3A1NA

Crystal structure of l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
315
structure length
315
Chain Sequence
MILVTGSSGQIGTELVPYLAEKYGKKNVIASDIVQRDTGGIKFITLDVSNRDEIDRAVEKYSIDAIFHLAGILSAKGEKDPALAYKVNMNGTYNILEAAKQHRVEKVVIPSTIGVFGPETPKNKVPSITITRPRTMYGVTKIAAELLGQYYYEKFGLDVRSLRYPGIISYKAEPTAGTTDYAVEIFYYAVKREKYKCYLAPNRALPMMYMPDALKALVDLYEADRDKLVLRNGYNVTAYTFTPSELYSKIKERIPEFEIEYKEDFRDKIAATWPESLDSSEASNEWGFSIEYDLDRTIDDMIDHISEKLGIEGKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Binary and Ternary Complexes of Archaeal UDP-galactose 4-Epimerase-like L-Threonine Dehydrogenase from Thermoplasma volcanium.
pubmed doi rcsb
source organism Thermoplasma volcanium
molecule tags Oxidoreductase
molecule keywords NDP-sugar epimerase
total genus 120
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2009-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3a1nA00
1FJHA 2OBNA 4JGBA 4E2WA 2QRJA 4DREA 1Z7EA 3AI2A 1E0DA 1XHLA 5A1TA 5B12A 3VDRA 1HZJA 2RHRA 2IDZA 1C1DB 2ZIZA 5TF4A 4BNXA 4XEHA 1KVTA 4NG5A 2PA3A 4LRSB 4Q3CA 3LK7A 2EP7A 4D3SA 4R01A 4GSKA 3DBLB 1G1AA 1JTVA 1T2FA 5DOVA 3GF4A 4FFLA 4R5HA 5KJEA 4IJWA 2C54A 1PR3A 4LN1A 5BSHA 1MFPA 3HUDA 3MEQA 1E7QA 1MFZA 1R37A 5B1YA 3GUYA 3PEFA 2AQKA 2BFPA 2VCYA 3GUCA 4IDGA 4AL4A 4FBGA 1C0PA 3UCXA 1GZ4A 5T6BA 3TFOA 2PZJA 2YZ7A 2BGMA 5JYEA 4LVUA 5COQA 4XCVA 2C07A 3ZHXA 1KVUA 3CSDA 2EJWA 1PIWA 1ULSA 1UXHA 2NLOA 4JROA 4Q9NA 3UFXA 1DFGA 3RASA 2PKRA 2QG4A 3NDJA 1HDZA 5ITWA 4Y67A 2GN9A 2NACA 4DQUA 4BNVA 4WUVA 1PJSA 5EQDA 2XOXA 5JAZA 3ZWCA 1LSUA 4BOYA 2TMDA 5DNAA 1BHSA 3ZH2A 2V6FA 3ZWWA 4JP2A 3AOEA 2CDBA 2OZPA 1Y9AA 1KYQA 3B1JA 4TZTA 4CL8A 2W2LD 5A4DA 1W0CA 5IG2A 4BMNA 1YDEA 4Y98A 4F6LA 3ONDA 4PFJA 1ZK0A 3Q0EA 1JVSA 3TL3A 4C7KA 4CUZA 3ROKA 4RF2A 2Y1FA 4YR9A 4NPCA 2G76A 4YPOA 2C29D 2B5WA 1GEGA 1P1FA 3ENNA 1HWYA 2I67A 4TRNA 5JY1A 1IZ0A 1GTMA 1PS0A 1O94A 1U8FO 2YV1A 1EEHA 3HQ4O 1H6CA 4XGNA 3WLEA 5I7VA 1NAHA 3BA1A 5KWEA 2G1UA 4IJUA 4YJGA 2FHSA 3OIFA 1A72A 3OBBA 2HK8A 1Y8QB 3JQ8A 1O8CA 4XIJA 5IFLA 4IS3A 1X7DA 2QZZA 2DUWA 2YW9A 4KTVE 2W90A 3JD1A 1QLHA 1P1HA 2WWRA 3D5QA 5H83A 4BNMA 1E7SA 4CMKA 2DC1A 1LC0A 2FPIA 2YV3A 3Q6IA 2IZ1A 1I30A 2HMSA 4N18A 3OHSX 1ENYA 2Y1DA 1B26A 3K9QO 3PTZA 4ALKA 2I6TA 1G6KA 1QRRA 3PLRA 4OYRA 4IMPA 3I83A 2PLAA 1EZ4A 1DHTA 5JDCC 3WDSA 4N5MA 4UULA 4J1NA 1PL7A 3GY0A 1C0LA 1PSDA 3CZRA 3H65A 2JHGA 4NBUA 3ADOA 1Q1NA 1GUZA 3INTA 3L6OO 1QXSA 5COAA 2H1SA 5DT9A 1YONA 4J49A 3GH3A 3WICA 3MTGA 1ISMA 2H6EA 3PK0A 4XQ9A 3ZHBA 1VRWA 5JAIA 4WGGA 1DB3A 4TVOA 3TOZA 1GZ6A 3AU8A 3RBXA 1GZ3A 3JD0A 5A04A 4E12A 4R1TA 4BQRA 3MZ0A 1ZK2A 1GY8A 4PZCA 3C8MA 2AG8A 2VYVA 4CV1A 4HFMA 4WLOA 2G0TA 3JYPA 1B8UA 2NU8A 3JQAD 1WXDA 2OHXA 1J5PA 1Y5MA 4H3VA 4J16A 1E5QA 1Z6ZA 3I6IA 3M2PA 4FOSA 4BNZA 2B69A 2Q49A 1YL7A 1GU7A 2B4QA 3I4FA 4L4SA 1LX6A 1PGNA 1X14A 1X7GA 3HHPA 2GN6A 4XGIA 3V1UA 4DIOA 1C1XA 3KYCB 3MJVA 4PN3A 1PJQA 4QUKA 3I4CA 1SC6A 4GWKA 4W9NA 5FWNA 2FMUA 4EJ0A 3R3SA 3KSUA 4I5EA 3KETA 1XU9A 5MGBA 1WP4A 2RIRA 2HRBA 4DBZA 1LLUA 4W82A 2VYVD 1JVBA 2J8ZA 4P4NA 8LDHA 1LDMA 1X15A 2Z1MA 4FQ8A 3HSKA 5JDIA 4M89A 1RM4A 4CM7A 3UF0A 2NVUB 4CUJA 3I9MA 3MTJA 3GVPA 1J0XO 1CDOA 4PLGA 1QKIA 4ITUA 4XYEA 4R16A 2FSSA 1HZZA 1UH5A 2R2GA 3PFWO 3H9JA 6LDHA 4L9RA 4QX6A 5DBIA 2R00C 3FBTA 1TT7A 1YB4A 3WGHA 3GN2A 3ZU2A 1PQWA 1DRWA 3ST7A 3C7CB 1GV1A 2D2IA 4FC7A 2BFMA 1T4DA 3JYLA 4GKBA 3SBOA 1QYXA 3ZV6A 3Q2KA 3VAZA 4RF3A 1X13A 5BSGA 2YUTA 5L7TA 3KYBA 1SZJG 1T1RA 3DZHA 1EE9A 2Y0CA 3B20A 1R16A 4IZIA 2FRDA 5L4NA 2X5KO 4Q3NA 1MG0A 4KZPA 4TVBA 4GX5A 4Q3BA 3I9NA 2VUTA 3EHEA 4IBOA 3TPCA 4ZQGA 5JS6A 1LDEA 2DVMA 5IXSA 1ID1A 4CMIA 4O5OA 1UDCA 1KVSA 4OJNA 5ES3A 2Q2VA 2NU7A 3K30A 3WSVA 2V6BA 4YCAA 1V3VA 4DPLA 4BO7A 1F17A 1XR3A 3QVOA 3GG2A 3JQGA 3DHEA 3JQ8B 5T67A 4YAJA 3L4BC 5ER9A 3P5SA 2NADA 2X9NA 3BTOA 4FPXA 4RPHA 3E03A 3RSHA 3UICA 4OSPA 1E1KA 3RUAA 3N7UA 3WGGA 3FBGA 4NK5A 1FDSA 1KEWA 1XQ1A 3PP8A 4CLHA 4D45A 4DMLA 2O4CA 2GSDA 4Z9XA 3M2TA 2P9EA 4GPD1 3TZKA 3D3WB 5DCUA 2HMVA 3SC4A 4E32A 1EQUA 4IDAA 4I5FA 1LTHR 3LQFA 4I5DA 3PWSA 2P91A 3PHGA 4AJPA 4BO1A 1MG5A 1NFRA 4S3MA 3U5TA 4UEJA 4EW6A 1M75A 4QXMA 2WJPA 1XCBA 3C3XA 4WCFC 1DIBA 3EW7A 2C82A 2P9GA 3ROQA 2PV7A 4IMRA 1NQAO 5THQA 3L6EA 4TKLA 1Q7BA 1IE3A 1VJ0A 5KIAA 1PJBA 4DC0A 1DO8A 1EUZA 5EESA 4IUYA 1OBFO 5T5QA 4LCJA 4FC6A 1T1SA 4CODB 3TOXA 1XEAA 3NAQA 1KEUA 2I5PO 4B4UA 3HB4X 3GRPA 1NPYA 1NNUA 4XA8A 3BHJA 3HDYA 4RVGA 1PEDA 2CUKA 3EZLA 3MJTA 4NBVA 3ANLA 4NJOA 3T4EA 1G0OA 4ILKA 1NQOA 1GPJA 4OXYA 3DZFA 3C85A 4XIYA 2O48X 1HLPA 2JFFA 3QE3A 4NBRA 3VH2A 2HJSA 2EXXA 4L8VA 3DL2A 4DVJA 2PZMA 3JQ9C 5TS3A 2OBYA 3NJ4A 3ZW8A 1GD1O 5JO9A 2VWPA 4G65A 2D59A 4NH4A 5EMHA 4FFNA 3AW9A 4GWGA 1I01A 3U4DA 4QECA 4E6PA 2VTDA 3GNSA 1Q0LA 4BNNA 1G0NA 3C1TA 2OGUA 4JK3A 4LW8A 4CLEA 1N92A 4LVCA 3GFGA 1OI7A 4BVAA 4ZN6A 1YB5A 1PQPA 3JCZA 2EW8A 5JBIA 1UXJA 1DFIA 2EEZA 1NTOA 3DHYA 4YYZA 3GEGA 3DTYA 4XRRA 5DOZA 5LC1A 3FRJA 3K31A 3RC1A 3H5AA 2DAPA 3GZNA 3ZWXA 4YQZA 4XJTA 1JKFA 1NHGA 4OAQA 4EBFA 5F5NA 4YRDA 1K6JA 3ULKA 2EV9A 3AUTA 1HE4A 4J7UA 5KCZA 2AG5A 3WG9A 4L76A 1H9AA 3PZRA 3TF5A 4B79A 2A4KA 9LDBA 3L9XA 2IEBA 4L74A 4OGWA 5BNTA 4AJIA 1R66A 4FGWA 4MKXA 2NSDA 4ROSA 1MUUA 2HO5A 4OHUA 3ICCA 3MJ4A 3E9MA 1HDOA 4WASA 1PL6A 3QWIA 3GG9A 1LLCA 1O89A 2D5AA 5DF1A 4GX2A 3RC9A 1IZ9A 1U7TA 1U3VA 2VWHA 1NFQA 5DCYA 4K9DA 3WQRA 3AUSA 1WMBA 1CERA 3F4BA 3GDFA 3PQDA 3GMSA 4RVSA 2FZWA 3JQBA 1LLDA 3WWYA 2O3JA 5CEJA 3B70A 4IZHA 3IKTA 5HTOA 1Q7GA 4IY1A 4BNLA 1FDVA 1KVQA 4N5NA 2Q1UA 4A27A 3KBOA 1P74A 1FK8A 2NU9A 5C37A 3P2YA 4FGSA 2JCYA 3DXFA 1ZJYA 4HV4A 3RUCA 1VJ1A 3KRTA 1ISHA 5JDCA 3SC6A 4BQPA 1ADBA 1JW9B 2GZ1A 3PI7A 4J91A 4MVJA 3F1KA 3IP1A 1P1KA 4HX5A 3L77A 2A94A 5ICSA 4YJFA 4JXKA 4GSLA 4D43A 4WNCA 5EINA 4KMSA 2C7VA 3DONA 3GZNB 1ZSNA 5KKAA 3WJ7A 1XKQA 5L51A 4EUHA 3L4SO 2X1HA 5GZ3A 1BSVA 3BTSA 1B8VA 3ZU5A 1E92A 3RC7A 3T7EA 2VWGA 2CF5A 4MKZA 3NTRA 4N7RA 3NDIA 3QVTA 1NP3A 5ICMA 2FSVA 4NBWA 2Q4EA 4BO5A 2ZB3A 4K28A 2DBVO 2HJRA 3INGA 3IP3A 4U0JA 1V9LA 2DFVA 2D1YA 3H3JA 5F21A 4ZQFA 5DBFA 2B83A 3GEDA 3O03A 4MIOA 4CR6A 2VT2A 3IJPA 3RIHA 4J3FA 3PWZA 2EKQA 3IL2A 1O9BA 3MWEB 4R68A 4AG3A 1RKXA 1PZGA 5AOVA 3KO8A 1R0SA 5DP2A 4YXFA 1N9GA 2P4HX 4PG8A 1U9JA 5JPIA 1H6AA 3WXBA 1HDXA 4P4GA 3PVZA 2WD8A 2HDHA 4BO6A 5A05A 3MCVA 2B36A 2G82A 4E3ZA 2VRCA 2Y0DA 3L6DA 4KDFA 2WMDA 3I9JA 4YAGA 2ZATA 4YT4A 4ZQEA 5G4KA 5IAAA 3V2HA 3GDOA 3BMOB 2IXAA 5FI3A 4BNYA 4CM5A 1FDUA 1D7OA 5L53A 3E5RA 5TGDA 1FDWA 3K2BA 4RVFA 5IZCC 1H6DA 2GF2A 3BMQA 5BQFA 3KLMX 1EUDA 3GQVA 3JV7A 4HUJA 2Q3EA 1K6XA 1ONPA 1B7GO 3KYDB 3DB2A 1VPDA 2O3QA 3W1VA 4Y6SA 2X5OA 2PWZA 5DBGA 3ZHZA 4WOKA 2X4GA 1ONOA 5G0TA 3KHUA 1HEUA 1NPDA 2AHRA 3GMDA 4J43A 1DJQA 1YJ8A 1KBZA 2FP4A 4M1QA 3VPSA 2J3KA 3GN1A 3WTCA 5KTKA 3K6JA 1E1MA 4RVUA 3KSDO 1VC2A 2CNBA 5EN4A 3L9WA 2JD2A 3RUFA 3ZCXA 1LQUA 2P5YA 4XYMA 4BKRA 1M6WA 3EGOA 3V2UA 2A35A 1HSOA 1U3UA 4HY3A 1EVJA 4B4VA 3GGGA 4XWYA 1V3UA 4EUFA 2YQ4A 4TRMA 4WLNA 3KYDA 1LDNA 1AN9A 2OMEA 5TSDA 4UUMA 2FOIA 1K5HA 4FOOA 4EJMA 3OIDA 4F46A 4GX0A 1E7WA 2PGJA 4X54A 2OORA 1MC4A 3WIEA 3I23A 3GFBA 2AE1A 4Z0PA 4BKPA 5AQ1A 2AE2A 3PGXA 1HKUA 4ZRNA 1AHHA 6ADHA 1JN0A 1XWFA 5GY7A 1TEHA 2WDZA 4CPDA 4DYVA 4YEDA 3WBFA 5I7EA 3ZU3A 2VTEA 1E6UA 3PHHA 2CVZA 1JWBB 4WPGA 3GEMA 4RORA 5TRTA 4YDRA 2YHIB 3FI9A 1R4MB 2VOJA 4M8SA 2H9IA 3NUGA 4QQRA 1T25A 2EIHA 5T8KA 1FMCA 2IXBA 4A5OA 4AJHA 3DMTC 4CMIB 1JKJA 5I7SA 5CDUA 3FTNA 1ZK3A 1OOEA 5FFFA 1EVYA 2RHCA 2CD9A 3ADPA 2JCVA 3ITDA 1CRWG 4NJMA 2O23A 3CXRA 4B4OA 3AUUA 1O95A 1A9YA 3PZBA 3JQGB 5KVCA 1U7HA 1JLLA 1IB6A 2VRCD 2C5AA 5KKCA 4BO2A 3INRA 4EITA 1YBAA 3JD2A 1HLDA 2Z5LA 3ABIA 1I3NA 1NQ5A 1L7EA 4TQGA 1DIGA 3BZUA 4IGFA 1QP8A 1E6WA 1A27A 2C59A 4K1LA 4RF4A 4HKTA 1WZEA 2JKVA 5HWSA 4IJVA 4S1VA 3UKOA 4CR8A 4A03A 2Q45A 4DPMA 4KWIA 2PY6A 3DZGA 3HZZA 4O6VA 2OUIA 1YQDA 4J1QA 4ND4A 5JCJA 5ADHA 2EHDA 1P0CA 4CV3A 3DAGA 4FFPA 2A92A 3QVXA 4YAIA 3AWDA 4J0FA 2GCGA 4AICA 2I3AA 2B35A 1WAMA 2QYSA 1F0YA 4BO0A 1GQQA 1R4MA 1Q2XA 4I9NA 5JNLA 4D3FA 4PLFA 3JYQA 2AQ8A 2BGKA 2NTJA 2X0JA 1E5LA 2NV6A 2POQX 3QA9A 3PJDA 3PJGA 3PYLA 5F1PA 5KNLA 2EG9A 4E5KA 1NFFA 3ASUA 4MVJI 4NFHA 3GPDG 1UAGA 2O3TA 1Z73A 1HSZA 4GI2A 2CMDA 4UAGA 2P9CA 2X86A 4ZICA 4MVJD 1NVTA 2D4AA 3RVDA 1SNYA 2HMUA 1GYPA 3EZYA 3GGPA 4D42A 1PZEA 3C7AA 3TN7A 2SCUA 1E7MA 4ZQBA 5T64A 4PZEA 5L7YA 1I3MA 3ZI0A 2Z1NA 2BD0A 2V7PA 4PG7A 2I76A 5KJCA 4XQEA 2W8ZA 2VHVA 4XKJA 3WGYA 1I8TA 1ZVMA 1HYGA 4OQZA 3UCFA 3GHHA 5DDIP 3ZWMA 1OC4A 4RZHA 5JAQA 1EDZA 3WGZA 1J49A 2Q46A 4R41A 1LXCA 1U4SA 3H8VA 3WBBA 4IM7A 1X0XA 1XA0A 2AMFA 4YTEA 1R12A 5I8ZA 1C0IA 3IUPA 4M49A 1DFHA 3KUXA 2Y68A 1PS8A 3RQSA 1B3BA 3ETEA 1C14A 1PGPA 1ZEJA 2DTDA 2F1KA 4R3WA 5JC1A 1NM5A 2CDCA 3F1LA 1PU2A 4HBGA 3PPIA 2CFCA 5KJ1A 1D1SA 1PWZA 2HUNA 4XB1A 1Q0HA 2BKAA 3PDJA 5G0WA 3GNTA 4J4HA 4WNIA 2GUGA 2DPGA 3RUEA 1I0ZA 3NV9A 4O63O 1PGQA 4IS2A 3AU9A 2P5UA 4R5MA 3E9QA 4EEZA 3C1AA 4E0BA 1HDRA 1AUPA 3VHRA 2EGHA 3DAFA 1HDYA 1NPTO 3UOGA 2YFHA 3EMKA 2ZQZA 1P1JA 2A9FA 3U4CA 4A2CA 1M2WA 2XAAA 3PQEA 1QV7A 4MVJG 4P8RA 1NHWA 3I9LA 1HDGO 5CDTA 4MO2A 2Q99A 5ITVA 3TQHA 3ZV5A 2Y99A 3DZKA 3NT5A 4DIBA 3WGIA 4BGIA 4IINA 2E6UX 4JX8A 1PR9A 1QYCA 3FR7A 2BRUA 4WLUA 5IZ4A 3LVFO 2NQTA 3AUAA 1NX6A 3IQDB 1QV6A 1GQYA 4RVHA 3NGLA 4DPKA 5G4KB 4DLBA 5IN5A 5CDYA 4W9NC 3M1AA 4KTTE 4RZIA 2FPGA 3JQFC 3WWZA 2D5CA 2Y05A 4JNKA 4AVYA 4IJKA 2NTNA 2QQ5A 4EJ6A 2QX7A 3AY3A 2ZQYA 1L7DA 3DC2A 4UUOA 1Y5RA 4B3HA 3PHIA 2GYYA 3JTMA 3JYOA 1E3JA 1KEVA 2YV2A 1NWHA 3DEYX 1CQJA 2NM0A 1T4BA 3FWZA 3G1TA 1W8DA 1N7GA 3GLQA 4XD2A 2I99A 5A5EA 2IZZA 4BO3A 4J9UE 2J3IA 3QSGA 1PJ2A 4UVGA 1YBMA 3DOOA 3ZNQA 4NZ9A 1MXHA 4UVEA 5AYVA 4W7HA 4FCCA 4MP3A 3O9ZA 4CM8B 1GV0A 3U3XA 1VSUA 1ORRA 4JJIA 4PLHA 5DCWA 4RPLA 4ND3A 4DWVA 4W6ZA 1PJLA 2Q1WA 3Q2IA 4XDZA 4CM6A 4Z6KA 2I9PA 2GZ2A 2R6JA 3FNHA 5FEUA 3IIEA 2C7GA 3ROPA 2UDPA 3NJ8A 1C1XB 1YOVB 3KYCA 2XXJA 5I9MA 4NU5A 3DBRA 1UJMA 4RPKA 3PRJA 2XXBA 1X0VA 3QQPA 4CQLB 1DRVA 3R6DA 5A9SA 3P19A 5TX7A 5THKA 4YQYA 2PK3A 4BGUA 4XYBA 5AXBA 1YXMA 2ZYDA 1ZMTA 3WQSB 2WYVA 3IAHA 3QWBA 4M54A 2WSBA 1YL5A 3E48A 3M1LA 4CM9D 1YE3A 4II3A 3L07A 5F1OA 3RUDA 3V1TC 5JMWA 3VPFA 2NTVA 1T2EA 2AEFA 2D3TA 4MDHA 1E3IA 2E49A 3D1LA 5G2OA 1TVEA 3WS7A 4JBIA 1O0SA 3AY7A 4MVJF 3KSZO 1FDTA 1A71A 4HFNA 3Q9UA 2EF1A 3LF2A 3F5SA 4QT0A 3RU9A 1R4NA 4DMMA 2NVBA 4O1MA 1O5IA 3A06A 3VKVA 3GPIA 1DEHA 2C2XA 4OM8A 3ZZNA 1UP6A 2WYWA 1LBEA 2VHYA 2HQ1A 4KDEA 3QY9A 2YDYA 2X5JO 3QLJA 3GDGA 3ETGA 4C7JA 3ANNA 1ZNQO 1BTOA 4BNKA 4NIMA 4ZJUA 1TT5B 3U9LA 3JD3A 1I36A 3FF4A 2ZJ1A 1PTJA 3WR5A 4PCVA 3W8DA 4Q3DA 4GAEA 1Z45A 1UXKA 4CM4B 1RM5A 3RBVA 2GLXA 4L73A 1DOHA 1DRUA 3S2IA 3KTDA 4G81A 4CMGA 4BKUA 4HNGA 3JQFA 3RUHA 5HS6A 1E1NA 2HK9A 5T57A 3RAJA 4XRGA 4OSOA 1U5CA 2PNFA 3AOEC 2B5VA 2VOEA 2XF8A 4B7CA 5T8KC 2QYTA 2F00A 3Q11A 1DDOA 2X9VA 3HDJA 4CLRB 5CG1A 1OAAA 1LSSA 3WIDA 5MDHA 4XQCA 4BO4A 4C4OA 1XDWA 3KXDA 5L3ZA 1DAOA 3SVTA 4TRJA 4IDFA 1IOLA 5JC8A 2YFQA 1SEPA 3H2ZA 4IGEA 4GL4A 4CM4A 1BXKA 2VHWA 5TLSA 3O38A 1MV8A 1VKOA 1BW9A 1R4NB 3W4KA 3ZNOA 1B2LA 3S2FA 3PWKA 3EY4A 1GPDG 1ZK1A 1H93A 2BF7A 2E82A 2GERA 2EKLA 5GZ6A 1RWBA 4BMVA 2QW8A 3O8QA 3FNEA 1O6ZA 3D3WA 3PLNA 1ZK4A 2VYNA 3CH6A 5A9SB 1TXGA 4ESOA 4P22A 2VZ9A 3VZSA 3ZW9A 2JFGA 5EERA 1EBUA 3I52A 4TKMA 2HLPA 1TA4A 3SLGA 3EUWA 5AVOA 1E3WB 2RH8A 4RCVA 2JL1A 2ZB4A 3B1KA 3GA0A 1VKNA 3VDQA 1P44A 4RPJA 1UAYA 1LRLA 3BMCA 4WEQA 1MXFA 1Y7TA 4BNIA 4YT5A 3RBZA 4YVFA 2IZ0A 4FB5A 3DTTA 3BIOA 2QRLA 1ZKMA 3PIIA 4AJKA 1SB9A 3ZWOA 1UXGA 4TWRA 3QP9A 4PG6A 3M6IA 4YB8A 4BO8A 4BGEA 2HAEA 1CWUA 3ZWPA 3UUWA 3PQFA 2XPCA 3OP4A 1V6AA 4CUKA 2O4UX 1GYRA 4CMHA 3ZN2A 2HU2A 4CM3A 3Q3CA 3GR6A 1Q0QA 1OZAA 3BMNB 3DR3A 4D0RA 4UVHA 2NUAA 1N1EA 1YRLA 3WYBA 1WVGA 1X1EA 3QHAA 4NJMB 5L9AA 2WYUA 5TJ9A 1PQUA 4DLAA 3F3SA 1LJ8A 3N74A 3S55A 1GFSA 3G1UA 1NASA 3GVCA 3HJAA 1QR6A 4CQMA 2VZ0A 2FR8A 4AFNA 1BDBA 4MIEA 1I2BA 1BG6A 3FPLA 5C7LO 2PGLA 1GAEO 3GAZA 1QG6A 3ZNPA 2W4QA 2OXIA 2IYOA 4JJGA 2LDXA 4M86A 2JAHA 4Y8VA 4OL9A 4BL5A 3TRIA 3UN1A 4Z9FA 2P68A 5I9LA 1A9ZA 1B0AA 5G0VA 3QVWA 3BYZA 1R0LA 3GVHA 4PLCA 4RLSA 3CKYA 4J1TA 4XB2A 1CF2O 4Y9DA 5A06A 2VYND 1H9BA 2O3UA 3IOYA 3LT0A 3H6KA 1D4FA 2Q2QA 4OMUA 1BW9B 4GLOA 3KVOA 4E30A 1YBVA 1F06A 1K0UA 1XYGA 3ZWYA 3WNQA 2RAFA 3NT2A 5L7WA 1H5QA 1V0JA 2EERA 5KVQA 2FR0A 1SB8A 2QIOA 3JQDA 1YWGO 1E3LA 4DL9A 3DMYA 3LU1A 1ZMOA 3G17A 2QZ9A 1E77A 1EBFA 4LK3A 4J1SA 2W98A 1JAYA 3BHMA 3F4LA 2BHLA 4D44A 1E7RA 1U5AA 2I66A 4BNTA 1LUAA 3VPHA 3IS3A 3CZMA 4L4RA 3X2FA 1M6HA 3FNFA 3OICA 1BXGA 4GMGA 3TZHA 5A03A 3VH1A 2HKIA 4BHTA 1E3WA 4U0KA 3C24A 2HCTA 2BMAA 2V6MA 1W6UA 4HFJA 4IQ8A 1IPFA 2WEKA 3CUKA 3W8EA 4R1SA 3DZJA 1H94A 3EAGA 3CMCO 1K2WA 1LA2A 4OKIA 4PLPA 3RD5A 5CEEA 3OF2A 4D79A 4I5GA 3TSCA 4DGSA 4P38A 1EFLA 2UUOA 3FN4A 3D4NA 3I5MA 5FYDA 4QEDA 4R54A 3RC2A 1AE1A 3DBLA 5JY6A 4YJDA 5F1KA 4K6CA 2E37A 4QFCA 4JP3A 3V8BA 3RU7A 5L4SA 2C20A 3QIVA 4RL6A 4JQCA 3OM9A 1CQIA 2NWQA 1RM3A 2DKNA 3TL2A 1Z75A 2J3JA 3H7AA 2IE0A 3SEFA 4R69A 3EYWA 5U9CA 1YKFA 2ZTUA 5JCXA 4LSWA 3ASVA 3VKUA 4QTZA 3U49A 4RV9A 5DZSA 1T26A 4BNGA 3WOHA 1HTBA 3IUSA 1P77A 4GH5A 4WJZA 1Z82A 2DQ4A 3RKRA 1LQTA 4D46A 2C5EA 7MDHA 3DBVO 2BLLA 3HNPA 4MJLA 1QORA 3ITKA 1B16A 1N8KA 4WLFA 3MOIA 4ZVVA 3ZWVA 4FJ2A 4AJ2A 1CJCA 2X7HA 3WGQA 1IULA 1K89A 1VLLA 1HL3A 1P1IA 1ZSYA 4WK6A 4J6FA 3SJUA 3NX4A 1ML3A 1GR0A 1WLYA 1ZXLA 2VQ3A 4U8GA 1EDOA 1U1IA 2YY7A 3OA0A 4AJ1A 1GCOA 3LLSA 1ZCJA 1HYHA 3DDNA 1KERA 1Y8RA 4XR9A 1KY5A 4BNHA 1SO8A 5K9ZA 4FJ1A 1Y1PA 4E5MA 4NI5A 4BNUA 3CINA 1B15A 2GZ3A 4E21A 1IHXA 4TZKA 4G2NA 1MP0A 4XYLA 3QV1A 2JJYA 3AFNA 1W4ZA 3TZQA 2Q4BA 5TQVA 1S7CA 2GNAA 5HS4A 3JQAB 4FFMA 4OXNA 1P31A 1TB4A 4F3YA 2VT3A 4L0QA 5CAEA 1S6YA 1DJNA 3Q9NA 3HADA 4IXTA 2FZEA 4CR7A 3CEAA 2ZYGA 3R1IA 1NXQA 3RI3A 3ON5A 4UEOA 4EGFA 1ZO8A 2BI8A 1NQTA 4WOJA 2J5QA 1E6EA 3KZVA 4LCEA 2AQIA 3WLFA 3H5RA 1I33A 2Y1GA 1LDBA 1TLTA 2DM6A 4DXHA 1UZMA 3X2EA 1WMAA 4J4TA 3JQ6A 2PD3A 4IDDA 1YOVA 1H0KA 1XGKA 1P1RA 1NR7A 2ZTVA 4GVLA 3U4HA 3MOGA 1E1LA 1LLQA 4IIUA 4F45A 3JQCA 4YJHB 1K6IA 1KVRA 4CLDA 4MP6A 1LSJA 5DP1A 1EQ2A 4A26A 1VL6A 1SAYA 1ZJZA 3K5PA 4XYGA 3RWBA 1R15A 3O4RA 1JKIA 4BKOA 3WFIA 4Z0TA 4B7XA 1SPXA 3RJ5A 1BMDA 1WWKA 2G5CA 3WGTA 1X1TA 1N2SA 4URFA 1UXIA 4U6QA 4F6CA 4ZD6A 2GDZA 3W4JA 1PL8A 1ZUD1 1M66A 1Q7CA 3OJEA 3TWOA 4EUEA 4BNWA 1SOWA 2FY8A 2AA3A 1YH3A 4E2XA 1SCUA 4BB6A 1EE2A 1QYVA 2JAPA 4R3NA 1VJTA 3DZBA 5JXWA 3RROA 1I32A 4LGVA 3AM5A 3DBRB 2PH5A 2GO1A 1AGNA 1RPNA 1VM6A 2GGSA 3VPXA 5FF9A 4MVJP 3AY6A 1P33A 1B3RA 3JQAA 1CYDA 1GUYA 5GMOA 1KETA 3ZV3A 5AXDA 3SX2A 1MB4A 1XLTA 3VPGA 5A02A 1P3DA 4ZRMA 2B37A 3G3EA 5CDSA 1A4IA 4YJFB 1DIRA 1R0KA 4OOEA 2ET6A 3G79A 1I5RA 1H2HA 1QLJA 2FR1A 2O2YA 4RGBA 4U7WA 1NVGA 3AJRA 4BB5A 4WCFB 5I8WA 2Q1SA 4HNHA 3WB9A 3ZWNA 2DT5A 4A0SA 4AJLA 4IDCA 4YRBA 2PZLA 4CMEA 1OC2A 1KY4A 5BNFA 2FWMX 1D8AA 2YJZA 1N5DA 3EVNA 4I9UA 4E2ZA 4RJTA 3UAGA 4PLWA 1HE2A 3WSWA 1DLJA 2J6IA 2WE7A 3FTPA 2LDBA 1I10A 2Y1OA 1J6UA 4JIGA 3FD8A 1DXYA 1GL3A 1OMOA 5KVSA 1YVEI 5K6AA 1U28A 2HSDA 2RBEA 3LLVA 3MJSA 1CETA 3A4VA 5JFOA 3HDHA 2YHUA 3E5MA 3UXYA 3BMQB 3TFQA 2CZCA 3D7LA 1JAXA 4W99A 5HBRA 3DFZA 1OFGA 2JD0A 3ONFA 1U2GA 1T2CA 3FR8A 3LZ6A 4ONEA 5KJFA 3E18A 3E8XA 2CF6A 4BIIA 5IZCA 1YO6A 4XX0A 3K8ZA 3OJOA 1M76A 4WEOA 2GR9A 4DIFA 2HMTA 3D5TA 1AXGA 3OA2A 4BO9A 2O50A 5B4VA 1CIVA 4JBGA 2ZB7A 1I3KA 5H81A 3G0OA 3QWAA 2YDXA 4KUEA 2BH9A 3F5QA 4MIYA 4FR5A 4WKGA 3VZRA 4OXKA 4BV9A 5JCJD 1MX3A 1QSGA 3L4BA 2B4TO 5BSFA 1EUCA 4JLWA 5A9TA 2P2SA 3LC2O 3N58A 2DUUA 2Y0EA 2ZCVA 2O3SA 4YJGB 3UHAA 1PS9A 3KLPX 1HXHA 1KEPA 4DUPA 3GGOA 3WTBA 4RQTA 4KOAA 1PJTA 4KQXA 3O8QB 3PHLA 4M55A 1DC3A 2DTEA 3G49A 3WQQA 4DQVA 1D3AA 3JD4A 1SOVA 1A7KA 4Z9YA 2BELA 5LCXA 1DIHA 1EFKA 4O0LA 2DTXA 1ZEMA 1I2CA 1ADGA 3GNQA 1IUKA 4MPDA 1M67A 3BAZA 1YQXA 3AK4A 2BGLA 4K26A 2VRBA 1LRJA 3GZ4A 3NTQA 3S8MA 1GYQA 4PRKA 1Y81A 4B8WA 1C0KA 1EK6A 3LT4A 4YJHA 3HN2A 1BVRA 1IY8A 4YT2A 5LDHA 1YL6A 2G17A 4DC1A 1VE9A 1U4OA 3GHYA 1ZZEA 4WCFA 3I1JA 3PDUA 2X23A 4R51A 4RF5A 3SXPA 3H9QA 3B1FA 5B4UA 4IQGA 2EWMA 1ADFA 3GAFA 4UEKA 5A3JA 3OSUA 3OQ6A 3WMWA 2GD1O 2NU6A 5HRUA 1XIVA 2EW2A 3PFFA 2HRZA 3D64A 3VH3A 2DBQA 3CPSA 4FDAA 1NWCA 1Z74A 2B4RO 4RLHA 4RQUA 1DHRA 4R9RA 4ALIA 1FF9A 3I9OA 1SMKA 4DQXA 2GN8A 3P2OA 3IDSA 1F8FA 1P9LA 1A5ZA 1U8XX 2JFHA 4OO3A 3HE3A 4GGOA 5LDGA 4UVDA 4I1IA 4Z3DA 3T7CA 3E9NA 4KWHA 3QRWA 4ZHSA 4ALNA 1YB1A 4E31A 4WE3A 3PJFA 5AXAA 2C2YA 2WE8A 2ZYAA 3I9KA 4TRRA 4MINA 4ZA2A 5CPBA 4AJNA 3WX0A 3WFJA 4R4JA 1NR1A 3FHLA 3VTFA 3WMXA 2VUUA 4CL3A 2PZKA 4YAKA 2H5LA 5CFZA 3AOGA 4GX1A 4CV0A 3K96A 5AXCA 2R00A 2O3RA 5A3VA 1LI4A 3FWNA 3HG7A 5TJHA 1W73A 4E33A 1WNTA 1WDKA 5G0UA 2PKQP 3V5NA 3EVTA 2O7QA 1N7HA 1XU7A 2X0NA 3VTZA 5EJ2A 3RCBA 3BMOA 4CLXA 1ULUA 3NGXA 4H16A 5JMPA 4IQ0A 4N5LA 1ZBQA 3H2SA 4ND2A 4GBJA 1C3VA 1K3TA 3GVIA 3H9GA 4PGFA 4GLLA 4EI2A 3AI3A 9LDTA 3NT4A 2BFAA 5JO0A 4YAEA 5BNIA 4XGKA 3GRKA 1QYDA 4CQMD 4XZ3A 3TNLA 3BXXA 1L1FA 3BMCB 3H3FA 1EVIA 4RDIA 1Y8QA 2NVWA 4CQMB 3DBHA 4BKQA 3R0IA 2AW5A 2V65A 4ND1A 2ZJ0A 5G4LA 1DPGA 2I3GA 5L95A 4ZQHA 4NBTA 5B4TA 1GUFA 5JW6A 2OP1A 2WM3A 1ZIDA 4NNJA 3OIGA 3SLKA 4CM1A 3K92A 4EEXA 1MA0A 3PYXA 1RYEA 5DN9A 1HRDA 4GGPA 3TJRA 3R3JA 1SBYA 1MGOA 2E4AA 1BVUA 1JU9A 2W2KB 5K0ZA 4HWKA 4CMEC 3OQBA 1LRKA 5EPOA 2X6TA 4A73A 4OOFA 3RFVA 1JA9A 4GMFA 1LC3A 1MC5A 1WDMA 5CHEA 2VNAA 5J23A 1IL0A 5JSFA 3AM3A 4DYDA 4E5NA 4FW8A 1VSVA 5CG2A 4OKNA 4R9SA 5GZ1A 5IDQA 2OO5A 3GK3A 4FD3A 4MOWA 4NU6A 4TROA 1MLDA 5F5LA 1PZHA 4II2A 2FPPA 5IDWA 4MP8A 3LT1A 5KJ6A 3F6YA 4I9HA 2VWQA 5ILOA 2AQHA 4J90A 1PGOA 1VL0A 5JAMA 3HB5X 1U3WA 4NK4A 1HE3A 4Z3KA 2Q50A 2I65A 4ID9A 2X0RA 3V2GA 8ADHA 3CTMA 5IDXA 2C0CA 4ALJA 2Q1TA 3S1LA 4J0EA 3JSAA 2B0JA 2ZK7A 2X9GA 4FN4A 3WGOA 4GKVA 3OETA 1TT5A 3BMNA 4YBZA 3EC7A 1D1TA 3OEYA 4JJFA 1DC6A 1IHYA 2UAGA 4HXYA 4PG4A 4AJOA 4BNFA 2ZTLA 3KV3O 3RFTA 1FXSA 2UV8A 1X7HA 3E1KA 5KOIA 2IEDA 5U1PA 4UUNA 1HYEA 4CMAA 2UUPA 4W4TA 2WD7B 4NR0A 3LSYA 2PH3A 2TMGA 4MVJH 2GPTA 3DBHB 3ZU4A 1XG5A 1UDBA 1ZXBA 5C7IO 1DSSG 3ETDA 3S2EA 3K73O 4NHEA 2Y1EA 4BNJA 3VC7A 4A10A 2JHFA 1BDMA 3D4PA 5BR7A 3FCOA 4U5QA 4LMRA 2GN4A 4R1UA 3VZPA 5I9NA 4TMFA 1DBVO 1EK5A 4NDNE 3VVBA 4E5YA 4UVIA 2Y93A 4Y6RA 1I3LA 1YJQA 3JQ9A 2Z95A 4NFYA 4PIVA 4W7IA 1HT0A 3MJCA 4CJXA 1YQGA 1R6DA 1SEVA 3WYEA 4JN6B 5EQFA 3ZDFA 4DA9A 1ARZA 1U2DA 3U4IA 3ZWBA 4WECA 3WNVA 4CM9A 4E13A 1GEEA 4XQGA 2H63A 3F47A 5ER6A 4I8XA 4P4LA 2IODA 3DOCA 1BXZA 2X22A 5IXYA 2AEMA 3GVXA 3NTOA 4IIVA 1J4AA 3H4VA 1GDHA 1I2ZA 1DC5A 1I24A 1V35A 2QRKA 4UREA 4J9VA 3OEWA 3RKUA 5BT9A 4L75A 5TT1A 4CMBA 2VNSA 2RCYA 3Q1LA 4IDEA 2E48A 3OJLA 1XELA 2J5RA 2X58A 4JCOA 1UP7A 2D0IA 4N54A 1BRMA 1NAIA 2IYPA 3NRCA 1DLIA 4Q3EA 4WCDA 2OP0A 2VHZA 3RJ9A 3RFXA 1TI7A 2NVUA 3STHA 4KUGA 1KIFA 2WTBA 5IF3A 1NVMB 2VUSA 3DQPA 4LISA 3UW3A 2BI7A 3D0OA 1ENPA 1LSOA 3VVCA 3CMMA 3GOHA 3P7MA 3F9IA 3IMFA 3OJFA 5JDIC 2W2LA 3E82A 1VI2A 3CE6A 1V3TA 3ICPA 4ALLA 2DFDA 3HFGA 1EMDA 3KB6A 1Y8RB 3MJEA 4Q39A 1AXEA 1H6BA 5CEFA 3KEQA 1GADO 3NKLA 4OIMA 5G0SA 1E3EA 1PJ4A 3E6AA 3IKVA 1YDWA 3NEPX 4LSMA 1E7YA 3HWRA 3ZHYA 1WW8A 3HDQA 3GT0A 3DO5A 1Y6JA 2DLDA 1QMGA 4IPTA 4AJEA 1P0FA 3OMLA 3JQEA 3QVSA 4KQWA 3JQ7B 1XQ6A 1CEQA 2YYYA 5EL0A 3OFSA 1UP4A 3DAPA 1U3TA 2PR2A 4NFSA 4IXWA 2J5KA 1ZSVA 1LEHA 3KOUA 5BSEA 5TIIA 4YRAA 4JBHA 1NYTA 3WYCA 2PD4A 4YACA 4CLOA 3ANMA 5JLAA 4MVJM 3OJ0A 4J2OA 3PYMA 3PJEA 2CDAA 2DPHA 3DHNA 3CIFA 2GRAA 2CY0A 2YQ5A 3JYNA 3V1YA 4EYEA 1ISGA 2GASA 4QSMA 3VOSA 3ZWAA 4PLYA 3LDHA 2DU8A 4QO7A 1LU9A 4K6FA 3UCEA 5DULA 4L4XA 1QYWA 1JDJA 1UZLA 3SJ7A 4E4YA 3UGKA 3LF1A 4KP7A 4DLLA 5U4QA 4H7PA 3C1OA 5A5FA 1T2DA 4LRTB 3HFSA 4G5HA 5IJZA 3LC7O 3I6QA 2EJVA 2RH4A 4PLVA 3O26A 4D7AA 1P45A 3C7DB 3PXXA 4XJSA 1T24A 2EP5A 5L4LA 2JD1A 4NQZA 5K6AC 3RUIA 2V6GA 4J2HA 1IPEA 1UR5A 3U0BA 2VHXA 1VL8A 2OFPA 4QO8A 2PTGA 3WJAA 5L45A 3NYWA 2JCXA 3QJ5A 5C7OO 1HETA 3BTVA 1F14A 1BXGB 3U62A 3W6ZA 2CVQA 1BWSA 3ZV4A 1RYDA 3A1NA 1ENOA 4A7PA 1ZH8A 2W2KA 3BTUA 4E2YA 1Y9EA 1ZFNA 2ZTMA 1HF3A 3A9WA 1WZIA 5CPFA 1A7AA 4QFDA 2EGGA 3FNGA 3H5NA 1LNQA 3OQ1A 5L40A 1B14A 5F3RA 4AJJA 1ENZA 3EDMA 4XDYA 3JQ7A 2HK7A 3PHJA 1UDAA 2DBZA 4FJ0A 4XR4A 4B7UA 3OECA 4B3JA 2OL4A 4FFRA 2CSUA 3I3OA 2IRWA 4GVXA 5TT0A 4Z0HO 3W8FA 2BFOA 1DC4A 5IN4A 2VN8A 1F8GA 4AJ4A 3TZCA 4D41A 3EK2A 5TNXA 5HM8A 1PGJA 1YS4A 4ZGWA 4CQLA 2O7SA 7ADHA 4O59O 3KEOA 3A14A 1GCUA 2NNLD 3AM4A 3S2GA 3D3EA 4OH1A 2ZCUA 1JWAB 1H2BA 1Z7BA 2X0IA 1BGVA 3T4XA 2PGDA 4CM8A 2P4QA 3QWHA 1V8BA 5ILGA 4J7XA 1RJWA 3A28A 3QWFA 2HMWA 3FPCA 2VZ8A 4FSHA 4HFRA 2UVDA 4PVDA 3TDKA 4EZBA 4ZU3A 3VZQA 2CVOA 5KVVA 1ADCA 3TZ6A 3DWFA 2Y67A 2WD7A 3HN7A 1LDYA 5ENDA 5IDYA 3H9EO 1PZFA 3JQBC 1PJCA 2PFGA 5JYDA 4GQAA 3ZGYA 1WDLA 4DBVO 4H15A 4DTIA 1N1GA 4IDBA 3PIDA 4J7CA 3B6ZA 5C3MA 2EKPA 4BV8A 2YHIA 3BHIA 1ONNA 5FI5A 4KUHA 4LMPA 1DIAA 1ISFA 4B3IA 4B8ZA 1XSEA 2X8LA 4PVCA 2PKQO 3LC1O 3U09A 5H82A 5HA5A 3K2EA 3LYLA 3W6UA 5A9RA 4MKRA 2Q2WA 4BUCA 5EIOA 3LT2A 4BMSA 3FSRA 2OOSA 4TSKA 4M87A 1KOLA 2AXQA 2UYYA 4UUPA 1C1DA 2Y1CA 4HADA 1WPQA 4YWJA 4I08A 4BGVA 3PGJA 4BS9A 2D8AA 2DBRA 4D0SA 5TC4A 1KC3A 2ILTA 4INAA 4E5PA 3ENKA 1GQ2A 5ENVA 4WLEA 4B4WA 1UUFA 3DFUA 4MVJE 4PZDA 4YT8A 2Y66A 4CLRA 5CDGA 4R1NA 1IYZA 3DOJA 3DMTA 2J3HA 3NDRA 2QHXA 1B8PA 1PWXA 4RPGA 3QW2A 4FFOA 3UVEA 4OQYA 1E3SA 3IC5A 2PD6A 2NQ8A 4YA6A 4D3DA 1UZNA 1LDGA 3W4IA 3H9UA 3VH4A 3MWDB 3AI1A 4J4BA 3COSA 2O2SA 3OH8A 5C5IA 1PX0A 4RO0A 3D4OA 4PLTA 3ONEA 2FN7A 3ZNNA 4CMJA 4PG5A 4FIZA 4FS3A 4PRLA 1NBOA 4NMHA 4U6SA 3ROMA 3F46A 3KM0A 4CV2A 1PJ3A 1RM0A 5COBA 3DZIA 1AHIA 3IJRA 5B37A 1KC1A 1ISIA 4ALMA 4CLOB 2ZB8A 3L0DA 1YGYA 1HDCA 4ND5A 4HP8A 3UH1A 4PLZA 4DRYA 1DAPA 5CP8A 1KS9A 4WLVA 1T2AA 5I7FA 1F12A 4Y6PA 3ORFA 2AEJA 1JQBA 1N9GB 1ISJA 4CMCA 4EDFA 1HE5A 3AFMA 3GC6A 1EVZA 4Q3AA 4RDHA 4RVDA 5JE8A 1ZW1A 1A4UA 2ZKLA
chains in the Genus database with same CATH superfamily
4IAOA 1FJHA 1ZM3A 2JAXA 3VNUA 2XUHA 2QRJA 3PHBE 4DREA 2ORWA 5K4GA 2QTVB 1CU1A 3AP3A 4N3AA 1T8SA 4G8JA 5GOZA 3VDRA 2R9VA 1VECA 4XOUA 5B1IA 1AKQA 4S2UA 5BV1A 2O54A 3UMFA 3TNFA 1E2LA 1YMQA 1CKEA 4NG5A 2PA3A 4LRSB 1OTXA 4Q3CA 2NYVA 3QKSA 4L2IA 4R01A 5AKXA 1UWCA 3VR1A 4D3SA 1JTVA 3ED5A 1L4NA 2NIPA 3LQ2A 1BZYA 1UF9A 1TLLA 1I5OA 1A8IA 2C2OA 4I1SA 2C54A 1PR3A 1E2QA 2LCFA 2WAYA 1HNNA 4K6MA 4Q48A 1TZKA 3NEJA 1W44A 4TWIA 1FP1D 1YZVA 1SXJD 3MEQA 2Q0HA 4LMBA 2RAUA 5AUPB 2I2BA 1P7YA 1R37A 3GUYA 3RAEC 4EA7A 2BFPA 3GUCA 2OFWA 3DDOA 3VJKA 3TBKA 1YRHA 4HGPA 4AL4A 1T15A 4Y0NA 1Z6AA 3UCXA 1EDEA 3U2QA 1LPSA 1UZAA 4H6VA 2GK6A 1CE8A 3PPYA 2MSEB 3LPNA 4ZOAA 3SJZA 2XUFA 2PL9A 1K66A 4AK9A 3BK2A 3AJ8A 1QRSA 2QX9A 4PIPA 2B4YA 4JROA 1UXHA 4QPNA 4Q5IA 2PCJA 2YOHA 1RNLA 2ZYHA 5IASA 2PKRA 5ITWA 3W6OA 2Q5EA 1P2GA 4QGBA 3T5AA 4ERXA 2PX6A 2WAOA 4DQUA 4WUVA 5AI9A 5EQDA 5JAZA 1NUAA 3B1XA 3MRVA 3TKLA 2CV0A 1P91A 3RS4A 1ZN9A 3CRRA 5FUMA 5J5AA 1XTVA 1BHSA 4C2TA 3LRTA 4EPWA 3OZ7A 3L0SA 3AJEA 3CS3A 3SC2A 1O77A 1G7SA 4JP2A 3ZWWA 3B1JA 1Y9AA 4NYMR 5DISB 1SBQA 1W0CA 3L8FA 1G291 2NX2A 1L8LA 3CFYA 1XVIA 4BMNA 1NXTA 2MR6A 2HA4A 2ZWAA 3OUZA 3EDQA 3ONDA 3HMKA 7ABPA 5DYYA 3KZOA 3D2LA 1LJLA 1V2HE 2PUHA 3AILA 3F74A 3O7WA 5EIFA 5LLDA 1SXHA 3OFNA 3D8UA 2H2HA 4H08A 3RYCB 4NPCA 1P29A 4WD3A 4ER5A 2ZRBA 3RS2A 4JQZA 4EUNA 5KYXA 3P9PA 1DC8A 1E4EA 1HC7A 4AIRA 1XWWA 4QOSA 2I67A 4TRNA 3AC0A 2AC7A 5FEMA 3X1YA 3KCNA 4EB3A 2QTNA 1P6UA 2RHDA 4RE5A 3Q7TA 3RRXA 4U7GA 1KDZA 4LJ4A 1U6IA 3RYHA 2J0UA 1H6CA 4XGNA 2QL9A 3B8HA 3HP1A 4RIHA 3JY6A 3AUYA 1NAHA 4TS9A 1KBOA 1LW7A 2R65A 1YZTA 2XCIA 3VZBA 2O8NA 3FPKA 3JSXA 3OBBA 2HK8A 4X95A 1MEJA 2OCAA 1QHFA 4KTVE 5TE9A 4Q34A 1QLHA 2OG2A 4MR7A 2P35A 4O4HB 4ZFNA 1LC0A 3UAZA 1J2TA 3DHWC 2FPIA 4G26A 4M9QA 4MI3A 3R0VA 4JUFA 1YHZA 3Q6IA 1C7FA 4QUEA 4IV8A 2BL4A 5AK3A 2YZKA 5EP3A 1IM5A 2Y1DA 4LRUA 4MA4A 1EP1B 3PTZA 2L69A 3SN6A 3BQNB 3DLTA 4OYRA 3SS8A 1EGHA 4K3UA 5B3JC 1DHTA 4WA8A 4IOKA 1CC1S 1JHQA 4U3JB 4UULA 1G9SA 3UB3A 4J1NA 1W36B 4S1OA 3AEKB 4QU5A 3SAJA 4AI6A 1NBME 3H65A 3SXUA 4DRXA 2V58A 5D8DA 1GUZA 2OV3A 3ESCA 3KJIA 4M9RA 2VP9A 4DY6A 4OQLA 5IEJA 2I22A 4C20A 1P62B 2WVHA 5EYPA 1EK0A 1SA0A 5BNIA 2XTMA 1QJCA 1Y8AA 2IOHA 3NBXX 1YR9A 4MITA 4J49A 4ZQCB 1ISMA 1KHTA 1RBMA 1ECPA 2W2TA 3PK0A 4MJXA 1VRWA 4Y9RA 4D82A 2ZRMA 3G89A 1V2GA 4TVOA 3E22B 3AU8A 4PO1A 5LN1A 1GZ3A 3JD0A 4E12A 4R1TA 3EC1A 1NM5C 1JLMA 1J99A 1QPGA 4TMXA 3HC7A 4M1WA 4LHEA 3QPBA 1QGUB 1NBMA 2WP0A 2CFOA 5FOSA 2AG8A 5SZHB 3UK7A 4D9IA 2E4VA 1VG0B 1XEWX 2VYVA 2ZUUA 4XX0B 3BJMA 3W3AH 2VS1A 4NH0A 3DUFA 4F8EA 3JWEA 2I4OA 4O1HA 5AIAA 3U3KA 6Q21A 4LF8B 5TPZD 2CEKA 2EU8A 2B6HA 4YUWA 1MA3A 4J16A 1KPIA 1PBTA 1XMVA 2A2ZA 2C0PA 1GXSB 1Z6ZA 2RGEA 4JGGA 4X5OA 4FOSA 3CB2A 1DMRA 1VHLA 2L42A 1ND5A 3EXAA 4ABTA 1X7YA 3KAQA 4Q6WA 3I4FA 2LE0A 2MSWA 1WQ4A 3AONB 4YIHA 3PC8A 4RS3A 4UTOA 2XCRB 4R71A 1R6XA 3B3AA 3K4HA 1PGNA 1X14A 1X7GA 4HTAA 2GN6A 2WTXA 3C70A 4I50B 1C1XA 2PX0A 3NNSA 4JBYA 5FLKA 5SV2A 2OQVA 3MJVA 3RYFB 4PN3A 2G8LA 5AW6A 3K9CA 1OZGA 1FRZA 1WXHA 2XE7A 5FWNA 2AJBA 1L5KA 2FMUA 5ALDA 5K2MA 1KO1A 1P7PA 4EJ0A 3R3SA 3KSUA 2FXVA 4H1VA 5AVZA 3AVYA 2ID9A 4DS3A 5K3FB 3GJYA 3U6KA 2HRBA 4WFJA 5I5EA 2VYVD 2J8ZA 4N5IX 4RSMA 3PA8A 4NX2A 1GILA 2BISA 3HSKA 3T34A 3TZEA 4EY6A 2Z5GA 5C35A 4CM7A 2N46A 2BFDA 5JDIA 1IU9A 4CUJA 3I9MA 5IF9A 3VVLA 1N6NA 1K9SA 4WV3A 2GARA 4ITUA 4HXFB 3VUEA 2HHJA 5KNDA 1VIVA 2XMZA 2X76A 3PFWO 5I9SA 3IEMA 3E0QA 4L9RA 3ZIAD 2B25A 2BBWA 3PNMA 2H1VA 4KI0A 1HQKA 5K5EA 3DWIA 1EFTA 3OO0A 3GAMA 4TVKA 1ES9A 1E1CB 2X3FA 1ULBA 2PKYX 2W48A 4XI9A 2I78A 5FUWA 1WTAA 3LFUA 3HA2A 2C31A 2PRZA 3JYLA 3KCQA 4GKBA 5JVDA 1GTJ1 1NVAA 3AEXA 4R2IA 1MO6A 1R0YA 1RXIA 3JS5A 1T8WA 1X13A 1XFDA 2A4MA 2PH1A 3MINA 3KVYA 1SZJG 4P36A 4XOIA 5D3MB 1BE0A 3ACCA 3UHOA 5HUQA 1EM6A 3B20A 1QYIA 1R16A 3AF3A 3W5DA 4LPKA 3DE1X 2FRDA 3S1AA 1IXKA 1XP8A 2QLJA 3LCCA 3R0XA 4D8YA 2IBTA 4B44A 1TK2A 4Q9KA 1UL1X 4MLDA 3A9TA 2PNJA 1I7PA 1YDGA 2ZS8A 3EQ9A 5JSKA 4ZQGA 1MT0A 3QIAA 5A4FS 1LDEA 1B0PA 2PXHA 5IXSA 4L1KA 3I5UA 1ID1A 2DX7A 5ED0A 3EIWA 3ZJVA 4V2UA 5JZBA 3EODA 3AR3A 1J2EA 1G8YA 3PTAA 1OU4A 2HDNB 3GT4A 5ALVA 3UOWA 4M2LA 3EFOB 3WHLA 4JU8A 2NU7A 3RC8A 4OI0A 3WSVA 2V6BA 4YCAA 1TLFA 1JLLB 3AJ9A 3CN9A 1F17A 1VIMA 2IITA 3GBSA 3IV9A 3MUFA 3QVOA 4BO7A 1AOXA 5KZMB 4YAJA 3L4BC 3MSCA 2NADA 2JLVA 3AINA 1Z4JA 4HBZA 3O8OB 1OLUA 5SYMA 3UICA 2B2CA 1E1KA 3DVAA 3IX7A 3T9EA 1WD5A 5BN5A 2NOAA 1ZWLA 3C5VA 3FBGA 3R0JA 1X7WB 3WKEA 2IYNA 3EZ6A 3IULA 4IIBA 4NCIA 4GYYA 4ZRDA 4CLHA 4D45A 1QGED 3SFTA 4CKEA 4AM8A 1ZD4A 3AGPA 1OXXK 5LXTB 2EFHB 4GPD1 2Q7XA 1KMMA 2VR1A 3CLRC 3OOWA 5ALTA 3UV7A 2HMVA 3NIWA 1AKUA 4E32A 4FGUA 1Z4OA 4BQEA 3RYTC 1QCDA 2RB5A 2WMOB 3BFPA 3DVSX 3LQFA 4PZLA 4C7BA 1K4KA 1XZJA 1TM4E 1CHDA 1AKYA 2A9PA 2P91A 3D8BA 3MELA 1JKMA 4KSYA 4S3MA 1L3BA 3DGFC 4AJPA 4BO1A 4I1VA 3HKEB 3ELYA 3JZDA 3A1DA 1Z8HA 1FMFA 1Y4DE 2JLXA 2ZYTX 3ESZA 1Z34A 1M75A 3NWPA 2WJPA 1XJ0A 4WCFC 2QXTA 3EW7A 2P9GA 4MICA 2FYTA 1XN1A 2ZP1A 1JGTA 3PGKA 1NW3A 4MS3A 4RJJA 1DO2A 2JH8A 5THQA 3TW0A 4DLPA 5L3SB 4PHGA 4S05A 3CE9A 4HX9A 2B30A 1PJBA 4DC0A 3H5LA 3AV0B 5EESA 2O2EA 4CODB 1T0UA 3EQ2A 3M7IA 2HADA 1XEAA 3BUSA 3NAQA 4P7FA 1JE1A 2I5PO 2JAWA 1N3YA 4LGYA 1G55A 4X8OA 1EJBA 4CETA 3HB4X 1KQPA 1I1QB 1NPYA 2QF7A 3D31A 3AFGA 4OHMA 5G41A 5BY2A 4PXYA 2EDCA 4EG7A 1ZD1A 1PL0A 4EO4A 4F8JA 4JUCA 3MJTA 4FI3F 4HWOA 5KYVA 5FH9A 3RBAA 4NBVA 1Z5WA 3QM1A 1A9QA 4QJBA 4NJOA 4FZJA 4BAGA 3SP1A 4ILKA 4B6SA 4RQAA 3KT6A 3IMCA 3E53A 3TR6A 4ENTA 2EWWA 3B53X 2XE4A 4XIYA 1YULA 5J40A 3WGKA 4UU7A 2JFFA 3QE3A 4CKYA 2DY0A 3EVDA 2AN3A 3AUXA 4NBRA 4X94A 4YGXB 5JPDA 4I6EA 4L8VA 4PNPA 1YMVA 1MBZA 2VKTA 4I4TF 2Z3WA 3RHFA 1VYTA 1M2NA 3UMVA 4YP0A 2IIVA 2Z8ZA 4RIFA 5IP5A 3W9YA 4BPBA 5CLHA 2EJTA 1RIFA 4G65A 5FDFA 1ZI9A 4FFNA 4UZFA 3AW9A 2WVJA 1CY8A 2OCLA 4RYLA 3TYXA 4LYYA 4B3RB 1Z06A 1H0RA 3N0TA 3PVCA 3GNSA 3G2HA 1AT1A 4JK3A 2P9ZA 1R9MA 3C1TA 3G02A 4Q24A 3ID6C 4LVCA 2O0HA 1GKUB 2XDQA 1PTKA 1QB7A 3OC6A 4BVAA 2NZYA 3G2LA 3BRQA 2HMAA 4LX0A 3LV8A 4QELA 2V1XA 3SJCA 5KYKA 2IS6A 1BWRA 4QYIA 2J0EA 1D2EA 2X8BA 3CX8A 3QEOA 1DEKA 1FRQA 3EXIA 3SZMA 4E88A 4EF6A 2BONA 3AKYA 1DFIA 1ZC4A 4P83A 1NTOA 2VVTA 3DHYA 3FVTA 1E9AA 3DVAB 4XRRA 1NI4B 4DG5A 5FWYA 1WE2A 3RC1A 1N0WA 2JS7A 4D3XA 1UINA 2MWMA 2DAPA 3FZEA 4XX1A 3KYIB 1RKUA 3QJGA 3WK4A 3R9XB 1H8HA 4XJTA 1NHGA 4EBFA 5AW7A 1GFIA 4P86A 4QHTA 3ZE6A 1SUIA 2II6A 4L76A 2REBA 2NXJA 1FX1A 3L9XA 2PYDA 2BYTA 3ASYA 2SKCA 4JI3B 2PGNA 3FUCA 3K0SA 2DUNA 4B3TB 4PQFA 4LHYA 5LZ7A 3HCBA 1QE0A 4ROSA 2O2GA 3E9MA 5DGDA 3PFCA 2YXPX 4P58A 5DI3B 2V45A 4DWOA 3LQ4A 5PGMA 2QL6A 3FPBA 3GCGA 3GG9A 3QWIA 1N2GA 1O89A 1X38A 3N9IA 4YGYA 3MHTA 2QP4A 3RC9A 4OYYA 3IUEA 2VWHA 2JHPA 4G23A 1H5UA 3QXGA 1QM5A 3WL5A 3A9SA 1WMBA 4G5XA 4II7A 4JBXA 4UM7A 4TMZA 2IV7A 2ONJA 3GDFA 4C3UA 4OATA 4RVSA 1EXDA 3VSBA 3IPLA 3I42A 1VSQA 3G2QA 3TQSA 2AT1A 2V7WA 2FWPA 5KOYA 2ZUBA 3HBLA 3UAXA 2P1RA 4LZLA 4KW7A 3GPCA 4JLKA 5CJ2A 1OKKA 2F64A 2LIPA 3A6HA 4P4SA 4U6NA 4IY1A 4TLMB 3RSCA 4BNLA 1WY7A 3UWOA 1GPAA 3KBOA 5FA6A 4EABA 1JIVA 3T41A 3BULA 5CB4A 1A8SA 2H4ZA 3LUKA 4OHRA 5LLSA 4ZJZA 3IE1A 1SUPA 5EI5A 2VNIA 1Z5VA 1IHDA 1DAHA 2PX3A 4FXOA 2GJ4A 1ISHA 4BVLA 1N0VC 4HDQB 4B84A 2R8RA 2JBHA 3PI7A 2XNDA 3H75A 4J91A 4LWPA 4KXMA 2IYWA 1S9HA 3LDUA 4YY3B 1ODSA 2QRVA 3I5YA 1K98A 4YJFA 2QIPA 4JXKA 1EWKA 1YB7A 3BSFA 1KMNA 3MTAA 2PPLA 4BC0A 3PXUA 4F3RA 3GZNB 4GHWA 1P9NA 1YZFA 2WIAA 3C3KA 1GTG1 1XKQA 1T6YA 1E9DA 2IU0A 1C1HA 3L4SO 4EUHA 5GZ3A 3BTSA 2FG7C 3GJZA 4KQFA 5C52B 4B5LA 3IVCA 1E92A 3ZU5A 1R0RE 3U1VA 4RD3A 3MBKA 2ZWOA 3ANTA 3LKBA 3TZLA 5AM0A 5ICMA 2FSVA 4D9EA 4P81A 4NBWA 1KQNA 4JA0A 4Z9BA 3T0GA 3ACDA 4WINA 3INGA 3IP3A 3NMUF 4K9KA 2DT8A 4BB9A 3H3JA 1EDDA 3KVVA 1XXHA 1NI4A 2P4UA 2V96A 4CR6A 2VT2A 1QFZA 1XWIA 1ZM2A 4LE1A 5DYNA 3RIHA 3TXXA 3BREA 4HR7A 5M2QA 3IL2A 3DOUA 3JZIA 2C3PA 1SVKA 3H5WA 4QG3A 2FQWA 1QO0A 2PG3A 3DL7A 2CXUA 3TQTA 5DFAA 5AOVA 2ATEA 2ARKA 4I4TB 2WU1A 2H2WA 1N9GA 4KR9A 4FSDA 4PTLA 2CVFA 3VPAA 2ZUDA 5LD2C 1HDXA 2V74B 3P1JA 5GQSA 5IVHA 2HDHA 2YBEA 4FE4A 3ZGNA 3HKBA 3ORSA 1FNMA 1R5BA 3FUUA 3MCVA 2QYOA 3RF7A 2Y0DA 5J4KA 3SXJA 2P1ZA 4KDFA 1I2MA 2H57A 3EVEA 1OLXA 4MH0R 3QPDA 5JWOA 3RRNA 7AT1A 2DQYA 2IW1A 4GR9A 3DZ8A 3AMVA 2YWCA 2UZ3A 3BMOB 3EZXA 2C96A 2ZBFA 2IXAA 2VJPA 4XCXA 3C0KA 1AA9A 1AQ6A 4J0HA 3S0JA 4CM5A 3VFDA 5TARA 1D7OA 4IDNA 5TGDA 3BD6A 4J3JA 1E1QA 4RVFA 1NN3A 1RJEA 4B17A 1I13A 2P77A 3TR5A 1QFMA 5KSZA 3GQVA 1YQQA 5LYJA 2BMWA 2HGZA 2OHHA 1K6XA 4KR6A 2QBYB 2XAUA 2GKSA 4RW0A 4EG8A 2P2LA 4OQ4A 1L9KA 2X5OA 2PWZA 4RMNA 5DBGA 4RCZA 1ZVJA 2YC2C 1FU7A 3KUUA 3NPMA 3GJ7A 4ZJPA 5G0TA 1B8OA 3FDIA 2AHRA 2H00A 3IKMB 4J43A 5FL7A 1YJ8A 1KBZA 4M1QA 4QXPA 3SIWA 2J3KA 2ZVJA 2AN9A 3GN1A 3VPSA 3ZKWA 4BASA 1F5SA 1WUJS 4MYTA 1E1MA 3HTXA 2ZVDA 2W7TA 3TK1A 3ND6A 4FYWA 5EXXA 5HYVA 1S3GA 1C7QA 2CNBA 5EN4A 2IUYA 5ALYA 2OSBA 4Z7QB 1JR3D 3IP9A 3VPDA 3AGQA 4ECAA 4A36A 1UBKS 3SSAA 1EK2A 4UKDA 4BKRA 2A35A 1E4YA 3N7TA 2V0NA 5FBWB 4HY3A 4LY6A 3MJFA 4ND8A 3WKBA 3LW8A 1QCCA 5CT9A 3S6JA 4JC4A 3THOA 1PQYA 4YRKA 2YQ4A 3U4GA 4FHEA 1VKRA 3OX1A 4X41A 1QQBA 1W85B 2CJYA 3KJGA 4QULA 4K87A 3R40A 2DHDA 5TSDA 4UUMA 6PFKA 2WTMA 1U3DA 1N3LA 4HN4B 1E7WA 2HF7A 2PGJA 1MC4A 4GM1A 4J6EA 2CWDA 2GHQA 5TQ2B 3CX3A 2AE1A 3GLVA 3OO1A 5EZYA 2V4MA 3EBOA 1E63A 3QQ5A 4BKPA 1UT5A 5AQ1A 1E2PA 3OEED 3V4SA 4LBZA 1ZOPA 1HKUA 2BR3A 3DMGA 1QDEA 1J2YA 1M72A 1AHHA 1V5IA 2G40A 6ADHA 1QDUA 3BBPA 1TEHA 2AD1A 1E9VA 2WDZA 3MLAA 4JLDA 2IOYA 2JI6A 1JNXX 4DYVA 4EVRA 2POCA 3DAHA 1JNYA 1UFKA 3UT5A 4K9QA 3M4XA 1NF3A 2BC9A 3LS2A 4WY5A 2CVZA 4EJSB 4WPGA 3GEMA 4RORA 5KNCA 3PS9A 5JHHB 2AD5A 1XL1A 2GB4A 2HF9A 1RLTA 2ORED 5AW1A 3ZY5A 1IAVA 3PUKA 1JL3A 1ZIYA 3HBJA 1XXLA 1R4MB 2VOJA 4Z1MA 3FFTA 2OWDA 3HABA 4HD8A 2B8NA 1T25A 2PKWA 4QQRA 1QVVA 2XVZA 3R6LA 3RREA 1FMCA 4DDTA 4UM9B 5J2UA 1MGPA 1EWRA 3THXA 5I7SA 2R7MA 2CDRA 2VLBA 4M0PA 1D2GA 1EVYA 2XUOA 1XHEA 2DFKB 1CRWG 2JCVA 2HA0A 4KN5A 3UAVA 4P4UA 5JCZA 1X19A 5EKXA 1E2GA 1U7HA 1XRJA 3H7IA 2QM0A 1T5IA 4W9RA 1C7JA 3DV0A 4K8OA 3RSZA 1LTKA 1U0BB 4I6GA 1HLDA 4RHXA 1CY0A 3C4VA 3ABIA 2OD9A 1PFVA 4D0GA 5AKYA 2OBFA 3I09A 3M6AA 4J29A 5AM5A 1EGQA 3CZCA 5JH7F 2GPWA 4EHAA 4JSRA 1U9CA 4PQEA 4MUXA 3HGMA 1PZNA 4K1LA 3NIFB 4FFWA 4RF4A 3QJYA 4XLTA 3T7KA 4HLCA 1C4KA 4OGGA 4JGIA 3PUJA 2R8EA 5B53A 2V9CA 4G41A 4Z8YA 1LBTA 1PVOA 3SHQA 3OEEA 2FPLA 3L43A 3R5FA 4GZ3A 4J1QA 4ND4A 4O6VA 1JQAA 3OLWA 3F3YA 1NC1A 1KKLA 2AS0A 2EHDA 4CV3A 1HURA 1FTQA 3CV3A 1JAIA 2RI1A 3ZWKA 1QANA 2GCGA 4PX9A 4BUZA 1KR5A 3SOPA 1NBMD 3E7FA 4LAFA 5B5SA 4C5BA 1WAMA 4HJXA 4ZO6A 3AL3A 3Q72A 2VBIA 3EG9B 3ENQA 3M6FA 5BOSA 1RYNA 5B3LA 4G9EA 4I9NA 3BC1A 1OTHA 3GCXA 5E7MA 2NTJA 4JLAA 3C48A 1E5LA 2NV6A 4QVIA 1RWWA 4NCKA 4V1CB 5GPBA 2RGXA 3FKSA 1F2UA 2IHNA 3JARA 3R5HA 1USKA 2YNMC 3QITA 4NFHA 3UTCA 2NZJA 1ZN7A 3HU2A 2ZBVA 2VXOA 1PNOA 2V7QD 4WDRA 2P9CA 1NN5A 1IY1A 2X86A 3WLHA 2W6JD 4MVJD 3UC5A 1E61A 1NVTA 1V26A 3FDZB 2BDUA 2HMUA 4TN5A 4YFYA 1UMCA 1JDUA 5D85A 3AF1A 4LE2A 3UK0A 3GGPA 4KXXA 4EKYA 1DVRA 5CM2Z 3TN7A 4TLDA 2GBGA 2M32A 2O5CA 5H80A 4PZEA 4DCGA 2Z1NA 3CU5A 3SY8A 2WAMA 1Y6RA 2JHAA 4XWAA 2W8ZA 2P11A 3QXHA 3KTAB 2CLOB 2VP2A 4MKGA 2WM9B 3X1DA 5JU6A 3GD7A 4J0QA 3UCFA 1W8IA 2A1UA 2E21A 3L8GA 4KR0A 3ZGXA 3P0HA 2HPHA 3PQ7A 2JFNA 4RHUA 1V5GA 3R5XA 4WWHA 3WGZA 4EGJA 1L1RA 2PM8A 1BJTA 1U2SA 4OLHA 2YVKA 1BIFA 5A2GA 4YO8A 1LXCA 3FOBA 4RVNA 4CDNA 3KIPA 3WBBA 1SU4A 3U44B 1CEYA 2B7CA 2AMFA 3PA6A 3ZLTA 1ZRSA 2F3QA 1GZUA 1ECFA 1KSFX 1C0IA 4KN6A 2IV3A 2EJCA 1SKYB 1IUPA 1ZITA 3N6RA 3ETEA 3W1EA 3M5PA 2F1KA 2PWBA 3FCXA 3OAAA 3OPMA 4BEBA 1EUQA 3ROTA 1NM5A 3Q7EA 4UPDA 2EBUA 2X41A 4K46A 4BECA 2QU7A 4Z49A 5E1MA 5DMHA 5KJ1A 2CFCA 1JEDA 1Q0HA 3R7AA 5JJKA 3PNYA 4K9NA 1OZHA 4WBNA 1NN0A 2OCDA 1QOPB 2YRFA 3R5KA 4RKWA 3FSGD 3TTSA 5LA6F 3GNTA 4WZBA 4EJSC 3STVA 5FOUA 3JVDA 1KI6B 4ZTZB 3FMOB 4WL0A 5FKJA 4Y2SA 1KDVA 1PGQA 2AR9A 2RBKA 4MUMA 1COZA 1PK8A 1XX6A 3ZQJA 4EFMA 3FPJA 3I01M 4V0SA 1GQFA 2EGHA 3DAFA 2QW1A 3KKOA 3U44A 1D5WA 2YFHA 4HVAA 1AGYA 4X63A 4ESHA 1P1JA 2A9FA 4JT4A 4QDTA 4X3CA 3U4CA 1M2WA 4H4CA 4JYZA 1RWPA 1T6ZA 4RHCA 1IOZA 2GTPA 4P8RA 2OBLA 4KIUA 3O94A 3R6WA 4RL4A 1QAOA 5L3SA 4RX1A 4B6EA 4EB8A 1A69A 3G5UA 5HKAA 4BFWA 4NS4A 2KMLA 2Y99A 3ML1A 3GLRA 4E5SA 2I2FA 4B9AA 4FNGA 2VDKB 4IKPA 4JX8A 4EKIA 3COZA 1RYBA 1TA9A 3FR7A 5LQKA 1UBTS 3WLNA 3IQDB 1PNTA 4HN9A 4ZT5A 2P8JA 5E0OA 4OHWA 3B9PA 3NGLA 1EP9A 2XQGA 3PCTA 4TUYB 2QENA 5JCPA 4KFUA 4KJXA 4RENA 4KTTE 3V80A 3T5DA 1W0KD 5KSYA 4LYHA 4DR5B 2DSTA 3JQFC 3V8PA 3W8RA 3WWZA 3ZYZA 4QC2A 4ZVSA 1IJBA 3K16A 1X7WA 4A2WA 3N70A 3JARB 3BE6A 3S7ZA 1HLGA 4G5FA 4N7JA 2XUDA 3U1BA 4Z53A 2QN6A 4QVGA 2WUFA 3ZDAA 1NW8A 4B3HA 4FNOA 1U9YA 2R4UA 4REMA 1JR4A 4GMHA 3CJQA 3VC2A 4LYFA 2VNJA 4P34A 2P9TA 3P45A 5JATA 3TSOA 3ZD7A 9ATCA 2MIIA 2YN0A 2O8CA 2H2IA 1RYZA 1FLAA 4PR0A 1PHPA 1VE7A 5LJLA 2J3IA 4UVGA 1YBMA 3DOOA 4M83A 2PUWA 3KP1A 4LRYA 3K15A 1LKZA 1Z4NA 1DGQA 2YIVX 3I04A 1ZGJA 3X1MA 4V0ME 3WRXC 1CEEA 4R2JA 3TQFA 5I4BA 2WVAA 4DUYB 3CHYA 3C14C 2V7TA 4JQSA 3LOUA 3GFPA 3R41A 4M1YA 5I4KA 2A0FA 1ZR4A 1ZKDA 4QM6A 4RPLA 1UK9A 2Q1WA 3EXFB 2I9PA 3BEDA 1P2DA 1U8TA 2GMWA 3IIEA 4NP6A 4QWWA 4NZYA 2NPIA 1C1XB 2I2XB 4Q4DA 2XXJA 1JG7A 3E9EA 3LBYA 1I1NA 1UJMA 4NU5A 5BXYA 4RPKA 3PRJA 4IH9A 3V4LA 4AP5A 3J80A 3QQPA 1OH6A 4CQLB 3DE5X 1FZQA 3I2IA 3P19A 1M6EX 4YQYA 1SCKA 3ZD8A 3LL7A 5AXBA 4YI3A 3D59A 5E6SB 5BMVB 3E8MA 3QWBA 2LTAA 3LUBA 2FW1A 4OGLA 2WSBA 2NGRA 4ZI7B 3W06A 5B30A 5C80A 1SXJE 4NULA 5B3JA 1G19A 3RUDA 1L1EA 1EVQA 4Q18A 2IUUA 2F7SA 2PGIA 3IVXA 5G2OA 4Z9AA 2LD4A 1P4RA 5B55A 3WZ2A 1K8ZB 3AQ4A 3ESRA 3KSZO 3IVAA 4OAOA 2XY4A 3A6LA 5A71A 4BVGA 2Z08A 3DGEC 4MJ3A 3UYLA 3LF2A 1W7AA 3SKXA 2ZRCA 1AKRA 4LQLA 4BVEA 1EFHA 4X0EA 3MUOA 5AKKA 1R4NA 3FMFA 2DPLA 5HQJA 3OQVA 3AVUA 1O5IA 4TM7A 2XE8A 3F7MA 1EX6A 4QNMA 3T7RA 4LMAA 4L6AA 2D06A 4E6EA 1DEHA 3PNLA 1FSGA 1S8FA 3C8ZA 3B8EA 1L8QA 4OM8A 2W42A 3DOHA 5UKDA 3K0CA 2VHYA 3CM0A 5K0GA 5CFPA 4B80A 4P92A 2JFZA 1D4OA 2EIXA 3BGOS 5BT8A 1TJ3A 1P18A 3CLUD 3GDGA 1F2TB 1SXPA 3ANNA 4BNKA 2BSQA 2G9RA 5EMKA 4ZJUA 4EM6A 3WA7A 1NU6A 3S4YA 2ZJ1A 1PTJA 1CHNA 2RHLA 4UNNA 5FWXA 4B33A 4EFNA 4Q3DA 1XVTA 5A2QA 1YS9A 1V7PC 2E9SA 4X1IA 4YDHB 1L5GB 2JCBA 1HG0A 1RM5A 5ALIA 2QNBA 1HT1E 3RSFA 1HNXB 5KYUB 3R8XA 3L1KA 4JUBA 4G81A 1ANKA 4L0MA 5TEVA 4HNGA 3JQFA 4M0KA 5FWAA 4ZOLB 3GIWA 3QPCA 5T57A 1UWLA 3RAJA 2HREA 3B3FA 5KSPA 1L7VC 5ICGA 4G5QA 3B60A 2XF8A 3HDVA 1B6RA 4X6LA 1J70A 5F3DA 5JZMA 1WCIA 1BHO1 3OKCA 1HT3A 1FMJA 1XQ9A 4D56A 4C76A 1L9XA 3JTEA 4EZEA 5KTNA 4DB2A 1H2EA 4WZBB 3AF5A 2FPSA 2ZBDA 3SE0A 3K0CC 3SS9X 3NIDB 3HDJA 2QTFA 1OAAA 3ES9A 4RA9A 4H18A 4R8RA 2IHBA 3CF0A 1BX1A 5AI8A 3WYFA 2AFVA 3MCTA 3ZYCA 5EYPB 5MDHA 1XDWA 3SVTA 2QUZA 1DAOA 3COVA 4NNOA 1W35A 1IOLA 4U2GA 2QQFA 2XDWA 4DCSA 4IGEA 1FP7A 1BXKA 1O97D 5B36A 2VHWA 4PSDA 3NPAA 1P80A 4Q21A 3IYLW 3VNRA 1VKOA 1R0BA 4EL0A 4FEEA 2LKCA 1M83A 2F9FA 2IUEA 2QSZA 1ID8A 3EY4A 2WWTA 1ZK1A 1H93A 4DCTA 2O1SA 5BQ3A 2GAOA 5AR1A 5KNBD 4YFVA 1QIGA 4TLCA 3O8QA 3V1UA 3D3WA 4IKOA 3UK1A 4F5WA 1L5NA 5C1OA 1NZDA 4RD0A 4P22A 3VZSA 5CVCA 1EG7A 2PQ2A 2TSYB 5EERA 2P78A 3I52A 1YVUA 5DVZA 1TA4A 5IEBA 1Q50A 3UPDA 3COWA 2C7QA 5EWMB 3TGPA 3K8QA 2RKWA 3BX1A 1SC4A 3RTCA 2CCKA 3GA0A 2XNSA 1VKNA 4C6HA 4NWIA 4UAVA 1WHTA 3FVWA 4NARA 1XK7A 1GSIA 2J9GA 1QGUA 1UAYA 4RPJA 4TL9A 5CB6A 1P5JA 4ZV9A 2FPPB 4WEQA 4RV4A 2DQSA 4R8KA 4BNIA 5J3JA 4YVFA 1MPTA 1Z13A 2IZ0A 5DM0A 2WJIA 2EHJA 3DTTA 2QRLA 1ZKMA 3HSYA 4O2AB 1D6NA 2NO6A 4ZAWA 4DR2B 4P33A 4L6IA 4P5EA 2PMEA 1QZTA 1JDBC 9ABPA 1G2OA 2HAEA 4URYR 3UUWA 1J0CA 1NF8A 2VC2B 4H77A 4DDVA 1YKGA 2ZU0C 3QKRB 3GXOA 3I01A 2M1XA 1Z22A 2GH1A 3PQFA 2NU9B 3CZ4A 3TJMA 4CUKA 4Q6BA 1ORIA 4HLDA 3ZN2A 5AVVA 3UJ3X 4PAQA 4OFZA 1BDHA 1X2EA 3BMNB 1ECBA 2OVBA 4MW6A 5CR9A 2NUAA 3GRYA 5KYYA 5TMBA 1G6OA 1V8PA 4JL8A 3RVRA 4HAYA 3WYBA 4OIFA 1X1EA 3QHAA 5J4LA 3ZCPA 1RI3A 3DKKA 2WYUA 5TJ9A 4BVFA 2PUAA 3T9BA 2XTNA 4W5NA 3W5HA 3LXMA 1SXJB 2EDAA 2BR5A 5DBEX 2I62A 4IVRA 2VZ0A 5EJ8A 4AFNA 1OHHA 1BDBA 1XROA 2AX4A 3T54A 4L9AA 3V8EA 4FZ3A 1FFEA 1UPXA 3AG5A 4MIEA 1J39A 1I2BA 1XEWY 5E38A 2J07A 2PGLA 2LKDA 1U2QA 1GAEO 4Q82A 2ATXA 2BR4A 3VA7A 2BGJA 2W4QA 1ESDA 2B20A 3DW3X 1GTL1 3OIYA 5BWLA 4I7EA 1PEAA 2OXIA 5MHTA 2IYVA 4IOMA 2IYOA 2WYIA 4FT4A 4LNAA 4HAUA 3D6FA 1PRYA 1G6HA 2LDXA 4NE7A 1XMSA 4Y8VA 3NHWA 3SMVA 4MQBA 1KZ7B 2P68A 2Q9BA 1GM5A 5BNWA 4Z5XA 4GYJA 1GGHA 2SKDA 1R0LA 3R20A 4KLCA 4RLSA 3RSOA 1GGNA 2ZSIA 3CKYA 4MQFB 4XB2A 4D8UA 1CF2O 4C0QC 3BCUA 3IVGA 2QTMA 4B2PA 3LT0A 2FWAA 2YIMA 1YJCA 4ZT4A 3WK5A 1KWGA 2YMPA 3KVOA 4ZV7A 1FXWA 2ONCA 4K6GA 1K0UA 1XYGA 1JYSA 1XD2B 2H0RA 1H5QA 3ED1A 2HSWA 1KEZA 1REQA 1EFPB 2FR0A 2I8LA 3JQDA 4YAUA 1US8B 3BB3A 3DMYA 3DTVA 1ATIA 2XSZA 3FKJA 3OCJA 4FX5A 4LC1A 2QZ9A 3V42A 4TL7A 4GECA 3GPLA 3IAFA 4WOBA 2XXAB 5CH5A 1L5SA 3LYAA 2FJUA 1L4EA 4RMJA 2ZIXB 2EZ4A 1A50B 2HBQA 1Z07A 1EX7A 4IUDS 4W5WA 3LCUA 4D81A 4BNTA 1MO4A 3RFCA 1JFLA 5BXQC 4IIXA 4TTQA 4C08A 5K3OA 4JI0B 4YK7A 3GELA 1C7RA 4PZYA 3TMKA 3D6HA 4LC0A 5DWDA 3TPFA 3K9FC 3IT2A 3OICA 4GMGA 4HDRB 4MGKR 4UOQA 4F56A 2ERYA 3BK7A 5A03A 3VH1A 4BHTA 1WZNA 4U0KA 1HZZC 3A6EA 4M8LA 3RRFA 3FZQA 4N82A 5IRCD 1Z0UA 2BFCA 1W6UA 3I1IA 1ZN2A 2M98A 4IQ8A 3EARA 1XZPA 2HRDA 5JANA 4Q7QA 5IJWA 3LCMA 4LEIA 3E9YA 4DIDA 3DZJA 5AW3A 1MW8X 2RHMA 3BD8A 1PNRA 5BMVF 1P2VA 3AR4A 3CMCO 3KL4A 1H8ED 5A3JA 4KLRA 4FFSA 2F3SA 1VXOA 2P2DA 5CEEA 1ZBDA 3BIJA 1EFLA 4HRXA 2I1QA 4H7HA 3SEZA 3ZTWA 2YZGA 2CYCA 3FN4A 1FPQA 2YFYA 3I5MA 4WBXC 4COKA 2JA1A 1IDN1 3QA3E 2O07A 3FGNA 3NP7A 1E4VA 4L5IA 4AY4A 3QXSA 3SMQA 4YJ3F 4JYAB 3V8BA 2WFLA 3LLCA 5EHNA 3QIVA 2P3SA 4JQCA 2DJIA 2NWQA 4KNVA 4MVXA 4O4JA 4KAFA 4JVMA 4KSCA 3TL2A 1P2BA 3O0DA 1VA4A 1EFVB 2OKGA 3JVVA 1Y4AE 4EK9A 2ZTUA 5JCXA 4RY0A 2V6JA 1WABA 4XSVA 3U49A 4HH3C 4RV9A 2JLWA 2OGZA 3MT0A 4ARBA 4GH5A 1P77A 3AYZB 1I4EB 2DQ4A 2VQ6A 3RKRA 4HSGA 2C5EA 2PXXA 3DBVO 3HNPA 1QORA 1CUZA 4FE7A 4EB0A 3U7IA 1N8KA 3MOIA 3GT3A 3T1HB 4AJ2A 1D4AA 4DXDA 2WSLA 4GRIA 3HXLA 3DLCA 1Y1SA 1QWOA 2J6BA 3QVGA 3ZJYA 1QHEA 4FS8A 3H5VA 4J6FA 2JGKA 3SR3A 1R8QA 4AAYA 2QXUA 5F2OA 4F46A 4GS5A 1WLYA 1E8NA 2UZ1B 3GLFA 1J8FA 1U1IA 1YR1A 2YY7A 2WIJA 3O31A 4KFSA 3LLSA 4HMQA 5AHKA 1OASA 1HYHA 1ZCJA 3USZA 5LDDC 2TYSB 3HNRA 3P2MA 1KY5A 2RK3A 1QHSA 3F8TA 3RF6A 1D0SA 1KMHB 4WXYB 1RYYA 5F9MA 2QMEA 4BNUA 2FOXA 2GXSA 3F6SA 4MWCA 1RHKA 2E4YA 2J6CA 3PC7A 1IH8A 2GZ3A 5CBKA 4D8WA 2X2PA 4YCSA 1DUVG 1P4GA 2P5SA 3EA4A 1QZXA 3PRKE 3TRJA 2YMQA 4XYLA 3QV1A 1UM9A 2ILVA 2PLNA 2H8GA 3NHFA 1AMUA 4KMRA 1L4GA 1UC5B 2YJ3A 3JQAB 1WF6A 2VJNA 3WWDA 2QTTA 1TB4A 4EY4A 2R48A 2O20A 3L82B 2YCBA 4MGHA 2AFHA 1ZOOA 3F49S 5KNDH 2ZYGA 5L3RA 2XMSA 3DT8A 1JSRA 2O57A 2PRIA 2M9MA 1V37A 2QD4A 2N0SA 3RRBA 3MILA 1TJ4A 3H5RA 1OGIA 4F5EA 1I33A 4DLTA 1F20A 4A0GA 2YZNA 2DM6A 3HH8A 1DJMA 4FD2A 4EUSA 4PYQA 5AKEA 1WMAA 3H8SA 3F73A 4M7OA 3EXG2 1QR2A 3LUJA 1TAQA 3SSOA 3K1ZA 3NYRA 4FKZA 4IDDA 3THYA 1H0KA 1P1RA 1X8LA 4GU5A 4GVLA 1E2MA 3FWHA 3MOGA 4UNIA 1MHPA 2WT4A 4OUDA 1W1IA 3FHCB 4F45A 2GD6A 3L6UA 1FU8A 1K6IA 1RT9A 4Y6LA 3QTTA 3LKDA 2OCYC 1WU7A 5CB8A 4N41A 1VPVA 3FGPA 5E7QA 2H65A 3RWBA 3O4RA 2CL7X 1OJLA 1UT6A 13PKA 1W46A 2IW3A 3C4QA 2NZ8A 2O05A 1SBIA 4IDQA 1WXGA 1W19A 2WIGA 4OHXA 4EG6A 1WVMA 1RXYA 1Q0UA 2G5CA 4C7VA 2EX4A 4KBFA 5JQGF 4KXVA 3UT5B