3HDJA

The crystal structure of probable ornithine cyclodeaminase from bordetella pertussis tohama i
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
311
structure length
311
Chain Sequence
AMLHIDDAMIEDAVTPQAAQEVLHAAFLDFGRGSAAMQRRVRTEAGGVKLSTLGAVIPGQGVAGAKVYTTIKGQFQFVILLFSAADGRPLATCDAGTLTRKRTAACTVLAAGALARPRSSVLGLFGAGTQGAEHAAQLSARFALEAILVHDPYASPEILERIGRRCGVPARMAAPADIAAQADIVVTATRSTTPLFAGQALRAGAFVGAIGSSLPHTRELDDEALRRARAVVVEWREQTLSEAGDLVLAAPDTGLDAKVVELADVLAGRAAARQADEDIVIYKSVGVGLEDVALAGYAYRRLAAQRGWPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ornithine cyclodeaminase
publication title The crystal structure of probable ornithine cyclodeaminase from Bordetella pertussis Tohama I
rcsb
source organism Bordetella pertussis
molecule tags Structural genomics, unknown function
total genus 106
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1780.10 Alpha Beta 2-Layer Sandwich ornithine cyclodeaminase, domain 1 ornithine cyclodeaminase, domain 1 3hdjA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hdjA02
1EK6A 5KJEA 1GUZA 1U9JA 4N54A 4JBHA 2VUUA 4XYMA 2OGUA 1IPEA 1LSSA 3QLJA 4FCCA 4CLOA 7ADHA 5ILOA 2WD7B 2B4RO 4MVJF 3TOXA 4RF5A 1LNQA 5L3ZA 1EDZA 4YRDA 4D3SA 3AM5A 4AJPA 2GF2A 1N5DA 1VSVA 1XQ1A 4FJ0A 3QVTA 1I36A 1BXGB 1NXQA 4WLOA 4BB5A 2X9NA 4K9DA 4P38A 3ZNNA 1JWAB 4YYZA 1IZ9A 2GD1O 4DQVA 1E7QA 1E1KA 2G1UA 3PI7A 3HDQA 4FOSA 4RVSA 5COAA 3H65A 5JCJD 2DBRA 2PGJA 1U8XX 2V6MA 3GGPA 2SCUA 4W7IA 1DIGA 5K6AA 1HDYA 1YO6A 3EUWA 1B14A 2WSBA 3ZHXA 2X1HA 4IZHA 4CMKA 1P1HA 5TGDA 3JD0A 1ZCJA 3DZKA 3IL2A 2ZKLA 1GUYA 3A06A 2CFCA 3JYPA 1DC4A 4NBRA 3MCVA 2VT3A 1ULSA 1DHRA 1HL3A 3H3FA 1CJCA 4XQ9A 4ZHSA 5L95A 2C7GA 1M76A 4R9SA 5IZ4A 4AJIA 3MJ4A 4DXHA 4OKIA 5DBIA 2I65A 3QIVA 1L7EA 2Q1WA 2NVUA 5G0UA 1PJTA 4IDEA 3HADA 1HDZA 1UXJA 5CDTA 3K8ZA 1R0LA 5KIAA 4XQEA 5EINA 3DMTA 5L53A 4QFCA 1E3JA 2C2YA 3UAGA 1HLDA 3HE3A 1UXGA 4IPTA 2CF5A 2NQTA 2X0NA 1O89A 2W2LD 3P7MA 4EUHA 3L6EA 4K28A 1N92A 4BO5A 1PWZA 1Y8QB 3NKLA 5ENDA 3DBRB 4EJ0A 3H5RA 1MG5A 4Q3BA 4E2WA 3WIEA 4E4YA 2QRJA 3I5MA 3NJ8A 2OZPA 5KTKA 1JW9B 1U7TA 3FHLA 4RZHA 4NIMA 2IEDA 4A73A 4W9NA 1DIRA 3M2PA 1DEHA 1V3UA 2VNAA 1YKFA 4QSMA 1U4OA 1R16A 3DB2A 1YVEI 4R3NA 4RPLA 1K89A 3SJ7A 3EW7A 3I23A 5CG2A 2ZTVA 3QP9A 2WD8A 5JDIC 1B3BA 1DJNA 1LQUA 2C0CA 1KC1A 3AW9A 3M2TA 3LT0A 4EEXA 3WWZA 3DBHA 3GOHA 4RORA 1NVMB 3NTRA 1JLLA 1KY4A 2FOIA 1Y5MA 3OICA 1ENOA 1O5IA 4L4XA 4RVFA 5MGBA 3DAFA 1R4MA 1ISGA 2NSDA 2YFQA 1J5PA 1WXDA 3OEYA 4U7WA 2OOSA 2E48A 3UN1A 3GDGA 2OHXA 3D5QA 5BR7A 1VE9A 1YL7A 3HB5X 1LEHA 4ALNA 3KSUA 4MIEA 4EI2A 3VPGA 2HCTA 3MTGA 1UXHA 3GEGA 4G2NA 2AQIA 4C4OA 2BFPA 3W8EA 1VC2A 3TWOA 1OI7A 4QXMA 4OO3A 4OMUA 4ZU3A 2X23A 4ALKA 1TA4A 4M89A 1P3DA 3WDSA 5KVCA 3FNHA 2P68A 1Y6JA 4D7AA 3AJRA 3ZV5A 3OJFA 2DKNA 2A92A 4U6QA 1V9LA 1PZGA 1YB1A 2EG9A 1H6BA 3OJOA 1KETA 4NBVA 1C1DA 4GX2A 4WLFA 1KVQA 1XLTA 2WD7A 1UAYA 4IDBA 4EEZA 2Y67A 5EMHA 3E9NA 5HS4A 4YAGA 1UAGA 4W9NC 1BMDA 4CV1A 4RVDA 1ZK3A 3ULKA 3QY9A 2JAPA 3MEQA 2O3RA 3JD4A 2E37A 1BXGA 3GK3A 3INGA 1ISIA 3UF0A 4ZICA 4BGVA 3EZLA 3K2EA 1TI7A 4ZQHA 1VL8A 3ZNOA 3DTTA 1I0ZA 3JQEA 4BO7A 3GFBA 3OQ1A 3CSDA 4RVUA 5G0VA 2C82A 4YACA 5JO9A 3FBGA 3MJTA 1HDGO 2QYTA 2EERA 4RGBA 3P5SA 4O5OA 2Q2WA 2ZTLA 3LF1A 4J1SA 5JO0A 1KOLA 1BW9B 2JFFA 4OIMA 2HJSA 2NUAA 1PL7A 1N7GA 1GZ3A 1DIBA 1C3VA 3W8FA 2BD0A 3COSA 1C0KA 4J16A 3GMDA 2I3GA 1G1AA 1LTHR 2QZ9A 3DXFA 2FSVA 1I32A 3OH8A 4KZPA 4OSOA 5U1PA 4ALLA 1QSGA 5COBA 2WTBA 4RVHA 3M6IA 3H9JA 3FTNA 3EYWA 1DO8A 3C1TA 1PGQA 1QLJA 3JSAA 5ITVA 4O63O 3NYWA 1EMDA 2YQ5A 1XELA 3GZNB 4NR0A 4FC6A 1GYPA 1W8DA 2QG4A 1E5LA 3NRCA 1C0PA 1ZUD1 4IZIA 1WNTA 1YB5A 3NV9A 3GNSA 4LCJA 3K73O 4CLDA 2UYYA 2UUOA 1E77A 3UXYA 1Y8QA 3DBRA 3E5MA 3QV1A 4Y98A 2GPTA 4TZTA 1B8UA 3WGOA 2I6TA 1U3TA 1XSEA 1CYDA 1P33A 2R2GA 4RPHA 4HV4A 5IXYA 3BMOB 4BNHA 4E6PA 4AJEA 1DC6A 3OF2A 4L8VA 2F00A 2Y1CA 1F0YA 3AOGA 1A7KA 4LK3A 4MVJH 4NFHA 4R4JA 5CPBA 3PK0A 3OQ6A 1NNUA 2VZ8A 2BF7A 4CMGA 1ZO8A 3RFTA 1PJ4A 4YAIA 1P1FA 5I7VA 4K1LA 4PLWA 4Z9FA 4MOWA 3LK7A 4N7RA 3EVTA 3I1JA 1DSSG 4NQZA 5A1TA 1SEVA 5LC1A 3VDQA 3UCEA 1SB9A 4XYBA 2O4CA 1R0KA 3GVIA 4YQYA 3MJVA 4RPJA 5EN4A 1B7GO 2VNSA 1U8FO 4R1TA 4MKXA 2Z1MA 1LC0A 1WDKA 2PTGA 4YAKA 1PGOA 3QWFA 3CKYA 2VHXA 4MVJP 3H9QA 4FFRA 2D3TA 4ZJUA 4B3IA 4JJFA 1TEHA 1HT0A 3JQCA 4IINA 4L4RA 3V1UA 3VPHA 1KVUA 4CQMD 4A26A 2WEKA 2BFOA 4ZA2A 1CEQA 1Q2XA 3EZYA 4GX5A 4YJHA 3PDJA 4LCEA 4ZN6A 3WLFA 4PRKA 1LLDA 3ONDA 2CDBA 5B12A 1GTMA 1NAHA 1YRLA 2HU2A 4GX1A 4LGVA 4E30A 4I5EA 5KKCA 4PIVA 5U9CA 1BWSA 2I66A 5JC1A 4K6FA 1N1EA 1UDBA 3DDNA 1AGNA 2GYYA 3PLNA 1PJSA 4L4SA 2Y1GA 1GYQA 2OUIA 2RIRA 4EW6A 1GCUA 1GCOA 1X13A 2WMDA 3ZW8A 3ZWCA 1IB6A 3IUSA 4FB5A 3D7LA 1B2LA 3EDMA 3PWSA 5EESA 3SEFA 2NWQA 1ZBQA 2GR9A 3IMFA 4QO8A 3WTBA 5A9RA 3HHPA 3MJSA 5G0WA 3ZWVA 3Q9NA 3ZU3A 4B4OA 4TMFA 1YONA 4CPDA 4E21A 4HWKA 1Z73A 3CE6A 3DMYA 3TZCA 1HXHA 5TC4A 4DLLA 1BW9A 1ZJYA 3JQ6A 4YTEA 2RAFA 3WQSB 3I9NA 4O1MA 3AI3A 4J9VA 4J3FA 1ZFNA 2JHFA 4ZRNA 4J9UE 2FZEA 1KYQA 3U0BA 4CUKA 4ND5A 1I10A 5KCZA 3WNVA 4FPXA 2FR0A 4BVAA 1HETA 4CR6A 1ADGA 2B36A 1SPXA 1LC3A 3S1LA 4XGIA 4U0JA 1DXYA 3GZNA 2PA3A 1GL3A 5F5NA 4DA9A 4XGNA 4ZRMA 2PH3A 2GCGA 2HK7A 1MC4A 4BNYA 1GZ6A 2EP5A 3GVHA 3AI1A 4WLUA 1QYCA 4H15A 5L7YA 3V8BA 1KS9A 1X7DA 3SVTA 3SX2A 2PNFA 1WWKA 3UOGA 5FWNA 4BNFA 4C7KA 3S2IA 5HA5A 2OL4A 3H5AA 3WJ7A 1OBFO 2CD9A 4YJGB 4GKVA 3LT1A 4NK4A 5IDWA 1BTOA 1NPTO 3DHNA 4J43A 2BRUA 1O8CA 1E3LA 3KXDA 2ZB3A 4J1QA 3BMOA 4ZGWA 1E6EA 4M86A 1RM0A 3RFXA 1ZK2A 3RU7A 4AJJA 3RKUA 4IUYA 1ONPA 3VH1A 4NBWA 2TMGA 1LBEA 1T2CA 3V5NA 3UHAA 4DRYA 1YQDA 3MTJA 1BGVA 1LXCA 2GZ1A 4WCFC 2P91A 2AE1A 5CDGA 3K30A 1C0LA 2ZJ1A 3HNPA 4E13A 1X7GA 2H9IA 3ZU2A 4BO6A 2BH9A 3JQFA 2B5VA 3IP3A 3I6QA 2EW8A 3DZBA 4NU6A 4Y6SA 3JQ9C 1MP0A 3WGHA 2FPPA 1ZEMA 2DC1A 2NU6A 1YL6A 1GV0A 4IXTA 1DFGA 5GY7A 3RWBA 1A5ZA 1PGJA 5JAIA 3BMCA 3GVCA 4IDCA 4JP3A 1Q7GA 1IY8A 2Q1SA 4XYGA 4WNIA 3GUYA 3PJFA 1A4UA 4WOJA 4UAGA 3HJAA 5IXSA 2YFHA 2JD0A 3DZHA 1W73A 4RDIA 1Q7CA 2CDAA 1GADO 3DR3A 4D3DA 1PZFA 2J3JA 5I8WA 2IZ1A 1IYZA 1MX3A 2AMFA 2DT5A 1LQTA 3H3JA 4UVDA 3RC2A 1KIFA 1IULA 1MXHA 1JKJA 1NHGA 1O9BA 3WBFA 4I8XA 1HYEA 3WWYA 1TXGA 5JXWA 3AM4A 4GSLA 2VOEA 1LSOA 4GI2A 1VL0A 3KEOA 4BO4A 4A5OA 4CR8A 4EZBA 2EJVA 3SLGA 1NFFA 3BYZA 1VI2A 1U3WA 2GN4A 4IS3A 4JN6B 4E31A 1Q7BA 2RH8A 4CLOB 3GDFA 4DMMA 2BLLA 3KTDA 3GGOA 1UDAA 1XWFA 1A72A 4NFSA 4MKZA 4BUCA 2H1SA 4UUNA 1YWGO 3L9XA 5T5QA 3AY3A 4XIYA 4FFNA 2EJWA 4CM9D 2AQ8A 3DEYX 4IXWA 1E3SA 1SB8A 1I30A 1BXZA 2Y1EA 3F1LA 3PJGA 3TZKA 4U6SA 3RBVA 1WPQA 1ADCA 5TRTA 5C3MA 1WAMA 3JD3A 1IHXA 3G79A 2CMDA 1EQ2A 4YT5A 3U4IA 4OGWA 5G4LA 3W4KA 2A94A 2ZQYA 3GF4A 4IIVA 4LN1A 4MVJG 5TJHA 4N5LA 3VVCA 2GASA 3L6DA 1ENZA 2X5OA 3AI2A 4RVGA 3I4CA 4WE3A 4IIUA 2OBYA 4NNJA 4H7PA 3HFSA 1KEVA 1I8TA 2AW5A 2I9PA 1L7DA 2GN8A 4C7JA 2W2KA 3CTMA 1WDMA 2EKQA 4OAQA 4NG5A 2LDXA 4DLBA 4EYEA 2QQ5A 3CZMA 4PLZA 4A10A 2HMWA 4OSPA 2NV6A 2NTVA 3TQHA 4E3ZA 4JNKA 1NR1A 4M55A 4RLSA 5B4TA 2O50A 1PJQA 3RASA 3S2GA 2RHRA 2VHZA 2NVUB 5IAAA 2HDHA 2ZCVA 4IDGA 4I08A 4L76A 3NTQA 4HFMA 4PLPA 4LMRA 4CMBA 3AOEA 1MFZA 1MA0A 3TZHA 3NGXA 3LT4A 4CMHA 4ZD6A 3GHYA 5L51A 3PFFA 4D44A 2NU8A 3GG9A 3D0OA 4X54A 4YJGA 2EEZA 5JYEA 1U3VA 1JA9A 4J6FA 3RC1A 1DLIA 1XYGA 3QQPA 1P31A 1EFLA 1ENYA 2X6TA 1F12A 3GT0A 4HADA 1PWXA 3JQBC 3CPSA 3W1VA 3R3SA 3JD1A 2H5LA 3F5SA 1ADBA 5A5EA 1RM5A 1DJQA 1U5AA 4M54A 1QKIA 1X15A 3DBLA 5ER9A 3ZHYA 7MDHA 1VKNA 2WDZA 2EP7A 1LDYA 1NHWA 4ND4A 2P2SA 4FGWA 2PK3A 4CM4B 4IJUA 1CQJA 3B6ZA 2NACA 4ND3A 1QYWA 4Q3DA 4NZ9A 1DRWA 4K26A 1KBZA 3B1JA 3GA0A 4MPDA 4UULA 3PJEA 1ONOA 5A4DA 1XEAA 4BNKA 3FBTA 2JD1A 4E32A 3ROMA 2D1YA 4NBUA 4AJLA 5IF3A 1M2WA 4ONEA 1I5RA 4YR9A 1QYXA 3L6OO 1PJBA 3LLSA 3I9JA 1QRRA 2PZKA 2C29D 4EITA 4CL8A 1JAYA 3E9QA 1NQOA 3RJ5A 4GLLA 4BKPA 3E82A 4J4HA 5T8KC 3PGXA 4EJ6A 2ZTMA 1AE1A 1WW8A 1NQAO 2YQ4A 4R41A 1X14A 3ZWNA 3JCZA 2DTEA 3WOHA 2P9EA 1C1DB 2DAPA 2AA3A 2FR1A 3TFQA 5B4VA 4GQAA 4E5MA 3UUWA 4XR9A 3Q2KA 5TS3A 3DAGA 5A9SA 3I6IA 3FPCA 4PG5A 4YJFB 4N5NA 4M87A 4CL3A 1U2DA 3F46A 3I52A 3PQEA 2HLPA 1HTBA 1VSUA 1XQ6A 1HE2A 4LISA 4UEOA 3DQPA 1EVZA 4J2HA 2H6EA 4PVDA 3JQDA 4PG4A 2FN7A 3Q2IA 4MJLA 1GD1O 3FPLA 5DP2A 3ZW9A 1FDUA 3QVWA 1XKQA 3FD8A 4GVXA 3U3XA 4YRBA 1A9YA 4CODB 3E5RA 1HDOA 3WTCA 5AOVA 1YBMA 2EIHA 1W0CA 2O2YA 4CR7A 1IPFA 3ZWAA 4FBGA 5BNIA 5JDIA 1NX6A 5A5FA 3ASVA 4QT0A 2V6GA 4FFOA 3UVEA 1H94A 3AUUA 4W99A 2BELA 2E82A 4BNIA 3HWRA 3MWDB 4LSMA 1R6DA 1YDWA 2O4UX 3PQDA 3TL2A 4CUZA 3WIDA 5AXAA 1BVUA 1J0XO 3RC7A 4FR5A 1R37A 4XZ3A 1ID1A 2NTNA 4II2A 1HDRA 3RCBA 1Q0QA 3A9WA 1C1XA 5DCWA 3V1YA 1P74A 1E5QA 2VCYA 2LDBA 3FTPA 5IN4A 2VYNA 4HFNA 1AXGA 5T67A 3ABIA 2QRKA 1ADFA 2R00C 1B8PA 1Y9AA 3RBXA 3NDRA 4RL6A 1NPDA 2IODA 1H9AA 3ZGYA 3ANNA 3D1LA 5I9NA 3PLRA 4BO1A 1MC5A 1WDLA 2VUSA 4Z0PA 5JYDA 4CMEC 1ZXBA 2CUKA 1XIVA 4TZKA 2I99A 1I3MA 2EWMA 4UUMA 3WGYA 1H9BA 3KM0A 3QWAA 5F1KA 2DPGA 4KQXA 2POQX 4Y9DA 2HMVA 4QO7A 1R66A 1P9LA 1I3LA 3CEAA 5JS6A 1T2DA 2R6JA 4BO2A 4F6CA 1RKXA 1N1GA 3GZ4A 4UVHA 1FDVA 4ZVVA 4BNLA 2WYWA 2NU7A 1LDBA 1QR6A 3LF2A 3QVXA 3KVOA 4CM4A 4DBZA 4NH4A 2ZCUA 4DL9A 2YZ7A 2Q49A 2Y1DA 3ANMA 3IOYA 3HUDA 4J1TA 2WYVA 3WNQA 5G0SA 3OP4A 4Z9XA 1TT7A 3VPSA 2IEBA 4CUJA 3CH6A 3RUDA 2EF1A 4BO9A 5A06A 2JAHA 1DB3A 3WGGA 1GAEO 1I24A 4J1NA 2YV2A 3OETA 2VHYA 4JQCA 4CMCA 5CFZA 3MZ0A 3PTZA 4HNGA 4L73A 4PZEA 5ENVA 3FR8A 4ALJA 2P5UA 4TRNA 5CEEA 4R16A 2DUUA 4PLYA 4BNTA 3GR6A 5T6BA 4WLNA 2Y0EA 4I9UA 1YDEA 1Y1PA 4GGPA 3Q9UA 4L74A 2QRLA 1D7OA 2XOXA 3PPIA 3ZU4A 4DVJA 2A9FA 2NLOA 1BDBA 1BG6A 4TVBA 5JY1A 4KP7A 4YJHB 5AVOA 1UZNA 3V2UA 3VTZA 3WYEA 1ULUA 3PWKA 3ZWBA 3JYOA 4MP8A 2CZCA 3PIIA 4IDFA 4BNGA 5A05A 3NDJA 1LU9A 3OJLA 3MOIA 3RBZA 1NTOA 4ALIA 2Y0CA 4CMAA 4MIOA 1D3AA 3CMMA 3HN7A 2C20A 4G5HA 2Q50A 4KTVE 1EFKA 4E12A 2VUTA 2G17A 5CAEA 4E5PA 4CV0A 3G1TA 4O6VA 3RUIA 1T2AA 1LLQA 4D79A 4YJFA 3ZWYA 3EY4A 3OBBA 2IRWA 3GDOA 3P2OA 5KVVA 3DAPA 4YBZA 4IMRA 3T7EA 3F4LA 3AFNA 3VKUA 3DOJA 3PIDA 3TN7A 1A27A 4AJ1A 1SOWA 1LSUA 2X0RA 4IMPA 5A02A 1HEUA 3U9LA 3W8DA 3OQBA 4R1NA 5EQDA 4IDDA 4U0KA 3FWNA 1JN0A 5IDYA 5C7IO 3ITKA 2JJYA 1P0FA 3B70A 3C7AA 1PEDA 1SEPA 2EKLA 3MOGA 4WCFB 4RCVA 4U5QA 5JCXA 5GMOA 1G6KA 2W98A 3PWZA 4JLWA 4DLAA 4OQYA 3AK4A 4AJHA 3DBVO 4F45A 4EUEA 4Q3EA 4FD3A 1PZEA 3GG2A 4BHTA 2IZ0A 1MXFA 2GUGA 3UICA 4NJOA 1QV7A 3KB6A 3UKOA 1AHIA 5THQA 1A9ZA 1GQYA 1R15A 1DDOA 1K2WA 5LDHA 3ZZNA 1SBYA 1SCUA 1HE5A 3KLPX 2JCYA 4YWJA 4DMLA 4GWGA 3GUCA 4H3VA 2DFDA 1IZ0A 2V6BA 4TKLA 4BMNA 3AM3A 4W82A 1PZHA 2VTEA 4IM7A 3ON5A 4OXKA 5I7FA 3R0IA 1NQ5A 4QTZA 1U1IA 3OFSA 5HS6A 2ZIZA 2YV3A 5H81A 1E3EA 4YT4A 2FPGA 4CV3A 4M1QA 1U2GA 3IUPA 5LDGA 2DBVO 3IJRA 3L4BC 2DLDA 1K6IA 3DOOA 3K9QO 4JGBA 4ALMA 1R12A 2BKAA 4NJMB 2C07A 3OIFA 4D0RA 3TDKA 1FDWA 3I9MA 1PR3A 2HMSA 2J5KA 4RQTA 2VT2A 2Z5LA 4FGSA 5JAZA 1ZMTA 5TJ9A 1D8AA 3H2SA 1E7RA 2W8ZA 1CQIA 4IJKA 3KO8A 1HKUA 1JAXA 3VZQA 4FC7A 4YJDA 5T57A 2I76A 5F5LA 1IL0A 3AUTA 4B8ZA 1I2ZA 1E3WB 4DWVA 3QRWA 3NT4A 4PLHA 4PLCA 4P4NA 1ONNA 1Z82A 5IJZA 1E7MA 3BTVA 3AWDA 8ADHA 1DBVO 2J8ZA 1JQBA 1B0AA 3BMCB 1EEHA 1VM6A 1WLYA 5L9AA 1B8VA 1YS4A 3A4VA 2C59A 3KV3O 1B3RA 3WMXA 1M66A 2FPIA 5DBFA 2YY7A 4HNHA 3VPFA 3F6YA 3WFJA 5HRUA 1QV6A 4GPD1 1EVIA 3IKVA 2B37A 3PGJA 2ZTUA 2A4KA 4CLEA 3U62A 2CDCA 2B4TO 1PR9A 4Q3CA 3BZUA 1V3VA 2HUNA 2ZYDA 3PQFA 1ZSYA 5FI3A 4QQRA 4AVYA 4PLGA 2X58A 3CMCO 5J23A 1D4FA 5FYDA 1KVTA 2UAGA 1NM5A 2FP4A 4WECA 4WUVA 2XAAA 2UV8A 1BSVA 5KKAA 4BB6A 3F5QA 2J3IA 1GZ4A 3C7DB 3GNTA 3I9OA 3LDHA 1H93A 4RPKA 4WK6A 1ENPA 4BMVA 5IZCC 3TZ6A 3KUXA 1T24A 2DUWA 1AUPA 1RYEA 1I2BA 1XHLA 2BI8A 1B26A 2HRZA 3G0OA 3GGGA 4B7CA 1EUDA 3IAHA 2J6IA 4IY1A 2WM3A 5KJ6A 2GERA 3RUHA 1QORA 1BHSA 2O3TA 3O8QA 4RF2A 4PG8A 1IUKA 5G0TA 3GHHA 1UZMA 4F46A 3BTSA 1MB4A 5IN5A 4FN4A 3ZI0A 2OO5A 5HTOA 2DTDA 2D2IA 3TJRA 3JD2A 4MINA 4WCFA 4AL4A 3P19A 1P0CA 2IYPA 3S8MA 2X86A 4JJGA 3O26A 4WEOA 4B3HA 4UEJA 2W2KB 1SAYA 4UUOA 4R3WA 4AJOA 1E6UA 1P1IA 3K96A 4EUFA 3N7UA 4U8GA 4OL9A 3JQ9A 4WLEA 5L7TA 1J4AA 4QX6A 2I3AA 4BO3A 2F1KA 1T2FA 4YAJA 1GPJA 3FF4A 5F1OA 3FRJA 3AU8A 2C5EA 1GR0A 1PGPA 4PG7A 3RUAA 2X4GA 3QJ5A 3DFZA 1NWHA 2RHCA 4GVLA 4PLTA 4E2XA 5C37A 1V8BA 2BI7A 2BHLA 2QYSA 1Q0LA 2PD3A 1NASA 3E03A 3OA2A 1ISHA 4IJVA 3IC5A 4FFMA 3B1FA 1IHYA 2YW9A 1X0XA 1W6UA 4FQ8A 1DRUA 2AG5A 3OECA 4MIYA 2VWHA 2HSDA 4GH5A 3WYBA 3ST7A 3DTYA 1JKIA 4NJMA 5B4UA 2DBQA 3MJEA 4S1VA 4TROA 3OA0A 2P4QA 1EBUA 1DHTA 4XJSA 5IG2A 1YBAA 4BNUA 3D5TA 4YT8A 1K3TA 4R1SA 3GFGA 4CM8A 4PZCA 4J4BA 1W4ZA 3MJCA 3DBLB 5BSHA 4I9HA 1HWYA 3EGOA 3GLQA 4KTTE 5CDUA 2BMAA 5BT9A 4MVJE 1Z74A 5THKA 3WJAA 1E3WA 1GV1A 2H63A 1QYVA 2VZ0A 1HYHA 2PGLA 4JK3A 3WQRA 1HLPA 2GSDA 3TOZA 2GN6A 2PKQO 5L4SA 5A9TA 5ICMA 3WS7A 4DBVO 4BKQA 2RCYA 5KVQA 3WFIA 3FCOA 3SC6A 1YXMA 2ZQZA 2O7SA 1DOHA 3NT5A 5ER6A 2AE2A 3ROQA 1P44A 2ZJ0A 1PX0A 1E92A 4J4TA 2Q2VA 1LUAA 1E7WA 3PP8A 3VC7A 1QP8A 3R3JA 3HZZA 4IBOA 2BGLA 4B4VA 4HY3A 2CSUA 3DOCA 4E2YA 2PZLA 4BNJA 2GGSA 2B4QA 5TIIA 4D3FA 2Y99A 4QEDA 4BNNA 4I1IA 3U4DA 3BXXA 1ZIDA 3PZRA 1FF9A 3QSGA 3GNQA 3LQFA 4BKUA 1CRWG 2C5AA 4UREA 5AXCA 4DIFA 1BVRA 1F8FA 1HDXA 4W7HA 1FDTA 3A28A 4NDNE 3EMKA 4AJ4A 4BKOA 4YT2A 1VKOA 3VKVA 2BFMA 1KVRA 3N58A 2ZB4A 2O3QA 3BIOA 3PEFA 4B79A 1QMGA 4I5GA 4J90A 3F9IA 2GLXA 1HSOA 2P9CA 3JQAA 5JNLA 3M1LA 4XKJA 4INAA 5A9SB 3PHHA 4II3A 4D41A 1DPGA 1ZH8A 2I5PO 3JQGB 4JCOA 3IP1A 3FNEA 3JQBA 3L77A 4WKGA 4J49A 5ICSA 3IJPA 1LI4A 1I33A 4IS2A 3WGQA 4A2CA 1P45A 1RPNA 3HN2A 5HM8A 1RM4A 1V0JA 5ILGA 4P22A 3L07A 3PHJA 4I9NA 2X0IA 2Q45A 5B1YA 3JQ7A 1Q0HA 1UH5A 4IGFA 3QE3A 2VZ9A 4OHUA 1MUUA 3GH3A 5TF4A 1AHHA 4XGKA 3ETDA 4DTIA 4DQXA 5I8ZA 1E7YA 2QIOA 3EAGA 1XDWA 3IS3A 5DDIP 3SLKA 4WOKA 2AQHA 4XD2A 4O59O 3UH1A 3T4XA 3VDRA 1HRDA 2PFGA 4BNVA 4PVCA 5EPOA 2G5CA 1EZ4A 5EJ2A 3HG7A 4Z6KA 4Z3DA 1ISMA 5DCUA 1N7HA 2EKPA 4G65A 1JTVA 5CP8A 4KMSA 1EBFA 4XB1A 2EW2A 1RYDA 2FSSA 1C1XB 4GBJA 1Y8RB 4DC1A 2EGGA 1Y7TA 3VOSA 1PS8A 2Q3EA 2UUPA 3A14A 5U4QA 3TSCA 2XPCA 3STHA 4BOYA 2D5AA 4UVGA 2X5JO 2Y05A 3KSDO 4GSKA 5KJCA 4WJZA 2AXQA 3WICA 5KJFA 4HKTA 2B0JA 4DYVA 1K6JA 2X5KO 4XRRA 3RUCA 5KNLA 1Y5RA 5T8KA 3ITDA 3PYMA 4DIBA 1Y9EA 1LX6A 2HKIA 3KHUA 4FJ1A 4OXNA 5F3RA 1MV8A 4LMPA 3VTFA 2O7QA 4J7UA 3KYCB 2Y0DA 2CVQA 2AEFA 1Z7EA 1H6AA 1N9GB 1O0SA 2ILTA 3HQ4O 1ZK1A 4D42A 5C5IA 1O94A 3D4NA 1Z6ZA 1GEEA 5CEJA 3ONFA 3ANLA 4J0EA 4BO8A 4XEHA 1LRKA 4PFJA 5G4KB 5JMWA 2Y93A 1OOEA 4GKBA 1TVEA 4JX8A 1H6CA 4XDZA 5L4NA 3JTMA 5IDXA 3VAZA 3DO5A 1UUFA 1CDOA 2BGKA 2Y1OA 1O95A 5JW6A 5KVSA 1KEPA 1ZK4A 1ZJZA 2IXAA 2OP1A 1EDOA 5I9LA 1QYDA 4GAEA 5AYVA 1PQUA 2VYND 1PS9A 3WQQA 5DBGA 1T26A 2Z95A 1JWBB 2JKVA 3ZDFA 4XX0A 3G1UA 1NQTA 4Y67A 5DT9A 4TWRA 4HP8A 3GPDG 3HSKA 1LDNA 3D4PA 5A03A 3E18A 2CY0A 1DC5A 1X1TA 2ZATA 1U28A 3LT2A 1LDGA 5KJ1A 5ES3A 1S6YA 3G49A 3ICPA 3VZPA 4QFDA 1PJLA 2HAEA 3D3EA 3LSYA 1NYTA 5JDCC 1A71A 1UP6A 4XWYA 1IE3A 1YJQA 5DOVA 2O2SA 1GYRA 2B35A 3RJ9A 2R00A 5ITWA 5K0ZA 3QVSA 2V7PA 1WVGA 3V2GA 3K5PA 2FHSA 3NEPX 1ZSVA 3ZWXA 4XYLA 3JQGA 4B7XA 1P1JA 4R51A 4L75A 2JCXA 4YXFA 4YRAA 2A35A 2WJPA 3GRKA 4GLOA 1KC3A 4CMEA 4YDRA 1EQUA 1ZZEA 3C1AA 4MP6A 2UDPA 4W4TA 1GY8A 5HBRA 4PG6A 3PFWO 4EJMA 1YBVA 1DC3A 2IXBA 3BHIA 4NU5A 4Y6PA 1H2HA 2OORA 4HUJA 4MVJI 1WZEA 3GVPA 3NDIA 5TSDA 4XQGA 1DFIA 3GN1A 4IQ8A 1YOVB 5TT1A 4CM7A 4WGGA 4AICA 5CDYA 1JVSA 3S55A 3HFGA 3ENKA 4OJNA 3GPIA 4PRLA 4QECA 4E33A 2EV9A 4ID9A 3DHYA 4OKNA 2I67A 3GY0A 1F14A 3EC7A 1NR7A 3BAZA 4MVJA 2PZJA 5K9ZA 3KYDA 2VYVA 1SMKA 1CIVA 1GPDG 2CF6A 2JFGA 3H9EO 3GC6A 3GVXA 1XGKA 1Y8RA 3ZCXA 4R5HA 1DIAA 2VHWA 1X7HA 2X9VA 3BMNA 4XB2A 1ZEJA 3ZWMA 5BSEA 2C2XA 5TLSA 1LDMA 3CINA 5C7OO 1A7AA 1E6WA 2D59A 1R4NB 6ADHA 5CPFA 3UCFA 2X0JA 2EHDA 1T4BA 3C85A 3HB4X 3ETGA 3Q11A 3WSWA 4OQZA 3RQSA 4OOFA 4P4GA 3S2EA 3BTOA 3DZFA 3AY7A 3BA1A 2NM0A 2ZK7A 2GNAA 3EK2A 1AXEA 4DPLA 3D3WB 2OP0A 2VRCA 2AQKA 3TRIA 2X7HA 3INTA 4Z0HO 2J5QA 3KYCA 4YCAA 4BNWA 3PRJA 3BHJA 2ET6A 3TZQA 4CMJA 5AXDA 4I5DA 1N9GA 1DLJA 4EGFA 1UR5A 5DCYA 3Q3CA 2Q99A 3F3SA 4NK5A 1UP4A 4TRMA 5KOIA 3G17A 3RSHA 3GQVA 3W4IA 1VRWA 1GQQA 1C0IA 1LDEA 3DHEA 3SBOA 1K6XA 5G4KA 1JU9A 4FJ2A 2GN9A 1MG0A 4L0QA 5FFFA 2Q1TA 2VTDA 2B83A 2HMUA 3PDUA 4DGSA 4ITUA 1YL5A 2YHUA 3D64A 3RFVA 4RJTA 3ZV3A 4FS3A 4R54A 3QVOA 4BQRA 2IZZA 4RDHA 4WPGA 4YVFA 5EQFA 3CIFA 5K6AC 1U3UA 1M75A 4B4UA 4JBIA 2EXXA 1KY5A 2YUTA 2X22A 4NI5A 4AJNA 4FSHA 3LZ6A 3K6JA 4BV9A 3FI9A 4J0FA 3FWZA 3I9KA 4PLVA 3W4JA 4A03A 4TRRA 1K0UA 3K2BA 1K5HA 1LLCA 2NU9A 3KEQA 5CHEA 3KSZO 5GZ3A 4DIOA 1PU2A 1YQXA 2O3UA 1OMOA 2XXBA 2ZB7A 4YB8A 2VWQA 2DBZA 4Q39A 1LSJA 4Z0TA 5JCJA 3WLEA 3N74A 2WYUA 3WYCA 3C1OA 1PS0A 4J7XA 1EE9A 1KERA 3DMTC 3IKTA 2E6UX 1SZJG 4KWIA 3O38A 4D43A 5TQVA 9LDBA 1S7CA 2VWGA 2O23A 2HK8A 4RF4A 5JE8A 2V6FA 1IOLA 1E1LA 4J7CA 3QWIA 4JP2A 1LJ8A 2NQ8A 4CM1A 3L4BA 1WMBA 4Q9NA 1PJ3A 2GO1A 4XIJA 5I9MA 4RF3A 3JV7A 2QZZA 2FMUA 5AQ1A 2AG8A 2NNLD 1I3NA 2UVDA 4IDAA 1Z7BA 3O8QB 3WMWA 1ZSNA 4J91A 3VVBA 2Y66A 2B69A 2X9GA 1ZXLA 3E6AA 3OSUA 1YOVA 1M6HA 3TFOA 5IFLA 4E5YA 2WWRA 2VN8A 3R6DA 4UVEA 2C7VA 2YDYA 4OXYA 3UCXA 2YHIB 4URFA 3ZHZA 2W2LA 3KETA 5H82A 3U5TA 4LSWA 3AY6A 2P5YA 3LLVA 3NUGA 1DIHA 1ZK0A 4NFYA 2QX7A 3RIHA 3KRTA 4IGEA 2D5CA 1VL6A 1SNYA 2V65A 3Q0EA 1JKFA 1V35A 3VZRA 5GZ6A 4XJTA 3SC4A 4M8SA 3WGZA 2OFPA 2HJRA 2HRBA 1ISFA 4AJKA 1EK5A 2GZ2A 1RJWA 4MDHA 1R4NA 2O48X 3VH3A 3I4FA 3JYQA 1P77A 3L4SO 3TPCA 3IDSA 1FJHA 1B15A 1NAIA 4BNZA 4Y8VA 1T1SA 3IIEA 4HFRA 1PL6A 1BDMA 5A3VA 4XRGA 1YJ8A 1NFQA 5L45A 4JXKA 3D3WA 4GMFA 4BIIA 4P4LA 2YDXA 2RBEA 1FXSA 3LC2O 4HX5A 4KUGA 1VJTA 2GRAA 3JYLA 3DZGA 4P8RA 2OXIA 1F06A 6LDHA 3O9ZA 1R0SA 5CG1A 4HXYA 3WSVA 1OZAA 4E5NA 3OM9A 2AEJA 3ZWPA 1AN9A 1H5QA 2NTJA 3U4CA 4BMSA 5IZCA 1PQPA 3ICCA 8LDHA 3DONA 2W4QA 4CM8B 5JBIA 1GEGA 3DZIA 1M6WA 1E0DA 4CQMB 1KEUA 4BV8A 2J3KA 4IQGA 3ENNA 3U49A 4B8WA 5JLAA 3EHEA 5COQA 3BHMA 4D0SA 3OIDA 4KDFA 2HK9A 4PCVA 3U09A 4DREA 4MKRA 1YB4A 5CEFA 2JHGA 1YGYA 4CMIB 5I7EA 3H2ZA 3ROPA 1EE2A 4ZQEA 1SOVA 2E49A 1J6UA 3L9WA 3LC1O 1EVYA 3PYXA 2FZWA 3SJUA 4E2ZA 1YQGA 2O3SA 3GN2A 3H5NA 4M49A 1DRVA 1TT5B 3T4EA 3GEDA 1T25A 3Q6IA 4AG3A 3AUAA 4IQ0A 1HZJA 4FW8A 4R5MA 3A1NA 3UFXA 3PHGA 1PGNA 3ROKA 1QG6A 3ADPA 4IJWA 4RO0A 4OM8A 2Z1NA 1NVTA 3B20A 4BKRA 4DPMA 3FNGA 4N18A 4DYDA 4D46A 3PHLA 1I2CA 4B7UA 3RUFA 4CM6A 1OAAA 1FK8A 5AXBA 5HWSA 2GZ3A 3C24A 4BL5A 4HFJA 3F4BA 4R1UA 2VRBA 5DZSA 1B16A 1LRJA 4KWHA 3GRPA 2CVOA 2CVZA 1X1EA 4Q3NA 3PXXA 4H16A 3ZU5A 4TVOA 4OOEA 1Z45A 3LVFO 2FWMX 5DNAA 5JAMA 1F17A 3JQAB 5H83A 4ND1A 3DFUA 1ZMOA 4JROA 3RKRA 2VOJA 3CUKA 1UZLA 3WXBA 1F8GA 3GAZA 4YPOA 5DN9A 2Q46A 1Y81A 3TNLA 4CJXA 1YE3A 4LVUA 4JJIA 2AHRA 3NTOA 4OYRA 2PD4A 3TF5A 1EUCA 5BSGA 2Q4BA 4FFPA 4MO2A 3RU9A 1GDHA 2DFVA 2FY8A 4QUKA 3JQ7B 5JY6A 2BFAA 2YHIA 2ZYAA 3PHIA 5I7SA 3ZNQA 4DUPA 9LDTA 3NJ4A 1BRMA 3RC9A 1N2SA 3V2HA 2GDZA 3F1KA 3ORFA 3UGKA 3FR7A 1PIWA 5DULA 3VHRA 2C54A 4E5KA 3GMSA 2PY6A 1CWUA 2D4AA 4PZDA 4CLHA 2WE7A 5EERA 2OMEA 4CLRB 5TNXA 3DZJA 1HDCA 4LRTB 1EUZA 4WNCA 5DF1A 1P1RA 4EDFA 1CF2O 3INRA 4ZQGA 3ONEA 3X2EA 2Q1UA 4O0LA 4DC0A 4WLVA 3I83A 3QW2A 4XQCA 3WB9A 3NT2A 3JQAD 2D0IA 2VQ3A 3DWFA 1TB4A 5MDHA 4XCVA 5BSFA 3LC7O 5FEUA 2ZB8A 3WBBA 2QHXA 1V6AA 2DQ4A 4B3JA 3JYNA 4A0SA 1ZVMA 4A27A 4AFNA 1H6DA 4Q3AA 5EIOA 2PLAA 2JFHA 2PV7A 1VPDA 5IDQA 2XF8A 3ZN2A 5JFOA 5G2OA 1ZKMA 3AFMA 3T7CA 3E8XA 5JAQA 2PH5A 3BMQB 1NVGA 4WASA 1UXIA 3H9GA 3LU1A 4A7PA 2QW8A 4YA6A 1H2BA 1DAOA 4XR4A 1PJCA 4NBTA 3OJEA 2PKRA 4TKMA 3RROA 4CQMA 4ZQBA 2Q4EA 3HDJA 1VJ1A 1Z75A 4FIZA 4CM5A 3V1TC 3RVDA 3TL3A 3L0DA 2G76A 1U4SA 4CMIA 3HDYA 1RWBA 5EL0A 2FRDA 4NHEA 4L9RA 4R68A 2D8AA 3WR5A 4DPKA 3E48A 1YH3A 4CLXA 4DQUA 3RD5A 4GGOA 1H0KA 1ML3A 4RPGA 5FI5A 2IDZA 2OBNA 1E1MA 1TT5A 1NBOA 2DM6A 3UW3A 1NPYA 2WE8A 4KUEA 3HDHA 4BO0A 3GEMA 3VPXA 1KVSA 2PR2A 2VHVA 4PN3A 3QHAA 3ZNPA 4GMGA 1GQ2A 3ADOA 4N5MA 3ZV4A 1X0VA 1TLTA 3KBOA 1XA0A 1MLDA 2B5WA 3FN4A 5FF9A 4F6LA 4TRJA 3GAFA 3NAQA 4ZQFA 4FOOA 2NVWA 4UVIA 2X8LA 1G0OA 2EGHA 3NGLA 1HF3A 1O6ZA 3NX4A 5JMPA 3B1KA 1JDJA 2P9GA 1HE3A 2HMTA 3CZRA 4UEKA 2AEMA 3C8MA 4TQGA 5DP1A 4CV2A 1UJMA 4Z3KA 1XG5A 1T4DA 3AU9A 1UDCA 1I3KA 5L40A 2NADA 4YAEA 2JL1A 3H4VA 3JQ8B 4JBGA 4CQLB 3OJ0A 1E7SA 1LA2A 4TSKA 3E9MA 3SXPA 3RUEA 1EVJA 2J5RA 1HZZA 3C7CB 4RLHA 3ZV6A 1E1NA 1FMCA 1V3TA 3U4HA 4LVCA 3OHSX 1L1FA 1VLLA 4Y6RA 1GU7A 3QWHA 1OFGA 4JIGA 4W6ZA 2Q2QA 5KWEA 3IQDB 3H9UA 1XR3A 4J2OA 1ARZA 2PZMA 3OEWA 1NFRA 5A04A 1ORRA 5B37A 4BNXA 1NP3A 4WEQA 2DPHA 4GWKA 3ZH2A 4RV9A 2VWPA 2CNBA 3JQFC 1PTJA 3OIGA 4K6CA 3ZWWA 5CDSA 3X2FA 4BGIA 5GZ1A 4MVJM 3H8VA 1GUFA 3ZWOA 4R01A 2FR8A 1SC6A 1PJ2A 1XU7A 3BTUA 4PGFA 4CM3A 1VJ0A 1Q1NA 2PGDA 1OC4A 4CLRA 3KYDB 4GX0A 2NVBA 3F47A 2ZYGA 3PVZA 1C14A 2DVMA 3EVNA 4BS9A 1PQWA 5JPIA 2IYOA 2E4AA 1UP7A 1FDSA 2TMDA 4ROSA 4XYEA 3BMNB 1ZNQO 1U5CA 4HBGA 5F21A 5JC8A 1D1SA 4BGUA 4KQWA 1LLUA 1NWCA 4ND2A 5ADHA 4RQUA 1MFPA 4YQZA 1CETA 1HSZA 1KEWA 3WGIA 5BNTA 3VH2A 1XU9A 2G0TA 4RZIA 2O3JA 3KLMX 5T64A 1QLHA 2HQ1A 1RM3A 3VZSA 3I9LA 3O03A 3C3XA 2W90A 3BMQA 3FSRA 3H6KA 4XDYA 3ETEA 3FNFA 2PD6A 1E3IA 2G82A 4NMHA 2JD2A 1BXKA 5JDCA 2PWZA 3M1AA 3S2FA 2BGMA 3K31A 3D4OA 3WGTA 5BNFA 2DU8A 3K92A 1ZW1A 4OH1A 4BQPA 4MP3A 3ZHBA 1UXKA 4WCDA 3G3EA 2JCVA 1A4IA 4E0BA 5JSFA 2YYYA 3R1IA 1SO8A 4MVJD 4PLFA 3P2YA 5L4LA 3WX0A 3OMLA 2VYVD 1DAPA 2YJZA 1M67A 1WP4A 3PYLA 5BQFA 3DC2A 4ESOA 3RAJA 4NPCA 3KZVA 2DTXA 2IE0A 4Z9YA 4R69A 5A3JA 4I5FA 5L7WA 1JVBA 3PJDA 2YV1A 4KDEA 1XCBA 3WG9A 1HYGA 1U7HA 2Y1FA 3QA9A 4YEDA 3PZBA 3KYBA 1T2EA 3RI3A 1ISJA 4ILKA 4UUPA 1J49A 1I01A 4KOAA 5TT0A 4CM9A 4EBFA 2HO5A 1CERA 3DBHB 5F1PA 3QWBA 3LYLA 1D1TA 1GFSA 1N8KA 2P4HX 3AUSA 4KUHA 3H7AA 2VRCD 3ASUA 3VH4A 1R4MB 4LW8A 4B4WA 1G0NA 3KOUA 4FFLA 3E1KA 4F3YA 3O4RA 4R9RA 2J3HA 4S3MA 5DOZA 5LCXA 2PKQP 2XXJA 3AOEC 5TX7A 4G81A 1DFHA 1QXSA 3I3OA 4GL4A 3MWEB 4LRSB 1T1RA 1LRLA 1P1KA 3DL2A 3W6ZA 3JQ8A 4CQLA 1PSDA 3W6UA 5C7LO 4BGEA 4XA8A 4BNMA 1MGOA 1WZIA 4FDAA 3CXRA 3Q1LA 2Y68A 1HE4A 4D45A 2RH4A 1WMAA 1OC2A 1PL8A 4AJ2A
chains in the Genus database with same CATH superfamily
4MQFB 1EK6A 1M0SA 4FKMA 1Z47A 4LNUB 4IWXA 3QNMA 3H0EA 5DXAA 3RSGA 2D1QA 3M0EA 4AJ9A 4XDHA 1C80A 5GP1A 1JGTA 2WU4A 2Z6QA 7ADHA 1Y1RA 2IHZA 3G7SA 1TD1A 2WD7B 2B4RO 2HRCA 1ESDA 1NUAA 2GVDC 1EDZA 4FQ7A 2CLFB 3ILVA 2R9VA 2IGTA 3NTVA 3I04M 2GF2A 1UFQA 2IZ6A 4TWAA 2W6MA 3QVTA 4LYDA 1FFXB 1K5DA 3UMJA 4FTWA 3W6OA 4BB5A 4D74A 1VHLA 1GTSA 2G04A 1NOIA 4KQJA 1RMYA 1HQCA 2Y1KA 5AVYA 2JGDB 2NQ2C 2PMFA 1MEOA 2ZIWB 3JR3A 4CNBA 2XIJA 3CVWA 4YYZA 3ZVMA 4DQVA 3K5WA 1RADA 1YQ9A 3S1AB 3DE3X 4WOPA 3HDQA 5COAA 4DT1A 4UXJA 3GRUA 2PGJA 1N0VC 1RJGA 3H13A 2V6MA 3N8HA 2IZ5A 4CLRB 3PCTA 2WA2A 3A4NA 4ECEA 5K6AA 4GPEA 1QCZA 2CDNA 2WSBA 3ZHXA 1NJ5A 5TGDA 1IZ8A 3JD0A 1VCIA 3NBAA 1ZCJA 1RWXA 1ZU5A 2C78A 4B0OA 3U7FB 1G5HA 2J4FA 5E7JA 5BSWA 3SXJA 1DC4A 4NBRA 1WCXA 2FZKA 3T7RA 1ECFA 2H5JA 1KWKA 1GDTA 1D2AA 1HL3A 1QDLB 2ZULA 3AGQA 3H3FA 4XQ9A 1M76A 1M33A 2PZFA 4AJIA 4B17A 4PZUA 1ISRA 4Z4IA 3I1IA 3OPYA 5BQ5A 1IXRC 2I65A 3F8SA 1AY0A 4UTZA 2ZVPX 5AKKA 1AQJA 1Z0AA 4NZZA 2WNIA 2H2WA 3TLZA 5KIAA 3IOMA 4XQEA 5AM5A 5EINA 4LQCA 4C0JA 3EXAA 1E3JA 3QA3E 4PSAA 4BP8A 4W5NA 2FUG1 1TQ4A 2G4VA 1WHSB 3U26A 3ZTWA 4Q93A 3WBKA 4HO1X 5BR1A 2K87A 1N5MA 1G41A 1UZUA 2YWRA 3TKYA 4MUFA 1UM9B 4NJEA 2ZJFA 4IV8A 5E7QA 5ALIA 5TE9A 1G5PA 1MVOA 1M2NA 1X7YA 4F56A 4OMCA 2GXSA 1ZIYA 2GCPA 1Y8QB 2VDPB 4X8HA 5ENDA 3DBRB 3QOFA 1J20A 4HLNA 4IMJB 1MG5A 1V4VA 3O93A 5EZ6B 1EHIA 4E2WA 3WIEA 5JS1A 4JU9A 2ODEA 5I48A 3V4LA 1TAGA 1QF9A 1QFXA 1Y5LA 1XVIA 3L43A 3NJ8A 3V1KA 4MGKR 2PUDA 1U7TA 1JIKA 4AMBA 2EX0A 4Q9KA 1QO7A 3V4ZA 3Q3JB 4IHQA 1DARA 2CJPA 4A73A 2XTZA 3KB8A 2GPNA 3M2PA 5BORA 1YKFA 2J5BA 4XXHA 3EX7C 4RPLA 1YVEI 3RVOA 3OESA 1T2UA 3SJ7A 3I23A 3GNLA 1NT2A 2GA9A 1MH1A 3SMQA 4MV4A 1KC1A 1E96A 3DBIA 1IB0A 2MTBA 3LT0A 4UHJA 3AUFA 2X13A 4EEXA 4HEHA 5A62A 3DBHA 2IXGA 2VPIA 4QJ5A 2IL1A 3NTRA 1KY4A 3OICA 2PM8A 4RVFA 1FNDA 3D6VA 3G0GA 3DAFA 2ZUEA 3KKLA 1ZJ5A 3DPUA 2NSDA 2P9YA 2R4QA 1WXDA 4ZCSA 5KSZA 2LZ0A 5A0TA 2E48A 3I2JA 3UN1A 3V33A 4ZK6A 1V41E 3GDGA 2FP3A 2OHXA 3D5QA 1QZUA 3I9V1 3C3MA 4G4IA 5D87A 5GJBA 3HPQA 3O7WA 4AULA 1LEHA 1A2KC 2ILVA 4ALNA 3KSUA 3HP7A 4WZZA 3GJ6A 1Q3TA 2HCTA 3P2KA 3IJ5A 4EI2A 5JQWA 3GEGA 2AQIA 3HV0A 4JOSA 2B4KA 3KDAA 3RRBA 4F5YA 2X8WA 2AXNA 5I9IA 3TECE 3UYLA 4C89A 1QGYA 4L0DA 4Z1OA 1BN7A 4JXJA 3R9WA 2YIMA 2H0QA 4OEHA 4Q9DA 1N75A 4DMHA 5JSQA 2P68A 1L7OA 3AJRA 3ZV5A 2GPJA 1IG0A 3OJFA 4M1OA 4DS3A 4PWZA 4CKWB 4DNQA 3CH7A 3PNKA 4CTNA 1K2VN 3AESA 3I09A 3ROTA 1RJ9B 3DOEA 2Z09A 2NSJA 3AV3A 4H08A 5HS4A 2BR3A 2O2IA 3B38A 5LQCA 1DBPA 1X8XA 1UEXC 4FHEA 4FHFA 2OO7A 1D2GA 4LY9A 4RVDA 3UUEA 1LPSA 2R68A 5ALNA 1QIGA 2H4XA 3MEQA 4LI0A 4XUCA 4CN8A 1Y8ZA 2J85A 3R3ZA 1H2ZA 3WVNA 3ZDZB 2E37A 1BXGA 3GK3A 3LPCA 1ODJA 3INGA 2VXYA 2W2XA 4RVCA 4I36A 3NS7A 3R5FA 3ICEA 3MILA 3UF0A 3L6UA 4JYMA 1GNLA 3IVGA 3K2EA 4QUGA 5IAOA 3FMPB 4WJKB 4BMPB 1UBUS 2O57A 3ADKA 1KIMA 4WKOA 1S89A 3GFBA 4YRTA 4ZAVA 1DDIA 5LQJA 4ZTZB 4YACA 2IHVA 5JO9A 3A36A 3QMVA 1HDGO 1JTEA 1X80A 1TUBB 2XITA 2V5AA 1EAYA 1KDPA 2F4NA 3IKMB 4X71A 4UZEA 5I9SA 3K6SB 4LPSA 3GLGB 2Q3CA 4B7AA 1QTQA 2Q2WA 4N3BA 1KQGA 4LZOA 4RPCA 4J07A 3E61A 1QZ3A 2JRLA 2ZJ3A 5JO0A 3G5AA 3R20A 4EPXA 3EOBI 3OQIB 1N5RA 1N7GA 2ACKA 1GZ3A 3K6RA 4CCYA 1R27A 4MW1A 4UMDA 3FFWA 3Q7PA 1G2OA 4YP7A 1C0KA 2Z2IA 2CNWD 1S2DA 1G1AA 2QZ9A 3FDZA 4TQUS 2FSVA 2JI6A 2HF7A 3IKJA 3I8XA 1QSGA 4MRSA 5E8RA 1V16A 2H92A 3M6IA 4Z4CA 3EMDA 2FN8A 2FZ4A 3FTNA 2A5LA 2J3MA 5KC8A 4QUEA 1H2YA 3EYWA 4G0MA 5HXAA 3C1TA 4MR7B 1BVYF 5LJLA 4S24A 1U1FA 4UM8B 5JSHA 3I45A 3NYWA 1WOYA 1XELA 4NR0A 4FC6A 1D6MA 5C51B 3LK6A 4MV7A 3A3OA 1S2MA 4MDEA 2FLKA 1DUIA 1QP7A 3RVPA 1UANA 1Z62A 2QVZX 1ZOPA 3L8CA 3F5MA 5IYZB 1E59A 4LCJA 2OILA 3CVVA 1R6XA 3PEYA 1CY4A 3LWBA 1S8OA 2GAIA 2GUWA 4TYMA 3DUFA 2I6SA 2REBA 3GFPA 3JXEA 4ZOLB 2A9OA 1N2ZA 4ZOAA 2GPTA 3LS2A 1PCXA 3INYA 4K86A 2IYFA 1LY1A 1TM2A 2CVFA 3V4VB 3EA5A 2I6TA 5E6SB 1H9CA 4N4AA 1XJ5A 1U3TA 4BEVA 2GM4A 3COWA 1FUIA 1G60A 1N0UA 3QY0A 4F1KA 2GPAA 5ALRA 3IQXA 5DRYA 3TZLA 2V7XA 1PFVA 2PLRA 1QH1B 5GQSA 4AJEA 1RR6A 3OF2A 1AJEA 3CNOA 2Y1CA 1QS0B 3A7DA 1A7KA 4LK3A 4D2IA 1QRTA 4DA0A 1HQYE 3DBOB 4PRZA 4AS2A 3AHHA 3HV2A 5CLQA 3IHWA 5KYYB 1TM7E 4RTJA 2ZM5A 1TL7C 1S2GA 2QGNA 4CMGA 4FFWA 1IM8A 2C5GA 1PJ4A 1Z8FA 1ZCFA 2ZIAA 3I2FA 1P1FA 3TIFA 3H16A 2Y2VA 1NIPA 1JJ7A 3H17A 4YONB 2W00A 3Q85A 4EB6A 1N32B 4N7RA 3DYVA 4NZPA 4JA2A 4L22A 1QG0A 2IHBA 1DSSG 2L0XA 5ALSA 3T38A 2FK7A 3VDQA 4Z49A 1J70A 2I78A 4XYBA 1R0KA 3MJVA 1NNI1 2KW5A 2NSLA 1KORA 1DKLA 2BUCA 2C2HA 4OQMA 4X3PA 5GPBA 3H2JA 3CKYA 2N3ZA 4MUXA 3ZJ5A 1BEEA 1T9ZA 2VHXA 1RXVA 2WBLC 3COZA 4LS3A 6ABPA 1TPZA 4HWPA 1S9DA 3DE7X 4GWLA 4QUHA 2VPWA 2D3TA 2ZB2A 1SKMA 1CTQA 1T1GA 2FVXA 2JGIA 3A6ZA 4JJFA 3MWGA 1FNCA 1TEHA 2HU7A 5BOVA 4D8YA 2QL9A 3P9CA 3VPDA 5C7YA 2NPIA 3VPHA 5A7FA 3TD9A 1KVUA 3L8ZA 4WFKA 1TYDE 4ZA2A 1HT1E 3D3QA 4GX5A 1JECA 4LCEA 4MUNA 2ZJBA 4DV4B 4AD8A 1XALA 3WLFA 4HDRB 5AVSA 3A6PC 5G1PA 4D8UA 5DH9A 3MQFA 3FCUB 4FKZA 3IEMA 4OMFG 5AKHA 4YV0A 2FW7A 1WUKS 4NOMA 4Q21A 4TL8A 4A3SA 1EWYA 4BMDA 1QHYA 2FFQA 4QODA 5B3JC 3ETCA 2FEKA 3OD1A 1T9AA 5FPQA 4AZ3A 4ZGGA 3I62A 4IHJF 3SFVA 1ULTA 4ER0A 2DFLA 4G37A 1T0IA 4L6AA 5LMCA 3PLNA 5C4MA 2ZYTX 1LLFA 5F4BA 4KVAA 1RAFA 2Y1GA 2DY1A 4E5DA 1P5FA 1GCOA 1X13A 2Q5OA 1XZHA 1WD7A 3L4JA 1L5MA 1FTYA 3Q5EA 1N0WA 2F59A 4O4IB 3UANA 1RC8A 4HI0E 2FW8A 3A1CA 3N1UA 4PO9A 1U0OC 3U16A 4FB5A 3F3YA 3EDMA 3PWSA 2X2OA 2YWJA 4JMPA 4OQFA 5BQPA 1XJ0A 3WTBA 2GR9A 1PG0A 4GI1A 2QW0X 3QPVA 4WVFA 3HHPA 4EATA 3MJSA 5G0WA 3Q9NA 3G2HA 4LAFA 3TLAA 1YULA 5EIFA 4DMRA 3A6JA 1F4PA 1STOA 1W4CA 2GCNA 1XL0A 4XARA 3CN7A 3EQ2A 3V48A 2QPLA 2CLEB 1Z73A 4RCYA 4Z53A 1K88A 3DMYA 1HXHA 4P4SB 3P9IA 4MGHA 5FORA 5IJAA 4DLLA 4NS4A 3H7IA 5ADUS 4HVTA 4YTEA 2VSNA 2F2TA 4DV5B 2CNDA 1T8TA 2B98A 4M1ZA 4CIWA 4O1MA 3AI3A 1H2RS 1TQ8A 1N4AA 1PL0A 4J3FA 4ZRNA 1KYQA 5C8YA 5HJ7A 4DIUA 1JDSA 3H83A 4BVAA 3L79A 4F3RA 1IBCA 4K2HA 2W6IA 3DV2A 4M0EA 5JTTA 3PCXA 1QVZA 2EQAA 3S1LA 1TYCA 3AUKA 1COWA 3U48A 2E4YA 1NLUA 4GXNA 2PA3A 5JZBA 3R75A 2D5IA 5D6NA 4DA9A 3UJHA 4ZRMA 5FPTA 1VB5A 3M6XA 1PR5A 2YN2A 1Q7TA 3AI1A 2QD5A 1QYCA 4H15A 4E2FA 1ZPDA 1E99A 1AKUA 1X7DA 2GFHA 2GRJA 3V8BA 4ZI7B 2H54A 4W8HA 5JXIA 1VYVA 4UM9D 4D3ZA 2DHCA 1KYTA 3DQZA 5FWNA 3V6LA 5LOVA 2G1JA 4BNFA 4C7KA 3BWMA 2NTEA 2NU8B 1XQVA 4OVKA 5HA5A 4IHKA 5IJ0A 5ESWA 2EZ9A 3CVOA 5WRFA 2KS6A 2LE0A 3BL5A 1DPFA 3KLOA 4G56A 5DNCA 5ITSA 4J43A 1O8CA 1XCLA 4YJ2F 3AO0B 521PA 1V11A 4JVNA 2IEAA 3C15C 3BMOA 4UBKA 3G2IA 3E3LA 1MC8A 4ZRDA 5F2OA 3RIEA 4DLZA 4ESVA 4EHLA 3ZVLA 4AJJA 1N6HA 1I0IA 2FZLA 3ICWA 4NBWA 4OIFA 3BIWA 3TIIA 3TNDA 2NUTB 1LBEA 1T2CA 3TBHA 3K0HA 5AOAA 3V5NA 4BU0A 2QR2A 4IVRA 3HKCA 4X1YB 1AV6A 3TR5A 5I5GA 1E60A 1P2FA 3P5BA 4WCFC 2A9QA 2IIBA 2P91A 3ESDA 3IMKA 4GQIA 1KSFX 5DHFA 1C0LA 1NOKA 4JH0A 2ZJ1A 3KQWA 3U3RA 3LH5A 1X7GA 2H9IA 3R7SA 3ZU2A 4BQFA 1W1IA 1PG2A 2PUWA 4ZPJA 4QOJA 3JQFA 3TTWA 2B2CA 2P69A 3GJRA 3OU7A 1GKLA 3T94A 3W04A 1H22A 3WLIA 3S1SA 5E2AA 1B76A 4EW3A 3JQ9C 4XVHA 4YMGA 3HABA 1CY2A 2FPPA 2C99A 2DC1A 1YL6A 2I8LA 2NU6A 2ZJOA 3BREA 1JXMA 3KSMA 4L9SA 2RGAA 4KV9A 1A50B 1YHZA 3F71A 3OEEA 3FNQA 4KXFB 4NENB 2ZI9A 4NEHB 4A6XA 4G4SO 1IY8A 1H2EA 3TTXA 3CLSC 3F2IA 3FB1A 1A4UA 1W1WA 4WOJA 3WK4A 1R8YA 3DEKA 4OD0A 1SOMA 1Z6TA 4G0UA 4TZ6A 2XEXA 2KX7A 1HA3A 2OZVA 1L8AA 4PPNA 3EZ2A 2X3YA 2XBUA 4RDIA 1WXHA 5LP6C 5ERXA 3DR3A 4ARSA 4YALA 5I8WA 4C2TA 1RQ2A 2C83A 3MLAA 2KMLA 4G4GA 3BHNA 3B52X 3T7AA 3VO2A 4CKZA 1GSOA 2ZJZA 4G9BA 3LLCA 5TQ2B 3EFOB 1ZR4A 5JD3A 3SHQA 2VYFA 1B41A 3AM4A 3PUJA 1ZI6A 4HDKB 1YRAA 5CA0B 5JSYA 4GI2A 5CB0A 1T3ZA 4BO4A 1O95D 4A5OA 3C48A 4GPIB 4TUYF 4DUGD 3EY9A 2C8LA 4HK4A 1A9XB 1ADJA 1P2DA 1TEVA 2W22A 1U3WA 1QCDA 3TCXB 1RRCA 4U3JB 2A4MA 2DQZA 2P7HA 1Y33E 2EW1A 3D8UA 3MSCA 4JBXA 2PL9A 4AN4A 3TB4A 2A5YB 4E7OA 1UDAA 5E7IA 1A72A 3HGMA 1WMSA 1JFSA 3R5SA 1ZH6A 4RH3A 1FNBA 4EJSB 3B13B 1YWGO 2GESA 4MA4A 1RXIA 4S1NA 1YNSA 5T5QA 4BFVA 3ZY2A 2I6UA 4X90A 3STWA 1UBTS 2IXEA 1SB8A 4DABA 2VDWB 4ZEXA 2LWIA 3I30X 3RIMA 1QH0A 3IT1A 2ACWA 1C9YA 5C3MA 3BCRA 5BV7A 1RIIA 3WAKA 1OV6A 1XRMA 1FS5A 2GOYA 3SZRA 5J3JA 2YZGA 4DQDA 5GAJA 3ILYA 2A0UA 2CMDA 4M9ZA 1ECJA 4YT5A 1CUDA 4C5CA 4EB0A 4LN1A 2OQRA 2GASA 3ASYA 3TIGA 4W5WA 1ENZA 2X5OA 1DBIA 1DBRA 3I4CA 3ETHA 1KEVA 2I8CA 1F9EA 1OGYA 2PWYA 1FW6A 1P4GA 2GCOA 3IUMA 3MWLA 1NTRA 4KN6A 1Z36A 4RFLA 8ABPA 3CTMA 2Z3VA 3MT8A 1HT3A 3A4MA 4UFOA 5AI5A 4EQ6A 1P2UA 4YO8A 4YRIA 2VZLA 3L0ZA 1ZRSA 5B57C 1AC5A 4A10A 3SP1A 3VR3A 2NTVA 3ZWDA 1SCJA 4E3ZA 1R5OA 3UMFA 1EE1A 3IIMA 4M55A 3CRNA 3MINA 1WZCA 5EP3A 2PRKA 2O50A 5CW2A 2ZVJA 1G8JA 1PJQA 2V1XA 4L27A 2QVYX 2IX3A 3B78A 1LTKA 1T6BY 1U0RA 2IBMA 5IJXA 3WGLA 4QOGA 2FA9A 1TYBE 1MX1A 2ZCVA 4IDGA 2WJYA 4L76A 4BN5A 4EG1A 4EJ2A 4PIPA 2HGSA 1MFZA 2A1TS 2XNKA 3LO8A 2FFRA 1P8JA 3LT4A 3EVDA 5IABA 1KY3A 1KMHB 3ELBA 4P98A 1GWNA 5L51A 2BC9A 3PFFA 4B34A 2JH3A 2G1AA 3D0OA 4QJ4A 1V5IA 3IBFA 2NYAA 1ZCBA 2YWHA 3FCYA 5JYEA 3JR7A 2JAXA 1CY7A 1WPGA 1P31A 5J59A 2VS1A 1PO7A 3I1FA 3QKSA 4OP2A 2IU3A 4TMKA 4U7FA 1F12A 3GT0A 3T1OA 3P9SA 3JQBC 1JBEA 2W48A 1AQNA 2R8OA 4Y6GB 2NT4A 5SY6A 5CT4A 2NPOA 1XHFA 3S5UA 2H5LA 2VHUA 2EFGA 3F5SA 4FLMA 5E8JA 2LXNA 1ADBA 4KMRA 4D82A 1RM5A 4EG8A 4N8EA 2FPWA 4KDCA 1RAAA 2REOA 4ZVMA 1J22A 1U5AA 2BZ0A 4YQEA 5T3UA 2PX0A 1M1YE 2O2GA 1QKIA 2XX3A 5AI6A 2AN9A 5IJ9A 3TJZA 4BLOA 3RS4A 5EYPA 1UPUA 1VBMA 5DPMA 5CT9A 2MYTA 3D02A 3NNSA 3AIOA 1XZDA 3QLUC 1CQJA 4O25A 2XYPA 3JASB 1YZ3A 2Q0SA 1YZGA 3DVRX 3U0VA 4DUYB 3AT1A 3TRFA 1EFRD 2CL6X 3B1JA 3CU5A 3C5WP 2GAJA 3KJEA 2OBXA 2RC5A 5DO9A 4UULA 4YJ3A 1AT1A 1C1YA 4XDGA 5FV7A 2IPAB 4KMOA 4IDQA 2JD1A 1ABBA 2D1YA 4PS1A 3U7RA 1MB9A 2Q3MA 1M2WA 5CCEA 1NVFA 4FR0A 5AP9A 1NN0A 1E5DA 4YR9A 5KEIA 1QYXA 2GXQA 2IP1A 3L6OO 4OHFA 3GEBA 1JR2A 1NYRA 1GL9B 2BFCA 1HOXA 1UINA 2XHZA 3IAEA 4FQ5A 2C29D 3NHSA 4J3JA 5FQOA 4DCPA 1OH8A 1NQOA 3LFHA 3QVUA 4EZIA 2LR0A 2PZBA 3SYNA 4BKPA 4M76B 4PX5A 1TF7A 4PHTA 2WFZA 1TA0A 3WKBA 5CVTA 1FXUA 2VTBA 1S7GA 1ST3A 2FEAA 5KNBA 4US0R 5MF6A 2BFNA 1AE1A 2J9RA 1FSZA 3EQ8A 1FNMA 1L1QA 3AM1A 2VQDA 1GNSA 4R41A 4X8MA 1QHFA 4Y2QA 2FNAA 4YRCA 4U7HA 3KCQA 3JCZA 1XWWA 2DTEA 4GPZA 4RANA 2UYCA 5KX5B 3FROA 3NM6B 4J2TA 3ECCA 5HEKA 2NIPA 5HIAA 4B0PA 1L5QA 4GC9A 1GGVA 5BSVA 4X95A 1V2GA 3Q1KA 4FYYA 4KQCA 4E5MA 4V1CA 3ZGNA 3GLFB 2FFHA 3HNOA 3Q2KA 3VAYA 4C05A 3KTOA 5A9SA 3I6IA 3FPCA 4PG5A 3I5UA 4YN3A 2IBSA 4M87A 4CL3A 1U2DA 4J76A 4M7PA 1XEFA 3PQEA 3GRVA 3RAPR 1HPLA 3K1JA 1HTBA 2P1ZA 3OOWA 4RY0A 3P4UA 1XQ6A 3LUKA 5D5HA 5JNRA 5JUWA 1AK2A 4AMUA 2QRVA 1RYNA 3MUNA 3H04A 4PG4A 1L8XA 4PXYA 1S3FA 4CQJA 5EFOA 4E5UA 4QM6A 1QTNA 2FN7A 2XVYA 2WKQA 3Q2IA 4MJLA 3SQDA 4US2R 4IZ6A 1LJUA 1ZS9A 2IEZA 3R5HA 1J7KA 5HTKA 1XKQA 4DQ0A 3FSGA 2X40A 3U3XA 3E5RA 1HDOA 3V4SA 1M6VB 1YBMA 4U7JA 3EXHC 4RA9A 2UUCB 2EIHA 1NVBA 1W0CA 2O2YA 2NGRA 4LFCB 3V8NA 4ZJZA 1SVNA 1IPFA 2B8NA 4G41A 5BNIA 1G55A 2J6CA 2WFLA 4JLUA 3WDKA 5A5FA 4R1MA 4I1VA 4JBNA 4NCHA 3I2KA 3WQHA 4B43A 1WOMA 4FFOA 1IN4A 3P0EA 4OUKX 1IEWA 3IH5A 3K0CA 4Q03A 2G0NA 3DFFA 3TTVA 1A8SA 4FBLA 3FBWA 3HWRA 4BNIA 1U28C 4X92A 4CUZA 5C46F 4Y9RA 1J0XO 2BYTA 3RC7A 1R37A 5ENZA 2NTNA 3IQEA 4O29A 1Z4QA 4QAQA 1GUDA 1BE8A 3DP9A 4KRGA 3A9WA 4DC9A 1C1XA 2H0AA 4R3UC 1LPPA 5D3KA 2ZP1A 2LDBA 3FTPA 4HFNA 1AXGA 2F3TA 3L1UA 4XPIB 5T67A 2DMRA 3OE4A 1E66A 3O2JA 4HLUA 4Q12A 5E6RA 4UC0A 2CYBA 4KJZA 4D9BA 2C7PA 1ECPA 5ARDA 1C9NA 3VU3A 2L69A 3UTDA 4S04A 1M72A 4MITA 4LC1A 5KVAA 1H9AA 3ZGYA 3N8IA 2YC2C 1C8VB 1JJAA 2AZMA 2RAPA 2H3EA 3D1LA 3LY5A 3Q87B 1QE0A 3Q3IA 2VUSA 4IQ4A 3HJTA 3PKJA 4Z0PA 1B8OA 1P1CA 1XIVA 4JJ6A 4CMEC 3OT5A 3SFTA 3PX7A 4NABA 2I99A 3MAJA 1SKYB 3ZQUA 3WGYA 2AEEA 5BPHA 3RYHA 2B6HA 1XXHA 4KQXA 4EPYA 1GVHA 2POQX 3PNPA 2HMVA 4B73A 1R66A 4PPGA 3SZ3A 4HNVA 1P9LA 4BAGA 4C5BA 3KZOA 1AIPA 1E3QA 2BTOA 2EARA 2JGNA 4BO2A 2BP7A 1KAEA 3CZCA 2BCJQ 3K1YA 5JROA 3U9TA 1KR2A 3AR4A 1M34E 1N1GA 1RKXA 3PNSA 5A0FA 3AYZB 5A2GA 1TTPB 4ZVVA 4BNLA 5FNVA 3N2KB 4EKEA 1PNVA 4MLDA 5DNDA 2BKVA 3LF2A 3QVXA 4IVPA 2WP0A 4ODIA 3QKWA 4YRFA 4MWBA 3ANMA 1B8NA 1KRXA 2PYIA 2FEXA 1TQHA 4RS4A 3R7BA 2O8CB 4R9NA 5HMLA 4F84A 4J1TA 4W1RA 3SXUB 3W0LB 3OP4A 3Q72A 1TT7A 3ESXA 5H5JA 1T5TA 4BO9A 4CUJA 2KWIA 2JAHA 1DB3A 4Q1AA 5A06A 4BXOA 2YYSA 5JECA 1H23A 3M4JA 4L0CA 2FGJA 1U7UA 2PJDA 2UZIR 3KWLA 2XCRB 4ZDKA 2AX4A 4TRNA 1Y6QA 1OWOA 1XRSB 2R48A 4HJXA 4R2HA 1GDDA 4WLNA 5A7GA 1W581 1P7YA 4D8WA 1YDEA 1G7SA 1Y1PA 4GGPA 3QE0A 3FMFA 3AJDA 4PEVA 3C8ZA 2XOXA 1C7EA 1EXWA 1QTIA 3BRWA 4Z51A 1X19A 1T13A 5J2TB 2XD4A 1CBUA 1T9HA 3CONA 3FE2A 1BE0A 1Z37A 4HB3A 1UZNA 2HJHA 5AVOA 3VTZA 3WYEA 2IH5A 3PWKA 4AKHA 3ZWBA 1IQRA 2FEPA 1BD3A 2YOHA 1P1BA 4V0SA 1I1OA 5ALHA 1VPVA 3QEOA 4M9QA 4RSMA 4WBSA 4B09A 2BHRA 2CXQA 3RNLA 1Z38A 3NDJA 4RK7A 1QH8B 4A0HA 1LU9A 721PA 3DYBA 3LMKA 5B1IA 3AVYA 1KI6A 1DC8A 5EWJA 1V8ZA 3OU6A 1Z3CA 1K5GA 1IMOA 3HN7A 2AOVA 2IUUA 3W2HA 4R1OA 2IHUA 5K3OA 2IT1A 4E12A 4HUTA 2I4TA 2B8TA 2PFSA 4QDUA 2ZLBA 2YZ2A 1WSAA 3IRVA 4GR4A 1GQFA 2PH7A 2NAPA 2BN4A 3F5DA 1E2KA 2DCMA 3ZX4A 3ANXA 3T7EA 4IMRA 5AHKA 4BDSA 3VKUA 1R3UA 3KZCA 2VR1A 3DLAA 4HF7A 4PBTA 4TS1A 1MQAA 2P9ZA 2PO7A 1EUDB 1Z0UA 1YZQA 2ZROA 3R0XA 4HDMA 4DA6A 3H11A 4YP1A 3N5CA 3ZZUA 1UPAA 1SOWA 1LSUA 1W5AA 3PPVA 1H8HA 3CE9A 4M1MA 4Q24A 5LZ5A 3HVHA 4RIEA 3ZLJA 1QC5A 4PF1A 5JASA 2XDYA 4IDDA 1EVLA 4MQ6A 4RA6A 1ZN7A 2WTXA 3RSZA 5C7IO 3ITKA 2NO1A 4P7BA 4QEZA 1OYYA 4HZUB 2X2PA 2REQA 3MOGA 1QIIA 1CPYA 3E0QA 3QENA 4U5QA 4UBIA 5DU2A 3F78A 1QIHA 2W98A 1YJBA 3ZBUA 4I3FA 4M9UA 4NLLA 3V9AA 3M9WA 4OQYA 3AK4A 3HCNA 4LY0A 5H3LA 3TXXA 2X3UA 1RFGE 4Q3EA 4Q7LA 1CQXA 3AP1A 4MI6A 4BHTA 2IZ0A 1NUPA 2IYUA 4S0ZA 4NWIA 3WWOA 3KB6A 3CSUA 5CD1A 3B12A 1GQYA 2O7NA 1DDOA 1CG6A 2JZNA 4L2IA 1SCUA 1XC7A 1HE5A 1VA5A 3BPSA 3DMNA 4YWJA 4DMLA 4GWGA 1U7ZA 4KLRA 5K3FA 1AQUA 2V6BA 2H5IA 1YFKA 3QX9A 4QNRA 4BMNA 2Z6AA 1P2GA 3I5AA 1B0UA 2VTEA 5IX8A 3B7WA 3ON5A 5LBIA 1DWPA 5IKOA 2ZEJA 5HX7A 2QAJA 3PI6A 2ZIZA 1CQZA 1JLKA 3QOWA 5HS6A 2YV3A 1T0BA 1E3EA 1ODKA 5EE0A 5HJ5A 3H8SA 5F35A 2J87A 1HO3A 3LAWA 2GNPA 1FQKA 5AJWA 1U2GA 1J5EB 2JAOA 4JJEA 4EA9A 2QAGB 1MRZA 4KIGA 2D5LA 3QE4A 3EIHA 5F9HA 1K6IA 3DOOA 3K9QO 3S81A 3LI2A 3R3XA 2BKAA 3G23A 3HGQA 4YJKA 1OR8A 1JNYA 2HSWA 3OQHA 4C14A 5EJGA 1TLLA 4D0RA 4YRQA 1H69A 2QSYA 3HBAA 2BVNA 4XFDA 3SF8A 1PR3A 3GJ5A 3IALA 1SKQA 4OBXA 1KJQA 5KYUA 4NAVA 1SR8A 1ZMTA 2CUNA 5JR3A 3UPTA 3CKLA 2FFAA 5DB4A 5DISB 5CFOA 2REXB 1CQIA 3Q9LA 4NYJQ 2GXUA 5LXTA 1U0HC 4QGSA 1HKUA 2WJ3A 3VZQA 4B3CA 4CCWA 1FSFA 1I1NA 1X9IA 2W6ID 1JEYA 1E3MA 1O9HA 1MO6A 1PK7A 4NU0A 3A05A 3QI7A 3G02A 4I6JA 4DJAA 3IXLA 2JEOA 5T57A 4DJJA 5KYVA 3VSEA 4C3ZA 4B8ZA 1ZH0A 1ODSA 2NNWB 1COWD 1E3WB 1N2BA 2B2XA 3QRWA 4M88A 4URZR 1I80A 4P4NA 1G6Q1 2H7VA 2ZVQX 1KAMA 4JL5A 4PLCA 5EWMB 1SG0A 1EFPA 4F4HA 2W70A 5IJZA 4B6SA 3NKFA 1DBVO 2A9KA 2CVHA 2FZ5A 2C2KA 4L4YA 4PC3A 5JIBA 4CEJB 4H3KB 1JQBA 4MYDA 4TKVA 1U3FA 1B8VA 2ZRCA 1U99A 4LF6B 1JEQB 3KVYA 1FTQA 3UHPA 1IWOA 4DUZB 2GNOA 2WIAA 1CR2A 3A4VA 1YZNA 3FCEA 1K75A 4XI9A 4CI0B 3KV3O 1Q7EA 1OBVA 5A7HA 4TZ0A 2C8VA 5AMXA 4TVSA 4EMBA 3C3EA 3PWTA 4GPD1 4IH4A 4F72A 2QTZA 3IKVA 2GJ9A 3QSYA 2J5XA 4OATA 1N33B 1VMIA 3MPUA 3IR7A 3THXA 4CLEA 4EFLA 1T5HX 4FNMA 4ZCIA 2YYZA 3Q8LA 2O8EB 1PR9A 2HPHA 4F4UA 2J31A 1WLSA 4U00A 2VA8A 3WRYA 2X1MA 5JAUA 5IEJA 3PQFA 5IKPA 1FRFS 3CLTD 1TM1E 1WCV1 2X58A 3AWIA 4Y0VA 2GHQA 5KCMA 1OCEA 1Z33A 2HFKA 3AHJA 1LBQA 2FWAA 1XRLA 2QTFA 1ZISA 3AF5A 2UV8A 5KKAA 4BB6A 4CIYA 2G4CA 4N82A 4LXUA 2VP5A 5CFMA 4UDXX 1SU8A 3SC2A 4ZQCB 4E70A 4DLRA 5DNWA 1ORDA 1MOPA 1D8TA 1U0GA 2I4MA 4UNPA 2YWEA 1ISPA 4AO8A 1RYEA 2HRZA 4A36A 3GGGA 1B26A 3G0OA 4KI7A 4B7CA 1LPOA 4KPYA 3LCRA 2OSVA 4IHAA 4IY1A 3DV9A 5DYWA 3OEED 4PM4A 4YRKA 5C8YF 3PF9A 4LKOA 2B30A 3CEHA 4ISBA 2EEPA 3O8QA 3NP9A 5G0TA 1U5BA 4F46A 3CF6R 4YK7A 2VIIA 3KQSA 3ZI0A 4FN4A 2BM9A 2OO5A 4MW4A 4CETA 3EDQA 4JV5B 2OQVA 4PAQA 2OXCA 1DXHA 1UKEA 3RGGA 2B8JA 1NI5A 4RHUA 3ODPA 1RI2A 1UWVA 3TJRA 1N78A 1M6NA 4AL4A 2J0UB 3DO8A 3ESAA 1XD2B 3OO0A 4AG5A 4BLSA 3E53A 1NVVR 2HPAA 4W1SA 2ZM6B 1KZ4A 4YP6A 2IA5A 2ODNA 3O26A 4UCWA 4B7ZA 4B3HA 4MQBA 4N3GA 4QATA 2BT4A 2AGVA 5KNCA 1P1IA 1T8WA 1ZN2A 2AR9A 4GI7A 2IOYA 1G63A 4HZIA 1V71A 1J2RA 4QLOA 1KH1A 1BO6A 3BERA 5IW8A 1WW3A 3B2NA 4MMYB 4JB8A 4DDWA 2Z43A 2J9GA 1L7QA 1NP7A 4A4DA 2ZE5A 3LRPA 4C4ZA 3B2QA 4GR5A 4D5EA 2BM1A 1ODIA 5AJYA 3CH5A 2HY7A 3MGKA 1A04A 2P9HA 3WRVA 4GVLA 3PNOA 1DGQA 1QIEA 2XVAA 1QV9A 4BJHB 5E38A 2BCEA 3GLIB 1H1LA 5ICGA 4GPBA 3I01M 4ER5A 1Q0LA 3AUJB 2H2GA 3IXQA 3LTNC 3AVXA 2OLJA 4S1OA 1U0NA 1V37A 5ICFA 3L7CA 1YFJA 4WXMA 3PKZA 2HRRA 2C4MA 3BD9A 4KR7A 2P4UA 3AERB 1RLJA 4EW1A 1FS4A 3DTYA 3HVJA 4FE7A 5B4UA 4JOQA 3RVLA 1Y4ZA 3L0IB 3D8BA 2VBGA 3OQVA 2BJWA 5KDOA 4C7XA 2WTUA 3I5YA 2P4QA 3IJEB 4UKDA 4KGDA 4HMOA 2X5NA 2G5PA 3L8FA 5DTRA 1A7JA 1K3TA 2XDAA 2H1RA 2W6CX 1OV4A 1QRDA 3HO6A 1HGXA 16PKA 4TL6A 4Y2VA 3M4YA 5DFAA 2AR0A 4TLAA 5AICA 4KAAA 5DEOA 2HHHB 1XAJA 3B7GA 1CR4A 3EGOA 3GLQA 5CDUA 3GOQA 4F6RA 1GG9A 4HC4A 4HH4A 1L4BA 3SKVA 4CFYA 5F64A 3RJMA 1WZUA 3VR3D 3WJAA 4Y6OA 2H63A 1DTSA 1ZESA 1DOZA 4QRDA 2PGLA 1NBWB 3WQRA 4BYGA 3AONB 4L5AA 1REQB 3TOZA 1JDNA 2ZBDA 3RG8A 5K0EA 2QLMA 5BRJA 2IPLA 4DBVO 3WLTA 5KVQA 5DM60 2A5JA 5GGYA 2IOQA 1UM8A 3BD7A 3L7LA 1D9XA 3SC6A 4X62B 1KMNA 4L5JA 4JELA 1YGPA 2ZPAA 3NT5A 1RTTA 1JQJC 2PO5A 1P44A 4IOJA 3QU7A 1PX0A 2APJA 1SULA 4XX0B 1E92A 3FWYA 2V9ZA 5AKLA 3KQMA 2QQFA 2Q2VA 5FP0A 2OO3A 1RXUA 1LUAA 2WOOA 1E7WA 2ID4A 1F1JA 1EFCA 1A2QA 3OKPA 3D4BA 4K9KA 3AFIA 2BGLA 4GYKA 4F2WA 3NMUF 3SYMA 2H59A 2YICA 2I8AA 3FY4A 3LP5A 4E2YA 4DXDA 1FU7A 3E7XA 1CF4A 3AHGA 5FBRB 2WKPA 5TIIA 1EG7A 3Q7QA 2CZQA 1X1BA 4UE3S 3IUEA 2JHPA 3DAYA 2GMWA 1Q1EA 1BCSA 2QMEA 3BXXA 2F3UA 3PZRA 3QSGA 4CL0A 3LQFA 3KOYA 2C3OA 5AO9A 5AXCA 4UREA 4A1OA 4X44A 1H3NA 1FDTA 4X3OA 3RYFA 2HD4A 5ES4B 5JBNA 4YT2A 2GYUA 2VJYA 5EUBA 5U4XA 2FPMA 3A1WA 1RLOA 2NO0A 2W11A 4RZXA 3G7UA 3CZPA 3PEFA 1FVFA 4MS3B 2PJRA 1CEEA 3F9IA 4Y30A 2P9CA 4OI4A 3COVA 4ENQA 4B6RA 2EBHX 1ELOA 1CE8A 4INAA 2WM2A 2YXEA 3UWOA 2SHKA 4B9AA 2C57A 1CK4A 3IP1A 3DEIA 1L1EA 2HNAA 2CMKA 3LYAA 1FOEB 1JHYA 1JZQA 5EKSA 1ECBA 3HXPA 1PWEA 3IQIX 3HBNA 1NBIA 3HN2A 4OGFA 2FRDC 3KKKA 4MS1B 4CGZA 4I3GA 3L07A 4UHCA 3L0YA 4I9NA 2ZUSA 1RLUA 3C41J 1THTA 2Q45A 3OZBA 1EM8A 1EWRA 3CNNA 4FCVA 4YRGA 4HNAA 2X8JA 1FFDA 3QE3A 4AT1A 2ZAGA 2CLSA 3EUEA 1ONBA 4TOIA 2JASA 4FKBA 3ETDA 1BXRA 5JWOA 3CNBA 3NFYA 4MV5A 5KNBD 5I8ZA 1MX9A 1E7YA 2QIOA 1MHTA 1XDWA 1T4GA 5AW4A 5I7WA 4O59O 3RTBA 5JATA 3I0ZA 4CDGA 4JIMA 1T8RA 4C7VA 1T5OA 1B4DA 1HRDA 4Y1EA 1FFGA 1BGXT 3PQ3A 2F64A 5EJ2A 4JJ8A 3PBKA 1GNQA 1ISMA 4GS5A 5DCUA 3ZH9B 3UGQA 2BPOA 2EKPA 3H0KA 5DBEX 4M21A 1EG2A 1EBFA 4I4CA 4LHVA 2C3YA 1RYDA 5M29A 1PT8A 4KIFA 4EA8A 2ARKA 1AX9A 1RXCA 4EK9A 5ISMA 5KSWB 2HW8A 3PRYA 3VOSA 2Q27A 1PS8A 2Q3EA 1R6BX 2UUPA 3A14A 1PW7A 2BEJA 3ML1A 3NIWA 4H7HA 4KDRA 4LZAA 1XZ8A 1E79A 1EX6A 4UVGA 1H3EA 5KJCA 3N86A 3PFIA 1GPBA 3NHYA 4O4HA 3RFCA 4EY7A 1A1VA 5BW4A 1V1MA 2I4LA 4I9FA 2B0JA 2Y6UA 1RAHA 4OHRA 5KNLA 3LWNA 5T8KA 2ZUBA 4R31A 3PYMA 4UEQA 4XIIA 1Y9EA 2ECPA 3NBYC 2ZJAA 5EY5B 1SCIA 2O7QA 2P2NA 1MB0A 2Y0DA 1U9YA 3KYCB 2WQ7A 3C5EA 4FYWA 1BJRE 4YJ3F 1P9OA 3QPBA 4BMXA 3EDRA 3CFYA 5BUCA 5LIRA 4MMZB 4UARA 1X7ZB 1C3OB 2ILTA 3M5PA 3HQ4O 5AM4A 2X6QA 3BWYA 4OU5A 1GNRA 2GK6A 5HSGA 4LFBB 2JARA 4NNOA 3CKKA 5FFMA 4C2AA 1SKBA 3KJNA 4KL8S 1GEEA 3P52A 5IT9A 4RYDA 1VDMA