4GMXA

Crystal structure of kpt185 in complex with crm1-ran-ranbp1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
209
structure length
205
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVLAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Selective inhibitors of nuclear export show that CRM1/XPO1 is a target in chronic lymphocytic leukemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/inhibitor
total genus 55
structure length 205
sequence length 209
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gmxA00
5M04A 4HAVA 2QG6A 4TYWA 4F4IA 3AVXA 4MKHA 2ZRAA 4C4PA 3QSYA 2XTNA 4OHVA 5CITA 1AKYA 2GEVA 3M1IA 2XJ4A 1DS6A 1YR9A 4M1SA 3BOSA 2ZANA 2A3RA 4LYJA 4DDWA 4DCVA 1TQ6A 3QKRA 1R5BA 2AKAB 1JAHA 3BFKA 3NHAA 4JSTA 3W6NA 3K53A 2ZI7A 3JZMA 3RANA 2G77B 4DUGD 5IF9A 2DFLA 2F1IA 3PITA 4B3CA 4M53A 2JLSA 1E94E 3GLHA 4G5RA 2QU8A 3QKSB 2ATXA 2ZRDA 4EAQA 4I1SA 4IDQA 4NCHA 1KK1A 3LW8A 2VF7A 4AYTA 2XNSA 2ZQ5A 4KFSA 1Z5ZA 3QVUA 1N6KA 2R62A 1ZM7A 4Q9JA 3FFAA 3VR5A 4JYBA 4IOKA 4TQUS 2J5XA 4HI0E 4A92A 1N6NA 2E1RA 2EWVA 2ERYA 2WWYA 3ZQJA 3PUYA 4G5QA 2Z5FA 5BQ5A 1KY2A 1NBMD 4PSAA 4RJLA 1GVNB 4OBEA 2ONJA 4Q9LA 5EE3A 4N0EA 2GCOA 2GBLC 3REGA 3K9HA 1D2NA 2OM2A 1Z0IA 4PPQA 2CXXA 1E2NA 3FHCB 3T1TA 4ZDWA 2DB3A 1E9FA 2VHTA 3M0EA 4GRAA 4JL8A 1SQ5A 4QNMA 4JL5A 4AD8A 3SHFA 3CX6A 3DKPA 4TYQA 2RGNA 2ODNA 4P31A 1E79A 5P21A 2JDID 3ZZ0A 2BMDA 3MAAC 5EQTA 3D31A 3EZFA 1S4QA 1ZM2A 3IILA 1VTKA 3GJ4A 3RNLA 3TR0A 5E7MA 4IHQA 3KZ1E 2HLDD 2C78A 5LD2C 1W7AA 1C9KA 3HU3A 2QMUA 3VKWA 5JWRA 1U81A 5J4YA 1MABB 4TSFA 1QG2A 5BWMA 3LBIA 4Q4HA 4ZKDA 2GJ9A 1Q20A 2FV8A 4LBWA 2IS1A 1N25A 4UJ3A 5JSZA 1SVSA 1KHTA 2ORWA 2GZAA 3HPQA 3SU8A 4EDHA 1G21E 2BJVA 2X1VA 4I1UA 4D2IA 3IQXA 1IJFA 5CJPA 3UKDA 1DAMA 2PZGA 2FZLA 4ZCIA 1S2MA 4BRWA 1A82A 4JBWA 3BD9A 3D7MA 3EG5A 3Q5EA 3B1XA 4DLYA 1WA5A 2A5FA 3VR6A 1FX0B 4F93B 3AEZA 3KQHA 2Z83A 4JJZA 4B3BA 1P3JA 2D4HA 2BM1A 4AC9A 1NI3A 2AFHE 2NQ2C 4HAXA 5HR5A 1FQJA 2RAPA 2FWRA 1K6MA 4S2EA 1E9AA 3L8YA 4M1MA 1J99A 2PCJA 4KFTA 2HXSA 2ZYVX 2F1JA 1U8ZA 4NZYA 1KSHA 1F5NA 4UXJA 4Z1MA 1WE2A 4NDZA 1YR7A 1ZYUA 4D81A 4X8HA 4Q1DA 2J0UB 3B13B 4AY2A 1J8YF 1RRPA 4LJ6A 1S3GA 3AF0A 3QKTA 2YV5A 3RHFA 3LA6A 2ZUCA 5JMTA 4R98A 4DEYA 5HCIA 2J41A 2FEMA 1N6IA 2GF9A 2WWXA 5AJXA 3TGPA 2KB0A 2DY1A 2AD1A 3CF0A 3DO6A 3FB4A 3U61B 3QXHA 2V8OA 1EGAA 4GPTA 4FD2A 4KVGA 5FPKA 2OFOA 2RHMA 4DSOA 4PQRA 2EFHB 4PC3A 3ZVNA 3CW2A 1JQJC 4PANA 1G7SA 2W58A 3U6BA 5FTKA 2A30A 3TKLA 2WICA 3C5CA 2CNWA 2WHXA 1N5IA 2GXAA 1JJVA 4W5HA 2FNAA 3JVVA 3NBFA 1GRRA 1W5SA 1OH6A 2VHQA 2JCSA 1I4DD 3CNOA 5CK4A 4ZKEA 4QJ5A 1Z6AA 3NH9A 2P65A 4Q18A 4IOJA 3U44B 3OAAA 2Q9AA 5FUYA 1OIWA 1S9DA 2ZI5A 3KJIA 3MLEA 3IIMA 1T3HA 3P32A 1AZTA 3PUWA 2HF9A 2FU5C 2R6CA 5EXSA 3G5UA 2ANBA 5LDDC 1KMQA 1RRCA 4BUJA 4D82A 2O0HA 3NXSA 2ZSEA 1BS1A 1ZCBA 2AK2A 5CLQA 4Q01A 5AWFC 1DTSA 3E5HA 1VYTA 3GJ5A 2RH5A 4XVRA 2IYUA 3SQWA 3O47A 1YZUA 3QVVA 4TL8A 4MH0R 5EP2A 4ZI3A 2JJ2A 1CR4A 1R0WA 1II8A 1US8A 4HUQB 4OQLA 1XU4A 4B34A 1JR3A 3AVPA 3W6PA 1MH1A 1S96A 1Z47A 2BJWA 3LH5A 3FKSD 4OQXA 5HCNA 3A36A 4LPSA 3IHLA 3PENA 4Q7JB 1U94A 3OESA 2XB2A 3NHBA 4TMXA 4LWZA 4DLWA 5B57C 5KPJA 1C1YA 2G1KA 3CONA 5KYKA 3LLUA 2ZSBA 3NBYC 2J59A 2JLRA 1ZNYA 5E4FA 2W83A 2ZRIA 2J0VA 3SJBA 2AKYA 2DFKB 2NO9A 2H1LA 4YMWA 1BH2A 1ZNXA 3RS2A 1GAJA 1ZNZA 2PEYA 2GWHA 4GZMA 4OK3A 1JNYA 1R7RA 2RCNA 4B74A 2E87A 4BFVA 1NSTA 3K70D 3VHLB 4G01B 3GLGB 2ZE8A 3A1UA 2CLSA 1G5PA 3Q7PA 4LHWA 5TXGA 1PVOA 3U3RA 4RD0A 4JLPA 3GFOA 3BRWD 3GLFB 3QXXA 3I8XA 2ZE6A 3CF6R 5DH9A 5JS8A 1G4AE 4WBSA 1EFHA 2NZJA 4LK2A 3SDZA 1WMSA 1NN3A 2QT0A 4GSYA 4G5SA 1OPXA 2C2HA 2QE7A 2VIIA 3FGNA 4JLOA 1KNQA 2GZDA 2ORIA 2VYFA 1CF4A 4IDNA 4QM7A 1E1QD 3H1TA 3VU9A 3A6PC 4JKYA 4IXNA 1BIFA 1T6NA 1UFQA 2QAGA 4L9SA 2JATA 4P32A 2BWJA 1SXJB 1DAIA 3PR1A 2OEPA 3TVDA 1KIMA 2WMNB 1DAHA 5IK2A 5DN6D 1KO7A 2IF2A 2H17A 1D2EA 3ZQ6A 2WWFA 2DWQA 2C95A 3CNLA 1KY3A 1E9RA 1P72A 4ON9A 1XXHA 3GPLA 1T3LA 3CR7A 2CL0X 2XSZD 3FKQA 3T5DA 3TNFA 4B73A 1KTVA 1U90A 1Z2AA 1TF5A 2OAQ1 1QZXA 2J0QA 3LXRA 1OHHD 1AS3A 1EX6A 1XTIA 1AZSC 2CK3D 4OQMA 4X8MA 1PZNA 1E4VA 1Z06A 3THOA 2LKCA 1HA3A 3BB1A 2FPMA 3NC1C 3AB3A 4RZ3A 5FL7A 5B2ZA 1E2MA 2Q9BA 3ZD6A 2WZQA 3CNNA 2VP6A 3WP0A 4C0AC 2XNDA 2XZPA 1H8HD 1N3BA 1Z3IX 2A5DA 2GVDC 2QMEA 2ZI6A 2FMXA 1QRAA 1I2MA 1YZQA 5EE9A 5A0FA 4B32A 3U4QA 3VR4A 5LPNA 1DE0A 1IBRA 2GETA 1SXJE 1YU9A 1XTSA 4BFUA 4CEJB 3KFVA 3O8BA 1FZQA 1UJ2A 4LJAA 1VCIA 2ZSFA 2QM7A 3C15C 1G5TA 4KVAA 1NJFA 3TQFA 2GEUA 4V0MA 2WWWA 3QF7A 2HYIC 5JCPA 3QF4A 1QVRA 3NVAA 3TBKA 1XMVA 4FWIB 3RSLA 3VR2A 1HYQA 4IFBA 1ZRHA 3N2IA 1X3SA 4IVRA 3AGPA 5JRZA 4HZUA 4M8NE 2PCLA 1AGRA 2YC4C 1RW4A 3NDBB 4YC7A 3K9NA 1NVVQ 3B6EA 5G3YA 2C77A 4DVGA 1W46A 3RWMB 1SHKA 1EG7A 2HUPA 3CRW1 4LYAA 3GLIA 1OXTA 1YHNA 2HDNB 3QNUA 4AYXA 2ZAOA 2XOKD 4B3DA 5DI3B 2G0TA 2ZI4A 1GKUB 4D25A 3TSWA 2W2VA 5FTJA 2JJ1D 1NY5A 4GBMA 4CEHB 1PUIA 4B2PA 2JJ8A 2ZI9A 5L3VA 4YMUA 1ZC4A 3NEJA 3WHLA 2WOJA 4BWYA 2PBRA 4HAZA 4EIWA 2G3YA 2ZPTX 3HU1A 1OH5A 2BBTA 2WKRA 1Z0JA 5E95A 1VKJA 3RWOA 3ICEA 1COWD 3UANA 2KSQA 3K0FA 4Q66C 4QBHA 4EJSC 5EP1A 3EIHA 4Q9IA 1N0UA 5G41A 1YJ5A 1UBEA 3V9PA 4R9UC 1Z6YA 2H18A 2R6FA 5ANRB 4LOAA 1Q3TA 2YWEA 3FYHA 4DRZA 4OK5A 1GM5A 5TVKA 2B8TA 4JIMA 3EARA 4O25A 4C9BA 4LX0A 2GCNA 4MYTA 5G40A 2J0SA 2VTKA 4DXAA 4EPTA 5JJIA 1TPZA 2OBMA 1YR6A 4JLJA 2IX3A 3H84A 4KV9A 2IYSA 2Z4RA 3T5GA 5D3QA 5B30A 3AVWA 1O87A 3F5FA 4TYPA 3ONWA 1OFUX 2QTFA 2GVZC 3DHWC 5J40A 2JLWA 4Q4JB 1M2OB 1P2UA 4MRVA 5K8TA 3K9GA 4JYCA 2O52A 4POAA 5C4MA 4L8GA 4JLNA 3TK1A 1NBMA 5CJ2A 1KI3A 4DJTA 1KK3A 3O8DA 4NMMA 1KO1A 1W1WA 4BFXA 3RRMA 4TQAA 4OHYA 1ZC3A 4N0DA 3MWKA 1ZU5A 2CBZA 2FFHA 5HZKA 4CGZA 4C0HA 3ZIAA 5JJLA 4RKFA 3I8SA 2O8CA 3HP1A 5CM9C 3L2OB 4JBYA 2JIZD 4UXHA 2HF8A 1FW6A 3FHTA 5FPHA 2PLRA 4HB3A 2A5YB 3KXKA 5FBQB 4LPKA 1AM4D 2ZR9A 1Z0AA 1ZNWA 1JJ7A 3DKVA 3QEJA 4ARZB 4F4CA 1DAKA 4EQ6A 2P5SA 2O8FA 3ZVRA 2VP9A 4PZLA 2GNOA 2OG2A 1HQCA 4FXPA 2QUZA 3FMPB 4QHSA 2R8RA 2IW3A 2QENA 1X86B 3CR8A 3CWQA 4OQFA 4Q47A 5JI2E 4CEIA 1EESA 3GJ8A 1CIPA 1KJYA 4DBLC 4Q7KA 1WF3A 1U98A 1H8EA 1ZW6A 1WRBA 3T1VA 1S1CA 3WRXC 3B2EA 5A4JA 3EA0A 1NSFA 4A36A 2PZEA 1XDBA 3C14C 1NP6A 4JT4A 3QQ5A 5J4VA 1OFHA 1VG8A 2W2XA 5FPTA 3WHKA 4DDVA 1ZD9A 3NTUA 1Z0FA 3FDIA 1GOTA 4HDQB 5KDLA 3UK6A 1JI0A 4MUBA 2Z4SA 2VHUA 2A9KA 2FFQA 5IRCD 2HCJB 1W49A 4JLAA 1Z83A 5GVSA 4G3XA 5SZKB 4Q7MB 1MO5A 1PLLA 4B2IA 1A5TA 1XPOA 5TARA 2J7PA 2NOAA 2LCFA 3C41J 2WSSD 2V1XA 2J45A 3AVQA 3TW4A 2AX4A 3Q8XB 2EW1A 2VH5R 4U7DA 4NYMR 1CU1A 1HURA 1SXJD 2O5VA 4J0QA 4NYIR 4YMSA 5EUMA 5J47A 2HT6A 4EPXA 3IO3A 2ZVPX 3ZD7A 4GOJA 1F48A 1P9WA 1Z28A 3RDPA 221PA 3VMFA 3K09A 4P4SA 2ZYTX 4MRNA 4MQBA 3CB4A 1GUAA 3IPYA 1IN4A 1XEWX 3FFBA 3RYTC 1TU4A 2FSGA 4G0NA 4YQFA 4QGHA 3FMFA 2YWHA 3DMDA 3TAHA 2TMKA 4JJKA 5KPDA 4D4MA 4A15A 3B9PA 3KTAB 1WDTA 1ZBDA 3MWYW 2WAYA 4C2TA 1HT1E 4W5WA 2ZJ8A 1PUJA 2XB4A 3UG6A 4GT1A 1N5LA 1XZPA 2ZETA 3E70C 3Q85A 4XOIA 2IS6A 5JJKA 1IN5A 1DELA 3CRMA 1OYYA 3A1SA 2OXRA 3DL0A 2BCJQ 1NVXQ 2I4IA 3WMGA 1HUQA 2E9SA 4HB0A 421PA 2IHBA 4BFSA 4BLSA 2QROA 2J87A 2VRWA 2OAP1 5FOWA 4UNRA 2CHVA 1KO8A 1W36C 4R71A 2VHJA 4LJ5A 4ERNA 2GK7A 3ZJYA 4PO8A 1T0JB 2OCAA 4X8OA 4BEJA 4DB2A 4OHWA 3I73A 1DG3A 3BERA 2O8EB 1SVKA 4ZI2A 2PZFA 1Z29A 4HYYA 1GKIA 3U60B 1LS6A 3P26A 1VDZA 2CVFA 1AS0A 3EXAA 4P3YA 5KSPA 1WB9A 1PLJA 2ZRFA 3QPUA 1U0LA 4NCIA 1CRPA 3AUXA 5GJCA 1LFDB 2NPIA 3PFIA 3FKSA 3QI2A 3L43A 2F1HA 2VP5A 3GJ3A 3SN6A 3RS3A 4Z51A 5UKDA 1G4UR 4RFVA 1A2BA 5TMPA 5FOSA 1YZLA 2ZS9A 4R7ZA 4QJ3A 1NVWQ 3KDSE 1R6BX 5FOVA 1Z6GA 4U02A 3UMFA 1SULA 3E1SA 5GJBA 1F2TB 2QQ0A 2O0JA 4ACAA 1OIXA 1NLFA 3RABA 2ZJ2A 4MGZR 4MYHA 1T0HB 2IHYA 1OXXK 2C04A 4ABYA 2FJUA 4NU0A 1G8YA 2ZU6A 4JVLA 1EWRA 5EZ6B 3GFPA 1UF9A 2WVJA 1WBDA 4TLAA 2ZXUA 3OEED 3DEFA 4B76A 4FMCB 1TQ2A 3EZ7A 4Q7LA 3KL4A 4QFMA 5JS7A 1ZM4A 2VP0A 5L3SA 3P1JA 2VEDA 1CR2A 1UKYA 2QTHA 3LDAA 1JBKA 1W0KA 2V1UA 5FTMA 4FMCF 3D8BA 1OT3A 4LBZA 4KSCA 4S35A 5LB4A 2F7SA 3F8TA 3EZ6A 3SQXA 2QAJA 4LJ9A 4PO1A 4OJKA 2ODWA 1KI7A 1E9BA 1JECA 4B6EA 2BV3A 4JLVA 3ICQB 1HH4A 1UBFA 3OFND 1RVDA 5AUQA 4MGKR 1DPFA 4RD2A 1CP2A 4AKHA 4XD7D 1K8RA 4M9XA 2N42A 3W90A 3QKSA 5TDHA 1S9HA 3LW7A 4QGAA 2ZSAA 3BFXA 4URUR 4W5JA 2JLZA 2Q6TA 1XPUA 1PJRA 5DN6A 4YONB 2GK6A 1S1MA 3FHOA 5GVRA 1BKDR 1MO6A 4G1UC 3QE0A 1S8FA 4E03A 3TUZC 2F6RA 4XWOA 2FE4A 4Q1BA 4DIDA 1JEDA 4TT3A 5C46F 2XSZA 3SYKA 5H70A 3ZYCA 4C7OA 3LLMA 4XSHA 4Q1FA 2BCGY 4WOPA 3I62A 1KSFX 1UADA 1T9HA 1YZNA 1G8GA 2PJZA 2IXEA 3QIAA 2FFBA 1CBUA 2IYTA 4HLUA 5SZJA 1OH7A 3OIUA 1G291 3MRSA 3X2SA 4IOMA 2Q3FA 3U3MA 4Y0VA 1P9RA 3ZZTA 1FMLA 1RFLA 4B33A 4HLQB 1J8MF 2FGKA 3X1WA 1DG1G 2VF8A 4V03A 1SGWA 1XF9A 1R10A 2WMOB 2NO0A 4B3FX 4D0LB 2MSDB 3L0SA 2WJIA 3I1FA 1U2RA 4M9QA 1CRQA 5D3MA 1F3OA 4NKRA 3PUXA 2AL7A 4WW0A 4RFSB 1NNEA 5JRJA 1XRJA 1YR8A 2LKDA 3SEAA 1JQLB 4URVR 3RS0A 1RZ3A 4EUNA 2IEYA 4M21A 4XVQA 1MABA 2V7QA 3THWA 1G17A 3IBYA 121PA 3IDQA 4AK9A 4JKIA 1QHHB 1WXQA 1S3SA 1XB2A 3K09C 2OCPA 3OE7A 3SE0A 1E69A 2B21A 1EK0A 2BMEA 3K0AA 1HQYE 3KQKA 2BBWA 3CBQA 4DCUA 4V0NA 5EP4A 5EUQB 4RZUA 2RGGA 2EQBA 4Q4HB 5DNYB 2BIFA 1HV8A 4OI0A 3FVQA 2AXNA 2G9NA 5JSZB 3THXA 3TW8B 1G19A 5A5GA 2F43A 2GXUA 1CS4C 4JL6A 1FX0A 3EWAA 1LY1A 4OJQA 4TL6A 3PCRB 4W7SA 1CR1A 4D26A 4M4SA 3U5ZB 1Q3HA 3LX8A 5FUWA 5JLJA 5EXXA 2XOKA 3GEEA 1HTWA 2ZEJA 1GG2A 5KDDA 4RVCA 1OLOA 3SJAA 1D6JA 2NMVA 5EZ5A 3HYTA 4OI4A 3B60A 5EE5B 5CDFE 4QBGB 2O8DA 1VCNA 2K5UA 5AR1A 2JLVA 4PQYA 2QBYA 2J0UA 2CHQA 2QY9A 2PJRA 4ZDJA 1COWA 4TYNA 1GL7A 3T1OA 4UKDA 5FFMA 1OB2A 4PAMA 1XEFA 4DT1A 2FSFA 2ONKA 1Z08A 1VHTA 4LBYA 2QRNA 3AM1A 3LWNA 4X8LA 4LJ8A 1Q1QA 1TQDA 4LYFA 4WXPA 5DGXA 1DOAA 1XX6A 3PUVA 1T3SA 4LSGA 5AUPB 2B7BA 2CL7X 5C1BA 4LDJA 2CVHA 4QXAA 5DYIA 3Q5DA 3KKQA 3SYNA 2FGJA 4Q1CA 3W3ZB 5J4LA 1QHSA 1Y63A 3WNDA 4YDSA 2GJKA 1S0UA 3AGQA 5DHFA 4AURA 3CRVA 2UKDA 1FL9A 1T8TA 4KAXA 2L0XA 4TQ9A 4P33A 1SHZA 3W34A 2D74A 4Q1AA 5KOYA 1YVDA 1R8QA 5G53C 1XTJA 4ASUA 1WBBA 1W2GA 5FOXA 2IF0A 4DLUA 1JAIA 3X1ZA 3NBXX 1ESNA 1FNMA 5F98A 1J90A 4LJYA 1GDDA 5C2JB 5C18A 2KBEA 3W9YA 3QY0A 4HDCA 4IEEA 1KAOA 4AYWA 1EFRD 4EJSA 4WZAE 1G6HA 2BVNA 3RVBA 3MD0A 2HYDA 2AFIE 1M8PA 2AXPA 3ADKA 3B1YA 4HUQA 4MKFA 1TTTA 1XTRA 1H65A 4KJZA 3WYGA 4DIEA 2RMKA 2JIZA 3VAAA 1G3RA 4RKEA 1N2CE 2WJGA 4YLGA 3A4NA 4GDFA 3CPEA 3SOPA 1M34E 1FP7A 3GEIA 3NIBA 1US8B 4IDOA 4HATA 5BN4A 4CW7A 4M1OA 4WAUA 2C96A 1KDOA 3S1AB 3LAWA 4PSVA 2DCUA 1G1MA 2RGEA 4AG5A 4CRWB 3PXGA 3EPHA 1KKLA 1JR6A 4PC1A 2OHFA 1XJCA 2G6BA 2OSBA 1IXZA 3MGCA 3TJZA 2ZS8A 2OESA 4CT4B 1NVUQ 3ADDA 1EFUA 2HJVA 1VYVA 4KFUA 4DSUA 4KBFA 1E2PA 1G3UA 2F3TA 2QM8A 3VX3A 2CLDX 4BZQA 1NF3A 1GNPA 4QGGA 2D7DA 4LRWA 1E32A 1Q1BA 2W0MA 2ZUDA 1NMYA 3V4RA 5K8LA 1AQYA 3AF4A 1NKSA 2B6HA 2WPDD 1L7VC 3OEHD 2AWOA 4QRHA 4ILEA 1DADA 1GKYA 1DAGA 4HLUC 4DZZA 1ELOA 2CE2X 1YE8A 4RD1A 5DHAA 1E1RD 3RRNA 1FTSA 2P6NA 2EFDB 3AP3A 4CF7A 4MYCA 4O3MA 3PQCA 2YVUA 5FPSA 1G9XA 1FMJA 2KI5A 3WMFA 1DAFA 1XD2A 1VHLA 2J1LA 2GJAA 4E22A 4CT5A 5J4KA 2WWIA 4NBSA 4DLZA 2EYUA 2B7CA 3GJ7A 4V02A 2WSSA 1K5DA 1E2LA 3DZ8A 3PVSA 3M6AA 5GJVC 2DFTA 3SHWA 3TQCA 4A8JA 1U8AA 4IEIA 4H1UA 2YOGA 2QGZA 1SXJA 4IOLA 3OZXA 1P7CA 4N1AA 3VU9B 3GLGE 3UPUA 1PV4A 4F7WA 2XZLA 2R2AA 4B47A 2XX3A 4FMBB 3PG5A 3KQLA 2D2FA 2KWIA 1IONA 2QAGB 1KNXA 2V6JA 3GLFE 3U3KA 1RKBA 1MR3F 3V4FA 1KI4A 2VQSA 4AG6A 3AF1A 3NC0C 3IGFA 2R44A 3N2EA 1XP8A 1GILA 3D6TB 4BGDA 4PX9A 3BAFA 1W0JA 2C9OA 1AN0A 5FPYA 1P2SA 4DKXA 5G3ZA 4K81B 2HT1A 3AV0B 1R0ZA 1G8PA 4QHTA 2SHKA 2X2FA 2ZI3A 4RCZA 1XCGB 5JBQA 5FBVB 3WNCA 1Q1ZA 3SBDA 2X77A 4LHXA 4DEXA 3BB4A 2ZRKA 1X8KA 3T06B 3THYA 4HB2A 3ZZUA 1GNQA 4A0FA 1HEIA 4WVFA 1N5KA 2OCBA 2OV2A 3F3YA 3DM9B 2JGNA 4KXFB 2W6ID 4UXIA 1FFHA 2B92A 1KDPA 5SZHB 1E9DA 4KLNA 2XXAA 3LRPA 2R6GA 1KAGA 3DVLA 4A2PA 1KI8A 1E79D 1HE8B 5FOUA 2DBYA 4DCSA 5KSZA 3U4QB 1M7BA 2GDJA 4PO9A 3N70A 2QPOA 3HJNA 3ZLJA 1OIVA 3LXXA 4YMVA 5JEEA 2QT1A 5HKKA 2Z43A 4LHVA 1RC8A 2F3RA 2QQEA 3RS4A 4PFSA 3TUJC 1G18A 3W5JA 2ODBA 4TSFD 3CPJB 1ONBA 3LBNA 3QF4B 5CB8A 721PA 3LO5A 4NONA 3RS5A 5JCZA 2PMKA 1CJTC 2FX3A 2IA5A 3GJXC 4TMWA 1YRBA 4B2LA 1CR0A 4I1VA 1BMFA 2ZJYA 4HZUB 4LC1A 2ZM5A 1TL7C 2C9CA 1RJ9A 4EFNA 4KBGA 1UBGA 2P67A 1KDTA 1ZJ6A 3K0EA 4UNQA 2I1VB 2AN9A 3KX2A 4IDHA 1XTKA 4LYHA 5EXPA 2QPAA 1P75A 4NP6A 3GLIB 1XJ0A 3ZS9A 4KODA 1UEIA 1G8FA 1KDRA 1U9IA 1AA9A 3LFUA 1G7RA 4KITB 3TR5A 3NWJA 4BRUA 3TSZA 3QOFA 2VHCA 621PA 3B5JA 4LV6A 5TB5A 2XXAB 2CJWA 4NTZA 4EFLA 1ESMA 3BH7A 1ODFA 1TF2A 4CZ2A 3OEEA 1KI9A 1XTQA 1E2IA 2IYVA 2WM9B 2V54A 4TTPA 4Z1MD 4A2QA 4DDTA 2Q0HA 2CCKA 5SZIA 2OBNA 1KI2A 2GJSA 3AVYA 1N6LA 3K0FB 5FUVA 3BK7A 3KUDA 2GEDA 3QEOA 4GFDA 2IYLD 3I72A 4DUGA 4E09A 1BO6A 1G7TA 3MWJA 3NDPA 3IEVA 3OFNA 4Q03A 5FUXA 2ECKA 1W4RA 2QMHA 5KUTA 3W8RA 4BLQA 1A2KC 2BEKA 3U7GA 2Q3MA 4E5UA 4US0R 1E2HA 2C5LA 2H7VA 3GD7A 3UWKA 5FBRB 2XGJA 5KSYA 4FCVA 4E07A 1ZUHA 4GMXA 1J7KA 4A0GA 1UAAA 1VYUA 4Q4JA 5CB6A 1E0JA 1ZUNB 4A6XA 1XMSA 2GF0A 1DEKA 4QGFA 2IYQA 5E3HA 2YHSA 4NYJR 1GRNA 4BFWA 3CO5A 4PC7A 4JVMA 4N3NA 4XVUA 1KK0A 3HWSA 1Z63A 3OAAD 1FOEB 1IOZA 4C0LA 2KE5A 2F9LA 4ESVA 5B58C 1F2UA 3SJCA 4IKEA 3VQTA 4DCTA 5F9FA 2VPPA 3UMSA 3EW9A 4GI7A 4DLSA 1E2JA 2C03A 2NO1A 3TSOA 2ZS7A 1KJZA 3QXCA 5DSZA 2JDIA 5BXQC 2JLXA 4B3GA 2ZRBA 3BWDD 2AR7A 1U0HC 1G7CA 3TUIC 2JJ2D 2CDNA 2NGRA 3MJRA 4D80A 2HLDA 1EX7A 4HAWA 1QHNA 2O8CB 4A8JC 2RGXA 3AVTA 1CULC 1XCPA 1SXJC 5KHOC 3NEYA 1I2DA 3VNUA 4CYMA 1E3MA 3GCGA 3UMRA 4Q1EA 1W48A 4P4UA 1KO5A 3KXLA 5DI9A 1ZD8A 1ZINA 4IJMA 3LBHA 4AKIA 4I99A 1Q21A 4UNNA 1SVWA 2VO1A 5CIWA 2H16A 3WMEA 2NZ8A 4Q4AA 4P0TA 4ZO4A 2YYZA 1CEEA 3P4YA 4NPHA 2PLFA 3U7FB 1XD9A 2Z6VA 5L3QA 5GJWC 4BLRA 4CEIB 4NYMQ 4NYIQ 1WP9A 4PXAA 2GILA 1G5RA 2HCBA 2WJJA 3B9QA 1NN0A 4UQOA 2YWGA 4FINA 2P3SA 2XAUA 1Q12A 4KCGA 1KI1A 3EPJA 3KKMA 2XTZA 4TLDA 5FBLB 4IVPA 1UKVY 1OJLA 4M2LA 1LVGA 1KSJA 4I1OA 3I5XA 4MYUA 1AQUA 3AP2A 3EIEA 2P5TB 5BYKA 1QDEA 3P4XA 3REFA 3X1XA 1MV5A 4PPGA 4US2R 3QUSA 2DYKA 1SKQA 3X1DA 2ERXA 2R9VA 3IO5A 1CJUC 2BEJA 5HPYB 3U7EB 4MRPA 3V00A 1LB1B 4XTCS 5JFGA 5HE9A 2QE7D 3P27A 2QGNA 1XEXB 4HUTA 4BEBA 3IBGA 3DDCA 3H86A 2ZRPA 3KKOA 5H68A 2BC9A 1F6BA 1YQTA 2D62A 2V4ZA 4BECA 1N6OA 5KDOA 5LD2B 3PEYA 2LWIA 4JT2A 2IS2A 3FTQA 5AJVB 4ZIRA 1GSIA 2IBMA 2J3EA 3SFZA 1E6CA 2JA1A 1G3MA 4C0SA 1P62B 4BZXA 5IK2D 2OFWA 4Q02A 4O2RA 1IM2A 4Q00A 4TL7A 1TQ4A 5JWHA 1MKYA 2GESA 4ZV4A 3FOZA 4P4SB 4A6PA 1W4AA 4GZLA 3AVOA 3TAUA 2CLCX 1IN7A 3L0OA 1P61B 3A1VA 3CH5A 3QG1A 4G5GA 1FNNA 2GCPA 1N0VC 1V43A 3IUYA 1CXZA 3BXZA 3P20A 1U9IC 1D9XA 4V0LA 1W2HA 4D0GA 2JASA 1U99A 3B78A 3VFDA 4BPBA 1P4SA 3OF5A 1E0AA 4TMZA 2XNDD 2ZU0C 4QM6A 1TMKA 3EPKA 1AK2A 3CH4B 1YZTA 3T35A 3WY9A 5TY0A 4QBIA 3R8FA 4O0MA 2O8BA 3B82A 1XEWY 1VG0B 1OB5A 1ZUIA 5IHPA 1VCMA 2C98A 2DHRA 3MFYA 821PA 2GTPA 1KMHA 1TF7A 2N46A 2ZJBA 3IHWA 4DC9A 4DLRA 3K0CA 2BKEA 2ZREA 1KI6B 2WWHA 3MCAA 5KTYA 2IWHA 3CLVA 3RLFA 2OLKA 4C0QC 2GKSA 2WWGA 3VKGA 5FR1A 1E0KA 4OL0A 2HJGA 2RB4A 4RY2A 2MSEB 2EFEB 2IYWA 1KYIA 2QMOA 4A4DA 5JI3E 3R7WB 4NH0A 1D8TA 3GFTA 1F2TA 1FUKA 1IN6A 2PL3A 3HYRA 5EE1A 3BH6A 3ZVMA 3BS4A 4MDEA 2FZ4A 4JVNA 4HDOB 1Z2CA 3K1JA 1Z22A 1UPTA 5FTLA 1NG9A 4OQNA 5H8WA 1YRAA 3BGWA 4BLTA 4C3ZA 2ZAMA 4LGMA 4DSNA 3UATA 1G16A 3ASZA 4NCNA 1OYWA 2DFNA 1NLYA 2FH5B 3VX4A 1JEEA 1VG1A 2NO6A 3KQUA 3G0HA 5C4GB 2N1BA 2DPXA 2Q3HA 1CJMA 3A37A 1GTVA 1R2QA 3U2QA 1GRQA 1U0JA 1UBCA 2V3CC 1P2TA 2VLIA 8OHMA 3ZS8A 4IVQA 4W9MC 1E1QA 2ZJAA 4M1WA 5GADl 5L3SB 1L4YA 4WZ6A 5FL3A 4RZ2A 4L5BA 2WJHA 5TV2A 1GITA 1G41A 2BMJA 1E99A 3QKRB 5IDVA 3QXJA 4LV8B 1N0WA 1OKKD 2IK8A 4LJ7A 3K8YA 1VECA 2H8KA 4WXRA 3EX7C 4Q9HA 3GLHB 1W4BA 1G3IA 3O8RA 3IQWA 1A1VA 4TLBA 1MOZA 1LF5A 2BOVA 2EWWA 1P60A 2REOA 2WOOA 1LNZA 3L82B 2JLYA 2W6JD 3CRQA 2IWRA 1N5JA 4I81A 1NRJB 4TMTA 2A78A 2HV8A 2MMCA 1OHHA 4IFEA 1G6OA 1FP6A 2P0EA 4PC2A 4XJXA 4ZCMA 2ZRCA 3L0IB 4EFMA 1ZU4A 2D3WA 1Z6TA 4PAOA 2CK3A 2QP9X 2ODEA 2HEIA 1X1RA 3Q9LA 4LJ4A 4RSGA 3DMNA 1ZMXA 4L15A 1N6HA 1W47A 1T8UA 4KHZA 4TN1A 4C7OB 2ZITA 4MA4A 1H8HA 1E4YA 3ECCA 4FN5A 2GCOB 2VA8A 3M4YA 3VR1A 2VSFA 3KJGA 4IDPA 2GJ8A 4M9SA 3QXSA 3NBZC 3A58B 3MSXA 2WKPA 4IRUB 2FEOA 1OH8A 2BBSA 4ZPXA 3KB2A 3RC3A 1BYUA 3BE4A 3E2IA 4URXR 3ZIAD 2W6IA 3C8UA 5DISB 1KJWA 3GLHE 4C0JA 4V0OA 1SVOA 1R0XA 2FDCA 1JB1A 4RFSA 1OFTA 1E96A 3DPUA 1JALA 3X1YA 5CDFA 1P2VA 1ZCAA 2X8AA 4F91B 2RGBA 3QBVA 3R9IA 3HDTA 1D9ZA 1AGPA 3QJYA 4TZ0A 3BH0A 1HE1C 1Q1EA 4XH9B 1QHHA 5CK5A 5D3MB 5FI0B 1QHYA 1II0A 2WJYA 2ZE5A 3WXMA 1L2TA 1TUIA 3EAQA 4M9ZA 4KI0A 2ZUBA 3LY5A 1ZVQA 2VP4A 4P4TA 3THWB 4LHYA 1KZGB 5JHGB 4FIDA 2CHGA 3K0AB 4IXMA 2ZE7A 1YZGA 3PIRA 4HAUA 5B64A 4GNKA 4JLDA 3A4MA 1H8ED 2VBCA 4ZDIA 1ZD1A 2FSIA 1LW7A 4L9WA 2JJ1A 3C5HA 2F9MA 3AKDA 2REXB 2F55A 4A82A 3THXB 5EP3A 4F92B 6Q21A 4I4LA 2F43B 4XWAA 2GRJA 1DVRA 5L3RA 1OV4A 3A4LA 1DBSA 4OI1A 1ZIPA 4QHYA 5H1YA 2OLJA 2BBOA 4CIDA 2X2EA 1UM8A 5F9HA 3ZVLA 2IUTA 2HXYA 4H1VA 2CEAA 1M7HA 1QG4A 1M1YE 2QN6A 4MGIR 3BB3A 2O8DB 2FFAA 4C30A 1RIFA 2J7PD 2ATVA 3Q7QA 2QBYB 2A2ZA 4LV5B 1EFCA 1M74A 2QP3A 3UIEA 4LHZA 5FR2A 1IN8A 3K0CC 4DDUA 1EFTA 1KOFA 1NG1A 4U00A 2X19A 4DT1B 4FCWA 2FOLA 4FCTA 1E2GA 3GEHA 1R5OA 3Q72A 4LCBA 2BHRA 4KYUA 2YJTD 2PMDA 3LVRE 1GWNA 1DO2A 1VIAA 5AJZA 1GNRA 3FMOB 4YDHB 3DZDA 3CZPA 2D7CA 2G88A 3AF3A 4GOXA 3U44A 4EPWA 2YNMA 3K9LA 4QKQA 4JLBA 4HZIA 2ZROA 4NE2A 1WQ1R 3WRYC 1Z6XA 1TU3A 5KSOA 1GZSA 4DSTA 3JVUA 3K70C 3CPHA 3T1QA 2H5EA 4HSEA 3TIFA 1NL3A 2ZRLA 3I92A 4KSBA 1JXMA 3AVVA 1JPNA 4MKGA 1L4UA 4BASA 2QPTA 2RGDA 3CX8A 4TZ6A 5DE3A 1OXSC 1Z0KA 2WKQA 3W6OA 4OK6A 3A8TA 4M0LA 4JMPA 5HE8A 1Q22A 4XTRA 3H0KA 3I61A 4B6FA 1VIYA 3B8HA 3IPXA 4EJSB 3FPAA 1QHXA 1II8B 2QORA 3ZDQA 1CJVC 4RD6A 5ELXA 4URWR 1PLKA 2B8WA 2EFCB 2OE2A 3QPWA 4C0KA 1QHGA 4DHEA 5EE0A 2YOFA 1M7GA 3S1AA 1VG9B 3SS8A 4Q48A 3BC1A 4JVSB 4D4KA 2OO7A 2PEZA 5AUOB 2AWNA 2FPKA 4HEJA 3WNBA 1FTNA 2PX3A 3DOFA 1P6XA 4UJ5A 4YXWD 1E9EA 3AQ4A 2ASEA 2IL1A 1OFIA 3GQBA 1XPRA 4DLTA 3A1WA 2EFGA 1A7JA 3B85A 2WV9A 4FW9A 5CM8B 5K8IA 3GLGA 4PC6A 1C4OA 3H2YA 3I4LA 4A0RA 1NIJA 1ZM3A 3GLFA 2GA8A 1IHUA 1NY6A 4DLVA 3O8CA 2AK3A 4B43A 4M22A 3LNCA 2MMGA 2IEZA 4EPVA 2G1JA 5HZHA 1MO3A 1JR3E 3OIVA 4QOSA 1VPLA 4MRRA 1VCOA 2D2EA 3B7GA 5BYJA 2EU8A 3VHXA 5JECA 3OIWA 4XSGA 1WCV1 4OYHA 3UWOA 4JZKA 4QJ4A 1XWIA 1ZIOA 1V5WA 1Q0UA 2RGAA 3ADCA 4B35A 3LX5A 3NH6A 3U7HB 4C2UA 4Y0AA 1G20E 1W0KD 1G64A 2RGNC 1L8QA 1YZKA 3MWLA 2CCJA 2NTYC 5AJYA 3VKHA 4WZBE 3SR0A 1E2KA 1XD2B 3U3JA 4NCKA 1NLZA 2AD5A 1QF9A 2OUKA 3QENA 4AKEA 4UNPA 5F2EA 2IYZA 3PEVA 1TADA 3JZAA 1R8SA 5IT5A 3CIOA 1RYFA 2IXGA 1D5CA 4Q4LA 1KSGA 1G3QA 2IUUA 4A8JB 4RZXA 1AIPA 3PJRA 1E9CA 1P9NA 1Z07A 3D3QA 3U6KA 3AKCA 1Y3AA 4FWTA 2ZTSA 2ZSDA 1GL6A 1XXHB 2GAAA 3ND8A 1W4CA 4R2IA 5CYPA 3RAPR 4PR0A 3ADBA 2KBFA 1UDWA 1LF0A 2YC2C 3F0TA 4HAYA 3QBTA 4KYIB 4TT3D 2WTUA 4PTLA 2IT1A 2W0SA 4B75A 4JLKA 3I5YA 2ZRJA 1MO4A 2CL6X 1SKYB 2ZRNA 4KLZA 2ZR0A 2ZJZA 3HPRA 3ND9A 2YKGA 4K8OA 4GMDA 2NG1A 4KO8A 4MUAA 4CEJA 1GFIA 4BZPA 2QA5A 2W00A 2R6DA 4B71A 1XNJA 2IYRA 2DR3A 1P73A 4ZCLA 4O2LA 4BE7B 2FG5A 2WJVA 1IJEA 1FQKA 2QSZA 1CLUA 2WBLC 2XJ9A 4AIIA 3THYB 2O0KA 4JS0A 1TEXA 5F3WB 4QG7A 4L4UA 2QI9C 1XZQA 3EZ9A 2RHDA 2G0NA 1UKEA 4PZYA 1SVLA 3LQRA 3OHMA 3TMKA 2OXCA 5J4HA 1FUUA 1RRGA 3AKYA 1XXHE 4M1KA 2J46A 5J5CA 4AKGA 4PHGA 4D0NA 4ZDKA 2V7QD 1I4TD 3MG9A 2R6AA 1N6RA 4DLXA 2ZJOA 4EKDA 2ZR7A 1LV7A 3GJ0A 3OE7D 5AK0A 4Z8XA 4HB4A 3TVTA 1GIAA 1SVIA 2V9PA 5JZVA 4JLMA 3TLXA 4B3XA 1SKYE 2FSHA 4NHOA 2I3BA 2CE7A 2QP4A 5DI3A 2H57A 3OIYA 3FMIA 1Q44A 3ZGXA 4D4LA 4OI2A 4CEHA 2WAXA 3WP1B 1XMIA 1EXMA 1UKZA 1OXVA 2CCGA 5FTNA 3J81k 3BORA 1YKSA 1R5NA 1TEVA 2C99A 3CWZA 4PZZA 4MRSA 3NG1A 5EXTA 5FOTA 4F4JA 1RJ9B 3W3AA 5E7JA 4BFTA 1CJKC 2ANCA 1DARA 1I4LD 2BKUA 2IYXA 2GZHA 3BIFA 3EIQA 4LBVA 4C0BA 4JBXA 4V0ME 4XWKA 1XBTA 2V6IA 2P6RA 2J7KA 1Q57A 3T15A 3PUZA 4PPFA 3U3OA 1IAQA 1ETUA 1W36B 3KQNA 3PV0A 1NVVR 4Q5IA 4YMTA 3R9WA 1AKEA 3EA5A 2CJWB 3C4JA 1ZAKA 1R4AA 1MT0A 1RRFA 2R65A 4NYJQ 5DIFA 4Z8YA 2H92A 3SC3A 1IY2A 1LTQA 3IIKA 3KFXA 2Q21A 1N6PA 4NL4H 1ZM9A 4XD7A 1Z8FA 3G82C 3GLIE 3Q3JB 4M1YA 2VL7A 4OKSA 3SI7A 3TRFA 1RPZA 1E2FA 5BN3A 4TMKA 2F1RA 1X8LA 1OKKA 1RE0A 4Q21A 2P2LA 2QNRA 2CNWD 2V55B 3HU2A 3RS7A 4B44A 4UNSA 3QKUA 5FI1B 2QEQA 3CRRA 2UZIR 4V0KA 2UVQA 1IQPA 3ASYA 3ZH9B 3W8NA 1G8HA 4CDGA 1E2DA 3SYLA 4Q9KA 3W5IA 3WYAA 2W6JA 1B23P 2OILA 3QG5A 1TAGA 3CZQA 3RC8A 2YINC 3MMPA 3AVUA 2JLQA 2RKOA 4PHTA 2W2TA 3HR8A 1FPMA 2EVWX 3T34A 3KJHA 2Z0MA 2G83A 4ASUD 3N5CA 2XEXA 1OXUA 1KKMA 1NN1A 521PA 2ZJ5A 3CX7A 3LD9A 3KKNA 4WIAA 2PH1A 3GP8A 1II9A 3IIJA 1MRNA 2ZVQX 3B1WA 4BQSA 3T12A 4A0HA 1J2JA 3K0SA 3DM5A 2PT5A 1QVAA 4BFYA 2J9RA 4IW3B 4EPYA 3AF2A 1ZP6A 4G5OA 4PPNA 4RD4A 4DB4A 1F2UB 2GHIA 1X8JA 4ARZA 1NMXA 2WSMA 4URYR 1JR3D 2A5JA 1KZ7B 5KO2A 1UDXA 4TTRA 3FE2A 2NIPA 5CIQA 2IYYA 1SVMA 1T91A 5BW8A 4US1R 1CKEA 1AS2A 2FA9A 3RRZA 4EQ6B 4PHFA 5FH9A 2QAGC 2WIAA 3RSOA 2O8FB 1CTQA 4PHHA 1E2EA 1XFAA 1TNDA 1TX4B 1XD8A 3EC1A 4LI0A 1W5TA 1O3YA 1MRSA 2A7QA 2ZYUX 1NBME 2KJQA 2BMFA 2VSOA 4MKIA 5LB2A 3B1VA 4TLCA 3B1ZA 4CVNA 3ETLA 4H9GA 3KJEA 3PEWA 1T5LA 4L16A 4Z54A 5EJEA 4URZR 4AI6A 4QBFA 4FMDB 5K8UA 4NCJA 1NIPA 3EPLA 2JLUA 1KO4A 2VP2A 1AJEA 3EASA 3SNHA 3UG7A 4U5XA 4Q4AB 2Q9CA 1Z0DA 5CLLA 3NKVA 4GP7A 1GL9B 3BJIC 3C16C 4FMDF 3VR3A 4TMVA 5DLQC 3CM0A 3KUCA 1T5IA 2FPLA 3GJ6A 5L3QB 1XMJA 4LY6A 5AUNB 2IS4A 1XJQA 2OZEA 4TWZA 2GBLA 3C7KA 3EZ2A 3I32A 3IKJA 4JSYA 3R20A 1E0SA 3LV8A 4Q19A 4XIGS 2ZYWX 2C8VA 5KU1A 2NO7A 2GXSA 4WA7A 5L8VA 3EWSA 2DWPA 4II7A 3R8CA 1XEXA 4K46A 4D4JA 2XITA 4LZZA 2XZOA 2GAOA 3AH8A 5CYOA 1QBKC 2QZ4A 1VMAA 2MSCB 3FWYA 1BOFA 5BN5A 5JWOA 3VNVA 1OSNA 3AP1A 1OW3B 3SZRA 3MUFA 2GXQA 2ORVA 4R2HA 5KNDA 1A4RA 2I1QA 3AKEA 4M1TA 5DO9A 2ZIAA 3L8ZA 4RD3A 3KTAA 1NJGA 4OHXA 4PQFA 3RRYA 2OBLA 4FI3C 2YZ2A 5AJWA 3HR7A 4PAQA 3EC2A 2IUSA 3R9XA 1E98A 1JXOA 3KKPA 4ZIRB 2WIBA 4PSKA 4GOKA 4F38A 5JEDA 2ZRMA 2IC5A 4KFRA 4ACBA 3AUYA 3BFVA 3T61A 3WBJA 2JEOA 1IXRC 1E2QA 1J70A 3SBEA 3CUEF 1OF1A 5KNBA 1B0UA 3CKLA 4A9AA 1W0JD 4MDFA 1UEJA 4QNRA 1KK2A 1SZPA 1U8YA 2QTVB 1M6NA 4HLCA 4TLEA 5FL7D 1R0YA 4A1FA 4RCYA 1D2MA 2JAQA 4BFZA 4DWJA 2FF7A 1XCMA 2AHOA 3L0PA 5KNCA 1EFRA 2O8EA 2BM0A 1HY3A 4B48A 1IY0A 1X6VA 1DAEA 1ANKA 2FN4A 4MGYR 4MITA 1IY1A 3I3SR 4GP6A 3TH5A 3TE6A 2D06A 3IEUA 1NKTA 4QC2A 3H4MA 2NPFA 4BLOA 1QHIA 4DCNA 3UXMA 1OE0A 3QPVA 1LS1A 2XTMA 3KB1A 3LQQA 5DYGA 1IXSB 1JPJA 2VSXA 3A1TA 1TUEA 4ITRC 4LUCA 4A2WA 1KI6A 2O8BB 4D6PA 3SJZA 4QL3A 1EWQA 2DWOA 4TYYA 2OFXA 5HKKD 1DO0A 1GP2A 3DOEA 3LVQE 4AWXA 1KMHB 3PEUA 1NMZA 3MJHA 4HLDA 3BBPA 4ESHA 1KGDA 1E9SA 1NN5A 2A5GA 2YOHA 2C9YA 2OT3B 2P6UA 3SFVA 3WYFA 5JHHB 1HT2E 3R7WA 3WBKA 4YXWA 4OHZA 2QL6A 1RYHA 3KXIA 2IXFA 2PT7A 2RGCA 3VTKA 1P5ZB 1BMFD 5LBIA 2BDTA 2ZRGA 2Y8EA 2REBA 2WPDA 3OEHA 2UZ3A 4TTQA 1BYIA 2CMKA 4GL2A 2QSYA 4EPRA 4BLPA 1K5GA 5E7IA 1E1RA 2EYQA 3GMTA 2YWFA 2OCYC 1T4GA 2ZRHA 4TL9A 1X1SA 4KU4A 3K70B 5FBWB 2QRZA 1W36D 1F60A 2PX0A 5HTKA 3CF2A 1W44A 4LC0A
chains in the Genus database with same CATH superfamily
2PWAA 4NOJA 1EP9A 2QG6A 5TE9A 4EABA 1GFZA 4AY3A 4B7AA 4BO5A 3AVXA 2D0IA 1RXIA 1KZ6A 2ZRAA 1G42A 2FHSA 2G4CA 3BGVA 3EY9A 1UWLA 3UZUA 2XTNA 3NAGA 4D41A 1DTWA 5JAHA 5K05A 2I7CA 4I9UA 3WGVA 5CITA 1DS6A 1QGAA 1A0OA 3A9WA 1AHIA 4LYJA 2B1RA 4DILA 1M6WA 1RKXA 1SCUB 1X8XA 4ND8B 4F9FA 1FIUA 3K53A 1QIDA 2ZI7A 1ZS9A 3EISA 1UIMA 3K16A 5IF9A 3KT0A 4UZFA 2DFLA 3PGKA 5ETJA 1ZVMA 5KDOA 4IF4A 1E94E 3GA7A 4RIFA 4G5RA 3SXUB 2F8LA 4GXRA 2IPAB 2Q2OA 3T9CA 1GZHB 3ZU5A 4AIRA 2RJNA 4I1SA 2Q3BA 1KK1A 2ZK7A 2NYVA 4AYTA 4F2HA 3NYIA 3LKVA 3FTFA 2HB6A 2BKLA 2R62A 2XMPA 2JLAA 4DR7B 4B82A 2FPRA 5K45A 3VR5A 2VATA 3ROFA 2HNBA 1EEHA 4JB2A 2I6FA 3G88A 1DNPA 4IOKA 3VSBA 4HI0E 1JHXA 5DN9A 1V4BA 4Q34A 3KAJA 4C01A 2J32A 3I6IA 3PUYA 2WSYB 4AP9A 1MQ8B 2HQRA 2XDQB 4UTRA 4PSAA 4RJLA 4WVLA 1PQYA 4NZOA 1E77A 4NNOA 3C7TA 2HV9A 4EEKA 1QR6A 5BSRA 3ZZNA 1R37A 4N0EA 2GCOA 3D0RA 3WMRA 2VOJA 3K9HA 1GG5A 1RBZA 5ALKA 1ZGCA 4GPEA 1DKRA 2OO5A 4GO1A 2TRSB 4GRAA 1OGIA 3JX9A 4JL8A 1YCDA 5CA1B 2KX7A 3EQ2A 1EJ6A 2EGHA 2LBPA 1NNEA 2YYSA 3GZNA 3K35A 4XYGA 4D8VA 4QBTA 1YL5A 1T8PA 4I2NA 3UWPA 1DUIA 5JCJD 3JYNA 3Q2KA 1NDHA 3MF4A 3MAAC 3DEYX 4C76A 3ADBA 3RUEA 1D7AA 3V4ZA 4IDFA 2EZTA 3UJHA 1HI9A 1VTKA 1XRNA 3GJ4A 4WCFC 3RNLA 4F86A 1F5SA 2HLDD 2C78A 4MI6A 5LD2C 4QT4A 2J6HA 4UHKA 1U81A 4F4UA 1MABB 1QG2A 1MA3A 1WCWA 3AR4A 4M54A 4N8EA 1Q20A 3ZY5A 5K3CA 2HLNA 3VPGA 4KVFA 1NJ6A 1N57A 2ECQA 4DLPA 1OREA 5DHSA 5JSZA 2R47A 2QN7A 1C3JA 1W5BA 3D7KA 4FD3A 3OCCA 4FFMA 2HUNA 3GLTA 4I1UA 5HMMA 1GPDG 4FE4A 1J33A 1YJXA 4K6GA 3OIDA 1ZH2A 4LFCB 5GPBA 2EJWA 4OHPA 1S2MA 1L9KA 4BRWA 3ZWAA 4EJ0A 1Q11A 4JBWA 5TEVA 1GEEA 4A73A 1VGQA 1L4KA 2A5FA 3EH1A 4ZZ3A 1KEKA 1ZEMA 4G56A 4FFVA 4OATA 4PFJA 4WKGA 3VR6A 4F93B 4OUKX 1DEAA 4P6VF 4EO4A 1H1LA 1W4LA 3IPCA 4DTCA 1A04A 4YS6A 2WYIA 1NI3A 2OMEA 4I9NA 1I2ZA 3AZOA 4HAXA 1S89A 2EHDA 3R0IA 4TUYF 2C4UA 4S2EA 1RZVA 2VZ0A 4IJWA 1J99A 3VNSA 4FE3A 5JC8A 2ZUWA 3LVFO 1U8ZA 4Q6WA 4WLVA 4O4IA 1GL3A 4BNYA 1ZYUA 3SHOA 3E61A 4Q1DA 4X8HA 4YYZA 1CUCA 2FSVA 3K71B 3B13B 1KHHA 3FUVA 5T7BA 4AY2A 1S3GA 3AF0A 3KR2A 3QX8A 4S0XA 4UE6A 3RHFA 3P52A 1EP1B 2ZUCA 1L5YA 3GT4A 3I6YA 4MGEA 4R98A 5DX0A 5JMTA 2J41A 1W581 3AFGA 4J8PA 2FEMA 5EJGA 3AXTA 3DL2A 5AJXA 1K7CA 3TGPA 2VN8A 5H9WA 3TTYA 2AD1A 2ZAGA 3QXHA 4RTQA 4E5YA 4GPTA 4WLFA 5IABA 3FVWA 4RSHA 4EG7A 5JE8A 1W73A 2IHTA 3LRTA 2RHMA 2QAIA 3M2PA 3AR6A 1FFEA 4KR0A 2BE9A 3ZVNA 4JXJA 1JQJC 4UDOA 1I6MA 2W58A 1TMYA 1WU8A 1SOWA 2P8JA 4LZOA 3SE7A 3TDKA 4YV0A 3C5CA 2CNWA 4ZVSA 5GZ3A 1I7PA 1KF0A 4OHRA 4W5HA 4QYSA 2GXAA 2PZKA 1OX6A 3LPDA 3MBOA 2VHQA 3HHEA 3RC7A 1V16B 4IV8A 5JPDA 2JCSA 1GLGA 1Z5PA 2JBWA 3B51X 4DF3A 3NANA 5CK4A 1U2DC 2YVKA 2XMDA 4KIUA 4ZKEA 5BV0A 4QJ5A 2AYYA 1Z6AA 3OG9A 5A5EA 3BBLA 4LSZA 4HDAA 1IBMB 4JEHA 4UM5A 3DBLB 5FNVA 2A8YA 4JDPA 4PYKA 4KJXA 4XR4A 3A4TA 1NVMB 1DHRA 1S9DA 1YMVA 2D2XA 2ZI5A 3KJIA 1T3HA 3ZNNA 2ACKA 4OLFA 3O8QA 1AZTA 1U7ZA 2ZJFA 2FU5C 3PUWA 4Y2GA 2E37A 2O3RA 3SDBA 3RB8A 5K8CA 5LDDC 4KX5A 3ELUA 5HQTA 1R50A 2PPLA 1L4HA 2AK2A 4ABTA 4MW6A 4PV7A 1PI3A 4UZSA 1DTSA 1XKQA 5COAA 1N7GA 1LA2A 4IIVA 2IYUA 3OPMA 4NQRA 1YZUA 4TXHA 1XRSB 3OTWA 1QIJA 4MV5A 3RNOA 4NHEA 1II8A 4YI3A 2BEVB 4KUHA 3I9JA 3OT4A 4B34A 3B3AA 1UUFA 2OY0A 1EPUA 1Z47A 2BJWA 4OQXA 3CCCA 3DHVA 4MYDA 4KRYA 4L4YA 3R4VA 4X64B 1VPEA 3A0UA 3NHBA 3I0ZA 4DLWA 5HWSA 1QQ7A 4ZQFA 1BHJA 1YUMA 4ZWNA 1DIRA 1Q2XA 2G09A 4LRYA 1EM8B 2JIBA 2XD4A 1JI3A 1KZ1A 2WQZA 1G20A 3H1BA 4BO1A 1ZNYA 5E4FA 4C5AA 4RMNA 1TYCA 3BE5A 1EFKA 1IBLB 2AZDA 1TMOA 4WZBA 5DP1A 5BMVF 2AKYA 3DA8A 1GR1A 4B3HA 1YOVB 4BLVA 2GUWA 4OJNA 4JNKA 1DLJA 1PV2A 3JARA 1ZNXA 1Z15A 2BSAA 2QR2A 1FS6A 2OENG 1ZIYA 3QX9A 4LMRA 3EFHA 3G1TA 3DLPX 2WHPB 2HN9A 4XA8A 4GZMA 2P62A 1OGJA 1ZH0A 1R6XA 5AIBA 4B74A 1CQIA 2NX2A 1DQZA 1NSTA 2JFGA 5CPFA 3FKJA 3TIIA 1WOYA 2ENUA 1P6UA 3TXXA 3FSEA 5B36A 3A1UA 3AZQA 1G5PA 3Q7PA 4LHWA 3I0MA 3OJ0A 4M1EA 3U3RA 3GZJA 5KYWB 3G6WA 4V3CA 3RK4A 3FCCA 1OOEA 2VCHA 5DBGA 1JWAB 1QAMA 5E6UA 2P0AA 4KN9S 3CF6R 5JS8A 4AWBA 2YHAA 4E5PA 2HXGA 3MEQA 2QT0A 3QYJA 1UJ4A 5ICSA 1MH9A 3GUHA 1O54A 3PL1A 4HQKA 1OPXA 2C2HA 2WEKA 4BBZA 1RLUA 4OXQA 2DGDA 4AZVA 4Z4IA 1JU4A 1QH1A 1N2BA 3D4BA 3ITDA 4OV6B 4QPCA 9ATCA 3R7FA 2GZDA 3RSHA 3NU1A 3ICPA 4PLFA 2G40A 4QT0A 1VJ0A 1OLXB 2ZBVA 4IDNA 5CEFA 4QM7A 1CF4A 1RWPA 3DOIA 3ORHA 4IXNA 3ASVA 2AI3A 1MIOA 2Y68A 3KSMA 1C7JA 1A7UA 2WUEA 3U0BA 2F3UA 1OASA 3HVJA 4L9SA 4YR9A 1H69A 4P32A 2OK8A 5CX4A 2CLMB 1SXJB 1DAIA 2BWJA 5C4IA 3F5QA 2A9PA 2OEPA 3OLWA 3UXYA 3I52A 4YO7A 2P4UA 2Z1DA 4Z9BA 4EF6A 3VH4A 2Z2JA 5DN6D 4E6PA 1AUQA 1K08A 3BZBA 3VU1A 1VC2A 4C29A 2C95A 1P72A 1N3IA 4ON9A 2OB1A 2FW1A 2HMSA 3L92A 3PHJA 2AB0A 3DBHA 2FOIA 3FWNA 4ZC1A 3ONEA 4FLFA 1ZD3A 3PT9A 2OZLB 1XLWA 4YHHB 2VDVE 3PFBA 5EVCA 4HXYA 3S8EA 1KAHA 2J3IA 1PZNA 2XT6A 3OU6A 5F35A 4KV7A 3KALA 2LKCA 1HA3A 2FN3A 2JI9A 1XTTA 3AB3A 2QVCA 3ABSB 2YYAA 3WYNA 2Q9BA 2EARA 4EG0A 3LOPA 2JI8A 1ODJA 2ESRA 3KSAC 2VP6A 1N36B 2UZ1A 1RM0A 2G08A 1J0XO 1M6VB 2H65A 2FZEA 2XEDA 4DIOA 4PYOA 3FMGA 1MT3A 2A5DA 3OHPA 3EVCA 4IR7A 3E0QA 4KE8A 5ALFA 2QMEA 2ZI6A 2FMXA 1Z33A 1SUBA 4GOMD 2PG3A 4OXKA 1CQWA 2B0JA 2TYSB 4W5TA 1KAQA 1N7HA 4B32A 4B0OA 1DE0A 1IBRA 2GETA 1XTSA 2PO5A 1APBA 1R66A 4KE9A 3ZZ1A 3KFVA 4BCCA 1B26A 3NTLA 1FZQA 1KPHA 3MLAA 2GEKA 3NBAA 1U04A 3QE4A 1V1RB 5KJEA 5TMEA 2QM7A 3E0XA 3A3PA 3JYOA 3DPSA 3K15A 3RG2A 1CIVA 1TGVA 2FPWA 3NJ4A 3QF7A 2HYIC 5JCPA 3F6PA 4CLHA 1BXRA 1PR9A 4F2WA 3BDVA 4CMCA 5I7RA 4FWIB 4FYJA 2FP3A 2BE7A 1POXA 5CTJA 1ZRHA 3DE7X 3M6UA 3S2EA 3L1HA 1X3SA 2RDMA 2Z09A 4L4XA 5JRZA 1RJEA 4G84A 2FEXA 4ZO6A 2PCLA 2PL5A 3NDBB 1NVVQ 1GGMA 2C4VA 3JD3A 3PQDA 4NOLA 3MTDA 3RD5A 3SSOA 4J0KA 2X7XA 3QUAA 1NXOA 1A1SA 3GLIA 1ND6A 3E9RA 4TKVB 2GVNA 3LCRA 2O2DA 3P9NA 4X90A 3DE1X 4Y98A 2NACA 2P11A 3AXSA 1QUFA 4YP5A 5HF5A 3BK1A 3OLYA 3OO0A 5DI3B 5HGJA 5ABPA 2CBGA 2I9PA 3HCEA 3JALB 1GPNA 4RYLA 2FK8A 5ECGC 1GKUB 3Q8KA 4FI3F 4GBMA 3HDHA 4B2PA 3KYIB 3F73A 5I5GA 4LMPA 5LBUA 2GI4A 5L3VA 4JJAA 4QOFA 2P3QA 3WHLA 4BVHA 3D2AA 3ETJA 4N9QA 4GI1A 2D13A 2D59A 3MT9A 1ZY2A 3ICEA 1COWD 3AHHA 3UANA 4CG1A 3QZUA 2ET6A 4Q66C 3N0RA 4EF4A 3JU3A 4KE6A 4A0QA 1WPRA 5EP1A 3TCXB 1HG0A 3H1FA 1N0UA 4L6AA 4K5QA 1ICEA 5ITVA 4G1FA 4CWAA 3T9DA 5ICEA 2G9QA 1IIBA 1XUOA 2OFPA 2P5YA 3FSGD 3EULA 4IILA 4PIVA 4LGYA 5B1SA 1L9XA 3SBXA 1U8CB 4E51A 1L7EA 2W2PA 2ZVJA 4WKBA 2W2LD 4C9BA 1ORDA 4R41A 2Y05A 2QB5A 4LX0A 4NAVA 2HNAA 4G67A 4EB8A 2AOWA 4B3RB 2VTKA 4ZN6A 1LBIA 1GCAA 2C2ZA 3EXFB 4O2BB 4QUHA 4R81A 3U39A 2WWRA 1TMGE 1QKKA 1I30A 1Z4JA 2DT8A 3UK7A 4MAMA 1KEWA 3TTUA 4ZCTA 2IYSA 3N8GA 1Y42X 4GLBA 3T5GA 2G67A 5D3QA 3AVWA 5LP1A 3UWSA 3LPLA 3BULA 3R4CA 1OFUX 3ITEA 4ND2A 2Z6AA 2PJDA 1W4ZA 2JLWA 1WAMA 4TV9A 1J22A 1M2OB 4XJVA 3L8EA 4IJKA 1AO0A 4MRVA 5K8TA 3R3XA 1ZIXA 4GPBA 4IM7A 2BR3A 4Z9YA 4IHAA 3TE7A 2QN9A 4HY3A 3FNGA 4UBIA 4DUYB 2ROQA 3OECA 3V4VB 2G8LA 3C1TA 3HNRA 1Z8NA 2FX2A 4N0DA 2C57A 2RHBA 1HETA 1ZU5A 3MWKA 4MAFA 4OMCA 4J7CA 2CBZA 4UUQA 5D51S 1TLLA 5JJLA 13PKA 3NIWA 4RKFA 4C07A 2GPAA 3HP1A 2WUVA 2EC5A 4PBTA 3D3WA 3QUTA 1H5NA 4P81A 4C6SA 3Q8LA 1FW6A 3FHTA 4EY6A 3L1IA 3GGGA 5HOQA 2PLRA 1YJBA 5HEKA 1AM4D 1UL1X 1Z0AA 1WEHA 1ZNWA 2X9GA 4F4CA 1XVIA 3WKCA 4DJ5X 3BJRA 3GNTA 4KQWA 5HS4A 2QSUA 5FIUA 5KREA 1DAKA 1QTQA 3O90A 16PKA 2P5SA 1NMQA 2CXSA 2QGFA 2ZB4A 4EQ6A 3KU4A 5HQ3B 2VP9A 4WOJA 3ZE8A 3JQGA 3KR9A 4QHSA 2JI7A 1HYGA 1MJ5A 4H31A 2QJTA 4LXHA 2FLVA 1X86B 3CR8A 1NW4A 4CEIA 1CIPA 1KJYA 1J9GA 1ES9A 2XZTA 1WF3A 4Q7KA 1S3IA 3WRXC 1VL8A 3R9KA 1JG2A 5A4JA 3O9ZA 1JQBA 2WD7B 3NPMA 3H2GA 1UOPA 3EA0A 2WD8A 5KYXA 2PKQO 2WVHA 4OO3A 1NQVA 2X1LA 3IP6A 5CXSA 4KZPA 2BF7A 3BCRA 1XDBA 1X9GA 4BMOB 4M8IA 2PK3A 4IHJF 2KLHA 2VK8A 3UCFA 1RYBA 1BXZA 4R8KA 3AI3A 4FZJA 4H4EA 4DC1A 2W8ZA 4OHCA 3AY6A 3FNHA 4HDQB 3UK6A 1LWNA 1JHQA 4U9UA 4MUBA 2NXNA 1H2YA 1SBIA 2Z4SA 3VJLA 3USZA 1XZIA 3DS8A 4C4YA 5IRCD 1NM5C 3HJRA 3RVLA 1JS1X 3T7KA 5GVSA 3GDGA 5SZKB 5LU9A 4ZYUA 4H3VA 1KGSA 1HDZA 4B2IA 2GPSA 3DD1A 2LUOA 1JDJA 4ZREA 1F1JA 3S28A 4PGFA 1LC3A 1MF7A 1SA0B 4YJ2F 5L4SA 3JQAA 3UQZA 4P53A 2BN4A 2QRMA 3C41J 5IEBA 3RBAA 1QIHA 3KOMA 2ZP1A 4Y1GA 1CF9A 2V1XA 5JQGF 4QUBA 2YHIB 1ACJA 5EIXA 2EW1A 2VH5R 2AG1A 5B58T 3UAXA 4NYIR 1BS9A 3GUYA 4RVFA 4EPXA 1AUPA 3IO3A 2E7ZA 4HRAA 2ZVPX 1T0PA 1XVLA 3A9UA 1QKJA 4WUVA 3RHSA 3U3ZA 3SIWA 1MU0A 4RGBA 4K1XA 5HBGA 3CB4A 3NHFA 4I1RA 1WPXA 1O5TA 3IQHX 1FFBA 4FP9A 1TU4A 4PZ9A 1CUHA 4L2IB 4QGHA 3FMFA 4WY5A 3K9FC 2A0WA 3H5VA 3GVCA 3SBOA 3FUTA 3IR5A 5DXJA 3ZN2A 4A15A 3B9PA 2CYAA 3MZ0A 1L5VA 5HIMA 5LQDA 4DR3B 3UFXA 2D0DA 1W87A 2RH8A 3HYLA 5FF9A 1HT1E 3A9RA 4CQMB 5IJZA 3R9XB 1MAWA 4TS1A 2XB4A 5CXXA 4GKVA 2UYQA 2QTVA 4OHUA 3ZWWA 3DSRA 2J48A 1Q15A 3E70C 2G07A 3KWFA 4AT1A 2IS6A 1IN5A 1BFKA 1DELA 2WUWE 3A1SA 4IEFB 1GQQA 3W2IA 1YR1A 4HX5A 4FDTA 1NF2A 3GLKA 3MYRA 5EGNA 1L6RA 3FRHA 2RAFA 4QDOA 4MP6A 2VRWA 2OYRA 3VI3B 2OAP1 1R0BA 3O94A 1PT8A 2CHVA 4P34A 4BYGA 2YYYA 3NRBA 3G9UA 3BWEA 5J2UB 3WRWA 1W36C 4LJ5A 4OXYA 3RVOA 3E53A 1YOBA 3BWXA 4L4RA 4PO8A 2YXNA 4X8OA 5JTTA 2FW8A 4DB2A 1T25A 1O6FA 3A3KA 4JLWA 2UUOA 4OHWA 3T7RA 2O8EB 3KOZA 2IPOA 1GO2A 1SVKA 3VNBA 2PZFA 4ZI2A 2PXCA 2QOEA 4HYYA 4RLQA 1BEUB 2GPTA 5BP7A 3U60B 1DOZA 3AEUB 2ETVA 1QK5A 4KLAA 1AS0A 1WB9A 1O95D 1XJ5A 2ZRFA 4Z4FA 1NNSA 1ZN2A 2VXCA 2PMFA 2Q4OA 4ISCA 1CRPA 4Z4EA 4TVOA 1LFDB 2DU8A 2Y6VA 4C05A 3GLRA 1QCDA 3QWIA 5IDWA 1VJCA 4AF8A 3T5TA 4J29A 2RJOA 3PNYA 4Y6QA 2JI6A 1SM4A 5UKDA 2NTJA 1JKFA 2DP4E 4C14A 1HL3A 1Q19A 1PNRA 1XLUA 2V7UA 4QJBA 3KDSE 1TKRA 1A9QA 3GRKA 4FXOA 5E6SB 3UMFA 3EZLA 1SULA 2OV1A 1PZXA 2X5KO 2ZQYA 1E3WB 3ONDA 5FEMA 5KQPA 4AF7A 3UJ7A 3BMOA 4YRKA 3LUHA 1GPLA 1OIXA 3TTWA 5CJJA 2ZJ2A 4MGZR 3TYXA 5ALIA 2R85A 1V45E 1IQUA 1WDLA 2AX3A 1G98A 1RYNA 5A9SB 3P2KA 4GKAA 5E6RB 2PSHA 2YY5A 1SXIA 1HT3A 4W9NC 4KQIA 2Q1WA 4YAJA 5C8YB 1RJWA 1WBDA 3WLKX 3OEED 4OVKA 3Q7EA 1U0TA 1WCIA 1XQXA 2O1WA 3OOYA 3DOUA 3OJXA 4DNPA 3SMQA 1XN4A 2VP0A 5DM2A 2QD4A 4FKMA 3GFBA 4INOA 3GFQA 1KQNA 1SHJA 1UKYA 1G8KA 2I4LA 5HIKA 1OT3A 1QFZA 1RAHA 3INNA 2C2KA 3GCDA 3JATB 3A6HA 4X93A 4ZQEA 3HO6A 5BSVA 4LRSB 3RVDA 4PX3A 1FUIA 4BDSA 5DM0A 2ODWA 4BX3A 3H9UA 1E9BA 3QV1A 4JEUA 4TLLB 4OEHA 4FHEA 2BV3A 2IYEA 1T9BA 3OFND 1DTWB 3UK2A 2ICAA 4MGKR 1DPFA 2GX6A 4PYMA 3B1FA 4KPUA 4BNKA 4LQLA 4AKHA 4FFDA 1K8RA 1UBJS 1DDOA 2N42A 5H4HA 3HNPA 3QKSA 1QB8A 5L6MB 3LHIA 3R6GA 1Z75A 3OX3A 2ZSAA 4URUR 3T1YB 5TR9A 3AMVA 3Q40A 1DO8A 2A35A 1F9AA 2JH8A 1PJRA 5DN6A 4YONB 1R15A 3IVXA 1UXJA 4EG5A 3RYCB 3FHOA 4MQFA 5GVRA 1S8FA 1MW9X 2QUKA 2ZJ7A 3OPXA 4G4SO 3DZBA 4OQDA 4E03A 4CG0A 1JLLA 4MZDA 4KHPB 7MHTA 1IUKA 1BW9A 4KO1S 1N2EA 2C5EA 3LLMA 4XSHA 2WU0A 1Y3HA 4HMPA 4J0IA 4BZWA 1UADA 1PR1A 5IVDA 1AOXA 1G21A 2HF7A 3ED5A 3I42A 5IUKC 1R8XA 1NQXA 2IXEA 5EZQA 3NGLA 3IP3A 3HHPA 1SD5A 1ZSNA 2IYTA 2P35A 1OH7A 1GUZA 1W93A 3GPBA 3IDSA 4LE2A 1FU7A 2AHRA 3I01A 4LVUA 5IBCA 2H1OA 2BM8A 3W04A 2Q3FA 4FYXA 3QVGA 3K30A 5I9TA 3U7RA 1J8MF 2FGKA 1DG1G 1MB3A 1R10A 2NO0A 1B0PA 1M76A 3I1FA 5DGDA 3T1NA 1KFCB 1SKBA 2AFHA 3QLTA 3K92A 4M9QA 1F3OA 4RE6A 3PUXA 3GZNB 2AL7A 4F71A 2I22A 4K2AA 1YR8A 3SEAA 3DFFA 3SZMA 1GCIA 1PX2A 5K5EA 1Y6QA 2IEYA 3H11B 4BVLA 1M3SA 3E82A 2V7QA 4PVCA 3AHGA 5EKTA 2PBLA 1KDVA 5C37A 1G17A 3IBYA 1EVKA 3PWKA 4N40A 4HDNB 4PBSA 1WXQA 3K09C 5FA5A 5G02A 2BMEA 3KDPA 4HLNA 1Q6YA 3CBQA 4XIIA 3DMYA 3FRJA 1JMKC 3KIPA 5KOJA 5GM2A 3OC6A 3OZ7A 2RGGA 4GXNA 2XUGA 4JENA 1B4DA 1GGVA 4JXKA 2IU3A 2PD4A 4CLOA 2XGMA 4OI0A 1SOAA 2VHXA 3WMXA 2R8PA 2G9NA 5JSZB 3N8NA 1AKRA 5B1DA 5IC6A 3ULKA 2GXUA 1X77A 4GYKA 1PJ2A 2RKBA 2WB4A 3EBPA 4W7SA 3TRKA 4B6JA 4WBNA 4Y2JA 4G8DA 1H2RS 3LX8A 1C1XB 4MWDA 3TBHA 5JLJA 2A9VA 3I28A 3QBJA 4OGKA 1V4NA 1AMOA 4X91A 5F2OA 5MFPA 3VOAA 3NOXA 2OGTA 3C7CB 3VYVA 4D92A 3HYTA 4TM7A 2XCUA 5EKDA 4DC0A 2FY8A 1ZWLA 1MTZA 1MZPA 5EE5B 1G59A 2ATEA 1EGMB 2PUHA 1H1LB 2RHOA 3ZY3A 1NYLA 1T8WA 4EITA 3WAJA 4G1MB 5IJ0B 2JLVA 2CSXA 1TZJA 5AM2A 2QBYA 2CHQA 1S2DA 2Q6KA 2QY9A 4Q1VA 1COWA 1Q3KA 2YX1A 4QUGA 1DC4A 4X7RA 4RADA 3GJSA 1EGVB 3LQ4A 5CT6A 4EHDA 3D1JA 2PMEA 2EERA 4DT1A 4O4IB 3KAPA 4MUYA 1G5FA 3QLVC 4ILKA 1TM3E 3DTVA 1OV6A 4PS0A 2Z5VA 4PYQA 2LVBA 1FCJA 2VAPA 3DLTA 3LF1A 2JFYA 3WIUA 4KIGA 4CM4A 4GDFA 4MX8A 5AUPB 1DOAA 1XX6A 5CHEA 1T3SA 2B7BA 1VLZA 2CL7X 3BG5A 2W2LA 3M81A 5KNDD 3H2SA 1JAYA 4DN6A 3ORFA 4QPPA 4ZYYA 2FWIA 2HRQA 4CJXA 3KKQA 2BHTA 3GH3A 3ZKWB 2V0NA 3SICE 1YJAA 1WCXA 3PQ8A 4KIFA 1KDZA 3WNDA 4DABA 1T35A 4D8YA 2NZVG 1IEWA 1M1ZA 2PX4A 3CNBA 4J4HA 4AURA 3KZNA 4KMMA 5L7TA 3H05A 4FDMA 3CRVA 1YCGA 2UKDA 5E8RA 1YL6A 2L0XA 2HFJA 2VZEA 3CUKA 4MMZB 1KXJA 4QDUA 4U7HA 3CLTC 3LGAA 4PG7A 1QC5A 5KOYA 1R8QA 3H6KA 3M34A 1XTJA 3WDKA 1ORHA 2BONA 1YE3A 3CGWA 2Q62A 1XA3A 3U0VA 4ECAA 5IT9A 3F5DA 2Q3LA 2VAXA 1GPWB 2GRAA 4KXYA 2IF0A 5DNCA 2QTCA 5CVCA 1QANA 4AUNA 5IM4F 5LL6P 1HDCA 5DBEX 1DXHA 3CLUD 5ARCA 5FNVB 2J0EA 1YNSA 1CUUA 3AOEA 3ZE7A 2R0QC 2Q7OE 3GA5A 3IERA 3OIFA 4HDCA 4DQ0A 2FRDC 4BO7A 1BVYF 3O8QB 2G17A 2GZSA 4RQTA 4GH5A 1XV5A 3WG9A 1PWZA 3RVBA 2EZUA 1ONNA 2PUTA 2HYDA 5EJ2A 1N9GA 2AXPA 1JW9B 3ZHXA 3ADKA 5LUAA 2QVYX 4HH1A 1TTTA 4OOEA 3JWEA 3DW3X 3EGDA 4QQNA 4DIEA 1Z5VA 1QAOA 3VAAA 3Q1KA 1K3UB 3L6RA 3WFIA 2WJGA 1XCOA 1XQ1A 1KQPA 3BKWA 3SOPA 5A5VA 5HJ7A 1FP7A 3ZV6A 3L7OA 4M83A 3T5CA 4FIZA 1WL8A 1Q2UA 4M1OA 2X6TA 1SO8A 3A2LA 4EL5A 1C0EA 4AG5A 2CHEA 1XZBA 4G86A 2VUTA 5L51A 3EPHA 3BPSA 3EDMA 4TV8F 2OHFA 2ZQZA 3IDZA 1UBUS 1U8TA 2G6BA 2WIFA 4REMA 4S1OA 3TLKA 4DCCA 2A0XA 3MGCA 3DYIA 4UUAA 3HKBA 1JVSA 2DQKA 2ZS8A 3PI7A 4HX2A 4MQ4A 4YAOA 4DDKA 1Y7LA 3ISVA 1EFUA 3H5TA 1UK7A 3MUNA 1VYVA 4KFUA 4W5OA 1V7ZA 2NSHA 3I4FA 1Q92A 1T9GS 3QPCA 5FO0A 4B09A 2V7GA 1E2PA 4LJRA 3VX3A 3LUJA 1J6UA 1Y7HA 4WZBB 4MIYA 4XX0A 3JWGA 1NF3A 3KSRA 4BZQA 2HRRA 1OR8A 3WKDA 4EY4A 1PZGA 9LDTA 2D7DA 3SC4A 3V34A 4M1ZA 4YDRA 5C5IA 1Q17A 1WW3A 1UP6A 4QUEA 4XYEA 5DX1A 4BWVA 1SWWA 3ZGNA 5K8LA 1UXKA 3VPFA 1L7VC 1BGWA 1TZMA 3OQJA 3Q9SA 1VL1A 4HLUC 4GGPA 2TS1A 3A6LA 1E1RD 2I3ZA 2W6PA 3L4EA 4HD8A 1MTOA 4TROA 3RRNA 1CQIB 2KYRA 3HDVA 4XYMA 2Y1FA 1I1HA 4CF7A 1TLTA 4DV0B 1JHUA 2VZ9A 4BP1A 2OPBA 3VHXB 4O3MA 1C14A 3PQCA 1D6SA 2CNDA 2J3HA 4FGWA 1THMA 4CHTA 4B3JA 1CUWA 5ITWA 1WD7A 1XD2A 1U2EA 2DUJA 1PT5A 5F78A 4BX2A 5KVCA 5E6UB 1PKEA 2BUAA 4JB8A 5J4KA 1MEOA 3X1JA 2HPVA 5HILA 1VHWA 2GD6A 2H48A 2Q5LA 2EYUA 5LYJB 2R96A 3GJ7A 3N07A 3HE3A 4V02A 3WJ2A 3R41A 3CN7A 1FTQA 3M6AA 3UWDA 1ISHA 2J5RA 3AJ8A 4A8JA 3KEMA 1QH1B 3P0RA 4DMUB 1JEYA 2YOGA 3CKKA 2F1KA 4GQIA 4CKYA 4ZEMA 3WTBA 1K27A 2I3AA 1EK2A 2G1AA 1P7CA 3LT2A 1ZO8A 3N7AA 1JE0A 4RV4A 2XZLA 1D4FA 1YI0A 5F52A 2B4TO 3PG5A 3TMYA 2D2FA 2HQBA 2KWIA 4OG2A 1QWOA 1UAGA 3DE0X 1FFXB 1F06A 1QXSA 3PNLA 4UD6A 5TQ0A 1MR3F 4U3JA 2CJXA 2PRYA 3SLKA 4E70A 1B16A 1Y81A 4JUAA 5CD1A 3AF1A 3KKZA 3NC0C 4ZVMA 3W8FA 4MWCA 3ZWXA 4B3MB 4ES6A 4PX9A 3BAFA 1W0JA 1GN8A 1YK1A 2C9OA 5LUBA 3QE2A 4WK4B 2IOFA 4PWYA 5BQ3A 5BR8B 5BWOA 1XVUA 4OA5A 1IDN1 4QHTA 2E4XA 4EGQA 3OEWA 3TS1A 5HUHA 4IUBS 2GB4A 1JQDA 5D8DA 3O2JA 1A8PA 5JBQA 3IPRA 3EFOB 5FBVB 5KVSA 1D1QA 3ELBA 2QTZA 2X77A 2GBFA 2BDEA 1ZRSA 4DLNA 1YB7A 4DEXA 4XGNA 3BB4A 3HGMA 1X8KA 3BK2A 4ETWA 5LNK6 4HB2A 3ZZUA 1GNQA 3E35A 3CUTA 1YSCA 3Q9NA 2GD2A 3U80A 4DG5A 4ARSA 3OLQA 5K0GA 4DADA 3CH7A 5SZHB 1VXRA 4G4JA 1C80A 2UZ1B 1SQ6A 3C3PA 3LI2A 3LRPA 3ZQKA 1JFFA 2JLBA 3D6VA 3HVUA 1HL7A 3DMRA 3N2NA 4QDJA 2MCFA 2AKEA 3NVMB 1GSOA 1CJCA 1KI8A 4DCSA 5FOUA 3MD9A 4YCMA 3UICA 2REQA 4QEKA 1J5XA 5NLLA 3N70A 3A1NA 2PKRA 1OIVA 1ADYA 1HRKA 1NYTA 2VRCD 1JKXA 1U7XA 4G6ZA 3KSUA 3WK9A 5JEEA 1XXLA 2OCDA 2Y0PA 3IMGA 2O3SA 2A94A 2HQ1A 1XVVA 3DEIA 2QQEA 3RRBA 3U7IA 4W6ZA 4B6SA 3OT5A 3IEPA 3RF6A 3W5JA 2JANA 3CPJB 3AIKA 1VXOA 721PA 3INGA 3PFCA 1OFGA 2QJWA 1MC8A 1RHUA 4G0ZA 1XAGA 5CFZA 4BVFA 3OM0A 1BCSA 1TUGA 4F06A 1UIRA 1YWGO 5THXA 1V9CA 4B2LA 3AI2A 3GDOA 1LFAA 2FWBA 3EJWA 4DXDA 5DM60 2ZJYA 5JJ5A 2ZM5A 2H2DA 4MI1A 3EVTA 4WECA 1AGNA 1LXCA 4RBNA 5LP6C 3T7SA 4OKIA 5KYNA 2YNMC 2Y3IA 2XOEA 2ADMA 1KBZA 1MVLA 1VIDA 3EXHC 3L6CA 4IDHA 1M8FA 4KQMA 2QPAA 4WXEA 4H7EA 4NP6A 2AN4A 1QMPA 4JJIA 3UT0A 1U8XX 3GLIB 1KVQA 1TAUA 2SECE 5CCEA 3GEBA 2VPYA 3LFUA 1DINA 1G7RA 3SF0A 3S2ZA 3LZ6A 1Y7IA 4H7IA 1I7LA 1JJAA 4HTFA 2OWDA 4PFQA 5E38A 4CQJA 4W63A 3QOFA 5ICGA 1OC4A 3R6DA 5TB5A 2EEPA 5BR1A 2XXAB 4EFLA 1O6BA 1P7PA 4RVOA 4TN5A 1P17A 1KMNA 4G23A 4CZ2A 1JL3A 1UQRA 1KKUA 3OEEA 1ZGJA 1IK6A 1NQ5A 1ZOOA 4YRBA 1E2IA 2IYVA 1YBFA 2V54A 3PS9A 2Q0HA 1UM9A 1OT5A 2G5PA 1WD5A 3HCBA 1PWYE 3MERA 3EMDA 3OI7A 4YWHA 2IXAA 5K4AA 2VDWA 1U7PA 4AX8A 1WVIA 2VAVA 1IUOA 2GJSA 2B4AA 3B6MA 3S70A 5JALA 3KCNA 5BMVB 1YB4A 3D3EA 3JW8A 2Z2XA 1QYXA 2GLUA 2YFKA 3D8HA 4DYVA 4MEAA 1DMSA 2UVDA 3CZCA 4E09A 4QYWA 1QFYA 1BO6A 1VLJA 2EG9A 2VAMA 4YP1A 2XKKA 1G7TA 3NDPA 3PSHA 4G0PA 2YXLA 3IEVA 2Y1XA 3OFNA 4O4HF 5MN5A 2FOXA 4LY0A 5BN3B 2J6BA 2M32A 1A2KC 2BEKA 2CWDA 2HJSA 2YY7A 2Z4TA 4FC7A 3U7GA 2Q3MA 4FQ8A 3WR5A 4US0R 2C5LA 4Q7EA 1NX9A 3GD7A 2RK3A 3UWKA 2Q2WA 2JRCA 3TO5A 5FUQA 2C2GA 2I33A 1Y1PA 2HWWA 1P0PA 2HK7A 2OYSA 2Z2KA 2V97A 4H7PA 2YWJA 4A0GA 4ZD6A 4EGSA 1UAAA 4A6XA 2BEUA 2QX7A 5BOVA 5E3HA 2YHSA 1GRNA 2LIVA 2WIDA 4E0BA 4JVMA 4N3NA 4WFIA 4AULA 3DAOA 2OORA 1WP4A 3HWSA 5JRDS 4M0DA 4DANA 4TV9B 1IOZA 2E4WA 2KE5A 4ZP1A 2Q50A 3ZTTA 1CQJA 1PYOA 3LP5A 3AJEA 1NW5A 1IEVA 4IKEA 2JLCA 1HE4A 1YRHA 1EE2A 3EC7A 4F6CA 4DZRA 3EW9A 4Q3DA 4DLSA 4WNCA 3HR4A 3VNRA 4F3CA 4DR5B 1MG0A 2NO1A 1QM5A 1WTCA 3HBNA 1WHSA 2BHLA 3QXCA 2IZ5A 4JR0A 3G2KA 5BORA 3UB2A 2NTNA 1EA7A 3PQ2A 4TS3A 3ZIDA 2C2MA 3ZI0A 2AR7A 3VYSB 4D1YA 4JB0A 1U0HC 4AJ1A 3PNOA 1X15A 1KOJA 1V8BA 1Z4QA 2AFRA 2NGRA 2WVAA 3LHFA 3QOXA 1NXTA 4L50A 1BEZA 4HAWA 1UQUA 5CH3A 2ZCJA 1OFUA 1XIVA 1Y5RA 2ETXA 3I76A 1CULC 4HGOA 4IH4A 3OQIB 3D3WB 2R1VA 3TQOA 4PLGA 1DC6A 3EA4A 2RFLA 3HSSA 4P7FA 1YNOA 2HH9A 5HF8A 2NP6A 1L4GA 5AP9A 4U9IS 4B83A 3IHTA 4FBMA 2LPMA 4R84A 5ALGA 4IJMA 3KT3A 4R1OA 3QWHA 3C3MA 1Y9JA 3LBHA 4EW1A 4AKIA 2WU8A 1DFIA 2VO1A 1WSAA 4RHCA 4DV2B 4RJTA 5A6SA 4U2GA 2NZ8A