4GMXA

Crystal structure of kpt185 in complex with crm1-ran-ranbp1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
209
structure length
205
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVLAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/inhibitor
molecule keywords GTP-binding nuclear protein Ran
publication title Selective inhibitors of nuclear export show that CRM1/XPO1 is a target in chronic lymphocytic leukemia.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 205
sequence length 209
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gmxA00
3KKPA 1EX6A 3WBJA 4G5RA 2ZRLA 1W0JD 4LYFA 3M6AA 4GRAA 2FDCA 4MITA 2ZE5A 4RZ2A 5TVKA 4WZ6A 4NHOA 5G40A 3CX6A 1N6IA 4NZYA 4YDHB 2RGDA 4HZUB 3W3ZB 1UBCA 3RLFA 4Q4AA 3RRMA 5A4JA 2QE7A 3E5HA 3VX3A 4N0EA 3R9XA 5CDFE 3KUCA 2QENA 3IILA 2OV2A 1SVMA 3GJXC 3PUZA 4Q1AA 4PSKA 5SZHB 1I4TD 2A5JA 1BH2A 1P9RA 3UMSA 4EPWA 3FMIA 2F3RA 3DL0A 3KUDA 2GF9A 1DAHA 4KYUA 3NWJA 1FQJA 3CLVA 4KYIB 5LB2A 1SHKA 1RIFA 4TZ0A 4M1SA 3HPRA 2QT0A 221PA 1KI9A 1LB1B 2IWRA 1A2BA 2QZ4A 3GLGB 2JLWA 1ZIOA 3Q85A 2QT1A 2WMOB 2P6NA 3I8SA 1COWD 1E79D 2JJ2A 2FFBA 1MO4A 4UNNA 5EP3A 1NVVR 5BYKA 3F3YA 2XB4A 4F93B 1BOFA 2REOA 2DYKA 3L82B 4M1OA 1WQ1R 4YDSA 3R7WA 3LBHA 2F6RA 2WIBA 3NH9A 3REFA 4LCBA 1OF1A 2W6ID 1XJQA 1VDZA 1J8MF 4B76A 1U0HC 5TY0A 1XPRA 2X77A 4CYMA 1R2QA 1JR3A 1KDPA 1IBRA 3AKYA 2JLUA 5D3MA 4D2IA 4LBWA 5JBQA 3VU9B 1M8PA 2HUPA 1HURA 1X8JA 3DMDA 3EWAA 4HYYA 3PUVA 3CW2A 4ABYA 1E2EA 1M74A 2ZITA 2N46A 1P9NA 5AWFC 2FFHA 1W5SA 2ZJZA 1TQDA 1Z6TA 4UXHA 1MR3F 2CL6X 4V0ME 4DZZA 3NXSA 721PA 2WKPA 4J0QA 3I1FA 1W46A 4DT1A 3U61B 2O8FB 3I72A 2GTPA 4D81A 4TQ9A 2J9RA 2KWIA 4IW3B 3IPYA 2FOLA 4KFTA 2AFHE 1DOAA 3TH5A 2ZREA 3P27A 4PSAA 5FPYA 4FMCB 2R6GA 1A4RA 3IKJA 2G88A 5CK5A 4AYWA 2BVNA 3QPUA 3OE7D 1F2TB 2H92A 2XZPA 4HZUA 4Q7KA 2BDTA 4DKXA 4DC9A 1IXSB 3NC0C 1W0JA 3ICEA 3VR5A 1KYIA 3EZ2A 2GKSA 2RGNA 4YONB 1G5RA 5DI3B 4PTLA 1JEDA 5DHFA 2VP5A 2VHQA 5FTJA 2A3RA 4M9SA 2QMHA 5FL3A 2BEKA 4LK2A 4F38A 3I62A 4B3FX 1OXSC 2ZJAA 2O8CB 4CDGA 1ZNWA 1OYYA 1W36C 1EFRD 3IEVA 4S2EA 2NO6A 1TX4B 1UKZA 5CM9C 3H4MA 1Z0FA 1W1WA 5EUMA 3GLGA 1E2MA 2ZRNA 4UNRA 5BWMA 4TT3D 4GFDA 3QBTA 5JWHA 3CR8A 1ZNYA 3X1XA 3K70C 1LW7A 5JWOA 1KGDA 3L2OB 3U4QB 3GFPA 4PQYA 3NBXX 4DCTA 3GMTA 2FFQA 2FSHA 2OCPA 2ZRBA 1COWA 1E79A 2GK7A 2CK3D 1Q44A 4URXR 4P3YA 2FH5B 4P4UA 3WYFA 4HB4A 4Q1DA 2CLCX 2CMKA 1T91A 1LS1A 3FFAA 4RZXA 2F1HA 1R0ZA 3VU9A 2OXCA 3FYHA 1AKEA 1JXMA 4M9ZA 2W6IA 4V0LA 4BFXA 3QE0A 4C2TA 4A8JC 1Q1BA 1SVIA 1SKQA 2FFAA 2R65A 5F3WB 3VNVA 2F3TA 4ON9A 1S96A 2XNSA 1LY1A 3CKLA 4OHWA 4KU4A 1U9IC 4MYCA 1E69A 4S35A 2O8FA 3AP2A 1BO6A 5EE5B 4C0SA 1Z2CA 4DLXA 3VR6A 4KVGA 3B1WA 5EP2A 3W8NA 3TUZC 1XF9A 2OBNA 4PPFA 2HT6A 1CRQA 2OCAA 4I81A 4XTCS 3GP8A 2UVQA 4Z51A 2J7KA 3M1IA 1NLFA 4NYJR 4OK6A 1J2JA 3FMPB 3L0IB 4AY2A 2A5YB 4UNPA 1F2TA 2AXPA 2ZS8A 4OQNA 3I61A 4PC6A 5K8UA 2PT5A 2W6JD 4JVNA 4Q7JB 1A7JA 5HE8A 1BYUA 1S4QA 3BB3A 5C4GB 2ODBA 2P3SA 2XJ4A 4I4LA 2WSMA 4QRHA 3OE7A 5DI3A 2C04A 3ND8A 3Q7PA 4ZCMA 2F55A 4HB0A 4YMWA 4PQFA 1QG2A 3ADDA 2VTKA 2QPTA 1G3UA 3BJIC 3HU1A 4A0RA 2OLJA 1E2NA 1Q1ZA 4R98A 2O8CA 2WSSD 2F1JA 1Q12A 4ZCIA 2VRWA 3GLFB 1UFQA 3CRMA 1R0YA 2X2EA 4Q18A 2MSCB 3GJ5A 4L8GA 1OE0A 2PMKA 1Z29A 2IYRA 2ZVQX 3EIEA 1EFRA 5JMTA 4V0NA 3ADCA 5IRCD 3U4QA 2V1UA 4H1VA 3FHTA 2GHIA 4NDZA 4TT3A 1NMZA 2FF7A 3QVUA 3DOEA 2FSGA 4P4SB 3L8ZA 2RCNA 4BRWA 2O0JA 4A92A 2KE5A 2ONKA 2QGZA 4QNMA 2OFOA 3ZQ6A 1DARA 1E2PA 2VF8A 3WRXC 2ZJOA 2IS2A 1IHUA 2HDNB 3SFVA 2CK3A 3AGPA 3L0OA 3T06B 1MRNA 2FEOA 2KBEA 5FUVA 1G7RA 2GXQA 1ELOA 4LSGA 5ELXA 2Q3FA 5EE9A 1NLZA 121PA 4C9BA 4WIAA 1G4AE 1K5DA 4MGIR 4URUR 5EP1A 1YZNA 2RGAA 3C4JA 4O0MA 3SN6A 2BM0A 2NIPA 2QMEA 1GL7A 2NGRA 3NHAA 4TMXA 4TZ6A 2WICA 4Q9JA 1E9RA 5JECA 2Z83A 2GJ9A 1VCOA 2WMNB 3MAAC 4MGYR 1JAIA 4LHXA 1EX7A 1KO8A 2GETA 2D2EA 4FN5A 1IAQA 1XP8A 1CS4C 1ZRHA 2REXB 2N1BA 3TR5A 2ZUCA 1AK2A 3PJRA 1CR0A 5FOWA 1ZD8A 1G21E 1KI4A 2HXSA 2ZE6A 1IOZA 5GVRA 3ZD7A 1IXRC 1IN4A 4XWAA 4DVGA 1SKYE 5BN5A 3VKWA 1VG1A 3A37A 4NONA 2IK8A 4US2R 1XEXB 2W6JA 1EWQA 1E99A 3J81k 1FMLA 4F4CA 2ZR9A 3W8RA 1NIPA 2BEJA 3B78A 3OEHD 3U6BA 3BD9A 1E0AA 3IO3A 5E3HA 4IVRA 1VHTA 4Q9KA 1GILA 1P2UA 3L8YA 5IDVA 3GLFA 4C2UA 2FN4A 1XEFA 2EFCB 4A0HA 2YINC 2QRZA 1Z6AA 4TQAA 1FZQA 1IN5A 1P2SA 2PLFA 2WSSA 3KJEA 4D4KA 2WWHA 3WBKA 1WDTA 4GP7A 4QGAA 3Q8XB 1HT2E 1UBFA 2GBLA 4RVCA 3G0HA 2ZJYA 3H1TA 3RS2A 4P4SA 1KDTA 3T12A 2RGBA 1N6HA 4DWJA 5KDOA 3THYA 3EZFA 2VHCA 5HCNA 1ZU5A 2QAJA 1Z0DA 1Z0KA 1ZNXA 2DWPA 5FOXA 1E4VA 1AIPA 1YVDA 3P4XA 1WA5A 1KK0A 1Z6GA 2NPFA 4A2PA 4M53A 1OFUX 1IJEA 1TF2A 2QMUA 2WKRA 3BIFA 1GRQA 1XTRA 3OZXA 4JL8A 1G7SA 1A82A 1OH6A 2W0MA 4LJ7A 1RYHA 2QAGC 4MQBA 5AK0A 1UEJA 1IQPA 4URYR 3BOSA 4Q21A 3KFXA 5C46F 2ZRKA 3CNOA 1L4YA 4XVRA 1L4UA 5FH9A 2QP4A 4LI0A 4NL4H 3I5XA 1D9XA 4TYYA 2CJWB 3R20A 1MOZA 3KL4A 1NN0A 2CHQA 2XNDD 3T5DA 3L0PA 2R6DA 2F1IA 2IEYA 2R62A 2WWWA 3VKGA 1X8KA 1JEEA 5KOYA 4NMMA 2JCSA 3E1SA 1OXTA 1JPJA 1QF9A 4WAUA 1U8YA 3BWDD 3VR1A 3BH0A 1Z06A 3KKOA 1B23P 1N6OA 1R5NA 1G7TA 1E9SA 2BBSA 1R0XA 2ECKA 3HP1A 2C99A 5DHAA 4TYPA 5A0FA 5F2EA 3HPQA 2OFWA 2ONJA 3H84A 1KI6B 4H1UA 1OLOA 2FZ4A 5KYKA 2VP9A 3LW8A 3W9YA 1DEKA 4DUGD 4R2HA 4TL6A 1P75A 3AKEA 5LB4A 2EYUA 4M1KA 4D4JA 4JT2A 3IIJA 4KSBA 3U7EB 2WJIA 3LXXA 3K9LA 3D8BA 4F4JA 1CBUA 3CO5A 3CNNA 3AVTA 1IY2A 4DBLC 3LAWA 1SHZA 1NMXA 1TADA 521PA 3ZZUA 5F9HA 4DXAA 1GKIA 3TW8B 2MMCA 3LX5A 3EA0A 3AKDA 1NVUQ 5D3QA 3W34A 3OEHA 2YC2C 1NKSA 2H5EA 2GAAA 3WMGA 1RVDA 4A9AA 5FPHA 1D6JA 3KDSE 4NYIQ 1XMJA 3NC1C 1M34E 2C95A 4LHVA 2H18A 2NMVA 3GEIA 1M7GA 2XITA 3CZPA 4B43A 1AZSC 2D74A 1FFHA 1G64A 3A36A 3OIUA 1U2RA 3QG1A 1ZM2A 3ASYA 5FBLB 2WWXA 3AGQA 1Y3AA 4DSTA 1Q22A 4TL8A 2BBOA 3O47A 2GESA 4M9XA 1T3LA 2K5UA 2NZ8A 1XMVA 2HF8A 5H70A 2RHDA 1NVWQ 1UF9A 3FHOA 4LPKA 1IN7A 1VYUA 4Q48A 2G1JA 1TQ2A 1VG8A 3LLMA 3IBGA 4FI3C 1NJFA 4LV6A 3T1QA 3LO5A 3IEUA 4BFSA 5G41A 2HT1A 3RRNA 5FL7D 1GM5A 3NBZC 4B3CA 4FD2A 2VP6A 1OSNA 2CJWA 1DS6A 4PQRA 1TMKA 2GJ8A 4B75A 2GJKA 3FKQA 2P6UA 1JNYA 4MRSA 3RAPR 2GCPA 2QTVB 1E98A 1G291 2QA5A 2GXUA 5CIQA 2H57A 4AG6A 3K9HA 3AB3A 3FMFA 4MRPA 3UXMA 3SR0A 2IS1A 1H8ED 5FOTA 1PUJA 2IYQA 2XNDA 3MJHA 3SJAA 1Z63A 5F9FA 3AVOA 3FVQA 3TQFA 4GT1A 2ZJ2A 1D8TA 1AQUA 1U99A 2DFTA 4QBFA 1W7AA 1PV4A 4LJAA 1PLJA 5HKKD 4HDCA 3NHBA 3PIRA 5FBWB 2X19A 1II0A 1IONA 2W83A 3K8YA 3M0EA 5CYOA 1X1SA 3OHMA 3X1WA 4D0NA 2R6FA 2IXEA 4JSTA 4Q9HA 1FX0B 2CL0X 3OIVA 4DSOA 3CB4A 3UMFA 3PVSA 4D6PA 3BAFA 4IVQA 1C4OA 1F3OA 4JLVA 4LJ6A 5SZKB 5GADl 1MO5A 4G5SA 1TAGA 3TNFA 4DUGA 3CNLA 2D3WA 2JLZA 5H8WA 3LD9A 1K8RA 4PO1A 2NO7A 4FINA 4LBVA 4RD2A 1CR4A 5H68A 4RKFA 4ZI3A 1GP2A 1FP7A 3FMOB 1E0JA 2AHOA 2JA1A 1GUAA 1G18A 3AP3A 1VMAA 3TK1A 5BXQC 5G53C 2ZYTX 2IA5A 1HYQA 1XDBA 1U98A 4LDJA 1M2OB 1SULA 1FNMA 3MG9A 4F92B 3AVVA 2YHSA 2IYYA 4LHYA 1GTVA 1KO7A 2IW3A 5AJWA 4QNRA 4MKGA 3OFND 3WNBA 4B32A 1HTWA 2J87A 3RANA 5TXGA 1GFIA 3HYRA 1O87A 4C3ZA 5AJVB 4II7A 2BMJA 2DWOA 3G82C 3IUYA 2HYIC 5EUQB 4HI0E 3V4RA 5LD2C 4YMSA 2BMDA 2GVZC 3P26A 2IEZA 1E9AA 3AF4A 2NG1A 3WY9A 1Z83A 3FHCB 2ORWA 4LBYA 4JLMA 3SC3A 4JVSB 3CR7A 1N3BA 5FL7A 1BIFA 1N6NA 1JR3E 4QJ4A 1TL7C 2OHFA 2AXNA 5EXTA 5JJLA 1TU3A 1P62B 1KAOA 2ODEA 3ZS9A 1KK3A 2WWYA 2OM2A 1QHIA 4D0GA 3SZRA 2QBYB 1G8GA 3GJ8A 3W5IA 1LFDB 1H8EA 1E0KA 1D5CA 1RW4A 3U3RA 2PJRA 5JEEA 4QOSA 3LV8A 3UWOA 2AL7A 4TMKA 5HPYB 4RSGA 1ZCBA 3U3KA 1ZM4A 4ZDWA 4G0NA 3A1WA 4AKEA 2WPDA 5KSYA 5HKKA 2AK2A 1QHXA 2MSEB 5AUPB 2V1XA 4RY2A 4JLOA 1W4CA 3QJYA 4PZLA 5L3RA 4K81B 3X1ZA 5JCZA 2IUSA 5KNCA 3W6PA 2Q9AA 5H1YA 3VR4A 1OV4A 4MKHA 4O3MA 3SJZA 3C16C 1W4AA 2CXXA 3H0KA 3GLIE 3D7MA 5LBIA 1OPXA 2I4IA 4M1MA 3LQQA 1ZM9A 5DYIA 3ZYCA 4XIGS 1S9HA 2PEYA 1QBKC 4UKDA 4UQOA 4EFMA 4BE7B 2HCJB 3AVQA 1T6NA 1E9CA 4LHWA 1WCV1 3MFYA 2QRNA 1W4RA 4BLQA 2FZLA 4JKYA 3KZ1E 4JLDA 3K9NA 3CZQA 2YWHA 1GNQA 2ZIAA 2UZIR 4PZZA 1G6OA 5FPSA 3F5FA 5HCIA 4W5JA 4A4DA 2RHMA 3Q9LA 5CB8A 2GJSA 4MDFA 3SHFA 5ANRB 4XTRA 3GLGE 3DKVA 4ZKEA 1UKEA 2FGKA 2ZUBA 1DELA 4IRUB 3NBFA 1W47A 1JXOA 2CCKA 2WZQA 6Q21A 3FOZA 1U90A 3KQHA 1X6VA 1G3IA 2FJUA 3BB4A 3OFNA 2QTFA 4JS0A 4OHZA 4DEYA 4M0LA 4PFSA 4IVPA 2CLSA 2PZGA 4ITRC 4CT4B 5KU1A 2BCJQ 2X1VA 5BW8A 4WBSA 3U7FB 2NTYC 2QQ0A 3SJBA 2FMXA 2B8WA 2J1LA 1HUQA 1WMSA 1RFLA 2AD1A 4DB4A 1KAGA 3N2IA 1V5WA 3ASZA 3PV0A 3MD0A 4D25A 2NO0A 1I4LD 4NTZA 4I1OA 3SOPA 4NYMQ 3W6NA 4AG5A 4HUTA 1JQLB 1PJRA 2FEMA 3UG6A 4M1WA 2QBYA 5DIFA 3I92A 3RWOA 1S2MA 1S3SA 1Z6YA 3SI7A 4C0KA 1GNPA 4IDHA 1P2VA 4O25A 3ONWA 1GWNA 3CRRA 1NNEA 2B92A 3GJ6A 4M1YA 2J59A 2IUTA 1T9HA 3E2IA 1KSJA 4MUAA 2ZJ5A 4BASA 4OHXA 3I8XA 4NCKA 2IF2A 4EPTA 4MYTA 4A1FA 1EWRA 4AKHA 1Z8FA 2YKGA 4D26A 1CJMA 2CNWD 4QM6A 4LYAA 1YQTA 4W7SA 4TSFD 3QKRB 5HTKA 1W44A 4Q00A 3REGA 3BBPA 4KFUA 2ZJ8A 4QHYA 2XTNA 3L0SA 5JCPA 3LX8A 4YMVA 1VIYA 1WE2A 5GJWC 1P72A 1TQ6A 3Q7QA 3GLHE 2WJHA 3W3AA 2XTMA 3ZLJA 1Z07A 3SFZA 1LV7A 1CULC 2ZM5A 1FTNA 2X2FA 2WWIA 2HV8A 2ATVA 2BCGY 2FSFA 2RGXA 4M21A 4HLUC 2RAPA 5M04A 1ZUHA 4P32A 1KI2A 1KK2A 2VQSA 4BLPA 2XB2A 2QL6A 1EG7A 3LQRA 1N6PA 1X8LA 2AK3A 3AF1A 4IEEA 4R7ZA 2WAXA 1VG0B 2PZEA 4JIMA 3C41J 3MCAA 2FPLA 2ZRFA 4JMPA 4C30A 1SQ5A 2HXYA 3ZIAD 4F4IA 4KBFA 4Q7LA 1OT3A 4IOKA 1ZC4A 3ZVNA 3SQWA 1P4SA 1OIVA 4OI1A 5TB5A 2BJWA 4TLCA 2P6RA 1VYTA 4GP6A 1KOFA 2OAQ1 2JGNA 5GJBA 4TTRA 4D80A 3K0FB 4K8OA 5EP4A 3U7HB 1CJTC 2RGCA 1E4YA 4MDEA 2XOKD 3AF0A 4E07A 4LZZA 2O8EB 2ZRJA 3B82A 3WNCA 1XXHE 4MGZR 3Q5DA 3GD7A 2BBWA 4L9SA 5FOSA 3A4NA 1Z6XA 3A4LA 4BPBA 2DBYA 2DY1A 5JFGA 2D2FA 3T1OA 1IJFA 4Q1BA 1HA3A 3JVVA 5LPNA 5CDFA 1U8ZA 3ZVMA 1NF3A 1R8QA 5DYGA 1AS2A 2BOVA 2CCGA 3ZJYA 2MMGA 1SVWA 5DN6D 4LPSA 4QL3A 2Z5FA 3O8CA 4NU0A 1G19A 2ZI5A 3IGFA 3QKRA 1ZD9A 4M8NE 2QPOA 1RRGA 4MA4A 5C4MA 3K0EA 1TEXA 4BLTA 1GKUB 2O0KA 3KB1A 3FTQA 2IF0A 2JAQA 2ZYWX 4EQ6A 3A1VA 2CNWA 1QHSA 5CLLA 4TSFA 4EKDA 4B44A 3EPKA 1D9ZA 1RJ9B 1CR1A 3LH5A 2XXAB 3BERA 1G16A 2OCYC 2ZSEA 3LBIA 3CH5A 1VIAA 4LJ4A 1WBDA 5DO9A 4B33A 2Q21A 2A30A 1N2CE 1UBGA 4EPYA 2OFXA 1LTQA 2QNRA 2P65A 3B8HA 4Y0AA 4HAZA 4B3GA 4P31A 1ZVQA 5FTKA 2DB3A 2ZANA 2ZRDA 1Z08A 2LKDA 3DEFA 2ZSBA 4R71A 4PPQA 2ZI7A 1YJ5A 4M9QA 2V55B 1G3RA 3I3SR 1U94A 4G5GA 1R0WA 3CRQA 4C7OB 1NJGA 2YZ2A 4XH9B 1Z0JA 3TLXA 2IS6A 3DPUA 2OAP1 2WWFA 3F0TA 3T34A 3K0SA 4QXAA 5JZVA 4AIIA 1ZMXA 2AN9A 4UNSA 2ZPTX 1XTQA 3AP1A 2E9SA 3ZIAA 5KO2A 1ZNZA 5KSZA 5L8VA 2QQEA 3ECCA 1SVOA 2CVFA 2VIIA 1ZM3A 4BFZA 4QGGA 4V0MA 3QKSB 3PEWA 3O8RA 3K0FA 4TLDA 2JIZD 5KSPA 4Z1MD 1II9A 3DDCA 5DI9A 4JVLA 4AWXA 2EWVA 2ASEA 2GF0A 3QY0A 4DCNA 3SQXA 3EC1A 1XCPA 2O8EA 1IXZA 1K5GA 2ZU0C 1EFCA 3KKMA 4GNKA 3QQ5A 5J40A 1YRBA 3QOFA 5E4FA 1S1MA 5J4VA 4KITB 2XOKA 2IYTA 3THYB 4RFSB 2E87A 4OQFA 1ZCAA 4LUCA 4B3BA 2OESA 1DADA 2GXSA 3U6KA 1NL3A 3MJRA 2GZHA 4GI7A 5AR1A 1XJ0A 4DDWA 3UPUA 2GZDA 5CB6A 2KB0A 4C0BA 1NN3A 2A5GA 2FA9A 3PITA 4OQMA 4PAQA 3RRZA 1N5IA 2ZRHA 4PX9A 4NH0A 4X8MA 4GMXA 2DFKB 5EJEA 3H86A 2V3CC 3WNDA 5J4KA 3U44B 4PC1A 1KI3A 3RC8A 4ZIRB 5DN6A 3FE2A 2GVDC 3LFUA 4LV5B 5A5GA 4GPTA 2PBRA 3AVUA 4Q47A 4A2WA 1N0VC 2ZI6A 4JVMA 5FUYA 3W90A 1RJ9A 1OFTA 2IL1A 2ZR7A 4PC3A 1KJYA 3VKHA 2XXAA 3EPJA 2V9PA 1KNXA 2QN6A 2VBCA 1M7HA 2IT1A 4WVFA 5E7IA 1UDWA 3R8CA 4OI0A 4Q66C 5BQ5A 1G8FA 1TUIA 2DPXA 2V4ZA 3ZD6A 1JQJC 3CPJB 3IQXA 4PC7A 3BGWA 1HH4A 2AKAB 3E70C 3GEHA 421PA 3EASA 5TDHA 1N0UA 2IYZA 4POAA 4OYHA 1ESMA 1X86B 2DFNA 2R9VA 4LHZA 1S0UA 2BKEA 3Q5EA 3SS8A 2CE2X 5DSZA 4ZKDA 3EZ7A 5FR1A 4F91B 4FIDA 1IY1A 4C7OA 4EUNA 4Z8XA 4NCJA 4V02A 3SNHA 3AH8A 4IHQA 4A36A 1MRSA 2BHRA 1A1VA 3CF2A 4EJSB 1U0LA 2DCUA 2IHYA 3QEJA 4HATA 4B2IA 3AVXA 4RD4A 1ZIPA 3RS3A 3AVPA 1XEWX 2OBMA 4X8HA 3N2EA 4LJ5A 4HB3A 1E2JA 5JRZA 5DNYB 1C9KA 2W58A 2CBZA 3LY5A 2GZAA 3HDTA 3QKSA 4CRWB 2IS4A 2XEXA 1F5NA 3AUXA 4G01B 2WVJA 1F6BA 3SBDA 4B71A 3B5JA 4NBSA 3ZQJA 2PX0A 4IXNA 2XTZA 2IYWA 1FP6A 5JI3E 1ZJ6A 1FPMA 1XTKA 4FXPA 4P0TA 2GCOB 4Z1MA 2JIZA 2PEZA 3NG1A 1ONBA 1CLUA 4XWOA 1R5OA 4RFSA 4ZDIA 5KUTA 1W0KA 3OESA 4QBGB 1NG9A 1II8B 2OSBA 2PZFA 1FW6A 2AWOA 2WAYA 1WF3A 1AS3A 4JZKA 3CPEA 4V0KA 2J45A 3RSLA 2O8BB 2DWQA 4PXAA 1SKYB 2YV5A 3MUFA 5EE3A 4BGDA 4MUBA 2BIFA 2ODNA 4C0LA 1R7RA 1Z3IX 3ZZ0A 3O8DA 4DCUA 4OK5A 5DLQC 1QVRA 1XTIA 2ZYUX 3TRFA 2YOGA 2C9OA 3TKLA 1Z0AA 2KI5A 3GJ4A 4G3XA 3TR0A 3U44A 1JI0A 4ZIRA 2VLIA 3OF5A 3P1JA 1DAIA 4HAWA 3WYAA 1LF5A 4A15A 2VSFA 2IWHA 3WYGA 4BEBA 2QTHA 4ARZB 3BFVA 1CRPA 3TMKA 5HR5A 3QVVA 2JLYA 2XSZD 1IN8A 4OQXA 2Z0MA 3LRPA 4RJLA 4FWTA 1T0HB 1YR8A 2FGJA 3EZ9A 5KTYA 4PPGA 1XZQA 2W2XA 1Q1EA 4OKSA 1VECA 2QUZA 5JS8A 1KMHA 4TL7A 2H8KA 2P5SA 5KNDA 1W2HA 3PG5A 4GZLA 1P73A 3RS4A 1AZTA 4HAYA 3P20A 2GXAA 2OEPA 3Q72A 2F43B 4LYJA 3QEOA 5F98A 1DE0A 2G1KA 3I32A 3QXHA 4IEIA 3T35A 2OCBA 1E9DA 4B6FA 1KI7A 4QBHA 5J4LA 1NBME 1ZYUA 1W5TA 2OT3B 4B48A 3UMRA 2OUKA 4EJSA 1AGPA 5FTNA 4JLNA 4DCVA 2QP3A 4L16A 4YC7A 2W0SA 2ZAMA 1G5PA 2P0EA 1SVSA 1US8B 4HDQB 2C5LA 1L7VC 3CWQA 4OHYA 2OE2A 1ANKA 4RKEA 1VCMA 3TAHA 3DOFA 2VP2A 3I4LA 4FCVA 1P6XA 2GA8A 4A6PA 1OB2A 1C1YA 1QHHB 2QSZA 3X1DA 3SBEA 3AF2A 2LCFA 3I5YA 3FPAA 2F1RA 3AKCA 3WMEA 2R6AA 2FSIA 1GZSA 2FPMA 4QHSA 2GCOA 2G77B 4TMVA 1OH8A 2J0QA 1JAHA 2BBTA 4CEHB 2WJJA 3UIEA 3VX4A 2RGNC 4B73A 4TYWA 1II8A 2E1RA 1P3JA 4OI2A 4YQFA 1QDEA 1OXXK 1KSGA 1DBSA 1VYVA 2O8BA 5IF9A 3B1YA 4P33A 2H7VA 4QFMA 4TL9A 5FFMA 3CM0A 3WHLA 3ADBA 4TLAA 2ERYA 4U00A 1DAFA 1VG9B 2C98A 3EG5A 4K46A 1E2KA 1SGWA 1W2GA 4BFUA 5JI2E 2CDNA 1GL6A 4EIWA 4ZDKA 3H2YA 1E2GA 5FBRB 1KDOA 2GNOA 3V4FA 4ARZA 4GDFA 1KI1A 1Q57A 2O0HA 2ZSAA 3IBYA 3OIYA 2ERXA 1KY3A 1KNQA 1SXJD 1XBTA 4LOAA 2WTUA 1T0JB 2GAOA 1EFHA 4DLWA 3T1TA 1D2MA 1YHNA 3OAAD 2BMFA 2XSZA 4G1UC 2VF7A 1LNZA 1SXJB 1T4GA 4UXIA 5B57C 1P5ZB 1G8PA 2G3YA 2EWWA 2OXRA 2R8RA 3UKDA 1J8YF 3MWLA 2WPDD 2F43A 3ETLA 4NCHA 4C0AC 2YOHA 1ZW6A 3A4MA 3U7GA 4V0OA 2A78A 1JB1A 4IOJA 3T5GA 2UZ3A 3CPHA 4A8JA 3AQ4A 1WP9A 1PLLA 1GKYA 1NVVQ 1E2HA 1OH5A 4ZI2A 1NN1A 2AFIE 3U2QA 1NKTA 2R44A 1KI8A 2AR7A 2JLXA 4JLBA 3SYNA 2YWGA 2OO7A 2ZS7A 2QSYA 4XWKA 1G3MA 4QM7A 1SZPA 2KBFA 4HDOB 1US8A 1XD9A 4D82A 1NSFA 1FUUA 4ZPXA 4L9WA 3QPVA 1ZINA 2ZI3A 3B1ZA 1QHHA 1FTSA 1CR2A 3KFVA 4HAVA 2V54A 1RYFA 3SEAA 3THWB 2YYZA 1RZ3A 3NKVA 1UBEA 1BS1A 4TMWA 2BMEA 3PENA 3SE0A 4WA7A 4PC2A 3EXAA 4C0JA 1AJEA 1NRJB 2ZEJA 1VHLA 1JJVA 2V6IA 4QBIA 3TSWA 4CEHA 2JLQA 3MLEA 1TF5A 2J0UB 4KJZA 5TV2A 4LY6A 4ESVA 2JJ1D 4HEJA 4KHZA 2ZR0A 4QHTA 4EFNA 1QHGA 2VHUA 3NBYC 2VP0A 3MWYW 2J7PD 4LYHA 5J5CA 3BH6A 5J4HA 2C78A 1IM2A 2EFHB 2ZRAA 2VO1A 1JBKA 4TQUS 4ZCLA 4DIEA 1I2MA 4OL0A 4IDQA 4PANA 3CBQA 3NH6A 5SZJA 3KJIA 1E9FA 3PR1A 1Z5ZA 4U5XA 2D06A 2SHKA 3VNUA 4A0FA 3RHFA 2Q9BA 4LV8B 3W6OA 4YMUA 3X1YA 2Z4SA 2ZSFA 4B2PA 3TSZA 4BRUA 1KKMA 4AD8A 1DO2A 3B1VA 3CX7A 1MKYA 2A5DA 3KTAA 4Q4HB 2XGJA 1UDXA 4HSEA 3BB1A 1CP2A 1OIXA 2ANBA 4M22A 1TU4A 1KO4A 4KV9A 3NIBA 3HR7A 5IT5A 2MSDB 3F8TA 1SXJA 4QG7A 4FMCF 4AKGA 3CH4B 3P4YA 2ORIA 1NP6A 3LLUA 1YR9A 1J70A 3BORA 1F2UB 3SU8A 3OAAA 3TVDA 3SDZA 1Z28A 1XMSA 2JASA 2QAGB 1XPOA 4KVAA 1JALA 3I73A 1UJ2A 5CYPA 3MSXA 5FUWA 4HAUA 3THXB 3MWJA 1DO0A 3KXIA 1KZ7B 4JBWA 2VHTA 3EA5A 4Q9IA 3IO5A 4XOIA 4EFLA 3RS5A 1GRRA 4MKFA 1KHTA 4C0QC 2C03A 5AJXA 3DHWC 3QKUA 1EFUA 4G5QA 1HE8B 3THWA 2NOAA 1IN6A 1XU4A 4M1TA 4W5HA 4MRVA 1D2NA 1XB2A 1MV5A 5GJVC 2NZJA 1ZD1A 3AV0B 1DG3A 2YOFA 4RD0A 2ZRIA 2IXFA 4Q03A 1FMJA 2J0UA 4DLUA 3B9PA 4NYIR 4UXJA 2P67A 1N0WA 4L15A 4HUQB 4Y0VA 4GOXA 3GJ3A 3QXCA 1T5LA 1U81A 4CVNA 2PCLA 2Z43A 2I1VB 2IXGA 4FCWA 2JJ1A 4B6EA 4UJ5A 4GSYA 4JLPA 2CVHA 2ODWA 3FFBA 4NYJQ 1AKYA 3K1JA 3VHLB 5JWRA 1UEIA 5JJKA 1SVLA 4O2RA 2V6JA 3B7GA 3P32A 1R4AA 5E95A 1XMIA 5KPDA 1G5TA 1DAMA 2J7PA 1D2EA 2LKCA 1MABB 3PUXA 1DPFA 1J90A 5KDLA 3QF7A 2ZSDA 4TLBA 4TMTA 2EQBA 1VKJA 1XNJA 4LJ8A 2CEAA 4NE2A 4OHVA 4CT5A 2ZVPX 1S3GA 2GBLC 1F48A 4PHTA 4B2LA 2WJVA 3CRW1 3GLIB 2ZRGA 4DLSA 2CCJA 1N5LA 4Q4HA 1NG1A 1E2LA 2FG5A 1VCIA 1CXZA 1S8FA 3ZVLA 3GJ0A 4HB2A 5SZIA 1G1MA 1S1CA 1YZQA 1XX6A 4IOLA 1JJ7A 3O8BA 4HLQB 2JLRA 4NP6A 4ZDJA 3CF0A 1F2UA 1S9DA 4Q1CA 3MRSA 1RPZA 1A2KC 4KLZA 4MKIA 1N6KA 2QAGA 1TUEA 3ZH9B 1Z0IA 2V7QD 2ZETA 4I1UA 4L4UA 1HEIA 4BECA 1XJCA 2P5TB 4PAOA 3THXA 2ZROA 2OBLA 1QZXA 3TUJC 3ADKA 2GEVA 3QXJA 4X8OA 2H17A 5JRJA 5FBQB 5JHHB 1NI3A 3IDQA 1XRJA 1TQ4A 2PCJA 4DLYA 5EXXA 1UM8A 1Q1QA 1XEWY 1ZUNB 5FI1B 4EPVA 4DHEA 5EE1A 3TUIC 2HEIA 3CF6R 3WRYC 4EQ6B 4Q1FA 4D4LA 4DLRA 1E0SA 4WOPA 1GOTA 3PEUA 3VQTA 1MO6A 3DM5A 4AYTA 4KBGA 1F60A 3BE4A 1RRCA 2ANCA 1CKEA 2EFDB 1HY3A 5JS7A 1M7BA 3EPHA 1DG1G 4HUQA 4PHGA 2CE7A 3LBNA 4C4PA 3IPXA 2GWHA 5JHGB 1YRAA 4EJSC 3GPLA 3BFXA 1XCMA 1J99A 2OLKA 3JVUA 1AQYA 5IHPA 2WM9B 1YKSA 3DKPA 2QEQA 1ZU4A 3MGCA 4HZIA 1ZP6A 4LX0A 1JR6A 1G8YA 5AUQA 4D0LB 1WRBA 3C8UA 2ZYVX 3LDAA 3KB2A 4BFTA 2GILA 1MABA 2QPAA 5TARA 1FQKA 3EZ6A 3VFDA 2A7QA 2JLSA 4GZMA 4N3NA 2XZOA 4UJ3A 3Q3JB 1RRPA 2I3BA 2REBA 1PVOA 3PEVA 3GLIA 1HE1C 5FR2A 2Z4RA 3GLHB 4E5UA 1MH1A 3NDBB 1V43A 4R2IA 2EFGA 3R9WA 4ERNA 2D7DA 2CHVA 3GCGA 5KDDA 5B2ZA 4DLZA 2EFEB 4Q02A 2G9NA 1NLYA 4AKIA 2G6BA 3A8TA 2ZRMA 1RRFA 3SJCA 1LVGA 1BMFD 2LWIA 3DZDA 4IXMA 3U3MA 3VR3A 5EZ6B 2D4HA 4MYHA 2GEUA 1G4UR 2VP4A 4IDOA 4Z54A 2Q0HA 3QENA 2A9KA 2HLDD 4DDTA 3K09A 2W2VA 1E9EA 2F7SA 5EE0A 4DB2A 4WXPA 3NVAA 3K0CA 2GEDA 2X8AA 3EIQA 1ESNA 3HU3A 3KJHA 4PHFA 3THOA 4BZPA 5LD2B 4GL2A 4IFBA 1L2TA 2WJYA 3ICQB 2EU8A 3BH7A 3B60A 4BWYA 2V7QA 1OXVA 3QF4B 3TVTA 3W5JA 2WIAA 2R6CA 1NSTA 1FUKA 4YXWD 2FWRA 2CL7X 4DEXA 4Q19A 1DAEA 3LVQE 1NY6A 3VTKA 5LDDC 1HV8A 3G5UA 4H9GA 1W49A 1L8QA 3C7KA 2VHJA 3EARA 3BRWD 3TJZA 5C1BA 1IY0A 4Q01A 3WP0A 2JJ8A 4I1SA 3T15A 1BYIA 3OEED 3LVRE 3HJNA 2GDJA 2B7CA 2YC4C 1XXHB 1N6RA 4JLJA 3QBVA 4B35A 3GLFE 2B6HA 4Z8YA 2IUUA 4CEJB 1QHYA 1KZGB 2PJZA 1Q3HA 2C77A 1CF4A 5DE3A 4EDHA 2QU8A 4RD6A 3QUSA 4ESHA 3K0AB 1VCNA 4TYQA 3U60B 4KXFB 3LWNA 1I4DD 2RGEA 2ATXA 2I1QA 3RS7A 4TYNA 2H1LA 1G41A 4US1R 3ZGXA 3IHLA 4DDUA 5FTLA 2ZXUA 5BN4A 4QJ3A 1KY2A 2A5FA 1W4BA 3QSYA 4AC9A 1P7CA 3QNUA 3PUYA 3GLHA 4CF7A 2IYUA 2PLRA 1YZKA 3V9PA 4YMTA 2Q3HA 621PA 3GFTA 3LA6A 1OKKD 2WWGA 1E2DA 3KQKA 2OILA 1W0KD 3QPWA 3AEZA 1YR7A 3S1AB 2B7BA 3SYLA 3EC2A 1Q3TA 4XJXA 4UNQA 2F9LA 5AUNB 1JECA 2DR3A 1P2TA 1YZGA 4TTQA 4EPRA 3X2SA 4PAMA 4NYMR 4BUJA 3WMFA 1UKYA 4OQLA 1N5JA 2IYLD 5KNBA 3B13B 4QGHA 1Y63A 1DVRA 1E2FA 3LW7A 4DJTA 4XSGA 1J7KA 1XD2B 2HJGA 1BMFA 5FOVA 1QVAA 3PQCA 4N0DA 1QHNA 1VPLA 3EIHA 1Q0UA 2C96A 3GJ7A 4LJ9A 4O2LA 4LWZA 4XVQA 5BN3A 3FKSD 2G83A 3RRYA 1LS6A 1ZUIA 2HLDA 2R2AA 3QF4A 4W5WA 2VPPA 4NKRA 2J46A 2IC5A 3KXLA 4FMDF 3U3JA 3RABA 3KQLA 4MRNA 2A2ZA 1KJWA 4QC2A 2ZI9A 4RD1A 5KPJA 4DLTA 2FNAA 3ZZTA 1G17A 2YWEA 5L3SB 2J3EA 1OFHA 1SXJC 3QKTA 4DRZA 3AM1A 4B3DA 2OZEA 4YXWA 1AS0A 1G8HA 5E7JA 1T3SA 4TTPA 5HE9A 2UKDA 4XD7D 1H8HD 1GRNA 1EXMA 1P9WA 2WOJA 1ETUA 2QM7A 3UK6A 1XXHA 1OXUA 1G7CA 2BC9A 1KMHB 4I99A 1E32A 1KMQA 3NDPA 4RFVA 821PA 1B0UA 4CEJA 3BC1A 2ZAOA 3OEEA 1RKBA 2VSXA 3HYTA 2J0SA 1TNDA 2Q9CA 4WW0A 2YNMA 5AJYA 2XJ9A 2C9CA 5FOUA 5B58C 3K0AA 3EX7C 2J41A 2L0XA 3B2EA 2IBMA 3HWSA 4BFYA 1Z47A 1CIPA 1GAJA 1KDRA 1R6BX 2ZUDA 4LBZA 3RNLA 3TE6A 4B74A 2QROA 1OFIA 2RGGA 1MT0A 4KLNA 4NPHA 5J47A 5HZKA 1K6MA 4MYUA 5G3YA 2KSQA 4WZAE 1CJUC 2OG2A 3PFIA 2B21A 1ODFA 1YU9A 3U3OA 3WHKA 4GBMA 2QY9A 4QGFA 2JLVA 4HAXA 3CWZA 5EXSA 3S1AA 2VSOA 3A1SA 3UANA 3KQNA 1XZPA 3K53A 3D6TB 1TTTA 2XZLA 1CJKC 1OKKA 4DCSA 2J0VA 4RZ3A 3ZVRA 1M1YE 1TEVA 4RD3A 2W2TA 1SVKA 4QKQA 2WJGA 4E03A 1E2IA 1CU1A 1W36D 5CJPA 5JLJA 1XD2A 4PO9A 4DLVA 1A5TA 4JLKA 2D7CA 1DAKA 2EYQA 2WV9A 1H65A 3N5CA 1E6CA 4JJZA 4D4MA 3K70D 2QP9X 1W36B 2TMKA 3RDPA 5FTMA 1DTSA 2ZJBA 1DAGA 3OIWA 3AF3A 1GDDA 4FWIB 4N1AA 4URVR 1LF0A 3FKSA 1U8AA 4OBEA 5JSZB 5EZ5A 5DISB 4Q9LA 2DHRA 1P60A 3K70B 5L3SA 5L3QB 1ZAKA 1E1RD 3GEEA 2RMKA 3MMPA 4OK3A 4G5OA 2H16A 3TQCA 1E3MA 1Q20A 2DFLA 1PUIA 4IFEA 1E2QA 4R9UC 4US0R 4PR0A 4PPNA 4JT4A 4YLGA 3KQUA 5FBVB 1XTSA 2YWFA 3HR8A 3RSOA 2NO1A 4JKIA 5BYJA 4AYXA 3BXZA 5CIWA 4XD7A 1H8HA 2O5VA 2Q3MA 2VYFA 2BWJA 1Z22A 3LNCA 3RC3A 1KK1A 1Q21A 1GSIA 4Q4LA 2VEDA 4AURA 5B64A 1U0JA 4A82A 4A8JB 3N70A 2GCNA 3DO6A 2Y8EA 3FGNA 5AJZA 4JBXA 1GG2A 4BFWA 3KKNA 1XFAA 1G9XA 3TBKA 1E1QD 1G3QA 1QRAA 1AM4D 2GRJA 4M4SA 2PL3A 1G20E 4FMBB 1O3YA 1TF7A 3EW9A 3UWKA 2B8TA 2RB4A 1GL9B 3QG5A 1EFTA 4AI6A 3KX2A 3KXKA 4BLOA 3PUWA 4IJMA 4LC0A 3AVWA 3A1TA 1XD8A 1YZTA 1FNNA 3L43A 4FW9A 3U5ZB 1GVNB 4HLUA 1NN5A 3M4YA 4WXRA 3KKQA 4U7DA 1OYWA 1PLKA 1X1RA 2P2LA 3BFKA 1HQYE 4EAQA 1XEXA 4BFVA 4E22A 4CIDA 3AVYA 5FI0B 4OI4A 4E09A 2YJTD 1CJVC 4Q4JB 4JYBA 4JSYA 4LGMA 4KCGA 3JZMA 1YZLA 4FMDB 4BZQA 1ZC3A 1NBMD 4CZ2A 1N5KA 3ZDQA 4TWZA 3D31A 5GJCA 4FCTA 1MO3A 3WXMA 4IOMA 3FWYA 1T3HA 3R9IA 1GNRA 4W9MC 2JDID 4TMZA 1NVXQ 4A6XA 4HLDA 1CTQA 1T8TA 3DVLA 2V8OA 4QJ5A 4ACBA 4RCYA 4OJKA 4LC1A 3V00A 2ZI4A 5J4YA 5B30A 5CK4A 2PX3A 3C5CA 5E7MA 1X3SA 3CIOA 4ZO4A 1SXJE 1UKVY 2HF9A 2ORVA 3RWMB 4U02A 1NIJA 5JSZA 1GIAA 2BJVA 4LRWA 3NEJA 5JJIA 5IK2D 3RVBA 3EPLA 4GMDA 2WKQA 3CUEF 4Q1EA 2FE4A 2VH5R 5L3QA 1ZBDA 1OHHD 5G3ZA 2PT7A 1G6HA 3C15C 4URZR 4V03A 3SYKA 3VAAA 4EPXA 1BKDR 3KTAB 1UAAA 2JEOA 4PSVA 1E1RA 3K09C 2VL7A 1KIMA 2GK6A 3C14C 4JL5A 4MRRA 2AKYA 1FOEB 1NMYA 2G0NA 3JZAA 2Q6TA 3K0CC 1UPTA 1E96A 1OB5A 1WB9A 4BQSA 4KI0A 2BM1A 1WBBA 3A58B 1E9BA 4IDNA 4ILEA 4PZYA 3UATA 3PCRB 3DZ8A 1GITA 2F9MA 2YVUA 3TSOA 4DSNA 1UADA 4A2QA 4ASUD 4CGZA 1W48A 3T1VA 1U9IA 5JEDA 3PEYA 3QI2A 4Q5IA 1EK0A 4B47A 1RC8A 2HYDA 4C0HA 1KO1A 2FX3A 3NTUA 3NEYA 5FUXA 2AD5A 1E1QA 3EAQA 4JYCA 2XAUA 1EESA 4TN1A 3R8FA 1KI6A 4KFSA 1R8SA 3QXXA 2QORA 3TAUA 4P4TA 2D62A 5EXPA 3PXGA 1OH7A 2AWNA 4XVUA 4HLCA 4Q4JA 4JBYA 2ZU6A 2O8DB 3DM9B 4ACAA 4JL6A 2ZTSA 4RCZA 2QGNA 1PZNA 1HT1E 1OIWA 4CEIB 3GQBA 1N6LA 1T8UA 1QG4A 4JJKA 5UKDA 2WHXA 3BK7A 3MWKA 5K8IA 5EQTA 5DGXA 1Z2AA 2HCBA 3AUYA 2ZRPA 3D3QA 3ZS8A 4BZXA 8OHMA 2IYXA 4KO8A 5KSOA 3EWSA 5GVSA 3RYTC 2IX3A 2Z6VA 3QIAA 1NBMA 3VMFA 1OJLA 1YR6A 5DH9A 1RE0A 2HJVA 4BLSA 1N25A 1HQCA 4MGKR 2NO9A 2JATA 4AK9A 1KSHA 1M6NA 1R10A 2XX3A 4XSHA 2EW1A 2JDIA 4JLAA 1XPUA 1ZM7A 2QE7D 5FPTA 1NY5A 4RZUA 3K9GA 1XTJA 1YE8A 3TW4A 4BLRA 3GFOA 1P61B 4B3XA 2QG6A 3HU2A 4MH0R 1T5IA 2IYSA 3KJGA 2EVWX 2IYVA 4Q4AB 2CLDX 4TLEA 3QXSA 3WP1B 1XWIA 3CX8A 1WXQA 3VHXA 5HZHA 4KFRA 5K8LA 4KSCA 5IK2A 1TPZA 2IHBA 1KKLA 3C5HA 2ZE7A 3FDIA 1OHHA 2ZQ5A 2QM8A 1KJZA 2GJAA 1EGAA 5AUOB 5CJ2A 1KTVA 2AX4A 3DMNA 5KHOC 4NCIA 2PMDA 4B34A 2FPKA 1YZUA 2JJ2D 2FV8A 3IIKA 1AGRA 5TMPA 5K8TA 4LJYA 4F7WA 4OJQA 4M2LA 2C8VA 3SHWA 5FPKA 5C2JB 2C2HA 2G0TA 2C9YA 2N42A 5P21A 4ZV4A 2BKUA 3T61A 3B6EA 4I1VA 3RS0A 3FB4A 2NPIA 3TIFA 1KSFX 2ZE8A 5CLQA 4DSUA 2O52A 4GOJA 4ASUA 3A6PC 3CONA 3CRVA 1JPNA 1JR3D 2WOOA 5CM8B 2FU5C 2RKOA 3IQWA 2J5XA 2QI9C 4GOKA 2WBLC 3R7WB 4WZBE 1CEEA 1FL9A 4KODA 4NCNA 1I2DA 2QMOA 3A1UA 3IHWA 1FX0A 5C18A 1R5BA 5D3MB 1OW3B 3BS4A 2W00A 2O8DA 3B9QA 4DDVA 4A0GA 1E94E 2VA8A 4CW7A 2RH5A 2NQ2C 5CITA 4CEIA 4BEJA 1VTKA 5L3VA 3LXRA 4IKEA 3B1XA 2ZRCA 1XCGB 4Q7MB 2BV3A 3UG7A 1KO5A 3ND9A 4PHHA 4DIDA 2CHGA 2ZS9A 4URWR 4PO8A 3VR2A 4DT1B 3TGPA 4KAXA 3IIMA 1AA9A 1AN0A 4IDPA 4X8LA 4L5BA 2PH1A 3B85A 2KJQA
chains in the Genus database with same CATH superfamily
1EX6A 1CRZA 1JEYB 4XJVA 1MFPA 5JISA 1W0JD 3B51X 3ROMA 4YJ2B 4MRMA 4XKJA 5TVKA 2XDAA 4J3FA 3K9CA 3CX6A 1N6IA 1R5JA 3W3ZB 2RGDA 4HZUB 4B85A 2B69A 3A05A 3GRYA 1RP1A 3AWDA 3O83A 3PVCA 5F78A 3RLFA 3DAFA 4H77A 4MK4A 3RRMA 3H8JA 1QS0A 4BNGA 1O9BA 3DXFA 1GFZA 3VX3A 3H5LA 3H83A 4BNVA 5L51A 1AO0A 3MN1A 2BP7B 3DZCA 2VF2A 2OV2A 2QU7A 2QUJA 1SVMA 3IILA 3GJXC 3GRZA 4K88A 4PLTA 3PUZA 3Q15C 4ZVKA 4AROA 1A8IA 4FYXA 4GM1A 2VDNB 3FMIA 4HVCA 1WXDA 2I6GA 4PRZA 4RF3A 4R16A 1REQA 3F6EX 4QXOA 2PXAA 2UZ4A 4XFKA 3Q8LA 1E8MA 4KYIB 1WLSA 2PR2A 1NFRA 5LB2A 3TQRA 1RIFA 1Y3IA 3QYPA 4RM3A 5HQ3B 2WA1A 4XDYA 3RSSA 1FFXA 5TR9A 5KC9A 1KI9A 2RH9B 3TL3A 2BONA 2NZ2A 1H93A 4AMGA 2YWJA 3OD5A 4DCMA 1NMQA 3RTBA 5A4AA 2ZIWB 1EJ0A 3Q85A 3GELA 1NLUA 2C84A 2HEGA 1EVQA 2RSLA 1PJQA 5ENVA 2VYVA 1C8VB 1QIGA 2R8ZA 5EP3A 1NVVR 5FRDA 3NORA 2FHSA 2QX4A 1UPCA 5GMOA 3RC1A 5BYKA 5EJ6A 4F93B 3C6YA 1QPGA 2REOA 1YDWA 1TJ3A 1QIMA 3EXG1 1QP8A 4NZOA 3WQRA 3L82B 4QAQA 3O3MB 3KYDB 4PLHA 4YDSA 5HBRA 3R7WA 4XCQA 2E0IA 2DPMA 5JNVA 4BE4A 5D00A 2NADA 3PU6A 2W6ID 1N33B 1EAMA 4S0ZA 4DQ0A 1J8MF 4B76A 2Q1SA 3DMHA 3LT1A 1K92A 5FWAA 1VLHA 4KIFA 2VT2A 3RYCA 3VXKA 3K32A 1FXWA 1M8PA 4HNRA 2HUPA 1QPZA 1XHEA 3HBAA 9LDBA 4MYRA 2EJTA 1U6IA 2O6LA 1M74A 4GI3A 4CLRA 2N46A 1P9NA 1THGA 1UMDB 1W5SA 2F62A 3RJ9A 3ZDXB 1Z6TA 1N7JA 3R5FA 3ZWKA 4ALMA 2QUHA 2VAMA 4WHMA 4V0RA 3LG2A 3TSCA 4J0QA 4MO9A 3I1FA 4LA4A 1AUOA 1MCZA 4W8GA 5HRUA 4G9GA 4D81A 2D2IA 2J9RA 1MMFB 3SZGA 2FWBA 3A6GA 4IW3B 4MVJE 3IJEB 2C9ZA 1VMIA 1DAOA 1NTOA 1JEYA 4BNHA 4QASA 5FPYA 5B1IA 2ID8A 2R6GA 2ZOSA 5HA5A 3ODGA 5T4EA 3O93A 4B8YA 4I66A 3IUSA 3IXQA 4LZLA 1IQRA 1OMOA 3ZWAA 2XUFA 2H2IA 3T3GA 1EQAA 1Y33E 2JAPA 2GT1A 3OE7D 3F9RA 3QPUA 2H92A 4E70A 4HZUA 3LLSA 2BDTA 2G4VA 1NZDA 3VZBA 3BD7A 4JI6B 1CEXA 1NA5A 3QFRA 4R1QA 4DC9A 3ICEA 2W8BB 3C5WP 5CB4F 3BJZA 1XIVA 3AI7A 1NBEA 1OCEA 2BP7A 2RGNA 3CCFA 3EAFA 1MG5A 4CKWB 1JBEA 1SBTA 4IRMA 5JD4A 1GZ4A 2ZIEA 1YOBA 4K6CA 4M55A 1LI4A 3ME5A 3LHSA 2Q3JA 1I24A 2VHQA 4R2LA 2A3RA 1OC4A 4WI1A 4GKJB 3RFUA 4BNJA 1JIQA 3DP9A 3R8XA 1K88A 1OXSC 2ZJAA 1X70A 4B3FX 4F3RA 5AJHA 2BEUB 5HQ3A 1ZNWA 3MF4A 4CODB 3A1EA 4EMUA 2XE8A 2O6HA 5I7SA 4S2EA 4ZTBA 3DO8A 3OFVA 1Z0FA 1W1WA 1B6GA 1MOSA 4TT3D 4GFDA 1GGFA 4LF6B 2XNCA 3P9ZA 1TPYA 3CR8A 4L4YA 5IF3A 3K70C 4K28A 2UUAB 2YY6A 4X54A 1DIOB 4D8YA 1KGDA 3M6VA 1VHJA 4IIDA 4NJMB 4CM7A 2MHCA 3KL2A 5CVUA 3GMTA 2JAOA 5U4QA 2VT7A 2ZT8A 3MOIA 1COWA 4JJGA 3KYDA 2CK3D 3H04A 4GP9A 4C7BA 4URXR 3HO1A 2VYND 2XY4A 3DW1X 1UEXC 1WCIB 2CLCX 2IDKA 1T91A 3K0KA 1SXQA 4RVUA 3ENNA 1PE0A 4RZXA 3M9XA 5IYZF 2CXRA 4WK0B 4N82A 1XQ1A 1XNHA 4L7VA 2C59A 4QIHA 3FYHA 5HILA 3WWYA 3BCUA 1T2UA 3A7EA 3BTVA 1E7WA 3G1UA 3LL7A 1IZZA 4M9ZA 1PKEA 4V0LA 3BRCA 5F12A 3ZK8A 1CWUA 1YI0A 3FUXA 3S81A 5CT4A 1UMDA 4A5SA 2XNSA 2I87A 1AUPA 1PEKE 5EUBA 1G66A 3QEAZ 1SQ6A 5ED4A 1UKCA 3O8OB 2G9ZA 2FZWA 3R5HA 4OHWA 4YAOA 4UTRA 2Z6QA 1XRRA 3EDRA 2X3UA 2I4LA 4C0SA 4DLXA 1Z2CA 1KU0A 3VR6A 4CDNA 5JV5A 5C52B 4Z6KA 3TUZC 4ER5A 3I52A 2YZGA 4EW1A 2R5NA 4A0QA 3ZCUA 5I4BA 3LX6A 2HT6A 3ACDA 5LC1A 3EFBA 4K9KA 1Z38A 3C98A 2QD3A 2FRXA 1UBJS 4YCAA 1NLFA 2CWDA 1L8XA 2FW8A 3Q3HA 4KVFA 3LUBA 3FMPB 4MUFA 1ZXXA 2Q1WA 2X7XA 1BD3A 4JD5A 4OQNA 4UNPA 4RWEA 1SAYA 2PT5A 2IHKA 4QPPA 2W6JD 3DZHA 4JVNA 1CUJA 2W8BA 4MW7A 4UZFA 3VO2A 4GWGA 4PIVA 1S4QA 3E35A 4MIKA 2R6R1 4RANA 4B7AA 4CKWA 2XJ4A 4PWYA 4QRHA 3UQYS 4UBNA 3QVXA 1M8KA 1VSBA 2C04A 4HX5A 3K2BA 3Q7PA 2F55A 2JFQA 3FJOA 3LFTA 4KWTA 4M8SA 1TFUA 4BQNA 2QRQA 5LXTF 5JYBA 1W19A 3LBFA 2BF4A 3BJIC 1CQWA 1YI1A 2BEUA 2OLJA 1Q1ZA 2O07A 2JANA 1ULSA 1YB2A 3MTBA 1YACA 2HHJA 3DCNA 2R6HA 1IG3A 3GLSA 3CRMA 4PYRA 4RH1A 3M6XA 1D1SA 4P7BA 4GOND 3PDJA 1R6TA 3O8LA 4GYWA 1Z29A 4RDIA 2ZVQX 1EFRA 4PVCA 4V0NA 1KVQA 4KV7A 1MX3A 6AT1A 4H1VA 2GHIA 4NJMA 1NVKA 4NDZA 3RNOA 4Z4IA 3QVUA 3IESA 1QLHA 2BUCA 4KQXA 2RCNA 4XB2A 5ALKA 3ZDEA 4UOEA 4Z3DA 5HS4A 4F8EA 4A92A 1NQTA 2HJRA 1NOIA 2ONKA 2QGZA 2YTZA 1UT6A 3A9SA 3HFRA 1KJ9A 4OU4A 4MIOA 1ZK0A 1WCIA 1N9GB 4PGGA 4QNMA 5IVIA 3UVEA 4DTCA 2G1PA 3NAGA 1C7FA 1JWBB 3PC2A 2IS2A 1QQAA 1X92A 1YVUA 2CXSA 2H48A 3ETJA 4D6YA 5JT1A 1HSZA 4HDRB 3W9SA 3SFVA 3T06B 1BWPA 5LQMA 5FUVA 1G7RA 1XA4A 4LSGA 4FJ2A 2C1XA 1KEVA 1NLZA 1Q0QA 2DSTA 3CLUC 4Y1RB 5ER6A 1X15A 3N2GB 1Y37A 1K5DA 1QRRA 4BWGA 3F97A 3E3OA 1PFVA 1YZNA 4YT2A 4OHOA 3D59A 2FG6C 2P9GA 2QQGA 2R5FA 4L5YA 3O8OA 4O0MA 5IKMA 3R0JA 3K8QA 5ALUA 3HN6A 5F23A 3DR5A 2EP7A 3I2JA 3W5UA 3D54D 4YRKA 4TMXA 3P19A 4TZ6A 3SZLA 3CMMA 2ID7A 2PZBA 4DR4B 3UT0A 2WMNB 2CXUA 2DXIA 4D44A 4GLOA 1B0ZA 1N5OX 1UWKA 1KO8A 1LSOA 3O90A 4MAFA 1LJ8A 3U3XA 3AR4A 3TZHA 1SKMA 3LDHA 4FGWA 2WFZA 1SBYA 1KQNA 2VUSA 1K7SN 4JU8A 2V7BA 1H9CA 3DVSX 1CR0A 2QSJA 4RQTA 4PVDA 4MUMA 1KI4A 3GRPA 1K8QA 2CNBA 4RHTA 3TE7A 1HL7A 2Y0PA 2BH9A 5K6RA 5ELLA 4GUAA 2B94A 4LY9A 5BNFA 4N8DA 7ADHA 2P9ZA 5DTRA 2C57A 5AVWA 4XWAA 1LPAB 3Q10A 1XI2A 3ZTYA 5CYGA 5DGCA 3VKWA 3N05A 3HTXA 2IY9A 2R48A 5BMVF 4US2R 3FR8A 5EMJA 4NNJA 2D0OB 3WO1A 1L1EA 3J81k 1OWMA 5GGXA 2ZR9A 3MERA 4FOTA 3QYJA 3BSWA 1IBSA 5IABA 1ZKDA 1FTYA 2BEJA 1ZOIA 2JBAB 2XRMA 3B78A 1MDFA 3ZE1B 5E3HA 3FRHA 5EI5A 5JCJA 2CDBA 1PGJA 5GINE 4M3NA 4PM4A 3TMYA 4N48A 1XEFA 2EFCB 4Q37A 4JYMA 3RAGA 3PPXA 1C9YA 2C8KA 2Q5FA 3D3EA 5JYCA 2WSSA 5KCZA 1ARZA 2H7YA 4JEMA 1F0KA 4LZNA 4X90A 3RRBA 5B1DA 3F4KA 1JG7A 1OLUB 5MN4A 3BILA 2FP4B 1RS0A 4D6XA 3H6KA 4CCSA 1EA5A 1MQ9A 3RVQA 3GUUA 1J7JA 2GYWA 1KDTA 1XDDA 3H8SA 3KJXA 4IV8A 3TTUA 4ED9A 4EVRA 5KDOA 2Q2QA 2Q4RA 1MB3A 3ZU6A 4BQOA 4AMZA 2JD0A 1Z0DA 1FSGA 2DWPA 1XL1A 2J48A 1N9GA 2XHZA 1AHNA 1NU8A 3P4XA 2LW7A 1KQGA 3SKXA 4HDRA 4BYMA 3QWFA 2NPFA 5IFLA 4A2PA 1CK4A 1OFUX 2DUUA 1TF2A 1Z5UA 4PF1A 4ZQGA 1GRQA 4IILA 4BO6A 1OH6A 4WNIA 4OB8A 3UMJA 3RIEA 2W0MA 2L2QA 5C4IA 4Y1RA 4HVTA 5ALQA 3N2GA 3LZCA 4URYR 3EZNA 3BOSA 4ETWA 1XCBA 5C46F 3OT4A 4UAVA 3CNOA 3AOGA 3H99A 4LKOA 2ZRQA 3MT8A 2QP4A 5AKXA 4ABTA 4R1UA 2O5EA 1NFFA 3EDQA 1D9XA 1M1YB 2H1RA 3PZRA 4TYYA 4RLSA 1Y3FE 4YS6A 4AP6A 1SCJA 3DOOA 5CW1A 2JKYA 4DZRA 1NN0A 5FHQA 5IPFA 1DBVO 4EF5A 1LBIA 2DF8A 2HF2A 2VXCA 4PZ0A 1QXSA 2Z1MA 2IEYA 4A7PA 1E4OA 2WWWA 4YCMA 1EIWA 2WT8A 2W98A 2Q41A 3FLBA 3E05A 5KOYA 4NMMA 1MEJA 5CEEA 1Y1SA 5LP1A 5AVUA 4AZTA 2QIPA 1NV9A 2H0QA 1Z06A 2B25A 2Q3DA 2W7TA 1B23P 3NI2A 1A9ZA 1E9SA 1G7TA 3DV2A 3NHYA 3G02A 1VE7A 2ATIA 5F2EA 3N3BC 2ROQA 2OFWA 2ONJA 3VAYA 3DJFA 4H1UA 4NV1A 2FZ4A 5KTPA 1AQNA 1BA3A 2VP9A 3LW8A 2GF2A 2QMYA 1DEKA 3DEAA 4TTSA 3FETA 1GYRA 1P75A 4KIWA 5LQDA 5ALEA 3L8MA 4D4JA 4NFLA 3IIJA 3ILVA 3U7EB 2JBAA 4EMBA 4PLZA 2E48A 3TBHA 5CT9A 3M5PA 4R1TA 5IVHA 1WU8A 4XFDA 3G0CA 3CNNA 5E1MA 1IY2A 1XDZA 1QCZA 1N34B 1NMXA 5EEHA 1GKIA 5AKGA 2MMCA 4UCXA 3EA0A 3TW8B 1NVUQ 2RCYA 1NFQA 3W34A 5A3RA 1BS2A 2G36A 2NVWA 2YC2C 3HGQA 4FLEA 1GV1A 4XVCA 2GAAA 2NSJA 1PT5A 2PWZA 4RHEA 3UAXA 1GRCA 4HQNA 4ZGWA 2JD2A 4NYIQ 2J07A 4F9GA 3W8EA 4HMOA 1OLUA 1QZTA 1WR8A 3R0VA 1DQSA 2FP4A 2QN9A 4ZQIA 3EEOA 4XR4A 1P4AA 4ZCPA 3LU1A 4GW3A 1XL0A 1H85A 3A27A 5EZYF 5GM1A 2OMEA 3RK1A 3WKDA 5JZBA 1AZSC 2JGAA 3OIUA 4Y2YA 4JYZA 1RLIA 1U2RA 4O02B 4X84A 1I32A 3ZK7A 3ASYA 5FBLB 1Q22A 1G60A 3PDWA 2BBOA 2CXTA 2I4OA 1UZMA 2IBSA 3SX0A 3C7AA 2R4TA 3OHSX 1QUEA 1Y6JA 2NZ8A 2W71A 2JW5A 4DV7B 3PFNA 3WYDA 3VDQA 1DRKA 3SIXA 1NVBA 4B82A 2CV0A 4UU8A 1C9DB 1VG8A 3JCZA 4PZAA 1NJFA 3TLBA 1D5WA 3LO5A 4DPLA 4X66B 3DT6A 2EG9A 2PD6A 1WMEA 2R00C 1Y8QB 1EAYA 2V5VA 2Y77A 4I9HA 4ILKA 4LCJA 5G41A 4AQYB 5H3HA 3VKVA 1GM5A 1QZUA 1HDXA 5A05A 1M1YA 2VP6A 3A0UA 4B3CA 1PSDA 3T3IA 5I9TA 1QCYA 4PQRA 1TMKA 2CDRA 2GJ8A 4B75A 5F2NA 2V65A 1JMVA 4WBXC 5H3LA 4JB3A 4EY3A 4MRSA 2PHZA 5E7QA 4XB6B 1XTZA 4YV7A 1X1TA 4DAOA 1Y9DA 2H57A 3RU9A 4AG6A 1X8XA 1UIMA 4KN5A 3UXMA 4YA6A 1GGMA 1H8ED 4TMFA 5I3ZA 4YAIA 1YBMA 2XNDA 3ESQA 3SJAA 3DD1A 1Z63A 3TW0A 5IN4A 2HC9A 4TKZA 1KVUA 1SWWA 3HCEA 5TQ0B 4OP2A 4YAKA 6CHYA 1D8TA 1U99A 1R50A 4U7WA 3GFSA 1UXIA 2LDBA 3CSUA 5KS2A 4UU0A 4RPJA 3NHBA 4JQSA 2C5EA 1OUMA 1NI4B 2I1LA 1IONA 2X19A 4HXFB 4JNCA 5FBWB 3D4OA 3AHGA 4F4FA 5A02A 1EUZA 4XB1A 3U9SA 1JU9A 3U19A 2PE5A 4UE3S 3DE2X 1VGRA 1EUYA 5G0SA 3T7RA 1EK6A 3VR4D 5K20A 2ACWA 2FSSA 4JT9A 1TQ8A 3CB4A 3PVSA 4L95C 4IHKA 5AI4A 1U7ZA 4D6PA 3WQBA 3BAFA 4LJ6A 1C4OA 4OM8A 4PE5B 1XZEA 2XQKA 3TNFA 4DUGA 1YDGA 3PNOA 5JNSA 4KAFA 4C43A 2D3WA 3E9YA 2OCKA 5THQA 3TW8A 2P62A 3WNQA 5H9VA 3LP8A 1VMEA 3W2EA 1JBQA 1FP7A 3FMOB 4XZ3A 1C2YA 1GUAA 3GUHA 1ZUWA 1N2BA 3EZYA 3GMIA 3G1TA 4FGKA 1XVAA 3ED5A 4ND4A 3RJ5A 2FX2A 3WZLA 5BXQC 2WUFA 2ZYTX 3WLSA 1BEEA 3PP8A 4E5MA 2XXBA 3EVAA 4EAAA 1ACMA 1SULA 3G2QA 4HXYA 1UCFA 2ZDQA 3BL6A 3T38A 4F92B 3KC2A 5DKFA 1P31A 3S3TA 3TFWA 1KRXA 2Y4NA 3SKVA 3PF8A 4OY3A 1BS9A 3MBIA 4NMWA 1XZJA 3DKIA 1I4OA 2OZKA 3P0IA 2OHHA 3ZXSA 4QLBA 1Y3HA 2XYPA 4BKRA 2A0KA 4EEKA 2Q46A 3RANA 4MVCA 1CF2O 2RE8A 1UP4A 1O87A 2QXTA 3AR5A 3QI7A 4G37A 4QSMA 3HBNA 1RLMA 4I50B 4II7A 2X0EA 2DWOA 2B3TA 2PRKA 1Y8QA 2FX5A 2WAOA 4M7RA 1LI5A 2OBBA 5EUQB 5CA0B 1U0BB 4E88A 3V4RA 3ZQKA 3ECSA 3WG9A 2BMDA 2GVZC 1F4PA 2IEZA 3AF4A 5CVDA 2OV8A 3FHCB 2J85A 2XPCA 1VRVA 1FLNA 2NV0A 4K0KB 1LDEA 3CVWA 5FL7A 1B0AA 1A50B 2CNDA 3ASUA 1NUTA 1N6NA 4KN8A 3UHPA 2YJ4A 1RCFA 2XQIA 1Q2UA 2VAXA 1TL7C 1JIXA 3ZWCA 1WMAA 4H7HA 4EMTA 5HYVA 5J2TB 2ZIGA 1P62B 4Q6WA 5E2AA 2MOKA 5EIHA 5TQ0A 2WWYA 3J7TA 1O94A 2OM2A 3RSZA 4IUDS 2HOQA 2JB9A 2LD4A 4IM7A 1YKGA 4P53A 4B71A 5AVYA 4LF9B 1NI4A 2V96A 3X1MA 2PJRA 3UWOA 2NQ8A 3R3YA 4ALIA 4NHEA 4CDRA 2J31A 1ZCBA 3CC8A 4ZDWA 4G0NA 3FFTA 2WTMA 4GQBA 3NIWA 2X7HA 4EQZA 4HD8A 5FUQA 3TL2A 3C8HA 2AJBA 3GDFA 4HUJA 4FHCA 4P4GA 2YICA 3BIOA 2ACKA 4RY2A 3SXUB 4OQEA 1W34A 2YNMC 3HHEA 5CTAA 5DP1A 2XLCA 5L3RA 4QYXA 1PEAA 4K81B 2O9JA 5JSKA 5KNCA 3W6PA 3MRTA 2AI3A 5A03A 1YTLA 4JELA 3WK4A 1GUBA 1P0FA 1VCHA 2YXPX 3T1HB 1H2EA 4F3CA 1TJYA 1W52X 2I4IA 1GGHA 1U11A 3HBMA 3D8TA 4XGQA 2OLEA 3UCFA 4XIGS 5C5IA 2IHTA 4B3TB 1N1DA 4GS5A 2AB0A 2ZB3A 3UXEA 4EYEA 1QBKC 2IGTA 3D0RA 3N58A 3Q3EA 2HCJB 1T1SA 3AVQA 1E9CA 1QK4A 1WCV1 4LHWA 3MFYA 1ZJJA 1EVKA 3DFKA 4R7TA 2PQ0A 4BLQA 1NW6A 2XUIA 1YQWA 2VPWA 1GNQA 1E1KA 3L7AA 1AKTA 1G6OA 1YHYA 5ILGA 3PHJA 2RHMA 1W6RA 3PHGA 3PLNA 4ZC1A 3SHFA 1UPXA 3A6DA 1T8WA 2C5FA 3B1FA 5IM4F 2ZUBA 1DELA 2HQOA 2QS9A 3GF4A 1AKNA 1U90A 4D9KA 3KU4A 4EO9A 4F5YA 1Y5MA 4I50A 3DAYA 2X23A 2BGKA 1G3IA 3EN0A 1BVYF 4LRSB 4UEWA 4ZVOA 5EHXA 2FJUA 4BGUA 4DA6A 2QTFA 5CA0A 3KR2A 3AJEA 4DEYA 4M0LA 4CT4B 3EGDB 1DZIA 2CLSA 2PZGA 3NV9A 1WJGA 1WQ4A 3QE3A 4WUVA 5K05A 3OE5A 1CIVA 3V46A 2VZ8A 3SJBA 4GVPA 1P1IA 1JNXX 2B8WA 2H3HA 3B1KA 4EW3A 2PDAA 4GZ3A 4XX0B 3KETA 1NKVA 1H2BA 3U7QB 4DB4A 2AD1A 5DW0A 1YTUA 3N2IA 4RTLA 3PV0A 3ON5A 3MD0A 1VGQA 2NO0A 2O3TA 2JHAA 3IELA 1JAXA 4M0FA 2P69A 4NTZA 4ZJPA 5BUQA 5P8WA 1WY7A 5KNLA 1Z18A 4RF2A 3PXCX 1QNLA 3DR3A 1NRXA 2P90A 4AT1A 5A5VA 3NUQA 4M1WA 2Q62A 4ZOLB 5DIFA 3I92A 1I7QB 1S2MA 1GZHB 1Z17A 2LIVA 3SI7A 1GNPA 3OCJA 1P2VA 4IDHA 3ONWA 1GWNA 3CRRA 3LUGA 3COPA 4UMDA 4B6SA 3IVXA 4RENA 4MP8A 1UOQA 3W5CA 3PTZA 4MUGA 1T9HA 1XCLA 3X1KA 3T8YA 3VNQA 2V45A 3L7YA 3N5KA 1W73A 4J1NA 4J91A 4OHXA 4BX2A 4F1KA 1HX7A 2WU4A 4A1FA 1X1AA 1Z8FA 2QNIA 4QDKA 5GZ6A 3SXUA 4G25A 1FFBA 3ZWWA 4AZ3B 5A2QA 2YKGA 5F3RA 2EAUA 1R9JA 4K9PA 3R3SA 4LYAA 4W7SA 3JWGA 2ACVA 3VJKA 4HFRA 1BKYA 1W44A 1OTXA 3FTFA 4TQGA 1JQ5A 4O2AF 4QVGA 3KYCB 1I6LA 2EFJA 3LX8A 1VDMA 3K0HA 3OOJA 4X0EA 1RKUA 1WE2A 4YMVA 1TQ6A 4S1PA 3NCHA 4TWJA 1H2WA 3LYLA 4RK5A 2ZM5A 1KAEA 2GZ3A 3HJFA 3MRXA 4A5OA 1WVGA 1FTNA 4OP3A 4B3IA 2JVKA 5I7WA 3ZDCA 2HV8A 1Y4UA 4BQPA 3H2KA 1V6AA 4KXMA 4TKLA 4CQMB 5M04A 4M1QA 2D0PB 4YHBA 1L5NA 1M6WA 3SKYA 1XALA 4H0FA 4P32A 3B48A 2VQSA 1MH9A 2X5OA 3G0IA 5J9FA 3KOWA 1GAXA 2G0AA 4F72A 2E4YA 2QL6A 1XRPA 3D7LA 2GB4A 1GU7A 5JROA 1ODKA 3P4UA 4BUCA 3OP1A 4QUDA 1V39A 2FPLA 3C70A 4C30A 2HMVA 1Y89A 3SR4A 1QDUA 1C3JA 2GA9A 5C9ZA 1ZC4A 4CWAA 4CGYA 1MTZA 3EGDA 1K5HA 1XRQA 5HKLA 3GB9A 4AJ9A 2JFPA 1CCWA 4FUQA 3KAQA 4H6XA 3VDMA 1U1CA 3MT7A 1Z56C 4JP1A 4MVJD 3FSGA 2PO5A 4TV9B 2FLVA 4XX0A 1BU5A 2EF0A 3GPDG 2F3PA 3U7QA 4ENSA 3O03A 4K8OA 1DBQA 1QTNA 2QL9A 1ZK1A 2Z57A 3G0BA 1E4YA 1K97A 3AFNA 3HZRA 2AFRA 1U9ZA 3S2ZA 1WUIS 4L73A 2XOKD 2B83A 1NASA 2P77A 1R9MA 4AN0A 4E07A 1ZHOA 2O8EB 5K3FB 2Y71A 2B8NA 2ZRJA 3EZLA 3NVKI 3FBGA 3MIIA 4ZOLA 3RFTA 1XXHE 4BB9A 1P0QA 1A9RA 3LGSA 3Q5DA 4MGZR 2P79A 4NE9A 5IMSA 1B8OA 1I2AA 1BE8A 5FPQA 3WAGA 2PL5A 5FOSA 4GBED 1Y6GA 1EFAA 1VJDA 4B5KA 1NC3A 2E4XA 4MWGA 8LDHA 5AW4A 1U8UA 2V5AA 5JFGA 5IP5A 4WN3A 2WT9A 2G5PA 3ZVMA 2RG7A 1GQQA 1R8QA 2WYOA 4TRRA 5DYGA 1UJ5A 2BOVA 2CCGA 4QYWA 5AKEA 2MMGA 4AZ3A 5IVKA 1RAHA 4I4NA 1V4NA 3HCRA 1TI7A 4KMMA 3O8CA 4RHCA 1RU3A 3TLKA 3SMVA 4MA4A 4AECA 1RRGA 1F8XA 1LZKA 3PGJA 3ID6C 5C4MA 4RA6B 3KYCA 2G07A 3IUJA 1JHQA 1TEXA 4M8LA 4P81A 1CQZA 3KB1A 2WINI 5JO9A 3ZWQA 5EERA 4P2BA 2Y76A 5DLEA 4EQ6A 1MAVA 2AC7A 1R6UA 2CNWA 1QHSA 2Z30A 3A1VA 2J30A 3C3KA 4XUGB 4AN1A 2VJKA 4TSFA 1C4XA 1E7YA 3QOYA 1D9ZA 4A8HA 1Z8DA 1R1DA 1RJ9B 1T6ZA 1UBKS 2CLOB 1ODSA 3HA5A 2H9YA 3M3HA 1LJLA 2ZBDA 3NYRA 4MVXA 3OIGA 4AQDA 4YK7A 2R1TB 3AFIA 2B6NA 3AR6A 2IYPA 4CQMA 3SEFA 4DIFA 5LN1A 2Q21A 4FX5A 4N76A 1N2CE 3FCYA 3FPJA 3WSTA 3SQMA 3RVSA 2LUOA 1HM5A 4YAEA 4EHHA 2IH5A 4P7JA 4K9NA 4JQOA 4G36A 3Q1KA 1BZYA 2P65A 1IEWA 4NDNE 2WJAA 4DA4A 1PQ4A 4P31A 4YJDA 3PK0A 1ZVQA 3P94A 4TS3A 1RI4A 5JNWA 2PH7A 4ECEA 2YHAA 2WDPA 4GXRA 1J0CA 5BRNA 4UTVA 2V7VA 3DOHA 2XE4A 4J1QA 5T7BA 3ETHA 2IZOA 4PPQA 2ZI7A 4P4LA 3AUTA 1XAHA 2ODPA 2V55B 2G8LA 1G3RA 3I3SR 4IIEA 4YAWA 3OO0A 3BXHA 3N86A 1T5TA 3TOZA 1AZLA 1U3TA 4NEGA 4BFCA 4C7OB 2QG4A 2YZ2A 2Y1EA 1TYBE 1M3SA 4AZVA 3TLXA 4JC4A 3CLRD 4WLFA 2E49A 3BT7A 2CBGA 4AIIA 3ETCA 4P98A 1RQPA 4UNSA 2ZPTX 3KLBA 3T4PA 1JEOA 3ZIAA 1D4ZA 1EJ2A 2CJPA 1IG0A 4TV9A 5KSZA 2FSPA 2VUIB 4PLPA 4Y1EA 3UJPA 3PEWA 4V0MA 4XDHA 5CLFA 2CUZA 2AH5A 2JIZD 4PFJA 3PGMA 5B2FA 3CKKA 3DXYA 3DQZA 2ZDGA 4RH3A 2C2OA 2XVMA 2YWXA 1SXHA 2Z3WA 4YECA 3H6GA 3D5QA 3BF7A 4KJXA 1UZAA 4OATA 4TSKA 5K3FA 1K5GA 2ZU0C 2O8EA 2HADA 3QQ5A 2I2CA 3R7NA 1K8YB 4LJKA 3TQOA 1KFCB 2F3QA 4QYSA 2GCGA 4R68A 4KITB 3PWTA 3RKSA 2XVXA 1JHPA 3N2NA 2FPXA 4ZT7A 2IPXA 5IFKA 4BKPA 4DIBA 3EIUA 3GDHA 3ZR4B 4AB1A 2FPOA 5CFZA 2OESA 4QDZA 4ML3A 3BKWA 2GXSA 2M1XA 3MJRA 3L1HA 4GI7A 3QM1A 4PBRA 1WUYA 2GZDA 2IUFA 4KW7A 3CVXA 1J2TA 3QMWA 1LLUA 3AX6A 4PAQA 4R0NA 3C74A 1HDEA 4O2BF 4XQCA 4QELA 2ZRHA 5ALNA 4WFIA 2Y27A 5I48A 2V3CC 3THYB 4RA6A 1OA1A 2ZKIA 4V2IA 1KI3A 1OX5A 2H5IA 1W6UA 2POCA 3PD0A 4Q0MA 5FI5A 3RPEA 3UF0A 3FE2A 1P91A 5AHRA 3WWPA 1IXYA 4FQ5A 1L5YA 1Z12A 2FCAA 2IOFA 4GPTA 2B5WA 4UHBA 5FHRA 2LZ0A 2ZZMA 2D1RA 3PFHA 4A2WA 1N0VC 3W90A 5CB4B 3CTPA 2XA9A 1RJ9A 1VQ1A 2IL1A 2POQX 5FUYA 1O94C 5CVEA 3RREA 3EPJA 4WGGA 1EU1A 5KNDD 3ANXA 1DBRA 2R1TA 4Y2RA 5D1HA 4YPFA 3LUFA 1U4NA 4QULA 4PZEA 1H6DA 2RC5A 3ZBPA 2YBEA 2RAVA 3BFJA 5K5EA 4OI0A 3BRQA 2Z8XA 5JDIA 3F7NA 4QXRA 3ZD6A 1JQJC 3IQXA 4LWPA 4P86A 3C24A 1HE2A 4UATA 2BT4A 3DWIA 3WL3A 3AUKA 3LOQA 1RKXA 2HMYB 1TAQA 3EASA 4GX2A 4R2IA 1G8KA 4CMCA 4OYHA 1TW3A 2Y1KA 5FKJA 5JXJA 2DFNA 2IU3A 2Q45A 2R9VA 2OCGA 3D2BA 4LG1A 1S0UA 3L77A 2BKVA 2CE2X 5HOQA 1HQKA 3EZ7A 4I4TF 5E2BA 5FR1A 3SJ7A 4Z7NB 4C7OA 4Z8XA 3C97A 4V02A 3AH8A 4LZOA 1MRSA 4O8ZA 1I51A 1P7WA 5D51S 1U0LA 2DCUA 4OJNA 4E51A 2DUWA 3IV6A 2ZXEA 4B2IA 4QGBA 5MHTA 1S7CA 5ITVA 4X8HA 1XEWX 1XDWA 3N2EA 4LJ5A 3SXJA 5JRZA 3OF3A 4JP3A 5DNYB 4ZOEA 2W58A 1I4EB 3CEJA 3DB1A 3E9QA 4LKRA 1SUEA 1MW9X 4HWPA 2YS7A 3LY5A 2W9XA 3LQ2A 4U7DA 3NM6B 5C3MA 2NUPB 4CRWB 3HCOA 4ALJA 1KRHA 2XEXA 4KX3A 2YHIA 1WVMA 4EZEA 5LQNA 3VBEA 5IYZB 5C8ZA 1E62A 1Z4QA 3PR2B 3M70A 3ZQJA 5C37A 3RLIA 5LVAA 2XTZA 5IUNC 5JI3E 3G6KA 3TLAA 1XN1A 1ZJ6A 2DUMA 2XF2A 4FXPA 3FIUA 1YGYA 4Z1MA 3WBBA 3EMBA 1GEGA 3L7CA 4Q9NA 4RSRA 3CPSA 2N3ZA 1VL2A 4C2BA 1ONBA 1CLUA 2H29A 4XWOA 1R5OA 2Z5VA 3A6ZA 2G72A 2I99A 1G21B 3N6RA 1W0KA 2XMDA 3W2FA 3FB1A 1NG9A 2AWOA 3LVBA 1ZQ9A 3WLKX 3RSLA 1VXOA 2Z04A 3PPYA 2DWQA 4K2HA 2Q1XA 4YREA 4B6QA 3VKUA 1SCIA 1Z3CA 3SC4A 4ZHSA 4BGDA 2DU8A 4FT2A 2VDMB 1DOHA 1GQOA 4C0LA 5PNTA 2IZ6A 2WIDA 2B98A 4ZEMA 3RFXA 1YL7A 3JXEA 4PQEA 3O8DA 2FWMX 3AEYA 5DLQC 2HMSA 1QVRA 1DTWB 3UJAA 5K0TA 3A6EA 3TKLA 1Z0AA 1C0PA 2KI5A 2WJ6A 5K8CA 1L1RA 2PA3A 4UMVA 4GMHA 3EDOA 4L8WB 4W5TA 2QX8A 4OAOA 3OF5A 2GLTA 4R40A 2X8WA 5ITZA 3KEFA 1ORVA 7MHTA 2VSFA 2X2PA 3WYGA 1XRSB 3BA6A 1H94A 4M54A 4QPCA 4ARZB 3H9EO 2HDOA 5HJ2A 3OX4A 5CB4A 4NZ9A 2JLYA 1XA3A 1HR0B 3O1LA 3MTJA 1YR8A 2O3SA 4XQ9A 2B4QA 3WJ1A 3L7OA 4BO8A 4DWWA 4ENPA 5CXQA 4KH0A 5K0SA 4PPGA 3LUAA 3LECA 4A6EA 4KDCA 4OKSA 2QUZA 4OP1A 2X0DA 1C1HA 3CS3A 4GI5A 3LRXA 1FFEA 5DXJA 2RHOA 1ZK2A 4CM6A 5JS8A 1F12A 3F46A 5NULA 2WP0A 4BRSA 3L4BA 4GZLA 4KBYA 1TOAA 2QB5A 3P20A 2Y4OA 1SD2A 4RXUA 2A9OA 4RLFA 1P1KA 5F98A 1DE0A 1X9HA 4W82A 3MTDA 4IEIA 3T35A 2OCBA 1E9DA 3JQ9A 2DC1A 2NXEA 3N6XA 4QWMA 2AW3A 1CQJB 3WX0A 4CV3A 3LQKA 4Q3AA 3IVAA 4BMZA 2PH3A 1JDTA 1JZSA 3NWPA 1SH7A 2QP3A 3IMEA 4L16A 1Y7LA 3I12A 3T41A 3VPXA 4C5CA 1XFDA 3O4GA 4YRSA 3HS3A 3U39A 1G5PA 2D00A 1ZD4A 1SVSA 1US8B 2JCGA 3CWQA 3GUZA 4H15A 1ANKA 4RKEA 1H0HA 2QRPA 3AMVA 3QPCA 4LXGA 3DOFA 5A4IS 5FUMA 3WB2A 2NUPA 2OOSA 2PKQP 1D4FA 2JZNA 4A6PA 2BSAA 1LKZA 1PI3A 1WNFA 2QSZA 3TX6A 4CTNA 1NBIA 4F5ZA 1C81A 3SBEA 4OGWA 5IYZA 4EI8A 4R83A 3I5YA 4GYJA 1CT9A 4RU1A 1SD1A 2R6AA 4YRQA 1GPNA 5EG5A 4MDHA 3ZXIA 3U0VA 3O95A 4E2XA 4TMVA 1LBTA 1PJCA 4Q3LA 5DF1A 5IWAB 2EFYA 1YRQA 2WJJA 3P45A 4LIPD 1KQFA 3G2OA 1IK6A 4ZREA 1G21A 1JW9B 1QVZA 1RHQA 3ZI7A 3HLTA 2VDVE 3KDPA 3OKCA 4A03A 1B2LA 1TJ4A 4DQUA 3U5TA 3W1WA 1VYVA 1JDNA 4OXNA 1USUA 3I9V1 3PXEA 3B1YA 2ZTHA 5F7ZA 2H7VA 4QFMA 4TL9A 3FSRA 3G9XA 2JFGA 4EG1A 3WGOA 1NVAA 5J1TB 1A2QA 1NTRA 3HKBB 3WHLA 3DOJA 5DEIA 3ZS9A 4POOA 1C3EA 2BGUA 1DTWA 3EG5A 4HMQA 4G84A 3OJEA 2INGX 5K6TA 1KYZA 1T5DX 4ZRDA 4XWGA 1D0SA 3AUAA 3SHTA 4IDCA 1E2GA 3ZHVA 4ARZA 1O97D 4S1TA 4DXHA 2IP4A 1QO0D 1OD6A 3BXFA 1J8QA 3EK2A 3LXUX 1HEYA 1KY3A 1SXJD 4LOAA 4BVAA 1QP7A 3WRWA 1RHKA 4R9RA 1T0JB 2Z8YA 4OL9A 3ROFA 1VP3A 1EFHA 4R1NA 1E1DA 5BMVB