3HDJA

The crystal structure of probable ornithine cyclodeaminase from bordetella pertussis tohama i
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
311
structure length
311
Chain Sequence
b'AMLHIDDAMIEDAVTPQAAQEVLHAAFLDFGRGSAAMQRRVRTEAGGVKLSTLGAVIPGQGVAGAKVYTTIKGQFQFVILLFSAADGRPLATCDAGTLTRKRTAACTVLAAGALARPRSSVLGLFGAGTQGAEHAAQLSARFALEAILVHDPYASPEILERIGRRCGVPARMAAPADIAAQADIVVTATRSTTPLFAGQALRAGAFVGAIGSSLPHTRELDDEALRRARAVVVEWREQTLSEAGDLVLAAPDTGLDAKVVELADVLAGRAAARQADEDIVIYKSVGVGLEDVALAGYAYRRLAAQRGWPAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ornithine cyclodeaminase
molecule tags Structural genomics, unknown function
source organism Bordetella pertussis
publication title The crystal structure of probable ornithine cyclodeaminase from Bordetella pertussis Tohama I
rcsb
total genus 106
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1780.10 Alpha Beta 2-Layer Sandwich ornithine cyclodeaminase, domain 1 ornithine cyclodeaminase, domain 1 3hdjA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hdjA02
3RFXA 1HDYA 1MGOA 4Y6SA 4M87A 4W6ZA 2BELA 3WMXA 5JMPA 4MIEA 2X0NA 4IDAA 2E48A 3QWHA 1PS8A 2E49A 2B36A 1EFKA 1WDKA 5T5QA 1WXDA 2JFFA 2FMUA 3VH2A 3AOEC 1BSVA 3KYCB 2Z5LA 3NT5A 5K6AA 1RM5A 1XGKA 3JTMA 5EQDA 4CQMB 5I9LA 4XYEA 4Z3DA 3PHGA 4FJ0A 1A4IA 2X0JA 3MWDB 3FF4A 4XYLA 4XYBA 3Q2IA 3GVHA 4CLRB 2WD7A 1NFRA 1Y8QB 3KRTA 4IUYA 5F5LA 1TT5A 4RPJA 1UZMA 2DPHA 1HETA 3ROMA 3U49A 2EV9A 3GFBA 4BVAA 3G49A 2C2XA 5DULA 1D3AA 4F45A 2XAAA 4RVHA 3MWEB 5CEEA 2I66A 3PJGA 2JHFA 2YV1A 3P7MA 4J9UE 4NDNE 3AOEA 5F1OA 5TX7A 4BKRA 3EK2A 1U3UA 1E3SA 4FGSA 4CV1A 4RORA 3FPCA 4BNHA 3ETDA 5JO9A 1ARZA 3FI9A 4WEQA 1UAGA 1X0VA 4ZQHA 4Z3KA 4JLWA 3HFSA 2O3JA 5I7SA 4A10A 4B3JA 1NPDA 1GQQA 3NX4A 2PKRA 4WCFB 3V5NA 3E1KA 3P19A 2A35A 2HKIA 3G3EA 4E6PA 1GYQA 3ZW9A 3INGA 4GQAA 3AUSA 3EHEA 3PI7A 2J6IA 2YY7A 4BNYA 3S2FA 1LRKA 1X13A 2NTJA 2OL4A 4YAJA 3FNHA 4JK3A 1Y1PA 4J4HA 2PH5A 4D45A 7MDHA 4YAIA 4LRTB 4O5OA 1CF2O 1TT7A 3RD5A 3VOSA 1CERA 1VJ1A 2Y0DA 4OKNA 3FHLA 1X1EA 3ZU3A 5CP8A 3CMMA 2ZYGA 3CPSA 1R4NA 2EHDA 5FYDA 5A5EA 2ZKLA 2O48X 3INRA 4CM8A 1Z7BA 3GZ4A 5LCXA 3ITKA 1ML3A 4W9NC 3GMDA 5JY6A 2DBQA 3LC7O 1LDYA 4E21A 3TZCA 1E1LA 2DTEA 4FQ8A 2V65A 2DBVO 4DC0A 3P5SA 3BXXA 4J0FA 4J1TA 1DIAA 3OJLA 2Q45A 3PP8A 2D5AA 2NSDA 5EJ2A 4CLXA 2GPTA 1EVYA 3F1LA 1OBFO 1B16A 3VDRA 2CVOA 5GY7A 1BXKA 2BMAA 2JCYA 1QYCA 1WPQA 4G2NA 2Q50A 3HZZA 2UUOA 4Q3AA 1PU2A 1ZNQO 2Q4BA 2B4QA 4J43A 4W9NA 4NBWA 1RWBA 1SOVA 1DIHA 2I3GA 3HDHA 5L53A 1PQWA 1PJTA 4LCJA 2ZATA 1JN0A 1U2GA 3GGOA 4HY3A 1R15A 4IQGA 4ZQFA 3F47A 4OXNA 4P38A 3DTTA 3I6IA 5KJFA 4ND5A 2AQHA 2DTXA 4CJXA 2J5KA 4PZCA 3WGTA 4CM4A 2V7PA 5JPIA 5B12A 1DRVA 1PJSA 3B1FA 2DKNA 3ZW8A 1H6CA 3AM3A 2HAEA 4W7IA 4TVOA 2CDBA 2GN6A 3WGZA 1PWXA 4PLGA 4WNIA 2FHSA 1JDJA 1E0DA 2W8ZA 4NK4A 4II3A 4PFJA 1C0PA 3PJEA 4DBVO 3BMNB 3NYWA 4L4RA 3Q9UA 2AEJA 3ZZNA 3NDRA 3E82A 4P4NA 1E3WB 4G81A 4E12A 3RU9A 2QHXA 2Q4EA 3DFUA 1ZEMA 3FWNA 5CPBA 4DXHA 4ZA2A 3VPHA 1G1AA 3DZIA 4U0JA 4Z9XA 3JQBA 3SLKA 4IGFA 1I3NA 2LDXA 1X7GA 2Y1FA 4BUCA 1GDHA 4EEZA 5L4LA 2GNAA 3I4FA 4R9SA 4BO1A 2EWMA 5JC8A 3E5MA 3ON5A 1AHHA 2PZJA 2HMVA 2OXIA 2W2KB 5L51A 2FZEA 4ZJUA 4GX5A 1KERA 4BGIA 3QVTA 4R41A 4ZN6A 1EBUA 1E7MA 2ZYDA 1Y9EA 1LA2A 2B0JA 4FBGA 1EUZA 1NQOA 4R1TA 4RVUA 1NR7A 4EJMA 4ZVVA 4LK3A 4RZIA 1LDEA 4BKPA 1HT0A 3PRJA 3W6UA 1N92A 4MKRA 3ZV4A 4C7JA 1LSOA 3GF4A 4XGIA 5EL0A 2ZCUA 4R3NA 1HEUA 2CDAA 2C82A 3B1JA 3AI2A 3IS3A 4UUNA 5L7TA 4E2YA 3ONFA 3GNSA 4S1VA 1XEAA 5T8KC 1HYHA 4Z0PA 1IOLA 5JE8A 1HE5A 1U28A 1QYXA 3OFSA 3KYBA 2HUNA 3SJUA 2GO1A 5EQFA 4PIVA 4UVGA 2QYTA 1PQPA 1UXHA 2FRDA 5JDIA 1I3LA 4B79A 1LU9A 2PK3A 3RUHA 3DMTA 1MXHA 3SBOA 3UCEA 3K2BA 3OJFA 4E13A 1F12A 5BSHA 2IEBA 3K6JA 2E6UX 4F3YA 3WGGA 3O4RA 3H2ZA 1EFLA 2IYPA 4YTEA 1HF3A 3DO5A 5T8KA 2EIHA 3GAFA 3WGIA 1LEHA 4OJNA 4CMGA 1W6UA 1YL6A 2HCTA 3DAPA 3ADPA 1Z82A 3OQ6A 1BVUA 2HRZA 3NAQA 3G1TA 4JROA 4FC6A 1EVIA 4J49A 3LLVA 3OA2A 1AGNA 4GX0A 1NHGA 5TS3A 1BDBA 4FR5A 4DLAA 3QY9A 3GN1A 3DMTC 1EVJA 4NFYA 2GD1O 4GI2A 1KEWA 1Q2XA 1GUYA 3OEYA 5J23A 1A27A 2O7SA 4G5HA 4ALIA 1R37A 4NR0A 4AFNA 2NV6A 3IDSA 1N5DA 4XQGA 2AQKA 1A7KA 1YRLA 4ALKA 4MVJF 3VDQA 1XQ1A 1NX6A 5F21A 4F46A 1T2FA 4K1LA 1PX0A 4XX0A 4ALNA 1HTBA 3EVTA 2C7GA 3IOYA 1YQGA 3KSZO 4D0RA 4RDHA 1I5RA 4CLRA 4IMPA 5HA5A 2ZJ0A 4JQCA 2BHLA 3I3OA 4GLLA 1VM6A 1XHLA 3PYXA 1EMDA 1HE4A 2IE0A 4ZRNA 1CIVA 1DB3A 5JCJA 2BH9A 1ISGA 2RBEA 2VHXA 1P74A 1LXCA 1MLDA 4PLHA 4WJZA 1P31A 4J91A 2YFQA 1HE3A 3AUAA 2WJPA 1IB6A 4Y98A 3WIEA 4PLZA 1TB4A 4IJWA 4HV4A 3B6ZA 1NQ5A 2DU8A 2PA3A 4JX8A 1R4MA 4RL6A 3ANMA 4Y6PA 4AJ1A 1J0XO 3CMCO 4J2OA 2HMSA 3FWZA 2J3IA 1JA9A 4E32A 1AE1A 1P77A 3JQDA 2HLPA 1QV7A 3GA0A 2ILTA 3WQQA 4KZPA 1FDVA 1X1TA 3DXFA 1E1MA 3N74A 1NASA 4ESOA 1B0AA 1K5HA 1JWBB 1GQ2A 5THKA 2O23A 3RC2A 3PJFA 2UAGA 3PVZA 5DNAA 1HDZA 1EUDA 4LRSB 3RQSA 4YB8A 1A9YA 3NRCA 3PIDA 2Y0CA 3GT0A 3KSUA 1LC0A 1LDNA 4NQZA 3WJAA 3HQ4O 4DLBA 1P45A 3GGGA 9LDTA 1V0JA 1T4DA 2X0IA 3P2YA 2EG9A 1UJMA 1ZMTA 3DOCA 1C14A 3AK4A 2WE8A 1IPFA 3K30A 3BHIA 4HXYA 1HLDA 4BO3A 1UUFA 3G79A 1LJ8A 4CMAA 2JD1A 2EW8A 2XF8A 1YH3A 3UVEA 4FSHA 1R12A 1U7TA 3K96A 4RDIA 3IIEA 2PH3A 1PJLA 4E0BA 1WVGA 2YZ7A 5FEUA 4MP8A 3WSVA 3DBLB 4WPGA 2ZK7A 2X86A 1H93A 1LSSA 2GUGA 4ZQGA 3L6DA 3ADOA 5ER6A 1L1FA 2J5RA 4URFA 3ASVA 2AHRA 3G17A 1PWZA 4CUKA 1DFIA 3EDMA 3ZWNA 1X15A 4BGVA 1K2WA 4XYMA 3U0BA 2DFVA 4HFNA 1ORRA 1GY8A 1H9AA 1Q7BA 3ZWVA 2YHUA 1R4MB 4BHTA 2BFAA 1UDCA 3WWYA 3GFGA 2CDCA 4R3WA 4R5MA 4KP7A 4LSWA 1TA4A 1CRWG 1ENYA 3JD2A 1DHRA 1C1XB 3JQEA 4R68A 1JW9B 2FP4A 4YQZA 1ZFNA 1HYGA 4E33A 3AJRA 4GLOA 3U3XA 4JBHA 5DCUA 3TZHA 1UDAA 3BMQA 3FNEA 3KUXA 4XQEA 3RFTA 1OC4A 1BMDA 3PQDA 5C5IA 3N58A 1GV1A 3PFWO 1YBVA 2OGUA 3WQSB 5JYDA 3OH8A 3I52A 2GN4A 1YDEA 3JYQA 1QORA 2GYYA 2QRLA 3DOOA 1UP7A 3HN7A 1YBMA 4B8ZA 4FFMA 3TL3A 3JQ6A 3EW7A 4E2WA 5IG2A 1VLLA 1NPTO 1WW8A 4JJIA 5ES3A 4IBOA 4YR9A 3LYLA 3GN2A 3IQDB 2D59A 3ZNNA 4Z6KA 4MDHA 1K6IA 4QQRA 4II2A 1LQTA 2H6EA 4K26A 2W2LA 3HWRA 2IDZA 5CPFA 7ADHA 4I5EA 1C0IA 2NU7A 3H9QA 1GUZA 3UOGA 1MG5A 2EXXA 4D44A 3HN2A 3ANNA 3PDJA 1HDXA 1KC1A 1QLJA 1X7DA 2DUWA 1PGJA 5F5NA 5TIIA 4EBFA 2AQIA 5THQA 3IKTA 3BZUA 3PXXA 3ICPA 3RBVA 1MC5A 3VPGA 3I4CA 4TMFA 1PJ2A 3W1VA 2VOJA 3QJ5A 1SB9A 3OJ0A 3MJVA 2JCVA 1RKXA 4TROA 1ZXBA 2WMDA 4MVJG 3R3SA 3KO8A 4CM9A 3RASA 3I23A 5KKCA 3JD1A 2NTNA 4Q3EA 4J1SA 2OP0A 4OMUA 3AUUA 4OQYA 3RKRA 3T4XA 3ZHYA 3O8QB 1PGOA 4UEKA 5LDGA 4CQLB 3JQ8B 4BB6A 2EKPA 3A4VA 1M75A 2I9PA 1PJ4A 1ENOA 2PGJA 4J1QA 4BNXA 1E3LA 1U4SA 3GUCA 5JC1A 3WQRA 3TZ6A 1Z45A 3DAFA 3LF2A 4ITUA 1ADFA 3QSGA 5A3JA 5EIOA 3GGPA 4BO5A 4E4YA 2X1HA 4Q9NA 2BFPA 2HK8A 4CM1A 4DGSA 3MZ0A 4CM5A 1ZK3A 3DDNA 3V1UA 3JQGA 5CDYA 4PG5A 4EGFA 1B3BA 2C07A 4A27A 2PWZA 4CMKA 3HHPA 5U4QA 1A7AA 1WWKA 3WX0A 1A9ZA 4B7XA 4CQMD 1ENZA 4GWGA 5KNLA 3TPCA 3UXYA 1MB4A 3DBHA 4W82A 5IZCC 3WLEA 1ONNA 1IZ9A 4N5LA 5JCJD 4JGBA 4N5NA 2X7HA 4IY1A 3NTRA 5IJZA 3BTSA 3I83A 1CQIA 1GYRA 1MV8A 4B7CA 3IL2A 3TF5A 1FDTA 3C7CB 3ZWXA 1FXSA 1GEGA 2D4AA 4OAQA 1ZEJA 2DAPA 2B4RO 3ENKA 4PZDA 3BMCA 4KDFA 1NTOA 1FDUA 5HWSA 2J3KA 2GSDA 1N1GA 1NNUA 4Y9DA 5A9TA 1H2HA 1L7EA 1NQAO 4IDDA 4JBGA 2IXAA 1IUKA 1E92A 1Z74A 1GR0A 1CEQA 1HLPA 1JVBA 1HSZA 1ZJZA 2ZB8A 3L6EA 3H5NA 3QP9A 4M1QA 3OHSX 4CLOB 3MTJA 3L07A 4AJOA 1DO8A 2IRWA 4YWJA 1LRLA 3ZWPA 4NJOA 4R16A 4DVJA 5KKAA 3JQ8A 1JLLA 3W4KA 2XXJA 3AOGA 3D0OA 4IQ8A 1T26A 4LISA 2FWMX 1PL6A 4NIMA 4RVSA 4WLVA 3S55A 3W8DA 5G4LA 4DBZA 1LNQA 1U5CA 1XWFA 1T4BA 1GQYA 4OIMA 1P9LA 2GZ1A 3H5RA 4BKQA 4W4TA 2AMFA 1E3JA 3MJTA 2CNBA 1OZAA 1CDOA 2EJWA 4XCVA 4RGBA 3TWOA 1VSVA 5GZ6A 5AXDA 1OAAA 4QSMA 3OMLA 5FI3A 4E31A 3H7AA 1BXGB 4JXKA 5KCZA 5KVQA 2O3UA 3GNTA 1X7HA 4CR8A 1V8BA 4ALJA 3KB6A 3QW2A 1VKOA 2A9FA 1B3RA 3HUDA 1DC6A 3PWZA 4R51A 1I3MA 1HZZA 4PGFA 1NXQA 4WLOA 3KVOA 3KZVA 1B14A 3FR8A 3O9ZA 4BO4A 1KEUA 3CKYA 2NM0A 4K6CA 3VC7A 3I9JA 1PL8A 4RPLA 1MX3A 3K2EA 1LLCA 3ZWOA 1WNTA 1EK6A 1ZMOA 1U8FO 2NTVA 4FFLA 4M8SA 3ZV6A 4HP8A 1A72A 2EJVA 4RZHA 4XRGA 5G0WA 5CG1A 1LQUA 4OO3A 3JYOA 3TJRA 2A94A 1WLYA 4E3ZA 4RJTA 3OICA 3PPIA 2NVWA 4NFSA 3ABIA 1PZEA 1FDWA 3H5AA 3W4JA 5IDYA 3GDFA 4TQGA 4IDFA 2GERA 3GDGA 4CQMA 5BT9A 1ULUA 3ETEA 1WMAA 4CMEC 3H9EO 2JFHA 2C5EA 2JFGA 3JQCA 2QG4A 1ZJYA 2P2SA 3NTOA 4BIIA 2ZB7A 2E37A 1C1DB 4RLHA 3V2UA 4Q3NA 1D7OA 5C3MA 2Z95A 1KBZA 3LT4A 4GGOA 4O59O 4B4WA 3DBLA 4D3DA 4E2ZA 4R69A 3B1KA 4HWKA 4KUGA 2JAPA 3ONEA 5ENVA 1J49A 2WYWA 3K92A 3L4SO 2VZ9A 5G0UA 4HFMA 3OP4A 1KETA 1MUUA 1GL3A 3D7LA 3KLPX 3M1AA 3PZBA 4LVCA 1VE9A 2OFPA 3BYZA 2GN8A 3ROQA 1PS0A 3GG2A 5DOVA 1UXKA 3E5RA 1RYEA 1HSOA 1KVRA 1B8PA 1GPJA 3FPLA 3KYCA 3GC6A 3MTGA 4N7RA 4Y6RA 2YV3A 4MKZA 5I8WA 2CY0A 4DQVA 5IAAA 3HE3A 1LBEA 3DZFA 4JJFA 2FPGA 5C7IO 3NJ4A 2ZTVA 3QVWA 4FJ1A 1O5IA 1DIRA 1UP6A 5DDIP 3DZHA 1WAMA 4GPD1 4D3FA 2VYND 4QO7A 3NDIA 3I9OA 5K6AC 4NHEA 1Q0QA 3UGKA 3PHIA 4IQ0A 1H0KA 4PRLA 4QT0A 1WDMA 4I9UA 1G0NA 1Y6JA 2X8LA 2DQ4A 1ADBA 2WD7B 3AWDA 3W4IA 2BRUA 4AICA 1TEHA 2GZ3A 2J3JA 5ENDA 1U4OA 5B37A 4L75A 3D5TA 3TDKA 1HXHA 2Y1GA 3K9QO 1ZVMA 1J6UA 5JS6A 2C29D 4XR9A 4YJGA 2J5QA 1ADGA 2O4UX 3FNGA 4CODB 2VQ3A 5ICSA 4BL5A 2EGGA 3CZMA 5T6BA 2EKLA 4GSLA 4ND1A 1H5QA 4MVJA 2HMUA 3SXPA 5G0TA 5AYVA 4PLCA 4IZHA 3H9UA 1PIWA 2VCYA 3OJEA 5DBGA 1CYDA 2TMDA 3SC6A 1YKFA 5CAEA 4AJNA 4CMIB 1RM0A 5U1PA 4PLYA 2O3QA 1U5AA 4IS2A 4B4OA 1IULA 2FR1A 4DIOA 1KVUA 5I9NA 3TZKA 1C1DA 3WBFA 1ZK2A 4PG6A 2BFMA 4RPHA 1JU9A 4PLVA 3ITDA 1DSSG 3QE3A 4GVLA 4BNKA 1M6WA 2SCUA 3QLJA 4HFJA 2QIOA 3NGXA 1YJ8A 1I30A 4L76A 1BTOA 5DCWA 4TRMA 5TGDA 4BO9A 3QQPA 3MJCA 1P0CA 3Q9NA 3F5SA 4ROSA 2VRCA 3S2GA 1P3DA 4KTVE 3JV7A 5COAA 2JKVA 4NNJA 4J4BA 4CMCA 2PKQO 1H94A 1GZ6A 1KVQA 3R0IA 2BI8A 1RM4A 2X5OA 2X0RA 1G6KA 2BFOA 3FSRA 3HB5X 1Z6ZA 2ET6A 4UAGA 3C7DB 4ZHSA 4CQLA 1HL3A 2HK7A 1WMBA 1JVSA 3LT0A 4LCEA 1RM3A 1LTHR 1YDWA 3PGJA 1PJ3A 1Y5RA 2G17A 2WYUA 3EC7A 4H3VA 1DRWA 2DPGA 2IXBA 3BMOA 3GR6A 4I9NA 3QVSA 3W8EA 1ISIA 2O7QA 3JQAB 3DTYA 2BGMA 1YS4A 2CF5A 4J0EA 4UVIA 1P1JA 3DONA 5L9AA 2I5PO 3GRPA 3L9XA 1DIGA 1NFQA 5A06A 5BSFA 1SOWA 3KM0A 3AM4A 3V8BA 2VHVA 1KS9A 3VPXA 4RF4A 2RH8A 3EUWA 2OHXA 3O8QA 4BQPA 4A0SA 4E5MA 1HE2A 3Q1LA 3D3WA 2WYVA 2X9GA 3U62A 4DMLA 1I36A 6ADHA 2EW2A 4EYEA 2FSVA 3DR3A 4RPGA 2CF6A 3AM5A 4IINA 4PG7A 5F1PA 5FFFA 4HNGA 1NAIA 4WLEA 1Q7CA 4HX5A 3OIFA 1DAPA 2W2KA 4BNMA 2FY8A 4YQYA 2UUPA 1T24A 2IYOA 1YQXA 2PFGA 3NT4A 1F06A 4CLDA 5B4TA 4YA6A 3WTCA 1E3EA 1KY5A 5AXAA 5KWEA 4A7PA 4GMFA 3C24A 3QVXA 1S7CA 4BV8A 1SEPA 1KEPA 4DQXA 3HADA 1YOVB 3RIHA 4IZIA 4UUMA 1QYVA 5DBIA 5TT1A 4EJ6A 4NBRA 5G4KA 2P9GA 3WLFA 4QECA 1MC4A 1E6EA 2ZJ1A 3DBRB 2P5YA 1ZBQA 2WSBA 2GCGA 4XWYA 1M67A 2TMGA 5T57A 3NTQA 2YHIB 4MVJI 1SZJG 2E82A 4XYGA 5KVCA 4WE3A 4O63O 1A4UA 1GCUA 1GFSA 1C3VA 3GRKA 5JAIA 1P44A 4GGPA 4FN4A 4FFNA 4FS3A 4CUJA 4MIYA 4PLPA 3NEPX 5EESA 4RPKA 5BSGA 4BNZA 4R9RA 1I2ZA 1LDBA 1Z7EA 4P8RA 1AHIA 1VJTA 1XLTA 4OXYA 3RC1A 2NADA 2VZ0A 3NJ8A 5L7YA 3TL2A 4IXTA 4NBTA 4BOYA 4PVCA 4IXWA 4MPDA 2ZQYA 1C0LA 1DBVO 4IDCA 2Q1UA 4BNUA 1OOEA 1HYEA 1DC3A 1PJBA 3L9WA 3LLSA 4FIZA 1PGQA 4A73A 1VKNA 2CD9A 3EY4A 5C7LO 4YT5A 1E3IA 2RH4A 1JTVA 4H15A 4XB1A 3PQEA 1X0XA 5DF1A 1EK5A 5I7EA 5JDCC 4D41A 2VWPA 3RVDA 2PKQP 3DZJA 2Y68A 4F6CA 5ADHA 4Q3DA 4WECA 1LRJA 4EUEA 3RWBA 5AQ1A 3M1LA 3S2EA 2ZIZA 4YJFB 1HDGO 2R00A 4YT2A 4NFHA 1PGNA 5HS4A 1P0FA 1NR1A 4FCCA 3DB2A 4WGGA 4YJDA 1TVEA 1B15A 1EE2A 2PNFA 9LDBA 1JAXA 3ETGA 1H6BA 4I5DA 3HDYA 3KEOA 3GMSA 5JO0A 1NAHA 3U9LA 3S8MA 1XDWA 3GG9A 3JQ7B 1XELA 4YRBA 4WLFA 3U4HA 5TLSA 4XIYA 5TSDA 5TNXA 4PRKA 3FCOA 2EERA 3GVCA 4XD2A 2BGKA 1EQUA 1BXZA 3RUIA 2D2IA 4YT4A 2I6TA 1D1TA 4DREA 3CXRA 4XGKA 3RBZA 4S3MA 4XKJA 4TZTA 4AG3A 1N1EA 4MVJM 3VKVA 4BNNA 3ZV3A 4NBUA 5AVOA 4WLUA 4OXKA 1NM5A 5JSFA 4IJVA 2UYYA 4YT8A 1GCOA 4DRYA 3R1IA 4XJSA 4A5OA 5COQA 5A5FA 1YL7A 1DOHA 3VTFA 4GH5A 4TRNA 1I2CA 5H83A 4BGUA 4IJUA 2WDZA 1GD1O 3JD0A 5HBRA 3L4BC 5HRUA 3K5PA 1DPGA 1D1SA 2VTDA 1ISHA 3ICCA 4Z9FA 2PV7A 5GMOA 3I5MA 3CSDA 3U4IA 1YWGO 3GLQA 2Y1CA 5LC1A 4EW6A 4JIGA 1ZZEA 3CE6A 5A4DA 2DTDA 3WOHA 4X54A 2B35A 3LDHA 1I10A 1ZH8A 1T2DA 1U1IA 3H6KA 3STHA 4AJLA 1H9BA 1N9GA 3LT2A 1O0SA 1E7RA 5BR7A 1KVTA 3TZQA 4DWVA 1N8KA 4R1SA 3TNLA 1DIBA 2NWQA 4MJLA 4L8VA 1P33A 3V2GA 4J6FA 4FB5A 3ZWCA 1AUPA 5CDUA 1B2LA 1YXMA 4BNTA 4ZGWA 5JYEA 5JMWA 3BAZA 3C3XA 4U7WA 1MG0A 3NDJA 4PN3A 2V6FA 3E9QA 4NG5A 2GF2A 3VVCA 2NU6A 3D4NA 1MFZA 2XXBA 1IHXA 4KTTE 5T64A 4CMIA 4I9HA 4D3SA 3HG7A 3JQ7A 3D4OA 1O95A 4CUZA 2G76A 3OEWA 2JHGA 4D7AA 5L45A 5JLAA 3VH4A 4KOAA 4B3HA 3HNPA 3F3SA 1HDOA 2YW9A 8LDHA 3RC7A 1N7HA 3M6IA 4NH4A 4RVGA 4F6LA 4RF5A 2O3TA 2BGLA 3WWZA 4M54A 1NVGA 4MIOA 2Y93A 2AXQA 5EN4A 4P22A 3TOXA 1ZK1A 1KEVA 4BO8A 1WP4A 4HNHA 2FR0A 4GMGA 3ZH2A 2PGDA 2WM3A 2IZ1A 3PLRA 3H4VA 5DOZA 2C20A 4JBIA 1HDRA 5A03A 1IY8A 3RJ5A 3VTZA 3OM9A 1P1HA 2F00A 5G0VA 4ILKA 4Z0TA 3ZI0A 2X9NA 3BHMA 1SPXA 4XGNA 5TF4A 3E48A 5EPOA 4DC1A 4NJMA 4WKGA 3WFIA 1YGYA 1ZUD1 3ZWAA 1NQTA 3C7AA 4JCOA 3PHHA 2QZ9A 2RHRA 2VNAA 2VHYA 4YACA 1IHYA 2AG8A 1XKQA 4NBVA 5HM8A 2CUKA 1ISJA 1VC2A 2HDHA 2Q46A 4RVDA 5A9SB 2WTBA 2ZTLA 3DEYX 4HBGA 4XQCA 2O2SA 2XPCA 1CETA 3QA9A 3UAGA 1XR3A 4BNIA 5EERA 3EVNA 1GAEO 5ITWA 5ITVA 3OJOA 4FJ2A 3G0OA 2PZLA 5ER9A 4W99A 2D0IA 4NMHA 1F14A 4BGEA 2Q99A 4WEOA 4D42A 2P9CA 1QG6A 2BF7A 1VL8A 3DHNA 4ALMA 2OUIA 2RCYA 1MXFA 4R54A 2VN8A 2CMDA 4QO8A 4EZBA 3WYCA 1VRWA 2OBYA 1U3TA 2IODA 3EZLA 5I7VA 3RC9A 3VVBA 2B5VA 3B70A 4WLNA 4BQRA 3DBRA 1EBFA 4C4OA 1WZEA 2FOIA 2BLLA 2CZCA 2HRBA 3OIGA 4OYRA 3TN7A 3D64A 3GUYA 5G0SA 4TSKA 3IUSA 5I8ZA 3RUCA 2BKAA 2X23A 4IDBA 2VYNA 1IZ0A 2C0CA 4PLTA 1F8FA 4BS9A 2DVMA 3QWAA 3H3JA 1HDCA 3MCVA 1UR5A 2VRBA 4CR6A 1QRRA 2Y99A 3RUDA 1DFGA 4YBZA 4I8XA 3F5QA 1MFPA 4CM9D 2EP5A 1W4ZA 2VUTA 3JQGB 3G1UA 1KC3A 1XCBA 1S6YA 3ZWBA 2GLXA 3AFNA 4FFOA 4DYDA 3Q6IA 3FRJA 4OM8A 1GADO 3DZBA 5A3VA 5IFLA 3KYDB 5JDIC 3RUFA 5A9SA 3MJEA 4RO0A 5JDCA 3OF2A 1SBYA 4DPLA 2X58A 2NNLD 5TJHA 4HADA 4YAGA 3BTOA 4GKBA 2P68A 1J5PA 1AN9A 3F46A 3GH3A 2B5WA 1F8GA 1YQDA 3ZU2A 4WOJA 3WR5A 4J7CA 3AUTA 3AY6A 2PD4A 2FN7A 1E7YA 3LK7A 1M76A 3ZNPA 4K9DA 4YJFA 3H8VA 2Y1DA 4UUOA 1QXSA 3EGOA 3ENNA 5DZSA 2H5LA 5DT9A 2PD6A 3LVFO 4DPMA 4E5YA 1DAOA 2DM6A 4OH1A 1TLTA 2P9EA 1QKIA 2PLAA 4L9RA 1Y81A 4TKLA 5IN5A 4J1NA 5CFZA 2ZYAA 3RBXA 3UW3A 1E3WA 5ICMA 3JYPA 4HUJA 2Y66A 2DT5A 4EITA 1B8UA 5I7FA 4CMJA 5CEJA 1PEDA 4EUHA 3LF1A 4IJKA 4FDAA 1CQJA 3F6YA 5FF9A 3JCZA 2J8ZA 4J4TA 2Y1EA 3TQHA 1E7WA 1O9BA 1ZKMA 1ONPA 1I01A 1DC5A 3O03A 4TZKA 2NU8A 4PVDA 3CEAA 2NVBA 2C54A 1Y9AA 3AY3A 4WK6A 4ND3A 4YDRA 3C1OA 5KJEA 4BNWA 3I9KA 1QMGA 3JQ9C 4WUVA 1T2AA 1XU7A 4IPTA 3D5QA 4YAKA 3PEFA 4BNGA 3HB4X 4H7PA 4Z0HO 1BW9A 5BQFA 2CVZA 1ULSA 3WNQA 1WZIA 1ZW1A 4ZQEA 3RCBA 2QYSA 1I0ZA 4UREA 1VSUA 2NVUA 3DL2A 1NBOA 3Q3CA 3WYBA 1E7SA 2NACA 3AI3A 4NU6A 3RUAA 1Y8QA 3PWSA 1T25A 5KOIA 2VWQA 1SO8A 2AG5A 2OP1A 4J7XA 1MP0A 1P1IA 5G2OA 2GZ2A 4YCAA 4M86A 5F1KA 3I9MA 3QWFA 4GL4A 5JY1A 1KY4A 2ZB3A 3SJ7A 3UICA 4M49A 1U3WA 4R01A 3GVXA 4TWRA 3ST7A 1N9GB 1B7GO 4U6SA 5EMHA 4UVDA 3E8XA 4YPOA 3KBOA 4N18A 3AI1A 2NU9A 3OETA 2HJSA 5DN9A 2J3HA 3GPDG 1WDLA 3KXDA 1RYDA 4O0LA 3CUKA 1YL5A 4IGEA 1PJQA 2AE2A 3DZGA 5A9RA 1FJHA 3ZN2A 4YYZA 2I67A 4XQ9A 5MGBA 5B4VA 3DWFA 5JCXA 5TT0A 4DL9A 1M6HA 2RIRA 4L73A 3A14A 4U8GA 3ROPA 1QV6A 2EP7A 1NFFA 2NLOA 2H9IA 3PQFA 5A1TA 3KOUA 4P4GA 4WCFA 1DJNA 1W73A 5KJCA 5TJ9A 4QXMA 4QX6A 2WD8A 3RUEA 3VH3A 3GVIA 4RVFA 4IS3A 3FTNA 1OI7A 3AU9A 2VTEA 3U4DA 5BNTA 2F1KA 1DC4A 4PLWA 1UH5A 1E77A 1ZSVA 1E1KA 2H63A 4RLSA 5AOVA 4D79A 2AW5A 2WWRA 5TC4A 2I76A 1JKIA 1KVSA 2WE7A 1R0LA 5L40A 8ADHA 2E4AA 3CIFA 4XA8A 3IJRA 4WCFC 1R0SA 3S2IA 1Y8RB 4OKIA 3AFMA 1HWYA 3VH1A 1I32A 3ZU4A 4A2CA 3WJ7A 4UUPA 4I1IA 5JFOA 4FD3A 1PQUA 3C8MA 3F4BA 4AJHA 1U2DA 3QWIA 4ND2A 4A03A 1NVMB 5H82A 3LC2O 2HJRA 4MINA 2QZZA 3GDOA 2X5KO 5JXWA 1UZNA 1N2SA 3WDSA 2DBZA 5BNIA 2PTGA 1B8VA 3FR7A 1IYZA 3D3EA 3M2TA 1ONOA 3IJPA 4OL9A 1E7QA 3SLGA 2NUAA 2VWGA 4UEJA 4ALLA 2P4QA 2G5CA 1R4NB 1U3VA 2VNSA 2UVDA 4GVXA 1EEHA 4YJGB 1NVTA 2X22A 3FBGA 1UP4A 3HJAA 4A26A 3DZKA 1KIFA 1YONA 1T1RA 3EZYA 1SNYA 4P4LA 2C7VA 2PR2A 4AJEA 2Q3EA 4NJMB 5JBIA 1W0CA 2O50A 3QRWA 4CM4B 1Q0LA 3K31A 3BHJA 1ZSYA 3WBBA 4BO6A 2PD3A 4FC7A 1EZ4A 2Q1TA 2I3AA 4FOSA 3ZHBA 3VZPA 2VT2A 2YFHA 1PSDA 3GY0A 4QTZA 4UVEA 4DLLA 1OFGA 1PGPA 4R4JA 1FK8A 1NWCA 1JQBA 4YVFA 3V1YA 4MVJD 2O4CA 4B7UA 4CL8A 3PZRA 3HDJA 1PR3A 3T7EA 3GEGA 1O89A 3ROKA 1EVZA 4JP2A 3PHJA 5JAMA 1NP3A 1BVRA 1F0YA 5CDTA 3PK0A 1Y8RA 2DBRA 3JSAA 1KOLA 2OZPA 1K89A 3DAGA 3M2PA 3GHYA 3NUGA 1EQ2A 1ZXLA 1O94A 4J16A 4XEHA 3TFQA 3HFGA 1I3KA 2WEKA 1IPEA 1DHTA 4LMRA 1UAYA 2IEDA 2OORA 3R3JA 1QYWA 4RV9A 4R1NA 3BMCB 3GQVA 1LDGA 5IDQA 1Y5MA 1V3VA 2IZZA 3BMNA 1UXJA 3I9NA 3JQAA 4L4XA 5JAZA 3KYDA 3VZSA 1LLQA 2YUTA 2VRCD 3A9WA 3PYLA 4KUEA 3SC4A 4UVHA 2ZQZA 2Q1WA 4E5NA 1Z75A 3DBVO 2JCXA 3AY7A 4GWKA 3OBBA 4CLOA 3C85A 4DUPA 2P5UA 4XDYA 2VYVD 5DP2A 3WFJA 4GX2A 3OQBA 5A05A 4K28A 5EINA 1DJQA 2D3TA 4PLFA 2Y05A 1HRDA 1GTMA 5IDXA 4J7UA 3WNVA 1K0UA 3OQ1A 4BO7A 3GVPA 2Q2QA 4UULA 3TFOA 4R1UA 5IZCA 4CV0A 4C7KA 1GYPA 4J2HA 1GPDG 5GZ3A 3CTMA 2Z1MA 2D5CA 3D4PA 1E6UA 1H6AA 3V2HA 4AJPA 4FPXA 1L7DA 3UH1A 4DTIA 1V6AA 4YXFA 1T2CA 2H1SA 4BV9A 1DDOA 2QX7A 4PG4A 3D3WB 1VL6A 1PTJA 5BNFA 4W7HA 4YRAA 3COSA 4JNKA 4J9VA 1I33A 1SC6A 2V6BA 4OGWA 3BIOA 1XIVA 2VHWA 3JQ9A 3WGYA 1YE3A 4AJ2A 1U8XX 3AW9A 3FNFA 3DC2A 4M55A 2XOXA 3JYLA 3WS7A 4N5MA 5CHEA 3SVTA 1QP8A 4YJHB 5B1YA 2BD0A 3L77A 1V9LA 1F17A 2QQ5A 3W8FA 3RKUA 3WICA 1BHSA 1DEHA 2HQ1A 2PZMA 2PGLA 3VPFA 2DC1A 4TKMA 3F4LA 3ORFA 5DBFA 3HSKA 3Q2KA 3WGQA 1FF9A 5DCYA 4AJKA 5IXSA 4K6FA 1JAYA 3IC5A 2EF1A 1YOVA 2R2GA 4KMSA 4RF3A 3KETA 3EAGA 1DLIA 1E5LA 1M2WA 1PJCA 1T2EA 5A04A 5H81A 2HK9A 3DHEA 3DOJA 3ZNQA 3ZCXA 4EJ0A 5IF3A 2O2YA 4CV2A 4Z9YA 3JQFC 3ZU5A 2Y67A 2NQTA 1V3UA 4U5QA 1PL7A 1SCUA 1U9JA 2D1YA 3CINA 5KIAA 3IMFA 1ZSNA 5TQVA 2POQX 2FPPA 4RQUA 2EGHA 4B8WA 3D1LA 3PIIA 5MDHA 1PZHA 4KQWA 4TVBA 3SX2A 3OSUA 3ZDFA 5K9ZA 4J90A 1O6ZA 2GRAA 2FR8A 3ZHZA 3BTUA 1BW9B 4Q3BA 3WGOA 4YRDA 5L3ZA 2YQ5A 3OECA 4CLHA 1HZJA 2GR9A 4FGWA 2W4QA 1EDOA 4JJGA 4MP3A 1ADCA 1BDMA 4LGVA 3PGXA 4EEXA 4L0QA 3R6DA 4GAEA 1R0KA 4LN1A 3ZWMA 3QVOA 1MA0A 2JL1A 1AXGA 4ZU3A 2X5JO 4Y67A 2VYVA 4LW8A 1UXIA 3DQPA 1LDMA 4H16A 2HMWA 4U0KA 3GNQA 4DIBA 2CFCA 1LSUA 3PWKA 1LLDA 2R6JA 4MOWA 4AJ4A 1I24A 3F9IA 4WNCA 3PTZA 2G82A 1EDZA 3GPIA 3DFZA 2A4KA 3HDQA 3ZHXA 2W2LD 1XG5A 4CPDA 4INAA 3ASUA 3WGHA 4MVJH 5K0ZA 2GASA 4PCVA 1EE9A 1V35A 3WXBA 1ISMA 1LX6A 1VL0A 2Q2WA 2RAFA 1FDSA 1GZ3A 3RFVA 3BA1A 2Z1NA 2AA3A 4CMHA 1QR6A 5JNLA 3E6AA 1PZGA 4TRRA 2Q49A 3P2OA 3FTPA 1N7GA 4G65A 1PS9A 1YB1A 1IE3A 4M89A 2R00C 1JWAB 3JYNA 4MO2A 3T7CA 3ZNOA 4B3IA 4HKTA 5JW6A 1P1FA 3NKLA 3E03A 1BGVA 2GDZA 2UDPA 4IIUA 1NWHA 1GEEA 3IP1A 3UKOA 1A5ZA 1M66A 4OOEA 4BB5A 4KDEA 5HTOA 3ZWYA 1RPNA 2FSSA 3X2EA 5L4NA 4UEOA 1PR9A 3B20A 1LUAA 1TXGA 4L74A 1GZ4A 1IL0A 1B26A 1UXGA 2OMEA 1ZCJA 5C7OO 2VWHA 3DHYA 3PHLA 2FPIA 4LMPA 2GN9A 3ULKA 1ZK0A 4ZD6A 4FFPA 3ONDA 3A06A 3QV1A 4IDEA 4FOOA 4R5HA 4WOKA 2B83A 4JP3A 3KTDA 4I08A 3UCXA 2PZKA 4JN6B 5B4UA 4CMEA 3E9MA 4DMMA 5FWNA 2X9VA 4OSPA 4Q39A 1ZK4A 2VT3A 3VAZA 3VZRA 2CVQA 4YEDA 2EEZA 1G0OA 4E5PA 4GBJA 3PLNA 4D43A 2VHZA 3O26A 2Y0EA 1KYQA 4DQUA 3WTBA 2GGSA 1C1XA 2ZB4A 1BXGA 4XB2A 1TT5B 1UZLA 4ND4A 2B4TO 4AJIA 1ID1A 4CR7A 4DIFA 2G0TA 4NK5A 4CM6A 3QWBA 4OSOA 1ZO8A 2QW8A 2RHCA 3TRIA 2YJZA 1XQ6A 4EUFA 3MJSA 1YVEI 1W8DA 5DP1A 2C59A 4IDGA 1JKJA 2JD0A 1D4FA 3KLMX 2Y1OA 2ZCVA 3A28A 3TSCA 2QRKA 5CDSA 3GK3A 4DYVA 5FI5A 3F1KA 2AEMA 1XYGA 2Q1SA 3L0DA 3BTVA 3H2SA 4ID9A 1BG6A 3UCFA 3UUWA 3RU7A 1FMCA 4CM3A 3RJ9A 3SEFA 1NHWA 1Z73A 1YB5A 1QLHA 3WSWA 1Y7TA 1YJQA 1JKFA 3OA0A 3LSYA 1VPDA 1R16A 3BMQB 1Q1NA 2O3RA 1P1KA 1XU9A 4E2XA 3K8ZA 1LI4A 2DLDA 2CSUA 3AU8A 4IIVA 4YAEA 2A92A 4CM7A 2OO5A 2IZ0A 5G4KB 3LT1A 3S1LA 4BKOA 2YV2A 4WASA 3DMYA 3H9GA 1GU7A 4D0SA 3C1TA 3EMKA 4RQTA 3KHUA 3WIDA 3NV9A 1PZFA 3EYWA 1K6JA 5TRTA 3VKUA 5IZ4A 4CM8B 1O8CA 3INTA 3FD8A 4XZ3A 4AJJA 3I9LA 1P1RA 5KJ1A 5CEFA 4I5GA 4TRJA 4RF2A 3PYMA 2UV8A 4DPKA 3WB9A 1H6DA 1ISFA 4CL3A 2V6GA 5F3RA 4BKUA 4KQXA 1Q7GA 4BO0A 4AL4A 5ILGA 1C0KA 4ONEA 3KSDO 3JQAD 1OC2A 2DUUA 4ZQBA 6LDHA 2C2YA 3IAHA 1XA0A 5AXBA 5A02A 5GZ1A 2HSDA 3UN1A 4CV3A 4DA9A 5IN4A 4D46A 4KWHA 4BNJA 2B37A 2VUUA 4NZ9A 1TI7A 3LZ6A 4PG8A 5CG2A 1QSGA 3UFXA 2ZTUA 4BNFA 4ZICA 3ZWWA 1Q0HA 3K73O 1CJCA 1DXYA 2QRJA 2VUSA 3VPSA 3U5TA 4XR4A 1E5QA 1T1SA 4EI2A 4Y8VA 3GEDA 3I1JA 3CH6A 4B4UA 4E30A 3U09A 4J3FA 4MVJE 5COBA 3JD3A 2VOEA 3KEQA 2YDXA 4YJHA 1R66A 3UF0A 1BRMA 4NU5A 2JD2A 3MJ4A 4BMVA 1VI2A 4QUKA 1J4AA 4FW8A 4NPCA 5AXCA 5IDWA 3FN4A 1LC3A 3C1AA 4Q3CA 4I5FA 1LLUA 2YYYA 4CLEA 5LDHA 5CDGA 3V1TC 4GKVA 1A71A 3RAJA 3IKVA 3RI3A 2AEFA 4XRRA 5T67A 4LVUA 4L4SA 3IP3A 3GEMA 3ZV5A 3WG9A 4BMSA 3T4EA 3PDUA 3CZRA 2X4GA 4HFRA 2YQ4A 1SMKA 3QHAA 3JQFA 4IM7A 1I2BA 4KUHA 1CWUA 1GUFA 4U6QA 4BNLA 3PFFA 3MEQA 3LC1O 3TOZA 2OBNA 1I8TA 4IMRA 1DRUA 3DBHB 3I6QA 1UDBA 1SEVA 3A1NA 2VZ8A 3MOGA 5HS6A 2G1UA 1YB4A 3JQBC 3GZNB 4CMBA 4BNVA 1ENPA 1NPYA 3IUPA 2HO5A 2JJYA 3E18A 3PJDA 3RROA 1K3TA 5KJ6A 2O3SA 2YDYA 4GX1A 1GV0A 1D8AA 2EKQA 3FBTA 5KTKA 2V6MA 2I65A 1U7HA 3BMOB 3GAZA 5L7WA 1RJWA 5KVVA 2P91A 3GOHA 2DFDA 5IXYA 1YBAA 1DFHA 1YO6A 2P4HX 2OOSA 2NQ8A 3JD4A 4QFCA 3QIVA 3Q0EA 1HKUA 1DLJA 5C37A 3LU1A 5JAQA 3RSHA 2LDBA 4XIJA 4XDZA 5ILOA 1LSJA 1R6DA 4O6VA 5U9CA 1OMOA 3NGLA 3L6OO 3OIDA 4NI5A 4OOFA 2JAHA 3E9NA 3Q11A 4PZEA 3ANLA 3O38A 4KWIA 5BSEA 1BWSA 1VJ0A 1SB8A 3WMWA 3WYEA 1XSEA 4EDFA 2W98A 4GSKA 3H3FA 4RCVA 2D8AA 3VZQA 4XJTA 3KV3O 2BI7A 3W6ZA 4BO2A 4ZRMA 3MOIA 2C5AA 4QEDA 4E5KA 1EUCA 4AVYA 5KVSA 2AE1A 2I99A 5I9MA 1X14A 2PY6A 2FZWA 2AQ8A 2W90A 2ZTMA 2NVUB 4LSMA 4QFDA 4BMNA 1QYDA 3H65A 1NYTA 4OHUA 4MKXA 1E6WA 4B4VA 3UHAA 2HU2A 3L4BA 3N7UA 4OQZA 3VHRA 1AXEA 3LQFA 1V3TA 2Q2VA 2HMTA 4FFRA 2B69A 1SAYA 3NT2A 3ZGYA 2X6TA 2YHIA 4N54A 5L4SA 3U4CA 4WCDA 3GHHA 5L95A 1H2BA 1K6XA 1ZIDA 3H9JA 4MP6A 4MVJP 4O1MA 1E1NA 3GZNA 3X2FA
chains in the Genus database with same CATH superfamily
5KAMA 3DXXA 5BUZA 7MHTA 2PUFA 2OHFA 2EQAA 2BELA 5KSOA 3PEEA 5JMPA 4D9CA 1Z4MA 1R6BX 5ICCA 1F6WA 1A0OA 4MYSA 5CFNA 3I42A 3OQPA 3IXLA 5T5QA 3ROFA 1J0CA 1BHQ1 3D2AA 2FMUA 2P2GA 3EA5A 4R8MA 1BSVA 1JDZA 3KYCB 2Z5LA 4H7EA 4LDPA 4WVFA 4CQMB 1NMYA 3JTMA 4RC9A 1R9JA 1UPBA 4XYEA 4A0QA 1QGUA 3IMGA 3F8WA 4GXRA 3SBXA 4E51A 1GWNA 1QPBA 3RYTC 5ES4B 3FF4A 4DLKA 4XYLA 3ICVA 2GCNA 1KEKA 2BRUC 3GVHA 3TH5A 1NFRA 1TDJA 1VFNA 5D8DA 5ECYA 3DOFA 4ZDKA 5A4MS 3ADDA 4CTMA 1VCIA 3MS2A 4KYUA 3C6MA 2DPHA 2EFHB 1MO4A 5EP1A 3TL6A 4XD7D 1R4ZA 4WBNB 2B8TA 5LLDA 4BVAA 1JIUA 1RW4A 2RGBA 4PCLA 3DNPA 1L5VA 5DULA 5TEWA 5GOTA 2NO4A 5CEEA 2CL7X 4NONA 5MFZA 3NHMA 2PX4A 3P7MA 2CXSA 2J3DA 2Z2XA 3I34X 4HUQA 4BKRA 4HAIA 4FGSA 3R9KA 5ECGC 1TF2A 1FX0B 3FPCA 4RORA 5DGIA 4D3XA 2P1ZA 4OA8A 4XJVA 1SHKA 3ETDA 4TSFD 3S99A 4X63A 1VSTA 4IG9A 1CR0A 1UAGA 4D92A 3EDYA 4TOIA 5CLGA 3HFSA 3CR8A 3TNJA 1PR4A 1U7UA 3BF7A 1TTPB 5C4IA 1M1ZA 3W5AA 4B3JA 1NPDA 3LDFA 4QDZA 1GQQA 4F71A 1FFBA 3AESA 3V5NA 3P19A 3DL7A 4YUVA 4OBBA 3PF8A 4FVTA 1LPPA 1OLOA 1IH8A 3AUSA 4EABA 4DNOA 3ABQB 3S2FA 1EP1B 1YVDA 1UFOA 1W30A 1IVYA 3EZFA 4WKCA 5TQJA 4J1TC 2GBLC 4D45A 4DWOA 2GPWA 5H9WA 1TFRA 2QG6A 4MO9A 5DYYA 5CYGA 1TT7A 3RD5A 3I39X 1CERA 2X8WA 2X14A 1VJ1A 3FHLA 2VP9A 1AKUA 2AYYA 1X1EA 1KJ8A 1L8XA 5HJ5A 1NULA 3X3HA 1Z0KA 2PRKA 2ZUVA 5FYDA 5A5EA 2ZKLA 1WSBA 4ZRDA 5LQNA 2XVZA 3TLBA 3INRA 4JQZA 4CM8A 3GZ4A 1I0LA 2IUYA 3A37A 3FF1A 3QNMA 3UMVA 5C1OA 4A91A 4W9NC 3UY4A 5JS7A 4AWAA 3OKPA 3L6RA 5C34B 1G42A 2MSKA 3HU1A 4NJEA 5HF5A 2WWTA 5AHOA 4AG6A 2NZVG 4CCAA 1JEYB 1HDIA 1NDQA 3NAGA 1T1EA 4RAQA 1T3SA 3CLSD 2ZRAA 2D5AA 3GFOA 1ABBA 3LUHA 4CLXA 2V7TA 3TW4A 4KQJA 4ZAYA 4PNZA 5GY7A 3C45A 3SSOA 4BQFA 3R5FA 4BFSA 2XQKA 4DUYB 2A1UA 3DUFA 4UE6A 1FP7A 1CS0B 1ZNQO 5LYYA 3VTAA 4CI0B 4MRNA 1OWPA 2B4QA 4JVMA 3DS8A 4EKDA 4RD1A 3R7SA 1U7DA 1J2TA 2Z56A 1LPBB 4GMHA 5CD1A 1EU1A 1SXHA 1SUSA 2AN9A 4PHCA 2P9BA 4Q9DA 4JI7B 2I3GA 3DVAA 3ORHA 1PJTA 3GLTA 4NFLA 3FKJA 1JN0A 5TF0A 1RQXA 2IIVA 2R66A 4B9EA 3ZX4A 3I6IA 1HQKA 1R5NA 2YFYA 3OWHA 1GPUA 5IAKA 3U7GA 3RK0A 2QY6A 2NZWA 4EPYA 3W5UA 3CNQS 4QOGA 3OIWA 4C7VA 1AKVA 2FDRA 1KQNA 3UQYS 1VMIA 3ZTTA 4TLMB 4Q15A 2HWYA 1C7RA 3M33A 1ZUWA 1OXVA 2V7PA 4N6NA 5JPIA 5B12A 2HWUA 1G5RA 1KO1A 3AM3A 2HAEA 3CW2A 3R3UA 4DIDA 2NG1A 1RHJA 1PWXA 1K9VF 3O3CA 4IWNA 2F43B 3CH5A 4OHWA 2WOJA 4PLGA 4WNIA 5TGTA 3RS2A 1E3DA 2BZSA 1E0DA 2W8ZA 3IO5A 1RKVA 3KQQA 1L4LA 3I5XA 2AD1A 4PFJA 3AYXB 2OQRA 3B2QA 1TJPB 4QPDA 5BN4B 5K45A 1T3GA 4DBVO 5CH5A 3BMNB 4Z3OA 1NVXQ 4L4RA 4MLCA 1SC3A 2AEJA 3C4JA 1M6NA 3Q9UA 4FR2A 2K2QB 4P4NA 4G81A 1TAGA 2ZAOA 1NBMD 3DFUA 2BUAA 3E5HA 3EODA 4V1CB 1ZEMA 4DXHA 1GNLA 4I99A 4WXMA 2VUHB 1G1AA 3FWKA 3DZIA 4Z9XA 3JQBA 4L72A 1VHLA 2VDOB 4BASA 1UJ6A 2OAEA 3EIOA 4IGFA 1GXSB 1GLNA 4D9BA 3TNFA 4CL2A 2WWGA 2Y1FA 5DBOA 1H3NA 4U2BA 2VPWA 4NOLA 1W85B 5L4LA 1R5OA 2XX3A 1CZHA 3M49A 3UW1A 3I4FA 4R9SA 4NYJQ 1KWKA 5DHFA 4WERA 2EWMA 3PQ6A 3L7DA 2I33A 3ON5A 3WAGA 2CHFA 1K7XB 2OXIA 2FZEA 2VG8A 1KAGA 1Z5GA 2BFFB 2NP7A 3QVTA 3U9SA 3OWOA 3SC2A 1K7FB 1JR3D 5CLFA 2ZYDA 2Q0XA 4H0NA 4HQ0A 1M83A 3CNOA 3C7KA 4PPQA 2PS3A 4V24A 4QM6A 1S9HA 2GILA 2AFHE 4J16C 4ZVVA 4LK3A 4OFBA 4GGMX 3WHKA 4BKPA 3CLSC 2OAP1 4OQPA 1G20A 1HT0A 3MB5A 3N8DA 5C51B 2XB6A 2IBSA 1JVNA 2Z3ZA 1N92A 2KE5A 1ZLXA 1E79A 4C7JA 4DM7A 1D6MA 1U0LA 1J8FA 3DMHA 2RK3A 4GD3Q 4WFQA 4OHYA 4D26A 4CKCB 2CDAA 1ECPA 1UWVA 2I7DA 5AKJA 3B1JA 2EWVA 3BWCA 5FWDA 3W5VA 4F04A 2PUGA 4OUDA 4E2YA 3HJGA 1S4QA 3QLVC 5FPKA 3NBKA 4Q03A 5E9AA 1IOLA 3Q85A 5JE8A 1VPWA 1JHOA 3R4CA 4HLCA 1ID8A 2CK3A 2HUNA 4L7QA 3U80A 4XUCA 1GTZA 2J4CA 4LZNA 3SBEA 1T2UA 2OXEA 4PO3X 2CYCA 2YWJA 4JENA 4EQZA 1Z37A 1SY7A 1UXHA 4G5YA 5JDIA 4D8TA 5ARBA 1PVOA 1M2FA 2WSMA 1LBTA 1MAUA 3T9DA 2P3LA 4J7AA 3PFNA 1BD4A 2G08A 3SBOA 4DCSA 4I1OA 4C0KA 1GAWA 5HUHA 4B09A 2O7NA 3R6LA 1DMRA 1YIDA 1VZ3A 3O4RA 1T1JA 4P80A 3WGGA 1EFLA 2GBFA 2IYPA 3MUFA 4YTEA 1HF3A 1F1BA 3DO5A 2EIHA 4IVRA 4LRXA 3U3OA 3WGIA 3UMSA 4N7JA 1SELA 5CW1A 2VDWB 1OF1A 1W6UA 2XBUA 3A4MA 3LPAA 4QHYA 3ADPA 3R24A 4ZV9A 1Z5VA 2H2GA 4L78A 3FYHA 4NKRA 1XKTA 2OQ2A 2HA4A 2RDMA 5JQGB 4GNRA 3OA2A 1BEUB 1GG2A 1NHGA 1DKPA 2ZUCA 3CGWA 4FR5A 4HAUA 4ITVA 4J6EA 2X19A 5CJJA 3ER8A 1N8NA 1JE1A 2FJUA 1SA0B 2ONYA 2X8AA 3ES9A 3UGJA 2GD1O 2NUTB 3DULA 5LPNA 2VZEA 3KQVA 1WOMA 3K9LA 4P82A 2Z5GA 3TUZC 1A27A 1UANA 3QOWA 1SN7A 1U1CA 1UKBA 2CWDA 3FPKA 1OBOA 1D4AA 4DXAA 1DGQA 1BOFA 3OFNA 3JS5A 1N1DA 2QTBA 4M76B 4E14A 3IDSA 3Q5DA 1V1MA 3AVXA 4CVNA 3R3HA 3DW1X 1XQ1A 2QLMA 5LYJA 4QD3A 4BCDA 4BRWA 1JHQA 2JCSA 4IW3B 1SKYB 2ODAA 5DN6A 3IR6A 1YQGA 2JGKA 2JK0A 2Q7XA 4D0RA 1WB9A 3FE2A 2EARA 4BX8A 5HA5A 4UU0A 2BHLA 2DULA 1XNGA 3PFCA 4R1QA 1XDSA 2CCJA 1VM6A 4ZWNA 1DEXA 1EMDA 2P9HA 2Q2OA 4BYMA 4UHFA 4ZRNA 2O1WA 2W6NA 5J58A 2YXNA 1ISGA 2VHXA 2C3YA 3EDCA 5B5SA 1DQPA 4KQFA 2RSLA 2NUAB 5D3MB 2HHCA 3IRVA 3JALA 4WJZA 2YFQA 3GLGE 1IWBB 3PX2A 1EJ0A 1HE3A 4CNQA 4DT1B 1M1YE 3FTFA 2WMNB 1PFWA 4HV4A 4IJWA 4IWXA 1ESEA 2C5BA 2DU8A 3VC1A 2PA3A 1W25A 3TB4A 4UHJA 2C83A 3OTIA 1R4MA 3OESA 4RL6A 2QP9X 5AJTA 1NE2A 1X80A 2PX0A 3HYNA 4B6EA 1J00A 4Y6PA 3DEIA 8GPBA 4AJ1A 1TTTA 5B7PA 1VKJA 2B30A 2HMSA 4ZC8A 1TRHA 4JT2A 2J3IA 2MTBA 2NV0A 1SQ0A 3CR7A 4OQ4A 4U7HA 5KINB 2R4TA 4P7JA 4E32A 3ILXA 3VJKA 1AMNA 5EFOA 3SDSA 2QU8A 1QV7A 3DOHA 2ILTA 4PPYA 2OV6A 5CTJA 3WQQA 5KB3A 2XXAB 1FQKA 4DCOA 1E1MA 1Q2UA 4DLRA 1RCFA 4KXNA 5CGQB 2VSNA 1NASA 2XUOA 4DCTA 1B0AA 2PO7A 3OEHA 1GQ2A 2OUKA 1IXRC 1J1IA 3DAHA 3FGNA 5KYGA 2IY8A 1IXYA 1HDZA 4DS3A 4PYJA 3L1KA 4Z1MA 3WMFA 1A9YA 4HNUA 4JVOA 3S68A 2BJWA 4C5AA 1Y98A 1UJCA 2FH5B 3QHQA 4KACA 3WJAA 4DLBA 2ZBDA 2WFMA 3S44A 1WY5A 3P2YA 5EJ8A 1Y82A 2DQKA 3QPVA 3RVPA 4CT4B 1Y4AE 3WGMA 1EM6A 3DEHA 2WE8A 1DCTA 4JLBA 2XQJA 1UAAA 3UBMA 2QDKA 3MN1A 3A6ZA 1W2WB 2JD1A 1QFSA 1KJJA 1SCQA 3NFRA 4FSHA 1IM2A 1U7TA 3K96A 3RNLA 5IVKA 1QKKA 3FYUC 4E0BA 3EIQA 1ULBA 1WVGA 1H69A 2ACKA 4OBWA 1E0JA 4NECA 2YNMD 3HCDA 3OSZA 3PGA1 4X94A 4WOBA 2Q0HA 3ITEA 4UTZA 3UKDA 3G68A 4OFXA 3REOA 3KD2A 3WSVA 4D1YA 1Y8AA 3OF3A 3PQ2A 3QK7A 4DDHA 1Z83A 2QMEA 1H93A 3A3PA 3VFDA 5F33A 3L6DA 1M6YA 3ADOA 3LQ2A 3A3OA 3FPJA 2CUTA 2AHRA 4TYWA 2ACWA 2AIRA 4AAYA 3N2EA 1ZGZA 1FCJA 3KHTA 1UDWA 3BEOA 4MYCA 1X15A 1OV6A 3LHDA 4AUNA 2MINA 2PO5A 3OAAD 4XYMA 2K7ZA 1FMTA 1L3IA 2GK6A 3T4PA 3VDNB 5KDLA 3SZGA 4E1AA 3O5AA 3LBYA 1QUFA 3OUTA 1TK2A 2FFQA 4D9HA 1Q7BA 5JAHA 1PSZA 4LYYA 4ESEA 3S27A 4UXIA 2PGOA 1R4MB 3UT5B 3W5DA 1UDCA 3EMVA 3WWYA 4R3WA 2R79A 4KP7A 4HMQA 4QBKA 1KMCA 3EUAA 4RACA 3U48A 4G01B 4HXGA 1CRWG 4Y0NA 5EHGA 1IJBA 1YF3A 1ENYA 1CVRA 1DHRA 2AG6A 2VS1A 3C14C 5DHUA 1ZZGA 5KYXB 3T35A 3K09C 4GOLD 3I01A 1KYYA 1R4AA 1HYGA 1MNAA 2E5FA 3R0ZA 4JLUA 2BMDA 4E33A 4I1PA 1HFEL 2X3YA 3KYJB 4FI3C 4XOUA 5FTKA 3U3XA 1O96B 1A2KC 1UMBA 2FW6A 2BI4A 1NVAA 3BIFA 4F4CA 2XZLA 2BMFA 1VGVA 4KIJA 3H42B 3RFTA 4YRSA 1XRLA 3KQYA 3JY6A 3QOXA 1H2FA 4HC4A 3WQSB 2WYHA 5C5IA 5JYDA 1T6XA 4HQ6A 3OH8A 4ZOCA 3SZRA 1DXOA 4QOIA 4D8XA 2ZROA 2EL7A 3ASZA 3RHSA 1QTQA 1Z0UA 1UP7A 4NATA 4DR1B 2O5VA 2ZS8A 4B8ZA 4D8VA 4MMYB 3UMBA 4P5DA 1HR0B 1NR5A 4FFMA 2XBLA 3W1WA 3TL3A 2EFDB 1KWGA 1DO2A 1LY1A 4A2PA 1EESA 3PEUA 1G5TA 1WW8A 2VDLB 3AV0B 5EJFA 1RKUA 1CJBA 2H4XA 2VT7A 3L18A 2ZRKA 4C29A 4CF3A 4LBVA 3BWEA 3FB1A 1ODLA 3IBFA 2JGDB 5DV9A 3GN2A 5FNVB 4H6VA 1KP2A 1N6LA 3N53A 1QPGA 4KN5A 3JRWA 3ZNNA 5CRIA 3FNRA 2IXTA 4MDHA 1LQTA 4RM2A 4X7MA 5AKKA 2OXRA 2GEBA 2BFCB 1N9ZA 2R84A 2VT6A 3QJGA 2WLSA 3HWRA 3K0CC 1A9RA 4I5EA 4V2UA 3KVYA 1HTTA 2HZBA 3BCHA 3LO5A 2NU7A 4N9WA 1S8NA 3H9QA 3NHJA 5BSRA 3T3HA 3ZKWB 1BS1A 1TC2A 4K8RB 1QZZA 3ANNA 1HDXA 1QLJA 4ZYTA 5JI3E 1JU3A 1X7DA 2DUWA 4JR0A 5GWXA 4EBFA 3M9XA 1SD1A 3QVUA 1UBJS 3ORSA 4IDPA 3X1KA 1MC5A 3NBYC 4G4SP 4Q4LA 4C4TA 2J41A 4P7FA 2QTLA 2VOJA 4QPJC 4B31A 4HVLA 4MUYA 2JCVA 2I03A 1W9MA 5HZKA 1ZXBA 2WMDA 4L8LA 1U8ZA 3UZUA 4V1CA 2I3DA 5DRYA 3MJRA 4YLYA 1BFKA 3NHWA 4WN9B 1NN1A 5CCDA 3MLEA 4EYGA 2AJLI 4I8DA 1Z5UA 1PGOA 4L07A 4PWZA 1K2VN 5JUWA 2EKPA 2UU9B 3SFTA 1D2HA 3A4VA 3AERA 2I9PA 3H5OA 1DJPA 4J1QA 2IHJA 2YMLA 1DCFA 1ZGHA 2PM8A 1E3LA 1C9YA 1ZCZA 3DYIA 3ZY6A 5JC1A 1P60A 2IY9A 4HPJB 5I5EA 1MDFA 2HK6A 5A3JA 5EIOA 4EDHA 3GGPA 3W2HA 2N1BA 1A9QA 2X1HA 3FYDA 3HXTA 4JVNA 4Q1AA 5A0FA 4DGSA 2D3WA 3E1GA 4RH1A 5LWHA 2Q0QA 3IHWA 4MHOA 2H4ZA 3SS9X 1G3QA 4EGFA 1WEHA 2C07A 4GYKA 4DE5A 3SGLA 3GGCA 2EKZA 3NHFA 3ICQB 1OJ7A 4GR9A 3HHPA 3WQHA 2MWMA 5K20A 1YI0A 3ENZA 4F5EA 4RVNA 1Y89A 1X1QA 1WPRA 2O2EA 2ZSAA 4LWOA 3I30X 4B7XA 4ZHQF 3TPCA 5B7GA 4LYFA 5ADVA 3NVKI 3DBHA 5DNYB 4UFNA 1ONNA 5H3HA 1DRKA 4G5XA 2HJ9A 4DVGA 4AY2A 2VHUA 1NIPA 3L84A 2RH5A 4B80A 1KI3A 2GH1A 4MI1A 4XX1A 3AVUA 1BS2A 1N7IA 3S5UA 3QMWA 1YKGA 4OP2A 1SKBA 4NBKA 2I34A 5EJAA 3LFUA 1P6XA 4P7KA 4ARBA 4B7CA 3IL2A 4MPTA 4LNUA 1FDTA 2CYBA 3JASA 1FXSA 5HK8A 2Q0SA 1RYYA 3THWA 1YDGA 2D4AA 4QAJA 1E2BA 4YCNA 5JD4A 1UPXA 1TC1A 4AZVA 2J3KA 1FY2A 1QF6A 2GSDA 1NNUA 2H59A 3I5AA 3K32A 4N8SA 1X2BA 1L7EA 3W5HA 2Z6AA 4CEJB 3B6MA 4RX1A 1SXJB 1A2BA 1VJDA 1W46A 2PLRA 1L7AA 1OLSB 2Y4NA 4URUR 4M8NE 1TM3E 3UANA 1P80A 2QF7A 4BZQA 1XTZA 1GR0A 1XK6A 3AUXA 1HSZA 2R65A 1TO2E 1KZHA 5FBHA 4IOLA 4KR2A 3I62A 4DADA 4YWJA 3LL4A 4HN9A 3ZWPA 4R16A 4EFMA 4BX0A 5KKAA 3OZGA 1CHDA 3DV9A 3JQ8A 1JLLA 2XEDA 1TAQA 4QG3A 1TTQB 5K8JB 3P20A 3D0OA 4IQ8A 4TV9A 5GONB 2F9FA 2VF7A 2X8JA 5JWHA 3PG5A 3HBNA 2FWMX 2R0QC 1HYQA 4RVSA 3UYKA 4BE7B 4WFJA 2ZP1A 5G4LA 4DBZA 4GE0A 1U5CA 1XWFA 4OIMA 5JISA 1GQYA 2CDNA 2GZ1A 4BKQA 5CFRA 2AMFA 1T1GA 1PJAA 4PFKA 2PJDA 3VYWA 1CDOA 3WKAA 1QIIA 2WAMA 2FPWA 5IM4F 4DJFC 4IHQA 4JKIA 1VLHA 3KQKA 2XGJA 1Y7LA 3GFRA 1H3EA 2RB4A 1YHNA 3LBIA 2WC1A 1TKBA 2HEGA 3H2JA 3Q6MA 4QSMA 3VGJA 3LP8A 5FI3A 2O6LA 4JXKA 1HMPA 1UWLA 3ZLBA 1ICIA 1CUDA 2ZWOA 3M4XA 1C2YA 1JSRA 2GJ8A 3GNTA 2IPOA 1V8BA 2G04A 3QW2A 4UTOA 1VKOA 5EC8A 3T9CA 4ALJA 1DC6A 5LZ5A 3UAXA 1JR3A 4KN9S 4EM6A 1EK1A 1HZZA 1Y3BE 3EUFA 4DM3A 1YE8A 2SICE 1NXQA 5FI1B 3KZVA 1B14A 3GJTA 3CKYA 1ZWLA 4EYKA 1PKXA 1PL8A 1VI5A 2I0FA 2J6CA 3K2EA 5EIFA 3SX4A 4HYTA 4XDGA 1NTRA 3E2IA 5ITZA 1U8FO 4RESA 3ZV6A 2A58A 4XRGA 5CG1A 3BSFA 1LQUA 5AUPB 3KJZA 4UZEA 4MUEA 1J2UA 4IF6A 4C6TA 2HN9A 1Z4IA 3D3KA 4OLAA 4RIIA 4TT3D 3LUKA 5HXAA 3ABIA 1U1DA 3H5AA 3CVYA 2DXIA 2ON6A 3A6KA 2F3QA 1XN4A 2GKSA 2VF8A 3GDGA 2QM7A 4CQMA 4O4IB 1ULUA 5EWLB 4MQ5A 4NICA 1KY3A 2YY5A 4QUDA 4CMEC 4GLBA 1M5RA 2JFGA 4JV5B 4IUBS 2QG4A 4JMLA 2CK3D 4KRYA 1U80A 3AF6A 1KA9H 2GWHA 4XTRA 2WY2D 3IB3A 2YS6A 4BVBA 4ESVA 3V2UA 4Q3NA 1D7OA 3TD6A 5HKLA 1KBZA 2XT6A 5DBEX 4E88A 4D9NA 2PUJA 4F7DA 4Z51A 2BGNA 1Q0PA 2ATVA 2H1OA 3ONEA 3GD5A 4GP6A 5IU6A 2WYWA 3FRIA 3K92A 1V7ZA 5G0UA 3WV5A 2Y0PA 1P2VA 4HFMA 5GP1A 3P52A 3OP4A 3CQ9A 5EOVA 4C21A 2BFWA 3HMQA 1KETA 2WINI 1GL3A 3KLPX 1W2HA 3OCWA 5IABA 3HCNA 2P9ZA 4LVCA 3ACCA 2OFPA 2YRFA 3BYZA 2GN8A 4HUQB 3DM9B 4IILA 4C0BA 5EZYA 3GRRA 1UXKA 3E5RA 3R4VA 4XIGS 2JEYA 1JFTA 1KVRA 4EIWA 3CF2A 2QYHA 4OX9B 2JS7A 3R8CA 1TEVA 3GC6A 1FUEA 1NGSA 3P32A 4XCXA 1H05A 3GIWA 4KDCA 2YV3A 4E15A 4CKWA 4LRWA 4HGQA 1RQ2A 3EXEB 2FRVA 4AYXA 2ZZNA 3FDIA 4NYMQ 3DZFA 4OLHA 4X5OA 5AVYA 2FPGA 1MOZA 3AETA 5T4HA 2V4MA 2ZTVA 3QVWA 1MIOA 1D5CA 1UP6A 5DDIP 3DZHA 3KEGA 1TM2A 4D3FA 2VYND 1NXVA 1Q1ZA 2Y1KA 3EVCA 3I9OA 3NWJA 4NHEA 4QO7A 4JI6B 5K6AC 1YB7A 4NCKA 2ZRCA 2C9MA 2QD2A 4P33A 3Q7EA 1NQWA 4PRLA 4B3SB 3NBUA 1SK8A 3TPFA 4I9UA 7REQA 1M10A 4UBKA 1ZOPA 2WD7B 2NPFA 3IQGX 1U7ZA 4OFZA 1P4GA 3ZDAA 4AXBA 4B46A 1C9DB 3DYBA 2CHEA 1S2OA 2J3JA 4FILA 4HXEB 5DXJA 1C8BA 1QDEA 5ENDA 4ZJYA 3THYA 5F78A 1Q1GA 1F3OA 4ATNA 1GGEA 5HGXA 2GA8A 3IPAA 5AKEA 5KTNA 1ZR2A 1J6UA 5JS6A 3D8BA 4XR9A 4KXYA 5FUYA 2NSHA 2GJSA 3PL5A 4E1VA 2YJNA 3CZMA 2Z9BA 1YMQA 5AICA 4UW9A 1F20A 3KT3A 1VMEA 2GBGA 2WM9B 2YZKA 3HXPA 4UMFA 1BAPA 2B0CA 1JHPA 4PLCA 5G0TA 4IZHA 1J39A 4IQFA 3AGQA 3H2KA 3GUHA 5DBGA 4WNAA 4CN8A 5LOVA 2X6RA 3R7FA 4DG5A 4UJ5A 4ZQCB 4DNPA 3IEIA 1HDEA 3QUBA 2O2HA 1MO5A 1P17A 3IVXA 5U1PA 2R5WA 3FPBA 4PLYA 2QTMA 3JAKB 1BKSB 3AESB 4IS2A 5EMNA 5HOEA 2FR1A 4DIOA 1Q0SA 2QTFA 3T3IA 1TRKA 3AEUA 1RFLA 2BP7B 4C1BA 3B9QA 3RE1A 3F8SA 5JPCA 3L7NA 2OG1A 2QX4A 2BDEA 1US8A 4HAOA 4PLVA 1O03A 2J4FA 4EUKA 5I6DA 1XTQA 5B1DA 2UYQA 2HA0A 3QE3A 1O1YA 1P61B 4BNKA 4HFJA 3NGXA 4EUHA 4BO9A 4L76A 1V71A 1P0CA 3OLCX 4EPTA 4ROSA 5KQRA 1X3LA 4M0CA 3KOOA 1KI6B 5B2ZA 5KTMA 1CF9A 1JLHA 4I6EA 5COAA 5FH9A 1I4LD 2ZXUA 1BROA 1RIIA 3JWGA 3ERCA 1GZ6A 1BGXT 2XWBF 3GCXA 2X5OA 3ZXIA 4H7KA 4F12A 1Z6ZA 4C7BA 1W0KD 4NYMR 1E6LA 1JIKA 3C3PA 4UAGA 3C7DB 5CA1B 2AFIE 4IQ4A 1O9HA 1HL3A 2HK7A 1WMBA 1WW3A 2H3EA 1GA6A 2A0YA 4ARAA 1NXSA 1T5BA 1XD9A 2HPHA 4GVPA 1N57A 2WAXA 1M0TA 1RM3A 4LCEA 3PGJA 2G17A 1RHUA 1T4MA 3G7NA 5HG0A 4GXQA 1SXJE 3UJ6A 3QVSA 3W8EA 1ISIA 1Q15A 1GPYA 2REOA 3N2YA 5LLSA 1SD5A 4F11A 1U04A 3HZOA 1RRMA 1VG0B 1QJCA 1L8AA 2CF5A 3LNCA 2QTWB 3P9RA 3B9RA 4J0EA 4Q82A 4QU9A 1P1JA 1Z5OA 2CLFB 3A4IA 3NIFB 5DHPA 1C9KA 5IAGA 5L9AA 5GADl 4RMGA 4YRJA 1NFQA 4FN5A 1K3UB 1O7JA 4E6EA 3B3JA 3KM0A 3PUJA 3RRXA 3AM4A 3V8BA 2VHVA 2YNMC 3KX2A 1PVVA 3TLKA 3BD9A 3CLRC 2CNLA 4K87A 4R7TA 4E5MA 4W5QA 2WZDA 3FCYA 1EJBA 1KJNA 2CXPA 2X9GA 3BGOS 3MSXA 3Q1LA 5AOAA 5HCNA 2IU6A 4PS1A 2QP4A 1G20E 5K3EA 4RPGA 1BQ3A 4UEQA 4JBWA 2VDPB 3A6EA 4LQLA 3TOSA 3LDUA 1RAHA 1E99A 4DMCA 4EO4A 1DI0A 2YMPA 4LVNA 5FFFA 5HUQA 4GDMA 3ET4A 3HMKA 3P1JA 2QPTA 3M83A 4HX5A 4XVQA 3QG5A 2GDJA 4QTXA 3O1JC 1QE5A 3OIFA 3K94A 1H1LA 3PI6A 1T24A 4FCTA 2IYOA 4RJLA 5CLLA 3KQTA 2BPOA 3K8YA 4YA6A 2BTQB 3LQQA 1E3EA 5AXAA 5H3LA 5EMKA 4IMJB 5KWEA 1INLA 4I6GA 2CLMB 4GMFA 3C24A 3QVXA 2CXQA 4QUHA 2UYGA 1SEPA 2VLIA 1KEPA 2AKAB 3TINA 1GPMA 1LI7A 1S9DA 3N8IA 3NKFA 4DQXA 5GIPE 4K6OA 4G0UA 3F3MA 2P3SA 4IZIA 4ZYVA 1QYVA 4D4IA 5BMVA 5J3JA 5C8YF 4C01A 3IODA 3W5BA 4NU8X 2P9GA 3FB4A 3OHPA 4KCGA 3WLFA 1MC4A 2VTBA 2ODBA 3JRXA 1PWHA 1EGHA 4HDSA 1Z0SA 2P5YA 1KQPA 1U2ZA 2GCGA 2ZYHA 1QR2A 1QCZA 1A7UA 2P4EA 2TMGA 1X92A 3VU8A 3C1UA 2PX3A 3NP7A 3M6FA 1KI7A 2YHIB 5DLYA 3K6SB 3EZ7A 4J94A 3FMPB 3DDCA 1G8HA 2FEMA 5AJYA 1GZ5A 4NPHA 3P9QA 5LZ8A 1GXSA 3KPWA 1GCUA 2F1IA 1H1TA 2YBEA 3FCCA 3A9VA 3OJCA 3IJEB 4GGPA 2A59A 4FN4A 4RVCA 2HHHB 4B3RB 3E53A 3RODA 4XB6B 2E4UA 1UC9A 3G2LA 4FS3A 1OA1A 1N5JA 1DPFA 3JASB 5INTA 2QV0A 1OT3A 1U6KA 3AC0A 2NZ2A 3D3JA 3WBKA 4BNZA 4R9RA 1L7XA 4Q00A 1G98A 2IOQA 1FP1D 2FW0A 3IILA 4N7MA 2BHRA 3BE5A 2I78A 2YWRA 1EX9A 5C7YA 2K4MA 3IIIA 4NBSA 4MI6A 3TL2A 2F4VB 4NL4H 4EG0A 1RC0A 4MPDA 2ZAIA 1C0LA 4XFDA 5ALGA 1DBVO 1YVPA 3OBIA 2AV6A 3AONB 2Q1UA 2BGGA 1FYEA 1AQLA 1OOEA 1H0SA 4Z4FA 2F7SA 3AIIA 3KBBA 2XLCA 3LLSA 2QS9A 3L8DA 4XARA 1N0WA 1AB5A 4ETIA 2CD9A 4TTAA 4E7OA 4H15A 1M34E 4OHMA 4QZVA 4IKEA 3PQEA 1W44A 2HDWA 1EK5A 4CCWA 5I7EA 3L1IA 1SCIA 1YCDA 2DBYA 3BRQA 3EBLA 4G26A 3DB1A 5E38A 4BUZA 1XJ0A 5ADHA 1LGYA 3N28A 4HQLA 1GLVA 3U26A 2CNKA 3EPHA 1VHQA 1RD4A 5DXFA 9ABPA 1Q0TA 4NFHA 2JIQA 4H7JA 1FUKA 1A77A 1FZQA 2ISSD 3C4QA 3DB2A 3ED1A 3T0FA 1U90A 4JCCA 3ZD9A 5KNCA 3E4DA 2PNFA 3K0FB 4PHHA 4AKEA 2HGSA 3NIWA 3ETGA 1O58A 3LPCA 4RWEA 1D5WA 4UHKA 3RRMA 4I5DA 1CD5A 3LHFA 3A70A 3KEOA 5ALPA 2VR1A 1WCWA 2LTAA 1NAHA 1KAOA 4LGMA 3JQ7B 1ZIOA 3OO0A 4HEA1 4OCZA 2WJIA 1X8JA 4Z2YA 3U4HA 2HO4A 4LDAA 4XIYA 1AMOA 5TNXA 1WHSA 4EL5A 4LZAA 4MPPA 4CIAA 1D6SA 3CNNA 4YUXA 4JC0A 2DCUA 1JI3A 3L1HA 4XD2A 4JC8A 2AI3A 2BGKA 4RTPA 1BDHA 3M70A 3RVSA 1D1TA 2WSLA 5F7JA 2RHLA 4UTPA 3MFQA 4MVJM 4BNNA 3JR7A 3LWBA 3LZDA 5AVOA 1NM5A 2ZKIA 4YT8A 4ZEMA 1EFAA 2BR5A 2H1FA 3R1IA 3MWKA 1J20A 4XJSA 3NCHA 1DOHA 3VTFA 1RI2A 5BQPA 2IU0A 4GH5A 4TRNA 3D31A 1I2CA 4N48A 1KJWA 3JWPA 4G86A 3JD0A 1Z4LA 1TQ4A 4UNRA 4IH1A 1BGWA 1ISHA 5IJ9B 3Q41A 1N6PA 1P5ZB 5FV7A 5LJLA 1QIHA 3PUZA 2Q3DA 3I5MA 4KI0A 3U4IA 2ZVDA 4O4JB 4Q18A 3ANSA 1GZ7A 1RSZA 3E7DA 5BY2A 5DNCA 3HJBA 4YFVA 1LWOA 3I9V1 1Y3HA 2W0MA 1N2BA 1Q14A 1ZZEA 2RHTA 2W6ID 3AHHA 3CE6A 4IIJB 4ZVMA 2IHTA 1XTJA 3IR7A 2IS4A 3LDHA 3T8YA 4UMEA 4K0KB 4UARA 4NV3A 2QL9A 3H6KA 1D9ZA 2WHPB 4GLFA 3K70C 1H2RS 2FN3A 4EF5A 1PZXA 4KDRA 4ZIRA 3EZXA 1O0SA 2YWGA 3GJ3A 1E0SA 1E7RA 1AV6A 1KVTA 2QLFA 3TZQA 2IXDA 2NWQA 4MJLA 4B44A 4J6FA 4M8LA 4DZZA 1V2GA 4RHCA 5LA6B 3WA6A 4O2AF 2VATA 3GT4A 4BNTA 4ZGWA 1LTQA 4TMZA 1YTLA 5JMWA 2Z2YA 1T9AA 2G1AA 3C3XA 1CY0A 4BX3A 3Q5GA 4PN3A 4IFBA 3E9QA 4M0LA 2FX2A 3HLYA 3WYDA 5JNUA 5FLXA 2NU6A 1NMXA 3VU0A 1CJUC 3ZLJA 3AUFA 3DTVD 3EXEA 2AVDA 5SYNA 3TD2A 4C6RA 5CX4A 3V4VB 2VKTA 3PWTA 3KQNA 1JHDA 3TAHA 1DBRA 5T64A 1E2LA 1QTRA 5AWFC 1T0IA 5JRJA 3Q8MA 5BYKA 3HG7A 3JQ7A 1VHWA 3OEWA 4N65A 3EVBA 5JLAA 4YUZA 2BCJQ 1HDOA 2YW9A 4W9RA 8LDHA 1QHIA 2H92A 2KQUA 3H1FA 3K4PA 4NH4A 2OBFA 4LF8B 1ZGGA 2A0KA 5K8CA 1ZUNB 3G23A 2BGLA 3KQPA 4U4AA 1XZAA 3WWZA 1M9NA 5CB4F 4UEWA 2FUCA 4P22A 2V55B 1ZK1A 1H2AS 2JFZA 2YINC 4LSZA 1D0VA 2JBAA 4BO8A 1WP4A 4HNHA 2FR0A 1CUUA 2O8FB 2PGDA 4S35A 3W90A 4D9IA 3SAJA 2I4MA 1YT5A 5DOZA 5IM5A 3LOUA 4HWPA 5JASA 5A03A 2OE2A 5D6NA 2PIAA 1JIJA 4BECA 3DTNA 1Q95A 3OM9A 1P1HA 4RIEA 3YASA 4CTKA 5F9FA 3MMNA 1HTWA 4ILKA 1T9CA 4TKVB 1OKKD 3ZI0A 3VR1A 2X9NA 2Y4OA 3VOBA 3E48A 3TMKA 1MAHA 3GO4A 4GBGA 5DNEA 1SHJA 4WKGA 3KOMA 2HBYA 4IHKA 1Y1RA 1ZUD1 3FCSB 4X95A 3L8HA 1JIVA 1SQGA 1VLZA 1YJAA 4A16A 5BN5A 1NQTA 1CBUA 1YC2A 3AQ4A 3C7AA 2VHQA 2CZGA 3CU5A 2QZ9A 4M83A 3V3KA 2B34A 1UOEA 3DGFC 4Q47A 3S0JA 4DA4A 4MDFA 2GVDC 3KIPA 2YNMA 4NEQA 4RTKA 2O8VA 3HXLA 2Q8PA 4YACA 1DX4A 1GKUB 3CF4A 2QRMA 1DV2A 2C4HA 2ZITA 4AY4A 3NETA 2CUKA 1DT3A 4W8GA 4G8CA 3DO6A 4RVDA 2WTBA 2ZTLA 3DEYX 3KJHA 2KWIA 4DABA 5H68A 2RAVA 2OV3A 3L4KA 4QQFA 1NG1A 2JB9A 1UKVY 4JS0A 1E2EA 1E2PA 3A6LA 3QA9A 2ZWVA 3G2QA 5LM3A 4BNIA 1SCJA 3N5CA 1QRAA 5C1IA 1U98A 4ZZ0A 4U5XA 2CLDX 6NULA 1GAEO 5BNZA 4LGYA 4IDQA 1F9EA 4MEJA 5KQMA 5LQKA 2PZLA 4W99A 2E2WA 2D0IA 1HL7A 4WK2B 3AKYA 2GXUA 1TD9A 3AKCA 1MX9A 1SBZA 3ED5A 4D42A 3K9GA 3OQIA 1QG6A 2BF7A 1V1JA 1VL8A 3ENQA 1T5DX 4R8SA 3TGWA 3ZZTA 1A9OA 3IE1A 1VBFA 1MXFA 4YMLA 3QF7A 3AL0C 1NVDA 4V3CA 1N3IA 1IY9A 2I7TA 2CFIA 2LZ0A 2X8BA 4KLCA 4M9SA 3DVQX 3ZJ5A 4Q4JB 4OEHA 4R0MA 1Y34E 2Q6IA 3ESCA 5GTDA 1U3TA 1M8KA 2IODA 2OQVA 3EZLA 4L4ZA 4BJ1A 2HHJA 3MTBA 2HCJB 2BR4A 3EZ9A 3GLUA 3SI7A 3VVBA 2WWFA 4BVJA 2FZLA 3VYTB 4REOA 3EIHA 2W2OA 3B70A 5E2BA 1M74A 1Q44A 3S70A 2DHEA 3Q1KA 4NRDA 2FOIA 2DFKB 1N2CE 2BLLA 3N6XA 3TN7A 1GZHB 1CUYA 3D64A 5B1IA 1E2GA 3TXYA 3IUSA 3TQCA 5HILA 2QD4A 2SHKA 4D6YA 2H06A 4KFSA 4G23A 4ZU1X 4IDBA 4KHZA 1FXUA 4Z99A 4HGNA 4LZJA 2DLCX 1T0BA 1THTA 5IJXA 3W79A 1CJKC 1L9KA 1XKLA 4PGGA 1F8FA 2FV8A 3NC1C 3MUOA 3OZFA 2CB0A 3IUEA 4LPSA 4C76A 2CBXA 1ZGJA 2IQ5A 3H3JA 1RPTA 1Z8NA 1A5TA 1E5DA 1UR5A 1JLRA 1H2YA 1RKBA 3ELYA 1ZDMA 3S40A 4YBZA 4I8XA 4H77A 3F5QA 4NAHA 3IDAA 1D7AA 2XRFA 2C4TA 2AC7A 3FPFA 5BW5A 4G97A 1USVA 4LF9B 3G8AA 4DYDA 3DKRA 1Y3FE 3FRJA 2Q9CA 1GADO 2C1ZA 2PLWA 5D3QA 5IFLA 4YMWA 2C4UA 1T5SA 4DRXA 3CVUA 1M34A 2JDIA 2OZVA 4RO0A 3LBHA 1YR8A 3OF2A 3UMRA 1ADYA 4Z9AA 1N6NA 4JT8A 4BWFB 4DMFA 2ZJ4A 1SOUA 5CLQA 3WIOA 4B9AA 5FRDA 1VJ5A 2X58A 2HH9A 4L8FA 4FCVA 3E2PA 1EVEA 3NQ41 4BVKA 1X6VA 3OCXA 2P68A 3ESDA 3ZDQA 1J5PA 3F90A 1N7JA 2R6ZA 1AN9A 2X0KA 2QORA 2KBEA 3CUEF 4J0JA 1RWNA 1AKMA 1XAJA 2WT8A 3A31A 4K5QA 3O0DA 1PHRA 2VBIA 1O6FA 4BLVA 4J7CA 2VIIA 5CVJA 4OAOA 1ZRMA 2VJNA 4KX5A 3RTAA 2RI1A 3ZNPA 4A0RA 4PZ0A 1A2QA 5AM4A 1U02A 1LW6E 1SCBA 4MW1A 3ZW7A 3P9XA 5K0SA 2LCIA 3PITA 3H8VA 4X3PA 4YJFA 5DASA 1QXSA 2VQFB 5LQUA 3R8FA 3ENNA 5DZSA 2H5LA 2ANBA 1AH2A 3LVFO 3VMFA 4EHAA 2PGIA 4CIVA 3DVSX 3B8HA 4WJLA 4P9NA 4HS9A 1DAOA 3OPVA 2ESRA 2PMEA