASA 3LL7A 2C7BA 2VHYA 4XLZA 2Q3LA 3MBIA 2E18A 1DIHA 3I05A 3ESQA 3QU2A 5D85A 5H3HA 2H2AA 4QLAA 1O8BA 2WUWE 2JGNA 1AGPA 5TMEA 2RHHA 4TVSA 2ZI4A 1WX1A 2WJIA 5BVGB 4CKYA 2R8ZA 2JLYA 1DQZA 1XRMA 3AFIA 3IERA 3N70A 1N8KA 3G2OA 3EGDB 1OHHD 2P27A 3H86A 4XQEA 1A8PA 1E4VA 1V7PC 2ZAMA 3QYAA 2FPLA 4NV1A 4RFSA 3LKVA 5A02A 1XXHB 1R4NB 1R9GA 3SC6A 2PMWB 1PR2A 3G2NA 1T9GS 5ALGA 5AUPB 1RWWA 1A8IA 1P9WA 1H4QA 5JADA 2AHRA 1M6YA 4YUAA 1XZLA 4EFDA 5EA2A 3ZGYA 3OZCA 2H06A 3QUSA 4NAHA 3LK6A 1RYMA 4GOLD 2W2KB 4IMRA 1XZGA 4YGXB 3SXUB 1WZEA 3AY6A 4KWCA 3G0OA 3WRXA 5CFLA 1DKOA 2G36A 1TT5B 4AQDA 5GIOE 1ZYUA 2AI1A 1TA0A 2QVYX 3GIDA 3K6RA 1PF7E 4NESA 4KQWA 3ZDYB 1X7WA 5CK5A 5DM2A 5IJAA 1FDRA 1L4BA 3E18A 4Q00A 1M0EA 1VHTA 1SQSA 2I1VB 2OHJA 4IOJA 3G2LA 2HPHA 4XWOA 1E6WA 4MGEA 2C5EA 1B8PA 3KXIA 3ESXA 1NNLA 1YS2X 3DD5A 1J70A 3GRAA 1W36B 4IWYA 5EP3A 2B1RA 2HRQA 1XFAA 2UZ3A 4RTSA 2PS1A 4JYCA 2G07A 2GBPA 3L79A 1L3BA 3K5HA 3ROXA 3RUEA 5BT9A 4YFVA 1TZJA 5EUQB 4YIKA 2AC4A 1AH2A 3ESAA 3T6KA 3W2GA 3R1IA 2CCGA 3QSYA 1FS6A 2I54A 4WFQA 5C9ZA 4MUHA 3GL9A 3B1VA 1DXQA 2DFTA 3GOHA 4Z2YA 1VE1A 2PTGA 5CEFA 3WIDA 3ZH9B 5EIEA 121PA 1CZRA 5F2EA 1I6KA 1E7RA 1OROA 4HDAA 4NDZA 3U7QA 3OE7D 2WSIA 3UVEA 4EYOA 3PGXA 4AS3A 4QSMA 1J5EB 2X4IA 1SBTA 3OEED 1IBMB 1IJBA 1ZONA 1P44A 2COUA 4FHEA 3V6LA 5J2UA 3DW1X 3OD5A 2AX4A 1ZXLA 1AUXA 2PJDA 4EJ2A 3M4JA 1KI7A 2YNMD 4U5QA 5KYUB 1BVUA 1W7AA 3A7EA 1PEAA 4GX2A 3E1KA 1WWKA 3EGDA 1I7NA 3GARA 1VFNA 2YMQA 4F2PA 1XXHA 1OI2A 2QZJA 4HSGA 4KQFA 3KZCA 4WXYB 3GPDG 1UFVA 4K1LA 2YCLA 2E4UA 2FHPA 2I4NA 1EFVB 2I2WA 4ZAXA 3JQBA 1SMKA 1ENYA 3CURA 3Q8XB 2E37A 4EHAA 3D2LA 1U94A 2OCDA 2VTKA 3TDNA 2NUAA 2HKIA 2OFPA 2RHMA 2IEAA 4XGNA 5H4GA 1GY8A 3TR0A 3R9WA 1BW9B 1QOQB 3SXUA 1ZWLA 2FPIB 2CB9A 3OU2A 3NM6B 2PFKA 3EIFA 5K6AC 1O96B 4AY2A 2PWZA 2PA3A 5LD2B 3JRNA 1U31A 1P5ZB 4LC1A 1F8GA 1W0CA 5C8YB 3O1LA 1K68A 1EEXB 1I7PA 3V4PB 3QIVA 2CZQA 3U7IA 2IU4A 1RD4A 1N1EA 1CF9A 1VDMA 4OV6B 4JVOA 5TGTA 4E2YA 2I80A 3NHPA 3CZ9A 3NBAA 1YUBA 1L7PA 1IYZA 1JEEA 4MVJP 4JLUA 4J2OA 1GR0A 4PFJA 5T4HA 4OJNA 4HDQB 4AJNA 1E32A 3QVJA 1U0RA 3WWCA 4CQLB 1LBSA 1MENA 2BGMA 5IKXA 3MA0A 5MN6A 4RSRA 2CJWB 4O2AB 5AJUA 5DE3A 1NW8A 3F97A 2J85A 2PWPA 4QGHA 3ZK9A 5J2TA 2DB3A 3AY0A 1IQ0A 1NYLA 2IBTA 4AMBA 4II3A 1OX5A 2P91A 1OWNA 1VSVA 2A1UA 3JQGA 5AK0A 1IZ8A 1PFGA 3PB3A 4WNYA 5FL7D 2G76A 3UFBA 2ZQ5A 1JT9A 2IIQA 2X13A 3UTCA 5JATA 2F6RA 4HEJA 1JDZA 4O08A 3KJZA 4EGSA 1M34A 3S1LA 3OOJA 4EG0A 5KHLB 2YWHA 2OV3A 3V8BA 1GVNB 3CN7A 2FW1A 4OK5A 3MS2A 1X1CA 2ETXA 1ZMBA 3OY2A 4KIWA 4CT5A 3MTBA 3VUFA 3WLAA 1XRJA 4PO9A 2IYUA 1VJDA 3MWEB 1YB2A 2G8NA 5CFZA 3B8EA 2W2LA 4GPBA 3ZTWA 1UZUA 4IHQA 5JTUA 1YDEA 5IHPA 1XVAA 4IDPA 1I10A 1LDNA 5L51A 3BXOA 3FDIA 4KO8A 4O3FA 2WHXA 1CY8A 4QTUB 4X1YA 4ZVNA 3EOZA 3L7OA 1BXGB 1V9SA 5TIIA 1Y8ZA 1AK1A 1GNQA 3HN6A 2GNOA 1PKEA 3M81A 1FXUA 3PHIA 2OT3B 3R7SA 3VO9A 4BO3A 4EGQA 3GGDA 4F1WA 3UWOA 1F6BA 2ZLBA 5EJ4A 1C0IA 1G20E 1C81A 1G5RA 2DRIA 3TOSA 4P93A 4K6OA 4WUVA 3G9TA 4UHBA 4OH7A 3KB1A 3LLCA 2Y1LA 4YASA 2X3FA 4DBLC 2FPIA 2DSNA 3DP9A 2OCLA 3CIOA 3F46A 3ICVA 1ZRSA 1PBNA 2N0SA 3DCJA 5CVCA 3L4KA 4XIJA 1ZNXA 3V3KA 3DBRA 3QPWA 3BSYA 1XN1A 4EGFA 2HHCA 1DEOA 1F17A 4IMPA 2PRIA 2HJVA 5EJIA 5SICE 5HQ3B 2MYNA 5CA0B 4JOCA 4YH1A 2C88A 1T5TA 1J1IA 1XF1A 3VH4A 3D7RA 1C2TA 1CQJA 3EIXA 3QHAA 1J8MF 1XTUA 2GEUA 2ANCA 2PO5A 3P7MA 1TIPA 3L0ZA 5HJ5A 2FDCA 1M75A 3CR8A 1AB6A 5H3LA 3IJ5A 3C2QA 1M73E 1B1AA 4KI0A 5JDCC 5JANA 3CLKA 4KK4A 3ZJVA 2CJPA 2CJWA 2WF5A 3GNLA 4O2AA 1Y0BA 4O2BB 4M6WB 2ZSDA 4DANA 5BW5A 5K9ZA 2NT4A 2UUOA 2YV3A 1JA1A 5DBIA 1PR9A 2XV1A 2YHUA 3M33A 3HRHA 4GG1A 3WJAA 3AW8A 1Y3HA 2MIIA 4OU5A 5ELMA 3EZGA 2VFAA 3V8MA 2JGDB 4ZGGA 1EFKA 1L1QA 4BKUA 2RD2A 1OWLA 2DH6A 5BW8A 2BT4A 1MD9A 3LUBA 2X9QA 4D57A 4TWRA 2ERCA 1JSCA 1VKJA 1J56A 5FUVA 2OO3A 1FC0A 2UUAB 4BB0A 1S3FA 3A6HA 1OWPA 3JRXA 1E9AA 1N2JA 4IWXA 3ZY5A 4UBLA 4C07A 1NW7A 1Q3TA 1O95A 1J00A 3AF3A 4B3HA 3DO6A 1IEWA 2XOXA 2ARKA 2QUIA 2Y71A 3IMFA 1Z47A 2I65A 2EF0A 5KOJA 3WA7A 2V6JA 5IXSA 4C01A 4DA6A 2VS1A 2FSFA 1NP7A 2IYQA 3KKLA 1ORTA 4PRKA 4B5LA 3D02A 1HDZA 2FW6A 3ML1A 3M5PA 4C3ZA 4EHIA 3RT1A 2WUDA 1XCBA 3FR8A 1ODIA 3JD2A 4OOEA 2RONA 2C8LA 4KYTA 4R1UA 2CUTA 1S8FA 3GLTA 5E9AA 5JLJA 5M7EA 1BXGA 3O4RA 1Z5PA 4NZZA 2ZI9A 1ML4A 1CX9B 3FZQA 3KV1A 5ABPA 2YC4C 4CLDA 3D3NA 4W5TA 4TV9A 3E2PA 4C5BA 1PR6A 2Q50A 3DB1A 4ZCQA 3PVCA 3N8GA 1QP7A 2QX6A 1Q6ZA 2XOKD 3QBDA 2CXPA 1C7EA 2H08A 4PVCA 3TXYA 4CV0A 3A1SA 2QZPA 3L0DA 1JHRA 4WVLA 3DG9A 4QUHA 3TINA 3VSBA 2I6GA 5LL6P 5KMGB 1LH0A 1SCUA 3EH2A 3I4LA 4UEQA 3UB3A 1PCXA 2EKBA 2VP5A 1WQ1R 2ZETA 4FGUA 4HDMA 4IDBA 4WEOA 5EFOA 4QUKA 2H5LA 4M37A 4XWGA 4LV5B 3QHPA 5B5SA 3VBEA 4XGQA 3H2SA 4MKGA 3DDNA 4WHMA 5K2OA 4FZRA 4LNAA 3HFGA 4UTXA 5JBQA 2C20A 2X1LA 1J21A 1GADO 4TV9F 3A2LA 1KTIA 1GRQA 5CLHA 2FKNA 3LWNA 3WXMA 4PX5A 3H2ZA 2CDRA 1M2HA 2CHVA 1AKRA 1Y7LA 2OXCA 3KFVA 1NM5C 2BR5A 2F17A 1BX1A 3AB3A 1ZD5A 5JAHA 2CV2A 5M3BA 1ADCA 5HK9A 3H9CA 1GKYA 1W4CA 4TXNA 5L3RA 1CSEE 4PNPA 5F64A 4DUGA 1LZKA 3V1MA 5C1IA 3UWMA 1TQHA 5BUCA 2OGUA 2R1TB 2EGUA 2WP8J 3OIGA 5EUCA 4MIKA 8LDHA 1QVZA 3CS3A 3VPBA 2C5SA 4QT0A 1IPEA 4IFIA 4RDIA 3KVNA 3TRDA 3VM6A 4B71A 5CEEA 1G8AA 1NL3A 4EZBA 1RXIA 3P9RA 1PUIA 2YMLA 1MRNA 5CLLA 5EZ5A 4MS1A 4JC0A 1FXWF 3DDWA 5DSXA 5JTTA 5FO0A 3URMA 2BMJA 5L9AA 2Z4TA 3UC9A 2VK2A 3DUFA 4FFPA 1SXJB 4JASB 3VR0A 1RHJA 2JRCA 3LUDA 4FW8A 4PG8A 2E5LB 4XIGS 4C5CA 1YI8A 3BMQA 1K89A 2WAYA 3CF2A 1XMXA 1GCIA 3SQNA 4DQVA 5DGIA 2E87A 4HZUA 2FR8A 4F9FA 3NEAA 2EQ5A 1EUZA 1E94E 1P4AA 4LZNA 3N2EA 1NPYA 1SA0A 1WCYA 4KG7A 4IKPA 4YJKA 1P80A 1K3FA 4HDRB 1BWPA 1KVUA 2UKDA 1TMYA 5DN6A 2XE6A 3TX6A 3VZSA 2R6AA 4EF4A 4FINA 4HAWA 4C1NA 3CKMA 3HCWA 4G4IA 1UK7A 4B87A 1TGYA 3OFJA 2AE1A 1P4JA 4PHCA 3I2HA 1RLMA 2PXCA 4B79A 1NQ5A 2J67A 4J0DA 3MBOA 4GXRA 5DXFA 1DKLA 4S1NA 2BFFB 5KYKA 1UL1X 1NYTA 5FWXB 2OQRA 5CLJA 2O48X 1OBHA 2F1HA 1N8SA 2CNWA 3GAZA 3TRJA 2ID9A 5EWMA 3T3EA 5AESA 1VRCA 3A31A 1XEFA 1JTFA 3U37A 4A1FA 3FKJA 5LP1A 3IOBA 3W4IA 4E5KA 4JLSA 1XA4A 3DZBA 1GHTA 3BMNB 3JWEA 4L22A 1NY5A 2RHBA 4M87A 5GY7A 5LOVB 3EQZA 4J3FA 4AF7A 1BD3A 3DE4X 1ULAA 1R16A 4JBGA 3TO5A 2QN8A 2PQ6A 2D2XA 1JV2B 2WTBA 1EWYA 2XYHA 3WMRA 2GPNA 1RLJA 1Y5MA 2YHBA 1ENPA 3G8CA 4DV3B 3T0IA 3VAAA 1UOQA 2IPNA 2H3HA 1E5TA 3ZXIA 2CEKA 3D1VA 3DEAA 1TK3A 4O4LF 1JQEA 1OAKA 3GT7A 3ER6A 4OHXA 3RS3A 4E21A 1DGQA 1I13A 2R1TA 3SSNA 3RUAA 3A9VA 3PENA 2ZB3A 4XJSA 2P2LA 1FOEB 2WWYA 5K8TA 4WZAE 1RNLA 3OTOB 3VNSA 3AF5A 4U7JA 2VDVE 5KUTA 1K7SN 1BX3A 2KWIA 4Z7NB 2C04A 4FQ7A 1JHXA 1HLGA 1UIMA 4LYEA 4ER0A 2OD9A 4JXXA 3NGXA 5B7PA 3ZN2A 1D1SA 2RB5A 3PGA1 2DQKA 4F3TA 1DO2A 4D4HA 5CW2A 2IF2A 1WXFA 2FJUA 3QVGA 5HS4A 4IHJB 1T4CB 4M8SA 1GN9A 4MW1A 1YS7A 1OH5A 3CO0S 3ITEA 2WRZA 4ZHQB 3ADBA 3I1YA 4R41A 2CFSA 5DCUA 4I50F 3UKOA 1L1RA 5JNVA 4B6PA 3LM8A 4K40A 4Y3UA 2SICE 1FVOA 4JK3A 4MV7A 1WV1A 1KJQA 4NKRA 3F6RA 2R62A 3TRIA 3HVUA 4L5JA 3GYBA 3P5BA 2ZRJA 3BYZA 3KFLA 1HE3A 4RY2A 4B1FA 5MFZA 4LPKA 1P91A 3ZDQA 5AW5A 1H2EA 2FFRA 4IJUA 1CJVC 4TL8A 3I76A 1ZD1A 4PAGA 1YRQA 3F5FA 4LNHA 1YRBA 4EH1A 1USVA 2WQ7A 1X14A 3RFTA 4CI9A 1B23P 3FZNA 2BFFA 3NNNA 2BHLA 5AVOA 2O7SA 5A06A 1N9KA 4DLPA 4DRXA 4W5RA 5IUKC 2CZGA 2DWCA 5F51A 1HDRA 1M2VA 4NWIA 4NZOA 4PQRA 4Z1MD 4ND6A 4BBAA 1WIWA 3TTYA 2O0JA 2XXBA 5AKGA 1TTTA 2BMWA 4FTWA 5TT0A 3OSUA 1DJQA 1QNFA 1JR3E 3FZEA 3TNLA 2DUMA 3UV3A 3A2MA 3C6KA 3PFIA 2WKPA 4OL9A 4QUAA 4WQMA 4B6OA 2GK6A 1GQFA 3BMNA 5L6MB 3QVXA 1MABA 1VA4A 2G0AA 5C4MA 1BHQ1 4FILA 2BHSA 4PLYA 4CV2A 3CLHA 2ZRBA 2ASEA 3SEAA 2J6IA 3AHIA 2ZULA 4OQZA 4A10A 4QULA 1O9BA 4HNUA 4YAFA 4B81A 5E4JA 2WU8A 2PMDA 4F5ZA 1E7SA 2VAVA 3LBAA 3LVBA 4QFBA 1QP8A 1X80B 2ZJOA 4GRDA 4PZPA 1KKUA 1PJQA 4KQMA 4OM7A 4A8PA 7YASA 3E9NA 4XJTA 4YX9A 4DKJA 1A27A 2QAIA 1OILA 3P26A 4PICA 1MB9A 3LY9A 3QLTA 2YQ5A 1RI3A 3CNOA 2CBXA 3A32A 3QPVA 4ZV9A 1E0DA 3C15C 4NCKA 4ND7A 1JAHA 3TIFA 1E2BA 5K01A 5HHTA 4R9SA 1BIFA 4UNNA 2B35A 1V4VA 3EC7A 1RPAA 4OUDB 4LJSA 1TC1A 5CT6A 1Q7GA 3DOHA 3TVTA 2REBA 4LA4A 4FOPA 3SZGA 3LQ4A 1Z68A 1G98A 1K98A 4EG7A 4IHJA 4JFAA 3I72A 4GNRA 4X8OA 1NJ5A 2Z30A 2JJ2A 3A6EA 4TRMA 4YAOA 1ORHA 1OIWA 1MVOA 5IVHA 5IF3A 5B55A 1WY5A 1NI4B 2ZQYA 1B42A 5ITZA 4JV5B 3SAJA 3OZRA 2X9NA 2IHVA 3AEKB 4BP8A 5KNBA 3HVHA 3EDYA 4AP6A 4DC1A 1WW8A 1QZXA 1ZSYA 2VQEB 3H4IA 5DYTA 4V0OA 2B30A 2D06A 2QYHA 2D5CA 4ZKEA 1L2TA 5HP4A 2A0XA 1XTIA 3BL6A 1MC5A 2YJ3A 2YYYA 1HRDA 3UOWA 4MO9A 4NICA 2R7NA 2WWVD 1VSUA 1TEHA 3KHTA 4MZXA 2PV7A 4R8SA 1EVYA 5LQKA 4QGGA 4BNLA 3HSSA 5CFQA 1LB1B 2H2HA 4OI1A 4AG5A 2J6BA 3Q2KA 4B7CA 4QBGB 2QN2A 3D6JA 4Q82A 2OXTA 2YVAA 3RS9A 3D2CA 3ENKA 4BE7B 3M83A 3VOSA 3N74A 2QMUA 2H5EA 3RD5A 2ZG6A 1NVTA 2PSDA 4LRYA 4YV7A 1F1BA 5EXDA 4QBFA 1GGNA 2CDBA 3AO0B 2FWBA 3U1BA 3U6BA 2RHDA 3TBFA 5HJ7A 2J4DA 2LIVA 3T0FA 1WUHS 3L8CA 3T4PA 2PMEA 4LHVA 4PYLA 3V2HA 4FSXA 5A4KA 3GN2A 3PXXA 3O0TA 3R7WA 4JJ6A 4E6EA 4ZGWA 5AM2A 4WKNA 1F8YA 3DO5A 5DASA 2WSSD 3C8UA 4BV3A 4C0QC 4H2DA 1DBSA 1NV9A 4NJMB 3X1YA 5F23A 1F14A 1NN0A 2ZI5A 1QRUA 1RQ7A 2KQUA 2WFLB 4LOKA 1GILA 1PT9A 4EWLA 4RZUA 2WKQA 2NZVG 5BO5A 1O77A 3Q0EA 2IHTA 4MUKA 3PJRA 1GO2A 1M72A 2ATEA 2OYRA 2QD3A 4P7GA 1PJRA 4PGMA 4OQMA 4JJ7A 4PBSA 1FX1A 1LVGA 4RMHA 3M3PA 4UBMA 5HGJA 4PCLA 2LP4Y 4AROA 5FD8A 1EVIA 3PFGA 4OP1A 3CE6A 4JP5A 2H4ZA 4KN5A 3MHPA 3R5FA 5FX2A 2QBYB 1KBQA 2ORWA 3F6CA 1R0KA 2C84A 3ES9A 1P4SA 3P1JA 1T5BA 4RPGA 1R74A 1MNQA 1VSBA 4JROA 3UHFA 1U1GA 4Y0AA 5LWQA 4FC7A 4GR4A 3H4MA 5IK2A 2X77A 1N1GA 4TZ0A 3GI1A 2PXAA 2Z6QA 1M83A 1OE0A 4BCBA 5KOYA 1OCEA 3AF1A 2QRVB 1MH1A 4GW3A 5BYBA 3AZOA 1JLLB 4R9NA 1YUMA 1DEAA 2HRZA 1NMEA 3NAQA 3K8YA 3HSYA 3WNCA 4AJOA 1NG9A 3D1JA 1Q83A 4P3OA 1ZNQO 3IA2A 5C5DA 2ORVA 3F3MA 4OQXA 2EHDA 2G04A 1Y5RA 2K7ZA 1U4SA 2OHXA 2XY4A 3BHJA 3EVBA 3JZMA 4L0MA 4MB0A 4YYEA 5B1YA 2OBNA 1IXYA 2JFNA 4ALIA 4D46A 5ITSA 1CVIA 1FRQA 3JD0A 1ULHA 2FTKE 4PE5B 3RJZA 1YA6A 1Q0SA 1WUYA 1MAWA 2YWCA 1FYWA 1K8QA 1P62B 4HFNA 3M9WA 3SF8B 2P4EA 2QIOA 3HB1A 4TZTA 6NULA 5IG2A 2P3OA 3PSHA 2M1XA 3THRA 3PA6A 3COWA 2AN3A 3EWNA 5DRYA 2GKSA 2B4TO 1Y8AA 2HDHA 4FMBB 3REQA 4EUEA 1SCNE 1GQYA 4ITRC 2J0VA 2N1BA 4JYMA 4XRGA 2P2CA 3TE7A 421PA 2WFLA 3OZEA 3ZW8A 2JD1A 2GBGA 4NIMA 3QTLA 4Q1AA 1EG7A 1PWYE 2OBYA 3RJMA 4A23A 1S2LA 4N9QA 4JU8A 3JAWB 5FUMA 1KJIA 1P4HA 1VG9B 3EZ2A 221PA 4U6NA 3VNBA 5DIFA 2VDMB 5FIUA 2XDQB 1ZCJA 4RHEA 4H3HB 4XR9A 1IHXA 1XDZA 1ZMXA 2WPDA 1RP1A 3R7LA 5EE1A 2JGMA 4X3CA 2X0IA 2HTFA 3CF4G 1LWNA 5LP6B 3PXCX 2JBHA 4GR9A 4OBWA 5AKJA 4A8JA 4ZT5A 2EL9A 4DR5B 1KXZA 2O0KA 2WJZB 4I55F 4YI3A 3H7IA 4KE8A 3TQCA 2OV8A 4BMYA 4I99A 4HQOA 1ADYA 2P2YA 2XEDA 3RV3A 1LI5A 3STUA 1QHEA 4D4IA 1DAHA 1A9OA 4TTQA 8ADHA 3B70A 1PQUA 3F1LA 5SY4A 4JLAA 4D44A 3H0CA 3C8DA 4GFDA 2QVBA 2JIQA 3UAZA 4A0QA 3H9QA 2HEIA 1E99A 4E33A 2OM6A 3TIGA 5ALFA 3ZHRA 3WYDA 2QRVA 1H66A 2MYUA 3HP4A 1JLLA 1PJLA 4L0DA 3RC3A 2WLSA 4BMCA 5U4XA 4R8KA 5GADl 2CL7X 2GZ2A 5E38A 4TVBA 1RWQA 2W93A 4HN2A 3CCBA 5HUQA 3KOMA 4IKOA 4A03A 3C5EA 4Z7QB 5GWXA 4RZHA 1O6ZA 1Y5NA 2WAOA 5AK3A 1Z08A 3RYIA 4U7PB 4BNFA 4I5GA 1YF3A 1MO2A 1O94A 4KRXA 2H7CA 1KJ8A 2DZDA 5SZIA 3DEFA 1JBEA 3R75A 2Z6UA 4WPGA 4GGMX 3TDKA 3CB2A 3TK1A 2EOAA 1V26A 1ISFA 1HOXA 4WH0A 5AXDA 1J9ZA 4R0NA 4DLYA 3EIOA 1K75A 3X1MA 2XZTA 3SF8A 5HVNA 1NVUQ 2FSVC 4ESEA 4TYMA 2H1LA 3ASVA 3WAKA 3NCHA 2V97A 4B45A 2K2QB 2WEKA 4GRIA 1CUGA 1T2FA 1OLUA 4YRAA 5LR6A 2W6QA 5BSWA 1IMJA 4C88A 4JR2A 4IO1A 3L1UA 2IYPA 1EESA 4AYTA 4LG1A 3SMVA 2VPTA 1DX9A 4E12A 2VPPA 5F3RA 3HHEA 2A9PA 3JAWA 4EOGA 2VTEA 4K8RB 2QWXA 4U6SA 1Q1QA 4DABA 2GILA 3BX1A 3STYA 1K2VN 1QF9A 4NEHB 2TRSB 4DZRA 1KJWA 2ZPAA 5JSHA 3A28A 4JOSA 3HBNA 1YHZA 2DR0A 5DOVA 4YREA 3T1TA 1K63A 2P2DA 2ATVA 2AZ4A 2DSTA 2HIMA 1EVJA 5C46F 3OI7A 2P79A 2XQFA 4MPPA 4CPDA 2P5TB 1VJTA 3RBZA 1XA3A 1HY3A 3EYAA 3QYJA 5FPHA 1HEIA 3GUHA 3H5VA 3KPVA 3TZQA 1VGQA 1COWD 1E2FA 1C3XA 1NW6A 3HDYA 2QTTA 1H2BA 3WFJA 5HM8A 4W9NA 4H7KA 3ZBTA 5JZSA 1RIFA 3SVLA 4ZQBA 5EPUA 3OIYA 1C0EA 5AJHA 2V0CA 3CZRA 4DEXA 3R6TA 2VK1A 3DV2A 4Z9BA 4QPCA 5TDHA 3UXEA 3RVNA 1VMIA 5HKBA 3T7EA 1QAOA 1ZD8A 3HDGA 4Y18A 4X3PA 3VJMA 3ITDA 3KD3A 4JQSA 1GG5A 3T3IA 1QANA 2P9JA 3I9JA 4HWSA 4JC8A 1IBRA 4RY0A 2GTPA 1GZDA 1KIAA 4QECA 3I3OA 1LCIA 2NO5A 3DBHA 1XROA 3OZVA 4ZAFA 4DZZA 2YICA 5KYWB 1MG0A 1EFRA 1Y6JA 1KO7A 2IEYA 3OC6A 3H6HA 1G21E 4QNRA 1E4OA 3H2KA 3X44A 2AXPA 3SWWA 5FEUA 4FI3C 3WRVA 2J9FA 2FSUA 2JIMA 3BIXA 1XMIA 1Z26A 3DTTA 1WSWA 4M86A 4PQYA 2FG7C 4S04A 2RFLA 2BSXA 4TYNA 3ENVA 2CLEB 4N6GA 2AN4A 2I76A 3GRRA 1XTQA 2GJ9A 2RAFA 4LMAA 3S70A 4S1VA 2CDAA 4H7JA 1FYVA 1XTSA 4YB8A 3OFSA 4NCAA 3KJEA 3RV4A 2EGHA 4K03A 1F5NA 4U6QA 1F7VA 2GCPA 1JQKA 1C9JA 2ZR7A 3K2EA 4M46A 2MCFA 4TKUB 3L1KA 5I7UA 2ZREA 3MINA 2Q45A 2Q3FA 4YLGA 3MWFA 5DM0A 1XEWX 1YKSA 2P1RA 1NIJA 2VSFA 4BO9A 1K6IA 4R1TA 5IP5A 4ENSA 4EABA 2BFBB 3F73A 1KZHA 4L7QA 2G5PA 3JVDA 3K70D 1HX7A 4GF5A 2ZBEA 1H2XA 4HQKA 1W76A 4DHEA 4MTCA 4E11A 4ZCIA 4RLSA 2LVBA 3PQ4A 1Z2AA 5IKOA 4P58A 3QVOA 3HCFA 4DWWA 4F85A 1KZGB 1SH7A 2KE5A 3ZUPA 1X94A 3KUKA 4H0NA 3B89A 5J40A 5ALLA 3RSOA 2IH5A 3SBOA 5HMMA 2RGNC 1KKMA 3VHLB 1ADBA 1F4VA 4AUKA 1XCMA 3UOGA 4D0GA 3QYFA 1WCXA 2ZSHA 3E6AA 4QXMA 1W6UA 1D6JA 4XQ0A 3FDFA 3IKVA 4ND1A 1E4YA 3CC8A 2MSDB 1JI3A 2Q29A 2WD8A 4IH9A 3AG6A 3RHSA 1XCJA 3V1YA 4BXOB 1TQ6A 1PVOA 2PLWA 2XNSA 3HBFA 3I2KA 3R0IA 1OR8A 1X9IA 2QAJA 3Q3VA 4HH4A 4E3WA 3K5IA 1W5FA 3Q6MA 4OKNA 1KHHA 2ROQA 1REQA 2IHJA 4QPJC 3IURA 1J0XO 4HQRA 4HYQA 3N86A 1GGFA 4YCBA 5KYWA 1T43A 1D09A 2NSLA 4F2WA 4FP9A 4HYTA 1AKUA 3TSWA 3RQSA 4BUCA 2VP6A 3A9WA 4D3YA 2MSWA 2O8NA 1UK8A 3Q85A 4ALKA 2Z1NA 1IBKB 4MVJM 2O8FB 1PGNA 4ROTA 3N0RA 4Q3EA 1Z6TA 2DKFA 3VO2A 1SIUA 2P35A 1H8HD 1STOA 5KNCA 4ZT7A 1EYZA 3C85A 3HBMA 1AKTA 2AEMA 3R4CA 4ZOEA 1GNLA 2R6ZA 1EXNA 1E9DA 1NR1A 2BJHA 3GVXA 4O2RA 4P82A 4RGYA 4L78A 1UM9A 4TPKA 1A9SA 2GAOA 1H0KA 2PGOA 4LJAA 1V1RB 5AHWA 5JBIA 1OH6A 2A0YA 1VZ3A 3UAGA 1CNFA 4OGLA 4TKUA 1HETA 3AQ4A 1NBEA 1YBVA 1JEYB 3A6FA 4ZALA 5KCMA 1M74A 2Q49A 2XB8A 5BWBA 1ZUWA 3TKLA 2IS2A 1VB5A 2YZKA 5FLKA 2BFBA 2OVBA 4QBHA 1RWBA 2XMCA 4FX5A 4IDGA 2WW8A 4MW9A 2QHXA 4LIPD 3HWX1 1NXSA 1W87A 1WAMA 3KPYA 2QRGA 2QF7A 3NYWA 4NOKA 1YONA 2GHTA 3C3BA 3HCEA 4DXAA 5CBKA 1UXKA 3SNKA 4UAGA 2HJ9A 3T0GA 3SS7X 1FJ2A 2CW5A 3NIBA 4F9EA 5J4YA 1GGJA 3BHMA 4J75A 1K7CA 1PL8A 1C4XA 3AM5A 1N2CB 2C3UA 3HYSA 3ZNQA 4DSUA 4O5OA 4DM4A 4FEEA 3NR2A 3ZG6A 2FE4A 4R7GA 3A1EA 4NQRA 4Q5IA 5TQJA 4GP6A 3WWZA 2P3QA 3HLTA 1H93A 1EFCA 2E82A 4F4UA 1KEEA 1F2UA 1H3FA 4I4TB 4H6PA 2P0AA 5JNRA 4Q4JA 4ZA2A 1XWFA 2H16A 1H94A 4NBTA 3AEYA 3LLMA 4TN1A 2PZLA 4DLUA 4JJAA 3KSUA 5IBQA 5NLLA 3SS8A 4BB6A 4TTRA 2QPOA 2EF1A 4B74A 3WWPA 1SEVA 2VF8A 4ICIA 3SXJA 1XCOA 2FOIA 1TJNA 4GBED 1G8HA 3E9EA 4LGYA 1SU4A 1X0XA 1AGYA 3DZHA 3L3BA 5AP9A 2RI6A 3PG5A 4Y1FA 1BOOA 1OD6A 1WLSA 5E6SA 3SJ7A 2VDUE 1QQBA 3BWDD 2VLIA 1PJ8A 1YZKA 1V8ZA 4X54A 3A6GA 4GZ3A 1H5NA 1XZDA 4B4KA 4Y7CA 4AP5A 2LDBA 5IJ0B 3K0CC 4B6RA 3NS7A 2ZUVA 1ODKA 1GTG1 1RJEA 3A6DA 1W0JA 3NTOA 4YJ2A 1BJRE 3E2IA 4L02A 2NUPA 3OPYB 4ZAGA 3UJ7A 1JHOA 1V8BA 1OPRA 3W6OA 3WGOA 1G2PA 5A6VA 1V1RA 3GP3A 4LXIA 3S2FA 2XWSA 3L8DA 3W8RA 5KVCA 4FYVA 3TOXA 4DLBA 3SYTA 2P6OA 1NZDA 1W4AA 1RXWA 4CG2A 2R6DA 4V0LA 3UW1A 3FCYA 1L5YA 2AJTA 2EG5A 2WHQA 4K7JA 4YRNA 3JYNA 2FFBA 2AI2A 1BXZA 1PJ2A 1P2BA 2B5OA 2I29A 2FVYA 3IAUA 4H6VA 4OQPA 4RM2A 4U39A 3ZE2B 5AOAA 3D4IA 2VPYA 4HFRA 4RV4A 3VAZA 2DBZA 1MB0A 2JFPA 3IQHX 2CC2A 3ZKWB 5TXGA 2R751 2GBIA 3JD4A 3MCTA 1TIBA 4PWYA 5G0UA 3A25A 5ILGA 3VC1A 2R1ZA 1CUJA 2AEJA 3GJRA 5FBHA 4AF8A 5G02A 3RIEA 4LBZA 3T7JA 1Q2XA 1U7XA 3SHQA 1BSVA 4BJHB 2Y9PB 5EC8A 4C4YA 2ZRKA 3CX4A 2O3QA 4MV9A 2BTQB 2RHTA 4MGYR 5F5LA 3B1XA 3ILSA 1DEXA 1LK0A 2UZ0A 5FPPA 3VZQA 3DR5A 2ZSFA 1SBIA 5FI3A 3KK0A 3LHIA 5DBFA 1JIJA 2FN7A 3HJRA 2ZZKA 1N5DA 3HO8A 1BXRB 1KERA 2QXYA 5JG7A 3WGUA 1URPA 3FMFA 5AJZA 4ETWA 3SK0A 2DH5A 1BMFD 4KGDA 2WF7A 1VMAA 2VDWB 3OKCA 3O7MA 4AC9A 4ZI7F 5EESA 4G5YA 1XZ8A 1R0RE 3AQIA 3GJTA 1CR2A 3N3AC 4AJKA 1FW6A 3V33A 2PZ8A 1AHIA 3O21A 5IABA 4JLOA 3I5UA 3ISVA 4DSTA 4AQ7A 2WJJA 2ZCVA 4JUAA 1H42A 5EMMA 3L4BC 3HR7A 3O6VA 2P8JA 1KI6B 1GT6A 2RBGA 1SUPA 1T3HA 2QLNA 5YASA 1HNZB 4FNAA 4IG4A 1E9SA 3GJ8A 4JBXA 4PF1A 3RBVA 4E08A 2V7GA 3KZ1E 1AC5A 4RJLA 4WA8A 3FA2A 3M6FA 2OOKA 2WB2A 2QL7A 3VQTA 4J94A 5AUOB 1U3VA 2FCAA 3OLQA 4M36A 3Q6NA 2GHQA 4PAWA 1PK9A 2MWMA 2P67A 1ODLA 4Y0VA 3T1QA 2JFFA 1SZPA 2V6IA 2V5UA 3QXCA 3OPYA 4U9HS 3PWKA 3QKWA 2HZBA 4F04A 1K66A 1Z2OX 2LCIA 3A3PA 3KOOA 4QQFA 3NQ41 4Q03A 5LQUA 1NKVA 1MIHA 2P5SA 4AM8A 3TTSA 4WBNF 5DKFA 2AEFA 1HDOA 3VSEA 4F2GA 3MHTA 3FUXA 4YYZA 2BI4A 1H0SA 4TKMA 3VHQA 1XC7A 4CLRB 4E2FA 2QN3A 1SOWA 1PJSA 1G66A 2YW9A 3MT7A 3MTJA 4RD6A 3GGSA 3JQ8B 3S44A 3ADDA 2W2QA 1J0BA 3G79A 3ZY3A 3EG9A 4EPTA 1Q0ZA 4IJ6A 3ZQ6A 2GN1A 1TT7A 1XP5A 5AKHA 2Z5LA 2WB4A 2FEXA 3CEJA 4FDUA 4LVUA 1TVEA 3HPRA 3LTEA 2AZXA 1SUEA 1V39A 5FYDA 1ESMA 2VHCA 5A05A 4A2PA 3G68A 2CLIB 1ZU5A 4GGPA 1H4SA 2XVYA 4NZPA 1GFZA 5DIZA 1PQ4A 1HSZA 1KORA 1P7CA 1V71A 2WAXA 4LHXA 4CE6A 4D3ZA 3PD1A 5KNLA 1NNSA 1WDLA 2WV9A 2AJLI 1U28A 3CX3A 4WK2B 4JY7A 4LW8A 5C7IO 2ID8A 2IQIA 3FBWA 5EWLB 4TKVA 4IV5A 2GM5A 1JQBA 3VRHA 4W8OA 1AZLA 1P6QA 1G16A 1SXPA 1B43A 4DJFC 4PINA 3UWSA 1HDYA 1KHTA 4R8MA 4IFTA 4Y6PA 2GAIA 2G40A 1QX3A 3KP1A 5IN5A 3TZBA 4HNVA 1BVHA 3DOIA 4CT4B 1DP4A 1WLYA 4KDCA 3RCBA 3X43A 5LA6A 1V16A 4QREA 2RKWA 3S81A 4ZVSA 2BISA 2GJ8A 3NEYA 2X0DA 3IVMA 1P1RA 2PUWA 4JLJA 3IHTA 5GAJA 3V7UA 4KR7A 3K0FA 3L1IA 4Y6RA 2AK2A 1N6HA 1T4DA 1R3UA 3P0IA 2XMQA 4NATA 4Q7MB 4UVDA 2Y76A 3LRPA 2OHGA 3OICA 4MPDA 5IEBA 4C43A 5C5CA 4N3AA 4P5DA 3EFBA 2I2BA 3IIIA 3LXXA 1YZ3A 1CJSA 3GMSA 3LV8A 1Q74A 4FN4A 4GP7A 2QJFA 4IJQA 1W8DA 1GCOA 3IALA 2BY4A 5M04A 2YN2A 3CZ5A 3ZIDA 1WF6A 2W2LD 3BGOS 3HJAA 4JFRA 3FROA 1W5SA 1IQUA 1OV4A 1QF7A 2XGMA 3KQSA 4OA5A 4TT3D 4B48A 4RTQA 5BYAA 2O20A 2IIPA 5IN4A 4Q9NA 2ZVJA 1TYZA 5SYMA 4GC5A 3IULA 4K9LA 3DEZA 4B2YA 2VZ8A 2WM8A 4LDRA 1S8OA 1ETUA 3IJRA 1O8CA 4K5QA 4PONA 1E7QA 4PN7A 2C0QA 2VJOA 5K6RA 3ICEA 4K9KA 4WI1A 3EWSA 4ZEVA 3C3YA 3WQSB 1AUOA 3FYCA 2H1OA 4F8JA 1QJCA 3EGIA 3F67A 2JASA 1EFTA 3CVVA 3NPMA 4M9SA 2I22A 2B2CA 3W5IA 1Z22A 2Q3HA 3E9QA 1ZNZA 3GEEA 5GOZA 4PYNA 1JT2A 3U80A 1YZYA 1N5IA 1ARZA 2XDWA 1LZLA 5EWLA 4ZJZA 5KDDA 3DLBA 1N6PA 3AM1A 1HDGO 4PANA 4UM7A 4LRSB 3KWFA 3RG2A 4E07A 1EVEA 4MYTA 3NDBB 2FX3A 4F5WA 4L75A 3OO0A 4KV7A 1N7GA 4XEHA 1VJGA 2XZDA 2YCBA 2QRLA 4N54A 1QDLB 3WHLA 4D79A 3ORRA 1XNJA 5KJ1A 1G9SA 4EB8A 3B2EA 4F7WA 1K92A 1G7CA 2PMKA 3ZHXA 1CRLA 1GKUB 1SUAA 2QPTA 5BMVB 1QGUB 3EPKA 1FU4A 2IS1A 5E4FA 1ZAKA 4IH1A 3H1AA 2K5UA 4ZK2A 1KYZA 4TS9A 3T7SA 3P5SA 2QUBA 4Y0NA 4ZV4A 5KTPA 3ST7A 1ISGA 1D2MA 4P80A 2WYIA 4C4ZA 2G1KA 4ZT4A 1X15A 4A6PA 3L7BA 3MPUA 4DYDA 2ZRCA 3TL2A 2ZBRA 2II6A 3KTOA 2WMDA 3LCJA 4K9MA 1O95D 2EJTA 2WAMA 1Q3HA 1SCJA 1X7YB 2OLJA 3IDFA 4Y2JA 3T7IA 3T9DA 4Z4GA 4JELA 4D25A 3OUUA 3KRTA 3WNDA 1A1SA 3H11B 1D3AA 1SKYB 4OFWA 3SSOA 3ZHSA 4EB6B 1O1YA 1EZ1A 2H2GA 3FNEA 5HJEA 2CXTA 4CZ2A 3R4VA 2B1GA 4MS3B 3PE4A 2FF5A 3NTRA 4R7TA 1RC0A 3BXZA 4I5EA 2RGDA 4LXTA 2R6JA 3NKLA 1O87A 1DCMA 4S0ZA 2YINC 1ZGCA 4C0XA 4DHWA 5IBPA 4F5YA 2DT8A 4DR6B 4G9BA 1JSRA 1X13A 1PEKE 4ZD6A 3AVVA 2HC9A 1JKXA 4GDMA 5BN5B 3V4LA 2X7HA 1XU4A 1L7QA 3HJFA 5D87A 1KFEB 5AH0A 5I5GA 3GDGA 3NM4A 5K6AA 1GL6A 3E3LA 3BE5A 3EZLA 3K0AA 1WULS 4HBGA 1XHLA 4CIXA 5L3VA 1IQPA 1EWVA 2A33A 3H17A 4MQFB 3AVTA 1LEHA 4LBYA 5TMBA 3FFXA 2FX2A 4E5SA 2FPRA 4JUDX 4XB1A 3ZX4A 2DWPA 5THKA 5D1NA 2ODNA 5H70A 5JS6A 3T5DA 2NOAA 4YRPA 5FA8A 4B4OA 4HAXA 4BGVA 3O8BA 2OQIA 3AEUB 1QR2A 1V43A 1ZW1A 2I6QA 2MSKA 2QP4A 4IIJB 3N07A 2HIGA 5DI3A 3X0DA 1PV4A 5LZ2A 5EGSA 1E20A 3RTAA 4BZPA 1GV1A 4C9BA 2XQJA 3ET4A 3EQ8A 1C9NA 1TM1E 2FWJA 2X7JA 3ASZA 4WW0A 3KZMA 3WMFA 5BN4A 1RFGE 2YNMC 3ANYB 4FQ8A 3GF4A 4DG8A 5ES4B 4N3NA 5TVKA 1QU3A 2O7NA 3OCUA 3GLIB 2GQ0A 1R8XA 4L08A 2PVSA 2Y0DA 4ND8B 5B57C 2C5LA 3EIHA 3U4DA 6ADHA 4YI5A 1TI7A 1OKKA 2VWHA 3NV9A 4QJIA 1U3WA 2EV9A 4JEHA 4DUGD 3EXEB 2D7CA 2PX0A 4NNOA 4GT1A 4TYPA 3DE5X 1GXSA 4MVJA 1SHLA 5FBRB 5DYNA 1XIVA 1Z0UA 1E2NA 3LU1A 2XXAB 4D3DA 4X9XA 5LQJA 1LJ8A 1AKYA 1DX4A 1C9DB 2FPGA 4B4VA 4X6UA 4JLDA 4RTOA 2ZTUA 1YU6A 1GSOA 4RTNA 1MT3A 4MV4A 7MDHA 1DC3A 3OU6A 1B16A 1KC3A 2ODTX 1ZH6A 2P40A 3RF7A 1Q5PA 3EW9A 1JU9A 4EB6A 5E7MA 3RT7A 1P3DA 1E8NA 4G4JA 3WB9A 5AQEA 2Q4TA 4I1OA 2GD2A 4MUGA 3UCFA 1T34A 1X2BA 4LX0A 3R3YA 4OJTA 1Q7CA 2QQ5A 3PC6A 1R0XA 4JLPA 5HMLA 1L5VA 2QNBA 3BMCB 3SICE 3FHTA 3C1TA 4BO1A 5BN5A 5KWVA 2C7RA 3CM0A 2PV0A 1JXAA 3O8LA 1EQ2A 1HEUA 1G59A 2RI1A 4DR4B 2VC2B 2WUFA 2Q8QA 5COQA 4G0WA 4MQFA 3C4VA 1L4FA 4RZSA 1K9SA 3QMVA 2AMFA 4PSDA 4MEAA 3W8EA 1OVMA 3Q6IA 3NWEA 3K20A 4HGZA 1NBME 5DP1A 5J4KA 3FTQA 1KAHA 4LJ4A 3RWOA 4BVFA 4W1QA 1JRLA 3ZBUA 1E3LA 1KZ9A 4O4HF 4XUEA 1A98A 1IUPA 1FS5A 2F3RA 2HO4A 2R7LA 1BHSA 4K3VA 4BQFA 4DJEC 2UZ1A 1Z07A 2QOEA 1WDTA 4IIJA 1M5UA 4YNBA 3VZPA 4FVTA 5JDCA 2VHQA 2GXSA 1S01A 3LTNC 1U2EA 1U2ZA 2Q1YA 2FRVA 3ZLBA 4DJ5X 1NONA 4S2EA 2EQBA 1M7BA 3VISA 2PX2A 4B3RB 3I2IA 3FFBA 3HJTA 3ZEAA 4QO7A 5CJJA 3ZK7A 1JA0A 5CT9A 1Z62A 1INLA 4MWEA 1XGKA 3GLIA 2I3BA 1CNEA 2AXEA 3IPCA 4YHBA 1M1ZA 4ND8A 4ZREA 5FTLA 3U60B 1BFUA 3R5XA 1TYBE 5IT4A 1DDGA 1MO4A 2HGSA 2P6RA 5KQRA 2ZRIA 2NTYC 3I5YA 3CH6A 1U8FO 4R51A 2M1ZA 3A26A 4IGFA 3FZGA 1QYWA 2CMDA 1DEKA 5HIMA 1E7WA 2QA5A 2AN9A 3GIWA 4DSNA 1MT0A 4MV6A 4NPHA 3VSAA 3UMFA 1CZLA 1ZMRA 5EJEA 1U02A 2W5UA 4EYKA 1ZRNA 2EBWA 3BE4A 1YL6A 2CFCA 1P72A 4PX9A 4K2AA 5FTMA 4PS1A 4GLOA 1KEKA 3KSAC 1T3SA 2D7JA 3OZ7A 4J0GA 4RHCA 2C99A 2DPXA 2VWPA 4G26A 1A0OA 3UWDA 4A4DA 3DA8A 3ACDA 3V42A 4BFTA 4DMFA 4X24A 2ZE8A 1PQYA 3BMCA 3K5PA 4L9AA 5CGQB 3T52A 3LHKA 3EWAA 1GZ6A 1WXDA 4X95A 5I7HA 1ZFNA 1P74A 4ZO9A 1KKLA 2I55A 4PAMA 2VPWA 4D98A 3BZBA 1S4MA 3BWCA 3ONWA 1YOVB 1LDYA 2WQ6A 4U5XA 4I3HA 3SHWA 1SZJG 3EWIA 4S1TA 4PM4A 3WA6A 2DY1A 4LJYA 2F7SA 4DMGA 3HKDA 2WJWA 4AS1A 2X23A 2E1RA 3R0JA 4RD1A 3LYLA 3TLGB 2J1LA 2JCYA 1BE1A 3GEGA 4AURA 4AULA 3UGJA 2NTEA 5CA1B 1KPGA 4DIUA 3CUKA 2Z9DA 3IUMA 1DBQA 4B2PA 1K8YB 2B1IA 4ZANA 4AECA 3T7DA 3IILA 4F9TA 2GESA 1RRVA 4Y8VA 4BO2A 4GI5A 3WVNA 2CLFB 3P9XA 4EDFA 5KQGA 3ER9A 4G5XA 2W6ID 3WNVA 3NV7A 2A4MA 4ZZ3A 3BIOA 1LFDB 1A76A 5DBOA 3EVZA 2C2WA 3HVIA 3WTBA 2WR8A 1CF4A 1G2IA 4YJFB 1NP6A 1O0SA 2M2IA 3F7OA 1E7YA 1L4UA 2Y67A 1KU0A 1S1MA 1SB8A 1T1IA 4LOHA 3LUGA 3N7AA 4PSVA 5CPFA 1T8TA 5I9MA 1DSSG 5K6TA 2DHDA 2SECE 2OZVA 2Y0BA 1OC4A 5JC8A 3ZHOA 5FDFA 2UXBB 4KMMA 4ZO8A 2VT6A 1V0JA 4D8TA 2IZ0A 1F06A 1GLVA 2AWNA 1ZRMA 2WWWA 2XKJE 3BE8A 4KXMA 4N65A 4QBIA 5FP0A 3AOEC 4M3NA 2VPXA 1E4EA 1GGVA 5JT1A 2JA2A 4E5NA 4RORA 2QZ9A 3F3KA 3VYRB 3BIJA 5ECYA 1TFUA 2ACKA 2VUTA 1T1SA 5EHGA 5HRAA 5ER6A 3FOCA 4RKEA 1KSHA 1L0BA 2GCEA 2J6CA 4PLWA 1CKEA 4GPEA 3SYLA 2CFTA 2NQTA 2Y9MB 1CUFA 5AI9A 2IYZA 2G25A 3OTQA 3EMDA 1E61A 3CZAA 3I9NA 2W7TA 5ALZA 1Y1LA 3A0RB 2GLUA 4HEHA 1RS0A 3TBHA 3TI9A 3TG2A 2JJ2D 2ZM6B 1L5WA 1Z88A 1K4MA 1AMOA 1D1TA 4XX0A 5BQXA 1CQPA 3KT8A 4JBYA 1CUYA 4ZOBA 4Q7EA 2WSLA 3A70A 2O23A 3FCSB 7REQB 3PQ2A 4G01B 5KNBD 2FKAA 2WNIA 4KAXA 1EVKA 3MMZA 4I9NA 4HXEB 4B31A 2V4ZA 1J8DA 1YB5A 1LBHA 2YN4A 5IH7A 4RIFA 1IM2A 5BNTA 3M5WA 3HB7A 5FLYA 4H7IA 1NSTA 2H1RA 3AUKA 4Y9DA 3RFCA 3WBKA 2BUAA 3BD7A 4BQSA 1E59A 1NUTA 4BNIA 1XLVA 2B36A 3LH5A 1BEUB 4YGYA 2C57A 2XI4A 4LOIA 3TLYA 3UHAA 3TLGA 4CL3A 5LWHA 2QD1A 5CTAA 4CIBA 4CM8B 1YR8A 4RK0A 2D1SA 1KIFA 2J46A 4G37A 4I0WB 4OLFA 3AERA 1V45E 1TK2A 3EAQA 2AOTA 5DULA 1NXQA 1RAGA 3VNQA 3F5SA 4ZJUA 1UAYA 4HQLA 3GNSA 2XUQA 1GSHA 3DMHA 1I7SB 4D9MA 3AP1A 2QMYA 1GNPA 3GUCA 1CJBA 1TQDA 3T54A 4BNDA 4DBZA 3KJXA 1USGA 5ADVA 1YFKA 4TX1A 4W6ZA 1WHTA 4OXXA 1A8SA 1U0JA 5CM8B 3VYVA 1TLTA 5HIIA 3TBKA 4BL5A 2HK6A 4YJFA 3ICCA 1Q0HA 1WNFA 4KYUA 2OB2A 3A3KA 2FWPA 3QW2A 1U3GA 4Y2PA 4QDZA 3U4QA 2A0WA 1N6NA 2PL9A 3JARB 3TTXA 1KTVA 3FE2A 4UVEA 2Q5QA 5I9LA 4AKGA 2QAGC 5BSKA 2H4HA 3TUZC 4REMA 1VXOA 2Q0SA 1IEXA 3SR0A 2VP0A 5F2NA 3OQMA 3M5DA 3PE6A 4JC5A 5CR9A 1VG8A 4LY0A 5J63A 4HWPA 3WYEA 1FYFA 1QONA 1U9IC 2ODBA 2XCOA 2O52A 3ICQB 1F3LA 1GPWB 4OM8A 3TXXA 4XYLA 1NE2A 2VTBB 4TTJA 3PIIA 3QGMA 4UTRA 3C3WA 1VE7A 1P2TA 4HBZA 1W2GA 3FYUC 3BFJA 2DFLA 1QZTA 3GGGA 3Q1KA 3X1ZA 4DDVA 2JH9A 2GZAA 3CW9A 3OA0A 4JBLA 3ZVKA 4S1WA 4A36A 4KQ1A 4RV5A 1DTEA 2HO5A 1NNUA 5SYAA 3T3MB 4NCBA 2P41A 3A9UA 4GMKA 2FW8A 2G4CA 2OCXA 3QWAA 4GYYA 4YR7A 1XAIA 3FHLA 1BE8A 5LXTB 5BW6B 3P4YA 3D8SA 4A2WA 1Z4JA 2FSHA 2RJOA 1BMQA 3N0WA 1SVUA 2FH5B 2GBLC 2Y1CA 3M9LA 1B7GO 3KTDA 3EIEA 3JQ9A 3C6QA 1B26A 2O6HA 3VTZA 1DJMA 1FQWA 2ZYIA 2HOQA 3FXAA 5FWNA 2PY6A 1E18A 4Y9SA 1KS9A 1SVWA 4EVRA 3U0BA 3WQBA 3KQPA 5CVUA 1RRKA 1FYDA 2WU4A 4EUKA 5K0TA 3EXIB 1RE0A 1Z5NA 1KAGA 2C96A 3OJXA 1RRFA 4JCCA 5FJJA 4LXUA 3GCZA 1JIQA 2YWFA 1PV1A 4P84A 4W6QA 4RPJA 3UXHA 5B64A 4WOJA 1ULSA 3CWZA 3BH6A 4CM8A 2D5IA 2KYRA 3A04A 3QUAA 4IXDA 4N39A 1AN9A 3RUPA 3ULKA 3K9HA 4G85A 1XVVA 4UUNA 5JZOA 1RHMA 1XMJA 2QMZA 1C8VB 2VUHB 3B52X 1I4EB 2Q3DA 3O3MB 3DVSX 1U2DC 3COSA 2H85A 4CUJA 4HO1X 1BA3A 4I3GA 4BMOB 5A9RA 1Y3AA 4IX9A 3WLMA 2G70A 3EAGA 1ABFA 3GGOA 1XKQA 2B2NA 1DQNA 4Q4AB 2DY0A 1J09A 2PSHA 3IPLA 1R3DA 4YN3A 5JOQA 4Q3BA 5JS1A 3PNVA 1T6ZA 2DJIA 3MMNA 4DCJA 1VHQA 3GBVA 5JU6A 1JALA 4IYJA 4B4WA 4GYWA 1OMOA 3RS4A 1P17A 1JMVA 4QYTA 1YJBA 3L05A 2PBFA 4HDNA 3SSMA 2M6LA 5AXAA 1N33B 1FX0B 1U1FA 2ZJ3A 3KR9A 2QT9A 4UVHA 2ALJA 3E9MA 2P1ZA 2ZTLA 1XEWY 1QCCA 3ITNA 3KQKA 1TPZA 1M54A 1V4BA 3Q4GA 2P6PA 4BVLA 3E82A 1NT2A 2FI1A 4UM9B 3KVVA 3NHLA 5B1DA 1JYEA 4BNZA 3ROQA 2R3SA 3ZV6A 3DMYA 2O5EA 1YS4A 2BCGY 5LXTA 3D64A 2VHEA 3VTAA 3ND6A 3H84A 1EZZA 2KLHA 1KY2A 4WNCA 1MXHA 3S2EA 1L7NA 4HNGA 3FB4A 1A8HA 1ZL0A 4KBFA 4B43A 4DN6A 4M0CA 1V35A 4AXXA 1GZVA 2NYVA 1WXXA 2WV7A 2YFYA 1QHGA 2IZ7A 2GD0A 3OJWA 3R41A 2A4KA 4WOBA 1WB5A 2VQ6A 4D5EA 5GMOA 2GWHA 4OYYA 3V4SA 2Z9BA 1KO1A 3ETJA 3ZJ5A 3FNBA 5GONB 3WG9A 1FFHA 5I9BA 1NZFA 2G9NA 2O19A 2NPOA 3RKRA 4QOFA 1BMDA 5AM5A 2AB0A 3CTMA 3M6AA 4X41A 2IWHA 6GPBA 2E5WA 4M9RA 3RARA 4RFVA 1DQYA 5IJ9B 4CKBB 3E84A 3GZ4A 2FK8A 2O57A 5EJ9A 2CCJA 2JKYA 1JX6A 4WZBB 1EK0A 4DMHA 4GI3A 2ZSJA 2HBYA 4N6NA 4F5EA 2NN3C 2BM8A 1Z18A 4CODB 1PYGA 4HB0A 4YJGA 2CVZA 5TQ0B 2DWUA 3S7TA 4CUZA 7ADHA 2CNNA 1G41A 4ZO6A 1FLAA 3QE3A 1PP4A 4L51A 3NJ4A 5AW7A 2QZZA 3G1UA 1UDAA 4KR6A 1WTCA 2GMWA 3LZCA 4F5DA 1QIJA 1Z5OA 1EWTA 1M6HA 1ZD9A 2H8GA 3G13A 4N0MA 1ODJA 4IY1A 4W9MC 1DBRA 4RHYA 4BATA 1DADA 5LQMA 2ZJ0A 2HU7A 1FFYA 3BAZA 3K71B 1N5OX 1Y3BE 3JQAD 3ZY2A 1JJ7A 2XCTB 2I5PO 1ZN9A 4G63A 5A2QA 4M9XA 2BDUA 3ZW9A 3IUYA 1RXUA 4GXNA 2GPYA 3GUZA 4L73A 5DHUA 2X1VA 1G8PA 4O4LB 4H7HA 4ZI5A 2B4KA 4IIYA 4QQKA 3UK7A 4CLOA 1FX0A 4NBRA 4J0HA 4K9OA 2NYUA 2YC2C 4FT2A 3R7NA 4UASA 1ONSA 2GTHA 2YRFA 3ED1A 4EVIA 2OV1A 3KEFA 3JQFC 3RVSA 1TMGE 7GPBA 1W29A 4YVFA 4CR6A 4NXNB 2ENUA 1EJ0A 1SKQA 4Q1DA 5BW4A 1QQ7A 1DZIA 3OM1A 1QGED 1WXWA 2EX0A 2XT0A 4OL0A 1VL0A 4OTZA 4LXYA 1HNXB 4I46A 1CV2A 2P11A 1YB1A 1YRHA 3BZUA 3L84A 3GN1A 3PX3A 3TKYA 1P45A 1SUWA 4LQ4A 1CW2B 2CNBA 2R85A 4DDUA 1O2DA 3G8YA 1PV2A 3C5WP 1NT4A 4I66A 4G9EA 4Y9RA 4IJWA 2NPFA 3PDJA 1KNQA 4UDXX 3REOA 1KGSA 3BH0A 1Q15A 1WKBA 3I64A 2WMNB 5KTYA 4REOA 3BB4A 2AD1A 1YR9A 1XOIA 4MP8A 1GZ7A 2J3JA 3NBXX 4FGKA 4MR7B 3C5CA 2BW0A 2B2XA 2QJTA 2QL6A 5KDLA 4W5NA 2PRYA 1ADFA 4RS4A 5EIAA 5AVXA 3VH3A 5C7OO 1V8DA 3P9KA 1T0BA 5K0NA 3O8DA 1TECE 4P35A 1Y4DE 1EFRD 3AY3A 5DBHX 1CJMA 4M0DA 5HOEA 4CKBA 1P8AA 2E3JA 2QM0A 1YFZA 3OTWA 4UFNA 4MP3A 1YQUA 3UV7A 3ZE9A 4UNSA 2JZOA 3NPAA 3M4YA 4F46A 4CL2A 3H75A 3GLFB 1J8YF 1AHNA 4F3RA 3OQJA 2GF9A 4A9AA 4IEIA 2FVXA 4MINA 3SJAA 2XMGA 1T91A 4G8JA 4RZIA 4EITA 5ADUS 5JMWA 2Z98A 3AB8A 1G8KA 4J0CA 2BEWB 2V8BA 1YK1A 2ODQA 1U1DA 4MHSA 3ZCTA 2X41A 4C4OA 3MWGA 4ZEMA 2F8MA 2J41A 2QLMA 5ADWA 2NPIA 2GK3A 5I7RA 4JYZA 5EMNA 3KEGA 4KFUA 3JASA 4JB0A 1JGTA 3RIHA 1ZK4A 3FTFA 1EX9A 2AN1A 3SU8A 2I7XA 4J6FA 5LZ9A 1GJRA 1LX7A 2AEEA 2MMGA 4CXMA 1DKNA 1DMSA 3Q87B 4UW9A 3R20A 1H0RA 1C0PA 4RL6A 1MU0A 2HJRA 2Y27A 5HYVA 3OF3A 3NGMA 4CR8A 4MZDA 4FFOA 3SYNA 1OREA 4CMIA 4EFLA 3ZBPA 1ADGA 2XQVA 4OHWA 1J39A 3DS8A 4P92A 1AKWA 1YU9A 1QXSA 3TZKA 2H1FA 4IIEA 3RFUA 4JB2A 1T1GA 4BFUA 5L3QB 2WICA 3RSZA 5A4MS 3IO3A 4UUAA 3BSSA 5TNXA 3PHJA 5D01A 5A0FA 4O33A 5E4YA 2NAPA 3D6FA 1US8B 2QROA 2YYZA 3I0ZA 3UN1A 4MCAA 3O38A 4XSGA 3HFSA 4OKIA 2AXNA 4QJ3A 5B37A 1IHOA 1TRHA 3PIDA 2Q6TA 3A10A 3MVEA 3G8AA 4WESB 3HNRA 4JUBA 5AJWA 2HYIC 2VDPB 2Q5FA 2NO7A 4F6RA 2VSOA 1QS0B 1KBZA 1MJNA 1NVXQ 1W94A 4L5AA 4IVPA 1Y4UA 4V1CB 2YY7A 2KB0A 3OPQA 5BPFA 4DA7A 3EA5A 5E6UB 4HX9A 2IV7A 4N7BA 5J5AA 5IKEA 4IJMA 4HN4B 3GZTB 4YMVA 5C51B 4D3FA 4KAJA 4QVIA 1YMQA 4CFYA 3ER8A 3HBJA 2WWHA 1K2WA 3LYAA 4KLZA 5DF1A 3C1UA 2FSVA 4PBTA 1JU4A 3L0BA 4FMCB 4GOKA 3REGA 2AK3A 1VSTA 4KFSA 3TX2A 3CZCA 3D4PA 3TOVA 3BBPA 5KNCD 3LY8A 4N8SA 4XWAA 1E2EA 5JROA 3QITA 4LWQA 3KLNA 2IHNA 3DWFA 3I5XA 2BYTA 1YQWA 3VC3A 3PEYA 1HWYA 4IZOA 4YT4A 3O90A 1DG1G 1JHQA 4B32A 2BEWA 5LMNB 3KKPA 2YXLA 3BT7A 2O9JA 1MORA 3RGGA 3VSCA 4Z5XA 4PGHA 2IXGA 2J0UB 4NCIA 1GCAA 2XA2A 3PR2B 2EXXA 2RHRA 1LLCA 1JMKC 2WTMA 2WJYA 3L43A 1DAEA 3KDPA 1KRXA 4PCAA 5CNKA 1OZAA 4XWWA 4NYJR 1KK1A 4LX8A 1U2PA 3D4BA 3QLEA 4GOXA 2HK9A 2QRNA 1TK9A 1UBSB 4TUYF 1KVSA 3EIWA 3UB4A 3ZLJA 3P32A 1DWOA 1GG8A 1VL5A 4RJJA 3B5JA 3WK7A 4BJ6A 4HV4A 3G0HA 3WYAA 3NC1C 1SNYA 2CY0A 5IAAA 3QUBA 2HWUA 4ZQEA 4GBJA 3CUTA 4B0OA 2AKEA 2IQ5A 4UUBA 3ENWA 3VSDA 3OO1A 1TM5E 1L1FA 3ZDXB 2ZPUA 1U2SA 1KFJB 1AUQA 3BA1A 4HCJA 2FUKA 3V8QA 4A3SA 1P33A 2PUHA 2C2KA 1WMEA 3O8RA 2CHUA 1A72A 1ISJA 2JW5A 1US8A 1EUDA 3LOQA 1EJBA 2WHPB 3EEFA 4E32A 1DHRA 5IDYA 3ZQKA 4IKEA 5JARA 2F9MA 2AG8A 2XSZA 4WESA 4MYCA 5IBRA 3ZI4A 4O1IA 1KAQA 3BL8A 1QGDA 2RHCA 3IHLA 3CNQS 3RJ9A 4U2EA 5TEVA 2YS6A 3RM3A 5AJXA 3U3KA 5BR1A 3RUHA 4KVFA 5C35A 4R1MA 4D4MA 2MU1A 5IEJA 1SBNE 2HLDA 1ORDA 1W5TA 1U2QA 2MTBA 1Y7HA 3BC1A 5L4LA 1YQQA 4R5MA 1I2ZA 3GG9A 4FFMA 1YDGA 2ZBPA 3TQQA 1JQ5A 1DAKA 3IKMB 1GQOA 3SXPA 1DC5A 1NTRA 2WIFA 3ZJTA 4BQIA 1S9DA 4TWZA 1X7DA 4CRWB 3QRWA 1Y1TA 4CQMD 3KLPX 4F91B 3L77A 4LXXA 4BB9A 2R86A 4BTLA 3M1AA 1IRIA 1SC3A 1W6RA 2BKAA 3QOYA 1L8XA 4U9IS 5JDIC 4ARCA 3LLUA 1AQUA 2OQ2A 3M5CA 4KITB 2IK8A 1JIUA 2QE7A 4EUSA 3WSVA 4LV6A 1NATA 4EY5A 1W0JD 3D5QA 2W2NA 3HVJA 4IDCA 4EW6A 3KZNA 4Z4HA 3BF8A 1ORWA 3QKIA 5REQB 1EHYA 2G9QA 3OE5A 3ACCA 2P9BA 2XCRB 2EWWA 1DO8A 2X5KO 3VR3D 4A91A 4RK4A 4MVXA 3PV0A 4DWVA 4NQZA 2OAEA 1UQTA 2I3DA 1OOEA 5FADA 4C29A 3U5ZB 4UDNA 2OCBA 1HT2E 1XRNA 1G42A 4KPUB 1PLKA 4UE6A 2XMSA 3IH5A 1PTJC 4D4KA 4EBFA 1EFLA 2DU8A 3W2HA 1N0IA 4GUAA 2Y1GA 5CPBA 5I9SA 1A7AA 1BAPA 2IYAA 2XMZA 3HEMA 3QSGA 3WLIA 2CLMB 2OZPA 2RGNA 4X8LA 1HT0A 3HKBA 2UDPA 3BQNB 2IY9A 4M53A 1T9ZA 3H2HA 4RVDA 4YK7A 2B6HA 3P9CA 3TPFA 2VXBA 4TKZA 4DEYA 2PX3A 4LF7B 2OGSA 3F1KA 5JPCA 2ZB7A 4MYRA 1GUZA 3WMXA 5C7YA 5FTWA 1HA3A 4YUYA 3Q5EA 2VAXA 4BNUA 5DEIA 3FCEA 1PT6A 1GQRA 2B6NA 3NAZA 1NSFA 1FTWA 4WMLA 3S0JA 5J2UF 3W9YA 3V9AA 3WQRA 3G1WA 2ZJAA 3NBMA 4O4JA 2XUOA 2PUDA 3A6ZA 1PUXA 1RMYA 3FPJA 1Y1RA 5AHOA 2NZ8A 1NVBA 5DISB 4ZVTA 4BZXA 2RH5A 4I55B 1DL5A 3IDQA 4IGEA 2V65A 5FTNA 3D8TA 4AG3A 4FSDA 4HLNA 4OIFA 5HKLA 3AJ9A 2HBRA 2O5CA 2XTNA 2HPAA 4GIBA 3RIMA 3U3MA 1FTSA 4DNFA 5IJWA 4HFJA 1NJ2A 3DFMA 3MIIA 1C1DA 5AM4A 2O0LA 5EHIA 3K70C 4JQYA 5EP2A 1K5DA 3SPXA 1KWGA 3V4FA 1LUAA 1UP6A 2Z6AA 1DJOA 4FBGA 3DXZA 1W2HA 4H4CA 4UPDA 4L5BA 4UUOA 4YP7A 3OWXA 3VZRA 3V6MA 4EKYA 4K2HA 4RC9A 2NO9A 5C80A 1R88A 2ZRLA 3W6ZA 3S8MA 1PYOA 4MI3A 5JMPA 3TQOA 1Q50A 1R8QA 3OAAA 3OMWA 3A4IA 4ZOAA 5DNUA 3QVVA 4Z2AA 4KR9A 4HN9A 2FEKA 1AKMA 1W75A 2R8YA 5IVIA 3CPJB 8AT1A 4CEHA 3EQ6A 1HO3A 4RTMA 4TSKA 4NEQA 1OB5A 1I7LA 2WZCA 1WMSA 2BFEB 3DONA 3MERA 4WBSA 5J2TF 2D74A 5I9TA 3U3JA 2YRXA 3UT5B 1E2UA 4HWRA 2J87A 3GQVA 3UFXB 3KVOA 5I7SA 1J49A 1RQPA 1Z06A 4ZQGA 5TVGA 3H2BA 3P9IA 4AKEA 4R6WA 5HPYB 1LV8A 1CPYA 3I37X 3HEAA 3PHCA 3TGPA 1LY1A 1M76A 3N2YA 1KMIY 1L5MA 3GEIA 4UU1A 1Q22A 4E5MA 1TCUA 1DIBA 1UFRA 1LPSA 1DC6A 1G0NA 4HMOA 1BGXT 4TXMA 4LJ8A 2V9PA 1SBHA 3A14A 5JCJA 3SVZA 4CN8A 4OHZA 2F90A 3KV3O 5DH9A 3MSCA 2C9BA 4M1WA 2X0EA 1T9AA 4KN6A 1E96A 1QYDA 2YL2A 1IDN1 3QPCA 2L82A 4XWYA 5EQTA 1USWA 5B1HA 5GZ3A 5KJCA 1GDTA 5I4IA 5AKYA 1E5XA 1X92A 4OHKA 1NDUA 1R6VA 3DTVA 3GLHB 4FONA 4RCYA 5TPWB 3NU1A 4P38A 2EKPA 1SG6A 1SXJE 2QSJA 2X19A 3FYSA 1NF3A 4YLYA 2O54A 5JSZA 2BGKA 2Q5OA 4JJEA 4L2IB 4XIIA 3E4CA 3DCIA 4CCAA 4UJ5A 2F3PA 5GZ1A 2WT8A 4WBXC 4LVNA 4NARA 1GLGA 4EM6A 1P6XA 2A94A 3OEYA 1Y89A 3K5WA 5F1OA 1TPYA 4AWXA 3Q3EA 4IVRA 1MTZA 2JEOA 4LC0A 4MARA 4KVAA 5IFLA 1Y5LA 1X3LA 1WUJS 1O08A 4TMKA 4EFNA 2JK0A 4JXZA 2Z08A 3AESB 3B9PA 4TMWA 3LBNA 1Z4OA 3IOCA 1ZVVA 2ABWA 3QJ5A 2HMYB 3AVQA 3K0CA 4L4UA 4U63A 1L7DA 4MR8A 4U7HA 3DHVA 1YQEA 4W7SA 5ALEA 4OY3A 4TN5A 1DCTA 2QEQA 1XG5A 1OPXA 4AZ3B 5F7OA 1AA6A 1Y7TA 3IR7A 3FDZA 1XT6A 1Z45A 2JI7A 2EYQA 4YDQA 2HPVA 2NU9B 1OU4A 5FA5A 3RYTC 3I4FA 1CDOA 5CT8A 2I7VA 4G5RA 3I8OA 3W1EA 3ZWPA 5EJ8A 5A0TA 1KJYA 1AUPA 1MC8A 3MM4A 4WOKA 1TUGA 2QTAA 4O2AF 3SC4A 1E58A 3SG0A 1FS4A 3CH7A 4QJBA 2XRZA 3VGPA 2PGAA 3N58A 1ZNWA 3OTHA 2VJPA 2ZUBA 1MO6A 1L7AA 4OCZA 1QE3A 2N1MA 3HCCA 3IOYA 1H5QA 1M5RA 3MJ4A 5DTRA 3UFXA 3RU7A 3N5CA 3BJZA 3QH4A 1N1DA 4G4GA 4Q02A 3WNQA 4ZDJA 4DV7B 2GFQA 2BH2A 2WZDA 4HJXA 3BG5A 4D82A 1D2NA 5AWFC 4X60A 2X6TA 3MZ0A 1QAQA 3TR6A 2FW9A 2H52A 5HKOA 3AI3A 2F1JA 3T7KA 1RLTA 4AL4A 1CHDA 3O2SB 2A5LA 4F6LA 1P6UA 3T9BA 1Z0DA 3KZXA 3N76A 4Q7JB 5SY9A 2NVBA 1KSJA 1PWZA 2N9UA 3FYTA 4NCNA 4P4SA 3I32A 2VH2A 3IE2A 2I6UA 3CLRD 4IZHA 2RGRA 3IXQA 1ZQ9A 5BSHA 3WHIA 1UXGA 3DSRA 2HLHA 4BVHA 1LNQA 1RYFA 1U4NA 2WTNA 4DIKA 1FTQA 1YZLA 3D7SA 3EZFA 1U0NA 1CERA 2J48A 4ETIA 4HADA 2NU6B 5DYYA 5TPWA 4BBPA 1Y6FA 3V80A 1LPAB 2CLHB 4KV9A 1OYWA 4RD0A 1XQVA 2ZTVA 1T1EA 4TWJA 1JH8A 2WKRA 1VQ1A 2PWBA 3A1TA 4J3NA 4CBVA 5HZGA 2Z3WA 1NN5A 1JKIA 5FR1A 5G3YA 2D6FA 3KHKA 3U49A 3L4BA 1R6UA 1UFOA 1ZOLA 3N39C 3PX2A 3GFOA 1OAAA 1EGVB 1S1CA 4GM1A 1OB2A 4H27A 3LXMA 4KVGA 4PZCA 4F4CA 1F0YA 4RF5A 3H8WA 3UUGA 2GF0A 3BTUA 3AESA 1VG1A 2I99A 1SVMA 4J1QA 4OGKA 1M1UA 1QQ6A 2W90A 3COZA 4C2BA 3ZJUA 4KNYA 2I4TA 1RRCA 2HA2A 4ENVA 8GPBA 2BGNA 1VFPA 3TPCA 1S4QA 3FYHA 4FBLA 1XV5A 5CA0F 5JEDA 2C5BA 1CFZA 1P61B 2ODWA 1ZICA 2IY7A 5IH3A 3Q88A 3EULA 3HSKA 4TXJA 4MGZR 5DLYA 5EIBD 4PGGA 5HTKA 2IWRA 4X6LA 1VA5A 2Q99A 3NHJA 1BEEA 4OLAA 3B6ZA 2PUCA 2Q8NA 1M3SA 3COYA 4XUDA 3WRXC 3SE7A 5IT0A 3PR1A 3GJ3A 4KGXA 3ZWXA 1FFXA 3D43A 3RIXA 3SS9X 1QGYA 1AZWA 4HS4A 4TTVA 4HPXB 1Q19A 1HYQA 5DBGA 5KQMA 3T34A 3T61A 4B73A 4R9VA 3DPUA 4HNHA 3RC9A 3X3HA 4GC9A 3TEMA 5AVUA 3H9JA 1NOKA 3ZYZA 2FG5A 4FLEA 2PKQO 4D96A 1K7YA 2IXTA 3FWPA 6AT1A 1N25A 4POAA 3VV2A 4BNJA 4X7RA 2HXSA 3NJ8A 4WFIA 1I24A 5HFAA 4E5PA 1O89A 3NFRA 1KDYA 3VX4A 5A1JA 4MWZA 4Z8YA 5LQAA 1UDRA 4EI2A 3WB1A 2GB4A 4TZKA 2NAFA 1TW2A 5AI8A 5C8DA 4YRFA 2Q9AA 3QI7A 4Y2GA 2V58A 1YOBA 1V5WA 4MRVA 1Z6PA 2RE8A 5JAUA 1KWKA 2O3UA 3G8BA 3GNTA 3WDMA 3LDFA 2WU1A 4NBKA 3C14C 3SDBA 3H6GA 2UXCB 3HR8A 2E7ZA 3FRHA 1YV9A 1VL1A 2GT1A 4REQB 3ZQ4A 4J1TC 2R0QC 5ESDA 4L72A 1WMBA 1NUQA 1XZCA 1E1YA 2V6MA 1Z37A 3IUJA 3KNZA 3NOOA 4JVLA 1JYSA 3A6PC 3CUSA 4KN9S 4K6MA 1GP2A 4W1SA 5T4EA 1XA0A 4CKWB 1SHJA 1AGRA 4RVOA 4A2CA 2OLKA 1ECJA 4YAWA 4L74A 4LQLA 1PJBA 4ZVVA 4A0RA 4BWYA 4GKVA 2G88A 1BS1A 3B85A 4M7PA 2FK7A 4K46A 3TZ6A 1L7VC 4PIPA 5E0OA 4NBLA 4CMKA 5KO2A 4G56A 2IPOA 4BS9A 5F5NA 3FPBA 3I9V6 3W6NA