3HDJA

The crystal structure of probable ornithine cyclodeaminase from bordetella pertussis tohama i
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
311
structure length
311
Chain Sequence
AMLHIDDAMIEDAVTPQAAQEVLHAAFLDFGRGSAAMQRRVRTEAGGVKLSTLGAVIPGQGVAGAKVYTTIKGQFQFVILLFSAADGRPLATCDAGTLTRKRTAACTVLAAGALARPRSSVLGLFGAGTQGAEHAAQLSARFALEAILVHDPYASPEILERIGRRCGVPARMAAPADIAAQADIVVTATRSTTPLFAGQALRAGAFVGAIGSSLPHTRELDDEALRRARAVVVEWREQTLSEAGDLVLAAPDTGLDAKVVELADVLAGRAAARQADEDIVIYKSVGVGLEDVALAGYAYRRLAAQRGWPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ornithine cyclodeaminase
publication title The crystal structure of probable ornithine cyclodeaminase from Bordetella pertussis Tohama I
rcsb
source organism Bordetella pertussis
molecule tags Structural genomics, unknown function
total genus 106
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1780.10 Alpha Beta 2-Layer Sandwich ornithine cyclodeaminase, domain 1 ornithine cyclodeaminase, domain 1 3hdjA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hdjA02
4PG5A 3FPCA 2A4KA 2O2SA 3RFXA 2G1UA 2EKLA 4BO0A 1E6UA 1GY8A 2AXQA 2O3UA 3KUXA 3RC9A 2QW8A 4L73A 5EQDA 4QO8A 2Y1OA 4CV0A 1YJ8A 5JMWA 2Y0EA 3EUWA 1MLDA 3V1UA 4B4WA 5JY1A 4J91A 5HWSA 5TF4A 4BO8A 2LDXA 1B26A 4E2ZA 4FGWA 5B37A 2EV9A 4IQGA 1KVSA 5L53A 4MVJG 5EERA 1T26A 3H4VA 4UUMA 1A9ZA 4DYVA 3TNLA 1UXJA 3GAZA 1FXSA 1PGPA 4J4HA 1F17A 1BVRA 3F4LA 1VL0A 3KHUA 3GDOA 3CXRA 3NKLA 1X14A 1OC4A 1ZXBA 3HG7A 3L07A 3QP9A 3WB9A 4YTEA 1QV6A 4DPKA 4YRAA 4WASA 4MVJE 3ZWWA 2TMGA 3ROPA 3DHEA 3U5TA 1SEVA 4RPLA 3LZ6A 1WP4A 3ZWAA 3AJRA 4BNLA 3H65A 4IZIA 1SOVA 3P2OA 4PLHA 4BNWA 2PTGA 3E6AA 4U0JA 4TQGA 1B8UA 4N7RA 3EYWA 3CE6A 1NFFA 4PZEA 1KYQA 4N54A 4JK3A 1GZ4A 3I9OA 2YFQA 3G1TA 3O26A 2AEMA 3P2YA 4TZKA 1NAIA 3RKRA 2OUIA 1RKXA 2P4HX 2DLDA 1X7DA 1WZEA 4Q9NA 1RM0A 5MGBA 5F5LA 2GZ3A 2IYPA 4OYRA 2GF2A 3JSAA 4XJTA 5ITVA 4BQPA 2CZCA 3LC7O 2AEJA 5EL0A 3JQ7B 3EW7A 3D4OA 3B1JA 1GUZA 2P5YA 2VRCD 4IJKA 4EUEA 5BQFA 4YBZA 3PJGA 3MJCA 1DPGA 2WMDA 1LSUA 3VZPA 2VRCA 3I9LA 2C7VA 2EP5A 3ITKA 4GI2A 1BGVA 4NR0A 1U5AA 1ISFA 2C0CA 1K89A 2OZPA 2ZB8A 2JHFA 3INGA 4J9VA 4CM5A 3RJ5A 2YHIA 3WWYA 3UN1A 1O95A 3S55A 3U4CA 5KOIA 3PWZA 1D1SA 1HSOA 4CQMD 1HRDA 2GYYA 1QLJA 3R6DA 1EQUA 1HWYA 1LDBA 2QHXA 4QEDA 4RF2A 4JJGA 2NU7A 4ND2A 3VC7A 4CQMA 4A5OA 1Q1NA 1UDBA 2O7QA 1O6ZA 3OIDA 2PH3A 1IZ9A 2WYUA 1Z74A 1LNQA 3DONA 3FNHA 1MC4A 3LU1A 3HB4X 1Y5MA 3BZUA 1WMBA 1NYTA 1U8XX 3WOHA 5G0UA 1PQUA 2FSSA 3DC2A 4GX1A 2ZTMA 3KYDB 1HZJA 5JMPA 5JAZA 1H6CA 4MPDA 5G0VA 1ZO8A 1H2HA 4BKPA 4FC7A 1YXMA 5A02A 5T64A 3UKOA 2B4QA 2IXBA 3C1AA 3KBOA 3GEMA 4BNYA 1U2GA 4HY3A 2I3AA 4R01A 4ZICA 4B7UA 2CY0A 1DHRA 1DDOA 2C54A 3H9UA 1E6WA 1TA4A 3VKUA 1RM5A 5KJFA 1HE2A 3MOGA 4K6CA 1DLJA 3OF2A 3WFJA 5AYVA 3HADA 1TVEA 4NIMA 3ZWPA 2RHRA 1V3UA 2OL4A 2TMDA 3OMLA 1PU2A 4RF4A 5A03A 2SCUA 2ZATA 2EW8A 4MOWA 4MVJA 4BO3A 4NFHA 4LISA 4RCVA 4E33A 1Q2XA 1XA0A 2XPCA 4PIVA 1GPDG 1U7HA 1M2WA 2E4AA 3IKTA 4ZN6A 3JQAA 1F8GA 2DU8A 5FI5A 5JDIA 5U4QA 5ICSA 1LU9A 3DWFA 4WUVA 5T5QA 3UCXA 2FHSA 4CMGA 3VDQA 2Y1CA 3A9WA 3OICA 1ZK3A 4P38A 4D45A 4YRDA 1VLLA 2EHDA 2IEBA 4DBZA 2WEKA 1U3UA 3E82A 1MV8A 3H5NA 3H6KA 4LMRA 4AJEA 2A94A 2BGMA 3AUSA 3S1LA 2RBEA 4INAA 4ALKA 1KETA 1MG0A 2VTDA 3L9XA 3K31A 5L95A 2YW9A 1GQQA 1P1HA 1KC1A 2HJRA 1D7OA 2NVBA 4HFMA 4YB8A 3U62A 1EDOA 1U4SA 1CF2O 2QQ5A 2Y1GA 8LDHA 5TLSA 1UP6A 1I01A 4IUYA 1AXGA 1VM6A 3RUFA 1XQ1A 1AN9A 4LVUA 4DBVO 1FMCA 3PHJA 4U7WA 1PZFA 3C7DB 4YPOA 1B14A 1IUKA 2AQHA 1W73A 1ZUD1 4Y67A 3WTCA 1LLCA 3L9WA 1F8FA 5FFFA 1P1IA 3QVXA 1SB8A 1Z82A 2I5PO 2VZ8A 3TN7A 2V6BA 3E18A 2PNFA 3QWBA 1P77A 3TSCA 1G1AA 3HFSA 2VWHA 1YQDA 2DC1A 4CM9D 4WEQA 1K6JA 2FR0A 2FRDA 3NTQA 4URFA 4XRGA 1DC4A 4ZRMA 2UDPA 4E4YA 2DT5A 1I24A 1Y9AA 2HRBA 5DP1A 4BNNA 4BO6A 3AU8A 4DMMA 4UVHA 4KP7A 4L4RA 3BTUA 3KO8A 2NUAA 2E37A 1BDBA 1R16A 1ZK0A 3D3EA 4I9HA 1SBYA 9LDTA 3L6DA 4E2YA 3BXXA 1X13A 3WGIA 3VH1A 1HE3A 4I5GA 2WM3A 4GX5A 3FHLA 1X0XA 1Y8RB 3PWSA 3TWOA 2I76A 4GSKA 1FDVA 2WD7B 4ZQBA 2VTEA 2ILTA 1VI2A 1GQ2A 1M76A 3TZ6A 3WMWA 3PGXA 1YBAA 4BKOA 1NPTO 2P5UA 4BQRA 4AJNA 3HQ4O 1SPXA 2AW5A 3OHSX 2VUTA 1DAPA 4BNKA 3WBBA 4A0SA 1Y8QA 1N9GB 3CSDA 3RC1A 2JFFA 5AXCA 3ZNNA 2X23A 4J7CA 4ROSA 3S2FA 4IGEA 1LRLA 4IJWA 2CMDA 1ONOA 3PFFA 3QWAA 1NBOA 4F3YA 4YT2A 5KVVA 1BG6A 3NRCA 4RLSA 3L0DA 4CLHA 4OGWA 1B15A 3BHJA 2X6TA 3AM5A 4CL3A 1ZVMA 2ZB4A 4XYGA 1GD1O 3GC6A 3I23A 1Z7BA 3DOJA 1GDHA 3H9JA 3V5NA 4J1TA 5JDIC 3NJ4A 4XEHA 1R4NA 1UXKA 5I7SA 2PKQP 4WECA 1EQ2A 4WLFA 4WLEA 4DQXA 2CF5A 3JV7A 2WWRA 1J4AA 1PS8A 1NR1A 3GVCA 3TQHA 3RUDA 1I33A 2VNAA 4DLBA 1EUCA 1GEEA 2VYNA 4F45A 3GGPA 4LW8A 2C7GA 2VHVA 2NVWA 3PP8A 5H82A 5JE8A 5KTKA 3IJPA 3JD2A 4DYDA 4R1NA 5B1YA 1QRRA 5KIAA 2ZJ1A 5TJHA 3BTOA 1RM3A 3WGGA 4OXNA 1P3DA 4JCOA 1I3KA 1XQ6A 1HL3A 1DHTA 4JIGA 3A1NA 1HDXA 3WNVA 1EBFA 3WMXA 2JD0A 2D59A 3JD3A 1DIHA 5IDWA 2NVUB 4L74A 3RFVA 5KVCA 2D3TA 4OQZA 5IF3A 2BGKA 4PVCA 3ITDA 3VPSA 2Y68A 4HP8A 4CR6A 1E3EA 3V2UA 1F06A 4R9SA 4ZGWA 1E5QA 3VPXA 3L6OO 3GF4A 1E5LA 4M86A 3ASUA 1ZSYA 2BFAA 2CDBA 1E1MA 4K9DA 3AU9A 3SEFA 3OSUA 1ADFA 1DO8A 4BB5A 4JXKA 1IULA 3GN2A 2C5AA 5EESA 2O3SA 4L8VA 4IZHA 3SBOA 1V35A 1CETA 1B8VA 1LRJA 3MJ4A 2PD4A 4DPLA 2B0JA 2DBRA 2R2GA 3ZZNA 1ULSA 4JP3A 3SX2A 3WIDA 2Q2VA 2VWQA 3GFBA 3IMFA 3TRIA 5FWNA 5L9AA 2GERA 4O0LA 2UYYA 3V8BA 2DFVA 3HZZA 4R3NA 2X5KO 1UXHA 1HEUA 4B7XA 3AM4A 4E6PA 1ZMOA 3KLPX 2PZKA 5CPFA 4RZIA 1MXFA 3NYWA 4XQGA 1HLDA 1MG5A 3I52A 2X9GA 1TLTA 1HXHA 5H81A 3ZWNA 3K2BA 3GEDA 4HNHA 4CM7A 4EGFA 4AVYA 3I83A 4Z9FA 1PJTA 1NWCA 3JQ6A 3U49A 1U2DA 1NQAO 5L40A 1LC3A 4GL4A 2DBQA 2HAEA 5L45A 4M8SA 2ZYAA 1O0SA 1YGYA 1EUZA 5FF9A 1B7GO 4XD2A 1DFHA 1KEUA 1C0LA 4B3HA 4FJ0A 5BSHA 1D1TA 1R0SA 2UV8A 1R0LA 3EVTA 1HDYA 2FOIA 2JKVA 1LLDA 1X7HA 5L4LA 1QV7A 3C8MA 1QSGA 2NQ8A 1D8AA 3GA0A 1R12A 1ZK1A 4Z3KA 3RUAA 1DB3A 1K5HA 1QYDA 4IINA 3LQFA 3RU7A 1WAMA 3IOYA 4BNVA 2GN9A 3LT2A 2Z5LA 4ND4A 5DZSA 2FR1A 5CDTA 4R68A 4E2WA 2DTXA 2JJYA 5DOVA 3RCBA 3T7EA 3WWZA 4A26A 2HU2A 4EDFA 1NASA 1PJQA 2AQ8A 1X1TA 3L4SO 3JTMA 3GRKA 4J43A 4JGBA 5DULA 3KV3O 1LA2A 5L7WA 2VOEA 1NWHA 4XQCA 5JLAA 4CL8A 4CPDA 2DVMA 2YV2A 4BL5A 1Q0LA 1PZGA 4JROA 1NHWA 1XKQA 2EIHA 3NGXA 4B4VA 4RPJA 3QWFA 4CLOA 5K6AC 1EVZA 3O8QA 4D3DA 4OKNA 4AG3A 4BV8A 4PFJA 1KEVA 2J3HA 3RJ9A 2O3JA 3AM3A 1YE3A 4CR7A 2YHUA 1CDOA 2BFMA 4KWHA 1LX6A 5JW6A 4J1QA 1GU7A 3D7LA 4ND1A 2YHIB 1X1EA 3AY7A 1J49A 5KKCA 5JFOA 3MTGA 1SC6A 3GDGA 3QIVA 1C0KA 4IMRA 3ADOA 1JDJA 3EVNA 1IYZA 3GNQA 3JYNA 1U3TA 1AHIA 4TRJA 5I7VA 3Q11A 3JQBA 4CQMB 5TIIA 3IL2A 5KKAA 2EW2A 3WLEA 4NK4A 1V6AA 5A9RA 3ZHXA 1QORA 1UR5A 3GHHA 4BNHA 3DMTC 3OH8A 3JQCA 5T8KC 1DLIA 4KDFA 4LVCA 5TGDA 4RVGA 1JAYA 2O7SA 1GUYA 2ZB3A 4CODB 3BIOA 5DCYA 4GLOA 4CLEA 4K6FA 4Q3EA 3GMDA 2VUSA 1VRWA 3K2EA 4J6FA 3IP1A 3VHRA 1SZJG 4CLXA 3SC4A 2GO1A 3V1TC 3RD5A 2GGSA 5CG2A 3TZQA 4XRRA 1IPFA 3KTDA 4O63O 5A04A 3LC2O 1YKFA 3TPCA 4PLFA 4ONEA 1E1KA 1JQBA 3AFNA 3RIHA 1JWAB 1A7AA 3JQ9A 5U9CA 1KBZA 1EE9A 1N7GA 3DBHA 4O59O 4Y8VA 4PG8A 1T2FA 1XGKA 4XKJA 4RVSA 2ZYDA 4Z9YA 4OOFA 1YB5A 4QXMA 4OJNA 3A4VA 1R4MA 1EVYA 4FOSA 3F4BA 4BHTA 2Y67A 4ND5A 1WDLA 3R1IA 2BH9A 3BHMA 4M87A 1E1LA 1ZSVA 5B4TA 4IDDA 3DEYX 1BVUA 4Q3DA 3JQAB 1NVGA 3UW3A 1ZCJA 3DZJA 4BNUA 3T4XA 5ILOA 2C07A 3WGOA 5JCXA 2HMWA 5A3JA 2DKNA 5L4NA 1RPNA 1GCUA 4LN1A 5IZCA 5JSFA 5ER6A 1VL8A 3LC1O 4CUJA 4FFPA 5TS3A 2EKPA 4W7HA 5TX7A 5JAQA 1KY4A 2IE0A 2PLAA 4DIBA 4YT8A 3FCOA 2FY8A 4GSLA 4OIMA 1PEDA 3DZKA 2RHCA 1BXZA 1PZEA 1DRUA 3GGOA 3PYLA 1E7WA 1VE9A 2NADA 4XX0A 4ZHSA 5KVQA 3ZHBA 4JNKA 1PIWA 1LI4A 3ZWMA 1C3VA 5BR7A 4XGIA 1WWKA 4KTVE 3FPLA 1PGNA 1B2LA 3BAZA 2AEFA 2JL1A 4RL6A 1C14A 1KOLA 1V0JA 3T4EA 4BO5A 3UH1A 3O4RA 5A5FA 4B4OA 3FR7A 4TZTA 5C7OO 1EFLA 4JBIA 1JW9B 5IFLA 3Q9UA 2XXJA 1E7YA 3FNEA 1YL5A 2ZKLA 4TSKA 2IYOA 1JLLA 1LDMA 2HK7A 4WKGA 3I4FA 4UREA 4JN6B 3ZV4A 1D3AA 1I3LA 4OSPA 2VQ3A 3FBTA 1PSDA 4BNZA 1T1RA 4FFOA 3AUUA 4IM7A 1N1EA 4TRRA 4H16A 4GQAA 4MDHA 5COQA 1A4IA 4YACA 3EC7A 5G0TA 4EITA 3F5QA 3M1AA 1DC6A 3MJEA 3PEFA 4DMLA 3JQBC 5L7TA 1I30A 1PJ3A 3GT0A 5A05A 1EE2A 1QLHA 3CEAA 1YDWA 4IMPA 4BMVA 3CMCO 3I6QA 3OQ6A 3CZRA 1LDYA 3DZIA 3EZLA 3OEYA 4IIVA 1VL6A 5A9SA 3BMOA 3DOCA 1ADGA 4J4BA 4UULA 3WR5A 1TB4A 4TMFA 1HYGA 1ZK2A 3GHYA 3MJTA 5I7FA 1GCOA 4W9NA 3FWNA 4CMBA 4RQUA 4CUZA 4BS9A 2Q49A 2C59A 3H5AA 1Y8QB 1U5CA 2X0RA 3RFTA 4IQ8A 1BW9A 1Z6ZA 2NACA 3HDYA 3EGOA 1WXDA 4LCJA 2EJVA 3I3OA 2D0IA 2UUOA 1ZBQA 4ZQGA 1C1DA 2PGDA 5F3RA 4BKQA 4Y6PA 4BNXA 5DT9A 2VCYA 4IS2A 4CUKA 1FJHA 3ZW9A 5CEEA 3JQ9C 4E0BA 2VHXA 2YV3A 1LEHA 1MXHA 3DQPA 4PLYA 3HFGA 4BO9A 4E5YA 2AE2A 1JWBB 3I9MA 2JAPA 4YJHA 3JD4A 5A06A 4WJZA 1I3NA 2YV1A 1R37A 4W4TA 4E3ZA 3LT4A 3U9LA 4TKMA 2X9VA 4NFSA 3QY9A 2PZMA 1IHYA 1OBFO 2R00A 4PG7A 1CJCA 1Q0HA 1YVEI 3IUPA 4S1VA 3QVWA 1R4NB 2I65A 1MFPA 2Y93A 1QR6A 2BF7A 4FSHA 3JYLA 2IZ0A 3VH3A 1LRKA 3LVFO 4RPHA 4QTZA 5IZCC 1E3IA 1Y1PA 3EMKA 1A5ZA 4BGIA 4IDFA 3PPIA 1JA9A 3VZQA 3NT2A 3G49A 1Q7GA 1E92A 3DB2A 3OA2A 4XYEA 5DNAA 4ALLA 1UZMA 4ALIA 5F1PA 2WDZA 1M66A 3ST7A 2NTNA 1WDKA 4YDRA 2OFPA 1GV0A 1FF9A 5G4KA 3DTTA 4O5OA 2GZ2A 2O2YA 2Y1DA 1UAYA 1R0KA 4ALNA 5G2OA 1Z75A 3AI1A 4UAGA 1AHHA 5DCUA 4OM8A 3R0IA 4DPMA 2C29D 2Y0CA 1T4DA 4BIIA 5HRUA 1GZ6A 4XGNA 3QQPA 2NTVA 3GVIA 1XG5A 4DC1A 2HKIA 4PRKA 1CQIA 3HJAA 2O48X 1KVUA 4EYEA 1E3WA 4IDBA 1U28A 4TKLA 3PDUA 4JQCA 3RUHA 3KZVA 5KNLA 4JJFA 1AGNA 5LC1A 5BNIA 1B0AA 2CSUA 3QVOA 4LMPA 1U1IA 3OJ0A 2OO5A 1Z73A 3E9NA 3ICCA 1K2WA 3ULKA 1E7SA 1K3TA 1LQUA 4MVJD 3WX0A 4C7JA 1JU9A 3UAGA 1HLPA 2EKQA 1XSEA 3DAPA 3L6EA 4M89A 4IIUA 2VT3A 1MFZA 4RORA 2D5CA 1J5PA 4A27A 4ALMA 1MUUA 3JQAD 4XQ9A 4LK3A 5MDHA 2WE8A 5CEJA 4O6VA 3E03A 2H1SA 3E9MA 4KUHA 4R1TA 1YB1A 3DXFA 4OAQA 4L76A 4P4GA 1G0OA 1BRMA 1I2BA 2BELA 4A10A 3OECA 4AJIA 1I3MA 2O3TA 1VJTA 1BXGA 3E9QA 2J5QA 4G5HA 3SC6A 4XA8A 3I4CA 1U8FO 1LDEA 2V6MA 2Q3EA 3QHAA 1R6DA 5IDYA 3QLJA 1LDGA 3GK3A 3RUEA 4W9NC 5H83A 1YBVA 4IGFA 4IDCA 4QQRA 4N18A 1CERA 1HDOA 4Y98A 4GMFA 3ZU5A 3KEQA 3E5MA 2YQ5A 4W99A 3WSWA 1SEPA 4NPCA 4NFYA 3WDSA 3CPSA 1F14A 2G0TA 3GG9A 3BMQA 4BNFA 2AHRA 4XZ3A 4BKUA 5BNFA 5JCJA 3WJAA 3W6ZA 3LF1A 1CQJA 3JYPA 5HBRA 3GZNA 3ORFA 2HO5A 3NDIA 3H7AA 1UUFA 4ZVVA 2IDZA 5CPBA 3SLKA 1V9LA 5JYDA 3WGTA 1H9BA 5I9MA 3D5QA 3I5MA 3A14A 4MVJH 2R00C 3RWBA 4U6QA 5T67A 1ISHA 3H2SA 3VPHA 4H15A 3QW2A 3WGZA 1DC3A 1KERA 4Y9DA 5CDYA 5IJZA 5FYDA 3PDJA 2JD2A 1I2CA 2FMUA 2CVOA 1GAEO 3ETGA 4QUKA 2GASA 1QYWA 5KJ1A 1GFSA 1LLQA 3KXDA 2A9FA 4M54A 2W8ZA 2VRBA 2ZCVA 2Q1WA 3MWDB 4XIYA 4GMGA 2WE7A 4CLOB 4YQZA 2ZQZA 2D1YA 3IUSA 5F1OA 3O8QB 4OO3A 4E5KA 1OZAA 1UP4A 3RC7A 3WSVA 2J3JA 4PLCA 4BNGA 1NM5A 1J6UA 3INTA 1PL7A 4RPGA 1HYEA 5DP2A 3KSDO 4HV4A 3W8FA 3BMNA 4FCCA 1QMGA 3JQ8A 4MVJF 2PA3A 1CRWG 2XXBA 3N7UA 5I8ZA 3W8DA 1NPYA 1GADO 3GUCA 4A73A 2GRAA 3DDNA 1RYEA 2AE1A 3OIGA 2HLPA 1XU7A 3PJDA 4HWKA 3PTZA 2POQX 1HDZA 1B3RA 2BMAA 3AUTA 1YDEA 3C7AA 1I0ZA 3H8VA 2V6GA 2NTJA 4BNJA 4LRTB 3VZSA 4WPGA 1BWSA 5IXYA 4YJDA 1DIBA 3KOUA 3DBRB 2HSDA 1GV1A 3EDMA 1ZW1A 4OL9A 4OSOA 2J6IA 1Z45A 3AW9A 1YWGO 5C5IA 2WYWA 2WJPA 4BMNA 4GKBA 2VHWA 3IP3A 2YDXA 4YJFA 4Q39A 4Q3CA 2Q1UA 1HT0A 1XELA 4CMCA 4IDEA 4G2NA 1E3JA 4J7UA 3HDQA 3VPFA 2OP0A 5COBA 1HZZA 5ES3A 5C7LO 4AJLA 1C0IA 1ZJZA 1R15A 1UXIA 1E7RA 3OEWA 4GGPA 3G3EA 3VOSA 3JQDA 3L4BA 4E31A 1XLTA 4RV9A 4LCEA 4ZQHA 1VKNA 3ZI0A 4XYBA 6ADHA 1QKIA 3PJFA 3FD8A 1H0KA 1DC5A 2AQKA 2VYND 3KSUA 1HF3A 1YONA 1XWFA 3RAJA 4IQ0A 1E1NA 3INRA 3EY4A 1ZXLA 3PRJA 1XDWA 4H7PA 4Z9XA 4HFRA 4AICA 5K6AA 1R4MB 1BHSA 3CUKA 4KWIA 3ZH2A 1KY5A 3B20A 5I8WA 5A9TA 5IAAA 1PQPA 3ETDA 4BGUA 2JAHA 3DZBA 1F0YA 4OH1A 1ZK4A 4G81A 2PKQO 1WPQA 1VPDA 1VJ0A 3GVXA 3LT1A 3NJ8A 3RU9A 3MJVA 1LSSA 1PR9A 2X22A 1P33A 4LGVA 3SJUA 1AUPA 4J3FA 1G0NA 2RH8A 3RKUA 4AJOA 1DBVO 4TVBA 3WTBA 4MVJM 3AFMA 1LXCA 3GNSA 5THQA 1U3WA 2X0NA 1T2CA 1N2SA 1SMKA 4EJ0A 1E3LA 2QYTA 3IIEA 4XR9A 3T7CA 3B1KA 3ON5A 3DMTA 4HUJA 2Y0DA 3WGYA 3QVTA 5T8KA 4N5MA 1B3BA 4QFDA 3OP4A 1UAGA 1LUAA 1LSJA 1ULUA 3FTNA 3ZWOA 4NBVA 4ID9A 2F00A 2PH5A 3PHGA 1T1SA 4F46A 2PGJA 2EEZA 4R51A 3DZFA 3IS3A 1KVRA 1P74A 2H9IA 5ENVA 2GN6A 2DTDA 5A1TA 2NQTA 3PVZA 2A35A 5EN4A 2CUKA 2J5KA 3IKVA 3RI3A 1KEPA 1GTMA 4I5EA 4C7KA 2PY6A 3WYCA 5T57A 1PL6A 1PZHA 2HCTA 2Q2QA 4FW8A 1PS0A 4X54A 1PTJA 3NDRA 2E48A 4ITUA 4D42A 2Y66A 4UUPA 4RVUA 4YAEA 3JYQA 5KVSA 1A7KA 2DUWA 5EMHA 4P8RA 4P4LA 1ZEJA 1JKIA 4QT0A 2X86A 3ANNA 5BNTA 4MKXA 1WZIA 3LLVA 5GZ3A 2ZIZA 4R5MA 4I1IA 5THKA 4CMKA 3FR8A 1DEHA 1PX0A 4Z0TA 3ABIA 3DHNA 1LJ8A 1HE4A 3OQ1A 3ZNOA 1K6IA 4XCVA 4OXKA 3EHEA 3K92A 4RVFA 1I5RA 4E30A 1I2ZA 2QX7A 3F1KA 2Q45A 5DF1A 3BMOB 1V3VA 3GPIA 3DBLA 5AVOA 4WOJA 4PGFA 1IHXA 3GAFA 4BGEA 5BSEA 3FNGA 5KCZA 1Q7CA 1I8TA 3COSA 3NTRA 2DQ4A 3R3JA 1T4BA 3PHIA 4UEKA 4MIOA 4BB6A 2Y1EA 2YYYA 1KEWA 1S7CA 4CV1A 2X0IA 3ASVA 1YBMA 4TWRA 4PLPA 2CD9A 5I9NA 3L4BC 2IRWA 1BW9B 1VSUA 3UF0A 4IBOA 2GN8A 1X7GA 3GFGA 3H9GA 4I5FA 3U4HA 4KUEA 5I7EA 3SVTA 4NG5A 2XOXA 1C1DB 4P22A 4FPXA 3TOXA 4ZA2A 2ZQYA 3DAGA 3TFOA 3JQEA 4J2HA 3QWHA 3Q6IA 1C1XA 4YJHB 4MP6A 1V8BA 2RIRA 4FGSA 4HKTA 4DUPA 2H5LA 2YZ7A 3H9QA 4RLHA 4YQYA 3STHA 3D4NA 3PHLA 3K9QO 3ZDFA 3A28A 3TZHA 1B8PA 3QSGA 4EJ6A 3H3JA 4YCAA 3DMYA 1XHLA 4WCFA 2E49A 4ZU3A 2JD1A 3HN7A 2D2IA 3G0OA 4GVLA 1NR7A 4J49A 1PJLA 4CV3A 2C20A 4YVFA 3C3XA 4E5NA 3CZMA 1KIFA 2FSVA 3QA9A 4J90A 4OXYA 2HUNA 4CM8A 1MC5A 1EVJA 1XYGA 1Y81A 3FI9A 1HDGO 4HFJA 3PIIA 3VKVA 3S2EA 5CDSA 4KZPA 1PGOA 3NV9A 2P2SA 2I99A 5B12A 3ZWXA 1ADBA 3KVOA 3NX4A 4TRNA 3ROKA 3K8ZA 1YJQA 2QZZA 3S2GA 5DDIP 1K6XA 1W8DA 1NFRA 2JCVA 2ZYGA 3KYCA 3AWDA 4NJMA 4PRLA 3L77A 1WW8A 5G4KB 1ZSNA 1M67A 4W82A 1Y6JA 1H6AA 3G1UA 5L51A 2UVDA 1VJ1A 4JBHA 1HE5A 2Y99A 3G79A 4GAEA 1PL8A 5KJCA 2PWZA 4XB2A 1NNUA 4BNTA 1LSOA 4FJ1A 3QVSA 4NJOA 5BSFA 4FFLA 2O3QA 3FF4A 3KLMX 1A9YA 1ISJA 1E3WB 1ADCA 3X2EA 3TF5A 3F46A 1BXKA 3PIDA 1NTOA 5JY6A 1TEHA 1HSZA 3GZ4A 5HA5A 4E5MA 4BNIA 3F3SA 3N58A 4WGGA 2V7PA 3GVPA 3NTOA 2GSDA 3ADPA 3UOGA 4BGVA 2X8LA 4II3A 8ADHA 1G6KA 2QRLA 3HHPA 2JCXA 4MINA 4FC6A 3EAGA 4R1SA 5IDXA 1LBEA 2DFDA 2AG8A 3PLNA 1UXGA 2D8AA 1DIAA 4IJVA 3GUYA 3GVHA 5L7YA 1E6EA 2X4GA 4I9UA 4A7PA 3VDRA 5EINA 2X58A 5EQFA 1OMOA 1E3SA 2ZTLA 3ZGYA 1YB4A 3JQGA 3F6YA 1DJNA 1EMDA 4ZQFA 5TT0A 3KRTA 1M6WA 4CM4A 4PVDA 2EGGA 4CJXA 4MIEA 4E21A 1BXGB 4UUOA 4F6LA 1MB4A 1ENOA 1CWUA 1ZMTA 3VH2A 3ZWBA 1E0DA 1TT5A 3Q2IA 1OAAA 5JXWA 1U3VA 4YXFA 1L7DA 3AOGA 5HM8A 1W4ZA 2ZTUA 3GY0A 1X0VA 4NMHA 2O23A 3HUDA 3GGGA 4GGOA 4RPKA 4D7AA 4IDAA 3BMQB 2NVUA 3VPGA 3DOOA 1GPJA 2X7HA 2HMVA 2Q4BA 2EG9A 4CM3A 1PS9A 2Q50A 5LDHA 1NQ5A 3FN4A 1PQWA 2C2YA 3X2FA 1LTHR 4EZBA 4Z0HO 4CQLA 3K73O 3GZNB 4ND3A 4FFRA 3WGHA 2Q99A 4WLVA 3OIFA 4RO0A 5B4UA 3PFWO 4FDAA 3HSKA 2O4CA 4WEOA 4DA9A 3UUWA 1PJSA 3CINA 3I9KA 3NT5A 2AG5A 4CLDA 4YAKA 3OETA 2Q4EA 5CHEA 2X5JO 3W1VA 1YL6A 4BVAA 1H6DA 2CFCA 3P5SA 5JAIA 3WG9A 3QE3A 1JVBA 4WOKA 2B5VA 3HWRA 5K0ZA 2EGHA 3RUIA 4B79A 4WCFC 3AI3A 3O38A 2B5WA 3NT4A 1ZIDA 3EZYA 4KOAA 4B4UA 1O94A 1ISIA 4GVXA 4LSMA 3GNTA 1PR3A 1FDWA 4CMIA 4EEXA 5FI3A 4EBFA 5CEFA 1EFKA 3NEPX 1EDZA 4HBGA 2J5RA 3E5RA 4Z0PA 3LK7A 1KS9A 3PJEA 4S3MA 1ORRA 5IN5A 4Z6KA 4RF5A 3N74A 4LRSB 5A4DA 1Y5RA 2QRJA 3GLQA 4XYMA 4NBRA 3SJ7A 1UZLA 2EERA 4LSWA 2CVZA 1P45A 3PXXA 1SAYA 4FD3A 3Q9NA 3D64A 5F21A 2WYVA 3TZCA 4MKRA 1FDUA 3BMNB 3JQ8B 2J8ZA 5CP8A 3D3WA 4DWVA 4RDHA 1ONPA 3BHIA 3PGJA 2Z1MA 1BMDA 2B83A 2DUUA 4M1QA 2DAPA 5A9SB 3C85A 1UDCA 1QYXA 3TDKA 3JD0A 2ZK7A 4BV9A 3ZW8A 4CLRA 1GYQA 3C1TA 1IL0A 2OHXA 4WNIA 2G17A 3TJRA 3KB6A 1A27A 3JYOA 2AQIA 4CM6A 5EJ2A 1KVTA 4CMHA 1PWZA 5C3MA 3W8EA 4IPTA 1BDMA 1ZKMA 3DL2A 2YFHA 5GZ6A 2B69A 4KTTE 1DIRA 4Q3AA 4J1SA 4PCVA 4XDYA 5AXAA 4YAGA 1IZ0A 3UICA 1MX3A 4DREA 4DIOA 5IDQA 2NLOA 3WLFA 4WCDA 4YJFB 1NVMB 5ENDA 3LF2A 1Y7TA 2W98A 1P44A 1O8CA 3OJEA 2GN4A 1Z7EA 3VTFA 3PZBA 3MJSA 1O5IA 3WQQA 5JYEA 4KDEA 4UVEA 1NHGA 3H5RA 4HNGA 4MO2A 7ADHA 3LT0A 3D1LA 2OMEA 5B4VA 4ZD6A 3FBGA 2NWQA 3GQVA 2FPIA 3BMCA 3OJFA 4WLUA 5JPIA 4CMAA 2VNSA 1NAHA 4KUGA 2P9GA 2C5EA 3WGQA 4D46A 5C7IO 2EF1A 4Y6SA 5CFZA 2PFGA 4R69A 2ZTVA 2OGUA 4PLGA 4FN4A 1CEQA 4AFNA 4DXHA 1DRWA 3FRJA 3KETA 4UVDA 1YOVA 3V1YA 1V3TA 3LSYA 3OBBA 4GWGA 4WLOA 4RGBA 4C4OA 2D4AA 3B6ZA 1SOWA 3DZHA 1DIGA 4MIYA 4CR8A 3IAHA 1T2EA 2I9PA 1YQGA 3OQBA 5JC8A 4FR5A 1GYPA 4KQWA 1ONNA 2W2KA 2GD1O 4HADA 4U5QA 1RJWA 1W6UA 3CH6A 3HN2A 1P0FA 4KMSA 4R1UA 4YYZA 1LC0A 1H2BA 1I32A 4L9RA 2BI8A 4YA6A 3H9EO 4XDZA 3OA0A 3PYXA 4NZ9A 4GLLA 3TFQA 2AMFA 1YQXA 1Q7BA 2FZWA 2Z1NA 1UDAA 2GNAA 4K26A 4OMUA 3S8MA 3U0BA 2G5CA 2VWGA 2XAAA 3AY3A 3MTJA 1EVIA 4EEZA 3GH3A 1EK6A 3IDSA 4YEDA 3P19A 2QZ9A 4NBUA 3VVBA 1ID1A 4GPD1 2GR9A 1TT7A 3SXPA 4GX0A 2CF6A 2VWPA 4U8GA 4CMEA 5GMOA 3O03A 3Q0EA 5ADHA 4YJGA 5ICMA 1TXGA 3GN1A 3U4DA 4HFNA 1QYCA 2HQ1A 2PK3A 3ONDA 2FPPA 3V2HA 2H6EA 2P91A 3WJ7A 4AL4A 3ZU2A 3U09A 5TSDA 1VC2A 1HDCA 3W4KA 1TI7A 1GR0A 1Y9EA 3ICPA 3VVCA 4FBGA 2FN7A 1LLUA 1N8KA 2FWMX 3IC5A 4OKIA 4QSMA 4YT5A 3GPDG 4AJKA 4BMSA 5IG2A 2OXIA 5A5EA 2IXAA 4R5HA 4B3IA 5JCJD 4R4JA 4K28A 5AQ1A 2OP1A 3E8XA 3LYLA 4GKVA 5G4LA 2PZLA 1J0XO 3LDHA 4DQVA 2NSDA 1S6YA 2BRUA 4RDIA 1UH5A 3DBLB 5DBIA 3WQRA 2QIOA 3UHAA 2BFPA 3QRWA 2YJZA 2Q1TA 4NU6A 5IN4A 4J9UE 4RJTA 1ZZEA 4RZHA 3WQSB 4ZJUA 3DZGA 3GR6A 5L4SA 3KM0A 1ISMA 3PLRA 1ZJYA 2QG4A 3B70A 3OJOA 4J4TA 4W7IA 1DFIA 5JO9A 4D0SA 2JHGA 2IODA 3ZWYA 2Z95A 3I9NA 4YAJA 3ZHYA 4E13A 3OJLA 1YH3A 4JBGA 3ZWCA 5BSGA 3ANMA 3RVDA 5JNLA 3AUAA 1YRLA 1C1XB 4BO2A 2DBVO 2JCYA 4D79A 2I3GA 5HTOA 4YAIA 1SB9A 2GZ1A 1AE1A 4XB1A 1HKUA 3DR3A 2QRKA 3AOEA 5J23A 5JAMA 5I9LA 1OFGA 4DLLA 1ARZA 1DRVA 3K6JA 2FP4A 4WE3A 4FB5A 1C0PA 5JO0A 3C7CB 4WCFB 4A2CA 5L3ZA 3RSHA 5CDGA 2H63A 1ZEMA 3ZWVA 4DQUA 2R6JA 3FWZA 4B8WA 4CM9A 3AK4A 3GEGA 3ENNA 2P4QA 3PI7A 1DOHA 5T6BA 4B8ZA 4CM8B 4XJSA 3HDJA 1GL3A 2B4TO 1DXYA 1A71A 7MDHA 1ENYA 3F1LA 1XR3A 3QJ5A 4FJ2A 4OQYA 4QO7A 2X5OA 2DM6A 4UUNA 3U3XA 4W6ZA 1AXEA 2NNLD 2P9CA 1NVTA 1GUFA 3GG2A 3F5SA 3P7MA 1U9JA 2Y05A 2ET6A 4DC0A 1N7HA 5TNXA 3D5TA 1ML3A 3KYCB 4NJMB 5GZ1A 2BLLA 2EXXA 3BTSA 3R3SA 4O1MA 1NX6A 4R54A 4KQXA 1GEGA 4ESOA 1UZNA 3JD1A 4WNCA 1YL7A 5IZ4A 3KSZO 1BSVA 1PGQA 2GPTA 3ONFA 1GQYA 4CMEC 2B35A 4DTIA 3ZU4A 2PD6A 5JDCA 1QG6A 1E7QA 2O4UX 5CAEA 2V6FA 3JCZA 3GDFA 4EUFA 3HNPA 1GZ3A 5KJ6A 2WD8A 3MCVA 3Q1LA 6LDHA 3DBHB 5DN9A 2IZ1A 1H94A 5A3VA 1P1KA 3WBFA 4XYLA 3JQ7A 1L1FA 4AJJA 3PZRA 1T2DA 1NPDA 4FFNA 1PGJA 4FQ8A 1PJBA 1VSVA 2EJWA 3PK0A 2XF8A 1P31A 2HK8A 3DFUA 3D0OA 1OOEA 5KWEA 1A4UA 3S2IA 2HDHA 2JFHA 4AJHA 3CTMA 3JQGB 3UFXA 1XU9A 1M6HA 3BYZA 4CM4B 2VHZA 4PN3A 5CG1A 4NBTA 3V2GA 4NH4A 2HJSA 4JP2A 3VTZA 4ZRNA 3NGLA 3DHYA 1ZH8A 4TRMA 4UEJA 3Q3CA 4J16A 1TT5B 2RCYA 1IY8A 1RYDA 2IEDA 1B16A 3RC2A 1RM4A 2NU6A 4I8XA 2BKAA 4M55A 2DPHA 3W4IA 4U0KA 3I6IA 3PQFA 1IE3A 3DO5A 1WVGA 4NI5A 3UVEA 1QXSA 3RBZA 2YDYA 4IXTA 2WSBA 5HS6A 5GY7A 2VT2A 3UXYA 5C37A 1X15A 3ZHZA 4BO1A 4YRBA 4Q3NA 5G0WA 3WS7A 2Q1SA 3ZV6A 4N5NA 3WICA 4PZDA 5TT1A 4CQLB 2PV7A 1HYHA 3HE3A 3KYDA 1PJCA 3F9IA 4E5PA 3VZRA 3WXBA 4GH5A 3HDHA 4UVIA 2OORA 3H3FA 3F47A 5COAA 1H5QA 3AOEC 2J3IA 3I9JA 4OHUA 3FTPA 1LQTA 3NUGA 4BKRA 3K96A 1SO8A 1NFQA 1YS4A 1HDRA 2BGLA 2B36A 4CMIB 3M6IA 5KJEA 3NAQA 3ONEA 1LDNA 3M2TA 4PZCA 3ZN2A 2IZZA 3MWEB 1FK8A 5IXSA 1ZFNA 2C2XA 4PG6A 2FR8A 5K9ZA 1OI7A 4II2A 3CKYA 4FIZA 3QWIA 2YUTA 4N5LA 2QYSA 5LCXA 3BTVA 1H6BA 1O89A 4J2OA 4WK6A 2VOJA 5AXDA 4PLZA 3O9ZA 2FPGA 5TJ9A 3IQDB 4B7CA 3D3WB 2NM0A 1UP7A 2Y1FA 4JX8A 2JFGA 4MP8A 2CDAA 4YWJA 4IDGA 4MVJI 4TVOA 3UCEA 1CIVA 3DFZA 5TC4A 2RAFA 4DL9A 1H9AA 3E1KA 4NK5A 3GRPA 1SCUA 4XGKA 4G65A 2VHYA 4D3SA 4IJUA 4CLRB 2BI7A 1NQTA 4ZQEA 3WYEA 1MGOA 1E77A 1N5DA 1H93A 2GCGA 4OOEA 4WLNA 4CMJA 4Z3DA 1PJ4A 2BHLA 5JS6A 5JDCC 5TRTA 2RH4A 3C1OA 3PQEA 2GUGA 4R16A 3RUCA 4DIFA 1NQOA 1QP8A 5F5NA 4A03A 4E32A 3TOZA 4DGSA 2P68A 4MKZA 2HMTA 4R41A 1EUDA 1K0UA 1I10A 2Q2WA 4L75A 1QYVA 3W6UA 3MOIA 3ZNPA 4D43A 4NNJA 4BOYA 3LLSA 2YQ4A 3C24A 3HB5X 1MA0A 3JQFA 4J0FA 3M2PA 1ENPA 2NU8A 2DBZA 4AJ1A 3ZV3A 4EJMA 3RASA 4NDNE 5DBFA 3DBVO 1T24A 4BO7A 1N92A 2FZEA 3RROA 4JLWA 4QECA 2UUPA 2VYVD 2ZJ0A 3EK2A 2V65A 4CV2A 2B37A 1T25A 2BD0A 2D5AA 1EEHA 2F1KA 3BMCB 2VYVA 4Y6RA 2HMUA 1I36A 2C82A 4B3JA 2I67A 1P9LA 2W2LD 4CM1A 2P9EA 1O9BA 2X0JA 2W90A 4GBJA 3ETEA 1FDTA 2W2LA 4EUHA 1WDMA 4L4XA 3U4IA 4BUCA 5JBIA 3DAFA 1KC3A 1YOVB 3GMSA 2GDZA 4NU5A 2PD3A 2NU9A 4M49A 2VZ9A 3RBVA 2HMSA 2DPGA 1Y8RA 3G17A 2WD7A 2G76A 3WNQA 3OFSA 5DOZA 1GYRA 3H2ZA 3AI2A 2G82A 3PHHA 2PKRA 4TROA 2OOSA 1XIVA 2UAGA 1ISGA 2X1HA 3ZU3A 3OM9A 1UJMA 9LDBA 1F12A 2ZCUA 4NBWA 5EIOA 3PWKA 2W2KB 5AOVA 1P1JA 5AXBA 1N9GA 3ZV5A 3DBRA 4P4NA 3SLGA 5F1KA 3NDJA 3ANLA 1NXQA 3I1JA 2EP7A 2E82A 3TL2A 2ZB7A 2GLXA 3TL3A 1MP0A 3VH4A 1CYDA 3PQDA 1FDSA 4AJPA 1IOLA 2Q46A 3B1FA 3UCFA 2WTBA 4QFCA 4J0EA 4JJIA 1YO6A 1P1FA 3MEQA 5EPOA 1JTVA 5HS4A 4MP3A 1N1GA 5LDGA 3FSRA 3K30A 1PWXA 3BA1A 3ZCXA 1P0CA 3WFIA 4RF3A 4XQEA 1WLYA 1DFGA 2I6TA 2OBNA 1DSSG 3W4JA 1ZNQO 3A06A 5TQVA 1PJ2A 2PR2A 3DTYA 3K5PA 4YT4A 4I08A 3ENKA 4ILKA 4PLWA 3ZNQA 1U7TA 5ER9A 4YR9A 3WIEA 4YJGB 3D4PA 3MZ0A 4PLVA 2O50A 4J7XA 2EWMA 1WNTA 4J1NA 3QV1A 4FS3A 4Q3BA 4RVHA 4FOOA 1RWBA 3GOHA 4AJ2A 1U4OA 2YY7A 2AA3A 2W4QA 2LDBA 4RVDA 1E7MA 2HRZA 4NQZA 1L7EA 4D3FA 4DRYA 4HX5A 4D41A 1KVQA 5ITWA 1EZ4A 2OBYA 4GX2A 4PG4A 3TZKA 4BNMA 4L4SA 3PYMA 4FFMA 4IS3A 2I66A 1JAXA 4L0QA 1W0CA 3UGKA 2HK9A 3M1LA 4D44A 3IJRA 4XIJA 4HXYA 3FNFA 1JKJA 4IXWA 5BT9A 4EI2A 2PZJA 4QX6A 1VKOA 1R66A 2CDCA 2CVQA 4ALJA 3AY6A 5ILGA 4H3VA 5G0SA 2B4RO 5DBGA 3JQFC 1HTBA 3E48A 1IPEA 4BO4A 2CNBA 2E6UX 2J3KA 5JC1A 1DAOA 2NV6A 2DTEA 4F6CA 3CMMA 5CDUA 1A72A 2VUUA 4XWYA 4E2XA 3RBXA 1JN0A 4E12A 4DVJA 1P1RA 3ROQA 2X9NA 3KYBA 4GWKA 5FEUA 2A92A 1HETA 2O3RA 4XR4A 1XEAA 4R9RA 1JKFA 4K1LA 3WYBA 1D4FA 1T2AA 3VAZA 4EW6A 1IB6A 1Q0QA 4I9NA 4UVGA 1EK5A 1XCBA 2VN8A 3KEOA 4PLTA 2PGLA 4IY1A 4U6SA 3RQSA 4D0RA 2VZ0A 4MJLA 3ROMA 4AJ4A 1BTOA 1DJQA 4DLAA 1ENZA 1WMAA 3CIFA 4MVJP 1JVSA 4RQTA 5U1PA 2BFOA 1NP3A 3Q2KA 4NHEA 1M75A 1EBUA 4R3WA 1OC2A 5DCWA 4I5DA 1SNYA 4UEOA
chains in the Genus database with same CATH superfamily
1A8PA 2E4UA 3ZY5A 3L7KA 4F12A 2O2SA 1ZITA 3KJNA 3I8XA 3ZUPA 1JDBB 4NPHA 1QX4A 1LPPA 1XROA 1VFPA 3QXCA 2WIKA 3ZX4A 3KUXA 4IHJA 1G5PA 2GWRA 2CFSA 3D2AA 4L73A 4B6PA 4GKKB 1QO0D 4N1AA 1WCWA 2Y1OA 3OZCA 1YJ8A 5ARDA 2HF2A 3EUWA 1MLDA 1QP4A 3A1EA 2HA0A 1PQYA 3HZHA 4Q9AA 2EDAA 2H5EA 3X0DA 4Q15A 2OCGA 2QM0A 4PX9A 2HNKA 1K4YA 2DWPA 1R6UA 4C89A 1DQPA 2JFUA 2XD9A 4TTIA 2CXQA 3G9UA 3JQPA 4FVTA 4MV1A 4PQRA 2C7PA 1KU0A 1TGYA 4EABA 4WBNA 3FYUC 2BGWA 1OR8A 1A9ZA 1BDHA 1T8WA 1UXJA 1XZCA 1FXSA 2ATVA 3GAZA 4J4HA 4Q93A 5FA8A 4DV4B 3PZRA 2F43B 3EIEA 3TW8B 2G7MC 1X14A 1QP7A 3QP9A 1FMFA 1RI3A 2E4XA 1ZJ5A 5IBRA 2X4DA 1NYQA 2JJ1A 2Z9CA 5FQOA 3HN6A 2JHCA 3CO0S 4R7ZA 3QKTA 1KNXA 1QC5A 1SXJE 2BEVA 3T0GA 3H16A 1U5BA 2BLNA 2YMMA 4RPLA 3KDSE 5DTIA 5HOEA 2OBXA 3LZ6A 3NS7A 2A1IA 2HT6A 2PRIA 1SOVA 3P2OA 1XB2A 4OXQA 4R1OA 3E6AA 3PUYA 1O87A 5DLEA 3OQOA 3DV9A 2QAGB 3UMBA 2I91A 5H0IA 2PUVA 1U2SA 3CE6A 1Z4JA 2JCBA 4IIJF 4N9QA 1KYQA 5KNBH 2NN3C 4AJ9A 1GZ4A 5BQ5A 3UANA 4Q1DA 2YFQA 2GNOA 3K1JA 2AEMA 2QT9A 3Q87B 1TF5A 3PC8C 1KJQA 4V0OA 3TKAA 1I94B 5JR3A 3LBYA 2P4HX 2DLDA 1DKOA 2VKQA 5KKNB 4HAOA 4W5OA 2EFHB 5F5LA 1DX4A 1V7PC 2Q41A 4XJTA 1YI8A 4E5VA 4C3ZA 2Y9PB 3NANA 2OXTA 4PYJA 3CKKA 1D9ZA 3LC7O 2D13A 4HNRA 1V5IA 3JQ7B 2DHRA 1FUEA 2FMIA 2PCJA 5DX8A 3P97A 3TTSA 1GUZA 1WLSA 3KZKA 2CHQA 2VRCD 4IJKA 3I1YA 4PGAA 4RA6B 4RSGA 4BKOA 3IUEA 4EPTA 1GNRA 3PJGA 4MPJA 2W6ZA 1LSUA 1OYYA 4U7GA 2EP5A 1KXZA 5HQ3B 2J85A 1UBEA 4GI2A 5ALLA 5ED0A 5FJJA 3DVQX 4C7MA 6REQA 1E2IA 1O95D 2ZRNA 4GOND 4JEUA 1JLKA 3INGA 4J9VA 2YHIA 1TJPB 4PICA 5F77A 1VCNA 3PUXA 3O4FA 2ZWIA 3FKQA 2PMDA 1V4VA 3DMRA 4UHDA 4GS5A 1D1SA 2CCGA 3L8DA 3I64A 3T7RA 2HW8A 5JAPA 1DEOA 2GYYA 3RF7A 1EQUA 1HWYA 2QHXA 3M7IA 4JWTA 4FDUA 1L7OA 1U6KA 2C42A 1UDRA 1LW7A 1Z6PA 2IYQA 2NU7A 4P3PA 1TCVA 2O7QA 2WFLA 4UMDA 3NMUF 2I0FA 4C0XA 1IZ9A 1W5EA 3MERA 2HFKA 4RY9A 3TAHA 1NMXA 4EKEA 1Z74A 1CK4A 3AH8A 3DONA 3H18A 2A9OA 1VJGA 3LP8A 1C8BA 1MC4A 3LU1A 3HB4X 4KGVA 2DH6A 1C0EA 1WMBA 1RI5A 3OZBA 1U8XX 3WOHA 2H29A 1WIWA 5G0UA 3IVCA 3ZY4A 1OBOA 4R0VA 2DPMA 3KYDB 1Z36A 1XDZA 4FKMA 2QROA 4M6WB 1MZVA 1ZO8A 1H2HA 1RYFA 5EWLA 5F2EA 1AY0A 4OJTA 1IEXA 2R11A 5T64A 3UKOA 2IXBA 3GMTA 5HR5A 3KBOA 1TZCA 3GEMA 3WL6A 4BNYA 4HY3A 2I3AA 1MDBA 4K0RA 1DHRA 2C2OA 5K3BA 4WESA 4FYPA 4B0PA 2V7WA 2OV8A 4N0PA 3VKUA 3ZWDA 4V3BA 2GHRA 4K6CA 4ND7A 3DDWA 5DGTA 3WFJA 3MAGA 1RAEA 1TM4E 2RKOA 2LCIA 3OPYA 3VNAA 3SR0A 2L42A 3OZUA 5JZVA 5K0EA 2W2OA 4KXXA 5EWJB 2WU3A 2MINB 2EW8A 1LI5A 4BO3A 4B43A 1NJFA 1PAUA 4UNQA 1SXJA 4DR4B 2H0AA 4N0MA 1T91A 5CT5A 2CNDA 2FX5A 2QF7A 4PIVA 5HIJA 1GKUB 4RCYA 2P6MA 5JPCA 1U7HA 1FTQA 3FPJA 4MMYB 3AVWA 4X20B 5DHFA 5HF6A 3QH4A 4JT9A 4OXXA 2ZS7A 3KOWA 4HTFB 1J2UA 4HXEB 5LQDA 2YNMC 2BPOA 3NGMA 1ORDA 5EJEA 1UWCA 2BHRA 3NUQA 2X8JB 2YVKA 4EX7A 3SDBA 5HJ2A 4WUVA 2BM1A 5CA1B 1GAQA 4NSNA 5T4EA 2FHSA 2OCXA 4CG0A 2G5GX 2R86A 1IJBA 2Y1CA 3A9WA 4CMGA 5EXSA 4IIEA 5LWHA 1VLLA 2CUTA 4QICA 4BX3A 3SYTA 4EYGA 2OPBA 4L9WA 3E8SA 4B6GA 1NW7A 2WEKA 3RRZA 1AMNA 3K2QA 3H5NA 3B13B 2HOQA 3W5JA 2XMZA 4DBLE 3T5CA 4M9UA 1T3GA 4U4AA 3ZBPA 1N6OA 2OHVA 1A8UA 1IXZA 3N59A 1OHHA 2CE2X 4INAA 1BA2A 4O4LF 4C4YA 1FMTA 3ACDA 5FBVB 3L9XA 1U7ZA 3QV2A 3U26A 4EVIA 1CY2A 4V03A 1UQRA 3U4QA 4P54A 4HFMA 2Q28A 3QOWA 4ZVOA 3DFKA 4EG8A 4IG4A 4DUGD 5IJAA 4X7RA 1U4SA 3D0KA 1DTSA 3K5IA 4ZZ2A 3MT9A 1AB6A 1EEXB 3DYIA 3RUFA 4G0QA 1XQ1A 2BSAA 1Z88A 4I1SA 4LVUA 4TWBA 2BCGY 2VDMB 2XCSB 1DCFA 2DXIA 2JKZA 3C41J 2HRDA 4DV5B 1EX7A 1N8TA 3EGEA 4YPOA 1FUYB 2AQHA 1K0FA 4XARA 4QODA 2ZIEA 3WTCA 1LLCA 2NTYC 2CV1A 3ORHA 2GKGA 1SB8A 2I5PO 2DQZA 2VZ8A 3TAUA 2V6BA 5K4GA 1E58A 1P77A 3HFSA 2QRVA 1YQDA 4CM9D 1V11B 1Y4AE 2BHSA 2G83A 4QT4A 2BR3A 3NTQA 4K9PA 4ZRMA 3U16A 1I2DA 3PNPA 3UMRA 3PTAA 2ZP1A 3LJKA 3LQ1A 3PGVA 1EGQA 4BO6A 3AU8A 3IV7A 1SVKA 5JRDS 1VQ1A 3KO8A 3FRIA 5BWNA 1P19A 4DMRA 4PWYA 5HCIA 1ZK0A 4I9HA 4RD1A 1SBYA 1Z4KA 4AQYB 2OEPA 4E2YA 1X13A 3OSZA 1JT2A 4FWIB 4ER6A 4I5GA 3M3PA 2FGJA 1QIDA 2WM3A 3N2IA 2Z2JA 2YKGA 3FHLA 1G6OA 3PWSA 3N8NA 5HFNA 4A3SA 2I76A 4C5AA 1QK5A 1OFHA 2O8FB 2YN4A 2ZJ2A 2R48A 4ZQBA 1T1JA 2VTEA 1U7UA 2GD0A 3AJ9A 1VI2A 2C4VA 3I8OA 1DG9A 4PX5A 3RVSA 4DWOA 1OZ0A 4BQQA 4HGZA 4FDTA 4BQRA 4AJNA 2AMYA 1LWNA 2PRSA 2F7SA 2GS9A 2HIMA 5DWVA 1RXIA 2YVLA 3J81k 4BNKA 4MQMA 4N6NA 3WBBA 3ZE1B 2IYXA 3B7GA 1N9GB 3UJ9A 1W35A 1KZ7B 2RHMA 3Q7RA 2XUOA 3VPCA 2ZUUA 3KOMA 3RABA 2QTZA 2OGSA 3M5WA 2ZT5A 3CLRD 2CEKA 3DHWC 3VDXA 2VF2A 3GB9A 5C4IA 3HL4A 2JGLA 3KJHA 3HR8A 1FSSA 1NW3A 2QPLA 2OE2A 1LRLA 5HUHA 3L6BA 3PX2A 4UAUA 4AD8A 3EAFA 4RA9B 1PUJA 3Q98A 4F3YA 1J00A 1P1CA 2OZVA 4I55A 3K6SA 4RLSA 4HAXA 2WQZA 2AN9A 1IHUA 1QHFA 4P3YA 2Y77A 4TTPA 1BAPA 2N46A 2WAXA 3BRCA 3WKEA 4K40A 3E22A 1EH5A 1QAMA 2X6TA 2QL5A 3AM5A 1KFKB 2WSMA 3ENQA 3GC6A 1JALA 1Z7BA 2X3FA 2H65A 3QLUA 1Y1QA 2G25A 3BK7A 3D6TB 5BURA 2JG3A 1QK4A 1C8KA 4LJRA 1TPYA 2P0YA 4GOLD 1U3CA 5GJWC 3UOWA 1F5NA 1ZGBA 3NJ4A 1OGIA 4BMZA 3IA7A 4HLCA 4EB8A 2PKQP 4WECA 1EQ2A 4A36A 3JV7A 1DWPA 2WWRA 4P0TA 4UEQA 3G2NA 3KBBA 1PS8A 4ZOLB 1RZVA 4HZGA 2VNAA 4MK4A 1EUCA 4NNPA 4DLBA 3H13A 5H82A 3CW2A 4U9UA 2OPHA 1H1DA 3U61B 5KTKA 4QNRA 1Y6GA 3IJPA 2V59A 1QDUA 1QFXA 5DIFA 3GFPA 1B1CA 1M7HA 1XZ8A 3LNCA 3UGTA 3D8RA 1RSZA 4OXNA 3ZJ5A 3NNDA 4CIVA 3RHSA 5FADA 4ECEA 4IRMA 3PEWA 1Y1RA 1JHPA 3A6HA 1E89A 4NCBA 3NRBA 1IVYA 1VBFA 2JD0A 4OEHA 4OMDA 1VBNA 1GGJA 1TOAA 3N0XA 5A6SA 4LV5B 4GUDA 4DDHA 4HS9A 3V9AA 5IN4A 3B82A 1JKJB 5TS2A 1QWOA 3PFIA 5IF3A 1C7ZA 2ZJFA 4WZ6A 3LQQA 2JI8A 2CLSA 4RJLA 3AEKA 2VK2A 2VT7A 3NAZA 4KKXB 4HDKB 3W7BA 3ZOZA 4D74A 4CF7A 3KSMA 4KQ6A 4HP8A 3ZE6A 1GLGA 1E3EA 1TM5E 1Z13A 2ISCA 1F06A 2XQGA 3A1CA 2XOKD 3H1TA 4R9SA 4PZPA 3GF4A 4R31A 1K6EA 4M86A 5ABPA 5IKEA 2OVFA 4DCGA 5DYTA 3CBQA 1K9VF 2UKDA 2GPAA 2ZIUB 3AU9A 3TVDA 1ADFA 1NBEA 4X00A 5DGCA 5KO2A 1OKKA 4BB5A 4RD0A 2XMPA 3GN2A 3JARA 4P4UA 3VR0A 2ECOA 2C5AA 2I3ZA 1Q74A 1CETA 3KC2A 5JH7B 2HO4A 2XV1A 1VLVA 2PSEA 3QUQA 5CX4A 3PE6A 3BMXA 3HJCA 4TMZA 3DDHA 3GRYA 1KAEA 3ZHVA 3ZDRA 2JLSA 1IB0A 3LLMA 1OSNA 4OGGA 5KOJB 1VECA 3QE0A 4OQMA 3V8BA 2DFVA 3VYVA 4C29A 1UXHA 4IV8A 2PN1A 1AKWA 5BOSA 2OV4A 4UNPA 3DEZA 1ZMOA 2QX4A 3KLPX 2PZKA 3NBAA 2P2NA 3FMFA 4XDGA 1C30B 4OL0A 4CWAA 4RCZA 1JEAA 4M0KA 1J7KA 1TLTA 3AFHA 4GBMA 5H81A 3SHQA 3UPUA 2DG2A 1L4GA 1XC7A 1EDDA 3I2JA 2BEWA 3LHSA 4AVYA 4ZDKA 4ITRC 4BFCA 1EUYA 2XBMA 1NWCA 5IF9A 3U49A 1CZRA 3CVUA 2L82A 5EE5B 1AN0A 1U2DA 3QYFA 2CJXA 1V5WA 3OZIA 4OHYA 5TDHA 1Z0SA 4MPPA 2QAJA 1IQ0A 1O0SA 2X4IA 1TZKA 4XJXA 2WQ6A 1E3MA 4FJ0A 5CLLA 1GKIA 5KTNA 1WF3A 3GUUA 4OCZA 3IR6A 4CI9A 5J2UF 5DYNA 1C1HA 1PQ4A 1LLDA 3FWYA 3GT7A 1X7HA 5L4LA 1GZHB 4X95A 5KQMA 1QV7A 2HXYA 1T10A 1DCMA 1RWPA 1U2PA 3C8MA 1D8AA 2PZBA 2RI0A 4IH4A 3CLVA 5K1ZA 1ZK1A 3FVQA 2I8LA 1OXMA 3IHWA 4PIPA 4PZAA 2WUVA 3RU7A 3A4YA 4BDTA 4C2AA 2GN9A 4Q7KA 1P4SA 2DT8A 3SX4A 3ACBA 1XCJA 4KG7A 4KQKA 2WUDA 1UWVA 4QL3A 2A9KA 4ND4A 3FFXA 5DZSA 5LKRA 3UAYA 4F7WA 1QG2A 1T5SA 3R24A 2KS6A 4OFBA 3I3SR 4Y7CA 1PD0A 2FGKA 3HDVA 5DSTA 4UHHA 3I5UA 5TQ2A 5LFAA 4EDFA 2VLBA 3DM5A 4HQ6A 1HQDA 1X1TA 3DYVA 1VIDA 3P32A 4M76B 1EGVB 3RHFA 3JTMA 2CLFB 3EFOA 3BGWA 1UJ2A 4PU0A 4JGBA 4H60A 5IM4A 3NYRA 4XIGS 1ZPDA 3BGDA 1DAFA 4K2HA 2I4MA 3OX1A 4Y0AA 3MCAA 1B6RA 1FQJA 1NWHA 2NIPA 3AONB 3CN7A 1VBKA 4YDHB 4CPDA 1Q0LA 3EGCA 3I30X 4K9RA 1Z8FA 2I6QA 4JUCA 2ORIA 1WMSA 1X9IA 3U17A 5CVVA 3NGXA 4RPJA 2ANBA 4CLOA 1SKBA 3CM0A 2R65A 2YH2A 2QVYX 3D2CA 2ZFUA 1WPXA 4TKUA 3DEIA 3WJ1A 3IGFA 4D3DA 5KYWA 4BV8A 1V9CA 3R0JA 4RJ2A 1YCDA 1KEVA 2CFIA 2ZI9A 5K0SA 2ZZMA 3FNRA 4DCMA 1MA3A 2C9ZA 4L4UA 3IE2A 5FBWB 1XVLA 3AETA 4A6PA 3FPEA 2WAMA 2C9OA 3HJHA 4KWHA 3BC1A 4MRAA 3UB2A 1A9PA 2FFAA 2R4TA 1KEEA 1U0OC 5AHRA 3OU7A 4CIYA 3D7LA 4AIRA 2XKAA 1J49A 2Q3MA 4WCVA 3SBEA 5JFOA 3MTGA 1YUNA 5D01A 3MFYA 1JDJA 2WG1A 4FYKA 4S1WA 3GEIA 4U8HA 4MW1A 2QBYA 2R6GA 1AHIA 5I7VA 1LV7A 3Q11A 3JQBA 1YTUA 3DDCA 2MIIA 3F6RA 5TIIA 4P6VF 3FYUA 2EW2A 4MI3A 1TQDA 4NK4A 3ZCSA 1WO8A 3PC3A 1JQAA 5IJXA 1H85A 2PLFA 3IAXA 4ZVMA 4BNHA 1P2FA 3JQCA 3FSGA 2ZYWX 2COUA 4COKA 1DLIA 2QE7D 4D9HA 3RYCB 1L3IA 5TGDA 2ES4A 4CL2A 1OWPA 4FQ7A 3IAS1 4IV0A 3GUVA 4CETA 3QKUA 1GL6A 2QSZA 1EA7A 1IN1A 3BIOA 4PC2A 1KP3A 3HPQA 5DCYA 3W2IA 4GLOA 1DC7A 2JFWA 4K6FA 4G9EA 1RQRA 4Q3EA 5HE9A 3N6XA 3ROEA 5AVSA 1ZCFA 2VUSA 2FN3A 1QHGA 1RADA 2IUTA 3D8SA 3K2EA 1IEQA 2GD6A 1WB4A 2VJMA 4GDMA 1XMOB 1RE1A 4CLXA 1RYNA 3FHJA 4B6RA 2BFCA 2JHPA 3H9BA 1VG0B 3V1TC 2QGFA 4B6JA 1NTRA 2BCEA 1ZG3A 2GGSA 4QBFA 3E0XA 3A1SA 2XE7A 2EFCB 4NYJR 5JANA 2GVDC 1P2DA 1QH1B 1ZS9A 3KTDA 1Q1QA 1V6CA 4O63O 3LC2O 3WWCA 2F1RA 1FNNA 4PLFA 4S04A 4B74A 1JQBA 1ZN2A 3IQEA 3NBFA 2V3VA 4OLJA 2N47A 3S70A 3T94A 1JWAB 3TOVA 2KLBA 4CKCA 2SKCA 4F4JA 1YA6A 1WUYA 3DBHA 1XTSA 4O59O 3CF2A 4WBSA 1D2GA 5D84A 2GB4A 1GZVA 1X1SA 3LDGA 4U2CA 1XGKA 1PFGA 2YJTD 1GGMA 2ZRKA 1XTPA 1G4HA 1MC1A 2SCUB 2ATXA 1NBIA 3A4VA 3WQQA 5BUZA 1FB5A 1T8RA 2V4ZA 4ETWA 5I47A 1PTKA 2D06A 4FOSA 4DCPA 1A96A 2A67A 4ND5A 5G53C 3T9CA 2KQUA 4XM1A 2O54A 1KAOA 1ZSVA 4O2AA 5B4TA 2Q6LA 3GLFB 1BVUA 4Q3DA 1Y1TA 3KQOA 3ODGA 4MHSA 2O5EA 1BS1A 3B60A 1ZCJA 3GFVA 2J32A 4LQDA 5CX1A 1QGED 1QHHA 2YWRA 4C1BA 5ILOA 2C07A 1SGWA 3D1VA 4Q4DA 3URMA 1LB1B 1KKMA 2PZGA 4MAMA 5L4NA 4FMDB 1P8JA 3GT4A 3K0EA 4N0DA 1ZWLA 4UEWA 5IZCA 4JOBA 2NOAA 2Q0XA 4PPGA 1FW6A 1VL8A 3UZUA 1SCAA 1OZFA 1RYBA 4CUJA 2GQ0A 2V7UA 3H4MA 3ESZA 3IALA 5TX7A 1FYEA 3T5AA 1E0KA 2FZGA 1U8EA 3HY6A 3KK0A 4MCAA 4CKEB 4DIBA 1LGYA 2R7KA 5AHOA 4Z9BA 2JA2A 3FCOA 1JQ3A 4P80A 3EISA 4D4HA 3GRFA 1M2OA 2QUAA 4WZAE 1BXZA 5LQSA 1EG7A 3PYLA 1GCGA 2NADA 4LDPA 3E4CA 4XX0A 5H1YA 2XE6A 4KB5A 1UKEA 1M1YB 4ZO6A 1A1SA 1VXOA 1UDWA 1Q14A 3T1VA 1PIWA 2HHJA 4CDGA 5BR7A 1H4TA 4H4EA 1PSZA 1MEEA 1PZNA 1VYHA 5JIBA 4Z4FA 4KTVE 3T1QA 1BCSB 2J67A 3FWKA 2UZIR 2AEFA 3L8ZA 1G21E 2P69A 2UUCB 1GSAA 4LC0A 1USGA 1WVIA 4IRUB 1WSAA 4N0QA 4R8SA 1FZTA 4ARBA 2F3RA 2ZYHA 4TZTA 3CVOA 4RXMA 3CHYA 1KY2A 1EFLA 1O08A 1U04A 2B2CA 4JBIA 4WT7A 4ZAXA 1I7NA 1WXQA 5IARA 2QRZA 4X64B 5IFLA 1XQYA 4RYDA 1AKNA 3ZVLA 2BMFA 3DDOA 3PXDA 4YJ2A 4B46A 2J9FB 3UB4A 3ZKWB 3P71T 3LMKA 2ZJ7A 3PX3A 2XZPA 3EJWA 3SQNA 3M9WA 4P7GA 4F0JA 2ZUWA 1D3AA 3DT6A 4HNUA 2DLCX 3L0CA 1NSTA 3SC2A 1G291 1OT5A 1NMZA 2J6BA 1T1RA 4FFOA 3W3ZB 4BNZA 2JW5A 1K68A 1M2JA 5ULLA 5MFPA 3L5OA 4DANA 3TZBA 3KT8A 4GQAA 4MDHA 4RK7A 4TV9F 4HVCA 4X92A 3HLKA 3FNQA 2QVGA 4ZQCB 3F5QA 4DM7A 1DC6A 3MJEA 3S5UA 3NTUA 3EZ9A 1H2ZA 4QWWA 4U39A 4I50A 5BUQA 4A6DA 1SXGA 3I2FA 3L05A 4IVQA 1CJSA 4FYIA 4F3RA 1DQSA 4GG1A 3AZQA 2IOYA 1KH3A 2NZYA 1XALA 2W6NA 3QFTA 1PRYA 1Q0ZA 4IKEA 4K86A 3ELYA 3RTAA 4K81B 5BV2P 1LDYA 5M04A 3II6X 5C1DA 1CDEA 3K4HA 5D3MA 1I4EB 3BMOA 1W30A 2I2AA 4KIGA 5K0NA 3PUJA 1ADGA 4BYMA 1OQAA 4R7TA 5LXTF 2EKBA 1ZK2A 3BWMA 1SA0B 3TX6A 3R7SA 1N2BA 4W9NA 2HX1A 2ZR7A 3FWNA 3MXTA 4JI1B 4CEIB 1JG6A 1OTXA 3AHGA 4BS9A 1JA1A 2C59A 2AXNA 2GAIA 1AGPA 1A04A 1Y8QB 3H5AA 5AKIA 5EKSA 3DEJA 3GFFA 2WHPB 2XTAA 1Z5VA 4IGAA 2QRHA 1Z6ZA 4MUEA 1UBRS 4WY8A 4UHCA 4Q05A 4LCJA 2EJVA 1NV9A 3U40A 3VO2A 3EB9A 2FQ1A 4EMUA 1ZBQA 3O8RA 1TZBA 2ATIA 3EE6A 4ZQGA 1C1DA 1P6UA 2DPYA 2F17A 3F7OA 3O8DA 4TMXA 5CW2A 5F3RA 3WLHA 4B83A 1FJHA 4WDRA 4IJ6A 1RVV1 3A37A 3JQ9C 4GMDA 3TLYA 5CEEA 2VHXA 1L8QA 3SDZA 4IIXA 4LS3A 4Y2GA 3K0BA 2VSQA 3DQPA 3KB8A 4BO9A 1W7AA 2JAPA 1NY6A 5KSYA 1FFBA 2C92A 3RYIA 2GZAA 3MHPA 1Q44A 2YV1A 3A3PA 4C9BA 3FJOA 1XNRB 1FVHA 2GRUA 1YDMA 5BY2A 2C5FA 2GAAA 2OCKA 3HACA 1E2DA 4NFSA 1M33A 2PZMA 1IHYA 5FFNA 1OBFO 1NXXA 5EYPA 3VX4A 2W58A 1ETUA 1YE5A 4PG7A 2BKVA 5ED4A 1WMDA 2EW1A 3HPRA 3HHEA 4HEQA 2R6CA 2BF7A 1USVA 5TMDA 1HNXB 4FSHA 1ITZA 4WZAA 3BGVA 1ODTC 1Z5WA 4JI6B 4C3VA 1BH6A 1P9OA 4MRNA 5IH3A 3UAWA 9MHTA 1DELA 4L28A 1BX0A 2HA4A 3PPIA 4TSFA 3FOEC 1G66A 3VZQA 1V47A 2L69A 2IU0A 3WWOA 1Q7GA 3D8UA 5CTAA 4U2GA 1E92A 1MJ5A 3KPWA 4AZTA 2RAPA 1CT9A 2JPDA 4P7FA 2FSIA 2HNBA 4KX5A 5JJKA 1J23A 2IXDA 4ALLA 4ENWA 1K98A 1KZYC 1F7VA 4HDOB 4ZMSA 4FYWA 1YASA 3W5AA 4UCFA 4ZPJA 4QXRA 1IONA 4QTUB 1T3SA 2Z6UA 4WN9B 3DMDA 2O6HA 1O4WA 3BDVA 1JS1X 4AZSA 3GCWA 1O4VA 2P4SA 5CVUA 1SWVA 1N9KA 4UBLA 1E62A 2CCJA 2ZIAA 2XZLA 4G1FA 5G2OA 2GEBA 3AI1A 3M6XA 3N0RA 1BFKA 2C2KA 4UAGA 5DXAA 4EG4A 4RWZA 4G63A 3BWEA 2Y0CA 4C76A 1RQNA 1GZ6A 3QMVA 1W88B 4L5AA 5E4FA 3WVNA 1WKVA 1OH7A 4TYWA 3QQPA 5CNIA 3CSUA 3N1UA 4MVCA 2PRKA 4DC1A 4PRKA 2FX2A 2O48X 4ZKEA 3D3QA 1OYWA 1E3WA 2D5LA 3LGSA 1K66A 2B8JA 4JQCA 3RWOA 1TYZA 3B38A 2FEAA 4JJFA 2YRWA 4PYLA 2JB9A 5HQJA 1DWOA 4IYRA 1ZVQA 2KJQA 3R0XA 1Z73A 2EDCA 3ICCA 3N8IA 1E7SA 2FWNA 2XEXA 4R0NA 3EGXB 3WX0A 4EBBA 1DAKA 1SXJD 4WZBE 5EP2A 3DKPA 1QH0A 2JAXA 1PFYA 2YWDA 3DUFA 3OCVA 4DWWA 3L6EA 2RJNA 1XO1A 4M89A 4YUVA 2I2FA 2R6R1 2VT3A 3AL2A 1MFZA 1GARA 3KKLA 2IHZA 1J5PA 1TCUA 1DZ3A 2Q3DA 3K8YA 3RE1A 1IJKA 4A27A 4ALMA 2MSCB 4BWYA 4E08A 5JS8A 1J0DA 1MOZA 4BMCA 3DL7A 3WLKX 4E6EA 2WE8A 1FA9A 4O6VA 3E03A 5CEJA 4KUHA 4EY3A 3N8GA 4WIAA 1NLMA 3SVLA 1BRMA 1I2BA 5LLTA 1ZD3A 4TTSA 4Y0VA 1K4KA 3RYHB 1CD5A 1I3MA 4C6HA 1XXLA 2O3TA 1VJTA 2Z3ZA 4CIBA 3E9QA 3GLSA 1SQ5A 2VP4A 1JR3E 1E2FA 1R74A 1X7XB 1U8FO 4C43A 4B0OA 1PVOA 2PDAA 3B6MA 3LBAA 4RTPA 3HKCB 4X1YB 5JNSA 3O3CA 4RD6A 1GDTA 4RKWA 1YBVA 3S4YA 5HM6A 1VGQA 1JIIA 4IDCA 1OHHD 3U60B 3PNSA 3ZU5A 3OZFA 1SG9A 5KWIA 3KEQA 3E5MA 4W99A 2PMEA 3WSWA 1SEPA 1BGXT 4NFYA 5EJFA 3EG5A 5I7UA 4BNFA 3L43A 1G8FA 4LYYA 2PE5A 1QZZA 1Q0PA 3HKEA 2ZKIA 1EVEA 1KO7A 2JI4A 5JCJA 3C4VA 1EP3B 3VU1A 3THWA 4G4SP 1V71A 1JEJA 2HYDA 3GZNA 3ND8A 3ORFA 2HO5A 1L2TA 1VP3A 3ANSA 1WQ1R 3MMXA 2A9RA 3SLKA 2JK0A 4JLVA 1M1NB 4ZO8A 5I3ZA 1GZ5A 2WMYA 3A2LA 4ME6A 5DPMA 3I5MA 4HUQA 4V0SA 4ACAA 5CJPA 4DLKA 2QRNA 4HPXB 4I99A 4R8MA 3S7TA 4M8LA 1ISHA 3ECCA 3H2SA 3SIPA 3BL6A 1BNCA 3VPHA 1K8XB 5DXJA 5E6UB 4HMOA 3T1HB 3KSBC 2AUNA 1XEWY 5IJZA 5EIAA 2ZEJA 5FYDA 3PDJA 3VXKA 2JD2A 1W2GA 4D6YA 5DYYA 3KKMA 2Z5GA 3MAAC 1YCGA 1BJTA 2B7CA 3OOSA 3G2JA 3WKCA 3U81A 1QIKA 1GFSA 1NJ5A 3RUPA 1SKUA 4LC9A 3K9WA 4OU5A 4LXUA 2Q1WA 3HB7A 3VMFA 5EZYF 2P65A 1E6LA 2ZQZA 3ZHUA 2REQA 1BJRE 3TINA 3O8QB 4HDNA 4OO3A 3T4PA 1Z62A 3WLIA 3IAM1 4R2LA 1I6WA 1KYXA 2JDID 3HFRA 5T6MA 2WLTA 1L8XA 4BLVA 3R9IA 3B3GA 3M4NA 4JNCA 5LPNA 1HYEA 2NO5A 3CPEA 4KC0A 2Z2KA 4R8LA 1W8IA 1VL1A 3BMNA 3DEKA 3JQ8A 4MVJF 2PA3A 1RKBA 1E60A 3AHEA 4F96A 5HIIA 1GADO 4MI6A 5J3JA 4LJYA 3BREA 1IN4A 5ESXA 4LNHA 3WRXC 5JSZB 4BECA 3KKNA 1NVXQ 2AE1A 2ZSFA 3BAFA 1TJ5A 1V7ZA 4HWKA 3C87A 5CLHA 5E9JA 3SYNA 4DAEA 2O8BA 1HDZA 3CF6R 4WZBA 2ESRA 5KDDA 3SXJA 1XRSB 1VIMA 2DE0X 3C7AA 3V48A 1MRSA 1PNRA 2V6GA 5CH3A 2ZAOA 1ZRHA 4OREX 4JP1A 1DIBA 3HP4A 1R00A 3UEOA 1ZW1A 5BN5B 1OGYA 4D80A 3AYXB 3RYFB 4JUFA 1Z3IX 3LA6A 4JELA 4R1PA 2B21A 4LJ9A 2LIVA 2WJPA 3TTVA 3I39X 1GWNA 4KX3A 4GKBA 5HJ5A 2GYWA 2JIPA 2Q6OA 2CLMB 3OLQA 4KDRA 3DCNA 2FPRA 4JGIA 2IS4A 4YV2A 1QB8A 1RJ9A 4G2NA 4UNRA 4INJA 3HDQA 4YECA 3ZQKA 1KARA 5C7LO 4MITA 2XWSA 1U6IA 4PHHA 1TRHA 5K03A 1R15A 3OEWA 4HUTA 3K20A 3VOSA 4OX9Y 3GRRA 3L4BA 2BR4A 4JIMA 4RV9A 3EPHA 1E2LA 2MSNA 4PO3X 4A0RA 4ZQHA 1GSOA 1VKNA 2QJFA 1CKEA 5DFAA 3QVGA 1CUUA 4TV9B 5AVWA 2BKUA 4Z4EA 3FD8A 1H0KA 4JYPA 1DC5A 2AQKA 1BDJA 1Q6ZA 2AD1A 2K5UA 4KSYA 1XWFA 4PE5B 3RAJA 1OH5A 1J97A 4IQ0A 5K8LA 3CUEF 4OV6B 2Q5QA 3EY4A 1Z2NX 4WY2A 3PRJA 1GU0A 3FX2A 3CT6A 3IERA 1LFDB 1RHQA 2C5SA 4LRWA 1XDWA 3MPOA 2Q5CA 1U3DA 1BD3A 4GMXA 4MR8B 5AM4A 1L5NA 4BXOB 2IUFA 1MAWA 4IAOA 4C88A 4ZCLA 4AICA 5FWDA 5AUNB 1R4MB 4FEGA 5KSOA 1GZ7A 1NQUA 1QV9A 3CUKA 3P9RA 2OWEA 3M6UA 5K3FB 1JEQB 4JH0A 4JB3A 1T8YA 2FEPA 1P0PA 3B20A 4IL5A 3H6HA 5TQ0A 1IBRA 3K9GA 2HRQA 1OX6A 1XVVA 4LQ4A 3BH6A 3HCNA 4A2PA 5AVQA 5J1SB 4G81A 1ZD9A 1WPQA 4JOCA 5EUBA 3ZCPA 4F5YA 1Y3IA 1LSSA 5IAJA 1NI3A 4KMRA 1LBIA 1OF1A 3K0AA 4LGVA 3CLTD 3MJRA 3VHXA 5B64A 1ZICA 1OTYA 2BISA 2XKBA 1V48A 4AJOA 5D86A 1ZUNA 4XVHA 4F4DA 1Y7IA 2GCOA 3WTBA 5KPDA 1AQLA 1LXCA 1OKKD 1JHUA 2R8YA 2ZJ6A 2OHFA 1LVHA 2X0NA 5F64A 2IU3A 1J9GA 3HUUA 2J09A 4F9GA 5F23A 3E7FA 3OKCA 2WUGA 3AEUB 3HA7A 3AKDA 3QGMA 3TLZA 4HUJA 4ITVA 3RGGA 3QU7A 4QFDA 1G63A 2CVPA 4CBVA 1RBZA 1TF7A 3FOBA 3WFZA 4EFKA 3ROGA 3SOZA 1ULUA 3FTNA 3DULA 4ID9A 2PH5A 3LX8A 4F46A 4DEYA 2BGIA 1NV8A 3BKXA 5F73A 3DZFA 2WFMA 3IS3A 3T12A 1P74A 5J4KA 2HDNB 2H9IA 3HR4A 1Y34E 1XTQA 4U5XA 5A1TA 2C3PA 3R6GA 3B2EA 3HO8A 2NQTA 3PVZA 2M6KA 3ZZ0A 5EN4A 4Z1MA 1SBTA 1HFJA 1NMYA 1Y5IA 1H8EA 4C7KA 1YMQA 1UOOA 2HBQA 1XQVA 2AZDA 1PZHA 4QC2A 1PS0A 1JLLB 4IX9A 1T1IA 4L6AA 4KXFB 5CA0B 1D03A 4PGMA 3SJCA 3CRVA 1RBQA 4UXJA 4UUPA 1ULAA 2MTBA 4MW2A 2PYIA 5KVSA 1XPUA 1A7KA 1W87A 4P8RA 1P4RA 3PVSA 5SYNA 3DJFA 2Z57A 5BNTA 3ANNA 4K2AA 4OQEA 1PDOA 3TEFA 4BCCA 4DLPA 1AMOA 4FX5A 4I1IA 1NW5A 5AP9A 4Z0TA 3UAXA 5LQMA 2C97A 5C3UA 4ZAYA 3RU3A 4U00A 3ZNOA 5KMGB 1ADYA 4N82A 2QPTA 4JI2B 3EHEA 3N28A 1I5RA 4RVFA 2M1XA 3G23A 2CDNA 5DMHA 5GAJA 1I1OA 1Z07A 1LNZA 2C96A 2VH2A 3O5AA 3MS7A 4K46A 4ZJYA 4TVSA 5A9SB 1Q19A 3DBLA 4LKOA 4WOJA 5AVOA 3KZXA 2HWWA 4BGEA 1E1YA 1Z35A 5BSEA 4EHIA 5JD6A 2AI2A 1PK8A 2G67A 3IBSA 4P36A 4E4TA 3COSA 1C81A 3R3JA 3EH2A 1U0TA 1T4BA 3PHIA 3E61A 4IJ5A 4IZ6A 4JXJA 4UEKA 4IEFB 4K03A 1FFEA 3NWEA 2AKAB 4L5IA 1Z9BA 1XBTA 3K4PA 4A0HA 8OHMA 1KEWA 2QM8A 3EQ8A 3RS3A 1XZBA 3DBOB 5AR1A 1R6BX 3HL0A 4PLPA 1H23A 2A14A 2IRWA 1BW9B 4IBOA 2JAUA 2GN8A 4I5FA 1SUDA 1C41A 2R1ZA 2ADMA 5CT9A 2I87A 3ICQB 1ZXXA 3AFOA 4K6MA 4EG6A 4Q4AB 1CRLA 2GKSA 1X94A 1EK1A 4ZA2A 3DAGA 3TOXA 5AFSA 2IH2A 3DT9A 2OZKA 1HX7A 1WHSA 1IIBA 2XVXA 4FEAA 2W8BA 5P8WA 1LK7A 5DYGA 4FWTA 1E2PA 4XOIA 3OI7A 3PCXA 4C0QC 5J4LA 2ZI7A 3T38A 1Q7RA 2O1XA 4TLCA 4HKTA 2RGGA 3L04A 3V33A 2QLJA 4RLHA 1JRLA 2ZR9A 1TF2A 3D4NA 3GRAA 4MEAA 4R3UC 3EH1A 4YQYA 3K9QO 4BVBA 4Y18A 1SUPA 1E9VA 4JQOA 4YCAA 1ZESA 4EJ6A 5BRJA 3QA3E 4H0FA 2C2WA 2KE5A 2NUBA 3BORA 3H2YA 4PQYA 2JD1A 4JB0A 3HN7A 4ZEVA 2QTWB 3B6JA 4KLNA 1N34B 1B2RA 1K5DA 1PX2A 1NR7A 2AXEA 3HO6A 4YVFA 3C3XA 3VAYA 5H7XA 4CM8A 4F93B 4J90A 4OXYA 1NVEA 1CDDA 5IC5A 1ZM4A 1CV2A 3P9PA 2VPYA 4B1FA 3UT5A 1UZUA 2BBSA 1NQXA 4DJAA 3HGMA 2W11A 2XD4A 4G0OA 4EIWA 3KALA 3PIIA 2VAPA 2JKYA 3DPUA 2X0KA 3FW1A 3G59A 3Q5EA 3AKCA 4G56A 1ZW6A 2CD7A 1O0CA 4G0VA 3ZWXA 4U9HS 2FWBA 4XVRA 3AV3A 1Z22A 1ZVVA 1PW7A 1T9DA 4TRNA 4J94A 1GCAA 3S2GA 1CUAA 5EIBD 1NOKA 1K6XA 1B93A 4X71A 1NATA 2I2XB 3AWDA 3KYCA 2P3LA 3L77A 4B3CA 1WW8A 5BSRA 2DZDA 5SZIA 1EZZA 1LBHA 3BZBA 1Y6JA 3OIVA 4N12A 1GAXA 5L51A 4JJEA 2UVDA 3IP9A 2ONKA 3PDHA 4N3NA 1VKZA 4Z4GA 1RZRD 1JJ7A 2JIZD 2OORC 4L3WA 1GNSA 3AZPA 4GI7A 4MS3A 4XB2A 3FVTA 4NJOA 2E2WA 3CT4A 4NWIA 5BSFA 1ANKA 4QVKA 1LNSA 2C7QA 1CR6A 4WNAB 3ZEAA 4G36A 4FFLA 3FSJX 2R79A 3FFWA 4DDMA 3X2EA 3LZDA 3W9SA 3F46A 3TF5A 1V9SA 1BXKA 1ZD5A 4TLBA 1IY1A 5EZYB 1S5PA 1NF2A 1GGHA 5F9HA 3CURA 3LIIA 2I2WA 3FLAA 4WGGA 4PO8A 2V7PA 3HABA 4QNNA 3CF0A 3TSYA 2J5BA 3UOGA 3OCCA 1M0WA 4EQ6B 8ADHA 2XGOA 4L9AA 1ETHA 2JCXA 3K15A 4FC6A 3EDYA 3C3YA 1TC1A 2I1LA 3EAGA 3DOHA 4I36A 4R1SA 4O25A 1A7JA 2WABA 4S1PA 4EQZA 2Q21A 3EQ7A 2BFDB 3ET4A 2ZU6A 2IPNA 1WR8A 3A2NA 3FNBA 4DV7B 4IJVA 3KQHA 4B73A 2KHZA 2R84A 3NZEA 1JMVA 1KDOA 2BGTA 4FNAA 2A0FA 3CH5A 5CD9A 3NDBB 2YJ6A 3BE8A 4US1R 2H2GA 3MG9A 3BFKA 2ZTLA 5YASA 3S6JA 1VOTA 4I0WB 1NURA 1UBNA 4K88A 3RB8A 2ALJA 3QENA 3LCRA 4JMLA 1OJLA 3KRTA 4IVNA 2EGGA 1XEFA 1NN0A 1SQ0A 1WQ4A 2P8SA 1Z63A 3AF0A 3ZK9A 1IH8A 4BASA 3BJIC 1JG3A 1C9YA 4M22A 4YYEA 2H7VA 2FW9A 4HQFA 3RVBA 3ZWBA 1DAMA 1ABFA 3CIOA 3Q2IA 5I8PA 3HMKA 1JI0A 4Q4JA 3PS9A 1U3VA 5JVDB 3WV4A 4YXFA 4FDMA 4QYTA 2C98A 2JANA 2P11A 1S3FA