3HDJA

The crystal structure of probable ornithine cyclodeaminase from bordetella pertussis tohama i
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
311
structure length
311
Chain Sequence
AMLHIDDAMIEDAVTPQAAQEVLHAAFLDFGRGSAAMQRRVRTEAGGVKLSTLGAVIPGQGVAGAKVYTTIKGQFQFVILLFSAADGRPLATCDAGTLTRKRTAACTVLAAGALARPRSSVLGLFGAGTQGAEHAAQLSARFALEAILVHDPYASPEILERIGRRCGVPARMAAPADIAAQADIVVTATRSTTPLFAGQALRAGAFVGAIGSSLPHTRELDDEALRRARAVVVEWREQTLSEAGDLVLAAPDTGLDAKVVELADVLAGRAAARQADEDIVIYKSVGVGLEDVALAGYAYRRLAAQRGWPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of probable ornithine cyclodeaminase from Bordetella pertussis Tohama I
rcsb
source organism Bordetella pertussis
molecule tags Structural genomics, unknown function
molecule keywords Probable ornithine cyclodeaminase
total genus 106
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1780.10 Alpha Beta 2-Layer Sandwich ornithine cyclodeaminase, domain 1 ornithine cyclodeaminase, domain 1 3hdjA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hdjA02
2CF6A 3IDSA 2QHXA 3WNQA 4JJFA 4LMPA 4CV1A 3GDFA 1MXFA 3QHAA 4LMRA 4MOWA 3G1UA 3QP9A 2EF1A 3DMTA 3HADA 3PIDA 4IGFA 1IPFA 1RKXA 4BKRA 2VNSA 1C0PA 4WK6A 4E5MA 1R16A 1RPNA 3CH6A 4R4JA 3RFTA 1YB4A 1Z73A 2R00C 2V65A 4I9UA 4WCFC 4RPLA 4EGFA 3HDJA 2ZQZA 4BO9A 5ICMA 1DC5A 3OIGA 3PLNA 1P1FA 1ZEJA 3X2FA 2B5VA 3V1YA 3OQBA 3VC7A 3IC5A 3PJFA 1KOLA 1MP0A 4IJUA 4BIIA 4WNIA 5KNLA 1NR7A 3DMTC 2PKQO 3I6IA 1PJ4A 1UAYA 3O26A 2JD2A 1KIFA 2P5UA 3EHEA 3DTTA 3F5QA 5BQFA 1DRWA 3AUSA 3RC9A 4CLRB 3DBHA 4RQTA 4CPDA 1M6WA 3Q11A 5C7OO 3EZYA 4FFOA 4NJOA 4AJHA 1BXGA 2FR1A 1ISGA 2E48A 3OJLA 1P1IA 3JD1A 2O48X 5JS6A 2C2XA 1U8XX 1PR9A 2VTDA 4J7XA 4L73A 3CTMA 4AJIA 4B8ZA 1ONOA 1NWCA 3PDJA 1NFRA 4ITUA 1Z75A 3S2GA 4XKJA 3PQDA 5CDGA 3DB2A 3FWNA 1IZ9A 5TLSA 4AJNA 2D5CA 1GD1O 1FF9A 3GNQA 1SB8A 2CDBA 5L7WA 3DOCA 2BGLA 3DAGA 3E8XA 1NM5A 4S3MA 4YCAA 4BQRA 4TRJA 4Z0PA 3S1LA 4L76A 4O63O 3ITDA 5DCYA 4JN6B 1UP7A 4BO6A 4JP3A 3K5PA 4K28A 4BO2A 1YB1A 3DHNA 3EC7A 3ICPA 2RBEA 3I9NA 5IDXA 1WNTA 2XOXA 2RH4A 5F1PA 1O8CA 3KEQA 1PZGA 2I76A 5JPIA 4YRAA 1DRUA 1M75A 3FNEA 3DBRB 4RPHA 3WQQA 3DEYX 3JQFA 1MFPA 3V2GA 1ENPA 5EN4A 1S7CA 3GR6A 4AJEA 1C0LA 4GLOA 1X7HA 1R12A 4TQGA 3E5RA 4FS3A 3L6OO 3OFSA 1DOHA 4O5OA 3N7UA 4RVUA 4IQ0A 4B4UA 3LVFO 3SVTA 4IGEA 2EWMA 2ZTUA 1T2CA 4GKVA 4BO1A 1G1AA 1LDBA 3ZWAA 1NQ5A 3E48A 3FF4A 5L40A 4KP7A 5HA5A 4CLRA 2PFGA 2D1YA 4W4TA 3ETDA 4UREA 1LLUA 1CERA 1WDMA 4YJDA 3DZKA 4QO8A 3W6ZA 5I9MA 1V0JA 4IPTA 1P0CA 3IUSA 3A4VA 4ZQGA 2DM6A 4NHEA 5HS6A 1PJTA 1LQUA 3ZWYA 5AQ1A 1EBFA 1LUAA 4TZKA 1UZLA 4NK5A 5HM8A 2G17A 4J3FA 4NJMA 5BT9A 3OJFA 3B1JA 4JGBA 4XEHA 1PU2A 1J4AA 3LLSA 3DXFA 1VC2A 4Z0TA 3GGPA 3ZHXA 2D4AA 4J0FA 4BKQA 3I9KA 4LK3A 3FR8A 5JMPA 4DMLA 2GYYA 2ZB7A 4D3SA 1TB4A 3WX0A 3A1NA 2IEDA 1ZK3A 2EGHA 4JIGA 5TRTA 1ULSA 3TZHA 4BO5A 3M2PA 4BNKA 5KWEA 4ZHSA 1HKUA 2JFGA 4HV4A 1UXKA 1YOVA 1C3VA 4E2WA 2VZ8A 1LXCA 3V2UA 4B7UA 1NPTO 4IZIA 1OC2A 2DTEA 3A06A 4EUHA 1W8DA 1AE1A 2A9FA 3JQ9A 3I6QA 2DPHA 4XDYA 2Y1DA 3NT4A 2Q50A 3FI9A 3OSUA 4OO3A 4WLUA 3ON5A 1LLCA 2IEBA 4DUPA 3NT2A 2NQTA 5TF4A 3VHRA 4II2A 1B16A 3WDSA 4CLXA 3AM3A 4Q3CA 4Z6KA 3MWEB 1DLJA 1BRMA 3AWDA 4KDFA 1P1HA 1PR3A 3GNTA 1T2EA 1G6KA 3JQBC 1ADCA 4E33A 4ND2A 3KLMX 1O95A 4PLYA 2X8LA 1JW9B 2CD9A 2C5EA 2HUNA 3CKYA 3NT5A 1BVRA 1YVEI 3NX4A 4NBVA 1VL0A 3O03A 1N9GB 3GQVA 3QVTA 3SJUA 5EL0A 4U0JA 1WZEA 5C3MA 4HFJA 3QWHA 1O9BA 1KEUA 1JWBB 2EJVA 3HDHA 1BDBA 4GGOA 1PS9A 3ANNA 1Q0HA 2YZ7A 2JJYA 4O59O 1CWUA 5F1KA 4TMFA 3JQ8B 5DCUA 4CM8B 2HO5A 5A5FA 1R0LA 4Y9DA 5JCXA 3WFIA 3OP4A 4I08A 5K6AC 3K8ZA 3QY9A 2GCGA 2HMWA 4RVSA 1ZSNA 5CDTA 4RF5A 4AJ2A 1VLLA 1HT0A 3GDOA 2RCYA 4YVFA 2Q3EA 1ZMTA 1QYWA 4WCDA 2JHFA 1GPJA 2HU2A 1C1DB 4MKXA 2BELA 1BSVA 3LDHA 2Q45A 5I7SA 2AG8A 2VUUA 4RVFA 4EJ0A 1DRVA 4BNJA 4XD2A 3G17A 3RUIA 5A9RA 2AQHA 5HTOA 4B7XA 4ALJA 1UZMA 3CMMA 2VWHA 3SJ7A 1T24A 1DFHA 3IAHA 3D3WA 4D43A 4S1VA 4LSMA 1AXEA 1VPDA 5DT9A 3ZV3A 4DGSA 3G1TA 1KVQA 5IAAA 2OZPA 5JFOA 4BNUA 4W9NA 3R3SA 1NXQA 2ZK7A 1EFLA 2E82A 3H5NA 4GX1A 5K9ZA 2ZB4A 1E3WB 2DKNA 3PWZA 4BMVA 2YJZA 5KJ6A 1ENZA 2AE1A 4RCVA 2ILTA 1D3AA 5JLAA 2NWQA 3WYEA 3RJ9A 4J16A 2W90A 3JQ6A 4B79A 3BHJA 3P7MA 1ISHA 5G0SA 3IQDB 5JY6A 3G79A 3KBOA 3SC4A 1B8UA 4J2OA 4UEJA 3DMYA 4AL4A 3NUGA 1GUYA 3P5SA 3NTRA 1ZXBA 3Q0EA 5TS3A 1LU9A 1B15A 3E5MA 1EK5A 4O6VA 1GAEO 4IQ8A 4RORA 1R4NA 2A4KA 2HMVA 1F0YA 4BNXA 2Y1EA 3OJEA 3DO5A 2DU8A 3AI2A 4YB8A 2VN8A 4OH1A 1U9JA 2C82A 1YDEA 3KYCB 5CPFA 3GZNB 1J49A 3AM5A 1O94A 3BTSA 4KTVE 1ENYA 2DTDA 3OIFA 3KV3O 2W2KB 4HNHA 4LISA 3PI7A 4Y98A 5TX7A 1QYCA 4IS3A 2DLDA 2IXAA 3IKVA 1E3IA 2PK3A 2AQKA 1LQTA 3DBVO 4J6FA 3GOHA 3K9QO 1BMDA 1TEHA 3O9ZA 5TNXA 2YFQA 3STHA 5CEEA 4R54A 3GVCA 2IYOA 4QEDA 5BSHA 3PWSA 4CL8A 3ABIA 4FQ8A 4XJTA 2UUPA 4D45A 3E9QA 3Q9UA 4XYMA 4N7RA 1LDMA 2QQ5A 2CDCA 1S6YA 4BQPA 1PQWA 3WGZA 4IJKA 1LC3A 1HDCA 2A94A 2V6GA 3QJ5A 2BLLA 1D4FA 1GY8A 4G65A 1IUKA 4ID9A 5JAZA 1UXGA 3LZ6A 2HRZA 2FSSA 5FFFA 5B1YA 1MFZA 5T57A 1YBMA 4BNGA 3PYLA 5C5IA 1VKOA 2BFAA 1DC4A 1YGYA 4BMNA 3JD0A 3JYPA 3EY4A 3GUYA 4NBTA 4PVDA 1XYGA 4MVJA 1E7YA 2FZWA 3HDYA 1PS0A 1V35A 4TSKA 2ZTLA 1KERA 2PH5A 1UUFA 2AW5A 4PFJA 3W1VA 1D7OA 5H81A 3KTDA 3VKUA 3UN1A 1GTMA 4I9NA 4NBUA 4NQZA 4F6CA 1JDJA 1E3LA 1F06A 3I4CA 4XZ3A 1XSEA 2DQ4A 4W7HA 4BNWA 4C7KA 5TJ9A 4CMIA 4MVJH 3MJ4A 4N54A 5AXDA 4DC0A 4Y6SA 2VCYA 2E49A 5COAA 1A9ZA 2AEJA 2PGLA 4HP8A 5ILGA 2W4QA 5C37A 1A72A 2VYND 3ZV5A 3MJCA 5KJEA 5FI5A 3D64A 2EKLA 5IDWA 2Y93A 4FSHA 3I52A 5LDGA 2JD0A 4IZHA 1NP3A 2WE7A 3GZ4A 4XIYA 2PZMA 2VT2A 1GU7A 4Z3KA 2WYWA 3MOIA 4NBRA 4XGNA 2QRKA 5A9SB 2Y1OA 4FPXA 1H6CA 1JLLA 2Y0EA 4N18A 1ONNA 3ROQA 2QZ9A 1Q7BA 5ILOA 2DBRA 1X14A 3WGHA 4EEZA 5DP1A 5KKCA 3F4LA 1ZJZA 4RLHA 1NASA 4HNGA 3U49A 5A3JA 3AUUA 1WZIA 1ISFA 1DO8A 2FHSA 1HZJA 3KB6A 3PJGA 4ZQHA 1L7DA 2OBYA 1P1KA 3O4RA 1LLDA 3U62A 1HDGO 2B4QA 4L9RA 4DIBA 4D0SA 2VZ0A 3G0OA 3PYMA 3A28A 1JVSA 1X7GA 2I99A 2BMAA 1K6IA 2D0IA 1X7DA 5EQDA 1U2GA 2VTEA 3ZDFA 4OOFA 1PJCA 4LCEA 3OQ6A 2AQ8A 3C7CB 3M6IA 4OJNA 1NFFA 1VJ0A 1R4MA 1Y5RA 1AXGA 1ZJYA 2HDHA 2O23A 1V3TA 1Q0LA 1GCUA 3GEGA 1U5CA 3WGOA 5B4VA 1T2AA 3BMQA 4MVJG 5EESA 4E5KA 5JE8A 2TMGA 5A04A 5CFZA 7ADHA 1O0SA 4OOEA 3ROPA 1NWHA 1R0SA 2E6UX 2HRBA 3GN2A 4BNTA 4YPOA 4CLDA 4CV3A 1RM0A 3ZZNA 5JYEA 1B26A 3GVXA 3EMKA 4ZU3A 5JYDA 1E1NA 4NH4A 3ZI0A 3RIHA 4CL3A 4AJLA 4AVYA 2POQX 3NKLA 7MDHA 2CSUA 3C85A 1YBVA 3HHPA 1Y9AA 3IUPA 1P31A 1I2CA 5U1PA 3RFVA 1I3NA 1P1RA 2PA3A 2VUTA 2G82A 1ULUA 5HBRA 4WE3A 1A4IA 3DZIA 2NTNA 1P0FA 1CEQA 3U4IA 5JSFA 2VRCD 5DBGA 1NHWA 5AOVA 1DIHA 5C7LO 3L4BC 3FPCA 3D3EA 5JBIA 4YJGA 2WD7A 4IM7A 2WSBA 3C8MA 3AOEA 4HWKA 1EVJA 5GZ1A 4FCCA 4M1QA 3TZKA 2IE0A 3ENNA 3Q3CA 4J1QA 5TC4A 4DBVO 4EBFA 1R4MB 4YRBA 5MDHA 1IY8A 4OMUA 2QG4A 1CQIA 3DAPA 4JNKA 4R9SA 4NG5A 1UR5A 1YQDA 2YV1A 1PJBA 3Q6IA 1PJQA 3MWDB 5I9NA 1P74A 3H8VA 3T7EA 4FFMA 2X23A 5A5EA 1LJ8A 1SZJG 1VJTA 2W98A 3BMNB 3ZU4A 2EJWA 1LA2A 2Y05A 2YV3A 4GKBA 5G4KA 1I01A 5IZCA 3WYBA 1T2FA 1TLTA 1EVZA 3AU8A 2VYVA 3NTQA 4NU6A 1N7HA 2ZTMA 3GAZA 5KVCA 2G0TA 1B0AA 4PLVA 1TXGA 3ITKA 3KXDA 1LNQA 1F8FA 3O8QA 1BDMA 4GI2A 4NFSA 4TRNA 1ZVMA 5I7FA 3RU7A 5T8KA 4QFDA 1BXKA 4B3JA 2IYPA 1HSZA 4UVHA 4DC1A 4A26A 3C1TA 4CQMB 1PGPA 2X1HA 2FP4A 4RPGA 4RJTA 2OFPA 1YWGO 4U7WA 4W6ZA 1IOLA 1EVIA 1HEUA 2I9PA 4XR4A 2CF5A 4OL9A 4I8XA 3PFWO 3G3EA 4TKMA 5I9LA 1PX0A 3QE3A 4LRTB 5L95A 2O4CA 5HS4A 4Y6RA 3PHGA 3RROA 5JDIC 1DB3A 1P3DA 3QA9A 2GRAA 2HK8A 1KVRA 3UCFA 3LSYA 3DBLA 2Y1CA 5JNLA 1SB9A 4RF2A 2O4UX 5ER9A 1BTOA 1I3KA 3MJSA 4D3FA 3JD4A 1WVGA 4ND1A 1B3BA 1A4UA 1CIVA 5JC8A 4WKGA 3CIFA 2HJSA 4AJPA 3MZ0A 5JXWA 2QRLA 1PZEA 1EBUA 4ALKA 3PQEA 4RGBA 3AM4A 3HUDA 4NNJA 4J0EA 2YDXA 4GX2A 3B20A 3CPSA 3VZRA 5TSDA 3V5NA 2Y68A 3U09A 4NK4A 3KHUA 5ES3A 2C54A 4WOKA 4C4OA 4Z3DA 4Q39A 1BWSA 2Q1TA 3ORFA 3ZNQA 2A92A 3TJRA 1DSSG 2HJRA 3AUAA 1Y9EA 4CM6A 1EQUA 5IF3A 1Y1PA 4J4HA 1WMAA 2Y1FA 1I8TA 5AXBA 1VI2A 3QW2A 1YQXA 1U3TA 3JQBA 1EUDA 4J49A 4PRKA 3PFFA 2D3TA 4MP8A 2RIRA 5L7YA 5BNIA 1I30A 5IJZA 3BMOA 4YA6A 1QYXA 1CRWG 2YHIA 3OA0A 1NQOA 2ZCUA 3FRJA 5U4QA 3RUDA 1RYDA 4DPMA 3CINA 1XGKA 2PNFA 1E6WA 4EYEA 2P9GA 5CG1A 4B8WA 3ZNNA 4CMEA 3TFQA 4ZN6A 4W99A 2VRBA 3RD5A 1UXHA 3PGXA 4BNHA 4RZHA 5KVSA 3S2IA 3RKRA 5CDUA 4WLVA 3UGKA 3AU9A 4IMPA 1XU7A 4FFNA 3O38A 2JCVA 4P4GA 4R01A 1QORA 2ZJ1A 5DOZA 1JKFA 3AOEC 4I5DA 4D44A 2YDYA 5AXAA 3SEFA 1WDKA 4BKOA 2J5KA 5GZ3A 1NVGA 3GVHA 4HBGA 1E1LA 4GL4A 2X9NA 3R0IA 4JCOA 2C07A 4ALMA 3DHYA 3H5AA 4F45A 3I9OA 2X86A 1E3WA 5B4UA 4TRRA 1E7WA 4URFA 3D4NA 5L51A 2GD1O 4IJWA 1ENOA 4A0SA 2GR9A 1GYRA 5DP2A 1U3UA 5JDCA 4FOSA 1ADBA 1ZW1A 4PLPA 3SC6A 5F1OA 3H65A 2Z5LA 5K6AA 3OECA 2G5CA 4J90A 4EDFA 4PG8A 4J7CA 1D1SA 1R66A 2IXBA 3QV1A 4FIZA 4EJMA 4BHTA 5G0UA 4IY1A 3RBVA 2NLOA 3WQRA 5IXSA 2RHRA 3UAGA 1E1MA 2P9CA 4J2HA 3Q9NA 5T67A 2QRJA 1I5RA 4XWYA 1OC4A 2X0JA 1SNYA 3PJEA 4GVLA 1O5IA 2H63A 3F47A 1BGVA 2O3JA 3AY3A 1IPEA 1LRJA 5BSFA 3JQ9C 3F1LA 1K2WA 3PK0A 1PJ2A 1HE2A 3JV7A 2JAHA 4CQMA 3C3XA 5L4NA 3ZU2A 2LDBA 5BNTA 1Y8QB 3RFXA 3OBBA 2HCTA 4QQRA 1ZKMA 3BMCB 4H3VA 1HRDA 4DQUA 2UVDA 4O1MA 4YAKA 3D4OA 3P2OA 2H9IA 3QLJA 4DTIA 5A05A 3H3JA 3JQ7A 5JY1A 3BHMA 4DLBA 4GSLA 4ROSA 5H83A 2PGDA 4YT8A 2BI7A 4B4OA 3QRWA 5KVQA 3QVXA 4LN1A 4DREA 1QKIA 1GQ2A 3JQDA 4GLLA 3DOJA 5TT1A 3ONFA 4AJJA 3K30A 2XXJA 2JFHA 5B4TA 1XELA 5JCJD 4W7IA 4GGPA 2EHDA 1LEHA 3KYDB 3PGJA 1U1IA 3OQ1A 5EQFA 2PLAA 1JKJA 3CSDA 3BTOA 2VWPA 4ND3A 3T7CA 1MB4A 9LDBA 2YHUA 1A71A 3JQ7B 1EUZA 4R68A 4RPKA 3AK4A 1I3LA 2CVQA 3E6AA 4G5HA 3TFOA 2VOEA 3HN2A 1NX6A 3O8QB 3ANLA 4NDNE 3OH8A 1Z82A 1E77A 1HYGA 4BNVA 1IL0A 3Q2KA 1SEVA 4BNFA 1EQ2A 2NNLD 3B6ZA 1XQ6A 5AVOA 1BVUA 3OF2A 1JQBA 3H9JA 2X5OA 1LDYA 4AJ4A 1T2DA 3UF0A 3A14A 3PDUA 5A1TA 4BO7A 2AG5A 5COBA 2P9EA 3OICA 2XF8A 3EGOA 2HMUA 4XRRA 1R4NB 2B37A 4BOYA 4XA8A 5JC1A 2Q46A 3F5SA 3NEPX 5IN5A 3VVBA 5KJ1A 1R15A 3EZLA 3TOZA 2O7SA 4W9NC 1XLTA 1KY5A 3EVTA 3WWZA 3ZN2A 1OI7A 2B4RO 2DT5A 3OA2A 4PLFA 2V6MA 1H2BA 3JQAB 3U4HA 2Q49A 4UUMA 4RF4A 3TZQA 3KSZO 4BNMA 2VUSA 2ZYAA 4NPCA 3WICA 4XB2A 1DIGA 4CLOA 5ITVA 4JXKA 4E2XA 5ENVA 4CM5A 2VYNA 1XHLA 2QZZA 3PQFA 3TL3A 1PJLA 3DFZA 4BS9A 1JAXA 1LX6A 3PHJA 1B3RA 4J1NA 1M67A 1IULA 5TT0A 3RUHA 2GF2A 4L74A 4KMSA 1U7TA 2YY7A 3OM9A 1NPDA 1MXHA 3AJRA 1U4SA 1FDSA 1NQTA 1GCOA 4D46A 1A7KA 3WSVA 1OMOA 3WOHA 5DBFA 4BB6A 4BNIA 1Z6ZA 4PN3A 2FZEA 1PQUA 5L7TA 4ZD6A 3JYOA 4FW8A 4MVJE 3W8DA 1NVMB 4XJSA 4U8GA 4YBZA 4E2YA 1A5ZA 2J5QA 1D1TA 3B1KA 4BGVA 2BRUA 1F8GA 4R9RA 4CM1A 5AYVA 2C2YA 2PV7A 3ETEA 4CUZA 4EITA 4NI5A 4LRSB 3ADOA 2FSVA 4NIMA 1MX3A 4MP6A 2UDPA 2Y0CA 4YAGA 3BAZA 3HNPA 3PRJA 2V6BA 5EINA 1HDZA 2EW8A 3GUCA 4Y6PA 4BNLA 1SCUA 4MJLA 3BHIA 4CV0A 4DXHA 1PZFA 4IDFA 3NJ4A 1C0KA 1E1KA 4ND4A 1QV6A 3NDJA 3HG7A 4CMKA 3GVIA 3I83A 3TDKA 2VRCA 4IBOA 1Y8QA 1A27A 3AOGA 3EYWA 3F9IA 1ADGA 5G0WA 1PJ3A 3CEAA 4M54A 5COQA 1DIBA 3JQCA 4IIVA 8LDHA 2AXQA 3I9LA 2ZIZA 1JN0A 4TRMA 4LCJA 4UEOA 4WNCA 1LBEA 3DOOA 4E2ZA 1U3VA 2NTVA 3K92A 2UAGA 1B14A 2VZ9A 2DC1A 4Z9FA 2EV9A 2OHXA 3ZNOA 2X6TA 2JFFA 5THQA 1V3UA 4I5GA 1WP4A 5DULA 5KCZA 1I2BA 4RPJA 2WD8A 1FDVA 1DLIA 4BUCA 2QYTA 5G4KB 1E0DA 1BXGB 2O3UA 5LC1A 2CNBA 2WYVA 5GMOA 5JAMA 1I2ZA 2C5AA 4IIUA 4DYVA 2D2IA 2JL1A 1NYTA 1VJ1A 2R6JA 2GNAA 5JAIA 1E6UA 2BFOA 3CZRA 3MJVA 2JAPA 3GF4A 4GSKA 5EMHA 2BH9A 3HB5X 1I36A 1U2DA 4DLAA 2D59A 4DL9A 2Q2QA 2VOJA 3L77A 5JAQA 1PGOA 4U6QA 1P9LA 1RM4A 1H6AA 2ZKLA 2P4QA 3BZUA 3K2BA 1HL3A 5EJ2A 2I65A 1WDLA 4RVGA 1NHGA 1AHIA 4XGKA 1UDCA 3GHHA 3SXPA 1MC4A 1PEDA 4OAQA 4WLEA 2NV6A 5JO0A 1LTHR 2ZYDA 4Y8VA 4EW6A 4IXWA 3X2EA 1OBFO 4JK3A 3FHLA 4MVJD 3JYNA 4IUYA 3D5TA 1H6DA 3IP1A 3GFBA 2PD3A 1DPGA 3FR7A 3L07A 1DHRA 1LSOA 1H0KA 4PG4A 4CMCA 2YHIB 1KEVA 2CUKA 3HZZA 2Z1MA 5JW6A 5IZ4A 4KQXA 5F21A 2FMUA 5GY7A 4D3DA 2VT3A 3ASVA 2OP1A 3WS7A 3VAZA 4Z9XA 1ORRA 3T4XA 3COSA 3W6UA 5EERA 1XEAA 1KEPA 4KUEA 1PZHA 1SOVA 2AE2A 1RWBA 2VYVD 2X0IA 1ID1A 2JHGA 1W73A 5A4DA 4O0LA 5G0TA 1UP6A 5IXYA 1I0ZA 1NVTA 4BO8A 4GWGA 1B8PA 1V8BA 1ZEMA 5ITWA 1T4DA 4YQZA 3I23A 4R5HA 4XRGA 1VRWA 4K1LA 1T1RA 3OEWA 4E30A 5CHEA 3ROKA 4GPD1 3ZHZA 3ZW9A 3B1FA 4DVJA 1G0OA 4JQCA 4YT5A 1LSUA 2H5LA 4YJFA 2FPIA 4G81A 4K26A 1YJ8A 3FWZA 4KOAA 2B83A 2H6EA 2A35A 1DFGA 3DDNA 3ZWNA 1ZIDA 3DFUA 4TVOA 5DZSA 1HYHA 2R2GA 1LRKA 4UVDA 5KVVA 4BB5A 4DLLA 3VOSA 3ZWPA 4FFLA 1K0UA 4F6LA 4WASA 2EKPA 2OBNA 2GASA 3I9MA 1EEHA 1E3JA 4ALLA 3V1UA 3WGQA 3HSKA 4CMEC 2NU7A 3AY7A 3NTOA 4DYDA 1KC3A 4I5EA 2EW2A 2WMDA 4R16A 1HTBA 3F6YA 3RQSA 5CEJA 3LC2O 3C7DB 1ZSVA 3GEMA 5ICSA 2X22A 3V1TC 4L75A 3UKOA 2CZCA 3ZWOA 3NDIA 1R6DA 1BW9A 4OHUA 3E9NA 4XR9A 4FBGA 5ER6A 1Q2XA 2NTJA 3GPDG 5KJCA 1WAMA 3E1KA 4KUHA 4PLHA 1FDTA 3VDQA 4UULA 2O3RA 3ZHBA 3INGA 5I7VA 4E4YA 1YO6A 3EDMA 1V3VA 9LDTA 5CEFA 1YH3A 2I3GA 4WJZA 1KC1A 1ZK1A 4YJFB 1HE4A 5H82A 3TWOA 3WLEA 4E5NA 1M2WA 2OORA 1A9YA 4CMBA 3WMWA 1HSOA 5AXCA 3BA1A 1ADFA 4IINA 4R1NA 5JDCC 1K6JA 1SBYA 4MO2A 5G4LA 2ZQYA 3KYBA 2GDZA 3GHYA 4CUJA 3RUFA 1E7MA 3DR3A 4E5YA 1QLJA 1TI7A 3BMQB 2J3KA 3OJ0A 2P91A 3JYQA 4IQGA 1YJQA 3QWAA 4DA9A 3H2SA 4HFNA 2WYUA 4B4VA 2PY6A 4FJ2A 1QYDA 4TVBA 4YJHB 1KY4A 4E32A 5LDHA 1LLQA 2PKQP 3HWRA 1YONA 3R3JA 3WG9A 3E82A 1Y5MA 4GMFA 2GN9A 4GWKA 1BXZA 2PTGA 3ZWXA 2NADA 2PKRA 2X0NA 3FBGA 3W4JA 3JD2A 3PHHA 1KVUA 1VKNA 4B3HA 2OP0A 1DIRA 2X5JO 2YQ5A 2B0JA 3WGGA 1ZSYA 2X5KO 2QW8A 4IDCA 3GZNA 4M87A 4WLFA 4MINA 5G2OA 1BG6A 3QIVA 3RCBA 3PWKA 4NU5A 4NFYA 4FGSA 1B7GO 3V2HA 3GGGA 3WGTA 3ZWMA 5ADHA 5L45A 4I5FA 5BSGA 4K6CA 1TT5B 4YT2A 3GA0A 4KTTE 5J23A 3GGOA 1D8AA 4OM8A 2I3AA 4MVJM 3ZWCA 3LF2A 4OSPA 1HXHA 3LLVA 3RU9A 2BGMA 4R1UA 3VH4A 1XWFA 5DN9A 4IXTA 3ZGYA 3DL2A 1DBVO 1YOVB 3QVOA 3VPXA 3N74A 3KOUA 2EP5A 5KIAA 3KZVA 4CV2A 1DAOA 2O2YA 4ZRMA 3JYLA 3S55A 4DMMA 2NU6A 5EIOA 1EE2A 1GYPA 4L8VA 8ADHA 4Q3EA 1H94A 4E13A 3S2FA 2NU9A 2J3JA 3H9QA 4ZGWA 2YQ4A 4PLWA 4JX8A 3DWFA 2W2LA 4J7UA 2GN4A 3GDGA 3EUWA 5JO9A 4OGWA 3DC2A 1E7QA 5KKAA 1PS8A 2WJPA 1PWZA 1ARZA 1N7GA 1E7RA 3ZV6A 2HLPA 4A7PA 4YR9A 4WLNA 4QECA 2NM0A 1SMKA 1FDWA 1U7HA 1KETA 4R5MA 1GYQA 3D0OA 4G2NA 4AG3A 1F17A 4KUGA 5A03A 4BV9A 3GMSA 1KBZA 3SX2A 2OXIA 2FPPA 4YAEA 3UHAA 3DZHA 3JQGB 4Z9YA 3WYCA 1H9AA 4XIJA 3QSGA 5MGBA 2FWMX 4EUEA 3IIEA 3IKTA 1DC6A 3FNFA 4E5PA 3H2ZA 1XDWA 1YKFA 3ICCA 5FWNA 3W4IA 2Q99A 4M86A 5DNAA 4JBHA 4KDEA 3AFMA 1VE9A 1E6EA 4E12A 2C0CA 1N1GA 2YW9A 3L9WA 1AUPA 3L9XA 1X1TA 2X9GA 1AHHA 1YDWA 2NVBA 3LU1A 5L3ZA 3L4SO 2B69A 4CJXA 3JQAD 4DPKA 4R3NA 1WMBA 2GZ1A 1HLPA 1N1EA 1WW8A 1C14A 1DHTA 3L0DA 2D8AA 3WGIA 4CM9A 4BL5A 1PGNA 5L4LA 3BYZA 1XU9A 2CVOA 2ZB8A 3B70A 1WPQA 3DTYA 1LI4A 1GEGA 1ZK2A 2W8ZA 2ET6A 2JD1A 4INAA 4YEDA 4J4TA 2VWGA 4A27A 4MIOA 4A10A 4CM7A 3UH1A 2NUAA 3INRA 5HRUA 1XR3A 1HWYA 1IYZA 4N5MA 4PG5A 1SO8A 2I66A 3ENKA 3ONDA 1QP8A 5IDYA 2Q1UA 1PGJA 3PIIA 3FPLA 1QLHA 1W0CA 3AFNA 5FEUA 4RVHA 2Q1WA 4UVGA 2FN7A 2YYYA 4OIMA 4NBWA 3GLQA 3C7AA 3ETGA 4CM4B 5U9CA 2HMSA 6LDHA 1MA0A 4RDIA 1JA9A 2P2SA 4WPGA 3WGYA 2NVWA 1ZCJA 2ZJ0A 3GMDA 3LT1A 4CLOB 3JQ8A 4CM8A 1SPXA 3UVEA 1X1EA 2DUWA 4WUVA 4ZQFA 3PPIA 1L7EA 2HSDA 1NTOA 1B8VA 3RI3A 3FNHA 2PD6A 3PP8A 4XCVA 2F1KA 3V8BA 5KOIA 4LGVA 1M66A 1ML3A 3UXYA 1WXDA 4MVJF 4BMSA 1DAPA 3LT2A 3PJDA 3NJ8A 2QIOA 1Z74A 4YAJA 3VTFA 4GMGA 2PGJA 1UZNA 2Q2VA 4WEOA 1JTVA 1K5HA 1VM6A 3VPHA 2CVZA 4CQLB 1QV7A 1TT5A 3L4BA 2PZLA 3IP3A 1GZ6A 2DFDA 3JTMA 4M8SA 3TZ6A 5A9TA 3EK2A 3KYCA 1EDOA 4J91A 3WSWA 1XCBA 4DRYA 2VHWA 4PG7A 4MKZA 3I4FA 4K6FA 3ADPA 3GC6A 1YBAA 3ZWWA 4BO3A 3GVPA 3ZW8A 5BR7A 3CE6A 2EERA 5A9SA 5C7IO 3WWYA 4ZRNA 1LC0A 4YAIA 3WMXA 4FC6A 1GL3A 4Y67A 5I8WA 3GG2A 3JQAA 4N5NA 4DIFA 3EW7A 4XQGA 4YT4A 4MIEA 1QG6A 1QRRA 4QO7A 1X15A 1PJSA 1ISJA 2HQ1A 1N2SA 2BKAA 4YTEA 5GZ6A 1ZXLA 4WOJA 3UICA 1CJCA 2P5YA 4QFCA 3L6DA 3U4CA 3OETA 3LT4A 3WNVA 1AN9A 4UUNA 1TVEA 4P4LA 4ZICA 3KETA 3NGLA 4UAGA 5ENDA 5L9AA 2GN8A 4QX6A 2WWRA 4R41A 4XX0A 4FB5A 1HF3A 1ZNQO 1GR0A 1NBOA 4PG6A 3GPIA 4FDAA 3UW3A 3I9JA 3DBRA 3DONA 1H9BA 4LVCA 1P45A 2VWQA 1IE3A 3GRKA 3NV9A 1FDUA 5JDIA 3H4VA 3LT0A 1UH5A 1GQYA 2UUOA 2Y67A 1DIAA 2AMFA 4I9HA 1GQQA 4XYBA 2X0RA 4J9UE 3P19A 5CP8A 4DQVA 3WJAA 2PH3A 4KQWA 1EE9A 3R1IA 1ZO8A 2UV8A 1SOWA 3FCOA 4B3IA 1C1DA 3EAGA 1GPDG 3VVCA 1I32A 5FF9A 1YS4A 2XAAA 3LQFA 4QUKA 1K3TA 2HMTA 2Z95A 5FI3A 2BFMA 2Q1SA 2J3IA 1T4BA 3LK7A 1EMDA 1DJQA 4J1SA 3HE3A 4BGIA 3NRCA 1ONPA 1C1XB 3VPSA 1XA0A 4H7PA 1QSGA 2O3SA 3TRIA 4F3YA 2DTXA 2Q4EA 3IL2A 4L4XA 3FTPA 2NQ8A 2DAPA 3QQPA 3WB9A 1NFQA 2GLXA 3C24A 1I3MA 3TSCA 3C1AA 4GX0A 4UEKA 1U5AA 4CMHA 4JBIA 3CXRA 4GX5A 2ZB3A 1OFGA 3VPFA 2JCXA 1H2HA 3RC7A 3PLRA 3LC1O 2Y99A 1RYEA 3N58A 4UVIA 2IRWA 3GRPA 1JU9A 4J4BA 1UP4A 2BF7A 3DZGA 3S2EA 4K9DA 2CMDA 3U4DA 4B4WA 4GAEA 4Q3BA 1NAHA 1GUZA 4RL6A 2GN6A 1BW9B 3Q1LA 5CDYA 3KSUA 2AA3A 3UOGA 3SBOA 4IMRA 4L0QA 4UUOA 4CODB 3VTZA 3OMLA 2O2SA 3VH3A 1P44A 4JROA 5F5NA 4HADA 1DFIA 1NR1A 4M89A 1GADO 1CQJA 2AHRA 2EXXA 1DDOA 3WTBA 2PR2A 3TL2A 2GO1A 4BV8A 1HETA 1HDOA 4LW8A 2SCUA 5G0VA 1YQGA 2AQIA 4NFHA 3ST7A 3BTUA 3UCEA 4CUKA 1QYVA 3FD8A 4XQ9A 4WECA 4DWVA 4MPDA 1UAGA 2VHXA 3INTA 4XGIA 3KVOA 2BD0A 4UVEA 2JCYA 4OXKA 3S8MA 3VH2A 3H9UA 4I1IA 1BHSA 1VL6A 2HK9A 1NNUA 4PIVA 1ZFNA 5I8ZA 2HAEA 3MCVA 1UXJA 5KTKA 4WCFA 3NYWA 3W8EA 3QVSA 3RBXA 4NJMB 2W2LD 1J6UA 4NZ9A 4IS2A 2IZZA 1A7AA 2X58A 4A5OA 1H93A 2Q4BA 3PYXA 3HQ4O 4LVUA 1V6AA 3PHLA 4R1SA 4EI2A 3ULKA 4CMGA 1N5DA 2QYSA 3T4EA 3OJOA 3M1AA 4NMHA 1ZUD1 4MIYA 4AFNA 4R51A 3PVZA 4YJHA 4KWHA 4P4NA 4RLSA 4ALNA 1WWKA 4E6PA 5CAEA 1HLDA 5IDQA 3GT0A 3WQSB 3W8FA 4YJGB 1E7SA 4WEQA 2C29D 5F5LA 4X54A 1PL8A 4B7CA 2IDZA 3JSAA 1SAYA 3VZSA 3GY0A 4ZJUA 4BO4A 1LDEA 3KEOA 4IDAA 1Q7GA 3ZHYA 3NDRA 1NQAO 1MGOA 3F3SA 1M76A 1ZMOA 2B4TO 4BGEA 4M49A 2WTBA 4YQYA 4RQUA 1EFKA 1TA4A 1H6BA 1ZH8A 4QT0A 4TROA 3VZPA 4XYGA 1KVTA 2I5PO 3QVWA 2B36A 4F46A 1U4OA 3I3OA 5EPOA 2X9VA 1ZBQA 4JJGA 3W4KA 1ZK4A 3WJ7A 4OQZA 1U3WA 2YFHA 3ZCXA 5A3VA 1QMGA 3TNLA 4DIOA 1KVSA 2EGGA 1YL5A 2Y66A 3KUXA 3K96A 3PZBA 1ISMA 4FJ1A 3TZCA 4A73A 4EUFA 1EDZA 1Q7CA 3QWFA 1ISIA 4QTZA 3TOXA 1JKIA 6ADHA 1P77A 3FSRA 3RBZA 1XG5A 4DQXA 5B12A 5DDIP 1EK6A 1PL7A 3K73O 4D42A 3BTVA 4WGGA 1X0VA 4RDHA 2UYYA 5TQVA 2BHLA 2IODA 1N92A 1N9GA 3GK3A 1SC6A 3H9GA 2VNAA 3C1OA 3L6EA 4BKUA 2HKIA 2CFCA 4R3WA 4PLGA 2WM3A 4D7AA 3U0BA 4HXYA 3VPGA 2ZYGA 5IG2A 4P38A 3JQGA 2J5RA 3ONEA 1LDNA 3RVDA 4BNNA 2E37A 2WE8A 3KM0A 4XB1A 1P1JA 2VQ3A 3SLKA 1FJHA 1YB5A 1UJMA 1P33A 1Y81A 2G1UA 1HZZA 5T8KC 5IFLA 2NVUA 4FD3A 2J8ZA 3R6DA 4E31A 3SLGA 4ALIA 2J3HA 3M1LA 3H6KA 3DZFA 4YRDA 1Y6JA 3WIDA 1I24A 5DCWA 3K6JA 4EEXA 1VSVA 3U5TA 3PHIA 4ZA2A 1JVBA 1KS9A 3F46A 4WLOA 5IZCC 1IZ0A 4MP3A 2AEFA 3KYDA 3E03A 4UUPA 3MJEA 2DBZA 2X4GA 4MDHA 1Y8RB 3TQHA 4PLZA 2B35A 3TN7A 1GDHA 4PGFA 2DFVA 2H1SA 4BGUA 3PTZA 3RC1A 4BO0A 3GFGA 5THKA 3HN7A 3ZU3A 1J0XO 1H5QA 1MC5A 3IJRA 4PLCA 4FFRA 2Z1NA 2BGKA 3KO8A 2NACA 2O7QA 2DBVO 3IMFA 4XQCA 1R37A 1GEEA 3FBTA 4QSMA 1EVYA 3JQEA 4CMAA 4Q3DA 1PIWA 2PZJA 5BNFA 2VHVA 1GZ3A 1I33A 5T6BA 4HX5A 2ZCVA 5JCJA 4M55A 1G0NA 1JAYA 2GSDA 4OSOA 3JD3A 2EEZA 3GEDA 2F00A 2C59A 4E0BA 4FJ0A 3GH3A 3TF5A 1O89A 1ZZEA 1RM5A 1F14A 1W4ZA 3RUCA 1YE3A 3VH1A 3M2TA 4R1TA 4U6SA 3TPCA 1RM3A 3RC2A 4E21A 2C7VA 2DBQA 1GUFA 3UCXA 5A06A 3WLFA 4GVXA 2GUGA 1DJNA 2FR8A 4FN4A 2GZ3A 3AW9A 4BNZA 2RHCA 2R00A 1PWXA 1J5PA 3AI1A 1EUCA 4JLWA 1ZK0A 1X13A 1AGNA 1OOEA 4BKPA 2GERA 3KLPX 3WR5A 2Y1GA 2YV2A 3RWBA 2DVMA 4JJIA 3RSHA 1CETA 3MTGA 3RUEA 4AJKA 4ZVVA 4GBJA 4CLEA 1E5LA 1Z7EA 4PCVA 1VL8A 4L4RA 3U3XA 4BVAA 1QXSA 2AEMA 3MJTA 3LF1A 3RKUA 3H3FA 1T26A 3WFJA 4EJ6A 3D5QA 2RH8A 3CZMA 4YWJA 1R0KA 3BMCA 3UFXA 3PEFA 4P22A 3ZV4A 1IB6A 3EVNA 5CG2A 2PWZA 1DEHA 1U8FO 2X7HA 2QX7A 2G76A 2V6FA 4PZDA 2IZ1A 2GGSA 2PD4A 5A02A 1K89A 4W82A 2EP7A 2I67A 4RO0A 2VHZA 2GPTA 4MVJI 4Z0HO 3ANMA 3LC7O 3ZU5A 3G49A 4JBGA 4OXYA 3F4BA 1E3EA 2J6IA 4CMJA 1YL7A 1GZ4A 3QWIA 3DQPA 2PZKA 4OKIA 1LSSA 4XDZA 4AJ1A 1B2LA 5TGDA 4IJVA 1T1SA 4DBZA 1HE3A 2XXBA 1MG0A 1E5QA 3VZQA 1Z45A 3PZRA 1X0XA 3OHSX 4OYRA 1CF2O 2NVUB 1UXIA 3FNGA 4PRLA 3HDQA 4WCFB 4C7JA 5T64A 4YXFA 4CMIB 2IZ0A 2OO5A 1IHXA 3E18A 3WXBA 1NPYA 1M6HA 3K2EA 2BI8A 4ZQBA 2YUTA 4CM4A 1FK8A 3RUAA 3CUKA 1Q1NA 3VKVA 4JP2A 4ONEA 1RJWA 3D4PA 1K6XA 1MG5A 4FGWA 2E4AA 3H5RA 3RASA 1VSUA 3P2YA 4PVCA 4FOOA 2W2KA 1PSDA 3K31A 4R69A 4RV9A 3U9LA 1XQ1A 1GV0A 2WEKA 4J1TA 1U28A 3DZJA 5FYDA 1TT7A 2VHYA 1EZ4A 3MOGA 4OXNA 4RVDA 4NR0A 2NU8A 2XPCA 2EKQA 1CDOA 4YDRA 4DPLA 1LSJA 3WIEA 1CYDA 2OUIA 3JCZA 3F1KA 4CQLA 3OIDA 2ZATA 1KYQA 1PTJA 2EIHA 1OAAA 4HUJA 2EG9A 1Q0QA 3AY6A 3H9EO 2BFPA 3IOYA 3IJPA 3Q2IA 5BSEA 1JWAB 1N8KA 4HKTA 2C7GA 2CDAA 4J9VA 5DF1A 4D0RA 3D1LA 3GNSA 4CM9D 2FRDA 4PLTA 3OEYA 3ROMA 1HE5A 4AICA 3RAJA 1HYEA 3AUTA 1OZAA 4BNYA 4U0KA 1NAIA 1IHYA 4LSWA 1V9LA 1QR6A 4L4SA 4KZPA 4YACA 3HFGA 5DBIA 3NGXA 1PGQA 2WDZA 4PZEA 4XQEA 4RF3A 2ZTVA 1E92A 2RAFA 2GZ2A 4Q3AA 5IN4A 1GV1A 3HFSA 3GAFA 1WLYA 2OOSA 3FTNA 2I6TA 1SEPA 4MVJP 1XKQA 4IDGA 2JKVA 5JMWA 3DZBA 5KJFA 1DXYA 3VDRA 4A03A 2B5WA 5I7EA 4AJOA 1C1XA 2C20A 4CR8A 1HDXA 2FOIA 3FN4A 4D79A 4A2CA 1L1FA 1GFSA 4GH5A 1C0IA 1PL6A 1F12A 1YL6A 1Z7BA 1Y8RA 3WBFA 2TMDA 4XYEA 4CM3A 3H7AA 2HK7A 4RZIA 4ILKA 1Y7TA 3I5MA 3KSDO 2NSDA 1YXMA 1YRLA 2DPGA 2V7PA 3ZWVA 4P8RA 4XYLA 5TIIA 4TKLA 3JQFC 4N5LA 3ZNPA 4EZBA 3AI3A 3DBHB 2OMEA 4HFRA 3DHEA 3BMOB 1DC3A 4IDDA 3I1JA 4CR6A 2OL4A 4IDBA 4Q3NA 2O50A 3D3WB 1HDYA 3MEQA 1I10A 2O3TA 3BIOA 5CDSA 3A9WA 5F3RA 2O3QA 1FMCA 1MUUA 4OQYA 3GG9A 1MLDA 3NAQA 1XIVA 1LRLA 4H16A 4GQAA 1LDGA 4U5QA 3UUWA 4OKNA 1UDBA 2WD7B 4MKRA 4FFPA 2FY8A 4E3ZA 5TJHA 2Y0DA 3IS3A 4QXMA 2DUUA 3BXXA 5T5QA 1W6UA 1MV8A 5L53A 1E3SA 3ASUA 3LYLA 5DOVA 2OGUA 3ZH2A 4D41A 3QWBA 1KEWA 5K0ZA 1UDAA 4TWRA 4CLHA 2LDXA 3CMCO 4KWIA 3ZWBA 4H15A 3BMNA 2P4HX 2FPGA 2Q2WA 3PXXA 3KRTA 5HWSA 4TZTA 1FXSA 4HFMA 4HY3A 1O6ZA 4YYZA 2D5AA 3MTJA 3DAFA 3DBLB 3GN1A 3HB4X 4CR7A 4ESOA 5B37A 5CPBA 4ZQEA 4II3A 2CY0A 4FR5A 4IDEA 3WBBA 4Q9NA 3WTCA 1HDRA 2P68A 3D7LA 4PZCA 4CQMD 1PQPA 4ND5A 3RJ5A 2FR0A 4FC7A 3HJAA 4J43A 5L4SA 1T25A 5LCXA 3E9MA
chains in the Genus database with same CATH superfamily
2CF6A 1QTIA 3TDMA 5CX1A 4DRZA 4W9RA 3DHVA 2ZP1A 3BULA 4XDHA 5B57C 2XYHA 4LMRA 5LYJA 2C7QA 3R0JA 3G89A 1J2JA 3IP9A 1MO3A 4MEJA 4QULA 3QP9A 3LKVA 5ERGB 2EF1A 3DMTA 4HZGA 1IPFA 3BX1A 3E15A 3W3AH 1AKYA 4FCWA 2IH2A 1C0PA 4M99A 4AQDA 3RFTA 3CH6A 1NBHA 3FUTA 4Q9DA 5FWXB 5HKAA 1A04A 1UM9B 1QLWA 1ZJJA 4EB3A 4RPLA 2DHQA 4UDNA 2ZQZA 5SV2A 1UEJA 2BJVA 4B87A 3PLNA 3HSSA 1ES9A 1XTZA 3V1YA 1W88B 3OQBA 3HXQA 4KIWA 1DI0A 3TEJA 2ZRAA 3AFGA 5AVYA 1W5EA 3PL5A 1HT3A 4J07A 1NR7A 2IYLD 4UU8A 3DMTC 3I6IA 2HPHA 2WG0A 1UAYA 5B3AA 3ZEIA 4M0EA 1C2TA 3E3AA 4F60A 1JEYB 3RWOA 3C5WP 3C3CA 2YWHA 3DTTA 1XU4A 3HB1A 4IJ5A 4PYNA 3F7NA 4WN9A 4CLRB 1S96A 1V16B 2ICAA 2NZYA 5AD1A 4NY1A 1MPTA 1QJCA 2PJDA 1L3CA 2RB5A 3EXFB 3NONA 4EG3A 4F91B 1OZ0A 3DDHA 1ZH6A 4FHCA 5JWRA 1XTKA 3U40A 3RUPA 3EZFA 1P1IA 1XL1A 2QNBA 3OJLA 2PM8A 5FOXA 4Z2AA 4ZYZA 5J58A 2HA4A 5KYWA 1IXYA 4BWFB 4ARIA 4I46A 4B8ZA 3F71A 4AJIA 4G5YA 3S2GA 4XKJA 2IF2A 4UNIA 5CDGA 1L4LA 2BDUA 3JTEA 2AFHE 1KP3A 3ET5A 4S12A 3ZE6A 1E9FA 1XCLA 1NYLA 1MJHA 1ZU5A 3D8HA 4JS0A 1SB8A 1ZJ4A 2ECOA 3I37X 3Q7SA 3FZYA 3DOCA 1Z37A 1QPGA 1I7SB 1E3MA 3BQMB 2CYAA 4MEBA 4U7FA 3SKYA 4O63O 1MOPA 2VYCA 3I9V6 1UP7A 4UBIA 1OKKD 2ZSEA 3OCCA 3DDOA 2CL6X 2A59A 1GPAA 3I9NA 3R6LA 2AI3A 2RH4A 3U1TA 4BVKA 2B3DA 2CLKB 4ZEOA 2BM1A 2LKDA 1DRUA 1M75A 3L6UA 3R0ZA 2HCRA 1CHDA 4IKOA 1J09A 4DWJA 3F5FA 4D8YA 1GTRA 5EMJA 3ODPA 2O20A 3DL7A 3FHOA 1HX7A 2YR0A 4YRNA 5EA2A 1VZ2A 2BMVA 2G80A 2WP8J 5DEOA 3TGPA 3NOXA 4E46A 1P1BA 2G9ZA 1YU9A 2BFDA 1V5WA 4DLYA 4EG6A 2Y1LA 3FFBA 1TJYA 3G2IA 4TQGA 1DDIA 2DJ5A 3E5RA 4FS3A 4YONB 1EX9A 1CT9A 2LCQA 1YR9A 1TE2A 1P4SA 2EWMA 1JEOA 1T2CA 4GKVA 4UXIA 5CLQA 4BO1A 4DMGA 5C8DA 1V11B 1Q14A 2J9ZB 3A6EA 1OTYA 2ZIEA 5DSTA 3E48A 2AG6A 3S2YA 3PGA1 3OZTA 2D1YA 4ZI7B 4I8IA 4NESA 3CLVA 4IG9A 4D4MA 3IMGA 5JS1A 1EFVB 3CX4A 2TMYA 1WDMA 1SK9A 2IHZA 2BBTA 4Y0NA 1CZNA 1O03A 4KOEC 5IM4F 1V0JA 3NUZA 4IPTA 1HT2E 1P0CA 3KWMA 4LNAA 4AKSA 1QTRA 5LOVB 4D6YA 2AWNA 3EW9A 1L5HA 1PKXA 1N3IA 1QH8A 1RIFA 1UPFA 4B74A 4UXHA 4BCBA 2VNIA 1KAGA 1SGWA 4JGIA 5CLIA 2QVBA 3RNOA 1LUAA 3VSEA 3ZJTA 2ZSUA 3OPVA 1MZVA 1PU2A 3HUUA 2QLTA 3DXFA 1VC2A 3CHYA 3QZUA 4H59A 2BTQB 2GCOA 3VU8A 3ZHXA 2QNIA 1CRZA 4GM4A 3UH0A 2IGTA 4BKQA 4EYSA 2AFIB 5KDOA 4NENB 4DMLA 5DI9A 1FL9A 2ZAIA 3QLUA 3WKEA 5IEBA 1WR8A 5ADVA 2ID4A 1ODFA 1T8RA 3JATB 4KXQA 1K88A 1D1QA 3OZCA 2ZFUA 3TZHA 4F4DA 1IJFA 5AVVA 3C7KA 3OE5A 3ABSB 1QQBA 3NU1A 3DB1A 3I64A 5HE8A 1U80A 3LSTA 3RRZA 5IXJA 3MPOA 2CD7A 4M9QA 1G5FA 1V1MB 4F3KA 1IHOA 1GT91 1Z07A 2VP6A 4QYIA 5FUWA 1OE0A 1FTSA 3OJCA 4OU5A 3B6JA 1E1QD 4B7UA 3DXXA 1KRXA 2C2BA 4LRWA 2WICA 3G7SA 1R0YA 3L46A 2VQFB 3OQNA 2H8GA 2A9FA 2XB6A 5DM1A 2BWJA 4OO3A 2R48A 2C03A 2X8AA 4RS4A 4WLUA 1ZITA 2J9YB 3OAAD 1XD2A 2RI0A 1LLCA 3PFBA 4QA9A 2M1XA 4MITA 3OQOA 3R8FA 3SC2A 4R0NA 5DWDA 2WF5A 3LL4A 4KXMA 2XDAA 1B16A 4XVUA 4G23A 2IK8A 4Q3CA 4Z6KA 3MWEB 1XVLA 1BRMA 3TAXA 2JLAA 4PC3A 3RU3A 1GTG1 4R7ZA 3BXEA 2FG6C 2YVAA 1ADCA 2Q29A 4FCVA 1QO0A 1NN0A 2Y9MB 4O4JF 2H4WA 4N3AA 5LP1A 4PLYA 1K3FA 2X8LA 1QP7A 3SC2B 1SCAA 1SK8A 3A2KA 2C5EA 3WYNA 2QTAA 3QBVA 3BIJA 4ZDIA 5FULA 2PE5A 4RA6B 4Q48A 4WXHA 2H92A 4NBVA 3NX4A 1A8UA 1O5TA 1WD5A 2OFXA 2QPOA 3UG7A 2I71A 2OXFA 1BMQA 1KK3A 2AI1A 5EL0A 1WQ4A 2AOUA 3CUWA 1WZEA 2EQBA 4WXRA 3TB6A 4J3JA 5ICGA 2Z6QA 2VAXA 2VBIA 5LM3A 1OT3A 3AHIA 4RTLA 1UPAA 4P5DA 5H70A 1K68A 1ZQ9A 2PZBA 3C98A 4IIJB 5FT9A 4F4FA 1TW3A 4GGOA 1IN5A 3UBTA 5C9ZA 1Q0HA 2ZRGA 3H5IA 2B7LA 3V34A 1CWUA 4HVTA 3Q5EA 2GO7A 3E9CA 4NAVA 3JQ8B 4G07A 4TMFA 3DLIA 3O7WA 4G9GA 1BWQA 1NVKA 5B1EA 1T2NA 3RAFC 2PJZA 3BE4A 4I08A 1QBGA 3D81A 3K8ZA 2GCGA 2JHCA 4WK4B 2B1RA 4XFDA 2CXUA 2HMWA 1M7BA 1SUBA 1ZSNA 1F0PA 4LBWA 4AJ2A 5HOEA 3J81A 2XVZA 5CTJA 5JQGB 4YVFA 5IM4A 4PZZA 1ZMTA 5DK6A 5EHGA 1Y4DE 1M73E 2LPMA 1JSZA 4K40A 1UFVA 4QQKA 1C1DB 3HRIA 3QKRA 4HJRA 1E66A 2B4KA 4MKXA 4G0VA 4AUKA 2QR2A 1NJ5A 5HJ2A 1CUYA 2GAOA 5CUQA 4U7GA 1CTQA 2PVPA 2JGDA 3SR4A 4A8JB 4B7AA 1VE7A 5JARA 1I1NA 2YY6A 3I45A 4ALJA 4ZGGA 3EX7C 1CUUA 3TNDA 1W8IA 2IIVA 3C4VA 3H42B 3IMKA 4IRUB 3DXYA 3IAHA 2MR6A 4JJEA 3D3WA 3AR9A 4R2WA 4EG4A 1FMFA 1ECGA 1H5NA 3G0GA 4F11A 1UQUA 1ZOSA 1JX6A 2RGYA 4DLPA 4U2BA 2QD1A 1JU4A 1GXSA 4BNUA 1NXQA 5T6MA 4ZJZA 3ECCA 1V8OA 2E82A 4LZZA 5FHRA 3H5NA 4I0WB 2HDOA 1P2SA 2DKNA 5F2KA 4ZT6A 1OU0A 3RPEA 1UC4B 3KAKA 1E0JA 1F48A 2ILTA 3B2NA 3ENZA 4ME6A 3WYEA 3K0AA 4KCGA 2WB4A 3RTDA 4DCCA 4I19A 2XYVA 4BP9A 3NIFB 2Y2UA 5HMLA 1OTHA 3IQDB 4AMUA 4C3ZA 2J6HA 2W6MA 5BWNA 3V46A 3SC4A 3GWZA 4MW6A 1YUMA 1B6SA 1VSTA 1GUYA 4CTMA 2ZB2A 5CEEA 1HG0A 3P5SA 4EWLA 2VDQB 3NTRA 4GOLD 3EQ7A 1JHQA 3KJHA 1WABA 3VV2A 1X92A 2QPAA 3E5MA 5EJ5A 1P73A 1Y7PA 1EK5A 3WGJA 4IQ8A 2BHTA 2ERYA 1KRHA 3LA8A 4C3OB 4EX6A 1RZUA 3DO5A 3AI2A 3MWGA 4YB8A 2VN8A 1E9BA 3KYCB 1TIKA 1P5JA 2QZSA 1K9SA 3ICWA 1J49A 2BBWA 1A8SA 3AMVA 3BTSA 3EVAA 2VDWA 3IJ5A 3NC1C 3Q4GA 1JF8A 2WV9A 4JC0A 4N3GA 5U4XA 2OCXA 2OFFA 1G38A 2MSDB 4LISA 4LC0A 4NX2A 4UFOA 5TX7A 4FXOA 1CC1S 3SE7A 5JNUA 4F06A 1QYCA 2HWXA 1JDZA 2LNDA 3RIXA 1D2GA 1Y4UA 3BGIA 1E3IA 5I3ZA 2AQKA 4LYGA 2BTEA 3DBVO 2RHMA 1ZOIA 1Z4PX 3K9QO 4J6FA 1QHSA 3KD2A 3BA6A 4BVEA 4CBVA 4K88A 2JJQA 3GVCA 4QEDA 4RE6A 4EG8A 1OWLA 2QN3A 5FXMA 4F2PA 3IOBA 2UUPA 5KNCA 3E9QA 5ALEA 3VPCA 5JZOA 4N7RA 2QQ5A 1MAVA 1S6YA 1D2AA 3A4LA 3UWPA 1SQ6A 4IJKA 2GYUA 1HDCA 1H4SA 2BKXA 3L7DA 2PX8A 1M2GA 4LC1A 1MQ8B 3RKSA 3WLIA 5FWYA 2Q5EA 3A6KA 1R3UA 2AH5A 2M9MA 5JAZA 4XJVA 1QK5A 3G2PA 5CITA 5H8WA 2W2QA 1PUJA 5FFFA 4BX2A 1JLRA 1J8YF 2HY7A 3MWKA 3N75A 5T57A 1LTQA 4HUTA 4YK7A 3F74A 4L02A 4JYMA 5IBCA 1YGYA 2ILVA 5DLDA 4PX5A 4AY2A 4B7ZA 4BMNA 2G9NA 2HU5A 4H77A 2P79A 2GZSA 1X7ZB 1N8NA 2BP7A 3DHWC 3GLIA 3QUSA 2FEPA 1KERA 2VCHA 4L28A 3LQ1A 3UEOA 1UOQA 1WJGA 5F73A 2QOEA 3ESRA 1E64A 1GTMA 1MX9A 2IU6A 4NBUA 4NQZA 2TS1A 4K2HA 5H3LA 4Y1GA 1KOGA 2GZAA 1N5OX 5FLKA 3RLFA 3CUEF 4F3NA 3I4CA 4XZ3A 1DO0A 3DE6X 3ADBA 1DEXA 1XSEA 2DQ4A 3KDPA 4RH3A 4W7HA 4JI1B 3U0VA 3HA3A 3FYUB 3I34X 1F8UA 5EEGA 2WTUA 2WOJA 1UZAA 2GBGA 4CF5A 3DW3X 1W44A 3A2LA 5AXDA 3V9PA 4Y6SA 2PLFA 4DC0A 1A9ZA 1WZUA 2PFKA 5K8IA 2PGLA 4HP8A 1CEEA 2HREA 1A72A 3L6RA 4MQBA 4DIUA 3MRTA 1TA9A 4K8RB 4QE3A 1UBJS 1UK6A 5C8VA 4BY9E 2F9LA 2MDTA 2XJ9A 4I9GA 4LFCB 3VPAA 4FFDA 4WW0A 4OGGA 4Z7JA 1D4ZA 3P9QA 4LBYA 3QLVC 4XIYA 5FFNA 2PZMA 4ZCLA 1GU7A 4MW2A 4BU1A 4LC9A 1X1DA 4Z3KA 3Q7RA 3Q7TA 3C6BA 4KWTA 5J2TA 1QHHA 4OHBA 1YB7A 3VBCA 1W93A 1BDJA 3E4CA 3D1JA 1H6CA 1JLLA 4TKZA 4O4JB 1M10A 2QZ9A 2G72A 4HUQA 5ILOA 4OLBA 3FOCA 1PEKE 3UJ8A 5CVDA 1RHRA 5DP1A 4RLHA 1V47A 5EGSA 1NJFA 1SHUX 3TLGB 3A9CA 1BCRA 4P54A 3B8EA 5A3JA 2IIPA 2VJBA 1D4OA 2GNPA 3KB6A 3PJGA 5GADl 2O2DA 2QMQA 3ZOZA 3A9TA 1Z6GA 2QLMA 2OVFA 3MIZA 3F97A 3O4RA 4JVMA 4RGQA 1HDGO 5EJGA 5IJ0A 1WTAA 4GRAA 4ZVKA 1Y3IA 4BVHA 4UD6A 3G0OA 4DIBA 2P9TA 3A28A 4NKRA 3QITA 1IZ7A 4LHZA 4PWYA 5AKXA 1U2GA 3ZDFA 3UJ9A 4C01A 1NFFA 2XE4A 1KORA 1R4MA 1Y5RA 2WJWA 3OKPA 1E1YA 2HDHA 1Q83A 2IYAA 1YBHA 1Q0LA 4OVKA 2FZ4A 4P58A 1U5CA 5DNDA 4C43A 1PUXA 3AYXB 1T2AA 4E5KA 1VLMA 3IDFA 4IHJB 5JE8A 2J33A 4B2PA 4DANA 2R47A 4OOEA 2IV2X 5GPBA 1NWHA 1EDDA 1R0SA 1VHTA 1OWMA 4HRXA 3B85A 1MX1A 2WFLB 3EVZA 3ZZNA 4OF4A 1B26A 3QFFA 1FFHA 1I7LA 2NO1A 4K6GA 5DTEA 3VNRA 4PNEA 5JYDA 4A15A 1IM5A 1E0SA 2HV9A 6REQB 1YS1X 3WK9A 3S29A 3TUJC 2POQX 3LX8A 4PRYA 4CIBA 3QGMA 2H1VA 1PYGA 1I2CA 2Q7DA 1I3NA 2PA3A 2WLSA 4LWQA 4PAOA 4WE3A 2OCBA 1RWMA 3CG4A 2PN1A 2NTNA 2YWJA 4KZKA 5KYVA 3A3OA 3JS5A 2VRCD 4OMFG 4L2IA 4KQIA 3NWOA 3CIOA 2QRQA 4LXHA 3I12A 3I1IA 3QUAA 4RX1A 1UWLA 2WM8A 3IQXA 4RE5A 4C6TA 5JBIA 1TTTA 4D3XA 2CFRA 4IM7A 2G5TA 1T36B 3C8MA 5E6SA 4KG7A 2QT9A 2Q8NA 3B53X 3I73A 3AIIA 2QAGB 4FCCA 1GNVA 4M1QA 4BAGA 1J00A 3Q3CA 2E2WA 2X0EA 5BR4A 3S8YA 1V4VA 2G9UA 3VJMA 3RYIA 2WF7A 1IVSA 3DDZX 1THGA 2QG4A 2VJPA 2PMDA 3NORA 3OLZA 3DAPA 3ND5A 4MGIR 4N8EA 4RKRA 4Z8YA 4XLLA 3LRTA 4JI5B 3WK8A 2DCUA 3QE9Y 1Z8NA 3VQTA 4ZI3A 4QVGA 1U81A 1N25A 4RKYA 1M7GA 1N6HA 1DWOA 3OUZA 4FN5A 5IC5A 4EGAA 3FSJX 4ZAWA 1PJQA 3LWDA 3MWDB 1P74A 5EE5B 4P7GA 4EUSA 5CCEA 2X0DA 5A5EA 3W9SA 1UJ2A 4DA6A 3N5CA 3OU2A 5CLFA 2WSYB 3HI4A 1WPGA 1A8PA 1TUEA 2EJWA 2MT9A 4FDMA 4GKBA 4DBLC 3LUHA 2AZMA 1AZLA 1FFBA 1I01A 4QUEA 5KU1A 3K1AA 2IH4A 3QHQA 1T2FA 2G83A 4M22A 3P4UA 5BWMA 3AU8A 3SZRA 3OKFA 4CKWB 4F4CA 3U19A 5CNJA 1Y34E 2VJKA 2V3CC 1HTTA 2QVXX 2YINC 1YHYA 4O2BF 4MJXA 2EYQA 1C5KA 1J0DA 1TM2A 2PMWB 4LZLA 2AOWA 4N0MA 3KXDA 5DM70 4RBNA 3RSLA 1LNQA 1BDMA 4GI2A 4NFSA 4YMHA 3PC3A 4N0PA 5H3CA 5J5VA 1BXKA 3QELB 3ZZ1A 1FSZA 1HSZA 1SKQA 1Z2CA 2CCJA 3CZAA 3JVEA 3QUBA 4QGBA 4UHFA 4UVHA 3RTGA 2PRYA 4F56A 4ZVSA 2TRSB 4ZO7A 4JC4A 2DQSA 3CUSA 1YZGA 2KB0A 3ETNA 4RPGA 1EG7A 1N9KA 4RJTA 4NYIR 4U7WA 3T3EA 3VX3A 3FNRA 1HEUA 1EVIA 2V5VA 2WIKA 5K3EA 4PZUA 2OCDA 4TKMA 5I9LA 2L69A 1U7UA 1XNQB 3P96A 4L8YA 4XW2A 3TSAA 5D51S 4OI0A 1E6LA 3PHGA 5T4BA 4EH1A 2X5NA 1UT5A 3QA9A 3RYCB 2FP4B 2HK8A 1M1NB 4LV8B 3T7AA 2P5SA 4YRMA 2FZ5A 2Y1CA 1SB9A 5E7QA 1NOKA 4OCZA 3R75A 4H18A 1OLXB 5ER9A 1I3KA 4CF6A 1NV9A 3HKBB 1AQLA 3JD4A 3QG5A 3SF8B 5FOQA 5LD2C 1DG1G 1KMIY 1CIVA 1KFEB 3C16C 4ND1A 1VA4A 1DL5A 1WCV1 4JYAB 1DQYA 2BKVA 3ELWA 3VHQA 16PKA 4BRSA 2HJSA 1U8CB 3OPMA 4Q6WA 4G36A 1G8YA 3FMOB 5FV4A 2QD4A 5KAMA 1CRPA 4ZXPA 3ZD8A 1EBUA 1V26A 4ALKA 4I1PA 1A5SB 4GM0A 1T91A 1XMJA 1YUNA 4W5JA 4NNJA 4WERA 5K2MA 4M6WA 4B3CA 1M83A 3IEVA 3ZCVA 4HF7A 3P0RA 3PTAA 2ONJA 2BFWA 3GUHA 4R8VA 3VZRA 3BPSA 3N53A 5TSDA 4H6PA 1GL9B 1OHHA 3V5NA 4NK4A 3KHUA 5EIBC 2VAVA 5AVUA 2XZPA 4WX2B 1N8SA 2C54A 3DDUA 3NHMA 1B6GA 4I3HA 1W2HA 1WZ2A 2Q1TA 3ZNQA 2O8FA 2WZCA 5HGJA 1DSSG 3IBYA 3PRYA 1Y0BA 2QTFA 3IPCA 4PC7A 4CM6A 3EGDB 1CR2A 1WMAA 5AXBA 1VI2A 4AM8A 4JD5A 3LFUA 3BDVA 2R1TB 2E4YA 4J49A 4JB8A 2QRZA 4MP8A 3AR4A 4PRKA 1WDTA 5L7YA 1OYYA 3TD6A 2CYBA 2VSXA 3BMOA 4F0JA 2IL1A 3DVQX 1Q0UA 1W5SA 1QFJA 3DAHA 3OA0A 3TTVA 1NMZA 2Z6AA 2HL6A 3CINA 3UZUA 1Z88A 3HJBA 3JRNA 1MOZA 1JR3A 3G6KA 5DJ5A 3MT8A 4ZN6A 3Q5GA 3VNAA 1MJGA 3EG5A 3ICVA 1L8OA 2HDNB 4F1KA 2F1OA 5TQ0B 3JQRA 2JLRA 5LUAA 1CPYA 2RHWA 2CVHA 2Q1XA 1WHSB 2NU8B 1C80A 1VJDA 3RKRA 3SHOA 1H9CA 1BD4A 3WLAA 1QORA 1XDSA 4WXYB 1A95A 1OREA 4GFDA 3BWMA 5KYYB 1N0IA 3X44A 2J5KA 2VDVE 1NA5A 1I0IA 2GN2A 2WKPA 3CX3A 3CV3A 4M0FA 4RQAA 4WSOA 4CEIA 2I87A 4HBGA 4R98A 4GL4A 3R0IA 4D4IA 3R5FA 2FH5B 1HRKA 4MGZR 1W30A 2P6UA 4Q1EA 1T0JB 1SVOA 1VB5A 1G8MA 4JLVA 4YLYA 1JLHA 1MH1A 5CM2Z 3DL0A 2UYHA 3NHFA 4URFA 3IRUA 1RZVA 5CT8A 2GD1O 2PYIA 4IJWA 5L51A 1E62A 2PYZA 4I81A 4PHCA 2HIAA 5D85A 4FOSA 3L0SA 4TLAA 4YJ2B 3SC6A 1M5RA 3RRBA 3H65A 5K6AA 3OECA 4M1WA 3LKBA 4X71A 1V6SA 2IXBA 4FIZA 4EJMA 2BONA 4Q0MA 3DE2X 4IY1A 3SBXA 3OQJA 2PS9A 5IXSA 4BEJA 4ZHQA 2GCIA 2RHRA 4RIHA 5B7PA 2HWUA 4EKEA 3IV7A 3L1IA 3QMMA 1R6BX 2GPNA 3B82A 3AR5A 2XHEA 4PAWA 5T67A 1RHUA 2DHRA 4XWYA 2C5SA 2X0JA 3R7BA 2PUBA 1SNYA 4O25A 2WP0A 2WHRA 2X1LA 3D7NA 3PJEA 5ERYA 3FYCA 2H63A 2PDAA 3HKEA 1QONA 2B1JA 3EJ6A 1BGVA 4FNOA 3EARA 2I78A 2I7CA 3N2YA 4N03A 2UUCB 3RF7A 3NP7A 3T0FA 4DQ0A 2X9QA 4YJ3F 2FMIA 3LUPA 4H31A 4LJ4A 3PUHA 3JV7A 5L4NA 1IM8A 3C45A 3PVSA 4CQMA 1OB5A 1G60A 3K9FC 3I9V1 3ZDCA 1RYYA 2P9QA 3RFXA 4ASUA 4CL2A 2HCTA 4RKFA 1K0FA 1V43A 1VGQA 1E3DA 2R97A 3BMCB 3AL0C 4YAKA 4DJTA 2H9IA 5C81A 3DC7A 3H3JA 2G77B 3JQ7A 3T12A 2WWYA 5BQ3A 4GSLA 3HBAA 4OQ4A 3UGTA 3KCNA 5JS7A 2HLDA 5HMMA 4LIPD 1KI8A 1NLZA 3P32A 5CFPA 1WQ1R 4G67A 1O94D 2BI7A 4GOOD 4I1OA 3QRWA 4WJLA 1GPUA 5IM5A 4EM6A 1YTUA 3ACCA 1QKIA 2QNRA 3ZLTA 1J25A 1FYFA 2OGSA 4DSAA 4AJJA 2GZDA 4BQSA 4C7OB 1EYZA 1DDGA 5B4TA 3IVCA 3CUTA 4LJ7A 4P34A 3BFXA 1XELA 1RR6A 2A88A 2PLRA 4TUYF 4B32A 4W7IA 4GGPA 3ZCRA 4BX3A 2QJFA 3LPDA 1E6CA 1QGED 3TKYA 3OAAA 4AZVA 1CE8B 4C4SA 1JIQA 1NXOA 1ETHA 1KJ9A 1DTWA 4D99A 1L4NA 1R8YA 3PC8A 3CH4B 4IJQA 5G1NA 1GLGA 3D43A 4INJA 3RQIA 2YS6A 9LDBA 1WD7A 3G2HA 4RPKA 3AK4A 1I3LA 4G5HA 4GKKB 3ZKWA 3S5JA 1NX6A 5AICA 2O7VA 3QXSA 4TS4A 3FYUC 4YASA 4NXNB 1E77A 2WJZB 2RKBA 1QB7A 4JVSB 3U4QB 1EU1A 4TTTS 1YS7A 4TMVA 2FJ0A 1DV2A 4MRPA 1QQ6A 5I4CA 2GPAA 2HJVA 2O0JA 1EK1A 1HORA 2JIRA 2XWJI 1PYDA 3NAZA 4GXRA 4R31A 3AEQA 1AQYA 1IVNA 1T2DA 4Q7JB 3PDUA 1LV7A 1SIWA 2QQFA 4KO3S 1G21A 4OH7A 4BO7A 5A1TA 5IAAA 5LVAA 4G0WA 2JLWA 3BMXA 4F97A 2XD9A 5I01A 4B83A 3EVDA 1T13A 1A7UA 3F6PA 3PFHA 1RXVA 2I4RA 3EFBA 1FTNA 1P6XA 1RW4A 2E4ZA 2Z08A 2IDKA 3F5SA 4Q47A 3OCYA 4MYHA 1QH9A 1J56A 4XWGA 3VVBA 5KJ1A 5CFQA 3EZLA 4W9NC 1D6MA 4LXQA 3EVTA 1DUIA 1WXHA 3VISA 4AMGA 1OI7A 2DT5A 4MWEA 4PLFA 5LWQA 1H2BA 3U4HA 5I6DA 2ZSKA 5ALVA 2Q49A 2VEDA 3L05A 4RF4A 2O8CA 1HA3A 2A9QA 4EP1A 2ZYAA 1O94C 2WTMA 1DIGA 1SXJE 2P2YA 4R7TA 2X19A 3GA7A 2G0AA 3JZDA 3SEQA 3RTEA 4IH9A 4UBNA 5LLDA 1ELOA 3F3KA 3MELA 3PQFA 4BNDB 2BGUA 4DUGD 4TTIA 3K8QA 4DV4B 2H65A 1KQ3A 2PLWA 4PZAA 2FWNA 3VBEA 1JAXA 3PHJA 1TEZA 1E2LA 5TT0A 1AKQA 2BN4A 4LK2A 4OFBA 4NH0A 4L3WA 5TMBA 1U7TA 2O5RA 2YY7A 3NJRA 1SA0B 1OPXA 3SYMA 3HKDB 3M7IA 2MSWA 4HQKA 1JPVA 5K3FA 3GEPA 3M0EA 4K9SA 4RTJA 4CYMA 4D46A 5A5DA 1GCOA 1A7KA 3QYFA 4H7DA 4M9RA 2VDPB 5K0TA 2ZSHA 4CGZA 3FTFA 3A6ZA 1ZMXA 5DBFA 3CKMA 3AP3A 5GJBA 2JFWA 2ZJ2A 2FZEA 1KSGA 4B9AA 4PN3A 3KR2A 3HA7A 3FOBA 2F4NA 4FW8A 3DTVB 3W8DA 4MWDA 2ORIA 4HO1X 4XJSA 4YBZA 3DM9B 2EKZA 3UNXA 4POOA 1OFTA 2J5QA 1F20A 3QKSA 2OENG 3PC8C 3T7TA 1QVRA 4NMWA 4RKQA 5AYVA 1MQAA 4N0QA 4LEIA 4EITA 2HNAA 3OSZA 4CEJA 4NIMA 2C83A 4K81B 1MX3A 5HF6A 1SOAA 1VB3A 2AS0A 2EFCB 2NPIA 2ATXA 2KI5A 4MP6A 2PSEA 2Q3CA 1PR0A 4C2TA 2Y0CA 1JZSA 3BAZA 3RS2A 2OLJA 4XWTA 4D45A 3UTCA 1RRFA 3JAMA 3PRJA 1B74A 3S4YA 4LXTA 5EINA 2ZKIA 2HMAA 3GUCA 4AIRA 5AHKA 1P9NA 1SCUA 4MJLA 3LT5A 1XCJA 2I7DA 1Y4ZA 4X63A 3NJ4A 2QR5A 3U1VA 4XPZA 4HLDA 2IKSA 2OTCA 2JA2A 3H6GA 3PT9A 4GZ5A 3TQTA 3UMGA 1VTKA 2VPYA 4REQA 4URHA 3GELA 3TDKA 1C4OA 3WIOA 4BJ3A 2Z58A 2XADA 4RJLA 2FCRA 2I33A 1A27A 5FBKA 3G8AA 5ALNA 4FDVA 4ZALA 1Z2PX 4WZAE 4QUJA 1ZCBA 3H2YA 2WV7A 2B4AA 4PWZA 1E2JA 4ZCIA 3NHSA 1BWRA 4ITRC 4CWAA 1DIBA 3JQCA 1XF9A 2AXQA 4AKIA 2V3WA 1KQGA 1AUQA 5IAEA 1XQVA 3NHWA 4QUIA 4UEOA 3KTOA 3UJ6A 1E0AA 1SVWA 2AWOA 3T5GA 1U2PA 1Q1EA 5HJEA 1KZGB 3BORA 3NHBA 2BFFB 3DOOA 4E2ZA 1M1UA 2ST1A 3U5TA 4UCQA 1X6VA 4HZUB 2WTEA 1IBLB 3VJKA 3ZLUA 3DWGA 3K92A 4XM0A 1TQ6A 1B14A 2ENWA 1CQXA 1NKTA 5I9TA 1U31A 3GLFE 2EV9A 2OHXA 3ZNOA 4AP6A 4N76A 4OBWA 1QGDA 3HBLA 3ND7A 1Q0PA 2JCGA 2RHHA 5C7YA 3T1OA 4WFKA 2WZBA 1TK2A 1J7JA 2WD8A 4KR2A 2FAXA 2XVAA 3N2IA 4M0MA 3ZHTA 4BUCA 1T9HA 1QHNA 1E0DA 3NKVA 4HNUA 1S2OA 1ZESA 2XYPA 2ASVA 1JXMA 1LJLA 2E1PA 1JALA 1GL6A 2FPKA 1PRYA 3I58A 3JARB 2R6JA 3NRJA 2GPSA 3FFWA 5CYOA 3TSWA 1JEYA 3H0KA 2C77A 5AKJA 3EN0A 1NMEA 3BJZA 3GF4A 4GSKA 3VA7A 1U2DA 1QQ7A 1TJ4A 4DL9A 2VOJA 3CXUA 4JFRA 1RM4A 4PU0A 2NSHA 3NLLA 4ZTZB 4P4UA 5EJ2A 4C22A 2CV0A 2I65A 2PXXA 1XMXA 1U8ZA 5DXJA 5BNWA 1EVEA 4XSVA 3CURA 3HKBA 1OU4A 3QW4B 1P7VA 1RSZA 4WLEA 2NV6A 1LTHR 4UTOA 3QPBA 1XT6A 1OBFO 4BPBA 2J08A 5C34B 4YHHB 4NP6A 3A1UA 2W58A 4IUYA 1EJBA 2AK2A 4EAQA 4R40A 4YREA 2H29A 3HJNA 2O5EA 5E1BA 1GQRA 3GFBA 2R8XA 2OKGA 1Y3HA 3L07A 4PG4A 1H0KA 1RYZA 2A33A 2JAUA 3LV8A 1A8HA 2XOKA 5HDQA 5BMVA 3VR6H 1Y8CA 2FB9A 5F21A 2FMUA 4EJSB 2G7ZA 5CFOA 1Q22A 5GY7A 5B30A 3SM3A 3W2GA 4BZXA 3TRHA 4HNTA 1J7KA 3GEBA 1QBKC 4Z9XA 2ZRJA 3R7FA 2IYVA 5EQTA 3T4XA 2GPYA 3HFRA 3JWPA 1XEAA 4KUEA 4GYKA 3PX2A 2VYVD 1RWBA 1ID1A 4Z86A 4LDJA 2CXTA 4O0LA 5G0TA 1UP6A 3AHFA 3BCSA 1Z35A 3N2LA 4JX9A 4NDAA 3ZVLA 5EEHA 4DGQA 4GWGA 1B8PA 1V8BA 3KQPA 5GGYA 1ZEMA 3C14C 3CH5A 1J8MF 1WP9A 3DGEC 4GPAA 4YPFA 4YQZA 1KO7A 1XNGA 3I23A 4R5HA 1VRWA 1ZY2A 4DC9A 5EKXA 3LWNA 4XOUA 3ROKA 5JJCA 1Z25A 4KKXB 3ZW9A 1QCDA 2Y77A 5DBHX 3RSQA 1COWD 1D09A 2FW0A 2HF8A 4Q37A 1UKCA 4UHJA 4YALA 5IMSA 2JGIA 1DO2A 3G88A 3RSCA 3SU8A 2DPYA 1QO9A 4Z53A 1II8B 3TTWA 3S44A 4AO6A 2O07A 4L15A 3P9RA 4UVDA 4AG5A 1ZMRA 3A2NA 2Q3HA 3G2MA 4RM3A 3W6NA 4K46A 1L4BA 2OAQ1 4XE5A 4G86A 1XMSA 3VR4D 1BX0A 2GASA 4ZVUA 2W2TA 4ALLA 3AL3A 1U7WA 4G5RA 3HSKA 3K0CC 5THXA 1R2QA 2NU7A 4IF4A 3NTOA 4E5VA 1KC3A 1EM8B 2DH6A 3ND9A 2EW2A 2YIMA 1T5DX 3L8YA 4XUDA 1C30B 3WO0A 2OHFA 1PG2A 3GEMA 4AMVA 5ICSA 5BWOA 2JG3A 1IU9A 1P3JA 2AT1A 4QFBA 3VKHA 1XDDA 2R4TA 4G01B 1H22A 2NYUA 3E9NA 4MW0A 4XR9A 2OKCA 2VPTA 1BA2A 4CFZA 1AKRA 1G63A 2NTJA 5JXHA 5MN4A 4KUHA 3WL7A 1KEZA 3KOYA 3DPSA 3LLUA 4MR7A 4XQ0A 4IO0A 4O1IA 2C9DA 4F86A 1W49A 1L0BA 2O3RA 1IQRA 3LPAA 3TNFA 2EVWX 4O2AB 1UBOS 3ZHBA 2AFVA 1J2TA 1V3QE 2G40A 2XYQA 4BJ1A 1YO6A 3DTNA 3EDMA 5F7OA 3OE7A 1MNQA 4EUNA 2XTAA 1Q0TA 2E1RA 5B58C 4RTSA 3UWOA 3TR6A 1UT8A 3WLEA 1HE4A 4O2AA 4U2EA 1JEDA 1APBA 1WMFA 2A8YA 2OM6A 1GPLA 3LUCA 3HA5A 5FOWA 3UANA 4Q4JB 1H8EA 3WMWA 5AXCA 3BA1A 2CDRA 3D6NB 4R1NA 3AGPA 3QU7A 1FSFA 1CFZA 1EFDN 1TAQA 4QNMA 2PXAA 4UFNA 4XSGA 5IK2A 4EA7A 1SBYA 3AKZA 4B3RB 4JYCA 2GDZA 4DABA 3T38A 3L4EA 2EZTA 2R7KA 4S1TA 1G6OA 4C87A 5IP5A 1QLJA 1TI7A 2G07A 4E5YA 1CULC 2HGZA 2P91A 3JYQA 1XD2B 3QMWA 1VXOA 3QWAA 3R7WB 4KSYA 4XWOA 2ALJA 1WCIB 1KJYA 3KQUA 2PY6A 4FJ2A 4E32A 3HZRA 1NVAA 4S04A 5D86A 5LDHA 1NQWA 4ZV9A 4AQ7A 1YDFA 2OQIA 3R3JA 4TTVA 4I4TA 4MI6A 4GMFA 1JS1X 4NOJA 1MABA 1NVVQ 1IOZA 2F8LA 2P3OA 1XZGA 2Y1XA 3FCAA 4HB4A 1NW6A 3N59A 2X0NA 3FBGA 1EP9A 4FZ3A 4O4HF 2F3TA 3QMPA 4US2R 3KUCA 4ISBA 3H1FA 2J5BA 2P2LA 3FAZA 2M6LA 1NI4A 4MCIA 4U63A 5EJ8A 3DT6A 1KFJB 4PXAA 1EFUA 2COEA 1X94A 2JJMA 3MINA 4I6GA 4ZZ2A 1MD9A 5ERXA 1F3OA 2O8EB 1E2BA 2CN1A 2QW8A 2ES4A 3GZNA 2GK7A 2JGFA 4M87A 4MINA 4MKIA 5A3SA 1M1ZA 3A25A 3AXTA 3I32A 4JLDA 3U7EB 2ZZNA 5IT9A 1YDGA 4EK9A 4YUVA 3F6SA 1LPAB 3KTAB 4NMXB 3ZPXA 2OK8A 5ADHA 1R50A 1I2AA 2WAXA 4YRCA 5AKIA 3IHTA 3K9WA 3NHYA 4HWPA 5KPDA 3UQZA 1O08A 5AUQA 3GA0A 4Y3UA 1YSCA 1D8AA 2PS3A 4OM8A 3ZHQA 2E9SA 2WJVA 3ZWCA 3ZVRA 1FZTA 4X6YA 4MRMB 1TRKA 4OSPA 3RU9A 2HZ7A 2BGMA 4TXJA 3TLYA 4JLKA 4XSHA 1XWFA 5B3JA 1JQLB 1PFKA 1WU7A 4IXTA 1CLEA 3ZDXB 2HXYA 1JHXA 1YOVB 3B6EA 3ZGYA 4C0JA 3QVOA 2C3UA 3DGFC 3VPXA 1Y4AE 1BS2A 4QKQA 3KOUA 2EP5A 4AKHA 1W25A 2WPDD 1KKMA 3JYLA 2OCIA 3EXAA 1X38A 3G7UA 3NIBA 2NU6A 2OLKA 3OPXA 4GGMX 4ICIA 4UMDA 4CTJA 4HQ6A 1EE2A 2OILA 1GYPA 4ES6A 4YCBA 4MVXA 2R8EA 3AF4A 3CO5A 3IESA 2H51A 4ZT5A 4AZ0A 1ZUHA 4QDJA 4C6RA 4MQ6A 3LG2A 1H94A 5D3MB 2OD9A 5FI1B 1CP3A 1JGTA 1NDUA 1U0GA 2BFCA 3BL8A 1G5TA 2J3JA 2NSYA 5L8VA 4N65A 1XVAA 1PWHA 2VT7A 2D06A 2YQ4A 4RL4A 4MHTA 2RONA 2W2LA 2CB0A 2GN4A 3DVSX 2WJIA 3ETLA 2F1HA 1CUFA 2ZSIA 2QMUA 4OGWA 2RHLA 4GYWA 3CNOA 1E7QA 4LRQA 2YXLA 3EJWA 4ISCA 2WJPA 4QYMA 1PWZA 4LE0A 4Q9JA 5KKAA 1E7RA 4RZSA 1FJGB 1CKEA 1GWNA 2I54A 4U6NA 4LBVA 2C7BA 1TPYA 2O1EA 3GH1A 1YHNA 1DCKA 4XIIA 4A7PA 1KI1A 1FDWA 1KETA 4R5MA 4A4DA 1QVWA 1NC3A 1L7MA 5JCZA 4XB6B 2GAFA 3LHKA 1VJGA 5DM4A 3TXXA 3UIEA 5A6VA 1CDEA 2CHGA 3I2IA 1L6IA 4WT7A 1OAOA 4JLMA 2FPRA 3R24A 4UPDA 2OXIA 3P71T 2FPPA 1GGKA 3DZHA 3JQGB 4XIJA 1G18A 5MGBA 5EKDA 3IERA 1GNQA 4CG0A 3T1YB 1ONBA 4FKMA 2GZMA 3HDGA 3I8SA 1V7PC 1C81A 1YVRA 1GUBA 1XROA 3H11A 5GJCA 4W5NA 4KXUA 5FWNA 4HAWA 5E3JA 2GT1A 2HRCA 3Q10A 3R0QA 5A5GA 2B6HA 2R44A 3A05A 3F3MA 1Y3AA 2HSJA 2JH9A 2QUKA 4JBHA 5ALGA 4RTKA 4QG7A 3ADKA 2C0CA 3QEJA 5DNUA 2YW9A 5BPHA 3OURA 1AUPA 1Q7RA 4EELA 1UKAA 5M3BA 2QD2A 1YDWA 4OX9B 2H48A 2VPQA 1DQRA 2B69A 4Q4CA 4GXTA 2VATA 1Q44A 3VKGA 3AVVA 1H66A 2IVZA 2WVJA 2D8AA 3BF8A 3AILA 1GGHA 1NBAA 2EKDA 3EPRA 3AHGA 3I6YA 2X6RA 3W9BA 1KDRA 3QYJA 4BL5A 4OLAA 3I4LA 3BYZA 1XU9A 3KKQA 2H2DA 3Q7PA 1WXEA 2W6JD 2W8ZA 2ET6A 3TIVA 3ZHRA 3H5TA 5DGCA 4DNQA 3EBPA 2P40A 3IAFA 4A10A 1KDPA 3I28A 1UODA 3KQVA 4G63A 2JLUA 5IT5A 5J63A