3A1NA

Crystal structure of l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
315
structure length
315
Chain Sequence
b'MILVTGSSGQIGTELVPYLAEKYGKKNVIASDIVQRDTGGIKFITLDVSNRDEIDRAVEKYSIDAIFHLAGILSAKGEKDPALAYKVNMNGTYNILEAAKQHRVEKVVIPSTIGVFGPETPKNKVPSITITRPRTMYGVTKIAAELLGQYYYEKFGLDVRSLRYPGIISYKAEPTAGTTDYAVEIFYYAVKREKYKCYLAPNRALPMMYMPDALKALVDLYEADRDKLVLRNGYNVTAYTFTPSELYSKIKERIPEFEIEYKEDFRDKIAATWPESLDSSEASNEWGFSIEYDLDRTIDDMIDHISEKLGIEGKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NDP-sugar epimerase
publication title Crystal Structure of Binary and Ternary Complexes of Archaeal UDP-galactose 4-Epimerase-like L-Threonine Dehydrogenase from Thermoplasma volcanium.
pubmed doi rcsb
source organism Thermoplasma volcanium
molecule tags Oxidoreductase
total genus 120
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2009-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3a1nA00
3DOCA 3AU8A 5TGDA 4I5GA 4M86A 4L4SA 1IPEA 1X1EA 2HQ1A 1N1EA 4ZICA 4DWVA 4E5YA 4PG6A 1U5AA 4RLHA 2JCYA 1GQYA 3RC2A 2PGLA 2UDPA 2C07A 3BHMA 4E4YA 9LDBA 4R01A 2NADA 5JLAA 3W6UA 4YT2A 1A72A 5A9SB 3DBHB 1VLLA 1YXMA 3PZBA 1T2CA 1TXGA 3W8DA 1ZKMA 5DBIA 1OBFO 2Y93A 1C3VA 5I7SA 2VOJA 3E82A 5T8KA 1PJLA 1BVUA 4PIVA 4MVJM 4W99A 4YJHA 4PVDA 1YVEI 1BXGB 4YRBA 3S1LA 3UN1A 1T2DA 1ZUD1 1UXHA 1ZXBA 4IGEA 4CMEC 3GVIA 4LSMA 2IE0A 3LLSA 2QG4A 4XGNA 3TPCA 1T1RA 1ZNQO 1E7MA 1HYHA 3PYXA 4YAIA 2EKQA 2PLAA 2EP7A 3RKRA 1LDEA 2P68A 1TB4A 4J4TA 5IZCC 3G49A 1H9BA 4ALMA 3JQAA 4OXNA 1C14A 1CRWG 1BW9A 4FR5A 2OUIA 1PWZA 3V5NA 1HTBA 4G81A 3JYPA 1TVEA 2NVBA 4YEDA 4P8RA 4AJJA 5C7IO 4GX5A 1W4ZA 4IQ0A 5I8ZA 4IDDA 2BRUA 4YQYA 4BO1A 4J0EA 2BD0A 3DO5A 3PI7A 2CVQA 2I67A 1PQUA 1HRDA 1XGKA 3HB5X 3FPLA 3K5PA 1E7WA 4GH5A 3AM3A 4YXFA 1B15A 1DFIA 3CPSA 3H2SA 3ZWXA 4YACA 3IJPA 2VWHA 1U7HA 1E0DA 3WB9A 4Q3BA 5L9AA 5JW6A 2JD2A 4GSLA 4E0BA 3DAPA 1ZK4A 2DVMA 1PU2A 2X5KO 3H3JA 3K92A 4INAA 1HDOA 5JC1A 1AE1A 7MDHA 2I66A 5HS4A 3PPIA 1HE3A 1YBVA 5TC4A 1NQAO 2PFGA 5ILGA 3GEGA 1JQBA 4NNJA 4RVSA 4PRKA 2FR0A 4M54A 4O6VA 4HP8A 1YOVA 1N7GA 4CV2A 4OOEA 4YCAA 1R12A 3D0OA 3RU7A 1B26A 2GF2A 1UXIA 2GR9A 4EJ6A 1JWBB 2ZB4A 3D7LA 4WNIA 2AQIA 1EZ4A 2C5EA 4PG5A 4OSPA 3C24A 1DXYA 4AJPA 5JCJD 5COQA 3RUFA 1C1DA 4BKQA 3E03A 1NHWA 1LNQA 2V65A 2FPIA 4FFLA 1H2HA 1I3MA 1ZH8A 4PZCA 3ZV6A 3JQ9A 4CLRA 3PWZA 3AUAA 5G0SA 2V7PA 1WDMA 2WE8A 1U9JA 1U1IA 4IJWA 3RUIA 1LDYA 3H3FA 2ET6A 4I1IA 5A9RA 2VNSA 2OO5A 1IUKA 3L6DA 5IDYA 3H9QA 3PK0A 2HMTA 2WEKA 3WGQA 4OYRA 4J6FA 3C1TA 5JO0A 2VT2A 3AJRA 3PWKA 4NJMB 3U4DA 5KVSA 1E3EA 3LT2A 5CDUA 1BGVA 4LRSB 1GAEO 1LJ8A 4P38A 2CF5A 2EW2A 2D59A 1NNUA 4U0JA 1BMDA 1W0CA 3KVOA 2YHIA 3Q2KA 3TZ6A 4WCDA 1V35A 2O3RA 1EBFA 1P1KA 1I3KA 3RBZA 2GZ3A 4D46A 3BMNB 4DLBA 2RHRA 5DF1A 2E49A 2PD4A 4FDAA 5G0VA 4WLEA 5IXYA 4B7XA 3GDFA 2B35A 3GDOA 3S2IA 1SB9A 4GVLA 1G6KA 5TT1A 3H5RA 1I2ZA 3DBRA 2V6GA 1IZ9A 3OEYA 4ZA2A 3EVNA 4G5HA 2A9FA 3PWSA 2HLPA 4DYVA 1X1TA 3CSDA 5HRUA 3OETA 3TZKA 3V8BA 1DHTA 2ZTUA 3GR6A 3WS7A 5IFLA 3AOGA 4ZVVA 4PG8A 1HETA 2ZKLA 1ENYA 3GAFA 3I5MA 4ZQHA 4AJ1A 4CM1A 3DBLB 3ZGYA 1SOVA 5JBIA 1OC2A 1PL7A 1HDGO 3JQ9C 1LRLA 3JYLA 4WGGA 4E13A 4NHEA 3JD2A 1FF9A 4DBZA 1GYQA 1O94A 3INRA 3GN1A 4NFYA 2OGUA 4XYBA 5COAA 3ZW8A 1CEQA 3GF4A 3HFGA 3NUGA 1PQWA 4HFNA 1MFZA 4Y8VA 3NAQA 4NR0A 4RO0A 4BQRA 2GN4A 5BSHA 3WMWA 4YA6A 3EHEA 3K30A 2I99A 4KTVE 4PLCA 5TIIA 4BO0A 2PZJA 1ZZEA 2JKVA 1ZJYA 2JD0A 1H9AA 1V3UA 2PNFA 4AJEA 4YRDA 2HK7A 2JJYA 3WICA 3FR8A 3WSVA 4WNCA 3I4CA 4F6LA 1E5QA 5AXAA 1NR1A 1OMOA 3A14A 5B4VA 4R69A 1VRWA 1NR7A 5GZ6A 6ADHA 3GGOA 2Y1OA 1NVMB 2FPGA 2Y05A 3ROMA 1VE9A 4RQTA 3FBTA 2I3AA 1AN9A 3AI3A 3GPIA 3G79A 3QIVA 4MIYA 5KJCA 2X0JA 4EEXA 2FN7A 4L76A 1L7DA 4PLGA 4UVEA 4DL9A 4WCFA 3GLQA 1E5LA 1E6WA 3D4OA 3F5QA 3DZFA 1LDBA 3UW3A 4DC1A 1XKQA 1QV6A 3RFXA 2OHXA 4CMIB 4TWRA 3PQEA 2B0JA 3H9UA 1WZIA 5JO9A 4YJFA 5KJ6A 4E5MA 3PVZA 4F3YA 3FCOA 4Q3DA 1RM5A 5IG2A 1KEVA 1ID1A 3QE3A 3VPFA 2YJZA 1CERA 4AJOA 3ZWBA 4WOJA 4WLUA 2PWZA 3QVOA 2AA3A 3BA1A 4LCEA 3B70A 3EVTA 4DMLA 1GZ3A 2PV7A 4YAKA 3ZU3A 2Y1GA 2VHZA 3DZBA 5L3ZA 3ZHBA 3DR3A 5A05A 4ZQBA 3L6OO 3HUDA 1LQUA 2RAFA 1L7EA 2YZ7A 5G4KB 2X0NA 2EWMA 2J6IA 5A9SA 3D3WA 1XG5A 1PL6A 4A03A 3ETGA 3ZWOA 1MGOA 2HDHA 3E1KA 4L8VA 3L4SO 3V1TC 1QMGA 1HKUA 4IIUA 4FC6A 4GWKA 5JCJA 5A9TA 3MJTA 1Q0LA 1CWUA 4MOWA 1BXGA 1H2BA 2HKIA 5ITWA 2ZTMA 3GEDA 3NTOA 1GV0A 4CUKA 2YYYA 4R9RA 1XWFA 3RFTA 3I4FA 5A3VA 5I7EA 3OIDA 4OH1A 3I9NA 2NTNA 4KP7A 5AYVA 3VOSA 4A26A 3RUAA 2DT5A 3W4JA 4AVYA 3RAJA 2JFGA 2ZJ1A 5BQFA 1IY8A 2C0CA 1Q7GA 3WYEA 3ZWNA 1QV7A 2IZ1A 2NQ8A 3LT1A 1N8KA 1MXFA 5ICSA 3VVCA 1E3WB 5TS3A 4BNGA 2IRWA 3DTYA 3HSKA 3MJSA 2VHYA 4CMJA 4BNIA 2E4AA 3GQVA 4DA9A 2IDZA 2I9PA 3F46A 4XWYA 4HBGA 3DZJA 4CJXA 3KBOA 1DIAA 2X7HA 4IINA 1PGOA 1R4MA 4NU5A 3DTTA 4CM8A 1X7DA 2AMFA 4BO3A 2WWRA 5DCYA 1I36A 2X9GA 1JKFA 1NTOA 1EQUA 1RYDA 3DZIA 4R68A 3NDJA 4IXTA 1DIHA 3WGZA 2QQ5A 2Z95A 4OHUA 5IDWA 3RKUA 3GK3A 3R0IA 2OFPA 4LVCA 4BKUA 1T1SA 2ZQYA 3Q2IA 4FB5A 3WLEA 1W8DA 2PGDA 4J7CA 4PZDA 2C2XA 1KEUA 3H6KA 3EC7A 3V2GA 5CEEA 1DAOA 1XA0A 2NM0A 1FDTA 1X7GA 2W4QA 4HNHA 2RCYA 4R1NA 1DIGA 4B3HA 2PH3A 4YQZA 5L53A 1TEHA 4L75A 3HZZA 1P9LA 1Y5RA 8ADHA 2DLDA 4E3ZA 5IXSA 4IDCA 5TF4A 4XCVA 1PJ2A 1R37A 1Z82A 2FRDA 3A4VA 3KETA 2IYPA 2EXXA 2XF8A 4QO8A 1QRRA 2WJPA 4IXWA 2I3GA 3F47A 3JQBC 5DP1A 5ADHA 3ITKA 5L4NA 4LSWA 1BG6A 1E77A 3FWNA 3OQ1A 1Z7EA 3I6QA 3LLVA 4B7UA 4BGVA 3C1AA 2CDAA 3E5MA 1DOHA 4Y9DA 3VAZA 5U9CA 4W7HA 3WDSA 4J7UA 4R5HA 1HDXA 2X9NA 3EY4A 3QJ5A 4IMPA 3WGTA 1XIVA 4XYEA 1I10A 4BO7A 4BNVA 3HNPA 3PDUA 1HZZA 3I9LA 2PTGA 2WD7A 4GI2A 1H6CA 1NQOA 1ISIA 1TT5A 3NX4A 3PRJA 2X8LA 3RFVA 1UXGA 1Z73A 4D7AA 3IP3A 4WLOA 5DCUA 4J90A 5L7YA 4YDRA 5JMWA 1O0SA 5CPBA 3GFBA 2FWMX 4KOAA 4CLEA 4DUPA 2EGHA 4ALKA 4R3WA 5DDIP 1N92A 3ONDA 2ZQZA 3ZNQA 3ZWMA 2QX7A 2LDXA 3HDQA 1VSVA 1NX6A 4QQRA 4I5DA 3U4IA 1ULUA 5AOVA 4N54A 3KYBA 2IZ0A 1R16A 3BMNA 1H93A 1OZAA 4FCCA 5JPIA 3FF4A 1R15A 1F8GA 4FSHA 4J1NA 4R4JA 4U6SA 1DPGA 1HEUA 1PGQA 4Z9FA 3UAGA 1R66A 4DPMA 1YB5A 3PQFA 5FF9A 2H9IA 2WYWA 2O2YA 3LZ6A 5EN4A 4XDZA 1KOLA 1XLTA 1J5PA 4WE3A 2OORA 2Q1TA 4J2HA 3IKTA 3DOOA 1I3LA 1ZK3A 3DWFA 3KRTA 4HFRA 2W2KA 1P44A 4M8SA 2NU9A 5KVCA 3GVXA 1X13A 4YT4A 5EIOA 1BXZA 4I5FA 3WLFA 5DZSA 3V1YA 2BMAA 4IM7A 3BMCB 3OQBA 3PXXA 4GPD1 3PFFA 4NBRA 5HA5A 1R4NA 1NFRA 3DBLA 1Y8RB 3OMLA 2OP1A 4OM8A 1ISFA 1EVIA 2CY0A 5CDYA 3PGJA 3AY3A 1LU9A 3FI9A 2O3QA 1GCUA 3GHYA 4JROA 4PLFA 3H7AA 2FR1A 1QYWA 3WIDA 4NJOA 4XJTA 1ZMOA 1LXCA 4BB5A 1OI7A 1ZFNA 3PYMA 3CUKA 5KWEA 2VZ9A 3HDYA 4Z0TA 3OP4A 1QG6A 3CINA 2GCGA 3KYDB 5I8WA 1YDWA 5JAQA 1ZEMA 4GX1A 3OEWA 3U49A 2HJRA 4XZ3A 4CLXA 4KUHA 3TL3A 2BFMA 1E6UA 4A73A 1PGPA 4PLHA 5B12A 2UUOA 2E48A 3RC9A 3ZWVA 5ILOA 5FFFA 2DTEA 3JQ6A 3DHEA 3RUCA 5JSFA 3ASVA 4MVJI 1ARZA 3ZWWA 3NV9A 5JFOA 4NMHA 1LBEA 4PLYA 1CF2O 2GDZA 2X5JO 3JQGA 3SC4A 3C3XA 4KQXA 5KIAA 1HE4A 4RPJA 3DONA 1HLDA 2BI8A 4ZRMA 3QVXA 3W8EA 2PZMA 3LU1A 4R51A 3QY9A 4B4OA 1ZVMA 2O48X 1Q7CA 2DKNA 1NFQA 3ADPA 3AI2A 4ILKA 4Y6PA 3U5TA 4YBZA 3DHNA 3CZRA 4IUYA 4XIJA 5JYEA 4AICA 4RZHA 3IAHA 5EERA 4LGVA 2GD1O 2EIHA 1ENOA 4JGBA 2VRCD 1JKJA 3JQFA 5TRTA 3GUYA 4GBJA 1P31A 3EZYA 4JCOA 3QWFA 4R3NA 1T2FA 3NTRA 4N5NA 4XB2A 3SXPA 5FWNA 2OL4A 1YS4A 4Q3NA 2RH4A 3CXRA 1NHGA 3N7UA 1H5QA 2AW5A 3AM4A 2DAPA 1LI4A 1GUFA 1JA9A 2PA3A 1MC5A 1B8UA 4KDEA 2PZLA 3E9MA 4NBTA 1IZ0A 1I5RA 2Q2VA 5LDGA 1JDJA 2CDBA 2GUGA 3EYWA 4YB8A 4D0RA 3ORFA 2WM3A 1ZIDA 4TMFA 1HSZA 3W4KA 4EJMA 2JHFA 1QSGA 2OMEA 2BELA 4CMEA 4O59O 4NPCA 1B14A 3AI1A 3SBOA 3TWOA 4I08A 1PGNA 3DZHA 3KSDO 2YUTA 3MWEB 3QSGA 4IZIA 4PRLA 1PS8A 4D42A 3QQPA 2G82A 4XB1A 4HFMA 5G4LA 2ZJ0A 4Z9XA 1VKOA 1PJ3A 3IKVA 2H5LA 2WTBA 3R6DA 2OBYA 3GAZA 3CKYA 3B6ZA 2YDYA 3PHLA 1T2EA 5DULA 1GDHA 1C0PA 3JQ7A 5ER9A 5HBRA 1J49A 4RF5A 2J8ZA 1FJHA 1HDRA 2NNLD 3AWDA 1E92A 4OSOA 4BO6A 1BVRA 4DMMA 1KERA 2JL1A 4CUZA 3E8XA 3I1JA 1P1RA 4BO2A 2GSDA 1YQDA 1FDVA 4PGFA 4OGWA 4PZEA 4U5QA 1C0LA 3IL2A 3W4IA 2DUUA 4CV1A 4XQGA 3ZZNA 2VWQA 1K3TA 5A3JA 3GH3A 1DFGA 4OOFA 3NKLA 1B0AA 1UZLA 4CQLB 3JYNA 1MB4A 4XKJA 3JQFC 1B3RA 4DRYA 2CVOA 2PKQO 2BFOA 2VRBA 2PKRA 1UAYA 1B3BA 1A7KA 1WZEA 2UYYA 3AU9A 4L9RA 3U4CA 4CM4A 1YH3A 1XSEA 3OJOA 1X14A 4J9VA 4OAQA 4YAEA 1P1HA 1A9ZA 3KEOA 1CETA 1HE2A 4BO8A 2JFFA 1QLHA 1Y5MA 2POQX 1AXGA 1N5DA 1X7HA 1D4FA 1SEVA 1M2WA 4U8GA 2VCYA 3JYQA 1LLUA 1UR5A 1B8PA 3QWHA 3OBBA 4I5EA 1EK5A 3PIDA 1UUFA 4XEHA 1VKNA 3DB2A 4GVXA 2QRLA 1BHSA 4HXYA 1BTOA 1CJCA 4BVAA 1T2AA 3ZV3A 3QWBA 1B7GO 3NT4A 2YHUA 1J4AA 2AXQA 2NQTA 1F12A 1GADO 2JAHA 5BNFA 1PGJA 1DO8A 2IODA 2O50A 3WGYA 3WMXA 3PHIA 4DPLA 4E33A 3NRCA 2PR2A 3NGLA 5BR7A 4CQMB 4ONEA 1EFKA 1DIBA 4DGSA 3JD0A 3CZMA 3MJEA 1I24A 5CAEA 3DOJA 3NT2A 4CLOB 4GL4A 1KEWA 3GEMA 4II2A 4YTEA 2Y1FA 2IEDA 1Y7TA 5KOIA 4BNWA 2C7GA 3JSAA 1OC4A 4J4HA 3ZHZA 1YBAA 1WVGA 4RF4A 2G17A 3BMQB 3RJ9A 1QKIA 1UH5A 1V3VA 4F46A 4N7RA 1GYRA 1LUAA 4KZPA 1U5CA 5J23A 3VZSA 3G3EA 4MVJP 2V6BA 4XRRA 3I9KA 2NVUB 5C7OO 3H5AA 4AJ4A 4AL4A 4Q9NA 2P9GA 5JNLA 2OZPA 5TX7A 2R00A 3CTMA 1KC3A 4XDYA 1E7YA 3T7CA 1SAYA 4MVJH 2PK3A 3GGGA 3S2EA 1U8FO 3ZV5A 3HG7A 4XA8A 3D4NA 3PQDA 1NPYA 1T25A 1EE2A 1HT0A 3GZ4A 1HYEA 4ID9A 4E6PA 3FNEA 4Q3AA 4E32A 5G2OA 1ONPA 2VHVA 2DU8A 2NACA 5HTOA 4J49A 1JU9A 3TNLA 4BNFA 5ES3A 3VKVA 3QWAA 4CV3A 4U0KA 2VRCA 3KYCB 3WNQA 3B20A 3IS3A 4FBGA 4KDFA 3ZCXA 1YJ8A 5EQDA 4YT8A 3PFWO 3KO8A 4H16A 4CLDA 3K9QO 4TROA 4M1QA 1D1SA 2DFDA 1G1AA 4D43A 5B1YA 1ADFA 1DLIA 2IZZA 3HE3A 1KVRA 4EGFA 3ZNNA 3RVDA 2PKQP 3AK4A 1LDMA 2P9CA 4YYZA 4TZKA 3TFQA 2OOSA 4FJ2A 3FPCA 3FNFA 1KS9A 1ZW1A 4CMGA 3SJ7A 2AEJA 3FHLA 5AXBA 5T57A 4CQMD 3WFIA 5CG1A 1UDBA 1Y8RA 4CM9D 2YFHA 3GN2A 3VZQA 5FI5A 1SO8A 3B1KA 1V3TA 4DLAA 1Y8QA 4DQVA 1C1XB 3GA0A 3WTCA 1KVTA 3RUDA 3E18A 2I65A 3SLKA 3TOXA 4NU6A 1EUCA 3HHPA 4DIOA 3UCXA 1OAAA 1DC6A 4XD2A 5EJ2A 4O5OA 3FR7A 4BNZA 5IN4A 2R00C 2O3TA 1I30A 2CNBA 2BLLA 4NIMA 1I0ZA 3A1NA 2CZCA 4JX8A 2QRJA 1LRKA 1Y6JA 2FOIA 1GQ2A 2A94A 2X4GA 3CIFA 4RVUA 3MEQA 2HRZA 1YONA 3SC6A 2FY8A 3WBBA 1DC5A 4J4BA 4NBWA 4C7JA 1ISGA 2BGKA 4MP6A 1I32A 1I3NA 1V6AA 3P19A 4JP3A 3VH3A 1S6YA 2GN9A 1J0XO 1QYXA 2PZKA 1D7OA 2P4HX 4FQ8A 4U6QA 4XJSA 2AEMA 3ENNA 1HDZA 4RPHA 5JY6A 2X0RA 4O63O 1C0KA 2J3HA 1DLJA 3O8QA 1NASA 1AHHA 4MKZA 1QYCA 3VH2A 1YQXA 1E3LA 5IDQA 3JQ8B 3WGOA 2FSVA 1D1TA 3OA2A 1U4OA 1ZK0A 3QVTA 2VUSA 3MWDB 3P5SA 2Q1UA 3E48A 1XR3A 2HK9A 4MDHA 1YL7A 1QORA 1ZK1A 4OL9A 4NK4A 4WUVA 3UICA 1M6HA 1GU7A 2YQ5A 3CE6A 1DB3A 4PG4A 4MKRA 4UUOA 1DHRA 3DAGA 3U4HA 3FD8A 3SX2A 4EBFA 3RC7A 4CLHA 3WTBA 3Q9UA 1YWGO 1KIFA 1CYDA 1PS9A 5GZ3A 1Z74A 4GMFA 2IEBA 1UAGA 3RBXA 2DFVA 1X0VA 4XYGA 4RF2A 4CUJA 2O3SA 1G0OA 3NGXA 2O4UX 2UAGA 4ALJA 3MJ4A 2AE2A 4IIVA 1XDWA 5CDSA 4HKTA 4W6ZA 1Y1PA 5EQFA 4JJFA 2ZTLA 3DMTA 1LDGA 3QW2A 4GGOA 5BNTA 2GGSA 5I7VA 3KUXA 4UREA 4DQXA 2V6MA 3PHGA 1OOEA 3BYZA 3WR5A 1KVSA 3GZNA 5CDGA 4QUKA 3NJ8A 1E6EA 3WYBA 5KVVA 3PHHA 2CF6A 2X23A 2P4QA 3IUPA 4Z3KA 2GN8A 3H9GA 1YL6A 2GERA 2Q45A 1VJ0A 1GUYA 2H1SA 4JN6B 2QYTA 5KCZA 2V6FA 4E2XA 1GFSA 4DBVO 4JIGA 5GY7A 3COSA 3PTZA 4IGFA 4W82A 4KWIA 4GQAA 4XYLA 3EAGA 5JYDA 4PLTA 1U28A 1XU7A 2X9VA 1J6UA 3INGA 4Z6KA 3H4VA 4HADA 1NBOA 5BNIA 2ZIZA 3IP1A 4CL8A 4Z9YA 3CMMA 2D1YA 2JCVA 3AUTA 1DSSG 3DBHA 1VPDA 3NYWA 4RZIA 3ROQA 4JQCA 3QHAA 2EJVA 1PX0A 1K0UA 3A28A 3M6IA 4EJ0A 3QP9A 4MP8A 2GN6A 3PJDA 2AQ8A 2YDXA 4GGPA 2Q49A 1GUZA 4PLZA 1JAXA 3GUCA 4QSMA 3AFNA 3FTPA 3LYLA 4BKPA 1EEHA 4RDIA 5JAZA 3AM5A 5HS6A 3JQBA 3UH1A 3M2TA 3ZDFA 4L73A 4BL5A 2W2LD 3P2OA 3EMKA 4UUMA 3UCFA 3HADA 3HJAA 2AHRA 3KEQA 4WOKA 2E6UX 1NQ5A 1N9GB 3DMTC 1DEHA 3LQFA 1GPJA 2FZEA 2P9EA 2B37A 1PJ4A 4NBVA 3ZWCA 1VM6A 4DIFA 2VYVD 1M6WA 3WGHA 1RWBA 5A1TA 1PJCA 4CQMA 5I9LA 2X1HA 4CMHA 3LVFO 2C54A 3QWIA 4FJ1A 1JVBA 4CM9A 1ZCJA 1O89A 2G76A 1WAMA 1YE3A 4GLOA 5KTKA 3KSZO 5U4QA 3ZHYA 1ZK2A 2WSBA 2Y67A 1P0FA 5CPFA 3OIGA 3Q6IA 3ETEA 4TVOA 4CM5A 2J5KA 1X0XA 3KZVA 2J3KA 3UF0A 1WLYA 4XGKA 1K6IA 3AUUA 5H83A 2RH8A 3RIHA 2G0TA 4JBHA 2EF1A 1P3DA 5IZ4A 1FDUA 1P74A 1XELA 3JCZA 4HX5A 2YFQA 4OQYA 2VZ8A 1YL5A 3IMFA 4BNNA 4ZGWA 3ZWPA 1WWKA 5JXWA 4U7WA 3JD4A 2NVUA 2EERA 1TA4A 4BO9A 4BS9A 2FP4A 5JC8A 4GAEA 3GVCA 3WOHA 2DQ4A 1A71A 4YJHB 4TSKA 1CQIA 4Q3EA 3ABIA 3VPXA 3IC5A 1IL0A 3WFJA 4R41A 1Z7BA 1UP6A 3RUHA 1JVSA 4TRRA 1BXKA 1IE3A 3CMCO 3KSUA 5F1KA 2ZYAA 3KHUA 5T64A 1BDMA 1Y81A 3TFOA 3LK7A 4CMBA 2H6EA 2Y0EA 3WWYA 5A4DA 1I8TA 1V8BA 3HN2A 5CP8A 1ONNA 1M76A 2VWGA 4IDBA 2O23A 1CDOA 4M49A 3JQAB 4IDFA 1BW9B 4IBOA 1GPDG 2FZWA 5JE8A 3RCBA 2JCXA 1FK8A 4RQUA 1M66A 3EDMA 4ITUA 2VHWA 1E7RA 1KY5A 1R0LA 3UXYA 1Q7BA 3INTA 4M89A 3W8FA 1IPFA 4EI2A 2I76A 4FFRA 1WMAA 3F1LA 3HDHA 3JYOA 1OFGA 3DFZA 1GEEA 3N74A 3MOIA 4MKXA 1EVJA 4LN1A 2Z1NA 1U3WA 3FBGA 5AXCA 2B4TO 4ND5A 4WLNA 3I9OA 4PG7A 5JDIA 2NU6A 4BKOA 3PGXA 3HN7A 5TJ9A 4A5OA 3WXBA 4NJMA 5EPOA 1GEGA 3SLGA 4L74A 3EZLA 4D0SA 1AGNA 3H8VA 3F3SA 3I9JA 4RF3A 4CM3A 1IYZA 2C5AA 2DM6A 3O03A 2ZATA 5F3RA 4AJNA 4ZN6A 3IOYA 3QA9A 3U09A 3PLNA 3JTMA 1C1XA 1U3UA 3F4LA 1SC6A 2BF7A 8LDHA 3T7EA 4IDAA 4D44A 1LQTA 2ZYDA 4K9DA 1HE5A 1YOVB 2O7QA 1MV8A 3EK2A 5MDHA 3ASUA 3HQ4O 1VL8A 2DUWA 4GKBA 5LDHA 1RM4A 2CFCA 4I9HA 5A04A 2WDZA 3BIOA 1EVZA 3P2YA 5DBFA 1EUDA 1E1MA 3DFUA 1VSUA 2CD9A 3ZN2A 4FOSA 4DLLA 3B1JA 4CMAA 1BDBA 1ZXLA 1C1DB 3VPGA 3R3JA 4CMKA 1XEAA 4QFCA 3ZU2A 3UVEA 3VVBA 1YGYA 3C7AA 4BKRA 4CLRB 4UVDA 1YRLA 1M67A 2X58A 4MVJF 4NDNE 4FW8A 4W7IA 3T4EA 4ZU3A 4YR9A 3ZH2A 4RGBA 5ITVA 3GFGA 5THKA 1NAHA 4ZQGA 3KLMX 1ISMA 2HJSA 1PJSA 4WEQA 2QHXA 5EESA 3L9XA 5CEFA 3U62A 4YPOA 3F5SA 2EKLA 3JQAD 4PLPA 4E31A 1SMKA 3IJRA 3JQ8A 3K73O 2B69A 5KJFA 4OQZA 3OECA 1YB4A 1ML3A 5JDIC 3JQEA 2Y0DA 5AVOA 4RORA 4Z3DA 3ZV4A 2P91A 4OXYA 3I3OA 3MZ0A 3V2UA 3X2EA 2YHIB 3VKUA 5C3MA 3JQDA 2CSUA 3I9MA 1E1LA 5CDTA 4IS2A 5L51A 4B4UA 5CG2A 1P1IA 3WQQA 2W2LA 3GNQA 3JD1A 3ULKA 3ITDA 4Y6RA 4QO7A 1MC4A 1SCUA 2I5PO 2EW8A 1ZSNA 4BNMA 4IMRA 4DC0A 1EDZA 3WGGA 3ZHXA 2VYVA 2P5YA 2SCUA 1LDNA 1WDKA 2D2IA 5FEUA 1ADBA 2EP5A 1UZNA 4IQ8A 2NU8A 3ONFA 1AUPA 2GYYA 1NVGA 3TZQA 3AY6A 2FPPA 1LSJA 1YBMA 4RV9A 1FDSA 2Y66A 2PH5A 4M87A 5F5LA 5CFZA 1H6DA 4WPGA 4TKMA 5DOZA 3FRJA 4ALNA 1ZSYA 2HMSA 3UHAA 4CMIA 1NPTO 5DT9A 5ENVA 5EINA 3VDQA 5B4UA 2FR8A 1JN0A 5DCWA 3JD3A 3RI3A 5TJHA 3R1IA 2NWQA 1B2LA 3LF1A 4E21A 2YY7A 4Q3CA 3ZW9A 4UULA 1CIVA 4RDHA 5L4LA 1VJ1A 3KTDA 1MX3A 3D3EA 4BGIA 2CUKA 4OXKA 1F06A 4D79A 2PY6A 1E3IA 1QXSA 4B8ZA 3Q9NA 1PZHA 4GX0A 4JBGA 5I7FA 1H0KA 3M1LA 2EGGA 4UAGA 5TSDA 1XU9A 3NTQA 4II3A 1Z75A 3RROA 1TT7A 3VTZA 4BNUA 5JDCA 1DJQA 1WDLA 4ALIA 3MJVA 5BSFA 4Y67A 3CH6A 3D1LA 2ZB3A 2ZCVA 5G4KA 1PIWA 4E5PA 2O2SA 1P1JA 4FOOA 2Z1MA 5IAAA 4BNKA 1T4DA 5EMHA 3VHRA 1P0CA 4FFPA 9LDTA 2Q50A 1HWYA 4JXKA 3WSWA 1UXKA 3ZWYA 2XXJA 5LC1A 3SJUA 3NJ4A 3K2EA 1K5HA 2JAPA 4A7PA 4BMNA 2DBQA 4PFJA 1O6ZA 1HZJA 5BT9A 2JFHA 5HM8A 4KUGA 4O1MA 2GO1A 4NFHA 1LTHR 3PZRA 2J3JA 2H63A 4DVJA 4Z0PA 3F6YA 1D8AA 2B5VA 4UVIA 1NQTA 3ST7A 4BQPA 4WCFB 1U2DA 5T67A 4JJGA 3SEFA 3MJCA 4RVDA 3OF2A 5JAIA 5LCXA 5L7WA 1MG5A 4FN4A 4AFNA 3W1VA 1MA0A 1E3WA 2B4RO 2Y99A 3ICCA 3G1TA 3G0OA 1Q0QA 4J2OA 4FC7A 3RSHA 2VN8A 3TF5A 3U3XA 1T24A 2I6TA 4JBIA 4YJGB 3HDJA 3DDNA 3DC2A 2BHLA 2E37A 3OICA 4B8WA 2VTEA 3EUWA 5COBA 3BTOA 3A9WA 4ZQEA 2BFAA 1NFFA 4ND4A 3Q11A 3WQRA 1WP4A 4D45A 4XRGA 4Y6SA 3WYCA 1GZ6A 4BNJA 2D5AA 2HMUA 2R2GA 4E2ZA 1PZGA 3M1AA 5L4SA 1PSDA 1VL6A 1IB6A 1ZEJA 3D3WB 3H65A 2VYND 2YV2A 3NT5A 3D4PA 2C2YA 4D3FA 4PCVA 3VZPA 5JDCC 3GC6A 1A9YA 1AXEA 1P77A 4UVGA 1SNYA 1VJTA 3ICPA 3KXDA 5KKAA 4ESOA 2D8AA 5TQVA 4MO2A 3ANNA 1LEHA 2ZYGA 3FNHA 1LC3A 1U4SA 3ONEA 5TNXA 4BNYA 5HWSA 3QLJA 1I2CA 4LW8A 5K0ZA 3AOEA 1FDWA 1FXSA 5DOVA 4O0LA 1RYEA 4TRMA 2Y68A 5L40A 4J16A 4FFMA 5G0UA 3X2FA 1YB1A 1C0IA 5JCXA 2VNAA 1G0NA 4XR4A 4BNLA 3RQSA 2GZ1A 4BO4A 5C7LO 3S2GA 1RPNA 1YDEA 3OJEA 3PDJA 4IPTA 4XQ9A 3SVTA 2EJWA 1LLCA 1ORRA 2DTXA 4R1SA 1AHIA 1PR3A 4URFA 4A27A 1PR9A 3JV7A 2X22A 4UEKA 4YWJA 3OA0A 1WNTA 3OHSX 3UFXA 1R4MB 3KM0A 4CM8B 3G1UA 2WYVA 3VTFA 1KY4A 1K6XA 2HMWA 2O4CA 3BAZA 5T5QA 1BWSA 1JLLA 4GLLA 1RM3A 3UUWA 1IHYA 2B36A 3PP8A 2GASA 4JK3A 1ENZA 3DQPA 4IS3A 2GPTA 4F45A 1ZSVA 1NYTA 3E5RA 4K26A 2NLOA 4WK6A 2B5WA 4J1TA 5FI3A 3WQSB 4A10A 4BO5A 2Y1DA 3RJ5A 1XHLA 1K89A 3RU9A 1QLJA 5IDXA 1HSOA 4AJLA 4N5LA 2QIOA 2NVWA 4FGWA 1WW8A 4BMSA 4EW6A 2NU7A 5C37A 1ULSA 1R6DA 3EGOA 2J5RA 4B4VA 4ND1A 3OM9A 1W6UA 1NXQA 2FHSA 1E3SA 1PZFA 4FD3A 4BNXA 2XXBA 1O8CA 4CR7A 5T8KC 4MVJD 2E82A 1LLDA 1U3TA 2HK8A 3AW9A 4RPGA 4FGSA 3TDKA 1X15A 4OIMA 4WASA 3DXFA 1WXDA 1W73A 3AOEC 3BHIA 4CV0A 3W6ZA 1RM0A 4PLWA 1ZO8A 4OKNA 5KNLA 1H6BA 4R16A 4QX6A 3BTVA 1NPDA 3BMCA 4FJ0A 2X86A 3LC2O 2RHCA 2HU2A 4J43A 2FMUA 5C5IA 3GRKA 3STHA 2XAAA 2WD7B 4J9UE 1L1FA 1TT5B 5MGBA 4I8XA 3O9ZA 5FYDA 1KEPA 1DC3A 2Z5LA 4B3IA 5H82A 2XOXA 2WE7A 1SZJG 2ZB7A 5ENDA 4XIYA 5GMOA 5IF3A 3MOGA 1CQJA 3R3SA 3RUEA 5A02A 3LSYA 4J0FA 1PTJA 1ISJA 2C29D 3IQDB 4TRNA 2Y1CA 3WGIA 1KBZA 4CM6A 3IIEA 4HV4A 4PN3A 1EDOA 3E9NA 3KYDA 1PZEA 4QT0A 1H94A 4NG5A 5L45A 3TZHA 2Q4EA 4W9NA 2G5CA 3PJEA 1UZMA 2HCTA 4CODB 1LRJA 4BMVA 4F6CA 4N5MA 4P4NA 3BTSA 5ICMA 4QEDA 1EFLA 3KOUA 5JAMA 3MTGA 5AXDA 1ONOA 2VZ0A 4H15A 3ANMA 4D3DA 5G0WA 3K2BA 4XYMA 4D41A 4OKIA 4FPXA 4G65A 3QV1A 4IJUA 3DMYA 4UVHA 1HDYA 1Q2XA 3PJFA 4KTTE 4K6FA 4B7CA 4MINA 3BZUA 2X6TA 1EVYA 4WEOA 3OJLA 1R0KA 1MUUA 2W2KB 6LDHA 1NAIA 4EUHA 1Y9EA 3BMOB 5A5FA 4IY1A 3QRWA 1LSUA 1N2SA 4QXMA 3LF2A 1P45A 5DBGA 4OMUA 3K6JA 4FFOA 3B1FA 3O26A 2OBNA 3ZU5A 1MXHA 3KV3O 4AG3A 4IJKA 1T4BA 4WLVA 3ZWAA 1R4NB 1DRWA 1SEPA 3MCVA 4RVGA 1E1NA 4BV9A 1HLPA 3NDRA 4HWKA 4KMSA 1IHXA 1U8XX 2BH9A 3MTJA 4BIIA 1QYVA 4YT5A 4ZHSA 2VYNA 3VPSA 5K9ZA 4LVUA 1YO6A 1T26A 2Q46A 2Y0CA 5K6AA 2C82A 1WMBA 3C1OA 2HSDA 2RIRA 1SPXA 3DBVO 3DEYX 3KLPX 4MPDA 1XYGA 4TQGA 3GMSA 1XCBA 5F1OA 3M2PA 2VTDA 1N1GA 3L07A 2YQ4A 3Q0EA 1NM5A 4W4TA 4X54A 2Q99A 3H9EO 4RL6A 1M75A 2AQKA 5JY1A 3GNSA 3HB4X 1ZJZA 3U9LA 3GVHA 4W9NC 3H2ZA 3E6AA 3WG9A 4JLWA 3JQGB 2NV6A 1ADCA 3GHHA 4HUJA 4EZBA 2AQHA 1KVUA 2UVDA 1HDCA 3WBFA 1DRVA 1RKXA 2HUNA 2NSDA 4AJIA 4ND3A 2DPHA 2QZ9A 4RPKA 1F17A 1BRMA 5U1PA 1E3JA 4XQCA 2C7VA 4UEJA 3PIIA 5JS6A 4RPLA 4A0SA 3L4BA 1A5ZA 4TZTA 3TQHA 4CR8A 1ZBQA 2QRKA 1HXHA 3WNVA 3D5QA 2Y1EA 4FFNA 4CQLA 4J3FA 1YKFA 4IDGA 4GMGA 1MLDA 1JKIA 3WJ7A 1PWXA 4YJGA 1D3AA 4DIBA 4LMRA 5AQ1A 2GZ2A 3OFSA 3WX0A 3S8MA 2DPGA 2G1UA 1K2WA 4HY3A 4YJDA 4G2NA 5K6AC 1LLQA 1UDCA 3C8MA 5ER6A 5L7TA 1NVTA 2UUPA 3GPDG 3H9JA 1V9LA 1R0SA 2ZK7A 3VZRA 1DIRA 4MVJA 5TT0A 4A2CA 3C7CB 4L0QA 2BKAA 3UGKA 1F0YA 3VC7A 1KC1A 2WYUA 3GG9A 4P4GA 4E5KA 4DQUA 1LA2A 3RBVA 2CDCA 5B4TA 1EE9A 3AUSA 2QZZA 3JQ7B 2IXBA 4H7PA 4MIEA 4TVBA 2VUUA 3I83A 4PLVA 4DYDA 4GSKA 4LCJA 3TJRA 1JTVA 1H6AA 2CVZA 3ANLA 3D5TA 1IOLA 5GZ1A 1Q1NA 4P22A 4E12A 1EUZA 4RVFA 3G17A 3N58A 4D3SA 4I9NA 4CLOA 3OIFA 4RJTA 1O95A 3VDRA 2UV8A 4B4WA 1NWCA 1XQ1A 2D0IA 3GY0A 3NDIA 3ROPA 4MVJE 1LSSA 1GZ4A 1P1FA 1Z6ZA 3E9QA 4IDEA 1GY8A 4B79A 1ENPA 4BOYA 3L4BC 3WJAA 3BMQA 4E2WA 3NEPX 4WCFC 2GLXA 4KQWA 4GWGA 3LC7O 1UP4A 4M55A 3C7DB 4OJNA 4CM4B 4ZRNA 3TL2A 4C4OA 2AEFA 3FTNA 2D5CA 1I01A 1Q0HA 3QVWA 2BFPA 2JD1A 4S3MA 1LC0A 3ROKA 1DC4A 5BSEA 4EUFA 2Q2WA 5KKCA 3Q3CA 4UEOA 1TI7A 1KYQA 3D64A 4NBUA 3F9IA 2GNAA 2WD8A 3KB6A 4BHTA 2PD6A 3TRIA 3V2HA 2P2SA 1DDOA 5IJZA 3WIEA 1PEDA 2PD3A 2AG5A 1SBYA 2CMDA 4EITA 4BGEA 4E5NA 1RJWA 4DXHA 2EG9A 2OXIA 3ON5A 1QYDA 3VH4A 3DAFA 4RLSA 2O3JA 4KUEA 5F21A 1SB8A 3O4RA 3KYCA 2VOEA 2QW8A 4XGIA 1ZMTA 1V0JA 2W98A 3GDGA 4Q39A 3UKOA 4J7XA 2HO5A 4WJZA 2GRAA 4XQEA 1EQ2A 4ZD6A 5T6BA 3QVSA 7ADHA 3OH8A 4IZHA 3V1UA 2RBEA 5A06A 2BGMA 5H81A 1LX6A 1HL3A 4L4RA 4R1TA 2ZCUA 1S7CA 1HYGA 3FNGA 1JAYA 4HNGA 4R5MA 4ZQFA 1NWHA 3DL2A 1GL3A 1EMDA 1MFPA 1Z45A 2EV9A 3ZI0A 1UXJA 3ZNPA 1PQPA 2EHDA 5I9NA 5A5EA 3PYLA 3FWZA 1GCOA 4DTIA 2DTDA 3A06A 3GNTA 4PVCA 4C7KA 3ZU4A 2C59A 1DRUA 4AJKA 2NUAA 3I6IA 3PEFA 2QYSA 3T4XA 4NK5A 4YAGA 1I33A 2A35A 5TLSA 2D4AA 4QECA 4JP2A 1YJQA 2DBRA 3UOGA 1U2GA 4OO3A 4RCVA 4ZJUA 2X0IA 1DFHA 1QP8A 3L77A 2W90A 3L0DA 5KVQA 2PGJA 4BB6A 3IUSA 4KWHA 3GRPA 4AJ2A 5CEJA 3F4BA 4Z0HO 4EUEA 4K28A 4BV8A 1U7TA 1VL0A 5CHEA 3S55A 4DPKA 3GG2A 2YV1A 4P4LA 1A7AA 1K6JA 5L95A 4LISA 3LC1O 4MIOA 3BTUA 3L6EA 3TOZA 2ZTVA 4RVHA 1GD1O 1IULA 2W8ZA 1QR6A 3LT0A 4J91A 4BNHA 4BNTA 2D3TA 3HFSA 4YVFA 3TZCA 4YRAA 4J1SA 1PJBA 3C85A 1UJMA 5I9MA 1E7SA 3UCEA 4WLFA 1GV1A 3FN4A 1O9BA 2JHGA 3JQCA 1TLTA 1B8VA 2EEZA 3BMOA 4EYEA 1GQQA 3RWBA 4ROSA 2B4QA 2EKPA 1UDAA 3VH1A 4J1QA 2F1KA 3AFMA 4WKGA 4IJVA 5JMPA 4Y98A 1N7HA 4NFSA 5IN5A 3OJ0A 1Y9AA 4L4XA 4QFDA 5KJEA 3PLRA 3GGPA 2P5UA 2VQ3A 1Y8QB 1JWAB 3LT4A 2DBVO 1VI2A 4K1LA 3K8ZA 4K6CA 2F00A 4B3JA 1B16A 5B37A 4N18A 4ALLA 1ADGA 3DZKA 1PL8A 4NH4A 1XQ6A 4EDFA 2O3UA 3U0BA 4CPDA 3FSRA 2IYOA 1E1KA 2DBZA 1MP0A 4FIZA 4EEZA 5THQA 1DBVO 3DBRB 4CM7A 1BSVA 4UUNA 5F1PA 4CMCA 1U3VA 1YQGA 4DREA 1NP3A 3L9WA 4NI5A 1E7QA 3TSCA 5DNAA 2A4KA 1SOWA 2FSSA 2OP0A 2TMGA 2O7SA 3BXXA 2X5OA 4JJIA 4TKLA 3CEAA 4BGUA 2J3IA 4MP3A 1A27A 3WWZA 2J5QA 3O38A 1KETA 1PS0A 3PHJA 4GX2A 1P33A 3LDHA 3O8QB 4H3VA 4BUCA 1DAPA 1VC2A 4S1VA 4JNKA 1A4IA 1F8FA 2Q3EA 2NTJA 2NTVA 5EL0A 3RD5A 2HMVA 4ND2A 2VWPA 1FMCA 2VT3A 3DHYA 3GVPA 1LSOA 5KJ1A 1UP7A 3ADOA 4E30A 1O5IA 1GTMA 1ISHA 2AG8A 3GMDA 4XX0A 1GYPA 2ILTA 3I23A 2IXAA 2B83A 2A92A 3IDSA 3GT0A 4LRTB 4WECA 5DN9A 4R54A 2WMDA 4LMPA 3AY7A 2BGLA 2VHXA 4LK3A 3RASA 3ZNOA 4R1UA 4CL3A 3F1KA 3VPHA 3EW7A 4I9UA 2HAEA 4GKVA 3S2FA 4AJHA 4UUPA 4MJLA 3DZGA 1GR0A 2HRBA 2ZB8A 1WPQA 5F5NA 4CR6A 3HWRA 3OJFA 3ETDA 3RC1A 4HFJA 4IQGA 4YAJA 4XR9A 2VUTA 1F14A 3PJGA 1EK6A 3K31A 2XPCA 3GOHA 1PJTA 1HF3A 2Q1SA 3OQ6A 2TMDA 2C20A 4QTZA 4E2YA 2YW9A 3K96A 3TN7A 5IZCA 5G0TA 2LDBA 2Q4BA 5DP2A 4NQZA 4NZ9A 2AE1A 2R6JA 1JW9B 1PJQA 3H5NA 5BSGA 1I2BA 1N9GA 3GZNB 4TRJA 3ENKA 1MG0A 2DC1A 3OSUA 1KVQA 4R9SA 2YV3A 5A03A 2BI7A 1DJNA 3I52A 4YJFB 4MVJG 2Q2QA 1A4UA 1EBUA 4FS3A 3Q1LA 2Q1WA 3BHJA 3P7MA
chains in the Genus database with same CATH superfamily
1JR3D 1KBQA 5TGDA 3CX3A 2RGCA 2PRKA 4M86A 1L4FA 2QGZA 4JL8A 1X1EA 5BSTA 3EQZA 4MZDA 1N1EA 3O4JA 3T4PA 2OCXA 3A6ZA 5FULA 2VEDA 3SZUA 3VJLA 2JCYA 4UMVA 1Y4SA 3V97A 2UDPA 3O1IC 1BS1A 1USVA 3MG9A 9LDBA 3W1EA 3KAQA 2AXPA 4YT2A 1IJBA 2LCIA 4TGLA 1NJ5A 4ZT7A 4HMPA 3LG2A 3IUQA 3I37X 1XEWY 1HQYE 1T2CA 2CE2X 5AW8A 5AW6A 3L41A 3CONA 1C4XA 4Q18A 4YMIA 4Z8YA 4DZTA 3WLNA 1ZKMA 4U7DA 1TKCA 5HYVA 3UT5B 4U2BA 3OPYI 5I7SA 4YWHA 3USCS 4EKEA 3KOZA 1BD4A 5SZJA 1B6SA 1X8JA 1BVUA 1QFXA 4YJHA 4DV0B 3SZRA 4KPFC 4KVGA 1ZXBA 1UXHA 3KHKA 3NHUA 1WL8A 4IQFA 5JD6A 3T95A 5G1NA 2ZAIA 3GVIA 4LSMA 5HFJA 4F4HA 2IYZA 2QG4A 1P2TA 3PT5A 1JJBA 4MQBA 5AKZA 5EJIA 1N5KA 1RLTA 4DBLE 3JR7A 2IZ7A 2NP7A 2PLAA 3M3HA 3HKEA 2EP7A 1PJ8A 3IR5A 3PIRA 1ZIPA 4Q9AA 2GK7A 1KFBB 3PC8A 3G49A 5H02A 3VU1A 1XQYA 5HDBB 3JQAA 4G4JA 3QX7A 1SQ6A 4FR5A 5ESWA 3TSYA 4JT8A 1N4DA 5EZSA 2EWVA 1BX1A 1F2UB 4XUCA 4MKFA 2JJMA 5LNK1 1GKUB 1X7YB 1E4YA 1C50A 3JYPA 2NVBA 1Z5VA 4CZ2A 4YEDA 4TUYB 1AF4A 2IYXA 3TJMA 4AJJA 2PUDA 4GX5A 1W4ZA 4IQ0A 4N0DA 4IDDA 3OQMA 5BQ5A 3FMPB 4BO1A 2NUPB 3OZWA 2BD0A 1SA0A 1JALA 3DO5A 1N78A 2CVQA 1PQUA 2AOVA 4YP7A 4ED9A 3NR2A 4IHQA 3H5TA 3QXXA 1XMOB 1XDSA 3QKRA 3B78A 3RRYA 3H2SA 4YACA 1JZSA 1FYWA 4O2AF 3WLPA 1D2RA 1YRHA 1U7HA 2JCBA 4DDMA 4UTOA 4WK2B 1TCUA 1RJGA 4MI6A 3SVZA 4E0BA 1PBNA 1QV9A 1E2JA 1HDOA 5LWQA 1J1IA 5AJZA 7MDHA 5JC1A 5KTNA 2G6TA 2I66A 1HE3A 4D1YA 1CVLA 3RH0A 3DLAA 4PINA 4OY3A 1LNZA 4N8SA 5ILGA 1ZM2A 1HY3A 2PRIA 2CSXA 2DKFA 4X1YB 5B1IA 4NNJA 1D2GA 2RK3A 2BFFB 2FR0A 4QOEA 4M54A 2PZEA 2YV4A 4O6VA 1L5HA 3PUJA 3MGAA 1ZOPA 1CD5A 2BDTA 2Q4RA 2HBRA 3GCDA 4HWGA 3RU7A 1B26A 4MPRA 3MWKA 1UXIA 4XGRA 2ZFUA 2ZB4A 1GQRA 1EZ4A 1X2BA 3PD7A 4PGAA 1IQRA 1KYYA 3WRVA 2QQEA 1UQUA 3C24A 3OEEA 5D5PA 3RHTA 1UBKS 4NYIQ 4RK0A 1F60A 4AJPA 4EPVA 5TQ0A 1MAVA 1DDIA 1FRQA 2V65A 3GPCA 1I3MA 1R4AA 5HKBA 2VPXA 2B1QA 2VZEA 4M9XA 4L8LA 2NUTA 4WT7A 3HPRA 3PWZA 3SQMA 3AUAA 3PXDA 5G0SA 3V3KA 1WSBA 2V7PA 4BFYA 1WDMA 1SVOA 2WE8A 3MD9A 1U9JA 4TTTS 3V34A 4CBVA 1K3UB 5KTYA 2BI4A 3EA5A 3H3FA 3HYTA 4KX5A 4Q4LA 3A0UA 4Q93A 1CUAA 4H3SA 2PTHA 1W36B 4C21A 1IUKA 2ONKA 2NU6B 2FMTA 1GDTA 2WA2A 4OYRA 4QYMA 2ZIAA 3C1TA 1Q3HA 2JBHA 2VT2A 5LZ5A 2NPFA 4B3RB 2GK6A 4MUXA 1E4OA 1DS6A 1F4LA 2ZYTX 2HZ7A 4EK9A 1O9GA 3B1XA 3S27A 2VDKB 5DPMA 3KD3A 3RW9A 1BGVA 3R7LA 1B76A 2EX0A 1KYXA 4HRVA 3OPYB 4JL6A 4DCMA 1XDUA 5C5CA 1RTKA 1BMDA 4YRMA 1DEKA 3KVOA 5ITZB 2YHIA 2Z6VA 3Q2KA 3TZ6A 4IVQA 5AI0A 1EBFA 1P1KA 1TA0A 5E9WA 3E4CA 1FLVA 2Y6UA 2GZ3A 4XUEA 4DLBA 1HE1C 4XFKA 3TOSA 3N2EA 5E4FA 2E49A 3I2FA 4FDAA 2XOKD 1N57A 5FHRA 1QOPB 4WLEA 1H4TA 1K3FA 1VSQA 2PX8A 2XVAA 1ZU4A 1J7JA 3ORHA 4WJLA 1C4KA 1R5BA 3CRVA 3V7FA 2Q21A 1KEEA 2XDWA 1I2ZA 4P4UA 4YMSA 4MVCA 4ZC1A 3WWDA 1XWWA 5HGJA 1RAEA 1Y4AE 2A5GA 3GUZA 4AO8A 2A9FA 2VFAA 4KV9A 2Z9CA 1O5OA 1WTAA 1DHTA 3E1GA 4CQJA 3ZKWB 1V1JA 1J2UA 1JR3A 4MYRA 3KB1A 3WL6A 5I45A 3AOGA 5EEHA 4FYWA 4PTZA 2XY4A 5E2IA 4AJ1A 5JUWA 3DBLB 3A7DA 3ZGYA 4S12A 2P0YA 3GGDA 1GN9A 3JZAA 4HDNB 4DKXA 2WD9A 5ETJA 4X24A 4MYSA 1PL7A 4KR6A 5BN3B 2DXIA 4WGGA 2WF8A 2GUWA 221PA 2Z4RA 3OOYA 4E13A 2X8JA 2DQSA 4DBZA 1GYQA 3SXUA 1EFUA 1NNEA 4MHTA 3KELA 2QRZA 5DO9A 4NFYA 3LHKA 4MHOA 4GL2A 4XIGS 1P0MA 1PT8A 4EY7A 4RK7A 4FGJA 4JMPA 1RKBA 3GF4A 1RPJA 1SELA 1SUFA 1N34B 4A5SA 1FNMA 4BC0A 1PZNA 1T3TA 5KSOA 2PL1A 3NRBA 1PI3A 2G36A 1IEVA 1TUIA 1Y3HA 4NR0A 3WRYA 3SDSA 5GGYA 2BR5A 2IP1A 3EHEA 2P4SA 3K30A 2I99A 4KACA 1ZH2A 3MUFA 4JVLA 4V1CI 4JEMA 2PZJA 4BO0A 4U9UA 1K66A 2Q8QA 2JD0A 3I9FA 4HNAA 4V0QA 5E7MA 4RLFA 3D2LA 4YRDA 2HK7A 4K81B 3ZDQA 3VYUB 2IDKA 4C6TB 4PHGA 2QJOA 5B3JA 3ZK7A 5AXAA 4E5SA 2LXNA 4JFRA 1RXUA 4PO1A 4AQYB 4KFTA 4HLDA 5GZ6A 2O5CA 3GGOA 3IOCA 3WLQA 1SXJB 5ALRA 1DTEA 1MORA 1PT6A 1X38A 5ALGA 5FWXB 3BIFA 4E03A 2ATVA 3FBTA 4DLUA 5F3WB 1AN9A 3G79A 2W71A 3QPWA 5FFNA 3TRKA 5KJCA 3AVQA 5ECDA 5EE0A 4DIEA 4EBBA 2WJWA 2P6PA 4EEXA 2PZFA 3PTAA 2XRFA 4ZYLA 1UM9B 5EHXA 1AOXA 4FFDA 4LWOA 4P7JA 4PLGA 1R6AA 3DEIA 3ZLUA 5CBKA 3Q87B 3A1CA 4FYVA 3DZFA 3U7JA 3AQ4A 3UW3A 2OO3A 3T7RA 4RV4A 3TX2A 2O1WA 3L6BA 2QTNA 1M2GA 4N0PA 2XE4A 2QAIA 3EXHB 3PQEA 4BQEA 3MILA 1KJ8A 3LC0A 4F5DA 2B0JA 2I2WA 4H4DA 2I29A 4YJFA 5LMUB 2V7GA 1UINA 4DCJA 3TAHA 3I45A 3HVHA 5K2MA 3TCNA 5E1BA 3LRXA 3D3QA 3Q10A 1J2TA 4B6OA 2A9JA 5FI1B 2E4XA 3VPFA 4AJOA 3E4DA 1LF0A 3QUCA 2C2MA 2PWZA 3GLIA 4ADSG 2JAUA 4QUGA 4N76A 3KKPA 1OLXB 3EVTA 1NURA 2BWJA 2PV7A 3ZPXA 1E2BA 2D4HA 5L3ZA 2FSVC 5TQ2B 3CJQA 4YRGA 3L6OO 4ZO7A 1G20E 1YVPA 4QG3A 4HZUB 1XVLA 1U04A 3GJ4A 3ZV5A 4BFVA 2AMJA 1H3NA 2X0NA 3R6WA 5KS2A 4PZZA 1JNXX 3D3WA 4QGAA 5AP9A 1FP4A 3QKWA 4KN8A 4V0OA 2HDHA 5FBZA 2XQKA 3TLJA 2C2OA 3K0FA 2KLHA 2P5TB 3L0SA 2QRUA 5JROA 1WHSB 4C2TA 3I9V6 3UMRA 1PNRA 3IB3A 2H52A 1YZYA 4FWBA 1PQ4A 3D6MA 1MIOB 5MGNA 1R4ZA 2GJAA 1DRJA 1ODSA 4K3VA 1M2EA 6Q21A 1NJ6A 4QEKA 1CY2A 3MFQA 1IFXA 2SKCA 3FGPA 1H2BA 3HGTA 2QR5A 3MJFA 4OSEA 2N3ZA 1KQPA 2G7ZA 3LL7A 4E2FA 1T9ZA 1P29A 2JEZA 4LDJA 2WP8J 3WRWA 3MHPA 3FKJA 5C1IA 3V7NA 1TO2E 4FBLA 5LOVF 1DXOA 4CN8A 1BDHA 1FTNA 3QUBA 2OCLA 4AMZA 3QNWA 1Y6RA 1U31A 3OIDA 2GXQA 5FOUA 3TTWA 3WWCA 4KP7A 3VOSA 1U2QA 5CFMA 3K2IA 1W5FA 1E89A 1O58A 1QVRA 4PO8A 2ZJ1A 3RAJA 1YI8A 3BN3A 1V7CA 2IZ1A 1V25A 2NQ8A 3LT1A 1R74A 3SF8B 2ZJ6A 1MXFA 2A0YA 2KB0A 1N77A 1DBIA 4QTYA 1E3WB 5TS3A 4BNGA 2I2XB 4G01B 1UC4B 2IRWA 3HSKA 4L8FA 4LXUA 2VHYA 3ZZ0A 3FAKA 3VO1A 4HAZA 3GQVA 3RS4A 4DA9A 1ECBA 4Z7NB 1N0IA 4B9AA 3DZJA 1Z08A 2Q5HA 4FDUA 4M9UA 1CDZA 1YDFA 1Z4IA 4Q24A 2P67A 4KSCA 5ALSA 3MYYA 5EEGA 3TD2A 3DTTA 4KVFA 1X7DA 3HCAA 1SHJA 1O08A 2AFIA 3C45A 3JWIA 1I36A 2X9GA 2EEPA 1JKFA 5EQJB 4YP1A 1O3YA 1QM5A 2HTFA 3PU6A 5EE1A 5B1HA 2GEUA 4C06A 2F3SA 4PSVA 1MVNA 4N65A 4WK4B 3REGA 5IDWA 1KFEB 4V1CB 2XOKA 3GK3A 1CLUA 1G8HA 1L4YA 4MUIA 4UARA 3ROEA 7AT1A 3H42B 1T15A 1ZN2A 4I50B 3HUUA 2PMFA 4V38A 5AI8A 3BFJA 1CFZA 3RVBA 4FB5A 3CBQA 1ZH0A 3WLEA 2PGDA 2R97A 2ZRIA 4PZDA 3C98A 2C2XA 1NC1A 1KEUA 3AVYA 4QQ8A 1M2NA 2DE0X 5CEEA 5KYYA 1OXVA 2CCGA 2NM0A 2P1DA 2XUQA 4KQCA 1SGWA 1FQKA 1X7GA 4LXTA 1DAHA 4HNHA 2RCYA 5FTMA 3C8HA 1B74A 1KZ4A 3OHPA 1OSNA 4TLLB 1BYIA 1SQFA 2C9YA 2NZXA 5CVJA 3SZMA 4FX2A 4L75A 2QZSA 3WGKA 1S89A 4L5BA 4KK3A 4U5XA 2NO0A 4I9FA 1EZZA 4XAQA 2P6NA 1P9LA 1QHHB 1Y5RA 3K15A 3W2IA 2G06A 1PK8A 2KYRA 2R11A 3A4LA 5BVGA 5IXSA 1T1GA 1XZFA 4QHTA 4KI0A 1PJ2A 3GV0A 4IJ6A 4K88A 4EWLA 1E2PA 1BVYF 1TM4E 2Z5GA 3RAEC 3EJ6A 4UNSA 3RVRA 5ADHA 3JQBC 3HL0A 4MUMA 4LSWA 2XLCA 3RG2A 4DUZB 4IIXA 4FE4A 3LLVA 5AVZA 4ZVRA 2P9JA 3VAZA 2FI1A 2YXBA 2J1LA 3TYXA 3WDSA 2BGWA 2HCJB 3BK7A 3S4YA 2WZQA 1IVYA 3DE7X 2F8LA 1FDOA 3IRVA 4IMPA 2G0AA 3CKMA 4JYPA 4R2KA 4XYEA 3ZJYA 4HUTA 1F5NA 4PZAA 4BXOB 1I10A 1PVOA 2GEVA 4HCJA 3I9LA 2P41A 2WD7A 3QLVC 2A4MA 4B35A 1PZMA 1NQOA 4FHGA 1RZVA 1NONA 5KYGA 2ZAMA 4RVCA 1KSHA 2IH2A 5LUBA 1JAIA 3HEAA 4OP2A 4RA9A 2R84A 2AUNA 2I2CA 2ODNA 2BZ1A 4J90A 4KGZA 5HK8A 4G9EA 4N8EA 3RNLA 3B12A 4DY4A 4JX9A 5JMWA 1WD7A 2YYSA 3BCRA 4ARZA 4B4KA 5KINB 1CUJA 3O4HA 1G2IA 4O29A 1G21A 1AIPA 4YO8A 1Y6ZA 1T0UA 1X7ZA 3KZXA 3RTAA 3V4FA 1Z0JA 5BRNA 2V7UA 4AS2A 2ZQZA 2GD0A 3LQ2A 2CXHA 3B6MA 2BONA 2GNOA 5REQB 4U2EA 1HFJA 3ECCA 4YJ3A 4O2RA 4RVNA 3D8NA 4C89A 2GM4A 1VSVA 1N2CE 3B85A 5EE9A 1FL9A 1OX6A 3U0VA 2IQIA 5AM3A 2PSDA 2JAWA 3JXEA 1INLA 1G5IA 3QXGA 1IHOA 2KJQA 3BMNA 4LE1A 3WL7A 1H93A 4QZVA 3SYMA 3PKIA 4DSZA 1UDWA 2GWHA 4MVXA 4BWYA 3HYLA 4OG2A 3L4EA 2I8CA 2BGRA 4CU2A 1CRQA 4J1NA 4R4JA 1HEUA 1PGQA 4Z9FA 4DPMA 1R66A 1YB5A 5AJYA 4BP1A 3HP7A 3CSUA 2XUAA 3NHYA 5FOXA 4DMFA 1JBQA 1XCGB 2F90A 3GT4A 1E61A 5F2KA 1YZVA 1OIVA 3GZTB 2GT1A 1I3LA 2W2KA 4WCVA 5CB4B 4F3KA 1CE8B 3GVXA 2Z2ZA 1X13A 1UQRA 3MINB 2ZWOA 3HEBA 3V1YA 3AEXA 3OQBA 1BQEA 1Q15A 4GPD1 4QUBA 1II8B 1I9CA 3FUXA 3PFFA 4NBKA 5DIFA 4OUDB 4EKIA 1WULS 2ZR7A 3BGSA 4P82A 1Y8RB 5H9WA 1L5FA 4OM8A 1ISFA 3LBHA 1OXKB 5CDYA 2WAAA 2WTXA 3H2BA 4RIEA 1S3FA 2IZ5A 2QSZA 3LDAA 4JB8A 3O3OB 1J70A 5JH7A 3PGVA 9MHTA 3H7AA 1CQJB 1T8UA 1YE8A 4NJOA 5CNJA 2FWJA 1ZMOA 1LXCA 2YWHA 3NBYC 5CBPB 2DOKA 1H05A 5KDLA 1PHPA 1U11A 3EBLA 1C8KA 4DRZA 4RDCA 4BZZA 1M2VA 4M1WA 4QXOA 1X7WA 3KYDB 4LOLA 1YDWA 5C8YA 4DLNA 4GX1A 3U49A 3K1YA 5CFPA 4PQYA 4XZ3A 4K9NA 1MPXA 5DW3A 2BMWA 1K68A 4FX5A 3R7WB 3TL3A 3ZUGA 4A73A 1E6UA 3HWX1 2ZUFA 1DKOA 5CLIA 3RC9A 4P98A 3ZWVA 5ILOA 4MWEA 1FJXA 5AUPB 2IBSA 4YDHB 3TMYA 1DARA 2FQQA 1OIXA 3D8SA 4LZJA 2XNDD 4GKAA 3L82B 3RUCA 1O4VA 3N1UA 4D97A 4AWAA 4MVJI 5HOEA 1Y6GA 1U9IC 3RIYA 3NV9A 2VJKA 5FTJA 3VO9A 5K8IA 2EFJA 1YUBA 2WTMA 3GCWA 1V11B 2GDZA 2IPXA 3MFYA 3SC4A 2RGGA 3V6LA 4GMKA 5C81A 1QWOA 1QZTA 3HP4A 1HLDA 3NNDA 3ZJ4A 4ZRMA 1IXRC 1H2RS 1ZG3A 3ET4A 2PZMA 3FWYA 3W8EA 2GEKA 4MAFA 1FYDA 1ZVMA 4MQUA 2DKNA 1NFQA 1YE5A 4Y6PA 4NOMA 4JOBA 5I4CA 1QO0A 2YFYA 4KXVA 1WSWA 1JDNA 5BSVA 1CQXA 2B2CA 1KOFA 2O0HA 2ZIVB 1K63A 1P91A 4G24A 4AICA 3PPVA 2SNIE 4BLTA 1XLTC 2EIHA 2B21A 2VRCD 2A6PA 3B6IA 3EEIA 4Y9UA 2A78A 1G2OA 5K0BA 1Z37A 1P31A 1AS3A 4B76A 1U7UA 3QWFA 1T2FA 3NTRA 3GRCA 4TMZA 3SXPA 3EXAA 4Y2UA 5JJ5A 4GWLA 1LI4A 1XWIA 2ZE6A 3BQ9A 1DVRA 1JA9A 2WUDA 3CISA 3SLRA 3DE4X 1N3IA 1MZPA 1B8UA 3SKYA 5AMXA 1QHSA 1VJRA 1Z6GA 2PZLA 1C1HA 4P81A 1JDJA 2GUGA 4YB8A 3QJYA 3V55A 3U7QA 3UK7A 3A6DA 3BWDD 4H7IA 1YF3A 4HDRA 1QSGA 4ASUA 1A9TA 4O59O 5K0NA 3B9RA 1MW9X 4LYDA 4LY0A 1BA3A 5BW8A 3GPLA 4HQRA 4PZ0A 2NGRA 2YUTA 3JAKB 1WPGA 3S99A 1O0BA 2D7DA 2RHDA 3RODA 4QYIA 5LQCA 1XNRB 1QIDA 1SUPA 1SOAA 2F9FA 2G82A 3C3JA 3CPHA 4IWNA 3T7JA 2CLHB 5AOCA 4W7SA 1VKOA 4RD4A 5LMZA 1NXOA 3R6DA 5EWMA 3R5KA 1MOZA 3GAZA 4HB3A 4AN0A 2O8DB 1A7JA 1IB0A 3T15A 1P8JA 3ZE1B 4BU1A 1O6GA 2PHZA 1Q1GA 2F1IA 1C0PA 5CH8A 5ER9A 1J49A 2ACWA 3SXJA 2J8ZA 1KMHA 1HDRA 2NNLD 4IIHA 1OD6A 4N8DA 3OVMA 3S7TA 4BJHB 2XUKA 4B4DA 1KERA 4DMMA 2JL1A 1JEYB 4EMBA 5JXJA 3I1JA 2GJKA 1FQJA 2PAFA 2FLVA 1H4VB 1VJ5A 1YQDA 3WL8A 4PGFA 1Z0KA 5CNMA 1TYZA 2IBMA 2ZE8A 1ECGA 4RJ2A 3IL2A 2OCKA 4C05A 1F0KA 2DUUA 2VQ6A 2ZRFA 4F56A 3N2LA 4XQGA 3T3PB 4BMYA 2LIPA 5DTQA 4H59A 1RPAA 2PSEA 2X9QA 3VSEA 4JI1B 4GPEA 1ZM9A 5ILQA 1VRVA 1B0AA 3ADBA 1UZLA 1IMJA 4YMHA 1ZNXA 3F71A 2IS6A 4DRYA 3B3FA 2PFKA 2CVOA 1WVIA 2DWCA 2PKQO 3IIJA 2LCQA 1FRFS 6REQA 7GPBA 1MJGA 2QQFA 2JLBA 1G7CA 5KCMA 4YMLA 1XSEA 4MA0A 3OJOA 4J9VA 4JELA 1NTRA 1XRRA 1XVIA 1VL2A 1V1RB 2Q3HA 3D7RA 1EX6A 3K9CA 4AX4A 1EWYA 1W48A 1NU6A 1BHJA 1IJFA 4JENA 4EAQA 3FOEC 4P1ZA 2VQEB 1V4BA 3L1HA 4NEQA 5JRZA 2HU8A 3LY9A 3UHFA 1ZM3A 1DTWB 2WA1A 1DC8A 2HXYA 4Z4FA 1P0PA 2UYQA 1M54A 1D6JA 2OV4A 3QWHA 3BDIA 2CNDA 5JSZB 4P80A 3A3NA 1T5LA 1K8ZB 3WL5A 2QTCA 5A4AA 1CZOA 2GD6A 1UUFA 3LYHA 5B6JA 3DCIA 3PNPA 1E9FA 2FSGA 4HXYA 4KXXA 5FA8A 3QKSA 3T7IA 3PXUA 2QN6A 4DIDA 3ZV3A 5CA0B 1B7GO 1TVKA 3NT4A 1A3CA 1J4AA 4UHFA 2NQTA 4F4DA 3NC0C 5DRYA 2PX4A 2HWYA 5ISMA 2UVQA 3EIEA 5BNFA 1GZVA 3WMXA 1UJ4A 2VJAA 3I1FA 3NGLA 1XP8A 4IDNA 3OTHA 1EFKA 1KR2A 3JD0A 5ALOA 4K0KB 1I0LA 5CAEA 2H57A 3NT2A 4ZPJA 2WIDA 3G9TA 3G2KA 1WXEA 5AHOA 2OQRA 3GLKA 5DIZA 5F9HA 1BCSA 3STUA 2MIIA 3ROTA 2IEDA 4R7ZA 1Y7TA 4YRLA 5KOIA 3QE9Y 4LE0A 1AZLA 2WHXA 3SP1A 3UXHA 4YHHB 2ZM5A 3E23A 1AHNA 1CNEA 4L85A 1NVDA 1TVMA 3BMQB 2M98A 3RJ9A 1DAKA 4AY4A 2XNKA 1XK7A 2O7VA 4KPUB 1V3VA 5AD1A 3HGMA 6NULA 4N7RA 3OZIA 4YASA 1U5CA 5J2TF 3STXA 5EJ9A 3DDSA 3T3EA 3K1JA 1F2TA 3X1ZA 1FLDA 2D0PB 3ZI7A 2W6QA 4M1ZA 2EQAA 3LE8A 1Y8ZA 1S2LA 3F8SA 3CW8X 3H5AA 4YCSA 3T3OA 2J3LA 1CQIB 2XNDA 3A6HA 1YAJA 3FROA 3KAPA 2R00A 4O02B 2H7VA 4U6NA 5K0FA 2LP4Y 3O2SB 4UNNA 2BHSA 2E1RA 4H35A 4PX2A 1WKVA 2VDWB 5AHKA 3T6KA 5BYKA 3BE5A 4F9EA 4CKEA 5E3HA 5LP1A 3GZ4A 4ID9A 2XMZA 1OGYA 4Q3AA 1ST3A 2DG2A 4NZNA 4E32A 2P1RA 4JI2B 5DB4A 5CGZA 2Q9CA 4UASA 2NACA 5HTOA 4IEIA 4RCYA 1QZXA 1JU9A 2VLIA 3VKVA 2QX9A 4O4IB 4YRTA 4CV3A 1VTKA 4CF6A 2VRCA 1M2KA 5F78A 2Y2VA 3KYCB 1Z3CA 3B20A 4KDFA 4AECA 1PV2A 4AC9A 2ZRMA 5EQDA 4D6YA 4G6ZA 3VKHA 1RVDA 1I3CA 3FUTA 4KIGA 4LTDA 1HRKA 3JW8A 4AZTA 1JBKA 5M5BA 2ISQA 2IZZA 3MYRA 2I78A 3TGWA 4J07A 2H4XA 2HO4A 1TJ4A 3ELUA 2XUFA 5JOQA 1EIZA 1Q22A 2ZAOA 3NC1C 4G85A 3D0RA 4BMZA 1I94B 1E5TA 2YC4C 4P2GA 3HCDA 3PE3A 3EMDA 3LHFA 4CMGA 1XTVA 3E27A 1KA9H 3TDNA 5DEIA 5ULLA 3H2KA 2Q6LA 3CU5A 4EHHA 4PRZA 2BJVA 3SEAA 4F85A 2Q28A 3B3GA 4WTOA 1VYHA 3CKKA 2FW6A 1ZQ1A 2QMEA 2HOQA 2YJNA 2HM7A 1WU7A 3NEYA 1R3DA 4NE7A 3NYQA 4R1QA 1OFUX 1SO8A 3GOQA 1V3TA 4BQOA 4UNQA 2DLNA 4IJMA 1BN7A 1UFRA 5A5GA 3WTCA 5FEMA 1GNVA 2B6NA 1PWHA 2BFBA 4NU6A 3MTAA 1EUCA 1C41A 3C43A 1UK9A 3DLBA 3UB2A 3I2HA 4Y1RA 1OAAA 1U2PA 3EZ2A 4XD2A 3UCXA 1IY1A 2Q6KA 2ID8A 2A0FA 3LKDA 2JGDB 1Q0TA 4CTMA 3L1JA 2IPAB 1WBJB 1XTUA 2CNBA 4DR6B 3H11A 2CZCA 2XITA 1P62B 5E6UA 5D51S 3QI7A 2D1RA 3KDPA 1B1CA 4LHEA 1XOIA 1GPLA 1Y6JA 4LYGA 2C7PA 3DVLA 1BEZA 5CT4A 5BNZA 1TTHA 3GXBA 4FB4A 1MEEA 2ZSHA 1EGAA 4BX8A 3CVXA 2FY8A 2QRQA 5KHAA 2ODPA 1XPJA 3KL4A 3RAPR 2IHNA 3F97A 3NATA 3O21A 4Q66C 3NVKI 3D7NA 4A0QA 2YWRA 4AO6A 1L4BA 1M33A 4PNZA 3FDFA 1XALA 4JP3A 3GDHA 3K20A 4JBXA 2P4HX 2N42A 2R8YA 2DSTA 4FQ8A 4U6QA 4XJSA 4EO7A 4ZZ0A 4RULA 4RPHA 4HAOA 2AUMA 2GEDA 1BD3A 2AZMA 1GTRA 1C0KA 4FHDA 2J3HA 1DLJA 3CY6A 1L8OA 3HXTA 5B3KA 4BGDA 3KR9A 1KDVA 4F9GA 4MKZA 2WICA 4HTFA 1QYCA 1WW3A 1YQXA 4TT3D 3GQBB 3JQ8B 3ODPA 4I3FA 1D1TA 2P9QA 1ZK0A 1RWMA 4UBNA 1CZRA 2VUSA 1E5XA 4A23A 4M0EA 4GRIA 1P9OA 2BBOA 2Z09A 2HK9A 2IU0A 4EJ2A 4E1AA 2F9LA 3MS4A 1LBTA 1C3OA 1MEOA 4NK4A 1Z4NA 1M6HA 2DMRA 5L3RA 2ZQ5A 4JXJA 1Z8DA 2YQ5A 4F4CA 1XZQA 1DB3A 4KWCA 3DKRA 1QVVA 5DYYA 3DAGA 2WKPA 1AKWA 5ALNA 3EF0A 3QGMA 3UG7A 2GDJA 5JXHA 1JFVA 3C7KA 2ODEA 3I2JA 5HVNA 4LJ5A 2CVFA 3WTBA 1YWGO 3MWGA 1KIFA 1YCDA 2QROA 1ECCA 4XIIA 5JI3E 4DV5B 1X6VA 3IURA 1FSZA 3RBXA 2ZYWX 1NJSA 2DFVA 3INNA 1CPYA 1KO7A 3SYKA 4XYGA 5I5EA 2FPWA 1SC3A 2O3SA 1G0OA 1T1EA 3DFMA 5KUTA 1ZOIA 4IDQA 5FADA 3FVTA 3I73A 1C9NA 2JRLA 5A5DA 3CPJB 1XHEA 3T9CA 4ALJA 2VH2A 5DYWA 2QTLA 1EFPB 3QPCA 4DDTA 1DUVG 3KJXA 3FNIA 4V0RA 5DM0A 1M83A 3ZIUA 3NOQA 5CDSA 1F1BA 2WSSD 4JJFA 2ASEA 2ZTLA 1QGZA 2PBRA 2G9UA 5EP3A 1M34E 1HE8B 1WPXA 4M7OA 4XVUA 3EXG2 2XCOA 3PFCA 5BMVA 4OLJA 3DKIA 3KT6A 1GFIA 1XD2A 2XVXA 1AGRA 4AF7A 2A0KA 2R44A 3WR5A 2R4QA 4H7HA 5CDGA 4QUKA 3WYBA 1E6EA 5KVVA 4JITA 1FE8A 3RNOA 2B2NA 2XWJI 5J5CA 4EZEA 4TTJA 2X13A 4Z3KA 5H8WA 2GN8A 2VSXA 1YL6A 3DLTA 2Q45A 3H9GA 1RACA 1VJ0A 3VPAA 5EJ7A 3BGWA 2QYTA 4EYQA 1MU0A 3VSAA 1GFSA 1XZBA 4RH3A 1SD1A 5F2OA 2ZVJA 4DMHA 4JIGA 4I55F 3E22B 1NZJA 2B1GA 3BERA 4KWIA 1VIMA 2Z5VA 2WZDA 3N7AA 2R6CA 1MO6A 2WUFA 3FSJX 1L7AA 3KLOA 3GT7A 3OKPA 3DUFA 4PLTA 2X9VA 1YQUA 1HT2E 1MVLA 3FZEA 3HZOA 4K9RA 2ZIZA 2ZKIA 4CTKA 2IEAA 3W4JA 4Z9YA 1MRZA 4MLCA 3D31A 3H0CA 4EGAA 5L45A 2D1YA 2JCVA 5B2ZA 3HCWA 4XDGA 2Y77A 5JCOC 1J8MF 1KJJA 3UK2A 2D2EA 3SQNA 2VS1A 3GNLA 4OAPA 5BNWA 3A28A 3LP5A 3IQXA 3QUQA 1JQEA 4EELA 5KTMA 4MP8A 3H5LA 3PJDA 3KS9A 3R7NA 2YFKA 2HV8A 2NZ2A 3WWOA 4IH9A 4KG7A 4KPYA 3WGUA 1BZYA 1O87A 3NKFA 2Q49A 2XHEA 4JNCA 1ZN7A 2PQ6A 1JAXA 3GUCA 4U9HS 5AKHA 2PN1A 2Q7OE 3T5BA 5MFZA 1KRXA 3HXOA 4M1EA 4UM7A 3BORA 5EIAA 2I8LA 5I7WA 3UTDA 1NUAA 3AM5A 3O94A 4EA7A 1RJ9A 4Y9RA 2CWDA 3UH1A 2DFTA 5DLEA 3ZDFA 3EE6A 2W2LD 3GRFA 3EMKA 2WU0A 3DYVA 3HADA 4XTRA 3LYAA 3SU8A 4BLPA 4A36A 3O90A 3GLGE 3K09A 3W8NA 3HPQA 2IXDA 2W37A 3ZE7A 5J3JA 2J45A 1Y4UA 4IICA 1ACJA 1IDOA 2QL9A 2X8WA 4MSUA 5JQWA 2VF8A 3DL4A 4N0EA 3QELA 3MPUA 4AUKA 4CEIA 3Q12A 2GFHA 2QUIA 5K5EA 1OZHA 4HYQA 5JRJA 4PSKA 2ZRJA 2HBZA 4PSDA 5KAPA 4K9QA 4CI9A 4EFMA 3THXB 3WGHA 5A1TA 2P11A 1JG3A 1V1MA 4QAQA 3VX3A 2X1HA 5I9LA 1E5DA 2AYXA 3MJRA 1FFAA 2FPKA 3EGCA 2G76A 4B1FA 4KGVA 1L1EA 1YE3A 1S3SA 2FZVA 3BBLA 5U4QA 4ZO8A 5BR1A 2Y67A 3QVLA 3IPXA 4Y1EA 1PSZA 1L1RA 2XD9A 2J5KA 4TVOA 5IJXA 4AX8A 1X0XA 3Q8KA 3C3AA 3KZVA 2J3KA 4ZV7A 1EG2A 2I4LA 3CJTA 1WLYA 3SIWA 1XDDA 3K1TA 2AN4A 3AUUA 5JAOA 1YRAA 2G0TA 2EF1A 3AXSA 1V7ZA 1Q3KA 1FDUA 4GRDA 1KFJB 4LY3A 1IK4A 4X20A 1Z5WA 4Y6QA 1QUEA 1G60A 1T43A 1ZHHA 4OQYA 4PR3A 3COYA 1TIBA 2QTHA 3HLKA 4CG1A 5I9TA 3ZWPA 4MR8A 4OHBA 1TEXA 3U26A 4FFWA 1RRKA 4XIFA 3HSSA 2EERA 4BS9A 1E96A 1R6BX 1SXHA 2DQ4A 2VVTA 2RH9B 4YJHB 4TSKA 3AHFA 2Y1XA 3EZ6A 1JTEA 1L7VC 1M1ZA 3IC5A 1N2HA 4G37A 5DNDA 2QIPA 4ZAZA 5FUYA 4YRFA 5FWDA 5DYGA 3C8ZA 3DV0A 5IT5A 1FMFA 1POWA 4EZIA 4OBEA 1WJGA 5AK5A 1BXKA 2H2WA 2OYSA 1D6SA 3R3ZA 4GPAA 2WTUA 3MW8A 1BDMA 2OV2A 2IYLD 2XTNA 3AYZB 1J0EA 2VF5X 3FHJA 4AIRA 5DI9A 2H6EA 4BX3A 3X1JA 3Q5GA 1KI4A 1NN3A 1E6KA 1I8TA 2WABA 1K8RA 2V98A 4IKEA 1T91A 5DNCA 2C7BA 5KHLB 2OCAA 3HKEB 3KZCA 4LJSA 3IEMA 4OX9Y 2VWGA 4MYUA 1YNOA 1ULAA 1CDOA 1GOTA 1J9ZA 2ZTSA 2V7VA 3JQAB 4FNOA 4IOLA 4MV7A 4RHUA 1QCZA 1IHUA 1QRDA 1UKEA 1JDPA 1UADA 2QTZA 2GOYA 1W35A 3EG9A 4UUBA 1GARA 4P5PA 1XZDA 1FK8A 2V6IA 2MJLA 4NKRA 1EX1A 4OHRA 4KDCA 4ITUA 2UZ1A 3RK4A 4HK4A 2LZ0A 2H7YA 2OV6A 1EGHA 3DYIA 1E59A 3EBPA 3LQQA 5I9BA 5K0JA 5KYXA 2XVMA 4EI2A 5J1SB 3AHHA 1JHPA 1GQFA 4JI5B 3ZTWA 4C20A 1WMAA 3F1LA 1PDOA 3TIIA 5B7QA 1HG1A 1USKA 1GEEA 2G83A 3DFZA 3I53A 3NYRA 3B36A 5AXCA 4NPAA 5IHXA 5E95A 3NGMA 3PC6A 3QKRB 1L3IA 1GIAA 3CLTD 2Z57A 1X7XA 3QTLA 5GAJA 4E7PA 1OXTA 3LOQA 3HNRA 1G7TA 3GRUA 3B7WA 4ANFA 2VDQB 3HJFA 1KU0A 2FA9A 3IIMA 4RJLA 2IF2A 4R0MA 4F1WA 2X40A 3G23A 4MYCA 4RF3A 3S1AB 4CM3A 2C5AA 4L08A 4WKCA 4DDHA 1QYIA 3B48A 4AJNA 1E0SA 1BA2A 1NBME 1N7JA 2WSSA 2HIHA 3NHFA 2OBXA 3PLNA 4X93A 3UJDA 1AKNA 1P4RA 1C1XA 3JTMA 5GOZA 3K70B 3C6MA 3IERA 3FPAA 1MX1A 3FDZA 4V0NA 4MPTA 3LYUA 1RQ7A 4X44A 1LQTA 4YUXA 1L5HB 1PUXA 1HE5A 3KKZA 1IC6A 2O7QA 2JNWA 4FOLA 4JS0A 4KFUA 1J5EB 3EUEA 5F51A 4TX1A 1GT91 2DUWA 3ENZA 4MV6A 1Y8AA 5AT1A 1YS7A 3G2IA 1J39A 2DHCA 4IUCS 4JC5A 1E2IA 1Z0FA 3BIOA 3OLCX 2ZPAA 1ZGBA 3H13A 1KNQA 1OPXA 1M1XB 5ALQA 1Z12A 1SY7A 1E1MA 2BBTA 4QYWA 2XNSA 1KZHA 4J6EA 4DLLA 4Z2AA 4F93B 1JFTA 5KTKA 2X7JA 3AVTA 3M70A 3F6BX 3G6WA 3FPFA 3R3JA 4CMKA 5CVDA 1XEAA 3B38A 5BVHB 3BB4A 3C7AA 2FF7A 2NUTB 1ZGAA 3VR5H 3OTGA 4YPVA 2QRMA 3DUWA 4NDNE 4N4AA 2A3RA 3PQ6A 4W7IA 1EESA 4UXJA 2OAP1 3K4HA 4PRYA 3T4EA 1EH5A 3PUZA 1BAPA 4ZU3A 4QBHA 1LS1A 4RGBA 4YX9A 5BUQA 3UKDA 1ZNZA 2R66A 5F2EA 1VHDA 2XB4A 1NAHA 3WKBA 1ISMA 2GN2A 2CLKB 1C8LA 4NF2A 1EIWA 2HCRA 2M2IA 2J5BA 4W9MC 1Z6AA 4LDQA 4Y7CA 3U62A 4LWZA 1SMKA 2F4VB 2AJ8A 4MRSA 4QDKA 4X6UA 5KJFA 4PFSA 3R3YA 4L7VA 1ML3A 4KMOA 3I01A 3GYBA 5DHUA 2X77A 1EFAA 2FQWA 3FIJA 4ZYWA 4BCBA 2P91A 4OXYA 5BMOA 1EFCA 3W5UA 1A8SA 2YHIB 4X84A 4E46A 4TN1A 2ZBEA 3IXMA 4O4HA 4E2ZA 2XQJA 3OKFA 3OE1A 2BT4A 3P27A 2W2LA 2I62A 1CR2A 3D1JA 4BRSA 3ULKA 2B25A 1K5PA 3RKSA 5KC8A 4JUCA 1GG2A 5DLYA 3W7BA 2B3TA 4PSAA 3K0KA 2L2QA 1MC4A 2FEAA 3D3KA 1KU6A 3SD7A 3DAYA 2C1ZA 2IHKA 4FOPA 4V0LA 1ZGGA 2JGMA 2J6CA 1ZUIA 4JZYA 3ZY5A 1VIAA 1T0IA 3EQ8A 2OR3A 1TU4A 2CEAA 4HJRA 2JEOA 2BMVA 1CY0A 1WY5A 2P5YA 3Q3EA 4G8BA 4XM1A 1EE1A 2WHRA 2XUPA 5K4HA 4N5HX 1KQNA 1JS1X 1LNSA 2EP5A 1UZNA 1Q11A 3EW9A 3ONFA 2NU8A 3S29A 1AUPA 1W4BA 4KGDA 2ZBUA 5CT9A 1YBMA 4C07A 2D54A 3OUUA 4IW3B 1JGTA 1WBBA 2Y66A 1Q91A 4WPGA 1XNHA 5KOJB 1S1MA 5JNUA 2EX1A 4TKMA 2JB9A 2WJ4A 4PO9A 4CMIA 5ENVA 1T8TA 4MUYA 2QM8A 4QBIA 5AW9A 3VDQA 3DDHA 4FYPA 3ND8A 4DNPA 1JN0A 1P7ZA 2X8JB 1O6FA 3JD3A 1EAYA 1C7ZA 3K9NA 4TWJA 3RI3A 3SXUB 2A5FA 4C2BA 2XUDA 3FNQA 2C5HA 3AW8A 3ZW9A 5JNSA 4UULA 3U9SA 4LWPA 1KXJA 2JKZA 2PRJA 2AD5A 1BWQA 3A70A 3FMGA 4FK8A 1OWNA 2H1FA 3ZDYB 5A4FS 4D79A 1DEXA 1E3IA 2FV8A 4I99A 4B8ZA 3HO1A 3LUJA 2NXNA 3HCBA 3HYNA 3F0TA 1L4UA 4TXMA 1O57A 3PCTA 4AY5A 2EGGA 2EZ8A 3ZDDA 3NHJA 1UM8A 1CHNA 2PYZA 2F43B 1TT7A 4G1MB 1S1CA 5B6IA 1XXLA 3L1VA 3ED5A 3DDZX 3MLEA 3D1LA 4GT1A 2ZB3A