1DCKA

Structure of unphosphorylated fixj-n complexed with mn2+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
123
structure length
123
Chain Sequence
b'MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
molecule tags Transcription
source organism Sinorhizobium meliloti
publication title Structural transitions in the FixJ receiver domain.
pubmed doi rcsb
total genus 39
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dckA00
4IF4A 4RS3A 2H3HA 1J56A 2PL1A 4RK1A 2OENG 1ZN2A 3F73A 1DCMA 2FLKA 1LK0A 4G0OA 3MF4A 3LOPA 3QELB 1D5WA 4LE0A 1ABEA 1RPJA 1LJUA 1D1QA 5T3YA 4UHKA 2AYZA 2QSJA 3LFTA 1K68A 3KYIB 1NXSA 3KG2A 3HUUA 2MYPA 1OXBB 2PAFA 4O1HA 3I09A 4ETMA 3GBVA 3GL9A 2XDYA 3EJWA 1PHRA 2IPMA 3I45A 3OLVA 5CHYA 5DKFA 3M6MD 5IC5A 3QLUC 4YP9A 3JVIA 3BRQA 2OQRA 4YRZA 1DZ3A 5B3JC 1NXTA 2GX6A 3CG0A 3NHZA 4MR9B 4D74A 5PNTA 1Z16A 3T6KA 2IPNA 4Z4IA 3C6QA 3ROTA 4XFKA 2FEWB 3LUDA 1BDJA 2JRLA 2JB9A 3N6VA 4G0YA 3DLHA 4MPTA 1YIOA 3A0RB 3OLYA 1E6KA 5GQSA 2VK2A 2BGGA 3H5LA 5CNMA 1YS7A 2FXIA 5EWLB 3FFWA 4MR8A 1T34A 1YVUA 1Z25A 3RVKA 3H1GA 1DCFA 2LIVA 1DRKA 1DP4A 2FTKE 3CG4A 1M5UA 5TPZA 4IGAA 4S04A 5ED4A 2R47A 4XAQA 5FWXA 4EYOA 3JY6A 1RXIA 5BR1A 4Y9TA 3S99A 2FMIA 2HPHA 4RY0A 4W5TA 1B00A 3C3WA 4W5RA 3F6CA 1YTUA 3TD9A 4RK7A 1JF8A 1EHCA 2A9OA 4KQ9A 4Z4EA 2QXYA 1NXPA 3G85A 2FKAA 4RKQA 2HQOA 1F51E 1DC7A 3HZHA 3LKBA 3RVOA 1CHNA 2E4ZA 4MLDA 4RK4A 4RY8A 4LDAA 3VNBA 1ABFA 4RY9A 1PUXA 3OMWA 2E4WA 4MRMB 4OLBA 4JOQA 2V0NA 4Z99A 3CFYA 1APBA 4F11A 5KI6A 3Q15C 2HQBA 4ZMRA 3HXMA 3H75A 4H60A 3CLKA 4MLCA 4PYRA 3HK2A 1ZGGA 1JWLA 4H3KB 2RJOA 3HUTA 1FFWA 3W9SA 3ILHA 4JAVC 4JB0A 1EWTA 4OLAA 4MS4A 1U04A 1KMIY 4LX8A 5JS1A 1DBPA 1YK0A 4WZZA 3GT7A 4KVFA 3OQNA 4MGEA 1ZDMA 3TX6A 1XWWA 3MYYA 4MS3B 3FFTA 4N0QA 4KMRA 2QU7A 3JTEA 4H3HB 5ABPA 3NBMA 1L5YA 4TN5A 1ISRA 2WB4A 1Z15A 2NT3A 3IP9A 3OLWA 2E4YA 5TQJA 4Q6WA 2ZWMA 5CNIA 4Z9BA 3QX9A 4CBVA 1NXOA 4QYMA 4RDCA 2E4XA 3RVPA 2VYCA 3CNBA 3IP7A 4IILA 4YLEA 1RNLA 2MSLA 2L18A 3LUAA 4O5AA 2GBPA 5KWSA 2M98A 2QV0A 2IYNA 2QZJA 4PZ0A 4KRFA 5TQ0B 1M2FA 5B3JA 2DRIA 4Q7EA 2Q5CA 4ML3A 5GOTA 4D6XA 1EAYA 3SNKA 4Z4FA 1U0SY 1NXVA 2PE5A 1GCAA 5FBKA 1QNLA 3O2QB 6CHYA 3H5WA 4TMYA 1U2PA 3Q7TA 4YWHA 5HKOA 3QX8A 3H1EA 2L19A 3QELA 4G0QA 4G0XA 4RK6A 4XASA 9ABPA 3UUGA 1JHZA 1NATA 3DZDA 5KQGA 5KQMA 1U2QA 1DC8A 3RVNA 3O2SB 4MQFA 3KJXA 3L49A 1W25A 4G0MA 4MS1B 1MB3A 5TPWB 3D8UA 4Q6BA 1EWKA 2MSWA 2R4QA 3T8YA 3UK0A 3FFXA 4FB4A 1DRJA 2MYNA 4EVSA 3IDOA 4HNRA 3DGFC 1AB5A 1A0OA 3QEMB 4WT7A 8ABPA 1DJMA 2FEKA 2JCGA 5FWYB 4E7OA 5T7BA 3TO5A 1QP7A 4XARA 1MIHA 4Z4GA 3KCNA 3LUJA 3EGCA 1PNTA 1JYFA 5DCLA 1BVHA 2PKXA 4N41A 3URMA 1Z18A 3N53A 4RXUA 4GPAA 2O20A 3A10A 3T38A 3HDGA 2CWDA 4KK3A 4MYRA 4EY3A 2MYTA 3N0XA 3N75A 4QPJC 1IIBA 3I42A 3QK7A 4IMJB 1FFGA 3Q9SA 4EGSA 3NNNA 1JBEA 3K4HA 2R48A 1LBHA 2PUCA 2YHAA 3H5IA 5KQLA 5KQPA 4N47A 4KREA 3HDVA 1K66A 4PEVA 4F3TA 2FQXA 1ISSA 4YCSA 3LMKA 2LP4Y 4NCBA 2PUGA 2JVJA 3ILYA 4P98A 1TJYA 4WXMA 3KHTA 5FBHA 1P6QA 3LUFA 3RVLA 1TVMA 3F6PA 2PUDA 2L17A 3O75A 3RQIA 3C3KA 5C5CA 2FW0A 3SY8A 1SXHA 4YV7A 1KGSA 4XXHA 3HS3A 3D02A 2IPLA 4YS6A 4MQEB 5EWMB 4QICA 5F64A 1W9HA 3BBLA 2HQRA 1F4VA 4JP1A 2E4VA 3CKMA 3N0WA 1L5ZA 4LZLA 3E3MA 5JNUA 4LDZA 4LRQA 2P9HA 4RXMA 1EWVA 5DLEA 3GBPA 3O1JC 4DQDA 5IULC 4IRXA 1FFSA 4L85A 5BRJA 4RK5A 2VUHB 4RK0A 2JBAB 2FVYA 3F7NA 3O2JA 3KS9A 3TMYA 4W5NA 2WRZA 4Z9AA 1JYEA 4GNRA 5HSGA 1NXWA 4XLTA 3GV0A 2LPMA 3N0RA 4N76A 3HV2A 1URPA 3KYJB 2B1JA 2PMCA 2YHBA 3BILA 5TQ2A 1MAVA 2GI4A 4F06A 1OXKB 4HYEA 3DGEC 1JX6A 4FE4A 4ZJPA 1QPZA 4Z4HA 3A3KA 3CZCA 5EWJA 3KKEA 3H6GA 3LTEA 1HEYA 4MR7B 3RVJA 3SG0A 3VNAA 3I5AA 3RVMA 1Z2EA 4RXTA 3OLZA 2I6FA 1MB0A 3JVDA 1P8AA 1RZRD 2MYUA 5KC8A 3HJFA 1UDRA 1FSPA 2R25B 1LJLA 1VKRA 1DBWA 3BRSA 3KSMA 4OTZA 1QO0A 1MVOA 4G0PA 1C4WA 4FE7A 4JA2A 4OG2A 1GCGA 5DGCA 3CU5A 5FWYA 1JFSA 1QMPA 3QLVA 2QVGA 4QYWA 1A04A 1QKKA 4DN6A 4EYGA 3T95A 2CHEA 3GA5A 3IPCA 1USKA 5BQ3A 4P1ZA 3OQMA 4YO7A 2CHFA 1NY5A 3QLUA 4KV7A 1PEAA 4RKRA 4O1IA 3MQ4A 4W5OA 3UKJA 3L6UA 4G0ZA 1VLZA 5IUKC 2A9QA 5KC9A 2RGYA 3KLOA 3A0UA 3K9CA 2IKSA 2QW1A 4G97A 2LBPA 2FSPA 4OATA 3OQOA 3EULA 4MQFB 3DLBA 2GWRA 3NNSA 1TM2A 1USIA 5JNVA 4NCAA 3DBIA 3H1FA 2IOYA 5JS2A 5FWXB 2ZAYA 5IBQA 1NXXA 3KTOA 2E4UA 3SAJA 3OO0A 2LUOA 2W42A 4KPYA 3QEKA 1E6MA 3JPYA 1DBQA 4F12A 2IDMA 4KK4A 2PLNA 2ID7A 3NHMA 2WJAA 4Z0NA 1E2BA 2F8TA 2QR3A 3M9XA 1CYEA 3OLXA 1P2FA 2WJWA 5TQ2B 3HSYA 2RJNA 4W5QA 2JK1A 1TLFA 1D1PA 5I4CA 1YMUA 1YK1A 5CNJA 5C5EA 3LUHA 3MA0A 7ABPA 4S05A 4G86A 2X7XA 4EYKA 3FGZA 4UHJA 4LE1A 4Z4CA 1H9CA 4RU1A 4E7PA 5JNTA 1SRRA 2NZVG 2JVKA 2MSKA 1GUDA 4EUKA 2L2QA 1A2OA 3OO1A 3Q41A 5CNKA 3MMNA 1PNRA 1SD5A 1BAPA 5E3JA 5DTEA 3M9WA 2WWVD 4PICA 4MR8B 4RV5A 3QLTA 1BDIA 1VPWA 5IUNC 1XHFA 3BREA 4MS3A 4N03A 1WETA 4MR9A 1ZESA 4MR7A 1QP4A 3Q7RA 3C3MA 4EVRA 2PUBA 1ZVVA 3C97A 4ZYLA 1RZRA 5IX8A 3SM9A 3RH0A 1QQAA 3IPAA 3LUKA 4MS1A 5JNRA 2A9RA 3EODA 1GLGA 3O1HB 3P9YA 2HSGA 3EQZA 4YR7A 3EDCA 3FDFA 5D2CA 2HJ9A 1JL3A 3EQ2A 2NT4A 4MRMA 1E6LA 5TPZD 2PUEA 4WUTA 2M1ZA 2FQWA 3HM9A 4M88A 1BDHA 5TQ0A 3B2NA 2FN9A 5IEJA 3CHYA 2PUFA 2KYRA 4F8JA 2WY2D 1GUBA 1JLKA 2NUBA 5IEBA 2WMYA 4JASB 1SXGA 5JNSA 3JPWA 3MM4A 3LUGA 1Z17A 2P4UA 3JS5A 1M2EA 1ZGZA 1RXEA 4TLMB 1KRXA 1P6UA 1U8TA 4ZMSA 3CRNA 1SXIA 4KQCA 4WXEA 2FEPA 1YS6A 5HM6A 3GYBA 5JNWA 1D2AA 3TB6A 3RVRA 1ZAYA 3ROFA 2GKGA 1ZH2A 4L4UA 3LKVA 4RZSA 4HNQA 1TMYA 2ID9A 1BA2A 3O74A 1Z12A 3E61A 1ZH4A 2VUIB 1JFTA 5HQJA 2B4AA 1Z26A 2PL9A 4NICA 4B09A 1PEYA 4NQRA 4PE5B 4YGXB 5TE9A 4NV3A 3OMXA 4MAAA 1ZHHA 2PUAA 5TPWA 1QQBA 2FMKA 1JDPA 1Z13A 2A9PA 3O1IC 2AYXA 3KLNA 5IUJC 2QVCA 3HVRA 3OM0A 2FMFA 2J48A 3EAFA 4HNSA 4EYQA 1KRWA 1M5TA 1FQWA 1NTRA 2N9UA 1C0EA 3IP6A 4MS4B 5EWMA 4ETIA 1LBIA 1ZITA 3LUCA 3HO1A 1R8JA 4N0PA 2CD7A 5BRAA 2FLWA 2NZUG 1USGA 3H5OA 4JB2A 4D6YA 1XHEA 4WWHA 3H6HA 2FQYA 3GWGA 5EWJB 2H0AA 3CZ5A 1AB6A 4EVQA 2JBAA 4ETNA 4LE2A 3H5VA 4ZPJA 1D4ZA 3OM1A 1VRVA 2TMYA 2F8SA 4DADA 3QEMA 2IPAB 2JVIA 4RSMA 3FMVA 3H5TA 1CEYA 2RDMA 6ABPA 1JH9A 3SQNA 4KFCA 1Z2DA 2PJUA 4TLLB 3N8IA 1DG9A 3CS3A 1Y1LA 4RWEA 3RVSA 1EFAA 3R0JA 4MQEA 5EWLA 3O21A 1QO0D 1I3CA 1ZY2A 3HEBA 1JDNA 1S8NA 3MIZA 3QLVC 3G1WA 3NNDA 3HCWA 1DCKA 1YMVA 4KNYA 3Q7SA 3IP5A 2FN8A 2FMHA 3CTPA 3RVQA 4IMIB 1QP0A 1JFVA 4OBBA 3GRCA 4KZKA
chains in the Genus database with same CATH superfamily
4PCAA 5LPNA 4MW6A 3VC3A 2LXNA 2VHXA 1WZEA 1AK1A 1N2CA 2J87A 4C4RA 1AUVA 4DLUA 5EQTA 4LWPA 3KEQA 1DJOA 4JFRA 4E5MA 3KQPA 4KO8A 4NJMA 2UZ1A 5TNXA 1LK5A 3UWPA 3R3JA 1UMDA 1TKRA 1K3FA 1AGNA 1PGJA 1X0VA 3H2SA 2V59A 3IUBA 3K9HA 1XF9A 4M1QA 2OMKA 5SZHB 1E7SA 1DINA 1NXSA 2RI1A 4E1BA 3NBYC 1HRDA 1U7WA 4Y98A 4RLHA 4H4EA 1O89A 1Y1TA 3SZGA 4IJ6A 1GLVA 2GK4A 3RAFC 1RYYA 2EP7A 5HUHA 1JEYA 4OHUA 2IPMA 3GXOA 2I7XA 1T5TA 4BMPB 4IXWA 3V8QA 4JLSA 4MYCA 3BIXA 3RSCA 4AKTA 3L4SO 4F85A 1IY0A 5A5EA 2PQMA 1KOLA 4ZPXA 3BICA 5ALOA 1U1FA 1QAOA 1Z5GA 3ILXA 3OPQA 2KW5A 1MH1A 1WIWA 3D0OA 3T0FA 2D0PB 1BD4A 1OXXK 3WGTA 3WZ2A 1CQZA 1VYUA 2PXAA 1W30A 1WHTA 4O8ZA 3OX1A 5H68A 4F4HA 1T3GA 3L9XA 2IZ0A 2Z3WA 1TVKA 3FKQA 1H2HA 1OPXA 1S2OA 1DIHA 3K1TA 2WHXA 4HFRA 1ZGJA 1EXWA 1PL6A 3AMVA 4EW6A 1TEVA 1Z5ZA 4GC5A 3TGWA 4I4IA 5FLKA 4DG5A 5J2UF 1Z25A 2QNIA 2IHYA 5E7JA 2LIVA 2SKDA 1DRKA 4XCQA 3FPJA 4ZCLA 4HDNA 5ED4A 2FRXA 3KAKA 1NUQA 1QPBA 2WFMA 3S99A 4ANFA 4BQRA 2FPUA 4GDMA 3D2AA 1L4LA 1M1YB 2V7UA 2QTCA 4RK7A 2JAOA 3DTTA 4LY3A 5HILA 5GZ1A 3G85A 1ZC4A 5CEJA 3U4MA 2AOUA 4M7OA 4TV9A 3H3FA 3A6ZA 3L7BA 4HZUA 3AW8A 4EY4A 5JO9A 1IRXA 1SIBE 1A77A 1L5QA 4MLDA 5CU7A 1O6ZA 1OKKA 2GDZA 1CX9B 2XMDA 3F96A 3RRJA 3CO5A 5JSFA 2R2GA 4KXWA 3WQBA 5DNCA 2W43A 1T5LA 3CWQA 1LCIA 1N7HA 3DLIA 3BMNA 3OT1B 4QC2A 2B36A 1CJMA 1ND6A 1XJ5A 3F2VA 3H75A 3PC8C 2XUHA 5HE9A 4A03A 5KHLB 1E3EA 3ZKAA 1GL7A 1OWNA 2BFEA 4I6EA 3NANA 5DYGA 3IT0A 1GSHA 2FEXA 2FRVA 4MW0A 5BSGA 3QSYA 2GPBA 4FB5A 3OHSX 1OV4A 4WXRA 3WKEA 4NS4A 4LX8A 4MDEA 4FGKA 4WZZA 4ZJUA 4KIWA 1VG1A 1RYHA 4MGEA 3UWOA 1T9GR 4BNTA 2CXXA 1DEAA 1ZK2A 2OK8A 3TRKA 1ODCA 3DZJA 2HR1A 4YBZA 4HR7A 2X7JA 3TBHA 3WDSA 1XMIA 3BHJA 1NLFA 3FNEA 3ZS8A 4RKFA 5KYUB 1EU1A 1TD1A 1LNSA 2VOJA 2Y0DA 4HLUA 1PQWA 2DPYA 2R2AA 4F8YA 4CBVA 4KPEC 3FNBA 3R20A 2GNOA 1E1YA 2B1QA 2HAEA 1Z62A 5BNTA 1FRQA 4QUDA 1HDEA 1VKJA 5JD6A 4LC0A 1IPHA 4K9KA 4QVKA 1X2EA 1C9DB 4I4TB 2M98A 1U28C 4MWCA 3PTZA 5FPKA 4GM0A 5DX1A 4ZN6A 2BD0A 3OX4A 5AHRA 5CYGA 3UV7A 1KPHA 3HXTA 4R9RA 1DKRA 1KBQA 2PMBA 3PGXA 2BTQB 4TQAA 5I3ZA 1C7ZA 3I0MA 4LXQA 2VDWA 1ZOLA 4LISA 4QO7A 5GOTA 3S1SA 3W9BA 2OFFA 3GRUA 4CQLB 2HLDD 2BPOA 1A4XA 1LF5A 4LG1A 3PC3A 3SHTA 2FG6C 3ZZMA 1GKKA 2VNSA 5DFAA 3PHIA 4RDIA 2BEUA 3ISJA 3KV3O 4Y6RA 1C80A 3B9BA 3CMMA 5ELLA 3EDOA 3RIHA 3IIEA 1IUOA 3E9DA 3QA3E 4BN5A 1NATA 4ESOA 2BONA 9ABPA 4DDKA 4KXUA 1UDAA 3KJXA 4EHDA 5IH7A 5AJHA 2IH4A 1ZISA 5TPWB 3WS7A 3CNHA 4E15A 4DY6A 2R4QA 3N5CA 2OD7A 1CUAA 3PUWA 1J90A 1J2JA 1SVSA 2ISQA 1YV9A 2HSZA 2MWMA 4MLZA 5EIEA 1U2SA 2ZETA 3H1AA 1WZCA 2IXTA 1A0OA 1FU7A 1UDCA 1V0JA 2CN1A 2ZYSA 4S12A 4WT7A 4DSUA 4DQKA 4ZARA 1XWFA 5T7BA 3U7FB 1ODSA 1X87A 2G25A 1BIFA 1OKKD 1TB4A 1JEOA 1L4GA 4HB2A 5E2BA 2HHHB 2DFVA 1UXJA 4AMBA 3Q7PA 1Q1ZA 1UJ4A 2C04A 2QNRA 4R2MA 4ALNA 3HXPA 4US0R 2QRJA 5CFZA 5H3HA 1NZDA 2WVHA 4PXSA 2J4FA 1JHPA 1G16A 1G8KA 4B3GA 5DM2A 5K4GA 1XUOA 2AFIA 3R6LA 4FZ3A 2ZZMA 5EINA 2HD4A 1MXFA 1VLHA 2BCGY 2FPMA 3IP1A 3U3DA 5T3UA 2RB4A 5AVOA 2R6GA 2ZB4A 2ZREA 1BGWA 5GIPE 2GR9A 3C1UA 3L05A 4N0PA 1VG9B 4YMUA 4DV3B 1VRWA 1RAAA 3JARB 5C0OE 5KYKA 4BZPA 4LHSA 4BMXA 3WSVA 3CF4A 2P7HA 4G8BA 2J5KA 3LMKA 3UJDA 3I23A 1WP4A 1OAAA 2BFEB 4CN9A 1TJYA 1PL0A 3FWHA 4GX1A 4IDEA 5CLQA 3DEHA 4DMKA 4CTJA 4M4SA 1I7SB 4C89A 2LGJA 2C57A 3WWDA 3HFRA 3PWSA 3CKYA 1WVIA 4BAGA 5K5EA 2BFAA 3LKDA 5AI0A 2C3YA 3FTPA 3HS3A 2OM2A 3KL2A 1TKCA 4P5EA 4PG6A 1NJ6A 1NI5A 3A27A 3N28A 1E98A 4JYMA 3NTOA 2GBLA 1ZXLA 4FLFA 4QICA 5C31A 4AG5A 5E4JA 1S1CA 3RBXA 3P9CA 5D3MA 3QMVA 3LQFA 4TM8A 1L3BA 3AUXA 3B1KA 3ISVA 4YCAA 5EA2A 3R75A 3TX2A 2HIHA 4M8SA 3IKTA 4RXMA 3AI2A 1CQWA 4JL8A 4WOJA 5KVVA 4NATA 4IRXA 5BRJA 4EA9A 3WWZA 1ENZA 2W37A 1FLNA 4D44A 1UT5A 1XLVA 2OORC 3R09A 4I5GA 4YQEA 2C7QA 1GL9B 4MW7A 3B6EA 1S7CA 4MDFA 1O54A 3PHBE 2PMCA 4KAFA 4RGQA 2FWMX 1S8OA 3GIDA 4HYEA 4M76B 1Z7GA 4X7BA 1KXZA 5EGSA 5C3UA 3M1YA 4AN0A 1T36B 4K8OA 2D1TA 1IQUA 2WJYA 3FCCA 3KVYA 3SKYA 1SCJA 2XT9A 2RHDA 3ZHYA 1VSVA 3ZIAA 3H2BA 3IQZA 3TQSA 1MB0A 2QK4A 3QIAA 1XGKA 1U3TA 4C5AA 1QOZA 3RW9A 2VQFB 1VPDA 2DMRA 1QFZA 2ZRGA 1XMJA 1LJLA 3LO5A 1MAHA 2CYBA 1EFKA 5JPDA 3TVYA 3V48A 3KB1A 1QO0A 3K31A 4ALKA 4FE7A 2X9GA 2X7HA 1Y7LA 4R8LA 5AHOA 3DDNA 4LDRA 3WJ1A 5C35A 2D3TA 3VZBA 4QYSA 4MQMA 5BUSA 3ZWQA 1R6VA 4BJ1A 2XQKA 5A2QA 2WP8J 1I13A 4PYIA 4CQMD 4YV2A 3MAGA 1GFWA 4AJJA 1R6TA 4GPIB 3IPCA 4QQRA 4Y1RA 5D3ZA 2JL1A 5ADUS 2HUNA 2BYTA 1HE5A 4ENPA 4RV4A 2RC5A 3W4KA 5B5SA 3PT9A 5TF4A 1OIXA 1Q1AA 5CA0F 2K87A 3HCBA 3MWJA 4URZR 5B37A 5TEVA 3AERA 1WCV1 3H3XA 2EEZA 4BLUA 1RFLA 4M9XA 4RELA 2JIRA 2R1TB 4HATA 4UTNA 5EIHA 3H9JA 1I32A 3BERA 3ETNA 4Y9UA 2X23A 1T9AA 3R7DA 3ZDDA 1PWXA 2GN8A 3U19A 4XCVA 3L01A 1KMHA 1NUPA 2PBLA 4INAA 4FINA 2Q1TA 3UG7A 5BW4A 121PA 2FCRA 1Q83A 2YMLA 2E4UA 2JH9A 3P2IA 3A3OA 5ALUA 3D64A 4NZYA 1FFEA 4LDQA 1PF7E 1YZVA 3WLFA 1K0FA 1KK0A 3QPCA 4Q66C 1K2WA 3FMIA 4B44A 5AVZA 4PPQA 2P2CA 4N7JA 4FM9A 1H2EA 3E2MA 1MO5A 3LWDA 1BRTA 3L6EA 4GP9A 4C6SA 3ERCA 1A4RA 4DSNA 1YQDA 4N0EA 4CI9A 3THYA 2AEJA 4B3BA 1D6MA 2XD4A 5I9TA 5C5EA 1R88A 4EKEA 1P74A 2C0PA 4U8GA 3T5DA 3G0HA 4UVEA 2Q1WA 4CW7A 1ORHA 2GCOB 1P9WA 1VA5A 3B1YA 4OBWA 2NVBA 3FH0A 2FY8A 4N4AA 5JC1A 3SJCA 5I4BA 5JSHA 2L69A 3OU6A 4B6SA 2OO7A 2ZBEA 5EQJB 4ERXA 1P19A 4ZVRA 5EMNA 3G2JA 2PX5A 5DTEA 1YQGA 2BFFA 5A06A 5ITSA 4Q3NA 3R9XA 1PFUA 3OIUA 2NP6A 1TIPA 2FZVA 3NFRA 3CBGA 5DM70 2FW1A 2JFZA 4YJ2F 1BHSA 4PXAA 3AFOA 4LXGA 3EEOA 2XF2A 1KQNA 2X0NA 3WWOA 2V5UA 1WETA 2C8JA 3S40A 2BI4A 1JALA 2XWPA 1Y33E 3CE9A 3ZVKA 2RH8A 4RVCA 1RJ9B 2IA5A 1PJ2A 1VXRA 2B8NA 2WQZA 2XYPA 1AUQA 1Q1GA 4IWXA 1I3MA 4JR0A 2HMUA 4BRSA 2OQVA 3AY6A 3K96A 3EZ7A 1AO0A 3FTQA 3TSZA 4XGKA 4MRMA 5JISA 1KYQA 2D1YA 2D54A 2PUWA 1XVVA 3O8BA 1BEZA 1VKHA 1BQEA 1WA5A 3FPSA 3GA7A 5EMHA 5CFNA 3V9AA 1NRWA 3BWXA 4F71A 4RHCA 2DSTA 4X61A 4KB5A 5F9MA 1ZBQA 1VOTA 2F43A 1DIRA 3TSOA 3EXEA 3UCFA 1TU0A 4BVGA 3ELYA 4UM9B 3W1VA 3DZGA 4B34A 3FMOB 4K6GA 1VP3A 1SKQA 1POXA 4MUXA 2YFQA 2GTPA 3U9TA 3GMSA 3EAQA 3TQHA 4HCJA 2YVUA 4G1MB 3UOAB 3VDMA 1EUYA 4NC9A 3D0KA 3IJRA 2NPFA 2ZWVA 4GHWA 3O4GA 3OZIA 2WKPA 1R18A 1T26A 1P4SA 2XQIA 3IQXA 1AZLA 1JG3A 4DYHA 1NJ2A 2H1CA 1NF2A 1QAMA 3NHYA 1B16A 4L4UA 4YX9A 3QZUA 3OQ6A 3ECAA 4I55F 2VYVD 4J03A 4Q3BA 2X8LA 5HPYB 3I34X 3JWEA 3UK1A 2F3TA 2WZDA 3ZI4A 4U2EA 1GQ2A 3GJQA 5JPCA 2P9EA 4FX5A 1JDBB 3CW9A 3OICA 4M46A 5ECYA 1EFVB 2YV3A 2I34A 1ITZA 3AUKA 4IZOA 4R31A 1TMKA 4CKCB 4TWZA 4UZEA 1CE8A 4NV3A 4IH1A 2ARKA 2VL7A 1R12A 4IVQA 4BNLA 1P0FA 1YOVB 1JA1A 3UGJA 1PT5A 2FUNB 4XWAA 3IKJA 1E3LA 1QH1A 1G7TA 1EI9A 2VYFA 2G07A 3IXMA 4J2HA 3RK4A 1DKMA 1F0PA 4BWGA 4YROA 4L4XA 3K9QO 1Q0TA 5B7NA 1DFGA 2VSNA 3CNQS 3TTTA 2XB2A 1ZOOA 3VNVA 4PLHA 1RLMA 4NF2A 3RFFA 4OHCA 1O9GA 1YGYA 4D4KA 3H9EO 2BKVA 3FYUC 3KP1A 5EZYA 1UJ6A 2V7PA 3JARA 5LCXA 4ETIA 1DKOA 3S2ZA 1ZITA 1YJAA 1JE0A 1ID1A 1KOJA 4ZKEA 2WUEA 4OFWA 1KETA 2XT6A 3KETA 3M9LA 1PVOA 1BVUA 2JKYA 2ZJ4A 3B9PA 3PZRA 5H7XA 5BOSB 3UJ6A 1PZFA 1A2KC 1QGOA 4WWHA 2NTVA 4MV5A 4DQLA 4G1UC 1OH6A 2H17A 5GM1A 1DJMA 1P4AA 1EP9A 1UXIA 4Z3DA 1SOMA 1FFYA 4AUMA 4X41A 4NJOA 2A30A 5E6UB 2GEVA 1OHHD 2XB6A 3OCJA 3OE7A 4LIPD 5ILOA 2IPAB 3N8NA 3FMVA 5F2EA 3WL4A 2H0RA 1DI0A 3FBTA 2B1GA 1WX1A 4A6DA 1G17A 3RRXA 4BATA 3IOYA 5DNDA 3FD8A 3HZOA 3ANNA 3N8IA 1Y6ZA 4FI3F 1UCFA 4PHCA 5EYPA 3PV0A 3KT0A 4K28A 2WF7A 2ZSAA 4R8RA 5ICGA 1FVOA 1X80B 1N36B 3NVKI 3IAXA 1WU7A 4OK3A 1JIQA 1W1WA 2BGRA 5FA5A 5LA6A 4EJ6A 4JZYA 4Y2JA 5I51A 1SEPA 2QXUA 1BH2A 3A4YA 3HADA 1Z0JA 2AT1A 1FNSA 4O4IA 4DIMA 3T0IA 3MHPA 1GIAA 1PNVA 3CTPA 1CB7A 1MV8A 4NENA 2G1KA 2VHWA 4PG4A 5HF6A 3VYUB 4ZWNA 1QK5A 2A4KA 4IF4A 5A9TA 4KBFA 4GL2A 3FHJA 1MJHA 5HKLA 3E9RA 1KWGA 2H3HA 2ZS7A 5DHRA 2O1EA 1OGYA 1EZ1A 4OXKA 2O8EA 2YXEA 4WZBA 3VR4D 1P62B 3ETDA 1DV1A 1R4NA 2I6TA 2ZXUA 5DV9A 2ZJ5A 4CNBA 1OX5A 2BT4A 2Z6VA 4WAUA 2JC3A 4KLNA 5HRCA 1P1FA 1N25A 4GOJA 4K86A 2OC9A 2XECA 1OR8A 1V71A 5FO1A 1BE8A 1ZD3A 4O2AB 3T7CA 1V8ZA 5JD5A 4K9QA 1VSBA 4TMVA 4XD7A 3U3MA 5KTOA 1YZNA 4YPFA 4P4GA 1EXNA 4JOCA 3E3OA 4RGVA 1P2GA 3SKVA 5EERA 5ALJA 5AVVA 4L75A 4BV2A 5IDQA 3BXXA 3TRHA 4FSHA 1G3RA 1WXGA 1OTXA 2VPZA 1NR1A 4DG9A 1MQSA 5JMOA 1XTIA 3SIPA 3BPSA 1RC0A 5EE5B 1K4MA 5JAUA 1RLJA 1FDSA 1QH1B 2JF0A 2ZE5A 3I9FA 1U8CB 2OB1A 2OAP1 2P78A 3BB4A 4K9NA 5EE0A 2QTFA 3T9AA 4XFKA 2JB9A 2W58A 4FK8A 3VAZA 2YWDA 4MWOA 2AE1A 3EXIA 2F1HA 5AHXA 1W59A 3K7EA 1V7CA 4K9RA 4U2KA 2VK2A 3BE6A 1FTYA 1X42A 1NKTA 3I39X 1XAIA 3FFWA 4F9FA 3PDUA 2RI0A 4X85A 2GD6A 3OQBA 1O94D 3A3YA 3H1GA 2YMMA 3DOCA 4B75A 4EHBA 8OHMA 1QYVA 1EX1A 2ANBA 3L4BA 1U0RA 3GFVA 4YUVA 5C1DA 3EE6A 2BW0A 4YQZA 3BE4A 1H4QA 3HM2A 1L5LA 2H57A 4MX8A 1YQXA 2BFNA 3I04A 3LX5A 2ZBFA 1GCOA 3ZN2A 1J09A 1E59A 1U8YA 5I4KA 2BFMA 5FTWA 1ODLA 3DHNA 4Y7CA 1W5SA 1WB6A 2DPMA 3PQFA 2VJYA 1R9JA 2F3QA 4AUKA 1WXXA 5GPBA 2BFBB 2E4ZA 4ZGGA 3Q87B 4AX4A 4Q4CA 1IL0A 3IVCA 4K6CA 2LE0A 3DNFA 5CT4A 1M54A 1X80A 4BKPA 2V0NA 1HRKA 1JAYA 2Y67A 1TA9A 3LRXA 3DUFA 4D9HA 5KI6A 3QU4A 1NW5A 2OXRA 2P9JA 4MGYR 3PUXA 1O95D 1H0KA 3I32A 4XUEA 2OUIA 5CVEA 3MWLA 3SBOA 1BMFA 2YY6A 1RLIA 2I4LA 1YONA 2LCQA 2G1AA 4JSRA 4KVAA 4PYRA 2VJPA 4IV8A 3TOXA 1VJGA 2PUJA 1KE1A 4ACAA 2DSNA 4LOIA 4ZYTA 4MRSA 3WK5A 2HOQA 1Y9ZA 1SVUA 2J9FA 4KXMA 4RJIA 2W7TA 2OKCA 3HWRA 2MCFA 2GKSA 2QD1A 4Q48A 3KQHA 4NBRA 1R0ZA 3ESAA 3SOPA 2A57A 4UAJA 1P8JA 1XD8A 4FGSA 4BNXA 1E9DA 2IEIA 1M1NA 1QQAA 3RG8A 1M8GA 3DWIA 2YZMA 2X0DA 2O8DB 2VA9A 4Q4HB 3NMUF 1ZM2A 4YP0A 1FTSA 2YWXA 5JSKA 5K8JB 1LPSA 3AH8A 4PHFA 1AQLA 4AUEA 4C2BA 1TC1A 1AMUA 5CNIA 1W5TA 4CL0A 2KPOA 4HAUA 1Q1BA 4OU5A 3IAM1 3EEIA 1JZSA 1RHRA 2HA5A 1GWNA 4HWKA 2ZE7A 4HBZA 2GETA 1Q74A 3USCS 3Q0EA 4YRFA 2KBEA 3BTVA 4AMGA 1P1IA 4NNPA 1YA8A 1ZN8A 5KWSA 2ZUTA 1IG3A 1TFRA 3FVRA 3M83A 3LSTA 3I6QA 1GZ4A 4G9EA 4K2AA 1NNUA 2Q1XA 3ICOA 1FX0B 2G5CA 2H7XA 3FWZA 4KQ6A 3UT6A 1AC5A 4TOIA 1W2WB 2Q5CA 5D87A 1EFLA 3L0BA 2NNLD 1NVGA 4G85A 3TQRA 2Q28A 2WHRA 7REQA 1L1QA 1CR2A 1RC8A 2Z6QA 2OHOA 3P2OA 1Q0PA 1V41E 1TYBE 2QLLA 4WN9A 4LV8B 4P4UA 3BHIA 2AMJA 4YJDA 3KUDA 2ACEA 3C4QA 2PYZA 2QAJA 4NMHA 4ZRNA 5GONF 5A4DA 5EJ8A 2I2BA 3BN3A 4WN9B 4L6CA 4RZIA 4C0HA 4JT2A 4EGFA 2PD3A 3FHTA 2FPSA 2BGUA 3C3AA 1AIPA 1DUVG 1C41A 1UKVY 4KJXA 1X1TA 3KZ1E 2ID4A 2ID8A 2JBWA 2IK8A 4FKZA 4Q1EA 4HLQB 2WTNA 4ZRDA 3QGMA 1DDIA 1I0IA 4XX0B 3WKAA 1W87A 4LOKA 4IINA 4BLRA 4ZTUB 4ZOQI 1U0OC 2Z8XA 3P45A 4K03A 3IB3A 5BV7A 2G0TA 3G2OA 4KR9A 1C50A 3AVTA 4UNPA 4HGYA 6YASA 2QY9A 1XVUA 2ZDQA 2AF3C 3K9WA 1QG6A 3FVVA 4TMKA 1EE2A 3AIKA 2YXNA 1HM5A 1XXHE 4OFBA 5DH9A 2VSYA 1YFKA 2GBFA 4CM4B 2ZYWX 3ON5A 1UANA 4AIIA 3HYSA 1AMNA 1JVSA 2GN6A 3ABQB 1JYFA 3MRSA 4HDKB 3W78A 1TU4A 2VCYA 1VI6A 3IUMA 4HPJB 2VLIA 4P34A 4MA0A 2HX1A 3R0IA 1F48A 2IL1A 3GFSA 1RJ9A 3R3ZA 4LZOA 1KK2A 4EEXA 1N1MA 4DBLC 5IXYA 3IA7A 3T38A 3HDGA 2CWDA 1MLDA 2P6UA 9LDTA 1H8HA 2MYTA 2XY4A 2JATA 3EIUA 3OEYA 2ZBQA 3DMDA 4IDFA 4NMLA 1B1CA 4BVKA 1HT1E 3MMXA 2WWGA 2C7BA 4YRIA 2QTZA 3GLHE 2Q6OA 5L3ZA 3I5XA 3GP3A 3LVRE 5KMGB 1Z83A 3H5IA 2PUCA 2C5LA 2PCJA 3Q85A 4MZXA 4JUBA 4NU8X 1TTTA 1IHPA 1JAHA 3WLRA 2W71A 4YCSA 1MNQA 2BHRA 2ESRA 4YP1A 3BFJA 1KJYA 1W88A 2C3MA 3DQPA 5JC8A 2NTYC 2AZDA 4M21A 3VH3A 1OBOA 5CYPA 1TT5A 5ALEA 3VKVA 4D2IA 5B1YA 3CA8A 2O3TA 1CY1A 2F59A 1QHSA 4DSZA 5JDIC 1MDFA 4MJ3A 2AFIE 5TMBA 2PT5A 3N6XA 2VP6A 4F46A 3RYTC 3QFSA 1SQ5A 2ZRMA 5CFLA 5KYTA 1NLZA 5EAIA 3ZZUA 2VJCA 2QR2A 1EVZA 5G0VA 1PG5A 1OILA 4EJFA 2VS1A 1PWZA 4PNHA 3CEJA 4QOIA 3PI7A 1I4DD 1SOUA 5C4IA 1Z6QA 5C7LO 3KT3A 1E1RA 2VUHB 3ZK8A 4CCYB 3F7NA 1JBKA 4JGBA 4PC3A 5U1PA 5TLSA 1P31A 4QTZA 4W5NA 3QFHA 3PIIA 4AICA 1LPOA 2ECFA 4DGSA 5JI3E 1NXWA 2OWDA 3GV0A 4XLTA 4B3XA 4B83A 4CM9A 4V3BA 4ZKDA 3ZY2A 2D8MA 2QSYA 4ENVA 2B7BA 1QDLB 3NT4A 1VE1A 1N2CE 2FZKA 4J29A 5ALXA 5BN1A 1YI8A 2X0RA 1YZHA 3TNFA 3H6GA 4E7PA 1HEYA 5CJPA 3E81A 3AB3A 4B73A 3DAOA 1PAUA 1QIEA 3U4GA 4BKOA 1USVA 2D4HA 3JQPA 1F9AA 1IBLB 3EY4A 3MIIA 1Y3CE 3WWPA 2WM9B 1OAKA 4EUFA 3MJVA 3JQAB 1VHDA 1LSJA 1N8TA 2I03A 2Y4OA 2HK8A 1Y5RA 4F4JA 1E18A 1WQ3A 1XRRA 4RQBA 4BP9A 3OPYA 2O3JA 1FK8A 1MVOA 3TUIC 3ROKA 3OFSA 5ES4B 1EWQA 5C8VA 3I83A 1U0JA 3TLZA 2Z08A 2G6TA 1IH8A 3LE8A 3H19A 4BCDA 1EP1B 5DOZA 3EOAI 5IHXA 2EJBA 3DBRA 1OVMA 1Y9EA 5DBFA 4ZAXA 3A8TA 1HXHA 3FRJA 2WLTA 4OHOA 3O8RA 2Z6UA 1B7GO 2ZJ0A 2O2DA 4JYZA 5F9FA 4B45A 3HY6A 2PQ0A 1DG1G 1PFVA 3B51X 1Z8FA 2ACKA 1H22A 3KCQA 4BPRA 4HVCA 1OI2A 2Q3HA 4R9SA 1V8PA 1PGPA 1ZNQO 2DKOA 2F64A 2QJTA 4H0FA 4L0MA 4PC1A 3AT1A 4MVYA 2QVZX 4FUQA 5LM3A 5M5BA 3VZDA 5D5QA 1J5EB 2GBCA 3HGTA 2BGNA 2V5VA 4Q4DA 2J9ZB 4EQ6A 4OATA 4ZDKA 1TRHA 5LA6B 2AMLA 1UR5A 1XYYA 5REQA 3QRWA 5LMCA 2LRHA 4J2OA 4P0QB 1U8ZA 5A05A 4BLTA 1UM9B 4MVCA 5H80A 3RFVA 1L4YA 5J2UA 2B3DA 1O97D 4A6XA 4EKYA 3V55A 1NC1A 5CB6A 4JI7B 4MV1A 5JZVA 1I7DA 2G36A 4KPYA 2EC5A 4BQOA 4ERNA 4CIBA 3FMGA 1D2NA 2IDMA 4BGUA 4BEVA 2JI6A 4CLOB 2JFNA 4OF4A 5HUQA 2E55A 1ESCA 5SV2A 3DTYA 4KYUA 5J2TB 1U5CA 2ZSKA 3D54D 5ALKA 4MWTA 1LQTA 1TLFA 3KLBA 1Q77A 2B1RA 3CYFA 3FZQA 3AL2A 4FT2A 4UU8A 5F73A 5CT8A 1YMUA 5AT1A 4R1PA 4EG8A 5HJ5A 1GY8A 1V9SA 5EE3A 5HF9A 5A6SB 3ER6A 4YMHA 2FHSA 1SPXA 1S8AA 2PGOA 3HVIA 5DCYA 2X7XA 3RF6A 4IIEA 4OLHA 3RT1A 2YY7A 4OQDA 2YWFA 1V95A 4BLWA 3MGKA 5IYZB 2Q50A 1ODKA 4IJ5A 4J75A 5C53B 3EGXA 5L3VA 3EC7A 2W9XA 3G17A 1A2OA 2B8EA 2ZJFA 2OGTA 4KWTA 4QDJA 1VIMA 1U3FA 4XLZA 1RBQA 1J4AA 3RIYA 1NN1A 2HTFA 1WBDA 5KNBD 4A92A 3MS2A 4JBNA 2E7ZA 1GQQA 1MX3A 1ODTC 2DH5A 3OD1A 3PSAA 4S1VA 1VG8A 4CYMA 1RZUA 2MR6A 2FB9A 3RASA 4OHYA 4DZTA 4E0BA 1IY2A 4E4TA 4A8TA 3BGOS 5ELMA 4Z49A 1T6NA 4DLTA 5B6PA 1W1IA 3IMGA 4ENUA 1Y89A 3DCYA 3PGJA 4TYMA 3SF8B 1QMGA 1QONA 3UHPA 4JYAB 3QQPA 1WDLA 3O1HB 3TLYA 1R5OA 2DHCA 4LZJA 1ZXXA 4O4HA 3MTQA 3O9MA 1KZ1A 4OEHA 3GY0A 4RHEA 1QE0A 3S29A 1PW5A 4XLLA 3U3JA 5TPZD 2JIBA 1F5SA 1IXKA 1T8SA 1VBKA 1J06A 5F1OA 3HCNA 4HYQA 2OY0A 3AB8A 3EUEA 1M3SA 3FHCB 3R0ZA 4H0NA 1A69A 1PFGA 1QGYA 3O83A 3O47A 4BMSA 4MQBA 5E3IA 1CEEA 1MABA 1U0EA 3K92A 1GPYA 2P4UA 3T3MB 2YWHA 4G09A 1TO2E 4TLMB 4D4LA 2Y1GA 1F8XA 2L82A 5IG2A 3RC1A 5DNAA 1RWPA 4CN8A 2MINB 1GADO 3P19A 1YS6A 2QRMA 1SELA 3GYBA 2H2WA 3MCVA 3NDPA 4UUAA 3WGJA 4N1AA 4F5WA 3VPGA 3A6KA 1ZAYA 4RZUA 5REQB 1ZH2A 5TS2A 4CEJA 2F43B 3DMYA 5HS4A 4P4SA 4DBLE 2YYSA 2X1MA 3EZ2A 4AAYA 2XVAA 3U5ZB 3QPBA 3GJ5A 4YUXA 3OEEA 1L5HB 1J8QA 3EPKA 1Q21A 3O8CA 1OGJA 3CLTC 3DMHA 5TE9A 4BY9E 5KOJA 2ZFUA 4A26A 4YAGA 3V4LA 1KP9A 3N8GA 1C1XB 2W2VA 5FBWB 3FA2A 3JQ9C 2QA5A 1GOTA 3UMVA 1NM5A 1Z13A 3JU3A 3SYRA 3O1IC 1RYNA 2IZ7A 2AWOA 3PPXA 3C4VA 1K3UB 1FNCA 2HYDA 4OYRA 3L7MA 4JBWA 3AY0A 4BWFB 3CINA 4WLVA 3HDTA 2RHBA 5BSTA 1XPJA 1QDEA 3SOZA 1YZLA 3SF8A 2W90A 4F4FA 2D2IA 4IXNA 1IOLA 3I01M 4C3OB 2I1LA 4KPUB 1GRCA 4CNQA 4OKSA 1AQNA 3SP1A 3I9V6 3UT0A 1SK9A 3CSUA 5EMMA 4C5CA 1JEYB 4OREX 6ADHA 1UL1X 2Z9CA 1ZLYA 3LYHA 4NHOA 1HT0A 1KO7A 2ZYHA 4OFXA 4I55B 5ARDA 3U6BA 4BGDA 1O94A 1OLSA 4YPOA 4RTOA 2ZI6A 4M6WB 1LEHA 3FBWA 5ALHA 4CT4B 4F92B 5JATA 3WIOA 5JCOA 1IPFA 1BOOA 2Q62A 2VNHA 3VA7A 2HHCA 4PCVA 3U62A 1NVWQ 1NURA 3EXHB 4UM8B 3PICA 3ZBTA 3NB0A 1QR2A 1JVNA 4JHLA 1B0AA 2JGIA 3V42A 2C9YA 4A10A 3VC7A 4C3UA 2AOWA 3VU1A 4EPRA 4KFCA 4AY2A 4R0VA 5IAOA 4CQJA 1R6AA 3PTLA 3ZW8A 2YCLA 3QVTA 1YSCA 4F0JA 4MVJH 3E4CA 3HJHA 2BEWB 4DMLA 2B4YA 3ZBUA 5CA0B 1HDGO 1NN0A 4LNUA 1TAHA 3HA3A 5CTJA 4G37A 1OFHA 4B43A 3RVQA 2Z5FA 3NTLA 3W0LB 1S1MA 1XQ1A 3JW8A 4TKUA 4CKWB 3FOEC 2AJBA 1M1YA 3W5UA 4Z1OA 1XJQA 3FCOA 1V5IA 3LZ6A 3TEJA 1YJCA 2YX1A 4AJLA 1HL7A 1U2DA 2AJLI 2OENG 4HEJA 5FBLB 1W73A 3AR6A 4JUFA 2V9CA 1DCMA 3M4ZA 3ZW9A 2YZ2A 1CUJA 1JW9B 4EG1A 4EF4A 1WXIA 4L1KA 1F3OA 1VLVA 2ZQ5A 4KMMA 1G7RA 4P4NA 2CUTA 4FDMA 5CDFA 4KN6A 2BZ1A 1YUMA 3ASZA 3ZJ5A 1F3LA 4LHEA 1K68A 3SDSA 4EJ0A 2RK4A 3GARA 4R98A 3WBKA 3HP4A 2BZSA 2VYVA 4ETMA 3P52A 3CWZA 5AM3A 5CG1A 4IUCS 1UDXA 3UPUA 1IOWA 4PG5A 3M70A 3N2EA 1PW7A 3W5CA 1E8MA 3BJRA 4I3HA 3EGOA 1Y34E 2D1FA 4K7JA 3Q2IA 5AOBA 2BH2A 1FQKA 1GA6A 3E8MA 3MGGA 4KGDA 2XTJA 4HXEB 1AV7A 4UE3S 1S3GA 1HEIA 4Y18A 1NF8A 5JFTA 3F1LA 5FA8A 5HIMA 2B6NA 2Q3EA 4CMBA 3LX4A 4WGGA 2GZ2A 3BC1A 1F1JA 2BMFA 3WYBA 2RH9B 4XVUA 3AI7A 1N7JA 3T6KA 1J49A 2D1RA 1OIWA 1WUIS 2MTBA 3BSWA 2DY0A 1BDJA 2HO4A 1VIVA 2NUTB 4G0YA 4GYWA 2Y71A 4YJ2B 4FUTA 4HDSA 3ROXA 3HM9A 3AFNA 2TMGA 5EJ4A 4HNHA 4BFXA 2C8LA 2KQUA 4Q3LA 3SIWA 3AVXA 3HUFA 1W8DA 2B0JA 1JR3D 2FG7C 3AVPA 4NDAA 3TQIA 3U7JA 4ZZ1A 5L3QB 1ZBDA 3IJEB 5EXSA 2QLJA 3GLIE 4UZFA 4O2AF 3DE7X 1G59A 1F9EA 4UD6A 3VMFA 4R2WA 1BEEA 4X8HA 4XB2A 4I4CA 4M37A 5CGZA 3KDPA 4AO8A 5DGXA 3QSGA 1MU0A 1XRLA 2BGTA 4J1TC 3A1TA 4F5YA 2B37A 3VNQA 2QRKA 5IBPA 2P40A 4QYXA 4QVGA 3O94A 4L57A 1KFJB 1R0WA 1UFQA 2H8GA 2K2QB 3FR8A 3JZMA 1KEKA 4EHKA 5JBIA 4NNJA 1JG6A 4YRCA 1TQDA 5GJBA 2QT9A 3ADDA 3AUYA 2WIAA 3ONVA 3V7NA 4WY5A 1REQA 5IMBA 1VFPA 2O6HA 4URHA 1K63A 2F17A 2JCBA 4GMHA 4I55A 4LF9B 2QAGB 3ONFA 1ZI9A 2C5GA 5ESRA 2GTHA 3IJ5A 4Y2YA 2PN1A 4AJEA 1XZPA 4FOTA 3SWWA 4F6RB 4QIHA 4QBGB 4WOCA 2DJIA 2QD2A 3RWOA 3BMXA 3EQ6A 1DQYA 1DU4A 1V8FA 4BNIA 1D07A 4V0ME 5LQSA 5K2MA 1AZTA 4OIMA 1V35A 1X3LA 5A62A 1VBNA 1QGDA 1ISGA 5LDGA 2IQ5A 4I4LA 1I1QB 2RJOA 4RANA 5CJ2A 2VHJA 4PSVA 5G3YA 5IABA 5JXHA 3AI3A 4H59A 4RTJA 4JJKA 2HN9A 3W5JA 5KS2A 4FGUA 4B3SB 4O1MA 4OYLA 4DILA 3PGVA 1Y6FA 3LC1O 1CBUA 3ZLVA 1SBCA 4LXXA 3D31A 4MRPA 4OAOA 2YC2C 1MORA 4OGLA 2CT8A 3QIVA 4JZKA 3L1JA 4BQEA 3C1TA 3BDIA 2GZAA 2IYWA 3FPCA 4LJKA 5CB0A 5TQVA 3FX2A 3WYEA 5HZKA 4G63A 2HCBA 4PTZA 4ZYUA 4FNGA 2BBOA 3E15A 3ME5A 2BM0A 3HKEB 4YJ3A 4MEBA 1ZAKA 2I65A 3N7UA 4WZAA 3LY8A 1DCTA 2I2CA 1YTLA 2IIQA 3TDMA 5BY2A 4CETA 4KRYA 3E0XA 1A76A 2QV0A 4L4YA 1RMQA 2WQ6A 1E1DA 3NUZA 4JXXA 4E70A 4L5BA 1MVNA 5H3LA 5IFKA 1Z75A 2QD5A 3OT4A 2QGNA 4X63A 3MCWA 4Z4FA 1SVWA 3CNNA 2DUUA 2Q4TA 4XSVA 3DEAA 2OLEA 1L2TA 4HUQB 2QT0A 4X3CA 3VKFA 1H5NA 2GZ3A 3Q7TA 4IIUA 1G7SA 4C01A 1KDTA 2V58A 4Q3EA 3ZR4B 4B0PA 1N2GA 3IAFA 2ATVA 1JT9A 4MVJG 3SX0A 4C7OA 3ZDZB 4YCNA 5BWMA 1XMPA 2OD2A 2YYAA 3QG5A 3AGPA 5SY6A 4D3YA 1EWYA 1M6WA 3JQ7B 4AMUA 1R4AA 2Q4DA 4D98A 4CDGA 2BTQA 2FW6A 2Y66A 3OCWA 4ROSA 1E2HA 3VR6A 5AKYA 5JHGB 4G0MA 5CEEA 2EKZA 2BP7A 1MB3A 2DCUA 4QDZA 5FOUA 1EWKA 2ZROA 5ILGA 1TJNA 1EE1A 2VQ6A 1GYRA 3UENA 2C4KA 1J2YA 5IDXA 3E2PA 3FPFA 1FQJA 3B1JA 1N34B 4I46A 2AC4A 4OQLA 4HAYA 4UXJA 4Y6OA 4MUEA 3D6AA 2WM2A 3ESCA 4G9BA 4RW0A 1AS2A 4YNBA 1PFWA 3HCOA 5EMLA 1Y8AA 2BEKA 3ZCTA 3DL2A 4QDXA 4TZTA 4XARA 1ISJA 2I6QA 3SLRA 2EQ5A 1V5EA 1OAOA 1P0PA 3MJFA 1IZ8A 1NQTA 2TSYB 3QBJA 3DB1A 1LNZA 2O2IA 3NOVA 1L7PA 2ZUVA 1H2RS 3A3PA 1DZIA 3ICWA 1O5IA 3ZGNA 1KFKB 5FTMA 2YIMA 3OQIB 3V1TC 1P33A 4BNNA 4B17A 3B85A 2I87A 2IUEA 1ESNA 3ELWA 4BWYA 3GQVA 3ICVA 3WNVA 2E6UX 2W0SA 2V3VA 4EB0A 1NL3A 1SB9A 1SXQA 3M4NA 3P0HA 2OKGA 3R1IA 4MYUA 3GCWA 1BN6A 2ODBA 4N47A 1U8AA 3KQOA 1CUEA 2PU5A 1K66A 3BMNB 2G40A 1SBHA 3CO0S 1EB9A 2ZVJA 3JD1A 4GOLD 5HE8A 2NUPA 5BSKA 4FFVA 1N4AA 3HDJA 3E7PA 3H2IA 1XI2A 4XM0A 1MRSA 5FBHA 4B0OA 4V2IA 3QYFA 1XMQB 1OFUX 4PQFA 3RQIA 2QZPA 4ZCTA 5LP6A 2QUKA 2WG2A 2EDAA 2G71A 3V1NA 3O7MA 3DD5A 4K88A 2B4QA 3VTAA 4AX8A 3AF4A 5F64A 1G2QA 5KNBA 4DIBA 4LCJA 3K9GA 5EJ2A 2ZRQA 5F4BA 4A8JA 4BUZA 1NP6A 1UJNA 3ADPA 3HXKA 1WZNA 1ZYUA 3OPXA 2DUJA 4Q4AA 4UM5A 3WRYC 1ECJA 3L4JA 5JNUA 2XDAA 1RJFA 3ABIA 2FYTA 5DI3A 3KB6A 4TV8A 2WVAA 3AG5A 2JS7A 3ENNA 5G1NA 1GGJA 4AWXA 3DMFA 2W6NA 3X3HA 2RGGA 2IEGA 1N9ZA 1C4KA 3TW8A 3TMYA 3EIOA 4FZ5A 3QFCA 3WRVA 2RKWA 3FTEA 1S3FA 3R77A 4NP6A 4OXRA 4BO2A 2FPWA 4ID9A 1QHEA 3AFIA 3ZE2B 1OH7A 4LX0A 4BRZA 2YOFA 3PC7A 4D57A 5CT9A 3VNAA 2HY7A 3TOZA 1U3CA 4DKJA 4KMOA 3AKYA 2H2DA 1XPRA 1P9NA 1QQTA 5KU1A 2XZDA 3UMYA 5HM8A 3I4CA 1F17A 2NZXA 1EK6A 1ENYA 2VG8A 1E7YA 2ES4A 2V4ZA 4AM8A 1NSFA 2AI2A 4GOMD 3H4MA 1DBWA 1QVZA 4YAKA 3NHBA 2K7FA 4R0MA 4GT1A 2BVNA 1HTTA 2CB0A 2XBMA 4IDQA 3UB2A 3UMRA 3QV2A 2YN2A 3MWEB 3HDYA 4ZQCB 4RTPA 1Y1SA 2FX5A 3RU2A 1JFSA 4R54A 4AN1A 2DBZA 2O05A 2NZYA 4PIPA 4AQYB 2ZIZA 3B3GA 1YDHA 4TWIA 5T8KA 3KAJA 3ZTTA 5C32A 4RL4A 3H7AA 1JP7A 1WO8A 3DONA 2CSXA 3ITKA 4ZO4A 7MDHA 3C7AA 3ORHA 4MKIA 4A1OA 1AHHA 1ETHA 4RKRA 5DGIA 3F8WA 3KLMX 2HWWA 3WB1A 4CQMA 2P65A 1VGQA 2JRCA 5GJWC 3KV1A 1WP9A 3MTGA 3RFXA 3UKJA 3KLOA 4H7DA 4DYDA 3K9CA 2FZGA 2Q5IA 2P6RA 1C9NA 3N0TA 2GYUA 2IY7A 1FDUA 3L1UA 1PEKE 2R00A 4MQFB 3NNSA 1FNMA 1CRZA 4JEIA 8MHTA 1WB4A 5A3RA 1B1AA 4FFWA 4LBWA 3GVCA 4YJFB 1ZM3A 4AJ1A 3DYBA 3OEED 3OO0A 2PRIA 4JI6B 3VDQA 3COJA 2H54A 3TAHA 1GRVA 4RPJA 1C1DA 4F7WA 1NUSA 5L6MB 4AY4A 1MAAA 1WM1A 3B3QA 4HPWA 3O8DA 4KK4A 5HBGA 5J5AA 4D9EA 2E6KA 1OLOA 1VHLA 3FCXA 4XOIA 4Y9RA 3GGOA 3QF7A 1T25A 2W22A 1VMDA 4HMPA 1KP3A 3PRJA 4PFQA 4MUHA 4UPDA 1MX1A 2FDCA 2JIZA 4YYZA 3OHPA 3HJTA 5IAJA 1ZD5A 2RC6A 1XHLA 2AUNA 2YR0A 3L1IA 5ALWA 2R96A 3K8OE 3LGSA 3R0QA 3EWNA 4C06A 4DCCA 4QLBA 5AW8A 5K09A 2JFXA 2AOTB 5FKJA 2CK3A 2HHJA 4EY5A 2VK4A 5I9NA 5F1PA 1M75A 5E9QA 5IDVA 2ZK7A 5NLLA 4D97A 2XGSA 4W5HA 4BBJA 1EWRA 4DLKA 3SPXA 4Z0HO 1S8FA 1VGVA 2Y1DA 4P31A 4Z8YA 3KVRA 2NO5A 2PNJA 3PYLA 3RS8A 2TYSB 3W6UA 4LS3A 5BQXA 2X2OA 3FYUB 1V3VA 4JP8A 4Z0PA 1E0AA 4BU0A 4DDUA 4OI2A 2EAUA 1BN7A 1GZSA 2RHHA 3I2KA 2CUKA 4OP1A 4HYTA 2W6IA 3BWDD 4WFJA 4ZI7B 1WY5A 1R0BA 4O33A 4MR7A 2G82A 2NSDA 1NJ5A 4G01B 1U6IA 4OKNA 2QW8A 3M5PA 3NWOA 1LVHA 3NBQA 3KOWA 4FNMA 3RH0A 1EMDA 1TW2A 4AW9A 4TLCA 3WB9A 1X7HA 2PSFA 4YWJA 2IX9A 3N2LA 1UXGA 3OCCA 3PRKE 4FCWA 1F38A 2JAQA 2DWUA 5A2GA 1T6ZA 3IYLW 3NOQA 5E1DA 1YVEI 2W2MA 3OFJA 3PLRA 3O8NA 4TSFA 4D3FA 3R3UA 3UIEA 4JROA 4YAIA 4HAWA 1GGFA 2HLPA 5IYZF 1E9EA 1YGPA 2FN9A 4BFZA 3M6UA 4DF3A 4XGRA 2PA0A 4FEYA 1JQLB 4M0UA 2IYLD 1RMYA 5I7SA 5B7PA 2GKOA 1DXQA 2VBCA 3D43A 3DYIA 4JASB 3ZHSA 1ZK1A 3NKFA 4F4DA 2DR2A 4JVSB 3RTCA 4KYTA 3H5NA 1DEXA 1ONSA 2F8MA 4QFBA 4G6ZA 5JD3A 3SF0A 1RXEA 3QE4A 4QLAA 2DEUA 3H1TA 2ZQYA 1HO3A 5SYMA 4P3YA 4QUKA 1PQYA 5KNDA 1SOAA 4N82A 3DB2A 3TG2A 1Q6ZA 2YRXA 1NMXA 1LV8A 3U31A 1I6WA 3PL5A 2CLKB 4GMGA 1V3TA 1KYZA 1YE8A 1JGTA 3KSRA 2ID9A 5K1ZA 4JLOA 4WINA 5AUNB 5DHQA 3W7BA 2PRKA 1J23A 1J0AA 1VYVA 1THMA 2EBHX 2Z95A 4IL5A 4KP7A 3SGLA 2VT6A 4Y1EA 2X0FA 4ZVVA 2XTNA 1TQHA 3WMGA 2W5UA 1E0JA 2ONKA 3TZBA 2O2XA 3BCSA 3CTMA 3LBIA 3L84A 3PQ4A 1CVRA 1QCZA 5SY4A 4FR0A 3UNXA 1P75A 3ADOA 5EN4A 1LPMA 4P54A 5AVJA 4CLHA 5ICEA 3THOA 1QU2A 2I99A 3OOWA 3L7LA 1K4YA 1KO1A 5LXTF 2XXJA 3F5SA 3CX4A 1D3AA 1HFJA 2PH1A 1D03A 1CY8A 1RI5A 1EA5A 3I6YA 1OLXB 1ULAA 4MINA 1DOHA 1DWPA 4MW1A 2QJFA 3MMSA 3KT8A 1ZCFA 2VN8A 3NDBB 5L6LB 3NO4A 1MHTA 4IQGA 1AKRA 4BOYA 5DULA 4YT4A 1Z38A 2J3MA 4DUGD 1XTRA 3I2IA 5BRAA 4L8GA 1SXJC 4JJ8A 4CTKA 4XJXA 1BDBA 4B3MB 2ZAGA 2VJNA 3QPVA 5EWJB 4YFYA 3UUWA 2Z4RA 1Z6GA 3ODPA 2V55B 4C4YA 1ZD2P 4BPBA 5KPDA 1J33A 1K6XA 1L7BA 1EM8A 3LTNC 1V4VA 2TMYA 2GF0A 3IAAA 3WLHA 4Z9XA 1ADJA 2AR7A 3PHCA 4RA6B 1CEYA 3TZKA 5KOYA 1VJRA 5FEMA 2UUCB 3B82A 2O50A 1J8DA 1JFFB 3HHEA 2PV0A 4XIJA 4HZGA 4DR1B 4MRAA 1E0SA 4DYVA 3O21A 1UDBA 3G2PA 3WOVA 2PX2A 2PM8A 3EY9A 1IN4A 4O29A 4HNAB 4IIBA 5JWOA 2JKVA 3WFZA 2PKEA 4RJLA 2HZ7A 3GGDA 5A3JA 4GZ6A 4YJKA 4EITA 1KK3A 4NDNE 4X6UA 5E6UA 4IMIB 3CVOA 1WPGA 2ATCA 1WVMA 2PT7A 1WPQA 2ZLBA 2ZT5A 3GWZA 3OTGA 4XGQA 1U7TA 1UC4B 5B36A 2UXBB 2NZ8A 2IFTA 2YFHA 1KZHA 3S5JA 3WNBA 2C95A 1Z8DA 2VHZA 1V6SA 3F3SA 3QXSA 1NVXQ 4L9AA 3KYBA 2OAQ1 4LHZA 5GZ6A 1EUDA 2Y8EA 4UDYX 4NBWA 4I1OA 5TVKA 1TZJA 3FYDA 3NM6B 4B4OA 4KIGA 4QHYA 1L7VC 1KY4A 3GNTA 3MWDA 4HVTA 1UOPA 2I4OA 2QSJA 2NYVA 2WV7A 4BVEA 1BMTA 1H0HA 3I1FA 2OCBA 2YBEA 1M6EX 4B4UA 2Q8PA 5TV2A 3F5QA 3EHEA 3AUTA 1NVMB 3GL9A 1JEQA 1XTBA 2XDYA 3C6YA 3H05A 3ND5A 4XIGS 3AINA 2K5UA 1BE1A 2V0GA 2C00A 1NR7A 2VUSA 5HZMA 1DOZA 2XBUA 2WD7A 3Q6NA 4YP9A 2FWNA 2PSEA 3EC2A 4QBTA 3B2EA 1WRBA 1FRNA 4I36A 3STYA 5JBQA 4A2WA 1KDPA 1JHOA 2JGDB 2O7RA 1U99A 2GX6A 3WG9A 2YYYA 3QITA 3KQNA 3A31A 2NMVA 3S8MA 4XJTA 1CUUA 4HGNA 3VKHA 4IV5A 1Y8CA 4PPFA 3B48A 4N18A 1Q1EA 1OWLA 1UEJA 3V1UA 2VCEA 3ZGLA 4PYLA 2GK7A 2BKEA 5AOAA 1ADFA 2WHEA 1G0OA 1FSFA 1U98A 3GRAA 3ZLBA 1JEEA 2IXDA 1XZKA 4UMEA 1MZVA 2J8ZA 1V4BA 3VOTA 4CTMA 5IWCA 4EZBA 4YXWD 3KHUA 1LB1B 4U3JB 2NTJA 1ST3A 1O97C 1V11B 5D84A 1EE9A 5JH7F 2WYHA 3ABOB 4EDFA 4BO5A 4ME6A 5EEGA 3UZUA 3VI3B 3A1NA 4B6GA 2P2GA 2CJFA 2YFKA 4DANA 3N2IA 1QIJA 2NUPB 1O03A 1PR9A 3QI7A 2BBTA 3JCZA 4R2XA 621PA 2H5LA 2W6PA 3MBOA 3OZWA 1E9AA 3PE6A 4QQNA 1XZ8A 4L08A 4B6RA 4NOKA 5CH3A 2K4MA 3RVOA 3UMBA 3ELBA 4FLEA 3IEMA 1IEWA 3EX7C 2AN1A 3PWKA 4HWOA 3PI6A 1ABFA 3AW9A 4RGBA 4NBSA 4M7PA 2AHOA 4MRMB 2BLLA 4LZPA 5T57A 2P7IA 2XVYA 4MI1A 3Q15C 2FPPB 3L18A 4N7MA 2EWVA 3RS0A 3ENVA 3EGWA 3QOYA 1U28A 1V48A 1LSSA 1E60A 3TLCA 1CUZA 1YCHA 3UB4A 1PWYE 3AP1A 4F1WA 4HNGA 4E5UA 1LD3A 1CDOA 1GILA 1UODA 1NQWA 2J3HA 2NYUA 2HJVA 2OXEA 4HN4B 1Q12A 1E79A 1TM7E 1DXYA 2CJPA 3Q98A 4HAXA 1UK7A 5LD2C 1W4BA 2K6GA 1TIBA 5THXA 3PJRA 1B42A 2EIXA 3LPMA 1EK5A 1X8KA 1SZCA 4H6PA 3KM0A 4IPTA 2Z2IA 3GP5A 4KMRA 1GNTA 1AQIA 4BL5A 2AUTA 4D9BA 3JQEA 3BF7A 1Z15A 1VL1A 3BMOA 4OI1A 5TQJA 3DDCA 2FDRA 5FOTA 3GVIA 3QHAA 4P7BA 1CS0A 4CGYA 1U7OA 2I33A 2VHVA 1BHQ1 2J0VA 2GZMA 4Q19A 1NPDA 3KSBC 3HJAA 4DR6B 3CRRA 2VYCA 3AXSA 3D3NA 4QDTA 4YLEA 3ZV3A 1EFVA 4WKPA 4KWIA 1V11A 4D0RA 2WIJA 3BK7A 3ETGA 4ZEWA 2GN9A 2EL9A 2VT3A 1R4MB 1UBOS 3DE0X 3PC8A 4PR0A 3ZD8A 1AO3A 4HZIA 3ZU3A 5CA1B 5T6MA 4TLDA 1NM5C 2XEDA 3RODA 1V2HE 2H4WA 1MENA 3WB2A 3HH8A 2ZPUA 1CDZA 1A1SA 1H65A 1RSZA 3QFTA 4KRGA 2H85A 4ML3A 4Q9DA 5AJZA 3RARA 3VHLB 4WOKA 2JJ1A 4YUZA 3QYJA 2J85A 4GM1A 1U4NA 2PV7A 5DTIA 5DI9A 2PIAA 1XKXA 1T8TA 1GL6A 5C37A 1L0BA 3LOUA 2L19A 1CF2O 3AFMA 3QELA 1CVLA 3G5LA 3PFBA 2CNOA 1IG0A 2V7VA 2BR5A 2WW8A 3D0QA 3FBGA 3I9LA 3CF6R 1Y9DA 3LCUA 3ML1A 1DEKA 4EK9A 4GL4A 1ACLA 1NTOA 5G0WA 3H84A 1NVAA 4YXWA 2O2SA 1NVEA 4OJQA 4I8IA 5DSTA 5AVSA 2HMTA 4BB6A 1ZD9A 5AUPB 4L5IA 3LBFA 4OO3A 4RAQA 4G4IA 4R01A 4RVGA 2J4CA 5EEHA 5FI0B 1E6WA 3V8EA 3ZCPA 2RGCA 3K3PA 1DL5A 2GAAA 2P3OA 3ZXSA 5AXDA 4CG2A 1XZDA 3O73A 1R3UA 2BGMA 1N6LA 1JWAB 2SKCA 2YRFA 3PGA1 3K94A 3ZU4A 2O2JA 4EI2A 5KEIA 1YTUA 1Q7CA 2COEA 2VO1A 3UBMA 3RYCB 5IXJA 3I9KA 3KT6A 1BD3A 1PFKA 3DT9A 4GG1A 3ZI0A 5K9ZA 1W6UA 5DCLA 3LPCA 4XTRA 1SXJA 5GWXA 3IXLA 3O7WA 4IJMA 4RM2A 4IX9A 4U5XA 4IIHA 4TT8A 1HDCA 2OE2A 3KELA 1IUNA 4LGYA 4ZVSA 5AXBA 1PR0A 5I9MA 3RC7A 4BO1A 1YA6A 1KIAA 3BGWA 3USES 1TFUA 4BQSA 2Y92A 4C30A 4MYRA 1HY3A 4ZEOA 1RWOA 1NBME 4I81A 2GZHA 4V24A 2ZRBA 4EB3A 4L3WA 4ND1A 3TTSA 1IPEA 1Z56C 3OU2A 4Q82A 5KNCH 1ZIPA 1X7WB 2H2GA 1KRHA 2WE7A 2I6UA 4G41A 4H7HA 4CR8A 5BV0A 2FE4A 2CLOB 1IQRA 2VT2A 4QGHA 3RUAA 2X4IA 1XNGA 3JZAA 1PJRA 4NQZA 4Q3AA 1VCNA 2QG4A 3ED5A 2XZTA 1PV2A 1R4ZA 1GXSA 5BQ5A 1KPIA 1YDWA 2JVJA 3EPPA 3ILYA 1SCIA 1ECBA 1WW8A 3LCRA 1I4TD 4FT4A 2ZS8A 2IY8A 4WDQA 2L17A 1YHYA 1V43A 4RNDB 3ZKWB 5C5CA 2JLVA 1DGQA 3GMDA 4L16A 4C1NA 1GVNB 5MHTA 3C3EA 1XC7A 1IVNA 2IYUA 1CYDA 3HLYA 2EZ9A 4D5GA 1TUBA 4F3CA 2X58A 2FJUA 4G5YA 3R7WB 2V8BA 3PDCA 2QP3A 1PJ3A 4V0LA 2DULA 1I51A 1LV7A 2WSLA 4IDCA 4KRXA 3BJMA 2PWAA 5AWFC 4NFLA 4Z7NB 2XOEA 5IT4A 4ZQBA 4RK0A 5SZJA 3HJRA 2H1SA 1TYCA 4DLYA 1E2FA 5HCNA 5A1TA 2UVPB 5DNWA 1I4WA 2WPNA 3ND6A 1X74A 1SUEA 2PNFA 2HMAA 5KYWA 5ELXA 3ND7A 2BY4A 5JTUA 4DA7A 4QEKA 3ODGA 2QUAA 4HWGA 1QBGA 3C7KA 4FE4A 3KDSE 3TM4A 4DSOA 4QAJA 3I0NA 2YFYA 1RQRA 4CG1A 1LSOA 5JSZB 4TS3A 3I3OA 2BRUA 2VJOA 3ZCSA 3STHA 1NE2A 1JSXA 4GR4A 1NBOA 1R8SA 5HX7A 3IPYA 1X1AA 5G1PA 4DEYA 2ZBUA 1DNPA 3G49A 2D2FA 4I5EA 5H3CA 1CUYA 1KI6A 3UK2A 2WAMA 1OROA 1T0BA 3DDHA 1A9XB 4GBED 4X7MA 5DRTA 2WHYA 1V1RA 3WLTA 1O4WA 3UOGA 3E9YA 3R5KA 4JA2A 1XELA 3HBFA 4ZODA 3ISTA 5JJKA 1OT3A 4ZFNA 1GZ5A 4R1MA 1KVUA 1NBHA 3NYWA 4TXNA 3WMEA 5C5DA 3HQ4O 1EESA 1YRQA 2GNAA 2OBMA 4MI6A 4ZAZA 2RGNC 3K70C 5DNYB 1Z4IA 1NKSA 4FMPA 4QTYA 2ZYTX 1KO4A 3NTXA 3WBFA 3GGJA 2GD1O 1PR2A 1P18A 1YIAA 2J5XA 3IOCA 3Q3JB 1RR6A 1AUXA 1ZA1A 3QF4B 4TLEA 4PBSA 4XR4A 5AMXA 4TRJA 3CVUA 2ABWA 4PSKA 1P1RA 4PZUA 2PJRA 4LF7B 3H87A 3TRFA 4F84A 2CJWB 3RQSA 4A9AA 3GEPA 4I08A 1EEXB 2WKRA 4KE8A 2CLIB 2Y1WA 4BV8A 4ER7A 2R85A 4WBNA 2QW1A 2LBPA 3HP1A 4LV5B 4PX5A 4ZQFA 5FBVB 3UMFA 3Q9LA 2COUA 1VQ1A 2X3FA 5IAGA 3R7NA 3FCYA 2IOYA 3FN4A 4QPDA 3FSRA 1QRTA 3QOWA 4GDFA 3LDUA 3IVAA 3M4YA 4FCTA 5ITZB 3TIIA 5AI5A 3FWPA 1PKEA 3OIGA 2Q5JA 2P3LA 1CUGA 2EFGA 4FGZA 2D7JA 3PLNA 1GFSA 4D0LB 5F77A 2CD9A 3HGQA 2NYAA 2WIBA 2Z43A 2A6PA 2FPGB 1JR6A 1U1CA 2JK1A 2QRPA 3ZWBA 1QQ6A 1JIXA 1ZU4A 3T9EA 2XSZD 2CFIA 2CKDA 5I4CA 2ZM6B 1FY2A 3MWEA 5CNJA 1RJDA 5EHZA 1UZUA 3OTHA 2XNDD 4JQOA 3WLJA 3L4BC 1U1GA 3GLFB 1HNWB 5AM1A 1UKCA 2OZLB 1RVV1 3LBHA 4QUHA 3H1BA 2FSVA 3AFGA 2GRJA 3OP4A 2YN0A 3QMPA 4WK0B 3W90A 3OTIA 1OFTA 4YMTA 3HDHA 2DWCA 3K8ZA 3EZLA 1V8BA 2JVKA 1NW9B 1W7AA 3IBGA 1XL1A 4ZXFA 3KPWA 2AFIB 1RXVA 3IAEA 1A5BB 2ATIA 5K3AA 2WWVD 2YWGA 1QDUA 2I29A 4XQ0A 5ICMA 2RH5A 1NQOA 1P2DA 5KOJB 1XQ9A 3N8HA 3DO8A 3V6LA 1I36A 4IEFB 4RA9A 1Y42X 3CVYA 1BX0A 1ORWA 2BEVA 2ZWIA 3HB1A 3NWPA 3UV6A 5ITVA 5LB2A 4F7DA 3EA0A 2QPOA 3P1JA 1G20E 4NZPA 1IOVA 3M49A 1JG7A 3AUFA 5KDLA 1PDWA 1H93A 1WAMA 3F5FA 2IUFA 5HWSA 1PSWA 1L3CA 5T64A 4Q16A 5EQFA 2P9BA 4OXQA 3P7MA 3GLGE 2PUDA 5HEKA 1QS0A 3L6RA 4HGQA 1KEZA 3HI4A 3SR3A 1ETUA 4QL3A 4RD2A 3CW8X 3VDNB 2VXCA 5LC1A 4M88A 2AA3A 3TDNA 1RCUA 2E37A 3BSFA 1TA4A 2RIRA 4ND8B 2QMHA 1ORRA 5FR2A 3FM9A 1A71A 1WNFA 2NZJA 1XWIA 5DNEA 8ATCA 1WBJB 4YAFA 3T1VA 2O1WA 2ZJ7A 3ZWNA 1ZGZA 1LJ8A 4W7IA 1G63A 1XTSA 4PO3X 4GSLA 5CVUA 4C7BA 2XCUA 2Z1MA 4ZI7F 5CLFA 5F98A 5CT5A 4D3SA 5CEFA 2V7GA 3LI2A 2QUIA 3IC5A 1JR3E 4CFYA 1U2GA 1XQ6A 3ENWA 2H00A 4EQZA 4GR9A 5HM6A 5BURA 1DC4A 5CH5A 2RKOA 4C6HA 3DQQA 3KYCB 3CZQA 4J1TA 1EVIA 2Z57A 2VPYA 3K53A 4QAQA 4UBJA 5KNDD 1P77A 3ESQA 1C3JA 1ONBA 3HY4A 3DBOB 3GRRA 1ZVQA 1VDMA 3LHIA 4MPPA 4IOLA 2B4AA 4KZPA 3RTAA 3OJ0A 3DVLA 4M0EA 1IXSB 1YC2A 2YRWA 2QMEA 3ZBPA 4B09A 4Z51A 5FOXA 1KI7A 2BDUA 2RHJA 3WLSA 3R7LA 2B8TA 3T34A 4MKRA 5B7QA 2JFFA 2QMOA 1PVDA 3LYAA 1K7SN 3LH5A 4ZICA 3MLAA 3VR3D 1NC3A 1UXHA 1NVVQ 1TEXA 5LLDA 2BL4A 1FP4B 1XZBA 1LPNA 2ZAOA 5DTMA 1P1JA 3HFSA 2RGNA 2BFCA 5ALMA 1ZM7A 5IUJC 1HFEL 2M9MA 3BGSA 3AF5A 5C8DA 1UBMS 4MRVA 2YJTD 1HKHA 4ZCRA 1XR3A 4HNVA 3F1KA 4DLVA 4Q9AA 3G79A 3AL3A 1TK3A 3QHPA 4URFA 2FGKA 2XMZA 2OG2A 3T1TA 4AMVA 4F2DA 1XZFA 3JQ7A 4N6GA 3D4OA 4L15A 2NTNA 1J8VA 4WLNA 3DJYA 4TYPA 1RU3A 2P9CA 4OPMA 1KY5A 1LXCA 1T4DA 2V6GA 2X76A 3GT3A 3H5OA 3RRYA 1Z6TA 3T0GA 1XHEA 4MGZR 4F2PA 3H6HA 1Z3IX 3JV7A 2LWIA 3GFBA 4KWCA 3ONEA 1A5AB 1KY3A 4B4VA 5ARCA 1OFGA 3OM1A 1E0DA 1X8XA 1O95C 4TWRA 3ZIDA 4AC9A 5JDCC 6ABPA 1VG0B 1N5DA 3U17A 4JUCA 1Z2DA 3PX3A 1NVKA 1Q15A 1XEWY 2PQ6A 2ZBPA 5HG0A 3TE7A 3CX6A 5KQRA 4FS8A 1XCJA 4M7RA 3AUAA 3F6YA 4JVNA 2VYND 3CMCO 3Q2OA 1QUFA 1ZY2A 1IBKB 3E8SA 4K3UA 1IN7A 4UVIA 1W4RA 4U6NA 2CEKA 3EQ8A 4ER3A 1IONA 1DCKA 1RJEA 4Q24A 4CHTA 3VO8A 2IYOA 4YUAA 1D2HA 4QU5A 5FP0A 3ZD9A 4QOJA 4GLBA 3U7QA 2Z8ZA 4L5CA 2GEDA 3KK0A 4PAQA 2HV8A 1ZMOA 3PQ6A 4BV3A 4YPVA 1VDZA 4BNUA 3K9LA 1TT7A 5H9VA 1L5SA 3QKSB 5LYJA 3OIVA 2J5BA 3DM5A 3PP8A 5AW6A 4RPCA 5KIAA 1M1UA 2H2HA 4ZOLF 5DGDA 4F3NA 3FG9A 2SECE 4JJGA 4V2UA 3D1JA 1IY8A 3X1MA 4JL6A 3TSYA 1PKXA 2Q2WA 3RAPR 4G0UA 1XA3A 3MZ0A 4UHKA 5CB4A 3VTFA 3KJQA 4M8LA 3W2IA 5LP1A 3AVYA 5JU6A 1PZHA 1VPEA 2A8YA 3EVZA 4N0MA 3STXA 1RAEA 3S44A 1AK9A 2ACWA 2IDZA 1N9GB 2H1IA 5J47A 1Y8QB 1A8UA 4UHCA 3NC1C 1N78A 4IHJF 3MTAA 1VHJA 4MKZA 4U7PB 5CHYA 3T7AA 5CBPA 1N0HA 2YHUA 3JSAA 1YR6A 1KMMA 4U7HA 5HF8A 1PJ4A 2PX8A 4YRZA 2J9XB 2V98A 1G98A 1JDTA 1QYCA 1HMPA 3WXMA 4NZOA 3GRKA 1GTMA 1P2BA 3M2PA 4D74A 5DJ5A 2B94A 2J07A 3RABA 4AVYA 3L5OA 3R2JA 1Y4UA 2GO7A 3ROTA 4JGGA 2UYGA 3G8CA 3U2QA 4A6PA 3LL7A 3QTLA 3L0ZA 4NMXB 3TFWA 2DUWA 3KKQA 3C15C 4RBNA 2X3YA 3QQ5A 5CTAA 1QZZA 2CL5A 1RRPA 1E2UA 3G9TA 3RANA 1KJ9A 4JITA 1AD2A 1JTVA 2E4AA 1S9DA 4TL7A 3VR6D 4JBGA 1P60A 1PYGA 2NO0A 4FSXA 4G8DA 2R1TA 1U9JA 4G0VA 3CG4A 5EY5B 2B78A 2OOKA 3KX2A 4QDUA 1Y1PA 4JI2B 1UM9A 5JHHB 3JY6A 1RXIA 3S2UA 3AKZA 1OB2A 3LAWA 2CXRA 3K9BA 4LBYA 3I04M 4LWQA 3UXYA 4RF5A 2R0QC 2QXYA 4M8KA 2XDQA 3EVFA 3PUJA 3ZWWA 4DE5A 3LX8A 4MGHA 3SLKA 5MFPA 3HZHA 1K6MA 3GJZA 3LKBA 5C7YA 1KEEB 3A6DA 4W1QA 1MN6A 2R66A 2RI6A 3P0RA 4RY8A 2NP7A 2H2FA 3TW4A 4N6OA 4RE6A 4QJBA 1FZTA 4POAA 4AU1A 4IUDS 5LZ4A 2Q07A 3GGSA 2X3UA 1MR3F 1UWVA 2BTOA 3C3JA 3D6NB 2HQBA 4IDAA 4QJ5A 2EF0A 5FORA 4B3DA 3PU6A 4Q34A 2FEOA 1JZTA 2GZ1A 3NXSA 2QMZA 3U09A 4KIFA 4N5DA 4XKJA 4OXXA 4J2TA 1U31A 1Q7BA 1P80A 3DD1A 4XYBA 3UJPA 1SY7A 4Y67A 1GU7A 1SQ0A 3OFNA 1E5LA 4ZVKA 2OO5C 1HR0B 2ZATA 4BLQA 5L9AA 2HLNA 3G3EA 2DPLA 2SICE 3ITDA 2PMWB 4DNQA 1ANKA 1LQ2A 3A1CA 4IXMA 3NATA 4RIGA 5LQCA 1DQSA 3MYYA 3QXHA 5EZYF 2HIGA 2QU7A 2XHEA 4UBMA 4TN5A 4E11A 1A9ZA 3S0JA 2WB4A 3WGUA 3LF1A 3VBEA 1RLTA 3GNLA 1I3KA 5FNVF 3L8YA 2IP2A 4EGQA 1VB3A 4MW4A 5HP4A 3AZQA 3QX9A 1YJBA 2GCNA 3VU8A 2IW3A 3RLIA 3I9NA 5B2EA 2J6IA 2VUUA 3GVPA 3IIIA 2C97A 3WYAA 4UCFA 2D06A 2EF1A 4B7AA 4DWVA 5LWQA 1XBTA 5I6DA 3B78A 4XEHA 5K3DA 3TTXA 1C7RA 1IBCA 2OK7A 4U4AA 1NNI1 3VVBA 2PHZA 5I7OA 3CUWA 4ABYA 4CXMA 5HA5A 4B35A 3WP0A 4XIIA 2HNKA 3CZPA 4E32A 4KRFA 1PL7A 3V9PA 2JZNA 3WLAA 3IOMA 4RLQA 5AKLA 1TYEB 2Y9PB 2WA1A 2XITA 2QTWB 4ZREA 2AVDA 5DSXA 4BYMA 3E48A 4QBIA 3CUSA 1XPOA 4ZO8A 5G02A 5CFQA 1MVLA 3H5WA 4V0QA 3KQLA 2E48A 2O3UA 5CBPB 3QX8A 3SMQA 3E3LA 3GJ7A 4TWBA 1GL3A 2RJ3A 5DNVA 5AOCA 2APJA 4GZ3A 3H8WA 4Y1GA 1A5SB 1ZL2A 4XASA 4LOJA 1X0XA 1CK4A 2EYQA 2WLSA 3TB4A 4A5SA 1T9KA 2HM7A 1OIVA 1W0KD 4HDMB 3L49A 3VR5H 1Z0KA 3SZUA 2C2MA 4C2UA 1Y9AA 3KZNA 1P5FA 2D59A 2YVKA 1L7EA 3UK0A 5K8CA 1PO7A 4MXDA 1TM4E 2VP9A 2DQ4A 3OHMA 3HCPA 3PEVA 3T99A 4CG3A 4M9RA 2PKQO 4RCZA 2HDHA 3X1ZA 1J5XA 5JECA 1LLFA 2JCGA 2H0QA 1R0CA 2IGTA 3KDAA 2FK7A 5C1PA 1FP1D 4MYTA 1BXZA 3T1QA 4KPFC 1WUJS 4BO7A 3F7MA 5KYWB 3LYLA 4X7PA 1KZ6A 3EGCA 3K0SA 2AD5A 3DOIA 3QU2A 2G9NA 2HU8A 1QSGA 2ZUDA 2I9KA 2HK9A 1U8FO 2TMKA 5CMLA 4UBLA 4A7PA 4F3KA 4GI3A 3T9DA 1XD9A 4JC8A 3PWTA 4DA8A 1VPVA 1SXJD 3JWJA 1T3ZA 1Z0FA 4JQYA 4Y6SA 2ZS9A 3A06A 1JNYA 1VIDA 3PNBA 5BSWA 5K99A 3OLCX 3G9QA 1VPLA 3QVUA 5I9IA 2Z2KA 1U11A 4JDPA 4U2CA 3OFND 1JHRA 3AEQA 4O4HF 4BQQA 2GYVA 3HZZA 1D2GA 4MK4A 5HCUA 1RKUA 4DAEA 3AK4A 4CV1A 3OX2A 3ZVLA 2OZEA 1LI5A 2AQIA 1XZEA 3PJFA 2R8ZA 1D9ZA 2LP4Y 3LCJA 4GP6A 5TMEA 4PHGA 4CQLA 1U3VA 4HF7A 4TV8B 5EKDA 2QL5A 4FQ8A 2GVDC 1AU9A 5AHKA 3TE6A 3PWZA 2VRNA 3NIGB 3FUUA 4KWEA 1S96A 3EVDA 4P7GA 4BU1A 1E94E 1H6DA 3UK7A 1YWGO 2C94A 3AR2A 4H7IA 1F4VA 2P2DA 2R44A 3GC6A 3DEYX 4FMCB 4F97A 3K0HA 2P1ZA 5CAEB 4OHVA 2E3JA 1T4BA 1T24A 1UQTA 4H18A 4FILA 3AJ9A 4OB8A 4YAJA 5IULC 4KPUA 3PR2B 4QXPA 4D9IA 2AKEA 1NMQA 2MT9A 1II8B 1SXJB 2QYSA 3E9NA 2WU3A 2VRBA 1P0MA 1N2HA 2Q8QA 1B14A 3IBCA 1IN5A 5DYTA 4E6EA 2ETVA 4DJTA 4M0LA 2DE0X 2GNPA 4OUDA 4N76A 3N0RA