1DCKA

Structure of unphosphorylated fixj-n complexed with mn2+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
publication title Structural transitions in the FixJ receiver domain.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Transcription
total genus 39
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dckA00
1PEAA 1MB3A 4Q7EA 5CHYA 1VRVA 1W9HA 2PAFA 2RJNA 2GX6A 1ABEA 2B1JA 5IEJA 2AYZA 2CD7A 1PHRA 3BBLA 4FB4A 1VLZA 4MPTA 1U0SY 5KWSA 4Q6BA 3HEBA 3KJXA 1P6UA 3EJWA 3H75A 1YMVA 3TX6A 4OLBA 1CEYA 1NTRA 1MVOA 1T34A 2WRZA 5I4CA 1USKA 1Z18A 3M9XA 3QEMB 4G86A 5HQJA 3H1EA 3CS3A 2HSGA 3KTOA 3KLOA 1M5UA 3GWGA 3RVMA 1RNLA 4PICA 4N47A 3QLVC 2GWRA 4TMYA 4G0QA 1YS6A 4RY0A 1DC8A 3MIZA 1LJLA 1OXKB 1ZESA 4MS3B 1QO0D 2LBPA 5IEBA 2WJAA 3KCNA 2GI4A 3QLUC 4RWEA 3H5WA 3N0XA 4Z99A 3GA5A 4JASB 4MR8A 1NXSA 1BDIA 1XHFA 3DZDA 3SNKA 3IDOA 4FE7A 4YS6A 1RXIA 4ZYLA 4QYMA 1QP4A 2A9OA 4QICA 1LBIA 1DP4A 1GLGA 1OXBB 2E4UA 5CNJA 3F7NA 1A2OA 4LZLA 2L2QA 4EYGA 2QVGA 4Z4CA 3N6VA 5TPWA 1U04A 2JVJA 1Z2DA 4YP9A 4G0MA 3HJFA 4RDCA 5IUKC 4PE5B 1SXHA 3RVPA 4EVSA 1R8JA 5IUNC 1F4VA 4N03A 2NT4A 1EHCA 4MRMB 2MYNA 5KQGA 4RK5A 4Z4FA 3LUFA 4RKRA 3BILA 4LE1A 4N76A 4H3HB 3T8YA 5JS1A 3EQ2A 3URMA 1ISRA 2J48A 3EQZA 2PUDA 4RY8A 2QSJA 3OLYA 2WB4A 4MLCA 1M2EA 2BGGA 1DC7A 3BREA 3L49A 4KVFA 4ETMA 5TPZA 3CU5A 3TMYA 1DBWA 1JHZA 3CTPA 3N75A 1L5ZA 5TE9A 1QQAA 4F3TA 4O1IA 3MF4A 3NBMA 4MR7B 3HK2A 2TMYA 4DN6A 4MQEB 5FBHA 5BRJA 8ABPA 5B3JA 2GBPA 1PUXA 2X7XA 4PYRA 4RK1A 1DBPA 3H1GA 2L18A 2L17A 3O75A 4RY9A 3SY8A 4N41A 4N0PA 1YK1A 2PUAA 2PL9A 4JA2A 3T6KA 3RVLA 2NUBA 4YRZA 3OLZA 1FFSA 1RXEA 2VK2A 3KYJB 3K9CA 4Q6WA 5KC8A 1ZGGA 4WT7A 5JNTA 3G1WA 3N0WA 1U2QA 3FFTA 2FXIA 3KYIB 4Z4GA 3EAFA 4ML3A 4ZJPA 3QELA 1EWVA 3Q7TA 3RVRA 4M88A 3P9YA 3C6QA 3F73A 3N53A 4JOQA 3RVSA 1ABFA 2A9PA 3RVJA 4NCAA 1J56A 4O5AA 1K66A 9ABPA 5KQLA 2LPMA 2P9HA 3H6HA 5KQMA 4D74A 5IULC 1YTUA 5ABPA 4LDAA 1BDHA 3I5AA 3OMWA 4MR8B 1GUBA 5EWJA 4UHKA 5JNUA 5D2CA 2FLKA 2R48A 3JY6A 4D6YA 3LUCA 1NXPA 1Z13A 4MS1A 3ROTA 3K4HA 3M6MD 4KPYA 4EY3A 2IYNA 5TPWB 4EYKA 2JRLA 1W25A 4XXHA 5DTEA 3O1IC 1JLKA 2FLWA 4Z4EA 3NHMA 2N9UA 3DGFC 3ROFA 3EULA 3HM9A 1C0EA 3BRQA 1BAPA 4NICA 2QVCA 1ZH2A 5FWYA 4EYQA 5DKFA 3C3KA 2FMKA 2PKXA 1QPZA 3D02A 2PMCA 1Z26A 3NNDA 3GT7A 2FQWA 2JBAA 1KGSA 3O74A 4OBBA 3KLNA 4Y9TA 4FE4A 4E7OA 5GQSA 4RXUA 1D1QA 5KQPA 1RZRA 2JB9A 2R47A 1KRXA 5EWLA 3OQMA 4W5NA 5PNTA 1B00A 3CRNA 4LX8A 3RVOA 5HM6A 5B3JC 4RK4A 2GKGA 3VNAA 3KHTA 2FMIA 1BA2A 4RZSA 3JPWA 5CNKA 1ZAYA 4Z4IA 3EDCA 4F11A 5T7BA 1NATA 5BQ3A 2FMHA 2PUGA 1HEYA 1UDRA 1Z25A 2JVKA 4G0YA 2FTKE 4YO7A 3SQNA 5E3JA 4IF4A 2YHBA 5HSGA 5FWXA 4W5TA 4IILA 2NZUG 1JYEA 4OLAA 2H3HA 2LIVA 1M2FA 1JFSA 1XWWA 3OLXA 1K68A 1PNTA 4KQ9A 4WXMA 2WJWA 3Q41A 4F8JA 1TJYA 2HPHA 3A10A 3QELB 1AB6A 4TLMB 3KKEA 1F51E 3JVIA 1DZ3A 4QPJC 4KMRA 2CHEA 4KREA 5ED4A 3LFTA 3QX9A 2IDMA 3LUAA 3CZCA 4G0OA 4YCSA 3ILHA 1E6LA 4ZPJA 4ZMSA 1M5TA 1E2BA 3F6CA 2A9QA 4UHJA 1A0OA 5EWJB 3RVKA 4HNSA 4YGXB 4KV7A 4JAVC 1MB0A 4RK6A 1JX6A 1XHEA 5CNMA 4H60A 4MS4A 3Q7RA 4KNYA 4MS1B 3H5OA 4QYWA 3FDFA 3GRCA 2NZVG 3IPAA 3LUDA 3UK0A 2QZJA 1JYFA 2OENG 3H6GA 4G0ZA 1YMUA 3DBIA 1EWTA 5TPZD 1YK0A 3EGCA 3OQNA 1FFWA 2FEPA 2DRIA 1JF8A 4RKQA 1P6QA 2E4YA 4HNQA 4IMIB 5IUJC 1AB5A 1D2AA 3HZHA 1GCAA 3MMNA 5FWYB 3HUTA 3GYBA 4MR9A 5IC5A 1LK0A 2FMFA 2YHAA 1JWLA 3A3KA 1CYEA 5JNWA 2FQXA 4OTZA 1SD5A 2HQBA 3O2JA 4HYEA 3LUJA 2PE5A 1GUDA 1Z17A 2P4UA 3O2QB 2PUFA 1NXWA 1FSPA 4E7PA 2JBAB 4EGSA 2V0NA 3MYYA 2WY2D 4G0XA 4L4UA 2E4WA 4D6XA 4G97A 3QK7A 1DCMA 1ZH4A 4YV7A 1TMYA 4JB0A 1L5YA 5IBQA 2FQYA 3A0RB 1JL3A 3O21A 4OG2A 1VKRA 3HCWA 3Q9SA 4NQRA 1I3CA 4Z4HA 2ID9A 1Z12A 2FN9A 1RPJA 3OM0A 4G0PA 2MSWA 3L6UA 2PUBA 5JNRA 3CKMA 5JNVA 1KRWA 4DQDA 3CZ5A 4MS3A 4RXTA 4EUKA 1USIA 2M1ZA 3DGEC 2MSLA 3B2NA 5FWXB 1LBHA 2VUIB 3TO5A 4KQCA 3GBVA 4KFCA 2FSPA 4KRFA 1DBQA 1PEYA 3C3WA 1DRJA 2ID7A 3UKJA 4YLEA 2QXYA 6ABPA 1JFVA 1URPA 2IKSA 4XFKA 1BVHA 1Z2EA 1BDJA 4LDZA 3A0UA 3H5LA 3HDVA 1P2FA 2PJUA 2I6FA 5IX8A 2LP4Y 3E3MA 1TLFA 3FFWA 4RU1A 3QX8A 1EWKA 4ETNA 5DGCA 2ZAYA 3HO1A 1VPWA 2NT3A 4L85A 4EVQA 4MGEA 3H5VA 2XDYA 3HV2A 4IGAA 2PLNA 4MQFA 1NXXA 4O1HA 3DLBA 1KMIY 3O1HB 4YWHA 7ABPA 3KSMA 3MA0A 3H5IA 4PEVA 1USGA 3HXMA 3QLTA 2L19A 3E61A 2IPNA 3S99A 3FGZA 4RS3A 5TQ2A 4W5RA 4MS4B 4EYOA 3FFXA 4PZ0A 3OO1A 4Z9AA 1RZRD 2R25B 2MYUA 4NCBA 4KK4A 5F64A 2O20A 3HS3A 1SRRA 2FKAA 4XAQA 1D4ZA 3C97A 3H5TA 2JK1A 4KK3A 4MR9B 4CBVA 2FEWB 2IPLA 3UUGA 1ISSA 4LE2A 2W42A 3W9SA 3IP5A 3O1JC 5EWMA 1JDNA 1LJUA 1NY5A 1Y1LA 3I45A 5FBKA 1ZVVA 1PNRA 3RVQA 5JS2A 4WWHA 1APBA 4H3KB 5JNSA 1ZITA 2QU7A 3D8UA 4B09A 4JB2A 2H0AA 3GL9A 3NNSA 4MAAA 2FN8A 4F06A 1E6KA 1DCKA 1Z15A 5C5CA 3IPCA 1NXVA 1C4WA 3IP6A 2E4VA 2QR3A 2FW0A 3JPYA 3LKVA 4LE0A 4P1ZA 1QO0A 3CG4A 2QW1A 1D1PA 2IPMA 3EODA 3KG2A 5C5EA 5TQ0A 3CG0A 2F8TA 4GNRA 3SM9A 3T38A 3ILYA 1H9CA 5GOTA 3I42A 2HQOA 1P8AA 2A9RA 4RSMA 4RV5A 3SG0A 2WMYA 1ZY2A 3OLWA 4OATA 1E6MA 2CHFA 3FMVA 3OO0A 4RXMA 2JVIA 4WZZA 3TB6A 2AYXA 1U8TA 4N0QA 4WUTA 2HQRA 1ZHHA 3R0JA 3QEKA 2PL1A 5HKOA 1TVMA 3MQ4A 4Z9BA 2Q5CA 1SXGA 2IPAB 3OMXA 3OLVA 4W5QA 3IP7A 3DLHA 3JVDA 3Q15C 3SAJA 2FEKA 3JS5A 4JP1A 4MQFB 2VYCA 2FVYA 3LUGA 3RVNA 1QMPA 5KI6A 4IRXA 2R4QA 3LKBA 3LUHA 4F12A 3F6PA 3HUUA 4HNRA 3HVRA 3IP9A 4RK0A 5TQ2B 1NXOA 3G85A 3I09A 3HSYA 2B4AA 2E4XA 1MAVA 3QEMA 4P98A 5EWLB 5T3YA 3VNBA 2QV0A 2KYRA 1QNLA 1JDPA 1MIHA 4TLLB 3RH0A 4LRQA 2HJ9A 4EVRA 3LMKA 4YR7A 3KS9A 3N0RA 5DLEA 1CHNA 3GBPA 3O2SB 3LOPA 3N8IA 2ZWMA 3BRSA 1EAYA 1S8NA 3CHYA 3GV0A 3JTEA 1U2PA 3Q7SA 1EFAA 3MM4A 3QLVA 1DCFA 3CFYA 5EWMB 5KC9A 1FFGA 2MYPA 2PUEA 1ZDMA 1DJMA 1JBEA 1SXIA 4ETIA 4MLDA 2OQRA 3LTEA 1JFTA 4ZMRA 1YIOA 3QLUA 2MYTA 2LUOA 3RQIA 3C3MA 3NNNA 3M9WA 1IIBA 1TM2A 4WXEA 4NV3A 4TN5A 2PUCA 1FQWA 3HDGA 5BR1A 3CNBA 6CHYA 1DRKA 2WWVD 2VUHB 4XARA 3LUKA 4IMJB 1ZN2A 4KZKA 5TQ0B 2M98A 1QP7A 1DG9A 4RK7A 3H1FA 4MRMA 4S05A 1QQBA 2E4ZA 3CLKA 2CWDA 1Z16A 4DADA 3OQOA 5TQJA 1ZGZA 2RGYA 4XASA 4XLTA 4W5OA 2MSKA 5CNIA 5DCLA 3T95A 1QP0A 1A04A 2JCGA 4S04A 1NXTA 4Z0NA 3OM1A 2RJOA 1D5WA 1GCGA 3TD9A 3NHZA 1YS7A 2IOYA 1YVUA 4GPAA 1WETA 2RDMA 4MR7A 4MYRA 1QKKA 2F8SA 1JH9A 5BRAA 4MQEA
chains in the Genus database with same CATH superfamily
3OP1A 3F6RA 2GNOA 5HOQA 4NDAA 1P5FA 2IYTA 2GXUA 2QZ9A 3I6MA 2EWVA 3AETB 5BV2P 4CMIA 5BWBA 3ZHTA 5CUQA 3DOOA 3KWFA 4GOXA 1SIUA 1ZL2A 3E58A 4U7FA 3F5SA 1M2VA 2V59A 2CJPA 5HILA 4PZCA 1NHWA 3GPDG 3TPZA 2JH8A 1GFIA 3DV0B 4JR2A 3DZKA 3DDHA 3B1JA 2CJXA 2FUG6 1YO6A 1ZOLA 2FX2A 3K0AA 2FFJA 2W4IA 3N86A 2EFGA 4MUGA 5F1PA 4A16A 3GFTA 4AD8A 3V8VA 2Z4SA 2B3DA 2H16A 4G4SO 1BJTA 2EWWA 1Z2AA 3OEEA 1Y4SA 3V9PA 3CS3A 4F9TA 1RM5A 5K6RA 3GRVA 3KHKA 4AQYB 3EDOA 1P77A 3UH1A 4FKBA 4N82A 4EHDA 1T6YA 3FI9A 3VHRA 2C5FA 4CQMD 1GTJ1 5SYMA 5CA0F 2X8AA 3UWDA 4BNLA 3P5SA 4HXGA 3KDAA 4M7WA 2UZ1B 5IEBA 3HVKA 2JFYA 3KCNA 4E46A 4H7JA 3R24A 3A4YA 3H5WA 5DLPA 3V7YA 4ZI7A 3N0XA 3C8ZA 3OM9A 2ISSD 4JEIA 3TLEA 4AROA 4CCSA 1ARZA 2YHIB 5I9IA 2UYYA 1AS3A 4YO8A 1XHFA 4B0OA 1QRUA 3AFHA 3JSXA 3L40A 4XYGA 2B5VA 5JSZB 4CTKA 1VYVA 3AFOA 1OMOA 3BM5A 1D2GA 3QBVA 4U3JB 3ZE9A 4HFJA 3G5TA 4RACA 1YQXA 2GLTA 4NYMQ 3I05A 4YXWA 3MMZA 3BFKA 2CHVA 4DL9A 3EIQA 3W90A 4I4IA 4BRUA 1EP9A 2O23A 4Y2YA 5LIPA 5G1OA 1DGQA 4JU9A 4MV9A 4P08A 4AYXA 3WRVA 5BR4A 4AS1A 1U8AA 2Q45A 3NBAA 1IXKA 4K5QA 1G8JA 3O4FA 4DMLA 2ZTHA 1JZSA 5IKEA 3T8YA 2X6TA 2X9NA 5DI3B 1E2IA 4CEJB 2OVFA 4JBYA 1VG9B 4TSFA 1E3EA 1US8B 3I6QA 3L49A 2G9UA 1BO6A 3PUVA 3EA4A 3LECA 3STXA 1F3LA 1EVYA 1AE1A 2HFKA 5K4GA 1WB9A 4WCFC 3HN2A 5FLEX 3LP8A 1JHZA 3CTPA 1V7CA 4EA9A 4R6XA 1GU1A 3QPWA 4QGSA 2VDVE 5IZ4A 4MR7B 4M83A 2GPBA 2BKUA 2AJBA 3NH9A 1VGRA 4YI5A 3K2IA 4PYMA 2BKVA 1V9LA 4RA6B 1LSUA 2QMOA 8ABPA 1F8UA 3U4QA 3A6ZA 4RK1A 1FLAA 2H57A 2FNAA 3PQ5A 1MKYA 3O75A 2BSXA 4KXXA 3MUFA 2W83A 1S7CA 1FSSA 1G17A 2WG2A 2VYVD 2IRWA 3G5MA 4X00A 3KYJB 4QQFA 2FQ1A 2X9QA 3BAFA 2MIIA 2RK3A 1ZGGA 3ZJ5A 4BP9A 4LJ7A 3KDSE 3X44A 4OL9A 3HJBA 3G1WA 3L4KA 1OXVA 4Y9UA 4Z4GA 1E9CA 5A6VA 1U4OA 1DINA 4BB0A 3QELA 5IP5A 3E9RA 1NTOA 3AY0A 3MWEA 1GQRA 3LOQA 3IDQA 2R6JA 1NV9A 3AEUB 3OX3A 3OKFA 2DTDA 4Y7DA 4RTOA 1EFUA 3B5EA 1QB8A 2FW9A 3FNHA 4KXLA 2UZ3A 1OROA 1RFGE 1U2GC 2WSSD 3DVAA 4WCDA 2G67A 4FE3A 1C9JA 3E22B 4URUR 1P5ZB 5BMVA 5DYYA 4EG4A 3I9V6 1HQYE 4DMCA 2X0EA 3MGAA 1HL7A 3RB8A 1Y4ZA 4Q19A 3ROTA 2XMSA 4TTQA 4W63A 1K8XB 5LXTF 4D8WA 1VJCA 4X6UA 3C3EA 1MUUA 2BH9A 1OZGA 1FL9A 2R97A 4HAIA 3TRFA 1GAXA 3FTCA 3JXEA 4QRDA 4WINA 3LA6A 4HAVA 4TT8A 1BAPA 1HX7A 1VIDA 2RHRA 4NICA 2P9YA 4YDSA 3A6DA 4KAFA 2V0CA 2VYFA 3UXHA 3ZQUA 5KWJA 3WDSA 1K3FA 3HU3A 4N5LA 4QJIA 5AKIA 1YASA 4FBGA 4QXQA 5DNDA 5KU7A 1AG9A 4UAVA 1YF3A 3TEMA 3O74A 3N5CA 2ZUBA 2Z6VA 3KLNA 4H77A 5D3ZA 2DCUA 4J76A 1UBEA 4BMNA 1NQOA 5I3CA 2X5JO 4Y2XA 3UB4A 1HC7A 1U8FO 3IR6A 4TYNA 5EWLA 2C4UA 4W5NA 1YB6A 5PNTA 2WJHA 4LMAA 4N01A 1NC3A 4COKA 5B3JC 3ORQA 3NKVA 4IUDS 3B7WA 1QPGA 3QXHA 3RCBA 2DGDA 3KD3A 3EDCA 1B6TA 2ZT7A 3FHOA 3D3KA 3FWKA 1T5LA 3WBFA 5KIAA 3EIOA 4ZV9A 3NMUF 4ILEA 2X0RA 3C7TA 2QAGC 5AXDA 5B7QA 3FCOA 1X9IA 5ALGA 1W581 4BATA 4PWZA 5FWXA 5KS2A 4S35A 2NZUG 4LV5B 2Q0XA 5ALRA 1FYVA 4MV5A 3GLHB 1SA0A 1XWWA 1NVBA 3JARB 4KVAA 6AT1A 2GM5A 5DTJA 3FSGD 2HRQA 1LBQA 2W98A 2IYSA 2FUEA 1RLJA 2QJOA 1DC5A 2AN4A 3K72B 5G0SA 3SF0A 1KYQA 4HUQA 1HDXA 3PSAA 4B32A 4CKCA 4Y2TA 3ZNQA 5HUJA 4KMRA 2WHXA 2CHGA 2EBWA 4L8VA 3KOUA 4TXLA 1IBSA 3P0HA 3MXOA 3HJGA 1JEQB 4B8WA 1A27A 1NN5A 3ZKWA 2LIPA 4H1HA 1EFKA 4WZBB 2AKEA 4UHJA 2JC3A 1IY2A 1UFKA 4GICA 3A3NA 3SK0A 3GT3A 2BFEB 2ZB8A 4J2HA 4EARA 3H2ZA 3I30X 2CZCA 5A6SB 4JLUA 1KJZA 4W9MC 4UCFA 1L4HA 3STHA 1F9AA 1QG2A 2PX0A 3BXFA 2JI4A 2ECOA 1SXJA 3FNBA 2D5AA 3E5RA 4ZI5A 1YMUA 2IXDA 3LSTA 4GM4A 3PNLA 4NZOA 2B92A 5KSPA 1JF8A 1ZNYA 3MUNA 4HNQA 3UAYA 3QQ5A 3HBMA 3H11A 1AB5A 1GCAA 1GNPA 4UXHA 5IC5A 4F71A 2VPWA 3V8EA 4GPEA 5J47A 1C9DB 2K2WA 2OCAA 4LRYA 2MJLA 3Q88A 4ZTBA 5JC8A 2VIIA 1D2NA 3EXG1 4C4YA 4OAPA 5FI0B 4E4RA 3ZXIA 2QQGA 3FTDA 4H15A 3HVHA 1G20B 1POWA 5EIOA 2VK1A 2Y67A 3HJHA 4ZI7F 5K8CA 2V0NA 4BNTA 5TSDA 3UQYS 1ZKMA 2R3SA 1H5NA 1DV2A 1O0SA 4RLHA 3PUXA 4BB5A 1Q19A 4F86A 2IHJA 3MB5A 2ZIAA 5BW8A 2JHFA 3LBIA 1TMYA 3D5QA 1KEWA 3OCXA 4NZ9A 2O0MA 1WXQA 1P5RA 2FQYA 2ZTLA 4MQ4A 2GPNA 4B4UA 1VKRA 1Q7GA 2QDKA 4MA5A 2FOLA 1ECBA 5ENVA 2AQKA 1Z7BA 3RRMA 3EFHA 4YFVA 4ENVA 1VZ3A 3QF7A 3L6UA 1WVIA 3A3YA 5EMNA 4YX9A 1ZVMA 4M9XA 3W9BA 4Y1EA 1JB1A 4DG9A 4C3VA 3JQAD 4N3CA 4IP0A 3MNFA 3QX7A 4J7AA 4O1MA 3WGYA 1ZWLA 4XFDA 3HPRA 5HCUA 3TINA 2PZFA 3B2NA 4DVGA 1N1DA 1IAVA 1VKZA 2HV8A 2VDUE 1K1EA 3QFRA 2BEKA 4IVQA 5IF9A 2NV0A 1MJGA 2Q2QA 1V8PA 3QPBA 1N6HA 4OJNA 4F97A 4HFNA 2H4FA 1OU0A 1SC9A 2XMZA 2ZANA 4YP1A 2DTXA 2W2VA 4Q00A 3I9OA 1MEEA 1HURA 2SNIE 1EUDA 5A5DA 2EVWX 4YRBA 1JT9A 2Q3BA 4OO3A 4DCSA 4U6NA 1JHQA 4HTFB 3R6WA 4X20A 4PX2A 2NTYC 5HG0A 1NRIA 3L8MA 2AE1A 1GNVA 1ZC3A 1JG6A 1I33A 1EGMB 2N46A 3E4CA 3KXIA 3HN7A 3ZU6A 5EKXA 5LMUB 1BXZA 4KI0A 3IA7A 3WMFA 1YB5A 5JQWA 4AQ7A 4F4DA 3WTCA 5FNVB 3ND7A 7ABPA 3A14A 3KR0A 1P1CA 3FRJA 1XZDA 3H5IA 1USGA 1RCFA 3PPVA 1BIFA 3QWBA 4M87A 2YTZA 5DEOA 5D7BA 4QUDA 5DN9A 4D99A 2ZJ3A 5TQ2A 2HFJA 1IXZA 1XA0A 8GPBA 3OCWA 3C45A 3EXHA 2TECE 2B61A 2PEZA 4IZIA 2Z4TA 521PA 2VPQA 4E33A 4GOMD 4F56A 4XIYA 2XNHA 3PI7A 3HO8A 2UVQA 4LQ4A 4M0EA 2UYOA 4W9NA 2RD2A 4MVJP 1NV8A 1G16A 5DBEX 3ZWVA 2GPAA 2C9MA 4F04A 1NBHA 3PU6A 3IR7A 3DL0A 3QZUA 5FLYA 1AU9A 4I55B 5H81A 1ISHA 1RXVA 4OJQA 4P4UA 1RLOA 3SM3A 3BVPA 2RGCA 1X1TA 1T4DA 1U0GA 3AVYA 1XRQA 3IVMA 4KO4S 2OHFA 1AKMA 3BFJA 4R3NA 3SJ7A 5LZ2A 4GG1A 2ST1A 1SD1A 5BMVF 3BHIA 4O02B 1HBJA 4C06A 3I1FA 4MGHA 4INAA 2VS1A 4BNJA 5G4LA 4E94A 2IFTA 1ZRNA 1UDCA 5E1DA 2HBQA 3B6IA 4B3TB 3BERA 4J0EA 1NPDA 4K40A 1JU3A 4RULA 2UU9B 5BSEA 2PH7A 1I51A 3OIWA 5IMSA 1PT7A 1U7WA 2ORED 4KPUB 3IXMA 1Z56C 3Q9UA 4DEXA 1SUCA 1DAIA 2X8JA 4OBWA 4X6YA 1U0NA 2YV3A 4U2DA 4D9JA 3EF3A 3P9RA 1I7SB 4RVOA 4XJTA 1TO6A 3GUVA 5DNWA 3R7DA 2H2IA 1FPQA 1GPJA 1N0WA 3TSCA 4LECA 4TN1A 4R1PA 4C04A 1QK5A 1TA0A 3FPGA 3PEWA 3HUDA 4IHKA 4DV4B 2OV1A 3VC3A 3MZ0A 4XGRA 5KJFA 4O4HB 3E7WA 5C35A 4O2AA 3PDWA 2JRCA 2NADA 4HFRA 3V4SA 3RFCA 3ON5A 2A14A 4MCJA 3SQXA 1X7GA 2OFOA 3E82A 1PVOA 4LUCA 1KH3A 2N1BA 4FJ1A 3AH8A 5CA1A 4GWLA 1M0TA 1ZMXA 4DTIA 1YDGA 1XQVA 3HE3A 3L43A 5ICCA 4HWGA 1M72A 4M60A 1IHYA 1YB4A 2XTNA 1A7UA 1WLSA 4OP2A 2I8LA 5D85A 3B52X 4HGNA 3PCRB 2EJCA 1UJ4A 2XUGA 1E7WA 3FH0A 3AETA 3OFKA 2WJPA 4ETWA 2JIMA 3BCHA 3LY8A 4EUNA 4E5MA 5HBGA 3DV0A 4QPCA 1LA2A 4EI9A 1EYZA 3HB1A 2WE7A 3LXMA 3PHBE 1U4NA 4CVNA 4B6JA 2X5KO 2HTEA 4DMFA 2OYRA 1UBUS 1TJNA 4R2JA 3O38A 1DE0A 1C0PA 3NAZA 5T3YA 4XR9A 1P6XA 2CDRA 4DLBA 2D5LA 2VF4X 3KUKA 4UKDA 1MF7A 1JDPA 2GZDA 4U7WA 1HYEA 4OB6A 3EY9A 2E3JA 1T2UA 3EFOB 3KS9A 2CVZA 3EUEA 3A11A 2A86A 4INOA 2D1YA 1GR1A 5G0WA 4GIBA 1BXRA 1YTLA 4KPEC 3ERCA 2UZ1A 1GEEA 2FYTA 4WZAB 5CFOA 1XEWX 1TF2A 3EYWA 3LT1A 2DUNA 4HLUA 5AKYA 4YR9A 4R84A 5IFKA 3IXLA 1LJ8A 4INJA 4MV4A 4E5YA 1B15A 3AKZA 3IO5A 1PJBA 1D5CA 3DCJA 3O4IA 3TE6A 1YIOA 1W36D 2MYTA 5JSZA 1NJGA 4M8SA 4DLNA 5ADHA 4U3JA 5JAQA 5A7HA 5BSKA 1Q0QA 3OZDA 3KOYA 1DKNA 2HK8A 2OFFA 7ADHA 2CXTA 1GTRA 4WA8A 2VNIA 5I9BA 3U4AA 5DM0A 3R7WB 1WUYA 5FULA 1NONA 2GEFA 2Q46A 5BQFA 5M04A 2HDHA 4ND7A 4ZAGA 3H1FA 2H9YA 4HLCA 4KIJA 1N6IA 3U4IA 5JLJA 4J6EA 3LC2O 4YHBA 4LGYA 4UXJA 5DI3A 1CB7A 3I6IA 4CEJA 1DX4A 4W5OA 2F64A 1JI3A 3OKCA 4GQBA 3ZWYA 1US8A 3T3OA 1MV8A 1QP0A 4DHWA 3OPQA 3HI4A 3QU2A 4QDUA 1L7MA 1LTKA 2W2MA 3A04A 1HLFA 3OM1A 4NR0A 1LPOA 1ZI8A 1NU8A 3BGOS 4CCWA 5HK9A 4KDCA 5JXWA 4N40A 5KVAA 1U2DC 4MR7A 4MYRA 3UPDA 1AN0A 1P61B 2OV4A 2DUJA 1H69A 3FGPA 4IKEA 4W5WA 2VYQA 5DM4A 4ER5A 2F8SA 1A8IA 4RA6A 1QPBA 4OAQA 2OV8A 3F98A 4XWKA 2CD7A 2WWRA 3WKBA 4DFDA 2IS4A 3PICA 2I3BA 2WOOA 1WF6A 4PO8A 1GUFA 3QH4A 2GUWA 3T9BA 5ICFA 3E4DA 1ADBA 2CE2X 4D45A 4D5EA 3DV9A 3X2SA 2AMLA 1RACA 4J0HA 3NFRA 1THGA 3L79A 1Q0ZA 4DA0A 3WA7A 2D13A 4UHDA 3JAMA 4KACA 1C8KA 1A5BB 3PGLA 3ORHA 4OX9B 4FKZA 4W7IA 4C7BA 4HGRA 1PYOA 3IDZA 1LLCA 821PA 5ILOA 1TADA 1XL1A 4TL9A 3AOEA 1LQ2A 2WM3A 1D2EA 3AEUA 4IWXA 2VAMA 3LCUA 3NDIA 3E27A 4LGVA 4WRRA 2JCVA 1NN1A 5J9FA 2WD8A 5GPBA 4ZZ1A 1IRXA 4R7TA 4BO9A 1L4NA 3WLJA 4XIGS 4A8TA 2WF9A 2X9LA 2CXXA 4PZEA 3U3DA 5BN3B 1L4BA 5AM4A 4JX9A 4DABA 4OI4A 2Y3IA 3NHBA 2C3UA 2WFAA 3ZZMA 1CJUC 1L5HB 3S1LA 2CC2A 4L4YA 4MCHA 4X6XA 3W04A 3WGVA 3V6MA 3RM3A 1NG9A 2IS1A 2QDXA 1JSLA 4BV8A 3PFKA 4JK3A 3QSYA 3EVGA 2NM0A 2JVJA 4DPMA 1AKQA 4GWKA 5ECWA 4P7JA 5KKCA 1XQWA 1VPVA 2QW8A 3BN3A 3A9UA 4OOEA 4EBBA 1FFAA 1QLWA 1EQAA 1R8JA 3VR5A 2H7XA 3LPAA 1ACJA 2NT4A 4C0JA 4EJFA 1UBTS 4MWBA 4CEHB 1NJFA 3KJGA 3OURA 4JHLA 1ZD4A 4I1YA 5E1OA 5LC1A 4AT1A 1EFPB 1XRNA 3JQFA 4TRRA 3LDUA 4TXNA 1GN9A 3EQZA 4YJGB 3HO6A 3L05A 2HTFA 1NE2A 1XD9A 4FFPA 4I8IA 2XNCA 4DM4A 5KOHA 1JLRA 3KAKA 4CL8A 4K9NA 4Y2RA 2HNBA 1QDLB 5TPZA 3RTEA 1QQ5A 4AWXA 1XP8A 1LFDB 4WVFA 3G6KA 1DKRA 1EA7A 1VBMA 2DE0X 2WG0A 3LU1A 5CLIA 3UMSA 4EJ6A 2VP9A 5F2OA 2CXSA 3AEQA 1EJ2A 4IOJA 4IIUA 4MQEB 2PJRA 1U3FA 5F5NA 2EQ5A 1JHAA 1Z6GA 1M2HA 1K8YB 1DAPA 1UKEA 2CL6X 3WLFA 5CPBA 2AWOA 3PXGA 2D54A 1G19A 1KO7A 2HBYA 2V7QA 2ZB2A 3FN4A 4DMKA 5EJGA 1MP0A 1MQAA 1P4HA 1RWOA 3DLCA 2EJTA 3LHDA 1P73A 1XA3A 3GLHA 5JFGA 2MINB 1CR4A 2B4TO 2CXNA 3LWBA 2BMFA 3JARA 4O2AF 5F2EA 3SEAA 4MVJI 1VJ1A 2FOXA 4AULA 2WMOB 4B1FA 3GCGA 1SU4A 3QVTA 1X1QA 6YASA 4IIBA 4PFJA 2QTCA 4BE9A 4MP8A 5LU8A 1IULA 2IIQA 1V7QA 1X70A 4P36A 4O5AA 4RQAA 1D4AA 1O6CA 4YRQA 3ROMA 4HQ0A 1HLGA 3Q0IA 3WZLA 7MHTA 3H6HA 2ID8A 3QVGB 5ICEA 1ORTA 3LDGA 1JPVA 1Z8NA 4D74A 2R68A 4WZBA 4EGAA 4I3GA 1QM5A 2A78A 1O9GA 2KQUA 3B6JA 2Z1DA 4IOLA 3DT8A 4OF4A 4PS0A 2BFEA 1DHTA 5A6SA 3ENVA 3DG9A 4M1MA 4BYGA 3IQEA 4RTQA 1MC1A 1XQXA 2JJMA 4GT1A 1OBFO 5BNTA 3KM0A 3KQNA 1IXSB 1DOHA 1QIIA 1FYXA 2G5TA 4WFKA 2RHOA 3MC1A 1K98A 5D1NA 4BMOB 3B1YA 4ZT3A 4EYKA 1VG8A 4GP7A 1E4OA 1MN6A 2EKLA 2I33A 4GM1A 3NT2A 3O1IC 4QYTA 5DTEA 3C1OA 3MT7A 3T1VA 3KZOA 1LV8A 4X93A 4B83A 3IIMA 2ZPUA 4ZZIA 4WESB 1ZH2A 3KSBC 1OZAA 4H7IA 3BQMB 5ADWA 3USES 5I7HA 1D2CA 3C3KA 3E9EA 4EKIA 4YBZA 3EVBA 5H7XA 2PMCA 1G20A 1KDOA 3SJZA 3QENA 3BF7A 3V46A 1CHDA 3FMIA 5IBRA 5KQPA 3WV5A 1FJGB 3V9AA 1V45E 3LF2A 3EAGA 3F3MA 4GGMX 5LD2C 2G5PA 2DWCA 1HEIA 3G2MA 4KKXB 2NPFA 4U1RA 3UMVA 1DAHA 4TMXA 2IU4A 2MDTA 3SZ3A 4BMXA 5MN6A 3U1VA 4J1TA 1Z83A 3SKVA 1V37A 4D8UA 1V7PC 5C5IA 4FZ3A 1SOAA 3DT9A 1FU4A 2XUFA 5F1OA 5CDSA 2HUPA 1M73E 1E1RD 1OKKD 5ITSA 3MFYA 4G1CA 4Q1AA 3E3LA 3P0FA 2FMHA 1MJHA 2IYLD 3ME5A 4EG7A 1OI3A 1E99A 5IT0A 1DV1A 1DJMA 3KETA 3RU2A 1K06A 5HSGA 3DE5X 4RH1A 1OD6A 1DBIA 4ZGWA 4FZVA 4LQDA 1I4TD 4TRMA 3VPDA 3LDAA 3PC3A 4BNFA 4U8GA 6GPBA 1M7BA 3EXEB 1HOXA 3NS7A 4CL0A 2W2TA 2ZTUA 4IYJA 4HQ6A 3MTIA 4L9RA 4WXMA 8AT1A 2M6SA 2WIFA 2BIFA 2WUDA 3FNRA 3W4JA 5ALNA 4C2TA 3P2IA 1CUEA 1T3LA 1H3EA 3KKKA 5LDGA 5B64A 1JA0A 1JJAA 1KE1A 4HX9A 2ZXUA 2ZJ6A 2VJMB 1CXZA 1QP4A 1RWVA 1RRGA 1ZG3A 4Q37A 1BHO1 2WTBA 4Y30A 5DHRA 3S2IA 5B6IA 3EUFA 5KDDA 1O58A 3LFTA 1K92A 4EMSA 3TVDA 2XE6A 1W73A 2CKDA 5HE8A 4UPDA 4OQDA 1UINA 3GJXC 4ZPJA 4LS3A 1NVMB 4ZMSA 5FNVA 1JHUA 1YI8A 2FWAA 3FPBA 1DRUA 3IAM6 3N8KA 2CLCX 2BHSA 5TARA 1GKKA 1A0OA 2QL7A 3VPAA 1WL8A 5EWJB 4U7DA 2CZGA 1SVSA 1N77A 2ZT5A 3VDQA 5BSRA 1RJGA 1N7HA 1ZONA 2WYOA 1MO3A 2IV7A 1O97D 4KNYA 1SCIA 3GFGA 1OB2A 1ONPA 3GRCA 3NGXA 1BW9B 2PMWB 5AXAA 5AVYA 3CLUD 3KFLA 2VT7A 1AURA 1DXYA 5DNCA 2DRIA 1NNI1 1R18A 5KJCA 5IUJC 4GOJA 4PC1A 1WDLA 5JZVA 3OJXA 2ZE7A 4QOJA 3U17A 1R0ZA 4N0EA 1OB5A 4YB8A 3K71B 2FPSA 3HUTA 1I4EB 4I55A 1Z4JA 3QE0A 2VT2A 1IUNA 3UK2A 3WLOA 4YCNA 1OC4A 3J81A 2VTBB 2B30A 1XTIA 4G01B 5HE9A 3PRYA 1Z17A 1U1CA 1X1AA 3KJNA 1ST3A 2BTQB 2BRUA 2DM6A 2P4UA 4QM6A 5EE5B 2JBAB 3GRRA 4E7PA 2G7MC 1TZ2A 5CHEA 3QXXA 5CPFA 4IFIA 2Y9PB 1FNSA 3PFIA 4RTJA 3CPSA 1H4VB 1ZQ9A 1R6DA 3WJAA 1EFTA 3FXAA 2Q3EA 3NBFA 1ZFNA 4CMIB 1KAQA 1O2DA 4BNVA 4V3CA 3NV9A 3CZQA 5KYWB 2ERCA 3IAFA 3O91A 3T5DA 3VH1A 4KPUA 2J32A 2RSLA 3KPWA 4I46A 2QNRA 3TCXB 1RWNA 3TYXA 3ZHXA 3AQ4A 4E09A 3PGMA 1YQEA 4ITVA 3EYAA 3ZZTA 1N5IA 4MS3A 1YB7A 2H9IA 5LYYA 4F6CA 4RJTA 4WBNB 4Z0HO 5JCZA 4MW6A 5ISMA 3GLVA 2VSXA 4MW2A 4DV3B 4MB6A 3VC7A 4YJ2B 4KXVA 4N1AA 4TYPA 1G98A 1P1IA 4O4HA 3PYMA 2OCBA 2Y1OA 4JNKA 3LYAA 5A4IS 1J2RA 2GQ0A 2P9CA 3KFVA 4YLEA 1EHIA 2EFEB 1URPA 2XUIA 2HBZA 2OT3B 2QNBA 2DBVO 3BIOA 3D6NB 3P5BA 1M6EX 3R6LA 5IX8A 1ND6A 1L3BA 3GLSA 4PZ9A 4E5PA 4BO1A 1Z38A 1Z6YA 2JLAA 5LNK1 5C18A 2WPDD 4PAGA 2IVZA 1VPWA 2BFDB 4L85A 3BJIC 4HUTA 1KFEB 4LK2A 1O97C 4HZUB 4B46A 3KJFA 1PU2A 3N2YA 3MOSA 3CLHA 4LBYA 5JZ9A 1X14A 2XXAA 4B6PA 2WZBA 3CZAA 2NYRA 3NHUA 1M8PA 4K6FA 3C7KA 3WWPA 5A5VA 5JD4A 5J23A 1C7JA 3MA0A 4NZZA 1SOWA 2G71A 4JYBA 5HHTA 2FK8A 2CLIB 3SYMA 3B89A 9LDBA 1QYXA 1XCMA 3B1XA 2J4DA 4PZ0A 3DH0A 5M29A 1M8JA 3RFUA 1W0KA 5K4AA 3OIGA 1B2LA 4HOYA 1JR3A 2G36A 2O57A 3HC7A 1EBFA 1I6KA 3WHLA 4R0NA 1P2UA 1SBIA 2SCUB 4KXQA 3SJCA 3N76A 1HDEA 4R83A 4MR9B 4NU0A 3UTCA 2FEWB 1RWBA 1JQDA 2YNMC 2DHRA 3EFOA 1JQJC 1X7WA 4OGWA 3I76A 3K9LA 4NU8X 4QU8A 3U2QA 4Z2AA 2XGOA 1H42A 4B5KA 4F84A 5IJZA 1LLDA 1ZVKA 3FR8A 5AI6A 2TMDA 1JDNA 3CW2A 1GTL1 3UUEA 4WZAA 4AURA 1JH8A 5KKNB 3IAHA 2I2DA 3I9JA 2HCJB 2NTVA 2QVZX 2VSYA 2GBIA 2DYKA 1E6WA 2X13A 5KQRA 3NVAA 2XCSB 1DOZA 1M74A 2OOKA 2QTZA 2IELA 3X1KA 1E5QA 2NYVA 2PD6A 2A30A 4MAAA 3P4YA 1GVNB 3R0VA 3B9BA 3DFFA 2ASVA 1JA9A 3V1NA 1I32A 4UVIA 5CEFA 3IPCA 4Q39A 3O93A 1LDBA 5GM1A 4IL5A 1AQYA 2Z4RA 4ZALA 2CDAA 4PYIA 2XT9A 1LVUA 1U65A 4LJ5A 3R7WA 5A4MS 2NV2B 3X1WA 1IJBA 4ZVSA 1C7IA 2QN7A 4PBTA 1U9YA 4NBLA 2VZ0A 3Q0TA 3AC0A 2NXCA 3HACA 5FUMA 1N4DA 4P7GA 2J7PA 3IQDB 2Y1GA 1CDDA 1G5TA 2A9RA 3D7SA 1AS0A 2JNWA 1KE2A 3MGBA 1DPFA 4IBOA 4L8GA 5JCOC 1BXKA 1VMAA 4C5BA 4YASA 3DDUA 4HAZA 4JB8A 2XQKA 4IIGA 5LWHA 2HT1A 5AFSA 5BPHA 3HU5A 2WHRA 2VTVA 3EQ8A 1XMPA 3JATB 4IQ8A 2Z30A 2GXAA 1AV6A 1G1AA 3OJOA 3N7AA 1P3Y1 3UOAB 3IJEB 4Y18A 3W3AD 1GZDA 3VUEA 2ZUFA 1Y8QB 3GP8A 1SXGA 2EWMA 2ZI3A 4XB1A 4DZRA 3JVDA 3SAJA 2HLPA 1ZK1A 2CT8A 5DYWA 3PENA 2Y1EA 1KETA 3G59A 2JGMA 2REQB 1QMPA 3BGDA 1EQUA 2QUAA 2A5GA 3M1AA 2NP6A 5IMBA 5DULA 4LNHA 1UJCA 1X3LA 3ANTA 4UMFA 4DXAA 5LKRA 3QVJA 1QCDA 2YFYA 1DC4A 1MOPA 2FZGA 4GBJA 4JN6B 2CKMA 2ACEA 2D62A 4J9VA 4KWEA 4TWAA 2XGGA 2C4NA 2ZSBA 1SCBA 2X40A 3EE6A 5HS4A 3AKDA 5K0BA 1KZGB 3MAGA 5DM1A 3E1SA 1OZHA 1XRLA 1YJ5A 3PJFA 4IV8A 4AK9A 4OJYA 4AJHA 3R5TA 3H3JA 1AUXA 1PV2A 3AEYA 3M6LA 4ZO4A 1AQNA 3LGXA 3LMKA 3T5AA 2PV7A 2QN2A 4PBSA 4R51A 5DLEA 1J9ZA 3E9YA 4KODA 4CKEA 1V9SA 4EM6A 1GTZA 1MO4A 1S6YA 4NQZA 2PQ6A 2YVKA 3UG6A 3ZXUB 3ZCRA 2DLCX 1AKVA 1F8FA 1RT9A 1ZDMA 2X15A 1GT91 2GJAA 5FNVF 3FOBA 2X14A 3RADC 3EW7A 5BN3A 1JBEA 5CYGA 4E14A 1BYIA 1PEDA 1GWNA 1KAOA 4ZAFA 3SQDA 1XU4A 2VDMB 4ETIA 4TTRA 1O94D 5JPDA 1EDEA 1XD2B 1SUIA 5AVKA 2IVFA 2WM9B 5DH9A 2LW7A 2X0DA 3SHVA 2R7LA 5LP6C 4B3RB 1L5HA 1IYZA 1W93A 1S7GA 1V5GA 3IHKA 4MIKA 4S24A 4TN5A 3SBXA 5CD9A 5CDFE 2YINC 4IUCS 1WMEA 2QD3A 2AZDA 2AOUB 1E2FA 4J7XA 1N2CB 1V41E 1NLYA 2HHCA 2XVXA 3FMGA 3LQ1A 4YRRA 4QPPA 5FFMA 3TSZA 3DDWA 3K4QA 1EK0A 3CEPB 1IEVA 2I4NA 4PSAA 4Y6SA 3K0CA 3ZLTA 2Q6IA 4OXQA 3WLEA 4ZZ0A 2OBBA 1RBQA 1CY0A 2ZUUA 3IUEA 4FNGA 1WMAA 3DHWC 3NM6B 4I55F 5FL7D 3TSAA 1FX0B 1DFHA 3NCHA 1Y9EA 5FBWB 5JCJA 4CEHA 4TX1A 4YH1A 1S3FA 2VAPA 4RL6A 4UTPA 1EFPA 4QUEA 4EB6B 1Z16A 3GLTA 3I01A 3CRMA 4YJGA 4HVLA 1SH7A 3GLGB 3T95A 1V16A 2VSNA 2JCGA 3A1DA 5FOXA 4Z51A 3IKMB 4CKWB 2F2TA 2KI5A 3AW8A 2QGFA 3TD9A 1DFIA 2QD2A 2VA8A 5GP1A 1N7JA 4OHWA 1XCOA 2IS6A 4YP6A 1IUPA 3ED5A 1NL3A 2ILTA 2QM7A 4R9SA 3K94A 4MQEA 4Y3UA 5HKLA 4DJDC 4DV0B 1XRSB 2QRMA 4ME6A 3AJDA 4IEIA 4UATA 4J6FA 5K45A 1M66A 3NRCA 2XWBF 1F48A 2HPVA 1PR1A 3ZWQA 1PHRA 4BN5A 1QGOA 1H2EA 1P0MA 5AICA 5KWSA 1G3RA 2VBIA 3OH8A 3GJ4A 5DW3A 4ARSA 2FR8A 1RKXA 3U3XA 4OLBA 2HIHA 3QNMA 1KRHA 4O4HF 3ESCA 1J70A 2MINA 2WM8A 3KJZA 4YONB 3TLMA 5AM3A 1EBBA 1ZEMA 4BVBA 2QLBA 4W6ZA 2C1ZA 2WAAA 4LK3A 3TIIA 5ETJA 4DZZA 5B6JA 5LZ4A 5KPJA 4OMFG 4UTOA 1N34B 1FLNA 1KERA 1P0CA 3FHLA 2BEUB 2BISA 3ZZ1A 3QLVC 4JUIA 1M67A 2DBRA 3ANXA 1ULUA 1XAHA 3D6FA 1XVTA 3FOAA 4RVFA 4LDQA 3DBHB 1ZESA 1O94C 2X4GA 5FUWA 5AWFC 3AXSA 1DRVA 3QVGA 5B1YA 2ZVQX 3IEKA 1GNRA 3TFQA 4LZZA 3K9HA 2CJWB 1C8BA 2P2ZA 4DR1B 2GPJA 4KBYA 3RKUA 3A36A 3Q8XB 2WMDA 2YYSA 4QEZA 2QBYA 1IPFA 4TZ0A 4J7CA 3VPSA 4RC9A 4HYTA 4B3MB 3HB4X 4I9NA 4DC9A 3W8RA 3RSOA 1C3OA 1LBIA 1JPJA 1UXKA 3HRHA 3F7NA 4H3SA 4I8DA 2L2QA 3PC8A 3WK7A 4M1EA 2ODNA 3JQEA 3LY9A 2C7VA 2ZJYA 4LXXA 5DGTA 3UWSA 3FSRA 3VU3A 5IU6A 2N0SA 2Z57A 4CQNA 4EFNA 5C46F 4DMHA 4WESA 4N03A 5FKJA 4QWMA 3EGIA 1S3GA 3DSRA 1EIZA 1A3CA 2FX3A 5E2BA 4KLZA 5LUBA 2AA3A 2IX3A 4QUBA 1P7VA 1P9OA 4LWQA 1X87A 3IQWA 3SXJA 2PUDA 4XWYA 2WB4A 3SMVA 4GZ6A 2E1PA 2VHTA 3NGLA 4AXBA 1TKRA 2FPRA 1GEGA 3SD7A 3AHJA 4LJYA 3UCXA 5IG2A 2P5SA 3EQ7A 3SHOA 2PBFA 2RAUA 1CDZA 2XI4A 3O4JA 3ICQB 1SFRA 1ZVQA 3U3OA 5I7FA 3LF1A 1ORHA 2CLOB 4KV9A 1CCWA 3TM4A 4I5EA 2OYSA 3UBMA 3F3YA 4U7JA 5AUPB 3QUCA 1VRCA 1NDHA 4D3DA 3ZVRA 3WO1A 1DC6A 2XF2A 1JJIA 1F38A 3L6CA 2L17A 2CVHA 4M9RA 3BZUA 3RHFA 1C4OA 4LAFA 2JAHA 5G1PA 4ZQIA 1JG7A 1F17A 3F4BA 4F5YA 4WECA 4FIZA 3W7VA 3OLZA 4MX8A 4Z54A 4I1OA 1P74A 2G77B 3EXEA 2PGLA 3DBVO 1L5FA 5IDXA 3S2YA 4EFDA 1SZPA 2W6JA 1KY4A 5FCDA 5FYQA 3W8NA 4LQLA 4HGOA 2VJMA 3CQ9A 5IDWA 2WF6A 1MVNA 3TGLA 2G06A 1QRTA 2P9QA 2OD9A 3WNQA 4YUZA 4AWBA 4FWTA 1ABFA 2BD0A 1YOBA 5BW4A 3MTJA 1PK8A 1RQXA 3JQBA 4XW2A 4XLLA 1CUDA 1EE9A 1JQEA 1INLA 1EA5A 1JVBA 3BPSA 1OXTA 1QG0A 2JGKA 2X1VA 3PHCA 4NU6A 1ONSA 2AD5A 5KWIA 1FS6A 5IK2A 2BF7A 3UJ9A 4HPWA 4EUSA 2J3JA 3Q6IA 5EWJA 3WMEA 4EQ6B 2DHDA 2FUKA 2XTJA 1GPH1 3R09A 4C3UA 4YCDA 1NXPA 3CUTA 4YLYA 3LS2A 3UAGA 1FJ2A 1YIDA 1QZTA 4HYYA 3CJTA 2WT9A 3ZTYA 2P6RA 4YEDA 1BW9A 1Z4QA 4FNMA 1IHPA 3NBQA 3L4JA 1J2TA 4WKBA 3ITEA 1U3WA 4JFAA 3ZE7A 2HMUA 5I7EA 1R88A 1MOZA 2AGVA 3U7FB 2C4HA 2C3PA 2IP4A 5DIFA 3WLPA 3NIBA 2I2AA 2NZ2A 4Q5IA 4RLFA 2WW8A 3NG1A 4K9MA 3RSSA 5JNWA 1O95D 4NCXA 4GZ3A 3ZBPA 5UKDA 1MNAA 1VKHA 3VZPA 3FHCB 2O52A 2ZBQA 5B3LA 5IT5A 1KMCA 2JBAA 3FMFA 4EPVA 1GFSA 2FF7A 3ZLJA 3WXMA 4JBIA 1GZHB 2GJ9A 3KKLA 3P9XA 1TLLA 5FWDA 1GAJA 4GKAA 1QZUA 2H5LA 2W2PA 4WY8A 1N2IA 1GPMA 3AO0B 1G6Q1 1BTOA 1HL3A 1R0SA 2NTNA 3VAAA 4A6PA 2WJIA 2DPYA 4Q01A 1BDBA 2L82A 2INGX 4RK4A 1NSTA 2ZSEA 4Q3KA 4BFSA 2MT9A 1T0BA 2I6XA 3GO4A 1V1RB 2O2YA 2Y05A 3ED1A 5KYWA 3H8VA 1BKDR 3P9CA 4GGPA 1JMYA 5A5GA 2Z5VA 1WVGA 4WKOA 2LXNA 2OFXA 5A5FA 5A7GA 4N5IX 4DV6B 2P3SA 3DXFA 5EKDA 4P4GA 3WMRA 4KFRA 2JFOA 3IB6A 2FTKE 1JHRA 2DMRA 1KQFA 4ZQHA 4IILA 4IJ5A 4WKNA 1XWIA 4FGKA 2HEIA 4YJ2A 4OLAA 4RV9A 4A2QA 4BGIA 3BFXA 4EEXA 4L4SA 3OZVA 3ITKA 2XMGA 4OXNA 4V2IA 4UOQA 4YRNA 1V6AA 3PGXA 2CUTA 4R9RA 3HMKA 3U37A 3N7TA 1T9GR 1HZZA 3RJTA 2XOKD 4HB0A 4Q7MB 4IDAA 3D2AA 3NEAA 4QG7A 3KOXA 3T4XA 5CG1A 3M5WA 1WZUA 1K7EB 2PLRA 1SC6A 5HMLA 3CEJA 2ATIA 4IS3A 1F51E 1A7JA 1SHJA 1EWQA 2Q7XA 1T35A 3G23A 2QM0A 4F3CA 1YA6A 4GSLA 2BFDA 1L7VC 2NVUB 3KL2A 2Z3WA 3BX1A 3W9UA 4YCSA 4HZUA 4X7RA 3FOZA 4ZI2A 3AHIA 2WIDA 3TTYA 3PX3A 1AO0A 1GL3A 4JHXA 5IWAB 2GM4A 4BO4A 4EABA 1W4AA 3LV8A 3PQ7A 2QRQA 3U7JA 2DG2A 4XKJA 3QWAA 1MAWA 4REOA 3H5OA 5EIHA 3W5JA 1ZN8A 3IQZA 1IDOA 1L5RA 2IPXA 2J46A 4JC5A 4PRKA 3AP2A 1NW9B 1G8HA 4EA8A 2AOXA 4G0ZA 2CBGA 4ZT5A 2YWHA 4LI0A 1SEPA 1OX4B 3OQNA 3H9CA 1SPXA 4A23A 3FE2A 4MUKA 2XUKA 4NU5A 5CMLA 5FTNA 3TQTA 3PWKA 2SCUA 3K7EA 1ULSA 1VC2A 3OA0A 2O1EA 3HZHA 3OQBA 5FADA 1SUEA 4MR9A 1FW6A 2QMHA 5NULA 4HGYA 4MYUA 3ADOA 4RTMA 1N6NA 1ZUD1 2MMGA 3MOGA 3QF4B 1E79D 3D2LA 1HTTA 1PQ4A 1TM5E 2HT6A 4HYEA 4RIFA 3ANNA 4KITB 2IQ5A 1OC2A 2OOSA 1Q15A 2QL6A 1CQWA 1GJRA 5K09A 2ANBA 2YJ3A 4DCPA 3BHNA 5SYAA 5BXQC 2DR2A 1Z08A 4MKZA 1C7FA 4A2PA 2KM1A 4CT5A 2OXFA 2B8WA 2CMGA 1L5YA 1AZSC 2QRHA 3F5DA 4AO6A 2VXYA 3EXFB 3FRIA 4JI8B 2QTRA 5IVKA 1NA5A 1FMTA 1HE1C 3LQFA 1QUFA 4BLVA 3ZWNA 2QX8A 3LC0A 4NJEB 1PJAA 1SG9A 3C7DB 1STOA 2XDWA 4ENTA 3T3PB 2K7FA 2WAOA 5AMXA 4N6NA 4C14A 2MMCA 4OQQA 4LJ8A 2QX9A 2VJPA 1E59A 2QG9A 1Q0TA 2I34A 3R74A 4F4JA 4OK6A 2WWXA 3GBVA 1R3UA 4ZN6A 2UZAA 4J16A 4MGIR 1AK1A 5COAA 3ZXSA 2XCRB 3V48A 4II3A 5D01A 3VDRA 1V2HE 2QZSA 3BGVA 1RQPA 3JTMA 3LPLA 3UYKA 3A0UA 5L51A 3PUJA 3BT7A 1QFMA 3G0CA 2TMGA 3QJYA 1DO0A 1V8ZA 3I4LA 3OX4A 3PKIA 4MVWA 2F8LA 4NE2A 3VZQA 721PA 1QVZA 3O3CA 2W00A 3GLQA 5ARBA 4YAJA 1E2GA 1OYVA 2CNWD 1Y8QA 3BG5A 1CR2A 1YR6A 3ORFA 4P38A 3GH3A 5IC6A 4F1WA 1VDZA 1TZKA 3E3AA 4NZNA 1UBHS 2EF1A 3KPYA 4EW3A 1LDYA 1NKSA 2REQA 4XSGA 5ERXA 3LXUX 3EEFA 3FGZA 1E66A 2C9YA 2FHPA 3C3BA 4YJKA 4TVBA 3W8EA 4XDHA 1HG1A 2EBUA 1I2BA 1XF9A 3AG5A 4IV5A 1ZX1A 4NONA 1TK2A 1QAOA 3IMEA 5G3ZA 1SRRA 4XAQA 5I7VA 4N6GA 3O9MA 4M1KA 1EP1B 1UJMA 1FF9A 2I7VA 3PJEA 2GZRA 5C8ZA 1R74A 3BXZA 4N18A 3ZDEA 3F78A 3A2NA 2REOA 3RARA 2RKWA 5CB0A 3R1IA 1Z7EA 4FONA 3H9QA 3RF7A 1F2TA 5SZKB 5B4TA 3EC7A 3AM5A 3L46A 3COVA 2GJKA 1QX3A 3Q72A 1CY8A 3PNOA 2W6OA 5TGZA 2NSHA 4GEKA 2C0QA 2X19A 4AYTA 4QEKA 2XW6A 1OIVA 2GNPA 3PVSA 2Z9BA 4JFRA 3IEMA 1RQ2A 3FLEA 4PLPA 1U11A 1I4LD 1XD2A 3HBAA 1VSTA 5F3RA 2RHWA 1IHOA 3SSAA 3ZJUA 3OAAA 3EFEA 1RTTA 2PT7A 3T5CA 1Y6RA 3H9UA 4KMSA 1DCKA 1G3UA 3SEZA 4J1SA 3WHIA 4MUNA 5HZGA 5ELXA 2EAUA 5ALEA 2NPOA 1N2CA 4G26A 2IHTA 2QR3A 1H22A 3HCBA 1E61A 1MV5A 3LKVA 5AI9A 4IKOA 3RTBA 4NOJA 2Q0SA 3UMJA 2GFQA 4LXTA 2V7TA 3IODA 4XGNA 5AK5A 1NMXA 4GMDA 3AHCA 2H08A 3T7DA 3WQQA 3WMGA 5JR3A 4GPTA 4DLWA 1FX0A 5BYBA 2G72A 5E38A 5LUAA 2JFHA 4IRUB 3Q7QA 5LDDC 3BFPA 3A1CA 4EB6A 1MO5A 2OCKA 2XV1A 4N65A 4RSMA 4MYHA 4F96A 3GLGA 1OWNA 4YQEA 4NULA 4RBNA 4BAZA 4QT0A 4UHEA 3OO0A 4C5AA 4E3WA 5B4VA 3IL2A 3EOBI 5AI8A 2FCRA 4CKWA 5I4IA 2ORVA 4GI3A 4M8NE 3LHKA 3I3SR 1FJHA 3DQPA 4M1OA 1CV2A 2ZOSA 4H6XA 1VL0A 2YWXA 3I52A 4JU8A 1PK7A 4ER3A 5HKOA 3JW8A 1VIAA 1U9IA 1PT8A 4FLFA 4ECEA 5JPCA 2B37A 1TZMA 3MWLA 4ZVKA 3OLVA 4KLRA 1UM9A 3ST7A 5JALA 3FWZA 1CQIB 1VDMA 2GAJA 1WOMA 4WBNF 4X5OA 4YMLA 2VYCA 5KI6A 1BROA 4UMEA 1UK6A 3QUQA 1BH6A 3E3OA 1Z8HA 2W2XA 3KQWA 4R2WA 4U0JA 1XVLA 4EHIA 3DMTA 4JJIA 4YJ2F 1T6NA 4BWVA 5FEUA 1UBMS 4CMCA 1WXXA 1PBTA 4QELA 3KQQA 1NP6A 4PLWA 2E4XA 4MIYA 1IM8A 4FINA 4YRJA 4AY6A 3PRJA 4P3PA 3LKZA 2KYRA 2O2CA 3KX2A 3NONA 4L6CA 3LW8A 3NBUA 4FZ5A 3GNSA 4NPAA 4JUBA 1TM7E 2BEUA 4R6WA 2Q21A 1RCTE 4QDKA 3ZYZA 4F7WA 4JP3A 4FB5A 1WV1A 4IKPA 4B4KA 5KPDA 3C14C 1OH6A 3G49A 3BWBA 4GRDA 3DZBA 3FSJX 421PA 3LOPA 1KFCB 3DBHA 5BVHB 5JYEA 1S2MA 1RP7A 2QQ5A 2EQBA 4AF8A 5T3UA 2MYPA 3EPRA 1XDUA 4TS9A 2CJWA 2O0KA 4IJMA 4UU1A 1Z4LA 2R84A 1ZVJA 2ZUDA 3BSYA 5JY1A 1L4YA 2I1QA 5FA6A 2EG9A 4BNHA 4C87A 3OTOB 4ZMRA 4RMGA 3RQIA 5HW0A 1GGKA 1SG0A 2ZGVA 1U0EA 2BFOA 2CNLA 1BE8A 2VDJA 5IT9A 4R1NA 1NNUA 2Z2XA 3HJNA 2NSDA 4G9GA 4XARA 2ADFA 1GR0A 2E49A 4FCWA 2RC6A 4HEA6 4IZHA 4L9WA 5AW3A 1MFPA 5HUHA 2QRVB 2WR8A 3T54A 1PFKA 2QD4A 5I7RA 4EO7A 2BPOA 3WQRA 1DSSG 1QGED 2FP3A 2OL4A 3D81A 3TKYA 1S8AA 1GQ2A 2VF8A 3CMCO 1TMOA 3ENQA 2Q6KA 2L42A 2XCQA 3GGOA 4IIDA 5EHQA 3ZY6A 2X1MA 1QHEA 1ZI6A 2BBSA 3GUZA 3N3BC 4B81A 2OG2A 1SIOA 3OQOA 2GHTA 2PFKA 2FDCA 4XASA 3SPXA 3DPIA 1GLVA 2ET6A 1O9HA 4IG4A 5DN6D 5JFTA 2FLVA 1UBFA 1NW3A 4ZRNA 3WWYA 3CRW1 1OV6A 2XNDA 4LYFA 1VP9A 3S2EA 5BN5A 2WTAA 1C9MA 4L1KA 2BGWA 3JQRA 3WNVA 1UPAA 1YS7A 4D3XA 5J4KA 1VBFA 1D04A 4AJOA 1QKKA 3GD7A 3I04M 1XVVA 3RLIA 3WRYC 2EEZA 4DJEC 4AJEA 1XLTA 2WD9A 3OQ6A 5AXBA 1QWSA 1DIHA 4O25A 1KS2A 1IQRA 4G5XA 2DEUA 2QXUA 3OZFA 1YKGA 2Q5LA 3C3JA 4FMCB 1GQFA 3OCVA 2Y6UA 1VLZA 1F20A 3U3MA 4TPKA 3WOVA 4Q6BA 5JD3A 3OEWA 4Q9NA 3TQQA 5A7FA 3FUTA 2IP2A 4CL2A 5JE8A 2Y2UA 3K2EA 3K70D 1I3MA 4K2HA 1EK6A 2ZSDA 3S6JA 1VSBA 1Z18A 2R6CA 4D44A 3C6YA 2ZJFA 5KCZA 1K4KA 1A8HA 4X9XA 4HPXB 1YZNA 4JBNA 2CY0A 5JFOA 1CUXA 4BLRA 2PFGA 4ND6A 2XRYA 3S29A 1M5UA 3GWGA 5K6AC 5LJLA 4D4HA 4CIVA 4GX0A 2E37A 3PXAA 5FOUA 1ATZA 5ECGC 3RJ5A 1T3ZA 5T6BA 1GPKA 3L7BA 5BWOA 3BH6A 3OOSA 4F91B 2G9NA 1FVFA 1FNCA 4PAOA 4MQUA 3ZHBA 1A97A 1AKYA 3SJAA 4DJ5X 5BRNA 2W2LA 4EHJA 1MT3A 4F5EA 1DG1G 2FCAA 1I10A 3I2GA 3KC2A 3QLUC 4X90A 3S28A 2R2AA 3KT8A 1EX9A 3KBOA 3E15A 4WBSA 2XYVA 2AZMA 2JATA 4ARCA 4RTLA 3KXPA 5H80A 3H2IA 3TD2A 4EQ6A 2J5QA 3N70A 4YS6A 1G3MA 3QHAA 1ESEA 5KQSA 1L8QA 4N49A 1DIGA 1Z5OA 4UTNA 2NXEA 1JAYA 5FPSA 4YCCA 1JQ3A 3ZS9A 4K88A 4MUXA 1ZH6A 4EENA 1H4SA 4P92A 2V97A 1JAIA 2REXB 4TZKA 2ACWA 1SXHA 1HO3A 1BE6A 5KB3A 4YDHB 1SN7A 4MRMB 3CLRD 4RX1A 1KKUA 1JQBA 2Y76A 2ZPTX 2XT6A 3BILA 1L4EA 4LE1A 4MQ6A 2B34A 3DLPX 5A9SB 1RYEA 5LWQA 1NVWQ 2VKTA 2EX4A 2IUFA 3F3KA 4Y2JA 1GXSA 1RI2A 2GD2A 3K9GA 3PPXA 1AMUA 2BGGA 2BUBA 3NWBA 2A5FA 2I9PA 3A6FA 3MRVA 5JWRA 1MMFB 1XO1A 4PFKA 4PSCA 3U13A 5DE3A 2P30A 2VNJA 5LR6A 3EGEA 3H9GA 3QM1A 3GC6A 2D06A 2AN5A 3UMYA 4UBJA 3KRTA 4CM8B 5SY4A 3OZGA 3T0FA 3T34A 3T5MA 3U1TA 2VQEB 1V1RA 2VJOA 3EG5A 3HB7A 3NUQA 3OVMA 4JKOA 4WCFB 2Z2IA 3B13B 5G0TA 1JKFA 3ZE0B 4D97A 1X13A 1SKYB 1GRNA 3M3HA 4IFEA 3HGMA 3IQXA 4QATA 4QEDA 2GBPA 5T4FA 1GPAA 1H9AA 3ND8A 4EHKA 1W2GA 2PS1A 3SHQA 2FZVA 1DBPA 3WRXC 1VLHA 1AM4D 4MJLA 5F1KA 1YXMA 4HWTA 1QK4A 3J80A 4ZZ3A 1H1LB 2B5OA 2H8GA 3VDXA 1FFSA 5AT1A 1N7IA 2J5XA 3ITNA 1CUIA 2IKQA 2I2BA 2Q4DA 3L06A 4R8RA 4X8LA 2WC1A 3NV7A 4XYMA 1M5RA 3DXXA 3WKEA 5IBPA 1IM5A 4EUHA 4F7DA 2EBHX 4IVPA 3WS7A 2GEUA 3BD8A 1PNVA 5C4MA 1QIJA 4ZJPA 2HR1A 4DIMA 4CQMB 3B48A 2ZP1A 1F9EA 4O59O 1ZD9A 3CRRA 3ND5A 5JAOA 1J56A 2VO1A 4MEAA 5JLAA 4Y2PA 4YT4A 3VHQA 1T9ZA 1E5DA 1N2XA 2NVUA 3I1YA 3NX4A 1Z34A 2C2YA 2FPGA 2J8ZA 3EASA 4YBRA 3UT6A 1QYVA 2BBTA 3NOQA 1SMKA 3W34A 3ZDYB 1RI3A 3NDPA 4M1TA 3GVHA 1DXHA 1NP3A 3M6AA 4IIJB 5AI0A 4Q16A 2ORIA 3G7UA 1PL6A 5KINB 1VLVA 2W6PA 1WW3A 1KFKB 1NR7A 1UXHA 4PWYA 3BHJA 3JZDA 5GONB 4DSNA 3QW2A 5H8WA 1FDSA 2Q1SA 4I81A 1H5QA 4MSUA 4OFBA 3PXEA 3GLIB 1LRLA 2H51A 2KWIA 2QRUA 4HHEA 1OX4A 3P8ZA 4R81A 5EMJA 5JDIA 1EB9A 1HT0A 2XWQA 1E4EB 3AR7A 1QHYA 3HXKA 2DJ5A 3KQYA 3E05A 3RIMA 2FKNA 3K8YA 4YIHA 4PLZA 4IQ0A 3C3CA 4OFXA 2B4RO 3F4KA 3RSLA 5H9WA 2ID4A 4LDJA 5LMZA 3F4LA 3E3NA 4OK3A 4BXOB 3QF4A 1QPZA 1KL7A 3QMVA 3LCVB 2C77A 3H17A 1U6JA 5DEIA 3NAMA 5GV7A 5ELLA 1GDTA 4A6XA 3R5KA 3TZCA 4YAGA 4Y9TA 3PUWA 1HNXB 1TMKA 3IALA 2QTVB 4J1NA 4LJSA 4QASA 3EXFA 4M1QA 5EVJA 5CB8A 2XBMA 3OMLA 4M6WB 4WLEA 2O3UA 2V5UA 4IXWA 3AVVA 3ZCXA 1KKLA 5L3VA 5EGSA 1V2GA 4NJEA 3E70C 2ZRIA 4KR2A 1JAHA 3K16A 1AGPA 1JR2A 2OO7A 5J63A 2EKBA 3DL4A 1M8FA 4AJ4A 1G2PA 2BVNA 4NJOA 5G1NA 3ZQ4A 4G0YA 2JD1A 2RHTA 1GV0A 1U3GA 5CDHA 2ZWVA 1Z39A 4LNUB 1H8EA 2QAGB 3OLXA 1I9CA 2ZRLA 1XYVA 1J24A 3K73O 1JLMA 3GU3A 4V0LA 4MRRA 2EW8A 1EVLA 1K5GA 5FORA 4F8JA 4IXNA 2QAJA 5DMXA 4CEIB 4X97A 2DUMA 2EZTA 4AN4A 3HCCA 2YMLA 3L4EA 1JHVA 2ZU6A 3OWHA 4ZAVA 4ES6A 1A9OA 2RB5A 3SSMA 1AKWA 1WUJS 1D6SA 3NEYA 5ED4A 3KZMA 4IYRA 4RVDA 1KI9A 1GM5A 3EXIB 3CZCA 4G0OA 1X77A 2WWHA 3ILHA 5DJ5A 4U6QA 2R5NA 3SP1A 1E2BA 3HV0A 2ZR7A 3H1AA 2A9QA 1KYTA 3L6DA 3FWHA 3G0IA 3Q3GE 5FOQA 1G64A 1HFJA 2FW6A 3KOMA 4YGXB 2GD6A 4OM8A 2JDID 3PHJA 4DR4B 1RHQA 5AJHA 3LUDA 2JGNA 1R0XA 3DC7A 1CR1A 4U2KA 2QZJA 2XVYA 5CDUA 3H6GA 4C29A 1DWPA 2D0OB 1BHJA 2D00A 1MG0A 1OGYA 1FFWA 4UTVA 1T8TA 1IWBB 1QYDA 3AF4A 3NC1C 1NJ2A 2FW8A 4ZDKA 3CVWA 4DY6A 2FPMA 1LK0A 4U5XA 3TVTA 4H16A 3PQ3A 4L08A 1V48A 1CYEA 1FQOA 3PXUA 1G2QA 2G08A 3Q5GA 3V1YA 5CEEA 2C95A 3NGMA 3QBEA 2V7WA 3K0HA 2GYUA 2XPCA 3KKOA 1J0BA 1C9NA 1YJ8A 4G1FA 4L0MA 5EG5A 5AW6A 3L0YA 3TNLA 2PZAA 2PY6A 4G97A 2ZDQA 4XWGA 5DCYA 4RTKA 4CMKA 2RHBA 3L5KA 3A0RB 1NULA 4F3YA 1C2YA 2VXOA 4NFYA 4OG2A 3KO8A 4RHEA 3GRFA 3Q40A 1X1EA 4X1YB 1S3SA 3FZGA 3PE3A 3ZJ4A 3H0KA 5F12A 5CFNA 2VHWA 3RT7A 4JBHA 5AUOB 2DB3A 1M8GA 3N2LA 2BP7B 4LHVA 2VPIA 3LO8A 3EVAA 4YALA 5FBLB 4B4DA 2Z58A 4DAEA 1FPMA 2B2NA 3KL4A 5ANRB 5IXSA 3ZZNA 4KRFA 3RC2A 5JJ5A 5GIOE 5JQGB 1AOXA 1MAUA 3QE9Y 3QJ5A 2I2CA 3F5FA 4CHTA 3IR5A 3I92A 2F3RA 5TVKA 2A5YB 4IICA 3TUIC 5CAEB 3I61A 1TEHA 1P2FA 3IKTA 1ND5A 4RM3A 2I6FA 3DEAA 1E3LA 3W0LB 4Z5XA 1XD8A 3ANYB 3NRBA 3DZIA 5A0VA 1PFWA 1A8PA 1T5OA 2FXVA 1Y3IA 5DGCA 1KYIA 4EVQA 1QRDA 1V5EA 2W6IA 1BVRA 3HYCA 4MGEA 1CQIA 5ALTA 3TN7A 2QUZA 4QO8A 3O1HB 5AJZA 4BV2A 1W85B 1TC2A 4TT3A 2CD9A 2G4LA 3ONVA 4PYQA 4PN3A 2QPTA 2L19A 2IPNA 4TS3A 1XEAA 4Y0VA 5LA6B 4W5RA 4MB0A 4MS4B 3SDBA 2EOAA 3IXQA 3UATA 1E18A 4QSHA 1KXZA 2QN6A 1UZNA 1T1RA 4WVLA 4G9EA 3TIFA 2GGSA 3UT0A 4M9CA 3VOTA 1RZRD 4FU0A 3OPNA 5EHGA 4FYJA 3AINA 1Z35A 1IMOA 3SICE 4JV5B 5HF8A 5GTDA 1XYYA 3I6ZA 3BB1A 5BV0A 3FKSA 5K3FA 2FE1A 4XB2A 4CIBA 1XZJA 2WBLC 3B51X 3M4XA 1FMJA 1X80B 2DFLA 1G7TA 2O07A 3M3DA 1ISSA 3ZDAA 3UK7A 5BVHA 1SUSA 1IIRA 3GRZA 3TK1A 2ZZMA 1BC5A 5JW6A 1BD4A 4YRIA 3PS9A 1TVCA 2RBKA 1UDXA 1UJBA 2VJCA 3D3QA 3FX2A 4BTVA 1ZCFA 1DKLA 1ODJA 2R00A 2XXBA 4DNPA 1U6IA 3ZVKA 2ONJA 4A15A 1DBSA 1RAHA 1HQDA 3TEJA 4Q82A 2H0AA 4CUKA 1TD9A 1QH8B 4F06A 4N7BA 2A0FA 3TIGA 2IU0A 5IVDA 3GJ3A 1JT2A 1DEHA 3BGIA 1PYDA 1G8MA 3Q2KA 1A5ZA 1E5VA 1OFHA 4I8XA 1ORRA 2QRVA 3JQAB 3EF0A 2VHQA 3U3RA 5ALOA 3VHXA 1GG9A 1ICIA 3C8UA 1KEVA 4GNRA 3GDWA 4KLNA 2NYAA 2XRFA 4PAWA 3I0NA 4MVJA 1R5OA 4UUQA 5AKLA 3RF6A 3TXYA 4IIHA 1H9CA 1ODIA 3FM9A 3O47A 1NBME 4LWPA 3E48A 2I6UA 1E2EA 4YPOA 3RBAA 1PLJA 3WGJA 1A50B 4JLSA 4UDNA 2CHFA 1PDWA 2NSJA 4OXYA 5C7YA 1RWKA 2PUTA 2YASA 3LK6A 3OQJA 4FFLA 2BR5A 4RXMA 2DT8A 3NOVA 4WZZA 3SEQA 1G7RA 1FUKA 1WZCA 2LZ0A 1U8TA 1NZDA 3AFNA 3GVXA 3LKDA 4RELA 2FWNA 4QOFA 1E5TA 1R8YA 3AR4A 1TVMA 1XYGA 4WOBA 5CIYA 3TUZC 4NPCA 3VR3D 4BVJA 3DB2A 4E30A 5CM9C 2C7OA 4F6RB 2ZYHA 5JY6A 1Y7TA 4V0MA 1RKQA 1OAOA 2C9OA 2YC4C 4YC7A 2QORA 3SQLA 3HBJA 5KHOC 2EGHA 4TVKA 5EP4A 2J5RA 3W6OA 3A2LA 2W90A 4W1PA 1MJNA 1UP7A 3IEVA 4HNRA 1TAHA 2IW1A 2UDPA 1CQZA 2IWHA 4KVGA 4YCBA 2C2BA 2OBNA 1G9SA 3R3YA 1ZM4A 3U3KA 5KMGB 2ZXEA 1XZQA 4B3BA 3PFCA 1L3CA 3FUXA 1M2JA 1OA1A 5CT5A 2QA5A 4KJZA 2LV8A 1MIHA 3H2KA 1CWUA 4LYEA 1KQNA 1HF3A 1ODCA 2VXCA 3TZBA 4A0FA 3AV3A 5TS2A 4BQOA 4L15A 2GBLC 5B5SA 3NDRA 4P32A 1MJ5A 1N8KA 1EFAA 3ELUA 4DQXA 3THWB 5IXYA 1M1YB 1V3TA 2C3YA 2HCTA 1JFFB 1MU0A 2Y0PA 4GNKA 5T5QA 5TY0A 2V55B 3GIWA 3D4OA 3KYDB 1Q44A 3HCFA 2HU5A 3RUFA 4GKJB 4RDXA 1XMXA 3AJ9A 4H7DA 3P9KA 4DV5B 2OC9A 3R77A 4NCHA 1Q7TA 4HWSA 2ACKA 4BCDA 2B4QA 3DFKA 1CUWA 2GS9A 2HRRA 3QW4B 4IWYA 3WL7A 2J30A 3PHGA 5DV9A 1R66A 1T3HA 1A4UA 3QEJA 4D26A 1UPUA 4TYYA 4X1IB 3BIJA 1QOZA 2VUHB 4AKIA 5DSXA 3MPOA 1XTPA 3SE0A 4ZCTA 3ECCA 4WBXC 4ER0A 3SS9X 2YS6A 2LCQA 3ZE2B 1R6BX 3IP8A 2D5BA 4XCXA 4ZYWA 2I87A 1FQKA 4MRMA 3UPTA 1J8YF 1H85A 3W6ZA 3UGJA 5A9SA 1DC3A 2Y93A 5ENDA 3LPNA 4EPYA 2AD1A 4F4FA 3JQPA 4R8LA 3LLCA 5C8XA 3ICEA 4AY5A 4HWKA 4EDFA 2VDRB 1FFCA 2ZTMA 3NPAA 1NXTA 5EXPA 4C3ZA 5E6SB 2D7CA 3UF0A 5JUWA 3GLFE 2ZVPX 1NP7A 3HNPA 1D5WA 1Y3FE 5EYPB 1UBOS 2BZGA 4FJ2A 4D98A 4CM8A 1IATA 1ZIXA 3D6VA 5H1YA 4Y1RB 4P3KA 5C5DA 1G38A 1X2EA 1GZ5A 1SD2A 2C42A 2Y2VA 4I1SA 4GHWA 4XTCS 3RUEA 4ZP1A 2AH5A 2PRYA 4M2LA 2P9FA 2GZMA 1U3TA 1HSOA 1Y1PA 2HKIA 2JJQA 2Y71A 3AHHA 1BMQA 3SDSA 1NNLA 3ITDA 5JVDA 3AF6A 4Q4HA 1H1LA 2PQ0A 4AKSA 5I9TA 2IEIA 5KEIA 3EJWA 3IAUA 4FDLA 1OYOA 3N0TA 3CWCA 1G6OA 1T34A 5K0LA 1KQOA 3GFVA 2HXGA 3UAZA 1USKA 2NW6A 4J4BA 3R0QA 3WGTA 3H7AA 3O7MA 2MCFA 1R9GA 1KPIA 2ZRJA 1CUZA 1N4AA 4QX6A 4JUFA 4D42A 3KTOA 2WQ7A 4CG3A 4YMUA 3RS5A 1T9BA 1VJ0A 3GXOA 3PR3A 2XQFA 4CQMA 1HR0B 3DMGA 5K2OA 1FXWA 1VQ1A 3SNHA 4RY0A 4BVGA 2ADOA 5CCBA 2PSHA 1JS1X 1NBOA 2ZIZA 3GGGA 5DTRA 4A91A 1QYRA 3L6OO 3FCYA 1J8FA 4G1EB 2F1JA 5TR9A 4AY3A 4QA9A 1FMCA 3EH1A 1FK8A 2EKQA 3HWX1 4A0GA 2IHZA 2XBUA 1OH7A 1H8HA 3G7NA 1U9ZA 1JHXA 1IH8A 1NVDA 2WNSA 3CRZA 4Z99A 3X0DA 1Z63A 1TIBA 2BV3A 1BDIA 1M76A 1ZGJA 2IUTA 1DWQA 2VR1A 3SNKA 2V5VA 5GONA 1PL0A 3E2MA 4B85A 1NRXA 1FFXB 1U2GA 3KCQA 2VTKA 1O3YA 2XSZD 4B6QA 1F7UA 3GLIA 5H68A 1KOJA 3BCUA 3G9ZA 4RO0A 4UC0A 5F77A 4G6ZA 4MWTA 2YVUA 1U1GA 1E4EA 3C3XA 1R2QA 3EH2A 3HEAA 4PTLA 3WY9A 1YHYA 4PPYA 1OI7A 2RG7A 4EG1A 4K0KB 1F4VA 1XJQA 3AI2A 2H1WA 3H9EO 2HJVA 5KQGA 1TKCA 4MYTA 4BNDB 5LDHA 4BXOA 3FDZA 1IY1A 2VDWB 5FI3A 1DWOA 4CLDA 2XMPA 1I8TA 3X43A 1JI0A 1PZHA 3LBHA 1YZ3A 3OLYA 3DFIA 2X3UA 4UD2A 1Z6TA 1CJTC 1Z62A 2F3UA 3MMXA 4I5FA 4FOTA 1XEXB 3TBHA 1J23A 1EVEA 1UBSB 2QTVA 4MROA 4C7KA 1GFWA 4KQJA 3I2KA 4XGKA 1HE4A 2QIOA 4QGBA 1X42A 3MVEA 1KDVA 4QOSA 1AUOA 1UAAA 4M6WA 3RHZA 1O96B 3VVCA 1MQ8B 1WUIS 2Q29A 2V9ZA 4IV0A 1WCV1 1KU0A 5FBHA 3ZEAA 4HD8A 5B3JA 1M34A 3GEIA 2QZ4A 3UUWA 4CG1A 5AVTA 2CMKA 4PYRA 3D8SA 1TXGA 4MICA 4MVJF 1JQAA 1KO4A 1FTSA 1YZFA 3HMQA 4LXGA 4DYHA 2VYVA 2BGKA 3CVJA 2ZPAA 3DAGA 3CM0A 5CW2A 5A05A 3A05A 5TDHA 4LNUA 5YASA 4BUCA 4TZ6A 4GXNA 1V8OA 2Y8EA 1ABBA 2QAGA 1VYHA 4BO8A 1IBLB 4OGGA 3ABZA 2G25A 2ZWPA 3WDMA 1W8DA 1VCMA 4X7MA 2IIPA 1CTQA 2AJTA 3A37A 2PZ8A 3KYIB 4CEIA 4RUKA 2QG4A 4UNSA 1E1NA 1WQ4A 4FS3A 2BGJA 4LYDA 4JJ4A 3TNDA 1BCRB 4JR0A 1FU7A 4XPIB 4NC9A 4UZEA 4FP9A 5DVZA 1I01A 2VDOB 2WZQA 2A4MA 4FHDA 3RS7A 3UHPA 1WBBA 1SC1A 2WV9A 3ASUA 4RPKA 5TF4A 4J91A 4EX7A 1W0CA 5KQLA 2PVPA 4YT5A 1W1UA 2HWXA 3ELYA 5DTMA 4XVUA 3H3FA 3R7AA 3PJDA 1BWQA 3AJRA 2E5WA 4FMCF 3PRHA 3Q2IA 4JKIA 4BGUA 4GMKA 4R3UC 4QE3A 3H87A 2VYND 1Y89A 1AKNA 1YCHA 2P9TA 2DUUA 1U0FA 2DTEA 3JY6A 2P40A 3LUCA 3O0TA 3PL1A 3VH2A 4D6YA 1UC4B 2QTHA 2RMKA 4RZXA 2PJDA 1KYXA 1NW7A 4KOAA 2PXCA 4KPYA 2Y0EA 3O9ZA 2ONZA 1OI2A 2A0XA 2G1UA 5EQJB 3UWPA 3KE9A 3FTFA 4BIMA 3I6YA 5E2IA 4UJ5A 4WIAA 4LXYA 4RJJA 2UYGA 3EULA 3SYLA 4MCIA 1ZJZA 4AF6A 3AT1A 4TYQA 5K0SA 2Q5IA 2YDYA 3QWHA 2YCBA 1WSAA 4EYQA 3D02A 1D2HA 1Z6AA 1LI4A 2XB9A 2JS7A 3VTFA 1EDZA 4ER7A 1P1FA 5DLDA 5L95A 4TQUS 1GO2A 1TVEA 4N7MA 4RXUA 1KORA 1DHRA 3RUPA 1JHYA 2C7BA 2AV6A 2QRKA 1FW8A 4B2YA 5LQCA 5L3SB 1BMFD 3CRNA 3BXEA 4D3YA 2VOJA 3QTBA 4ESHA 4RIGA 4X8MA 3G82C 1ENYA 1JEJA 3G2QA 5A4JA 3PGKA 1XZLA 3QMWA 1RYFA 1E3MA 3FOCA 4RZSA 1EXVA 2YQ4A 5LD2B 5AK4A 1GL9B 3LVQE 1TEVA 4ND4A 1P81A 4TQGA 3SHFA 3ZLVA 4OIFA 1S2GA 3LPDA 3QPVA 4QDXA 2JH9A 2BP7A 5BR8B 3K1JA 5KNDA 4ZFNA 3O82A 3S7ZA 4WK2B 1YGPA 1QSGA 1N8SA 1M1YE 1P7ZA 2FN7A 5IM5A 1AZWA 4E2ZA 1TU3A 4MVCA 5T6MA 3QX3A 2I66A 5HFAA 3LLUA 4O0LA 3UMRA 3KR2A 5JQGA 2EQAA 4RPJA 2E5LB 4BEVA 4KQXA 1RLUA 2ZYAA 1JJFA 3WHKA 2I3GA 3DEZA 1DIAA 4GP6A 1TJPB 5CAEA 5EZYB 2FUNB 5JZBA 5KTYA 3UAWA 4PSUA 1LNZA 4A9AA 3JVIA 2WU1A 2WE8A 1Q7CA 4QQ8A 4J3NA 1NT4A 2CXRA 5IFLA 1U7OA 5GGXA 2J3LA 2AJLI 4UFOA 3DZCA 5JD5A 2C5HA 1A9ZA 5FV7A 4E11A 1WAMA 4UVEA 1YIAA 1D09A 1W85A 1J00A 3FVTA 1Y9DA 5ALIA 3QV2A 3RV4A 1PD1A 4HNSA 1GITA 2FP4B 2W9XA 2B6NA 4R0MA 1YH3A 1MB0A 3MLAA 4JAVC 2JIPA 2R5FA 2WUVA 3H19A 4MS4A 4OHUA 4PQEA 1ZM7A 5LA6A 3RS9A 4YYEA 4G5YA 2XKJE 2PA3A 3IVGA 1KO8A 4UEQA 4EFLA 4N0DA 2YFKA 1T3SA 3CRQA 3L8ZA 4L4RA 4HVCA 3MSCA 2JEYA 2RK6A 4FWBA 3O90A 1YRBA 1NN0A 1Y8CA 4IGKA 4IMIB 1Q17A 1L4GA 2ISQA 1EP2B 2EP5A 4FQ8A 2XYQA 4Q7KA 4DSAA 2OK8A 2PWBA 1FXWF 2UYHA 3GMDA 1X80A 3F5QA 1JWLA 4O3FA 2O14A 5JAHA 3KKQA 4C7VA 3LLVA 1GPUA 4OEHA 1ZSNA 3BK2A 4BP3A 2FSUA 3O2JA 4I5IA 1BFDA 4DVJA 1D8AA 1DFGA 2GAOA 4GBMA 1L5WA 4K3VA 1KI8A 4WL0A 4IIJF 4IJWA 2VPXA 3TTTA 1BX3A 1QVWA 4M0KA 1AO3A 4II2A 4YRKA 5J58A 5COBA 5GONF 3IBYA 2J9RA 4YV7A