3A1NA

Crystal structure of l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
315
structure length
315
Chain Sequence
MILVTGSSGQIGTELVPYLAEKYGKKNVIASDIVQRDTGGIKFITLDVSNRDEIDRAVEKYSIDAIFHLAGILSAKGEKDPALAYKVNMNGTYNILEAAKQHRVEKVVIPSTIGVFGPETPKNKVPSITITRPRTMYGVTKIAAELLGQYYYEKFGLDVRSLRYPGIISYKAEPTAGTTDYAVEIFYYAVKREKYKCYLAPNRALPMMYMPDALKALVDLYEADRDKLVLRNGYNVTAYTFTPSELYSKIKERIPEFEIEYKEDFRDKIAATWPESLDSSEASNEWGFSIEYDLDRTIDDMIDHISEKLGIEGKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NDP-sugar epimerase
publication title Crystal Structure of Binary and Ternary Complexes of Archaeal UDP-galactose 4-Epimerase-like L-Threonine Dehydrogenase from Thermoplasma volcanium.
pubmed doi rcsb
source organism Thermoplasma volcanium
total genus 120
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2009-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3a1nA00
3IKVA 3C7CB 3SC4A 3JD4A 1EQUA 2GUGA 3UCFA 4HADA 4K9DA 4R3WA 1YONA 4WECA 4A73A 1JQBA 1MB4A 2OFPA 4BV8A 2DUUA 4R54A 3OEWA 4FGWA 3EVNA 3UF0A 4CMGA 1MP0A 4FD3A 4QQRA 4DIFA 1EBFA 1VE9A 1H93A 3SLKA 3ZNPA 1VL0A 1EUZA 1CQIA 1N92A 1VL6A 3PRJA 3ZWCA 3UW3A 1ZEJA 3PQFA 2CY0A 2P2SA 1U7HA 1FK8A 1YL5A 4DRYA 2PTGA 1LC3A 2QRJA 3NJ8A 5I9LA 2CSUA 1E5LA 5HBRA 1ZCJA 3T7EA 1YH3A 5T8KC 2JL1A 4J0EA 3PPIA 3B1JA 1X13A 1X14A 3GGOA 4XYEA 3KO8A 4XQ9A 4XYGA 3C24A 4UUMA 1TT7A 1EVZA 3S2EA 4BHTA 3QV1A 4HNHA 3GUCA 3CKYA 3KLMX 3ZV3A 3RAJA 5FI5A 1AXGA 3BTUA 1TVEA 1E3SA 1EVIA 1D3AA 4N5LA 3VVCA 4CL3A 1L7DA 1NVGA 4J7CA 3WJAA 4UVIA 3L9WA 2O4CA 2YFHA 1PJQA 3CTMA 4E3ZA 3F1KA 2ZTLA 4U6QA 1YQXA 4H3VA 4GWKA 4U8GA 3ZU5A 2AEJA 2E6UX 2FZEA 3QWIA 3JTMA 3EMKA 4DXHA 1KVUA 3K96A 4RF3A 1LJ8A 1R37A 5TF4A 1Y81A 4D41A 2X1HA 1WAMA 4YAKA 3FR8A 5KOIA 2UYYA 2BKAA 3FPLA 3OECA 4PRLA 4B79A 1W4ZA 1XU9A 2OOSA 5CDYA 1S7CA 1E6WA 1LX6A 3ULKA 4CODB 3QVWA 4EDFA 5G0TA 4AJIA 3UICA 4ROSA 3JV7A 1YDWA 1O8CA 1RKXA 3DHEA 4PLCA 4R9RA 3INTA 3GN2A 4E2YA 5ER9A 1R12A 4PLTA 1FDVA 2O23A 2YHIA 3G1UA 3U4HA 2O3SA 3BAZA 5EIOA 4FFNA 4BB5A 1R0KA 2X58A 3C3XA 3R0IA 3I9OA 1KC1A 2ILTA 5L7YA 5EJ2A 2Q1TA 1BXGA 3VTZA 3WQRA 4OOFA 4BO1A 1EFLA 3QA9A 1O89A 1NVTA 1I3NA 2ZYGA 1ZFNA 1ZJYA 4WASA 5G0VA 2WMDA 1DIAA 1UAYA 1LLUA 5TGDA 1UDAA 5DCUA 4CUJA 5EQDA 4JROA 4IQ0A 5EL0A 1PJ2A 5B37A 2P9GA 3QVTA 1XR3A 1B0AA 4R51A 1E3EA 5TQVA 5JE8A 3QIVA 5COQA 2VYVA 1I2BA 3ADPA 4MVJI 3W4KA 1BW9A 4IDFA 3LT1A 1GZ3A 4PLYA 1YQDA 1T2AA 1JU9A 2HK7A 2EKPA 1PJ4A 1ZUD1 3K8ZA 2W2KB 1ZK2A 2FPPA 3OJEA 3RBZA 3H9QA 3H5NA 3SBOA 4MJLA 4KOAA 3GVIA 3FHLA 2XXJA 3ANNA 3U49A 1HEUA 4FSHA 4KWIA 5T67A 4F45A 3NT4A 1WLYA 4M54A 1KVQA 1ZVMA 3K9QO 9LDBA 1ISHA 4DQVA 2WD8A 4WOJA 2HJSA 3MJTA 3VPGA 3V8BA 2Y99A 1Y9AA 3AU9A 3L6OO 3W8FA 3QE3A 2VZ9A 2C7GA 3WGTA 2G76A 2O3QA 3JYQA 4QXMA 4PGFA 3CEAA 1GCOA 1JTVA 3G17A 4K6FA 4YRBA 1PJSA 3M1LA 2I5PO 3GT0A 1GUFA 1IE3A 3CMMA 3RU9A 1YOVA 3D5QA 4II3A 1PZHA 3PJEA 2VRBA 3FN4A 4CMCA 1Z6ZA 4PIVA 3F9IA 2Y93A 3KRTA 5EQFA 1JWAB 1DSSG 4J2OA 4AJEA 4R1TA 1P1HA 3AFNA 5F1PA 4NIMA 3S55A 1W8DA 3MCVA 2BD0A 4IQGA 2PZKA 4E0BA 3GGPA 4Y9DA 2HMUA 2B83A 3VDRA 1HDOA 4XQEA 1CQJA 5KTKA 4RCVA 3E18A 4WUVA 3JQAA 2WYVA 2Y67A 3ADOA 1PGOA 4PZCA 2R00C 4CV2A 4HP8A 1C1DA 3AOGA 1GYQA 2X5JO 3ONFA 4RVUA 4GMGA 2YQ5A 3RCBA 2PY6A 1H0KA 3H65A 4PZDA 3F1LA 5TT1A 1ADFA 4MVJA 3ZWMA 3NDJA 2GPTA 4LVUA 3F5QA 3TPCA 2R2GA 1Z45A 2Q50A 2OGUA 3RBVA 4CMIA 1TI7A 4BNXA 4PLGA 4ZA2A 1V6AA 5ADHA 3TFQA 2WM3A 5T57A 3R1IA 1EVYA 3OA0A 4RPHA 3DZKA 1T2EA 5G2OA 1PZEA 4YPOA 4B7UA 4LISA 1VSUA 3I3OA 3WQSB 3E8XA 5A4DA 3AUUA 3NUGA 1HSZA 3M2PA 5JBIA 6LDHA 3VZRA 4Z9FA 1D7OA 3V2GA 4I9NA 2OBNA 2UUPA 3FTPA 3KV3O 4NU6A 1F8GA 3RROA 4ZRNA 1E7QA 1X1EA 4IXWA 5BR7A 1P3DA 2JAPA 3DL2A 4N7RA 3IUPA 5F1OA 1CRWG 4WNIA 4BOYA 1KS9A 5B4UA 3H3FA 2WDZA 4R1NA 4EUFA 2I3AA 3PGJA 4WGGA 5C7IO 5L45A 1J49A 4YJDA 4D3DA 3WMWA 1N8KA 4MO2A 1MC4A 1N2SA 4TROA 3ZV5A 2Q1UA 4N54A 3JYLA 4WEQA 5KVQA 4DMMA 1V0JA 1P1FA 1DHTA 5DT9A 1WZEA 1XLTA 4XIYA 2BH9A 4FC7A 3LC1O 2Y0EA 1T1RA 1PL8A 3L07A 4QUKA 4PRKA 1BDMA 4NK5A 1LSOA 2BF7A 1PJCA 1IPEA 1HRDA 2NQTA 2EP7A 3OICA 1MXHA 2BHLA 3MJVA 1OI7A 2EJWA 3IDSA 4BQPA 4IXTA 3MEQA 5JAIA 3LVFO 4OYRA 1MG5A 3SJUA 4XRRA 1N1EA 1UXHA 1DC3A 3UCXA 1QRRA 1R4MB 3D3WA 3PP8A 4ND2A 3TSCA 2IDZA 4CLRB 2FR1A 4UVEA 9LDTA 4GSKA 3IKTA 4PVCA 3GHHA 1E7MA 4AJPA 1C0PA 4MIOA 2VRCA 3X2EA 2UUOA 4IINA 3WICA 4YAJA 3DAFA 2NACA 1KIFA 4BKQA 3PHGA 1OOEA 1GV1A 1QLJA 4FDAA 3JQFA 1PIWA 4UEKA 4W6ZA 2PA3A 3HB5X 2PV7A 3GVHA 5DCYA 2NUAA 3SJ7A 1W6UA 3B70A 4R4JA 1Y7TA 3V1TC 1BSVA 1IPFA 3GPIA 1I32A 1NBOA 4IJVA 1H6CA 3BHJA 4MP6A 4DC0A 1GFSA 1CF2O 4R41A 2GNAA 4UAGA 5I7VA 3WXBA 2Q46A 1GZ6A 4DYDA 1V8BA 2JAHA 5U9CA 1W73A 3ZWBA 5HA5A 4R1SA 1KEUA 2JCYA 3H2SA 2VHZA 4DGSA 3EDMA 4EJMA 4BO7A 3LDHA 2JHGA 1ONNA 1GADO 1PS0A 4NZ9A 3AI2A 3Q6IA 3BTVA 4FJ2A 1FJHA 1U3VA 1IULA 2PGJA 1C1XA 6ADHA 4KUEA 5JMWA 2NVUA 3EC7A 4B4UA 1X15A 1U9JA 3NTQA 3M1AA 4GPD1 5GY7A 2IXAA 4DLLA 3A14A 1B3BA 2C82A 3NGLA 5KVVA 2G82A 3KSUA 2X9GA 4UREA 4R5HA 5T64A 1QKIA 1GV0A 1I0ZA 1UR5A 3ZWNA 3HDJA 4DMLA 4BNYA 4M49A 4MVJG 1D8AA 1DC4A 2A4KA 5I7EA 1M67A 3I52A 5DF1A 3AY7A 2J3HA 1B8UA 4LRTB 2DLDA 5A5FA 1C0KA 1B15A 4JGBA 4FB5A 4KDEA 5JY6A 1SAYA 2VYND 4J91A 3W4IA 3ZWOA 3K73O 4JQCA 4TKMA 5I7SA 4K6CA 1NTOA 4CQMD 4D44A 2GR9A 1ADGA 2HK9A 1PSDA 2C5AA 4AG3A 2VUSA 4JXKA 2I9PA 1ISGA 4FC6A 4D43A 5IXSA 2YFQA 2OUIA 4AJHA 2ZTVA 3MOIA 4NFSA 5BNTA 3ZV4A 3GDGA 2Q4BA 4GQAA 3JD0A 1M66A 3WLEA 1DHRA 3JQFC 2ZQYA 3E48A 3GEGA 4AJOA 1QYWA 4YCAA 4OMUA 1E1NA 1UDBA 3GDFA 5GZ1A 3BTOA 3D3EA 4BNKA 4KUGA 2HJRA 4J4BA 1YGYA 3DBVO 4FCCA 4OQZA 5THQA 4GGPA 2UAGA 1T2CA 3JYPA 1H9AA 3BMNA 5CDUA 4I9HA 4L76A 1UP6A 4B3HA 4BNVA 2JD0A 3QJ5A 5EPOA 3UUWA 1DRWA 2O3UA 5JCJA 3PJGA 4E32A 1ZH8A 4Y67A 4XR9A 2LDBA 1N9GA 2RHRA 4FJ0A 2HUNA 3H8VA 1JVBA 3ZNOA 4ZICA 1A9YA 2FOIA 3A4VA 4YAEA 5TIIA 1P45A 2VUTA 3JQ7A 5CFZA 1JDJA 3MJCA 2W4QA 1C0LA 4IDGA 1W0CA 1XELA 1VM6A 2WD7B 3WGOA 1TA4A 4YA6A 5TRTA 3WB9A 2ZB8A 2ZTMA 4QECA 1ZMOA 3OH8A 3C7DB 3DDNA 1UH5A 3PYMA 1OC2A 4YJHA 3WTCA 5JNLA 4UUPA 1YBAA 4LGVA 4FBGA 3BMOB 4AJ1A 3NYWA 4BNIA 3FBGA 5L53A 1EFKA 3BYZA 4TZKA 1GU7A 1LDYA 2AE2A 2W98A 1ZK1A 3DMTA 4LCEA 4WNCA 4CQMB 3ZWPA 2JD2A 4UVHA 1JN0A 4K1LA 1RPNA 3OIDA 4ILKA 5T6BA 2ZK7A 4RZIA 1PJLA 4RVGA 2BFPA 3F4BA 2FR8A 3DXFA 3NT2A 1HSOA 1E3WB 1KVRA 2EKQA 3PJDA 3DO5A 1NWCA 4J1TA 3H7AA 4LCJA 4BNTA 2B4QA 1A72A 4A10A 3C1OA 2DTEA 1EDZA 3F3SA 2OXIA 1KBZA 1X1TA 2D1YA 5TT0A 3EGOA 1VSVA 2WJPA 2DPGA 3PHJA 3V2UA 3ONEA 1NFQA 3VH3A 3DZGA 2Q2VA 3NDRA 3OJOA 2VZ0A 4YT2A 2JFFA 3HG7A 5L4SA 3CMCO 2PKQP 3MTJA 1Q2XA 2Y0CA 1HDRA 4IS3A 1YBVA 4BS9A 3RUHA 2C07A 3LT4A 3GOHA 4EEXA 4J0FA 3KETA 2BRUA 3DFUA 1GY8A 1HE5A 4BNFA 1V3TA 4IQ8A 5JPIA 3DC2A 5ENDA 1ADCA 3FRJA 3DZHA 1UZNA 3WJ7A 1EK6A 5GZ3A 2DTXA 3PLNA 4K28A 1TT5A 1R4NA 4CLHA 4CV0A 4IIUA 2O48X 4C7KA 3C1AA 2B37A 1VJ0A 2JCVA 3E1KA 3CXRA 4YRAA 3IIEA 2X6TA 2BI8A 4E21A 1V35A 1WP4A 3GMDA 3DFZA 3ZW9A 3I9LA 1LI4A 1R15A 5COBA 4Y98A 1ISFA 1ISMA 3I4CA 2HQ1A 1T4BA 2EGGA 3ZWXA 4MKXA 4BO8A 2Z5LA 5TJHA 3JQBA 5JW6A 5JSFA 1A9ZA 4O63O 5COAA 3LF1A 2CDAA 1GD1O 2EEZA 3I1JA 4NBTA 4KDFA 4IDEA 1A71A 2C5EA 3I9JA 1TXGA 1SOWA 3PK0A 5EERA 3KZVA 3ZU4A 4CMAA 3DBHB 4U0JA 2GZ2A 2GYYA 1BXZA 1DC5A 1PS9A 5HRUA 2O3TA 3IS3A 3LC2O 3KSZO 1LQTA 2YW9A 2Z1NA 1HF3A 4E5KA 1M76A 3KYCA 3WWZA 3FI9A 3RI3A 4J49A 3K30A 5BNFA 1U28A 3WIDA 1E0DA 3H4VA 5ER6A 2HDHA 1LQUA 5JC1A 1YB5A 5F5LA 4RDIA 4E5NA 2QZ9A 4A0SA 2AQ8A 3ZWYA 1EDOA 1ZK4A 3I23A 5I7FA 5IZCC 2A92A 3AWDA 2VHYA 5A03A 1DLJA 3JQCA 3IMFA 4CLOA 4BVAA 2VNAA 5HTOA 1XYGA 4ZRMA 5IDQA 1PGJA 3ZWWA 4OGWA 1D1TA 1UXJA 2PD3A 3RIHA 4A5OA 3TZHA 3GGGA 4JBGA 2Y1GA 3OETA 4XQGA 5IDYA 4MVJM 5JDCC 2ZB4A 4YBZA 2G5CA 2GO1A 2EGHA 1LLDA 2WE8A 3QLJA 4PFJA 1JWBB 2DPHA 1PGNA 4DWVA 5KIAA 1EUCA 2WYUA 2D3TA 4A03A 4W9NA 4DQXA 1LSJA 1YBMA 4AFNA 1QYVA 3TJRA 4OXNA 3ZWAA 4CM5A 2I6TA 4OKNA 3ONDA 1Y8RA 1VPDA 2HMVA 5L9AA 3ZN2A 4EYEA 3P5SA 1XA0A 4BNUA 1LEHA 3DZFA 3PYLA 2VYVD 2E37A 4UEOA 3K5PA 3KLPX 3UHAA 4FFLA 1H2HA 3E5MA 1I3LA 3ZV6A 3NEPX 1XKQA 4E13A 1K0UA 1NHWA 2C0CA 4Z9XA 4E5YA 1R0SA 1NAIA 2DUWA 4RZHA 4HWKA 1HE2A 1ZMTA 3D4NA 3ZDFA 5JAQA 4GKVA 4BKPA 4M8SA 3ZI0A 2NV6A 1DIBA 5CEEA 1ZIDA 5CDTA 1I10A 3IQDB 5A04A 2VZ8A 5AXAA 4B7XA 5J23A 5DDIP 1H6DA 3PWKA 2QRLA 4NBVA 3H9EO 1LDEA 4XB1A 1C3VA 2EF1A 4XWYA 1NQTA 5CG1A 1A5ZA 5BSHA 4MVJP 5ITWA 3WGQA 1FF9A 4YVFA 3HE3A 3GEDA 1AGNA 5TSDA 3I6IA 5JDIA 3P19A 4QTZA 4XKJA 3MZ0A 1B2LA 3UAGA 2NSDA 1YL7A 4MOWA 1WMBA 2JD1A 3CUKA 3E9NA 4B4OA 2YHIB 1H5QA 5CHEA 4ALLA 1Z74A 4FFPA 1GTMA 3SX2A 2DBQA 3VZPA 2C29D 3JQ6A 4R1UA 1J5PA 3U0BA 1BXGB 4ALKA 5EMHA 4A26A 3WWYA 4TSKA 4WOKA 2NVWA 4D3SA 2BELA 1X7DA 4KP7A 1GQYA 3MOGA 3NRCA 1BXKA 3E03A 4L75A 2WSBA 4ZQBA 5BSFA 2R6JA 3ENKA 4BKUA 2J3KA 3JQAD 4CQLA 4WLNA 1MLDA 4Q3CA 1EVJA 1RM0A 4NR0A 1PR3A 3QWBA 2QZZA 3C7AA 3GN1A 3IL2A 4NQZA 4UVGA 3T4XA 4AJJA 4J9VA 1ARZA 1JVSA 2PFGA 4IJUA 3U4IA 4CM3A 1XSEA 1F06A 1QMGA 1YKFA 3I5MA 3L6DA 2YZ7A 3PFWO 1BW9B 4MVJD 5A9TA 4J7XA 4DTIA 3AI1A 3DMYA 3PIDA 4M55A 3NT5A 2NM0A 3W6UA 4BB6A 1YQGA 2V6FA 1BHSA 4PN3A 3EY4A 1SO8A 4J4TA 4OXKA 1LC0A 3FWNA 4E2ZA 1UUFA 2NADA 4XIJA 1ZW1A 4D79A 1ULSA 1NQOA 2ZJ1A 4BO0A 3WOHA 3WGYA 1HDGO 3RSHA 4QEDA 2BFMA 1P1RA 1WDMA 4II2A 4Q3AA 3VAZA 4BNLA 1B3RA 3DTYA 2Q1WA 1HT0A 2O2SA 3WG9A 2AMFA 4E5MA 1XIVA 2Y1CA 4DVJA 3JYNA 1QYDA 3HFSA 3ZWVA 4GLOA 4J4HA 1JKIA 4CM4A 3UFXA 3RUEA 1XQ6A 1BTOA 1I36A 1ENYA 3LQFA 4YEDA 2P9CA 5KKCA 3FNGA 3VC7A 2CDBA 4DUPA 1LBEA 1LDGA 4CLXA 3N74A 2PNFA 1YOVB 5ICSA 1IZ9A 2EW8A 2FWMX 4YB8A 1LRJA 4B3JA 1HYHA 2EXXA 3KHUA 2OL4A 2J8ZA 4URFA 4AJNA 3LLVA 2BFOA 1YVEI 1BMDA 2CVOA 3GZNA 5DULA 5T5QA 1ID1A 4YT8A 3TZ6A 1UDCA 2GN4A 2W2KA 4ITUA 3VZSA 4FW8A 4ZU3A 2EP5A 5L51A 4ALJA 4AJ2A 1WDLA 1WXDA 4AJKA 1U5AA 4XGNA 3H3JA 3QWFA 4N5MA 2W2LA 3JQAB 5TX7A 1N1GA 1ZXLA 2FZWA 4PLHA 3PZRA 3VPHA 1C1DB 5A3JA 2YY7A 3DQPA 3IJPA 2CFCA 5DZSA 3AUAA 4CMHA 5JAMA 4XR4A 3RUAA 4BMVA 3CIFA 2HMTA 3Q2KA 3VPFA 1ZSNA 2VRCD 4BKRA 5FYDA 4GI2A 5I9MA 1PEDA 1B16A 1HE4A 1YE3A 1QV6A 4CMIB 1YL6A 1K6IA 4IBOA 4OL9A 3HSKA 4BO6A 4AL4A 3GG2A 5K0ZA 2QHXA 3ETEA 3GQVA 3JSAA 4CUKA 3I6QA 4Z3DA 1EZ4A 1E92A 5B4VA 4DPKA 5IF3A 4CM7A 4BNNA 3MWDB 3RKRA 1LNQA 4UVDA 3OEYA 3EK2A 1F12A 2GERA 2IZ1A 4BO3A 4Z9YA 4RPJA 1X7HA 4RQTA 3OMLA 4WCDA 3BHIA 3F4LA 4PLPA 5H82A 4XJTA 3FD8A 4PG4A 2CF6A 4BNHA 4CMEA 1P77A 1O6ZA 1VC2A 2A94A 3UOGA 1AHIA 1DRUA 3V2HA 4XGKA 5CPFA 3FTNA 1Z82A 1A7KA 3AFMA 5A9SA 1J0XO 2X86A 3NTRA 3WGGA 8ADHA 4GX5A 2ZTUA 3BIOA 4FS3A 3LZ6A 2VNSA 3P2OA 4QFDA 1K5HA 2VWQA 4OXYA 4DA9A 1ULUA 1NX6A 4NJOA 5G4KB 3GHYA 4FGSA 4UUOA 4NH4A 4WLFA 3Q1LA 1NPYA 2H63A 1OC4A 1RYEA 1M6WA 4JBIA 1Q7BA 1GUYA 2VUUA 4B8ZA 5LCXA 3RFXA 1WVGA 3FBTA 2GLXA 4Q3BA 5F5NA 3E9MA 3JQEA 5IZ4A 3PTZA 3WFIA 5L95A 2BMAA 4IIVA 4LRSB 4CM6A 1GQ2A 3D3WB 1LDMA 4Q3NA 2VHVA 1UP7A 5TC4A 2G17A 4NMHA 2E82A 1NFFA 1P31A 1PGPA 5AQ1A 5CDGA 3FSRA 5JLAA 4S3MA 3WMXA 1DJNA 2IXBA 4FQ8A 3ZZNA 4Z0PA 1UP4A 3EHEA 1AN9A 3C8MA 3QP9A 5U1PA 1AUPA 2V6MA 4RORA 1I3MA 1B14A 1O94A 3TOXA 4LSMA 3VTFA 3Q9NA 1KC3A 2Q45A 2VWGA 3VDQA 4YJGA 3ZGYA 4OJNA 3UGKA 3ST7A 4PVDA 4YT5A 2FHSA 1CYDA 2Q1SA 3QRWA 4RPGA 3SVTA 1BVRA 3OQBA 3TOZA 3BHMA 4XYMA 4FFMA 1DFHA 2HLPA 3DZIA 3U3XA 1GPJA 2PGDA 1B7GO 2DBRA 1I2ZA 1V9LA 1T26A 3ICCA 3ZNQA 2GSDA 3ITKA 4J43A 4BIIA 1H94A 1OZAA 5TLSA 1T4DA 1Y8QB 3K31A 3D4OA 3JQGA 3K2BA 5CP8A 1NASA 2FY8A 1SEVA 2AQHA 4HFJA 3AJRA 4YYZA 2AEFA 1LLCA 4CM8A 4OSOA 1ONPA 1KVTA 5KJFA 5JCJD 2O3RA 1P74A 3KB6A 1Y9EA 1YDEA 3AUSA 4GWGA 3FF4A 3H9UA 2JFGA 1C1XB 1DBVO 4RF2A 3RU7A 4BO2A 5G0UA 2YJZA 4G2NA 4HV4A 5L4NA 2NVUB 3OIGA 4TRJA 2J3JA 4HBGA 4E2XA 1VI2A 1DRVA 2I76A 4GX0A 3OM9A 1R66A 5IDXA 4JJGA 4TRMA 1PX0A 3B6ZA 1PWZA 1HTBA 3JQ9A 1LTHR 1XCBA 4IGEA 1DAPA 3GF4A 2HK8A 2E48A 5CAEA 1G1AA 2I67A 2G0TA 3AOEA 4CMKA 3LC7O 4J1SA 4F46A 5CG2A 5G0WA 4PLFA 3Q11A 4GKBA 4J1QA 5FWNA 1YXMA 3KXDA 2C59A 3QVOA 2OP1A 4G81A 3WSWA 3WGHA 3NX4A 3PDJA 2PWZA 2ZCVA 2DC1A 3EW7A 4I5EA 4A27A 5JMPA 4M87A 1BGVA 1C0IA 4RL6A 4U5QA 1ZJZA 2QYSA 4D0RA 4IPTA 4W82A 5A02A 3PGXA 3HDQA 5KKAA 2GN8A 4QO8A 4BNZA 1B8PA 4OOEA 1R16A 1XU7A 4CPDA 1EUDA 3D1LA 1VRWA 3D7LA 3WDSA 1QXSA 2GDZA 4BNGA 1MV8A 5BSEA 4GSLA 1J6UA 3ZU3A 2D5AA 4NG5A 3RJ9A 3RQSA 3JQDA 2DBZA 1DC6A 4YRDA 4E30A 3HB4X 1E1LA 4XDYA 4LMRA 4YAGA 1E1MA 1ZSVA 3BMNB 5KJ6A 4TZTA 1TB4A 4NNJA 3UVEA 2YYYA 3DOCA 3N7UA 5B1YA 4Q3EA 1N9GB 3R3JA 2I99A 1CIVA 1NFRA 3DBLA 3ICPA 4DLAA 3EAGA 4CLDA 1K2WA 3AY6A 1H6BA 2RIRA 2J6IA 4Y6RA 4CV1A 4D45A 3JQ7B 5AXBA 2JJYA 3DBRA 3RVDA 4CMBA 3OSUA 5IJZA 3GZ4A 3P7MA 2EW2A 2PZLA 3OHSX 4I8XA 1MC5A 1CWUA 1V3UA 2EWMA 2OBYA 1UZLA 4NFHA 1A4IA 4YAIA 2VHXA 1Q0HA 4R69A 4Z3KA 4K26A 1T2FA 4NJMA 4YJHB 3WS7A 3RBXA 3KBOA 3ORFA 2D0IA 4W7HA 1BWSA 1JW9B 1E7SA 1U5CA 2ZJ0A 1OFGA 1DIGA 2HKIA 3LLSA 5B4TA 1DEHA 5AOVA 2ZCUA 2D59A 4EJ0A 4KTVE 1RJWA 3B1KA 1Z7EA 1XGKA 5LDHA 4XRGA 3KYDA 1DLIA 4YQZA 4D0SA 3GVXA 1QP8A 1NPDA 1ENOA 3LU1A 3TN7A 3G0OA 1O0SA 1Z7BA 2C2XA 1XDWA 2JCXA 4U0KA 5MGBA 5ENVA 1DAOA 1IL0A 1PQWA 3JD3A 4MVJE 1EE2A 1MUUA 1VJ1A 1WWKA 3ANLA 4R16A 4U6SA 4ESOA 3G1TA 4C4OA 1SOVA 1MX3A 2DFDA 4MPDA 1R0LA 2QIOA 4WCFA 3WGIA 2C54A 3V5NA 2QX7A 3U09A 2GN6A 1UZMA 1HYEA 1E77A 1UXGA 2XF8A 4FFOA 5A3VA 4TWRA 5C7OO 3PEFA 1E7WA 2O7SA 3VZQA 3QWAA 5BNIA 3JD1A 4IM7A 2GZ1A 3AI3A 4YACA 2Q2WA 2QW8A 1NVMB 3KOUA 5H83A 4DBVO 1Y5MA 3AM3A 3HWRA 2CD9A 1BRMA 2YDYA 3WR5A 2AQIA 5JYEA 3SC6A 5C37A 2H9IA 2Q99A 2VYNA 2X9NA 1Q7CA 4JLWA 3L4BA 1BVUA 4IUYA 1EBUA 3ZHXA 1GQQA 1EMDA 5AXCA 3MJEA 2DFVA 3VPSA 4CQMA 3S1LA 3WQQA 2X0RA 2VCYA 3TL2A 3UKOA 5JY1A 4X54A 4RV9A 1DFGA 2PGLA 4WLOA 1P0CA 3GK3A 5AVOA 1VKOA 3O8QA 4CM9A 4BV9A 1TT5B 1R4NB 1Z75A 1K6JA 2CZCA 3JCZA 4N5NA 4XDZA 5HS4A 3DONA 1ZSYA 4XYBA 4JBHA 2O7QA 1ZK0A 4RVSA 4TVOA 1I33A 1LSSA 3O26A 2P4QA 1QV7A 2O3JA 4P38A 4H15A 4DIBA 2JKVA 4BUCA 4XZ3A 5IDWA 1RM5A 1GYRA 1HKUA 4NPCA 4ZQFA 1BDBA 4INAA 3F6YA 3HQ4O 3DOOA 4I5DA 1NNUA 4ZQHA 4ZQGA 4XQCA 3ROMA 3GC6A 4E33A 2BGLA 1UAGA 2NU8A 3JQ8A 5TJ9A 4I9UA 2C2YA 5H81A 3DHNA 2P4HX 4WK6A 4U7WA 1KETA 2PR2A 2Q4EA 4OM8A 4PG7A 4GBJA 5LC1A 2DKNA 4P4LA 4IDDA 2RHCA 5T8KA 3KYCB 5F21A 1P1KA 4RGBA 1HE3A 2FPGA 3NDIA 3KM0A 2AG8A 1X7GA 3EZLA 4JP2A 5DP2A 3DMTC 5A05A 1NM5A 3PWSA 3Q9UA 2CMDA 1DJQA 1CDOA 4YJFA 1WNTA 1NWHA 2P91A 5HM8A 1AXEA 4WLVA 3T7CA 5EN4A 4UEJA 3OJFA 1A7AA 3BZUA 1FMCA 4MIEA 4DPMA 4CLOB 3H5RA 4Q9NA 1GEGA 4ZQEA 4Q3DA 1PTJA 1KEWA 3QY9A 3BMQA 2EIHA 1U7TA 2IEDA 1PJBA 4O59O 2B5VA 4NU5A 1ZEMA 3OFSA 4RJTA 2FPIA 5BT9A 2OP0A 4RVHA 1A4UA 4TVBA 3DR3A 4M89A 1DO8A 3V1YA 5G0SA 3CZRA 3KUXA 3K6JA 3I9NA 1O95A 3K92A 3OJLA 3VHRA 1U4OA 1Y8RB 2F1KA 5JO0A 4ND5A 4IY1A 2QYTA 3W8DA 4N18A 4WJZA 4A2CA 4B4WA 2D5CA 2JFHA 4RO0A 4XA8A 2RBEA 2NTJA 1ISIA 3BMCA 3ETDA 1FDTA 1NR7A 1OBFO 5BQFA 2Z1MA 2IZ0A 4KQWA 4R01A 3JD2A 1F0YA 1JAYA 3AK4A 3GNSA 1L7EA 3VH1A 2AW5A 3OF2A 4J3FA 4C7JA 2X4GA 2I3GA 2AG5A 1N7GA 1SB9A 3OJ0A 5DNAA 3U4CA 3WTBA 1I5RA 2Q3EA 4J9UE 3ZNNA 4BKOA 1KVSA 1OMOA 3CZMA 4ALIA 3DHYA 3MJSA 4HX5A 4Z6KA 3AM4A 3GAZA 4PCVA 2TMDA 2DT5A 2WE7A 2X8LA 1TLTA 1SNYA 5L7WA 1MFZA 3F5SA 3JQBC 2V6BA 1X0VA 2VTEA 3H9GA 1SB8A 1JLLA 3S8MA 1KY4A 1LU9A 1GDHA 1NQAO 3H9JA 1X0XA 2GD1O 1BG6A 3CINA 4MIYA 2OO5A 3D64A 4JJIA 4PG8A 1PR9A 3Q3CA 4J90A 4YDRA 3TL3A 1M6HA 3GRPA 3E9QA 4GLLA 2B4TO 3E82A 2AEMA 3H5AA 1GUZA 2VOJA 2D2IA 3COSA 3ROQA 2WTBA 4RLHA 3HFGA 3U5TA 4DQUA 1V3VA 3D4PA 3I4FA 1LDBA 3FNHA 3RFVA 1XHLA 2GASA 3L9XA 1HZZA 3GAFA 3NKLA 4PZEA 1P9LA 4IS2A 1Q0QA 3RKUA 2UDPA 2X22A 1LUAA 4BMSA 2H6EA 1AE1A 2QQ5A 4R68A 3S2IA 4GVLA 3AM5A 2ZYDA 2IYPA 4TRRA 2W2LD 1P44A 3VKVA 4CQLB 3INRA 1QORA 3ZCXA 1YB1A 4TKLA 2UVDA 4L4RA 3O38A 4FR5A 4ID9A 2DTDA 5JXWA 1PS8A 1T2DA 3T4EA 3V1UA 2W90A 4LMPA 1DIHA 1JA9A 4TQGA 3DZBA 3IOYA 2HRZA 1I3KA 4ND1A 5ILOA 3X2FA 3GNTA 2I65A 1GYPA 4CUZA 5CEFA 2SCUA 4L74A 4RF5A 1U2DA 4GH5A 4W9NC 1MXFA 5EESA 2HCTA 2X0IA 2Z95A 3A1NA 5FFFA 2XPCA 4UULA 2AQKA 1H9BA 4BO5A 3L4SO 1CJCA 3UXYA 4G65A 3W1VA 3RUDA 2OZPA 3SEFA 3CSDA 4ZGWA 3U4DA 2R00A 4E12A 4DLBA 4IDAA 4O5OA 3WBFA 1ZNQO 2HSDA 3OIFA 4QO7A 1HDZA 4S1VA 3VPXA 4CM4B 2YV2A 4IGFA 1T25A 4OHUA 3ETGA 1ISJA 3KYBA 3QQPA 5CPBA 2AE1A 1Y6JA 3PJFA 5AXDA 4IJWA 2Y0DA 4D46A 3WYEA 1C14A 3OP4A 2B4RO 3HJAA 3B1FA 4P8RA 5GZ6A 2CDCA 2OORA 4BO9A 3AU8A 1ZKMA 1E3IA 1Z73A 1IYZA 2VOEA 3WGZA 4HFNA 3GZNB 3TNLA 1HWYA 1QYCA 3F46A 1NP3A 1MG0A 3GY0A 3PIIA 5IG2A 1XEAA 4LW8A 1PWXA 2AXQA 2F00A 4RF4A 4AJ4A 4TMFA 3ZW8A 3NJ4A 3KVOA 4PG6A 3TFOA 1O9BA 3FNEA 5A5EA 3TWOA 5JDIC 3HDHA 2W8ZA 1H2BA 2BGKA 2LDXA 2AA3A 2EV9A 4P4GA 1UXKA 4EITA 1YJ8A 1MGOA 5JO9A 3RC9A 2X5KO 4RPLA 1Y5RA 1ZO8A 2FP4A 1P1IA 2GZ3A 3PYXA 5L40A 2Y05A 4EW6A 2PZJA 2NNLD 5EINA 2Y68A 1IY8A 5KVSA 2BLLA 4QX6A 2IODA 4LSWA 3WX0A 3GDOA 2P5UA 1PQPA 4CR7A 5GMOA 3W8EA 3QVXA 2NVBA 1KEPA 4JNKA 4Q39A 3RC2A 2FSSA 4IMRA 5FF9A 3SLGA 4YT4A 1KYQA 3KTDA 2B69A 4BMNA 1U8FO 2NU9A 3U62A 4B4VA 1E7RA 4D42A 5I9NA 1GR0A 4OKIA 4MKZA 4CJXA 4XD2A 1LRKA 1F14A 2X5OA 1SEPA 3U9LA 4DREA 2DBVO 4JK3A 1FXSA 3TRIA 1YRLA 2NU7A 4HNGA 4BQRA 1WPQA 1EEHA 3ASVA 4W7IA 1HETA 4IDBA 1E3JA 1P0FA 1E6EA 3GEMA 5ICMA 2HO5A 2BGMA 2E4AA 1ML3A 1U8XX 4P4NA 1GPDG 3ROKA 2CVQA 2GCGA 1NPTO 2Y1FA 3LT0A 3OA2A 4R9SA 1RM4A 3PFFA 1ZBQA 2EHDA 4HKTA 4HUJA 2OHXA 3RC1A 8LDHA 3WYBA 2P68A 4WLEA 3INGA 4L0QA 1NQ5A 4GAEA 3GFBA 4P22A 5A9SB 4W99A 4I5GA 3PLRA 1YJQA 3GUYA 2PK3A 4R3NA 3A28A 3F47A 3TZQA 3G49A 3PHLA 2XOXA 5I8WA 3ZHZA 1EE9A 3GVPA 4FJ1A 1ORRA 2DQ4A 4EGFA 4F6LA 1N7HA 4W4TA 3CE6A 3RFTA 4EEZA 4KTTE 3P2YA 4I5FA 3NAQA 4J1NA 4ALNA 1KEVA 3QSGA 4MDHA 2JHFA 2VHWA 4IZIA 5KWEA 1GAEO 1VJTA 1K3TA 4J16A 3DOJA 3JYOA 3H2ZA 4EI2A 1XG5A 1WMAA 4B8WA 5IN5A 3M6IA 1U1IA 4KMSA 4BGUA 4BO4A 1U2GA 3DZJA 1CEQA 4PLWA 5DBGA 2FR0A 4NI5A 1IUKA 3PI7A 3E6AA 3PVZA 3GMSA 2XXBA 3IP1A 4BGEA 4DIOA 2FN7A 2PD4A 4ZD6A 4M86A 4E5PA 4E2WA 1E6UA 3GR6A 3H6KA 5TS3A 5KVCA 5ILGA 3D5TA 5JFOA 4XB2A 5KJEA 5K6AA 4NK4A 2VTDA 4QSMA 4XX0A 5U4QA 4D3FA 3EVTA 2DVMA 2IE0A 1DFIA 1KOLA 1WZIA 4L4SA 4YJGB 4E4YA 1DIRA 2YV1A 5C5IA 5AYVA 1ENPA 3FNFA 4EUEA 5JS6A 5G4KA 3Q2IA 1G6KA 4CM1A 3QWHA 2HU2A 4MVJH 4B3IA 3PQEA 3RUIA 4L73A 3NTOA 4L9RA 1A27A 3GPDG 1PZFA 5HWSA 2VN8A 5IAAA 2TMGA 1FDSA 3AW9A 3L77A 1RWBA 4TRNA 1PJ3A 3GVCA 2ZB7A 3HZZA 3LYLA 4WEOA 5KJCA 5L7TA 3PHHA 3O4RA 1DDOA 3KEQA 1I01A 1QYXA 3IUSA 3O9ZA 1N5DA 3G3EA 3JQGB 1MA0A 3DB2A 4FOOA 4LVCA 1HYGA 2J5QA 2CNBA 4CM8B 3FCOA 1J4AA 1Q7GA 1R6DA 2FSVA 3UCEA 2ET6A 3FR7A 1R4MA 1I8TA 4CL8A 2RH4A 2G1UA 2HAEA 4G5HA 5DOZA 4CLRA 3WNQA 4AJLA 2CUKA 3HDYA 5LDGA 4AVYA 3BXXA 3ON5A 4ZN6A 5F3RA 1F17A 4J6FA 3WBBA 4CMEC 2VT3A 2X7HA 2PKRA 3ASUA 4DC1A 3R3SA 5JC8A 3DEYX 1B26A 2H1SA 2Y66A 1LSUA 1M2WA 2GGSA 1PZGA 2QG4A 3B20A 2AHRA 1U4SA 4OO3A 4IZHA 4PLVA 1QR6A 5DBFA 2WYWA 1NR1A 3BTSA 1U3UA 1M75A 1U3WA 1I30A 2D8AA 1SC6A 2FMUA 1T1SA 1U3TA 2YUTA 2X0NA 2GRAA 4OAQA 2RCYA 4OSPA 3GA0A 5A06A 1G0OA 1Y8QA 4LN1A 5JAZA 1Q1NA 2POQX 4NDNE 2A9FA 3HN2A 2EJVA 1JKFA 3PZBA 1YS4A 3TZCA 3GFGA 3N58A 1EQ2A 1LLQA 3MTGA 4NBRA 2V65A 2EERA 1E5QA 5ITVA 5K6AC 1E7YA 2D4AA 4WE3A 2CVZA 1NAHA 3ZHYA 4HFRA 1DB3A 1KERA 5HS6A 2GF2A 2Y1DA 3TQHA 4XEHA 4GGOA 2O2YA 4XGIA 3E5RA 3HADA 1HDXA 4Z0HO 3NV9A 1ZK3A 1JKJA 3L6EA 3I9KA 4JN6B 4EUHA 2C7VA 4CV3A 3S2FA 4MP8A 3ZU2A 3ROPA 1NXQA 5DCWA 3LK7A 2QRKA 1K6XA 3ITDA 1AHHA 4FFRA 3STHA 4OH1A 2X0JA 3DAGA 3RC7A 3RWBA 3PWZA 2P9EA 2Y1OA 1VL8A 2PLAA 3GNQA 2ZKLA 4Y6SA 3HNPA 4F6CA 5DN9A 1NYTA 5FI3A 3KSDO 3OQ1A 5IXYA 3DBLB 1ENZA 2PH3A 2ZQZA 2C20A 2YQ4A 3L0DA 5IFLA 1LDNA 1CERA 2NTNA 2FRDA 5JCXA 4WKGA 1EK5A 3G79A 3GRKA 3DBRB 4CM9D 4ZJUA 1P1JA 2RH8A 3BA1A 4FIZA 4RQUA 5F1KA 2EKLA 1T24A 2NWQA 3DWFA 4CMJA 3TDKA 3DAPA 3A9WA 4ONEA 3WFJA 1GZ4A 4A7PA 2NTVA 3EUWA 5B12A 4NJMB 3VVBA 4BGIA 3PXXA 3W4JA 1D1SA 1KY5A 1WDKA 1D4FA 5G4LA 5FEUA 1VLLA 3IJRA 4CLEA 3LSYA 1PJTA 2VQ3A 4RDHA 5DP1A 4KQXA 1PGQA 3HN7A 4IJKA 3KYDB 1HDCA 1YB4A 2PKQO 2J3IA 3FPCA 3IAHA 3Q0EA 1IZ0A 2Q2QA 4WLUA 3C85A 2V7PA 1E3LA 1F8FA 4E31A 1SBYA 2NLOA 1P33A 4FN4A 4Z0TA 1TEHA 2VWHA 3JQ9C 1GL3A 1XQ1A 3CH6A 1WW8A 2P5YA 2Q49A 3VH4A 1SCUA 2GN9A 4BNMA 3CPSA 4L8VA 2X23A 3AOEC 1RM3A 2CF5A 1XWFA 3OBBA 3EYWA 3VH2A 4CR8A 2WEKA 2I66A 4XCVA 5KCZA 4ND3A 4WCFB 4EJ6A 3TF5A 1OAAA 4PG5A 3C1TA 4QT0A 1L1FA 1HXHA 4BGVA 4JX8A 2EG9A 2HMSA 3MWEB 1YO6A 1S6YA 3SXPA 1K89A 1JAXA 1DPGA 2NU6A 1QSGA 2WD7A 5JYDA 4RPKA 1LA2A 4E6PA 3KEOA 1RYDA 3EZYA 4YXFA 4JIGA 2YHUA 1GEEA 2BI7A 2B0JA 3IC5A 3QW2A 4MP3A 5DOVA 1HDYA 4MKRA 4IDCA 2O4UX 2ZB3A 4RLSA 4BNJA 4H7PA 3MJ4A 4JCOA 5DBIA 4XYLA 3BMOA 1HZJA 1PL7A 4FPXA 5A9RA 3K2EA 2B35A 7MDHA 5KJ1A 3R6DA 3I9MA 3O8QB 4QFCA 4D7AA 3QVSA 2RAFA 4I08A 2J5RA 2A35A 2IEBA 2PD6A 4DPLA 3GG9A 4H16A 3WIEA 5KNLA 4EBFA 1I24A 3OQ6A 1G0NA 4FOSA 5A1TA 2J5KA 5IZCA 4I1IA 2IRWA 2DAPA 2XAAA 3RUFA 4OIMA 2BFAA 3RUCA 1ZXBA 3DTTA 5L3ZA 4M1QA 1E3WA 3GLQA 4R5MA 3ZH2A 2WWRA 5CEJA 5TNXA 4YR9A 3JQ8B 3UH1A 1IHXA 4B7CA 4RVFA 2UV8A 5JDCA 4GX1A 5C3MA 1DOHA 3S2GA 1HLPA 1MFPA 4JJFA 1CETA 1Q0LA 4NBWA 4BL5A 4EZBA 2OMEA 4Y8VA 1YWGO 1UJMA 3PQDA 2X9VA 4Y6PA 2V6GA 3VKUA 5CDSA 2VWPA 3GH3A 2B36A 4HFMA 1LRLA 4ALMA 4JP3A 1HL3A 5BSGA 3HHPA 1IHYA 2DM6A 4KWHA 2DU8A 2PZMA 3FWZA 4YWJA 4YJFB 3QHAA 5MDHA 1VKNA 4HY3A 4HXYA 4RVDA 4XJSA 3WLFA 3NGXA 1H6AA 2E49A 1Y1PA 2Y1EA 4J7UA 4CR6A 1HLDA 2B5WA 4ZHSA 4F3YA 4GVXA 1FDWA 1GCUA 2PH5A 3BMQB 3TZKA 4LK3A 1LXCA 4KUHA 1QG6A 3ANMA 4O0LA 4YQYA 3RD5A 4DL9A 2HMWA 1ADBA 2O50A 4NFYA 4WCFC 3I83A 1NHGA 2NQ8A 4L4XA 5ES3A 3W6ZA 4DYVA 3UN1A 3WSVA 5IN4A 3AUTA 3A06A 4J2HA 2IZZA 2H5LA 1I2CA 1QLHA 1SMKA 4NBUA 4YTEA 1SZJG 4ND4A 5K9ZA 2IYOA 5C7LO 1SPXA 4O6VA 1IOLA 4DBZA 1ZZEA 1DXYA 1PQUA 3HUDA 1E1KA 1FDUA 1UXIA 5THKA 1PL6A 3DBHA 3L4BC 3ENNA 4WPGA 3VOSA 2YV3A 4IMPA 4KZPA 3BMCB 4PLZA 3M2TA 4GX2A 4OQYA 3PHIA 4ZVVA 5L4LA 4GMFA 2ZIZA 3IP3A 3LF2A 3RASA 2YDXA 2VT2A 7ADHA 3ZHBA 1ONOA 1B8VA 5I8ZA 4MINA 3AY3A 1PU2A 3WNVA 3D0OA 2ZYAA 1O5IA 3O03A 4BNWA 4O1MA 4NHEA 3LT2A 1IB6A 2HRBA 4UUNA 3ABIA 3WYCA 4MVJF 3PDUA 2ZATA 4GL4A 3RJ5A 4AICA
chains in the Genus database with same CATH superfamily
1Q12A 2H1IA 3C7CB 1ZAYA 3JD4A 4MZDA 1DQRA 1EFCA 3EB9A 1XK7A 1LJLA 1WXXA 3CZ5A 3GUUA 4K9DA 4OPMA 5K3FA 1YONA 1DWUA 2WG0A 1FJ2A 1JR2A 1JQBA 4WECA 3MUNA 4P4UA 2OFPA 1Y9JA 3FHCB 4BV8A 5JYCA 2DUUA 3ZGZA 4ZAVA 3UJDA 4OQXA 4FGWA 2Y6VA 3G0CA 4RWZA 4KXWA 3VZCA 3SLKA 2GQ0A 2XTJA 3GZTB 2IDKA 4JYMA 4GDFA 1EUZA 3UMFA 4BP1A 1NVBA 3CT4A 2OVFA 1OU4A 2AI1A 3UV6A 2BFWA 2JFZA 3AJDA 4XE5A 2PA0A 4Z2AA 1THTA 2GEDA 3FF1A 1FNMA 1GPAA 2B30A 1FK8A 1YL5A 3C4QA 4MYUA 4EJ2A 1GRQA 3ACDA 2WV9A 5I9LA 1E2DA 5KYUB 2CSUA 5HBRA 2IHKA 3C7KA 3C1UA 1J39A 1DXOA 5T8KC 2ATVA 2BPOA 3A37A 3QE9Y 1IQUA 1L7XA 4J0JA 1X13A 1X14A 2GKOA 2V3VA 4FDVA 5TGTA 3S2EA 1OXMA 3GUCA 1Z6YA 3ZV3A 4YDQA 1ZW6A 1NM5C 1N25A 4B43A 1EVIA 5AHXA 4DN6A 1A5SB 1U9YA 1Y7PA 1LD3A 2Q8NA 4B3TB 4MGZR 1L5NA 2C3PA 3RKSA 3WJAA 4BLOA 3FYSA 1C1HA 1YRAA 2ZJ4A 3QVVA 3DPSA 4L78A 3F5FA 2V8BA 5IXJA 2IE8A 2C2BA 5FPYA 5HSGA 4LF8B 2Q3MA 4U8GA 4Y2VA 4OHWA 1G20A 2E6UX 2FZEA 5EJ4A 1Y5NA 3NXKA 4ZVLA 4C04A 3SR0A 1KVUA 3K96A 1IK6A 5DMHA 2ZYRA 1OV6A 1YIDA 1ZWLA 2BZ0A 1H85A 4X1YA 4D74A 3AT1A 1WAMA 2SKCA 4YAKA 1RP1A 3R7NA 1NW4A 1UMDB 3ANSA 1TJ3A 2VT7A 4PRLA 1Z3IX 1D2AA 3TMKA 3SKXA 1E6WA 1VG9B 1JE1A 2HMYB 1LS1A 3QVWA 3U26A 3ULKA 5KSZA 3UICA 3W0LB 3E23A 4Q24A 1M7GA 1QJCA 1YDWA 1O8CA 2PO7A 3WBKA 3DW3X 1TD1A 4Q12A 1Y1QA 1JG2A 4MB0A 1FTGA 2Y4OA 3G2MA 4NYJQ 5BPHA 5ER9A 4I50B 3CLRD 4XIIA 3G1UA 2O23A 5A71A 5I4CA 4IOMA 1JPUA 4L6AA 4CIDA 2O3SA 4WY8A 2Q9BA 4TV8A 1K98A 5EIOA 4PR3A 5AHOA 3A4YA 3TW6A 4JFRA 3ILHA 1CNFA 1QNLA 1XPOA 1SCNE 3C3XA 2OCBA 3R0IA 2QNRA 3I9OA 5EJ2A 1X9HA 2FPOA 3HY6A 1K97A 4DMFA 3THWA 4NOJA 1KO4A 3DLCA 1NVTA 1I3NA 3PKZA 4IOLA 5AM4A 5HKKD 5UKDA 2M2IA 5BOVA 3I73A 1S4QA 1TO1E 4HAYA 3A1DA 3Q9LA 3UY4A 4O3FA 1PZXA 2RJ3A 4MLDA 4L8LA 4Z4FA 1ID8A 4RMGA 1LLUA 4CUJA 4JROA 3DUFA 4LGYA 2VCHA 4IQ0A 1SXQA 4BMCA 4F8YA 1T2NA 3ONWA 1UMKA 3QVTA 1XR3A 2V7EA 2FQXA 3KJFA 5TQ2A 3VI3B 4DW8A 1E3EA 2YJNA 1I7PA 1B6TA 3TLEA 1U02A 5COQA 4W9RA 4RHYA 2O1XA 3ZDQA 1I2BA 3OOHA 5C4GB 3VHXA 4KL8S 4R1LA 3UXMA 1ZD2P 3VMFA 4GNRA 4KR0A 1KKLA 2CYAA 4IF4A 4PLYA 3O90A 1YQDA 1Z0FA 3CLUC 8MHTA 4IHKA 4JMLA 4ZIRA 1K4MA 1PLKA 1RRVA 2X2FA 3OJEA 1ZMRA 3H9QA 1KZGB 3H5NA 4G5FA 3PNBA 1PCXA 3W2FA 2JBAB 3HTXA 5FB3A 2XXJA 4D4IA 5WRFA 1Y6QA 3OFKA 1XC7A 1TF5A 1FXWA 1HEUA 2ODAA 4FSHA 3SJAA 4YV7A 4ZHQA 2I0FA 3NT4A 2QPAA 3E9CA 3H9BA 1KR2A 3O4VA 3OCCA 4H4CA 3IE1A 4D99A 1ISHA 2PSDA 2ZBRA 3U17A 4WOJA 1EFTA 4DFDA 1RP7A 1E2IA 1TK2A 2BAGA 2ERXA 2EX0A 2GOYA 2HJSA 1VRCA 3RIMA 3V8BA 3KKKA 4CKCB 3RF7A 3AU9A 2RGNA 3VZDA 4LECA 3W8FA 4DSZA 3ADDA 3OPQA 2G76A 2O3QA 1C50A 4QXMA 4KQHA 1PFUA 3R5KA 1AXRA 4Z1OA 2VBCA 2PCLA 3CEAA 1LJUA 3UMVA 3NBXX 3ONVA 4BQQA 1L7VC 1FQKA 1L5FA 1TTPB 1V71A 1YIOA 2QTRA 2UZ0A 3M4YA 1U63A 2I5PO 4H1WA 4CDNA 2HLDD 4K2AA 4II3A 1PZHA 1DBQA 2VP5A 4JLBA 2IYUA 3F2VA 1CE8B 2ZJBA 3KRTA 1NLFA 3I04A 4PHFA 4J3JA 2W42A 1KDRA 1M1NB 5BV0A 1J0CA 5KS2A 3A05A 3GA7A 5I47A 3A9RA 2PSHA 1Z5VA 4NIMA 1VYTA 3ZE8A 3DULA 1LWOA 4RU1A 4RJLA 4OAPA 4MQBA 4F5WA 1QCYA 4MPPA 5CB4B 4W5RA 4IQGA 1VL1A 1DEOA 3VR6D 4BMXA 2C7RA 4Y9DA 1P9WA 1CQJA 4EY6A 2O7NA 3I2GA 4RCVA 1U6KA 3F7MA 1KARA 3SY8A 1GR1A 2B94A 2Y67A 4MWCA 3OCXA 3ADOA 4NZOA 1FSPA 1E3QA 2ZULA 3TB6A 2YWRA 3D3QA 1H8ED 1S1MA 1RHMA 5K4GA 3G88A 3BXZA 5IFKA 3LVRE 1CZLA 4G0XA 3SD7A 3RCBA 1MO4A 2PY6A 4YCMA 5JAUA 1VLJA 1EINA 1FP2A 1ADFA 1ESEA 1KO1A 2IHJA 1UBFA 3AKYA 1CFJA 2IQIA 1X8LA 1GQOA 2FE4A 3CNLA 2IEIA 4OGFA 3ZWMA 4LVUA 4E5UA 1CUJA 3TPCA 1KFBB 1EVEA 2H4FA 4KGXA 3GT4A 3H84A 2Z04A 2OGUA 4G8BA 1WZNA 3RBVA 3ASZA 1C4OA 4CMIA 4OV6B 5A3QA 4ZMSA 1XZ8A 4F4CA 2ACVA 4JKIA 4M0MA 2OORC 4J0IA 3OWHA 2HHHB 2XOEA 2QG6A 2QJFA 1YC2A 1XZAA 5T57A 421PA 4JI2B 2RAPA 3SEQA 2H4XA 3TB4A 2PMKA 1EWVA 3OA0A 5K99A 3DZKA 1MJGA 4OP2A 2QWXA 1FC0A 5C8YA 1L7AA 4BASA 5F9MA 1NVVQ 3I1YA 2NAFA 1WMDA 4OI2A 1VSUA 3WQSB 1UOPA 2CXRA 2ZAMA 5DGHA 5JNWA 4BN5A 2CXPA 2DCMA 4QODA 5L3QB 3OZGA 1QZ3A 2AI2A 2UZ4A 5DHAA 3DV0A 3M2PA 5JBIA 4KXMA 3VZRA 1Q7EA 4I9NA 5IUNC 2OBNA 2UUPA 3KKEA 4UTOA 4DIDA 3ICEA 4HGRA 1C4KA 4KO1S 1YS2X 3JTEA 1E7QA 1UPCA 2D54A 4UARA 1MEOA 3KLBA 3PPYA 4N7RA 1A9SA 4FMPA 4BOYA 3LFUA 3E7PA 3PEVA 4QTYA 5C7IO 2I3AA 3PGJA 4MVYA 4YRSA 4FS8A 2ZZMA 2AR9A 4X8LA 1KXZA 4TROA 1Z68A 3L7CA 1BKDR 2IEAA 4N54A 3CRZA 3IMCA 3AR6A 2AMYA 4P7JA 2CJWA 5LXTB 3M3DA 1G19A 3TNJA 3C8DA 1DHTA 3MXTA 3V6LA 3L92A 3AF2A 1XLTA 4Q1BA 2BH9A 5GIPE 3A9CA 5EMNA 1MBZA 5FBZA 5DVZA 2Y0EA 3KPUA 3TJZA 1XRRA 3OZWA 4OLFA 2YCBA 3L07A 4QUKA 5D01A 5EHXA 4UHKA 3T1VA 3L7BA 3SWWA 3O31A 1BDMA 3ISJA 1G8GA 3UJPA 1BWPA 2YXBA 2BF7A 3CEHA 1IPEA 1HRDA 2KQUA 1AKNA 3K70B 2EP7A 1CZHA 2NQTA 4HLUC 2BHLA 2CMGA 2YV5A 4A2PA 4BQPA 3Q12A 4IXTA 3MEQA 5JAIA 1GRNA 1UKYA 3BJIC 1OVGA 3L7OA 3STVA 5C52B 1TQHA 2VP4A 1TL7C 3D2BA 1UXHA 3PGVA 4KDCA 3D3WA 1CV2A 4UQLA 4NULA 5HUQA 4UASA 1SXPA 4GSKA 1DO0A 1N6RA 4Y1FA 5DM2A 4S04A 5E3HA 5T3UA 3FHJA 4BBPA 4MQMA 1I51A 1ZOIA 5C5DA 2GYUA 4HGPA 4AIRA 1DTSA 2UUOA 4IINA 3BL6A 3EQ7A 1KIFA 1CUZA 3PHGA 2JVKA 1OOEA 4Z4EA 3NVKI 2PX0A 1T9AA 1HTTA 3DL4A 4R7TA 4B3MB 3G8AA 2LW7A 3GXBA 3L8GA 3W3AD 5AI8A 4PBRA 3UH0A 3FOZA 1DCKA 4UEKA 2PA3A 2WUDA 3KOMA 4OHBA 1MOZA 3L1JA 1PX2A 2JAOA 1YCHA 3KKZA 4R4JA 4CRWB 5L3SB 3RVBA 4Q4DA 4ZYXA 4I1UA 1BSVA 3GPIA 1L5VA 3WNCA 2HGSA 3SR3A 4MP6A 3V7UA 1DS6A 3QEBZ 4M7OA 4L9AA 2B4AA 1PKXA 3EWNA 4HTFB 4XLZA 4FBMA 1EJ2A 2KI5A 3I6BA 2GNAA 3DR5A 3E35A 3K05A 1BIFA 4ASUA 2CCJA 4WAUA 4QLBA 3KR9A 1DQSA 3T7AA 1V8BA 3KB1A 3SF8B 2EZTA 3C15C 2GFQA 3LQYA 3MRSA 3PXCX 4GM0A 1F3OA 3T1NA 1TZBA 4O4IB 3GLIA 2E5LB 5KX5B 2LUOA 4DGSA 1LV8A 1COWA 2IYXA 3EDMA 3P2IA 3LBIA 5B3LA 2JHGA 3ZTTA 5TGZA 2ODBA 5A0VA 1GGFA 1ONNA 4FZ5A 4UEWA 4HQNA 1IXRC 1GADO 1PS0A 1M6VB 1XD2B 1AX9A 2Q2OA 1DWOA 3AI2A 4V0NA 1EXMA 3BTVA 5ICFA 4QEZA 3OOEA 5J59A 1E8DA 3I0ZA 4ON9A 4JUFA 4Z7NB 1YRHA 5AW0A 1CIJA 1K8ZB 4W7SA 1IULA 2Y8EA 1WXWA 3ZUGA 1P6QA 4F60A 1LY1A 1C1XA 2I1WA 1JFFA 2I6QA 2IDJA 2P65A 2Q3DA 1OXTA 2HBRA 3HB0A 2NVUA 3HUTA 3OC0A 3PDIA 1U7UA 4AZWA 2VJMB 2DHQA 2H9YA 4MA4A 3DV9A 1W44A 1XZCA 3LRTA 3NTQA 2I7CA 4BN4A 1GNVA 2XKJE 3IERA 4AP5A 2YC4C 2IXAA 1G4UR 1QJ4A 1IMJA 5KVVA 4AF8A 1Y3BE 4IL5A 2P2ZA 3G8BA 1ESNA 3OKPA 4R5HA 1UR5A 3C8ZA 1L5MA 1SA0A 1I4EB 2ZJAA 4TMXA 3RRFA 1NP7A 2JEYA 1OWPA 2B0CA 1XNGA 4M49A 3ZWNA 4DMLA 1REQB 4RTPA 5K09A 4X8HA 1JIVA 1CHNA 3RSCA 1ZX1A 1YJAA 4JUAA 3AY7A 4S24A 3ZQKA 4E07A 3JRXA 3KNZA 5KNBH 5EWLB 4C4XA 3RYFA 5JY6A 4B48A 1S5PA 1BH2A 1P1BA 1SBNE 2HX1A 2Z9BA 1EA7A 3JAWA 4J91A 4MMYB 3O1IC 1XTSA 5I7SA 1EK2A 3NORA 3OP1A 4D44A 1Z0SA 3LP6A 3MTQA 4QHTA 4EFMA 2UU9B 1JEYA 5CCDA 3QOYA 2C5AA 3AV0B 3JSXA 5LB2A 4BVKA 1RFLA 2XE4A 1KS2A 1L9XA 2P4SA 4Q9DA 4RTLA 1XPRA 1F0NA 3FYDA 2CNLA 2XUFA 1USGA 4FZRA 4D43A 2OUIA 5KZMB 2VNIA 1JE0A 3WGLA 5LUBA 3RODA 4NFSA 2QW0X 3WKCA 2H8KA 1Q95A 4GPBA 3GDGA 4FFWA 1GTRA 2XDWA 2Q4OA 4JI8B 1BNCA 1W4AA 5HZKA 3UWSA 1DHRA 3T3GA 4D9MA 3JQFC 4GNKA 3W5CA 2EYQA 3E48A 3OZDA 2JIMA 2IPXA 3CW2A 4UPDA 1QYWA 1CCWA 1E1NA 4KN5A 1UDBA 1Z4NA 3L6RA 1JFSA 2GCEA 1F60A 4ENRA 1EB8A 2C8JA 2HJRA 3MGCA 1Y63A 5KSOA 3SDSA 5B6IA 2J3EA 5BN3B 1VL2A 5DTQA 4LS3A 3TGLA 2PDAA 3BSFA 4V0SA 3DE4X 5BUZA 2O0JA 1ODKA 3W90A 3LUGA 2WB4A 1J0DA 1CR6A 2IELA 3QIAA 4EF6A 3WLKX 4EG4A 1T8SA 4QJ5A 4W8GA 2VHEA 3BD8A 4QU9A 4B3HA 1NE7A 4PTYA 3UUWA 4BNVA 5BUSA 4QOHA 3PJGA 3JQRA 4XR9A 3KQHA 4ZDKA 2RHRA 2VYFA 4ENWA 3NIGB 1PR1A 5KINB 3WIOA 3KTFA 3OEED 2QIPA 4BE4A 5TIIA 3TCNA 3CEPB 1JIUA 3KZNA 3U1BA 4IDGA 4O4HA 3WGOA 5IUJC 1M5RA 1HK7A 1VM6A 1N0WA 4YGYA 3EBPA 3WB9A 2ZB8A 3V80A 2ZTMA 3H19A 3AF1A 5DI3B 4QECA 1QU3A 4M1OA 2Q0QA 4D0LB 2QZPA 4C78A 1X7YA 1UH5A 2IXDA 3FWHA 3AEQB 2W6IA 4YJHA 2BM0A 1E9VA 3WLAA 5JNLA 1I9CA 1ST2A 4EIWA 4FBGA 3OQMA 4S1TA 3B89A 2JA2A 4QUAA 1FYWA 4TV9A 4DSTA 1XNRB 5CXXA 2YJ3A 1UJ5A 1NC1A 2M6SA 4BEJA 2AE2A 4HXFB 2VXYA 4EI8A 5K1ZA 3AHJA 4GOOD 4LCEA 2ASVA 4WNCA 4CQMB 2AL7A 2JD2A 3D6VA 3II6X 3O3OB 5IBQA 1DX4A 2J9FB 5C81A 4BP8A 4L85A 1LF5A 2H0QA 5CGQB 3JPYA 5AI9A 4F4DA 4ZODA 4XWGA 1OJ7A 1KP3A 4RZIA 3KXPA 5IJXA 2P7IA 4JQOA 1YR8A 4TWBA 3UB3A 4RVGA 3F4BA 1I7LA 4OQEA 3DXFA 3S2ZA 1HSOA 1VPLA 2EKQA 1B42A 1LPSA 3BCRA 2C9DA 3DO5A 1YCFA 2M98A 3A1FA 3NIWA 4IICA 1TLFA 4M1KA 1S8OA 3QVUA 3RT9A 3C1OA 2OXIA 2A0XA 2P11A 1X1TA 4IDNA 3DDUA 4L5CA 5A5GA 1VP9A 3IVGA 1NXTA 3PT5A 4IHJB 2DPGA 4OAOA 3T1YB 4UHCA 3V2UA 2KM1A 3AVOA 2K2QB 3EQ8A 3RFCA 3U3DA 3DZGA 1Q91A 1SFRA 1UQTA 3F2IA 3O8OA 3R5SA 1J0EA 4O2BA 4KMMA 4C4PA 3U19A 4JC8A 3FFXA 5E6RB 2VZ0A 3HFJA 2WYIA 4OB6A 3RT7A 4AU1A 5L4SA 3CMCO 4OTZA 2PKQP 3IFSA 3MTJA 4TM8A 4LIPD 2QTBA 4X41A 4Z8XA 5F5XA 5GM2A 3V8NA 3VOBA 5HW0A 1C3OA 4BS9A 3VPDA 4DA7A 1F2UA 1AMUA 5JD5A 1G8JA 3HKDB 2QV0A 1GY8A 3DFUA 3TLXA 2PGOA 2H11A 4L5BA 3WZ2A 3EMVA 4BNFA 3DGFC 4IQ8A 3EZNA 4MR8A 4A1FA 2RGAA 1ADCA 1G21E 3VYSB 2OY0A 1G2QA 4X97A 3GGCA 3NTUA 4RUKA 1OWOA 4PXYA 3EPPA 3Q87B 4K28A 4LZNA 3LO5A 4MS4B 2KB0A 3KQKA 5CM8B 5LUAA 1EM8B 4HUQB 4NZYA 2V3CC 5EYPA 2HDOA 1Y1RA 3NAMA 3ZE6A 2B37A 1HQKA 1ZCAA 1W9HA 1U3FA 2CWWA 3E1KA 3TVDA 1ODLA 4D8WA 1W94A 4WZBB 1ZRHA 4GI7A 2C2GA 1V35A 4PIMA 3CZQA 1KZ4A 1TAGA 3F6EX 1LI4A 2RFLA 1ISFA 1KYWA 1ISMA 3NM6B 4OHOA 1ESDA 3CVVA 2EVWX 1ORDA 3VDXA 4ARVA 1SUBA 4NJEA 4BO8A 5CA0A 5JW6A 1A9ZA 1NY5A 3K6SB 4JJ6A 4R2HA 3PKJA 5KWJA 1GD1O 4M1MA 1W88A 3OHPA 2CXSA 4FGLA 5JSUA 1OIWA 4M9QA 5A7FA 2R7NA 3GMTA 5B1EA 1KQ3A 4HDMA 3IEVA 4U39A 1SOWA 2YVLA 4ZCIA 4OHMA 3FE2A 1E6MA 2PZFA 3GEBA 2P3OA 1UFVA 4U0JA 1GUAA 2GYYA 1BXZA 1DC5A 1PS9A 3B5IA 5BOSA 2AJTA 1NZDA 1AMNA 1ADYA 4M0UA 1HF3A 4NONA 3ASYA 4E5KA 3CV3A 5CUQA 5E38A 4KFRA 4U7HA 3CGGA 2KWIA 3FI9A 3TXAA 2OV1A 3CWZA 3NEAA 3QKUA 4DCNA 2VDUE 2B4YA 3FVVA 2HJGA 3QXJA 2AYZA 3O2NA 5JC1A 1YFZA 1DRJA 1YB5A 2XMCA 2ZSBA 4CKZA 4NYMQ 2OR3A 4RNDB 3GIDA 3FFAA 2AQ8A 4ZZ2A 3H6GA 3JASB 3I23A 1X9IA 4MQ4A 4KXVA 3DNFA 5H3LA 1KDVA 4HDSB 5CH3A 4QJ4A 4C87A 1SOUA 4IG9A 1DLJA 1N75A 3G5MA 4JT9A 1XYGA 1RYHA 1Z0DA 5GOTA 4BQEA 2M32A 3STTA 3CUYA 1ECPA 3O21A 4OGWA 3K94A 5H9VA 1L4FA 3QFFA 3PEWA 1S2MA 1AA9A 4QBIA 2HQOA 4D3YA 3MJFA 4JBGA 1IUOA 3JWJA 4BMZA 4D9BA 4LV8B 1IC6A 4OQDA 4NAVA 4ER5A 2RONA 1ZOPA 5BQPA 2GO1A 4QXRA 5CLHA 2DPHA 2BM9A 1HDIA 1L4EA 1WP9A 1KE2A 4AMYA 4CEIB 3OJXA 3A27A 5PGMA 4MWBA 4AZTA 2FG7C 1V43A 4DQXA 4HPWA 1SQFA 2BRUC 1QYVA 2R48A 4CM5A 2VP2A 1RXUA 4AZ0B 4YAFA 1C7JA 3EQ9A 3G82C 5EKDA 2HXYA 2PYZA 2IJGX 1GPWB 2QP4A 1CG6A 2AYXA 4LRQA 3DO8A 4RIFA 4WJLA 3KLPX 4YPFA 3KSMA 3AX6A 5ITZA 5H3HA 5ALIA 4W63A 5JNUA 1IDOA 1TU0A 4F6RB 1I3LA 2AJCA 3NEPX 5C1BA 3FPBA 1GA4A 1JBEA 3D8UA 2O8BB 5CA1F 2QN2A 1GRVA 3VHXB 4GPAA 2HRQA 4Q0MA 1W2GA 3UJ7A 5I45A 3LJKA 4RZHA 4RKFA 4I6GA 3IPCA 4PU0A 4F8EA 1HE2A 5LNK6 1DJLA 1K0FA 1U90A 3KZKA 3OCVA 1UBTS 4LMAA 2ODWA 5G3YA 2FAXA 3U80A 1V16A 3KLOA 5KYXA 1DIBA 4QM6A 1ND6A 1XMVA 3D2AA 3EZ2A 1LI5A 1KZ6A 3TUIC 1I10A 4BWYA 1X7WB 3KWLA 3B3GA 2VZ8A 2YIMA 3DDCA 3DV2A 3KZOA 3EPJA 2G8NA 5K45A 2O19A 1E0JA 3H9EO 2P9HA 1LDEA 4XB1A 4GUAA 1AF7A 5CG1A 5EZYF 2CT8A 1CZKA 4YUXA 2G4LA 3RREA 5BSHA 5ITWA 1AKMA 1E5XA 2PYIA 2YN0A 1CUUA 1Q50A 1UF9A 1CNEA 2RGUA 4C89A 5B3KA 1NBAA 3PFIA 1ZIYA 4IFBA 1BD4A 3I6IA 3S29A 4YUYA 5JDIA 4OQNA 3A2MA 1N3IA 4ZI7F 3AMVA 4H6WA 1TO2E 2WTAA 1IXKA 3ETNA 2MR6A 1H1LA 1N2ZA 1WMBA 4HAVA 3V8EA 3VXKA 2YHIB 3GLHA 4EGJA 1XMQB 3CN7A 1Z74A 4GE3A 1UKVY 1CJVC 4PONA 1Z25A 5IVDA 5FTLA 1EX7A 2CNNA 5IYZA 4FFPA 2WRZA 3WMGA 1QOQB 3TD2A 3N5KA 5KYNA 2J45A 3RWMB 3HM9A 1O87A 2C2OA 2C29D 1II0A 4IQFA 4JI3B 4EBBA 2NX2A 1BXGB 4Y2UA 2W6OA 4RA6A 1JEJA 1IH8A 5EMHA 3WWYA 2JANA 4D3SA 4GT1A 1C3XA 3E8MA 3RS2A 1X7DA 2ZBUA 3AIKA 3O1HB 3MOGA 3A1UA 4KPGA 2OBLA 5JEEA 3MRVA 4RSGA 3OF5A 3CSSA 3CPHA 4L75A 4IIJB 2R6JA 5LBTA 1GZSA 2J3KA 4RX1A 4UXJA 4B09A 1Q5PA 4MQ6A 1MLDA 1OLXA 2YH2A 4Q48A 3WWDA 4NR0A 3K1AB 3WYFA 3QWBA 3ZDRA 3LRPA 3C7AA 5JISA 4NQZA 4UVGA 3PX7A 1RTKA 2HTEA 1E8NA 2GBPA 5FP0A 3ZHSA 1ARZA 1W25A 2VAPA 4K6GA 2PFGA 1UBRS 1MKYA 3LL4A 2QD4A 3G1WA 4IJUA 1GG2A 3WMRA 2WVJA 4X90A 1NSFA 4HEHA 1EG2A 2O52A 3U1VA 1BW9B 3DLHA 5A9TA 1RMYA 2JIZA 1XDDA 3AI1A 3PDWA 3FLEA 3PIDA 2O54A 2GCNA 1VHTA 1NKTA 2NM0A 2RBKA 4Y2QA 4HDKA 4BB6A 1BHSA 4INPA 1XXHE 3S2SA 2FPPB 3IVAA 4OXKA 5EXXA 2B98A 5C8VA 3PEYA 1YNOA 3FWNA 3WIUA 3OZUA 1RLOA 1ZW1A 1ULSA 4QLAA 3X3HA 2JGDB 3V4OA 1L5ZA 2ZJ1A 4UM8B 4AJ9A 1NXXA 2GHQA 3RK1A 1HDGO 3CURA 4RTOA 3JYHA 4UXHA 5BSMA 2XGGA 1YDHA 4II2A 3PXBA 1B3RA 3DTYA 2Q1WA 2FYTA 5LZ4A 3HN6A 2BEKA 3AJ9A 2AMFA 3KJHA 3LY8A 1E66A 5EIHA 10MHA 2PANA 3EASA 5BQOA 1QYDA 5CLQA 3NBAA 3HFSA 4LHXA 4GLOA 3WO0A 4KX5A 5FBVB 1JKIA 3FDZB 4CM4A 4DZZA 4Y2SA 3UT5A 4L27A 3RUEA 1XQ6A 1X8KA 3WJ2A 2V7QD 1ENYA 4G0WA 3DO6A 2Z58A 3IPXA 5KKCA 1FZTA 2CDBA 2X4LA 5CXSA 4D56A 3EDOA 1F0PA 3CNNA 3H1PA 2QKYA 1MOPA 1SVMA 2JIPA 4PAMA 1SCQA 4HB0A 2EW8A 1LRJA 3A2LA 1HYHA 2A58A 5LKAA 2GDJA 4AJNA 1TVKB 4URFA 2PUEA 3LLVA 2BFOA 2CB0A 1KMHA 2R3SA 5HFAA 5AUPB 2OHHA 3GZNA 5DULA 1ID1A 4XCXA 3TZ6A 2EBFX 3EWSA 1ATZA 4A4DA 2JI8A 1V9CA 2W2KA 3VPGA 4Z53A 3UIEA 4ZU3A 1XHEA 3EVEA 1RFGE 2Q6IA 4CG2A 1E3MA 1T9CA 4PCLA 1E96A 1BJRE 1PJ8A 1WDLA 2F67A 1D4OA 4B2YA 5AW9A 1K4YA 1U5AA 2Z2IA 1XVVA 3I0NA 4CIBA 4NRDA 3L40A 2GEKA 4GZ3A 3JQAB 3MCUA 4N5MA 3MT7A 3BRWD 4E7PA 1ZXLA 1WSDA 1XEWX 2HFKA 3NYRA 5FULA 4EVQA 2QTGA 2P67A 5EVJA 1PFQA 3PZRA 3VPHA 3ZK7A 5ADUS 3VNAA 4LDNA 3UGTA 3BXFA 4P7FA 4QE3A 4DM7A 1QS0B 4DDUA 4YQEA 2CFCA 2H2IA 5SYMA 2ZUEA 3AUAA 2ID8A 4CMHA 1LH0A 3X0DA 5JAMA 4DWWA 2PUBA 3LKDA 3HXKA 3RS9A 1RLMA 1V37A 1NI3A 3PCXA 2NTYC 1G3QA 1QV6A 2PGXA 2TS1A 4J75A 1MVOA 4WESA 2Q21A 3GLGB 1HG0A 3LVQE 2R85A 2VJLA 1KDOA 4QHYA 4BO6A 1OI3A 4HDNA 4KBGA 4WZBE 3QVMA 2XJ4A 3WK6A 5ADWA 3JSAA 5H9WA 4DLNA 3RR2A 4CUKA 3N2EA 5AI0A 1PHPA 5LWQA 1CU1A 1TW2A 5CX1A 1S89A 3L41A 1GGJA 2Q3BA 3KQOA 4CIYA 2ZIAA 5CFQA 5B4VA 5IF3A 4HNAB 4C2AA 4CM7A 5KNBD 2HJ9A 3HEAA 2N47A 4NDAA 2XBLA 3WKDA 4A0HA 2J09A 1QHHA 1A1SA 1LNQA 1H0RA 3AI7A 3EK2A 3FAKA 3H2JA 3QPVA 5CM9C 4PO1A 4AO7A 5F23A 1RZRA 3QE2A 1PK8A 3QU9A 2R8RA 3R3YA 3R75A 1X7HA 4PRYA 4YV1A 3BHIA 3BREA 4X91A 2WUWE 2WSLA 3EA4A 4PG4A 3SQOA 3T06B 2HCJB 4FB4A 2A94A 2VDRB 2A5LA 1AHIA 1QQBA 1I3OA 4N47A 5KNDH 2JFPA 1PUXA 2A9OA 2C3MA 5G02A 5KMGB 5A9SA 1HT3A 1J0XO 3NTRA 16PKA 3WGGA 4AMVA 5A4IS 3MJHA 4GX5A 3LFHA 4TT3A 1XDGA 4DARA 4FS3A 3DZCA 2VNSA 2CV0A 4QFDA 2JHCA 2VLBA 4IOJA 2BP7B 4TT8A 5F12A 5FNVB 1NX6A 3HMQA 4NJOA 2CLFB 2RGNC 4TMKA 2DHCA 2DHRA 5G4KB 3ELDA 1X8JA 3U4QA 1ZUWA 3LQ4A 1OU0A 2IY9A 2GMWA 1NPYA 2H63A 2OUKA 2WJHA 2ZT8A 3KOOA 4K40A 1P9RA 3LTEA 4P3NA 3VR0A 4JBIA 1P5ZB 2ZROA 2FPWA 2IOFA 2VUUA 3E81A 5LCXA 3RFXA 3GA5A 3RK0A 4B8ZA 4MUYA 5LA6B 1U0SY 3IUQA 3N0VA 4YI3A 4Q3BA 2PQMA 2G6BA 1O03A 2CBGA 3JQEA 3JWGA 2H4WA 5IZ4A 1XA3A 5DWQA 4PNPA 1TU4A 3W6OA 3SCZA 2NXCA 5L95A 1GLGA 3LLUA 4IIVA 2ZT5A 4CM6A 4I3FA 2BHRA 2LV8A 5CNIA 4RD0A 4NMHA 1P31A 4Z2YA 1JA1A 3HV2A 5AQ1A 1XMJA 3ZZTA 4O25A 2GN1A 2CFTA 3ZZNA 2JDIA 3K32A 3OIWA 2W48A 2VSYA 3FCEA 3UENA 1UP4A 4CG1A 5CDFE 2BKUA 4U8HA 4OA8A 3P2MA 3IJEB 2BKLA 2GTIA 4PPQA 1HNXB 1WKVA 5U1PA 3CX8A 5THXA 1UPTA 2HLDA 4CEJB 4RORA 1I3MA 3DJFA 5DNDA 3RYHA 2VPIA 3QK7A 4M1ZA 3TOXA 4I55A 1VLMA 5GINE 2OAGA 3Q9NA 1BMFA 3LIPA 4ETMA 2VWGA 3VDQA 1LBIA 4CKWB 3ORRA 1I1OA 2P3LA 5IVPA 4YT5A 5JXHA 3GJ3A 3HDTA 1PWEA 3BQ9A 4RVOA 2XD9A 1J70A 4URHA 1ORTA 2FHSA 2IXEA 3T52A 4B35A 5BWOA 2A9QA 3EZGA 1YZKA 1HFEL 3V4VB 5PNTA 3BHMA 4FFMA 1DFHA 1Z0JA 3AZQA 3DZIA 3FKSD 3U3XA 4IGAA 2WAXA 2PGDA 1JU3A 3QMMA 1T26A 4IHJF 3L1IA 4A8TA 1X70A 3A3PA 1L4GA 1RQXA 3BWDD 1EGVB 2WINI 4K87A 3DW1X 3UJ8A 2YMLA 5TLSA 3CS3A 3K31A 1RQLA 3OJWA 1HOXA 1KY2A 5CXUA 5FNZA 3KT6A 4KO8A 4O33A 3OQOA 2YJ6A 4PZZA 3KWMA 4HFJA 3AJRA 4LVOA 2W93A 4DR3B 1LLCA 3OTHA 4CM8A 3R0VA 4QDOA 2EYUA 2ADFA 4IX1A 1E2HA 4H35A 2O3RA 3HY4A 1P74A 3RS7A 1W581 3NEYA 3CLSD 5AO9A 5IAEA 5DYGA 3FRHA 3AUSA 4KE6A 2BHSA 3OU7A 3K9BA 3ZHQA 3U7HB 4DG9A 3DEHA 4C22A 3PQCA 4E7OA 2WYHA 4QWMA 3BULA 1T35A 1VMKA 2Q8QA 4E2XA 1VI2A 2F59A 1CD5A 3K5HA 4GX0A 4P0QB 1L7NA 2Y27A 1B74A 3G85A 4G1VA 3IPAA 1LTHR 1CUHA 5M2QA 3TEMA 1ZM2A 2J3MA 4MK4A 1FS4A 3VGPA 4ABYA 4E1AA 2Z98A 1G1AA 1N2OA 5CAEA 1BE1A 3ZGLA 1DEKA 2I67A 1XLTC 2RI1A 5IKXA 4CMKA 1Y1SA 3STXA 4B4KA 4CXMA 1FIUA 5CG2A 5G0WA 4PLFA 3Q11A 5FWNA 2IHBA 3KXDA 1VE3A 2C59A 3EW9A 4Y3UA 4G81A 1DMSA 3TVYA 4AN4A 2PUDA 4EG8A 4P0TA 1TM3E 2PWZA 2XRYA 3ZZUA 1MHTA 3ET4A 5LYJF 1GTZA 3EW7A 3OOWA 3LUBA 3R3ZA 4M87A 2DFPA 5DYTA 3NALA 4RHCA 5AW3A 5B58T 1AD2A 1JV2B 2RAVA 4RANA 2JK0A 2VDVE 1NXVA 1V11B 3AR5A 1FFXA 3EG5A 1I1HA 1L8OA 4RL6A 4U5QA 2QRNA 2ICAA 3RSSA 3S6JA 3W9YA 3QUTA 1Y7LA 3HDQA 1MQAA 4DUGA 1IN7A 8AT1A 1A50B 4Q6BA 2CNOA 5LPNA 5H4HA 2RGRA 3ZJTA 2PL9A 1ZJ5A 3IVRA 3E4DA 1ULTA 4QOIA 3D1LA 2J5BA 3D7LA 1QXSA 2I2AA 1QGDA 1Y34E 3LCMA 1JR3E 2GZMA 2NAPA 5JVDF 2ZWPA 2H48A 3CRNA 2JLBA 2WJZB 2D5AA 2EKDA 1DV2A 1RCFA 2BEWB 2WPDD 4UUQA 5ECDA 4AXXA 1MABA 4JYBA 3NBFA 2HBYA 4L08A 3G2JA 4P31A 4YRDA 3TLYA 1QRTA 3R9WA 4B0PA 3MFYA 3AR7A 3HB4X 1QVRA 1P17A 1BU8A 2F48A 4JLUA 4XDYA 4DHEA 7AT1A 1KJ8A 3CO5A 1WB9A 1ZSVA 2A0KA 1GGMA 1M8KA 2HSJA 4OFXA 4DC9A 4Z4CA 5KJ6A 3OD5A 3V9AA 1QB7A 3ZE7A 4UNPA 2IDMA 3U39A 5B1YA 5GVRA 4C7BA 4CHTA 2C03A 2I99A 2HJHA 3W1WA 1E99A 1CIVA 3DBLA 5H3CA 5CBPA 4GOKA 3PB3A 3ZE2B 3U44B 3CEJA 1K2WA 1H6BA 4QUDA 1FUKA 1TX4B 3C6XA 4IP0A 5C32A 2EBUA 3IQEA 5IKEA 1Z2EA 3W3AA 2JJYA 2R44A 3RVDA 4EDHA 1OUMA 2EZUA 3OSUA 1FQJA 1ZITA 1YI1A 2EW2A 2HEGA 2G9ZA 2ODQA 3OHSX 2FMKA 1X1DA 1CWUA 4I8XA 4PYRA 5AT1A 4EMUA 2XYPA 4MRMB 5IKOA 2EWMA 4IRUB 3ZI7A 3AKEA 2WC1A 4KITB 1A4IA 5AIAA 2VHXA 4AYXA 2ZYUX 1VCNA 4IYRA 4ZT2A 3OHMA 4GMKA 2YN4A 1V2GA 2P5SA 3A1WA 3BXHA 1D2HA 3G9QA 4C30A 1AKYA 1KU6A 4CF7A 5I3ZA 3KL2A 1VG0B 2VXCA 5KU7A 3LLSA 1J06A 3CN9A 3FTEA 3DKKA 2ZCUA 2D59A 4RHUA 5ALJA 4KTVE 4EJ0A 1RJWA 3PD0A 4LE2A 2B7LA 1XGKA 5JYBA 3C39A 4H27A 4YJ2A 5LQNA 4QYSA 1KPIA 4KE7A 1U2SA 4US1R 1PBNA 3OURA 4HS9A 2OPHA 2XCTB 1GPLA 2W6PA 4QICA 4U0KA 5BR1A 5I6DA 1HV8A 5F51A 4F5EA 1E58A 1DAOA 3WLHA 3DOUA 3GCDA 4XJXA 2IPMA 1W34A 3TGWA 2ZJ2A 1E6CA 2V8OA 3K72B 1VJ1A 1MUUA 1T8PA 3ANLA 4U6SA 3V4ZA 4ESOA 5IULC 3SXJA 4I9FA 1TCBA 1TKCA 1V4BA 1R0LA 2X6RA 2XUOA 3O0DA 4WCFA 5DGCA 2QX7A 1BOOA 5LLSA 3TDMA 1UZMA 3C74A 2R5FA 2WSIA 3QXCA 4H0FA 3GLGE 1E77A 4FUTA 4UMVA 5A3VA 4GS5A 5C7OO 1KYIA 1E7WA 2O7SA 3PEFA 5CFMA 2CXNA 2Z4TA 3MWJA 5ALSA 5DPMA 2CCGA 1USKA 2P41A 4ZEOA 1D04A 2GZ1A 3P97A 4IM7A 2Q2WA 4QREA 3E0QA 3HB7A 4LDPA 5GJVC 1PUJA 4D8TA 3KHTA 3OX2A 3CRMA 1NONA 2HBQA 3HWRA 1ECLA 5EIEA 5JYEA 3GGDA 2R5NA 3CZPA 3I76A 2H9IA 3LCCA 3O8BA 3R8XA 1Y3CE 3DEAA 1S9DA 4HNRA 3ZHXA 1EMDA 1UOOA 1BEUB 3MT9A 2SNIE 3N8DA 1L7PA 4EVIA 2PX3A 2F9FA 2GPNA 3MB8A 4ZYUA 1E3TA 1DNPA 2X0RA 3TL2A 4D5GA 2I80A 5BYAA 3EPLA 2RGEA 3ME5A 3UJNA 3E22B 1L5GB 1P0CA 3GK3A 4EELA 2PS3A 5G40A 4CKBB 1VKOA 3O8QA 1Z75A 2QT0A 1K6JA 4N5NA 4XDZA 5ICCA 3KPJA 3JARB 1MJNA 4B6OA 4U3JA 2J9XB 1K88A 4JBHA 4RVSA 4LYJA 4KEAA 3VTKA 2G77B 1LSSA 3SKYA 1QV7A 2F9LA 5IVKA 3ESXA 1F9EA 2WWVD 4F4HA 2PRSA 4IV5A 1GTVA 2ZREA 1JU4A 3V8MA 2BEJA 5HHTA 1F20A 3FFWA 4I3GA 3T8YA 2RJNA 1JTFA 2QJRA 3NHLA 5CB0A 2R7KA 4H2DA 2PLWA 1G6OA 5FKJA 4INAA 3FWKA 3PGMA 2CDNA 3HQ4O 4BVHA 4MHTA 3BWMA 4ZQGA 4LFCB 1JFLA 3ROMA 3QF4B 4EHFA 4AS1A 2PR7A 1UAGA 2O8VA 2YJGA 4I9UA 3GRAA 4V1CA 1M2OA 1YZTA 4C7XA 1DTEA 1QM5A 3AETB 3C6BA 2E5WA 3DHNA 4HGNA 3ZLUA 4E4RA 5GOZA 3LRXA 5LMCA 4PQYA 2Q4EA 2WFLB 4U7WA 2FW9A 4A23A 4PG7A 2WJJA 3HGTA 4YECA 3RSOA 5FV4A 1OXVA 4MWTA 3BGOS 4EFLA 2YBEA 3M6VA 1ONBA 1UFRA 4IDDA 5CM2Z 4A8JA 4LF4B 3ABSB 2J4CA 2RHCA 3GJXC 3QPWA 3RVNA 5F2EA