4GMXA

Crystal structure of kpt185 in complex with crm1-ran-ranbp1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
209
structure length
205
Chain Sequence
b'QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVLAAQYEHDLEVAQTTALPDEDDDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Selective inhibitors of nuclear export show that CRM1/XPO1 is a target in chronic lymphocytic leukemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/inhibitor
total genus 55
structure length 205
sequence length 209
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gmxA00
4C4PA 4DLUA 2GAOA 4M9ZA 2OFXA 1EFUA 3DMNA 1QHYA 1SVLA 1CU1A 1XCMA 1YR9A 3NEYA 4OKSA 5DI3B 5FPYA 4B3DA 3B1WA 3LH5A 1XD8A 1CJTC 4X8LA 4K81B 3CF2A 5LBIA 2ZANA 3W3ZB 1YRAA 2VH5R 3LLUA 2GILA 3GFPA 1E1QD 3C14C 2QTVB 4CYMA 2EFDB 1MKYA 3C5HA 2VYFA 5AJWA 1Y3AA 3SYNA 3X1XA 4ZI2A 4QBGB 4V0ME 1XNJA 2XGJA 4JS0A 2FEMA 1CRPA 1YU9A 2CK3D 1LS1A 3NXSA 4RZXA 3AUYA 3TIFA 3KQNA 1MABA 3KDSE 3L0OA 3R7WA 4TWZA 5UKDA 5CDFA 2IX3A 2VP5A 3EX7C 2HJGA 4M22A 3TLXA 2ZRPA 3TUJC 4TLBA 1SZPA 3AEZA 3HU2A 1XX6A 1JXMA 1NY6A 1LFDB 2Z4RA 1OW3B 1W47A 1ZIOA 1GFIA 1Z8FA 4XSHA 4DEXA 1M34E 2ODEA 4A4DA 3DM5A 3U3MA 3MWKA 3RS7A 1DG1G 3GPLA 4CEJB 4MRRA 4BLQA 3GQBA 2Q21A 1T5LA 1W4AA 3B1YA 5CK4A 3SNHA 4G5QA 3RRYA 3GEIA 1NIJA 4PSKA 3RS2A 1M7BA 1TX4B 4FI3C 2UKDA 4NCIA 4OHVA 1UKYA 1NSTA 4DZZA 4M1WA 1T9HA 2VO1A 4JZKA 5AJYA 4ZI3A 4XIGS 2ANBA 1LY1A 4LJYA 1O87A 4GZLA 5HKKA 1ESNA 4MYCA 4ZPXA 3QG5A 3WHKA 1T8TA 1UEIA 3EA0A 4Z54A 1G4AE 3EASA 3IEVA 3H84A 2RH5A 2XXAB 2ZI5A 4RD2A 3B60A 2FFHA 2V6IA 3NBZC 1GIAA 3THYB 4P4TA 2BM1A 4ASUA 4XTCS 2QSZA 2W6JD 1G6OA 1T91A 4G5OA 5C2JB 3TNFA 2P2LA 1Z6YA 2AKAB 1Q0UA 3B9QA 4DIEA 2VP6A 2XNDA 2G88A 3ND8A 4H9GA 2O8CB 1ELOA 5DN6A 4D26A 2YKGA 3QKRB 5IHPA 2GESA 3KXIA 1GTVA 3IEUA 4O2LA 1P72A 4XVQA 3Q8XB 2ZRJA 2EVWX 4DCSA 2FFAA 4P33A 1US8A 3U4QA 1QHIA 4NZYA 5CJPA 1GP2A 3L2OB 4LI0A 2R44A 5JLJA 1NNEA 1VECA 4ZDJA 5AJZA 2IHYA 2HT6A 2IUTA 2WSSD 1CBUA 3OE7D 2ODNA 2XAUA 2Z83A 5GADl 5GVRA 4ZCIA 1KI7A 1ZW6A 3DL0A 4DIDA 2C98A 5J4YA 4HLQB 5BW8A 1TQ2A 2BEKA 1W0JA 3RC3A 2P5SA 3CR8A 5TMPA 1S1MA 1JAIA 5DI9A 5HTKA 4ZKEA 4FMCF 5KO2A 4LV6A 5EXPA 1WB9A 2ZRNA 4NPHA 3AVWA 2CCJA 2ZSBA 3TUZC 4Y0VA 3AP3A 3KKOA 2FA9A 5EP1A 4DCNA 3AF4A 4HB2A 4US0R 4R98A 5B2ZA 4BZQA 5E7IA 3TVDA 1FP7A 1T4GA 3DOEA 1KI4A 1ZU5A 3EXAA 3HDTA 4Q1DA 3IHWA 1CR2A 2XEXA 1T0JB 1R8SA 2IF2A 3UK6A 4WXPA 4OI1A 3AGQA 1DTSA 2WHXA 4KVAA 5EZ6B 2RAPA 1ZP6A 3GLHA 3GD7A 1Q3HA 4ZDWA 1JR3E 4C7OA 2D3WA 2YC2C 1NVVR 3SR0A 1Q1QA 3OIUA 5CJ2A 3HPRA 4DDWA 5DI3A 5BWMA 4DLZA 3U3OA 1GOTA 1N5IA 2OUKA 3ADKA 4LJ6A 4CZ2A 3CRMA 1Q1ZA 1KNXA 1Z0KA 2Q9CA 4G3XA 1YVDA 3JVUA 1OXTA 4HSEA 2QRZA 2GJKA 1LNZA 3ZD6A 4M9SA 3TAHA 1E9CA 2GXUA 1JB1A 1YZLA 1HEIA 1ZINA 4NTZA 3UXMA 4PPQA 5EP2A 4BFSA 1GNQA 2ZI6A 2ZR7A 1ZM7A 1N2CE 1XDBA 1F2TB 1HUQA 5JBQA 2GVZC 2Q9BA 3K8YA 2ZUDA 5JCPA 3ZJYA 3RABA 4QJ4A 4BQSA 1D2EA 1JR3D 4EQ6B 3T5GA 2VP4A 2XB2A 2GJAA 4RD1A 4ARZB 5EP3A 2X2EA 3TAUA 2P0EA 1NL3A 2RGNC 4LRWA 4EFMA 1RPZA 2R6GA 3T1VA 5JS8A 1S9DA 1MOZA 3RNLA 1UKZA 4YC7A 4D0NA 4PHGA 3H1TA 1SVIA 5J5CA 3DPUA 4O2RA 3QXHA 1E3MA 1T8UA 5FTMA 2QP9X 5FTKA 3RWOA 3W8RA 4CEJA 4Q19A 2IS6A 2C9CA 5FPKA 2C03A 2ZIAA 4B3XA 3P32A 5SZHB 1FTNA 3QEOA 5J40A 1EFRD 3LV8A 5E7MA 4PZLA 5SZJA 3WNCA 1KMHB 1YJ5A 2PMDA 3NH9A 4ZDIA 3ADDA 1AGPA 1YKSA 2WWHA 1MH1A 2ZRCA 4IEIA 4Q48A 4FMCB 3GLIE 2NO0A 1YE8A 3AKYA 1GWNA 4QHTA 3KUCA 3IPYA 4U5XA 2BV3A 4DRZA 4B34A 3KUDA 2BJWA 2HXSA 4KBFA 821PA 1X1SA 1AZSC 4TYYA 2AD5A 2XXAA 2C96A 3B5JA 4AKIA 3THYA 5L8VA 2VHCA 1JEDA 1KSFX 2XB4A 3SJZA 3CZPA 2JASA 1KO4A 2IYYA 4BLTA 4IOKA 1N6RA 2WJVA 2YOFA 1KIMA 3U61B 1KI6B 2O8CA 1KK2A 2JIZD 3QKRA 3G82C 2WJYA 2FMXA 4ACAA 3B82A 3VQTA 1JNYA 1CP2A 3VX4A 1UBGA 3IILA 1MO5A 1OXUA 4CT4B 2HEIA 1NVXQ 1KI8A 2QGZA 3U2QA 2O8BB 3P27A 4C0AC 1XTSA 2AK3A 3KZ1E 1TQ6A 4A0HA 1CULC 3AF1A 4IXNA 4KSCA 1BOFA 721PA 1MV5A 1OIXA 2XSZA 3C4JA 3EZ7A 1J8MF 3QKSB 4BWYA 2W0MA 1K6MA 4OHZA 3KKPA 2QL6A 4URVR 4Q1CA 4KLZA 3KQHA 3CX8A 3F8TA 4PHTA 2WAXA 1EXMA 5SZKB 2P67A 3HYRA 2GEUA 3A4LA 1K5DA 4QL3A 3UG6A 4AWXA 4NH0A 4QC2A 4L9SA 3CRRA 4Q4HB 2DB3A 1N0WA 2JCSA 4EPTA 2F1JA 4GOJA 2WJJA 4M1TA 1E9EA 3K9GA 3P1JA 2GHIA 2L0XA 2OO7A 4F4CA 5FTNA 5DNYB 3SE0A 1SVKA 4MRPA 1R10A 4GBMA 4BZXA 3OIVA 1EG7A 2JJ1A 3VR1A 1ZRHA 3OEHA 5FUXA 3NKVA 1IN7A 1XWIA 1KYIA 1L4UA 3LW7A 5EXSA 1DAEA 4XSGA 1D9ZA 3HWSA 5KPDA 5C4MA 2HF9A 4POAA 2R2AA 2IYVA 4KO8A 3C7KA 3FMOB 3TW8B 2OFOA 4DLSA 1JEEA 2QMUA 3PG5A 1NKSA 2ZU6A 4PC7A 2XITA 5CYPA 2JLZA 4GDFA 1SKQA 4NU0A 1TF2A 3GCGA 1WRBA 1NN0A 2JDID 1TQDA 2WICA 2ZRKA 4YMUA 1E94E 1R4AA 3VKGA 3I1FA 1Z6XA 3AVOA 2P6UA 3WBKA 4Q4AB 3BGWA 5DYIA 3CIOA 3AF3A 1W0KA 3K9LA 3KQKA 2PX3A 1A82A 1P6XA 2PEZA 3SBDA 2F9LA 4BPBA 2NO6A 3L43A 3NBXX 3RS3A 4PC2A 1EFCA 4C0LA 2D74A 1XZQA 2F3TA 2XOKA 3W6OA 4S2EA 2IS2A 1QVRA 4L4UA 1DVRA 1F2TA 1G7RA 2KBEA 4E07A 3N70A 2BC9A 4TTPA 4LX0A 3D31A 1KO7A 2VHQA 4EQ6A 1JQLB 4RKEA 4TMVA 3TRFA 3IBGA 4I81A 3EIHA 1N6HA 2WWYA 4JKYA 1TUIA 2F1IA 4ARZA 3BERA 2ODWA 4AKEA 4Z8YA 2QP4A 1F2UB 3TGPA 3PUWA 3UPUA 1XD9A 4QBFA 5FTLA 3B6EA 1WBBA 1YRBA 1XTJA 2OCPA 2ZE8A 4HDCA 3HP1A 4DBLC 1CLUA 3GLGB 3Q85A 3QPWA 2Z4SA 4YQFA 1GSIA 2PLRA 4MGKR 5AWFC 1OFIA 4MITA 1ZVQA 4NMMA 3WY9A 1J2JA 1ZM9A 1ZUNB 5FUVA 5CB6A 1SXJA 4HDQB 2JEOA 1VG8A 3K0AB 3L8ZA 3W3AA 2QE7D 2WWWA 2ZRFA 2DFKB 3DM9B 3OEED 4QGFA 4AYTA 1KMHA 2J7PA 4DCTA 2A2ZA 4M53A 2EFGA 1IN6A 5IT5A 1RC8A 2FWRA 3ZVRA 2C04A 3T1OA 2VP9A 3ZH9B 5HZKA 1F60A 1KDRA 4TTRA 2ZPTX 3EZ2A 2NIPA 4URZR 2MSCB 5CLQA 1L2TA 2ZROA 1DARA 1WE2A 4HI0E 4PQRA 5KUTA 4NYMR 5FBQB 4WZBE 3DDCA 4IKEA 1AK2A 4QBIA 4TMKA 3L0SA 3WYAA 1BYUA 1VMAA 1WF3A 3UWKA 1AS3A 4HAVA 1RFLA 3G5UA 3L8YA 4KXFB 5A5GA 4KI0A 1OF1A 1XEWX 2WWGA 4HB3A 2F1HA 1W1WA 1KI6A 3IUYA 3RSLA 3CX6A 1A7JA 3RVBA 1M7GA 1Z0IA 2ZEJA 2ZVQX 3GJ3A 1G3IA 2ZSFA 3GP8A 4KSBA 4Q7LA 1P2SA 2VQSA 1N5JA 4Q7JB 4RZUA 3CH4B 4B75A 2HCJB 3WBJA 4DHEA 2HYDA 3AF2A 1LVGA 1N6OA 4UNQA 4BFTA 2O8BA 2D4HA 2RGAA 4PC1A 2ZRHA 3KKNA 5FFMA 5FL7A 4HLUA 5EE1A 4IJMA 3U3JA 2ZAMA 5BXQC 4D2IA 2OCBA 4FIDA 3QKSA 4EPVA 3W9YA 3THWB 2ZSAA 1Z08A 4HEJA 2PZEA 2W00A 4O0MA 1H8HA 2V8OA 5FTJA 4MKIA 3AVXA 1JQJC 2GEDA 3C15C 3LNCA 2QEQA 1FZQA 1JXOA 2Q3FA 2W2TA 4JJZA 5G40A 1Q12A 2ONJA 3VR3A 4TYNA 4I99A 2BMDA 2FGKA 3K1JA 2A5FA 4FD2A 4IHQA 1RIFA 3OZXA 1QF9A 4QGHA 1QRAA 1U8YA 2QA5A 2J0SA 1TF7A 1SXJC 2BBSA 5CIWA 1G4UR 2J1LA 3GLFE 4K8OA 1GKYA 3KJGA 2UVQA 2FZLA 2G1JA 3CPEA 3PUYA 4MKHA 1WXQA 3EZFA 4DKXA 3SJBA 2IT1A 4MA4A 1DAKA 4IVPA 1RRFA 4DVGA 4DSNA 4HAZA 2Q3HA 2V4ZA 1UF9A 5DLQC 1P9NA 1ZD9A 1P5ZB 4IDNA 4U02A 3B85A 4PSAA 4KVGA 1BH2A 2WKQA 5GJWC 2NO9A 2H5EA 3AP1A 3PFIA 4HDOB 1X6VA 3QPVA 5FUYA 2EFCB 1OHHA 4RKFA 4EPXA 2YVUA 4JBWA 4A2QA 4B43A 3SQXA 2GRJA 2OZEA 1JECA 4X8MA 3EW9A 2CMKA 4R71A 1KOFA 4CEHB 2BBWA 2B21A 2GBLA 1COWA 1E9DA 1NLYA 4B6FA 2GAAA 2FX3A 2CHVA 1UBCA 4ACBA 1XRJA 1W2GA 2IWHA 5EUQB 1RRCA 3E70C 3MWJA 1PV4A 5F3WB 4GI7A 3U44B 1RVDA 1KSHA 4DJTA 2AWOA 1VG0B 5JRJA 1HYQA 2KWIA 2R6AA 2YYZA 3B78A 3KL4A 4A1FA 3A36A 4URXR 1JJVA 3THXB 4RFVA 1F2UA 4ZO4A 1KO5A 1TMKA 3Q7PA 1ZM4A 1XCGB 3LBIA 1D2MA 1X8KA 5FOSA 4DUGA 3GLGA 2Z6VA 3D8BA 3RRZA 2ZS8A 4TLCA 1U8ZA 2HT1A 3EZ9A 3T34A 4RD0A 3WYGA 4OHWA 3F5FA 3P26A 4MKGA 1I4DD 4OQXA 4QM7A 1RJ9B 1ZAKA 3K0AA 1W4CA 1FQJA 5DYGA 3I3SR 5D3MB 3QXXA 5FR1A 1NSFA 4JT2A 4IVQA 2ZRIA 4QRHA 2XJ4A 3QI2A 2G0NA 1R7RA 4TL9A 4XOIA 4HUTA 2AR7A 4Q1FA 3ZYCA 2BIFA 5JWHA 2H7VA 4D4LA 4FCVA 2HDNB 5TARA 1AZTA 2H8KA 4OI2A 4DLXA 1ZU4A 4FMBB 3AM1A 2XTMA 2WSMA 1GL6A 3CNLA 3BD9A 2G77B 4RD6A 2ZVPX 1KZ7B 1Z3IX 1U8AA 2ODBA 5EUMA 1E79D 4GNKA 3FVQA 4PFSA 3A1WA 2OCYC 3I61A 4DLRA 2CE7A 3UMFA 4LJ7A 1TL7C 2RGEA 5AJVB 4DB2A 1TQ4A 2VHJA 4D82A 4HZUB 4MGZR 1EX7A 2YWHA 5CLLA 3FMPB 3ZIAA 1HURA 1P4SA 1GZSA 1U9IA 4PAMA 4BFYA 4ZKDA 1KKLA 3EIEA 3RHFA 4M2LA 2HXYA 1VIYA 4TQUS 4Q00A 2JATA 2Z5FA 4HYYA 1KTVA 3GLHB 5JRZA 1NBMA 4RCZA 2XJ9A 1IM2A 4HLDA 4MYUA 4HB4A 4P4UA 1PJRA 1CTQA 2A9KA 1UJ2A 2AK2A 2V55B 2FPLA 1YZKA 1P62B 3IDQA 4LBVA 4MH0R 4B3GA 4B47A 4ZCMA 2CBZA 1XCPA 2J3EA 3CF6R 4GMXA 4PPNA 5LPNA 1XP8A 3T5DA 4TZ6A 4YDHB 3E5HA 2GDJA 2OESA 5K8UA 4OQNA 3UKDA 4IW3B 4MYTA 3WXMA 1EESA 2ZRMA 2BKEA 5K8IA 1ZCBA 4TZ0A 2JJ8A 3IPXA 1X86B 1G3MA 1VHTA 4LHVA 5FPTA 2PT7A 4FWIB 3K70B 1H65A 3VR2A 1Q44A 5FOWA 2VA8A 1E2DA 4QG7A 3RSOA 5KPJA 4MUAA 1D9XA 1TAGA 3SBEA 1E4VA 4M9XA 2CJWB 4EPRA 4PHFA 4Q5IA 3EPLA 1TTTA 2OLJA 5C46F 2R9VA 1TU3A 1U0HC 3SI7A 4BLPA 2W6IA 1GILA 1SULA 1KSGA 2ZS9A 1WA5A 4G5SA 2DYKA 4BECA 1KK1A 1YZGA 4KFSA 2OHFA 2A7QA 3H4MA 5FOUA 4TLEA 3J81k 5A4JA 2IYWA 4IRUB 3GEHA 4B74A 1N6IA 4NONA 1Q21A 4MQBA 1U9IC 3KJEA 1N6LA 3REFA 1E9BA 1ODFA 4DEYA 1W36D 5FOXA 3U44A 2FPMA 5HKKD 3EPJA 1M7HA 4TQ9A 4MUBA 4Q1BA 2C9YA 3THXA 2H57A 5JI3E 2QY9A 2I4IA 3K09C 3QXSA 4MRSA 3UMSA 5JWRA 2H16A 2ZETA 3U60B 1NP6A 1E1RA 4UQOA 1LW7A 3LBNA 2IF0A 4V0MA 4N0DA 621PA 4QFMA 2WVJA 1DO0A 1XMJA 5HCIA 4GT1A 4N0EA 2MSEB 2GK7A 2IHBA 4ITRC 3GJ4A 3QG1A 2A5JA 4GPTA 1R5OA 4ABYA 3CF0A 1KNQA 4NDZA 4GZMA 4V03A 4W5HA 5DISB 2XNDD 5L3SB 4DLYA 2R8RA 3ZZTA 2YWFA 5DN6D 1RJ9A 3T15A 4MYHA 1VTKA 4AYWA 5D3MA 3PEYA 1Z83A 3OHMA 2PZFA 3FB4A 1SVMA 1UBFA 1J7KA 1QHHB 4URUR 2I3BA 4QBHA 4L16A 1N3BA 2O0HA 1OXSC 3I72A 1FW6A 2B6HA 2GK6A 1G8YA 4LC0A 2MMGA 2ZITA 3T06B 3OFNA 3UWOA 1WQ1R 1G7TA 1KDPA 2BMJA 2WWFA 4PC6A 3AKDA 5DO9A 4US1R 3B9PA 4JBYA 2WMNB 3IIKA 1S9HA 1ONBA 2RGNA 1W7AA 1B0UA 1AQUA 3LW8A 1W0JD 2W58A 3THOA 2QROA 3BFKA 1VYUA 4LHYA 2RGBA 2CNWA 1YZQA 3BS4A 4NCHA 3CNOA 5KNBA 1G6HA 1OJLA 1XJQA 3O8CA 2AHOA 2DBYA 1DAMA 2VIIA 4JLNA 4V0KA 5CM8B 1AGRA 1KI1A 4HZUA 1KKMA 2J5XA 3FKQA 4V02A 2ZSEA 3TJZA 1F5NA 3JZAA 4TLDA 5KDLA 1ANKA 4Y0AA 5IK2D 2Z0MA 4ON9A 1V5WA 1P7CA 4B73A 2BBTA 5J4LA 1VDZA 2ORIA 4JLMA 5HPYB 3QBVA 5HCNA 3CH5A 4UNSA 1N5KA 1QBKC 4PAOA 3D6TB 2X1VA 2BMFA 1PLJA 3QNUA 4YONB 3PITA 4LPSA 5M04A 4UNRA 1DOAA 1OKKA 4KU4A 4M8NE 4US2R 4NYJR 4DDVA 4FMDF 3TE6A 2AL7A 3O8RA 1XEWY 2GKSA 2A5DA 4TYWA 4MRVA 5C18A 5K8LA 3FOZA 2V54A 1CRQA 1DAIA 3EA5A 2ZRLA 2BHRA 4DB4A 3QVUA 4TSFA 3CBQA 2OBMA 2WPDA 4KITB 1X8LA 4PZZA 1P60A 5EE5B 4QJ3A 4B32A 1NG1A 3T12A 4LCBA 4A15A 5FUWA 3KQUA 1ETUA 1YZNA 2VP2A 5LDDC 3NC1C 3BJIC 3FMIA 4ESVA 2NZ8A 3G0HA 1E9SA 2CJWA 3ASYA 5E3HA 4EPWA 4C30A 1C9KA 1NLZA 4M1SA 3WNDA 4ZIRA 2BMEA 4D0LB 2ZE5A 4KYIB 5H68A 4DC9A 2R6DA 1H8EA 5F9FA 1G21E 3TQFA 1AS2A 2KBFA 2VBCA 2QZ4A 2XNSA 1E2PA 1TEVA 3NDBB 2OE2A 2ZQ5A 2ZS7A 1ZC3A 2RGXA 1G3RA 3MSXA 4MGYR 2NO7A 3AF0A 2JGNA 3SFZA 4BLOA 4GSYA 1DAFA 1DS6A 1KI9A 1VPLA 4D6PA 3O47A 1RW4A 4GP6A 1SXJB 3CNNA 2ZTSA 1P61B 1P75A 3FKSD 4L5BA 1CR0A 2VP0A 2ZJ8A 3N5CA 3LAWA 3MG9A 5EJEA 1GITA 1A1VA 4B3BA 1YR8A 1IY2A 3PIRA 2EFEB 4WOPA 3SFVA 4C0BA 5L3QB 1QHXA 3F0TA 3KB1A 1R0XA 4IVRA 4UXIA 4MDEA 5A0FA 2WZQA 1D5CA 1U0LA 3MJRA 1MR3F 5LD2C 4F91B 1W48A 4V0NA 5ANRB 4C2TA 3GJXC 4LYHA 1Q3TA 4LUCA 1CR4A 1NLFA 1Z6AA 1XEFA 2QGNA 4I4LA 3AVVA 2F6RA 4FW9A 2GEVA 4AC9A 3ZD7A 3IIMA 3ZZ0A 4OQFA 4B3CA 5L3SA 1II9A 3WMGA 1A4RA 3D7MA 1KAGA 1R0YA 4RD3A 4V0LA 1S0UA 5JEEA 3K0SA 3BB1A 2CVFA 4OJKA 1Z6GA 1GG2A 2WJHA 2ZYUX 1T3LA 3TVTA 2P6RA 4BFZA 1QHHA 4FMDB 2VSFA 5HE9A 3K70C 4D0GA 1P9WA 4AURA 4HAWA 3BAFA 4JLDA 2X19A 4Q9KA 3QENA 1GNPA 3FTQA 1DG3A 5GJVC 3CWQA 4O25A 2XSZD 3BRWD 3REGA 1F3OA 1Z2AA 3LVQE 5HR5A 4OJQA 2D7CA 3QY0A 1P9RA 2WMOB 2RGDA 4GOKA 2GZDA 2HLDA 2PEYA 3W34A 3WMFA 2E1RA 1W5SA 2NGRA 2CL0X 2QMEA 2JLUA 3AVYA 4DSUA 4KHZA 2KI5A 4LC1A 1IN4A 1BMFA 3DVLA 3MWYW 2A30A 3FYHA 4OK6A 4Q66C 4B33A 4B35A 4QHYA 2WIBA 3CZQA 2GJSA 1ZNXA 2N46A 1D8TA 4LJ9A 4JLKA 5KHOC 1F6BA 4URYR 2A5GA 4JL8A 4DLTA 2ZAOA 1L8QA 3X1DA 5FPHA 2PL3A 3QJYA 4Q9IA 1OYYA 3IQXA 3RANA 4A6PA 2GF0A 1E9AA 3OEHD 3D3QA 3LWNA 5E7JA 2C8VA 4FWTA 1NJFA 3I32A 1CIPA 1A5TA 1G5PA 4OBEA 4C0KA 4RSGA 1W5TA 2OXCA 2B8TA 4LWZA 5JS7A 3ZDQA 1B23P 2ONKA 2HCBA 4QHSA 1KO1A 4I1OA 4PHHA 2WOJA 1PUJA 2DFNA 1G7SA 2QPAA 4LYFA 421PA 4Q1EA 1ZMXA 1YR7A 4LHWA 1IXRC 1U94A 3CRW1 3AKCA 2BVNA 1W0KD 3ZZUA 1HT1E 1ZCAA 3VR6A 1UEJA 1T5IA 1T6NA 2BCGY 1XMSA 4EJSB 1SHKA 2X8AA 4QOSA 3C8UA 1ZYUA 4I1VA 3W6PA 4GL2A 1OV4A 2P3SA 4H1VA 2XOKD 3S1AB 4JLBA 2IUUA 4D80A 5KDOA 1Q22A 2DPXA 3B1ZA 4BFVA 2O8FA 1IXZA 2K5UA 2WM9B 5EXTA 4PTLA 1D6JA 2ZJOA 3WRYC 4R9UC 1OH5A 1CJMA 3I4LA 2CCKA 1XXHE 4JLVA 3A1SA 1BIFA 2XZOA 5AUQA 2NTYC 4JYBA 5DIFA 5TDHA 4NYIQ 2I1QA 2OSBA 3DZDA 3CRQA 3DOFA 3W5JA 3MJHA 2R6FA 1P3JA 1CR1A 4N3NA 1N0VC 4MGIR 1IN8A 2VTKA 1UBEA 3BWDD 2PLFA 4PQYA 4Z1MA 5KSPA 2YZ2A 3ICQB 4EKDA 5FBVB 1GL7A 2JLRA 1A2BA 3IHLA 4BLSA 1CJVC 1RZ3A 5BYJA 4X8HA 1BKDR 2WOOA 3K0CC 5HZHA 4OHXA 2ZYVX 4BEBA 3IQWA 3BK7A 2J7PD 4L15A 4DLVA 5AUOB 2QM8A 2XTNA 1GNRA 3VTKA 1XPUA 2IS1A 1E2NA 2PMKA 2GNOA 1KJYA 1YHNA 5L3QA 1R6BX 3EARA 2C95A 1RKBA 1E2EA 2CLSA 4LDJA 3AVTA 1GM5A 5TXGA 1CXZA 1NVVQ 4Q47A 2A3RA 1JI0A 1QHGA 1U99A 5G3YA 2XZLA 1FQKA 1I2MA 3AKEA 4I1UA 4JMPA 5L3RA 4YXWA 3UATA 4AD8A 5BQ5A 1R0ZA 5EE9A 3A8TA 1C1YA 2ZE6A 3EAQA 4TMZA 4BLRA 4TT3A 3TSOA 1XPRA 4U7DA 2VEDA 4JLOA 1ZD8A 2UZ3A 4Q7KA 4JLJA 1VYTA 5E4FA 2DFTA 3R8CA 3K9NA 1UDWA 1WP9A 5LB2A 3PJRA 5SZIA 1XD2B 2DWOA 3U3KA 5CYOA 4HZIA 3RC8A 1SKYB 2O0KA 2BOVA 2G6BA 3PXGA 4QJ5A 2ECKA 2FPKA 4M1OA 3TSZA 5CM9C 3NBFA 2NOAA 3C41J 1NY5A 2ZJBA 1A2KC 2J46A 3NDPA 5EZ5A 2JJ2D 2AXPA 1VCNA 3M1IA 5FL7D 3V9PA 3MRSA 2E9SA 1G16A 4HATA 2B92A 3W6NA 1HQCA 1VCMA 5F9HA 4LJ5A 2EW1A 4BE7B 1ZUHA 1H8HD 2CLCX 2GXAA 2JLWA 1NIPA 3SN6A 3A4NA 1AIPA 4A0GA 1XZPA 4F4JA 2IXEA 5G41A 1OXVA 4JSTA 4LGMA 1WBDA 4B3FX 2IYTA 3DO6A 5CB8A 3C16C 1DO2A 4RZ2A 4B2IA 3GJ0A 3OF5A 4GP7A 4JIMA 4DDTA 3CX7A 1WMSA 1Z2CA 3UANA 1RYHA 1PUIA 3MCAA 4NHOA 4JVSB 1QDEA 3EWAA 1U81A 1CJUC 1Q1BA 2AKYA 2B7BA 2ZJ5A 1CF4A 6Q21A 4PSVA 5H1YA 4EUNA 1GUAA 4C0HA 1NKTA 1Z63A 2QBYB 3X1ZA 2EYQA 3T61A 2RKOA 1E32A 2Q6TA 3N2EA 5KOYA 3CW2A 1RE0A 3U6BA 1IAQA 121PA 2IXGA 3MD0A 1JPNA 2FEOA 4TYQA 1FP6A 3A4MA 2O8DA 4UXJA 4D81A 3LD9A 3IO5A 4TL6A 4A2WA 5BN4A 3GJ6A 3RS4A 2OBLA 1E0JA 1HT2E 5IDVA 3CKLA 4LK2A 2IYUA 2YV5A 3RS0A 4EFLA 2D2EA 2V7QA 3U7EB 1OHHD 3GLGE 3B7GA 2PCLA 1JALA 4EJSA 2NPIA 4G01B 2FE4A 1Q57A 2WJIA 4LJAA 3BOSA 4MKFA 5EXXA 1SVWA 1COWD 3S1AA 5JFGA 2ZE7A 1HA3A 1EFTA 2CE2X 2PJZA 1LS6A 4JVLA 2IK8A 1G8HA 2EQBA 3KB2A 3NH6A 2C5LA 2CVHA 1E6CA 3LXXA 1VHLA 1P73A 2PBRA 3IKJA 1YZUA 1M1YE 3ZQ6A 3BH6A 4QNRA 3BH0A 3GEEA 1IY1A 3BFXA 3UG7A 3VMFA 1LF5A 4A82A 1OB2A 4R2HA 4XWOA 1UKEA 3WP1B 4KLNA 2GCOA 1ZUIA 2GVDC 4DUGD 4URWR 4LY6A 3W5IA 2GWHA 1PZNA 1E2KA 3ZS9A 3M0EA 2IYLD 4JLAA 1OH8A 2J7KA 3KXLA 4AIIA 1G5TA 4PX9A 1OFUX 4Q01A 4KBGA 4BRWA 4A9AA 4E5UA 1AS0A 1AJEA 4TL7A 1GAJA 4IOJA 2V9PA 5GJBA 3B1XA 5CIQA 2J9RA 2OG2A 3TMKA 5J4HA 3PV0A 1S8FA 3TSWA 3VHLB 2WKRA 4BRUA 4XD7A 1SQ5A 4D25A 4AG6A 2OXRA 4BFWA 3FFAA 2IW3A 3LQQA 3JZMA 1QVAA 2BEJA 2C9OA 1U0JA 5JSZB 1XMVA 1E2IA 5CITA 2ZI7A 3OAAA 2W83A 1G8GA 1NBME 1J8YF 1X8JA 3C5CA 3QEJA 5DH9A 4EJSC 1NI3A 3EG5A 1NRJB 3QF4B 2C78A 1DAHA 4A92A 4ZV4A 1EGAA 1G5RA 1IXSB 1XD2A 3A1UA 3P4YA 5J4VA 2O52A 1GRQA 3H86A 3HU1A 1FTSA 5B57C 4KJZA 2G9NA 2GJ8A 4JYCA 2FSFA 3QKTA 2F1RA 2CEAA 2GF9A 4K46A 4PANA 3SC3A 3ZIAD 3VNUA 1GVNB 2OAP1 2BKUA 2VRWA 2D62A 2LKDA 3AH8A 1J90A 4CVNA 5KSZA 2BDTA 1NVUQ 2ZJYA 1R5BA 3EC2A 3W90A 3KX2A 2HUPA 3QUSA 5DHAA 4ILEA 5L3VA 2Y8EA 2VHTA 1NBMD 4DWJA 5CDFE 2E87A 2IL1A 3K09A 1OXXK 1E2GA 1S1CA 4DXAA 5LD2B 2OBNA 1FOEB 2ANCA 1CEEA 1N5LA 1FX0B 3GJ7A 4AKGA 4PZYA 1NMYA 2CLDX 2YHSA 5KU1A 1TUEA 2ZM5A 3BXZA 3OIYA 3SYKA 4JJKA 5J4KA 1TADA 2LCFA 4IXMA 3TBKA 5CK5A 1JJ7A 2OLKA 1SGWA 2J41A 4MRNA 1J70A 1MO3A 1OIVA 2GETA 4M21A 2JLVA 2YNMA 4NP6A 1XU4A 4A8JC 4TL8A 1QHSA 1EFHA 5FBWB 1EWQA 4HAXA 2QBYA 2Q3MA 1P2TA 2QAJA 4RFSB 2H92A 3IBYA 1UKVY 1FUKA 3TQCA 3CR7A 1G64A 5B30A 3PR1A 1VKJA 1VCIA 5DGXA 2Q0HA 3GMTA 4IOLA 1Z29A 4ZIRB 1Y63A 3HPQA 4NYMQ 2FJUA 3FMFA 4A0FA 2QP3A 1PVOA 1E1QA 1I2DA 2W6ID 4XTRA 521PA 1XTKA 4OQMA 1UAAA 3FGNA 4JLPA 4Q18A 2ERYA 3CLVA 4P4SB 4N1AA 2EWVA 2DWPA 3SYLA 4NL4H 2CK3A 1RRGA 3MLEA 4EIWA 5ELXA 3ZLJA 4OI0A 2D7DA 3R9WA 3VFDA 1U90A 2FG5A 4G5GA 4HUQB 1NN5A 1BYIA 4HAYA 3B13B 3CWZA 1XJCA 2VSOA 4B44A 1OYWA 3UMRA 1E2QA 1GRRA 4TMXA 3ZQJA 2W2VA 5FOTA 3KJIA 2ZRAA 2QU8A 2YWGA 3QE0A 4B71A 1TEXA 1KMQA 5JJKA 2BJVA 3U3RA 1VG1A 2CHQA 4PO9A 1JBKA 4BASA 3VU9B 4OHYA 1G9XA 1S96A 2IYXA 1E1RD 2ZI3A 3BB4A 1NN3A 3EIQA 2G0TA 3NTUA 3WHLA 1YQTA 3AVQA 4LJ8A 2IEZA 3I5YA 2H17A 2NPFA 4ASUD 1NG9A 1XBTA 3KFVA 2JA1A 2WV9A 1JPJA 3JVVA 3LRPA 2QI9C 1PLLA 1W44A 4DCVA 4EAQA 1Z07A 3R9IA 4F92B 3BE4A 1X3SA 1YZTA 3EZ6A 2QTHA 3PUVA 3VR4A 5JMTA 5E95A 2YWEA 2ZRBA 4XH9B 3WNBA 4YMTA 2RGCA 3OFND 5P21A 1Z22A 3LFUA 1KO8A 1N6KA 3NVAA 4WZAE 3EC1A 1G8PA 2FF7A 4EFNA 2W6JA 2J45A 4AKHA 3BIFA 1KY2A 5JSZA 1Z28A 2RHDA 4AYXA 1U2RA 2QQEA 3LX5A 2AN9A 2C77A 2OFWA 3H0KA 3K0EA 1KK3A 3B1VA 3WRXC 3GLHE 3ZVLA 3PUZA 1L4YA 2CNWD 3GLIB 1G291 2ORVA 2CHGA 3QF4A 5GJCA 4TLAA 1KSJA 2ZR9A 3I92A 4C2UA 4QM6A 4B48A 2FU5C 2PJRA 2BWJA 2WSSA 4OK5A 2PT5A 2I1VB 3OE7A 2NQ2C 2QPTA 4NYIR 1BO6A 2ATVA 2IXFA 2N42A 2ZI9A 1G3QA 4B2PA 2QMOA 2YC4C 3TH5A 4TYPA 3L82B 3U6KA 3U5ZB 2AFHE 1EK0A 3ASZA 1FFHA 5KNCA 1FL9A 2KJQA 3AVUA 1ZNYA 2ZREA 3MGCA 1N25A 4CEHA 2XZPA 1OKKD 1ZJ6A 4JVNA 2REOA 1FX0A 1MO4A 1KZGB 2MMCA 2QG6A 2VSXA 4H1UA 3QOFA 1E2FA 1W36C 1Z0FA 1ZNWA 4PQFA 4C0SA 2WKPA 5B58C 3UIEA 2V3CC 1DE0A 5IK2A 2O5VA 4U00A 3R20A 2LWIA 1UADA 2ZUCA 4TSFD 4W9MC 2WPDD 3SU8A 2JLSA 1NJGA 2X77A 2IWRA 2QQ0A 1M6NA 1T0HB 3TKLA 1Z0JA 3QVVA 4QXAA 4Q1AA 5EE0A 3OESA 3K70D 4HLCA 4B6EA 4RFSA 1KDTA 2O8FB 2F3RA 1S4QA 4F93B 5DHFA 2ZYWX 4WW0A 2KE5A 2RB4A 4F38A 4M9QA 1QHNA 2PZGA 3RWMB 1OIWA 3I73A 1U98A 4XVUA 4UXHA 2QSYA 4CT5A 4NCJA 1H8ED 3Q72A 3B8HA 1XFAA 5EE3A 4C3ZA 1IHUA 4KFRA 2IBMA 1ZD1A 1DELA 4TQAA 3X2SA 4BUJA 4AK9A 1MO6A 1OB5A 2ZXUA 3NBYC 3CO5A 4A6XA 1E2JA 4P4SA 2FH5B 3FPAA 2XX3A 2QAGB 1ZNZA 2G83A 2LKCA 2WAYA 3Q9LA 4XVRA 2PCJA 3RLFA 3RYTC 1KK0A 2ZJZA 3ETLA 1JR3A 5EQTA 2REBA 5H70A 3Q3JB 4HUQA 4YMVA 4L9WA 5FI0B 4Q4JB 1DEKA 1II8B 1LF0A 2G3YA 4CRWB 4LHXA 3T1TA 2C99A 2TMKA 5AR1A 3U7FB 1IN5A 2CL6X 3EPHA 2KSQA 2IYRA 2ERXA 2F9MA 1W2HA 4NCNA 1IONA 3Q5DA 3FHTA 1W46A 3V4RA 4LOAA 2FN4A 3VU9A 4Z8XA 2QNRA 2ZU0C 3AQ4A 3SJCA 3KQLA 4A36A 4G0NA 4OQLA 2ASEA 5JHGB 2J0UB 3FDIA 2F55A 2DHRA 3CB4A 4E22A 2Q9AA 1Z6TA 3SJAA 1E2MA 3T1QA 4DT1B 2NMVA 1IQPA 1PLKA 4IFEA 2C2HA 2UZIR 1IOZA 1EFRA 3SEAA 3FKSA 5JECA 3PENA 2ZJAA 3FFBA 2FNAA 3A1TA 4WVFA 3VR5A 1XXHB 3AVPA 5KSOA 1E9RA 2IA5A 2XTZA 3OIWA 3I62A 2YOHA 4KODA 1XF9A 2V1XA 1L7VC 2SHKA 2FZ4A 4C0QC 2GCPA 1NN1A 4JKIA 4ZCLA 2YINC 1FNMA 1GKIA 2DWQA 1Q20A 1DBSA 1GKUB 2A78A 2ZJ2A 1Z06A 3P4XA 1K5GA 4IOMA 4M0LA 4A0RA 1TPZA 2F7SA 4JSYA 3X1YA 1HE8B 1G20E 2FFQA 3QF7A 3SQWA 2VF7A 3CUEF 2RHMA 5TVKA 4TTQA 4CW7A 2QRNA 2IEYA 3ICEA 3KKMA 1N6NA 2O8EB 1G7CA 4YMSA 3ADCA 2HLDD 5TB5A 3X1WA 1XJ0A 5TY0A 4DCUA 5EP4A 4CEIB 2JIZA 1OH7A 1BMFD 3GLIA 1VCOA 3LBHA 1DPFA 3KJHA 1S3SA 1AM4D 4BZPA 2DCUA 4TMWA 2RMKA 2B8WA 1OLOA 3GJ8A 1FMJA 4MDFA 5KTYA 1Z47A 1N0UA 3K0CA 1G8FA 1OFTA 3CPHA 2JJ1D 1ZM2A 3EPKA 2R62A 3O8BA 4UKDA 1E98A 1TF5A 5FBLB 5G53C 5FPSA 4GRAA 2GCNA 4PPFA 221PA 2FFBA 4LHZA 4Q03A 5C4GB 5BN5A 3GFTA 4RZ3A 2FSIA 3HU3A 2MSDB 4IDQA 4P0TA 2AX4A 3AGPA 2VPPA 1Z5ZA 1LV7A 4IDOA 1VYVA 2J0VA 1LTQA 2O8DB 2OEPA 8OHMA 4WAUA 3VKHA 3ZGXA 1VG9B 5IRCD 4I1SA 4G1UC 2WBLC 4HB0A 3DEFA 1T3SA 2W0SA 3BC1A 2VF8A 2V6JA 4G5RA 3AV0B 1UFQA 1E2LA 2HV8A 3TK1A 3TR0A 1ZIPA 2ATXA 4X8OA 1CS4C 4UJ5A 5D3QA 5KSYA 2P5TB 3SZRA 2V1UA 3RDPA 2BBOA 1Q1EA 3PEUA 1P2UA 3CM0A 4RVCA 4AI6A 1SXJE 4FCTA 4JBXA 4R7ZA 4E09A 2VHUA 2J59A 1G3UA 1I4LD 3FHCB 4QGGA 3TUIC 1OT3A 3BB3A 2HJVA 4M1MA 4RD4A 2JDIA 2AWNA 3A37A 3Q7QA 4CIDA 5AJXA 2N1BA 1KDOA 4XJXA 3GLFB 3ADBA 3K53A 4OYHA 3WYFA 2ZRDA 4EPYA 1IY0A 3EWSA 2QTFA 5AUPB 4F4IA 4JL5A 3NWJA 5LB4A 1MRNA 2GCOB 3CRVA 4O3MA 2OV2A 1ZC4A 4JVMA 4TN1A 5JI2E 1HE1C 3I8XA 4Z1MD 2NZJA 2QAGA 1SVSA 2ZI4A 4OI4A 1C4OA 1AQYA 4CDGA 2QM7A 4NKRA 1E2HA 1XMIA 3RRNA 3NHBA 3CPJB 3QIAA 2B7CA 1SXJD 5AK0A 2IYZA 1R8QA 4ESHA 4Q4JA 1SVOA 1II8A 1WDTA 2Z43A 4DSTA 3MFYA 1LB1B 2EWWA 5BYKA 3A6PC 2QUZA 4L8GA 3GFOA 3SHWA 5IF9A 3NIBA 4A8JB 5FI1B 4ZDKA 5F98A 2GXQA 5FL3A 1AA9A 2P65A 3K0FB 4HAUA 4A2PA 1MRSA 3MUFA 4J0QA 5JCZA 5JJLA 3FE2A 5K8TA 3U7HB 1Z0DA 2GA8A 4NCKA 2BM0A 1VIAA 2J0UA 3P20A 2AFIE 3IGFA 4LBWA 4PXAA 4KFTA 4PR0A 4DT1A 3MMPA 4NE2A 4RY2A 4YXWD 4NYJQ 2P6NA 4Q9LA 2IYQA 4LSGA 2VLIA 2QE7A 4TT3D 5H8WA 3OEEA 2H18A 3VKWA 1XXHA 2EYUA 1EX6A 1OE0A 3VNVA 4M1KA 2YOGA 3DMDA 3ZVNA 1E0AA 2EU8A 5TV2A 5C1BA 3V4FA 4JL6A 1KY3A 4IDPA 1FNNA 4PO1A 2F43B 3E2IA 3V00A 3ND9A 4WA7A 3T35A 3PEWA 1KGDA 1HH4A 2OILA 2X2FA 4KFUA 3QXJA 1XTQA 4LPKA 2HYIC 2FSHA 3QXCA 1WCV1 5DSZA 3LXRA 3SS8A 3KTAB 5FR2A 4PO8A 2O8EA 2J87A 3ONWA 1DADA 3QSYA 1Z0AA 3RRMA 3H2YA 1QG2A 1XPOA 3BBPA 4LBYA 1AKEA 1E96A 4CEIA 3QPUA 2EFHB 1T3HA 1I4TD 3VAAA 2GZHA 4II7A 1GDDA 1NVWQ 1G17A 1E0KA 2QAGC 4KCGA 3ZS8A 3O8DA 1N6PA 4UNPA 1CJKC 1G41A 1K8RA 1IBRA 2H1LA 3DHWC 1ZBDA 2NG1A 2JJ2A 4Q7MB 4WZ6A 5JJIA 4M4SA 1OH6A 3MWLA 4LV5B 4P32A 1R2QA 4C9BA 4WXRA 1CKEA 4DDUA 3AP2A 4LBZA 1II0A 3FHOA 1XEXB 2RGGA 5FBRB 1RYFA 4GFDA 2DR3A 3LX8A 4R2IA 2AXNA 3ZVMA 1AN0A 3LO5A 3LLMA 2KB0A 1F48A 3ECCA 1UM8A 1XTIA 1FUUA 3GJ5A 4Q4HA 3WMEA 2O0JA 1OFHA 3PQCA 4FINA 3E1SA 4P31A 3MAAC 1QZXA 2ZUBA 1G18A 2JLQA 2QMHA 2CCGA 4DLWA 5AUNB 1BS1A 2QN6A 1R0WA 2ZSDA 3BORA 3LDAA 2FSGA 4BEJA 3B2EA 3U7GA 2CL7X 4YDSA 2D06A 4D4KA 5JWOA 2PH1A 1V43A 2V7QD 2OCAA 4LYAA 2D2FA 4XWAA 1NMZA 1EWRA 2REXB 1KI2A 2W2XA 3PCRB 1MABB 4W7SA 3R7WB 1D2NA 3M4YA 2QENA 4KAXA 4CGZA 4BGDA 3DKVA 5BN3A 4BFXA 2GXSA 2NO1A 4XWKA 1KJZA 2WTUA 2WIAA 2FV8A 4M1YA 4AY2A 4GOXA 2DY1A 1GRNA 1FMLA 2ZR0A 1OPXA 2OM2A 2IC5A 1UDXA 2FDCA 1JR6A 3IO3A 4WBSA 3TW4A 1XTRA 2GJ9A 4JT4A 4Q4AA 4TMTA 3SOPA 3GLFA 4F7WA 4KYUA 1E69A 4RJLA 3AB3A 4FCWA 3L0PA 3RAPR 2HF8A 4BFUA 5FH9A 3VX3A 3NEJA 3W8NA 1HTWA 4Q9HA 1M74A 4LYJA 4B2LA 5KNDA 2GTPA 1E4YA 2CXXA 2YJTD 1W4BA 3QQ5A 4GMDA 4HLUC 2IYSA 1W4RA 2FOLA 3HR8A 1W36B 1G1MA 4FXPA 2CDNA 5HE8A 2ZYTX 3NC0C 2QORA 3FWYA 1RRPA 4CF7A 3A1VA 4OK3A 3DZ8A 3IIJA 1M8PA 3A58B 4YLGA 1SKYE 1R5NA 3M6AA 4A8JA 5KYKA 1HY3A 3LA6A 3WP0A 3HR7A 3DKPA 3QBTA 4S35A 4QNMA 1NMXA 3NHAA 3K0FA 4XD7D 4C0JA 1XB2A 5JEDA 3R9XA 3F3YA 1ZM3A 3BH7A 3RS5A 5J47A 3TR5A 4YMWA 3PUXA 2QT0A 4QGAA 4D4JA 5JZVA 2JAQA 5B64A 2OAQ1 2BCJQ 1P2VA 3OAAD 3I8SA 5KDDA 2IS4A 2VL7A 2JLXA 4P3YA 1M2OB 2IUSA 4PPGA 2A5YB 2WWIA 3NG1A 3PEVA 4Q4LA 4LJ4A 1OSNA 3KFXA 3KKQA 2QPOA 4E03A 4EDHA 4PAQA 1DAGA 2QT1A 2AD1A 1SHZA 5G3ZA 3VHXA 1US8B 3U4QB 3CONA 1IJEA 2G1KA 4OL0A 5JHHB 4RCYA 1E0SA 4LZZA 4D4MA 1J99A 2F43A 3PVSA 5DE3A 1GL9B 1KJWA 2R65A 4IDHA 2WWXA 4KV9A 2FGJA 4PC3A 4Q9JA 4UJ3A 1HQYE 3KXKA 3LVRE 2R6CA 1MT0A 3K9HA 2RCNA 3N2IA 4QKQA 5FOVA 4UNNA 4DSOA 3LQRA 3BFVA 3KTAA 1O3YA 5GVSA 4ERNA 1E79A 2DFLA 3QKUA 2ORWA 4FN5A 3SHFA 1S3GA 2JLYA 3L0IB 4Z51A 2ZRGA 1IJFA 2GBLC 3HJNA 4V0OA 3I5XA 5F2EA 4W5WA 1X1RA 1YR6A 1JAHA 1TU4A 3AUXA 3LY5A 3HYTA 4AG5A 1G19A 1UPTA 4Q02A 1KI3A 1QG4A 1ESMA 2OT3B 2GZAA 1E99A 4IFBA 1S2MA 1HV8A 4WIAA 4B76A 1E9FA 2PX0A 1KHTA 4IEEA 4NBSA 4Q21A 4LV8B 4W5JA 2J0QA 3Q5EA 1AKYA 3R8FA 3THWA 1FPMA 3SDZA 1XEXA 1W49A 1TNDA 1KAOA 2WJGA 4C7OB 1NF3A
chains in the Genus database with same CATH superfamily
1O96A 2A94A 2DU8A 3ZHQA 4B8YA 1XZAA 1NQOA 3VSCA 3H8VA 2GAOA 1M67A 4QDKA 5DHFA 4PZ0A 1XCMA 5A1JA 5JPCA 4OKSA 4B3DA 1EUYA 2ZK7A 1O94C 1IJKA 1MC5A 5JD4A 1XD8A 5HFNA 4A1OA 5ALQA 4D3DA 5JOQA 3CF2A 3DC2A 5LBIA 3V42A 3W3ZB 5BP7A 1XRPA 1U0TA 3CLKA 1DQZA 3K16A 4LK3A 5CU7A 3I58A 1GPMA 5L4LA 1E1QD 3A4VA 1PGOA 1EM6A 2NTJA 2Q4DA 1T9DA 1MPXA 2V45A 4FEEA 3RT9A 1Z68A 4D42A 5A6SA 2VUHB 3VH3A 2B82A 1QGUA 5ALUA 2ODTX 4UMFA 2XGJA 2IYPA 3DDOA 1J0CA 1LS1A 1U7PA 2A4KA 2P69A 2VDRB 3L9XA 3P9RA 4RZXA 3TI9A 3JSXA 3R7WA 1SCJA 1CZKA 3L0OA 4OQYA 1F14A 2V0NA 4AWAA 4Z1OA 4F3NA 2JFVA 3G79A 3WGVA 3ZNPA 4I6JA 5JH7F 3M3DA 1N2GA 5DK4A 5FQNA 3AEZA 1SHUX 1UODA 1XX6A 3PBKA 2E4AA 1IM5A 5C53B 3HBJA 1XO1A 2G9QA 4KRYA 4Q4DA 2GF2A 3UXHA 4OBBA 1YVUA 3E4CA 1J9ZA 1JMVA 1UT5A 4L3VA 3MGKA 3OG9A 4QPZA 4B17A 2GO1A 3QNMA 2XMQA 2ZCVA 1W1UA 3NHYA 4TRRA 3N3BC 5AW8A 4PW0A 2YW9A 2XWSA 3QE9Y 2Q27A 3MWKA 5LCXA 3WLEA 1DG1G 2VNAA 5KJFA 3W5DA 5HTOA 4G8JA 2OHHA 4BLQA 3GQBA 2Q21A 3PC2A 1T5LA 2R4UA 2X7XA 2ZBUA 3WA7A 1GA6A 1HKHA 3RRYA 3GEIA 1DMSA 1N2OA 1NIJA 4LRYA 4ZYZA 4NCIA 3PRJA 2UKDA 4FI3C 4OHVA 4QULA 3SF0A 3UUEA 1RXVA 1A8PA 1RT9A 2IU0A 13PKA 2QR2A 2VEOA 2QV0A 1U04A 1YB6A 2VO1A 4JZKA 3IBCA 5JZBA 2G70A 1H1TA 1M8KA 1DCKA 2I65A 2NW6A 4NG4A 2ANBA 1JHPA 3WYNA 4LJYA 1UBOS 3V6MA 1E6MA 1EVIA 1ONOA 3QG5A 2Q4EA 2J0EA 3WHKA 4MDEA 2C58A 3D6NB 1UEIA 5EKUA 2WD7B 4EHIA 1G4AE 2RHJA 2CFRA 3GRFA 4RD2A 1D4OA 2VKTA 3ETGA 2FFHA 1OY1A 3C3MA 2OA0A 4YJKA 5AW9A 2I7TA 2FYTA 1KJJA 1PT5A 3AI1A 1RD4A 1G6OA 4PS0A 5G02A 5C2JB 3RKSA 3CZMA 4YB8A 3TNFA 2G1PA 2Q28A 1Q0UA 1XZMA 3B9QA 2VP6A 4FCCA 1SOUA 2O8CB 2VTVA 3HXPA 5DN6A 2GHTA 3U7QB 4D26A 4F5WA 4ZGGA 1OV6A 1NVAA 4WTOA 1BXKA 1X42A 2Y4OA 5FAXA 4TRMA 2EVWX 2DPLA 2GPWA 2HWUA 3TVYA 4DCSA 5JRDS 5K45A 5LMNB 3HCCA 1UQUA 1BROA 3A14A 3LVFO 5CJPA 5JLJA 2V7WA 1HGXA 1DCFA 2IHYA 4KVZA 1NDHA 3VV3A 4UMVA 3LC7O 4AZ0A 2XAUA 3F4BA 3QLVA 1AHNA 1L5GB 2I4LA 1KORA 4PEVA 1GU7A 3IP8A 4GI1A 4D4IA 3LCVB 1RKXA 4UM8B 5AW4A 4ECEA 1NOKA 2DUUA 3NALA 2HHHB 4QGSA 2C98A 2CHFA 5BW8A 1TQ2A 1KR5A 1QZUA 1DXQA 2O3SA 3EGVA 3LPLA 4WCFC 2H3EA 5TMPA 2YZNA 2FPWA 1O97C 1S1MA 2IV7A 4XLLA 4ABTA 1G8SA 5DI9A 1YR3A 4ZKEA 1ORRA 3JALB 3L7JA 4LV6A 5EXPA 2GR9A 3JY6A 4MQ4A 5MFPA 4YY3B 1FP1D 1R4NB 3QW4B 1H93A 1C1DB 3F6PA 3STVA 3WGKA 2FWPA 3TLGB 2CCJA 2ZSBA 3E58A 4OU4A 4Y0VA 3ZI0A 3TUZC 2NV6A 3JPYA 1VGQA 3FYSA 4HB2A 4U2KA 5EP1A 2MIIA 5B2ZA 2O5RA 1DKRA 1JS1X 2VYCA 3D4OA 4KN9S 2A33A 1O8CA 3EXAA 3HDTA 5CFNA 3W5AA 1E0DA 4ROSA 4IJVA 3QFTA 4POOA 3IHWA 2CNBA 1CR2A 5FO0A 3SF8B 1YC5A 2XR1A 3DQZA 3O4HA 2XEXA 2IF2A 3VISA 4WXPA 4OI1A 5HRUA 2VPIA 3AZOA 3KBOA 3R77A 4FEAA 2QRVB 4PWZA 4TN5A 4KVAA 4I55B 5EZ6B 4WWHA 1U02A 1GNSA 4WXYB 4DREA 4KQJA 4N6NA 3BZBA 3GLHA 4UM7A 5HIAA 2Y9MB 1C14A 3GD7A 1JR3E 3KZKA 1OPRA 2XWPA 1CDEA 4IG4A 3M8KA 3SR0A 4CLRB 1VA4A 4CKBB 1OBOA 5DW3A 1JEQA 3DYIA 4OU5A 5CJ2A 2JLBA 4R41A 2O9JA 3ST7A 4ROTA 3I6MA 5DI3A 1E5LA 3TYXA 3U3OA 4RH0A 1HMYA 2OUKA 2O19A 1HMPA 1DC5A 3AEQB 1ZEMA 1KNXA 1JI3A 3AY7A 2IDKA 1CRWG 1J09A 2VJOA 1EDEA 3AR6A 3JV7A 4D4HA 1HSZA 2XGOA 1HR0B 3ZDBA 5DHTA 2GJKA 3W2FA 3ZD6A 1CZRA 4M9SA 5JBNA 1LLUA 2GAIA 1V7PC 2I3AA 1RMQA 2QTVA 2XRFA 3OQIA 1J39A 3IOEA 3L84A 4FHGA 1F9AA 2QTTA 3TQIA 1ZINA 3SIWA 4N7JA 2ZI6A 1ZM7A 4KGXA 4KNWA 1XDBA 4DUYB 5KTRA 4XGIA 4QJ4A 3JTMA 1HFWA 5EG5A 4BQSA 5FWYA 3SZ3A 1JFSA 4WCVA 2XB2A 4OKNA 3EZLA 1GT91 4JWKA 4EQZA 1RHRA 4ARZB 3KB8A 2NTEA 2X2EA 5EP3A 1NL3A 1I4EB 4ETWA 1YL5A 1RPZA 1LJLA 1WX1A 3DE3X 3L05A 4NG5A 5JS8A 2CYAA 1EVLA 1GSOA 2XQGA 5AH0A 4CN8A 2C2WA 1UKZA 3RHZA 1YVEI 4ZP1A 2PBLA 2NM0A 1SVIA 2WDZA 3DZBA 4GE0A 5ETJA 3DPIA 4O2RA 1QUEA 5MN4A 3VGJA 4R7GA 1ZMOA 4JZYA 4RIFA 4PGHA 1W5BA 1PG2A 4UDXX 2B0CA 4YMIA 3TO5A 1XU7A 1FDTA 3DEHA 4JU9A 1ST3A 2ZR8A 3ZWXA 2Y9PB 4L6CA 1T1JA 2ZIAA 3SEFA 1QH8B 4B3XA 3BHIA 2XT0A 4W8GA 2Z5VA 1FTNA 4OHMA 4LFBB 1TCUA 1HM5A 4IIGA 2YJ5A 5SZJA 4I7EA 2FFJA 1QO0A 1YJ5A 2DQYA 2PMDA 4PU0A 3VR5D 4ZDIA 3ADDA 3WKCA 1YKSA 2Q6OA 3AG6A 3D0KA 3PDWA 4FMCB 1TYDE 1IBLB 1SOWA 2JD2A 3DAFA 3KT8A 4W82A 5IH7A 2QLMA 2CNKA 4DQ0A 2H4XA 1KMMA 3IAUA 1QP0A 4QHTA 3RUAA 3KUCA 1Z2DA 2BV3A 1Y3HA 5AW1A 2ZIZA 1P5FA 2HI0A 4V2UA 3RSZA 1R6TA 4KMOA 5KVAA 1EK5A 3LIPA 3OP1A 5KKNB 1V9CA 3JAMA 2V8BA 1IZZA 1Y8ZA 3DO5A 1JEDA 3WFIA 3M2TA 4OJYA 3DAYA 3JQBA 4FR5A 3SJZA 4CQJA 2ECPA 2DTXA 3C5WP 1U2QA 5CNIA 2OCXA 5B3KA 1KO4A 1C3OA 2IYYA 3GT7A 4MEJA 3W5VA 1WXFA 2YOFA 2QUHA 3FNRA 4YJ2F 5MDHA 3QKRA 5FNVB 1C3VA 4KQWA 1MAWA 2WJYA 3R23A 3B82A 3VQTA 3HNRA 5CB4F 3LX6A 2D1YA 4YAUA 1QCYA 3HZOA 1Z0UA 1RRMA 5BMVA 3Q41A 3KLBA 5MF6A 1NVXQ 2QGZA 1JKFA 3U2QA 2O8BB 4UZEA 4LFAB 5BV2P 4O33A 3RJ5A 4C0AC 1XTSA 4AJEA 3KZ1E 1V1RB 1ZSVA 3UF0A 2A9JA 1S02A 3M9XA 1CULC 3AF1A 4DMFA 1DEXA 4MW4A 1I9CA 3D8RA 3CV3A 1OIXA 2X0IA 4WMLA 4WLNA 3BDVA 4CHGA 5DSTA 4JI0B 1JX6A 3EUFA 2YFQA 1U9JA 3KKPA 1A9XA 1BA2A 3ETCA 4RANA 3G7SA 2GSDA 1N8SA 1QB8A 4KLZA 3CCCA 4PHTA 4PLVA 1Y4SA 1K5DA 4QL3A 1NONA 2VJAA 4Q4HB 3I2YX 1ONNA 3R7LA 2FKAA 1PR4A 4FNOA 2A14A 1RLOA 4M1TA 1TU0A 3NYRA 1AXEA 1NXWA 3GYGA 2FQ1A 3ZV4A 5ADWA 5IKPA 3T3NA 2IPNA 2Y71A 4F4CA 1HDGO 4MI9A 1SVKA 5DNYB 1R10A 5IJAA 3OIVA 4C0WA 1UK9A 1SCAA 1A9YA 3V2GA 3ZY6A 4UBKA 2BDEA 4X41A 5LQUA 1IN7A 2O05A 3ZK9A 1KYIA 2RG1A 3NNNA 4YA6A 4AN0A 3G1TA 4FE4A 3M6XA 3O0DA 3A04A 4HFNA 1WMDA 2G80A 3EXHA 1I1HA 4FILA 4KO8A 1BE8A 1NOJA 5GM2A 1N2SA 2IHKA 3FZYA 2FZ5A 3MJEA 2ZU6A 4M49A 2PKQO 3ZBQA 5CYPA 3OKFA 1TF2A 5ESXA 4MUGA 3UJNA 1DCTA 1WXXA 3B7PA 2PLNA 3GUVA 1LUAA 1NN0A 1TQDA 2XRZA 2VWPA 3KYCB 3WBKA 1P3Y1 3R0IA 3CIOA 3E5RA 2M2IA 2VS1A 3K9LA 4CR8A 3HUUA 2PX3A 1IHXA 1QIMA 4LOHA 1VJ0A 3IMFA 3MUOA 4YAFA 2XIJA 4PC2A 1EFCA 4C0LA 2D74A 1XZQA 3E53A 4XLZA 1KOJA 2F3TA 2ZWIA 5C1IA 5B7PA 3AJAA 4DV7B 1XZJA 1NVMB 4EB8A 1QVRA 4OMFG 4RWEA 1G7RA 1F2TA 1PWZA 5IH3A 2Q5CA 1DIBA 4TTPA 1SC6A 3D31A 4P22A 3WFZA 3N8DA 1F7VA 1D6MA 5CTJA 3QK7A 4MIKA 5EWJA 4RKEA 5B37A 3TTYA 1ZJJA 4QRIA 1V3QE 5DU2A 3UCFA 2PK3A 3INNA 4A03A 1D5WA 3FPCA 4BVAA 1EZ1A 1TUIA 4X20B 1CZOA 3K92A 1MFZA 4Z8YA 3OTWA 2QP4A 4IJ5A 2PLAA 3KR9A 3UPUA 3JQ7A 4GR5A 2LIPA 1TEZA 3UV3A 1Z5GA 1YRBA 3PCXA 2Q3BA 3D8NA 1M66A 2ZE8A 4QDZA 3GLGB 3QVWA 5ALGA 2BEWA 3QPWA 2CEKA 2DRIA 2HTFA 3INYA 2HGZA 2AQIA 1MNQA 3HCDA 2PLRA 5B6IA 4UVGA 1SB9A 1OFIA 2OB2A 4Z99A 2B2NA 3LG2A 3CQ9A 3EDYA 1NI4A 4GKAA 4YQEA 5CB6A 3KPJA 4O02B 1Z5WA 2YCLA 1VG8A 1L5VA 4GQBA 2WWWA 1XZEA 4R4JA 4XX0A 3MW8A 2V5VA 5SY6A 2A2ZA 2ZJFA 1F4PA 1YXMA 2WP0A 4M0CA 1PFWA 2EFGA 2VPYA 1WXWA 5DNDA 3RVQA 3UPDA 2WZCA 3EXHC 3RHTA 4CQMD 3DUWA 3EGDB 4NHEA 4QPPA 2P3LA 1Y3IA 2WUVA 2Q0XA 4YRMA 1KMIY 1G5QA 4B8ZA 1F60A 1W8IA 4G2TA 4ES6A 4BAZA 4URZR 4F7DA 2ZROA 3G2LA 1DARA 1WE2A 1Y1LA 1P0CA 1E1NA 2WU8A 4HI0E 4PQRA 3RBXA 5KUTA 1XELA 3DDCA 4MR7A 2BLLA 4LWQA 4GGPA 4TMKA 1ZXLA 4FKMA 4JR0A 1SBIA 4ITVA 3U7RA 1VMAA 2EKDA 3UWKA 3AJEA 3L8YA 4YAKA 4IXDA 3A6ZA 3FYUA 1I3MA 2F1HA 2QW1A 1V1MA 2ARKA 2Z2KA 1LI4A 3QW2A 1A7JA 4F3RA 2W7TA 1XNRB 2ZEJA 3GJ3A 1EH5A 3BICA 3O4VA 3GLRA 5IMSA 5IAJA 1U7UA 3S3TA 1CF9A 3CH4B 3DT9A 1L4EA 1PFUA 5TNXA 3WBJA 4BWFB 1U0OC 2HYDA 3L7OA 1QP7A 2W6PA 1LVGA 3PD1A 3MYYA 4KE6A 4PM4A 2ZTUA 2RGAA 4PC1A 4DFDA 4P84A 4GZ6A 4RYLA 1K9VF 3DTVB 5AI6A 3UA4A 1CEQA 4D2IA 2OCBA 2CKDA 4OSEA 3T4EA 4J16A 1ESDA 3W9YA 3THWB 3HKCA 3PDCA 1J8QA 2PVSA 1Z08A 2PZEA 1XRLA 4K6FA 4O0MA 4FFWA 3HBNA 2Q1WA 1TZBA 1PX2A 5BY2A 3AVXA 3BK1A 3R7FA 1JKXA 2ZZNA 1SR8A 3U19A 1KPGA 1JXOA 4TTVA 4CMHA 1ECCA 1IXYA 1Q12A 1LX6A 3EAFA 2BMDA 4INPA 1ECGA 3GIDA 2A5FA 3Q9NA 4FD2A 4GX1A 4EY5A 3OZXA 1QF9A 1WCWA 2N47A 1U8YA 3FVTA 4QGHA 1TF7A 4X24A 2J0SA 4AAYA 2BBSA 5CIWA 3K6JA 3JQPA 1G4UR 1CY6A 1R64A 4COKA 3GLFE 1TMYA 2GRUA 5AJUA 2FAXA 3HVIA 4E15A 2UVQA 2WILA 3RFXA 1GFSA 1JFRA 3PUYA 4UE3S 3VYUB 3VKFA 2JGLA 1FYFA 2GCEA 3WWYA 5CX1A 1NJ6A 3EVBA 4B7XA 2F62A 2QTBA 3EH2A 5AQ1A 4R6WA 5JIBA 4B7UA 4Q7QA 3NWEA 1P74A 5MFZA 2JRLA 3SJBA 4MA4A 4BO7A 3U3ZA 1G2QA 1RRFA 3PNOA 4DVGA 4U2FA 5EPOA 1RXSA 4J75A 4EP1A 2RHWA 1KH3A 1UF9A 4N5HX 1UPUA 2QJRA 4LGCA 3VZPA 4DIMA 1P9NA 1ZD9A 4J03A 1E7YA 3MBIA 3B85A 4LDZA 3UMGA 1MZPA 1V41E 2WIFA 5IVDA 3KC2A 2PT6A 3RC2A 5GJWC 5DDIP 4EO9A 3V9AA 2H2WA 2CMFA 2NU8B 1PJSA 4A2QA 4DEVA 1SG6A 4K0RA 4B4WA 1A5SB 1ZH0A 3FNEA 4EMSA 1KOFA 4OEHA 2QZ9A 5THXA 5YASA 5IANA 1F8GA 1UWVA 2I62A 4WFQA 2B21A 3HEAA 2XUGA 5AP9A 2HJSA 3BL6A 1NLYA 4BX0A 4B6FA 2GAAA 5KNDD 5DP1A 3M6LA 1CT9A 4RJKA 4Z9XA 2H2HA 3FWPA 4ACBA 1F51E 1NFRA 3L1JA 1WW8A 3GDHA 3MJVA 4AW9A 2QHXA 1MFPA 4QT4A 1N3IA 2Y1CA 4GI7A 5CCDA 3ZWCA 3W5UA 1Z8DA 4J16C 3QBEA 4DJTA 5IJ0A 2KWIA 1GPLA 2XNKA 3DAHA 4GGMX 5D00A 1SOMA 1ULBA 5T4EA 2O0MA 1F2UA 5AYVA 3LT0A 4BX8A 3HVJA 4RKYA 4DR3B 1PSWA 3L06A 2FW7A 4MW5A 4R0VA 3QTTA 4TTSA 1W25A 1X8KA 4F2PA 3R3VA 4ZT6A 4F21A 5A2GA 4TLCA 3K31A 2IIPA 4KE9A 4WJLA 5CFRA 4RK6A 5I7WA 4GM0A 5ADUS 4YUAA 3OLCX 4J07A 1T2EA 3VZCA 4MKGA 2H4WA 3ORRA 4BLWA 1P8JA 3I3SR 5DGCA 3RIHA 2VXYA 2AHRA 2X5KO 3E9MA 4IQ4A 1GPWB 4JJFA 3WWDA 4RLSA 4AUNA 4FFVA 4J0CA 4ER6A 5K6AC 3OH8A 4HAIA 3JU3A 2D8MA 5A4AA 2FZGA 2OHJA 2ZRIA 2ZTLA 4GVLA 3T95A 1FIUA 3DE6X 4ZT3A 3C74A 1VHWA 1R7RA 4JLSA 4TL9A 3CNQS 3ZYCA 1NYLA 3ZWWA 5JWHA 5BRNA 1U1IA 3NMUF 2G08A 1E8NA 3PK0A 3ULKA 3KYJB 4CPDA 4F9TA 5TARA 4LQ4A 2X3YA 4OI2A 1CCWA 5ALDA 4J4BA 1JEOA 4FMBB 1JIXA 3S5UA 3WX0A 4ARBA 3AEUB 3GYBA 4G6ZA 5JO9A 1TA9A 2X86A 1YCDA 1ETHA 1ECFA 3BD9A 3FFWA 1R27A 2BP7B 2ZVPX 3H42B 1SAYA 1R0RE 3F3MA 4EHHA 3DW3X 3FVQA 3OF2A 3OQOA 3MJFA 2R2GA 4YRTA 1QYRA 1N7HA 2CE7A 2Q3DA 3CGGA 2PR2A 4ND3A 1T1EA 4AXBA 3IEXA 1X38A 4EBBA 3DEIA 4QOJA 4W9RA 3DKKA 4X0EA 2DPHA 4CU5A 1TQ4A 1GPH1 1ZQ9A 3RC1A 2VHJA 4E5KA 4MGZR 3USCS 2WJZB 1N32B 1ZKMA 2GPTA 2H3HA 2HHJA 2YWHA 3EXIA 2DERA 3Q10A 4M37A 1EXDA 1OVGA 4ER5A 1U9IA 3ID6C 1H9BA 4OHRA 4WZAB 2H0RA 5DXJA 3WFJA 3A9TA 4WOKA 5AVZA 3NR2A 1ACLA 3U26A 3ER9A 1ZN8A 4L0CA 2H5LA 3JYPA 4H6VA 4CKCB 1W4ZA 1VJGA 4PG8A 1E2BA 4WD3A 1YOVA 3FZGA 1T43A 2H2FA 3RD5A 3OM8A 2BKLA 1V8DA 3NHSA 3ROPA 4OQQA 4LQCA 1EUQA 2HHAA 1C4XA 2ZSHA 4OQPA 2A1TR 4RCZA 6ADHA 1WB5A 4GH5A 2HB6A 2HQ1A 4P4UA 1HE3A 1JQBA 1CTQA 1PJRA 4LBVA 3BVPA 3OZWA 4OHOA 1P62B 4LIPD 1QE5A 5ULLA 3Q98A 4RYDA 2J3EA 2PG3A 4H7EA 4TXMA 3ENQA 3HCRA 4TZ6A 3NB0A 4L2IB 2FOIA 4BU1A 4TS1A 4KYVA 1PR6A 1S2LA 4I5IA 2GAJA 4P36A 5IWAB 2OESA 3IQFA 4MR9A 1UJMA 2QRMA 5CG1A 4BQIA 4P5PA 4IAOA 2XWJI 3I28A 2YDXA 2BKEA 2W2KA 4GI2A 4HCJA 1FFXA 2JJ8A 4B82A 4OY3A 3NIDB 3RTEA 4XFDA 1A27A 4RM3A 5AKLA 4FWIB 5KQRA 4JELA 2GT1A 2P4UA 2PS9A 5FOWA 4AJNA 1PQUA 1U2GC 4QUJA 3U39A 1SD2A 1TQ8A 4M54A 4Q1VA 5IDYA 3RSOA 1VI6A 4MUAA 1E4VA 1UT6A 4FK8A 3ACBA 3OTGA 3WLTA 4C4OA 1EA5A 1Z25A 1DHTA 2H1SA 4PHFA 4GZ5A 4RK1A 1UZMA 4ZO8A 2R87A 4KUGA 4LF5B 1Z2PX 1J1ZA 2HV9A 3FW1A 3NM5A 2PMEA 4EY4A 2SKEA 5JALA 4YCNA 1DKQA 3IOCA 1BZYA 3B12A 4JC0A 4BP3A 4BLPA 1GILA 1C29B 1SULA 1WAMA 1YFZA 4D9FA 2ZSJA 4D0RA 1QYDA 1PGQA 2OCDA 5CEJA 2YY7A 1PR0A 9MHTA 3QOXA 3EEYA 2QUJA 2QOEA 4H3HB 3GFQA 1VXRA 3GELA 4Y6RA 4BQRA 1YUNA 1KEZA 3TAXA 1NZDA 2VTEA 4NONA 4Q9NA 3QY9A 5HK9A 2P2NA 4Z9AA 1WZCA 1U9IC 4MWBA 3KXDA 4AFNA 5J3JA 2EGHA 1E9BA 2JI4A 3IUSA 4GSKA 5LZ8A 1R18A 1GGFA 3KALA 5K6RA 4Y6GB 2EZUA 1WHTB 1FLAA 2UUAB 4KFCA 3U44A 3B3FA 5CH8A 1M7HA 5FWXB 3GCWA 2RIPA 2C9YA 4RVHA 3QFSA 1O6GA 3THXA 3VBCA 4Y9UA 4F06A 4YCSA 2XMPA 3K09C 4AUKA 2PX8A 3KG2A 1W85B 1S89A 3LGXA 4C6RA 3GC6A 4Z0PA 4YRJA 3UGKA 4WV3A 4G9EA 4GT1A 4MQFB 2VDQB 1X13A 1LDNA 1PRYA 2AI3A 4ITRC 5E2IA 3GJ4A 4RBNA 1BOOA 2QN9A 4D57A 1R5OA 5AXAA 1EFDN 4FC6A 4V24A 1KNQA 2Q2WA 2ZBQA 3ANSA 4J1SA 4AIRA 2XNDD 4D98A 4YRIA 4M0KA 2YWFA 1TGYA 4MKZA 4PLFA 1YRHA 1C8KA 4K6OA 4D9NA 2HX1A 1QG6A 3IR5A 5GGXA 4BVKA 2J08A 3FVRA 3PEYA 3OHMA 4N3AA 4ZEMA 4P80A 5F64A 1T8YA 3KWMA 4J1TA 2AE1A 5DJ5A 3OETA 4L16A 2O0HA 1OXSC 3I72A 3TL6A 3BWEA 2JJYA 1NXTA 1G8YA 2HK6A 4CV1A 1AO3A 2ZITA 3UWOA 2B2XA 1L4BA 3OFNA 3CZ4A 1Q0HA 2CT8A 3BHMA 1G7TA 1KDPA 1B16A 1VBFA 4W7IA 3GEPA 3RT7A 3B9BA 5K8JB 3T9CA 4NNOA 4ZO7A 3ZE0B 2HSEA 4FKZA 3FJYA 3B9PA 3LDUA 4X6UA 5EEGA 1ONBA 2RGNA 3MWGA 5AKZA 3WGOA 1B0UA 4ZYYA 5KAMA 1W0JD 2W58A 3THOA 4RF4A 2C9DA 4HOYA 3ANMA 2YW2A 4YASA 2GBCA 3BS4A 1CNEA 3FRIA 1KRHA 3KOZA 1L8LA 3CNOA 3LQ4A 3OFJA 3QFRA 4OG2A 4RS3A 5ALIA 3Q3VA 1A2OA 1UJBA 1R88A 1UBKS 4EKIA 3OLXA 1PNRA 1N8TA 2JI9A 4JLNA 2SCUB 3MINA 3R6GA 1LSOA 4HZUA 2J5XA 3FRHA 2A3NA 2GCIA 1JT2A 2ZSEA 3FKQA 3GLUA 4GD3Q 4XDHA 2VG8A 4E32A 3INGA 1GKKA 3SEQA 3WYDA 5CVTA 5A02A 2IXTA 4RK0A 1ACJA 4X6XA 3CVXA 1WHSB 5C8YB 1PWHA 3GWZA 4F84A 1WQ3A 2BBTA 1R0BA 2HU7A 4XWWA 1VDZA 5AHXA 3F73A 4GSLA 2CV0A 1YE5A 1OZFA 5HCNA 2B61A 4UNSA 2VDWB 3L1VA 1N5KA 5PGMA 3QVKA 2VJYA 2Z8ZA 3QVSA 1O2DA 1PLJA 1E8DA 4YONB 4L5IA 4LPSA 5M04A 4UNRA 3NUGA 1DOAA 1V8PA 1EDOA 1OKKA 2WIKA 2XMSA 4PYLA 1FU4A 1H4TA 1UMCA 3ELBA 3OE1A 4NYJR 4U0JA 5IUJC 2PUDA 1WZ2A 3O8RA 1AMUA 4WH0A 1T6ZA 3H8JA 2NO4A 3OZRA 5ALSA 4MRVA 5C7LO 1EWTA 3CSDA 4DMMA 2M1ZA 2V54A 2C61A 1L0BA 2NUPB 2BHRA 3WV4A 3QVUA 1QIKA 2BKAA 2OHGA 3CBQA 3BEDA 1FFAA 4M55A 2VJKA 9ATCA 4J1TC 5HHTA 1LBQA 2OHXA 2EFJA 2IYAA 1P60A 2QRLA 3DBOB 4KBYA 2NQTA 4XSVA 4AO7A 3ELYA 3W4IA 2AVNA 3FPJA 2WJ4A 3AFMA 1FDRA 3PJGA 3IDOA 4MMZB 4D9KA 3G2HA 3H11A 3HEMA 1L5WA 4FJ0A 1YZNA 2PNJA 3SQNA 3KQUA 5L4SA 2WUGA 2YJ4A 1LPMA 3NC1C 1EGVB 5CPBA 3SQDA 4BQOA 3G0HA 3GDGA 1ESCA 4CV3A 3SX4A 4EPWA 2XXJA 1IB0A 4M1SA 1RXWA 4ZIRA 1TCVA 2MSWA 4QYSA 3DKIA 1EP1B 2PKQP 1NQAO 4H4EA 1H8EA 4X93A 1RYEA 4W9NA 3TQFA 1LA2A 3V4PB 5AI4A 3EVEA 2QZ4A 1VGRA 2H7YA 1LXCA 2WNHA 1TEVA 3NDBB 2OE2A 2ZS7A 2G25A 1ZC3A 4UOZA 1L4NA 2FWMX 5LP6F 1LJ8A 2RGXA 1RQXA 3BE8A 3OCVA 1OBFO 1PW5A 4B1FA 5IARA 1DS6A 4D6PA 4BV2A 4FXOA 4HDSB 3OECA 2QW0X 4M0DA 4RSRA 1BNCA 2IEBA 3FKSD 4D02A 3ESXA 2X4IA 3TOZA 1CR0A 1RHMA 2OHVA 1Y8RA 4S24A 3EGXB 3F4LA 1WXGA 1YZVA 4E5VA 1TLFA 1RBZA 2EFEB 3CVJA 2WE7A 3SICE 3SFVA 3WO1A 5EKSA 2E6UX 2CF5A 2X58A 1SPBS 3F0TA 3KB1A 4MPTA 4UAUA 4UXIA 5DWDA 5A0FA 3UTCA 4JJ6A 1PEAA 5LD2C 4F6RB 5EMMA 2EKQA 5DHQA 1W48A 5ANRB 1WVMA 4C2TA 3A28A 3C3KA 1H2XA 1J5PA 1ZLYA 3Q5GA 4ARUA 1CR4A 2GM3A 2LNDA 3EY9A 3QE3A 4IZ6A 5DTEA 4D79A 4GLFA 4E1VA 5F7OA 3WNQA 5EFOA 1CD5A 2D2VA 2H11A 1QBGA 1KFCB 1WPXA 1JSXA 2G07A 2GHRA 3KU1A 1X7ZA 1AKMA 2F6RA 2GEVA 4OBXA 4QRDA 1TO6A 3IIMA 4UVHA 3OZGA 5I4BA 1QB7A 3C4QA 4OQFA 2ESRA 1YKFA 3LY7A 1FU8A 1Q14A 3UJ9A 5JAZA 3OSUA 4E4YA 3BIWA 2ACVA 1RVV1 2XVZA 1OD6A 2ODPA 4FYJA 1E6UA 2AC2A 5DWQA 1GG2A 3WOHA 1WV1A 1T3LA 3KJFA 2P6RA 5ES4B 2AQHA 1A71A 1O1YA 4FMDB 4IUDS 2VSFA 3Q0EA 4BMCA 2PGAA 5HE9A 4HHEA 3W2IA 4YMHA 1VIDA 1OI2A 2OVFA 3DFZA 1M2EA 4Q9KA 3QENA 1QM5A 5DOZA 2COUA 2EGGA 3DXFA 4HQLA 1DG3A 3GPDG 3USES 1SUPA 2XSZD 4Q93A 3A31A 1FJ2A 4C1NA 4DV6B 1F3OA 3IA2A 1Y5LA 2D7CA 1YONA 1U1EA 3PGLA 4W9NC 4DXHA 5BRJA 1T10A 4ATNA 1XR3A 4DABA 3WMFA 2E1RA 1W5SA 1SKUA 1W29A 3M4ZA 4R1PA 4C4SA 3AVYA 4OGWA 2JBAA 2O6LA 5DIZA 1A3CA 4LC1A 1WY7A 2DFDA 3F5SA 1ABBA 3OICA 4P3OA 4Q66C 4J4TA 4B35A 2I22A 2JFNA 1XDDA 2GJSA 1XTPA 2N46A 3DLCA 4LJ9A 5KHOC 1ILWA 3ESCA 1HYEA 4MB6A 1JWAB 4GLOA 2DGDA 3V8BA 5TQ0A 1L8QA 1T5HX 3X1DA 3FNFA 1JHRA 4YRZA 5LYJB 4DCPA 1VE9A 5JU6A 1QU3A 3Q8LA 4WZZA 4R1MA 3OEHD 3KTOA 1V5GA 3D3QA 1R15A 3NWBA 4IGKA 4UARA 1PS0A 2C8VA 16PKA 2I2CA 5E7JA 4NICA 2VPZA 5JCJA 3I32A 4A8HA 5BV7A 1CIPA 4AY6A 2AI2A 2QUIA 1RNLA 2P1DA 4HWPA 4OBEA 4BNGA 5EJ4A 2VWQA 3RJ9A 4EHLA 1A9PA 1BGWA 3MK31 4LWZA 3SJ7A 3ZDQA 1RZRD 2ONKA 4Q3NA 1XNQB 1ISHA 1EXVA 3K1YA 2Q3JA 4XIIA 2V7TA 3KZCA 1HL3A 1KO1A 1SBTA 1L4LA 3A3KA 5TS2A 1FMTA 1PUJA 2HSWA 4BTVA 1OWOA 1W8DA 2E6KA 2Y1WA 1M73E 1SQGA 4OIMA 3UQYS 1TOAA 3PPIA 2QWXA 5BN4B 1W52X 3EQ8A 1VSBA 1RQ2A 1UAYA 1R12A 3OQPA 1AQ6A 4Q1EA 5A5FA 1P29A 3HDGA 3ZCSA 4A2CA 1SU4A 4CL3A 4O63O 1D7OA 2ZUUA 4JJEA 4PSCA 5HUQA 3GN2A 2QN2A 3ED1A 5EHGA 5FRDA 3ZLBA 4YTEA 1FNBA 2V7UA 1GN8A 1T5IA 4W6QA 2ZBVA 3O4JA 1XMSA 4EJSB 1KIAA 2PAFA 4UPDA 1GQOA 3M5CA 3PC8A 4NBLA 3ZWBA 4V39A 4DJJA 1ZYUA 5DYYA 3HO6A 5DXFA 1K08A 4YR9A 4HEHA 1WCIA 1QK4A 2JAHA 3B1ZA 2O8FA 1L5MA 3C98A 3A06A 3WGZA 3B3GA 1P2DA 3LOQA 4Z4GA 4XXHA 4PTLA 2VSYA 1D6JA 1NSYA 1SUSA 3WRYC 5AIAA 1YE3A 2HLPA 4JLVA 5H80A 1JFFB 1JDTA 2ZYSA 3ZKWA 1U2TA 3PXBA 4X54A 4BVEA 5DIFA 1PJ4A 5HS6A 3IKLA 3GFRA 1VLLA 4S12A 4H18A 3C5EA 2XGMA 4FIZA 3W5JA 2EG5A 2H9IA 5INTA 1H0RA 3ZW9A 1P3JA 1J33A 4N3NA 4OXXA 2P5UA 4MGIR 1IVYA 5CURA 4DYDA 4OGKA 3GEDA 1IN8A 4P8RA 3ZNNA 4C4AA 2X0RA 5JJCA 3BWDD 2X1LA 4DNOA 3MD9A 4PN7A 4Z1MA 3SIPA 2XB8A 3ICQB 3GCZA 4NXMB 4UMDA 5FBVB 1C7FA 3EN0A 1A2BA 2PMCA 1X77A 2PV7A 3NVMB 3O2NA 1MQSA 2DH6A 4PS1A 1P4GA 4XYBA 3EC7A 4BMPB 2MSKA 3TD6A 4BEBA 4EHBA 1OROA 2BT4A 1RLJA 3BWVA 2Z2ZA 4DA9A 2GASA 4ENPA 3HYSA 5J59A 2QM8A 2XTNA 3VPHA 1GNRA 1RAAA 3VTKA 3WTCA 4F9EA 4Z7JA 1RP7A 3PZBA 5IAKA 4E2XA 3ISJA 2Q7OE 2E7ZA 1J42A 1FE8A 1KE1A 3M9LA 1BS2A 2IVFA 1R6BX 2PNFA 2ZFUA 3D2LA 4U8GA 2C95A 1L5FA 2GRAA 1LSJA 3H9CA 1GA1A 5EQDA 5I7VA 2CLSA 3H2JA 3WA6A 2PGJA 3BE5A 5TXGA 1SCKA 1L7RA 3IR6A 1PT9A 1QHGA 3NAGA 5G3YA 3T3PB 3MT0A 3F47A 1PX0A 4I1UA 3AKEA 5L3RA 4N8SA 3ML1A 2A57A 4AD8A 2HRBA 1R0ZA 4BL5A 4U2DA 2ZE6A 3KCNA 1R74A 2OTCA 3BGVA 4G0ZA 4HH4A 4I4CA 3L9WA 4TT3A 3EQ6A 3F97A 3TSOA 4BMDA 4U7DA 2VEDA 4JLOA 3P4UA 3QBJA 4MNTA 3ZW7A 1OZHA 3PC8C 4ZOAA 4BNYA 4FGZA 5LIRA 4WNAA 1PL8A 1KC1A 3NAQA 4MWTA 1TW3A 1NUUA 2IU4A 2BMAA 5EMHA 3U3KA 3ZE6A 3L4BC 3DZHA 4KMSA 4U6SA 2O0KA 4BNLA 2BOVA 4I9NA 4K3UA 4QJ5A 3RC8A 3AW9A 3CE9A 4IIEA 3EVZA 2ECFA 4OM7A 3NBFA 1IG3A 1RYMA 4PZAA 2NOAA 1Z26A 1NWHA 3KB6A 3O3NB 3AZQA 1LRKA 2JJ2D 3DXZA 3M1IA 3O8OB 3PPYA 2JK0A 4G5YA 5EMNA 3MRSA 5DCYA 4PE5B 2QMQA 1Z5UA 2XYVA 2WW8A 2AXEA 4HFRA 3V33A 4LVUA 4NJMB 3ZWPA 4ZK2A 1Q11A 5I5GA 2UXCB 4BE7B 3OURA 1U80A 1H8HD 2CLCX 2GXAA 2HMWA 1YR2A 1NIPA 4OA8A 3SN6A 3A4NA 5H81A 3G0BA 1KJ8A 1Q17A 4YYZA 4CTKA 3GK3A 4F4JA 3A6JA 2IXEA 4JSTA 2E85A 5BV0A 4MP6A 2IYTA 1XUOA 3DO6A 3O83A 1GAXA 4ZVNA 1DO2A 4RZ2A 3U7JA 1PUXA 3ET4A 3BRSA 3OF5A 3CX7A 3H5VA 5CBPA 1I0LA 4TVOA 3GLSA 1PUIA 1CUFA 3MCAA 3OJCA 2LTAA 4NHOA 2NZUG 3T4XA 1TFRA 3VR4H 4F85A 3ZHOA 1U7WA 5JNUA 3PCTA 3PGXA 4YUXA 3WB1A 3QHPA 4DV1B 3FZEA 2ZWAA 5KQGA 4GBED