3D1VA

Crystal structure of human pnp complexed with 2-mercapto(3h) quinazolinone
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
288
Chain Sequence
ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Structural studies of human purine nucleoside phosphorylase: towards a new specific empirical scoring function
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d1vA00
1Z36A 1Q1GA 1B8NA 3OOEA 3OZCA 4D8VA 1PR1A 3DDOA 4LKRA 3E9ZA 5CXQA 4MCHA 3QPBA 3UT6A 1M73E 1PKEA 1PR0A 1RR6A 4QASA 5IFKA 3KVYA 3MMSA 3IOMA 4R2XA 1QE5A 1TGYA 4YNBA 3NM4A 1V48A 1LV8A 4PR3A 1Z35A 4F2WA 5EFOA 5DK6A 1PR6A 3INYA 3IEXA 3BSFA 3DJFA 1NC3A 2A0XA 4PNPA 4IP0A 1T8WA 3E0QA 4DA8A 4QARA 1OVGA 1JDZA 1JPVA 4RJ2A 3PNPA 1T0UA 2OC4A 4TTJA 5FAKA 1YQUA 3T94A 1YRYE 3EMVA 4GKAA 1PW7A 4BMZA 4YO8A 1RYZA 1U1FA 1U1GA 1PWYE 4EB8A 1RFGE 1OTYA 3BGSA 5EUBA 1V45E 1Z5OA 5CCDA 3DPSA 1TGVA 1JP7A 2OXFA 2A0YA 3OZBA 3EUFA 4WKBA 4TXHA 4TXLA 5F77A 5ETJA 4M7WA 1XE3A 4QAQA 1A9SA 3LGSA 3BL6A 3NM6B 3D1VA 1NC1A 3KHSA 4NSNA 1PR2A 4DABA 2HSWA 3OZEA 1OTXA 3OPVA 4D8XA 4DA7A 1RCTE 1A9PA 3ONVA 1SD1A 4KN5A 1SD2A 1JDVA 5F7JA 1Y1SA 4WKPA 4P54A 1B8OA 1U1EA 1ECPA 1U1DA 1VHWA 1NW4A 1Y1RA 4X24A 1PF7E 4D8YA 1Z37A 3FB1A 3TL6A 1RSZA 1Z34A 2RJ3A 4QATA 1K27A 5F7OA 2QTTA 1JDTA 1SJ9A 4EARA 4M3NA 4I2VA 1JDSA 2AI2A 4YJKA 2PGAA 1PK7A 1PR4A 5C80A 1VFNA 4BMXA 4WKNA 4TTIA 3C74A 4QEZA 1OUMA 3SCZA 4LNAA 1K3FA 5F78A 3KVRA 3FWPA 5K1ZA 4TXNA 3P0EA 4R31A 2B94A 4F1WA 3O6VA 2QSUA 3FUCA 1SQ6A 1Z33A 4DAOA 1I80A 3UAWA 3OOHA 1TD1A 1YBFA 3GGSA 4OJTA 3DP9A 4OGLA 4TS9A 5CYGA 4GLJA 4D98A 1RXCA 1RT9A 4GLFA 1YQQA 4F2PA 3ODGA 4OEHA 1YR3A 1FXUA 1A9RA 3MB8A 1JYSA 1RXUA 3UAYA 2HWUA 4TS3A 2AI3A 1JE0A 3OCCA 1TCVA 4JWTA 1T8RA 1OV6A 2OC9A 4WKOA 1PR5A 2OECA 4L5YA 4M1EA 4L0MA 2AI1A 3EUEA 3UAXA 3NM5A 3NBQA 3PHBE 3FOWA 1LVUA 2H8GA 1PK9A 2IQ5A 3PHCA 5I3CA 1V3QE 1PBNA 1A9QA 4NY1A 4BN0A 1ODLA 1CB0A 3OF3A 1T8YA 5JPCA 1U1CA 1T8SA 3KU4A 4K6OA 1OU4A 1Z5PA 4FFSA 4F3CA 4OGKA 4TXJA 2BSXA 3K8QA 4G41A 1V4NA 3FNQA 4D9HA 2XRFA 3GB9A 5CXSA 5EPUA 4F3KA 2ISCA 1TCUA 5F7ZA 4NS1A 3BJEA 5IU6A 3UAZA 4JP5A 3LA8A 1V41E 4MARA 4LNHA 2I4TA 4MCIA 4TTAA 3O4VA 5F73A 4H1TA 5KB3A 4E1VA 1N3IA 1ULBA 4R2WA 5B7GA 1WTAA 1JE1A 4DARA 4L5CA 1Y6QA 1CG6A 3PNSA 2HN9A 3LBAA 1Y6RA 4OF4A 3ENZA 4BMYA 5B7PA 4DANA 3EEIA 1C3XA 2Q7OE 5B7QA 1ODIA 3F8WA 2GUWA 4JOSA 5F7XA 2I8AA 1ULAA 1JDUA 3KUKA 4GMHA 5CCEA 4ECEA 1A9OA 1A69A 3DF9A 4LZWA 4DA6A 5F76A 1VHJA 1G2OA 1ODJA 3U40A 5B7NA 4L6IA 1LX7A 2AC7A 1K9SA 1ODKA 3E9RA 2ON6A 1Y1TA 3K8OE 2QTGA 4YMLA 1Z5NA 4DA0A 4G89A 4U2KA 2A8YA 1ZL2A 4TYMA 1RXSA 5CYFA 2HRDA 3UAVA 4QFBA 1Y1QA 1Z39A 1ZOSA 2P4SA 2QDKA 1RXYA 4L5AA 4G8JA 4WKCA 2QPLA 4UC0A 3KVVA 1A9TA 1V2HE 2A0WA 4TXMA 4DAEA 1Z38A 3P0FA 3OZDA 4OY3A 3FAZA 1VMKA 4LDNA
chains in the Genus database with same CATH superfamily
1ZN9A 4LDPA 3IV9A 3IQWA 4RCYA 3KCNA 4YWHA 2PV0A 4TSFD 1X94A 3D7LA 3H8VA 1FX0B 2MYTA 2NGRA 2XYGA 5TS3A 4DBLC 3BSSA 5BV1A 1NVDA 1U0SY 3V2HA 2G07A 1MDBA 4N8DA 4ARZA 1GN8A 2ZJ4A 4NZNA 1XZIA 1QFYA 4YPFA 2PUBA 2B98A 2JC3A 2CCGA 2WPDA 3GNTA 3QU9A 4GKBA 4TMWA 4FIZA 3KXLA 5IP5A 3UCXA 1MABB 3V1YA 4UE6A 4EGAA 1ZC3A 3KT6A 3LY8A 4NBWA 1NQUA 5L7YA 4M8NE 3ZD8A 2UU9B 1A1SA 2LCFA 1RKXA 1PL0A 1RHKA 3U1TA 1L6RA 1SVUA 2JCBA 5CNMA 1U80A 5AVRA 5A9SB 4N8SA 5JVDB 2A5GA 2Y9PB 4ZJPA 3NAGA 4GEKA 3ZWNA 1PSDA 4PRYA 4WY5A 5BQ3A 2D8MA 5FFMA 4S05A 3HGMA 1JVNA 2NZVG 4H6XA 1AQ6A 3RF7A 1CY4A 4ALNA 4BNTA 1G98A 3D2BA 4Z53A 3PU6A 3K2IA 2XTMA 1O57A 4WFQA 3CINA 1I4OA 2GT1A 3CC8A 5JCZA 3LJKA 1V6SA 4LV6A 3ICEA 4U2BA 3RUCA 4ISCA 1L3BA 2BKUA 2G9UA 4OLJA 1UC5B 3LWZA 4IQ8A 3IP5A 2QN8A 3SJZA 2W2KA 4R9NA 1I5RA 1E3EA 3BGIA 2KBEA 3M7IA 4PC6A 4LDRA 2R66A 1E7QA 4JUDX 2VHCA 1V11A 1CR6A 1CZNA 4ZCIA 4F5DA 1YCHA 4UOQA 5AVSA 2G1KA 3OJOA 2Y1FA 1DJMA 1BWQA 5HJ5A 3UFBA 1BHSA 4TZ0A 2YINC 5DM4A 2XUJA 1V95A 3LK6A 4G4GA 4OSPA 3MJSA 4PG6A 5FAKA 3IVAA 3N87A 1M2OB 3GYBA 3D7KA 1Z7BA 3ZDZB 1M74A 2W6IA 3M6MD 4XX1A 3OM1A 5CDUA 1ZL0A 1IHUA 4JKOA 4DLSA 4BO3A 3ME5A 1F5NA 1PEDA 4FB4A 5FWAA 5JZVA 3QEMA 1C9DB 2PMFA 4FKZA 2AZMA 1Y82A 3OWHA 4G85A 4R3NA 1JVBA 2MDTA 4C43A 2VDKB 4R1MA 1BDMA 5HFAA 1RFGE 2P6PA 2F3PA 4FS3A 4G97A 5BWNA 3RFVA 3D43A 5AW2A 4QU5A 4ZAYA 2LDXA 3UB4A 4ZI7A 1XXHB 3N2GB 1NBMD 1ZGGA 4ZXPA 4F0JA 5KNDA 3CGWA 2X5OA 3AEUA 2WU0A 1SFRA 3L8DA 2YV5A 5HGXA 3JALA 4C0XA 2FZKA 3JAWB 2J1LA 2Q46A 1MOPA 3L1IA 1B2LA 3Q10A 4KMSA 4WFIA 1LKZA 2ZVJA 3DZDA 1PLJA 5JSYA 5HKKA 1G21B 4F46A 4K2AA 1MC1A 5BUSA 1H69A 2AA3A 4MQ6A 5EZYB 2RHGB 5JAOA 2XF8A 3N8HA 2XODA 3MCZA 4YASA 3FLBA 3RKRA 1CZUA 3DQZA 3G88A 2QTCA 3UK1A 4C04A 2YJTD 3KKMA 3CZMA 4AG5A 1B8UA 1XPOA 3OC6A 1Z4PX 3D1VA 4COOA 4XVHA 2WWHA 3DDSA 3PQCA 1AO0A 4IV8A 3DBLB 3ZGYA 4BV2A 3QSYA 3G7UA 4HB2A 2K5UA 4JVLA 3BF8A 3V8EA 4JT9A 2IHYA 1CUZA 1OLOA 2IYXA 5E7IA 1CEXA 4KODA 5EXSA 3EXEA 1UBOS 2OE2A 3DXYA 4M1SA 4MDYA 4NJEA 4OQEA 4BL5A 5BXQC 3PGKA 4PGGA 1T4CA 3EQZA 3ONVA 1B42A 1G41A 4JMLA 3QVVA 3IUNA 4MSUA 1CKEA 4CM1A 2PSSA 1WZCA 4Y6RA 3T5DA 3M82A 1DKRA 4W9MC 2GHTA 3QMPA 2P2YA 1YNOA 4LZNA 4W5JA 2R79A 4WGGA 3ZJVA 5HIAA 1CQJA 3D5EA 4TUYF 2OWDA 4BMCA 4DLZA 1LJUA 2GN8A 4DLYA 3SIRA 4N48A 2P6NA 3FCAA 3HP1A 5JR3A 1JWAB 4O4IB 1E1MA 1LS6A 1X77A 2NU7B 4EHIA 1QS0A 2XYPA 4N3BA 1H22A 4JSYA 4AMZA 4DW8A 3ESDA 4YMGA 2QM0A 2VT3A 2PKCA 4EITA 5ERYA 2KMLA 3MD9A 3OJFA 1R7RA 4BPRA 4AZSA 2AK2A 2IUEA 2VP6A 4UHEA 5JFGA 1VJ1A 1YC5A 1R8YA 1CHDA 1JIJA 1OC4A 1KXZA 3K8YA 3NT4A 4XYMA 5FOQA 4YJKA 2A57A 5K0TA 1XMXA 4LY0A 2WWXA 4QFMA 1C8VB 3TR0A 2HM7A 4UZEA 4PZAA 1VFNA 2PJRA 3SC3A 3WLNA 1IPEA 3ZY5A 4AL4A 4DJ5X 5BN4A 3GWZA 3OPYI 4DJDC 4UTRA 1ZY2A 3GQBA 1KJNA 2NYRA 4KOAA 1LBHA 4JROA 4UNIA 2XKAA 3G5UA 5K8IA 2JZOA 5AW9A 2C04A 1Z2NX 4EVIA 5BVGB 3LT5A 4QJ3A 1TO1E 5D3MA 4LNAA 1UWLA 5HKLA 1ZG3A 1ND6A 3OX3A 3ZCUA 1PQPA 5KINB 2O4CA 4GIBA 5CR9A 2RGUA 3HZRA 5JHHB 4RJTA 3UHAA 3NVKI 1SCDA 1CJMA 4FS8A 4G5OA 2FYTA 4PWZA 2WB2A 4BRUA 4RK0A 3ZUPA 3CW8X 1PUXA 1NY5A 2HY7A 4PTYA 1J1UA 3T7JA 3SR0A 4J0FA 4WK6A 2H4HA 3WBFA 1UMKA 1Z33A 4KX5A 4HNSA 1MPTA 4G9BA 1W0CA 2CLHB 3V4ZA 5IDQA 1OIVA 1JHMA 2OD7A 3WP0A 1EFVB 1OILA 1VCMA 3JVIA 2ZUTA 5CLLA 3WFIA 4DCVA 3WQSB 4E51A 4I9GA 4GDFA 1VCOA 3JPYA 5BUQA 4HJRA 1AQYA 3E8SA 1O9GA 3O38A 3KZCA 1TYEB 4FP9A 1Q14A 4FT2A 2ZPUA 3KXKA 4J0JA 4U9HS 3GHYA 1L5FA 4ZCLA 2Z2XA 3P9CA 2Q6KA 1DT3A 3VAYA 4RTJA 2JIDA 1ZD9A 1JR6A 3UWDA 1YQQA 1TYCA 4MO2A 5B1SA 3HJGA 2VJNA 3PICA 4HH3C 2HSEA 2X15A 5FLEX 4MP3A 5A3QA 1AJEA 3V4PB 3W9BA 1U4NA 4I8IA 4ZMRA 2BHLA 2DOKA 3KO8A 2AG8A 3EYAA 2XV1A 5BV8A 2H5LA 4HL6A 2RHMA 2X14A 3O3CA 3RFFA 4R41A 5FNVA 3CLRD 4B5LA 4EG6A 4E5UA 3GCDA 2A0KA 3DOFA 4YP1A 1S2OA 4EY5A 3E84A 4BMVA 1JYSA 2Y1GA 1GUBA 2Y8EA 4IVNA 1HWYA 4XWWA 1L7EA 1YTLA 2IUYA 1L7XA 4RL6A 1RHQA 2QY9A 3IHWA 3RI3A 3U44B 2I1VB 3KTAB 1SKAA 4XYLA 3D2AA 1YU6A 2IXFA 4JB3A 4MUKA 3GUZA 3OA2A 1T8RA 1GADO 2P65A 2WAMA 3P52A 4WKOA 2JK1A 4OK5A 3FFWA 3IDQA 1LNSA 3GXOA 2DFKB 3A04A 3RSSA 4B40A 1DARA 2BKLA 2GJ4A 2ZBGA 1L5LA 1EIWA 3WZ2A 4V1CA 1O96A 4CUKA 3UBTA 1E32A 4E46A 2OBBA 2FPOA 3GLFE 1KO8A 2I4MA 4OJNA 1BAPA 4UAVA 4LOHA 4W7IA 5E6UB 2DCUA 2WHRA 1G5TA 4BAUA 3ON5A 1ZVVA 2HW8A 1QP4A 3GRUA 3T3MB 2G9ZA 3T7AA 2FWBA 3R20A 4N0PA 5EIEA 5CMLA 3I3SR 4TVOA 3TM5A 4CR6A 3PFGA 1NU6A 1D04A 3VA7A 1CB0A 5HSGA 1ZVJA 5CX1B 1XUOA 1NY6A 1MC4A 2VSQA 3ZDDA 2FF7A 3IULA 1IBMB 1LBIA 3IXMA 2CKMA 3MOGA 5GIPE 3OU2A 4N0EA 1O9HA 2FFHA 2XMGA 4AQDA 1V35A 4Q47A 1CVLA 1EX6A 2ZWMA 1CUIA 4XWTA 4LTDA 2PGXA 2FW6A 2FVYA 1SAYA 3JWIA 2EJCA 4V3BA 1R27A 4IL5A 4JYCA 4BFLA 5FORA 4EK9A 4JJ8A 4H0FA 4H7HA 1QIIA 3TK1A 4EW3A 2C8LA 2O7VA 4UD6A 4HDSB 4OYYA 4BNDB 1QCCA 1KARA 3KPVA 1XZJA 4OFWA 4PX5A 2CXNA 2OV8A 2XB8A 4ZAGA 4Q00A 2IS2A 2IYFA 2WKPA 4R1UA 4RQBA 2OQ2A 1REQB 2XRFA 4ZYUA 4YJGB 4CMEC 4E2WA 5JXIA 1E62A 2MYNA 1DRKA 1BE0A 4F3KA 5C5EA 4DMFA 3TI7A 4DR2B 2NOAA 3PP8A 3IPLA 2QAGC 1DAOA 2QX7A 1GPAA 4UKDA 4GI2A 5CA1A 5H83A 4EG3A 1SO8A 1YQWA 1FOEB 3T5TA 2NP7A 3UF0A 1PVDA 1T5HX 1HM5A 3R3SA 5SICE 1PDOA 3AIOA 2J3MA 3RC9A 4C7KA 1MN6A 3K0FA 3CV3A 3EGIA 4JLNA 3D3NA 2EG5A 4AG6A 3FOAA 1GZUA 4R81A 2YASA 4M6WB 4R01A 3GZNA 1O6BA 1ZITA 4XIGS 3GRKA 5C8VA 3H9JA 4RVFA 1YR2A 2KB0A 4EATA 1UDRA 1KKUA 2XNSA 2XD9A 4FHCA 1KZHA 5A4DA 3G8BA 5DNYB 4UTNA 4U2DA 3R44A 5ALFA 1LX6A 3REQA 5CB4F 4O0MA 1H8HA 1FBTA 1O89A 5AVVA 2BYTA 2AN9A 3ZHQA 4UM5A 4AJ1A 3PHIA 4LXYA 4G07A 4MKIA 2HQ1A 3FJ1A 4WLNA 3IKJA 2HCFA 2MSWA 1N9ZA 5ALSA 4X62B 1G6HA 1D2RA 4Y2QA 1P1CA 1EFRD 4EGCB 3F4LA 4AXXA 4EY4A 4HUTA 3WYCA 4YCMA 1XNQB 1Y6QA 5CLFA 1C4WA 4L9AA 1AQJA 2B37A 1PEYA 3VKWA 2B30A 1U9IA 1XYVA 4GH5A 4RS4A 2O8DA 5JW6A 3FYSA 1Q83A 1QGDA 4P6VF 2X1VA 3U9TA 4D9JA 3ZY4A 4F56A 1YAJA 3H2KA 3OEEA 2QM3A 1AMUA 4NENB 3PQ7A 4OAPA 5KMGA 2ZAYA 2ZIAA 1BJTA 1U7UA 1QLHA 3A6ZA 3P4YA 1C3OA 3LO5A 5EAIA 3UJ6A 1VRWA 3HKCB 1XT6A 5TT0A 3KX2A 1UQUA 3TQIA 3G5MA 4BNNA 1T1JA 4IJQA 2B0CA 4AJNA 4FMCB 2C2KA 4S35A 5CEJA 4ZV9A 1SVWA 1LLDA 4Q7JB 1TVKB 4FUQA 5ER6A 5JASA 1X7XB 2HV8A 1W9MA 2VHXA 4C0HA 1VJCA 4YFYA 4AZ3B 2MINB 3NO4A 5F5XA 4BP3A 4YP9A 8AT1A 1W581 4FLEA 5JLAA 1B43A 4MQFB 4CLDA 5CCEA 1QIDA 5JYBA 1IJBA 1ZD3A 2YYYA 2ZYUX 3ZKAA 2PVPA 1PZNA 2CW5A 5AVOA 1NJGA 2IEIA 4NFSA 4ARVA 4BVFA 3KWMA 5JU6A 1J0DA 1P5JA 3WIDA 2YFQA 3IBTA 3ZU4A 2WIJA 4IIDA 3AFOA 3JD3A 1ZUD1 1KSGA 2AG6A 5SY6A 2GO7A 2AZXA 5TPWA 2B0JA 1Z15A 1GUFA 1XKTA 3GL9A 2WEKA 3S3TA 1ZGAA 3N76A 3DNFA 3F1KA 2E55A 2HMTA 2K4MA 1JAYA 1I7PA 1XMSA 3W79A 1AKTA 1QFZA 3WGNA 3HL0A 5C2JB 2WUVA 5MN5A 1GQ2A 3DYBA 4HWOA 1WQ4A 3FXAA 2XMBA 3K9LA 4M53A 4BTVA 4EUHA 5B37A 4XIFA 3VR2A 3L7LA 5JS8A 4M83A 4PZUA 4BBZA 4GICA 5E1DA 1FFEA 4ZZ2A 3RNOA 3CN7A 4G2TA 1QGOA 5HCUA 2A8YA 1PYDA 4M8LA 4YP7A 3B6MA 5FRDA 2ADOA 1YFLA 2WUGA 3U4GA 1G7SA 1LQ2A 1NG1A 2H0AA 4KMOA 1JLKA 2DBRA 2J7PA 2Y67A 1LVGA 3LC1O 4MINA 2XVZA 4BN5A 1ZH2A 5BNZA 1TI7A 2J41A 1AX9A 4JLSA 5KYUB 2BEVA 5M29A 2EATA 2QTBA 3OLCX 4MA0A 1KIMA 4C6HA 3QEBZ 1GPYA 3EGDA 4G5SA 3GT7A 5G4LA 3OICA 5IJXA 2BUBA 1JTFA 4GPEA 4NE7A 2Z8ZA 5GWXA 3SBOA 4CHGA 5KO2A 1ZK4A 2QX9A 2WABA 2WZCA 1CJCA 1ABFA 1Y1LA 2QPLA 1QRTA 1U11A 5TE9A 2F8SA 3TMYA 4D9EA 3R9IA 4BEJA 1QHGA 1VMAA 3LCRA 2W6JA 3LKBA 4GHWA 4HMQA 1V8FA 3DDNA 3UMVA 3Q2KA 4QDJA 1S4MA 4R1TA 3BZWA 1ICEA 2MWMA 3PDHA 1X87A 1FUEA 1WB9A 1DDGA 1SVOA 1G3UA 4GKJB 1ZWLA 4B6GA 1TQHA 1TAQA 3DBRA 3M6UA 2G4VA 1UPAA 3DFFA 2UUPA 4Z4GA 5EKDA 4LFCB 3CVYA 2DVMA 2EF0A 1QYCA 2HUNA 3UHJA 3F3MA 5AKLA 3ORYA 3WWEA 1MVLA 1ZBQA 1A77A 1B1AA 1PJAA 2DPHA 2WU8A 1PE0A 4B9EA 3FGNA 3PUWA 3RLFA 2XXAA 2Q1WA 1KNQA 2PWYA 1JZSA 3DMPA 4TVBA 4OHXA 3QK7A 4F9GA 2HFKA 2H29A 2AJBA 2RGEA 2VJOA 4YALA 1U3WA 3E58A 3FLAA 1HFWA 4QIHA 1E1KA 5EIWA 3CKLA 1RXEA 3FNEA 2E5WA 1N2CA 3GZ4A 4JENA 1QWOA 2XCIA 3FX2A 1K4KA 1UKAA 2BP7B 2RG1A 4ZYZA 1C4XA 2BFOA 1K86A 2QW0X 2WP8J 1L4FA 4ZXFA 5FTNA 4GXTA 2EKPA 1V4VA 2CNBA 3L0DA 3T5AA 3GD7A 1J07A 1JAXA 3QPBA 3FVTA 1P45A 1LBEA 2P6MA 4BO9A 4ZOLA 2X0DA 3MRSA 4LF7B 3MK31 4EHFA 1XO1A 3PUXA 3T41A 4EDFA 4G8CA 1TT7A 1XXHE 3TPCA 2AZTA 2CFRA 1C0PA 4RD6A 4CMCA 4WNAA 1TFUA 1DIAA 3MGCA 5LBTA 2GARA 1ZH0A 4IHJA 1A7AA 1KAQA 4HDNB 4TLDA 3BF7A 3K16A 4R8MA 1WMBA 1ZISA 2EJBA 5FHQA 4KC0A 2V59A 5LNK1 1PT7A 2J8ZA 3NFYA 4RYLA 5EQFA 1EG2A 1IBRA 1QMGA 3OEYA 3FUWA 1G21E 1YB6A 4ZOCA 1CDZA 4J76A 3TNYA 5C7OO 1ADFA 3CTPA 1G59A 2QX8A 2OTCA 4ZHQA 1NHGA 1YRAA 5AJYA 4LYAA 1U8YA 1CS0A 1CHNA 3RSLA 2JRCA 5JPIA 5JZBA 1AIPA 1CBUA 4E30A 2H17A 4XSVA 1JQEA 1KI8A 1T25A 3A1DA 4H18A 6REQB 5LQNA 2NVWA 3OPYA 4KPUB 4GVPA 3SZUA 4CG2A 4DDMA 1VL1A 2OV1A 3W9UA 3LKZA 1AQIA 1JV2B 4CL3A 1OVGA 1RWPA 3ZDFA 4KBYA 4K1LA 1JJIA 1M2FA 4MWOA 4PE5B 4LJ7A 2NQ2C 1ZJ4A 2FZEA 2MR6A 3WL6A 1BMFD 1L4LA 1X7YA 3R9XA 4IIFA 1M1YB 3EEFA 2Y6VA 4OLAA 3ELDA 3ZU6A 1RKVA 1AGYA 2VDLB 1Y1PA 5ENDA 4MVWA 4QUHA 3AJDA 2BZ0A 3QMWA 3I64A 1PJBA 2YIVX 5B6PA 3B8EA 3H1EA 3HKEA 4H60A 2WZBA 1WR8A 4RH0A 1DX6A 3GEDA 4WCFC 4HS9A 2R1UA 4BE4A 3U7HB 2HRRA 4G24A 4DV7B 1JB1A 1E1QD 2IZ1A 5K0BA 1KO4A 4RC9A 1L5VA 2YWCA 1RD4A 1UQTA 4G5YA 3WLTA 3ZLBA 2C5HA 1OZHA 2QXTA 5JWRA 5A05A 3W5CA 1JP7A 3B2QA 1VGRA 1JT9A 3CRRA 3OOWA 4DCSA 5EHXA 3K71B 4W5RA 2A0YA 1EVLA 1YB5A 2G7ZA 3W06A 3T0IA 3PUIA 3LS2A 2PT5A 4YLGA 1EGMB 4PO1A 4KR6A 1Y8CA 3CW2A 1WMDA 3AF2A 3WYAA 5DM70 3O8CA 3L7IA 3F71A 3KKQA 4RYDA 3BXHA 3RSQA 3JQ9C 2EW1A 2QRVB 4LYHA 4RHYA 5JCXA 1SA0A 3I01A 3ZHXA 4CKWB 3UMYA 3U62A 1AD2A 1EEXB 1TB4A 3VZPA 1G66A 4IDGA 4PAMA 3EFHA 1E0SA 3AETA 2WKQA 1OQAA 3KHSA 3U4QA 1PR2A 3B70A 2JS7A 3THSA 3Q8WA 4NOMA 5DOZA 1L3IA 4CFSA 1JG6A 4HF7A 3BCRA 3KKKA 1E2GA 3HJUA 3G2OA 2RG7A 5FJJA 1AH2A 2W6CX 2YHBA 1QTRA 4BJ5A 5LL6P 2RIPA 3GRYA 4UEKA 3HUUA 4B75A 3CU5A 2VQDA 3TJMA 2ZI7A 2O8EA 1OLXA 4MNTA 4U8HA 3WFZA 3O9ZA 5EMHA 2PN1A 1Y1SA 2EEZA 2P9HA 3RD5A 4UAUA 4QDKA 3LWNA 1I01A 2XADA 3VXKA 2J3EA 3GLHA 5BO5A 4CQJA 2B5VA 2DFNA 2ID8A 5ADUS 1VHWA 3OX2A 5TDHA 1GAXA 1UOPA 5FQNA 1PF7E 1NUSA 5KNBD 1SB8A 4NZZA 3DYVA 3VU3A 1Z37A 4QUAA 2QN1A 3MRVA 3DV0A 1U02A 1E9SA 1RSZA 3FUTA 3ZV4A 2QTTA 4BLTA 3KLOA 4DILA 1P2GA 5KKNB 3T7SA 1NF3A 3GARA 2PSHA 3EZXA 4CM9A 1Q77A 5AUNB 1W34A 2PMCA 3V1UA 1YA4A 1YOVB 4X1IA 1ADBA 4MKZA 3SIWA 1ENPA 3BE8A 1PR4A 4X7PA 3B53X 5L3SB 5F98A 5G2OA 2I2FA 5TEWA 1OAOA 3HJTA 5EWLB 4EGFA 1E60A 3L0IB 3ZTYA 2HK8A 1Q3KA 2ZRMA 2ZYTX 3DKIA 4KWTA 4DMCA 3EEBA 4RM2A 5A5EA 1QH8B 3EDMA 2IYOA 3FPBA 3NJ8A 4TWAA 2CL7X 4KH0A 1KQNA 4E31A 1G0NA 4FE3A 3KTDA 1MORA 4M1OA 4U6NA 4BCBA 4XKJA 4F2HA 3H3FA 5P8WA 1Z0FA 1RKQA 4HGNA 4N5IX 5F35A 5TJ9A 3RVMA 3UENA 5MN4A 2JGKA 3H6GA 3UCEA 4ZC1A 2HJGA 3C3JA 4MVJF 4R31A 5EJMA 4A91A 4CUZA 2JKZA 1D9XA 3DT9A 4LHWA 1TF7A 2LKDA 4O0LA 1D5CA 2SCUA 1R1DA 2ZIGA 2QTLA 3QVGA 5LUBA 2A5DA 4MTLA 5HUHA 2YL2A 1P81A 3LL4A 3CT6A 4RKYA 1IN7A 4YPVA 2HH9A 3L6EA 3FA2A 3F6RA 3VX4A 4D6PA 2Y1LA 3G5TA 3PC2A 1E3QA 1PUIA 1K68A 1ZU5A 3DF7A 1P0IA 1W5SA 4IUCS 3EWAA 4LN1A 5EGNA 5KNCA 4QYSA 5EUQB 3V00A 2AR9A 1T3LA 4JC0A 1KH3A 1ULHA 2P0AA 3DP7A 3UAWA 2J87A 3I9MA 3OQPA 3VISA 3VZCA 2NU6A 2HJSA 4BFUA 3QWIA 4AWAA 5KTYA 1Y8RB 2ZJFA 3QPWA 1WW8A 3S55A 3USES 3AOGA 1QG4A 2FUCA 4J2OA 3OM8A 5CG2A 1XIVA 2ACKA 3NCTA 1YI8A 4OU4A 1D4ZA 1K06A 1YVUA 1DHRA 1NIPA 4HGYA 3RFXA 2PZAA 2YXEA 3QYAA 2DWQA 3UW1A 3KR0A 1CC1S 2QP9X 3JARB 1RXCA 1E3IA 3DZBA 3PWSA 4WCVA 4H7JA 4FHFA 3PXGA 5DI3A 3UOAB 1TAUA 1RT9A 1SBIA 1DOAA 1U0HC 1I1NA 1J56A 3PKJA 3TIFA 3KQNA 1VC2A 1LSUA 3C7TA 4LVNA 3G7SA 3W8DA 4F71A 5CFLA 1BW9A 3W5AA 2VPTA 5JWHA 5EINA 1VSVA 3O95A 1DP4A 1EQUA 2RDMA 2X13A 4IUDS 2HZ7A 1N92A 1F2DA 1QH1B 3K53A 5ERGB 3EW9A 3KYIB 4DB4A 3MB8A 3HTXA 3O1JC 3NJRA 3X1WA 3ZIAA 4YHHB 4RF4A 4FFVA 3D6FA 1TEZA 1XMJA 2NMVA 1I2AA 2ZCJA 3G6WA 4X8LA 3DE5X 4H0CA 4YRKA 2OCYC 3UK6A 3IH5A 1JEAA 3SF0A 1F06A 2AI3A 1U90A 3GLTA 4YC7A 2ADMA 4JWTA 4OUDA 4U6SA 1S1MA 3FBTA 1SCAA 3QFHA 1BX3A 1BN6A 1MJFA 5C4GB 3CLTC 4QPNA 3KEFA 4EG5A 4G1FA 5I7FA 4CFYA 2W42A 1A3CA 4LJLA 4B33A 3ONWA 1MRNA 5H0IA 1T5SA 1FVXA 1S2IA 1H2FA 1NBME 1MOSA 2WAOA 3AG5A 3LVFO 3PDIB 3BUSA 5FBHA 2C4TA 4ZVTA 3BREA 4DGSA 1SC9A 1ZK3A 5AKIA 2HHJA 3UOWA 3ZDYB 5JY1A 1DXHA 4W5QA 4LJRA 2PFKA 3FPFA 2VJAA 1ZJ6A 4MUIA 2PZLA 1A96A 2FOXA 1UFVA 2Z58A 1SVIA 2BJVA 4NAHA 5AJZA 3W0LB 4DIDA 5ARBA 4WBXC 1B00A 2IBMA 3IGFA 4GZ5A 1GQYA 1LF5A 2MSKA 1U2SA 1N7GA 2GJAA 3LQYA 3PFCA 5H3HA 3TO5A 3PNQA 4UQPA 3AG6A 3OZRA 2GEUA 5CG1A 2DHQA 3U4DA 4G37A 2VDWB 2G1UA 4QBKA 3JASB 1P0MA 4IDHA 1HDOA 4YJ3B 1DBSA 2L42A 3R7NA 5DNCA 3GROA 3NEYA 4N03A 4TM8A 5CD1A 1R3UA 1EK0A 5F52A 2JGNA 3L1HA 2XT9A 2TMDA 4FFNA 5DSZA 1PYGA 2AVDA 3EAFA 3L4BA 3W8FA 4Z7NB 3HJFA 1LZLA 4LJKA 5HDQA 3ES9A 3BA1A 4MOWA 4Z9YA 4FB5A 1D03A 1UK8A 2VC2B 1HRKA 1DEKA 1SXIA 4LZJA 5JAZA 1B0UA 2W6PA 4F3CA 5IT9A 3ZHBA 1P9LA 2FE4A 2I8LA 1RQGA 3EDYA 3FLEA 5IJAA 4Q4DA 3FN4A 1R18A 3VOTA 2X8WA 1QZ3A 3HB7A 5GVSA 1HYGA 4Q66C 3F6YA 4Y6GB 2F1RA 4DC1A 3H7AA 1Q22A 4YMTA 3ETNA 1XA4A 1Z45A 1JFRA 1O3YA 3KUCA 3UMGA 1UM8A 1W0JA 4Y8VA 4KRXA 1QGUB 3M6AA 5B1YA 2PIDA 4ZOEA 2A9FA 5FBVB 1GDDA 4GPZA 2I65A 4IIJF 1CF9A 2O3TA 2RGNC 3HBLA 4PU0A 4NZ9A 1VKZA 1EJ2A 3Q40A 2R6CA 4XI9A 4H2DA 1PV2A 3GRAA 5C0OE 5CUQA 4G0ZA 3G17A 1H2WA 4RZ3A 4E5NA 3AR8A 4ZZ1A 3CBGA 3WYNA 3WK4A 1O03A 4IHAA 1ZM7A 3FAKA 3UJCA 1E4OA 4WLUA 3TRFA 5L4NA 4LISA 2VHVA 4LYEA 2CMFA 1X7HA 1P4SA 1UR5A 2WVHA 4K9LA 5JO9A 1QBGA 3WVNA 1U9ZA 4GBMA 1E3MA 1GKYA 2IU0A 2RGCA 1H1LA 1U65A 5IG2A 4ZQHA 1IONA 2RK6A 3Q8KA 2NXNA 1NXVA 3OPMA 1U7PA 4ANFA 2JL1A 2Q21A 3UXMA 1ZHHA 2H54A 4X8MA 2C78A 4ZVUA 1X80B 3IXLA 1DADA 3GG2A 5AESA 1TVMA 1JE1A 1RYEA 1WHTB 4HEQA 4NYMQ 4X1YA 3TFQA 1NTOA 1P2SA 4GC9A 3WWZA 4DY6A 1OJLA 5AW6A 2X0NA 2F48A 2EGGA 3I76A 1RYBA 4TTSA 5T3UA 2GPYA 3SHTA 1EDDA 1RTTA 1U3FA 4ZEOA 3ICQB 1DKNA 3EXG2 3JD0A 2HN9A 4DMUB 1DTWB 2B61A 2WF7A 3VPFA 1M1NA 3C5EA 3V1MA 3WE7A 1YR1A 2VRCA 3K9BA 4HNQA 4RMHA 4RJJA 4BZPA 3NUQA 1RQXA 1WXIA 2K2WA 3ZD7A 3EVCA 1MQAA 4B2YA 3MB5A 4PZZA 2WTNA 5C3MA 3KG2A 3U7RA 4AZTA 1N6RA 3R09A 2X4IA 1NQOA 2HSGA 3COYA 3I8SA 3KQVA 3VDNB 2WKRA 6PFKA 2AR0A 1CF2O 4C7BA 2GUWA 1ZWKA 4U63A 5IJWA 8OHMA 2C94A 1Q11A 2H2AA 4Z1MA 4JL6A 5L3VA 2PMDA 1F6BA 3LXUX 3PQ5A 1BCRA 2ZSAA 4E70A 1HNXB 1Q44A 1ZSNA 4NDZA 4BMPB 2W2KB 1OZFA 3HSKA 3PNYA 3L77A 1HQYE 3U0VA 5C51B 2OLKA 4GF5A 4OP1A 5SZHB 3KOXA 1QWSA 3B3JA 2HK6A 1JDJA 2Q4BA 2UZ3A 3INRA 4QG7A 3VR1A 3GUYA 1RWXA 2VJYA 3B60A 3DVRX 4KIFA 4OO3A 3MTAA 3CRVA 4Y67A 5ADVA 2BR4A 5I7EA 3LPMA 4OBWA 1HKHA 3EXFA 4NNJA 4GGPA 3KQTA 3PGMA 4PC2A 1X7GA 2JD0A 1OE0A 2ZS7A 4PLTA 2ZTLA 4ZANA 5TT1A 4BFXA 2VFAA 1V3TA 1Z18A 2FEMA 4DWOA 3EULA 3DOCA 1TYDE 5IK2D 3U40A 1FP1D 1ZEMA 3TCNA 5DYIA 4EPVA 4B7ZA 1VPLA 2XUHA 5DN9A 2FCRA 3GJXC 4I4TA 1VA5A 1P7WA 3C70A 4MKFA 4RVHA 3LBIA 3WL3A 4NH0A 4X6YA 2VTBB 1P60A 4NDNE 3TVTA 1EZZA 2X7JA 3DBHA 3ZU2A 3FVVA 3OURA 1U8FO 5HPYB 4R68A 3AESA 2XWSA 4KKXB 2BEKA 2AW3A 3NTXA 3NOXA 1QYDA 1RHUA 2CD7A 4I19A 1KC1A 1YHZA 2P5UA 5BWCA 3QOFA 2BT4A 4LY9A 4N39A 3AZPA 4WINA 3VHQA 4E07A 3MIZA 1MLDA 1WKVA 2WHYA 5FLXA 1V71A 4JLWA 4ZWNA 4YT4A 3UVEA 4RK1A 1EYZA 1Y9EA 2HJHA 5J2UA 1VQ1A 4L7VA 4XQ0A 4BIIA 2J30A 4P0TA 4DR1B 4HDMA 4FFPA 1X1SA 2RGRA 2G6BA 2EARA 1YV9A 2G3YA 2XDAA 2Z56A 3HDTA 1NMSA 1U3TA 3JALB 3QUSA 4GG1A 2GDZA 4KR3A 2D4AA 3LFHA 3ZN2A 3FPEA 5JECA 4POOA 4QXRA 1P2FA 1LC3A 3ONFA 4GX5A 4BKPA 2AXPA 3R6LA 1RZVA 3C39A 2E48A 3WDMA 1Q0TA 3JWHA 4TM7A 2G67A 2F9MA 2IYNA 1EFUA 2QE6A 1I1QB 1YD7A 3PNLA 2XB9A 4UUBA 3TLMA 2NQTA 4ZT4A 3IEPA 4BEBA 3GT0A 1KVSA 1VE3A 3AI7A 3OZFA 1H65A 3QHQA 1Q0UA 1O8BA 4Q4HB 4R69A 2PUAA 1YR8A 2OO7A 4FGUA 4R3UC 2AOUA 3MWDA 5CNJA 4DJTA 4U7JA 3E22B 1NRIA 1A8HA 3GJSA 4NV0A 1UIMA 2OHVA 1PN3A 3DFIA 3UJBA 3UB2A 3C7DB 4G1BA 4UMDA 3H5WA 3TL3A 1KVQA 1MB3A 2G25A 1YNSA 4JLBA 2NYAA 4LX0A 4NJEB 4OOEA 1PG0A 3LU1A 5B4UA 1YI1A 1E6MA 2R68A 3NZEA 3KAQA 2XA9A 3B51X 4XR4A 3THWA 1BX1A 2BMDA 4MV4A 3UB3A 1W46A 2ZJ0A 2VDVE 4OX9Y 5JJCA 1ISMA 1YQGA 2JCXA 5T41A 4Z4FA 2P30A 4BVJA 2ZBRA 2PS3A 1LFAA 1M1YE 5HFJA 4AO6A 5DGCA 3ICVA 1TYAE 3KZVA 2ZRHA 1NV8A 3QVOA 3B85A 2VJLA 4IMRA 1FPQA 4P35A 4PCUA 1A4RA 2RB4A 3AYZB 4KACA 4N47A 4ON9A 1FU7A 1RHRA 1Z4MA 4LCJA 2IKSA 3HRIA 2D8AA 4MCHA 3VYWA 3U3RA 2CYAA 2IEZA 4BO7A 1RR6A 3GDGA 1PR0A 3T4UA 4DSUA 4QASA 2IP1A 2QVGA 2VNHA 4MI6A 4FMDF 4GS5A 3WC4A 3VI3B 4BATA 3BTUA 2ZROA 1RQLA 4GYWA 1S8NA 3EPRA 5KTMA 3GEMA 1DJNA 4TV9F 2O1XA 5JQWA 1THGA 2CDAA 4TRMA 2D00A 4JA2A 1GQSA 2B1IA 4Q7LA 1Y33E 2WR8A 3AY7A 3T5PA 3PXUA 1UJNA 1KGSA 2IYUA 5K09A 3O3OB 1VM6A 1LXCA 2EQBA 5LMNB 1DOHA 5K8VA 5FWNA 3NS7A 4WE3A 4WNYA 1M9NA 1CV2A 1XL0A 2O9JA 1BQ4A 3LUHA 5FADA 3VSBA 1E6LA 4DR3B 1FLAA 3CH7A 4MIEA 3KSBC 5AI0A 2IX3A 3K96A 1U7OA 1N8NA 1T24A 3HKBB 4LV8B 1HYHA 3L6RA 4ZYYA 1N5KA 4JI8B 4JCCA 4MXDA 3NNNA 2JLWA 3QKSB 4F4FA 2GM4A 1QRAA 2JGAA 4MRMB 1NX9A 3ANNA 4KBFA 3SR4A 4DA8A 5JHGB 3VVLA 3HXTA 2O0MA 4PXAA 3WFJA 1KEPA 1CNEA 1IVYA 3FCOA 1G9SA 2Y1WA 1CJVC 3DLTA 3USZA 5JRJA 4G4SO 2NXCA 3O03A 3UGQA 3LP6A 4XWKA 5M34A 1DXOA 1U6IA 4HDKB 5IEBA 1IBCA 4Y3UA 1NBEA 1W4RA 1NYQA 4U00A 1XMVA 3EW7A 5IAAA 4NCIA 3R7SA 1PG2A 3JRXA 3E3OA 3G2QA 2Q4EA 2V55B 4KITB 3GJ6A 2GTHA 5C8XA 3WKCA 2J9GA 3AVTA 4KNWA 3A4TA 3KE9A 5BWBA 2P0YA 4HI0E 3QIVA 3NAMA 1ZCFA 2BCEA 3NPAA 1R0SA 1Z5OA 4KFSA 4Y1EA 3LYAA 3TQSA 4LWZA 3GNSA 2J45A 4RZXA 4DWJA 4A36A 3DMTC 4I5FA 3W2IA 2ZLBA 4CDRA 4QGHA 1JDNA 5I7UA 3EUAA 1N2OA 1FVHA 1DIBA 5H8WA 4FC7A 1CETA 3F7TA 1PT9A 1R5JA 4TYYA 5BOVA 4R40A 1IQPA 3I0NA 3EUFA 3NCHA 4A5OA 5KTKA 4RANA 2C7VA 2VOJA 1SRRA 2DQZA 2HLDA 4TXLA 5F77A 4S2EA 5ETJA 1RI1A 3OZ7A 1VLVA 2Q2OA 3A1WA 3GJ3A 4G1MB 4M0MA 4DOMA 1VDMA 4WBNF 1N8TA 5A5GA 1ZRSA 3E4DA 4NECA 3K9HA 1FJGB 4BPBA 1AZTA 1G5RA 3AF5A 1HPLA 1VCIA 5AVQA 4UHCA 5AW8A 3QNMA 5HR5A 2JGMA 5TQ0A 1TC1A 1Y9JA 4PYOA 5JC8A 3UAOA 5DGIA 4BLWA 3B1YA 1U0LA 3IIJA 4DABA 1IAQA 3OT1B 5AHOA 1IHYA 1J6UA 4LZPA 2EOAA 5CVCA 2E82A 5DHAA 3RBZA 1ZX1A 1COZA 3JCZA 4I9NA 1G16A 1KI6A 1XEXA 1RCTE 4ZEVA 3PRJA 1CZRA 1BIFA 1UMCA 1Q0PA 1Y7LA 3SSAA 1QO0A 4V1CB 3H2BA 3KSRA 1ZIOA 2AX3A 2Z8YM 2D0DA 1U5BB 1YJ8A 2FK7A 3F78A 1DZ3A 4OQ4A 3RT9A 4RE5A 1XDUA 2IPXA 2WJWA 5FB3A 4YRAA 5GADl 1TU3A 5ALDA 3PQ8A 3QVTA 3M89A 4I1IA 4D7AA 1CRLA 3CR7A 3IPAA 1ECPA 1CUEA 4C21A 4E32A 3Q12A 4FJ0A 1S89A 2QEQA 2H4XA 4D8YA 4NARA 4L08A 1ZLXA 5F1OA 2PKXA 2G71A 2AMLA 3SYNA 4D3FA 4E4TA 4F2DA 2OMEA 1M6EX 3A70A 1XMPA 1K27A 2IYVA 2WMOB 3GW8A 3JYQA 5J2TF 2BWJA 3BKWA 4O2AB 3R3HA 4J9VA 2VIIA 3PNBA 3A9VA 4XYEA 3U3OA 3WG9A 2FPLA 5B3LA 4UVDA 1UJCA 1PDVA 4MV8A 1L5HA 4MGKR 4UNRA 1DKPA 2I8CA 2ZAGA 1DU4A 1M6WA 3GFGA 5G53C 1UKBA 2PWPA 2VPYA 1ZK2A 1YB2A 2YS7A 4TN1A 2R5NA 2BGMA 3MWJA 4W7HA 2C7PA 4A4DA 1HV8A 5FOTA 3C74A 1DIGA 3JATA 5FWDA 3EZ2A 4DA7A 3Q15C 5F2EA 3TLEA 1WMEA 3G9TA 5BYKA 5E7JA 4ER3A 1XQ6A 5K01A 4UHFA 4X7MA 3KVRA 3K70D 2XB4A 3T5BA 2WT4A 4S0ZA 4CG1A 1E4YA 5BSKA 2AD5A 5IT5A 1RRGA 4OFXA 1ZKMA 4IH4A 1TJ5A 1ZAYA 4HGPA 4YX9A 4ZI2A 5DF1A 4HZUB 4MEAA 2WVJA 4ITRC 4FOTA 3VR0A 2VYVA 2ONYA 5FJIA 5FDFA 1JSLA 1XZGA 4Q3AA 5AYVA 3SHFA 4L6AA 3BBLA 4MYCA 2ZAOA 4BVGA 3JRNA 1C8BA 3I1YA 3O93A 9ABPA 4GMGA 4R8KA 3QLUA 4CMGA 3TZEA 1Y8ZA 1NW3A 2QU8A 4BFZA 3LF2A 2H2GA 2Y6UA 2QL6A 3ADKA 2JHPA 1I4DD 4B3SB 3AKDA 4NMWA 1JQKA 1RDFA 3DMYA 4RJLA 4Y6PA 1VYUA 1ZGHA 3MS4A 2D0PB 3FYUC 4FFLA 3AT1A 1KI2A 4P7FA 2CL6X 3BD9A 2VJKA 4HR7A 3SZRA 2H5IA 1YDWA 3O4GA 3CF2A 3QE9Y 2ZIEA 1ZM2A 2CCJA 2ZYVX 3QITA 1BJKA 1ZUNB 4NBTA 2VXCA 1E5LA 2UZ4A 1PVOA 1T9ZA 1TQ8A 2C84A 1N0IA 3AILA 1QYVA 2Z1MA 3HRKA 4JB2A 2GD1O 4YAFA 5ALIA 3L7DA 4QLAA 4IZIA 2WRZA 4TSRA 4UVIA 4QPDA 3T1QA 5BWOA 5HK9A 3KE8A 1YL7A 3BDVA 1A95A 3AWDA 3F4KA 1XCOA 3C97A 3HHEA 2CNNA 3R0ZA 4JOQA 4IIGA 4X71A 1GRNA 4O4JF 3W2FA 3W77A 3L7BA 2HSDA 2X2EA 5JD3A 4X1KA 4NBVA 4CYMA 3TAXA 2DWPA 2C99A 2VHJA 4DC9A 3OLVA 3PDJA 1HDXA 3H4MA 4FDTA 4HOYA 4BFCA 1NMXA 4EIWA 4Y9RA 1VI5A 4EWLA 4FJ2A 1ZQ9A 3Q3VA 4HQRA 1ODFA 4ID3A 3RIGA 1EWYA 1JE0A 3F2VA 3CLVA 1JKIA 3EVAA 4KH1A 5F1PA 1NZJA 5AXCA 3GH1A 5ITSA 4UEOA 3VJKA 3P96A 1IUPA 1V7CA 3EA4A 1II8A 4EW6A 1Z62A 4U9IS 2DP4E 1Y8QA 5H02A 2P8SA 5IBQA 5KHLB 3THXA 2J07A 4JUCA 3UOGA 3JR7A 3SR3A 1I14A 2GPNA 1DIHA 4XPIB 2OCAA 1VKHA 4Y0VA 4KGZA 4NX2A 2B3TA 3Q8LA 1FXWF 2HXYA 4KRYA 1UK7A 1ACJA 4ND1A 4KQXA 3IE1A 1PT8A 4R1SA 4E1AA 2EIXA 1MC8A 1LVUA 3HCBA 1U2PA 5BR8B 3NWJA 2ALJA 3LX8A 2FP4A 3FCXA 2H06A 3OQOA 3MLBA 4A8JC 4FM9A 1UAGA 2QK4A 3SD7A 3Q0IA 3TLZA 2VSOA 2E4AA 5TPWB 2XSZD 1F51E 5G1OA 4EG4A 3GQVA 5ALGA 2BM1A 4LFBB 3O4JA 4RQAA 3GLVA 1D2HA 4QVKA 5CYPA 3CMMA 1Y7IA 4A6EA 1TM2A 2HU8A 2QJOA 3HA3A 4KXYA 2IE0A 1KL7A 2LW7A 4RFSB 4GQAA 4YMHA 1HY3A 5IHXA 5KHOC 1DPFA 1KORA 1WZNA 1ZKDA 1T8SA 1Y7PA 4HYQA 4RABA 4WIAA 4YRZA 1I3LA 3OO1A 1GJRA 5KNDH 1QQBA 3DEKA 2EV9A 3LYHA 4NK4A 1YRBA 3A9UA 3HCCA 1MIOB 3EIWA 3H5VA 3MS7A 4P86A 4Q6WA 2XT6A 1ISSA 2BDUA 3RVKA 3S1AB 1W7AA 3H0EA 5ADHA 1R0XA 4HWPA 2GCEA 4IHKA 5KWSA 2VLBA 3QVKA 2V7QD 1P72A 4MHTA 1NUTA 3K8QA 4MPPA 3IYLW 1WCYA 3IAXA 3O2SB 3B8HA 4ZVQA 1OPRA 3LUCA 3UG6A 1L7NA 1QHYA 4G0XA 3SLKA 5E1BA 2XMRA 2P2LA 2R2GA 1TW3A 2WAYA 5ALMA 5GGXA 1SKUA 1UPFA 1Y5NA 1Q15A 3L7CA 1F8GA 4LHYA 1G8MA 3ONEA 3RLIA 2UUAB 4B6OA 4K26A 5FTJA 2QTMA 1WUHS 1NFQA 2SBTA 2VXBA 2ZRBA 3LWDA 5KYNA 4GRAA 3NHKA 1U0JA 3DVQX 4DR4B 3OT5A 3OZSA 3A31A 3D7RA 2WBLC 4NQZA 4WJZA 5JXJA 3PFIA 3SM3A 1XTIA 1ZQ1A 3I0ZA 5TQ2A 2OAQ1 3SFVA 1BQ3A 1V3UA 2RKWA 1BRMA 3EF1A 1W36B 1N5DA 1Z12A 4KWIA 3X1XA 2AUMA 2G5TA 3L5KA 3QOWA 1ZI8A 1C5KA 3ESBA 3HUDA 4R2IA 4AY3A 4Q1EA 4TTAA 1XALA 4FUTA 3EGXB 4Y9TA 3X1YA 3H6KA 5DX0A 4B7UA 1WZ2A 4R1NA 2R2AA 1QGYA 3VHLB 1GA4A 2C9CA 2VXYA 2Q0XA 3TR5A 1OLSA 2SHKA 3CF6R 4RK7A 2BMEA 5CBKA 2RSLA 4Y9UA 3WYDA 4BC0A 4YR7A 5LIPA 3WA7A 2YZGA 2EIHA 1HC7A 3IP6A 4WK4B 4CL8A 2JH3A 2FWMX 1T1IA 1NSFA 2R48A 2W8ZA 3PRHA 3GEPA 3TUJC 5JJ5A 2OP0A 1I13A 4FDVA 4DNXA 3P9NA 4PLZA 2J0SA 2O54A 5CVVA 2IUSA 2Q41A 4MIOA 4PFJA 4ZOLB 1P3JA 4YH1A 3V1LA 4B85A 4O4LA 4F85A 2J48A 5D5PA 1IZZA 2FSFA 3RUFA 1CFJA 4IGIA 1AMOA 1QDEA 1MAUA 3E9YA 2A3NA 3ZYZA 1OX6A 3FW1A 2V6FA 4MRSA 4CCYA 2EP5A 4U8GA 2B1GA 4I50A 1NW6A 2P9YA 3AR7A 5B7QA 1EE1A 4K9RA 4ZAWA 3ND8A 1W87A 5A03A 2QBYB 3OWXA 3MTJA 1T36B 3F8WA 1EHYA 4IQGA 1ENZA 2O52A 3ED1A 4J4TA 4RL4A 1WNFA 3F8SA 2A1IA 1ENOA 5FUMA 4C07A 4ZHQB 3JQBC 1KOJA 4KPEC 5JS7A 3U09A 1LSJA 4EPTA 1D2CA 1Z7YA 2P91A 2ZYRA 4P80A 2CKDA 2A59A 4M37A 3VPBA 2XQKA 1UMDA 2CXOA 2GN4A 3QG1A 4DJEC 5KSWB 3T3NA 1J7KA 2FTKE 2XZOA 2FGJA 2B36A 4ID9A 4DLTA 2IDKA 4WESA 4K88A 4WXRA 3L7OA 4Q48A 4GZ6A 3VOAA 1C1XB 1D6NA 3WDLA 5KTRA 3NHSA 1RZRD 1DRUA 1VHTA 1VBNA 2XLCA 3JQEA 3D4BA 4PLGA 4BGIA 1IEXA 4S3MA 3A4LA 2ZT7A 3ZPXA 4YAWA 3SX4A 1NP7A 5JADA 4E09A 4WVFA 1FX1A 3AK4A 3GPCA 4UBOA 3K70B 3NKVA 4N65A 2OBXA 1KEKA 4L57A 1B74A 2V7PA 1J2JA 1GUAA 1G8KA 3FSEA 3QH4A 1EJBA 2XUIA 4GI1A 4LZAA 4Z9FA 2ZT8A 3P4XA 3ZKWA 4MR8A 4E2YA 1MZPA 2RCYA 2ZE7A 4J9UE 4UD2A 2ATEA 3JWEA 4CG0A 2XXJA 2B6NA 5G1PA 4CTKA 1EAYA 5D2CA 5DU2A 2GCPA 3AFGA 1BDIA 3QBDA 3NOQA 2RKBA 3A7EA 1KJYA 4UUNA 4DQDA 2O20A 2JAXA 2P5TB 3NORA 3ENVA 3FPGA 1WBJB 1IWOA 4CM8A 4J6EA 5A1JA 3BHMA 1EM6A 4IUBS 1YS6A 1ZD5A 4OG2A 2BTEA 4OLHA 3RTBA 3HXMA 4N6NA 3NGLA 4JT4A 1VKOA 2GZ3A 5F1YA 4RLFA 4DIUA 1FJXA 1Z73A 4JX8A 3A1SA 4PFQA 3PC6A 4AP5A 4Y98A 1U7TA 3DPIA 3D6TB 4CU2A 3JWGA 4DRXB 5KPDA 4DSNA 3GEEA 2WWWA 4M0CA 1YZTA 3DOOA 3GVCA 3L49A 4O5AA 2GTIA 5JCPA 2FG6C 1BYUA 2P2DA 4JP8A 1OY1A 3QXGA 1SC4A 5LB2A 3PUYA 2BHNA 3WYEA 1OH8A 2ZJ5A 5I6DA 4AP9A 5KVAA 1YT5A 1FJHA 1QF9A 3GBVA 3LD9A 4M0PA 2AG0A 3CKMA 4YV0A 2XBUA 4QDUA 2X7XA 3KL4A 1L5SA 4YXWD 1QQAA 4BMDA 3VNQA 3EGCA 1WCV1 3U5ZB 3ELWA 5AJVB 3KSUA 1PS0A 4WLFA 3MT9A 2ANBA 1Q1GA 1XDWA 3E9QA 5FX2A 3GP5A 3QXHA 4GYKA 4PPQA 1QQ6A 5DTIA 3KV3O 4S04A 2C9ZA 4EUSA 1E5VA 2J6HA 4XE5A 5SZIA 2AHRA 2FN9A 5HTKA 2QLTA 2ZT5A 2Z9BA 2XCQA 3HXOA 3GLHB 4Q9HA 4YV1A 4B3CA 3KOMA 3TUIC 2YOHA 1E1LA 5ERXA 1YGPA 4GXQA 3GDHA 2Q07A 3NTRA 4J0EA 4PLPA 4Q3DA 2GCIA 3E81A 5CW1A 5HF9A 4LOAA 2E4VA 4HLUA 4HNAA 1CQWA 2HFJA 1BVYF 2RI6A 2WJ3A 4XAQA 3GXBA 5CM2Z 3DV0B 2CUKA 2Z0MA 1XTUA 2RH8A 1M73E 2ZJ3A 3EVBA 4P1ZA 2IH5A 3AFIA 3T06B 3EHDA 3WMGA 5JTTA 3EEYA 1TLFA 1RLMA 1XWIA 1H94A 3SP1A 1XZFA 2WA2A 1T0JB 3D4IA 1YZVA 1NVXQ 2Q3CA 4FYMA 4H9GA 3IDAA 4KGXA 5KYXA 2ZZMA 2ZJ2A 5B12A 4MQLA 2XQFA 3UHPA 3U1VA 2RHHA 4W8HA 3EA5A 1E77A 3P27A 4WXEA 3KJIA 3Q41A 4LBWA 2W90A 5EFOA 2C2HA 4FPXA 3KXIA 4PLCA 3NHJA 3ONDA 1JI0A 2ECFA 2EAUA 4JK3A 4MWGA 3Q5GA 1C8KA 3GHHA 4GVLA 1PFQA 4QQRA 1ST3A 3FFAA 1LPAB 4IFTA 4P2GA 4XM2A 5C5IA 3GBPA 3EARA 2WB4A 1PGQA 1N2SA 1R4MA 1SC1A 1NN0A 3IMGA 1UOQA 2JASA 4PYLA 5ALPA 4WEQA 1LPMA 1DX9A 3MSCA 1J42A 1GT6A 1OGIA 3SC2B 4YMVA 2EWMA 1M0WA 1XQ1A 1MGPA 3DT6A 3WLPA 2V45A 1JKJA 5HKOA 4WI1A 5KX5F 1CJUC 4Q3OA 4ZCSA 2CV0A 4YRLA 2GYWA 2QN3A 3RJZA 4XDGA 1WS6A 2W8BA 5JSZB 3EMVA 4L85A 1NT2A 3O31A 3ZU3A 3HK2A 4RULA 5CTAA 1M8PA 1Z68A 5DX1A 3ZV3A 2AWNA 1RC8A 1GPKA 4LX8A 2EDCA 1VDZA 4YLEA 2PD3A 2Q99A 3P97A 3A6PC 4MUFA 4HPXB 2WM3A 3GCXA 2VUHB 1X0VA 1EQAA 3CNBA 4HH0A 2VYFA 4EGSA 5I7RA 4IY1A 4LYFA 4DA4A 4DM3A 2AFRA 5KYYA 3OSZA 4BZQA 2ZTHA 2XNDA 5DI3B 3RFCA 2ATVA 4RIFA 2R7LA 2ZB3A 4D0LB 2A4MA 4RESA 5BR1A 4QVIA 1BW9B 1DIRA 2XTNA 3ND5A 2HHCA 4YJ2B 3KQHA 2EFDB 4Y1RB 4EQ6A 2YXBA 2JLQA 2QPAA 2YH2A 3N7TA 3H5LA 4ZVNA 3X3HA 4DIKA 4LCBA 1FS4A 2EBHX 2H0QA 5FA6A 2QLNA 3DUFA 1QAQA 3ETEA 4Q3LA 1XDDA 1UQRA 1KYWA 1P2VA 1RWBA 4IEFB 2G72A 4ASUA 2WLSA 2VN8A 3I5AA 1SPXA 2B4YA 4HS4A 4LMBA 2J9XB 4E5PA 5ALHA 3LGSA 3AEQB 1PNOA 1Y6JA 4S1VA 3KAPA 2ZTMA 4EVQA 3FYTA 3GGGA 2AE2A 3DQPA 3S70A 3V1KA 3RYHB 1KHTA 1RJDA 1WEHA 3DXZA 3HEMA 4M0UA 3Q9NA 4N7RA 3ADCA 1IOLA 1BCSB 4V0NA 1ZGJA 3MIIA 4IHQA 5EKXA 1QZZA 4EF5A 3OF2A 1KI9A 2UZ1A 1QAMA 4HD8A 4QJ4A 2IV7A 4CQNA 1Z0IA 4JX9A 1U94A 1QHEA 1K5HA 3MUEA 4P53A 5ENVA 4ZAVA 4EB3A 4R6XA 3RRMA 4EUNA 4OM8A 2QXUA 4ZVLA 1QZXA 4YACA 2Z2YA 2OHHA 4PANA 4DG9A 1X9HA 2R7NA 2QRMA 1Z5GA 5IJ9B 3L01A 4G26A 1KDOA 4KG7A 3W8EA 3D8HA 1IM2A 2WHPA 4FCVA 4X24A 1Z0ZA 2H92A 1BN7A 5H4HA 2YRXA 1RJ9A 1PGJA 3CXUA 821PA 4YIHA 5I8WA 3WGLA 4D82A 4ODIA 2GOYA 2NUTB 1B76A 1T3ZA 2AEJA 3MTGA 2B92A 3AUFA 3FB1A 4RU1A 1CPYA 4NPHA 5F12A 4P0QB 1LU9A 4A2WA 1KMNA 1EAMA 1QHHA 2L2QA 1VYHA 2C2BA 3F49S 1WP9A 2GEDA 3VR4H 1FSZA 2J5KA 4CM6A 4I2VA 1JDSA 4XARA 5ALXA 3O73A 4UPVA 4YRJA 2UV8A 4P3OA 3MBIA 1E2DA 2A9OA 3CUKA 4OQLA 3CZAA 5GONA 1SXPA 2DJIA 2FB9A 4U3JA 1KDYA 1SZJG 3B7PA 2QUKA 1K6EA 3V3TA 1M8FA 1J70A 1P8AA 4BS9A 2O8CA 1MW9X 1YI0A 1T5DX 2CBZA 3QNWA 3WGQA 3H87A 2XTJA 4WDRA 3SCZA 3FOCA 1N77A 2W2TA 3P2IA 2IEAA 2PBFA 2QTWB 4HXEB 4LDQA 4Q15A 5CT5A 3WOHA 2I3BA 2VVTA 4K2HA 3V4OA 4E2ZA 3AEKB 5LQJA 3TZQA 3UMCA 5F78A 1F2VA 4JBNA 2QRHA 1AKVA 2EFHB 3L7YA 4CMIB 1UBCA 1PSZA 4DV4B 4QYMA 5DP2A 2X6TA 4DYDA 1TZMA 5EHQA 4PSDA 5FPKA 3V34A 4DRZA 3EN0A 5F2NA 1JJVA 1YJAA 3I2HA 4DEXA 4AECA 3HZHA 1GRRA 3NWBA 2WUWE 1RI4A 3A6DA 2RGGA 1JFFA 1GTJ1 4DCGA 4CETA 1CDEA 4N5LA 3F9CA 1LSSA 1U7ZA 1RJFA 1TKBA 2KLHA 3F5SA 4TZKA 2OOKA 1VL0A 3LUJA 4OFZA 1YBFA 2WKWA 2ZSBA 4G0QA 4DM7A 1HX7A 5K3FA 1JJ7A 3HQ4O 3S8YA 1Z8FA 4OJTA 4CV2A 3DZ8A 4B2IA 4E14A 1W49A 9LDTA 2CB0A 2PH3A 1ZK0A 4F72A 2GF0A 2FR1A 3CNLA 5HM8A 3O90A 4UXJA 4DE5A 4HAOA 3U3DA 2XJ9A 3ZK7A 3UC9A 1J2RA 1UIRA 1A5TA 1RBYA 5CTJA 2FF5A 4HTFA 3KV1A 4FZJA 2IGBA 4LS3A 5ALNA 5JALA 3IUQA 2RGYA 4BGDA 3OCJA 2FKAA 1VLLA 3A0RB 2QKYA 3H19A 2CNKA 1YQTA 3HYCA 5KYGA 2RD2A 1LRJA 4B6SA 4KDRA 4E5YA 2HD4A 4Z9XA 4YRGA 2BGWA 1I5OA 3FVWA 5ELMA 3HA5A 2VWHA 2ZRDA 3HPRA 3GUVA 4J4BA 1XMIA 4MCJA 5DM0A 4CDGA 4ZKDA 4MW2A 5KTSA 1VP3A 5ELXA 3ETDA 1RXUA 4OQPA 3CLRC 2IBSA 1SU7A 1MG5A 1UP6A 1O95A 3DEJA 3IQXA 3HBAA 4RD3A 3QEOA 1NKSA 3CLHA 1ELOA 2W4MA 4DDTA 1ZPDA 2D5CA 2QR2A 1ORTA 5CJPA 2JFNA 3EMBA 2W37A 1SXJD 1GDTA 1S02A 4G5QA 2VP2A 4YAUA 3JQDA 2P4QA 2CHEA 5IH3A 5JV5A 1H8EA 4P81A 16PKA 1D9ZA 5JS1A 2QVYX 3V3KA 2R1TA 1ZXLA 1NONA 3N8KA 4MV5A 4QSMA 3UAXA 2FR8C 4AICA 1C30A 4A0SA 1G60A 2JI8A 1NJFA 4TT3D 5CB4B 2AYYA 3PHBE 1PFYA 4IXWA 1WPXA 3ZHYA 4ALMA 4M36A 3NEAA 4ARAA 2AXNA 4PVCA 4I55F 3FZNA 3T6KA 1V3QE 3WLEA 2AF4C 4YQFA 1E6EA 1PBNA 2ZKIA 4N49A 1E66A 4NY1A 4W1RA 1U7WA 4HB0A 1Q1BA 2AQIA 3RVQA 5JO0A 2JBWA 4NULA 2BZSA 1MO4A 3NDPA 1O94D 4ITVA 3ZE2B 2XKBA 1VPEA 2A1TR 3CBQA 3PXDA 3TE7A 3MCAA 1D1QA 4MP6A 1AUXA 1M2VA 3KT0A 3CW9A 2LVBA 3S2ZA 1T2EA 5L4SA 5LZ2A 1SXQA 3AESB 3KU4A 1LWOA 3ZHCA 1ZIXA 4H3SA 4NH4A 1V5FA 1Z5PA 3BMQB 1BHQ1 1SGWA 2XLBA 3HCNA 4BCCA 1JQ3A 2IZ6A 3BIWA 4GW3A 1JEOA 1NRWA 2NM0A 4X44A 5CURA 1LA2A 2B4RO 2Z6QA 4OGKA 1EVQA 3DA8A 2ZP1A 1CUHA 2VDUE 4MLPA 4LG1A 4WOBA 2PE5A 4B34A 1XVUA 2WT9A 3O3MB 2XIJA 3K2BA 1K97A 1JA0A 4MR7B 2R62A 3O4IA 3RYIB 3KSDO 2G40A 2NXWA 1U0FA 2GERA 4EJ2A 5FL3A 5EJ5A 3TRDA 1TCCA 4TS1A 5IMSA 4IH9A 3LZCA 4Y2HA 3L6BA 1VXRA 1K1EA 2FX5A 1QUEA 3K6RA 3QU4A 4PRZA 5KPJA 3SHQA 1WKCA 1DC6A 3W34A 1K08A 2PGLA 4C0LA 4N8EA 1IN1A 1RWMA 1YE3A 3RARA 4Z2YA 3PFWO 2ZSEA 1P6UA 3GUUA 4Q3NA 3UJ3X 2KQUA 4GOXA 2Z3WA 3MWFA 3WNVA 1FNCA 1Z6XA 4I8DA 3GVPA 2GK3A 3JV7A 2Q1SA 5ITZA 2JANA 3DXFA 1QYXA 1XTSA 1YFKA 2HIMA 3GPDG 5DHUA 1BFDA 3UNXA 4RIHA 2PD6A 2VHTA 3HR7A 2ZFUA 4TZTA 5HIJA 4OI0A 5JRZA 4NNPA 1JR4A 4NCAA 2FMFA 3CVVA 2JIZA 1JZQA 1Z3CA 4FSDA 3LDUA 1OFTA 4L5BA 3IAM1 4RJIA 2JLZA 3OZWA 3O26A 4DSZA 1F0NA 1GOTA 2P2ZA 2AN4A 4LNUA 1ULBA 5HZMA 5B7GA 1WTAA 2I1LA 3PB3A 4MVJD 3BA6A 5JSUA 2D1RA 3H9EO 1SU6A 2R5FA 2IEDA 3N05A 2PNFA 3RV4A 2HWWA 3PX3A 2FRDC 1KS2A 1BKDR 1PJ3A 1OI3A 5AUPB 1H42A 1NTRA 1QG0A 3N9IA 1DQRA 2GASA 1LW6E 4N7BA 2HA2A 1I0ZA 3CWZA 1NVBA 3U4AA 5P21A 1UM9B 1ZJYA 2BM0A 4QFDA 4WOPA 3AQIA 1V1RA 3QA3E 5KQMA 4YEDA 1IBLB 2PGDA 3UFXB 3E7FA 4FDLA 1K7CA 5SYNA 3H4VA 3KQLA 1Q0QA 2BMFA 4KDEA 1PFWA 2VJPA 2E89A 4Y2RA 3RSCA 3WGZA 2P6UA 1RLJA 2PGJA 1QFXA 1NI4B 4B45A 1SXHA 3TGPA 1R88A 5K9ZA 4PGFA 3RQSA 1ODIA 2R5WA 2OHJA 3HLKA 2PK3A 2CXTA 2WQ6A 1K7SN 3OETA 4JJ6A 5HZKA 2WYIA 4LVUA 1U28A 1S9DA 3LXRA 3JSAA 3PPWA 5MFPA 2P79A 1XYYA 3DL2A 1EWQA 1JDUA 1PNQA 3OSUA 4KUEA 2WY2D 3UH1A 3SHVA 4LRXA 4DRYA 2V3WA 1W4ZA 1G19A 2AOTB 2C61A 1B93A 3G68A 1UKCA 1NXQA 3I2YX 5HJ2A 4DSAA 3EGVA 2F64A 1V5IA 2R6AA 4BNDA 2K7FA 3TTUA 1DTSA 2WFAA 1WCWA 5KNCH 3AL0C 5LYJF 1QBKC 1K8XB 3KR2A 2EQ5A 1AZLA 3PGLA 3PQ6A 4FSXA 4HMOA 3QKIA 4UU1A 2CV1A 3DKVA 4EA7A 4M98A 1TQ2A 2ZUFA 1I32A 1O0SA 2HV9A 2QTZA 3A6JA 1W5AA 2AE1A 4QEDA 3UGJA 5LNK6 3MAAC 1CIVA 1EX7A 2DFDA 4V0MA 1G6Q1 4GWLA 3E9RA 2BKVA 1QQ7A 1N2JA 3CX8A 3NHMA 1BXGA 1KR5A 1T4DA 3WISA 4XD2A 1NZDA 1IM8A 2VJMA 3DJYA 5BW8A 1IATA 1NN5A 3MWEB 5KVVA 2QTGA 1XF1A 2HHAA 3GLHE 2CSXA 4NHEA 1KK2A 4MAFA 2PPLA 4F3NA 1JXQA 2P2GA 4F92B 2VAMA 3BXEA 3INTA 2JI4A 1EDEA 4RVDA 3RAJA 4LKOA 4TTRA 5JBIA 5D85A 1YKGA 2ATCA 2XCSB 1O8CA 4BUZA 1RI5A 3I9OA 2PPVA 4D4MA 1JH9A 1NFRA 4JR0A 5GOZA 5CYFA 5U1PA 3TWOA 1WRBA 3PX2A 4R9VA 1W94A 3RGWS 4PZ9A 4RMNA 5JVDF 1MJNA 2Q8QA 3OU7A 4QUEA 3UAVA 1RU3A 1GCIA 4BX8A 2BE9A 2QZSA 5ELLA 1V9SA 3IMCA 2NW6A 3M9LA 3ESQA 2BD0A 4OJYA 1EJ6A 3L40A 1A5AB 1VL8A 3FY4A 3IO5A 4RIIA 1UPUA 3CZQA 3FPKA 5IBCA 2BAGA 3WR5A 2QDKA 2B8TA 1C0KA 2RC6A 1CCWA 4U02A 4QREA 3ZTWA 3TG8A 3B6KA 2C07A 1NASA 4GMDA 4OLBA 1CR2A 5AW4A 4DPLA 2J3JA 5ALWA 1XL1A 3DH0A 1RABA 2WA1A 1CYEA 1YVDA 4H27A 2B4AA 2QZZA 2PKWA 3AJ9A 1F48A 3LX5A 4NOKA 3WQBA 1WTCA 4D44A 3DAGA 4B2PA 1TUBA 1A7JA 1D1SA 3RAGA 5BMOA 1XDZA 2B34A 1E99A 2GAIA 4FFWA 2QAIA 2X4GA 4B1FA 4Z0NA 1HNZB 1HZZA 1VMKA 3I9FA 4HQOA 5LP6C 2O5VA 3BE4A 1VBMA 1L5KA 3KWFA 4EW2A 5JAPA 3GFBA 1XK7A 4HGQA 1YQEA 2O8FB 2Q4RA 2R6GA 3T1NA 4WKGA 3B9BA 3GAFA 1EWRA 3HE3A 4NKRA 4RKEA 4DCOA 2VH5R 1ZGCA 2PXAA 4BNFA 1B8NA 2SKDA 4BZXA 3BGWA 1JLLA 3OZCA 1GAWA 2IXTA 1Q50A 4G0YA 4UATA 1WVMA 2F43A 3P9PA 1SXJB 3IR7A 4WZAA 1H4TA 1SK8A 2VR1A 4DKXA 1O87A 4BNVA 3T5CA 1HH4A 2MIIA 1M5RA 2J9ZB 4JASB 4WX2B 1NW8A 1I4TD 1OROA 1US8A 2BR3A 3VZRA 4CM4A 2Y05A 1D0SA 1IEQA 4UEQA 2PEYA 5KKAA 1QNFA 4HWGA 4YMSA 2EZ9A 4TUYA 3G8AA 2MMGA 3BJIC 2PUEA 2P41A 3PGXA 5CFMA 2QS9A 5AUOB 3D6MA 4L4ZA 4U7WA 1N0HA 3D81A 2XF2A 1YKSA 3NWEA 3TE6A 4UNQA 3CZ4A 3WL4A 3GMSA 1V7PC 2XT0A 1V96A 2GBLC 5A4AA 2CLMB 2O4UX 1FTNA 3JXEA 1FP4A 4WOKA 2ZJZA 2NAFA 5HMLA 3FKSD 3RC3A 2VHWA 4AS3A 5H9WA 1EFHA 2QMUA 5IEJA 1Z63A 3IA2A 3HEAA 4DNOA 1UMBB 2PWZA 1V48A 3ZW9A 3BORA 3MT8A 4DLLA 2JAQA 1V8PA 2II6A 1EUDA 2PV7A 2GYYA 5EZYF 4PYNA 1JBEA 1TKAA 5DTEA 3JATB 2RE8A 4YDQA 1GQOA 4BLPA 5ESXA 2GD0A 1WD7A 5LA6B 2OG1A 3VHRA 3U3ZA 2I2WA 3EMDA 5CFQA 1UJ4A 2DU8A 2PCLA 3L8ZA 1R0BA 2JDIA 2X8BA 1QHIA 3AR3A 5IYZA 3WIOA 1ZVKA 2DPLA 4H4EA 4WA7A 3NX4A 2C83A 4B8ZA 2NSYA 3PZRA 5BQOA 4U2FA 3FUUA 4QYIA 4G0MA 4NE2A 1CXZA 2BUAA 3PTLA 3ND9A 3QMMA 1J20A 1ESDA 4JOBA 4MH0R 3FTFA 1LPNA 2JLBA 2ZRLA 3H13A 3L8MA 2LKCA 4YBRA 4A0FA 2ATIA 2YIDA 1PG5A 4GP7A 5FIUA 1HBJA 3VNSA 3V2UA 5J4YA 4BMZA 4HWTA 3OQIA 4UUMA 1TE2A 2ORED 5FBRB 1VJDA 5AK5A 4OHMA 4AKIA 2DC1A 2OCXA 2PZFA 4O4IF 4XVCA 3PR3A 3TBFA 3OBIA 2XOKA 1D07A 2J4CA 1BEEA 5EUBA 1M8JA 3T3IA 5CFPA 4ZEXA 3I61A 4DMGA 4KCGA 1SG0A 2J33A 3T8YA 2JVIA 2XCOA 4OYRA 4Y2YA 2YIJA 1UKYA 2R3SA 1PFGA 1YS7A 4KLNA 3WK7A 5IABA 1N0UA 2P2SA 3HB5X 1ITZA 3UXEA 4BRWA 1FFAA 1Z83A 1IB6A 3F46A 3ORRA 4XVQA 3OZBA 2VXOA 4ZCPA 3EISA 3ZGVA 1P9NA 1T6YA 2OD9A 3BTSA 1MDFA 4JLKA 5AJHA 5DFAA 3PPVA 3IDFA 4O25A 3HCFA 3KZMA 4Q4AB 1RBMA 3M34A 2HI0A 3DZFA 2CBXA 2YICA 3DTYA 2VF8A 1FNSA 1T1SA 4IFEA 2WG0A 4ETWA 4GL2A 1XZPA 1P0QA 1JDBB 2Q1YA 3AR5A 4WXYB 3CX7A 3I9NA 2P9FA 3IMEA 4MWDA 2HXSA 4AUKA 1A9SA 1SHUX 2B69A 2OMKA 4UASA 1XTTA 3I9V6 4UBLA 2YJ5A 3NM6B 4EQZA 5K0SA 1JKFA 3FMIA 3IIEA 3EHEA 4GR4A 2NUAB 1II8B 1Z4IA 2ERXA 2QRGA 1TAGA 2YXPX 3IODA 4MI1A 2GGSA 3A3YA 3D6UA 2IYLD 3NFRA 5C1IA 3OZEA 3TTXA 3THXB 2I7XA 4L9WA 1G7RA 1QF6A 1THMA 2FPPA 2ZI5A 2HSJA 4UTXA 2ZVPX 4D8XA 3ECAA 1N7JA 3DL4A 2WM2A 3JWJA 4OD0A 4LA4A 4GX0A 1KYIA 3VH1A 4DCCA 2JARA 2XE4A 1R9NA 1GR0A 4FYPA 5F3RA 1BDJA 2Z1DA 1K6IA 4YJFB 3OEHD 4JKYA 1KDRA 4HQNA 4Y2UA 1RXVA 3HB0A 3DG9A 1M6VA 4IDAA 1GUDA 5T64A 2W43A 3FG9A 3MHPA 3ST7A 1TYZA 4EHNA 4F97A 3FCUB 4I1YA 2RHTA 3ZE7A 3OEWA 1PK8A 1L5ZA 2QLBA 3PUHA 4BV8A 1KZ9A 3NEJA 3AP2A 4WV3A 2V7TA 3NP9A 3D0KA 2YVAA 4EY7A 4U7DA 4C08A 4IJWA 2Y99A 4YK7A 2CHUA 3TL6A 2F3RA 4NYIQ 3OCUA 2OHXA 4TTPA 3HFGA 4F1KA 2FJUA 4EY8A 2CNWA 3HMKA 5LDHA 4AKGA 2PYIA 2C5FA 4YAIA 1AQUA 2QGNA 1QVRA 2GAAA 3MOIA 3OLXA 4OSEA 5ECGC 1FDRA 3GX1A 4OBXA 3RSGA 4JV5B 1VOTA 2VZLA 2ACVA 2JIRA 1B6SA 4I5DA 2ZB7A 4CNQA 1Y3AA 3NWPA 5CP8A 3CNHA 3HXPA 1XAIA 5AJXA 3F98A 3ZWCA 5BW4A 4QEZA 3OZUA 2ZUBA 5C5CA 1JG4A 1W8DA 4UAGA 4K8OA 2LIPA 3UT5B 3V46A 2Z08A 4M54A 1U0TA 2C3YA 4UVGA 4M60A 5B36A 1K3FA 3ODPA 5IPFA 2NO5A 3DD5A 2FRXA 3N7UA 4J91A 5EZ5A 2YIMA 4TXNA 5H3LA 1XRJA 1XQWA 4A73A 1ADGA 2YVKA 4MGEA 1E92A 3PUZA 4UDNA 3H5NA 2I6TA 1NWHA 4PHHA 1AV7A 3I30X 4B4KA 3TNFA 2Y71A 1WZIA 2W71A 3ZR4B 3HABA 4GGOA 1Q0RA 4F8YA 1G1MA 5E6RA 2PQ0A 2JKYA 4GLLA 1FRQA 4E21A 2XZTA 4ZYVA 1SBZA 4BVBA 1NRXA 1TD1A 2HBZA 2CD9A 3ELUA 4P7GA 5JOQA 2GCOA 5B1HA 3U1BA 1QP7A 3IIIA 3GGSA 2ZI9A 1RJWA 3C5HA 3DLCA 2HLNA 5LJLA 2XUZA 1TADA 3NDIA 2OLEA 3VGPA 1TJNA 3L05A 1RWKA 2PYZA 4HP8A 4ARIA 3PHJA 3N2KA 4I66A 1KKLA 4N0QA 1KO7A 1EWKA 2OV6A 4IPTA 1II0A 3NGXA 1H1DA 2ZANA 4JP1A 3IIMA 3I52A 2FZVA 2HF2A 3TDKA 4MUNA 3VKHA 1WCIB 1XTBA 1ZAKA 3AI3A 4KUGA 3PC7A 5C1OA 1U8UA 1OXBB 2IITA 1CZKA 2YV4A 1R5BA 1BE1A 5IAOA 1MHPA 1XZEA 2OQRA 3LDHA 5BN1A 1GZHB 2J3QA 3OPXA 4FW8A 4UDYX 5LDGA 3VR4D 4B4WA 1BDHA 4PLYA 4O4LB 4FFMA 1A9RA 1T8TA 4O1IA 5C8YA 1YA8A 1I10A 3B1FA 3FTCA 4PS0A 3IPRA 2OZPA 4EBBA 2HTEA 5B3KA 2PMKA 3GLGB 4ZCTA 4LQ4A 1W4AA 2JI6A 4FYHA 3R3XA 1XD9A 3MMNA 3BXFA 4S1TA 4A92A 4BO6A 3E53A 1TNDA 3BRQA 1YJQA 1DDOA 3CLUD 1NVWQ 4JELA 4UVEA 4WLEA 3RIHA 2B4QA 4DJJA 1NIJA 2GX6A 2AK3A 3QF4B 2CDCA 2X3YA 3B3GA 4JY7A 5AHKA 5KYWA 4PYMA 1NSYA 5A7FA 2OC9A 4YI3A 4ND8A 4D02A 2BLNA 4IYJA 4QA9A 5HJ7A 5IZCA 2C31A 3ILYA 1T1GA 1NBWB 3ZWQA 2JGFA 5JH7F 2OR3A 4L0MA 4XJVA 3D64A 3LVBA 4M1YA 2AI1A 2IEBA 2OCBA 3MSXA 1QP0A 1JNXX 1R9MA 1LTQA 1JMKC 2GLXA 3E4CA 5TMPA 1NVAA 3NBQA 5DIFA 3IE2A 1YQXA 4N54A 2JLCA 3CISA 1PZGA 2VAWA 5IF9A 1CY2A 2QORA 2WJIA 2IYSA 2I2AA 3MS2A 2I6FA 2IQ5A 1LLUA 1UFRA 2I66A 1Y0BA 5J59A 1H05A 4ROTA 3MHTA 2GZAA 2HRBA 2ZI4A 1W19A 2V6MA 2QRKA 3PIRA 5IC5A 5LUAA 1ISGA 5ENZA 5HHTA 4Q24A 2QR5A 1TUEA 4IDDA 2FMHA 2HPZA 1QV9A 3G79A 3TZHA 3V8PA 3EJWA 2C9MA 3RSHA 3DDUA 2H1CA 5HX7A 3EVDA 4R2JA 2RH5A 3QFFA 1M0EA 1FP6A 1Y5IA 3OKAA 3KXDA 1YOBA 2E4XA 3ZNQA 2C7RA 2QQFA 4F91B 4IRXA 3K0SA 2TMGA 1TK3A 4D25A 1P18A 4UBNA 4K03A 2CJPA 2D54A 2IZ5A 3D8SA 4WJKB 1DKLA 5LKRA 4CF3A 4QSHA 3KKOA 3FIJA 2PUCA 3QLTA 4KFUA 2P11A 1FLVA 3O8LA 1UINA 2OUIA 4L5JA 3K5WA 3K5IA 4IDCA 2BSXA 4GYJA 4TXJA 1PV1A 5KCZA 1Q12A 4LZLA 3VNBA 3KHKA 4L9RA 3M8KA 1M76A 4KEAA 5D01A 5BMVF 2PX8A 3T3DA 2JLAA 4LV5B 3F90A 1NOIA 3X2EA 4XX0B 2QE7D 2XDQA 3OFND 1XZNA 4FMCF 5DCLA 4BXOB 1YIDA 3DONA 4G5GA 4A0GA 5CFRA 2ZIVB 3Q1KA 4IOMA 1RI2A 3BOSA 1TJ4A 3KB6A 1DPGA 1TCUA 1UK9A 3BQNB 3C3PA 3IAS1 2FQWA 2VBFA 4TPKA 4XWYA 2R87A 3BM5A 1CNMA 1FTWA 1YFZA 1EFLA 3V2IA 4AYXA 4G0UA 4M0DA 1RP7A 1S2GA 4FR2A 4S1NA 3UAZA 1EQ2A 2O3QA 1GZDA 3THYB 5FTKA 5D00A 1HOTA 1WG8A 3WYBA 4E03A 1BFKA 3WAGA 1MFPA 1GNVA 3O3NB 4J94A 2FJ0A 5SV2A 1P5HA 3BRSA 1VMEA 4R0NA 1ORWA 3CVOA 1G63A 1RWQA 3O8QA 4MULA 1MOZA 3FF1A 5CPBA 3K0CA 4IIHA 4KO3S 3RG8A 1XI2A 5KDLA 3P9QA 1NJ8A 4UULA 2YKGA 3HY3A 5HCIA 4O3FA 1QYIA 2NU9A 1ATIA 1DNPA 2PX3A 3QKRA 4TL9A 3IUYA 2ZETA 1TQ4A 2B9EA 3CA8A 2GTPA 3QA9A 4LHXA 5JD5A 3RS9A 2OZVA 3G5LA 1CR1A 3K1JA 1XJ5A 4GE3A 4RVCA 3WK5A 3UPTA 1ZRHA 4FGJA 1THTA 2GJSA 2PLNA 5IAJA 3IT1A 5K3AA 1U1IA 1ZD1A 5B7PA 1ZH6A 2DH6A 3VSCA 1G5PA 2HSZA 1C2YA 1T26A 2QXYA 1WXHA 4BDSA 4AMUA 2FMXA 4HDQB 4MRAA 5AKZA 4QGBA 1H9AA 3P71T 4JVSB 3KTFA 3EBOA 2IEYA 2XTZA 2GXSA 3P32A 1Q7RA 3LMKA 1K66A 2VPXA 3H7IA 5YASA 1Q0ZA 1SG6A 1P6QA 2HREA 3LDFA 4Y6OA 3AVPA 2PH1A 3ZZNA 3FCYA 5BN3A 1ADJA 1HZJA 3IEIA 3OE5A 2UVPA 3U7QB 4ZHSA 3MWLA 1W1IA 2OVBA 2FQXA 5KQSA 1NA5A 2JF0A 2Q29A 4I1OA 1O7JA 4L6CA 3TCKA 1WD5A 3CMCO 4OLFA 3V4LA 3IDSA 2J3DA 1E79D 3G0IA 2AJ8A 4MMXB 2XUPA 4P98A 1E2BA 3GJQA 1NNI1 3FROA 1MB4A 3QJGA 2OL4A 2E0IA 2XRYA 5KTPA 1R64A 3DVSX 3GRPA 4RCZA 3FFBA 3UA3A 3TVDA 5IZ4A 1EGQA 2G9RA 4KDFA 4PAWA 1GUZA 2R8EA 5COQA 2H7CA 1XQYA 2AEMA 4QDXA 3H9CA 4B31A 3NBYC 3WWOA 2GD6A 3ZWXA 4BNMA 3VOBA 5JFOA 4ZIRB 2QW1A 5LU8A