4GMXA

Crystal structure of kpt185 in complex with crm1-ran-ranbp1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
209
structure length
205
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVLAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibitors of nuclear export show that CRM1/XPO1 is a target in chronic lymphocytic leukemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/inhibitor
molecule keywords GTP-binding nuclear protein Ran
total genus 55
structure length 205
sequence length 209
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gmxA00
3ZVRA 1UF9A 4XWKA 4ASUA 1N25A 3BFKA 4N3NA 3GFOA 3ASZA 1KO4A 5KNBA 4MRNA 4C0LA 3K0SA 5DHFA 2W6JD 4JBXA 5FI1B 3T15A 1Z28A 3QENA 1ELOA 4C0JA 3OE7A 3RYTC 3DOEA 3CNNA 2K5UA 3ZIAD 4M1MA 3W8NA 2ZR7A 2ZTSA 1CF4A 2GDJA 1KY3A 4LBVA 3NVAA 3L2OB 1RVDA 4NYMQ 2A7QA 3FFAA 1FP7A 2C98A 1XJQA 4JVSB 5CK4A 3CNOA 2G0TA 4KLZA 2ZRBA 3GLGB 1OXSC 1X8JA 1DAKA 3TK1A 1ZUIA 3DMNA 3UMSA 1FL9A 1KGDA 1C9KA 1XX6A 5EZ6B 2NO7A 1W4RA 1N6PA 2P67A 4A6PA 2G1JA 2DYKA 1G18A 2IHBA 1VHTA 2ZSDA 4Q7JB 2H17A 4M9ZA 1XU4A 1F48A 3K9LA 1Z29A 2IXFA 4Z1MA 2KE5A 1H65A 2AHOA 1J2JA 5TB5A 1AS2A 1QF9A 4PPNA 4DZZA 2XB4A 3CH5A 1Z2CA 4FCWA 5DIFA 4BUJA 1XXHA 1Z8FA 5KSYA 2NG1A 3PEYA 1OV4A 1TQ2A 3RNLA 2QU8A 4Q4HB 2CCKA 1Y63A 1FNNA 4LJ4A 2R8RA 2BDTA 1DG1G 4M1TA 1VECA 2I4IA 2F6RA 2WJYA 4EQ6A 1LS6A 4IDQA 2AX4A 2JATA 2OBMA 3TRFA 5BN3A 1OW3B 5A4JA 1ZJ6A 3W34A 3CF0A 3GEIA 4DSTA 2W6ID 3AKYA 3B9QA 1JAHA 1UBGA 3W90A 4WZ6A 4JYBA 2ZRGA 1AJEA 2ZR0A 3L8YA 1K5DA 4CZ2A 3EWAA 1YRBA 4KBFA 4AKGA 2WM9B 2D06A 1YZQA 4AI6A 1JXOA 4PHTA 1RJ9A 4OQNA 4RZ2A 1NIJA 1YE8A 3I5YA 2V54A 1KSJA 4A6XA 1XCPA 2GXQA 4XTRA 2GA8A 2JJ8A 2R62A 1OH6A 4QGAA 4ZCLA 2WWXA 1RRFA 4JL8A 2FSIA 4TMZA 1TUIA 2EFHB 4TL8A 4DKXA 1NBMD 3EIHA 2BCGY 3IIMA 4A2PA 2WAYA 2NZJA 3BXZA 1QHNA 3ADCA 2PLFA 4TZ0A 3MWLA 2OCPA 1ZU4A 1E2EA 3FKQA 5AJZA 3CO5A 4LV5B 4US0R 2IYQA 3KKOA 3T1VA 4BFTA 3AF1A 2REXB 1SXJD 4JLPA 1OXVA 1VTKA 2FA9A 2ZSEA 3MWJA 4R2HA 4FN5A 1YZNA 4LHXA 3L82B 4JLVA 5EE9A 5TDHA 2O8FB 5C4GB 3UIEA 4M22A 5FOSA 2CCJA 3MD0A 4KLNA 3MCAA 2JLZA 3DEFA 1JB1A 4QNMA 1OKKD 1P4SA 2J1LA 2CNWA 3EWSA 3TQCA 2D2EA 3DM9B 4XIGS 1XPUA 1J8YF 3KJEA 1T0JB 3PEUA 1SVKA 2Q3FA 1NLYA 1VYUA 1HY3A 1UBCA 1CRQA 2E1RA 4HYYA 1Q1QA 5FUWA 4OQFA 2ZSAA 1OHHD 2ZETA 1L7VC 3WNBA 2AWOA 1KO1A 5FBLB 4OL0A 2FFBA 2J0QA 3RS7A 5JSZA 1KMHB 4MYUA 1OFTA 1W1WA 1HURA 4MDEA 3O47A 1P2TA 2W2XA 2VL7A 4RSGA 1SGWA 2DBYA 2KSQA 3IPXA 3KQLA 4GP6A 3KUDA 5KPDA 4DJTA 5H1YA 1D8TA 2B7BA 3F8TA 3JVUA 3WYGA 4DDWA 3FWYA 2CXXA 3VR1A 1M7HA 4II7A 5L3SA 1KOFA 2GKSA 3NC1C 1ZM9A 2FG5A 1GVNB 4M0LA 3U7HB 2HEIA 1GTVA 4G5OA 4PSAA 4RZ3A 3TUJC 2MMGA 4YXWD 5L3QA 4IJMA 4PC3A 2ORIA 4P31A 2VYFA 4BEBA 2XSZA 4LUCA 1NN0A 2QI9C 4ZV4A 4PAOA 4ABYA 2IYXA 3VU9B 4WXPA 3T06B 1GIAA 1IOZA 4F92B 1U99A 1OFUX 2ZJ8A 1IN4A 3D7MA 3OE7D 5F9FA 2D7DA 3FMFA 4QM6A 5DN6A 1DTSA 2FE4A 4JKYA 4M1OA 1XEXB 2ODWA 3WP0A 3A37A 2PMKA 4Q7KA 5EP1A 4DLXA 5JJIA 4YMVA 3BBPA 5KDLA 1W0JD 2JIZA 4L9WA 2QGZA 1FPMA 2ZRPA 1AQUA 5BW8A 3P1JA 4BE7B 3U3JA 3FMIA 2IF2A 3BRWD 4KYUA 2QGNA 4C30A 2O8DB 1CJVC 3AP2A 1TU3A 3LX5A 1JR6A 1G64A 5E4FA 5FR2A 4P32A 4PPQA 3TQFA 2IUUA 3WY9A 4EPXA 2YYZA 2XGJA 4HZUA 1UFQA 3B8HA 1G6HA 1G7TA 1UBFA 4YXWA 2QT1A 2YHSA 3FPAA 3THOA 2ORWA 4POAA 1AK2A 2R2AA 4PHFA 4TT3A 3I8XA 1VG0B 2TMKA 1KMQA 5FUYA 2J0UA 5JJKA 1HE8B 2GXUA 3CLVA 2WPDD 3BOSA 4U00A 3UXMA 2OCAA 2XTZA 5FPSA 2OBLA 3RC3A 3P4XA 2EQBA 4B3BA 4QXAA 1M1YE 4TQUS 1Q57A 2GAOA 2YWHA 4C7OA 2YWGA 2QUZA 1ZNYA 3MRSA 3UWOA 3K0FA 2GRJA 4Q1CA 5J4LA 3TR5A 3F3YA 4OYHA 3SHFA 1D6JA 4A4DA 5JSZB 4I1VA 4L4UA 4JLDA 1N6NA 1XEWX 3KL4A 2JASA 4IKEA 2R6CA 3FKSA 2R65A 4G01B 4TQAA 1US8A 3W9YA 3RS5A 3CX7A 5FOTA 5AR1A 1VG9B 2CL6X 4DLRA 2WSSA 3GLGA 3Q5DA 3HP1A 3PUZA 5P21A 2YC4C 1ZBDA 3QVVA 4ACAA 3L0OA 1Q21A 2XZLA 1G8FA 1N6RA 3EPJA 3BB1A 3ZVNA 3H4MA 3RRYA 1E96A 2P3SA 4P4SA 4A82A 4DIDA 3ZD6A 2FPMA 1E1RA 1RRPA 4R9UC 4BQSA 1TMKA 3FHTA 3P27A 3IQXA 2IBMA 4B33A 2C9YA 1OB5A 2FSHA 4TYQA 1RYHA 3VR4A 3RSOA 1UPTA 3X1DA 2ZI9A 2CJWA 4TMXA 1NIPA 2JDID 5DYIA 4WZBE 4HUQA 5EXTA 1E3MA 5DHAA 4HSEA 1MRSA 6Q21A 3THWA 1R0ZA 2P5TB 2QMHA 1MT0A 5H8WA 1U0HC 2IX3A 2JLXA 1U94A 2RGEA 4QGHA 2AKYA 3BWDD 1W0JA 3TE6A 3W8RA 2GHIA 1XCGB 3I5XA 4RZXA 3RS0A 4GZMA 5AUQA 5G53C 1XMVA 2G83A 1DAGA 3GJ0A 4PXAA 2IWHA 2XB2A 1KK2A 1TEXA 1HT1E 3G82C 1E69A 2OCYC 4IOMA 2NGRA 2VBCA 4M1KA 2P6UA 1JECA 1E2NA 1M8PA 4QFMA 1CR4A 4QGGA 3RSLA 5KNDA 4AKIA 4V02A 4DHEA 3P4YA 1C1YA 4JLMA 3L0SA 3DDCA 4EKDA 1KZGB 1UDWA 5CDFA 4DLWA 1FQJA 2ZSFA 2X77A 3ZZ0A 3OEEA 2X19A 4MRRA 5J5CA 4P33A 3ICQB 1T3LA 1E9AA 1N6HA 4OK3A 5GVSA 2HUPA 1WBDA 4JS0A 1J8MF 2VP9A 4JVMA 4O2RA 3KXKA 1CJUC 1E2HA 2GXSA 4GBMA 2VIIA 3EAQA 3SJZA 2VH5R 4P0TA 3EZ7A 4OK5A 3F0TA 3BAFA 1T5IA 2H57A 1LB1B 2REOA 4K81B 3TSOA 3CPEA 3KJGA 4JT2A 5FL3A 2GXAA 1KK3A 2ZS9A 4Q21A 1G20E 3UK6A 3QI2A 2PJRA 1XTSA 4XWOA 2Q21A 2WOOA 4DT1A 1VIAA 5JCPA 1HEIA 2YV5A 1G7RA 2WV9A 4ILEA 3RDPA 1HYQA 1E2DA 3KZ1E 4JVLA 3UG7A 4PTLA 1XFAA 3M6AA 4BRUA 4R71A 3QBVA 2QEQA 3I73A 2QSZA 2OO7A 2GCPA 2BWJA 3LQRA 1COWD 1NSTA 2P6NA 3NWJA 1GFIA 2GJKA 3AUXA 3GLIA 2O52A 5FTMA 3K0EA 3A1UA 2OZEA 2H5EA 2V7QA 3QSYA 4TL9A 4YQFA 3B5JA 4LYAA 1I2MA 2JA1A 3KDSE 3AVPA 5BYKA 1JBKA 1XEXA 1R0WA 4PQYA 3VNUA 5FBQB 3K09C 3NEYA 4B34A 2ZI6A 3SDZA 3THWB 3THYB 1U81A 1ZC3A 5JLJA 1W2HA 1D2EA 1U9IC 2F7SA 4ZIRA 1ETUA 2QY9A 2QBYB 1YHNA 3AF3A 1O3YA 1ODFA 2W83A 3RS3A 1XRJA 4AYTA 4A2QA 3EPKA 1S9HA 4N0DA 1JNYA 3K0AB 3NHAA 4Z8YA 1U90A 3EZ6A 2ZYVX 4MRPA 4TLAA 1Q1ZA 2AN9A 1ZM2A 1LTQA 2R6AA 4DCTA 2RHDA 1EWQA 4NCKA 4Q00A 2QAGB 3ZVLA 4QKQA 2UKDA 2ZVPX 1R0XA 3H84A 5DI9A 4X8MA 3ADBA 2IHYA 2WKQA 2RHMA 5HE8A 3AF4A 3WBKA 2BMJA 3CW2A 1BOFA 1OB2A 1OF1A 2P6RA 1R5NA 4BPBA 1XJCA 1YR9A 3JZMA 1LW7A 1Z08A 1HT2E 4G5SA 4QBFA 4GMDA 4A92A 3HU2A 1ZCBA 1N0UA 4M9QA 1A7JA 2ZEJA 1P62B 4B3DA 1K8RA 2R6FA 3NHBA 3BJIC 3HYTA 3L43A 1G8PA 3RABA 1OIWA 1VMAA 3U61B 4AKHA 2EFDB 1TF5A 2BEJA 1UADA 1D2MA 3A8TA 3SFZA 1U0LA 2CE7A 4BFVA 4BECA 2NO6A 2UVQA 1DELA 4YMWA 4B2LA 4BFZA 3K1JA 2WWWA 3T1TA 2XOKD 2ZI3A 3OFNA 4B6EA 1J99A 3T5GA 5C18A 1V43A 1BYIA 1HH4A 1JPJA 2WWGA 2XTNA 3CH4B 2JLQA 4UNQA 2HXSA 2CK3A 5LD2B 1WP9A 4KFUA 2OAQ1 2G88A 1OH8A 3SC3A 1N0WA 4HLDA 4Z51A 4EDHA 4LYJA 5LDDC 3GLIB 1NN3A 1Q3HA 1GRNA 4D0LB 1EK0A 2GAAA 5A0FA 2QP3A 4FINA 4KXFB 2N42A 3KX2A 1PUIA 2Q6TA 1VIYA 2WJVA 2D4HA 4DLUA 1CRPA 2NIPA 4LBWA 3Q85A 3WNDA 1CJMA 2JIZD 4Q5IA 1E32A 3ADDA 4M1YA 4XOIA 3QVUA 1GNRA 2VTKA 2Y8EA 1XTJA 2DFKB 3VR5A 2O5VA 3M4YA 5HR5A 2AWNA 1Y3AA 2R44A 2VF7A 4BFYA 5L3SB 1MOZA 3MUFA 4LJ9A 2UZIR 3NH9A 2J3EA 2OFWA 4LZZA 3AKEA 3DM5A 2HJVA 4NKRA 1OXUA 2A2ZA 5EE3A 4EQ6B 1V5WA 2ZRAA 4YC7A 2PZFA 1CBUA 3QY0A 5DYGA 1E9FA 4TQ9A 1P3JA 1SVOA 2IYUA 3Q8XB 4LV8B 721PA 4I4LA 1Z47A 1EXMA 3WHLA 4A8JA 3TGPA 3DVLA 4TMTA 2WVJA 4C0HA 1WB9A 1CU1A 1YZTA 2AXPA 4RD3A 4TLCA 2RGNC 4CEHA 2ZRMA 4Q1BA 3K9NA 2ODNA 2XEXA 4DLYA 1S96A 2GILA 3GMTA 3UMRA 1UM8A 2GJSA 2GJ9A 4FCTA 2BMDA 2IS1A 2WHXA 2VHJA 5FTJA 3QBTA 4EJSB 2ZUDA 4XVQA 3W5JA 2IXEA 4UNNA 1YRAA 3LW7A 2A30A 1XPOA 1WXQA 3HJNA 1DAEA 1Z6YA 3KQHA 2H8KA 5FOUA 3BB3A 1CJKC 4KYIB 2V3CC 3SN6A 2HLDA 2BCJQ 3AVXA 2C5LA 1AS0A 2PBRA 4DCUA 1RIFA 1X1SA 1LNZA 1B0UA 2ZU0C 3SZRA 3O8RA 4PPFA 1L8QA 2EWWA 2XX3A 5CYPA 2BMFA 3OFND 3ZJYA 1NF3A 1I2DA 3AVVA 2XXAB 1MO3A 2A5JA 5GADl 1XXHE 1ZVQA 3VFDA 3GLIE 5E3HA 2X1VA 2J9RA 5F3WB 1E0AA 2XNDD 4US1R 3PXGA 1NKSA 4G5QA 3AEZA 4ZDWA 1E0SA 5JJLA 3UWKA 3AVYA 3CWQA 4GDFA 4BFUA 1TTTA 2E87A 2YC2C 4HB2A 3SI7A 4C9BA 3I92A 3NEJA 4P4TA 4AC9A 3HPQA 3MGCA 2RAPA 2CHGA 1J90A 4Q9LA 4O25A 1MABB 1MH1A 3GLHA 5CB6A 4G3XA 5KO2A 4OQMA 1G291 1R0YA 4RFVA 3RAPR 4GZLA 3MFYA 3EZ9A 4DC9A 4DT1B 2VP2A 1X6VA 1XPRA 2ZS7A 2VP5A 2Z6VA 2FF7A 4Q9IA 3R9IA 4M2LA 3WP1B 2IF0A 4C0AC 1NMXA 2BV3A 2IC5A 4Q4HA 1SVIA 3W6OA 1PJRA 3EX7C 3X1ZA 3M1IA 2J87A 3NH6A 2NPFA 1YR8A 5BWMA 1YZLA 5JEDA 1N5KA 4KV9A 1YR6A 3TAHA 3WRXC 2IA5A 5LD2C 2FEOA 4TTRA 1RKBA 1OT3A 4HDQB 2IYSA 5KOYA 1XTRA 2IYTA 2NTYC 3LW8A 1CTQA 1RZ3A 4H1UA 5B57C 1I4LD 2OV2A 2RKOA 3IDQA 2ZXUA 2YWEA 3UATA 3WYAA 1ZYUA 3E5HA 4HAXA 1T4GA 1E2LA 2H7VA 2VLIA 5FBVB 5E95A 1Q0UA 2O8CA 3LFUA 5IDVA 4BZQA 1E2GA 1Q3TA 3SR0A 1GKYA 1ONBA 1KZ7B 2F3RA 4TTPA 1C4OA 3BORA 4A36A 4PSKA 1AM4D 2QQEA 4B47A 1SXJB 2CLSA 1GNQA 1KAOA 2WOJA 1TADA 4NU0A 3T5DA 1A2KC 1CIPA 4H1VA 1B23P 2ZAOA 1FX0B 1OFIA 2H18A 4HUQB 4MRVA 4NYMR 2XJ9A 3CWZA 3KXLA 1ESMA 5J4YA 5FH9A 2FU5C 3GP8A 2W00A 1G17A 1Z0KA 4AURA 1OIVA 1VHLA 2IYZA 4Q4AA 1T3HA 3GPLA 1Q22A 1EFRD 1IN6A 2VPPA 4MGKR 2CJWB 2O8FA 3BE4A 3DHWC 5EE0A 4TLEA 3OIVA 3EA0A 1E9CA 2EYUA 1W0KD 3C5HA 4QC2A 4JSTA 1GKUB 1M6NA 4GFDA 1SXJC 3V00A 2UZ3A 2PJZA 4V0ME 4Q4JB 3SQWA 1NN1A 4DLTA 2JJ1A 1GITA 3THXB 5SZJA 1E9RA 2GTPA 3B1XA 1KI6A 4DIEA 4AYWA 4OHVA 2DFNA 5J4KA 1R5BA 1YR7A 3ND9A 4LC0A 4QJ4A 3X1WA 4B32A 3E1SA 1XMJA 4KODA 1TQ4A 3GJXC 1FW6A 1CP2A 4UJ3A 3ICEA 4PZLA 1YVDA 2GCOA 2AFIE 5GJWC 3B1WA 2MSCB 3TKLA 3QXJA 3EA5A 3I4LA 4EFMA 2A9KA 2QTVB 3LV8A 3OF5A 3B1ZA 1W2GA 3TUZC 3PENA 5F9HA 2X2EA 2GEDA 5CM9C 5IRCD 3QQ5A 2ZI5A 3QG5A 4DVGA 2NO1A 1BH2A 3BD9A 3SE0A 4OI2A 4JJZA 4URVR 4QGFA 1XMSA 4LJYA 3K0AA 3SJCA 4GI7A 5K8UA 3T35A 4WA7A 4LSGA 1TQ6A 1WF3A 2J0SA 1S1CA 5IK2D 4WOPA 3LBIA 4B76A 3NXSA 4QHTA 3U6KA 1VKJA 3NBXX 4MA4A 2C95A 2WICA 1HUQA 4KFTA 2B8TA 3OESA 4MKIA 4UXHA 5KSOA 4TZ6A 1TU4A 4AG5A 4RD1A 1YZKA 1VDZA 1KJWA 1CKEA 1E9EA 1KI8A 4RFSA 3GJ4A 3RLFA 4D4LA 2WKRA 4U7DA 2HLDD 3QOFA 1E2PA 1OH5A 1E2IA 3I72A 2JLUA 1M74A 2OT3B 2V4ZA 1TL7C 3AH8A 1MR3F 4EPWA 5EXSA 4HAUA 4MYHA 3WBJA 5EUQB 4QBGB 3SEAA 1XJ0A 3GJ3A 3JZAA 4WZAE 3U4QA 4AY2A 3WNCA 2XNSA 1UJ2A 5DNYB 3UKDA 1QHYA 4Q7LA 3PITA 3A4LA 3VR2A 2ZRJA 5LB4A 2BMEA 4XH9B 3U60B 3U7GA 2FZLA 3QF4B 1Z0DA 1N6LA 3EZ2A 4M4SA 2QMEA 3QF4A 1G3QA 2I1VB 1KJYA 4ERNA 2NOAA 3AVTA 5H70A 4CRWB 2CCGA 3S1AB 2EFCB 3CKLA 2ERYA 2CDNA 1VG1A 3C16C 5JWRA 1JR3A 4BLRA 5EQTA 3TSWA 2YINC 1E79D 3SOPA 3GLFA 3QPUA 2QROA 1UEJA 5CM8B 2A3RA 1VCNA 2PZGA 2IS4A 4TYYA 2CEAA 2QMUA 2ZSBA 2P5SA 2WJHA 4C7OB 2ZI7A 3GQBA 4E22A 2PCJA 3U5ZB 2O0JA 4JLNA 4NCNA 1ZP6A 4UNRA 1UKEA 2V1XA 1UBEA 2J7KA 2ZANA 4YMUA 1G1MA 2QSYA 2AK3A 4Y0AA 1L4YA 4Q02A 3KKNA 3X2SA 2ZE5A 1IQPA 3LBHA 4P3YA 1CR2A 5C1BA 3IQWA 1AA9A 3HYRA 3PCRB 4GT1A 4PZYA 3ZVMA 3Q72A 3BH0A 4IFBA 4MKGA 3QKUA 4RCZA 3OIYA 4EAQA 3VR3A 2XTMA 4B43A 1T6NA 3B2EA 1E94E 1GKIA 3IKJA 4CYMA 2FSGA 2JLWA 4B3GA 2O0HA 2KI5A 3U3OA 2G77B 3R7WB 1R4AA 5GJVC 3SYKA 2ZREA 1KSHA 3K9HA 5JFGA 2DFTA 1RW4A 3QJYA 4MITA 1XD9A 2WWHA 2RMKA 3IHLA 1M7BA 1N3BA 1JPNA 1QDEA 5IF9A 3G0HA 1P61B 2ZAMA 4C0SA 4HB0A 4I1OA 4C3ZA 2QA5A 1LY1A 3QXXA 4NHOA 2PEYA 5EXXA 1QHIA 2AL7A 2Q3MA 2ZJ5A 5AWFC 4LBZA 1P9NA 1YZUA 2G0NA 2OUKA 5KPJA 1KKMA 2X2FA 3DMDA 2GNOA 1NLZA 3EZFA 3HU1A 3O8DA 2CHVA 4PQFA 2FSFA 4A8JC 1L4UA 2YNMA 2A5FA 1RYFA 1PLKA 3AVOA 4DLSA 4YDHB 4F7WA 1DO2A 4A0FA 2WJIA 5FL7D 2GF9A 4BFWA 1IHUA 4L5BA 1LV7A 3C4JA 4QBHA 2O8BA 2YOHA 4GOJA 4DCVA 4RZUA 2HT1A 2VHTA 2GJAA 3QKRB 4XSGA 5AK0A 1WQ1R 4KI0A 1E2FA 3EXAA 3W6PA 2WWFA 1XTKA 3ZQJA 3AF0A 521PA 1G8YA 3F5FA 3MWKA 1RRGA 1BO6A 5BN4A 2IUTA 3IHWA 2BM1A 2CHQA 4QHSA 2AFHE 4RD0A 2ZIAA 4CGZA 4F93B 1G4AE 421PA 3Q3JB 1U8YA 4MYCA 4LJAA 3SBDA 3UPUA 2XXAA 4PO9A 3FGNA 4PO1A 3MAAC 4PQRA 1D2NA 3CX6A 3KKMA 2FFAA 2GZAA 3OEHA 3OEED 3R7WA 2JEOA 2RH5A 4D80A 3TH5A 1OJLA 1R8QA 2W6IA 2ZROA 4WW0A 3CRW1 4ESVA 4L8GA 4EFNA 1XTIA 1E9DA 3TJZA 4AD8A 4Q1FA 2FOLA 4R2IA 2FFHA 4BZXA 1F2UB 1F60A 3HPRA 4Z54A 2VQSA 2DCUA 4PC7A 2NMVA 1YJ5A 3A36A 3PUWA 4TYWA 1F2TB 2DWOA 1II8B 2QRZA 3QXSA 4HLUA 1E1QA 4MUBA 2VSOA 4UXIA 1NVWQ 4D4JA 1CR0A 4RD2A 1N6KA 1D9XA 2XNDA 1G5RA 2YOGA 3MG9A 2WKPA 4D4KA 3D6TB 4F4CA 1ZUNB 1W4BA 5HZHA 4P4UA 5BQ5A 3VKGA 3C5CA 5JRZA 3T61A 5ELXA 2CLCX 3IIKA 3U4QB 3QPWA 4L9SA 5CIQA 5DE3A 1XBTA 2REBA 1EX7A 1E9BA 1SQ5A 2RGCA 4Q19A 1CS4C 4B3XA 4ZIRB 2Z4RA 2V6IA 2IEYA 4W9MC 3A1VA 1FOEB 2C03A 2D3WA 4I1SA 2ZRLA 4K46A 1HA3A 1KDPA 2H1LA 1JEDA 1KTVA 1L2TA 1Z5ZA 1OLOA 4A0RA 2E9SA 2QT0A 2WJJA 1WCV1 1T5LA 3L0PA 1R5OA 1Z6GA 2C96A 4Q4AB 2JJ1D 4QJ5A 5FUVA 5CDFE 2EVWX 5DN6D 1NN5A 5HKKA 4DSUA 1RC8A 1N5JA 3PIRA 4IDNA 4CDGA 5B64A 2W58A 2GK6A 1PV4A 1P75A 1OPXA 5K8IA 3U44A 1T0HB 3CUEF 1T8TA 1VYTA 4JL6A 4MRSA 3L8ZA 4PR0A 1AGPA 5FOXA 4UKDA 4QJ3A 3VX3A 1MO4A 2IYWA 1GG2A 4U02A 2ZRCA 1S1MA 3AVUA 2OESA 4RVCA 2ZRDA 1W49A 2ZI4A 5F2EA 4RFSB 3ZYCA 4X8OA 1W36C 4GNKA 2VO1A 2CLDX 2GCOB 3RRMA 1NRJB 4BZPA 3KQNA 1NVVQ 3LX8A 4OQLA 1SVSA 2IYYA 3VR6A 3K70D 2GZDA 4NCIA 3SQXA 2YJTD 4A15A 5FFMA 5JHHB 3LAWA 1KI7A 1N5LA 1U9IA 3DO6A 2FNAA 2JJ2D 3ASYA 4DRZA 5FTLA 4JLJA 2HYIC 2PEZA 1GILA 4GPTA 3K09A 4ZI3A 1EFCA 1U8ZA 1G3RA 3VMFA 1FUUA 2DY1A 2Q3HA 3MJRA 2ZRIA 4IVQA 4S35A 1JJ7A 1Q1BA 1N0VC 1QG4A 1XD2B 4JLKA 4RKFA 2B6HA 4ZDJA 4IDOA 4D25A 4V0MA 2QTFA 1QRAA 1CJTC 2QPTA 5FBRB 1GL7A 1FFHA 1MO6A 4GMXA 2FMXA 1ZW6A 2I3BA 2LKCA 1KI2A 1KI6B 4OI4A 1DS6A 1GM5A 1NSFA 3DZDA 4JLBA 2JLRA 3MWYW 2O8DA 2P0EA 1NKTA 2OFXA 3VHLB 1VCOA 1X8KA 4FW9A 3NDPA 2DB3A 5TV2A 1Z63A 3IBYA 2IYVA 2F1RA 2N1BA 2PL3A 3ZS9A 4ZKEA 4KFRA 1JQLB 4ASUD 1XZPA 5LBIA 4KO8A 1KNXA 4HI0E 2BEKA 3G5UA 2OLKA 4GL2A 4ZI2A 4TT3D 2IS2A 5K8TA 2J59A 3VAAA 3SS8A 3B13B 1T3SA 3KQUA 4M8NE 4OJKA 5AJYA 4MGYR 1HE1C 1W36B 4A0HA 2KJQA 5B30A 2F3TA 2PCLA 5DI3A 4MYTA 3W3AA 2KB0A 5FL7A 2IYRA 3SHWA 3BH6A 3X1YA 1FNMA 3K0FB 4R7ZA 1M2OB 1E4YA 1NMZA 4B74A 2IT1A 4CEHB 2FPLA 3PEVA 3GJ5A 4PX9A 2RGDA 1G9XA 3ECCA 2QL6A 4DB4A 3R9XA 1DG3A 221PA 3H86A 2MSDB 3ZH9B 4JZKA 1BYUA 2VF8A 4TL6A 1XXHB 4R98A 1W44A 2BBSA 2V9PA 4DSNA 1A2BA 1QHHA 1E99A 2BBOA 1OXTA 3TNFA 2QPAA 1Z2AA 1IONA 1FMLA 5TY0A 3GJ6A 3TSZA 1RPZA 1QZXA 4FXPA 4OI1A 4OHWA 5AUOB 1YQTA 4BLOA 1KYIA 4YMSA 4Z1MD 5EJEA 4TYNA 3C41J 4JBWA 4AWXA 3DL0A 3GFTA 4X8LA 4NCHA 1KY2A 2ECKA 2QQ0A 1CLUA 3A58B 3BH7A 3KTAA 5JWHA 1W7AA 4TL7A 3DPUA 4PSVA 1MO5A 2Q0HA 1NLFA 1HV8A 1ZD8A 3EW9A 3B1VA 3QKSB 4BRWA 5AUPB 1NP6A 4MH0R 2LWIA 2ZPTX 5LPNA 4TMKA 4Q7MB 2Q9CA 1R7RA 3GLHE 3THYA 3AP3A 5CJ2A 1G41A 1QBKC 2IK8A 1TX4B 1KNQA 1BKDR 3FDIA 3OZXA 4B2IA 4B3FX 2QBYA 3OHMA 4A1FA 4CEIB 1P2SA 2C77A 4H9GA 4NDZA 4C0KA 4FIDA 2A5DA 1NI3A 2YWFA 4G5GA 3IPYA 3R20A 5JWOA 2ODBA 3V4FA 4HB3A 1TPZA 1Z3IX 5IK2A 2A5GA 3E70C 1F2UA 4I81A 3DOFA 4K8OA 2QNRA 2XSZD 1EFUA 2V8OA 3I61A 4FMCF 1NVXQ 1U8AA 4CT5A 4D2IA 4JVNA 5HCIA 1XB2A 2QORA 5EE5B 3RS2A 3K70C 2O0KA 4RD6A 2AD5A 2N46A 1KI9A 1IJFA 5AUNB 4QL3A 4NE2A 3RRZA 5C4MA 1A1VA 4E5UA 2BBTA 4LYHA 1A4RA 2IW3A 2D62A 1IY1A 3I32A 4IXNA 4LHZA 5FBWB 2ZRFA 4IHQA 2B21A 1TAGA 4LJ7A 5HPYB 2V6JA 2RGAA 4MKFA 4OHYA 5KYKA 2O8CB 3VU9A 1W4CA 1LVGA 4Q9HA 1Z0JA 4E09A 2OILA 4HLUC 1XEWY 3Q5EA 2IS6A 2A78A 4OHZA 1N2CE 2BBWA 4JSYA 4F4JA 2RGGA 5C46F 2GCNA 1KI4A 4XJXA 4D4MA 3QE0A 1Z0FA 3DKPA 2FN4A 2OXRA 5DGXA 4ZO4A 3RWMB 3GFPA 1FTNA 1K5GA 1M34E 2FPKA 4NZYA 2FV8A 2ZRKA 3B1YA 3V4RA 4Q1DA 2ZVQX 2EFEB 1KSFX 1SVLA 5CYOA 3TW8B 1SXJE 1LFDB 1X8LA 3EARA 4UJ5A 3EPLA 4US2R 3LLUA 5EZ5A 3KFVA 4LV6A 2H92A 3BIFA 3ZGXA 1ZM7A 2RB4A 5D3MA 4Y0VA 1TEVA 4AG6A 4GOKA 5GVRA 5JI2E 2V1UA 1OFHA 3U44B 2C04A 3LQQA 3KJIA 1MABA 3AKCA 3B60A 3GLHB 2OE2A 3LDAA 3Q9LA 5EXPA 2R6DA 2CK3D 3TBKA 2Z83A 2ZU6A 2OBNA 3IUYA 1OIXA 2EFGA 4W7SA 3T12A 5K8LA 3BB4A 2O8EA 4HATA 2ATVA 2B92A 5G41A 2HF9A 2FEMA 2BVNA 1UKZA 2H16A 2LKDA 2WJGA 3IGFA 1DAFA 1W5SA 3EC1A 4BLQA 4HUTA 5SZKB 3RWOA 3ONWA 3P26A 4KJZA 1G7SA 1MRNA 1TF2A 2FGKA 3LRPA 1NJGA 2FDCA 1DPFA 5JRJA 4LWZA 1U98A 1EFRA 1W47A 1XTQA 3U3KA 4EPRA 4DXAA 1NG1A 2QE7D 4QOSA 2P65A 1Q20A 1GZSA 1PLLA 3GEHA 3OEHD 3P32A 2YKGA 1ZNXA 1TNDA 4TWZA 5CB8A 2QAGC 3BC1A 1KAGA 2IL1A 3N2EA 1QHSA 3PEWA 2JDIA 3ZD7A 2VP0A 5HE9A 2QRNA 4NYJR 5L3QB 3DZ8A 2BJWA 4OHXA 2ZJYA 2CL7X 2QG6A 4UXJA 4ARZB 1SKQA 2OEPA 2WIBA 3GD7A 1US8B 1ZM4A 1PLJA 3CZQA 2QTHA 1SKYE 4HAYA 2JJ2A 2XZOA 5GJCA 1SVMA 4QNRA 5DLQC 4EIWA 3QXHA 2ZJOA 3T1QA 4JLAA 3VQTA 5DSZA 3CNLA 3AUYA 5CIWA 2VHUA 4PHGA 3QEJA 5FPHA 2QP9X 4ESHA 3I3SR 3AM1A 4IDHA 1KK1A 3LO5A 2WMOB 4O3MA 4KSCA 2QENA 2ZJZA 3JVVA 4KU4A 1Z6XA 1GRQA 1U0JA 3QKTA 4IW3B 5AJVB 1YU9A 1KJZA 4Z8XA 1NJFA 1G8HA 3KKQA 3KQKA 2P2LA 2OAP1 5DI3B 4DLVA 3DKVA 4NMMA 2DWPA 4ZDIA 4Q4JA 4GRAA 1H8EA 2HV8A 1X3SA 5A5GA 1G4UR 2OXCA 3QIAA 4S2EA 2ERXA 1ZUHA 1JR3E 3UANA 5CLQA 2JCSA 3ZQ6A 4DUGA 3I8SA 1JAIA 1SHZA 2ZJBA 1M7GA 2C9CA 4F91B 5HKKD 1IY2A 4XWAA 3PJRA 3SFVA 3RRNA 3SNHA 3LA6A 3MLEA 3U2QA 4C0BA 1NL3A 1ZRHA 1IXRC 1II0A 1NBMA 3QKRA 4MDFA 4QHYA 4LY6A 4NL4H 1E1RD 1EX6A 4HLQB 1S4QA 1W46A 2GF0A 3AP1A 1WDTA 3VTKA 4TMVA 3GLGE 1FMJA 4BLTA 4PC6A 5L3VA 4MQBA 5TMPA 5L3RA 4Q03A 1QVAA 4AK9A 1AZSC 2WZQA 3EASA 3B85A 1R2QA 2VP4A 3OAAA 5DO9A 2VHCA 3R8CA 4LJ8A 2VA8A 4MGZR 3TW4A 2IYLD 4DSOA 2W0MA 2OM2A 5E7MA 1JXMA 3BFVA 1DE0A 1WA5A 1BMFD 1LF5A 4JL5A 1GRRA 1ZC4A 3LXRA 1E1QD 2GESA 1AKEA 1RE0A 4C4PA 3WMEA 3QF7A 1TUEA 3GJ7A 4JT4A 3WMGA 1T9HA 4JYCA 1OKKA 1P9WA 2B8WA 1WRBA 2RGBA 3LH5A 2RCNA 5LB2A 4BLSA 1DAIA 1OSNA 2WSSD 2QAJA 1W48A 2FGJA 4N1AA 2EU8A 3WYFA 1IBRA 2C2HA 2ZRHA 1U2RA 4DEYA 3A4NA 2YZ2A 4W5WA 3FE2A 3VKHA 4HAWA 1FUKA 4B48A 1SHKA 1Z07A 4KAXA 1XCMA 2OG2A 4Q47A 3NKVA 1BMFA 2CBZA 2GVZC 4IOKA 1VCIA 2HXYA 3AGQA 4CW7A 2ZYUX 1GWNA 4PC2A 2ATXA 1IXZA 3RS4A 1IN7A 2GK7A 4PAMA 4OI0A 2O8BB 3A1TA 3H2YA 4TTQA 1ZIOA 5FOWA 5FTKA 4FMCB 2HYDA 2KBFA 3SYLA 1W5TA 2ZRNA 1DEKA 3WRYC 3T34A 5M04A 1ZNWA 3LVRE 1IM2A 5CLLA 2GBLC 2ZE7A 5E7JA 4UNPA 3GLFB 1CR1A 5J4HA 4OK6A 4DBLC 3QPVA 1G6OA 2D2FA 3QUSA 1P2UA 2PLRA 2PX0A 2BOVA 2W0SA 3IEUA 3NBFA 1CXZA 3CR7A 1S9DA 1S3SA 1RRCA 1NY5A 4HDCA 2VSFA 1XF9A 1NBME 621PA 4AKEA 2DHRA 2J7PA 3K53A 2PMDA 3P20A 3FHCB 2C8VA 3WMFA 4V03A 4EJSA 5BN5A 1ANKA 4NTZA 2FH5B 4PO8A 4UNSA 1DO0A 1DAHA 4J0QA 2W6JA 4N0EA 5DISB 4FMBB 2L0XA 1Z83A 3CPHA 4ZCMA 2I1QA 4YLGA 5FR1A 2GETA 2CNWD 2MMCA 4LOAA 3LBNA 2HCBA 4XD7D 1XD2A 4LX0A 2F1IA 3A1SA 1SVWA 3AGPA 4KVGA 1NVUQ 2OSBA 3EIEA 4NBSA 4E03A 2NZ8A 4LHYA 1E98A 2ONKA 4M1WA 1ZAKA 4QBIA 4FMDF 4IVRA 4W5HA 1ZD9A 2QAGA 1XZQA 2W2TA 3KTAB 2JLSA 1F2TA 3I62A 2EWVA 2KWIA 2ZUBA 5EE1A 1QVRA 2QMOA 4IRUB 3BFXA 4YMTA 5JMTA 1Q12A 4XD7A 4HZUB 1GL9B 4M1SA 5AJWA 4EPYA 1N6OA 2DFLA 1AIPA 4IEIA 3R8FA 1P60A 1BIFA 4L16A 4XSHA 4M9SA 2Q9AA 5FUXA 2OCBA 4V0NA 2GEVA 1WE2A 5FPKA 3IO5A 4RY2A 4WVFA 5H68A 2GEUA 4BEJA 3AQ4A 5HTKA 2BJVA 1COWA 4RD4A 4GOXA 5C2JB 3TR0A 4V0KA 3KB1A 2BM0A 4OBEA 1NG9A 1ZCAA 3NBZC 4FD2A 1UEIA 4Q4LA 1DVRA 1KI1A 1S2MA 1KHTA 4IEEA 3FMPB 1OH7A 4XTCS 2YVUA 3C8UA 4TLBA 2DWQA 4LBYA 3ZS8A 5FTNA 4CEIA 4A2WA 4B71A 4FWIB 1OE0A 1SULA 3KXIA 3PUYA 2C78A 3LLMA 4HAZA 5JBQA 5JEEA 3AF2A 4Q01A 5JECA 2RGXA 2ZUCA 2WTUA 2F9LA 4C2UA 4PZZA 5FI0B 3CBQA 3VX4A 1EG7A 1T8UA 1JALA 3VHXA 2ZITA 1VG8A 3OIWA 4NCJA 4NPHA 1G5TA 1NMYA 3LNCA 4TN1A 2F55A 5B58C 4CEJA 3SJBA 2QZ4A 3Q7PA 2ZJ2A 1RFLA 1UDXA 3TLXA 4B6FA 2QP4A 4KSBA 4EJSC 3EIQA 1P7CA 1RJ9B 1OYYA 3FFBA 4KITB 2V55B 2F9MA 1Q44A 3ND8A 4LHWA 1N6IA 4IDPA 3PUXA 1IN5A 2KBEA 3NBYC 2ZE8A 4L15A 5EP3A 4B44A 4A8JB 1DAMA 1NY6A 3BK7A 3LXXA 3TVDA 2G3YA 2XZPA 1EGAA 1XMIA 3AKDA 1G3UA 4NH0A 4U5XA 4FWTA 2CVHA 1P9RA 1D5CA 3LY5A 3KB2A 2MSEB 4IOLA 2AR7A 1UAAA 2W2VA 4LCBA 1FZQA 1JR3D 1S3GA 1II8A 5G3YA 5FOVA 1IJEA 5JHGB 2YOFA 1GAJA 1KK0A 3IIJA 4D0NA 3RVBA 3W5IA 5KSZA 5JZVA 5KSPA 1Z06A 4CT4B 3NDBB 1XP8A 4JJKA 1HTWA 3B7GA 4NP6A 5IHPA 4EPVA 3T1OA 2JGNA 3OAAD 3CPJB 1I4DD 4AIIA 1TF7A 2D74A 2WWIA 3X1XA 4EUNA 4JBYA 4ZDKA 5L8VA 3ZLJA 2CE2X 4Q48A 1R8SA 1DARA 8OHMA 3FHOA 2AD1A 1FQKA 4G5RA 3D3QA 3IO3A 1S8FA 4HB4A 1GP2A 2WMNB 2GWHA 2GBLA 4Q18A 1VYVA 2EYQA 4M53A 1OHHA 1ZINA 3EPHA 4JIMA 4LGMA 5TVKA 4LDJA 2XITA 1KI3A 4DLZA 4D6PA 4KFSA 2Z5FA 1G3MA 4RKEA 3NIBA 3CIOA 4ITRC 3SYNA 5E7IA 5KNCA 3RHFA 4DB2A 3U7EB 3OIUA 3E2IA 2HDNB 3HDTA 3SU8A 2HJGA 3B6EA 3TVTA 2WWYA 5DH9A 3O8CA 3CF2A 3TUIC 4BFXA 2ODEA 4WBSA 2FJUA 1UKYA 4TMWA 3GLFE 2XJ4A 1E79A 2BKUA 4Q66C 1H8ED 4IXMA 3ZZTA 3HWSA 3WXMA 1AKYA 2Q9BA 1CEEA 3IEVA 3GCGA 4DCNA 1PUJA 4NYJQ 1G21E 4I99A 5TARA 3U3RA 1AN0A 3A1WA 1Z22A 3B9PA 4W5JA 4B35A 4PC1A 2ZE6A 3W3ZB 1XD8A 3CR8A 3RANA 3UG6A 3FYHA 2OLJA 2QPOA 4IVPA 3UMFA 1F3OA 4B2PA 5UKDA 3U6BA 3K8YA 4URUR 4NYIQ 5BYJA 1QG2A 4X8HA 3CF6R 3N5CA 4EPTA 2FZ4A 1IY0A 3L0IB 1G16A 4KCGA 2VHQA 2WIAA 4DDVA 3LVQE 5D3MB 4BASA 3AVWA 3BS4A 4G0NA 1WBBA 1MV5A 1AQYA 1P6XA 3ADKA 1JQJC 1I4TD 4PANA 2G6BA 1F6BA 2BC9A 1D9ZA 1XNJA 2D7CA 5JI3E 2ZM5A 5KU1A 2PT5A 4V0LA 3R9WA 2ASEA 4HEJA 5JCZA 4Q9JA 1AZTA 3PG5A 2F1JA 3EC2A 3REFA 3A6PC 4DWJA 1T91A 3CM0A 1FP6A 3VNVA 4WAUA 1NVVR 1Z0IA 4EFLA 1K6MA 1KSGA 1VPLA 1EFTA 2IXGA 5CJPA 2IUSA 3A4MA 2ZQ5A 4OKSA 3PFIA 4A9AA 4LK2A 4ACBA 3KKPA 4KHZA 2ORVA 3ETLA 3QXCA 1KO7A 1W36D 5G3ZA 1ZU5A 4FMDB 3J81k 1EFHA 2VEDA 3CONA 4LHVA 4LYFA 5KTYA 1JJVA 2J46A 3B82A 3V9PA 3GJ8A 4LRWA 4PPGA 3B78A 4HAVA 2QN6A 2PT7A 1SZPA 5KHOC 1HQYE 4B75A 1QHGA 2AKAB 1KKLA 3AB3A 4ARZA 3EG5A 2ONJA 2WPDA 2JLYA 2HF8A 1HQCA 2JAQA 2VP6A 5BXQC 1IAQA 2BKEA 5AJXA 3K0CC 3TAUA 1CULC 3D8BA 4IFEA 2JLVA 4D81A 1P2VA 2HT6A 2F43A 2GVDC 3CRRA 4G1UC 4M21A 2F43B 4E07A 2F1HA 4OQXA 1E2JA 1XWIA 3FB4A 2VRWA 4ZCIA 3O8BA 5SZHB 5KDDA 4GSYA 2ANCA 5FPYA 1AS3A 2J7PD 2VSXA 4MUAA 4NONA 4TLDA 5B2ZA 4BGDA 2FX3A 3CB4A 1P5ZB 2DPXA 3CRMA 2CVFA 4F4IA 3PR1A 2A5YB 4YONB 1IN8A 2C99A 3W6NA 1MKYA 4HDOB 5F98A 3SBEA 5TXGA 1F5NA 4DDTA 5GJBA 5IT5A 4DEXA 1O87A 1KMHA 4V0OA 2CL0X 1E2KA 3C14C 3HR7A 2RGNA 4OJQA 4B3CA 1ZIPA 4XVRA 3IBGA 3BERA 3CX8A 4KVAA 2J5XA 3Q7QA 1GUAA 1J70A 3C15C 1X1RA 2J41A 1NNEA 2PX3A 4URZR 2WSMA 3VKWA 2WAXA 3C7KA 1PZNA 1SXJA 2PH1A 1X86B 2WBLC 1DOAA 4JMPA 5HZKA 2HCJB 1FX0A 3PUVA 4GP7A 4HLCA 4JKIA 3GEEA 1OXXK 3FMOB 1W4AA 1E0KA 3HU3A 4B73A 4LJ6A 3HR8A 4LPKA 2IWRA 1Z6TA 1S0UA 4TSFA 4LI0A 1G7CA 2J0UB 3FOZA 4JLOA 1DADA 1ESNA 1KIMA 2ANBA 1E9SA 1GNPA 2V7QD 2ZYTX 3D31A 1H8HA 3PV0A 4CVNA 2R9VA 1ZNZA 2NO9A 3NC0C 4LJ5A 2G9NA 5SZIA 1KDTA 2O8EB 1UKVY 4URWR 2IEZA 4MKHA 1R6BX 3FTQA 3FVQA 4Q9KA 3REGA 1ZD1A 2R6GA 1GSIA 2LCFA 1P73A 3N70A 1GOTA 4QG7A 3THXA 1PVOA 4O2LA 4P4SB 5EUMA 3BGWA 3N2IA 2FFQA 3FKSD 1EWRA 4DCSA 2J0VA 1A82A 3S1AA 4M9XA 5KUTA 821PA 5FPTA 4BLPA 2QM7A 1XDBA 4WXRA 4D0GA 4TYPA 2Z0MA 3PQCA 4HZIA 4I1UA 5EP4A 3ZIAA 1LS1A 4C0QC 4A0GA 4FCVA 4MGIR 1W0KA 1A5TA 1ZMXA 3LD9A 1VCMA 3H1TA 3QNUA 1E4VA 2EW1A 1FTSA 2ZR9A 4D82A 4URYR 2NO0A 4ZKDA 1LF0A 4ON9A 4CEJB 5CITA 1Z0AA 4FI3C 5JS7A 1GDDA 1WMSA 3K70B 5G40A 3U3MA 4TSFD 4QM7A 1E0JA 2ZS8A 3MMPA 2GZHA 2GJ8A 1KO8A 3I1FA 4PAQA 121PA 4CF7A 3CRQA 4O0MA 4XVUA 4LC1A 1QHXA 2CMKA 3CRVA 3KUCA 3KFXA 3NTUA 1E2MA 1JEEA 2J45A 1G8GA 4Q1EA 4RCYA 1QHHB 4D26A 3QKSA 5J40A 2Z43A 2AXNA 1TQDA 5JS8A 1R10A 3WHKA 2XOKA 2B7CA 2OFOA 3NG1A 2BIFA 2SHKA 1YKSA 2ZJAA 3QG1A 4LPSA 3AVQA 2NPIA 4ZPXA 1J7KA 2QE7A 2OHFA 1OYWA 1IXSB 1ZM3A 2FWRA 4DUGD 4DDUA 3U7FB 1E6CA 1Q1EA 1SKYB 3K9GA 3AV0B 4BFSA 5CK5A 4PHHA 1N5IA 4C2TA 1G3IA 4URXR 5ANRB 1EESA 5KDOA 1YZGA 2QM8A 4BWYA 3QEOA 4UQOA 4WIAA 1KDRA 3MSXA 3MJHA 1P72A 1DBSA 2G1KA 4YDSA 3SJAA 5J4VA 4F38A 3TMKA 4Q1AA 3RC8A 2PZEA 1BS1A 5HCNA 5EP2A 1E2QA 2BHRA 4KBGA 5D3QA 3ZZUA 3CZPA 1II9A 2XAUA 1JI0A 3TIFA 3KJHA 2ZYWX 5J47A 3H0KA 1G19A 2Z4SA 2NQ2C 4NYIR 4AYXA 2X8AA 1G5PA 1KO5A 2C9OA 4PFSA 4CIDA 1H8HD 1XEFA 4QRHA 4IOJA 1KDOA 3K0CA 3LWNA 1AGRA 2AK2A 1Z6AA 3M0EA 3PVSA 2DR3A 3IILA 3ZDQA 1GL6A 4RJLA
chains in the Genus database with same CATH superfamily
7YASA 4XWKA 1ZZEA 4FILA 4ASUA 4DMKA 3FWNA 4P83A 3D5TA 3ASZA 1KO4A 5KMGB 3EGCA 3I5MA 4ZFNA 2HPAA 4KQJA 1KTIA 3HR4A 3RC9A 3RBAA 2G9ZA 4G8DA 1P19A 4KZKA 1ZJZA 5EN4A 1ELOA 3Q2IA 2AG8A 4C0JA 4S04A 2D8AA 2VAVA 3FWZA 4G0QA 4M1MA 3IQZA 3AHIA 4YJHB 4N0QA 1PDOA 1RMQA 3AU8A 4KAAA 4RFVA 4YJHA 3X0DA 2GDJA 1XPJA 2NUAB 4D8YA 1WULS 2HZ7A 3E9QA 4F12A 3DGFC 7ABPA 4A8TA 1YXMA 1P80A 4BVHA 4EI7A 3GMIA 5SYAA 5B58T 4KLZA 3FETA 1K86A 4MJXA 1Q91A 4PX2A 2GZMA 4CMKA 1X8JA 4ESOA 3TSYA 1DAKA 4I8XA 1TKAA 2NUPB 1JAXA 2I2WA 2IGTA 1TW2A 4C3VA 1XX6A 1M2VA 5EZ6B 1W4RA 2VH1A 3B9BA 3PWZA 1I6KA 3CR3C 3H5NA 5ALUA 4F4FA 2J6IA 4UHHA 4RTNA 3OZCA 4A6PA 3EF1A 3GY0A 2G1JA 4G0OA 3TEMA 3ZV4A 1G1AA 4OP3A 5B1DA 1O4VA 4ZZ3A 3H9EO 1Y33E 1VMIA 2Z8YA 4DMCA 1SRQA 1VHTA 1F48A 3NBQA 1YRHA 3FNBA 3UXHA 5B3LA 1FSFA 2HH9A 3ETGA 3F5MA 3EDRA 1AS2A 5J2TB 1XK6A 4DZZA 2L82A 1K88A 3A3YA 2MR6A 3CH5A 4I8DA 5DIFA 2HRQA 5JJ5A 4D96A 1YJXA 1M5UA 2NG1A 4OGLA 4YRBA 3PEYA 1BE8A 1JE0A 3H13A 1UBUS 3KE9A 3ZJVA 4JXKA 4FS3A 4JOSA 4LJ4A 1EVLA 1NBHA 1K0UA 1XZAA 3KKEA 1WD5A 3HCBA 1DG1G 2F00A 2R5FA 3GEPA 1SKAA 4Y2YA 2RB5A 4EQ6A 1JQBA 4IDQA 4HQFA 2MSLA 1LZKA 3RV3A 3E35A 2ZKLA 2PA3A 1V3UA 1RABA 3VR5H 1ZJ6A 4KOEC 3SGLA 2IHKA 2YL2A 3GEIA 2YYSA 1FS4A 2ZWMA 1LNQA 2VRCA 2W6ID 3B9QA 1UBGA 3W90A 3DBIA 3N2KA 2ZRGA 4CM6A 2BGNA 2NV0A 2AMVA 3V2GA 1AK9A 1AJEA 5NULA 4P54A 4GKBA 5BNWA 1I3LA 1K4KA 3QVMA 4G0WA 2P9EA 5J5AA 1ZFNA 1MVOA 3GN2A 5AHXA 3TINA 3U5TA 4G0UA 1TO6A 4ZGGA 1RJ9A 2WFAA 1SOUA 3C6MA 3ER6A 1RQLA 4LI3X 4XUCA 4ZEXA 5DXJA 4EGSA 2PD4A 3OLQA 3I5YA 1UDCA 2V54A 1BMQA 3HMQA 4G9EA 2NZYA 2OHGA 1XCPA 4P34A 1NHWA 4A6XA 3TE7A 4E94A 1QU3A 2CFOA 2WWXA 4YRCA 5JV5A 3ZQKA 4HEQA 1NXSA 1PT7A 5I9LA 4L73A 2BCGY 2A35A 1PU2A 3IIMA 5C7OO 3M6VA 2FZGA 4F3KA 1T2CA 1Z8HA 3GJRA 2C4MA 1K6JA 1E8DA 1RQXA 5M5BA 1ZU4A 1JI3A 1A76A 4BFTA 1HDYA 2ZB2A 4LV5B 4US0R 1SCIA 1SQGA 3LFHA 4YBZA 2J5RA 1PEAA 1OXVA 3AHCA 2VPTA 4AWXA 4RJTA 4GMGA 4FN5A 3O9MA 1P0CA 4MROA 4ZQIA 4JLVA 4JQYA 2O8FB 3UIEA 2O2SA 4DQKA 1DJMA 4M22A 3ENQA 5FOSA 5DX0A 1K7FB 2CCJA 2P1RA 1U1IA 4KLNA 3MCAA 1NQWA 4XARA 1JB1A 2I1LA 1D1PA 1P4SA 4UD6A 3KAJA 4FE4A 4KYTA 2C3YA 3DFFA 2H4YA 4RKYA 1WAMA 3W5UA 3KJEA 4XR4A 4PINA 4QGSA 1SVKA 5A3RA 1ABEA 3LNTA 2C2BA 3C70A 1VYUA 1CUUA 1HY3A 2E55A 1UBCA 1GSAA 1MJNA 2E1RA 3MELA 1Q1QA 4JB0A 4G0YA 4NICA 2C4VA 4AG3A 2G0AA 3D0QA 1FXWF 5D6NA 4ZYVA 1OHHD 4KWTA 4A27A 1TLLA 2ZETA 1L7VC 1DIRA 2BUCA 3B70A 5BV0A 2C2ZA 3H42B 5FULA 4ALKA 5JDIC 4UFPA 1KO1A 2HCFA 4RQBA 3LCMA 4OL0A 2M6LA 3TTYA 2XA2A 4WN3A 2YN2A 3RS7A 3OI7A 1OU0A 5EHQA 3HGTA 4ISBA 1GZVA 3O47A 2I6QA 1GGFA 1P2TA 2W2XA 4KMRA 4RSGA 3KQLA 3IOCA 3AV3A 4M0DA 2VDJA 4HXGA 2QYOA 1U0SY 2PYDA 3O0DA 1I36A 5KPDA 4FR2A 4YGYA 3UUWA 2CFSA 3BG5A 5JO0A 4NXNB 3CX3A 1SIBE 4KQHA 4MV4A 5GV8A 3A3KA 4DDWA 2VAPA 3RVRA 1JBQA 1WEKA 3KHTA 2DKNA 4AX4A 4F5EA 5HKAA 5AIAA 4MA5A 1KZ4A 4AQYB 1S8NA 1GTL1 3NC1C 5CNKA 2PL1A 3NEPX 1U3FA 1ZM9A 1GVNB 2FW7A 3CSUA 4G65A 3U16A 3UF0A 4G5OA 4RIGA 3TUJC 1YQGA 5L3QA 3WTBA 1ONSA 1EP3B 3AUFA 2XUFA 4P31A 3OU7A 5ECYA 4BEBA 3GLQA 2ID7A 4N47A 2PJDA 4LUCA 2ZJ1A 3II6X 1PNTA 5CT9A 2QI9C 5EXEA 3WKDA 5BVHA 5K0GA 4ABYA 2IYXA 4D45A 1TJ4A 3EOBI 1E64A 4YROA 4BGEA 4F92B 1U99A 1UBHS 2YIVX 4WD3A 3FMFA 5IKEA 5ALTA 2PFSA 4S05A 3COWA 3D1JA 3HKBA 3L05A 1DTSA 3FNQA 4IHJB 1DTEA 2R4UA 4E1AA 1TFRA 1YDEA 1CD5A 1V16B 4ETIA 1XEXB 2ODWA 5B12A 1YFLA 2PMKA 3TPFA 1V16A 3F96A 3G1UA 4GLBA 5JLAA 4WOBA 1V8FA 3KKLA 1W0JD 5KDLA 4L9WA 4BO3A 2ZRPA 1NXXA 1XRMA 3KE8A 4Y2XA 4H16A 1XDWA 2PKEA 2PL9A 2VXOA 3DEKA 3PC8C 1Y5RA 1GGNA 4KTTE 2DUJA 1OX4A 1XQYA 5CH3A 3LPAA 4DMUB 5BV2P 2RSLA 1S7CA 3BRWD 3AEUA 2QGNA 3C3JA 4KYUA 2XUHA 5JC8A 3C8HA 1JR6A 3KFLA 2VZEA 3P9SA 2Q6IA 1HTBA 2XKJE 3O8OA 3PKIA 4K6FA 4P32A 1JFRA 4RWZA 2J07A 5E9AA 3TQFA 3WY9A 2YJ4A 2YYZA 4N5NA 3RUHA 1MQ8B 1UFQA 3PNOA 1G6HA 1JLLB 1UBFA 4NI5A 5CLHA 4B8YA 4TROA 5LU8A 3IIIA 2QT1A 2WU3A 4R69A 3PX2A 4QYTA 4KFCA 2ORWA 1AK2A 4I5GA 2EKQA 5DT2A 1XZEA 3DFIA 3I6IA 1V45E 3H9CA 2GXUA 3VOSA 1GZ5A 2WPDD 1SQ6A 1QYRA 3ZV3A 4URFA 3UXMA 1CC1S 2FMUA 3WHPA 2D7JA 1NJSA 3RC3A 3WKAA 1GTMA 1KH3A 2YIJA 3C0KA 2YWHA 3SIWA 1ZXLA 1MPTA 3W1VA 3G1WA 2I78A 3DA8A 4H0NA 1ZNYA 4UATA 3R0XA 5KVVA 1M54A 5LVAA 1NQVA 4Q1CA 5J4LA 3F97A 1ZMRA 1Z4LA 1D6JA 2PWBA 2YJ3A 3MHPA 4L4UA 3DTVA 1T2FA 1RXWA 2WYVA 4LDZA 2ZTUA 1N6NA 1XEWX 2A94A 3T5CA 3BEDA 1X80B 1XZLA 3FKSA 4TQAA 4CI9A 1RLMA 1JVNA 4NABA 2X7XA 1IBSA 1Y1RA 2PNJA 3CX7A 4FFOA 5AR1A 1FY2A 3WFIA 1ODCA 3HP1A 3PUZA 3INYA 5JQGB 1V8DA 5P21A 1TEZA 4JUBA 3AERA 1WUKS 3DAPA 3C7DB 4YJ2B 4B6PA 3OPYA 5FBZA 2OZPA 3H5TA 2C9ZA 1VSUA 1WHTA 5C8YA 1NXQA 3A27A 3H4MA 1LC0A 5DM2A 3PKZA 3NKFA 2E6KA 2MU1A 4A82A 3TOSA 4HQ0A 4IUDS 4C4OA 1MD9A 4R9UC 1WW2A 1U8XX 1T6BY 4FDMA 3TTUA 4BQSA 3UPUA 4KKVA 3DE4X 3FHTA 1Q1NA 2ZJ6A 3H5RA 3IR5A 1E5TA 4AF6A 2WRZA 1GZ6A 2C9YA 3OU6A 2NXJA 3LXUX 4TOIA 5A7GA 4DMGA 1OB5A 2F8SA 5IT4A 3GP3A 1JIIA 1NDUA 2C92A 4WLNA 4D9KA 1U02A 4KXVA 2CJWA 2BSXA 2J4FA 1FDUA 2KW5A 3MBKA 4WZBE 1DKPA 4KC0A 5HCNA 1ZL0A 3FM9A 1X7ZB 1DC4A 2V7XA 4EF5A 6Q21A 3Q7EA 5KYUA 3R44A 1HK7A 1WR8A 1UBTS 2I6UA 5CFPA 3CTPA 2QL9A 5I8PA 4GYKA 2JLXA 4HDRA 3ZY5A 2O2GA 1YD7A 3BWDD 1W0JA 1MT3A 2PAFA 3TE6A 5BPFA 2GHIA 2IBTA 1RJFA 1NJ8A 3VNSA 3W5DA 1XMVA 1DAGA 1EA5A 5M7EA 1E4EB 1PS8A 4E3ZA 2FPGB 3LDUA 4K26A 1KFJB 4M1KA 4ALLA 3CKMA 1K8YB 4QEZA 4QFMA 3G8AA 1ITZA 3RSLA 4KREA 4MVJF 1C1YA 3M9XA 1DCFA 1PS9A 3K9QO 5BNZA 4OQQA 5CDFA 4BWGA 4L28A 4EI8A 3IEKA 3U4IA 1DQNA 1ZGHA 1MAWA 1GYQA 2X19A 4KYVA 5DBFA 4E2YA 4FS8A 3QVJA 3GRCA 3ICQB 4QUBA 2EW2A 3QTBA 1SJ9A 2I2AA 3FDJA 5CCDA 5GVSA 3OQMA 4H77A 3QWBA 5IVHA 4EDFA 3Q6NA 4RM2A 3K2BA 2XH8A 5DMXA 1CJUC 1E2HA 1A3CA 1EVKA 1VJ5A 4IP0A 2VIIA 3BFPA 1NMQA 1YQ9A 2Z2JA 3MILA 4P0TA 4ZZ2A 2PUGA 4OK5A 2MJLA 5IX8A 4D9NA 1V4BA 4YY3B 4RK1A 4I1YA 2OQIA 2FFJA 3LFTA 5TMDA 2GXAA 1YUNA 2HHJA 2YZNA 1FFWA 3MRVA 4Z2YA 4HEA6 2A1UB 4Q21A 4AN1A 1HBJA 1NNI1 4XOUA 3BDIA 3DXFA 3UK6A 3I2IA 1QUFA 4XWOA 4E5PA 1AO0A 1TM3E 4DT1A 3IUJA 1C8BA 2XYHA 4IJKA 2HSDA 2C7VA 2O4CA 4OB7A 1TI7A 1VHWA 2WV9A 4QUEA 5DK4A 4WEQA 3CLHA 4BTLA 1E2DA 2X58A 3MRXA 4K9KA 3DGEC 3GHHA 4MI1A 4IUBS 1OBFO 4QT0A 4XM1A 4BRUA 5EJ6A 1BU8A 3Q0TA 1JHDA 1TGVA 3H4TA 1Y8ZA 5BP7A 2GCPA 4EL5A 1KJ9A 3AT1A 5HA5A 1COWD 3FVTA 5HZMA 2PBLA 3KRTA 5ERYA 5BV7A 4RQUA 3TG8A 3GLIA 1EQAA 1U3TA 1INLA 1JH8A 1R6TA 3CU5A 2OZEA 3JD1A 4GKAA 2HRDA 2H5EA 4R0MA 3E05A 5JZOA 4S1VA 4LGVA 1C3XA 4ZHQB 2WK1A 3B5JA 5CFZA 1ONPA 1L7BA 2OYSA 3FVWA 4FZJA 1MGPA 2Z2KA 3NEYA 3SF8B 5LKRA 4GZ3A 2WQ7A 4RLQA 4BXOA 4JI8B 3A9VA 2BGRA 2B6NA 1W2HA 3IE0A 5ALWA 4Z7NB 1ETUA 2C4WA 2EDCA 2QY9A 3A6DA 4JR1A 5TVGA 4JI3B 1O3YA 4R9RA 2W83A 3RS3A 1XL0A 2WDZA 2HO4A 1XRJA 2JI8A 4X90A 1BJRE 3OZAA 5DLEA 4AYTA 3HJAA 2VDWB 2GEKA 2VT6A 1YOVA 4MVJP 4Y2VA 1JNYA 3NHAA 5JNUA 1U90A 5TT0A 3MCVA 2ZYVX 2I3ZA 3VMMA 2AN9A 4C7BA 2VPYA 3TOXA 4NCBA 3ZDRA 1X1BA 2C9BA 2VDVE 5EQFA 1HFKA 5H02A 1QFYA 2FYTA 2FMTA 1ZLXA 2R6AA 1Z4KA 4UPVA 2M6RA 3AO0B 3HBNA 4Z9AA 4NCKA 2UUAB 1AXRA 4HCJA 4U8HA 1RM3A 3ZVLA 2BFPA 2H0AA 2UKDA 4KGVA 1NQOA 3GRZA 2ZVPX 4LY0A 4DA7A 5C5EA 3ZDEA 5KYWA 3DEAA 4JEHA 4HP8A 4X8MA 4D79A 2IHYA 2WKQA 3ETJA 3FNHA 3H11A 4HDSA 3UJPA 3GJZA 3PNBA 1M1YA 4RKQA 1BOFA 1OF1A 3B48A 4FTWA 4MWOA 2G5CA 3TLJA 4E4RA 1M1YB 3F8WA 5BNTA 3PLAE 1HT2E 3UKOA 3BQMB 4A92A 3VVMA 3HU2A 4NDAA 1QVZA 1N0UA 1FVXA 1PWYE 3DZJA 1A7JA 1W88A 1IZ9A 1P62B 1EB9A 1L5RA 4LGCA 1MU0A 4OU5A 3NHBA 4B3DA 4B83A 4E70A 3U61B 1G8PA 1SVNA 1OIWA 2BKVA 2EEZA 3N7AA 4LQLA 4GGPA 3RU9A 4AL4A 1TF5A 4DMHA 1A9SA 3RH0A 1YWGO 2JAXA 3SHTA 5H80A 2FRDA 1BCSA 4N82A 4TLMB 3DOJA 4MJLA 2WHRA 1DKUA 2CE7A 3FCXA 4LZLA 4WT7A 1G8JA 1RU3A 2UVQA 2WU4A 1B73A 4OOEA 4QU5A 5DMHA 5DW0A 3K1JA 2WWWA 4B2LA 4DIKA 1JMYA 3OO0A 4O1IA 1HR0B 4B6EA 1NVEA 2NVUB 5C18A 2WA2A 3MB5A 5JYDA 2N47A 2WWGA 2Q6KA 4U6SA 2OTCA 3H8WA 4MV5A 4UNQA 4B8WA 4BO0A 1GLNA 3NYWA 2XI4A 3MHTA 3C1AA 1J5XA 2IU4A 3F4KA 2P9QA 1M2JA 2HU7A 3FI0A 3A6FA 4DTIA 1NN3A 1YB5A 5F1OA 4IHJF 1WMFA 4HGQA 4UPDA 5K3AA 1RZUA 4WBNB 3M5WA 3W06A 5EIFA 1NYLA 3KX2A 3KAQA 1VIYA 5AW2A 5EJ2A 4DLUA 2PRKA 1CRPA 1NFRA 1ZJWA 3Q85A 3BN3A 1PK9A 2JIZD 2D0DA 4DG5A 3T4PA 1P7PA 4IWNA 4HOYA 1DDGA 3VAYA 2OZVA 3ADPA 3QVUA 3WJAA 3L3BA 1GNRA 4DA9A 5CB4A 2VTKA 2Y8EA 5LQMA 1YAJA 2O2CA 5K8CA 4JASB 5D1HA 1Y3AA 4KE6A 2QUJA 3CW9A 4AUEA 4BFYA 3MUFA 1U2EA 2C88A 4HNAB 4LJ9A 3UFXA 3IHTA 2PH7A 1J0DA 2P77A 3DAGA 2QMYA 2B82A 4OY3A 3RHSA 2EX1A 2XNCA 4NKRA 5CLJA 1MNAA 4KAJA 4RZHA 5EE3A 4JGIA 1PHPA 2BFDA 2I91A 3BMNB 3BCSA 1O6ZA 1DDIA 3URMA 4I5DA 2F67A 4JODA 4AVYA 4JXZA 4PN3A 5ALXA 1JEJA 3Q9UA 1ZN7A 4CKXA 1VL1A 3OQPA 4I4LA 1IMOA 3JR3A 2NTVA 3N3BC 4TMTA 2WVJA 2ZZMA 2OZLA 1EDZA 1AY0A 1SB8A 3G9QA 2FEXA 3OF2A 4FGWA 4C4SA 3K1AA 2F90A 4Q1BA 5DGCA 3CLRC 1H1LA 1ZVVA 2AFHA 1EFKA 4KXNA 5A04A 1DIOB 5DU2A 1P1FA 3TLGB 4NQRA 2Q4TA 3UMRA 1DT5A 4FCTA 4AW9A 5JNLA 2WHXA 2VHJA 3HXOA 1M8FA 1WY5A 3QBTA 4WASA 1OGJA 1IZZA 1QIIA 4EX6A 3V7NA 1HYHA 2RC6A 3ABIA 3ANYB 4H31A 4UNNA 3GEBA 1GAXA 4QUAA 3GXBA 3LW7A 3L6BA 3TDMA 1DAEA 1I1OA 2O3QA 1ZA1A 3EQ2A 5FOUA 1M6EX 3SN6A 5KWIA 3ZCVA 1E4OA 4F56A 2C5LA 4INAA 1FFGA 1AS0A 2J3LA 3OZIA 3WGYA 4RLFA 4JC4A 4MLZA 3RQIA 3ZNPA 5AK6A 2J85A 2WM8A 2EWWA 3OICA 3DQZA 3V46A 5HQ3B 5JVDA 2BMFA 5CG1A 4BXOB 1NF3A 5AW4A 1I2DA 2CVOA 1BDIA 5EWLB 2OQVA 3AVVA 2WT8A 3I12A 4I6EA 5IN4A 2V9CA 4J03A 4E6EA 1NHGA 4BJ3A 2PMBA 1ZVQA 4RVNA 1HDOA 1W93A 2A9JA 4FKBA 4IUYA 3QTTA 3WL4A 2H3HA 4EHHA 3RG2A 4RGVA 5JQWA 5LLDA 2XNDD 3WLRA 1NKSA 2SNIE 2C2WA 4G5QA 4ZDWA 5JEDA 2J9FA 3KSUA 1YA8A 4BV3A 3NWEA 3BIXA 2VTVA 5KKCA 3AVYA 3QPAA 1SB9A 5YASA 1BEUB 1DJQA 1ZWKA 2YC2C 4CQJA 2HMAA 4UTOA 5DYGA 2CXRA 3I92A 3OOSA 5EIOA 5HJ7A 5IUNC 3HPQA 1TK3A 1ACLA 3PPYA 1FYEA 1MIOB 2NT3A 3CC8A 2PRSA 5IC5A 5JCJA 1KMCA 5T4HA 5CB6A 1BA3A 1MH1A 2B3DA 2LTAA 1H0SA 5BWBA 2PZBA 5E9JA 1RNLA 3BTVA 2YWJA 4PYKA 2A58A 4FQ5A 4J8PA 4WV3A 3RAPR 2YQZA 4DC9A 4XEUA 4DT1B 4MIEA 1I0IA 4EELA 3R3VA 3AHDA 2UVPA 4IV8A 2FF7A 5IKPA 2VQDA 3SD7A 1EUCA 2MIIA 4RAQA 5JADA 1C2YA 3CJTA 4YP5A 1KFKB 2IC5A 2QS9A 1R37A 1SVIA 1SU4A 4FMPA 3NPAA 1T1SA 4Q4HA 4UNIA 1MC1A 3EX7C 1XU9A 4HGOA 1DV1A 1CUDA 2HLHA 2JZOA 2VZ9A 1CQZA 5JAMA 2DHCA 5DRYA 1YR6A 3TAHA 2VTDA 2EFYA 1RLUA 4TTRA 1RKBA 3UJDA 3WQQA 4I1PA 1OT3A 1U2SA 2AR0A 2EJBA 5DRTA 2IYSA 2NTYC 3TM5A 2JFVA 1UKAA 2ZXUA 3IDQA 3ORQA 1D4FA 2PZJA 3UATA 4RTMA 3LC2O 4R05A 4L8WB 1E2LA 2H7VA 5GONF 3VPSA 5IF3A 4M7PA 5DTRA 5CA0A 3T5TA 3QM1A 3EOZA 1TKRA 2O8CA 3OJOA 3LFUA 3BD7A 4RULA 3ZU3A 1Q3TA 2GEJA 1GKYA 1KZ7B 1TUBA 4CKWB 1YVUA 4AJNA 3O93A 4BO2A 1HYBA 3N58A 2F62A 1AM4D 1W96A 1M0WA 1P3Y1 5IJ0A 4B47A 2EIXA 2QN3A 1NT4A 1OBHA 3PDHA 4RYDA 1H2EA 1MTOA 1CW2B 1UK9A 5DX1A 1CIPA 3COVA 1VXRA 3PJGA 2RH4A 1FX0B 2W6MA 1B8VA 3NHUA 4HUQB 4MRVA 2GZRA 4HT3B 4D02A 3GRFA 3GP8A 5LNK6 3JVIA 1Z0KA 4OBWA 2EP7A 1OIVA 1X94A 1XJ5A 1XZKA 3JQFA 1T3HA 3CLKA 4L85A 4GL4A 5BNIA 1TOAA 2J3QA 3GAAA 2ES4A 2VDRB 1IOLA 2O3UA 2PVCA 5TX7A 3R5TA 3ZW8A 3FI9A 3OKCA 2CJWB 2CD9A 3BE4A 1E62A 3OIVA 4QYSA 4Q6WA 2VTEA 4TLEA 2EYUA 1Y8QA 1W0KD 5FFFA 5JCXA 1L5MA 5E4YA 2X2OA 3DW1X 3U37A 2WF9A 4BS9A 2Z3WA 2UZ3A 3LX6A 3S2ZA 1TAUA 3FLAA 2DQYA 1NN1A 3N0XA 1ILEA 1QSGA 1YO6A 1UK6A 2XB6A 2CB9A 1GITA 4FT2A 3ZU4A 3THXB 2JJQA 2P1DA 1Y6GA 2B2CA 4X92A 1D8AA 1PJZA 1KI6A 3AINA 4FU0A 4U2KA 4OHVA 4AYWA 2IZ7A 1PR9A 4LC0A 4F9FA 1T8YA 4ZJYA 5IDQA 1T26A 1NVKA 4Q3BA 5JQGA 1JILA 1EP1B 3KZMA 3HFRA 5ALPA 3LT0A 1WUIS 1YVDA 3NV7A 3ZU5A 3AI3A 2PUWA 4YCBA 3DT8A 3MC1A 3VU1A 3EA5A 3I4LA 2Q4RA 2QTVB 4O6VA 4E1VA 3RADC 2M32A 1TM7E 4LFAB 1YE3A 1DXOA 2QRHA 3PENA 4MQEA 2JIBA 3CEMA 3EBLA 1KH2A 3DNFA 2FEWB 3JTEA 3NWOA 3QG5A 3D7LA 4NS4A 3X1JA 4B6SA 2J9YB 1ST3A 3CNQS 3LVBA 5E3IA 1XMSA 4LJYA 3K0AA 4LMRA 5JH7F 1X7XB 3BQNB 2M6KA 4EHJA 3PC8A 2I0FA 2OWDA 2ZIVB 4KWEA 4JI5B 2C8LA 2BJHA 4U7GA 1H0KA 1TQ6A 1WHSB 1LDYA 1ZH0A 1WNFA 2FWBA 2L17A 2PLNA 3NHYA 2IPXA 4WOPA 4B76A 1LCIA 1OZ0A 3NBXX 1BXKA 1M2OA 4MA4A 1U3VA 1XA4A 2MYTA 3A14A 3B3JA 1S6YA 3BMQA 3OESA 3PC3A 5DP2A 2IHNA 4UXHA 2PVSA 4KPGA 4OUKX 4V38A 2FPWA 3QP9A 4YRTA 5D5PA 1RWPA 3P0EA 4I4TF 4LQ4A 1WCXA 1KP9A 1OLSB 4AG5A 1T9GS 4ONEA 1VDZA 4B2YA 1KJWA 3EF3A 1CKEA 1EHIA 2VJLA 1KI8A 1Z74A 4RFSA 1BMTA 2M9MA 2XADA 3V1NA 4EHKA 1E2PA 1P91A 1PYGA 1UXKA 3LHDA 1M74A 3A7EA 1JHVA 3UTDA 3AH8A 2A92A 2FPOA 1JH9A 4OJNA 3PD7A 4LE0A 4MYHA 1P3DA 3LT4A 4LFCB 3WBJA 4Y6QA 1LK0A 3HXPA 5A3QA 3SEAA 1HLDA 3E4CA 3JZAA 4WZAE 2NU9B 1OVGA 3JQ8A 3U4QA 3GCWA 4AY2A 1QRTA 2XNSA 1UJ2A 3WB2A 3PITA 3A4LA 3C3YA 2IELA 3ELYA 4BNNA 2IOQA 1FFSA 1H66A 3QUBA 4TS3A 5LB4A 2DTDA 5JSKA 2BMEA 4GUDA 2CGEA 4XH9B 4ZYWA 3QF4B 1ODSA 2FZ5A 1E66A 5D51S 1Z0DA 2B20A 1G8MA 1DDOA 2DT5A 5MDHA 5DNUA 3I01A 2PT6A 1JDBB 2Q5OA 4UFNA 4WN9A 3SC4A 1U28A 3FCOA 3PXXA 4BJ5A 4CN9A 5IASA 3I04M 4EABA 2BISA 2CCGA 2BMWA 3CKLA 2FR1A 2ERYA 3PQ7A 3UOAB 4BYMA 2G28A 3C16C 4GPEA 3FDXA 3KLMX 4LVCA 1R27A 2FQYA 4ETMA 3TJMA 4BLRA 4GR9A 5EQTA 2YINC 3QLTA 2FW1A 3L41A 5A4AA 5BN3B 1GRVA 5CM8B 4RYLA 2FDRA 3IV9A 3ZTYA 4HS4A 2PZGA 2AMFA 3URKA 1Y8QB 2ZSBA 3O4JA 2WJHA 4C7OB 2ZI7A 1ZI8A 3GQBA 3KOOA 4U3JB 2O0JA 5K51A 4Q9AA 3E82A 2H4JA 1E3QA 3UHFA 5HF6A 4FHFA 4UCQA 5FB3A 3RT9A 3F5SA 1OFVA 1JJFA 3HBJA 3TLCA 4HGZA 3ZUGA 1G1MA 1E7SA 2QSYA 4YUVA 4GRIA 2WNSA 1L4YA 4Q02A 1QO7A 3R9XB 3KOXA 4G8CA 3A6ZA 4M7RA 5LYYA 2OXFA 4PZYA 1AA9A 4GT1A 3PCRB 1M5RA 3WTCA 2BDUA 2H6EA 1QXSA 2VJOA 2CLLB 1O97D 3ONDA 2IU3A 3C8MA 3BH0A 3O4VA 3QKUA 4L6IA 3B1KA 2QZSA 3HLTA 3BXPA 2OOKA 3G2LA 1UMCB 3HSYA 3KOYA 2QQFA 3LTEA 4LNUA 4X20A 1T6NA 3VC2A 1A88A 4B43A 3CZ9A 3INRA 3OSUA 5E38A 4PNPA 3P0FA 3QNWA 2Z09A 2H2HA 4RHCA 3X2FA 1AUPA 2XHZA 5LIRA 4N18A 4OQEA 1YCDA 2O0HA 3BAZA 3MQFA 2D5CA 2G77B 3AIIA 3NDRA 2ZREA 4Z9XA 3QJ5A 1YU6A 1JP7A 1R8YA 4RKRA 3QE2A 3SXPA 1A77A 1XD9A 2HW8A 1WDKA 5AXCA 2Y9PB 1TQ8A 3LLSA 2P79A 4BFLA 5KC9A 3NFRA 2IODA 3G0HA 2QX9A 3KDAA 4C0SA 1YZHA 2WJ6A 1RTTA 4C3ZA 5T3YA 1NOKA 1F0YA 1LSSA 4K40A 4NHOA 2QDXA 4PWYA 1XAIA 6YASA 3W78A 1QHIA 2AL7A 3TIGA 5ICGA 2PAAA 4HDRB 3VVLA 3W2GA 4LE1A 4RHYA 2EKZA 3PR3A 1FLDA 1I0ZA 1P9OA 5AHWA 5TGZA 1T8PA 4DIFA 1KKMA 2X2FA 2QJTA 3GBPA 4DUPA 2OMEA 3EZFA 4DLPA 1CZKA 5DW3A 4GU5A 2FSFA 1B76A 1YA6A 1L4UA 2YNMA 2A5FA 3PA8A 4UE3S 1PLKA 4YP6A 2PKXA 4YDHB 4KNVA 3QWAA 1WPXA 4HPXB 3HB9A 1J5EB 5FL7D 2P68A 1ZUNA 1VCHA 4QBHA 2O8BA 2OHIA 4IS3A 4NBLA 4RPLA 4BGVA 4GOJA 3DFKA 4R1TA 2TMGA 5GGYA 3HUDA 5AW1A 2HT1A 3QKRB 5J2TA 4XSGA 2XWPA 1XQVA 3BSWA 3PT5A 2DPHA 1E2FA 3EXAA 3O2NA 1IM8A 3LT1A 3THXA 2H2WA 2G1UA 1MB9A 1DT3A 2AJDA 1E5LA 4K86A 1P7VA 3ZQJA 1WX1A 3A6HA 3KT8A 3DBHB 3L1IA 3QVGA 4M83A 1CY7A 3FUCA 3LUHA 5FHRA 5A7HA 4V2IA 3ZKWA 4TKMA 3NETA 2IUFA 1UP6A 3C6KA 4JHLA 4DQDA 4KDEA 5AKLA 3DLIA 3ZXUB 2AFHE 4OXXA 4OLHA 1FFAA 3HXTA 4QJIA 4DA0A 3FH0A 4EWLA 1G4AE 2OM6A 4N0MA 3PC4A 2I4OA 3BTOA 4F93B 1U8YA 1K06A 1HZZC 2PXCA 2RBEA 2Y92A 3FGNA 3PLNA 1TYEB 3SBDA 4DANA 3LC0A 1YBAA 4C21A 4YCSA 4XGQA 2CF6A 4UUMA 4BKUA 5KU7A 3CX6A 4JI4B 2GZAA 2IZ1A 2RHBA 4XM2A 3R7WA 4JT9A 3UAOA 5LQNA 2BTEA 4YAFA 4CCYA 1ZG3A 1NF9A 3L7MA 1XNGA 3V8BA 4LF8B 5CA1B 3D3WB 2JD1A 3LKZA 3IQGX 4WW0A 4J9UE 5K0ZA 4L8GA 4EFNA 1GA6A 1T3TA 3WSVA 4AD8A 3COPA 4IZ6A 2FETA 3Q1LA 2FOLA 5EQJB 4R2IA 4BZXA 1F2UB 3HPRA 1AHNA 2CLMB 5FUMA 3WB9A 2GBPA 3DZHA 2HIGA 3G6WA 1YJ5A 2YYAA 3IUQA 3PUWA 1W2WB 4TYWA 3PP8A 4MP8A 4LRQA 4PYQA 4E5KA 2DWOA 2B4QA 3S28A 3QXSA 3SDBA 4D43A 2W2QA 4HLUA 2VSOA 5DGTA 3TRKA 1CQWA 3Q0IA 4OREX 3IOMA 5L4NA 4PSDA 4QXQA 1N6KA 5KQLA 4CLHA 4XIYA 1NUTA 2XNDA 5LXTA 5GIOE 3RF7A 4IZIA 2WKPA 4C14A 3WAKA 2CUTA 4P84A 1G2IA 1USVA 1DIGA 2QMZA 1KYZA 1WETA 2GBGA 5BQ5A 3C5CA 1GSHA 3X43A 4LF4B 1HDEA 1C9DB 5ELXA 1JA0A 1XEAA 2CDBA 2FP4A 1C81A 2Z04A 3IIKA 3JQ8B 4HQ6A 3U4QB 2ILTA 4II3A 4MCIA 5DE3A 2BEUB 2RAVA 2Z4RA 5LZ4A 2V6IA 4G1FA 1GARA 5CAEA 1YR2A 4I1SA 2MCFA 3SX2A 1L5FA 3EQ6A 3TVYA 3KWLA 1WZIA 2ZJ3A 3HEAA 1Z4QA 1KTVA 1KVTA 2V7UA 4U6NA 1TM1E 1OLOA 2Y76A 3OIGA 3G02A 4XW2A 4EA6A 1I94B 1PP4A 4RVDA 2WJJA 5KQGA 3FG9A 3L0PA 4RTKA 2C4HA 2R60A 3EGXB 1VB5A 3IJRA 3ZYZA 4ZYLA 5FUVA 4IRMA 1D2RA 1UZAA 4ZXFA 5IT9A 2EVWX 2QLNA 4I9UA 3WGNA 4CTKA 5HKKA 3UUFA 5I7RA 1PV2A 2X8BA 4YPOA 2ZUEA 2XAAA 4S1TA 4IDNA 4EG0A 4CDGA 3HUTA 2I22A 3L7AA 3QVTA 3F6PA 2V6FA 3JD3A 3T35A 4NZOA 4L6CA 4CIXA 3NJRA 1C0EA 1P0IA 4CKBB 3E8SA 1MTZA 3OPXA 3D3WA 3L4BA 1ENOA 3CUEF 4YJKA 4J91A 1VYTA 2P69A 4JL6A 4ZD6A 3L8ZA 1T9AA 3SS7X 3W5VA 4LGYA 1N5MA 3ZQUA 4DLKA 3JV7A 1ORIA 1RZVA 4QDXA 1Y1QA 4YHHB 4E12A 1SUDA 2ZRCA 3C7AA 2CJFA 4GLLA 4K1LA 1Q0SA 2WKSA 4AJKA 5KVAA 4GI1A 2R4QA 1W49A 5F2EA 5BWNA 1OAOC 4RFSB 3ZY6A 3GG9A 4EHBA 4X8OA 3SSMA 1Q83A 1KS9A 2CLDX 3WSTA 4RAOA 3RRMA 3DT9A 4ZI5A 3KWMA 1KYQA 1NVVQ 2WT9A 3JYOA 3P9YA 4HYEA 1WB5A 4RELA 4B3HA 1SVSA 2ZW9A 3VR6A 1TVEA 3BMQB 4TWBA 3K70D 3SQXA 1SHJA 3CW8X 1DQSA 4A15A 1P8JA 3DLHA 4E1BA 2V4MA 1J0BA 4D9IA 3B20A 5ITZB 1REQB 1E3DA 5DOZA 3A6KA 2AZ4A 4QDKA 1TJ5A 2DH5A 4N3CA 5DBHX 4DRZA 5FTLA 2IDMA 4JEMA 3I1YA 3K09A 1E6UA 5DEOA 1N9KA 1ZLYA 3AZQA 1CVIA 3N28A 4N65A 5DTJA 4FGSA 4BCDA 4CFZA 3GMSA 3PIIA 5CAEB 1JJ7A 4C03A 3CLUD 1QCCA 2B6HA 5AJHA 4D25A 4TWRA 4V0MA 2GPSA 4DC1A 3CFYA 2ZYAA 3GCDA 3I8OA 1GL7A 2V8BA 3RBZA 2Q50A 5IANA 4L5JA 5CLGA 1M8JA 1VL0A 2I3BA 2LKCA 3P9PA 3DF9A 2AE1A 1PQPA 1U2QA 1X7DA 1ADYA 3MFQA 1GM5A 5I7EA 1NSFA 2Q5JA 3G5AA 2JLRA 2NV6A 1SC6A 3MWYW 5CBKA 2O8DA 1LH0A 5DZSA 4H7HA 1CERA 3EEYA 1VCOA 1T5SA 4FOLA 5TV2A 2JBAA 5IC6A 2Q4EA 2WAMA 4LZJA 2XA1A 3KS9A 3BL5A 1C3OA 4AUMA 2VN8A 2X41A 4LRSB 1JQLB 5H9VA 4ASUD 4K9LA 4KO8A 3RK0A 1FTYA 5DDIP 3TMAA 1ZESA 4QTXA 4FNAA 1DP4A 3MF4A 4ZAGA 4ZI2A 4TT3D 3X44A 1H2FA 4NU8X 3VAAA 4E6PA 4HDAA 2YW9A 1GGHA 4YR7A 1M66A 3M9LA 1B6SA 4M8NE 4XWYA 1NATA 3EAFA 4DSAA 4FGLA 1T6XA 1A95A 2P4HX 1IWPB 1JSZA 2W6OA 1EXNA 2XQKA 1CUCA 4IDGA 4QAQA 3EVBA 1STOA 4HTFA 5B30A 2TS1A 1EBFA 1B7GO 3GZTB 3X1YA 2IYRA 1JHOA 3O3MB 3WRXA 1E4YA 4GKVA 5P8WA 3GDHA 3HL4A 5K0BA 3PEVA 4ZU1X 1RYEA 5K6AA 3A32A 3PX7A 4HD8A 3FZQA 2ZYRA 2QL6A 4OFWA 3R9XA 2X6QA 3H86A 2MSDB 1CNFA 1O6FA 3ZH9B 2WM2A 2VF8A 3JQRA