1DCKA

Structure of unphosphorylated fixj-n complexed with mn2+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
publication title Structural transitions in the FixJ receiver domain.
pubmed doi rcsb
source organism Sinorhizobium meliloti
total genus 39
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dckA00
4MYRA 1FQWA 2PKXA 3H5LA 1P8AA 4RK1A 4ZJPA 3DLBA 3LUHA 4H3HB 1M5TA 3IP6A 3RVMA 2JVJA 4F8JA 3O2QB 4MS3B 4ZMRA 4IF4A 5EWJA 4MS1B 2R48A 2H0AA 4EVRA 5TQ2B 4KREA 3MA0A 3EODA 4XXHA 5BR1A 3T6KA 4KFCA 2X7XA 5JNWA 3KJXA 1DCKA 1R8JA 5JNVA 1K66A 4MR8B 4KQ9A 5JS2A 4W5NA 3OO0A 3KS9A 5C5CA 5B3JA 4NQRA 5CNMA 2JBAA 2IOYA 3SG0A 2QW1A 1E6MA 3ILHA 2FKAA 1ZDMA 2JVIA 3CFYA 4G0YA 4LDAA 5TPZD 3JTEA 4W5TA 4FE7A 1D4ZA 1JFSA 3SY8A 3HV2A 4RKQA 3RVKA 1C4WA 2JCGA 1ABFA 5TPWA 2M1ZA 5ED4A 4GPAA 2P4UA 4EVQA 4MLDA 1RXEA 3OQOA 3GYBA 4IILA 4S05A 5CNJA 2IPMA 2WY2D 5GOTA 4DADA 3HXMA 2QR3A 3HUTA 4LDZA 4O1IA 4PICA 3RVSA 5IUJC 2PUCA 4TLLB 2VUIB 3H1FA 4KVFA 5TQ0A 1ZITA 4QYMA 1JFTA 1EHCA 1EWTA 1JDPA 1JBEA 3HDVA 3CZCA 3MM4A 1TMYA 4RWEA 5EWMB 1JDNA 5FWYB 1U8TA 5JNTA 2L17A 2E4UA 3L49A 4W5OA 3KSMA 1BDHA 1F51E 5IBQA 1W25A 5KI6A 4N76A 1ISRA 3QLUA 3P9YA 5HQJA 4G0MA 1NXWA 3CNBA 2TMYA 2H3HA 4MR7A 4FB4A 2WRZA 4G0QA 4Z4HA 3CLKA 1DRKA 1F4VA 2PL9A 5BRJA 1E6KA 3H5OA 3OLXA 3T95A 4HNSA 3OM1A 4NICA 1TJYA 5TQJA 3EAFA 3I09A 4YV7A 3LUJA 3KCNA 2I6FA 4LX8A 4E7PA 3IP9A 3DBIA 3IP5A 5DLEA 4EY3A 1PEYA 4F3TA 4G0ZA 4KRFA 3N0RA 3JY6A 1YIOA 2AYZA 4NCAA 2QZJA 2WWVD 1QNLA 1YTUA 2MYNA 3H5IA 3JPYA 3GL9A 3Q7RA 1CYEA 2GX6A 1PEAA 1RPJA 3GA5A 4MQEA 4ETIA 2CHFA 3QLTA 3H6GA 2JVKA 4TN5A 3OLVA 2FW0A 3OO1A 4N03A 1USKA 3F6CA 3K9CA 1ISSA 1JX6A 2ZWMA 6ABPA 4YO7A 2A9OA 3SNKA 1YK0A 3QK7A 1QPZA 2PUDA 1L5YA 3RVPA 1FFSA 2FQYA 4Z9BA 3F73A 4EYGA 3GBPA 1KGSA 4MAAA 4DN6A 4QPJC 4MR9A 3LKBA 5T3YA 1ZHHA 4G86A 4LRQA 3IDOA 3L6UA 5HSGA 1SD5A 1GCGA 1PHRA 3SM9A 2IPAB 4YCSA 1APBA 1JYEA 2QXYA 4JAVC 4XARA 2WMYA 4RK6A 3I45A 3KKEA 2JB9A 3F7NA 4Z4EA 1L5ZA 1U2PA 4QICA 3HUUA 3O1IC 1DZ3A 3TX6A 3A0UA 3CHYA 3O2SB 4YS6A 2MSLA 2HPHA 2A9PA 3UK0A 2FMKA 3FDFA 3C6QA 4QYWA 1FFGA 1QO0D 1DCMA 2RJNA 3ROTA 5D2CA 1JLKA 4LE0A 1DP4A 3H5VA 4EUKA 3KLOA 2VYCA 1EWKA 4KQCA 3T8YA 4JOQA 3LUGA 3RVLA 5GQSA 1MVOA 2HQRA 1Z2DA 5KWSA 5FWXB 3LUKA 2IKSA 6CHYA 4MRMB 1NTRA 2FQWA 3EJWA 3EULA 3H6HA 4MS3A 5BRAA 3O1HB 1ZAYA 4OBBA 1XHFA 1XWWA 4MS1A 2IYNA 4DQDA 1ZN2A 1ZVVA 3E61A 1KRXA 4RK4A 5TQ2A 3FFXA 3GT7A 3C97A 2IDMA 4RK5A 4WXEA 1DC8A 2NUBA 1VKRA 4MR8A 3SAJA 1JL3A 5KQMA 1W9HA 3OM0A 1GUBA 3N75A 4NV3A 1DBPA 2L19A 3FFTA 4Z4FA 3UUGA 4JASB 5EWJB 3DLHA 4HYEA 2LPMA 4RY8A 5EWLB 1LBIA 2CD7A 3N6VA 4MS4B 3KLNA 3LKVA 4YLEA 3QLVC 3T38A 2R25B 1NY5A 1Z25A 4IMIB 1MIHA 2O20A 3RVRA 1VPWA 3DGEC 2QVGA 1LBHA 1YMVA 1USGA 3MQ4A 3Q9SA 1BA2A 4RZSA 3EQZA 2ID9A 1UDRA 2HQBA 1URPA 3CRNA 3KG2A 4LE1A 4N47A 3O74A 3FMVA 4UHJA 2JBAB 1LK0A 2AYXA 4F06A 4D6YA 1EWVA 3GV0A 4XAQA 3TMYA 2FMFA 2FMIA 1C0EA 2W42A 4GNRA 1S8NA 1FSPA 1MAVA 4OLAA 4RXTA 2KYRA 4KPYA 2FXIA 5JS1A 1JFVA 3D02A 3A10A 1ABEA 3OLYA 1USIA 3RVOA 1I3CA 5TPWB 3OLWA 3NHMA 4JB2A 4EYQA 1M2FA 3HVRA 3CZ5A 1Z12A 1DG9A 3EQ2A 4RDCA 5CHYA 3GBVA 1LJLA 4PEVA 4RK7A 4HNRA 1D1QA 3NHZA 2LBPA 3C3WA 2M98A 5ABPA 4WZZA 1Z16A 2NT4A 2QU7A 4F11A 1DCFA 4D74A 2GWRA 3HDGA 4KK3A 3HS3A 4YWHA 5TPZA 4IRXA 2L2QA 3C3MA 3HK2A 2HSGA 2VK2A 3MMNA 2RGYA 5IULC 4IMJB 1GUDA 4JP1A 2GKGA 3KYIB 4YR7A 3RVJA 3R0JA 1DBQA 2ID7A 3QEMA 4CBVA 1SXIA 2BGGA 4G0OA 2FN9A 3N0XA 3NNDA 4NCBA 1MB0A 2PUEA 5T7BA 4TMYA 4XASA 4RKRA 1ZH4A 5DKFA 1Z18A 4EYOA 1CEYA 4ZMSA 4G97A 4EYKA 3NBMA 3M9WA 4RV5A 1VLZA 1P6QA 3IPAA 3KYJB 4OG2A 1ZH2A 1Z17A 4TLMB 1P2FA 2E4XA 2N9UA 3ILYA 1RNLA 2DRIA 2J48A 3LMKA 4WXMA 4ETMA 4MQEB 4MQFB 4UHKA 2FSPA 5KQLA 4Z4GA 2LUOA 3OQNA 3N0WA 1YS7A 2B4AA 4H3KB 3EGCA 3CTPA 3NNNA 1SXGA 3HEBA 4XLTA 3ROFA 2A9QA 2E4ZA 2R4QA 3MIZA 4WT7A 4Z99A 1H9CA 5IEJA 1Z26A 5IEBA 5PNTA 1AB6A 2PL1A 3H5WA 4W5RA 4H60A 2PJUA 4Z4CA 1WETA 2CWDA 4YRZA 4LZLA 5KC8A 3QELA 4MR9B 1A04A 1NXVA 3LUFA 4N41A 2F8TA 1NXSA 3TB6A 1PNTA 2GI4A 2PUFA 2E4VA 1GLGA 3EDCA 1QP4A 4JB0A 1NXPA 1J56A 4ETNA 4MRMA 3RH0A 4ZPJA 2FTKE 1JF8A 4N0PA 4RSMA 3LUDA 4Z0NA 3KHTA 2MYTA 2FLWA 3H1GA 4PYRA 3JVDA 4WWHA 5F64A 5I4CA 1DJMA 1D1PA 3O2JA 4S04A 2FMHA 2A9RA 2RDMA 1DBWA 1KRWA 3URMA 3O21A 4YGXB 2JK1A 1FFWA 1U0SY 2WJAA 2WJWA 3QLVA 1KMIY 1QKKA 3M6MD 5FBHA 3VNBA 4KMRA 1K68A 4IGAA 4F12A 3N53A 3A0RB 3CU5A 2YHBA 4FE4A 2JRLA 5EWLA 1JYFA 4MS4A 1TVMA 2NZVG 4PZ0A 5TE9A 1NATA 4KV7A 3TO5A 2QVCA 3Q15C 4RXMA 2MSKA 3JPWA 1D5WA 4OTZA 3QX9A 1QO0A 1RZRD 2MSWA 2V0NA 3FFWA 3DGFC 2E4WA 1LJUA 3HCWA 3RQIA 2HJ9A 1GCAA 4EGSA 1OXBB 3QEKA 1PNRA 1U2QA 2B1JA 3BRSA 2QSJA 1ZESA 4O1HA 3HM9A 5IUNC 2RJOA 1A2OA 5EWMA 5B3JC 1NXXA 5FWYA 1P6UA 3LUCA 4LE2A 4O5AA 3Q41A 4KK4A 2FQXA 1DRJA 3D8UA 3I42A 1BDJA 2HQOA 3BILA 3BREA 1RXIA 3N8IA 4ZYLA 4RK0A 2OQRA 3F6PA 2FEPA 5KC9A 3FGZA 4G0PA 4MGEA 5JNSA 4WUTA 1VRVA 3GRCA 5TQ0B 5KQGA 4Q6BA 2PUBA 4RY9A 4W5QA 9ABPA 4HNQA 2GBPA 1IIBA 2L18A 3C3KA 4RS3A 5HM6A 3DZDA 4Z9AA 5BQ3A 4MLCA 2QV0A 3JS5A 4D6XA 5JNRA 1BAPA 3HJFA 3H1EA 1YS6A 2FLKA 2IPLA 1XHEA 1Z2EA 3M9XA 2FN8A 3CG0A 1M2EA 4MR7B 5IUKC 1SXHA 3CG4A 3H75A 1QP0A 2NZUG 4L4UA 1RZRA 2PE5A 3MYYA 2NT3A 1TLFA 4P98A 3QLUC 3I5AA 2Q5CA 2LP4Y 4KZKA 2YHAA 3JVIA 3HSYA 4Y9TA 1YVUA 1QQBA 2E4YA 2WB4A 1JWLA 1PUXA 3MF4A 4RXUA 5JNUA 4Z4IA 2XDYA 2FEKA 2IPNA 1ZY2A 3SQNA 1ZGZA 3GWGA 3Q7TA 1YK1A 4P1ZA 3LOPA 3TD9A 5IX8A 1U04A 3UKJA 3OLZA 1YMUA 4Q6WA 1EAYA 2ZAYA 1E2BA 3QEMB 1BDIA 4RU1A 3CKMA 4Q7EA 5CNKA 3OQMA 3G85A 3O75A 2PLNA 4ML3A 1T34A 4MQFA 3HO1A 4L85A 3RVQA 5CNIA 3VNAA 4RY0A 3RVNA 1Z13A 1D2AA 2CHEA 5IC5A 1EFAA 1M5UA 3HZHA 1CHNA 2VUHB 3BBLA 4EVSA 1DC7A 5KQPA 2FEWB 3B2NA 4JA2A 2FVYA 1QP7A 3G1WA 3BRQA 1JH9A 1AB5A 5DTEA 1BVHA 1JHZA 4XFKA 5DCLA 1NXOA 3IPCA 3O1JC 5E3JA 8ABPA 2F8SA 4OLBA 2LIVA 3KTOA 3CS3A 3H5TA 2OENG 1TM2A 1B00A 1OXKB 1SRRA 3OMWA 4MPTA 3Q7SA 1E6LA 5C5EA 3E3MA 2MYPA 4KNYA 3K4HA 5HKOA 5FWXA 1ZGGA 1NXTA 4YP9A 3S99A 1Y1LA 1QQAA 2R47A 4OATA 4PE5B 2MYUA 5FBKA 3IP7A 3LUAA 1HEYA 1QMPA 1MB3A 3NNSA 5DGCA 4B09A 4G0XA 3OMXA 3A3KA 3QX8A 1Z15A 3W9SA 4E7OA 2PUAA 1A0OA 2PUGA 2PMCA 2P9HA 2PAFA 4M88A 7ABPA 3LTEA 3QELB 4N0QA 3LFTA
chains in the Genus database with same CATH superfamily
3MMPA 1BZYA 1EGQA 2VSNA 1UPTA 4CUZA 2V6BA 3DE2X 3KB8A 4PR3A 5E2BA 3RC7A 3C7TA 2CLFB 4OQMA 3VZDA 4BXOA 4RTNA 3IP6A 1I80A 1VBNA 2PA0A 3OE4A 5DXAA 1TQDA 2R5FA 4IF4A 4FOOA 3IUJA 3NV9A 1QONA 1XA4A 2H6EA 2XE4A 1IJKA 1QG2A 1SZPA 2P2YA 4YO8A 3CLVA 2E2WA 1XL0A 2IPXA 3EODA 3G49A 5BOVA 4B3GA 4G41A 1VL0A 5EC8A 5KNBH 3U4HA 2BFAA 3DOCA 4B3MB 3EFBA 4NV1A 2QLNA 4LKRA 4PSAA 2QIPA 3GCGA 4PLGA 4BMZA 4DIUA 5LP6A 3AILA 2DLCX 2F43B 5D7BA 2V1UA 4GZLA 1ZH0A 4PSCA 2SHKA 2ZDHA 2IOYA 4E5SA 1A5SB 3MD9A 2HA0A 2PYDA 1XVUA 2DQKA 4FFDA 3CX4A 4K6KA 1NW8A 5BVHA 3ABSB 2O8BB 3TF5A 1U8AA 5H16A 4OK3A 2ACVA 2BKUA 4BP3A 1NOJA 3VISA 1THTA 1DKLA 4BVHA 2FCRA 5GP1A 3DV9A 4L8LA 4NENA 2TS1A 4MPRA 2O06A 4RHTA 1V6AA 4RMIA 4IV8A 1AXRA 2VJDA 3C3JA 4P2BA 5GV8A 4B32A 5KOHA 3H2SA 3SLRA 4ZQHA 2RB5A 3WRWA 4XIYA 3C4VA 4G5OA 1VQ1A 3WLFA 2ECOA 2WVJA 1BW9A 3I1FA 4L02A 3N58A 1F2TB 4D9KA 5B1EA 4CLOA 5ALIA 2QDXA 3E3NA 4DDVA 2P7IA 2V4ZA 4JITA 4FM9A 1EX7A 2DLDA 3R5TA 3SGLA 1OX4A 5JVDF 1QDEA 1EK0A 4WTOA 4PS0A 5BSKA 2VJPA 1BRMA 4WXYB 2AMJA 2D4AA 4KPUA 4RVOA 3EF3A 2PV0A 3AR8A 4KPEC 1N57A 2QNBA 1NVWQ 1ULBA 1N5DA 1NNUA 1VI6A 3FDZB 3KXKA 4V1CA 1U3WA 1FU4A 1NA5A 2P9FA 3NFRA 4HWKA 4YT5A 3SXUB 4WY8A 5BR4A 3MZ0A 4AS1A 3QJ5A 4LJ8A 3QF4A 2I71A 1F4VA 2DQSA 2ZYIA 1WP9A 1I3OA 1W0KA 4EQ6B 2PBLA 4OPMA 1XZ8A 3C74A 4F5DA 3CZPA 2I22A 3D6VA 2PZAA 1N5MA 4QDZA 2EKBA 2H1WA 3UXHA 5IH7A 2MHCA 5DH9A 4F3TA 3EUEA 3BUSA 2ZI6A 1K5GA 2OZPA 3HDTA 3HV0A 3ZHTA 4AY6A 3FPFA 1I6WA 4FZJA 4DEYA 4DLPA 3BB1A 1CKEA 4I1YA 4LV5B 3GL9A 3IUBA 4IFBA 3CGWA 4FGLA 4POOA 3D6UA 3TMKA 1NZFA 2IFTA 2JRCA 2OAP1 1KJJA 5HF6A 3FOBA 3D7KA 5KNLA 3U9LA 1BN7A 2OM6A 4JEUA 4JBLA 1ESZA 3UWOA 3KR0A 5JLAA 2C92A 1PI3A 2IVFA 2O23A 4HB0A 3K8ZA 1YIAA 2FMXA 3KKNA 2KLBA 3LY5A 2VDKB 1A9QA 4YRLA 1Q57A 2FPUA 4I9NA 2G0AA 2M6SA 1CZRA 1GXSA 1XZPA 1Q22A 1W6UA 2QY9A 3ABZA 5DGXA 2G6TA 3HE3A 3QYAA 4GRAA 1XEXA 5EE5B 3RVPA 3SQLA 5IJXA 2C7VA 3M3DA 3GJZA 1YFJA 1YZKA 3PQ3A 2XCLA 3GBPA 5LZ7A 1FJXA 2A9KA 5AJYA 3I01M 3AFIA 3TXYA 1G8KA 2FX5A 1NBEA 5AUNB 5DMXA 1Z5WA 1QFYA 1SUSA 1GCGA 4M9ZA 3K9BA 3H99A 3L06A 1A77A 3V1YA 5JSZB 1QK3A 4D9MA 3F0TA 4PGHA 4PLHA 1L5ZA 4YV0A 2IOQA 5H3HA 4U7WA 1YZVA 1P0MA 4HC4A 3INYA 4X6XA 1RWVA 5AK0A 2OA0A 1T5BA 4ZC8A 4TV9B 3D4IA 3PITA 5M7EA 1NBIA 1ZJYA 1ZISA 1EMDA 1KS2A 2J9GA 3MWEA 1YQXA 2P6UA 1X86B 2ROQA 1JLKA 4I50B 4JLSA 5DRYA 1MRSA 5L4NA 2VYCA 2Z6VA 3HJTA 3RSZA 2WMDA 4B5KA 3TNYA 1HDCA 1WDLA 1NX9A 1XRLA 1ISFA 3BX1A 4FKBA 4QUKA 1XALA 3MLBA 4ZV4A 5FWXB 2HJGA 3T3NA 4TYWA 3R6LA 1I6KA 4MUAA 1OXTA 2EYUA 4R84A 1XC7A 4YREA 2EZ9A 5H0IA 4CI0B 1PVVA 2VEOA 3K9HA 3GH1A 1YL5A 2X58A 3TZHA 3TR0A 4DJFC 3HTXA 4F6CA 3KQOA 3DAGA 2IDMA 3LY9A 4KQ1A 1EVIA 1PWEA 4UNIA 5T67A 2GXAA 4ZOBA 3L8MA 3WLKX 1P8JA 4B3DA 3IXLA 2X8LA 1VKRA 4MR8A 3U16A 2WJPA 2X8JA 1NRIA 2PCJA 3CR3C 3NKFA 5KQMA 1PJ3A 4AWAA 1UPXA 3I92A 3RSLA 3GFFA 2XR1A 1S2DA 3HUDA 5ITZA 3NV7A 1CIJA 3OOYA 3WV5A 3KB2A 2HT6A 2XUFA 4N9QA 3MBOA 4BB0A 5KSWB 3R9WA 4HYEA 4RY8A 1GRCA 3RS3A 4FGJA 3G13A 5HWSA 4L5YA 3LLSA 3T38A 4DEVA 2XTMA 3QLVC 2R25B 5TVGA 4LJSA 1IEWA 4L8YA 4GD3Q 2ZK7A 4GSLA 3H86A 4LDQA 3BFKA 4UCFA 1VPWA 4RZSA 3UCFA 1LNZA 3FH0A 3PEEA 3OE7A 4ISBA 3TD2A 2ZT8A 3ISVA 2AV6A 4UUAA 1MKYA 4ZVLA 4J0KA 2GEBA 1DPFA 2E6KA 2FEOA 1EJBA 2I5PO 3H11B 2H92A 3P4UA 4S2EA 3ZR4B 4CTMA 1JJVA 2JCVA 4EGQA 1RRVA 4V03A 1HKHA 1LBEA 4GYKA 4UOEA 4UAJA 1OTXA 3A10A 1USIA 1M9NA 4HFJA 4EYQA 2UUCB 4MLZA 5IASA 1ZH6A 4Z9YA 3KYCB 4RK7A 2AWOA 4M1MA 4TKVA 1L7VC 3K0EA 2I6GA 3B1XA 1MC1A 3M3HA 1KYVA 2Q5EA 2RIPA 2Q46A 1GRQA 2WTNA 3IO5A 3LW8A 4JMLA 5CX1B 5E6RA 4C5AA 1MQAA 4OQNA 5ABPA 1JA0A 5DNUA 1W36C 1G7CA 1V7QA 1Z36A 3C1OA 2H16A 3H2ZA 4IUDS 2QDKA 4M3NA 4ZI5A 1II8B 2XDQA 1AJEA 3DEYX 4CDMA 3C0KA 1M10A 3SHFA 4KK3A 3GA0A 4M22A 3ICCA 4TMFA 1AZTA 2QE7D 5LZ4A 1UANA 1ADCA 4JZKA 3DVRX 1GNPA 3VKVA 3E1KA 2AC7A 4YQZA 3C6BA 1CS0A 3AM4A 3DA8A 4KW7A 4L27A 2RG1A 1H85A 2NV2B 2CXNA 1EESA 4F2PA 1KI9A 1TQHA 2ZI5A 4BVEA 1FJ2A 1QGDA 1PUJA 1KF0A 3AVYA 1L4HA 1L7DA 1AF4A 4W82A 4PBTA 4EFDA 1GLNA 2HX1A 1AK9A 3M89A 5ENDA 3NKLA 4U9UA 3IMGA 4CV1A 4F45A 4G0OA 1U9CA 4E5VA 5HCNA 5JASA 1UM9A 5JD5A 3JSAA 4I9HA 3GD5A 1FVXA 1MORA 3JQBC 1PO7A 1VYTA 1Z18A 1NHGA 3LL4A 4IDPA 5CBPB 1GNSA 1B8UA 2J9FA 5ALFA 3LGSA 4KCGA 2IOHA 1P6QA 1QQ7A 3KYJB 1WBDA 3SS9X 4G0NA 1XRSB 5ALMA 2CDBA 2DPYA 4WXMA 4ETMA 4DJDC 3ZWWA 3D5TA 3SHWA 1OR8A 3AGQA 5GONF 3BHJA 2Y0EA 1P4AA 2LUOA 4MW1A 3G2OA 3HC7A 1IBMB 2V03A 1YS7A 1FXWA 2A78A 2XMDA 4B33A 1VIVA 2WJ3A 4JC8A 1S2GA 1PFYA 1A95A 2NGRA 3NNNA 1LPPA 3QHAA 1VKZA 1KK3A 4IJVA 4GPBA 5K3FB 2JGJA 2Q6LA 4KG7A 2ZXFA 1ZHOA 1THMA 3ESQA 4FT2A 2E3JA 4HHEA 4JP2A 4L78A 2E4ZA 2R4QA 3O90A 1EUDB 4TMVA 4A2CA 2Y1LA 4N5LA 1H3NA 3V8RA 2FZ5A 1DKUA 2Z9BA 3UKDA 4C2BA 1RRMA 1QANA 1YZHA 1Z33A 4J75A 5IS2A 5DXFA 2NIPA 4X65B 3WTCA 2WNHA 4FNAA 1T4BA 4FKMA 3WIBA 3ZHBA 1QYCA 2P0YA 4YJGB 2P5YA 4BVJA 1N5KA 2UVDA 3JZFA 5IHXA 4YXWA 3WK6A 3ANMA 5FPQA 1L5WA 3GEDA 1JQJC 2QLFA 2BBWA 3E03A 2GK4A 5MFZA 3M8KA 1K3UB 1XFAA 3OFSA 1DG1G 3TEMA 2FTKE 1IXRC 4CTKA 1ZAYA 1G64A 5IJ0A 1NQTA 5CXQA 1DU4A 2IK8A 4U3JB 5D1HA 1I6MA 3DWFA 3GVIA 1IY0A 2XOKA 3GK3A 2FCAA 2OTCA 2QTHA 2XUZA 2ZS8A 2ZYVX 3VR6H 1MA0A 3LP6A 4TQAA 1WDWB 3CLTD 4EF5A 1Q7BA 5KCZA 2RFLA 2I66A 1E6EA 5BW8A 2ZGVA 3OQIB 3X2SA 5IJ9B 4YRGA 1OFIA 1RKVA 2OHHA 1JEJA 5DM1A 1ESMA 1C0KA 3I2KA 3T06B 5A0FA 4DB2A 4EF6A 3RUFA 3X1XA 1E3DA 4QAJA 1RXUA 1ZC4A 4MS4A 4B47A 2C4MA 3LQ4A 4PN7A 1A8UA 5KDDA 3OPYA 4EGAA 1RIFA 2OCAA 5LIRA 2B3DA 1UBNA 3OF5A 3P0EA 2VNIA 3PSHA 2CLIB 3QX9A 4UHBA 3CVYA 1MV5A 4CM5A 8ATCA 4GI2A 4AW9A 1PWHA 5IVPA 4MQ5A 4MRNA 4Y2PA 3DVQX 2E4WA 4NFYA 1L7EA 2QV7A 3DTNA 3OOHA 3FPCA 4LNHA 4YJ3F 1UAGA 3HB1A 4BJ1A 2DY1A 3MD0A 3QENA 3TM5A 3ZK9A 4H17A 1GPKA 2ZG6A 3A04A 5TIIA 3HM9A 3MTAA 4J0EA 1VI2A 2HCFA 1KZ4A 3IBYA 2FQXA 3FNGA 1YKSA 4H7IA 2QG6A 3E35A 3QEJA 1B8PA 2G25A 3BSYA 4PCVA 5TT0A 1IN1A 4UHDA 3LYAA 2ZR7A 3F6PA 1ZX1A 4BNTA 2HJHA 2Q5OA 7GPBA 2WIBA 1AMNA 1EZ1A 2J7PD 3EXG2 4DY6A 3GRCA 1WMEA 4N0DA 4TSFD 3AEKB 4LCBA 3C5VA 4RY9A 1Y3CE 1UDWA 4W5QA 3KE8A 4Z53A 1QRUA 3C3KA 4A0SA 4I4TB 1JS1X 3DZDA 1JDBC 2A7XA 4J4TA 4RD4A 3N2YA 2VHJA 3BF8A 4LQLA 4P33A 4KACA 4R1QA 1BAPA 3C15C 3WGVA 4YIKA 2ZZNA 5C80A 4E09A 5DOZA 1PNQA 1R6AA 3F7TA 3D6FA 2RJ3A 1TI7A 1XHEA 4H9GA 3MJDA 2VJQA 1RI2A 4QUBA 5CA0B 4U5QA 4WOJA 1B1AA 5JAIA 3DOIA 3ZTTA 2Z1DA 2YHSA 3OY7A 4FCCA 4R0NA 1N6HA 1NFRA 1TQ2A 4M8SA 2W6QA 4P98A 4E13A 4HV4A 1OWLA 3G02A 4I36A 3STVA 4LJLA 3VUFA 1N3LA 2XF2A 3TMAA 4A16A 4EB6A 3OE1A 2BGUA 4PQGA 3UHFA 3NS7A 3O8OA 1ZY2A 2ARKA 3PGLA 3VHXB 2LWIA 4CFYA 1U1GA 4IFTA 4C03A 1NJSA 1ZOSA 4UW9A 5KTNA 1DTWB 2P9ZA 1BGVA 3ASZA 2C5GA 2G88A 2OCKA 3W8DA 4Q7EA 5JMPA 1GCUA 2JA1A 3C3DA 2VDOB 2EFJA 3EQ9A 3NCTA 2Q7XA 1LDNA 4DCNA 1K0FA 5KYUB 3H7IA 5A4KA 3DVSX 2C5LA 3RIHA 4L3OA 3RVNA 3UB2A 5EQTA 1UKZA 2CHEA 3P2KA 4QBGB 4H2DA 3CX3A 1Q77A 4G4GA 4ND4A 3VTFA 2P3OA 3AJEA 3GRFA 5E1OA 2AN4A 4HLDA 2MINA 4WESB 5DI3A 1JQAA 1AB5A 3EF0A 3MWGA 1QF7A 4CM4B 1SWWA 1LBTA 4KOAA 2ZU6A 3TNJA 2H1RA 4W5WA 4K6MA 4LHWA 4KE8A 1Y9EA 2G6BA 3AF4A 4TTRA 5TC4A 1TFRA 1ZK2A 1SOVA 1VI5A 1YH3A 5NLLA 2IXEA 4P3PA 1UAAA 5LYJF 2A35A 1LBSA 1UJCA 2G1KA 2O3UA 4MUKA 3ZG6A 3L8FA 1NN5A 2PGXA 3IAM6 4BFXA 3KSUA 5GV7A 2WJHA 5HTOA 3UPUA 1Y1LA 1YU9A 3H1TA 3LDAA 4MV8A 5K8TA 1G8YA 4JKYA 5FPHA 1BX1A 2D5LA 3IP7A 3G3EA 3JVVA 3CSSA 3V1UA 1TKCA 1HMYA 1CX9B 4PSUA 2AXQA 1Z29A 4PGGA 3RAJA 2ZYRA 2JH9A 2QN3A 3OMXA 5TVKA 4J3NA 2QRVA 2VBFA 5DEIA 3P2OA 2ZKIA 5C8YB 2JBWA 1HRKA 2QTTA 3OD5A 1N0UA 2XT9A 3PNMA 4N0QA 1CY4A 3A4YA 3HMKA 3JZDA 5LUAA 4KLZA 4MGYR 1NJ6A 1TMOA 1ZA1A 4PXSA 2CV2A 2J6BA 2YWFA 1Z7YA 4EKEA 1XCMA 1XMJA 3L0OA 2QGZA 5B7GA 5J4LA 4NEHB 1UK8A 5FBWB 4JQSA 4Y2GA 3WNQA 4EPTA 5LNK1 2BTEA 3AR6A 4M49A 2FF7A 3ETGA 4X94A 2ZVJA 1M1NB 3PVZA 5L4SA 2EV9A 2FZKA 1CRPA 5JJLA 2J67A 3EGEA 3AF6A 1R8JA 2Q3JA 4Y0AA 4GU5A 3SR3A 4D1YA 1RI1A 3SIXA 4ZCIA 2C4TA 3GLFA 4D44A 4TWBA 4DGQA 3I62A 1E66A 2DUUA 3BL5A 3CN9A 3H8SA 3QMPA 1IDOA 2CVHA 2J3QA 2R6GA 4PSKA 4Q93A 5FL7A 4IO0A 3RRXA 4NE7A 10MHA 1U5BB 3CCFA 1XU4A 3QXGA 3EW7A 3CFYA 1TW3A 4HQLA 4QPDA 3TQIA 1PD0A 5J43A 2Y66A 1BIFA 3B9RA 3QA3E 5BYJA 4R71A 1WP4A 4ZYUA 4DRXA 1PZEA 2HPAA 3LVQE 3UJ8A 4D79A 4LJ6A 3W06A 1NF3A 1Z5OA 5TPWA 2M1ZA 5ED4A 3PWZA 2DEUA 4YH1A 3EPHA 1TTQB 1V1RA 5GIPE 4JI0B 5AVSA 3VNVA 1U0NA 4X9XA 4KB5A 4NK4A 1PD1A 4ZZIA 3E9EA 2B99A 621PA 4MRAA 2D1YA 2QUHA 4LDZA 4EPWA 1ISJA 2PFGA 5ALVA 3RARA 1FNNA 1DIGA 3V5NA 1SEPA 3H1FA 3IT2A 4M87A 5ERXA 4XCVA 2PYIA 4TT3D 4W1PA 4N8EA 4R8KA 3L8HA 5K3DA 4L2IB 3T4EA 2PTHA 4ZIRB 2C4VA 3H17A 2HW8A 1JDNA 1F4PA 1UFOA 1ADYA 2B8WA 2G9VA 3GJSA 5F3RA 3USES 3I2FA 1EXNA 2P4QA 3JD3A 1VPLA 2R87A 1ISRA 3BWVA 1NUSA 3CNHA 4ES6A 2JKZA 1AQIA 4CT5A 1EP1B 1RXCA 2GD2A 4CCWA 2DECA 1DARA 1LV8A 1SKYB 1D2GA 1O0SA 2R6FA 3E18A 3N2IA 4L28A 2OO5A 5EXTA 5JPDA 4PLTA 2HTFA 4WA8A 4JUBA 4DXHA 1C3OA 2EW2A 1QF6A 5CB0A 4ECAA 1TK9A 1JWBB 1TLTA 2C2BA 1OVGA 4E88A 5CA1A 3QM1A 3CW8X 3EFOB 4YI5A 4WINA 1QX3A 2Q3DA 3DLAA 3NEAA 3ZGYA 1JQEA 1Q7EA 4OLHA 4BIIA 5FKJA 1B4DA 2VBCA 4FLEA 1P80A 1XRNA 2I7DA 1RWKA 4U7HA 3UUFA 4BPRA 2EJWA 4JLJA 2GBIA 1ZYUA 4UZFA 4O2AB 1B0ZA 3UT0A 1USWA 2J87A 2D1QA 3EXEA 1XMVA 1WCIB 2AMVA 1PR6A 2C04A 2FMUA 2JH8A 3DMGA 3K4QA 3KHKA 5D01A 2XNSA 3RBAA 1R5NA 2H59A 1OH7A 5KWJA 4A23A 1Z0UA 4BCDA 3GLIE 3TL2A 2EG9A 5L7WA 2C2WA 3F6CA 2FW9A 2JFFA 3LNTA 2Y93A 3W5BA 4PPFA 1NI3A 2ZWMA 1BSVA 4Z7NB 2R4TA 1SUDA 3DBVO 2PUDA 2FZWA 4CM1A 3SM3A 4AN0A 4MJ3A 1QPZA 3HU2A 1JAXA 4KRGA 2GRAA 4ZHQB 1NIPA 2ECPA 1I14A 2JCXA 4M83A 5JIBA 3HWSA 4CLRA 3WJAA 3G89A 4ZANA 3QWFA 2GVZC 1ODLA 3U37A 3V97A 4DTIA 3IDOA 4XYBA 1LLUA 4MEBA 1OE0A 1C4OA 4X71A 5DLPA 2QY6A 1PNOA 4JAVC 4LECA 4P2GA 5DX1A 1JIQA 2DQ4A 3ILXA 2B4YA 1NSYA 3F5MA 3I45A 3KKPA 4M6WA 3T9FA 3QW4B 4HAIA 1A88A 1GNRA 3BIJA 3HYRA 5C34B 4F7WA 1O4VA 1RE1A 2VDPB 3O2SB 3VH3A 4CIDA 2B83A 3D8RA 3BSSA 4NNOA 1P5RA 4ZDJA 3KBOA 1SOUA 2KS6A 3WOHA 3QVWA 2RJNA 3ABRB 4LWOA 3F8TA 5AW8A 2GS9A 1HNXB 2XTNA 3OURA 1CUEA 1U9ZA 3ZKWB 3EVNA 3W2GA 3OEYA 3WWYA 5P21A 2HQRA 2J31A 5JD6A 3UJNA 3FPGA 2YV4A 4HEA1 4MUYA 4WK6A 4EHLA 2XGJA 1BKYA 3EJWA 4GEGA 2XV1A 1JKFA 1PFQA 1AC5A 4V0MA 4TZ0A 3U39A 1OZHA 1KRXA 1GAQA 2C8VA 4KI7A 4DSAA 3FI0A 5JCOA 2FR0A 5IKMA 4J1TC 3C3XA 5E9WA 3WGNA 4AY2A 1F3LA 2B34A 3DQQA 3L8GA 4JNCA 3OCVA 4CCAA 3CE6A 1EUQA 1RQRA 4GI7A 3HVHA 3A3PA 4FDLA 4LTDA 3RFXA 2XCRB 4EYEA 3GU3A 3BWBA 5F12A 1QH8B 3G88A 3FHLA 2XUKA 4GMGA 2YV2A 1CD5A 1TKBA 4JASB 4CKBA 5KUTA 5EIAA 1ZRMA 4RNCA 3CPHA 4TLCA 1W5FA 2BSQA 2QSYA 3LFHA 2C99A 2FSVC 2IUUA 3KLNA 2WVHA 3LK6A 4CTJA 4WZAA 5C81A 3CNLA 4P4GA 3CT6A 3HL0A 3MRXA 2QVGA 1Q20A 1EA7A 2O0KA 3SYLA 1KMMA 3TTTA 4F0JA 1W9MA 2O07A 2BTQB 1Y7TA 3RIYA 5JNSA 4AG6A 1K08A 1UIRA 1M2OA 2PUJA 3IJEB 3M6AA 5F7JA 2B5VA 2PLAA 3K35A 4K26A 3K6KA 4ZQCB 1S1MA 4X63A 1G7SA 5GGXA 4M1SA 2FMIA 3H8JA 4C7KA 4BKUA 5AM4A 3FUXA 2D1RA 2AG8A 4MEJA 1H1LA 2ATCA 8LDHA 1FMFA 5F9MA 1KMHA 5LM3A 3AVVA 3NH9A 3ZNOA 5CDFA 3FOFC 1GUFA 1PT5A 3D02A 3QI7A 4IWNA 2UYGA 3IFSA 3HDHA 3OLWA 2HXGA 1BS2A 4AJ9A 2N42A 1VPTA 2H5LA 1DG9A 2OKGA 5AKHA 2A0WA 3SJUA 2J5QA 2ZB2A 3JZMA 2BH9A 1I3KA 1DAKA 2EFEB 3WIEA 1Z4KA 1QB8A 2QS9A 1JDVA 3G9QA 5F76A 2DAPA 1ZJZA 3GG9A 3ONDA 4GX5A 4Q9KA 5DIFA 1CJBA 1NUQA 2ERCA 2ZBGA 1EFRD 1PZMA 1TRKA 2IYAA 1R8QA 3QUBA 4IDNA 3T9AA 2OORA 3AEXA 1AOXA 3W7VA 4NK5A 4RGVA 2OESA 1VE3A 4L5JA 3RADC 2AN3A 5DT2A 3LH5A 4YJFA 3PQFA 4KWCA 5FLYA 2ZPAA 2X9NA 3HJBA 4DY4A 4RTQA 4P4SA 1AX9A 3NVMB 1Z6YA 4PRKA 4JUIA 5CJ2A 3W6OA 1STOA 4YYZA 1P1JA 1FF9A 3DTVA 4GAEA 1K5HA 3V2HA 1N9GB 2CB0A 3R9KA 3TAXA 2WFAA 3TQFA 1RAEA 3QEMA 2WTAA 2HGZA 5KOJA 2BBOA 4HZGA 3UPTA 3PXBA 2Z2IA 5AXCA 5BSRA 2Q3CA 4XIJA 5IAGA 1E89A 5JDCC 1FUYB 1RYBA 3CZ9A 5LQDA 3NZEA 1XVAA 4ENPA 4LQCA 8AT1A 1RJ9B 1NKSA 2BN4A 2H2DA 3E9DA 1D4FA 2QMZA 4XW2A 1A7UA 3G1UA 5HMLA 1NW6A 4B87A 5KX5A 4RTMA 4OG2A 1BROA 1YGPA 2AMYA 1C14A 1SNYA 5DMHA 4H08A 16PKA 1N6NA 1X0XA 1QHIA 4EM6A 4LXTA 1TZ2A 1VBKA 4G5QA 4IBOA 3INTA 4O4IB 2ADOA 3BL6A 2DF8A 3FCAA 4J43A 4KIUA 3VPHA 1YRQA 1RZUA 3MPOA 6ADHA 3KHSA 2B4AA 2ODQA 5D3ZA 1ZD8A 4N7JA 3ROGA 2H1HA 2ZI3A 2LCIA 5LU9A 4OLFA 3PVSA 2CKDA 3M4YA 1IIRA 2RHHA 2AFHA 5EMLA 3NHFA 5CB4B 3BCRA 1E6WA 1T6YA 1I4OA 4OAQA 4WCFA 3RAFC 1HZZC 1GGJA 2FPPB 2FRDC 2XOXA 2G9ZA 3EMVA 3JYQA 5DYGA 4HPXB 3IB6A 1YQTA 2QTWB 1E4EB 3HJCA 4FPXA 3VKFA 1CK4A 5A3QA 3GOHA 1IHOA 2C07A 3K09A 1NXVA 2F8TA 1DAGA 3L7IA 1L5RA 3MLEA 5ICFA 3LHKA 3EXHB 1ZXXA 3OJEA 5EN4A 4FFLA 2WKWA 3WYBA 3E53A 1GL6A 3BHMA 2FSHA 4DQ0A 3DQZA 3P9KA 3U6KA 2AXPA 2OHXA 2IVZA 2X9LA 3HNRA 3UENA 5CBKA 5ECDA 2XMZA 4Q7KA 3GCZA 4EI2A 4RJTA 2PL5A 1CEQA 2F55A 1IVYA 1ULAA 2DT5A 2GXQA 5EZYB 3IELA 1E7MA 2JFQA 4OK5A 4RCVA 2R6HA 5ER9A 5BSGA 3PVCA 5FR2A 1BXRA 3GO4A 2I7CA 4MKGA 1EFVB 1ULUA 4AJEA 2YFHA 2O1SA 2HQSA 2MIIA 5EMMA 3U60B 3B2EA 4NX2A 5EIXA 1FJHA 2P62A 3N53A 2VOEA 3UICA 4B8ZA 4A2QA 3L0IB 4PCUA 3TJRA 2G9QA 1RD4A 1TVMA 2I55A 2FH5B 4M1YA 3F6RA 2QVCA 4XDGA 3N2LA 4C2AA 1F0YA 3KB6A 5EEGA 1TGYA 2JFPA 2YTZA 1RI3A 3NUZA 4HYYA 4OQXA 3L4JA 2P67A 1R15A 3S0JA 3AJRA 3DF9A 2WW8A 4HPWA 4QT4A 4IPTA 5HE8A 1TE2A 4QLBA 1RYFA 2HRBA 2HJ9A 2CLSA 2Q8QA 3EOBI 4QYIA 2BVNA 3GPBA 4U7TB 5B1IA 5HZKA 4KIWA 1XVIA 3QUQA 5CH5A 2WQ6A 2J9ZB 3CZAA 1R74A 2HSJA 2XYQA 3BGOS 1AG9A 3LYUA 4QO7A 4C7MA 4QQNA 5CDUA 5FFNA 1JB9A 4FEEA 1MOZA 2AHRA 3DOEA 1R9NA 2DBYA 3N8IA 4RFVA 3KT0A 3AHIA 1G2IA 1AURA 1S4MA 2PZBA 5L3SB 3LZ6A 2FPRA 4E21A 4IVRA 4PR0A 1UXKA 1QR6A 1H6AA 5BT8A 2Q9AA 2BD0A 3A6PC 3MUNA 1CY6A 3MXOA 5CG1A 3UV7A 2IV3A 1VZ2A 2VSFA 5EXPA 3S7ZA 4QXRA 2L18A 4P4TA 4TLEA 4MLCA 1BEEA 5JHHB 1CDDA 4ZARA 2QV0A 1Q16A 4ZTBA 4D6XA 3JD1A 1LY1A 2V9CA 2WD8A 4PFSA 2F4NA 3O9ZA 1T9HA 1EA5A 3BORA 4F6RA 1JJIA 5BSTA 1I7QB 1IZ0A 4I2NA 1UODA 2YS6A 3H0KA 4BPBA 4XOIA 3VV2A 5EHNA 2CCGA 1ZMRA 3DVAB 1N3IA 2B7CA 4U7FA 4WADA 5HUJA 1CDZA 3JVIA 2YIVX 3TR5A 4RA9A 3EZXA 3V2IA 1QV9A 5I7VA 1E6UA 2VS1A 5AOCA 4PTZA 4LV8B 1SPBS 2FEKA 3QIAA 4HAYA 5K3CA 1FX0B 1IC6A 1YCDA 3Q2OA 2VK4A 1FS6A 1GHTA 1H8HA 1WRBA 2H07A 2RBEA 4L74A 3RTEA 4BWVA 2ZIFA 3BJEA 5BN4A 3SF8A 4XR4A 2R6CA 3L4BA 1XQ6A 1R3DA 1RI5A 3PA8A 5KVAA 4HH3C 4LOJA 4AYXA 3LK7A 4EO9A 3O75A 4XVHA 3NONA 5KAMA 1A72A 3RUCA 4DWVA 2ZJYA 3DKRA 2QTRA 2EL7A 2VTVA 3TOZA 2OFOA 1I2AA 4OIFA 3LLVA 3VSBA 1VSQA 4QODA 1C4KA 1E1KA 1Y4AE 1JAIA 1M5UA 2QRPA 3LGAA 4FSHA 5CXUA 3OUTA 5FUMA 3QVGB 3S2FA 2C9ZA 1NP7A 5CJPA 5ENZA 3QG5A 3WTBA 3KAKA 1PT8A 3L04A 3VDQA 1P3Y1 4JN6B 5FLEX 4DYVA 1JHZA 3IQHX 4KXWA 1T8RA 3OCXA 4CU2A 1ZS9A 5GPBA 2IS4A 1E1CA 2BKEA 2JJ2A 3DV0B 3TNFA 2RAFA 1CW2B 1QO7A 4CTOA 1N8KA 4K6CA 4Z1MA 3IUNA 4RV4A 3HZRA 5KNDH 3B82A 4Y0NA 2LDBA 4YRDA 1FSGA 4GG1A 5C4IA 2H1CA 2BCGY 4OATA 1TCBA 3EBOA 4CKCB 1C3EA 1J20A 1SUWA 1OZAA 4OFXA 3SX0A 4UU0A 5MF6A 3EXG1 4M7OA 4N8SA 5AKLA 3GMSA 1V5IA 4RIEA 3V7FA 1LVHA 3PRYA 1HQCA 1BVYF 2IUSA 3H4VA 3VV3A 2B1GA 3LIPA 3K6SB 3EXFB 3R0QA 1FFEA 2IBMA 3SHTA 2FEMA 1RWMA 3M9WA 5FOWA 1WB4A 1LWOA 4XWKA 3R3ZA 5C1IA 1USUA 2ZE6A 3F7MA 3ZQ4A 3T7RA 4HH4A 4UPVA 4BB6A 1L7RA 1ZVJA 5F2NA 4IR7A 4ZAXA 1P19A 5JFTA 2K5UA 3GRPA 4X90A 2MCFA 1YBAA 1ZM3A 1HBJA 1P72A 5EQFA 2OFXA 4YJHA 2JLZA 4HS4A 2QM0A 4B0OA 4KEAA 4BNVA 1UK6A 3T34A 1LQTA 2YC2C 1ZU5A 1Y4UA 1E4VA 3ENQA 2ZDQA 3OZSA 4DR4B 4MVJD 3TUZC 3DNPA 3K0AA 4MZDA 2AT1A 3CLHA 3TQOA 1H9AA 1ZWLA 4I5FA 2WWXA 1GAWA 2BFBA 2G1AA 4N3AA 4R1TA 2JVIA 3G17A 2SKCA 4KO4S 4G0YA 4BJHB 4YHHB 5CGQB 3CZQA 1WA5A 2VN8A 3IXQA 3QTTA 3EIWA 1R5OA 3MTDA 1Y98A 2JIOA 3HV2A 4Y2RA 3Q4GA 2WWFA 1K4YA 3LC2O 1I1NA 4O4JF 4RKQA 4PQFA 1EFLA 4IYJA 4UBOA 1WBBA 1KETA 5DN6D 2ZRLA 1Y4ZA 1Z38A 3DB1A 3AY0A 3L0ZA 2Y1CA 4P58A 4Q12A 1EXWA 1OBFO 4CM9D 3R7NA 3JQQA 3MOIA 4NDAA 1OAOC 3NJRA 3MWDB 3AJ9A 3WX0A 4HBZA 4OH7A 4KXNA 4EATA 3Q7QA 4R7ZA 3WB2A 3URKA 3R8XA 3N8GA 2QYSA 1NASA 2D7JA 5E0OA 3V4OA 1ESEA 4YEDA 2FUEA 3D4LA 4MVYA 8GPBA 1CQZA 3VJMA 1EWTA 4DDKA 5K6TA 3JD2A 1T0HB 1NF2A 2WIJA 2BFMA 1DPGA 5EJFA 1ZMXA 4AJPA 3RRZA 3GDFA 3QSYA 1HFKA 4W5OA 3EX7C 2VHUA 2JC3A 5F9FA 4EY8A 3SSMA 3F2IA 3CJRA 4DRYA 2RHTA 2YZGA 1CNFA 2UUOA 2NU8A 1GZSA 4BVGA 4ZJZA 1IATA 1XNRB 1PR9A 3PFHA 3O4JA 3HUFA 2IZ7A 3T9EA 2BM0A 4LVNA 3BZUA 5KNBD 3GMTA 4W7HA 3OLXA 5IFKA 1L7OA 2XNHA 5C8VA 1HL7A 4HATA 3FZNA 4IIJA 1G21B 3NTXA 2YCBA 3KPJA 5B30A 2C3UA 3FJ1A 3RYFA 2AEFA 4GFDA 2EYQA 3DBIA 2W71A 2D0OB 5DLEA 1HQKA 3K8YA 2RBGA 4FDMA 2PD3A 2BR3A 3HVJA 2O8FB 1WUKS 2GN6A 2XYPA 4BVFA 3VQTA 1P75A 1C3VA 2D8AA 5AYVA 3R76A 1WSAA 3UAZA 3H2HA 3ZZTA 5JXHA 4AJ2A 1NQAO 2C84A 3AW9A 3AU8A 5JTUA 1AHHA 2OSBA 4W7IA 5HYVA 3ONVA 2CHFA 1B7GO 3UA3A 1V11A 1ZIYA 3IR5A 2FRDA 4AF8A 2NYRA 2QT0A 3AHCA 2GAJA 2XD9A 3EVFA 5I8ZA 1N0IA 2OC4A 3N2ZB 5ANRB 4EJMA 4H3VA 1DIHA 1NSTA 4IX1A 4RD1A 5DYNA 3KLBA 1PSZA 2YJZA 2WU0A 1QNFA 2HMWA 4JJKA 3OEWA 1IUNA 4WX2B 4E51A 4EGCB 5T4FA 1ZUD1 4NL4H 5EA2A 4EYGA 5HP4A 3LRTA 4ZCMA 1R4NB 4QXMA 4EARA 2A3RA 1XTRA 1U7PA 3HXOA 1YO6A 4DN6A 4GC9A 1ZOOA 4LRQA 4GX1A 1CCWA 5IU6A 1D2NA 3D1LA 2CXOA 3BFPA 1NAHA 1QE5A 4MDYA 1ECPA 1ZL2A 2CVPA 5MN6A 4UM5A 5JECA 2G0NA 4PNHA 4HDRB 3TQTA 2O8CA 2I2WA 2C61A 3ETEA 1LDBA 2RH8A 1CY8A 1QO0D 5ECWA 3QYPA 2ZIVB 1M0SA 2HMVA 5IRCD 1VE7A 4MHTA 2AC4A 1YDFA 4NMHA 1W85A 3KLOA 3QKRB 2Y1GA 4HDQB 4KTVE 4WFKA 4GX0A 3T8YA 4C0XA 4OI1A 1QG4A 3A2LA 4HAZA 3T7CA 5ADVA 1J9ZA 4XQ9A 1BJKA 3QYFA 3BQMB 4Q9LA 3H04A 3LLMA 2HHAA 2ZRMA 1I24A 1NTRA 1W87A 4L0CA 5HHTA 3ZQUA 3OJLA 3FFAA 1VP9A 2A5FA 3W90A 1ZVVA 1T9BA 5TQ2A 4UEJA 2VF5X 3PR3A 2C5AA 1VXOA 4FOLA 5G1NA 3SZLA 4YR9A 5LJLA 3C45A 4YAGA 1DE0A 1WKCA 3BHNA 1T5TA 1ZNXA 2PH5A 3I28A 5KKAA 1KE1A 2QVBA 1VPVA 1Z2AA 2OBFA 4CM6A 3EQ8A 3MAAC 4CDRA 4GRIA 3ODGA 4MVJF 3OM0A 4LISA 1PDOA 2L19A 1W1IA 1RLIA 3Q3VA 4YBZA 3UUGA 1EFKA 3M6WA 4TVBA 4C0WA 3QGMA 2OOKA 1KAQA 3A9RA 2ZYAA 3V48A 5EWLB 1KPGA 4DMFA 1LBIA 3WWZA 3W34A 4NCIA 1BQ4A 1E9AA 2NU7A 3LKVA 1M2GA 1JPJA 1O08A 1R0XA 2NV0A 4FFMA 3RVRA 2I3BA 2ICAA 3FPBA 3SZMA 4D9NA 1DAPA 1USGA 3E58A 3F74A 3T52A 3B5IA 2BFFA 4LOKA 2JLXA 3AUAA 3E22A 2HQBA 3QWHA 3ZHZA 4LF5B 2VP5A 3CRNA 1IXZA 3PDIA 3RWBA 1DWOA 2XBLA 4F06A 1J0EA 3I6IA 3L9WA 3B9QA 3AP1A 2AKEA 5I7SA 5HFAA 4C9BA 3MWYW 5LA6F 4GBED 2CZGA 3B1JA 1E2NA 4NZZA 1RLJA 1YOVA 3AVTA 1Z8FA 1Q0SA 3R0VA 1D1TA 4LOIA 3EMDA 1W4CA 2PRIA 4WMLA 2XMRA 5DB4A 1Q0ZA 1MPTA 4E5KA 1K4KA 3UHPA 2ZSEA 1X9GA 4JLUA 2HMUA 2XXAB 2ZQZA 4PQRA 4LJAA 4RDCA 4TYYA 3R24A 2H1SA 1L5FA 2BFDB 3EVZA 1XMSA 3FYDA 4HNRA 4TXNA 3RQSA 4IGFA 4V0LA 3R3HA 4ABYA 1PZFA 5MHTA 2XVZA 4N5MA 4PC6A 1EB9A 5E7IA 5IHPA 2ERXA 4HNGA 3D4PA 1VCHA 1ZRNA 3EVAA 1OREA 1R9MA 3L7CA 4C88A 2O5CA 3DCYA 2OD9A 3PIIA 4CXMA 2CMDA 4ZEMA 4ZI7B 3STUA 3EEIA 2C57A 1JLRA 4YLGA 1LTQA 3MMNA 5ICEA 2XCSB 2RHMA 2GF2A 3U4CA 4JI5B 3CX7A 4YMVA 5J2UA 1I2CA 1TUEA 4DT1A 3LCJA 3JQFA 5TLSA 2BI4A 3BB3A 3P52A 2D2EA 1SB8A 1ECLA 2E89A 1I4LD 2VDWA 4EDFA 4UUQA 4D25A 5I9BA 1MFPA 3KYIB 2F48A 5FNVA 5EIEA 1H22A 4QDUA 4JLNA 3ZE7A 5JZSA 5B36A 5BUCA 2G06A 3MRSA 4TYMA 3NJ4A 4NH0A 1ZN8A 4IDBA 2FOLA 3BJIC 4TQ9A 5ICGA 4ZZ3A 3F96A 1UP4A 2HF8A 3GP3A 4RKRA 5EYPB 2QZ9A 4TL8A 4MUXA 2HU2A 1WVMA 4EGFA 1BNCA 1C9KA 1E98A 3OT1A 4EO7A 1SM4A 5HILA 3K73O 3NCHA 1RKBA 4XM0A 5AJHA 4IL5A 1LSSA 1WSWA 1ZRSA 3GLTA 4RQAA 3BAFA 4LY3A 1F17A 3WBKA 2KLHA 4DBLC 5HZHA 9ATCA 2I6UA 1G291 2QK4A 2W4IA 1PJSA 3D6AA 1NP6A 2V4UA 4UUPA 1PEDA 3W0LB 5CCXA 1TU3A 5A6VA 2VAVA 1SCBA 3N2KB 3MJEA 2CEKA 4PHFA 2EKPA 3DZCA 3C3BA 3JRXA 1B2LA 4I3HA 4QU0A 2PXHA 2ZJ8A 1CZKA 3VC2A 2D5IA 1KDZA 3O3NB 1RJFA 1OGYA 4MWCA 4ZEWA 4IIDA 3KOXA 2DOKA 2W37A 4LKOA 1RMTA 3WZ2A 1Z75A 3H5WA 3WO1A 3S1SA 2L82A 2E48A 1N2JA 1OBCA 2G09A 2ZSHA 1UZLA 2VTEA 3FNEA 3NOVA 4FZ3A 3ZE1B 3TSZA 4LZLA 1YI1A 4AZ0A 5AIBA 3O31A 1DJNA 1VXRA 3T7DA 1PNTA 3PPXA 1CTQA 3THWB 3IMKA 5BXYA 2CCKA 1ZMBA 3AINA 4LRTB 4MWEA 4KDRA 3TPZA 2HHHB 5A5DA 2XT6A 4FZ5A 3JASA 1EEXB 2ZREA 4L4RA 5B3LA 2X40A 1M2VB 4AKIA 4RSMA 1MO2A 3TTSA 1HF3A 4TQGA 1KAEA 5EXSA 3RODA 2FMHA 3IILA 4MV3A 4PFJA 4PHCA 1QLJA 2RDMA 1KRWA 1COWD 4W1SA 2VSQA 1KYXA 1NVAA 4ZGWA 2QL9A 3IAM1 4V39A 2WU3A 1J90A 1OYVA 4KMOA 1WU7A 1ZH8A 3KALA 5LDHA 1P5ZB 5DHTA 4DDTA 1F4LA 4P82A 3SI7A 3ZU3A 5F33A 4EW1A 4ENVA 1NVTA 4ENSA 3CWCA 3A0RB 3CV3A 3CU5A 3AKYA 3D6TB 4MAMA 2CSXA 2WYHA 1A9RA 2BJWA 4JY7A 1Q0TA 1JJAA 3KO8A 1R0YA 2Z3ZA 2CFIA 3HDJA 1Y8CA 3U3MA 2IW3A 4PLVA 3SS7X 4I6EA 3DXZA 3PHJA 3IL2A 1GTZA 3PJEA 4XUCA 3GAMA 4HH0A 5EJ4A 3OPQA 3GLGA 4OUKX 3TW8A 3GLFE 2RK3A 2OCGA 2JAOA 3N9IA 2PSJA 5GINE 1LJUA 1B0AA 1RC0A 1CETA 5BQXA 4RD3A 3ZHUA 2WM8A 3L0SA 1PV1A 1ZI8A 1PNRA 2H2WA 3LA6A 4AROA 4QXPA 3R4CA 1W96A 1J0XO 2BZ1A 3IP8A 4PQEA 5EIOA 5AXAA 4P4LA 3SOZA 4Z49A 1K88A 2XYHA 3K1AA 4L16A 4XGIA 1MO6A 1YUBA 2XAAA 1SKUA 3IMEA 3Q41A 4ERNA 1Z4PX 1QGUB 1T15A 4D3FA 3U6BA 5A0VA 3VYWA 1OLUA 4GR5A 2X8BA 3RSHA 4BC1A 3A70A 1KO7A 2IP1A 2Q41A 1GQ2A 4E4RA 5BW4A 1DJQA 1JFRA 1Z0ZA 2QEQA 2WU1A 3FJYA 4GOND 4J0GA 3T61A 4XYEA 1ZJ4A 1OUMA 2H48A 2QAGC 1CWUA 3S55A 1G59A 5HRUA 3IC5A 1ZQ9A 1M1YA 3AIKA 4RFSA 2NG1A 3GP5A 1DTSA 1NY6A 3RS4A 3BD9A 4Q4DA 4OYHA 2XRZA 1Z5GA 4KQEA 2EX4A 3AOEC 1UKVY 4X44A 3K71B 3GXOA 1E94E 3TTXA 3G82C 3NAQA 1Z63A 2YMLA 3ZHQA 2V7XA 4X54A 2WFLA 2WM9B 3KOYA 4QXQA 4R2WA 4EAAA 4WNCA 5J40A 2QJTA 2VDRB 1EUCB 2W83A 4L7QA 1CY1A 5JANA 2GFQA 2IPLA 5C51B 2J5RA 4BRWA 4TV9F 1BHQ1 2UYYA 3PWTA 1T1RA 5EKTA 2FN8A 2PANA 3PGA1 1C7QA 1OWNA 4G01B 4GPTA 3BOSA 2IYZA 3DE1X 4MR7B 4FYKA 4RAQA 1XK7A 1Y6QA 5JS8A 1TZBA 4LF9B 4RD0A 2E49A 4BHTA 1HWYA 2WHYA 3TLBA 3WYCA 1B15A 2H7VA 1G17A 3C3YA 3VSAA 1FUUA 1SUPA 2W7TA 2OGWA 3C5WP 3PK0A 2I76A 4K5QA 2WUGA 1GYRA 4PONA 2EKQA 3F4BA 2Y9MB 1PZXA 2JJYA 5LMZA 2BEKA 4U39A 1JG1A 3B6MA 4YRMA 1H42A 3G8CA 3HMQA 1DX9A 4RZQA 1KMQA 1Y5NA 5CYFA 3GPLA 3LRPA 3SBXA 1P0CA 2QQEA 3TDMA 3VSDA 5FPTA 2NNWB 1U04A 4QATA 1HC7A 2AZ4A 1NQVA 1GUYA 2QI9C 2BHSA 4GYJA 2I99A 1K6MA 4L0QA 4L76A 2XITA 2H08A 3PC3A 5L7TA 1O9HA 5KINB 1VJ5A 3VZBA 1CSEE 3IV7A 1KOJA 4U02A 2PGNA 4B4VA 5F7ZA 3UMFA 5F98A 5AD1A 4OY3A 4Q1FA 1FB5A 4URYR 3K1TA 1DC7A 3DDHA 1GL9B 1OJLA 2K2QB 3P4XA 2GJSA 3OAAA 3RC2A 3T5AA 1U98A 1NP3A 3J81A 1YC5A 1UWVA 3DDCA 3ZE2B 4KE6A 4WI1A 1I3LA 1JDUA 5KREA 3AY7A 4P84A 2HRQA 1G8MA 2QYTA 3S8MA 3GZNA 4KODA 1P7PA 2X2EA 2ALJA 1CLUA 2VKTA 1T3LA 1N0VC 5EIBC 5JCPA 1T0IA 4BJ3A 1L5NA 5GGYA 3IOYA 4ERXA 4AFNA 4BWYA 1XTZA 1U7DA 3OPXA 2CMGA 1RQNA 3N07A 4YMWA 1IU9A 3QWIA 4UNPA 1QCYA 2G4LA 2R47A 1W2GA 2H4HA 2XZDA 3CJTA 4PE5B 3D31A 2FZCA 3OWOA 3UC9A 3IPXA 1JHOA 4INJA 1QMPA 1MB3A 3G0BA 1X7WB 4Q00A 3ZWBA 1FNMA 1SMKA 2WQZA 3HKCB 5B12A 1P0PA 3A3KA 2YH2A 3ILSA 4JGIA 5DYYA 5CEJA 1HFEL 4JYBA 3MJRA 3HBAA 2PAFA 3JD4A 4M88A 2NVUB 4JJEA 2F1OA 3PB3A 2Z2JA 1TM5E 1DC6A 3OLCX 2GGSA 2VWQA 4W1RA 4F5ZA 3L7MA 3NVKI 1C9NA 1R10A 4B2PA 3UV6A 3N2GB 4EL5A 4RK1A 3WMGA 5F35A 4NZMA 1OFVA 1XZIA 1CPYA 2WG2A 3VTZA 3WGKA 3IE1A 1FFYA 2GR9A 4RGYA 4DMGA 3U7HB 3AJDA 4Q3BA 4E5UA 2AR9A 4F2DA 3R3UA 4V0ME 3CUUA 3MA0A 2BHRA 5BPHA 2AFVA 3RYHA 3OP4A 4I6GA 2FJUA 1IY1A 2WK1A 3D3WA 3P96A 3E23A 4E03A 5C7LO 2OBLA 3DZ8A 1IMOA 1OXVA 3LPNA 1OU0A 3E7WA 1GPAA 1R8XA 4KQ9A 3A14A 1IULA 3KS9A 1JDSA 2CDCA 3EVDA 1OH5A 4W8GA 1PJTA 1ZICA 5K4GA 4D7AA 2BV3A 4H16A 1R4MA 1ZDMA 4LDAA 1IDN1 3DOJA 2BMEA 4I1OA 5HIMA 4WRRA 1GGEA 1B14A 1E0SA 5B37A 1AKUA 1RMQA 2BGJA 2VATA 5F73A 2BONA 3HKBA 1GVNB 4HYQA 5JSYA 1HE1C 2I33A 2QRLA 3C1AA 3EYAA 1NVBA 1BG6A 2M1XA 1DV1A 1UPAA 4BGUA 2ZB7A 4CLEA 1CNEA 3WYNA 4PYKA 4E2XA 4B3SB 1SIOA 3BMXA 1RXEA 5DXJA 2X5NA 5AOBA 3J81k 3U4MA 2ZSFA 3W1VA 4ZJYA 5B1YA 1U0BB 5CNJA 4MUNA 5FPSA 1DEXA 1RW4A 1T1SA 3Q2IA 2C8LA 4WEQA 4DADA 4ZYZA 5IUJC 2H18A 1ZW6A 4XRRA 1QKIA 2HYIC 4TLLB 1E18A 3BICA 3KOWA 4FNGA 4NYJR 4KVFA 1ZITA 2IIPA 3C7CB 3FVQA 4LF6B 1CF4A 4OREX 1JDPA 1M72A 3V42A 1T8SA 1IN7A 4XEHA 3V33A 5JRDS 1MT3A 1U8TA 3JATA 4EITA 3G5TA 4G5FA 5CW1A 1G20B 5CDFE 2E4UA 1V5WA 3ZCPA 4AWBA 2VNHA 1N7IA 2R68A 3ZDRA 1ZXBA 5CVDA 3CNBA 3I8OA 3U3JA 3G68A 4KQJA 4EH1A 3G8DA 5AESA 3AUYA 1ECGA 5DI9A 2GAOA 4A4DA 2Z56A 3ZUGA 2YWHA 1PL8A 3IQIX 3NHRA 4PWZA 4LC9A 3C4JA 3L3BA 1E2FA 2HADA 3IBTA 3H5OA 4LDJA 5BQ5A 3KU4A 3S2GA 2O59A 1A4XA 3OIFA 1ZK1A 4M89A 1U6IA 4V1CI 1OFUX 3CRMA 2PGDA 4UPDA 5AP9A 3IEVA 2GPBA 4BNNA 2WIKA 3K9QO 4KFRA 1A2BA 4MW2A 1YD7A 3IP5A 3X1JA 4EY3A 5FT9A 1K9VF 2X13A 5CXXA 3B7GA 4E5PA 4DREA 1FCJA 1MB4A 4ZZ0A 2EGGA 2DR2A 1I1QB 1N33B 5J58A 1GU1A 4GM4A 4RMNA 1GGMA 4H1VA 1ORIA 4HP8A 2Y27A 5EINA 1KIMA 1X80B 3QX7A 2ORVA 3SE7A 3VO2A 2IH5A 3EZ6A 5IAOA 5B6PA 3OZUA 3SXPA 3FUVA 3JALB 2VHCA 3L77A 2PMBA 1YS4A 2CXQA 3Q9UA 4IHJA 2ZB4A 5KWVA 1E1QA 1A4UA 1SVWA 1REQB 4QWWA 3H6GA 1EQUA 3U7JA 5JVDA 4RLHA 3EWSA 1SULA 3P8ZA 2ZXEA 3R3XA 3K9CA 1X8KA 2PZ8A 2VHTA 3I3OA 4IWYA 1YZTA 4JROA 4Q1VA 3NO4A 1J25A 2DQYA 1KHTA 3AXSA 5D7NA 1AZWA 4LOAA 5B4UA 1ZGHA 3LO5A 2PX2A 4KN6A 4BQQA 3KZVA 2ZSJA 2DR0A 1Y3IA 3H18A 2VHEA 3QIVA 3DPSA 1UT6A 3VC1A 2R96A 1NM5C 4LWZA 4LFBB 1J70A 3NHPA 3DE7X 4K2HA 3W3AD 2H5EA 2BEWB 3D2LA 1SC1A 4XD7D 5T3YA 4DJJA 2RBKA 2CZCA 1QHSA 5LPNA 3GUHA 3AEUB 5HJ5A 1TQ4A 3RGWS 2ZSDA 2W6MA 3CLRD 1G6OA 5E1MA 5F1OA 4RMHA 2V74B 2GZ3A 3K5WA 1E63A 1GRVA 3U4AA 1VA4A 1FFGA 1G3RA 4ZVKA 3R41A 4PQYA 1NVEA 3K6JA 2AN1A 1L5HB 2FV8A 2OMKA 1YR7A 2ZETA 3WL5A 3RV3A 4LRSB 3T3EA 4MGKR 1JJBA 2BFCB 3AETB 5JJKA 1NNEA 2Z5LA 2ZAIA 1W35A 2HA7A 3EWIA 2IEYA 3BTOA 3TJZA 1G7RA 1UKYA 2RC5A 6CHYA 5HJ2A 1V95A 2GHTA 3AEZA 3ESYA 5AUQA 3HPQA 2Z6UA 1SQ5A 3ZIAA 1U80A 3TH5A 1KY2A 4E2FA 4I4TF 3R7WB 4NMXB 4PFQA 2JFXA 2WJZB 1U3VA 1NFQA 1T3SA 1WBJB 2E5FA 4RK4A 2BH2A 1WUHS 5BSUA 2VYVA 3I1JA 4UASA 5ALRA 4EFLA 3C1TA 4EB3A 1IB0A 3DLCA 1F6DA 3SC2B 1V3QE 2DWPA 3FRJA 4B76A 5C4MA 5CA0F 2PUHA 1JEDA 4XH9B 1Y6GA 3ZHXA 5TDHA 2HJSA 3ZGXA 1UUFA 2JIDA 2WMNB 2XYVA 3AF3A 3OVMA 3WQBA 2PWPA 1ONBA 1KPIA 5EWJB 4AWXA 3JRNA 3F5QA 1ORWA 5ITWA 2WTEA 4BU1A 3EXAA 3P0RA 3PZRA 3CF4A 3GR6A 4YLEA 1W4BA 3EGVA 1TAHA 3HL4A 3MCAA 4LY0A 1JJFA 3RUPA 5CP8A 4CL3A 3KJIA 1Q1BA 2XNJA 3NORA 2X0EA 1BA2A 4PNEA 3WZMA 1IY2A 5L4LA 2V3WA 4HWTA 2ZCUA 5F1KA 5IDVA 2QTFA 4DLBA 1T6XA 4UHJA 1QRRA 4Y18A 5DO9A 4DNFA 5CYGA 4PCAA 821PA 1WOYA 4B6QA 4Q7LA 2FMFA 3ZDAA 2GVNA 4QLAA 3G8AA 2ZB3A 4L5BA 4OLAA 2NN3C 3FY4A 4EEKA 2ZUDA 3EIFA 5FXMA 1JEAA 3IX7A 3CIOA 1HX7A 2ACEA 4B2LA 3KKQA 1NN1A 3P9SA 4IIFA 3V8EA 2Q5LA 3NHMA 2X4GA 1K6XA 1KYQA 1M75A 1Z12A 2C29D 1DIRA 4W6ZA 4DR3B 5JYCA 5C2JB 4BLUA 1E3EA 3FNQA 1LJLA 4R2HA 5AHOA 1L5QA 4XUGB 3B78A 2EZ4A 4HMOA 4Q1CA 3RRBA 3TW0A 3W8RA 1R6XA 4M9CA 1YULA 3EDQA 2O50A 5HS6A 2GEVA 4NJMA 4L4SA 3VU9A 2O2XA 4RIGA 2YW2A 4KBYA 5I9NA 1HE2A 2IXGA 2DYKA 3WO0A 4D74A 4J3JA 1JLLA 2FJ0A 2GFIA 4UHEA 3K9GA 3DOOA 4N65A 2ZWAA 2QW8A 3NVDA 4L57A 4I8IA 4YWHA 2G67A 3SDSA 3JQ7A 3DLHA 3AESA 2O1WA 4Q4CA 3C3MA 1RZ3A 1DHRA 1K8XB 4ZP1A 3HPRA 1C7JA 2EJCA 1FS5A 1RZVA 4LNUA 5DHAA 1Z39A 5FF9A 3Q9LA 2PPVA 4DSZA 4YUAA 5K20A 1V47A 3NDPA 4B6FA 4KXLA 3FLBA 4V38A 4CEIB 4G5YA 2HNAA 1QC5B 1PFKA 2OSVA 1EVZA 1RBQA 2AD1A 4RABA 4MEAA 3GD7A 1L4BA 5CPFA 4FOTA 3WA6A 2GTPA 3FXAA 4EHIA 3GZ4A 3HDQA 2ZJ2A 2TMKA 3F46A 4B8YA 2JGFA 1PYGA 2C97A 2PUEA 2O7RA 2YVAA 4CV2A 4UTNA 2W6ID 1THGA 1EK5A 3IBFA 4FEAA 3AY6A 1EE2A 2HK8A 3FOWA 3QU7A 6GPBA 4IH4A 1MO5A 1J9EA 2HK9A 3JZIA 3NBMA 5DASA 3EA4A 3RBVA 5KHOC 2O5EA 4B3JA 4AC9A 3UZUA 1Z17A 1DB3A 2JF0A 4PCLA 1FUKA 3NX4A 4A2PA 2Q21A 3EIXA 2XXBA 2ZBVA 3NVAA 4RPKA 5FNZA 2HNBA 5B1HA 4CF4A 1L1EA 1M2HA 2RGAA 3OT4A 3A4VA 3ANXA 4YIHA 1OFTA 4UM8B 3FLMA 2HTEA 3DJYA 2H4JA 4H59A 5G4KA 5CLFA 4CEHA 3NM4A 5G0SA 2W2LD 3EGCA 4ZVVA 3HKDA 1ILWA 5HFJA 3RO7A 4H7DA 3CYFA 1C1YA 3HEBA 3SYRA 3CPEA 4GKVA 3S29A 1PK8A 1U94A 1EUYA 2OBYA 2GD1O 2IV2X 1SR8A 3ZV7A 2QZPA 2PM8A 9LDBA 3WWCA 3KD3A 4UHHA 3GI1A 5JH7B 1TDJA 1WETA 1YB6A 1YR3A 1SG0A 2HA4A 3ETLA 4G67A 4NG4A 4B45A 3QELA 4KQWA 4RCZA 4HUQA 4CT0A 1C8KA 1UDAA 5HZGA 5KJ1A 1CJTC 1EK1A 3W5JA 3WE7A 4KWHA 3PNOA 2X0DA 3BWXA 4JBNA 1FW8A 3HBJA 1J56A 2GT1A 2HY7A 4AY4A 4B3XA 3Q85A 1IRXA 1NPTO 2CDRA 2E5WA 2FLWA 4WWHA 4P92A 5GM1A 1SH7A 4ZCSA 2GBLA 2LRHA 3G1TA 4S04A 2V0GA 3I6BA 3PF8A 2VRBA 2OBNA 2ZSAA 3E84A 4AG5A 3IHTA 5K9ZA 4IUBS 1FDSA 5DM4A 3ZBQA 4MYHA 2R6ZA 4FJ0A 2HIMA 1WW2A 3LWBA 4P34A 5GONA 1O95A 3VNBA 3HA2A 4HNTA 1AGYA 4F1JA 1K68A 4PAWA 4AF7A 3ADCA 3O91A 1BWSA 4G8CA 2RE8A 3R5SA 3LVBA 1RYDA 3ZH9B 3G59A 3A2NA 4URXR 2NZVG 4LTMA 5MN5A 1RE0A 2QTVA 3UFBA 2EP7A 3UAGA 5D1NA 4B6EA 4F4HA 3PQ2A 4KO8A 2MSKA 3LSTA 4A1OA 1FYDA 1D5WA 3MCUA 4D3ZA 4M1WA 3QLEA 3DR5A 1FRFS 2RHCA 4D4LA 2B25A 3BMQA 2SKDA 4KUGA 2YHIB 3X1WA 3E8XA 3HXKA 2FA9A 1VIMA 1YJXA 3L6EA 3M7IA 3OJWA 4R9NA 3IH5A 3BRSA 5CTAA 2FWBA 5ALEA 4N5NA 1SU7A 1Y3HA 5KYWA 5K01A 3WNBA 5EJ9A 5ALHA 5I48A 2Q0SA 1Z7GA 4KL8S 4NJOA 2CJPA 2OG1A 2C8KA 4MITA 4QSMA 4RNDB 5KOHB 3UOWA 1E3SA 1YS2X 5ITVA 3RYCA 1D4OA 4N3NA 4TTIA 2WD7A 3PLAE 1I0ZA 3RFTA 5ES4B 2WJVA 1RCTE 3NJ8A 4Q21A 4ZHQF 5BUSA 4CLOB 1Q0LA 4HKTA 3TI9A 2XSZD 1SCDA 5KQGA 4AN1A 2EATA 1V41E 4ETWA 3EIHA 1OX4B 1ZR2A 1KO5A 1NI4A 4BQRA 2G17A 4AO6A 1M1XB 5ADWA 1Q2XA 4YMSA 4ZAGA 2PAAA 4KPUB 4BNFA 2YINC 4BCCA 3IPYA 3ZDFA 4C21A 4I1VA 4DDMA 2G9UA 5JNRA 1PR5A 1BWRA 2JLAA 5DCWA 3T0IA 1F2UB 2WDZA 4V1CB 5JISA 1X13A 3BERA 1Z68A 2EJBA 3DH0A 3DEZA 3PHBE 4U8GA 5ARCA 1WNTA 2QORA 3DVLA 4AZWA 3D6MA 3AUFA 5JFGA 3PHLA 3FWNA 3PHCA 1D8AA 3QF4B 4P0QB 3C8ZA 1Q7CA 3L7NA 1P6XA 2VJAA 3IURA 5EXEA 4ZCTA 3STWA 4JJFA 2CJWA 2PFSA 1T4DA 3DDSA 1AO3A 4Y8VA 4YJ3A 5FUQA 3HJGA 1PGOA 5K6AA 4L6AA 2C7RA 2W0MA 4TM7A 4GR4A 5LQUA 3I39X 1DBSA 2IUEA 1OAAA 3PKZA 1V7CA 3MUEA 4UTOA 1Q44A 2TECE 5KTYA 4Z4IA 4MRVA 3TIVA 1UIMA 1ADFA 4LQDA 5AM5A 1N1DA 5D3MA 3BJZA 3KVOA 4EJSA 3SQNA 2JIQA 5AJUA 2B1IA 1M6HA 1H23A 1MTOA 1T9DA 2HXSA 3GWGA 4GEKA 5BUZA 1WHSB 2VQDA 1POXA 2V97A 1UMDB 3WMEA 3TD9A 5DHUA 3KZXA 4LYGA 4RE5A 1E99A 2IHZA 3E2IA 3HLTA 3IAHA 3JWGA 4PZCA 1YJQA 4FD3A 1FVHA 3ZQ6A 3MINA 2PLNA 2YMPA 3ZV5A 3GT3A 2R65A 1T34A 2EIHA 3ZNPA 4RD2A 3BEDA 4NC9A 3FSGD 2QQFA 3OTHA 1D2AA 4EPRA 4RPLA 1EAMA 3WNCA 4V3BA 2V7QD 2QE7A 2XXJA 4MW5A 1JXOA 1DEOA 4JLPA 4DA9A 2X1HA 1HNNA 3CF2A 2QD1A 1GXSB 3KFVA 2B92A 1V4BA 1BVHA 5FA6A 1WQ1R 3BFXA 1XEXB 3CVXA 3OZGA 4GYYA 4DV3B 2GPNA 1Z5NA 1WCXA 2D5BA 1RLTA 2X5KO 2X0JA 4YECA 5E3JA 4X62B 4COOA 2P91A 2Y77A 1OIWA 3ZDBA 2OENG 1DO0A 4JI2B 3T5TA 2PSEA 3BXZA 5EFZA 1FQJA 1O6GA 1H66A 1U2DA 2PQ0A 2G77B 3PGVA 3RHSA 1M2WA 2XAUA 4M54A 4YUWA 4HXYA 2F3QA 2I34A 4ZEXA 1GT6A 1ECJA 3ANNA 3WA7A 2EEPA 1UCFA 4C6TB 1COZA 2VC2B 4WZBB 5HIJA 1GILA 1HEYA 2IHTA 1CFZA 5DGCA 5EZ6B 1D09A 2WWWA 2ZJ4A 3JU3A 1A71A 3HCNA 1O57A 1O4WA 3MWEB 1NMEA 4KV9A 4G25A 4NTZA 4NE9A 4Y1FA 4DR1B 2WA1A 1N2SA 2KBEA 1NUAA 3IDSA 2O19A 1ADJA 3U1VA 4CLHA 4GOMD 2IF0A 5T8KA 5JQGB 2I4LA 4AZSA 4RFLA 4MVJP 4ZODA 4EY5A 1OROA 3AV0B 4XLLA 4I46A 2C94A 2XUAA 5FOVA 1M5TA 2JVJA 1ZBQA 3O2QB 3I1IA 2XQKA 5SV2A 3DYVA 1P7WA 3W05A 1A9YA 1NJ8A 4EY6A 3JD0A 5TMPA 3TGPA 2Z2KA 1E9CA 1TQ8A 2EVWX 2CEAA 1E6CA 1T36A 2C9DA 3L7KA 3JAMA 3CZ4A 1K66A 3K31A 4MR8B 1GGKA 4PRYA 1MP0A 2J85A 3OX3A 3H5AA 4HDKB 2YXLA 5LQKA 4X20A 1RWWA 2CYBA 2DPHA 2YUIA 2Q50A 3KTAA 3PQ7A 4JKOA 5M3BA 1VFPA 5ITZB 1FDTA 2MSCB 1LD3A 3LC1O 3VO1A 4C1BA 3WFIA 5LYJA 3QFSA 4ARZA 4EOGA 2GUGA 4LWPA 1EFDN 1A97A 3RJZA 4ZEVA 1A4IA 1DJLA 4K3UA 4CR6A 4A73A 1KJYA 3KQMA 5LP1A 5I7OA 4LF7B 4BN5A 1KYWA 2W5UA 3O47A 1Q7TA 1ABFA 3HA7A 2GRUA 4GM1A 5FJIA 1GG9A 2P0AA 3P2EA 1BMDA 1C7RA 4GPAA 1YC2A 2WPDD 3I6QA 2B21A 3H42B 1SVNA 4M8NE 5AVWA 1E20A 3V7NA 4M60A 4YUYA 2CBXA 3COSA 3QFRA 2PUCA 1DJOA 1M7GA 3S1AA 2C9OA 2YWJA 2Z57A 4DNXA 3JCZA 1MF7A 3D4BA 4D8XA 1ZUIA 3RK4A 3MCZA 3T35A 1QWSA 4DLAA 4F97A 1O0BA 3ZY6A 4IDDA 2BE7A 1XRMA 5IARA 4XQ0A 2H2HA 2OVFA 3AP3A 3SZUA 2O1EA 3I2YX 3VX4A 5CB4F 1NJGA 2P2ZA 5FTKA 1QF9A 1QFJA 1KOGA 3P9YA 2Y1WA 2RH9B 3DEKA 1NXWA 2XCIA 5E6RB 3OIWA 1I4TD 2YXBA 1TVEA 5JZMA 4EHJA 3ORYA 3SICE 2H3HA 5ALUA 3ZHOA 2ZUFA 3TSCA 2PYZA 4FFRA 1J97A 2E55A 3OIUA 5TEVA 3CMCO 4G1FA 4MCAA 1H65A 1E6KA 4KH1A 4JX9A 2EZTA 2FUCA 3AF1A 3EFEA 4U5XA 5T5QA 1Z2OX 2J9XB 3GDHA 3NYRA 4AJ1A 5BV2P 3T1HB 2CUTA 3KJGA 3I09A 1R6TA 3LV8A 2GM9A 3FW1A 2B7LA 5AVOA 3KCNA 4LSWA 1CS0B 1LXCA 2SCUB 4WJZA 4E7PA 4A0HA 4TV8F 4DNPA 1P2VA 1GZ6A 3WY9A 1ZKDA 4OUDA 1KE2A 2YV5A 1KZ9A 4Q4AA 4V2UA 4PGFA 4Y2VA 1E69A 3G5UA 5AHRA 1HR0B 4BQPA 1DT3A 2JFNA 2AOTB 5EZYF 3KD2A 5FLKA 4ZV9A 1OLSB 2RGRA 4UCXA 3IR7A 4DVGA 4YAJA 3RRJA 4DIKA 1B3RA 2J7PA 2QUZA 1XJQA 3ZY5A 1P3JA 4JC4A 1MT0A 4TSFA 1M83A 1XZKA 3HUEA 4TXLA 2JVKA 4TN5A 3EGDB 4UDOA 3TQQA 3TVDA 4M0UA 2H4YA 3EY4A 3FZQA 5FEMA 1XCPA 2R1TA 4IDEA 4U2BA 1FDUA 5EPOA 2YJ6A 1AY0A 4CT4B 4BRZA 3HB0A 2GCIA 3A7DA 1L0BA 4JIMA 4JI7B 4UVEA 3VJLA 2NAFA 3BTSA 2Q27A 2PRYA 4JVMA 3OZCA 2G1UA 3BKXA 3LKBA 4MR9A 2QD4A 4R68A 3B89A 1T0PA 5EHGA 2C9BA 3EOZA 5B4VA 2F7SA 1JU4A 1S3FA 3PUHA 2VTBB 3DHYA 5BSHA 4DMLA 4AMUA 1TXGA 4BMSA 2JB9A 1HV8A 1SO8A 1BMTA 4LF4B 2QJWA 2H1FA 1I3NA 4MNTA 2X5OA 4NNJA 1Z3CA 5BW5A 5CFNA 3KQKA 4CG0A 3NTRA 1JVNA 5BVGA 2EWWA 2P9GA 3ZDEA 1TL7C 4OAPA 2PG3A 1W581 1XYGA 2LXNA 4NPAA 4IW3B 5D2CA 4ZFNA 3PJDA 2XCTB 3RC8A 2I4NA 2V7PA 3PR2B 3HYCA 3KQSA 3RVLA 5GQSA 5I9SA 5REQB 5L3QA 1QG6A 3VTKA 2HM7A 1Z2DA 3UAOA 1WV1A 1KYIA 1UMBB 1Q5PA 3I12A 4FINA 1BXKA 4QYSA 2PSSA 4TXJA 4N82A 5DX8A 1Z8DA 2A9FA 2XA2A 4FS3A 4OBBA 3IT3A 1J2TA 3GLHA 1AQYA 2ONYA 3DT8A 2EC5A 4MQBA 3MGCA 1GKYA 4ALKA 3HCEA 5HA5A 5BNTA 1PR1A 1U3TA 1M0EA 2YFYA 3C97A 4G26A 3OSUA 1VKJA 4GW3A 4P53A 3ICPA 4PLZA 3MT9A 1VLHA 4AUMA 3TEFA 5JXJA 2GETA 1RP7A 4HO1X 3SAJA 2NWQA 4UVIA 3NIBA 1N4AA 3L02A 3AL2A 4RIIA 4MV5A 1GUBA 3N75A 3UOAB 1JT2A 3SQWA 3ABOB 4B6RA 2BFWA 1JT9A 3OUUA 4U2EA 1ZMTA 5A0TA 4YP1A 2IEDA 5I7HA 3GHHA 1KWKA 3IMCA 1CR4A 3VH2A 4MS4B 2IU6A 3L6CA 5ERGB 1E8MA 3W8NA 2EQBA 1V8ZA 1QE3A 3L0BA 3LAWA 1H0HA 3HU5A 3TG2A 3WRXC 3WB1A 3K15A 4G81A 4LJ9A 1F8UA 4X45A 4QD3A 3Q98A 4LYDA 3VHQA 5CFPA 4LE1A 3PENA 3GN1A 3GLGE 3O1LA 4UHFA 1LK0A 2HZBA 2JGDB 1OLXA 4XD2A 1EWVA 5IXYA 1KQFA 4QJ5A 4BO6A 5KCMA 1VG1A 2VP9A 3MERA 4AP6A 2GMWA 5A3SA 3HLYA 5F51A 1K98A 1Y8QB 4FGKA 5DHQA 3TLYA 2VJMB 2QAGB 3OHSX 4FBLA 4QASA 1Z4OA 4URZR 2VNKA 3HJHA 4Q3AA 7REQB 3U5ZB 3OU7A 2OR3A 4YONB 4N48A 5SY9A 1GG2A 3QVLA 2AJDA 5LLTA 2VOJA 1Q3KA 1QG0A 1WULS 1D1QA 5H80A 2H7CA 3U81A 3V34A 3R6GA 1RJGA 2I78A 2QVYX 3M49A 4NH4A 4DG9A 5ELLA 5P8WA 4GP6A 4ZAFA 1OI4A 2WSBA 3RWOA 1NW3A 5LZ9A 2F1HA 2GWHA 3F9RA 1JKXA 2ZYTX 3L8CA 1NLFA 4XQEA 5K0GA 1KDRA 4YRBA 1K7SN 1L7BA 3BH7A 4IRXA 2HSGA 2YWEA 4EHDA 2Y1EA 1VL1A 5BV1A 2ZBFA 5AW3A 2ZUVA 4JGBA 1OKKD 1PLKA 1ZEMA 1AE1A 1TJ3A 4KYUA 4IICA 2D0DA 4WK0B 3U26A 1Z74A 2GTHA 2XW6A 2NZJA 4KWIA 5IBCA 2F64A 3GCDA 3GLSA 2JBHA 1GPJA 3KC2A 1XZQA 1NURA 3R5HA 2IP2A 3T1OA 3HACA 3RUDA 1ADGA 1FY2A 2IU0A 1MDFA 2FYTA 1T3HA 1NV8A 1ZD2P 1YTLA 3PC6A 2KB0A 4C76A 2H57A 2D7DA 2Z95A 4JP8A 1R88A 3WWDA 2BGRA 1UMCB 4Q3LA 2QPTA 2YJ5A 3K5PA 1R0BA 3O8OB 3IS3A 4NYMQ 3O73A 1ATIA 1AZLA 4FDTA 3V8QA