3A1NA

Crystal structure of l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
315
structure length
315
Chain Sequence
MILVTGSSGQIGTELVPYLAEKYGKKNVIASDIVQRDTGGIKFITLDVSNRDEIDRAVEKYSIDAIFHLAGILSAKGEKDPALAYKVNMNGTYNILEAAKQHRVEKVVIPSTIGVFGPETPKNKVPSITITRPRTMYGVTKIAAELLGQYYYEKFGLDVRSLRYPGIISYKAEPTAGTTDYAVEIFYYAVKREKYKCYLAPNRALPMMYMPDALKALVDLYEADRDKLVLRNGYNVTAYTFTPSELYSKIKERIPEFEIEYKEDFRDKIAATWPESLDSSEASNEWGFSIEYDLDRTIDDMIDHISEKLGIEGKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NDP-sugar epimerase
publication title Crystal Structure of Binary and Ternary Complexes of Archaeal UDP-galactose 4-Epimerase-like L-Threonine Dehydrogenase from Thermoplasma volcanium.
pubmed doi rcsb
source organism Thermoplasma volcanium
molecule tags Oxidoreductase
total genus 120
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2009-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3a1nA00
1P31A 1HTBA 4XQGA 4BNJA 4BV8A 2D59A 1FK8A 4RPHA 5HS4A 3BTVA 1PJSA 1YOVA 4MIYA 4RPKA 1UXJA 4D41A 3DBVO 2PFGA 1UZNA 1PL6A 3PTZA 4G2NA 1TT7A 4O6VA 3AUUA 4XJTA 2VUTA 1P44A 4GX1A 4RORA 3F5SA 4FCCA 2QHXA 4HUJA 5EINA 2RHRA 3WQQA 5HS6A 3A1NA 4FJ1A 1PGOA 2YYYA 4FGSA 4R16A 1N8KA 2HMVA 2IXBA 4R9RA 3UCEA 5IAAA 1JAYA 1XGKA 2Y67A 1AGNA 1BG6A 1GZ3A 2DPHA 4CUZA 4DLBA 2AXQA 4CLHA 4E12A 4DC0A 3IL2A 2FZWA 4EJ6A 2EGGA 4FFRA 1KYQA 4QUKA 3QVXA 1I2CA 2G82A 5L45A 4CMEA 1LRLA 3WLEA 1IHYA 2PZMA 4DGSA 1SBYA 3LC2O 3G1TA 2WD7A 4PLYA 5EPOA 3CTMA 3JD1A 3AU8A 3VZSA 1W4ZA 1T2EA 1GU7A 4JGBA 4IJUA 4URFA 3ZNPA 2E6UX 2R2GA 3K2EA 3CZRA 3Q2IA 3ONDA 3WIEA 2EKLA 3PGXA 4K6CA 1MV8A 4MKXA 3VHRA 3WGGA 4PN3A 3HN2A 1O89A 1MX3A 5A9TA 1TB4A 2NU7A 4BGVA 2QG4A 4I9UA 1J6UA 3UH1A 1U4SA 1E3LA 1PZEA 2XOXA 1DEHA 3GLQA 5C7LO 3UKOA 4FW8A 1KC1A 3OA0A 4XB1A 5ILGA 2CF5A 1UZLA 1EDZA 4ZN6A 4L73A 1GL3A 4XR4A 1N7GA 3LC1O 3V1TC 3X2FA 3I9MA 1AXEA 1Z7BA 2NSDA 3S2EA 4CLDA 4CLXA 3S1LA 3GGGA 3MTGA 4AJ2A 1ZSNA 4CPDA 4E21A 3RU7A 1OFGA 2BHLA 1Y5MA 1F0YA 1XKQA 4LMPA 1P3DA 3ICPA 3QVWA 4D45A 4M55A 5DBGA 1M75A 4ZQFA 4WE3A 2PD3A 2PD6A 3E18A 3W6ZA 1PJCA 3GDOA 3F46A 2X58A 3ITDA 1B26A 1G0OA 3Q1LA 2VT3A 3AY3A 3HWRA 2PNFA 4RPGA 1GD1O 4AICA 4KP7A 1FDUA 2A92A 5COBA 3FBGA 1YS4A 3H5RA 1HYGA 2DU8A 3QP9A 3GPDG 1Y1PA 3P2YA 3W1VA 2AG5A 3MOGA 1K6XA 3INTA 2J5RA 1Z45A 3IC5A 4FC6A 4KWIA 1SB8A 3FWNA 2VTDA 4GVXA 1HE2A 2PKQO 2NU6A 1KY4A 1VPDA 3DZGA 1XIVA 4MINA 5DP1A 4UREA 4YRBA 5FF9A 1ZSYA 3JQ8A 2JCVA 2EP5A 4TZKA 5T64A 4CM8B 4E6PA 3NDJA 4IJWA 4B4WA 1K2WA 4ZA2A 2QZ9A 5CPBA 1BDBA 4WPGA 3L0DA 2VUSA 3DZJA 3HG7A 2HAEA 3TWOA 1FXSA 4QX6A 5B37A 2C29D 2FPGA 2NADA 1U8FO 3E1KA 4HP8A 7MDHA 3JYQA 4NZ9A 5BNTA 5FI3A 2VNSA 1T2AA 3GUCA 5JO9A 4CQMA 1T24A 5CG2A 2YHUA 3P7MA 2EHDA 4FQ8A 3EK2A 3HNPA 4D7AA 4BMSA 4ZQHA 3S55A 5BSHA 4YAKA 2IYOA 4CMKA 3PFWO 4D3DA 1YQGA 5I7EA 4A26A 2J8ZA 3IKTA 4M1QA 2PZKA 2B37A 3RC2A 1C0PA 3K73O 4YAJA 4RVGA 4WJZA 5TJHA 4XRRA 1I0ZA 1MXHA 4YJGA 3ZHXA 4RVHA 2CUKA 3OIDA 4Q39A 3ASVA 2NNLD 3D4OA 4YT4A 1X7DA 4L8VA 4UVIA 4CMCA 1JDJA 2BF7A 3DBRA 3H9GA 1W8DA 1G0NA 5COQA 2J5QA 5DN9A 1ADFA 1Q0HA 5TT0A 3S2FA 3VAZA 3ZWBA 4BHTA 1BXGB 4P8RA 7ADHA 3PHJA 1I24A 1U3VA 2J3KA 3PK0A 5DCUA 1YBAA 2RIRA 5BSGA 1VSUA 2P5YA 5T8KA 4CR6A 3LLVA 2ILTA 4OXNA 5IZCC 1NFFA 4BKQA 1J4AA 2QRKA 2X1HA 5CDGA 1EZ4A 1MFPA 5JE8A 2CDAA 3RFVA 4I5GA 1L1FA 4DBZA 5IZCA 1PQUA 1ZMTA 3KEQA 5GY7A 2NV6A 1ZK4A 3K9QO 2UUOA 4U0JA 1VSVA 4UVEA 1A72A 1HE3A 4TZTA 1HSOA 4J1SA 2WEKA 4NK4A 3GVCA 4J1TA 4YQZA 3ONEA 2P2SA 3DZFA 2JKVA 3QY9A 3EGOA 3KSUA 4AJKA 4E13A 1Y8QA 3AWDA 2OZPA 1Q0QA 2NTVA 4HX5A 4NMHA 4AJEA 2NU8A 4XQCA 2EKQA 2OXIA 1WMBA 3G1UA 4MVJG 2IE0A 2H9IA 1WAMA 4RF2A 5G0WA 1PJBA 2Q45A 1AUPA 2D8AA 1HLDA 2O3TA 4GX2A 3V2HA 3VZRA 4BNIA 4XYMA 3V2GA 4F6LA 2ZQZA 4BO5A 3I9LA 1GAEO 4B3JA 1CEQA 1E7SA 3SC6A 3B20A 3U4HA 2Z1MA 4J7UA 3GAFA 1J5PA 4RQTA 4XKJA 4BMNA 1E92A 5DP2A 3BMOB 1H9AA 4J7XA 3WBBA 5IXSA 3AUSA 3F1LA 1ZO8A 4KTVE 5JC1A 3AM3A 4J4TA 3K5PA 1ZJZA 2PKRA 2HRZA 5KJFA 4CM4A 4UUPA 2VYNA 2G5CA 3C8MA 2B35A 4YA6A 1HE4A 3VC7A 2HRBA 1QRRA 3DOJA 3SLGA 4J4BA 1XG5A 1VJ1A 3B70A 3V1UA 3RUAA 4BNMA 2O7SA 2UVDA 2WSBA 4LGVA 3DXFA 4IUYA 4J1QA 1IE3A 1LEHA 2J3HA 3JTMA 5A5EA 1ISFA 4N5NA 1TT5B 2WD8A 4CM3A 1KVSA 2VT2A 3ORFA 3WR5A 4WLUA 1XU9A 4BNYA 4YYZA 1UXKA 3PYLA 5A5FA 4P4NA 3OJ0A 5BQFA 1BVUA 2GNAA 2PZLA 1PS9A 3CMMA 4MJLA 4Q3EA 3ADPA 1KS9A 3DB2A 2VHYA 4FOOA 5EN4A 4D0SA 1MUUA 4WLFA 3IMFA 2WE8A 1XDWA 2UV8A 3GA0A 4QFDA 1XEAA 1PR3A 1OI7A 1F17A 2Z95A 1IUKA 4BGUA 5CDYA 4YJHB 3DDNA 1SNYA 1QORA 1N2SA 2V65A 3DTTA 3H4VA 4NPCA 4XCVA 3DZKA 1NTOA 3AOGA 4Z0HO 4E5YA 1LQTA 2YV1A 2P68A 3UAGA 4PLGA 2Y1DA 4DC1A 1ENOA 3C7DB 1D4FA 4R1TA 5KJ6A 2Y68A 3A06A 2X8LA 3H3JA 5C7IO 2NVUB 1DIGA 1FDVA 3NRCA 1A9YA 1NFQA 1WZIA 3PZBA 1UUFA 2Y93A 3AFNA 2Y1FA 4WLNA 2JD1A 4BIIA 4CLEA 1ZKMA 3DFZA 1HDGO 3KLPX 5ER6A 3WYBA 4UUNA 1U1IA 2Y0CA 6ADHA 5DDIP 5IJZA 3CPSA 1PR9A 4ND3A 4YCAA 3NDIA 4NBVA 1G1AA 2X9NA 2UDPA 3OQ1A 1NPTO 1EUCA 3JD0A 1GZ4A 2NQTA 3ZHZA 1B7GO 1F12A 1WLYA 1I36A 4RF3A 3DBLA 4B3HA 1QSGA 2ZQYA 4G5HA 1O0SA 4MVJD 3PJGA 1UH5A 1N9GB 3PHGA 3JQ6A 2JAPA 3NGLA 4N54A 4WNIA 3EZYA 4XGIA 1IL0A 2BGKA 4XRGA 2HKIA 2HUNA 1H0KA 3WSWA 2CNBA 5TQVA 3ON5A 5IDXA 5H81A 4OOEA 4QT0A 4J90A 1YJ8A 1I3NA 1NFRA 1QYCA 2CVOA 3CZMA 3QW2A 4FBGA 1XYGA 4ZQEA 2BELA 2O7QA 3STHA 4OSPA 4BKUA 4I9NA 2CY0A 3IDSA 5MGBA 3L6DA 1BXZA 1GFSA 4QFCA 4XQEA 1LSJA 4KQWA 2PV7A 3K8ZA 1O5IA 2JFFA 3NGXA 4NU5A 1H6BA 3RD5A 4CR7A 4DLAA 3IP3A 3Q6IA 4OO3A 4LVCA 1EVZA 2NWQA 3RUHA 1LDGA 4WCFC 2YHIA 1BDMA 4MOWA 4KUHA 4BO7A 4BO4A 4JK3A 4ZU3A 1PGJA 1ZNQO 2ZB7A 3GMSA 1NM5A 4GGOA 4WCFA 2JCXA 5H83A 4L9RA 1SB9A 3PXXA 1PZHA 4QQRA 3PWSA 1HSZA 2NVBA 3HB4X 3VZPA 3V5NA 4FN4A 5L40A 3FTPA 2BD0A 3NV9A 1LDNA 1GDHA 2RAFA 1MC5A 2OHXA 3T7EA 1XR3A 2AE2A 2J3JA 2A35A 2VZ9A 3ANLA 3CXRA 2VCYA 4JP3A 4YT8A 3RUEA 2X9VA 3DFUA 4Q3CA 3L77A 4Q3NA 4EZBA 4CQLA 4ROSA 4BKRA 4NJOA 3DBHA 4DRYA 3QLJA 1RYEA 3GZNB 1WMAA 3KYCA 4H15A 5CDUA 3GVHA 1R66A 3GN1A 4J9UE 3KBOA 4RVFA 1VKOA 1PL8A 4DQUA 1GCOA 4M86A 2ZB4A 3L4SO 3SJ7A 2FZEA 5G4KA 3VPFA 1DXYA 1ADGA 4J0FA 4Z3KA 2BH9A 4J2HA 1F06A 2C54A 1DC4A 2DVMA 2E82A 2JFHA 3GHYA 3D7LA 4NIMA 1K89A 2BLLA 3IJPA 3LC7O 1SOVA 4J1NA 3GEGA 5I8ZA 5JDCA 2JJYA 2GO1A 4FFNA 2EW8A 5F3RA 2NU9A 1Y8RA 4W82A 1HDXA 3NT4A 3DAPA 3BMNA 2DUWA 2Q1SA 2D4AA 3TRIA 1VI2A 5FFFA 1DAOA 3S2GA 2D2IA 3U4IA 3GGPA 1ID1A 4XWYA 4WECA 4AJNA 4DVJA 5EESA 1B8UA 1OC4A 2IZ0A 2QW8A 1E6UA 4I1IA 5KVVA 1LX6A 1HDYA 2YV2A 1NPYA 2ZTVA 1VC2A 3IJRA 4JBGA 4YTEA 3OQBA 4MKZA 4B4UA 1P1RA 1M2WA 3JQBA 4IBOA 5DULA 4XDYA 3CIFA 2GASA 4EEXA 1KY5A 4GL4A 5CDTA 4LN1A 1ZCJA 4RGBA 1ORRA 2WYUA 2PGJA 5L3ZA 1SCUA 1L7EA 2FR0A 3TZKA 3W8FA 1YQXA 1QLJA 1RKXA 5JSFA 3K31A 3DHNA 4ZJUA 4ILKA 1ZBQA 1P1HA 1IB6A 3KYDB 4JJIA 5JAIA 1DC3A 1NYTA 2A9FA 3AI2A 2JHFA 1D1TA 3LVFO 1H5QA 5L4LA 1RM5A 4RCVA 5EIOA 3VTZA 4BMVA 4CM9D 1QV7A 4UEKA 3H5NA 2AQKA 2P9EA 5KWEA 3WIDA 1PQPA 1WW8A 4R4JA 1IY8A 4ZD6A 3FR8A 3GY0A 4WLOA 3N7UA 3PZRA 4EUEA 4NJMA 2R00C 4CM1A 3L6EA 4HFMA 8ADHA 5IZ4A 3SVTA 3PJEA 2ET6A 1I5RA 4IDBA 4TRMA 1XCBA 1DB3A 3MJEA 3D0OA 3DMYA 2GLXA 5H82A 4EITA 4ALNA 2BFPA 3O8QA 2WWRA 3UHAA 1NVGA 1EFKA 4I5DA 4O59O 3VOSA 3NDRA 5G0TA 4BS9A 2ZIZA 1DIHA 4RL6A 2ZJ0A 1R0SA 3BA1A 4IXTA 4R69A 4FS3A 1U5CA 3AUTA 3QVSA 4FIZA 4MVJP 1E3WB 1Q7CA 2I66A 2Y05A 3BTUA 4BKPA 1YONA 2YV3A 1DIBA 5THKA 2ZCVA 2V6BA 3PFFA 4DLLA 5KTKA 3ZU3A 2QYSA 1TLTA 1O6ZA 2GCGA 3D3EA 4L4XA 3HDYA 2O2SA 4E5KA 2NUAA 3E6AA 3IOYA 4GH5A 3ZHBA 2X5KO 4E3ZA 1E1KA 2V7PA 3GAZA 3MJCA 4K28A 3ZW8A 1TXGA 3HFSA 1U3UA 4JJGA 5IDWA 3PLNA 1B14A 4NG5A 1D1SA 3H2ZA 3ZNOA 2AHRA 2O2YA 4NR0A 4EBFA 4UEJA 1WZEA 1GYPA 1S6YA 4JX8A 2O23A 1OBFO 4XIJA 5TNXA 2GRAA 1NXQA 3LSYA 4ALKA 4YJFA 2C0CA 1E7YA 2TMGA 3COSA 2WE7A 2HSDA 1Z73A 1A27A 1ZXBA 4IDFA 4I08A 5AXAA 3JQ9A 1KVTA 5ENDA 1Z74A 3TNLA 1DIRA 4OQZA 2CDCA 4HFNA 4TRNA 4C7KA 4DL9A 1Z6ZA 3FRJA 1JA9A 4CV1A 1HE5A 4GQAA 3O26A 4W7IA 2C7VA 3DTYA 4Q9NA 4F3YA 3OIFA 5B4TA 2SCUA 3BHMA 3GNQA 2WYWA 4F45A 3RI3A 2O3UA 4D0RA 3ADOA 1YQDA 5G0VA 1K6JA 3ICCA 1SEVA 2X6TA 2JL1A 3ETDA 4TMFA 3H7AA 1ENZA 4DQXA 5EQDA 4DPMA 5KIAA 2B4TO 2E49A 4GVLA 4XEHA 3RC7A 1VM6A 1PJLA 2FR1A 3ZH2A 3ZV4A 4G81A 4BGEA 3DOCA 2OP0A 3ANMA 2POQX 1UXGA 4L74A 2PD4A 3OJEA 5JPIA 4FFMA 2X9GA 3LF1A 5DF1A 1V0JA 3PQDA 1JW9B 1F8GA 4Y9DA 3QIVA 4AJPA 4E0BA 5CG1A 4W4TA 2VHZA 4OKIA 3SXPA 1DC5A 3OP4A 5JMPA 5KKCA 5L53A 1EMDA 4OXYA 3E9MA 3WMXA 1R4NA 1DLIA 2C5EA 4I9HA 1C0KA 1BMDA 9LDTA 1FDWA 1UDCA 5L4SA 4XB2A 3LQFA 1I2ZA 4QXMA 3KRTA 2AEJA 2ZK7A 4W7HA 4N7RA 3AFMA 4BQPA 3QV1A 4FOSA 1Q7BA 2AG8A 4JBIA 4ZQBA 2RBEA 5EMHA 2WJPA 3RC9A 4PLWA 4ZQGA 4TSKA 3KO8A 4D3FA 1LLCA 4R41A 2HMWA 1I3MA 3GHHA 4DIOA 2NACA 3OJFA 4EJ0A 3JD2A 1CWUA 3QVTA 4RVDA 5CEFA 1MFZA 4JIGA 4DXHA 4XQ9A 4BNKA 4W99A 3I6IA 5HM8A 1A7AA 4BNGA 2Y1CA 3E5RA 1R4MA 2O3QA 3GEMA 5EJ2A 4DUPA 3PDJA 5G0UA 4XYEA 5JY6A 4J4HA 2FMUA 3ASUA 4UVGA 4OQYA 2OBYA 1N92A 2RH8A 3QWAA 5JW6A 4YJDA 5A02A 4R68A 1NWHA 3JQGA 2BGLA 1ZXLA 3F9IA 5DCYA 3LT0A 1O94A 5L9AA 4Y98A 1PJ2A 3G79A 4EYEA 1YKFA 4JP2A 4E2YA 1Y7TA 4YAGA 1AHIA 4B3IA 3LU1A 1P74A 1U2DA 2Q1UA 3BIOA 3GVIA 1AN9A 4R1UA 3U09A 4LRTB 1EUDA 3KEOA 3ZV6A 3OEWA 4IGFA 3C7CB 3KV3O 3T4EA 3DHEA 3LT4A 2WDZA 3PPIA 3JYNA 4FFPA 4JBHA 4CQMD 1K3TA 2FN7A 1ONOA 4HADA 2W2KA 2FWMX 4FPXA 4LCEA 3RQSA 4BNWA 1U3TA 2W90A 1X14A 3GGOA 1PJ4A 5DT9A 4BO1A 4DA9A 1YBVA 3QVOA 3RBZA 3I83A 1GADO 2GDZA 2OUIA 3RASA 2DTDA 2AA3A 4I8XA 3D5QA 3M2PA 1BW9A 3OFSA 4ND5A 4PLTA 5DOZA 5ICSA 1C1XA 1MP0A 2DQ4A 2QX7A 3JQCA 4GMFA 4PG7A 4A0SA 4BNZA 4XDZA 1H6CA 1C1DB 4WCDA 2VTEA 3ZZNA 4U7WA 1HT0A 1SMKA 1T2FA 3IIEA 3PHIA 4RO0A 1N1GA 2O3SA 4GGPA 4ID9A 1YRLA 2C07A 1CERA 3CEAA 1NX6A 1PL7A 3HE3A 2OORA 4JQCA 4CMIB 1M76A 2C2XA 1I01A 3GK3A 3OBBA 4FD3A 4QO7A 3GNTA 2AEMA 2ZTUA 3BMCA 3H8VA 4GLLA 2HCTA 4DIBA 2GZ3A 3BMQA 1CETA 4A10A 4XR9A 2EXXA 5EERA 2PLAA 1LRKA 1WWKA 1X0XA 2PKQP 1LJ8A 4H16A 3GH3A 1SC6A 5A9SB 4OHUA 2DBZA 2VRCA 1B16A 3FNFA 3TOXA 2P5UA 3E5MA 1PGQA 4F46A 8LDHA 1T1SA 3WGHA 3NX4A 5DBFA 2D5CA 1KVRA 4F6CA 1E7MA 3NTQA 3ROPA 2D5AA 2VUUA 1E1MA 2Q3EA 1OZAA 2W8ZA 1PJTA 2CF6A 3GMDA 3P19A 3RUIA 4FB5A 3DAGA 1XQ1A 1CYDA 1ISIA 1BGVA 3JQAB 1P1JA 4B8ZA 1E6EA 3F5QA 5JFOA 1U2GA 2B4RO 1GQ2A 2IODA 3NJ4A 1YO6A 3OIGA 1Q7GA 1UXHA 4R5HA 3TPCA 1BWSA 1NNUA 2E4AA 1DFHA 1R37A 3H2SA 4BL5A 4NU6A 1NHWA 4EEZA 1E3JA 1ZK3A 4WK6A 3JYOA 1JWAB 4R5MA 4FSHA 4WOJA 4GMGA 5DCWA 4OGWA 5I7SA 3VPHA 2VZ0A 4IMPA 4CJXA 1H6DA 1TVEA 3PJFA 2H5LA 1LXCA 4GX0A 1MB4A 1EFLA 3AY6A 2O4CA 5BT9A 3H9EO 3RAJA 4UUMA 4EGFA 4E30A 4NI5A 3KETA 1CQJA 1HDRA 2XPCA 4CMJA 4W9NC 1YOVB 2VYND 2P9GA 4DTIA 3WWZA 3ZWNA 4J9VA 2HMUA 4W9NA 4TWRA 5JS6A 4IDEA 1RJWA 5EQFA 4RLHA 3W6UA 3RUCA 1FF9A 3UN1A 4FDAA 2BRUA 5TLSA 3I6QA 1JWBB 2HDHA 3PQEA 3TZHA 3RUFA 5AXCA 1JVSA 1ISGA 3DHYA 4Z9YA 4NNJA 4O1MA 4WEOA 1J49A 4B7XA 3M2TA 4R01A 4OL9A 3W4IA 1Y6JA 4BNUA 5AQ1A 3HB5X 3L4BC 2R6JA 2CVZA 2I76A 3ZWXA 1SZJG 4OH1A 4U6SA 4M8SA 4PVDA 3D4NA 3ZGYA 4P22A 5A1TA 5I7FA 2VRBA 5EL0A 2WD7B 3NUGA 1WNTA 1Y5RA 2YZ7A 5I9LA 4D43A 2GZ1A 2O50A 4RDHA 3WQRA 3DQPA 4IQ0A 3TFQA 1YDEA 2DM6A 2C82A 3DMTC 3OH8A 4PLZA 1U9JA 3V2UA 4R1SA 3W4KA 1ZMOA 4EJMA 1W6UA 1LQUA 5JCJA 3DMTA 2J5KA 3WTBA 1Z75A 3HHPA 4ND1A 4NK5A 1VKNA 2V6FA 5KOIA 1V9LA 2CZCA 4IS3A 5G4LA 3D3WA 2JHGA 3MWDB 3Q9NA 2LDBA 2IDZA 4YT2A 9LDBA 2I99A 1QYWA 3ANNA 1SO8A 4CLRA 4BNLA 4LRSB 5FYDA 5GZ1A 2J3IA 1I32A 3SEFA 1Y9AA 1B3BA 4RVUA 5I9NA 4PRKA 2YQ4A 3I23A 3M1AA 1F14A 2W2LA 3P2OA 3ZWOA 2VYVA 3CE6A 4HBGA 4OAQA 4P4GA 3VZQA 4DMLA 3F1KA 1HL3A 4CLOA 4PRLA 1YGYA 2V6MA 1BTOA 5HWSA 1Y9EA 1GYQA 1O8CA 4G65A 5T67A 5A4DA 2H6EA 3TN7A 4X54A 1DRVA 1PWXA 2OGUA 4UAGA 3L07A 3PRJA 3MWEB 4B79A 5CEJA 3JD4A 5I9MA 1E1LA 2C59A 4GWGA 1SEPA 5I7VA 1JLLA 2GN9A 3KSDO 4RZIA 1JU9A 1SOWA 3V1YA 1T1RA 1NQOA 1N5DA 4NH4A 4E2WA 1DHTA 2DTEA 3HQ4O 3DAFA 2RCYA 3PI7A 4JLWA 1GTMA 1C0IA 2CMDA 4ZRMA 1E0DA 1B15A 1U5AA 1R0KA 5IDQA 4BB5A 1V3VA 2HMSA 1VL6A 4BNFA 2AE1A 4Z9XA 4YR9A 1LA2A 4R1NA 1I10A 4RF4A 3JQ8B 3WXBA 4BQRA 1LRJA 5CHEA 5HA5A 3AJRA 3L9XA 1X0VA 3MOIA 4N18A 3JQ7A 2FY8A 2CFCA 2NTJA 2RH4A 2ZB8A 3WJ7A 4PLFA 2YFHA 1ENPA 1GY8A 2O4UX 3U9LA 1T2CA 1Y81A 3TZ6A 3H65A 5L7YA 4GWKA 4MVJH 3W8DA 1YVEI 3OF2A 5IG2A 1LNQA 3C3XA 3U3XA 1ZJYA 3VPGA 1JKFA 3ITKA 1U7TA 3PQFA 1CDOA 1GYRA 4CQMB 3FSRA 4IDDA 1YXMA 3QWHA 3KXDA 3VH2A 3NYWA 1EK6A 2VWQA 3TL3A 3SC4A 4DYDA 3E03A 5IXYA 3GFGA 1YB4A 2C2YA 3RFXA 2E48A 1ISHA 2WM3A 3EC7A 4KUEA 3ZWWA 4E2XA 5KNLA 4NDNE 4OM8A 3DZHA 4E4YA 1U3WA 4CMAA 3FBTA 4NBWA 4QTZA 4YJGB 3PLRA 3K96A 4KWHA 3ZWCA 4TVOA 4U5QA 2YJZA 5L7TA 3A28A 1MC4A 3IP1A 1N7HA 5LDHA 4MP8A 1YL7A 3UCXA 2W98A 5KJ1A 4UVHA 3DBRB 2A94A 3A4VA 2NQ8A 1LC3A 1H6AA 3RVDA 4BO9A 3I4FA 4PG4A 1HLPA 5ER9A 1ONNA 2FSVA 3RBXA 4U8GA 2EJWA 4RQUA 1GQQA 2FOIA 2VNAA 3PP8A 4XGKA 3FPLA 1U4OA 2GSDA 1A4UA 3ZN2A 1P45A 1PJ3A 1T25A 4W6ZA 2P9CA 4HXYA 1EBUA 4YRDA 1M66A 2O48X 4K26A 4NBTA 1ISJA 3F4BA 2FSSA 1H9BA 3EW7A 4R54A 1PU2A 1GV0A 1UAGA 3D1LA 4M49A 5LDGA 5IFLA 1H2BA 3PJDA 4L4RA 5F1OA 5A03A 3B1KA 4E33A 1HEUA 5FI5A 2HJSA 3LK7A 3U5TA 3H5AA 1HDCA 2W4QA 3HSKA 4HY3A 5C7OO 3E8XA 1ZEJA 4Q3DA 5FEUA 1D8AA 1B8VA 1DOHA 2VOJA 5F1PA 1GUYA 1HYEA 1Y8QB 2B83A 1SPXA 4LCJA 1LDMA 1ARZA 3BTSA 4BO3A 2GF2A 3GVXA 5JYEA 1I8TA 3HUDA 5JY1A 4Y67A 1DRWA 3MJSA 1PSDA 3FF4A 3B1FA 2X22A 4I5FA 2IEDA 3KB6A 4XZ3A 2HK9A 3BZUA 1E5LA 1ONPA 1BVRA 3PVZA 4AJOA 1TA4A 4YAIA 5JO0A 3IS3A 1EE9A 4CV3A 1NR7A 1BXKA 3I5MA 2DLDA 2GN8A 1VL8A 3GF4A 4YRAA 3R3SA 1C3VA 1D3AA 3DZBA 3IKVA 1AE1A 5JLAA 1FDSA 4P38A 3KYBA 4RJTA 3L9WA 2ZATA 5LCXA 4OKNA 3RWBA 4U6QA 3CMCO 1PS0A 3PWKA 4KOAA 1ZVMA 4J0EA 4K9DA 4PVCA 1GZ6A 4ALJA 3BTOA 4XYLA 2CDBA 4ALMA 4CM4B 4TKMA 2QQ5A 3DEYX 4KDFA 3OM9A 3KTDA 4A2CA 4PGFA 1DLJA 3TOZA 4P4LA 4DPKA 1X7GA 1IHXA 5KVCA 4R9SA 1AHHA 1MG5A 1PZFA 4IS2A 3FN4A 4DIFA 1T26A 2VOEA 1R15A 2DT5A 1HDOA 2A4KA 3PYXA 3QA9A 4CMBA 2BI8A 3I52A 3ZW9A 4CM8A 4K1LA 2AW5A 1JKIA 4TVBA 3LDHA 2B5VA 4BO0A 3ULKA 4B8WA 3C24A 2EGHA 4WEQA 5DZSA 2R00A 1R12A 5A3VA 4QSMA 3C7AA 2HQ1A 2ZTLA 3RKUA 2C20A 4BO8A 4D44A 3WGIA 3QQPA 2B4QA 3FTNA 1DBVO 1RM3A 3VDRA 4GLOA 5K0ZA 5JAMA 2GD1O 3GN2A 4J43A 5CFZA 3I4CA 1KIFA 1HZZA 1NPDA 2HJRA 1H2HA 3Q3CA 4RPJA 2EV9A 1JAXA 2NTNA 2BI7A 3I1JA 4GPD1 1UDAA 3VPSA 3SBOA 3IUPA 5B4VA 5BSEA 2IRWA 4Y8VA 5F21A 4LK3A 4CR8A 2ZTMA 2DBVO 4E5PA 4IMRA 3IAHA 3TDKA 2PZJA 2Y99A 3WFJA 2DC1A 2ZCUA 1NBOA 5ITWA 3BXXA 2OFPA 4DYVA 2IZ1A 4Y6SA 2Z5LA 5AXBA 3ZV5A 5IF3A 3QWFA 4S3MA 1PGPA 4Z0PA 3GG2A 3QWBA 4CM5A 1BXGA 4J2OA 4ALIA 1W0CA 3SLKA 3O9ZA 2ZJ1A 3F47A 4E32A 4FGWA 4PLHA 3RU9A 1NQAO 4FC7A 2UUPA 2H63A 4Z6KA 4YAEA 4MKRA 3H9JA 1M6WA 3KVOA 5ADHA 1DPGA 2GPTA 4BNTA 3IUSA 4PCVA 3TSCA 2C7GA 2GR9A 1YL6A 4HNGA 1P1FA 4HFRA 1DO8A 3WNVA 3GC6A 4MIEA 4ND2A 4IIUA 1ZK0A 1AXGA 4AG3A 4GI2A 4EW6A 1U28A 4TKLA 2IYPA 3DBLB 3WJAA 1WDMA 4MVJM 4YPOA 3EHEA 5K6AC 4PG5A 1LLDA 1B8PA 1XELA 3B1JA 1A7KA 5DOVA 1R16A 5K6AA 1IOLA 4KDEA 2GN4A 4IY1A 4IJKA 1MGOA 4DPLA 4B7UA 3QWIA 4S1VA 3NAQA 2DPGA 2Q4EA 3ENKA 3FHLA 1LBEA 5TGDA 4Z3DA 3EZLA 4AL4A 1LU9A 4KZPA 2YW9A 3BHIA 4OMUA 2VWPA 4MP3A 5ILOA 2EWMA 2JCYA 5G0SA 3RBVA 3WWYA 2Q49A 2B5WA 4Y6RA 4E2ZA 3CSDA 4B4VA 4OYRA 4HV4A 3ZI0A 3WOHA 4DWVA 5F5LA 2YFQA 4HKTA 4D42A 2YHIB 4MP6A 4L4SA 3HJAA 1ZEMA 3BMOA 3OECA 4UUOA 4WCFB 2WMDA 1DHRA 3HDHA 3QJ5A 1JTVA 3PIIA 4BUCA 3TL2A 4CMGA 3UGKA 5T6BA 4DREA 1X7HA 3WFIA 3INGA 3QSGA 2FRDA 2Q1TA 2XXBA 5ENVA 4BB6A 1CRWG 3R1IA 3NTRA 4H3VA 2Q99A 3UVEA 3AM5A 4II3A 1LTHR 1R6DA 2DAPA 1BRMA 2F1KA 3I9NA 1EEHA 4QECA 3GDFA 3KUXA 4CMEC 3I9KA 4IIVA 3UUWA 1DFIA 1XQ6A 2VN8A 3V8BA 4CQLB 1XWFA 1DRUA 3DBHB 3DWFA 3KYCB 5BR7A 5JDIC 4JJFA 4WASA 3A9WA 2H1SA 1E1NA 1HZJA 2O3RA 3K6JA 3VTFA 3C1TA 5JDIA 4R51A 1J0XO 1TT5A 1V3UA 2Q4BA 5G4KB 2D1YA 3GFBA 3WGTA 2X0RA 1PJQA 2VHXA 2D3TA 4WOKA 4XIYA 3OJLA 4A7PA 1ZW1A 3D64A 2E37A 3HFGA 3WB9A 4KQXA 2UYYA 1P0FA 3WLFA 2Q2WA 1MA0A 1Y8RB 3PEFA 5GZ6A 3VDQA 1NQ5A 3BMNB 2X5JO 2I67A 5JXWA 3WS7A 3TJRA 4PLPA 4PLCA 4YJHA 4YDRA 4B7CA 4BNNA 1MLDA 3TFOA 3WQSB 5L51A 4ZVVA 2G17A 1ENYA 2PH5A 3RJ9A 2Q2QA 5GZ3A 1GPDG 2X23A 2XAAA 1PWZA 4OSOA 1UDBA 2GYYA 3C1OA 3UW3A 1WXDA 3SX2A 1ADBA 3AI1A 3JQEA 4YB8A 1UP7A 1TEHA 2NVUA 1M6HA 2FHSA 3OSUA 2Q1WA 3EMKA 4MVJE 3ZU2A 3A14A 3Q2KA 1DJNA 2OL4A 2OMEA 5GMOA 1HRDA 1QG6A 2GGSA 1E77A 2CVQA 3UCFA 5A3JA 1IYZA 3JCZA 4GKVA 2OO5A 4WGGA 4ZGWA 2B69A 3ZU5A 3E9QA 4DQVA 1MG0A 3WTCA 4J7CA 1P1IA 1RM0A 3RJ5A 3FNEA 2HO5A 1RYDA 3W8EA 3U62A 3Q11A 4OIMA 1B3RA 3ETGA 5TS3A 2YDXA 2CD9A 1N9GA 1GCUA 3JQFC 3RCBA 1XSEA 1E7QA 2VRCD 3G3EA 1LSUA 2HMTA 1CF2O 2ZYAA 3HZZA 3JQFA 2AQHA 3FPCA 3K2BA 1DC6A 4N5LA 4NJMB 2VQ3A 1NASA 4J91A 1UR5A 4L75A 5A06A 2NLOA 5DBIA 1P1KA 1RPNA 2EEZA 5AYVA 3O8QB 4INAA 5ITVA 1Q1NA 3FI9A 4IINA 3ZWYA 4J16A 3Q9UA 5TIIA 2Q50A 2UAGA 3JYLA 2BFOA 1ISMA 1X15A 3LF2A 1I30A 5L95A 3U0BA 2GERA 3ETEA 2Q46A 3GEDA 4EI2A 1XLTA 5HRUA 3GRPA 2IZZA 2P4QA 1V3TA 3BHJA 2BFMA 2JFGA 2OOSA 4I5EA 1EBFA 1RM4A 2YY7A 4EUFA 5ES3A 4J6FA 3ABIA 2ZYDA 4FJ0A 4O0LA 1E7WA 1QYXA 3OICA 4U0KA 3RFTA 1BSVA 4AJ4A 5TT1A 2B0JA 4IQ8A 3HDQA 5KJEA 1KERA 3D5TA 5L4NA 4BV9A 4PFJA 2EG9A 3KHUA 5JNLA 1NP3A 3GUYA 5AXDA 3TZQA 2V6GA 3U4DA 3TF5A 1JVBA 3NT2A 4E5MA 1D7OA 1UXIA 5C3MA 1JN0A 3GPIA 1V6AA 3GZNA 3OJOA 4IDGA 3F6YA 4XGNA 3T4XA 2ZB3A 3CKYA 3FD8A 3M1LA 5T8KC 5JC8A 4PG6A 1E3IA 4FFOA 2Y0EA 4Q3BA 4HWKA 5T57A 2DKNA 3U49A 4A5OA 4YJFB 1KEUA 2YDYA 3VH1A 5JCXA 3PDUA 3DL2A 5A05A 3S8MA 1CIVA 1LC0A 4TROA 4YWJA 3WYEA 1KC3A 5J23A 1ZFNA 4HFJA 4BNXA 4KUGA 4RV9A 3EUWA 1A4IA 3ZNQA 5K9ZA 4WLEA 4IJVA 1NQTA 3WGYA 4MDHA 1KVUA 2HU2A 3PWZA 4MO2A 5COAA 1RWBA 1X1TA 4MVJF 3GNSA 3K92A 4XYBA 1YB1A 3G17A 3I3OA 2BMAA 1FMCA 2I3GA 3LZ6A 1E3EA 2VWHA 3GVPA 1H93A 1WDKA 2DBRA 3PIDA 4EUHA 1IZ0A 3GOHA 1YJQA 4BVAA 1EVIA 4A03A 5A04A 3OEYA 4FJ2A 5JCJD 3JD3A 2PY6A 3H6KA 4GBJA 1VJ0A 3ZCXA 3AK4A 3ZWMA 3QRWA 1GUFA 1ZK2A 1M67A 3VKVA 5FWNA 2QRJA 2HLPA 3L4BA 2X86A 3N58A 4IQGA 2EJVA 3GT0A 3KYDA 3AW9A 4Z9FA 4WUVA 1QP8A 3PHLA 1E7RA 5CDSA 4ONEA 1R4NB 5HTOA 3RKRA 1U8XX 1P9LA 3OETA 4IDAA 3JSAA 3ZWVA 4KMSA 1HYHA 4AJIA 4BO6A 2Y1GA 1Q2XA 4R3NA 2W2LD 3OA2A 1ZK1A 2VYVD 4TRJA 3DO5A 1DAPA 4FR5A 4JROA 3WBFA 3X2EA 1A71A 1IZ9A 3ROMA 5TC4A 1PQWA 2IEBA 3I9JA 2GN6A 3ROQA 5CAEA 1PX0A 2FPPA 1I3LA 2X4GA 1KETA 5BNIA 4LISA 1PEDA 3E9NA 4JXKA 3LYLA 4LSMA 2FPIA 1QMGA 1UZMA 2YQ5A 4NQZA 3WGZA 2PTGA 4KTTE 4ZHSA 3EAGA 2F00A 1B2LA 2G1UA 4RDIA 1GUZA 2BGMA 3HN7A 2PGDA 1WDLA 1I3KA 5HBRA 4YVFA 1R4MB 4K6FA 1EK5A 1NAIA 1LSOA 3RUDA 4EDFA 3AU9A 2J6IA 2PA3A 1CQIA 1LDYA 2QRLA 4PG8A 1VE9A 1E3WA 4RPLA 1GPJA 1EDOA 3AI3A 4PZDA 1K5HA 3G0OA 4M54A 3RROA 1I33A 1NAHA 5KKAA 3JQGB 3TQHA 3TZCA 1LLQA 4LSWA 3AM4A 4QEDA 2BKAA 3LT2A 2AQIA 3ZNNA 1DFGA 3OQ6A 3UF0A 5JAZA 3KOUA 3PYMA 3WG9A 5TJ9A 4YACA 4MPDA 1K0UA 4CMHA 3RC1A 4IZHA 4YXFA 1EVJA 2WYVA 3C85A 2C5AA 2YUTA 3HDJA 4UVDA 3S2IA 4GAEA 3F3SA 4IPTA 4N5MA 1JQBA 5U4QA 4L76A 5IN5A 2GUGA 3T7CA 3FWZA 3ST7A 1YBMA 4GX5A 2W2KB 3WX0A 3UFXA 5KCZA 2JD0A 1PTJA 3INRA 3AOEC 1OMOA 1VL0A 2XXJA 2DFVA 4PLVA 1QYDA 4WLVA 2X0NA 4D79A 2TMDA 6LDHA 3AOEA 2G76A 2PK3A 1K6IA 5ICMA 3PGJA 4CL3A 1C0LA 5JBIA 4RZHA 4YBZA 3ZDFA 1BW9B 3LT1A 5KJCA 2GZ2A 1C1XB 1S7CA 4IXWA 4XD2A 3NJ8A 5U1PA 3MJTA 2DTXA 3H9UA 5A9RA 4CUKA 5TRTA 4BNVA 1IPEA 1UP4A 1I2BA 4AJJA 3B6ZA 5TX7A 4B4OA 4CM7A 1B0AA 4RLSA 3UXYA 2EP7A 5AOVA 1PGNA 2EKPA 3ZWAA 4O63O 2IXAA 3ZU4A 4CV0A 1PS8A 1VJTA 1G6KA 1N1EA 3GRKA 3DC2A 3NTOA 4WKGA 3BMCB 3KZVA 3BMQB 2FP4A 1DSSG 1V35A 4Y6PA 2D0IA 2ZYGA 2HK8A 4MVJA 4UEOA 3R0IA 2QZZA 3SJUA 4M89A 1MXFA 1QR6A 2WTBA 1EQ2A 1ZIDA 1LDEA 2EERA 3WYCA 4DBVO 3QE3A 3H3FA 1ZH8A 1TI7A 1VRWA 3MTJA 3Q0EA 1IPFA 4CODB 4ESOA 1A9ZA 1EE2A 1T4BA 3MCVA 4JNKA 1XHLA 3EVNA 4GSLA 3UOGA 1HDZA 3F4LA 4XX0A 3C1AA 1HXHA 5TF4A 2EW2A 3OMLA 2DBQA 4M87A 4PIVA 4NFSA 1OC2A 4E31A 1NWCA 4JN6B 4YQYA 2I9PA 4ALLA 4BGIA 3E48A 5THQA 1QKIA 2HK7A 4NFHA 1KOLA 4LMRA 2Y1OA 3GR6A 4PZCA 1YDWA 4R3WA 3VH3A 2X7HA 1BHSA 4BO2A 1ZUD1 4D46A 4ITUA 4AJ1A 1WP4A 2JD2A 3DOOA 4Q3AA 3MZ0A 3BYZA 2X0JA 3RIHA 3DR3A 1ADCA 4IM7A 2VZ8A 1YB5A 1H94A 1YWGO 1NHGA 1HKUA 5JAQA 5JMWA 4CUJA 4XJSA 2PGLA 3BAZA 1LLUA 3O4RA 5CP8A 5AVOA 5JDCC 5CEEA 1E5QA 4OJNA 1ULUA 4OXKA 4UULA 3WMWA 3UICA 5B12A 3W4JA 2OP1A 2EIHA 1FDTA 2AMFA 3JYPA 2LDXA 1E6WA 4J3FA 1KVQA 1O95A 2Y0DA 2VHVA 3GG9A 1F8FA 4IZIA 1QLHA 3KLMX 4C7JA 4TRRA 3L6OO 1R0LA 2RHCA 3EVTA 3FNGA 3FR7A 3KSZO 1Z7EA 2Q2VA 2BFAA 1KEVA 1O9BA 2Y1EA 1C14A 3VKUA 3VVCA 1NVMB 5KVQA 2CSUA 4AVYA 1Q0LA 1YE3A 5DNAA 4BNHA 3JQBC 1IULA 1DIAA 2VWGA 4GKBA 5G2OA 1VLLA 1QXSA 2OBNA 3ONFA 4ND4A 4AFNA 1HWYA 3WNQA 2I65A 2NVWA 1QYVA 3GZ4A 3G49A 3WDSA 3O38A 1EQUA 5KVSA 4NHEA 4AJHA 5CPFA 5U9CA 4C4OA 1OOEA 4ZRNA 2VHWA 3FNHA 1LDBA 3JV7A 2X0IA 3MJVA 4NBUA 4OOFA 5C37A 5B1YA 2Z1NA 4II2A 1JKJA 1X13A 1KBZA 4LW8A 2G0TA 4PZEA 1E3SA 5F5NA 3E82A 3RSHA 1U7HA 3DONA 1GEGA 3KM0A 1SAYA 2PH3A 3VPXA 3R6DA 4E5NA 1GV1A 5C5IA 5I8WA 4TQGA 5L7WA 1L7DA 3D4PA 4MVJI 5T5QA 1PIWA 2XF8A 4BKOA 1GQYA 3DZIA 3ROKA 1NVTA 3H9QA 1C1DA 2P4HX 2PR2A 1V8BA 3D3WB 3U4CA 3VH4A 1LI4A 3CH6A 4NBRA 3EYWA 5F1KA 4RF5A 2FR8A 3FCOA 2ZKLA 1LUAA 1XU7A 3ZV3A 4XA8A 1FJHA 2AEFA 1Z82A 3EDMA 4CLRB 1HETA 1XA0A 4CMIA 2PWZA 4A73A 3WGOA 1W73A 3NT5A 4CM9A 1DJQA 4MIOA 2I6TA 1P0CA 3NKLA 4WNCA 4H7PA 2NM0A 3GQVA 3AY7A 3GDGA 1WPQA 2AQ8A 4DMMA 4CV2A 1CJCA 3CUKA 3ENNA 3I9OA 4D3SA 1T4DA 4CLOB 1DDOA 2DUUA 3JQAD 1OAAA 4YEDA 5A9SA 4CL8A 4Z0TA 1YL5A 2I5PO 1ZZEA 1UP6A 3WSVA 4FFLA 3QHAA 1UJMA 2DFDA 3OHSX 1ZSVA 2QYTA 1P77A 3IQDB 3NEPX 1EVYA 4LVUA 1KEPA 4RVSA 3MJ4A 1KEWA 5LC1A 2JAHA 4NFYA 5IN4A 3WGQA 3WICA 1ULSA 3VVBA 1PZGA 4QO8A 5IDYA 1X1EA 3CINA 5BSFA 3K30A 3JQAA 2O3JA 4JCOA 1P33A 1GEEA 2I3AA 1UAYA 4J49A 4IGEA 1A5ZA 4HNHA 5TSDA 2QIOA 4XYGA 5MDHA 3AUAA 2P91A 3ZWPA 4CM6A 4ZICA 4L0QA 1QV6A 2Y66A 1GR0A 3O03A 4O5OA 1ML3A 1WVGA 1LSSA 1T2DA 3ZHYA 3MEQA 5B4UA 3JQ9C 3JQ7B 1HF3A 1YH3A 3JQDA 4GSKA 2X5OA 3EY4A 3HADA 4AJLA 3R3JA 3N74A 4A27A 3LLSA 4BOYA 1EUZA 5JYDA 2EF1A 3M6IA 4IDCA 5BNFA 3PHHA 4YT5A 3P5SA 1NR1A 2B36A
chains in the Genus database with same CATH superfamily
1A77A 1SXGA 1HTBA 1XZHA 3B38A 5LA6F 3GUZA 2EBUA 4RPHA 4W8HA 5ERYA 3V4FA 3W05A 3H2KA 5HS4A 2CMHA 3ML1A 5EYPB 2FPKA 4JDPA 5BQ3A 2X8WA 1UZNA 5AVWA 2HFKA 2ZFUA 3PTZA 1TT7A 4A5SA 2QG6A 4ZODA 3TI7A 3RSSA 3AB7A 1M73E 3EDRA 2FW7A 2FJ0A 3V2IA 5IJ9B 1I14A 3UXMA 1AH2A 2HPVA 5GJBA 1CJUC 2HO4A 1M34B 2V03A 1DKPA 1HMYA 1G6HA 4GFDA 3T12A 3ZPXA 4KR6A 3BEDA 4FCCA 1U98A 3EMVA 2PMDA 2J7PD 2XCTB 2J30A 3JVVA 4AULA 3B1YA 2X41A 1SULA 3P8ZA 5HS6A 4QJIA 2X2OA 4R16A 4WZAA 5DI3B 1N8KA 4Z4GA 1XI2A 4JL5A 1CF4A 1CNEA 3RLFA 4IQFA 1GZ3A 2DPHA 1TU4A 4OQXA 1BE0A 4DLBA 4CLHA 4F4FA 3NW9A 2FFAA 2EGGA 3AKZA 2J67A 4HDOB 4X20B 3B6EA 2ORED 1LBHA 2XX3A 1S2NA 1B43A 1GTVA 3QFCA 3NDBB 1LRLA 2GEKA 3QEMA 1AM4D 1IHYA 1L4BA 3HMKA 4RETA 3LC2O 4G1BA 4A2WA 1KAQA 4ZCQA 2AUMA 3VZSA 3QLEA 4BLPA 1SUBA 4L72A 4IIYA 1W5TA 3DOUA 4IUDS 1WEHA 4D9NA 3ACBA 1YHZA 1BS9A 3VPCA 3KE9A 3U39A 4KQGA 2DYKA 3CZRA 1O5TA 3ONDA 4Q24A 4ZDJA 1TM3E 3PGXA 4K6CA 4PZLA 1MV8A 1I0IA 2FDXA 2GZDA 3PF9A 3VHRA 2WPDD 5BSHA 2NAPA 2ZYSA 3KQQA 1MX3A 2ZT6A 1II8B 4W5WA 1HRKA 2OCBA 3OCVA 1TB4A 3O7WA 5AJXA 5DBEX 4ERXA 4UKDA 2QG4A 3EVFA 2XUZA 1J6UA 4OA8A 5SYAA 3ZKAA 3O21A 2K87A 4EO7A 1GAQA 2XOXA 1USUA 5E9WA 2H3EA 3VSDA 3IUBA 4IUCS 4RQBA 5C7LO 3F7NA 1KC1A 1FQOA 5AVXA 5ILGA 1KH2A 2CF5A 1JIQA 3K1JA 1X80A 5FLKA 1W1WA 4INJA 4Z99A 1GL3A 3RSGA 4XLZA 3LC1O 3FY4A 4N39A 1Y6GA 4MAAA 1A95A 5BW5A 3K0AA 1PNVA 3S2EA 4ZO6A 4CLDA 3GUUA 3S1LA 4DDHA 4DUGD 2BFNA 4TLEA 1XT6A 5A4IS 1OFGA 1GCAA 4ZAVA 1A97A 3CCBA 1Y5MA 3REOA 2F1IA 4XWOA 2GJSA 3C5HA 3Q7EA 1JE1A 4EKEA 2FH5B 2PUTA 3ICPA 3QVWA 4OGGA 3M70A 1RHMA 3W6ZA 4ZQFA 2O1EA 2FXIA 2OENG 4ZCIA 4MA0A 1PJCA 1PRYA 5IXJA 3Q40A 2ADMA 3AL0C 2AFVA 3Q1LA 3S29A 5KX5B 2VT3A 4ES6A 2LZ0A 3R6LA 3C3YA 2YTZA 1J20A 1QE5A 4QYTA 4RPGA 4NE2A 3IXLA 3FPKA 4KP7A 1YS1X 2A92A 3EBOA 2P1DA 1MT0A 1XROA 3DXZA 5COBA 2ECQA 4BU1A 1DDIA 2A0YA 1HY3A 1HYGA 2II6A 3QP9A 3A1SA 4EVRA 3MBOA 1Y1PA 3W1VA 5AJHA 4QVKA 3SHVA 4JEHA 2ZSJA 2OCDA 3WWOA 1Z45A 4KH0A 5I4CA 2CUNA 2AZDA 1EXVA 1KI3A 1SKMA 1TD1A 1A9OA 1SC3A 4GVXA 1HE2A 3UGJA 2PKQO 1RBMA 3QBDA 4NEQA 5IVHA 2NU6A 3Q8KA 4QG3A 1IRIA 1FU4A 2BR4A 2XCOA 1HURA 1JQ3A 4XIIA 4UREA 3T7RA 4YRBA 3UJ6A 1CJKC 5FF9A 4OHWA 4DJJA 2EP5A 3O8DA 1EX9A 3IXMA 4MW9A 1CLUA 1EA7A 3PFIA 2FGJA 4YAUA 4E6PA 3NP7A 4KO3S 4ENUA 3FJYA 5IJXA 4F0JA 4MX8A 2ZM6B 4ZA2A 3T9DA 2PZEA 2DG2A 1J2TA 1N4DA 3IAM6 4LE1A 4WPGA 1R8SA 1XDUA 2W6QA 5CPBA 3DZJA 3VOBA 3PUIA 4ZYTA 5B37A 1T36B 1W46A 4JBWA 3UMCA 4BFWA 1U99A 3VC1A 1H1LB 1GVNB 4NZ9A 5I4KA 4JYBA 2CFRA 2PVCA 4QU0A 4YO8A 4NFLA 2XVAA 4UBJA 4CF5A 3N2IA 5CG2A 3CLSD 4KMOA 2EHDA 2F67A 2IU6A 2R86A 1E6KA 2RHOA 3AEKA 3AKDA 4MHSA 4UE3S 3PPVA 4IP0A 4D7AA 3JRNA 4BDTA 5JS7A 3ICQB 4WKNA 1JEQB 1FRZA 2IYOA 2WHYA 1KMCA 3PFWO 3BWDD 4N82A 2E5WA 3RSFA 3L18A 5IYZA 4Z4EA 5I7EA 2PRKA 2Q3DA 4HB2A 1E69A 1KE1A 4M1QA 5C8YB 4RTPA 1Q16A 3IKTA 2B37A 2CUZA 1J0DA 2FX2A 3RC2A 1GKLA 1HQCA 1L5RA 3SX4A 1BYUA 3UATA 1YCDA 4ENPA 1BKYA 2NYAA 5YASA 3B36A 1TUEA 4RVGA 3T9BA 3VUFA 5JRJA 1IBKB 3FHJA 3A9SA 3GUVA 4PO8A 4YJGA 2MYPA 3TTWA 3SBEA 3UT5B 2G72A 1UBLS 2FI1A 2AZTA 2V8OA 5B1HA 2H1IA 2H07A 2OB1A 2QRPA 3D4OA 1X74A 3M6MD 4LBYA 4Q03A 4K8OA 2VPWA 3QVJA 4UVIA 1CEXA 2BF7A 5C1IA 4QBGB 3DBRA 2R8EA 1KSJA 2J5QA 1MQ8B 3GRUA 4XVQA 5J63A 3TMYA 3HVUA 1BXGB 4EY5A 2VP3A 3PLAE 1I24A 4AG5A 1U3VA 3GJ0A 3LYHA 4L5CA 4WHMA 3VJKA 1FLAA 2P3SA 2QQGA 3WQHA 2QMZA 1O8BA 2WB4A 4XVCA 3U37A 4D82A 1N3YA 3DAHA 3S5JA 1PP4A 2P5YA 1HLFA 3EG9A 5T8KA 2YJ5A 1CS0A 5KWIA 3NC4A 1NFFA 1KMQA 2R4UA 3RFVA 3IP8A 3NWEA 2GPAA 3GUHA 4QQFA 3DYBA 4I5GA 2NUTA 3IILA 1YFLA 1CZOA 1U9IC 4MMZB 2BTQA 5GM1A 4QWMA 5GGYA 4BNDB 1W34A 4J1TC 4U0JA 1P4GA 3QMPA 2OZVA 1UBFA 4M0DA 2ECOA 3H5OA 2RGWA 3ZE2B 4CHTA 5AK5A 3KOWA 3F5DA 5BWCA 2P2SA 4LQDA 2JKVA 4AJKA 9ATCA 2IUFA 2QAGB 3A1DA 2PSJA 1XDBA 2YVUA 1O4VA 1Q0QA 2ZJFA 2ABWA 2GESA 4HX5A 2J9FB 1FA9A 3KT0A 4NMHA 5BQPA 2NU8A 4QPCA 1BNCA 4JP1A 2FEWB 1Q22A 3EPRA 2XZDA 4RD3A 2W2QA 1QGUB 1P0QA 3DDCA 4GM4A 4WZBA 1NW5A 3ROFA 5BOSA 1RTKA 2EBFX 2WJJA 3M4ZA 3HMQA 5G0WA 1PJBA 4OSEA 2D8AA 2O3TA 4GX2A 3FCEA 4QA9A 1DX6A 5KQMA 4XYMA 1WB4A 3VR6A 2ZQZA 3I9LA 1GAEO 2D8MA 4ZXFA 4BGDA 3SM9A 3OIUA 1QO9A 2YRFA 1CEQA 2C2OA 1NOJA 3DEZA 4XM0A 3B20A 4EKGA 2Z1MA 1Z2EA 4INPA 4J7UA 1QFXA 5B1DA 1J5PA 4EHNA 4WJLA 4RQTA 2FWNA 3V00A 4YUWA 5AK0A 1UL1X 3HB7A 4BMNA 1ONSA 1SXJA 4ED9A 2P0EA 4ITRC 1R10A 4I36A 1Y8AA 4K3UA 5KOJA 4EQ6A 3V9AA 3W5SA 4P81A 1JALA 3AUSA 3F1LA 4HBZA 3W5HA 5BVGA 3AIIA 2G83A 4KTVE 3AM3A 1LBQA 5EAIA 2ASEA 2IHYA 1YBFA 3LLCA 2PKRA 5AK3A 4GKKB 1F2UB 5DNEA 5KJFA 1EG2A 3HWSA 4MZDA 4O4IA 1P7WA 4RJIA 1C7FA 2G5CA 2NZVG 2VYNA 3EIWA 1R8JA 1KY3A 1UBCA 2B35A 1MC8A 2I55A 3C98A 3BKWA 4EB6A 5J4YA 4ZYYA 5JASA 1Z22A 4J4BA 1XG5A 1XRLA 2C7QA 2V6JA 1O03A 1X7WA 1BX3A 1YJAA 3R5FA 3RUAA 4CG2A 1JSRA 4QYSA 4OEHA 2WIFA 1NVKA 2VP5A 2WSBA 2YIMA 3II6X 3DXFA 4LGVA 5EKUA 1B76A 2OM6A 1IE3A 3FMGA 3M5CA 2J3HA 1BQEA 4YV7A 2XKKA 1MAWA 3GP8A 3D0KA 4YRKA 1Z3IX 4N5NA 4EAAA 1H1TA 4B3RB 2QD3A 3ILSA 3NHLA 4CM3A 5IC4A 4IZOA 4GECA 3WR5A 2ZVQX 4WLUA 1ZVJA 3GCWA 4U7HA 4X7PA 4YYZA 1UXKA 3DBIA 4RD2A 1KYTA 4RL4A 5LD2B 2HU5A 2ZUSA 1BE8A 4DB2A 2WA1A 4P34A 4HN4B 4KC0A 3O8NA 3I9V1 3WLLA 2C31A 3KZCA 4C7OA 1TM1E 4PBSA 2O8CB 4OLFA 4WLFA 3F49S 1ZGAA 2COKA 4QNMA 2WE8A 2UV8A 4QFDA 5DNDA 1DUIA 1UC8A 4ISCA 2M6KA 3Q7RA 1F17A 4BLSA 1AGYA 3UQZA 4BGUA 3CN9A 3DOEA 1T8RA 5DYTA 1VHWA 4HCJA 3GIWA 5CDYA 4YJHB 1TFRA 2XVYA 2ZIFA 2GTHA 4PNPA 5DM1A 1JHPA 5TMEA 4MPRA 4E08A 1N2SA 2CMFA 2V65A 3DUFA 1YVDA 3TUIC 4Z0NA 3DZKA 2XW6A 2WJHA 4GM0A 1I4LD 1R8QA 4P93A 4PU0A 4G5SA 5KTNA 4NBSA 1N6IA 2GEDA 4R1TA 5KJ6A 3BF8A 1UJCA 5AQEA 1EZZA 3HCWA 2RHWA 1MRNA 4MGYR 4OBXA 5TQ2B 5C7IO 2WF7A 2NVUB 3TE6A 1F1BA 3IHKA 1DIGA 3L0IB 1AS2A 1NFQA 1WZIA 2HA0A 3G23A 2PN1A 1UUFA 1NW4A 1LCIA 3AFNA 4FSXA 4S12A 4GZ5A 2Y1FA 3PEUA 2ZQ5A 5DBOA 2NXCA 1KZHA 3C7TA 2NG1A 2W43A 3Q8MA 4C0KA 1ZKMA 5DI9A 1CEYA 2JFNA 3DFZA 2C4UA 3C43A 4UUNA 3WLHA 1AUVA 1U1IA 1ZIPA 1DG1G 1SVUA 6ADHA 2QTMA 1DJLA 5DDIP 4QZVA 3REFA 2J3LA 2IP2A 2H11A 4U3JA 4ND3A 3A4YA 3BXFA 2O0MA 1MR3F 2P41A 4M8LA 4XQ0A 2AJDA 1B1AA 2ZJ4A 3T3NA 1L5SA 5FB3A 1ODSA 1CQXA 1K6MA 3AJDA 3OQ1A 5EXXA 4C3VA 5HKOA 2NQTA 1K7XB 1U7XA 1VLVA 1WLYA 4RF3A 4FINA 2VDJA 3UAYA 4HG2A 3O4FA 1NI4A 3MSCA 3Q98A 4G5HA 5C4MA 1QF9A 3AVUA 5TPZA 3S1AA 4YMGA 1GGKA 2QRQA 4E2FA 1QTIA 1N9GB 1BFDA 2JAPA 1KJ8A 4JI5B 4QGGA 3WGUA 4TYQA 4LV5B 4DZZA 4P32A 4XRGA 1Z5NA 1CUBA 3BXGA 2WY2D 2IHZA 1N9KA 3U3JA 4IO1A 2F4VB 3T54A 3MBKA 3JAWA 5A6SB 3JZDA 1QCYA 4QT0A 2GVZC 2OCGA 3WYAA 1FMFA 1NFRA 2EF0A 3TL3A 2PX2A 2O7QA 4E03A 1E6MA 4OHPA 3AUXA 4RMGA 4D8TA 5CVUA 2IF2A 4M8IA 5KB3A 4AQ7A 3L6DA 1YFKA 5LBTA 5D86A 2AZMA 3OTWA 4ZVPA 2Z9BA 1UBOS 4KQWA 3CF6R 4I14A 1F0PA 2PV7A 3K8ZA 2JFFA 5IMSA 2OFWA 1H6BA 2C8LA 1NVUQ 2MINA 3Q6IA 4DLAA 3SC2A 2QD2A 4D26A 3WLSA 1NTRA 4U2EA 1EVZA 1JS1X 1OAOC 1KMIY 1MQ9A 1DINA 1NM5C 1W85A 1ICEA 2N75A 2ZWVA 4N65A 1BDMA 4PQGA 4KUHA 4WCFC 4E4RA 4KSCA 4YRMA 4PQEA 4PS1A 2W48A 2WAXA 3AZQA 4C7MA 1DX9A 2WU4A 1PZXA 2CXHA 4L9RA 1W2HA 2H2DA 2WF6A 3Q2OA 1Z2DA 3HV0A 3OOSA 4GI1A 1UKEA 4RHFA 2RC6A 5J4HA 1HSZA 4IGKA 4CL0A 2DOKA 3VZDA 4D98A 4DJFC 4M22A 1Z2OX 1D5WA 2BD0A 3VC3A 1L8OA 1MC5A 4NAHA 3T7EA 1XR3A 2AE2A 1OFUX 2A35A 1V6SA 2YZNA 3CXRA 2VZ9A 3V7FA 1RT9A 1J0CA 3CQ9A 4AB1A 2D5LA 1D2NA 2XA2A 5D2CA 3DFUA 1WPXA 4A1FA 1YR6A 1Q0UA 4CBVA 3ZGLA 3IRUA 4LJ4A 4G6ZA 1O87A 4AQYB 1PFVA 2H1RA 2PMCA 4ZRDA 3C39A 4ROSA 3NGMA 4NJOA 4DRYA 4H15A 4EPWA 2PUGA 4ID3A 1E96A 1G66A 1O95D 1PNOA 1R66A 3F7OA 4RIIA 4UFOA 5E8JA 5GAJA 4ABTA 2FSGA 1PEKE 1VRCA 3NYQA 4RVFA 1U8TA 5LQDA 2CJXA 3GPCA 3MMNA 3HBFA 1ZI9A 4ARBA 5FX2A 4O1IA 4N12A 1RP7A 3SJ7A 3L4SO 1UM8A 2FZEA 1R64A 1A04A 2Q9CA 3OLYA 1K3UB 2R8ZA 1ADGA 3CISA 4J0FA 4Z3KA 2XDQB 3TPZA 3TZLA 5JOQA 2O8BB 5D6NA 3GGJA 1U1FA 2I22A 1JU3A 3EQ8A 2QMUA 3G2MA 4FEEA 2NO4A 4QBKA 4TYMA 2BGGA 1BKDR 3NHKA 4NIMA 1K89A 2BLLA 4TWBA 1BHO1 3IJPA 5IBRA 5JDCA 2ZI4A 2DWPA 1JXMA 1TCUA 2EW8A 1J06A 1QHGA 2BFCB 1G6OA 1SUIA 4JUIA 4W82A 1RMQA 1UWKA 2GO7A 3DAPA 3F2IA 3LP5A 5FYQA 4AN4A 2I91A 1UT6A 3TRIA 1GTSA 1C9KA 1VI2A 3L8CA 1BO6A 2WIBA 1PWEA 4TS3A 3G2QA 3R4CA 4H6VA 4HMQA 1E1CA 4IILA 4HGNA 3MQ2A 1W5BA 4DVJA 5EJ5A 3D54D 2IZ0A 4X6LA 2GXQA 4JA0A 3IESA 1WCV1 5KVVA 5DLQC 5G1PA 4O2RA 4J3NA 5IKXA 1OKKD 1D4ZA 3PE6A 3WZLA 4LSZA 3TLZA 1M2WA 1HUQA 1SU4A 4OAOA 1N1DA 4OK5A 1IUNA 1M1ZA 5DULA 4ZVNA 2GASA 1A9XA 4UHEA 1L4KA 4DSAA 2XXAB 4P5DA 4RGBA 1EM6A 5AJUA 4C4ZA 4PF1A 2PGJA 5L3ZA 1X7XB 3CVWA 1SZPA 2C00A 1L7EA 3WWCA 2QP3A 2QL9A 4DLUA 4R7TA 1XTIA 3DVQX 5IAKA 2H0QA 1NQWA 3DHNA 4ZJUA 3QLVA 5DTQA 1EK1A 3M1IA 4K6GA 1IB6A 5BYJA 3ANYB 4L9WA 2I34A 1DC3A 1Q77A 3NHRA 4KQFA 3AI2A 2JIMA 5JAIA 1ZD4A 2WNIA 4RH1A 3CVVA 1TEXA 2ZT8A 3CF4G 1FYVA 3D4IA 1F60A 2XRZA 2XUQA 4RCVA 5EIOA 4HGOA 4LRXA 4L9SA 1ABEA 1UFRA 3OPYI 1IBRA 1Z26A 3H5NA 3KVVA 4C1BA 1SIBE 4AJ9A 2BBWA 3WIDA 4URYR 4DT1B 2P1RA 2J0UB 1WW8A 3B1WA 4FBMA 4ZD6A 4I3FA 1TTQB 3ZLVA 3P9YA 4BN5A 1UEIA 3RPEA 1U63A 1S2MA 3CJTA 1CD5A 1I4EB 3AQ4A 2Z3ZA 4JLMA 1P5RA 2IYEA 4Q1CA 3FPEA 2WIGA 4CEJB 4IDBA 4GYWA 1MEOA 3FYCA 4PAGA 1F5SA 1RWKA 3GJSA 5H82A 4AU1A 1SXQA 1FDIA 3NBXX 4JYMA 1SUDA 4ALNA 2BFPA 4EITA 3WRXA 4I5DA 4GOXA 4O59O 4WBNA 1AC5A 2H08A 2XUOA 3COPA 3EXIB 1BE1A 1DIHA 1E5VA 2ZIZA 1X7ZB 2XTZA 1VI6A 2ZJ0A 3BA1A 4I9GA 1I4TD 4IXTA 4X45A 5AVTA 2FMTA 4BVEA 1X1QA 1L8QA 1OF1A 2VRNA 4FIZA 1E3WB 5DASA 2IIBA 1YONA 1DEOA 2W2MA 2RSLA 4ATNA 5FOXA 3VNSA 3KJXA 2XUDA 3LWZA 4H27A 3LCVB 1Y4AE 1SHTX 2CNKA 4I6GA 2B61A 3F6SA 3KAJA 1R0WA 4N0MA 4R2LA 4TL8A 3ZU3A 1O6ZA 3D3EA 4GIBA 4YMSA 5DWQA 4O2AB 2O2SA 4E5KA 2HA4A 4MHTA 3PUKA 2HNBA 5ALDA 5CLQA 4GH5A 2PA0A 4RFLA 1A5BB 1PDOA 1Q1AA 5EZYA 2A0FA 5TGTA 3BJMA 3F97A 1EG7A 5BRNA 4JJGA 1GARA 3H2ZA 3ZHOA 3ZNOA 1W4LA 1V5IA 2CLKB 3TG8A 4M60A 2O2YA 2IT1A 1I80A 1GG5A 2OZEA 3I45A 4M8NE 5LLSA 3TGPA 4UEJA 4WI1A 3ER9A 4DCNA 1XNRB 3I1FA 4XIJA 3LRXA 3OZFA 4FE3A 1KS2A 1KY2A 2RGNC 3STTA 3T7AA 4A8JB 2C0CA 1E7YA 3BG5A 2TMGA 4FZRA 2HSDA 4ICIA 5LYJA 1A27A 3OY7A 2CKDA 5AXAA 3JQ9A 3HRKA 4MQUA 2IW3A 4GQBA 4Y2PA 1Y5IA 3WB2A 1DIRA 1G6Q1 2AF3C 3T5AA 1HFJA 2CDCA 4HFNA 1K97A 2JGMA 3R40A 5A3QA 2YVAA 4WCVA 3GV0A 1TM2A 5HW0A 4DARA 2VNJA 3FRJA 4P1ZA 5C5CA 3D6TB 3ESRA 1IQUA 3K09C 2JB9A 2W8BA 3EGIA 5HF9A 3QKTA 5KSYA 5FBRB 4W7IA 5BWMA 2BFBA 2YYSA 3V55A 2W22A 5MN6A 5KC9A 4PHGA 4WT7A 1D4OA 4DSTA 4IJMA 3GNQA 2WYWA 4P6VF 2O3UA 4D0RA 1YQDA 4C4XA 4YRCA 1C1HA 2FX5A 3ICCA 3QW4B 2GA8A 4OLHA 4F4HA 1G19A 1KQFA 2AG6A 2JL1A 3Q7TA 3ZGXA 1P5FA 1ND5A 1Y98A 4KJXA 4ZVKA 4M0LA 1F38A 4TMFA 4LWPA 3HBAA 4TVSA 3DTNA 5E3JA 2VAPA 2A1IA 2O7VA 3OFKA 4EQZA 5KIAA 5LOVB 5BP7A 2AFIB 2E49A 5CCDA 3RC7A 1VM6A 2F8LA 2VP0A 1KYWA 2R6FA 3ZV4A 1A7UA 1KI6A 1KH1A 1AVTA 1G9SA 3HFRA 4G81A 1L3BA 4X6UA 3R8FA 3DOCA 3UXEA 1G5RA 2OP0A 3R09A 3N6VA 4ARZA 2XYGA 2WR8A 3U1BA 3TK1A 5JPIA 2PYDA 2ZE8A 4QDXA 4L08A 1Z2PX 1ODJA 4NARA 2ODQA 4FHFA 4G0QA 4MZXA 2GCEA 2JVIA 2RGUA 4NH0A 3IJ5A 4OJQA 1PG5A 4TTQA 4Y9DA 5CLHA 1ELOA 2LCFA 3A6ZA 3SF0A 3SI7A 1XMXA 4G4SO 3TXAA 3ZTWA 4XX0B 4MYRA 1XFAA 5JMPA 1CUHA 3DFMA 3L7DA 3WMXA 3S7ZA 2KX7A 3O7MA 1OYWA 1R4NA 3CX4A 2HLHA 5SZHB 1C0KA 2G7MC 4RH0A 1HKHA 1Q84A 1IZ7A 2QUAA 1J1ZA 2R6GA 2ATCA 4FVTA 3AR3A 1D5CA 1F3OA 1G2QA 4AS1A 3EXHB 4N7RA 2OBLA 2ZWPA 3AFIA 5KTPA 4FOSA 1Q7BA 4MQFB 4JBIA 4QOHA 5EMHA 2RBEA 2B1IA 2F3QA 5DK4A 3RC9A 4ZQGA 2P2LA 4TSKA 2OXCA 4V39A 5LYYA 1LLCA 2CV0A 4C3OB 2HMWA 3QXCA 4P2BA 4WXYB 5DIFA 4DIOA 1NI3A 1YAJA 4OB8A 1N3BA 4MH0R 5KAMA 3CLRD 4EJ0A 1JG7A 3JD2A 2AXEA 1V4VA 4TV9F 1CWUA 1NUHA 4V0ME 5KWSA 2GNOA 4GM1A 1N7IA 4DXHA 3S40A 4DVGA 1JQKA 1IHUA 1XVVA 2CK3A 3UTDA 3FMIA 1P2DA 1R4MA 2BONA 4JBXA 1UZAA 1G5TA 1XTQA 4W1PA 1CP2A 4DUPA 4PR3A 3O0DA 3ZE7A 4DG8A 1B41A 3FUUA 1JG4A 1AK2A 1XDSA 3KCQA 2AL7A 3GJRA 2QRMA 2R87A 2RH8A 3MUFA 3KQOA 4YJDA 3PFHA 2O59A 3LK6A 4R68A 1UADA 4TL9A 3OOWA 5AI9A 2BGLA 1ZXLA 3F9IA 5F3DA 3S5UA 2CUTA 3PGMA 4LHZA 1O94A 2KHZA 2GJKA 2GLUA 1TJPB 2C2ZA 2PSFA 1RJEA 3VPDA 1ZAYA 1YKFA 2CDRA 4E2YA 1NMYA 5C31A 2IUUA 1P74A 2ZBRA 1M2VB 2BC9A 2H1VA 3BIOA 3U31A 2YZMA 5EMKA 1AN9A 2WVHA 4FFBA 1OIXA 3KPYA 5C81A 3U09A 3M9XA 4LRTB 3KEOA 3O2JA 3K6KA 1D9ZA 4IGFA 3NBQA 3DXYA 3D4LA 4TTVA 4DGQA 1SUWA 3LT4A 3TR6A 4UM9D 1VB5A 4LDAA 2J09A 5F5XA 4JBHA 1JHOA 4UE6A 4B7ZA 4G25A 3A9CA 1RRFA 2BM1A 5KDOA 1ONOA 1VJRA 3H2BA 1CJVC 3G5MA 1SCKA 5DHFA 2FWMX 3GU3A 4RTMA 4RKEA 2J32A 3TR5A 5HYVA 3GGOA 2JVKA 5DT9A 1DOAA 3AJEA 4H3KB 1YBVA 4LGYA 4C29A 4BFCA 4S05A 2BCEA 4TYWA 2EDCA 3L5OA 4BVGA 1YRQA 4U39A 2C3UA 1IDN1 3ZDZB 5EXSA 2VR1A 2DTDA 4KJZA 2NO1A 4JR2A 4JHLA 1CR1A 1BW9A 2QN9A 3N86A 4GI5A 5DOZA 4TWAA 2GPYA 1C1XA 3K1TA 1G21B 1E62A 2PQ2A 1TZCA 1Z4NA 3E7WA 3NHFA 4L3WA 2Q5JA 4O4HF 3DNFA 4XDZA 1N34B 3T9CA 3DWEX 2P9YA 4L57A 3VRHA 1GTG1 4BWFB 2MSEB 5JNUA 1C1DB 1HDIA 2PIDA 3FDJA 1IRXA 2VTEA 5GPBA 3S2SA 2CNLA 4OLBA 1R6TA 3ZZNA 3VHLB 5FO0A 3TX6A 4YUAA 3DMRA 3IIEA 1AKVA 3GLTA 1T3LA 2XF2A 3MAAC 2C07A 5JQGF 4JQCA 1JHUA 1XMSA 2FF7A 4CMIB 2C2XA 4H3HB 3OBBA 2QF7A 5H3CA 3WSTA 4BXOB 2AEMA 3SS7X 1P4HA 3VQTA 2G5PA 2HCTA 2DLNA 1I7QB 3RYFA 1ONBA 2PUHA 1GNSA 2EXXA 4MS3B 3R8CA 2VHTA 3UJ8A 1ZOOA 3OC0A 3GH3A 2E4WA 2ZIAA 1F8XA 3R5JA 5CW1A 2Z98A 4OHUA 4QHTA 3RC3A 5A9SB 2VRCA 4XCXA 4WZZA 1AQJA 4I1PA 2P5UA 2AX3A 3E5MA 6REQA 5FL7A 3QPWA 1OQAA 1JBKA 1DGQA 3EIHA 2F3SA 5E2AA 1CE8A 3N2KB 3WHPA 2D5CA 4P7KA 1JAHA 4BLUA 5HXAA 3C3DA 2R9VA 4MW0A 2KPOA 2VUUA 2JLYA 1RLJA 5AOAA 2FNAA 3JATB 1LNSA 3KB2A 2CF6A 3RABA 3RUIA 1YS2X 4M37A 2PBZA 3DAGA 1Z5OA 1BGVA 4PYJA 2MYNA 1P1JA 1U2GC 4RMJA 4U2DA 5JEDA 1JDNA 2OV6A 2WDPA 3URKA 2GVDC 1T15A 2J1LA 3H83A 4BY9E 3NM4A 2E18A 3EMBA 2B4RO 4PYLA 3UQYS 4ENWA 1U9IA 3ESXA 3K6RA 1YO6A 2NPIA 3PNKA 4UTVA 1VIAA 4R5HA 1ZRNA 2IWRA 4EG4A 2J4FA 4BEBA 4BL5A 4L6IA 3VA7A 1NMXA 4KPUB 2BLNA 3RVQA 5DU2A 3C15C 4QJ5A 3C6YA 4BBPA 3TNDA 5I7SA 4TQ9A 4GC9A 3VPHA 1WMFA 3KKZA 1AKEA 2G09A 1NVWQ 2IOQA 1LFAA 4UBNA 1H6DA 1TVEA 1BX1A 5HJEA 4WZ6A 1QDLB 1LXCA 3DG9A 3AY6A 3QLUC 4UUMA 4FHCA 1WS6A 4TT8A 2WA2A 3N59A 1V5WA 4NI5A 3KETA 3TQQA 2DFTA 1FNDA 1E4EA 3IERA 4PSAA 4HUQA 4W9NC 2VYND 1QR2A 4B35A 2WFLB 4B3GA 5DN6A 3HCBA 1VA4A 2HMUA 4H0CA 2BMEA 5HIKA 1GZSA 1JXAA 3DE2X 4TWRA 3TB4A 1NMEA 4QYWA 3M82A 2ZIWB 4KKVA 4RLHA 2KYRA 5DGIA 4D4MA 4OLJA 1N8TA 2FQQA 2L19A 5TLSA 3UN1A 4FDAA 4C0QC 1Y8ZA 1YD7A 3I6QA 1EAMA 2QTHA 3D2BA 1SQ0A 1TJ3A 4OFZA 1JWBB 2JJQA 3PQEA 3TOSA 3TZHA 4ZYZA 4LXGA 4G24A 5AXCA 1JVSA 1ISGA 1KMMA 3CWZA 2GJ8A 3DHYA 4HGZA 2WAOA 1ZM7A 1FUUA 3N05A 4KNVA 4V0SA 3UJHA 3R0JA 4BZQA 4L07A 2DUMA 4W5JA 3WYNA 5ICEA 5BN4A 2J46A 4NU8X 4MB6A 4ZZIA 3M2TA 3R7NA 3W4IA 1BHJA 4QOGA 3KR1A 3ME5A 3ZWKA 1QQAA 3RTBA 2A9OA 2I76A 3WV4A 1SZJG 3C97A 1QUEA 4QTTB 1Z88A 3R6WA 3M6LA 2IPMA 4PVDA 4OXRA 4RW0A 5H4HA 3ZGYA 3T7JA 4P22A 5KOYA 1RWXA 3H0EA 3NUGA 4G5XA 2YZ7A 4A7PA 4EAQA 5I9LA 4AECA 3RVLA 1X9GA 4B3DA 3GT4A 2ZIEA 2CJWA 4J0QA 4DLZA 4H7JA 4DNXA 5HKKA 4D4GA 3ENVA 3DMTC 3OH8A 1QVZA 3NVDA 4R1QA 1AN0A 1Z34A 3BH0A 3Q6NA 3DE5X 4M7OA 4R1SA 3SFVA 4EJMA 2WF5A 3ZJTA 5JCJA 4TS1A 3ROEA 3IEVA 1SUCA 4OHOA 2J5KA 3W5UA 4CKYA 1AZWA 4GE0A 2NU7B 4RK7A 1VKNA 3E2MA 4IG9A 2ZJ5A 1V9LA 1OLUB 2CZCA 4IS3A 4MUNA 3WNZA 4LZZA 1S9DA 4PSKA 4CWAA 3KP1A 1N5RA 2XT0A 1V8ZA 1BDIA 2C9MA 5ALFA 4QUHA 3ZDCA 3VKHA 4UAUA 1Z83A 3N8GA 1C50A 2EOAA 2FE4A 3ANNA 2PCLA 3THSA 1SO8A 3EPLA 2Z4RA 4BNLA 3MFQA 4PZPA 1T13A 4TOIA 2J3IA 3PT5A 4DCMA 1JQAA 3CLTD 1Q91A 3HWX1 4MJ3A 1B3BA 4OQ4A 4IGIA 3TOVA 2NSYA 4PRKA 5I9NA 5KX5F 5ULLA 2F62A 2F3UA 2ZUDA 1NN5A 3IP6A 1CVIA 3O4VA 4P3KA 2W2LA 3P2OA 2VYVA 3CE6A 4OAQA 4P4GA 1RYZA 3BE5A 3VZQA 4JKYA 5TMPA 1GAWA 2I8CA 3OIWA 4OBEA 2P6RA 2PWAA 4DSNA 2XNDA 2ID4A 2XIQA 4EDHA 2GAFA 3GT3A 3UWMA 2OGUA 4WXHA 1QKKA 2XUKA 3L07A 1RFLA 1QIIA 3CZAA 3MWEB 2FW8A 2WIAA 3PRJA 5I9MA 3RG8A 3I01M 1U0EA 4O4JB 3JAKB 2BBSA 3B6IA 3KFLA 1QDEA 1FPMA 5TPZD 5JSQA 1RPJA 2XTMA 5I7VA 1JLLA 1IIBA 2BEUA 2GN9A 4W5OA 4NV0A 1C8KA 3MRVA 3FDZA 4XJXA 1ZNYA 4N7MA 3WYGA 1W48A 1XTBA 2AJ8A 1SOWA 3IQZA 3V1YA 1E3TA 1OV4A 2G08A 2O8NA 2QK4A 4Q3OA 1F6BA 5LB4A 3WRWA 5K8IA 3COZA 2BFFA 4FYJA 4QEZA 1MQSA 2AH5A 2W00A 1EJBA 4LBVA 1UBMS 3DAFA 3LT5A 1QIJA 3P1JA 4BMPB 1GR1A 3GXBA 4EZIA 3PI7A 1SZCA 5IASA 1C7EA 4C6TB 5K03A 1E0DA 1B15A 3TTXA 1NXTA 5IDQA 4Z4IA 4OX9Y 2HMSA 1VL6A 3QY0A 3AF0A 1QPGA 2CGEA 1PTJC 4RF4A 5CHEA 4AS3A 3OO0A 3TMAA 2OHGA 3DFKA 4FE4A 4V0MA 3WLTA 1YU9A 2B2XA 2EFGA 2FY8A 2BCJQ 3DAYA 3JQ7A 2ZB8A 4V24A 1BEZA 4PLFA 1FYFA 2YFHA 1ENPA 1QJCA 2P6MA 4IEEA 1KSHA 2F8MA 2FEMA 2WJAA 4JDUA 1NYRA 5C8YF 1D6SA 5CYOA 1LNQA 3A0RB 1ZJYA 2VHUA 3D6MA 1U7TA 3R5SA 1GPKA 3D3KA 2DSTA 2JGEA 3V80A 1LD3A 3NTXA 4LHWA 4EG5A 1UM9A 2PMWB 5I4BA 4H77A 3RHTA 4FT4A 1D1QA 2CNOA 2IPAB 2PXCA 2V4UA 4INZA 3TD2A 3AF2A 3UK7A 2PGOA 4ADSG 3KXIA 3R76A 1T1JA 3GFGA 2C2YA 3V7NA 1FP2A 2M9MA 5HOQA 4KUEA 4DV1B 1T6XA 3IPRA 3LAWA 2VF7A 2JLRA 3GRYA 2FPWA 3FWPA 3LWNA 5I4IA 2A9KA 2Q5QA 4DC9A 1U1CA 4PEVA 4O2BA 1ZCBA 3U4QA 4RSHA 1TA9A 3K8QA 2QP9X 3QV2A 4B6OA 5JZVA 3PLRA 5DRYA 3FUTA 4EHDA 4NXNB 3B3JA 4KWHA 4PXYA 2JLVA 2FX3A 3X44A 3EISA 4U5QA 2YJZA 5FH9A 2IU3A 1N7HA 3ZK8A 4MP8A 4BUJA 3VHXA 5H0IA 5KJ1A 4FNAA 4UVHA 4DA4A 3PEYA 4B6GA 1FVXA 2PLWA 1X7YB 2QYHA 1A2KC 1YI0A 3PR1A 3SOZA 2LE0A 3EW9A 3I4FA 2EQBA 3L01A 1WZ2A 3HRHA 3UPUA 4J94A 4RQUA 4L8YA 2PG3A 2VNAA 2VQSA 4XGKA 1OX4A 5D3ZA 2WJVA 2O8EA 2GSDA 2P2GA 1A4UA 3PUHA 2BH2A 3AGQA 1PJ3A 1T25A 2XKAA 3FF1A 4HXYA 4W6ZA 1EBUA 2IF0A 4K26A 4IDPA 3F0TA 1HM5A 3GFSA 5E6UB 4LC0A 1YTUA 2FSSA 3LZDA 1IK4A 4B3BA 5B5SA 4R54A 4FDLA 3D1LA 3C1UA 4JLUA 2CHGA 1J39A 2QLTA 4Q9DA 1P19A 4PSCA 5F1OA 3WKAA 4F9GA 5AVQA 3B1KA 2K4MA 5E9QA 3ZE8A 4Z4HA 5EKXA 2BN4A 5E1MA 4S1WA 5E4YA 4V0LA 1THMA 2A2ZA 3HSKA 3MLEA 5FUMA 5JAOA 3E8XA 1VE1A 1OX6A 4ZYLA 1ZEJA 5FEUA 1QHNA 4NV3A 4YUVA 4KO2S 121PA 1Q0PA 2B83A 3KNZA 4HWRA 2G1JA 1SHZA 3AEZA 3DC7A 3HCAA 3NVAA 3QUCA 5FOWA 3VNUA 3T0IA 2VDPB 3IR6A 3N75A 2N46A 3JPYA 3HJNA 3FF4A 1A1VA 2X22A 3RU2A 2Z5VA 1S8NA 1CR6A 2AT1A 1IZ8A 1CQPA 3I34X 3JVUA 1OUMA 1JUDA 4R81A 3AXSA 1N2CE 1ONPA 3PVZA 4D3ZA 3ABZA 3KZKA 5CFRA 1GNRA 1H23A 5B2EA 1RZRA 5FULA 5AM3A 2L82A 3EZGA 1VL8A 3SIXA 4JB0A 2V7VA 3P4UA 4QFBA 3LJKA 4JQZA 4X24A 3EUAA 2HXSA 3K5WA 4RJTA 2R97A 4RNCA 3AF3A 1E2EA 4GMKA 1CY8A 2OEPA 4OKNA 3AVXA 4G0YA 4JSRA 4QTYA 4U6QA 5IJWA 3G9UA 4K9DA 4PVCA 4QYIA 4YR7A 3KQWA 1WMDA 4X9XA 3CLVA 5H5JA 1ZUNA 2CBZA 2X8JA 2XE8A 3QEJA 3TKYA 1Z35A 2C5FA 4KGVA 4YHBA 4BFZA 1VP9A 3VUEA 4BEVA 4KDFA 1L3CA 4DJDC 4B4KA 4OHRA 1E3MA 1DLJA 1HMPA 2VK2A 2A5YB 1TU0A 3A9VA 4P4LA 3TOZA 4DPKA 4Z1MD 1IHXA 5K20A 3UC5A 3EPJA 1SXPA 4GKJB 4ZT3A 2E6KA 3KHTA 1LPMA 3SHOA 1HDOA 2A4KA 1BA2A 1XXHB 2IUSA 4WIAA 1AS3A 3AUYA 5ALVA 4MDYA 4TVBA 2QNIA 3LDHA 2X6QA 2EWWA 4IHQA 4WWHA 1O6GA 3VX4A 4NX2A 3NFYA 3ZKWB 2OBXA 2IQ5A 1Z4MA 2J08A 2EGHA 3C24A 4WEQA 5DZSA 3OQIB 1TZMA 4QSMA 4MV7A 1W0KA 1ZGHA 3IELA 3MN1A 2I4MA 4BO8A 2C20A 3QQPA 1U2PA 4HDKA 3HK2A 3QVLA 1V11A 4O02B 4KO1S 2FSUA 2LGJA 3GN2A 4EKIA 5IH7A 2WYOA 3JWPA 3I4CA 2FYTA 4RY9A 4M1OA 5T4EA 4ROTA 5EPUA 4Q37A 2HH9A 2A9JA 2HJRA 1H2HA 4RPJA 4UCFA 4F38A 2DH6A 1W4AA 1M10A 1I7DA 3MCZA 3MT7A 4GPD1 2GBIA 3IR7A 4EJSA 3DJFA 2IS1A 4UQPA 3VPSA 3QU4A 2A4MA 3AFGA 3SBOA 2Z2XA 5AI0A 3BH6A 2J07A 5B4VA 1SU7A 3MTBA 2QRUA 4F84A 1R7RA 1JA0A 2XDYA 5F21A 2W11A 4OQMA 5C32A 1HFWA 2DBVO 3PIRA 4OX9B 2CNNA 2HJ9A 4E5PA 5GVSA 2FB9A 3IAHA 3SR3A 3ESBA 5ITSA 2PZJA 2A84A 1FFXA 2HFJA 1FPQA 2I2WA 2ZCUA 4PFQA 4DYVA 1CR4A 2IZ1A 2XUJA 3ZV5A 1K5DA 5EI5A