3HDJA

The crystal structure of probable ornithine cyclodeaminase from bordetella pertussis tohama i
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
311
structure length
311
Chain Sequence
AMLHIDDAMIEDAVTPQAAQEVLHAAFLDFGRGSAAMQRRVRTEAGGVKLSTLGAVIPGQGVAGAKVYTTIKGQFQFVILLFSAADGRPLATCDAGTLTRKRTAACTVLAAGALARPRSSVLGLFGAGTQGAEHAAQLSARFALEAILVHDPYASPEILERIGRRCGVPARMAAPADIAAQADIVVTATRSTTPLFAGQALRAGAFVGAIGSSLPHTRELDDEALRRARAVVVEWREQTLSEAGDLVLAAPDTGLDAKVVELADVLAGRAAARQADEDIVIYKSVGVGLEDVALAGYAYRRLAAQRGWPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of probable ornithine cyclodeaminase from Bordetella pertussis Tohama I
rcsb
source organism Bordetella pertussis
molecule tags Structural genomics, unknown function
molecule keywords Probable ornithine cyclodeaminase
total genus 106
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1780.10 Alpha Beta 2-Layer Sandwich ornithine cyclodeaminase, domain 1 ornithine cyclodeaminase, domain 1 3hdjA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hdjA02
2W2KB 1DHRA 4DREA 1YOVA 1EFKA 3BMQA 4WLFA 4JX8A 3FD8A 1AUPA 1E77A 1F8GA 2DTDA 3DZFA 5AXCA 4FOOA 2ZYDA 5BSFA 4L4XA 4GPD1 1K6JA 1EDOA 1ARZA 3OA0A 3GY0A 1T2AA 1T2CA 4W9NA 1Q0HA 1CQIA 1PU2A 3K9QO 4IMPA 4IDDA 1D3AA 4R5MA 4D46A 1ENZA 1H9AA 1T2EA 1UH5A 1LQTA 5LC1A 5A06A 3GGGA 1P44A 4MO2A 5BSHA 3W4IA 4RJTA 1PQPA 3V2GA 1LA2A 4J0FA 4BMSA 1I10A 1GUYA 3VKVA 3PZRA 1GQ2A 1R4NB 3WWZA 2FZWA 2HMSA 4AICA 1R4MA 4P4GA 4UUOA 1CYDA 1KVUA 3HSKA 3UVEA 4EJ0A 5C7LO 3NAQA 4XA8A 1LXCA 4GWGA 3DZBA 4OXKA 5GZ6A 1Q2XA 4IDBA 4JROA 1B8PA 1JDJA 4KTVE 4CLEA 3WYBA 3JQCA 1EUZA 3AY3A 1NHWA 3H4VA 1MFZA 5TQVA 3U4CA 2DTXA 2PZLA 2VTDA 4W7IA 1Y7TA 2FR1A 3U5TA 2AEMA 4OIMA 4E5NA 4ZA2A 3NKLA 4JK3A 4A73A 2VWGA 1NPYA 2DKNA 5DP1A 1UAYA 4P22A 5A9SA 2EXXA 4LK3A 1ENOA 1LBEA 2YY7A 3ZCXA 2E4AA 1V3UA 2AE2A 3U62A 2GN6A 3RC9A 5JE8A 1HE5A 2P9CA 2E82A 2RAFA 4J90A 4P8RA 5JAZA 5KVSA 4I5GA 4CLRB 2YJZA 1P33A 1LLQA 3DOJA 3L6OO 3TZ6A 1D8AA 2B4QA 2G5CA 1B14A 5AOVA 1UP7A 3RCBA 1GADO 4HKTA 1Z7BA 4CMBA 1XR3A 2VOEA 1E1KA 1LRJA 1TXGA 1GUFA 4CM4B 3S1LA 4NBUA 5JDIC 4PVCA 1QSGA 1ZK3A 4RORA 4GBJA 2A4KA 3OIDA 3WBFA 4EITA 4ZQFA 2ZTUA 1PS9A 2Q46A 2Y93A 2EKLA 5IF3A 2J3IA 1I2BA 1CRWG 2PTGA 5DP2A 5G4KB 1I5RA 5ER6A 1H6AA 2FP4A 2PD4A 5A04A 1JKJA 1DHTA 5A5FA 1VJ1A 1X14A 5G4LA 5JCJD 3LZ6A 1ZVMA 3E82A 3PWZA 4CV2A 5G0VA 7ADHA 2AQIA 5HRUA 4FFOA 2Y1FA 4BUCA 2EKPA 1I3NA 1YL7A 3LLSA 1R16A 4GH5A 2QYSA 1XU9A 3M1LA 4MIOA 3OIGA 3VKUA 3ICPA 3WOHA 5COBA 1U8XX 1M76A 1OOEA 2VUSA 1UAGA 4RF3A 1J5PA 1C3VA 2HMWA 4E2ZA 4BGUA 2X0JA 2VZ0A 5CDYA 3G0OA 3WGTA 1OAAA 3B20A 3K8ZA 1UZLA 2VYND 5AQ1A 2Q1WA 5FWNA 3H5RA 3GHHA 1ZSVA 4FN4A 4W4TA 1PGOA 5I7VA 1E5QA 1XELA 1DOHA 1F12A 2CVQA 1FMCA 2FHSA 2GSDA 4ZD6A 1UDAA 4M89A 4UVIA 3QWFA 5CFZA 3INRA 3FSRA 4WUVA 5IDWA 3ZWWA 5JCJA 3TNLA 4XZ3A 3ENNA 1XGKA 2JCYA 3FN4A 4PG4A 3WG9A 5L4SA 2Q1TA 3L6DA 1LUAA 3P2OA 4WGGA 1PGJA 5IAAA 3B1KA 2EHDA 4XRRA 4DPMA 4TZTA 3DZIA 4KTTE 5K6AA 1IPFA 1MV8A 4BB5A 4DL9A 5HA5A 4C7KA 3H9UA 3GDFA 3ETGA 3HNPA 2Q1UA 4J9UE 1EVJA 4DLBA 3DBVO 1P77A 5F5NA 1K3TA 3BAZA 3VZSA 3ROPA 3GN2A 4CUJA 5I9MA 3D4OA 4B7CA 5TF4A 4BQRA 4N5LA 4RVHA 3RU7A 4GLOA 1YB4A 3HDJA 4FFLA 3VVCA 3QIVA 3GRPA 2HK8A 4RZIA 2JFHA 4XIYA 3FWNA 5KNLA 1ONOA 2I6TA 2P2SA 5I8ZA 2PH5A 4HFMA 4OSPA 1IUKA 2W98A 4PLGA 3O4RA 4MOWA 1E7MA 1I0ZA 3TFQA 3OEWA 4ND2A 1ML3A 4LMPA 4WKGA 2P9EA 4E2WA 1QRRA 3QLJA 3JQ7A 4B79A 1MP0A 1ORRA 3T7CA 3FRJA 4L4SA 4ZQBA 3DTTA 3LYLA 2UAGA 4IDGA 4P38A 3QVTA 4I08A 1JWBB 1KS9A 5FI5A 1YGYA 4XYEA 1G0OA 5BT9A 5KJEA 3V1UA 3OICA 3ONEA 1NQAO 1WVGA 4DRYA 1GTMA 3BHIA 4IGFA 4IJWA 4YRBA 3H9QA 4ND5A 1O94A 2BFOA 3VPSA 1HTBA 1IULA 1C1XA 1J0XO 2ZQZA 3KLMX 3DWFA 1MGOA 3TRIA 4PN3A 3WMXA 3O03A 2I3GA 2WE7A 3TOXA 1E6WA 2YW9A 2YDYA 4XDZA 4BNHA 3ONFA 4OXNA 3C7CB 4YVFA 4X54A 3E9QA 1NP3A 3ORFA 4RV9A 1SNYA 4YT4A 5L9AA 2GLXA 3ZHYA 1R66A 4XYMA 4QO7A 1A71A 3DDNA 4UAGA 4YAKA 5KVCA 3KRTA 1I32A 1ID1A 3EDMA 3I6IA 4HP8A 3JQFA 2VNAA 4JP2A 1EQ2A 1P9LA 1A27A 2C54A 4YJHA 4R1TA 3D4NA 2ZYGA 3OP4A 4BO3A 3UHAA 3LDHA 1KYQA 1UXKA 3NYWA 4D41A 1QYDA 4FW8A 4J2HA 4BKPA 3UICA 1ADFA 1Z45A 3JQAB 1A7KA 3K30A 2UDPA 3NV9A 2AE1A 1U7TA 1UDBA 2GNAA 3E48A 4IY1A 2J3KA 3GDOA 1GR0A 4TRJA 4G5HA 2B4TO 3T4EA 3WR5A 2IYOA 3L4BC 4GX5A 4BQPA 4MKRA 4TRNA 1WAMA 3D4PA 5TT1A 2BGLA 3GGOA 2AG5A 3Q11A 2O48X 2CF5A 3GVCA 3ZV4A 3F47A 2XXJA 4M1QA 2CNBA 1GZ3A 4DPLA 1DO8A 2HQ1A 3R0IA 3UN1A 1T24A 3W8DA 3NT5A 1K0UA 1KIFA 4DC1A 3BTSA 4B7UA 2BGMA 4NZ9A 3AFNA 1NASA 1ISJA 3DMTC 1SEVA 4R16A 3O8QB 4BGVA 3S2FA 1A9YA 2HRBA 4XGKA 1SPXA 1BWSA 4FFNA 3KYCB 2GR9A 5L4LA 3ANMA 3QWAA 4I5EA 3A9WA 4PG8A 4NJMA 1NQ5A 2PH3A 1VE9A 2VRCA 1W0CA 5KTKA 1YQXA 4KUGA 4XD2A 3ROKA 1E3IA 1Z75A 2OZPA 3RKRA 3GOHA 3IDSA 5DBFA 2CY0A 4MIEA 4DQXA 3DZJA 4M55A 3UF0A 2QW8A 3ZWCA 1P1KA 1BTOA 4QECA 3NJ8A 1PWZA 3K96A 4PLVA 2GASA 3K31A 4JN6B 1P74A 4R1NA 4JXKA 3WQQA 4INAA 5HBRA 3WLEA 2QZ9A 4BKRA 3LF1A 4G2NA 3NGXA 3BMQB 1CF2O 3O38A 2AEFA 3PYXA 3F3SA 3Q2KA 3MTGA 4FS3A 1L1FA 4CMEA 1D7OA 3RBZA 3CMMA 1HRDA 2H6EA 5F3RA 5HWSA 4PRLA 1QYWA 4NK5A 4M49A 5DDIP 4L74A 1HSZA 3E18A 3IP3A 3KSZO 1A72A 2JCVA 2B83A 3G1UA 4CQLA 2VHWA 3L07A 1EVYA 3LF2A 3L9WA 3GEDA 4O59O 4O0LA 4W82A 1E3LA 4HBGA 4LW8A 1CDOA 4D7AA 3BZUA 1AHHA 3OM9A 2NVUB 1H6BA 3B6ZA 3GEGA 2PZJA 5KVQA 2O50A 3PHIA 2I67A 4RLHA 4U6SA 1XKQA 3HE3A 4RZHA 1V6AA 1E3EA 5TIIA 2X0RA 1PQUA 4AJ4A 3U09A 1M6HA 2ZCVA 3I1JA 4PLWA 1WXDA 1YBVA 1ZMOA 3EY4A 1KC1A 2VTEA 5JYDA 4Q9NA 5G2OA 4F3YA 1ZXLA 1RM0A 1SC6A 4YB8A 4GGOA 4LCJA 1ZJZA 3R3JA 4IXWA 2WM3A 3PHGA 1OBFO 1E3WB 3OH8A 3WNVA 4E21A 3AUTA 4DMLA 2C2XA 3GVHA 1ZJYA 3DZGA 4YWJA 4BKOA 1D1SA 3GMSA 4OM8A 2I3AA 1AN9A 3HUDA 5L7TA 4TWRA 4GGPA 1E3WA 3E8XA 3W4KA 3JD0A 3RUDA 4BNMA 1WDLA 4LN1A 1N2SA 3ZWYA 1NWHA 2QRKA 3PQFA 1PGPA 4ZGWA 5JCXA 4HADA 2EW2A 5IDXA 4Z0PA 3BTOA 3I4FA 4R9RA 4QXMA 2E49A 1C0KA 1UDCA 4W6ZA 4M8SA 1IB6A 4RPKA 1PJTA 2O3RA 4OAQA 4MIYA 4ZN6A 5C3MA 2BI8A 1GQYA 4BNLA 4CMEC 2QYTA 3ZWBA 2Y1OA 1UZMA 4J1TA 5TRTA 1QP8A 3ZWXA 2HO5A 4N54A 3Q9UA 4GX1A 1QORA 3D3WA 2HRZA 2CSUA 3GHYA 1PIWA 1S7CA 4WEOA 1YBAA 4EUHA 5I9NA 5AXBA 3KM0A 2EW8A 1I3KA 3AI2A 3TWOA 4L75A 3ANNA 2ZK7A 1OC4A 5IFLA 1PJCA 5ES3A 1GFSA 3ZW9A 3VH2A 4YAGA 3JQ8A 2GDZA 4W99A 5TC4A 2HK7A 3UCEA 1N92A 4K1LA 4WPGA 3UXYA 1ISMA 4IINA 1V0JA 3EW7A 3PI7A 5JAIA 3VOSA 3GFBA 4NH4A 1ZW1A 1DC6A 4GX2A 1E1LA 3PDUA 3UGKA 3KOUA 1X7DA 3SBOA 5CEJA 6LDHA 1N8KA 4OQZA 3IKTA 3RASA 1I2ZA 4XIJA 4ROSA 5CEFA 5CEEA 2OHXA 1ZCJA 4CL8A 4QX6A 2TMGA 3RUIA 1YH3A 1EVIA 2B5WA 3ZNQA 3JQBC 4A26A 2C5EA 4N5NA 3ZI0A 3PTZA 4OSOA 3RFXA 4J91A 2X6TA 3FNFA 4ZQHA 4LSMA 2YV3A 3KYDA 4DYDA 1Z74A 4ND4A 3V1YA 4CLOA 3TZHA 1LQUA 1NHGA 4NIMA 3ROMA 2HUNA 1Y5RA 1WDMA 2OFPA 4A5OA 2ZQYA 5C7IO 3FWZA 1E6UA 1UXHA 3E1KA 1MA0A 1XU7A 4IXTA 3RFTA 1O6ZA 4CM4A 3F1KA 5B4TA 5F1KA 3I6QA 1PJ2A 3JD3A 3FPLA 4II3A 5A4DA 3TFOA 3MWEB 1L7DA 2V6BA 3ITDA 4I5DA 1A7AA 4TRRA 2C20A 1P1JA 1JN0A 2AA3A 2GUGA 3LSYA 4LVCA 2J5KA 4NI5A 3X2EA 3DR3A 4AJ2A 3WGIA 5I9LA 2ZJ0A 4YJDA 2NLOA 2V6GA 3GA0A 4FSHA 1QG6A 2CDCA 1H2BA 2FR0A 1DLJA 2B0JA 1QKIA 4BV9A 3DAFA 3ABIA 2OMEA 4ALNA 4PLZA 2NTJA 5MDHA 4E13A 3OBBA 2FR8A 1KETA 1UR5A 3OJOA 2Y1EA 3H65A 4KWIA 4A10A 3ETDA 4KWHA 4AJHA 3D7LA 4CMJA 1OFGA 5COAA 4WASA 3KSDO 4I1IA 4B4WA 1OC2A 1E92A 4OHUA 4MINA 3RSHA 3M2TA 4YTEA 3ZU3A 3JYNA 4NHEA 3RUCA 5L40A 3FPCA 5AXAA 3I9LA 4J4BA 5BR7A 4FFRA 3WIEA 1V3VA 3F5QA 2E48A 1E6EA 2YQ5A 4BV8A 3MOIA 1E1MA 4BNFA 1YB1A 3RAJA 2NV6A 3D5QA 4XJTA 2HAEA 4PLHA 4EUEA 2Z95A 1DRUA 5G0TA 4F45A 2X9GA 3KTDA 3IS3A 4J16A 1TEHA 3LC2O 1KEWA 1YRLA 3VZPA 4YQYA 3U3XA 2W90A 4GLLA 5I7EA 1F14A 2DC1A 5JNLA 3FHLA 2OBNA 2DUWA 4BKQA 4YR9A 1LSJA 1UJMA 3ZH2A 2YHIB 3LT2A 5CPBA 1RM5A 4BNWA 3IQDB 1HSOA 1DDOA 3BMNA 1HDXA 5A03A 2PA3A 2R2GA 1B2LA 3Q1LA 1EE2A 3ZWAA 2UVDA 3GPIA 3SJ7A 2YV2A 1G6KA 1GUZA 3PP8A 5JLAA 2P9GA 3NRCA 4MVJM 4XB1A 1A9ZA 3TJRA 5KWEA 2BFPA 5KCZA 2Q45A 3VZRA 4C7JA 4Z6KA 3W6ZA 4E5YA 3WFJA 2Q50A 2IXAA 4FQ8A 2WWRA 4A27A 4QSMA 4D43A 4ZHSA 5C37A 3P5SA 4BVAA 1IY8A 3ZNPA 5CDGA 3F9IA 1BXKA 1LNQA 4MJLA 3FTPA 5IXSA 1ZK1A 2Q4BA 1KY4A 4AJKA 2JL1A 2FRDA 3FR8A 4TMFA 2XPCA 4MVJD 3RI3A 4IJKA 5KIAA 4ONEA 3LQFA 4YCAA 3CIFA 4CM9A 4ALJA 4YJFA 4XJSA 2FWMX 4CMIA 4PLFA 1H93A 2I9PA 2GERA 3PJEA 4KP7A 1VJTA 4LVUA 4E12A 4TQGA 1OZAA 4DXHA 4NJOA 3PHLA 4IJVA 3C1TA 4RF2A 2PGJA 1HZZA 4S3MA 1Z73A 4YEDA 4CUZA 3B1FA 3IOYA 3CZRA 4L8VA 3ANLA 3WSVA 4NU6A 4P4LA 1B26A 4B4OA 2GN4A 3L4SO 4JNKA 4S1VA 1KC3A 1WLYA 2OBYA 3F46A 4CLOB 1YS4A 2ILTA 2GGSA 4AJIA 2Y1CA 1Y8QB 2XAAA 5DCUA 1NVMB 4M54A 4RL6A 3M1AA 3JQ6A 5DCWA 2CF6A 2IZ1A 4WJZA 1UP4A 3CMCO 3FCOA 4FIZA 2JFFA 1PQWA 2X22A 3EMKA 4J7CA 1MXHA 1NPTO 4NBVA 5GZ1A 3TOZA 3COSA 1PGNA 1ONPA 3G17A 2VYNA 2NM0A 2Z5LA 2Y1GA 2BGKA 3WBBA 2VHZA 4A2CA 5EL0A 1NQOA 3OJ0A 3ZNOA 1NTOA 3K73O 3MJSA 5JDIA 5BNIA 1UXJA 3H9JA 1R37A 1A4IA 3RBVA 4MPDA 3E9NA 3VTZA 4E2YA 4R4JA 3BA1A 1PJBA 4FB5A 2R6JA 3KBOA 4IM7A 3GMDA 1U5CA 1HF3A 2NQTA 5B4UA 4BNGA 5CHEA 2Y66A 3GAZA 3NX4A 4PZDA 2GPTA 4IBOA 3ZU5A 3OIFA 4MP3A 4FBGA 4UUNA 4ZVVA 2C0CA 4UVEA 5F1OA 2AQKA 3ZNNA 3H3JA 2Q1SA 4DBZA 1GZ6A 1QYXA 3AUUA 5JBIA 3BIOA 1QYCA 1DEHA 4PIVA 5CG2A 4UVDA 1U3TA 2IZZA 1QLHA 3EK2A 1I01A 1LDYA 1HDRA 2FMUA 3AW9A 4U7WA 4XCVA 5AYVA 2RHCA 1CETA 1O0SA 4R3WA 4WE3A 2VHXA 4O63O 3DZHA 3HWRA 4MKXA 3JQGB 1I3MA 2YFHA 4PGFA 1BHSA 1PJ4A 4RLSA 3PJDA 4E5MA 4KOAA 4UEOA 3ASVA 3QVXA 1I36A 5T64A 4TKLA 1LEHA 4BNXA 1B15A 1B7GO 1XLTA 5JAQA 3E5RA 1J49A 2X8LA 5EESA 2FN7A 1EZ4A 3E03A 1WZIA 4L9RA 3QRWA 1NAHA 5I7SA 1WMAA 2I99A 2ZIZA 3JQ9A 4TVBA 4WCFC 4BHTA 2A94A 4ITUA 2BI7A 4U5QA 4WLOA 1XG5A 3MJVA 2Y1DA 2J5QA 5DULA 3S2EA 2X9VA 4Y8VA 1LDBA 5JYEA 1S6YA 4NR0A 1DIAA 3NTOA 2Q2WA 3HN2A 4FD3A 4UVGA 1U3WA 4IQ8A 2WYWA 4W9NC 4FOSA 1QXSA 1XIVA 3GGPA 2VHVA 2W2LD 4J3FA 3P7MA 1R0KA 4FJ2A 3UH1A 4BNJA 4AFNA 4WCFB 4Q39A 1U4SA 5T8KA 3QA9A 4WEQA 1YDEA 1GPDG 4GSKA 2DAPA 1YO6A 4R41A 4UEJA 1PTJA 5T5QA 5THKA 1VM6A 1ADCA 3PLRA 3QWHA 1GYQA 3AWDA 4BIIA 1LSUA 5CDSA 5LDGA 1PS0A 1ZO8A 1PSDA 4DLAA 3VDQA 1HXHA 2O2SA 3SC6A 2VT3A 4QFCA 4Y6RA 3QV1A 3I4CA 1T1RA 1Y9EA 3D3WB 3IMFA 3SLGA 3GG2A 4CMHA 5TJHA 4B3JA 1YWGO 1BDBA 4YAIA 1SBYA 1B3BA 1U3UA 2W2LA 4WECA 2IODA 1XWFA 3DBRB 4IDCA 3RWBA 2ZKLA 2D3TA 2WEKA 3K2EA 5A3JA 2WJPA 2VZ8A 1T4BA 3MJCA 3PRJA 4BO5A 2HK9A 2VN8A 3VZQA 5DBGA 4XYGA 5FF9A 5LDHA 1LC3A 1TLTA 3WYEA 3V2HA 3GAFA 4RCVA 1AGNA 3LC1O 2DU8A 4YRDA 2Q4EA 1F0YA 1PEDA 3H9GA 4Y67A 3RUFA 4GQAA 3EZLA 1M67A 2YV1A 2YYYA 1ENPA 3WXBA 3PFFA 1ISGA 4EW6A 3DFUA 2NACA 4Z9FA 1DC4A 2R00A 1CQJA 3C7DB 3TZQA 1V9LA 3RC2A 4PCVA 2DLDA 3JQ7B 5L51A 1XHLA 1XQ6A 3FNHA 2FPIA 3IAHA 2JCXA 3L0DA 3OF2A 1NPDA 4N5MA 5DBIA 2CFCA 2NADA 4FC6A 3JCZA 4DIOA 4CM8B 3WGQA 4DUPA 5JC1A 2I76A 1C14A 2EJWA 1HYEA 2JD0A 2O4UX 3QHAA 1RPNA 5JY6A 2IDZA 4Y6PA 3ZHBA 3H7AA 2BKAA 5ER9A 2EWMA 1ZFNA 1W6UA 2EGHA 1TB4A 1M2WA 2FPPA 3WTBA 1ZXBA 3M2PA 4CQMB 3ENKA 5AXDA 1EDZA 3GLQA 3TL2A 3ON5A 3CTMA 2UUOA 3DMYA 1H0KA 3PK0A 1MFPA 3BMOB 3KSUA 4D3SA 4C4OA 3GQVA 4QT0A 3RKUA 1FJHA 2P5UA 3R6DA 4WLVA 1B0AA 2CUKA 2QRJA 3MWDB 5TSDA 2VOJA 2X5JO 1JTVA 4H7PA 4OQYA 4E0BA 1VSVA 3MOGA 1VKNA 3PDJA 1FDUA 1C0PA 3U4DA 1YBMA 4DA9A 3AFMA 1MLDA 1U1IA 1WMBA 8LDHA 4YA6A 2YZ7A 5EMHA 7MDHA 1P31A 2RCYA 3HDQA 1Y9AA 4R54A 2F1KA 3F5SA 1JW9B 3ZZNA 4NJMB 3WGZA 3GZNA 4KDEA 4PLTA 2LDBA 3U4HA 4G81A 3I5MA 2D4AA 2HMVA 4J1QA 4TZKA 1QR6A 1M66A 2D8AA 1YXMA 3QVWA 4E5PA 4WCFA 1WNTA 4LCEA 4B8WA 1W4ZA 4CR6A 4J6FA 4J4HA 1C1DB 4Y98A 5K6AC 3GVPA 5ILGA 4KQXA 1XA0A 4O6VA 1ZNQO 3Q0EA 1Y5MA 4URFA 5KKAA 1E1NA 4D42A 5U9CA 1P1HA 3DBHB 3OSUA 3ZHXA 3NTRA 1WWKA 1BVRA 4L0QA 4WLUA 3N7UA 5EPOA 3AI3A 3BTUA 3JTMA 5JPIA 4RVUA 1NR1A 2NVUA 5KJFA 3TDKA 9LDBA 3CE6A 3V5NA 4BMVA 1RYDA 3I52A 2ZTVA 3U9LA 3T4XA 1F17A 4JBHA 5IDYA 1PZGA 4DQUA 1H9BA 1XDWA 3DBRA 1VSUA 5A02A 1ISIA 4RF4A 3JQFC 5IG2A 2HSDA 4OKNA 1DAPA 3G79A 5U4QA 2HKIA 2C82A 3S2IA 2YDXA 4PZCA 5ICMA 1PS8A 1U2DA 2P68A 1BXGA 1VJ0A 3B70A 4XGIA 3NJ4A 2A9FA 5A05A 2J5RA 4CMAA 5L7YA 4BL5A 1WDKA 5HM8A 1PJLA 2PNFA 2ET6A 3IP1A 4FC7A 2PGDA 1IYZA 2EF1A 2OP0A 5AVOA 2PZMA 3PEFA 4Q3AA 4J0EA 4BGEA 3UAGA 5B4VA 5JW6A 4IDEA 2AMFA 2CZCA 4Q3EA 3KUXA 2ZB7A 5BSEA 4G65A 4PG5A 3N58A 3ADPA 3AOGA 3OEYA 3R3SA 2JHGA 1E7YA 1R0SA 1ISHA 2X4GA 2XOXA 3PHJA 4XB2A 3RU9A 4YPOA 3PGXA 4BO0A 1DC3A 4YDRA 4EJ6A 2IE0A 4HXYA 3EHEA 4F46A 4CV3A 4BNKA 4KDFA 4DBVO 4CLRA 1TT5B 1Q7GA 3TSCA 3CINA 4WOJA 3F1LA 3WLFA 4A03A 3IKVA 5GZ3A 4OH1A 4IUYA 2O23A 2ZTMA 1EUDA 2H1SA 1DFIA 1DXYA 5IDQA 3H6KA 2JKVA 4EJMA 3QSGA 5FYDA 3FBTA 3RUAA 4Q3CA 1MC5A 4TSKA 1B3RA 3FNEA 4ALIA 4MVJH 1H6CA 4RPHA 5G0WA 3S55A 3GN1A 3KV3O 1XSEA 3D3EA 4GL4A 3A1NA 5BSGA 5THQA 3AJRA 3STHA 4DC0A 4YXFA 4OMUA 1F06A 2AHRA 3WJAA 2AG8A 1H94A 4I9UA 4DMMA 4ZICA 2O7SA 1AE1A 5J23A 4DLLA 1GQQA 2EV9A 4GVLA 2VWQA 5EN4A 1E7SA 1VI2A 2EP5A 1HE2A 3H8VA 1Y8QA 2EEZA 2WMDA 4OOFA 2YHUA 5HS6A 2OOSA 3EVTA 2HMTA 1JWAB 2XXBA 1BVUA 2YFQA 1IHXA 2F00A 4R1SA 4CJXA 2JAPA 1C1DA 3AK4A 4EEXA 3D0OA 1FDWA 3Q2IA 3C8MA 3GF4A 2FPGA 2NNLD 4NMHA 2P91A 4B3IA 4L4RA 4U0KA 3DBHA 4FPXA 4JQCA 4RF5A 1PJ3A 5CDTA 4HUJA 4RPLA 2Y67A 4RGBA 3OECA 4GKVA 5JMPA 2QIOA 4H16A 1NBOA 2X0IA 3TL3A 4NQZA 1MG5A 1OI7A 3NDIA 1DSSG 2HCTA 4L73A 1ADBA 2PGLA 1I33A 4O1MA 4YAEA 4I5FA 1I8TA 4MVJE 4LMRA 5DT9A 1PJSA 1KBZA 2CMDA 2PKRA 4XRGA 1P0CA 5EERA 5B1YA 4D0RA 2QZZA 2G82A 2BH9A 2NTNA 3VPGA 4H3VA 4F6LA 5IZCC 1GZ4A 2B5VA 3S8MA 3AY6A 1OMOA 3K92A 2BLLA 3WMWA 2PKQP 4II2A 5CG1A 1YKFA 5DCYA 1HDCA 3D1LA 3ZWPA 5KJCA 1YL5A 2QHXA 3GNTA 3UOGA 2PFGA 3JYPA 4KQWA 1T1SA 2WYVA 5ENDA 1NFQA 3PIDA 2FSSA 4GMFA 4AG3A 4I8XA 4CR7A 5JFOA 2PD3A 2C2YA 2IYPA 2GN8A 2DFVA 3CKYA 3DL2A 4YQZA 4DQVA 2O3SA 3AOEA 4GX0A 1EQUA 4YYZA 3UCXA 4EEZA 1GY8A 2WDZA 3HFGA 2GRAA 4ZRMA 3WGOA 3A14A 5EJ2A 2HDHA 4QTZA 2BFMA 4IQ0A 2Q2VA 3OMLA 4JBIA 2IEBA 4BO1A 2DBRA 4DGSA 1HKUA 4B7XA 1DFHA 1QLJA 1TT7A 4OO3A 1YOVB 3ITKA 3RBXA 2WYUA 4EUFA 1U5AA 3DHYA 5F1PA 1E5LA 4NFHA 1Q1NA 1HETA 3VHRA 3DOOA 2VZ9A 4XQGA 3DAPA 1GAEO 4J7UA 3KEOA 1T2FA 2O3UA 1Y8RA 1K6IA 2OORA 2WD7B 5DOZA 3V2UA 1RKXA 4CPDA 4F6CA 1VL8A 2O3QA 5CDUA 1N9GA 4R3NA 5TS3A 2RH4A 3WYCA 5TGDA 1DJQA 1HLPA 4W7HA 1GEGA 3HADA 4CM9D 3AOEC 1M6WA 1N1GA 4FR5A 3BXXA 4PRKA 1LU9A 1YB5A 3BHJA 2YHIA 1IZ0A 1KERA 4ILKA 4TVOA 4UUPA 5T6BA 4LRSB 1GYRA 4HNGA 2PR2A 1SB8A 1X1EA 1PGQA 2X5KO 3R1IA 3RVDA 2EG9A 2NU7A 4B3HA 2X1HA 3ZV5A 4IJUA 1KVSA 4BNIA 4U0JA 3WQSB 3WDSA 4BS9A 1V35A 1ONNA 4ALKA 5ENVA 2GN9A 1YQDA 4CQMD 3WQRA 3RD5A 3WTCA 4JCOA 3FF4A 3DAGA 1HLDA 4XQEA 2VRCD 4FFPA 4A7PA 1ZK0A 3LT0A 4IGEA 3GZ4A 1HL3A 4BKUA 3SJUA 5ITWA 4PG7A 3WB9A 4WOKA 1BGVA 2DT5A 4ZQEA 3ZU2A 4J2OA 5BNTA 1HDGO 5KJ6A 3L4BA 2JD1A 1C0IA 4YJFB 3IC5A 2BFAA 3PYLA 1T25A 4DPKA 1CIVA 4BNNA 1NQTA 5A9SB 4GMGA 3DO5A 4CL3A 2TMDA 2FSVA 1LX6A 2D59A 4CLDA 3FR7A 1BXZA 1VPDA 1T2DA 4FGWA 3VH1A 3SX2A 2VT2A 1DJNA 1LRLA 3PZBA 3JQ8B 4QO8A 1K6XA 5B12A 2PY6A 3ST7A 3GVIA 3NTQA 1PJQA 2PLAA 5LCXA 1A5ZA 5TJ9A 3ZV6A 3WICA 3OQBA 3AUSA 1LDGA 4JGBA 1R4MB 3EYWA 1DIHA 1KEUA 5G4KA 3MTJA 3ZGYA 4L76A 3C24A 1V3TA 3WJ7A 1BG6A 4MKZA 2HMUA 1DLIA 1X13A 5A1TA 2SCUA 4PLCA 5DN9A 1MX3A 2C7VA 3I23A 1KEPA 1U7HA 3S2GA 4XQCA 5KJ1A 4UUMA 1BW9B 2DBQA 2Y99A 3NDRA 3EVNA 1X0VA 2W8ZA 4B4VA 1PZEA 1Q7CA 3HG7A 4CODB 2V7PA 1IOLA 3N74A 3DZKA 4IMRA 3HB5X 2HU2A 1HE4A 2H5LA 5JXWA 1ZBQA 1G1AA 4ZQGA 4ESOA 2EGGA 4ALLA 4E32A 3KHUA 1LDNA 4NU5A 3DMTA 3QWIA 1CEQA 5JDCC 1Q7BA 1I30A 5FI3A 1GYPA 3K5PA 2IEDA 4MVJF 1V8BA 1MG0A 2CD9A 3U0BA 2Q49A 3DTYA 4JJIA 4MDHA 1ISFA 3NGLA 1MC4A 1ZSNA 4DYVA 4RVGA 4BNTA 2NWQA 1VL6A 2WD8A 4JBGA 3ZWMA 3C7AA 3GH3A 4EGFA 3A28A 1KY5A 3ZWOA 4RPGA 3BMCA 1UUFA 1FK8A 3ZW8A 2JD2A 4JP3A 2WE8A 1E3JA 3VH4A 5ICSA 1MXFA 4XX0A 1P0FA 2J8ZA 2Q99A 1PX0A 2B4RO 4Y6SA 4Z3DA 1PZFA 6ADHA 3BMCB 3FNGA 4I9NA 4NBWA 2FZEA 4NPCA 4AJJA 5ITVA 5EINA 4ND3A 2D5AA 1ULSA 3EZYA 5TT0A 1SMKA 1LTHR 4BOYA 4E4YA 4GAEA 1NAIA 1B8UA 1YL6A 4N7RA 2BMAA 3JYQA 3MZ0A 4XQ9A 1NWCA 3SVTA 3PWSA 4GVXA 4XGNA 1R12A 2EIHA 3AI1A 1K5HA 3LK7A 1YE3A 1EEHA 1IHYA 2DVMA 3F6YA 4J1NA 5BQFA 1BMDA 1U8FO 5BNFA 4HV4A 1Z7EA 4BMNA 3UUWA 2C5AA 1ADGA 1N7HA 4CMCA 3INTA 4RDIA 5H83A 3AUAA 3AU8A 4YBZA 5B37A 1SCUA 2AW5A 4AL4A 1ZEMA 2B69A 3F4LA 1D4FA 3DC2A 2UV8A 3WWYA 2CVZA 3ASUA 3VVBA 1TA4A 4TRMA 1PWXA 3O8QA 3BMOA 5L4NA 1E3SA 1QYVA 4M86A 1NVGA 4CM8A 2J6IA 3WNQA 4BO9A 5G0SA 4IDFA 4HY3A 4WNCA 3GG9A 1PL7A 1R15A 4P4NA 3ZDFA 1Q0QA 2Q3EA 4FGSA 1Z82A 5TLSA 3GNSA 4XYLA 2X7HA 2O3TA 1ZIDA 5KOIA 3G3EA 3Q3CA 3OJFA 1NVTA 2WTBA 3QJ5A 1EBFA 3RFVA 3V1TC 4OGWA 2BHLA 3W8EA 2VQ3A 4QEDA 1C1XB 5JC8A 2CDAA 3AU9A 3CH6A 3UFXA 4YT2A 4CMGA 1N9GB 3CEAA 3EAGA 4DWVA 1JAYA 1X7GA 3RUEA 4PG6A 1K89A 4UULA 3MJ4A 4D45A 4BO6A 2RBEA 3PPIA 3ROQA 3HZZA 1GDHA 3JQAA 3LU1A 3PXXA 4RVFA 2E37A 2D2IA 1X1TA 3RJ5A 4BO7A 3GPDG 2OP1A 4R01A 4ZRNA 3WIDA 4BNUA 4FDAA 5DZSA 2DFDA 3TZKA 2CDBA 1VLLA 1HE3A 1XQ1A 1PL8A 4J9VA 4E2XA 3WX0A 1DRWA 4IIUA 1RWBA 1C0LA 3GEMA 3L6EA 4E30A 1LSOA 2C07A 2HLPA 1RJWA 1RM4A 1M75A 1ZMTA 4O5OA 4K28A 4NFYA 1DIBA 2DUUA 2NTVA 3PHHA 2C7GA 4CM7A 4D0SA 3VTFA 4MVJG 3MJEA 3UW3A 2JJYA 4HWKA 1U2GA 3GR6A 2D0IA 4XEHA 4OOEA 1VL0A 4XWYA 1E7RA 3QWBA 4YRAA 3Q9NA 2E6UX 1EMDA 2NQ8A 5F21A 8ADHA 1X0XA 1DB3A 3DB2A 3HQ4O 4XR9A 3TPCA 4AJNA 3JQAD 4EI2A 1DIGA 3PVZA 2JHFA 1D1TA 1J4AA 1I2CA 1HWYA 4GI2A 5DOVA 2HJSA 3E5MA 1NX6A 5K0ZA 5TNXA 2OUIA 3VH3A 9LDTA 3TF5A 1JKFA 2G0TA 3NDJA 3ZV3A 3OHSX 1VKOA 1I3LA 2O3JA 2IXBA 4Y9DA 5EIOA 3I9JA 5JMWA 2BELA 4RPJA 4EYEA 1VRWA 5A5EA 1XYGA 4NBTA 4IZIA 1UXIA 1UXGA 1E7WA 1HYHA 3DBLB 3JD4A 3QE3A 1SB9A 1NFFA 4E5KA 3IIEA 5U1PA 1WP4A 3JQDA 1Q0LA 4QUKA 1U4OA 2B35A 2EJVA 2NU6A 3HDHA 5CPFA 4RVSA 5T57A 1ZKMA 3VAZA 1IL0A 3MCVA 2UYYA 3H2SA 1FXSA 4PLYA 1TI7A 4R5HA 5F5LA 1U3VA 1ZZEA 1R6DA 5IN5A 5JO0A 1NXQA 4MVJI 1O5IA 3OQ1A 2X86A 3WFIA 1KOLA 2JAHA 2IRWA 2X23A 3OA2A 4IQGA 4PVDA 3LVFO 1JAXA 2NVBA 2O7QA 3ZHZA 3D5TA 3SLKA 5JY1A 5KVVA 2ZCUA 4ND1A 4DTIA 1SO8A 1NM5A 3SC4A 3TQHA 5JDCA 5JO9A 4NFSA 2RHRA 2QG4A 4ZU3A 5H81A 5CAEA 2GZ3A 1N5DA 3HFSA 1H2HA 1O8CA 4MVJA 1FDSA 2QX7A 2AEJA 2PD6A 4BO2A 4D44A 1SZJG 2UUPA 4JLWA 4Z9XA 3SEFA 1ZSYA 1BDMA 1P1RA 2VUTA 1XCBA 3KVOA 5EQDA 2WD7A 1LLCA 3L77A 3UKOA 4B4UA 4CMIB 3C1AA 2R00C 1SOWA 1U28A 3O9ZA 2GZ2A 1BSVA 1HT0A 3HB4X 5KKCA 4BO4A 4RQUA 1Y8RB 4LGVA 4J43A 3QQPA 1N1EA 4LRTB 1LI4A 3I3OA 3B1JA 3O26A 4PLPA 5EQFA 5TX7A 1NNUA 3ICCA 1ZEJA 1J6UA 4J7XA 4QQRA 5HTOA 3GC6A 3DHNA 4NK4A 1DFGA 2V6MA 3BTVA 4ZJUA 4AJPA 2LDXA 2I66A 3INGA 1GCOA 1TT5A 4NG5A 5A3VA 4J4TA 3RIHA 4CM1A 4CV1A 5IXYA 2ZTLA 1U9JA 3U49A 2QQ5A 3ZU4A 2VRBA 1SAYA 4R68A 2ZYAA 2FY8A 1IPEA 1EFLA 4YT8A 5DF1A 4E31A 3IL2A 2D1YA 4WLEA 3KZVA 3PWKA 3RUHA 2Y0EA 3BYZA 3NT2A 1KVQA 3CXRA 4J49A 5C7OO 1WW8A 1YDWA 2DBZA 3OETA 3UCFA 2X5OA 1PR9A 1IZ9A 1EK6A 4JIGA 3TZCA 3QP9A 2VNSA 3CSDA 3IUPA 3ZWVA 2EP7A 3K2BA 5JAMA 1RM3A 4K26A 5T67A 2RH8A 3WGGA 3Q6IA 4PFJA 1SOVA 4IIVA 4OJNA 3FTNA 3H2ZA 4D3FA 1YVEI 2Z1MA 4YJGA 3K6JA 2C29D 2BRUA 3PIIA 5CP8A 3RROA 1JA9A 3DONA 3JQBA 2QRLA 2NU8A 4BNVA 4CMKA 4CQMA 4BNYA 5ADHA 3KO8A 4B8ZA 3IJRA 3ZN2A 2VYVA 1CJCA 3WGHA 1PL6A 3RJ9A 3PQEA 3EC7A 3G49A 1P3DA 3PQDA 1DC5A 4BO8A 5JS6A 3NT4A 4TROA 3JYLA 2XF8A 3PGJA 3JYOA 4ALMA 3MJTA 3MEQA 4EZBA 3EGOA 3CZMA 1LDMA 2PZKA 2Y0CA 2ZB8A 3AM5A 3DBLA 2GO1A 3GUCA 4AJEA 4CV0A 4JJGA 4IZHA 3EUWA 2BF7A 2I5PO 3ADOA 4Z0HO 1XEAA 1LLUA 4WLNA 3VPXA 3GFGA 3WS7A 1G0NA 4K9DA 3H3FA 5L7WA 4H15A 1E7QA 5L3ZA 2H63A 3C85A 1KVTA 2YUTA 3QVSA 3DXFA 3JD2A 3JQGA 2Y68A 3JD1A 3BHMA 4ID9A 3QY9A 3ULKA 3GZNB 3KXDA 4CQLB 4AVYA 1VC2A 1H5QA 4IDAA 4OKIA 3WGYA 2VYVD 1DBVO 4DIBA 2G1UA 1FDVA 3GUYA 1HDYA 2PKQO 3E6AA 3FBGA 1K2WA 4GKBA 4U6QA 3BMNB 5GY7A 5FEUA 4UVHA 3PFWO 2G17A 3OFSA 2EERA 2GCGA 4UEKA 1NFRA 1JVSA 1ZK2A 4WK6A 4IS3A 2PV7A 2V65A 1EE9A 2DBVO 1T26A 1B16A 1P45A 1GEEA 1W8DA 4D79A 4AJLA 4AJ1A 3H9EO 4XYBA 2BD0A 1BXGB 3PLNA 1P1IA 1KVRA 3IJPA 3VDRA 1ZUD1 4EBFA 3E9MA 3H5AA 4LSWA 2W2KA 2DM6A 2OL4A 3A4VA 1FF9A 4UREA 4A0SA 1EBUA 1FDTA 1QV6A 2EKQA 4Z0TA 1L7EA 3SXPA 3W4JA 1O89A 2W4QA 2B37A 1H6DA 2GD1O 3P19A 4HFJA 4HFRA 4JJFA 3VPFA 5FFFA 3C1OA 1JKIA 3TN7A 1ZK4A 2FOIA 4N18A 1X7HA 3X2FA 4CLHA 3ETEA 2P4HX 3HN7A 4HFNA 2GYYA 2P5YA 3PJGA 3LC7O 4OYRA 4FCCA 1JVBA 4LISA 4IPTA 4R69A 1DPGA 1GU7A 2D5CA 3ZWNA 4CUKA 4E6PA 1Y6JA 3KYBA 4I9HA 2AQ8A 1GCUA 1ULUA 3V8BA 2YQ4A 1PR3A 3VPHA 4YJHB 3C3XA 1ENYA 4BGIA 5DNAA 4EDFA 4R51A 4CM5A 3DOCA 4K6CA 2O4CA 2DQ4A 1NR7A 1HYGA 2NSDA 1F8FA 1YONA 2DPGA 4CM3A 1LDEA 4J1SA 3HHPA 4QFDA 3DQPA 4XKJA 3W1VA 1P1FA 1CERA 1EVZA 4MP6A 1PZHA 3I83A 3DFZA 4YJGB 5K9ZA 1GL3A 1R4NA 1GV0A 3FI9A 4MVJP 2ZB3A 2ZATA 4RDHA 4XDYA 2X0NA 1SEPA 5IN4A 1GD1O 4BNZA 4PZEA 3IUSA 4OXYA 2VWPA 5MGBA 1AHIA 4K6FA 3KETA 4TKMA 1ZH8A 4MP8A 3H5NA 3KB6A 4CLXA 2GZ1A 2H9IA 5JSFA 3QW2A 4Q3DA 4R9SA 4KUHA 4Q3BA 3AM4A 5I7FA 5H82A 2POQX 4M87A 4WCDA 1N7GA 1MUUA 4Z9YA 3KYCA 1T4DA 1O9BA 3JQEA 2VUUA 4KMSA 1JU9A 3KLPX 1LC0A 2OO5A 3HDYA 5COQA 1LLDA 2AXQA 1MB4A 2NUAA 3GRKA 4FJ0A 3U4IA 3W6UA 2C59A 1HZJA 2Z1NA 2JFGA 3F4BA 2OGUA 3A06A 3NEPX 4BB6A 3GT0A 3L9XA 3I9MA 3P2YA 4XR4A 5IZCA 5C5IA 2I65A 4OL9A 3AM3A 4CM6A 1DRVA 1LRKA 3RC1A 3OQ6A 2ZB4A 1GV1A 2VWHA 5GMOA 1W73A 3ONDA 1QMGA 2PWZA 2VCYA 3D64A 4RQTA 2J3JA 3LLVA 1YQGA 1X15A 2PK3A 1KEVA 2WSBA 5L45A 2Y05A 3CPSA 3KYDB 1R0LA 1Y81A 4R1UA 5A9RA 3G1TA 2CVOA 1EUCA 3M6IA 4Z3KA 1HEUA 3RC7A 1LSSA 1BRMA 4E3ZA 2HJRA 3I9OA 4RO0A 1B8VA 1HDOA 2B36A 2NVWA 4DIFA 4YAJA 4HX5A 3OJLA 1UP6A 4DVJA 5L95A 5A9TA 2GF2A 2RIRA 4KZPA 1WPQA 1LJ8A 1NYTA 2G76A 3PYMA 4FFMA 4U8GA 4WNIA 5T8KC 3VC7A 2P4QA 3DHEA 1BW9A 4YT5A 1TVEA 4FJ1A 1JQBA 3PJFA 5IJZA 1AXGA 1O95A 1Y1PA 1EK5A 3WSWA 3JSAA 4RVDA 1Z6ZA 3DEYX 3CUKA 3QVOA 4KUEA 2AQHA 2J3HA 2OXIA 1YJ8A 4YACA 4Q3NA 4GWKA 4E33A 1I24A 2Q2QA 1CWUA 1WZEA 3GK3A 1RYEA 2IZ0A 2X9NA 5I8WA 2ZJ1A 3GVXA 5HS4A 4NDNE 1DIRA 2O2YA 2V6FA 5G0UA 1AXEA 3OJEA 4IS2A 2A92A 4D3DA 3JQ9C 1YJQA 2Y0DA 5IZ4A 1DAOA 1UZNA 4AJOA 3AY7A 3I9NA 4NNJA 2A35A 4HNHA 2DTEA 1HDZA 3KEQA 3RQSA 4NBRA 3HJAA 3GDGA 2DPHA 4CR8A 5L53A 1IE3A 1GPJA 2X58A 3LT1A 3T7EA 3LT4A 5ILOA 3I9KA 1QV7A 4GSLA 1E0DA 1A4UA 1JLLA 2VHYA 2NU9A 3NUGA 3GNQA 3W8FA 3JV7A
chains in the Genus database with same CATH superfamily
5IYZA 2GZMA 2D2FA 3MTAA 3E2PA 4FX2A 4DV6B 2WSSD 4FFBB 4RA6B 1IC6A 4WVFA 1VPVA 4WLFA 4BRSA 1YUNA 3FD8A 4X1IA 1LV7A 2SBTA 1OW3B 1OVMA 1HG1A 1OZGA 1UBFA 2XVMA 3DNMA 3JWHA 3KAQA 5AXCA 1RRCA 2H1LA 2FZLA 3L6CA 3QUBA 1D5CA 1E58A 3K9QO 5EIXA 4ND8B 2K7ZA 3OPYB 4DQLA 1Y7PA 1T9AA 1JQ3A 2UYOA 1V2HE 2IS2A 5ALXA 1YZYA 3VV2A 1Z38A 3REQA 3SIPA 2YZNA 4MO2A 3DH0A 2GRJA 3JWGA 4F8EA 5BSHA 1PQPA 4BKMA 2PS3A 5D00A 3SF0A 1N5MA 3SEQA 1I10A 4HMPA 2N1BA 2GX6A 2PEYA 1QS0B 4BP8A 2FZWA 1NXOA 4YH1A 2DT8A 2VSOA 1WXHA 2WQZA 4F11A 2HMSA 2RHHA 1OYYA 3M9WA 4OV6B 3REQB 3ZIAD 4V0QA 3E9CA 2ODTX 1KVUA 4UUOA 2VHEA 4EJ0A 3PC6A 3NAQA 1RHMA 3LWNA 1YMQA 1LXCA 4KLZA 4QUGA 2XUAA 4PF1A 4DBLE 4OXKA 1E6MA 4FYXA 1Q2XA 4BDTA 3SD7A 1OZFA 3RSFA 2E55A 3LY8A 3LYHA 4AD8A 1NHWA 4A8JC 2VH1A 3WLRA 2WI8A 1ECLA 3U4CA 5A7FA 3L7YA 2VQFB 4CEHA 1EYZA 2VTDA 1FUUA 1N5IA 2BE9A 4PC2A 4W7IA 3TUJC 4YHHB 3TE6A 3U5TA 4OIMA 4L5AA 3LKZA 2A9JA 1OF1A 3U1VA 4BZWA 4R1OA 5A9SA 3RB8A 3CX8A 4P22A 3F78A 2HF8A 2ZWMA 3O95A 3ACBA 3PNOA 3U1TA 5JMTA 2Z8YA 1ENOA 3DMHA 4AXBA 4R83A 1SCKA 4HQRA 3ETJA 2E4AA 1XEXA 3A1TA 3RT1A 1K9VF 4FYPA 4PFSA 3RYIA 5HR5A 3HXQA 1TTHA 3DJYA 4I5GA 3LXRA 2VJNA 1VE3A 1P33A 1QF9A 3ET4A 2Q6TA 5GV7A 4V1CB 2WW8A 1XCMA 2QTRA 2P62A 2G5CA 2P9TA 5AOVA 2VYFA 3C6ZA 3IA7A 2ZBVA 3TZBA 3T1VA 4AX8A 4KXYA 5KOHA 4HKTA 2H3EA 4URWR 3QXXA 4CMBA 1XR3A 3QLVA 2AB0A 3D54D 3X1KA 5JSZA 3MB8A 3DLIA 3R23A 4QOSA 1GUFA 3TLKA 3SSOA 3S1LA 2PX2A 5A62A 5CVVA 3T3MB 4KAAA 4HLUA 4IHQA 3KZCA 4NBUA 5JDIC 4DARA 1QSGA 4P86A 2FMFA 3H84A 3NM4A 3QNWA 2FX3A 4D9FA 4PV7A 5FO1A 4UHEA 4EITA 5KTPA 2X7XA 4ZQFA 2ZTUA 4X64B 3EPLA 4ERNA 3BIFA 3HBJA 4ZTBA 5AKGA 1KI8A 3FFBA 5KMGB 3RAPR 2COUA 1I2BA 1WXQA 2G71A 3GLTA 5G4KB 5DP2A 4EARA 3GPCA 2QVCA 3M81A 5ER6A 2PD4A 3EA5A 3K9WA 4G9GA 3M1YA 2AX3A 1Y8CA 3B7GA 4I8DA 1VJ1A 1Z35A 4TV8B 5JCJD 2FVXA 1ULTA 1UBCA 2DMRA 2AH5A 3IV7A 4Q7MB 1FSPA 2CK3D 1EGHA 1YCDA 2ZYWX 5IC6A 2VH2A 1XK7A 1X39A 4MB2A 2I0FA 3A4NA 4E46A 5BV1A 4F84A 2MSEB 1RYYA 4P7KA 2JGFA 1XU9A 3E23A 4MIOA 1KSFX 1N75A 3HWWA 3OIGA 4Y2YA 5COBA 3ZTTA 2WVAA 4RF3A 1J5PA 3KKMA 3OEEA 2HMWA 2HHAA 4TWIA 1WHTA 4BGUA 3HP4A 4ZHQF 1NNEA 2VZ0A 1VCIA 3AFOA 1Q44A 4WBNF 2P5SA 3JS5A 4NFLA 4LHVA 1QHGA 2O9JA 1T9GR 1UZLA 4MRMB 3F49S 1KJ8A 5DIFA 2HNBA 2QN1A 3I1IA 4OQFA 4RAQA 5AQ1A 2ZZNA 3CEPB 4OMCA 1U9YA 1W29A 4HRYA 4W4TA 1E5QA 1DOHA 1F12A 1XTVA 4NENA 5JBNA 1UOEA 4H17A 3KPUA 1BKYA 2J0QA 2WRZA 4MJ7A 2WF7A 1MEOA 2V45A 3AL2A 1JJAA 3FIJA 3GJZA 5HRCA 1YS2X 1N2ZA 4L85A 3VHQA 5IDWA 3ZWWA 4PX9A 4QFBA 2YV4A 3HFJA 1XFDA 2DOKA 3ESYA 3QVGB 2Q1TA 4G63A 4L0CA 4YP5A 3RTEA 1TJ3A 2CHEA 1M8FA 3GWZA 4G1VA 1KZ7B 2EHDA 2GSWA 1JDSA 2I54A 2UVQA 2C0PA 5AFSA 5K4HA 3LH5A 3N0VA 2VYQA 1M5TA 2NO9A 6NULA 5E6RB 4L27A 4BB5A 2ATIA 1EP1B 4DL9A 2W6JD 3HCCA 3U4AA 2GKGA 1NJFA 5DH9A 1P75A 3W2FA 1JAZA 4J6EA 5BSVA 2HRDA 3GDFA 4Z49A 2Q1UA 2QY9A 3IP6A 3UGTA 2CV0A 2JGDB 3EAQA 4CDRA 2VDVE 3QA3E 3EGVA 1K3TA 2IP2A 5F5NA 3BKXA 1I6KA 3G9TA 1WQ1R 4EPRA 4B7CA 4AP6A 3ZJVA 5TF4A 4BQRA 4I1PA 2H8GA 3WZ2A 4L9WA 2JH3A 2B92A 3AGQA 4GLOA 4RVHA 1W85A 3HCNA 5CIWA 3OCZA 2HEGA 3CGWA 4JLUA 3UIEA 3H0KA 4QDTA 1U0NA 1E20A 2I62A 4KE8A 2I6TA 3JU3A 2VBGA 4E4RA 5C8YF 2L69A 4M7PA 2JLQA 2FN8A 2XMSA 4OTZA 4PLGA 5AM2A 4KXUA 1U8ZA 1SKAA 4PYLA 4ND2A 4UEQA 1KA9H 5FDFA 5JQGF 4GP7A 1E2IA 1F3OA 1USIA 3JQ7A 4R0NA 5KCMA 4L4SA 5AW2A 1JR6A 5KDOA 3TXAA 3MERA 1PK7A 2A1TS 3MB5A 4GE3A 1VE7A 3QVTA 5FI5A 5BT9A 1GUDA 3STXA 2PFSA 1GGJA 1GRQA 2B4AA 2B99A 2YX1A 3FPKA 5FHQA 1XCJA 1VG1A 2H8KA 5F3WB 1GXSA 3K0HA 4EGSA 1NOJA 4FFSA 1SD5A 4ND5A 5KTYA 5HFNA 3HM2A 1SD1A 1C1XA 1J0XO 2J59A 2IIVA 1G1MA 2CLEB 1PFUA 2D1TA 1E96A 3MPUA 1CJKC 2W6CX 4FHDA 4JMLA 2IXTA 4OUDB 2CBGA 4X6LA 3O03A 2COKA 2P30A 1XA4A 3EQ8A 2XKJE 5AW8A 5DWQA 4NYJR 2WJIA 2GDJA 4XDZA 3SOPA 4B3CA 4OXNA 1FTSA 2ZBQA 3KAKA 4GOLD 4M1KA 3E9QA 2R6DA 2ZJ3A 2QAGB 3IAM6 4O0MA 4Y6QA 3ZEAA 4QG3A 4C4SA 2A57A 1Y4UA 1KHTA 2HFKA 2VPPA 3E27A 3KQMA 3DDNA 4M46A 1I32A 4HP8A 1MZPA 4NCAA 2VNAA 2XB8A 4QGFA 1A27A 2QZ4A 3UHFA 3G6KA 3GIDA 1ISSA 2ZJAA 4I5IA 1KYQA 4V0SA 4Z9BA 4D41A 4BKPA 3EOBI 1F7UA 1A7KA 3K30A 2UDPA 3B6MA 3NV9A 5KNCH 4IY1A 4J8PA 3CVYA 4Q21A 1IAQA 3G9UA 1YFLA 1S3IA 4FW9A 4BU0A 4DF3A 4EUNA 1Q22A 3LYUA 2ERXA 1L7VC 1PDOA 2X4DA 3QYPA 4YLGA 4F4CA 4Q82A 2XDQA 4BQPA 3WR5A 2IYOA 3L4BC 2RHTA 4GX5A 2YXPX 2H51A 4UXHA 4ZCPA 2RHMA 3SQMA 4MKRA 2V6JA 3F6SA 4BMXA 2Z83A 1ZR2A 1Q57A 3OX4A 2GAAA 2ES4A 2I22A 3OCJA 2BGLA 2H4YA 5EHIA 2B82A 1F9EA 1N5OX 2O48X 3DPUA 3L7AA 5A71A 2AKEA 2PX0A 1J42A 3JARA 1GZ3A 4M1QA 1MT3A 2HQ1A 2FP3A 2GMWA 3MBKA 4N3GA 1K0UA 2FEOA 3AX6A 4RLQA 5F51A 4DC1A 4TZ0A 4B7UA 1H4SA 4X7BA 5C3UA 3BEDA 1QDUA 4YAFA 3X1JA 2BHNA 1HFEL 1DKLA 1ZNYA 2VP6A 3H5LA 4C07A 3NTLA 1TO1E 1XTZA 5EJAA 3KUUA 3HTXA 3Q87B 4BGVA 2GPBA 4ZCMA 4JI6B 3U7FB 2W83A 5JVDB 1JKJB 1Z08A 2Z98A 3I05A 3RRXA 1AH2A 4NCBA 1SVOA 1CDEA 2NO6A 2OV8A 3BWXA 3KYCB 4UDOA 1DXQA 2GCOB 1Z4QA 2F1OA 1P7YA 2HIHA 3ANMA 4JJKA 4N65A 3SBXA 4MRSA 4NNPA 4PG8A 5L4LA 1RJDA 1NQ5A 1E6LA 1JFRA 1UOOA 2WSSA 4PSDA 1VE9A 2VRCA 1YS9A 4OMDA 3RK0A 3OE7A 3LV8A 4GFDA 4TYPA 1E2PA 4XD2A 1OXTA 5TGTA 1Z75A 1TF7A 4MITA 4ZVLA 2OXTA 3WRYA 2JLSA 3OWXA 2V7UA 3NIWA 4MIEA 3BEOA 3THYA 3QVKA 4LYJA 2Q3LA 1QZZA 1MN6A 1M0TA 4RIGA 3ZHVA 3FDFA 3IP8A 4IEFB 3K09C 2GPNA 2ZSHA 2EAUA 1ZMXA 3K31A 5CB4A 3QEMB 1VMEA 2JJ8A 3WQQA 5JTTA 4INAA 1YV9A 5HBRA 3SQOA 4BKRA 2I9KA 4BVKA 4XQ0A 1UEXC 1COWA 3LW7A 4F1KA 2WIJA 2UVPB 3H19A 5K3CA 1CF2O 3TG2A 4L5CA 1JR4A 3VKGA 3ZVLA 2J9FB 4D4GA 3LX8A 3ZQJA 1LWNA 3NOQA 3RBZA 3BXZA 3D81A 5HWSA 3AVXA 3RS7A 1N3LA 1NW4A 1QYWA 3F71A 1XYVA 3V6MA 4XIFA 4R31A 5KNCA 1Z5GA 3BJIC 1PKXA 3L7KA 3N2ZB 3KSZO 1PQ4A 1QNFA 4PU0A 4FMPA 4YONB 3U56A 2XDWA 3EZFA 4CQLA 1VKZA 3IGFA 3OU6A 5KYUA 3L9WA 4LX8A 2BUCA 1XJQA 4R2WA 1QWOA 1UAAA 3RVBA 2AGVA 3IB6A 5DTIA 2NAPA 3BJMA 3J81k 1CDOA 2WHQA 4KJXA 2YJGA 2XECA 2W6NA 1H6BA 3BN3A 1GG9A 3WA7A 2GWHA 4BWVA 3W90A 3B8EA 4BMYA 5TPZA 2O50A 2V8BA 3V8VA 4V0ME 4C0JA 1W0JD 1MQAA 1XKQA 2AOWA 3IP7A 4RZHA 5CCEA 1NSYA 1E3EA 5TIIA 4OB8A 2VL7A 5F2OA 3ZDZB 4AJ4A 1LS6A 1C80A 2HRCA 2QX9A 3I1JA 2WKQA 1ZMOA 2CVPA 1KC1A 4S1NA 1NJ1A 5J40A 4RH3A 3GP8A 5G2OA 1ZXLA 4RXMA 1SC6A 2XNHA 4XUEA 2E1RA 1OJ7A 5EVCA 5SV2A 5JFTA 2XYQA 1E3WB 3AUTA 1UK9A 2PYIA 3EMDA 1GL9B 4U1RA 1K97A 1QE5A 3L92A 4JA0A 1JQJC 3MLEA 1GGMA 3QXSA 3NW9A 2I3AA 4MZXA 2X19A 3FUVA 4RKWA 2J3MA 5L7TA 4FWBA 1Z07A 4TWRA 3Q12A 3VJLA 2WAYA 3LUKA 4HDSA 4GNKA 3ADBA 4D4LA 3E7DA 4C6HA 3WNZA 2H4HA 2AZMA 1TCUA 1WDLA 4G4SO 1AA9A 1RLTA 2NYVA 3AFGA 4RW0A 4R0MA 1FA9A 4KR9A 4BQOA 5I7RA 3R7LA 1VMAA 4B17A 5KO2A 5BUCA 4GOMD 2EW2A 4BCBA 4PX5A 4UPVA 4DIEA 4D1YA 5I7OA 3ILHA 3NM6B 4JSYA 1GQOA 5EKDA 3DQQA 1JA0A 4RNCA 1C0KA 4IRMA 3GJ5A 2E7ZA 4LXGA 1NDUA 1XROA 4M8SA 5LXTF 1BOOA 4JC0A 3RVJA 3NYQA 1NI3A 4ZEMA 5LSAA 3FIUA 1GQYA 4CMEC 1CF9A 1AN0A 2A5GA 3HJFA 1QP8A 2D1SA 4N54A 2AW3A 5ES4B 2HRZA 4G5RA 3MGBA 2XOKD 2JLUA 3H9CA 3KZOA 1B8NA 1P4HA 3ROXA 3W9BA 3FKSD 2VZLA 5CDHA 4Q02A 1E79A 1E5XA 4ANFA 4DWWA 3PT5A 5I9NA 1EIWA 3VISA 3W5JA 4KJZA 1UPUA 2EW8A 5E9JA 1YKSA 2G04A 2E9SA 1WSDA 4D3YA 3IYLW 2MSKA 4HWRA 4JLMA 3A32A 4G0OA 4WZAE 5CJ2A 5GINE 3ANNA 2ZK7A 4Z53A 1GFSA 2XHZA 4TN5A 4YAGA 1K3FA 1PP4A 4W99A 3RK4A 3TVTA 2JEYA 2HK7A 1C7EA 2XZTA 2AI3A 3CW8X 3SSAA 3UCEA 4O08A 1P0IA 3CSUA 3FTDA 4KLRA 3VR5D 1V0JA 4A15A 2QN6A 3D3JA 1JHPA 2JANA 3M8KA 3VOSA 4GPBA 4LF4B 3DVQX 5JZMA 5B2FA 2JKZA 2ECQA 2RJNA 3H13A 5LKAA 3WIVA 2J9GA 2RGUA 4GX2A 1E3MA 1G4HA 3DCJA 4Q12A 3L5KA 1QKJA 3KOUA 4JLNA 3HKDB 3PR1A 3H04A 3SBOA 6LDHA 3D7KA 4LDAA 4OQZA 4KWTA 3K6RA 3IKTA 3AP3A 4WNAA 1AQ6A 1G7TA 2H85A 4KVAA 3RT9A 8OHMA 1AKNA 2IX9A 2Y0PA 3CCFA 3Q8WA 3UT5A 2OHXA 4FEEA 4CL8A 3ED5A 5FAKA 2AL7A 4I36A 3JAMA 1YH3A 4HEA6 4G8JA 4V3CA 6Q21A 4MAMA 3WHLA 2DHRA 2E4YA 4QDOA 2C7PA 3AV0B 1OREA 2JBWA 2ZUBA 3FW1A 1QGUB 3PTZA 3RFXA 1A2KC 3GJ0A 1U7WA 2FV8A 1AHNA 2MMCA 3QFCA 1DKOA 3PNLA 2YV3A 4JHXA 4P32A 4DYDA 5M7EA 1I4LD 2HGZA 2E5LB 3TZHA 1NHGA 4YLYA 3MFQA 5U4XA 4UMFA 4ZOAA 3R7WB 5ALWA 4LY0A 2HUNA 4RHEA 1XMXA 1SHKA 3U4GA 5C52B 5HJ7A 1ATIA 2OFPA 2ZQYA 3WLTA 2AOVA 4IXTA 1J33A 2F4NA 1WCIB 2DWQA 1I7SB 1TM2A 3P9IA 4YUAA 2K87A 3TSAA 4Q1AA 1JF8A 1FUIA 4LRXA 4DR1B 4Z4IA 1JDUA 3C8HA 3CH4B 3FUUA 5ICCA 2FSHA 1GDTA 1SKQA 2V6IA 2G4LA 2VDQB 3TFOA 3GGCA 2AKAB 2V6BA 1FRZA 3ITDA 3Q9LA 4L22A 2C20A 3I2HA 3IEUA 4KI7A 1RYZA 3ZJYA 3G2JA 6PFKA 2FFQA 4LVCA 1HO3A 5I9LA 2X4LA 1X7YB 1PT6A 1XPUA 1CQXA 2AN4A 3LTNC 3T4UA 1G98A 1NN1A 3DEZA 5JI2E 2NLOA 1XC7A 4XWAA 1QG6A 1H2BA 2FR0A 1QKIA 2OMEA 4JJ6A 5JRJA 3FLBA 4NCIA 1Q11A 2ZLBA 5CGQB 3IERA 4EKEA 4LBVA 4E13A 4FUTA 1XKXA 2B9EA 3AEZA 1KJQA 4Q93A 4A10A 821PA 2UXCB 3KQWA 4H60A 3LKDA 5EE5B 4AJHA 3W5BA 1E9VA 1NRWA 3GJ7A 5COAA 4LDZA 1JG3A 1KQPA 1N6RA 2RGGA 4I1IA 1RQGA 5JS1A 2DFLA 2M1ZA 3IQIX 4MINA 4UCXA 5DTMA 1US8A 3M2TA 4TS3A 2QXUA 2PKWA 1NW6A 3SMVA 2GJ4A 3ZU3A 1ZUIA 1TIBA 1NJ5A 3HZHA 3JYNA 4IKPA 5AXAA 2ODEA 4N6GA 4RKEA 2HPZA 3IUEA 2F8MA 1JQEA 1UL1X 3OOWA 1ZICA 4TSFD 5AH0A 3ZVKA 3HGMA 3QE2A 5EGSA 3MOIA 1E1MA 4Q1CA 3KSBC 3AR4A 1BJKA 3EAFA 4EJFA 2PUGA 2NV6A 1UKEA 2NXJA 1Z7YA 4IGIA 4ZVSA 5HOQA 4P9NA 2OORC 5G0TA 3UMMA 1J8YF 2OYCA 4MGIR 1E9BA 4YQYA 1WIWA 1F14A 2DC1A 3CA8A 3PUKA 2QE6A 3H75A 2W48A 2O1SA 4BKQA 3OE7D 4ZVTA 4C5BA 4YR9A 1N0UA 1REQA 3EIWA 3ZH2A 1YS7A 4QL3A 1Z4MA 1CR1A 5FV7A 5E6SA 2JHPA 1RD4A 3AKYA 4JT2A 1HSOA 3WK6A 3OFVA 4WBXC 5AJVB 3PC8C 3ZXYA 1X7ZB 2R2GA 3FLEA 3RKSA 1PDVA 1ADYA 3KQQA 4FLFA 1TU4A 3H3XA 1NX9A 4RA9B 1G8MA 4YASA 5BURA 1U65A 2R8OA 3TYXA 1AF4A 4ZKEA 3EJWA 4A0RA 5ITVA 3I62A 1IUOA 1BH6A 1GUZA 2IUSA 2PG3A 2P9GA 3B7PA 2H29A 3NRCA 2OZEA 4MVJM 3RSCA 1MW9X 3TJRA 4LK2A 2E4VA 3A1WA 3A26A 1F1BA 3VZRA 1ICEA 3RHTA 4QOHA 4C7JA 4Z6KA 3CVVA 5MHTA 4ZHSA 4BGDA 5AVSA 3AEXA 3P5SA 2GZAA 4NZZA 4U7DA 3MQ4A 1BXKA 4MJLA 4CDNA 4FYYA 3WK8A 5JEDA 2K7FA 2ZIEA 4OQXA 1Y1LA 2F9FA 5EKSA 4M60A 5J5VA 5IXSA 1FFHA 3FR8A 1KFJB 4M0LA 4TMFA 2ZYRA 4HWTA 2C2OA 4ER7A 5AM4A 4PAOA 1QO7A 2FEKA 2Z2XA 3PSHA 3GLKA 1CUEA 4M36A 4ZVRA 5EMKA 5L3QB 3LQFA 5JS7A 3PNBA 2JLYA 3VRHA 4YJFA 2P2YA 2FWMX 1RAFA 1KI6B 2WKRA 4IIGA 2I9PA 3PJEA 2WG1A 4PCLA 5TEVA 4MB6A 4AF8A 7AT1A 4LVUA 2FYTA 4NECA 2QBYB 2HSZA 4JFRA 1RI2A 4NJOA 1W7AA 1TPYA 2MOKA 1WETA 1M33A 1E2EA 3DVLA 4BFVA 1VJGA 1XPRA 2PRJA 1MC1A 2R5FA 4S3MA 3VR4D 4AI6A 1ZN9A 1Z73A 4I3FA 3Q7TA 3B1FA 3IHKA 3CZRA 4HDCA 4HPXB 3WNDA 1QFXA 1UJ5A 1B26A 1J1ZA 2GN4A 4JNKA 3U3MA 3EFOB 4B4OA 2Y2VA 3CH5A 1P4AA 4QYMA 1LZKA 5H9WA 3FHTA 2Z09A 3F46A 5KQPA 3DL0A 2VLIA 3LHKA 4FB4A 1YS4A 2ILTA 1T5LA 2Q1YA 1EJBA 3FNQA 1ZH6A 4YRQA 4F1WA 2BP7A 2ODQA 2V55B 2YYZA 4DRXB 5JOQA 2J5BA 5K05A 1BHQ1 1N9ZA 1RJ9A 1YE8A 3BIXA 3JQQA 4OHOA 2XTZA 4O3FA 4PPFA 5CYFA 3M1AA 5DCWA 2CF6A 3DW3X 2ZDGA 3IPXA 4FIZA 4TXHA 4FWIB 5C1PA 4QDJA 2OVFA 4PAQA 5CVEA 5T41A 1DC8A 1EP9A 2CL6X 4J7CA 1YR3A 2ZWVA 3FWPA 1I4EB 1NPTO 3HBFA 3W2IA 3N2KB 3TOZA 5J4KA 3COSA 4H6VA 1OTXA 4EYSA 3G17A 1FNDA 2VYNA 2Y2UA 3HKDA 2HZ7A 4KKVA 1W76A 4Q00A 2YXLA 5FUWA 4BATA 1JGTA 2Y1GA 2YR0A 3TEFA 5E6UB 2BGKA 3QU4A 5AVZA 1NQOA 2DZDA 3J7TA 2WU4A 4LZAA 1GA6A 2ZFUA 4ES6A 1ECGA 1S4QA 2WLSA 1XZJA 4PQEA 1H1TA 1Q7TA 1ZRHA 2DBYA 3GEEA 4F56A 3V7UA 4N9QA 1L8XA 2ATCA 2XEDA 4R4JA 4RX1A 4UOZA 1UF9A 4XFKA 4IM7A 1TIKA 3PFCA 2WIAA 3H5OA 3Q7QA 4WZ6A 4AWXA 3IR6A 3VV3A 3KD3A 2DY0A 1V11B 2JAWA 5CHEA 3TB6A 4PXAA 1UEJA 2EBUA 1R0RE 5KHAA 1OD6A 2GPTA 3QOFA 4AM8A 4BFUA 4MP3A 1JVNA 4NYJQ 4BC1A 2A4MA 4UVEA 5DLYA 1A8IA 2HREA 1YD7A 2AQKA 2GF9A 3ZNNA 1MTOA 2IOFK 1U0LA 1TAGA 2A14A 3H3JA 4G1EB 4X3OA 4DBZA 3OQPA 4M0MA 5REQB 3UXHA 1MVNA 2YIDA 1ZRSA 1DEHA 3V7FA 1II8A 3PVSA 4JV5B 2L0XA 2OB1A 3C0KA 5AYVA 3QEJA 4ZALA 2RHCA 4R3WA 4B09A 4N41A 1STOA 4ADSG 2VHXA 3VNUA 4O63O 3DZHA 1XVUA 3JQGB 1OGYA 2M6SA 4X44A 1BHSA 1ZI8A 1IG0A 3Q4GA 4KOAA 4UEOA 1O6FA 1I36A 3O90A 2JARA 2P78A 1LEHA 3ML1A 1JDBC 1LK7A 1B15A 1JEEA 5FLYA 1R0YA 1XZQA 1VCNA 2RGNA 1ZOSA 1J49A 2ZCJA 4LFAB 1RXVA 5DXAA 5ICFA 1UBOS 4KIUA 3ZR4B 1B6RA 1CIPA 4DJ5X 5I7SA 3A1DA 3JQ9A 3KEGA 4U39A 3TTXA 5KHOC 4ITUA 2IVFA 3N0RA 4U2EA 1QGED 1XG5A 3Q6MA 1NE7A 2BMFA 4CN8A 5DXFA 3GEHA 1FYXA 2F3RA 5EE1A 1FRFS 2VPIA 4GEGA 4LJLA 1CVIA 2AJ8A 2J9ZB 2WIFA 4L15A 4LXHA 3HN2A 1J0CA 4FD3A 2HH9A 4JENA 5A3QA 4UVGA 2PLFA 3AQ4A 5EZYF 1ZU5A 2VPYA 4W9NC 5BNZA 1XZ8A 2C00A 5K0JA 1DARA 5AKEA 2VHVA 2H5IA 1QS0A 2D13A 3E3LA 3G0HA 5HF8A 2VDNB 1KOGA 1P4GA 2O8FB 3QUQA 3NHZA 4BNJA 2G9NA 3AHHA 1G18A 2R5WA 3QA9A 4ZYLA 4N0EA 5E1MA 5IJ0A 1YDEA 4GSKA 4EOGA 1M1YE 2DAPA 1UZUA 3B1WA 4R41A 4UEJA 1NBHA 1PTJA 4G25A 1YQQA 4HZUA 5T5QA 3GLFA 3I2GA 5IPFA 1VM6A 1T8SA 1NBIA 1ADCA 5F33A 5CFNA 4KX3A 1GYQA 1Q3TA 3AWDA 3S2ZA 1LSUA 2TRSB 5TQ0A 4ARCA 5F7ZA 1PSDA 1HXHA 2WHEA 4PGHA 1SKMA 3HCOA 4HDRB 2VT3A 1DUVG 4G4JA 4JLJA 2DP4E 1XQ9A 1W0KA 1QHFA 4R2HA 4Y6RA 1CY7A 2H48A 4QDXA 4PO1A 4YI5A 3I4CA 5JAUA 1V16A 3CX7A 1ABEA 2HLDD 1G21B 1NI4A 2XHEA 3EMBA 4MR7B 5AICA 5E1BA 3UXMA 3SLGA 2PL9A 4FMBB 4B3JA 3CZ9A 1I4TD 5CW1A 1BDBA 1G4AE 3RFUA 1FJXA 1P4SA 2ZM6B 2VJPA 1MMFB 3IIKA 3DBRB 3GNLA 4IDCA 3ZS9A 2NZVG 3RWBA 4C88A 1IVSA 1A77A 2WJPA 3MJCA 1T4BA 5CXUA 1CBUA 2JZOA 3DVSX 4FLEA 5DBGA 2EP8A 1HDIA 2C58A 1AF7A 3STVA 4UPDA 1LC3A 1W581 4HQLA 4CQJA 3LKVA 4XW2A 1EB8A 3T34A 2MU1A 1ML4A 3LO8A 4MUBA 4S2EA 4BV3A 721PA 4X6XA 3H42B 2WOJA 3WIBA 3N76A 1WD7A 1RVDA 4OK3A 3Q9SA 3F7NA 4U6NA 1XCOA 1D4ZA 1YDMA 3I9V1 5A4KA 1TKRA 1G66A 5TXGA 4EPWA 1LFDB 1W9MA 2YV1A 2YYYA 4R8LA 4ENTA 5JNUA 3M7IA 1NXTA 4LRYA 4QYIB 2C83A 3T7TA 3WXBA 1HQCA 4EIWA 4KU4A 2CZQA 2R00A 3NBQA 3UPUA 3T1YB 1N7JA 4R3UC 2DLDA 3JQ7B 2Z5FA 3HVIA 2G3YA 3FNHA 2QR5A 1I2DA 2PUCA 1VP9A 5C8DA 4F7WA 4BVHA 1NJ6A 2LP4Y 5KX5F 2H1FA 3A3NA 4GF5A 3HR4A 4H31A 1NPDA 1OYVA 4WN9B 2XIJA 5DBIA 2XWQA 4MQLA 5ALJA 4A2PA 4Q0MA 5LPNA 3V2IA 5DYWA 4UNSA 4P5DA 1X2EA 5J59A 5FBRB 4PAWA 1QOZA 3QFRA 3PC4A 1C14A 4KO4S 4PGMA 3T0IA 1IHUA 4JT9A 1RPNA 2QMUA 4B8YA 5JY6A 1TE2A 1D6MA 1AMNA 4KXLA 3P9NA 2JIBA 1D1QA 2ECPA 3BWCA 3D2AA 4F9FA 2BP7B 4KPEC 1WHSB 2HSGA 1SUFA 3BH6A 4RANA 3M2PA 3NWJA 1Y98A 3L0YA 1C4XA 3GLQA 3RTBA 1LTKA 1EM8B 3D0QA 1U81A 1FX0A 3ICVA 1JJIA 3PK0A 1MFPA 3MIZA 1VLQA 5CHYA 3KSUA 4D3SA 4HQFA 1J5EB 4QT0A 1A69A 3M4XA 4L8FA 4TSRA 2IY8A 3GFRA 2Q29A 2P5UA 4Y9SA 4K9MA 4MQ4A 1KZ9A 2VJMA 3IQHX 3DULA 4RTRA 2ZJBA 5TSDA 2OO5C 4ZK6A 2VOJA 2Q7OE 5B7NA 4EF5A 2XODA 2PMWB 2VEDA 1YCHA 1NDQA 4DRZA 4MR9A 1M9NA 2P35A 1YBMA 1HOXA 5BV8A 2W22A 3VR5H 3SM3A 4XTRA 1OU0A 4UZEA 3OLYA 5EMHA 1LW7A 2RCYA 2AWNA 4MA4A 2ZSKA 4JUDX 4NDZA 5BSMA 1KL7A 1JW9B 2EQ5A 1RJGA 1XMJA 3CW9A 3KPVA 4NJMB 3W5IA 1L5OA 4D97A 4QZVA 1MTZA 4KDEA 1CUAA 4JBNA 4B45A 3CUEF 4G81A 1Z2DA 4MNTA 2HMVA 2PS0A 1OGIA 2X76A 1THGA 2MR5A 3OZDA 3QVWA 3HBAA 1PO7A 4QPPA 4E5PA 3VNBA 1W4ZA 4X1KA 3KTAB 5F2KA 2FMIA 5IC4A 4GZMA 2C0QA 1SCBA 2BEVB 3O5AA 5K6AC 4TX1A 5ILGA 4KQXA 1XA0A 1YMUA 4HZUB 1ZNQO 1XEFA 3Q0EA 4O6VA 2MCFA 5U9CA 4WHMA 3VJRA 1SXQA 2IH2A 1SURA 3P71T 3DBHB 2ARKA 1YU9A 3OSUA 5AKLA 3A2LA 4QBGB 3NTRA 2CT8A 1EFAA 2CMGA 1RPZA 1BVRA 5LB2A 1AQIA 1CY8A 2JBHA 3HSYA 4WLUA 2V1UA 2JAXA 2DFTA 4IILA 3AI3A 3JTMA 5EHNA 4G4IA 3MMZA 4YCDA 5JPIA 4F2GA 4Q9JA 4EAQA 3HCFA 1Y3IA 2QQ0A 3AJDA 1SZCA 4G26A 3QFHA 4WINA 5FWDA 3S1AB 3P0FA 3V5NA 4ACAA 4US2R 1DKNA 2ZTVA 4G2TA 4ZJPA 2JI7A 1N6HA 3KNZA 5FOXA 1N2CE 4JBHA 1Z28A 3LFUA 1Y82A 4CEHB 1AY0A 1ZDMA 3UK6A 1YKGA 3DBRA 5A02A 2YN2A 4JD5A 3CSSA 5CNIA 3SJCA 4HLQB 5BN1A 4HHEA 3JQFC 1EWQA 1YB7A 1F5NA 3B6JA 3IAS6 3KUKA 2DSNA 2QN2A 4CT4B 3PKZA 5DTJA 3G79A 4I50B 4GC9A 2RHOA 2YDXA 5SY4A 2PNJA 3K8YA 1X3SA 1X8KA 1PS8A 2FWIA 4RA6A 1BXGA 4XGIA 5LXTA 2J5RA 1SK9A 4BL5A 2BHRA 4KQEA 3Q85A 4FDMA 2RB4A 3IP1A 2EF1A 2ZRKA 1Z3IX 1QO0D 4ERXA 4KITB 3BXFA 3ETLA 3I73A 1V6SA 2P11A 1OI4A 1JR2A 5LLDA 4OHVA 2AMFA 1L5RA 3IH5A 3T41A 1XDDA 4UQPA 3KUXA 5BSEA 4V0RA 5LNK6 1MRSA 4NPHA 4PG5A 3AOGA 2B7BA 3OEYA 2XAUA 2JHGA 1HORA 1E7YA 1PAUA 1ISHA 4BV2A 1G9TA 2ZI6A 3RU9A 3PGXA 3NTUA 1K1EA 2HRRA 4EJ6A 1U2DC 4LOIA 4JOSA 2IE0A 4HXYA 3EHEA 4BNKA 2YQZA 3I72A 4EB3A 2QMQA 1VIMA 5JJLA 1MJNA 1TT5B 1Q7GA 1GWNA 2B34A 2ZREA 4WOJA 1Q16A 3TSCA 5A2GA 2QUBA 2X1MA 1H1LB 2G80A 1BKSB 1M8KA 2WNSA 3AHCA 2O23A 4K03A 1ZIOA 2ZTMA 4GO1A 1HL7A 3IJEB 2AXNA 4Y0VA 1DFIA 1OI2A 3KZMA 3DC7A 3HXPA 1DXYA 1DAIA 4B4DA 1AMUA 3H6KA 2F55A 3PICA 4EJMA 3TJMA 4C08A 4P92A 2GEKA 2JGRA 2HNAA 2ZI4A 1QO0A 2V1XA 3A6KA 3EUEA 3F4KA 4Q3CA 2HW8A 4X62B 1G8PA 3OM1A 5IABA 3BQMB 2A67A 4C7VA 2GYVA 4FKZA 3KV3O 2E5WA 4UNQA 3WZMA 4H4EA 3A1NA 3D59A 4TLEA 3VUEA 1YAJA 1DQNA 2E85A 2GAIA 1FSGA 2WJZB 4JELA 4RCYA 1KE1A 3UJAA 1Z2AA 4BLQA 4D3XA 1PLJA 4JBYA 1SQSA 3DOHA 2V74B 4K9RA 5JD3A 4DEYA 2IP1A 2AG8A 4ZICA 4DMMA 2H1CA 4ZOLF 1MVOA 2VR1A 3PRYA 2WSLA 1TJ4A 2GBFA 1GQQA 2P1RA 5BO5A 4DLLA 4EQ6B 1MEJA 3SCZA 4O4HB 4RJ2A 4D8VA 3A6LA 3NLLA 4MYCA 4BEWA 1OFTA 5JSUA 5IUKC 1XFAA 1EG2A 4KFUA 1Q0PA 5DSZA 2HDOA 2BFDB 2EFGA 4RGVA 5BOVA 3HJBA 4D82A 1SCUB 4QRDA 1XN4A 2YHUA 4PN7A 4DV4B 4AN1A 1W36D 2JVKA 3RRMA 3TOCA 1ETHA 4KGZA 3C6MA 3LP6A 3JYHA 4F2DA 1NVXQ 2NSLA 4G8DA 4DA0A 4FKBA 3VNAA 5ABPA 3QUSA 2TS1A 2CMKA 1WCYA 2YFQA 4B32A 2J9XB 5ISMA 1EDEA 3AR3A 3KTFA 2OCXA 3Q2IA 3C8MA 2WU8A 3BVPA 3I2KA 3GW8A 1FEZA 4OB7A 1DMSA 2I6GA 5FPHA 4B3IA 4GU5A 1CZNA 4H1VA 4FPXA 4JQCA 4RF5A 5AIAA 5C8VA 2GYUA 4CFYA 2BEUA 4P5EA 2CCKA 2Y67A 3EZ6A 4RGBA 4WZBE 5FFMA 2CGEA 5EY5B 1SOMA 4JOQA 4H16A 1FDOA 1KMIY 2X0IA 3RVSA 4C3VA 4EBBA 2DERA 3NDIA 3AR7A 1RS0A 1Z4NA 2X8JB 3D6VA 2HCTA 4Q9KA 5BR4A 2D1QA 4QPJC 1VG0B 4YP7A 4TXLA 4L73A 1U0EA 1ADBA 3BFPA 3TRKA 3NXSA 3F5DA 2PXCA 2IHYA 3P52A 1NF2A 4DLZA 5B30A 3O9VA 4B75A 5AW3A 1I8TA 4ZOLA 4NYMR 3HDGA 3SSNA 2ZQ5A 1TVMA 2QRGA 2YJNA 4ZO4A 5IW8A 4AP9A 1GPKA 1MZVA 4LMRA 5JPCA 4U2GA 2GD6A 4IVRA 4ESVA 1PJSA 3COYA 3DT8A 1BFUA 4IJQA 3RIGA 1M1ZA 5ERXA 4CF3A 1XU4A 3L1UA 1AKVA 4PPQA 1AC5A 5EERA 2ZUSA 3OFNA 4D0RA 4ZCIA 1SA0B 3IT2A 3CX4A 3GRCA 4ARIA 1MJFA 1N6IA 4IXDA 4JB8A 5B6JA 2BZ1A 2ZT5A 2CXHA 2VJQA 4ZAFA 5IZCC 1GZ4A 5CT6A 1NYLA 4RACA 3QNUA 2B5VA 1LBSA 3AY6A 5C32A 3GRAA 3K92A 2AFIB 5EE9A 3N75A 3MYRA 1XTIA 2O8EA 1JPNA 5DCYA 1FLDA 1GZVA 2JIZA 5CU7A 5DGDA 1CJSA 1KAOA 4B82A 4KQWA 3JYPA 1T1SA 1CC1S 2HLDA 3M6FA 4IIYA 3T5BA 2GTIA 3TRDA 1FS5A 1XLTC 3SG0A 4I8XA 1C5KA 3HEBA 4X41A 3D6AA 1Y0BA 2PD3A 2R86A 1VOTA 3GMTA 4JLVA 5PNTA 4D9CA 4BE7B 1TYDE 4LBWA 4ZVOA 4B2YA 2DH5A 1MO6A 4BRWA 3A27A 3MVEA 3UCXA 4LOHA 1Z26A 2ALJA 1VFNA 2GRAA 4P36A 1LK5A 1ZHOA 5UKDA 4E3WA 3ZDCA 4F1JA 3ERCA 2IEYA 5AK6A 3A14A 1CY1A 3DHVA 2CXRA 3HY3A 4IHJB 4UU0A 4JYPA 5BNWA 5FPKA 4HJXA 2MTBA 2L42A 3DJFA 4IQ0A 3N87A 4M4SA 1M7HA 4X24A 1NBAA 3F6BX 3NI2A 1KK2A 2J3LA 1HKUA 3IDZA 1DFHA 3KQSA 4B7XA 5DSTA 4X1IB 1ZINA 1O6CA 1SM4A 3IJ5A 4TLCA 3U7IA 4PWZA 3HYCA 3RBXA 4BZXA 1CUBA 2XDYA 4BQSA 5LZ7A 1E5LA 3HK2A 4AWBA 1JHUA 1GKYA 1QTQA 2AOUA 3NNSA 5LM3A 1PR5A 4XQGA 1DVRA 3EWAA 4J7UA 2Q27A 3THXA 2R97A 1QPZA 3HR8A 2G70A 3FOCA 1K6IA 1YZLA 2WD7B 3O2QB 2OD9A 4Q4HA 3V2UA 2PU5A 5JWRA 4F6CA 4EHHA 5CDUA 5TS3A 1J99A 4W1QA 3O31A 3VAAA 5HJ5A 1XAHA 5TGDA 1HLPA 1W19A 2PSDA 3LHDA 3R3VA 2ZIGA 4DWJA 3HADA 2VG8A 2IX3A 1D6NA 3AOEC 1N1GA 3R3XA 2C61A 4N82A 1PSZA 1M1UA 4XWWA 4PRKA 3FXAA 3GD7A 4XM2A 4W5TA 5IT9A 1IZ0A 5JATA 4R2MA 4DZTA 1KPGA 1TAUA 3BSFA 1U31A 4UUPA 4GKKB 4RFLA 3DXXA 4EGJA 4QGHA 5AI0A 3GJ3A 5THXA 3OQNA 1CY4A 2RE8A 3I28A 3G2KA 1JU3A 2Y71A 3WHKA 4Z7OB 1J56A 1GYRA 4DOMA 4LVOA 4ZREA 1SB8A 1NBEA 3RVDA 1DAHA 2EG9A 3EZGA 3HACA 1LTQA 4YV0A 3IRUA 4I46A 2X1HA 1WLSA 4XVHA 3ZV5A 4IJUA 5IFKA 1KVSA 4BNIA 3PIRA 5DHFA 3IEIA 2H00A 3WDSA 3LC0A