1DCKA

Structure of unphosphorylated fixj-n complexed with mn2+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
b'MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
publication title Structural transitions in the FixJ receiver domain.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Transcription
total genus 39
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dckA00
5JS1A 5JNSA 1UDRA 2RJOA 3O21A 2LIVA 2P9HA 2PLNA 3O1IC 3DGFC 5JNRA 2FQYA 3LUDA 4ML3A 4F3TA 3OM1A 1ZY2A 2WB4A 3FMVA 1JX6A 4Z9BA 2FQWA 3URMA 1WETA 5ED4A 4WT7A 5PNTA 1MB0A 1YS7A 4ETMA 8ABPA 4RY9A 1LK0A 4L85A 4DADA 2IPMA 5BR1A 2FSPA 4CBVA 3RVLA 4OLBA 3NNNA 4LX8A 3LMKA 3GYBA 3QLVC 3RQIA 3QLVA 4Z4EA 4YLEA 3BRQA 3D02A 4MQEA 1B00A 2KYRA 2OENG 3G1WA 3IP7A 3DBIA 4RK6A 5D2CA 3SQNA 3OQNA 3EULA 1KRXA 2E4WA 4MPTA 4IRXA 2FKAA 3I45A 3OMWA 3OMXA 4MLDA 1URPA 5CNMA 3VNBA 3G85A 1D4ZA 1ZHHA 1LBHA 1DBPA 4IMJB 2QV0A 5FBKA 4XARA 1PUXA 2JBAA 4N76A 4EYKA 5HQJA 1DBQA 2L18A 4MLCA 3CZ5A 1LBIA 3RVOA 1USIA 3IP9A 4JOQA 1QP7A 3M9WA 3CZCA 1RXIA 1R8JA 1P6UA 4ETNA 3IPCA 4HNQA 1KRWA 4EY3A 1GUDA 1QP0A 1NXSA 2FTKE 1Z12A 2H3HA 1JFSA 3L49A 2CHEA 2NZUG 3OQOA 4KVFA 3K9CA 5DGCA 3OO0A 1BDJA 2LBPA 2ZAYA 4NICA 3GA5A 4OG2A 1PEAA 3CRNA 2RGYA 3EODA 2H0AA 3LKBA 4G0PA 2PKXA 3MA0A 1ZN2A 3HSYA 3L6UA 3TX6A 4G97A 3C3KA 1T34A 4UHKA 3CHYA 1CHNA 1AB5A 2FMFA 1J56A 2MYUA 3QELA 5KWSA 1DC8A 4MR9A 3E61A 5DCLA 5HSGA 3KTOA 4PEVA 3BRSA 4WXMA 3RVSA 4G86A 4B09A 1ZAYA 4KMRA 1EWVA 3DLHA 2A9RA 1RXEA 1TVMA 3O1JC 4RZSA 3C3WA 5JNVA 3S99A 4PZ0A 3HDGA 3LUJA 2VUHB 1IIBA 3IDOA 3Q41A 4MRMB 1QQBA 4RWEA 2HQOA 4HNSA 4W5QA 4JASB 3HDVA 3TD9A 2ID9A 3F6CA 3KHTA 3A10A 4D6XA 3Q9SA 1QP4A 3MM4A 3GBPA 4MAAA 1W9HA 2GX6A 2P4UA 1DRJA 4RY8A 4WWHA 1SRRA 5FWXA 4H60A 4RXUA 4KREA 4N0QA 3IP6A 3CG4A 1GCGA 2R4QA 2L2QA 2FW0A 5DTEA 3GBVA 3B2NA 4PE5B 5TPWA 5BRAA 2VUIB 3RVJA 4H3KB 4RK7A 4OATA 3QLUC 1TM2A 1Z13A 1Z25A 4Z99A 4N0PA 2QXYA 1DG9A 2IDMA 1DRKA 4G0XA 2PUBA 4L4UA 4O1IA 3ILYA 5TQ2B 4FE7A 4MQFB 1QO0A 1Z26A 3JVDA 4Z4FA 5FWYA 4KNYA 3LUFA 3T38A 3H6HA 3H1GA 2MSKA 3MQ4A 4FB4A 1JBEA 4W5RA 1SD5A 1LJUA 1ZITA 2PMCA 1E2BA 2V0NA 1TLFA 1DCMA 1KGSA 4RDCA 4P1ZA 5HM6A 5B3JA 3NHMA 3OLVA 4FE4A 1SXHA 4TMYA 1DC7A 4E7OA 3KYIB 5TQ0A 3RH0A 3MIZA 4TN5A 1JFVA 1ABFA 2CHFA 2Q5CA 2GI4A 4LDAA 4EYQA 3VNAA 4HYEA 5KC9A 3LUAA 5E3JA 4LDZA 3MMNA 4WXEA 4GPAA 4D74A 3EJWA 4XAQA 4RKQA 3CTPA 5GQSA 1JWLA 4G0MA 3EQ2A 3NNDA 5EWLB 2JB9A 3HUUA 1U0SY 4JB2A 3K4HA 3LUGA 1EWKA 2PAFA 4P98A 5TQJA 3M9XA 3N8IA 4F12A 2IPAB 1ZH2A 1A04A 1Z16A 2M1ZA 4W5TA 1NY5A 2A9QA 3RVKA 3N53A 4RXTA 4RK1A 3KS9A 3GRCA 3H1FA 3GWGA 1F4VA 2ID7A 3C6QA 2ZWMA 3H5IA 5C5CA 1FFGA 1MVOA 3GT7A 1Z18A 3H5LA 3CFYA 4TLMB 3JVIA 4QICA 3HV2A 2A9PA 1AB6A 4Z4IA 1PHRA 5BQ3A 4RS3A 1YTUA 1EFAA 1E6MA 1QMPA 2HQBA 6CHYA 2E4ZA 1NXXA 3UUGA 1Z15A 1K66A 3MF4A 4ZMSA 2FMIA 3QEMB 4G0QA 4YWHA 1VKRA 4S05A 3RVQA 4Z4GA 1JYEA 4Q6WA 3MYYA 4LE1A 5DKFA 2HJ9A 5F64A 1NATA 2AYXA 4YGXB 3FFTA 3A0UA 5KC8A 3T8YA 2FN9A 1JDPA 1E6LA 4N47A 1LJLA 1OXBB 2CWDA 2PL9A 3C97A 3HCWA 5EWMB 4IILA 3E3MA 4XFKA 4PICA 2M98A 2WJAA 2YHAA 3H6GA 4MR8B 4RKRA 2PUGA 1RPJA 1BA2A 3TO5A 3UK0A 3HK2A 1U04A 4JB0A 4OTZA 4M88A 2WWVD 3EDCA 3QEKA 3I5AA 3EQZA 2PL1A 1MIHA 3BBLA 3JTEA 3LTEA 4NQRA 2FLKA 1EHCA 2FQXA 3QLTA 4YP9A 1M2EA 5IEBA 3OLYA 1YVUA 3N0RA 1APBA 2JK1A 3OM0A 3A0RB 3KG2A 2PUAA 1YMVA 3SY8A 3DGEC 3GV0A 2RJNA 2NT3A 4MS1B 3NBMA 3T6KA 4MS4B 2PE5A 1MAVA 4RU1A 2QSJA 4MR7B 2PUDA 2IKSA 5FBHA 4Z4CA 3FFXA 1FSPA 3RVNA 5GOTA 3RVRA 4W5NA 2FEPA 4YCSA 4XXHA 4Z9AA 3F7NA 1CEYA 3F6PA 1XHEA 2FMKA 3NNSA 1VRVA 4W5OA 1C4WA 5EWJB 3HS3A 5JNWA 2FVYA 2E4UA 5BRJA 1U2QA 1JHZA 1USGA 4MRMA 2WRZA 3OO1A 1W25A 3HEBA 2JVIA 2MYTA 1ZVVA 4KQ9A 1FFSA 2WMYA 2JVKA 3QLUA 3JPWA 4G0YA 4OLAA 4Q7EA 2LUOA 3O2JA 3H1EA 3HXMA 2QVCA 1A0OA 4F8JA 2NUBA 3N6VA 4ZYLA 1P6QA 2NZVG 4MS3A 4XLTA 3SAJA 1HEYA 3UKJA 4E7PA 4QPJC 3HZHA 3I09A 5IEJA 2FMHA 3Q7RA 1YMUA 4JA2A 4ZPJA 1ISSA 2E4VA 1PNTA 4KQCA 4LE0A 2YHBA 1DCKA 1EWTA 5TQ2A 4LRQA 1M5UA 3Q7TA 4MQFA 2IPLA 2NT4A 5IUNC 5KQMA 3QX9A 4Q6BA 3KLNA 2HSGA 4F11A 3CLKA 3SNKA 4JP1A 4LE2A 1RZRA 3O2SB 1XWWA 1ISRA 1L5YA 3GL9A 1I3CA 3QX8A 4KK4A 1PEYA 4HNRA 3OQMA 2MSLA 3H5OA 5IX8A 1RZRD 1P2FA 1QKKA 1C0EA 3OLZA 3FFWA 3FGZA 2B4AA 3D8UA 2HPHA 1D1PA 3KSMA 2VK2A 6ABPA 3KCNA 5TPZD 2F8TA 4MQEB 4YS6A 1FFWA 3H5TA 1SXIA 1U8TA 3CNBA 5EWLA 1D5WA 2QW1A 4KFCA 4RK5A 4KV7A 1VPWA 3I42A 5CNJA 1BAPA 1NXPA 3A3KA 1YK1A 1A2OA 4YO7A 2QVGA 4RXMA 1L5ZA 1PNRA 4WZZA 3ROFA 3RVMA 3LKVA 4RV5A 1S8NA 1OXKB 4F06A 1H9CA 4IF4A 5JS2A 5HKOA 1VLZA 1DJMA 1NTRA 4RSMA 4RK0A 9ABPA 2HQRA 2RDMA 2R47A 3IP5A 4Z4HA 2JBAB 3QK7A 1EAYA 1CYEA 3LUCA 3C3MA 4IMIB 3O74A 2R48A 2FN8A 4Y9TA 2WJWA 2LP4Y 2E4XA 2W42A 7ABPA 4PYRA 4ETIA 4KRFA 2MYNA 4JAVC 1ZGZA 3F73A 2FLWA 4LZLA 3LUHA 2L19A 3M6MD 3QEMA 1BDHA 4NCBA 1RNLA 5IULC 4KZKA 4Z0NA 5KQGA 4TLLB 1KMIY 3JY6A 5IC5A 3HO1A 3H5WA 2FEKA 4EYOA 4YV7A 5KI6A 2O20A 1FQWA 5CNKA 4ZJPA 1XHFA 3SM9A 3N75A 4KK3A 3LUKA 1Y1LA 4NV3A 2L17A 4EYGA 2PUCA 4YRZA 5EWMA 1DCFA 3Q7SA 1ZH4A 2PJUA 1Z2EA 3HVRA 2PUFA 3RVPA 2B1JA 4N41A 1JFTA 1M5TA 1K68A 2QR3A 3H75A 1Z17A 4MR8A 4EGSA 3KJXA 3QELB 1GUBA 1TJYA 4MR9B 4S04A 2F8SA 2E4YA 4EVSA 1JL3A 1DZ3A 1QNLA 1SXGA 2N9UA 5DLEA 3JPYA 5CHYA 4RK4A 2OQRA 4GNRA 1JH9A 3KKEA 4WUTA 4YR7A 2X7XA 3IPAA 4N03A 3SG0A 3CKMA 4EUKA 2GBPA 1ABEA 2AYZA 4MS1A 5IUJC 3P9YA 4MS4A 3OLWA 1BVHA 3Q15C 1P8AA 1GCAA 2A9OA 1QQAA 4MR7A 2LPMA 4H3HB 2JRLA 3N0XA 4O1HA 4KPYA 4UHJA 2WY2D 5FWXB 3NHZA 3OLXA 3H5VA 5C5EA 5T7BA 1JYFA 3ILHA 1YS6A 3ROTA 1TMYA 1DBWA 3CG0A 1F51E 3EGCA 3TB6A 1E6KA 3EAFA 4D6YA 5EWJA 5JNTA 2R25B 3O75A 1D1QA 5TPWB 2XDYA 2IPNA 2IYNA 4IGAA 3DLBA 3HJFA 4MYRA 3LFTA 2JVJA 4XASA 3HM9A 2DRIA 2VYCA 1YK0A 4OBBA 3KLOA 3DZDA 4G0ZA 3CS3A 5KQPA 1JLKA 4O5AA 3TMYA 2MYPA 5TE9A 4EVRA 5FWYB 4MS3B 5I4CA 1NXVA 4DN6A 1QPZA 1ZDMA 1U2PA 3N0WA 1Z2DA 3O2QB 4NCAA 1USKA 3CU5A 1D2AA 4DQDA 2GKGA 2MSWA 3JS5A 1NXOA 2QU7A 1JF8A 1M2FA 4RY0A 2JCGA 3T95A 4QYMA 5KQLA 2IOYA 3BREA 2I6FA 5TQ0B 2FXIA 5JNUA 2QZJA 2J48A 4EVQA 2PUEA 4ZMRA 3R0JA 2FEWB 1YIOA 1DP4A 1MB3A 2CD7A 2GWRA 2TMYA 3LOPA 4QYWA 5CNIA 5IUKC 5T3YA 3KYJB 1ZGGA 5IBQA 1JDNA 1QO0D 3O1HB 3W9SA 1ZESA 2BGGA 4MGEA 1NXTA 5B3JC 1NXWA 1GLGA 3HUTA 1BDIA 5TPZA 3BILA 3FDFA 4G0OA 5ABPA
chains in the Genus database with same CATH superfamily
4FR5A 4ZA2A 3M82A 1ZBDA 2NO7A 3G9QA 1PZGA 4D6PA 4RZXA 4FLMA 4G5YA 3EVGA 1Q0ZA 5AR1A 1ADJA 1OPRA 4P7FA 3JYHA 1NW3A 2AKYA 3KETA 4OKIA 4CKWB 2QIPA 1WSWA 3MJHA 3H9BA 3ZHSA 2PU5A 2XOKA 3BDAA 5FB3A 3HNOA 1M7HA 3FKQA 1H8ED 4QYIA 4I08A 3E22B 3B89A 5DP2A 1RP1A 2Y71A 4LNUB 1NP3A 3U3KA 4B4KA 4HG2A 4R40A 4R69A 4ZOLF 2NACA 2NU7B 2V7VA 4QGAA 4Z4EA 4C04A 4L5CA 1UWLA 2XD4A 3FVRA 3IT2A 3IIEA 1R8XA 3LSYA 4OHBA 4UUQA 4UZEA 2BZGA 5KTMA 4ZEVA 5BV2P 3R7AA 1CR6A 1K3FA 1XKTA 2XSZD 4GECA 7REQA 1Q19A 2HD4A 2ZYHA 4JLKA 4MQ6A 4NBWA 1L3BA 5DNYB 2PA3A 1M8FA 3ENKA 3O0DA 1V3QE 4YJ2B 1NY6A 3ZK7A 5AKHA 4ALLA 3LUBA 3L06A 1NYLA 3RUPA 5MN5A 3Q2KA 3EF0A 5EJ7A 1H65A 1KMQA 4MHSA 1PUXA 1SVIA 1PFYA 5EIAA 4LVNA 4JGIA 4HLUA 3HHPA 4UUBA 4GWLA 3TW0A 1OBHA 3VH4A 5C8XA 4Z2YA 1P5JA 4ZAWA 1ZD5A 4CUKA 3N87A 1B0ZA 4A0GA 3BUSA 1XWFA 3OT1A 2WJ4A 1JMYA 4X93A 2JAOA 4CR7A 1Q5PA 1ZA1A 2ZB2A 1GUDA 1ZK1A 2J5QA 2OCDA 4IF6A 2Q1WA 3P0JA 4WKBA 4KR9A 4FFVA 2NOAA 1P44A 4L74A 1B4DA 3LLCA 3LBYA 1X1QA 3KQPA 1CP2A 1OZHA 4IDFA 4MQLA 3FOWA 3PHJA 3AJAA 4OCZA 2FPMA 1RQLA 5TRTA 3TNDA 4EHBA 1LJ8A 4V24A 5IMSA 3UAVA 1AKVA 5ELLA 2IZ5A 3ZXIA 4CDNA 5BXYA 1P2DA 3AF0A 4OG2A 4YJGA 3O83A 4BKOA 1Z28A 4MQMA 4CLOA 4GQAA 2XTAA 1GZ7A 1SG9A 2WYHA 1JR3E 3GRVA 4MJLA 4QPCA 3VKWA 1R3UA 4MIOA 3DMYA 5ALEA 4TLEA 2J9XB 2AOUA 1WHTB 3ISJA 1N2CE 1XR3A 2Y77A 3G8AA 3OEWA 4BAZA 3FCCA 4X24A 1DAMA 1YQ9A 5IW8A 2NP7A 1CIPA 3HWSA 4DSTA 4NBTA 4UHBA 1QO9A 5J63A 2P9JA 2K6GA 1CYDA 4LC0A 1DRUA 1UCFA 4R6XA 4YFYA 3DLHA 1Z39A 2YINC 3U7GA 1MPXA 2NSLA 5JAPA 1N0WA 1IIBA 4RBNA 3CPHA 1NQTA 1JE0A 4M8IA 4HFRA 5CM8B 4Q3EA 4AZSA 5K0NA 4BO0A 4K9RA 2JJ8A 5DNUA 1SZJG 3V97A 1E0DA 2Q0HA 1IJBA 1BMDA 2Q6TA 4GT1A 1X8JA 1ACLA 1O94A 5KSYA 1UK7A 1W46A 5T6MA 5F1YA 2CN1A 2HC9A 2YWFA 1MV5A 3G7NA 3HDJA 4F5EA 2VF8A 5LIRA 3JQBC 3TB4A 4L8LA 4JLVA 4IFTA 3ZZMA 2FZLA 2WAXA 1WOYA 4UM9B 2C04A 2ISQA 2VKTA 4H60A 4ZRDA 2GAAA 2W6PA 3P4XA 4YC7A 1AQUA 1P4HA 4ZOAA 2B37A 2E87A 3IUPA 4JLDA 4RORA 4XJXA 3VGJA 2VP9A 1VCMA 1X80A 1M7BA 2P4SA 4CF5A 3FVVA 5E6RA 2RCNA 3OF2A 4Z99A 4ZVVA 5TS2A 3WLNA 1RAEA 1WZCA 2B1QA 4WFKA 2UKDA 3PRYA 1ONNA 2YVKA 3D0RA 2Z8XA 3OF5A 4XA8A 5HIIA 2D00A 2IH2A 3OZAA 3G9TA 4PRKA 1XNGA 1YHZA 5ITVA 2P2YA 1HLPA 2B36A 2QRPA 2V7UA 3M5DA 3TM5A 1FOEB 1PT8A 2COEA 3LLMA 4OQPA 1JP7A 4CTOA 1PJCA 4ZEWA 5IH7A 5EMJA 4EOGA 4AICA 2XTMA 5A6SA 5AI0A 5KNDH 1SMKA 2I4IA 2AZMA 3QA3E 3RHSA 3I1JA 5LOVB 3T9DA 5INTA 4W1QA 1XMVA 4XWKA 4ER6A 1Z2AA 1N1GA 4GX2A 5BQ5A 2IP4A 1GKKA 5C53B 1V16B 4IHJB 1HQKA 3ISTA 3PK0A 1P3JA 3W3AA 4JLNA 3LL7A 3Q3IA 1JXAA 2G5CA 2O8BA 1G1MA 1Q7RA 3ELYA 3PUJA 3MJ4A 3FM9A 1RDFA 1GQRA 4Q4AB 5EYPB 4D74A 5I7VA 3H05A 4YCAA 1JDBB 1QOZA 4GC5A 4GGPA 4TL7A 8OHMA 3IC5A 3TG8A 2PKQP 3NTQA 3QE0A 2YWDA 1ISMA 4P98A 2GEKA 1HDZA 3W8NA 5ERXA 4I1YA 4F12A 2GHQA 2JI4A 2ZI9A 4BGUA 4C1BA 4J76A 5BYKA 1AV7A 1NUSA 3GGOA 1SVKA 3NTUA 3GG2A 1CY1A 4D8VA 1NPDA 4C6TA 3CVJA 2DWUA 2JFXA 1F20A 2YZNA 3R6GA 3RAJA 3LZCA 1XF1A 4A0FA 3GWGA 5HZHA 2C99A 1XMSA 3B48A 4MVJG 1XXHB 2HO5A 1EGAA 1G5IA 2OMKA 9LDBA 3O6VA 3QWBA 4QFDA 1N57A 3REQA 5LIPA 2I3ZA 2Q4RA 4G1VA 1QIEA 3OUZA 1O9HA 4RELA 2XYVA 2HQBA 2H6EA 3SPXA 5BWOA 4UW9A 3H8SA 1RKQA 3VO9A 2H9IA 3T15A 3C7TA 2B99A 2E21A 3QLJA 4P5DA 1OAKA 3K5PA 2FMIA 1MV8A 5J2UA 5FLEX 1BD3A 2PBRA 4N3CA 4PINA 2PT6A 1OX6A 4DEVA 3M1LA 2BMFA 4GU5A 4ARIA 1L4YA 2P0AA 1M0SA 1U7WA 2I67A 3HC7A 3U0VA 4K9PA 4KMSA 4OIFA 2DFLA 2FEXA 1IZ8A 1QHYA 5FTNA 1VCOA 4URXR 4A10A 3MJVA 3L0YA 3HCWA 4JBXA 4AXBA 5FT9A 4FFRA 1AV6A 1LX6A 4H35A 3K0EA 4EEKA 3JYNA 4CQMB 1RPJA 5FA6A 4C6HA 4DLRA 2P77A 4Q12A 5KQPA 3DXFA 1DQZA 1DKOA 3FDIA 4D0SA 5DGXA 2RK4A 1VC2A 4EUEA 5BNWA 4IIGA 1YAHA 4WFIA 5EMLA 5FOVA 3GLTA 1EHCA 3UPDA 3WMWA 1E60A 2Q4BA 3PSHA 4U7PB 1W6RA 2H59A 2CEAA 2CYBA 4BMPB 2VUTA 3KG2A 2H2FA 2I55A 3I9V1 3QMPA 4U7HA 5J2TF 1ZC3A 4YRMA 3N05A 4IQ8A 4HDSB 1ZIXA 4V1CI 5K6TA 4DJAA 1RHRA 3I2IA 3BTSA 1FVFA 5D1NA 4H1WA 5GMOA 2KE5A 4QECA 3MD9A 3WYEA 2PUDA 1NJ5A 2IKSA 3NDJA 1P73A 2BMAA 2Y1OA 3ZBQA 4AJ1A 1L4HA 2B5WA 2QRKA 4TUYF 4W9NA 4NMHA 4DLPA 1RHMA 1YA6A 3C4JA 1UC5B 1W44A 5ALVA 2ALJA 2V58A 1FQJA 1C30B 1VLJA 1MORA 2WM8A 3NALA 4IOJA 3K9NA 4XJTA 4OP1A 4AQDA 4BL5A 1PLJA 1RRFA 4W5OA 1T1EA 3GRPA 1RYFA 3U16A 4YCNA 3LDGA 1R4MB 3OIDA 1PLLA 4V0SA 3UT5B 3WIDA 5FPHA 2PX5A 3B6EA 4U63A 5BRJA 2XR1A 2GD2A 3BEOA 1EP2B 1HI9A 5CDUA 1BYUA 3LS2A 3ZZ1A 1O8BA 1W5AA 3P8ZA 5D01A 3NG1A 4FD3A 3D59A 4FM9A 4KXLA 1JJ7A 3QUSA 3U0BA 3X44A 4AKTA 2YWCA 4DMCA 3C48A 3KT8A 5JZBA 1CRZA 4RFVA 1Y3CE 1Z5ZA 5AJUA 4TVSA 3OCJA 4EA7A 3ECAA 3NKVA 1E20A 3DC7A 2YC4C 1WV0A 5K2MA 4E4TA 4ETNA 4FN5A 1SHTX 2EC5A 2A57A 4EHKA 2J1LA 4E13A 5JD5A 2ILVA 3U4QB 3ZVNA 4C0SA 3HWRA 1X19A 2QRHA 4J90A 1HEYA 4C4OA 2I9KA 1M1YB 1XLVA 4MWTA 1PNOA 3VAYA 4J2OA 3RU9A 1YDWA 2BUAA 3KB8A 4IDPA 1ZPDA 3L02A 4PANA 1T4CA 2QG4A 5AUPB 1Z6GA 2BTQB 3SLRA 1KYIA 1PW7A 2O0LA 3KKLA 4HADA 4IQ0A 2ZZKA 5DTMA 1I5EA 5DCYA 1BRTA 1EWTA 1XCMA 1F38A 3JWGA 5IUNC 1IFXA 4OXXA 5A7FA 2JFNA 4AZ0B 5KWVA 4M0DA 1CEEA 1TMOA 5JC8A 4HPJB 5CLQA 3NUZA 1DKPA 3O92A 3PDWA 4H17A 4BWVA 4QDOA 2H1WA 2J4FA 4B2IA 1SURA 2P65A 4LE2A 3OIGA 1WDWB 3OM8A 3T5DA 1BXRB 2JCVA 4TTQA 1ISRA 1L5YA 2XT6A 3NETA 4WPGA 1F8YA 1T0PA 4ZCIA 1VB3A 2Z6VA 1GKUB 4PLFA 3LBFA 2B92A 5DBEX 4RMJA 1IG3A 3T7DA 4CMBA 2R4TA 3JAKA 5A06A 3LY7A 4DUPA 3EYAA 2EDCA 3RODA 1ISJA 3W4KA 3TW8A 1P1KA 1JG3A 2C3MA 5HBRA 5IBCA 1RWOA 2GF0A 1X7GA 2GPNA 4KV9A 4WLVA 5D3MA 5AW3A 1SXIA 5EWLA 3A3OA 2C5SA 5KDOA 5LUAA 4YB8A 1LSJA 16PKA 4D0NA 4AN1A 2Q21A 1J5EB 1L5ZA 3SYNA 1ULHA 3DUWA 1PJ8A 4RV5A 3B52X 2GHTA 3SMVA 3UMGA 1G20E 4BFSA 1IY9A 2XOKD 1K1EA 4BX0A 3QU5A 4S0XA 4ZQIA 3LQKA 4I6JA 1SG0A 3EW9A 4X8MA 3SQDA 2QX9A 4LHXA 3UFXB 5BWCA 2JF0A 1E3WB 1I80A 5AJYA 1FDTA 1K5GA 2OCKA 1NYRA 3LUCA 2PGJA 1DO0A 4X7PA 1T8WA 5TY0A 4PS0A 2IFTA 3FPFA 5L53A 3V00A 4N54A 1U3GA 2QN2A 4DMRA 3FE2A 1CY2A 1KEUA 4LOAA 4A0RA 4QPDA 4KMOA 1KMHA 1NR5A 1UM9B 4LQCA 5H83A 4BTEA 4K40A 4QZVA 2AC4A 4I8IA 3T1NA 3FHCB 1NC3A 3AR7A 5AK4A 1UBEA 2AWNA 2ECQA 1RQ7A 3H5WA 1J97A 1DV1A 1CNFA 1QDEA 3FCOA 3L84A 5CURA 1AN9A 1QF7A 3FX2A 4D4IA 2QSUA 3DE1X 2H5IA 3PNSA 4RFSA 5B4VA 1IN1A 4ZHSA 2JASA 2WHQA 3NV9A 5C8YF 3BB4A 5AVQA 1GO2A 2YV5A 1E3JA 1I3NA 2C9DA 3CF2A 1YQWA 1FMTA 1N8SA 3SSNA 1MTOA 1Y4ZA 4GR9A 5A0TA 3THWB 2QGNA 4AUNA 4HNUA 4YPFA 1NSFA 3DFUA 2IX9A 2ZANA 1GUBA 3AZOA 3B7GA 4GUAA 3ZWQA 1ID1A 4TV8A 1XRQA 1T0JB 4EVSA 3WAKA 2N9UA 1BG6A 1QGZA 3JPYA 2HIMA 4RHFA 2Y1XA 1EB8A 1DIBA 2EKQA 4E5KA 2XQKA 4OBXA 1KTIA 3Q6MA 1Z2CA 4KC0A 4Q21A 4F92B 4MINA 2VP3A 3PC7A 5EKDA 4WVLA 3UO8B 4EB0A 1ABEA 4YQEA 3TZEA 3Q5GA 1J0EA 4URZR 3S2YA 4JSRA 2FGKA 2JFZA 3L7NA 4UZSA 4G8JA 3V8BA 3PG5A 4QLAA 2E85A 1R0RE 3OEED 1G291 2JRLA 1XD2B 4WLFA 4B3FX 1KMMA 1JHXA 5FWXB 2E18A 2WHRA 1S3IA 3ROKA 1W4BA 3H0EA 2UZ4A 5T7BA 1WMBA 2IS6A 2FZGA 3SZRA 2JD1A 1HF3A 4FJ2A 2CNKA 5KNCH 1WRBA 2R25B 2HK8A 5HJ7A 1UJ6A 1XA0A 2R6HA 2VJPA 3SVZA 4CTMA 1NU6A 1W96A 2HCFA 3OZWA 4GRDA 3AKYA 4KJXA 1YQGA 2DRIA 1QUEA 2QN8A 4RJJA 3NFRA 5CDHA 1DMSA 4HS4A 1IPEA 1ISGA 1I94B 1II0A 4G84A 3K9QO 3G0DA 1JILA 4PONA 4A6XA 5IWCA 4DN6A 3GEIA 5KINB 4UHHA 1Z2DA 2G4LA 3FPCA 3NT4A 3M4YA 1ZLXA 3ZYCA 3W5CA 10MHA 3HP1A 3P9QA 1CRQA 2QX6A 1VSUA 3KQLA 4AU1A 3MRVA 4CKYA 1C9KA 4D9HA 1J8VA 4FNMA 4QM6A 4CRWB 5JPIA 1CY6A 1I0LA 1M2FA 4HXFB 4LQ4A 4C4ZA 1DWPA 1SUEA 3C6YA 3WGNA 2ZJ3A 5CA0B 4XYGA 3G5AA 4EKIA 3M49A 2FGJA 2FK7A 3QG1A 4KWTA 4ENPA 3KYJB 3B3QA 2WTUA 2AJLI 1Y81A 1U0OC 1M2GA 3E4CA 4BKQA 1WTAA 2Q4OA 4MWEA 1A2QA 3O1HB 3ZU6A 2ID4A 2JC3A 4MUNA 3QXSA 2NVUA 2O8DB 1JAXA 2X8JB 4JIMA 3DL0A 3BILA 3IV6A 3X0DA 2D2EA 1OA0A 4KMMA 4PHCA 3U7QB 1KI6A 1VLLA 4P7KA 1U5BB 5JNSA 4X3OA 1G8HA 5CD1A 1OBVA 1R9NA 4R81A 3KKQA 1G6HA 2GJKA 4G1BA 3ZEAA 1JIJA 1H2BA 3IJ5A 4P0QB 2ODEA 5JNRA 2BP7B 1YOVB 3N0VA 4ND8B 1AJEA 1E99A 3KR0A 3Q88A 1J90A 1YR6A 1R16A 3R2JA 4X6LA 1WETA 3CUVA 4PF1A 2JH3A 1N2GA 3MCAA 1XCPA 1RBZA 2PSDA 1OYOA 4OAPA 2WIJA 2B2XA 4FFNA 5M34A 3VHXA 1L9KA 1J0AA 3BGDA 4Y30A 1G21A 2PGAA 3UGKA 4WFQA 2JHCA 4O4JF 1U7PA 1UODA 3IP7A 4D57A 2VOEA 3DO5A 3QJGA 2ZJOA 3GFRA 4P6VF 4D82A 1XDDA 4A91A 2VCYA 3F46A 5DSXA 3PP8A 1HE8B 5HILA 2FFQA 2AJCA 2Q5HA 3T1HB 4MLDA 1VDZA 5IJWA 3GAZA 4UJ3A 1XEXB 1KQ3A 1LPPA 4KQHA 1LBHA 2HLDD 4IH9A 4FFDA 3P0HA 1MG5A 5F7XA 1RYZA 1QX3A 3P20A 4JUBA 5J23A 5KYGA 5L4LA 4WLUA 2H08A 4XARA 4BMCA 5CT9A 2HXGA 4ZJUA 3IDZA 1YDEA 3VV2A 3FXAA 3THYA 1D8TA 1ZCAA 2VJKA 1Q7GA 2QY6A 2X1LA 4K2HA 4P4LA 4B7UA 3QSYA 3QXCA 3R1IA 4FILA 2VEOA 4HNQA 2XAUA 5IXYA 4IICA 3VOAA 1QP0A 2TMGA 3JASA 3L6CA 4W6QA 1HE2A 3PXDA 4XZ3A 5C7YA 4ESVA 3ZY5A 3W1EA 3ZI7A 1Z7BA 4X92A 3MRXA 1OV4A 4A23A 3GLUA 1BH2A 4EB6B 4EH1A 1QCDA 2HJHA 5EQFA 3EEIA 1E3LA 2XE7A 3O84A 4Q47A 1P0CA 5DHSA 3REGA 4C4XA 2IW1A 4PFSA 2V0CA 4E1VA 1XTQA 4B9EA 4KYUA 4ND7A 5COAA 5T5QA 4QASA 2VTBA 2P7HA 5AW0A 3K35A 3LQFA 4LGVA 3NHFA 3MA0A 2IZ0A 3ND9A 2Q0SA 1L4FA 2W7TA 4IQGA 3KOMA 1KQNA 5ALTA 2GO7A 2G4CA 1IUNA 2J59A 4L3WA 3ZDYB 1P1JA 1CVRA 4TYNA 1VHWA 2WYWA 5HSGA 4R0NA 2UZ3A 4JB8A 1GEEA 5KX5A 2Q3LA 1M6NA 2A9RA 3MUEA 3O1JC 2CNOA 2DF8A 4LDNA 5EIWA 4CKBA 1M6EX 1PJZA 2QLNA 4EENA 4QT4A 5CVVA 3B3GA 5FQNA 2GWHA 2C82A 1K75A 1V7QA 2RK3A 3FLAA 3I8SA 4PYLA 3O3NB 2JGFA 2ENUA 1L7VC 1Y7IA 4FYMA 4Z53A 1U80A 1ZN9A 1CQJA 1T5DX 4HAZA 4MUHA 4RVNA 4BEVA 1DRJA 1G8GA 1RYHA 3JZFA 1C9YA 2QL7A 1UOPA 4RHUA 4UU7A 4YJ3B 4KREA 1OYVA 1P0FA 4GOKA 1COZA 3U4CA 4DZZA 4DCOA 1PZNA 2Q1TA 3VTKA 2PRIA 3NIDB 3MYRA 4GI2A 1WB5A 1KBOA 3M5WA 3QY0A 4HS9A 4LZAA 4ENSA 4YMGA 1R0ZA 5SZJA 2HJVA 2AMYA 1LPOA 1VG8A 3EPRA 1DG9A 2YXNA 2JIZD 4KLZA 3D6FA 3FWYA 1W9MA 5AJVB 1LDGA 5TQ2B 3PLAE 1OW3B 2YUIA 3S1AA 4D9NA 1Z26A 2LDBA 4EKGA 2J0QA 3X1DA 4O8CA 5C8DA 5AXBA 1J23A 5LC1A 2R86A 1O54A 2HJSA 5LN1A 2J0EA 4LWPA 1QGED 2IIQA 3G13A 2YKGA 4Z0TA 2CSUA 3NTVA 3MQ2A 4D80A 1XZQA 2BI4A 3DZJA 1VPDA 3GNLA 3TUJC 2YWGA 5B3JA 2NZJA 4URHA 2LNDA 1ZM7A 3W0LB 1QCYA 2IE0A 3OQVA 2QT1A 4NXNB 3RH0A 4D44A 1EAMA 1X94A 4RKFA 1SOMA 4RAQA 4ZI3A 4TMTA 1MNQA 3QYJA 4TTSA 2QX4A 1E4YA 1Z33A 2YDXA 2X1MA 3PICA 1YQQA 4R9VA 3TS1A 3LUAA 2QTZA 1AXRA 1CQIA 2Q27A 2IUSA 4RV9A 1X7YA 5FPYA 1V43A 1AOXA 1AMNA 2NXNA 2PUTA 4W4TA 3CZPA 5JD6A 3Q11A 1HFWA 4BJ5A 2OG1A 1WKCA 2PZFA 2J41A 1VJ0A 3TIGA 2GTPA 2DR3A 2QTHA 4ZCSA 1RJ9A 2ZBDA 5GZ1A 2C5GA 1VPEA 3ODPA 3KYDB 3PTLA 4N12A 3L8CA 4D2IA 4KG7A 2AEFA 2XJ4A 2CUKA 3ZBTA 3DBHB 4GBMA 4BMXA 3W5IA 3CLRD 4AL4A 1MOQA 4F21A 3HABA 1RRMA 4QBTA 4AS1A 2EU8A 2HSDA 1HEUA 3PEVA 1U2DA 1RPTA 3NAQA 4FFLA 4MI1A 1Z18A 3H5RA 4KWHA 4U7TB 4WDQA 4OI1A 4I3FA 4DLXA 3WLRA 4EAQA 2RD2A 2J30A 1E8MA 1KZYC 1ORDA 4KFSA 5EA2A 5KDLA 3RTCA 3Q40A 2ZRDA 3WP1B 1BMFD 4UUAA 5E4FA 3HKEB 1YVRA 4DLZA 3D3NA 3VR5D 1KJNA 1NXXA 1ZNWA 2ZTMA 1HDIA 1GCOA 1XWIA 3ET5A 1JECA 1I5OA 4GKVA 1FNNA 3PDCA 4B8WA 4FOOA 3CUSA 5C8VA 1P18A 3WLQA 4JQSA 3H7IA 3UM9A 2EZUA 1GR1A 5I7SA 2P3OA 4J0CA 1F0PA 3F73A 3TDNA 4EGQA 5DKFA 1GKIA 5ALIA 5B64A 2VWPA 4RA6B 1VL8A 4QC2A 3SE0A 3ROMA 1ZNQO 3HKDB 2D1RA 3VSAA 1E3MA 4YY3B 1PL8A 2QGZA 1X7DA 1RWBA 1VJDA 4XPZA 1GCUA 1GSHA 1IMJA 1TZJA 2M98A 3FBTA 4O29A 2YHAA 4P4GA 2VF4X 4BWYA 1OIWA 1QIKA 5KJFA 4GVLA 3VKGA 2DETA 1PJRA 5LDHA 5C0OE 3OWXA 3USZA 3F9RA 1WBBA 1SOAA 3A32A 1FVOA 4D8WA 3WLTA 1B73A 2P4EA 1J6UA 3EG9A 2R8PA 2Q6OA 3DD5A 3AESB 3KB1A 4GBJA 4DIBA 4ODIA 3OZEA 1JPUA 2XNCA 4KBGA 4YP7A 1CLUA 3ZE1B 3WKEA 1FDRA 2RGCA 3PUHA 4ZV9A 1SCBA 3ETJA 1RPNA 2FPSA 2X14A 4Q02A 4UCXA 2BZ0A 4G56A 3LDAA 3ZU3A 2QVYX 1XELA 2OOKA 2PYZA 2HWKA 2XGGA 3CKYA 3G82C 1U7ZA 1YZQA 4KWIA 4MVJH 4RU1A 1N2IA 2Z98A 3V7FA 1EUQA 2R00A 3QPCA 2FEPA 3AVQA 3BEDA 3TUIC 4HQOA 3I9JA 5REQA 1PJBA 1Y89A 1L5NA 1FNBA 2GDZA 4BNXA 3PNPA 3WZ2A 2I8CA 1LLQA 1N2BA 1BKYA 4YJFA 4DZTA 1H1DA 1ENPA 4ESHA 5LZ4A 2DKFA 5DB4A 4B17A 5EESA 3QVJA 3LDUA 2WBLC 1O96A 2QD3A 1X8LA 3AUXA 1GZVA 1NUAA 4I36A 1DAFA 5AI8A 3DL2A 2HCTA 4X3CA 2YRXA 3T9EA 3JZIA 1NRWA 2H4FA 1US8A 4QVIA 1HYBA 5A04A 1JIKA 3HEBA 1KYWA 3WO1A 1XQ1A 3IE2A 5HKLA 1S9DA 1H0SA 4AIRA 1JLHA 4ZI7F 1XZEA 4QYSA 3FYDA 4PYIA 3K16A 2H65A 2QF7A 5HTKA 4UCFA 2RIRA 2ZDGA 4MMYB 3L8MA 4Q7EA 4IZ6A 5CVTA 3T06B 4F8JA 2IYVA 2A92A 2NUBA 5UKDA 3KM0A 5JLAA 1Y1PA 3EGDA 3NGMA 4UDYX 5L51A 4PSDA 3ER8A 1SUWA 1LDMA 3L7JA 1R88A 1W75A 4MW5A 4UEOA 2D2IA 2GHIA 3VTFA 3PTZA 1JEJA 3PNLA 3NHKA 2WV9A 1KS2A 2V9CA 3EEOA 1RW4A 5SV2A 3VR4H 1G20A 1MC5A 1FTWA 4ZVOA 1HX7A 4ZMBA 4XTRA 3TOVA 1Z6PA 2OVFA 3KKKA 4RPIA 1VJ5A 3Q5EA 9MHTA 1MMFB 2DFVA 4M98A 4ME6A 4RMHA 4GPEA 4HWSA 3UV6A 3EPJA 4PXSA 1N3LA 4UJ5A 1RXWA 2ET6A 3MUNA 1K6MA 121PA 2EBWA 2JKVA 2IHNA 1N8KA 1Z6TA 2OBBA 3DHEA 1RYEA 3P2EA 4OI0A 3RNOA 4DJJA 2Q9AA 1SHUX 3MMSA 4LJ8A 4UU1A 4R2IA 2BFEA 5L6MB 3KALA 1V9CA 3DV9A 4BN4A 1GPKA 2AJDA 2CBXA 4HGPA 2DYKA 2Q6LA 4DEXA 4HX9A 1S1MA 3UJ6A 5B3LA 3W9UA 1SHJA 2FPGA 4RMNA 1C4OA 2PUVA 4RVGA 4UCQA 1E9CA 2AOTB 3H5OA 4QYIB 1YCDA 3FHOA 1C0EA 1KERA 5AK0A 3MJEA 2HPHA 2VATA 3H2GA 3ZWNA 1WZEA 2BOVA 1C9EA 6ABPA 4JB3A 4OU5A 3TXAA 5HZMA 2I1QA 1E18A 4M60A 3KQKA 1W4ZA 1D7AA 3CUWA 4PX5A 4PPFA 4D3XA 4MXDA 2WB2A 2CXTA 3B5JA 4BVFA 4KFCA 3R5FA 1YBVA 1MRNA 4FCVA 7REQB 1QV9A 5EIEA 1BAPA 3IAS6 1HY3A 1C7ZA 1Y8RA 3ZTTA 3RU2A 4OXQA 1JJIA 1L5VA 2P9EA 4CMGA 1AD2A 1O1YA 2QLTA 3JQ6A 3LKVA 2XW6A 2IS1A 2XZOA 1BE1A 1DI0A 3IJEB 4IG9A 4GX1A 4YRNA 5K8LA 3G2KA 1RBYA 4I5GA 1WW3A 4JI4B 2XYPA 2HRZA 1NMQA 2XUKA 3L46A 4FKZA 4PYKA 1DRWA 2W6ZA 1JMKC 1U99A 4GDMA 1HGXA 3DW3X 1EAYA 5AXAA 2XZLA 1K86A 1WSAA 5FR1A 5JAOA 4MV4A 3TZ6A 3DM9B 4C4RA 5IU6A 2KQUA 4YP0A 1C41A 2VXYA 1SXQA 4Y2QA 3O3CA 4JGGA 1XJWA 4RQAA 1MX3A 3F5MA 3TCNA 1G60A 1JR3D 3QV1A 3QEAZ 1ZR4A 1QORA 2VNHA 1PS0A 3OT1B 2EKBA 4JVMA 2NQ2C 4RANA 4X1IA 1Y6QA 1NVGA 3IRUA 4FEGA 4X3PA 3PC8A 1XFDA 3GFTA 1C5KA 1JIUA 1WZNA 3UAOA 3W6ZA 4YRKA 3MWEA 5HPYB 2PS1A 2DLNA 5L3ZA 2J87A 3ZWDA 3JR3A 1DB3A 1ANKA 2X2EA 3IPRA 2GR9A 4TN1A 4G36A 2AWOA 2V1UA 2FE1A 3KXDA 2XOXA 1IJKA 3HYTA 5C7IO 4BN5A 3JY6A 1EUYA 4WDRA 2DZDA 2Q07A 1K8ZB 2ZRLA 3LG2A 1EQ2A 2O20A 3MSXA 4MWZA 3I4LA 1I6LA 1KFKB 1PU2A 1GZ5A 4YJGB 4CLOB 1TA4A 1C0LA 2GLXA 3T5AA 4Y0AA 1MJGM 4L6CA 4ZTBA 5A3JA 4D9MA 2Q50A 3SZUA 2O8FA 1VL5A 1AC5A 2WYIA 1AVTA 3FZQA 1GVNB 3IA7A 2FR1A 4FMCB 1OASA 4Z7NB 2AOUB 1LTKA 4MR8A 3KEGA 1UKBA 5JDIC 4WVFA 1JA0A 1Z5UA 5DTJA 1M6VA 3DDUA 3FPAA 4FKBA 4NYIR 1KBQA 5E0OA 4PLZA 3X1XA 2VT2A 4WLOA 1XCOA 1MW9X 2ZVPX 3OU6A 2Q5EA 5J5AA 2C96A 4XWYA 2OQRA 5DM60 3K4PA 1DEAA 5AO9A 1MAAA 4OAOA 3IPAA 3NM6B 4N03A 1VJTA 3GFGA 4J16C 1PQUA 1P9LA 5I4BA 1LBEA 4IVPA 1ZISA 2K5UA 1QH9A 4CYMA 3Q15C 5DM1A 5F9FA 3E7XA 3BICA 4UHDA 1TKCA 2JFUA 1FXUA 4F8YA 1EE1A 3W2TA 5F7ZA 2C4HA 3DP7A 2AX3A 4G0NA 4R54A 5T4EA 5E7IA 3P9PA 3FTPA 1JYFA 4BGVA 1VHJA 2YH2A 1GPBA 4IGAA 1XRSB 1UAAA 4IEIA 5E6RB 2BI8A 2WTBA 1GWNA 2JGMA 3RBVA 2XCUA 4TSFA 3ZHUA 4Q9IA 3VC1A 2A84A 2VBFA 4CL3A 3KLOA 2HGZA 2B94A 5IARA 3H83A 4NK4A 2P9FA 2OFFA 4OQEA 3QVKA 3WOVA 2W2KA 2P5YA 1WBDA 3GJQA 2WTAA 2CL5A 1ZDMA 4Q24A 3OCYA 2Y0CA 4NH4A 2OT3B 1E9SA 3KJNA 3IDFA 4B74A 3KC2A 4DCVA 3DE3X 2ZWIA 3FWKA 1PSZA 1Q1EA 2YV4A 2VL7A 3HHEA 1XCJA 5A6SB 3T9BA 1R0LA 4M9SA 3S1LA 3EUWA 4E3WA 2A0FA 4L4RA 4FBLA 3QHPA 4Q1FA 4CQLA 5I8ZA 1TKRA 3HL0A 3VYRB 2ZB8A 2XVXA 1V4NA 2QM0A 4QEZA 1I1OA 4Y2VA 3LGSA 3KR2A 1X87A 4A2PA 1R6AA 3BJRA 5E38A 3V5NA 1KJ9A 2PZ8A 2VXCA 1C3EA 3IVCA 5L95A 1N5RA 2GRAA 1JDNA 2EEPA 2QPLA 2O8BB 5FNVA 4TGLA 3ZZNA 1QM5A 1JSCA 3GPDG 1ETUA 2YCBA 1BFDA 3DFMA 4OQFA 4TWBA 4G0OA 2H18A 2XE6A 3L0BA 4NFLA 3R77A 1QYDA 1R66A 5K0LA 4DSZA 3BSFA 3T0IA 3H4TA 4ENQA 1TJ5A 5CLLA 4KVGA 2VJAA 4FYWA 2DH5A 3DB2A 4B9AA 1K4MA 5B30A 1YR1A 9GPBA 4K5QA 4PZPA 1KZ6A 2EJWA 2XE8A 1L3CA 3MLEA 1FBTA 5EGNA 2J67A 2PVCA 4I0WB 4BV9A 3TRFA 1SZCA 4MWSA 1UF9A 2AMFA 5ED4A 2RGAA 3QVOA 2IPMA 4F9TA 1ZW1A 5T57A 1XVVA 4DIMA 2GJ9A 1MEEA 2D62A 1MEOA 3PGVA 1DQPA 2OD2A 3CCBA 4EY6A 3REQB 4ZQGA 1VYTA 3WLOA 3UWMA 3EQ6A 1U0JA 1IN8A 3ETLA 2PKQO 4ZYVA 3ICPA 1DLIA 2IZOA 1YZTA 5C1DA 2Q8NA 3I05A 4L5BA 5HE8A 5HFNA 3Q6IA 1E96A 3FOAA 4FOPA 5J2UB 1Q2XA 4X44A 2HW8A 7MHTA 1F5SA 4TKMA 4LJAA 2O05A 3VNBA 4MYSA 4LY3A 3W1VA 4E32A 3G0GA 4DA4A 2R11A 3AERB 1ONBA 1NG1A 2ZJ2A 4FW9A 4RULA 1CETA 2FI1A 2EKPA 3Q8XB 3PIDA 4GRIA 4OA8A 4EW1A 1N6PA 3KAJA 2XWBF 4R1MA 4M54A 1FRZA 2A0UA 4P4SA 4F85A 1E59A 2CL7X 1AZTA 1J22A 1DBQA 1E5LA 3EISA 4FI3C 4X60A 4NNPA 5ALMA 2NPOA 3NBQA 1LTQA 1E5VA 1MA3A 5JXWA 2DH6A 1AUXA 1VE1A 4RD2A 5FA5A 2XBMA 4G5HA 5B6IA 5DW3A 1NR7A 1P8JA 2RAUA 5KZMB 3FYTA 1YKGA 5C3UA 2H3HA 2PCJA 4BVAA 4KQGA 1BU8A 2XMCA 1TT5A 3WKAA 2QTMA 4IJQA 4QDZA 4KACA 4AQYB 521PA 3L1HA 5LMUB 5KSPA 3VYWA 2X5KO 1C7QA 3EY4A 4QGHA 4G9BA 2IRWA 2AA3A 2HFKA 4CKZA 1CUCA 3MTDA 1GUAA 1Z4QA 1GNQA 1F60A 1ND6A 621PA 1H0HA 2IYLD 5FDFA 4I4CA 4LOKA 1XMXA 3ELDA 3FZGA 4D98A 1AQIA 4G97A 3QI2A 4FQ5A 5IT0A 2RGNC 2MYUA 3M6LA 4HZIA 3UXEA 4Q9LA 5K0GA 4JELA 1DQNA 5AK5A 3A31A 3HA5A 1VE9A 4E2XA 3LCVB 3UF0A 2PZAA 1IOLA 2ZQ5A 3K7EA 3ZWBA 3HDGA 4U8HA 3L4JA 1GSIA 3OJ0A 2IPOA 4M99A 1GPAA 3MS2A 4JASB 2VYFA 4CPDA 2PS0A 5FAKA 1ZHOA 1ZD3A 4Q00A 3KHTA 4ZO6A 1N6KA 3RUHA 4P7BA 4W1SA 1EEHA 3GBPA 2Z4TA 3KEQA 3RUEA 4E15A 1IBKB 2P2DA 1ES9A 4X20A 3RTGA 4L8YA 4UNRA 1OC2A 2LV8A 1PAUA 4RY8A 3N5CA 1CNEA 1OD6A 1E0JA 1ZGJA 4Y18A 4BU0A 2QTNA 4EX7A 3A1WA 4U9UA 5JXJA 1FBNA 2HHJA 2BJHA 4N0QA 3TSWA 3OIFA 5B1EA 3ENNA 1B6TA 1ESCA 4NRDA 4QUHA 1PZHA 1XG5A 3RVJA 2QI9F 1T4CB 3Q7QA 1GP2A 5G1PA 3HBLA 3RS7A 2R85A 4NC9A 4FNOA 2TMDA 3HJNA 1Z25A 1OR8A 2JLQA 1ADFA 1ODSA 2O0MA 4J1TA 3V8VA 4U7JA 3ZCUA 1LQTA 4KPFC 3CJRA 1XGKA 1EK1A 2VDJA 2G1KA 2QTAA 5TMBA 1OKKA 3KQTA 5HWSA 3KTDA 3TZQA 3MQ4A 1GGVA 1HM5A 2MSKA 1ZK0A 2OFWA 1UOOA 2L42A 4J0GA 1T2DA 3LC0A 1FK8A 3DDSA 2OXTA 5LQCA 2G1JA 3OJCA 3AETA 3SR0A 1EA5A 1BVUA 2OUIA 5CCDA 4MKXA 1UPUA 3F78A 2DTXA 1T2VA 4UAGA 4X6UA 4FMDF 4DLTA 2VO1A 4OSEA 4ILKA 5FTKA 2H63A 3T3EA 1BA3A 2OB2A 3MIZA 4V0KA 3CRVA 3JAKB 4Y1RA 5F12A 1U0LA 2QZ9A 3W90A 5T6BA 1Y34E 1HRKA 3TW8B 4D56A 4Q7LA 4HYYA 4C6SA 1XROA 2P9QA 1Q3TA 4JUCA 3Q8WA 1L1RA 1L5KA 3TSCA 3NO4A 3OU2A 5D3MB 2X0FA 2EP5A 3NEAA 4MGYR 5EWLB 2EJBA 3UHFA 5C5DA 4KYIB 4NARA 4KPUA 2VHVA 3DEYX 2ZIZA 5IH3A 3LHSA 3PSAA 5GJBA 2BSAA 1ZH2A 4UPDA 3FW1A 2D1FA 3KUKA 3CW9A 4LI0A 3WJ7A 3IXMA 3NI2A 4XDYA 5DV9A 5JXGA 3QEBZ 3RVKA 2VLBA 3ZIUA 1H4QA 2JA2A 2H8GA 3NQ41 4QAJA 4F71A 4NPAA 5IJAA 4A8TA 1IVYA 3C6QA 1XRNA 5HW0A 1JEYA 4GEKA 3DH0A 1L7BA 2P40A 3STVA 5LQUA 4AJHA 3O31A 4DSUA 4TLMB 2FMUA 1PHRA 3DE0X 3OQJA 4M2LA 2QMQA 2Y1LA 3BHIA 4UHEA 3ITEA 2DGDA 2ZQYA 3MF4A 5FORA 2RKOA 1ENOA 1JHPA 1IY2A 1WMDA 1KMHB 1PR9A 4G0QA 4K46A 4MUBA 4ND4A 2J7PA 2K2QB 3WIBA 3Q72A 3V3KA 3ZD6A 2ETXA 5CVDA 2QT9A 4KGXA 4Q6WA 1DKRA 3X1KA 4N65A 2I54A 2QD2A 1JT2A 4FZ3A 4YGXB 2X5JO 3ZIDA 4CQJA 1Y8ZA 2GKSA 4RFSB 1JIQA 1KEEA 2BM8A 4B6OA 4JX8A 3BVPA 1OXBB 2A88A 4KIWA 4P38A 4R2WA 2HT1A 5EXXA 1FJHA 1RAFA 2YY7A 3OY7A 3ZVLA 3IB6A 4BO7A 4RKRA 4POOA 4MCJA 2A5JA 2OBNA 5IVDA 2XITA 3LPAA 5DCWA 4OUKX 1XZMA 3E23A 4QGSA 3EWNA 5F21A 4TV8B 3EDCA 5DYYA 4RIIA 2CDNA 4MRSA 5JWOA 2ZJ5A 5IDWA 2Z9DA 3COYA 2B4QA 4MV7A 2FZ5A 3FR8A 3SIXA 2ZWPA 1ZH0A 1FFBA 2NTJA 4EI9A 3N0RA 4CWAA 2JK1A 1O9GA 3NCHA 2PUAA 1L5RA 4YRCA 1YZNA 2DAPA 2J5RA 2Z57A 3DGEC 2Y1EA 4ND6A 3JXEA 5CYOA 3ZE2B 3M2PA 1CB0A 3HMQA 1IPHA 2VTVA 3I2HA 3NIFB 4QPPA 4WGGA 3BBPA 3C1TA 2HA5A 1SK9A 3KHSA 3SDZA 4V38A 4EAAA 2C1ZA 1TCBA 3UK7A 4W5NA 2ZSKA 1ZD4A 4I6EA 1VE7A 3F7NA 4X5OA 1POWA 2WG2A 1VHDA 3LCCA 1X1EA 1L9XA 2YZMA 4MVCA 2HIGA 2JHFA 3RSSA 3S27A 4AKEA 4YMUA 4CFYA 4LGMA 3IP8A 1NVKA 3GLGA 1GPH1 1I2BA 3BXFA 1KHTA 2YN2A 3GPCA 3IQZA 5FBZA 1EDEA 4AUMA 3A36A 1Z75A 3OOEA 1CS4C 1PZEA 4I8XA 4FZVA 4PSCA 4GWGA 4BKUA 2V6GA 4ZYZA 1XVAA 1QIJA 1NAHA 4BMNA 4F45A 1VL6A 2ZJZA 1QVAA 2X0DA 4CMEA 4NF2A 5BWBA 1OU0A 3V8RA 4MIEA 4LXGA 3HY3A 2BKAA 2JVKA 3DEFA 4D4GA 2P90A 4LF9B 1K0UA 3DOOA 3G2PA 5A0VA 4LQDA 3CLVA 2FSSA 3INYA 4C0JA 4ZVMA 2LCQA 5JASA 3HDYA 4CIXA 3E3OA 3BDVA 3PNYA 4UQPA 2PMFA 4AF6A 1TUGA 2HEGA 5DN9A 1HMYA 2AOXA 2BLLA 4MVXA 3K0KA 4TSFD 2WHXA 3QMWA 4GOOD 4IGKA 4EHHA 1KY2A 3AT1A 1GR0A 2RHCA 4WZBE 1T9DA 4NY1A 1G2OA 2CVZA 2GVZC 2IXEA 2XQIA 3IILA 3GFPA 5G40A 4UTNA 4ALIA 2NVUB 4F5YA 4WN9A 3SGLA 1M0EA 2H7CA 4UNNA 2A0WA 5DOZA 2ZRJA 2ZG6A 2VJYA 1KI6B 1NX6A 1Y8AA 5H02A 3Q1LA 1ODCA 2BLNA 1Z62A 4XVRA 4I81A 1HE5A 3DF9A 3BKWA 2PVSA 4ID9A 3DAOA 1VHLA 1NQXA 3NBUA 4O2BB 1R5BA 1NKVA 1SO8A 3DQQA 5F76A 4JVNA 1J2UA 1L4LA 3N3BC 1NVWQ 1N2XA 2C9CA 3L92A 3KLPX 1BVRA 4N40A 3E3LA 5BYAA 5IZ4A 3TGPA 2BDEA 3PFIA 5MF6A 1E4OA 2NVBA 1ICIA 4IIBA 3THOA 4H7IA 4PWZA 1ZINA 2BCGY 2PMDA 4BECA 3PEYA 3P2OA 1UXJA 2XUIA 1XZAA 1A82A 3RT7A 4BKPA 4X65B 3GW8A 3RV3A 3R44A 5JAIA 1G9TA 3VHXB 1E6EA 4Y9DA 4KEAA 4O5OA 3PVCA 1G21B 4KSCA 1E2UA 4PPGA 3Q3VA 1V96A 3IVRA 3TLEA 1FFWA 2PUJA 2RGEA 4C87A 1IK6A 1CUGA 2EDAA 2HHAA 4DC1A 4RVHA 1HTWA 4XD2A 3TL3A 2VP5A 4QNMA 1L1EA 2JH9A 4RXMA 3OFVA 3EVNA 3MBIA 1J1ZA 2CXXA 2DUNA 3STYA 2FSUA 1OA1A 3L4EA 3OQBA 3RABA 4UBNA 2YW9A 1R10A 4IF4A 1NW8A 1U2GA 4X8HA 2WKPA 2WAOA 3WGYA 4HFNA 3VH3A 1W36D 3MD0A 2H4YA 1WXIA 2F8LA 3ESXA 3OZIA 1XLTA 1YFJA 2FPOA 2NPIA 1E3DA 4GD3Q 3H5AA 4XUEA 3RE1A 3IMGA 1NLFA 1LF0A 1ODJA 4IMIB 1MW8X 1WUYA 1SB8A 1HE1C 1WDLA 3PWSA 1HE4A 3QF4A 4ZHQF 3THYB 2AMJA 3O4JA 4OB7A 4XX0A 1QZ3A 2W42A 3PE6A 5BSUA 3VXKA 1XZCA 3IRVA 4MDYA 4ETIA 1RADA 3JASB 1IDOA 1OWNA 2GT1A 2VOJA 3C5CA 4OXNA 3AVUA 2W6QA 1KSFX 1CIJA 3AIKA 3UB2A 4CM3A 4TKVA 5LP6F 3RWOA 2COKA 2E49A 3AR9A 4Q7KA 3RTDA 5AVVA 1CUSA 3HEAA 1MA0A 2XNJA 2H0RA 4GLLA 1RLTA 2QD4A 2PFSA 3A27A 3NW9A 4Q4LA 2VTBB 5K3AA 4P7GA 2IYOA 3NIWA 1D2EA 2VAMA 3Q7SA 2G63A 3DOJA 1J0CA 3MQFA 1PFKA 2G06A 3GNTA 4X6XA 4XGIA 2M2IA 3KWFA 1F6WA 4DL9A 3EW7A 2QNIA 3FYHA 5I45A 3GUZA 3KUXA 1Q0PA 2OV3A 3F49S 4J0FA 3SZLA 4D99A 2AE1A 2G7MC 3AEXA 1KNXA 4G4SO 1B16A 5KX5B 3CRMA 3OIWA 4IFEA 5DXAA 1IE3A 3IBTA 4BMDA 4BP1A 2WK1A 4HJXA 4CKBB 1XU7A 2A94A 2OCBA 4JOBA 2XCQA 4E46A 2O6LA 2FPLA 1V39A 2BEKA 3HCRA 2YOFA 4AYTA 1DX4A 4PHTA 1ONOA 2AYZA 3OICA 3ETDA 1WV1A 4L51A 1GJRA 1DOZA 2AG0A 2FUKA 2PK3A 2VH2A 3N59A 5EE9A 3WFJA 2JI6A 1Y9EA 2LPMA 1CQJB 3T5TA 1K4KA 1K97A 1MRZA 1ZCZA 5HBGA 5LQRA 4LK3A 1Z4JA 4YQFA 2BGLA 1GL7A 4N6NA 3QYAA 2QENA 3GT4A 3SC3A 3ZG6A 3IEPA 2ASEA 3KXLA 5J59A 4AS3A 5ENDA 2FW7A 1IN5A 4XVCA 5H4GA 2IYNA 5LFAA 4LMBA 1V6CA 3BFXA 1JDTA 3LWDA 3RW9A 3IXQA 2OKCA 2Q45A 1KIAA 3HFSA 3WIVA 3I5UA 1HKUA 2WD8A 4EZBA 2M6LA 4XR9A 3S1AB 1I7NA 4EECA 4C05A 3SVLA 4I1SA 1P2SA 1UZNA 4BLPA 1YE3A 5M7EA 1II9A 3HFGA 1JHUA 3T7IA 3N0WA 2PH7A 3PJEA 5DGTA 3SU8A 3U60B 1YI1A 3VAAA 2EV9A 2IIPA 5A4MS 5IRCD 1E7QA 1OE0A 3BGVA 4LBWA 2DOKA 3Q3JB 2YN4A 1DKUA 1UH5A 4GNKA 3WNBA 2NUAA 5BN5A 3C16C 1R27A 3KL4A 1R0KA 5JEDA 4FDVA 1Y6RA 2DCMA 3HU5A 4DC0A 2PG3A 4LCJA 5BMOA 5I47A 2EARA 3IQWA 3DT6A 2NZXA 3A4IA 4DIDA 4H0CA 2Q1SA 2ZRAA 1YA4A 3ANNA 1K92A 4YACA 1CQIB 1GAQA 3GHYA 5C8YA 3RYTC 4F46A 2AJTA 1HYEA 1SBYA 1KHHA 1X7YB 3M1AA 5EEHA 4ARCA 1PZMA 2Q3CA 1G42A 2VJMA 1H9BA 3WGQA 2DY1A 3VDNB 4LOIA 4UARA 1LDEA 1A9SA 1MQSA 3WYGA 3FTDA 4IDAA 3GMDA 4KBYA 4XOUA 3EK2A 5FHRA 4YYZA 3AH8A 4L0QA 4OYRA 2G8LA 3BCUA 1RJ9B 2N0SA 3CKLA 4V02A 5I4IA 3DGFC 2L69A 1U1EA 3RUAA 1W8DA 4MUGA 4P4NA 1IDN1 1H2XA 2C5HA 2O9JA 2J8ZA 1QHHA 3GMSA 2JIMA 4J3FA 4RETA 1CZLA 4MV1A 4ZZ2A 1QK4A 2RGBA 5I9SA 1KO1A 3T4PA 3X1ZA 2BAGA 3TMAA 4EI7A 4F38A 3LY8A 1XXLA 2FSPA 1H6AA 3EGWA 1ZL0A 4PX2A 4NNOA 4COKA 1EDZA 1NJ6A 2EFEB 4BEJA 1W5FA 2H0QA 1FP7A 1K63A 1V95A 4WFJA 1X13A 1LBSA 1E6UA 1WPQA 5A1TA 1EXVA 1U8CB 1GA1A 2OO7A 3DS8A 3ISVA 4M4SA 3ZDFA 4EYEA 1W34A 1CUBA 3DMFA 2IA5A 2ZYIA 3N2NA 3SJ7A 4HLDA 4KKVA 4PG7A 2VPYA 2WW8A 4Z3OA 2W2TA 3LKZA 3VYTB 3WNVA 4AT1A 4GPD1 2YHSA 4WKOA 4B5LA 3CWCA 2JFQA 1PNQA 1N9GA 1VI2A 4CLHA 1DEKA 2Z30A 1B15A 1H2RS 3G23A 2BRUA 2W2NA 4BNDA 4L16A 4RVUA 2H1LA 4XE5A 4RD1A 4LGYA 2XTJA 3RSQA 4ZODA 2XMSA 3AF1A 3DVLA 3O0TA 1MAHA 1BHQ1 1GZDA 1ZJZA 2J9RA 2I80A 3G59A 3O94A 3W8EA 5JJBA 1UZAA 3IP9A 8ADHA 1GGJA 1QP7A 1EK6A 1ULZA 3L7MA 2HWYA 4UE2A 3LT2A 3EUAA 3H1PA 4Q5IA 1RHJA 2YQ5A 1NXSA 2BHSA 2MJLA 4L9WA 4D4JA 1DCTA 3EG9B 4LN1A 4TS1A 4WIAA 3UQYS 4YJHA 1GU1A 5FJJA 2H52A 4M7WA 1U4OA 1LF5A 4JKIA 4DBVO 1BCRA 1BDJA 1J9EA 2BTOA 1ZD9A 2GEUA 2RK6A 3E0XA 5TSDA 1JVBA 1KFBB 1N1DA 1CUXA 4NICA 1YJ8A 2CYCA 3COVA 3MBKA 4TLAA 4Z9XA 2YIMA 3EODA 4UBMA 4GMHA 5FI1B 2CT8A 1GNPA 3G2MA 3WBKA 3AIOA 5REQB 2ZSDA 3QKRA 4MVJI 4RD4A 3D3EA 2VNKA 2Q1YA 2JHPA 4ZO7A 4YJFB 5FJIA 1CDZA 1EUCA 4H7EA 3ZBPA 2ZIUB 4Q03A 4V0RA 2FMTA 1O95A 1O96B 1H2ZA 3PX3A 1NQ5A 4LVOA 2QLLA 5TS3A 3W1WA 3EZYA 1YZKA 4MGIR 4LRTB 3EAQA 2DUWA 3TRDA 4EGAA 1P19A 2J31A 1US8B 4HNSA 1KPHA 4YJKA 4YX9A 1QBGA 1E3EA 1CUDA 3AHIA 5HG0A 3QH4A 4QDUA 5H3CA 5KOJA 2IGBA 1JTVA 4O4JA 3DMHA 5GADl 1AO3A 3SHQA 1IY1A 3BK1A 3FLBA 4E5VA 5BV8A 1SRRA 2FEMA 3HFJA 2IOHA 3IUYA 2MMCA 3EGDB 4YP6A 4KUEA 3M70A 2VNAA 1YL6A 2EHJA 2PJDA 4QBIA 4F9GA 2BZ1A 2GN9A 4RJKA 5EIXA 2I4TA 4GF5A 2VQ3A 3ENVA 1TQ2A 5BN4A 3DD1A 3U7EB 1SOVA 1GUZA 4PQGA 4C0KA 1EVIA 2ADOA 4M9QA 4L4UA 4JIGA 3E9RA 3II6X 4P36A 1GIAA 3T7CA 1EP1B 4P53A 3WRWA 1B2LA 1TMKA 1I36A 4PSVA 4N3GA 1I7LA 3DE7X 1D8AA 4BIIA 4CCYA 4MRAA 4PLVA 2V03A 2COUA 1CULC 1MH9A 1UJCA 3IOMA 2HU8A 4IHAA 1MZPA 3I8OA 2BFEB 4MJ3A 3R8CA 3TCKA 3NYQA 2DULA 2Q3JA 2VHEA 2Z5FA 2AW5A 4HFMA 4NU8X 3WL8A 2WG0A 3KYIB 3RK0A 2C0PA 4U00A 2FPGB 3L6RA 1GAWA 3DJYA 1N78A 5IAAA 2FG7C 3HCPA 1TI7A 2V8OA 2I71A 1S89A 2OGTA 1QQ7A 1TZMA 4HUTA 4MHOA 1ODLA 1X6VA 3C45A 4RO0A 4JUFA 1IYZA 4LY9A 1XQ9A 3X3HA 5TARA 3U7IA 1LNSA 3I1YA 5CK4A 1DTEA 3ZDCA 3WLMA 1XRRA 3CYFA 2JB9A 3D7RA 5EVJA 5JC1A 2X6TA 1Q12A 3EVCA 4QUGA 4I1VA 4KLCA 4FEYA 1DJOA 1Y8RB 3RC9A 5FUVA 4LRXA 2IPAB 1CZHA 2XQFA 1MJNA 3GJSA 1ZUHA 1MH1A 1G9XA 1I8TA 1RWQA 1O97D 1DSSG 2WUWE 1Y33E 4XR4A 2X5XA 4ZN6A 1HFJA 2HN9A 3ETHA 3N5KA 1NV8A 4J03A 4JC4A 1PFWA 2Q6KA 2YFQA 4QU5A 4IIXA 3H1FA 2OE2A 1ML3A 3GGGA 4HEHA 3O1LA 4AWAA 2BEJA 1VB5A 2P79A 1FS6A 3KVYA 4COOA 3H2IA 3EIEA 1T9AA 3KBOA 1G3IA 2XWQA 3R6LA 3AG6A 3TGWA 1L5QA 2IZ6A 8MHTA 1GU7A 1DTSA 1AB6A 2Z5GA 1TT7A 2ONYA 4J7CA 3PXGA 3UKDA 1NE2A 4NX2A 2HHLA 2GZAA 1JUDA 3KT3A 3LA8A 4X1IB 1KEWA 3GO4A 3VC2A 4KI7A 2CDBA 4YI3A 2V6JA 3RRBA 3BAFA 3DKKA 4JWTA 5EJMA 3MWEB 1U4NA 2R6FA 2GSWA 3F98A 1UDWA 4I55F 2QOEA 1JEDA 2CLFB 2YYYA 2YZGA 3ZCVA 3V4SA 5JAQA 4Q15A 2CLSA 2FPXA 4D46A 3MYYA 3QVLA 2C3YA 1CVLA 2IOFA 3DEAA 3RIXA 3ZBUA 2NSJA 3P9SA 4XIFA 4LF7B 3T1VA 3DWGA 5C80A 1HYQA 1E58A 4W6ZA 2NVWA 3EXHA 3PDJA 3R4VA 3VTZA 1O03A 2PRJA 2O8FB 1NYQA 4XGQA 1NZFA 1CJVC 2AX4A 3SEQA 2ODQA 4AZVA 1BE0A 4D1YA 1BVYF 3DDWA 3OX4A 1I4EB 4MR8B 4H4CA 4P4TA 4FNGA 3ZYZA 3HK2A 3NP9A 1SC3A 2FKNA 3O8OA 4JBWA 4RM2A 4UMDA 4XB6B 1M6VB 4WCFC 2VN8A 2I1VB 5KWIA 4QNRA 1ODIA 1SUBA 4EF5A 1G3RA 5IJZA 5FPPA 1IHPA 2Q46A 1Y4DE 1KYVA 1SCJA 1UOEA 1N9KA 2FQXA 2HNBA 3HFRA 3I04A 3QMMA 4GI1A 4MYCA 2BCJQ 4PU0A 5GY7A 5IEBA 4K8RB 4DWVA 5AKGA 2IE8A 5FQOA 4UM5A 3RNLA 2OC9A 2AFRA 5C4GB 3KT6A 1GNLA 4DG8A 1XTSA 1UFRA 1UFOA 2BISA 2DWCA 2F4VB 2B9VA 4ZAVA 1OH6A 1QCZA 1E62A 4WZBA 5HE9A 3CVUA 1OZGA 1O6FA 5SZIA 1NZDA 2QYHA 5CFOA 3SP1A 3WDKA 2ZR0A 3DTVA 2IHJA 1MQ9A 4Z9AA 4U9HS 3T4XA 4YLYA 2WU4A 2ZI5A 1CV2A 4Q3OA 2GZRA 1VLQA 4P0PB 4N6OA 3B1VA 4BTLA 4UTVA 3EXIA 4FW8A 4MMZB 2GNOA 3GZTB 3UQZA 4DMUB 5JNWA 4GSYA 2O5EA 3WMEA 1JU9A 1N6RA 3OOWA 2G17A 2WUEA 1A1SA 1O87A 3K70B 2QVLA 2W6NA 4F1WA 3ZWCA 3NOOA 1W25A 2W2KB 1T2FA 1A71A 4HDKA 1IWOA 4B7CA 4PV7A 3WWEA 4IIVA 2IIBA 4G23A 2B21A 1OPXA 2FOXA 4GXNA 1NHWA 2LUOA 3KJZA 3CNHA 3SSOA 4D9KA 5B7NA 4G5OA 4M21A 5I7FA 3O93A 3W77A 2G70A 2J3QA 3JQAD 3RT1A 1FPMA 2NZVG 3LX4A 4JA0A 1HTBA 2O8CB 1K3UB 1PL6A 2V3WA 3B3FA 5DTRA 2ZITA 4PCUA 3UBMA 3UMYA 1F1JA 4DCJA 2GZ2A 3D0OA 5SICE 2QN7A 1LS6A 3IVAA 4GIBA 4PPYA 3OZDA 4QUIA 2E4VA 1PNTA 3PNKA 2DHEA 1CSEE 5F4ZA 3GDOA 1FYVA 1AA9A 5AYVA 1D2RA 2XQJA 4D3DA 4E21A 1W47A 2RHRA 4GYWA 1S2OA 3GAFA 1WUHS 5HKBA 4YRRA 4UREA 2R7AA 2QG6A 4LSMA 4J29A 2JEYA 3INGA 4GE3A 5NULA 3TKYA 1WQ3A 4GOJA 3A8TA 1ZKMA 4OK3A 5B1IA 4UE3S 3TPZA 3R7LA 4BP3A 3ZLBA 1WXGA 1G5HA 5JDCA 1CEYA 1P0IA 1I3LA 4Z54A 3INTA 4UC0A 2RIPA 3CF0A 3I0NA 2YHUA 3WYCA 4Y9SA 1NXQA 1BQ3A 1HFEL 3F3YA 2R7MA 4U8GA 3NIGB 2WUDA 4PLPA 2FLVA 2OAGA 4XYMA 3R23A 3RS8A 2IYPA 1J07A 2N42A 4HD8A 4G63A 5LA6A 3TRKA 2RCYA 3CLTD 2Q62A 3PU6A 1JQBA 2BT4A 2ATVA 1WJGA 2CNLA 4RKYA 2FZ4A 5K6AA 1PNRA 5H0IA 1BX1A 2WIAA 1XN4A 3LQQA 1WXWA 4HKTA 3SZMA 4EHFA 2ZU0C 5EHXA 1T0BA 5KNDD 2PT9A 3F5DA 1ECLA 3IDQA 3IMCA 5FD8A 4DR4B 1T9HA 4OHXA 2OHFA 1YC5A 4UNPA 3ABRB 3MJRA 1DIOB 4E22A 5K4HA 2HQRA 3WLLA 2X1HA 4B3TB 2YFHA 3TQIA 4P4SB 4ZI7A 3MJSA 4HB3A 2IEAA 5J40A 3LYLA 5K0EA 4PAWA 3VHQA 5EPOA 4PNPA 5HGJA 4PZUA 1TUBA 3BF8A 4PLGA 1SQ6A 1NT4A 3M6AA 1HE3A 2LP4Y 5HMLA 5JALA 2VNSA 1PT9A 1ZYUA 4ZTZB 5FF9A 3G9ZA 2JFPA 1EXNA 1QTRA 1JMVA 1E98A 1SU4A 3O4VA 4LZLA 4ZAYA 5FNZA 1KOLA 4YROA 3RJ5A 4B6JA 5K8UA 5LQNA 1P5RA 1TT5B 3WYAA 5IULC 2RI6A 4JU8A 1U98A 2ERXA 3H4MA 4HEQA 2FZKA 5HIMA 1TECE 4HLUC 4W82A 3GP3A 5CTJA 1GNTA 1UIMA 4JVLA 4QELA 3LW8A 1Z0AA 3SM9A 2NM0A 4DPMA 2N75A 2E55A 3TQQA 4NV3A 3TUZC 2P9CA 3ICVA 3P4UA 4FR0A 2ZAMA 4BJ1A 1XDGA 3ZGLA 3BL5A 1KAOA 1E2FA 3VPDA 3R5SA 2J3KA 4WX2B 1K68A 1EGMB 1TQ8A 2ZE8A 2WMNB 3H75A 1N6OA 4KO2S 3WRVA 4GR5A 2B6NA 5C37A 3TIIA 1LVHA 1TQDA 1XDBA 2HV9A 2QTFA 2RMKA 4KYVA 2H54A 1EVKA 3U48A 3SHOA 2XYGA 2QRVA 4TYYA 1VKOA 3V1LA 4NOLA 3WHKA 2H1SA 1BN6A 4GQBA 4TKLA 2IEDA 1LKZA 3U3RA 5EMHA 5EMNA 1SKUA 1H93A 3UMMA 1JFLA 2R5FA 5E7QA 3NT2A 5E8JA 2OZKA 2V74B 2XEXA 1L8OA 3I9NA 3I30X 4G9GA 3AKZA 1DTWA 3B7WA 5K8IA 4EMSA 1P8AA 1GRCA 3WLIA 4HQFA 1VLVA 3ZJYA 3D2CA 1IHYA 4LYDA 3ZCXA 4MKGA 2IYXA 4EM6A 4X20B 5EZ6B 4EEZA 4QWMA 2JHGA 3GN1A 1FJ2A 3GY0A 4BFTA 2O0HA 1ZMTA 3IKVA 1K7FB 3T1TA 1O95D 2JKYA 3CX7A 3I2GA 4WZAA 1FFYA 5EWJA 3WSTA 1O94C 4OLJA 5AESA 1FRFS 3K32A 3HCCA 2YWHA 3AR5A 2ZATA 4DZRA 2JVJA 4AMUA 4OBBA 4S35A 1YK0A 2V7QD 5THXA 1J5XA 1LQ2A 3RG2A 3WA6A 3DZDA 1ZN7A 4Y6SA 1PR0A 3WC4A 5J4LA 1JLKA 2HA4A 2IH5A 3BIXA 4Q1DA 1F2UA 5LZ2A 2MYPA 4TLDA 3K2BA 4BO2A 5LBUA 1IZ0A 3O2QB 3UPTA 4YRQA 5FI5A 3HU2A 2GFIA 1RKVA 3MIIA 1KJWA 4URWR 4C29A 1XZFA 2XD9A 3AETB 3BWCA 4GI5A 3SK0A 1MP0A 4ZVNA 5J58A 1WXDA 4GSLA 5EKTA 5FP0A 2FSHA 1GT91 6ADHA 3T95A 1P74A 2CB0A 3LOUA 5C18A 3LC2O 1V6SA 2JKZA 4AD8A 3DA8A 1TD9A 2OHOA 4A6DA 4BQOA 1GV1A 2GYYA 3GLHA 5ALQA 4Y1RB 5K3CA 5AVUA 4G2TA 3RS4A 4CF6A 1ZGGA 4R2KA 4GS5A 4FXPA 4DUZB 4K6HA 5AK3A 4LTMA 4BE7B 3HJCA 2J4CA 3KUDA 2WDZA 4NZYA 4DILA 1YZ3A 2WJIA 2WA1A 4IZIA 1EWRA 4KPUB 2AYYA 3IV7A 2P2GA 3FB4A 2Q5OA 4PZAA 1UDRA 5CLIA 4Z9YA 3CLSD 1M3SA 4DQLA 5B7QA 2B3DA 3C70A 3UTCA 4H7DA 2P69A 4G25A 4Q39A 1VYVA 3IFSA 4C14A 5JZMA 1EX6A 5CCBA 2OO3A 3WLJA 3S1SA 2FDCA 2BFBA 2OBXA 1JX6A 2J45A 1EH5A 3DUFA 3GJ8A 4FUQA 2FQWA 4IXNA 4M86A 2PS9A 4H1TA 4MA5A 4WT7A 1YS7A 2PMKA 1JEYB 1D7OA 2M6SA 2ODPA 3OTIA 3DZIA 4MRPA 4EP1A 2C7QA 1ZC4A 4EYSA 3FKJA 5DE3A 3LX6A 3LMKA 1TA0A 2EP8A 5D3QA 4OOFA 1TAHA 3PB3A 1GU0A 3A05A 4XM1A 3TQRA 1KEVA 4EW2A 5KVSA 1IJFA 1DE0A 1O4WA 1A1VA 1RLOA 3ZKAA 5B1DA 2WSMA 2HSJA 3PQ7A 2JAPA 4IRXA 3FSGA 3Q3HA 4J49A 3MGGA 4O2LA 3R5KA 1OX4A 4P08A 4QULA 3WL6A 3ZWKA 4BNIA 3D0KA 2R7LA 2XE4A 5M04A 2GB4A 3I64A 4B82A 2O0JA 1URPA 2PXXA 1QB7A 2YIVX 3QTLA 1DVRA 2KX7A 2QY9A 1S2NA 3DL4A 3ML1A 3PI7A 5I3ZA 2QNRA 3HV0A 5GM1A 4L6AA 3QENA 1A9XA 1GFWA 1OGJA 2IVFA 5EP4A 1KEEB 3BD6A 1DPGA 4A3SA 5ICEA 3GU3A 1MR3F 1ZUNA 4QDKA 3VH1A 4ADSG 4ZCPA 4BLRA 3CM0A 2JEOA 4U2DA 4KXYA 1TO1E 2G5GX 5ECGC 3E8MA 1ZD8A 3ND8A 3PXBA 3T7RA 2W00A 1MAUA 3DWEX 1DAPA 3D1JA 5JSKA 4AVYA 1L8LA 3M9WA 3QVWA 1JXQA 3V4LA 2UYYA 1N2SA 1HBJA 1JNXX 3DQPA 1I7SB 4JD5A 1N3BA 1KY3A 1T4MA 2ORIA 4GLFA 3L0SA 2CHEA 1U81A 4FC7A 3AMVA 3WKBA 5ISMA 5YASA 3FCAA 3R20A 4KP7A 1IEQA 3R76A 5E2AA 3SBOA 4DNOA 2ZRGA 1UINA 4IV0A 4R9RA 2OBLA 5HJ2A 4HB4A 4HAVA 4A36A 4J0HA 4YTEA 2FWIA 4EY5A 1YO6A 3IJRA 3NVDA 3L6UA 3UT0A 4I50F 1N8TA 3I6QA 4OGGA 5HS4A 2W8BA 1CUEA 4UHKA 3CVVA 3ENWA 2ODAA 1J56A 2P30A 5EERA 2QQ5A 4HEA6 2OK8A 2Z08A 2ZM5A 3GLGB 3QKSA 5JHHB 3EEYA 1A88A 3UOGA 4LGCA 3AONB 1X1SA 3GZNA 3IGFA 9LDTA 4FN4A 5ER6A 4RTNA 1TVMA 2Q5JA 2VZEA 2IEBA 3I01A 2YOGA 5SY6A 3G2LA 4W9NC 1X1DA 5LZ8A 4OH7A 1VGRA 1PVDA 2OD9A 3L7AA 4OLFA 5EZ5A 3N76A 4NCHA 1IN4A 3O4GA 2H4XA 3K2IA 4PCLA 5CXSA 4AF8A 4INOA 3ILVA 4MQUA 3DTVD 1A9PA 2PT7A 1L8QA 2YR0A 3NWEA 4LC9A 1BHO1 2GX6A 3M6IA 1W94A 4PG6A 5K9ZA 3AVYA 1Q6YA 4TWJA 4KSBA 1FQKA 3KZMA 2AG6A 2VBIA 3NXSA 2JJMA 2VYVD 2H3EA 2DHDA 3BH7A 2DUUA 1E5TA 2ZTVA 3D7SA 1HETA 5ILGA 1WWKA 3P32A 1V8PA 4X7BA 5IBRA 5DT2A 4UVDA 3V48A 3B2NA 4PE5B 4QVGA 3QX3A 2HZ7A 2CB9A 2CLDX 1U9ZA 4WJLA 1Z13A 4DAOA 5JATA 3T7EA 1QJCA 2ZR8A 1C14A 3NV7A 5GGXA 3U09A 3Q10A 1F4LA 2XXBA 5CRIA 2OYRA 4HBGA 3H04A 5FOQA 4WN9B 5ERGB 2QYTA 2P2SA 5BP7A 2CW5A 2Q2NA 2DHRA 1LJUA 2ZBFA 2P1ZA 5ITSA 2WLTA 4S1VA 4XFDA 5KYVA 2VP0A 1Z34A 5GWXA 2XUZA 1M34E 1UQUA 1DC7A 1X3LA 3HXPA 4QUBA 1G4AE 2EFYA 4S1WA 3VPAA 3X2EA 5K0FA 5LQAA 2GJSA 1J8DA 3DHNA 2G72A 3PD1A 5EFOA 1WG8A 4ICIA 2ORED 4RHEA 4S1PA 1ABFA 5KNCD 2EL9A 1SBCA 1XMJA 1Z4LA 1D04A 4AX4A 1E0SA 1V6AA 3CZAA 4UXHA 3HP4A 1QB8A 4B84A 1WU7A 2ZEJA 2K87A 4RKQA 3BWDD 3I9OA 4QGGA 4XAQA 2YIJA 8GPBA 1IEWA 3DLIA 1A96A 3B1ZA 4WKGA 5CR9A 3H2HA 1M8KA 4JC8A 1HNZB 3IKJA 2OXCA 3ZDDA 3CLRC 1N7JA 3AF5A 3FY4A 3QPDA 1RYBA 1WVMA 1Z16A 1UC8A 1HFKA 3PVZA 4Q4CA 1TYDE 3MWDA 4F6CA 1FNCA 2BKLA 1FNSA 3QPBA 2PUHA 3RRXA 3BCSA 1E2DA 3AB7A 3I76A 1O89A 4S12A 4D3FA 1E9FA 1HNNA 1GQOA 2AQ8A 4XLLA 4I5DA 2ZWMA 2AN3A 2WMDA 1Z22A 1KKLA 1E1LA 1VFNA 1NASA 5H80A 1IY8A 4C7JA 4EJSA 2Q99A 1MLDA 1Z8FA 1LLUA 1U0GA 3OZVA 4EMTA 3QF4B 4XRRA 4DNQA 1FDVA 1E7SA 1N6IA 3MT8A 4XX0B 4A2WA 2NTEA 1AKYA 1Y3BE 5ALRA 3A1FA 3H0KA 3KLBA 4IJUA 2DPLA 5IKOA 4EX6A 2FP3A 4NJMA 2I2FA 5FV4A 1RRGA 4EJ0A 3FOFC 1GZUA 4DBZA 1UZUA 3QOYA 1BDMA 2J9YB 2JW5A 5DISB 2YVQA 4TKVB 4UNIA 5ITWA 4AI6A 4R8VA 3OURA 4DB4A 1C1XA 4R8KA 3PV0A 2AYXA 1JLMA 2WNSA 2HT6A 3MTGA 4LJRA 1ECJA 4AKIA 3ZGOA 1M2WA 1ENZA 2XRMA 1JZQA 1JXMA 3CH6A 3SLKA 1DXYA 2FWNA 4Q01A 2QJFA 2CWDA 1IUOA 1KXJA 1F8FA 1CZUA 1RM5A 2EWWA 3DXYA 3L8YA 4RC9A 2A5DA 5CIYA 1ZM9A 2VP2A 4Y2HA 1JQDA 1P4RA 4DV1B 4W9RA 3UK0A 4TZ0A 1BCSA 2ZI6A 1RC1A 1ZMBA 1M2OA 2ZREA 3EVEA 4HC4A 2R62A 2CJXA 2PV7A 4ZOBA 1QPGA 1ZK4A 2H16A 3C14C 1X8XA 2ZIAA 3W4IA 4R7TA 2OCGA 4MKZA 2Y2UA 1IWPB 1Z0IA 3C5EA 3VHRA 3FKSA 4H9GA 4AC9A 4B33A 1FC0A 2ZUWA 3PDIA 5MFPA 4CL0A 4B80A 4FLFA 2B20A 2D8AA 2YYSA 3V9AA 1ODTC 4JQYA 1VJRA 4NE2A 5JSQA 4GEGA 4I1UA 1WDTA 1B74A 1ZM3A 4BU1A 1NRXA 3W4JA 1PGPA 1F8GA 2C8VA 2WUGA 3FFXA 2WVGA 2IDJA 4TXLA 1Q57A 2ZKIA 3WGVA 4PPQA 4KQFA 2YXBA 3ZKWA 3ETGA 4CM7A 1N5DA 2Q49A 4CMAA 4EG8A 1PHPA 4F3YA 1OFVA 2Q1XA 3LFUA 3ZHQA 3FSEA 5LL6P 1K3TA 3FN4A 4BQEA 2A4MA 4EHNA 4KFTA 2IODA 5JEEA 2W48A 3E18A 4DEYA 2C2BA 3RFVA 2WSBA 3RJ9A 3QPWA 5T4BA 2F1OA 3G7UA 4U2FA 3QGMA 2O0KA 4JUIA 2HWWA 5TVKA 3OKCA 2H2AA 1N0HA 1QIGA 1IULA 1G5RA