1CLEA

Structure of uncomplexed and linoleate-bound candida cylindracea cholesterol esterase
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
534
structure length
534
Chain Sequence
APTAKLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLNGQKFTSYGPSCMQQNPEGTFEENLGKTALDLVMQSKVFQAVLPQSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEIGSPTIFPPAQMVTKSVLMGKPIIHVAVNYRVASWGFLAGDDIKAEGSGNAGLKDQRLGMQWVADNIAGFGGDPSKVTIFGESAGSMSVLCHLIWNDGDNTYKGKPLFRAGIMQSGAMVPSDPVDGTYGNEIYDLFVSSAGCGSASDKLACLRSASSDTLLDATNNTPGFLAYSSLRLSYLPRPDGKNITDDMYKLVRDGKYASVPVIIGDQNDEGTVFGLSSLNVTTNAQARAYFKQSFIHASDAEIDTLMAAYPQDITQGSPFDTGIFNAITPQFKRISAVLGDLAFIHARRYFLNHFQGGTKYSFLSKQLSGLPIMGTFHANDIVWQDYLLGSGSVIYNNAFIAFATDLDPNTAGLLVNWPKYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALMTNPSSFFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of uncomplexed and linoleate-bound Candida cylindracea cholesterol esterase.
pubmed doi rcsb
molecule tags Lipase
molecule keywords CHOLESTEROL ESTERASE
total genus 187
structure length 534
sequence length 534
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1995-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cleA00
3VKFA 1QIEA 1P0IA 3IURA 1J2EA 4KAAA 2PKYX 3PFCA 5JAUA 4HRXA 4X6XA 4H0CA 2HU8A 2I3ZA 1YB7A 2HRQA 3C6YA 3WKCA 2QZPA 4CCWA 2HA5A 4ZREA 1YCDA 4FNMA 5JATA 5FXMA 4Y2QA 2XUGA 1C4XA 1U8EA 4BCDA 2VAXA 5ALNA 2V97A 5ALYA 1VZ2A 1LPOA 3PE6A 1YAJA 3WA6A 2OGZA 5KREA 1A8UA 4DGQA 1AQLA 4NS4A 1TIBA 4OYLA 3ZWQA 4UBJA 1P0MA 4QWWA 1YASA 2WG0A 3W9UA 4LKOA 1XZLA 5AKHA 1VE7A 4X6UA 1CUJA 1USWA 4UHEA 5AJHA 5EIAA 4BE4A 1CUCA 2ZYSA 1O6GA 3LIPA 2XQGA 1CUFA 2JGIA 2XQJA 4CG3A 2JGKA 3IUNA 2R11A 5LZ2A 5EHQA 5ALWA 5AKIA 5DYTA 3H1AA 3ANSA 3FYUB 1CUWA 4NVRA 1CFJA 4F21A 1H22A 2WTMA 4Q1VA 3I2KA 2QUBA 3PDCA 4J0GA 3IULA 3WKDA 4IO0A 1B6GA 2Z3ZA 4RNCA 5FUMA 4X00A 5LZ7A 3H0CA 3LP5A 1AURA 1ZD2P 3C6XA 1R50A 2BAGA 5KWIA 5BWCA 3I6YA 2VJBA 1S8OA 5CH8A 5ALZA 4WFJA 3VVLA 2ACEA 3B12A 2DQZA 4HZGA 5K3CA 5HF5A 1ZGCA 4E14A 4JEIA 1CUXA 1ACLA 2XB6A 4MYSA 3DYIA 5LP1A 2HIHA 1LPPA 5K3BA 5ISMA 4H7KA 2XMQA 1YSCA 1EK1A 2PSDA 3G0DA 1JKMA 3LCRA 5EI5A 1EINA 3R41A 5AK5A 2Y6VA 2BKLA 2JEZA 1VZ3A 1YA4A 4FNGA 1WPXA 2ZYIA 4B80A 3VVMA 4DNOA 3AUKA 4XX1A 2C5GA 2B61A 4XWGA 1MX5A 2JBWA 1AZWA 1IUPA 4DNFA 3WJ1A 5JADA 2XUOA 5HK9A 3ANTA 4P08A 2VJDA 3IUQA 3HRHA 3GA7A 4EY7A 4A23A 3MUOA 4FFWA 1J06A 5EIHA 4N5HX 2WILA 4WFIA 4A5SA 1MU0A 2ES4A 1ZD4A 2FJPA 3OG9A 2HDWA 2XUJA 3VJMA 2AJ8A 1ETHA 2XMRA 1ODCA 2B9VA 3EQ8A 3CCCA 2D5LA 3R3UA 1JMYA 1JFRA 1ZI9A 4Q3OA 4JYMA 3K2IA 4QDUA 4U2FA 4G9EA 2IX9A 4DTCA 3O9MA 3Q0TA 4Y9SA 4BVKA 3I2IA 1K8QA 3WJ2A 4KE6A 1XZCA 4KE8A 4QLOA 1LPAB 4GWLA 3D0KA 4MYDA 3VISA 1EHYA 3BF8A 1W52X 1K5PA 4H7FA 3M83A 3O4IA 1CRLA 4X3CA 4PQEA 2I3DA 1ACJA 4AO7A 1O6FA 1CUIA 2XMGA 1LPNA 3FVRA 2XMZA 2EDAA 1A88A 4YASA 2RONA 1K6EA 1FJ2A 2HA0A 3FOBA 4OB7A 3AZPA 3PUHA 2WUFA 4UPDA 5LIPA 4UHBA 3NWOA 4DNPA 1ODSA 3I2HA 2RAUA 3WWPA 1MT3A 3L1IA 4C89A 2BCEA 2DHEA 3I2GA 2OCGA 3CN7A 4A16A 3HC7A 3M3DA 2XT0A 5I8PA 5AI6A 2C4HA 2PU5A 4Y2UA 1MAHA 4G4JA 3G0IA 3DL7A 1YB6A 2WLSA 3OM8A 5AO9A 4GW3A 2J3QA 2O7VA 3AIMA 3BDIA 3IB3A 3R40A 3ICWA 4BB0A 1Y7IA 3R3XA 4FBLA 4X92A 4I19A 1D07A 1CUHA 1I6WA 4AX4A 4C6HA 4DMHA 4BZWA 1CV2A 4BC0A 2DHDA 2Z8XA 3H04A 3W06A 2JGFA 5HF6A 4PNZA 4AMZA 3ZI7A 4B0PA 4BTLA 4E15A 3WQHA 4MWTA 4Q05A 3KWFA 2XUDA 5AM4A 5JZSA 2XUHA 4BZZA 5EFZA 3KDAA 5CH3A 5ALUA 2V98A 3PFBA 1DU4A 5IVDA 4PW0A 2PX6A 1U65A 5DYWA 1XZBA 3QITA 5FLKA 1UWCA 5FPPA 3G8YA 3JW8A 5AM2A 4ETWA 5AM0A 2OXEA 3L1HA 4Z49A 3RM3A 1X70A 4UFOA 2UZ0A 1PV1A 1X2EA 2J3DA 5HFAA 1ZJ5A 2V96A 3DKRA 4X71A 4BBZA 5IVHA 4J0JA 2QKYA 3STYA 5HFNA 3KD2A 1K4YA 2VEOA 4QWMA 2QJWA 4OYYA 2OCIA 3YASA 4DIUA 2WHPB 4K6GA 5ALQA 1QZ3A 4MJ3A 2AXEA 3TGLA 5DLPA 3G0CA 5AKEA 3AILA 5SYNA 5D3ZA 1AC5A 2ZJFA 4IH9A 1W1IA 1XLVA 2J4CA 4OB6A 2WIFA 2XLCA 1XZFA 2Y2VA 4QLAA 4IH4A 3O4JA 3H19A 4B9EA 4X7BA 3DOHA 1YS2X 5E4YA 1YR2A 4G1FA 3WWCA 4DMKA 1XQVA 2XMDA 2RHWA 4GHWA 1JT2A 3G7NA 3QMMA 1THTA 5YASA 3QMWA 4GDMA 4M0MA 3F9CA 4LYDA 3R3WA 4B84A 5K5EA 5ALXA 2I03A 4X6YA 2H9YA 4BRSA 1SCQA 2QM0A 3FSGD 1E8DA 5DNWA 3STUA 4U2DA 1G5FA 1QIHA 1ORVA 1LBTA 4YPVA 4IHAA 3FYUA 3BJMA 5ALFA 3G02A 4H7HA 1EA5A 4J0DA 2HA2A 3H2JA 5H3HA 5HKBA 5A2GA 2XDWA 4J0KA 4FLEA 3HYSA 4U2BA 2GBIA 2WJ3A 4H18A 5CRIA 5EHZA 1EB9A 3WLAA 2HU7A 3FNBA 2GYWA 4PSCA 1NU8A 3C6ZA 4OPMA 5BV7A 2AJLI 2XMBA 3WK7A 5AI0A 3FAKA 3D7RA 1XRNA 4WDQA 2IIVA 1VA5A 3QH4A 2WIGA 2GZRA 5AM1A 5ALGA 1QO7A 2XUPA 3R0VA 3V1LA 4TPKA 4XJVA 2VJAA 3TJMA 1MAAA 2QT9A 2JEYA 3A2LA 2XMCA 5I9IA 3BE8A 3D59A 4DYHA 4HS9A 2JF0A 1BCRA 4ZV9A 5K3FB 3OOSA 4CIAA 4Y2XA 4EB0A 4GI1A 4W63A 5LZ4A 3GBSA 1THGA 2OPHA 4Y2TA 4OD0A 3WK6A 2HADA 2H1IA 3H17A 2PVSA 4D9JA 2O2IA 3QM1A 4OB8A 1ZICA 1AGYA 4J3JA 4DNQA 1QFSA 1ZIXA 1QLWA 5CXXA 1J07A 1VA4A 4M0FA 4BVLA 3I1IA 3PF9A 3AINA 4E46A 4BATA 3AZOA 2NW6A 4AO6A 1XRPA 4UUQA 2PSEA 2G5TA 4OUKX 3EF3A 4P93A 4BRZA 1CR6A 1HDEA 2VQ6A 4KE7A 1PFQA 1WPRA 3O9VA 1EDBA 2QXUA 2Q0XA 3G0GA 1EVQA 2YASA 2E3JA 1E66A 4U2GA 2RIPA 1CUVA 3HACA 3QPCA 5ALSA 1XRRA 4Y2PA 3WWEA 1B41A 4AMYA 1WB5A 4EZIA 4ZGBA 5JZ9A 4BCCA 4KAJA 5ALTA 3WKAA 3VJKA 4FFVA 4J7AA 5JD6A 1R88A 4RE6A 3C5VA 3LIIA 2XUAA 3WMRA 4FOLA 3E0XA 2VJCA 5EHNA 1GT6A 3DD5A 1R4ZA 3C8DA 2WHPA 2QMQA 1GKLA 4G4IA 1UOQA 3FVTA 3MUNA 2WFZA 1XQWA 2WHQA 4AB1A 3I6MA 1FFBA 4U2CA 2RHTA 1A7UA 1N5RA 2ONCA 2ZYHA 5HCUA 2JGMA 1JI3A 4ROTA 4N8EA 3C5WP 4J0HA 3ZLUA 4B85A 1DX6A 3ED1A 2HU5A 4EHBA 3RK4A 4EY8A 5C7YA 1G4HA 1CUEA 3FCXA 1QTRA 1XLWA 3K9BA 3NGMA 5ALEA 4Y7DA 3WIOA 2PUHA 1H23A 2GYUA 3X3HA 3WI7A 3I28A 5K3DA 5AM3A 2EEPA 3ZLTA 5K3AA 1AMNA 1DINA 5AH0A 4ZV7A 3WL6A 2ZVDA 3D5EA 4UBOA 1UXOA 1MNQA 4KYVA 2FUKA 4I4CA 1MX1A 4LIPD 4OU4A 1NU6A 1BEEA 4YK7A 2WJ6A 3A2NA 3G0BA 5AKLA 5AIAA 5T4BA 2H7CA 1AUOA 3DS8A 1EI9A 1E5TA 1MO2A 4G8CA 3QYJA 3I2FA 4BE9A 1UKCA 1KEZA 4X95A 1WB4A 1TK3A 2AJDA 5JARA 2HRRA 1VKHA 2BUBA 1G42A 1T4MA 4G9GA 1YA8A 1EK2A 4L3WA 1BN6A 1TQHA 4WFKA 1U4NA 3QMVA 2WSLA 1WCYA 1MPXA 4FBMA 1R1DA 2WQZA 1IZ8A 4FLMA 1QJ4A 1Q83A 1WB6A 2PL5A 2QR5A 4B82A 4BDTA 3ZPXA 4JH0A 3TEJA 1UOOA 4MXDA 5AIBA 2VT7A 5E4TA 1FSSA 1W4LA 4XIIA 3S2ZA 4BVJA 1K63A 2HFJA 1FFEA 2XLBA 4H7EA 3W04A 5ALLA 2OAEA 4W9RA 4UBLA 1BCSA 1W76A 1XZAA 2QXTA 4HTAA 5ALPA 2ROQA 4BYMA 2OGSA 2HA7A 4S0XA 2HA4A 1L7QA 5C8VA 2PSFA 4M0EA 3E4DA 4W1PA 4X94A 3OURA 3GELA 5FDFA 3QVMA 5K3EA 4K5QA 4UFNA 1DX4A 3STTA 1F8UA 1LZKA 5BWBA 1Q84A 1UFOA 2QUAA 5JAOA 3WYDA 4PO3X 4AN0A 1VE6A 3H1BA 4C87A 3BIXA 4FWBA 5BOVA 5HZGA 5AKKA 3F67A 1E3QA 4JNCA 2CMFA 1LZLA 3H18A 1UK6A 4BTVA 4X91A 4TGLA 3WWOA 3DQZA 4EA6A 4BDSA 2GYVA 3FCYA 1H2ZA 3RKSA 3S8YA 3SX4A 5JD4A 5D7BA 2WFLB 1A8SA 1HLGA 3E3AA 4F5ZA 1QOZA 2HM7A 4P92A 4BAGA 2O2HA 5HQ3B 1GPNA 3R3ZA 4C88A 2JIDA 5AP9A 1VOTA 4B81A 1C7IA 1ISPA 4YX9A 1X2BA 4V2IA 3E1GA 5HKAA 1UT6A 4C4YA 2BUAA 4Q3KA 3G9UA 4QE3A 2EDCA 1WM1A 5LKRA 2WFMA 4ZRDA 1EVEA 1GZ7A 1CUYA 1TCCA 4F60A 5JZBA 5AK4A 3DJYA 1Z68A 5A71A 2H7XA 1JJBA 2VT6A 4GLBA 5LLSA 4E11A 1JJFA 5J3JA 4N8DA 3IUJA 1LPMA 2ZJ6A 3DLTA 1R9MA 4AQDA 2YH2A 4IH1A 3HABA 5C8ZA 3QBJA 1BE0A 5EIEA 3LLCA 5DWDA 3F96A 4L9AA 4EY6A 1GQSA 3M81A 1XZHA 4PV7A 3GFFA 3EQ7A 2O2GA 5LZ5A 2DCMA 1HPLA 4QNNA 5JANA 1TCAA 3U0VA 2B20A 5AOBA 4CCYA 5AK3A 2WIKA 3C45A 2JGLA 4B0OA 1EH5A 4L72A 1XFDA 4AZ0A 4WDRA 1JJIA 4F0JA 1Y37A 4BAUA 4K6KA 5HK8A 4WY5A 4J0CA 4AO8A 2OG1A 2YXPX 3WK8A 4WJLA 1GQRA 5ALOA 1BRTA 3W9BA 1YAHA 2CEKA 2VATA 4LXGA 4LXHA 1EXWA 1DQYA 5ALVA 4JUIA 2GBCA 5ALJA 1IZ7A 3BDVA 2AJBA 2XUFA 3VJLA 5IH7A 5IVKA 1ZI6A 2XUQA 1SCKA 4AN1A 2H7YA 2OCLA 3WK4A 3OC0A 1CUBA 2HA3A 1RP1A 5ALHA 1SFRA 1QFMA 4UBMA 1UKBA 3EIOA 1L7AA 1UZAA 1XZGA 3WL7A 2X8BA 4UBNA 5T4FA 4Y2RA 4CG1A 3STVA 3ZV7A 3H2IA 3DEAA 3I2JA 4UHCA 2DQYA 4KEAA 3WKBA 3V9AA 3AZQA 5AOCA 3DNMA 4DSZA 1F0PA 1VLQA 2WU4A 2WG1A 4HRYA 3CN9A 1AKNA 1QIFA 1W6RA 4UHFA 2FX5A 4UBKA 2PBLA 2OCKA 3H2GA 7YASA 1N5MA 4EY4A 2C5FA 4N8SA 1KU0A 5A7GA 2DR0A 1BU8A 2WIJA 4CG2A 3Q8WA 3FLAA 4C4XA 3STWA 5EHXA 4FKBA 1HQDA 1XRLA 4G4GA 5AI4A 2WTNA 1CEXA 4BAZA 1GPKA 5LZ8A 1BS9A 4PSUA 4UBIA 4RPCA 4DMCA 4L0CA 5CT4A 5ALDA 1M33A 2P8SA 4QDOA 5AKXA 4H7JA 4ITVA 1EX9A 5I7UA 4MQLA 5LKAA 3CCBA 3ZLVA 2GBFA 1DWQA 3WL5A 3HJUA 1XZKA 2GBGA 1HBJA 4DSAA 4Y2YA 2PM8A 1YS1X 4HXFB 3WIBA 1EDEA 4XVCA 2RI6A 5CTAA 1OXMA 4KJXA 1UOPA 5JIBA 2ACKA 3HLKA 2PU7A 1OILA 1TRHA 1ODTC 2R8BA 3KOOA 3FBWA 4W1RA 3N0TA 2HFKA 3PICA 5ESRA 1LBSA 1Q0ZA 3O0DA 2ECFA 2WUDA 4OCZA 2VTVA 4KACA 2Z3WA 1VJ5A 3A2MA 2OLEA 2ZSHA 4TVKA 4K6HA 4NZZA 3M82A 4MWSA 5A6VA 4EY5A 1DT3A 4W1SA 4Q34A 3D2AA 2PUJA 2CJPA 4J0IA 3C70A 1LGYA 5ALRA 4KRXA 1JU4A 2XQKA 4Q82A 2WM2A 3QPAA 3WWDA 5CT6A 2WJ4A 1C7JA 4EUSA 4QEKA 3R3YA 3EQ9A 2DFPA 4CIBA 2WIDA 3B3QA 1XKLA 5CH5A 5JALA 1PJAA 3O4GA 2FJ0A 4LYEA 4DMFA 1BN7A 1H2WA 4K2AA 1SCIA 5KWJA 1QIDA 4OU5A 1ZIYA 3LS2A 3PUIA 1W75A 1RWQA 5A7HA 2BFNA 2QRUA 3AIOA 5AI9A 1MTZA 2C0QA 3QPDA 2I78A 3STXA 5DYYA 3H2HA 3BL8A 2GZSA 3KWJA 1T2NA 4N5IX 3B5EA 1E8NA 1F6WA 1JMKC 3ILSA 2G5PA 4J03A 3AFIA 4ZXFA 1J1IA 3OPMA 5E4JA 4KAFA 1N1MA 3WZMA 4BP8A 1MX9A 4B9AA 3L1JA 1LPSA 1FFDA 5C81A 4H7IA 3IA2A 4GECA 3FYUC 3D4LA 1XLUA 4QDTA 1EDDA 2XI4A 1CUSA 4KRYA 5LZ9A 1ORWA 2XQFA 5D3KA 1QIKA 3HSSA 4FDMA 5AI8A 2BGRA 3WL8A 2QVBA 3BJRA 5AOAA 5LYYA 1CQZA 3FWHA 3UUEA 2G63A 4AZ3A 1SC9A 5HQ3A 4G8DA 4QA9A 4ZI5A 2K2QB 1MJ5A 4MQMA 5ALMA 3ESCA 1R9NA 4W1QA 5AI5A 1XZEA 1VXOA 2J4FA 1LPBB 4DM7A 4X90A 1A8QA 1TCBA 3PI6A 4RE5A 5F4ZA 1MNAA 5CT8A 5CURA 4X97A 1GXSA 1TAHA 2Y6UA 1SOMA 3R3VA 3ESDA 1HKHA 2CBGA 2ORYA 3N2ZB 4RGYA 2C58A 3DYVA 1CLEA 1P0PA 4OSEA 3KSRA 2W22A 1DTEA 1UK7A 3IIIA 3D2BA 4HVTA 3W05A 2CB9A 4H7DA 5CT5A 3C87A 5DNUA 3KXPA 1AX9A 5DNVA 4GXNA 3AIKA 4LHEA 5KBYA 3DOIA 1VXRA 4B83A 2X76A 1ZD5A 3IDAA 2ZSIA 1F0NA 4H77A 3GROA 1R3DA 2D0DA 4ZWNA 2O7RA 1LNSA 1UK8A 1ZJ4A 2XE4A 3IBTA 5HF8A 5C8XA 1XZIA 1IUOA 3V1KA 2WUGA 1XRQA 4FTWA 4Y2SA 5EGNA 5IVIA 3QZUA 5CT9A 4G8BA 2CUTA 4HXGA 3F97A 4X85A 3U1TA 4MEBA 3D3NA 3FYTA 5JD5A 1XZMA 2BGNA 2DHCA 1XQXA 3VDXA 1ZGBA 5D6OA 1WHSA 3C8HA 2B4KA 1N8SA 2VF2A 2VAVA 1CUUA 4O08A 1DWOA 4C01A 3JYHA 4UFPA 5AK6A 4FLFA 3P2MA 3NOXA 5FV4A 1L7RA 2RGUA 2BUCA 4EBBA 1BROA 1QE3A 4AXBA 2WKWA 2PSHA 1XZJA 2JGEA 2CKMA 3MGAA 3UMJA 5AM5A 3VXKA 2V9ZA 6YASA 1DQZA 1P0QA 4INZA 1QTIA 5SYMA 3RLIA 5JASA 2HHAA 4ARBA 2YYSA 1G66A 2BJHA 3ESBA 3WK9A 1ZI8A 5AICA 3HI4A 1GKKA 2CZQA 4KE9A 4GBGA 2WG2A 3WK5A 2ZJ7A 5AKYA 1MN6A 1QO9A 3I6ZA 4I3FA 2WFLA 1IMJA 3F98A 3K6KA 2G4LA 1ZD3A 5AKGA 4CI9A 1DWPA 3BF7A 2W6CX 1GPLA 5T4HA 2LIPA 3IUMA 1E8MA 1CUAA 2WHRA 5JAHA 4QDZA 4DLNA 3D2CA 3JWEA 3WYNA 4H35A 3RARA 4BC1A 3HEAA 1CUDA 3G9XA 3MVEA 3V1MA 5CBKA 1JU3A 3TRDA 3V1NA 1Y7HA 5ALKA 4P9NA 4IQ4A 3W2TA 5FKJA 2Y2UA 1U2EA 4B7ZA 1NX9A 3BIWA 4NMWA 1UKAA 2Z8ZA 4G5XA 3T52A 2Y1KA 2QOEA 2X5XA 1DT5A 3CXUA 1XRMA 2JGJA 3DCNA 3ICVA 5A7FA 2WUEA 2IITA 4Q3LA 1WHTA 4BCBA 1E89A 2Z5GA 4HAIA 4C4ZA 3G9TA 5JYCA 1QGED 4KR0A 4UHHA 1UK9A 3OTQA 4BP9A 5ALIA 3SK0A 2OGTA 3C43A 5A62A 4CCYB 4FHZA 3SC2A 5E2IA 3DKKA 3HXKA 3GZJA 4PF1A 2PSJA 1RYYA 3FLEA 1QIGA 3H2KA 2OQVA 1CQWA 3GUUA 5FOQA 3T4UA 1XQYA 2C0PA 2QJRA 4LXIA 3F8SA 4ARAA 4X93A 1LLFA 4Y2JA 1HL7A 1ZOIA 1XKTA 5CMLA 5FP0A 2C7BA 1TKRA 1Q0RA 1IUNA 3UUFA 3A6ZA 3DL4A 2PPLA 1QIJA 2XMSA 5AHXA 3BWXA 2XUIA 1EB8A 3A70A 2XUKA 3WKEA 1OCEA 2XQIA 1FFAA 1WOMA 1CPYA 1XROA 2AJCA 2HL6A 1CIJA 3O4HA 5T4EA 2HA6A 3EBLA 5CXUA 1KU6A 2ZYRA 3IVMA 3DDUA 3FLBA 4WY8A 3NUZA 2WU3A 3SWWA 3FSGA 3I1YA 3V48A 4QDXA 1XZDA 4QZVA 1FFCA 1H2YA 3O95A 5HF9A 1CUGA 3WA7A 5AKJA 4FMPA 3G9ZA 2QTBA 5FPQA 4WCVA 5DJ5A 4MEAA 1QIIA 4HXEB 4JYPA 1GGVA 4PSDA 1IVYA 3ESAA 1CUZA 2OAGA 5AKZA 2VSQA 4UHDA 2DSNA 3HZOA 5CW2A 2QS9A 3PF8A 5DTIA 3C6BA 5IKXA 1QIMA 4B6GA 4GEGA 1QONA 5DTJA 4CFSA 1BEZA 1H2XA 5FRDA 5K3FA 4U2EA 1CVLA 4Y2VA 2OQIA 3BXPA 5JAPA 2VA9A 3AJAA 3WZLA
chains in the Genus database with same CATH superfamily
3T5MA 1ZD8A 3D6TB 4MJLA 3VKFA 2I4MA 3E35A 3HYRA 1ENZA 3GRKA 2CBZA 2MMCA 4IIGA 2WICA 4QUKA 3PV0A 4IJUA 6REQA 1YA6A 4M9CA 1KMNA 3QXHA 3SR4A 2BEKA 4PGAA 3A3YA 3DLPX 4QBIA 4N3BA 4JIGA 2QMEA 2VUHB 1NJSA 2XWPA 4IQGA 4UUPA 4KAAA 4EG8A 2JZOA 2YYZA 1V9CA 3RWMB 5JAUA 1JBKA 4X9XA 2G4CA 3ZWAA 4OH1A 2QZSA 2AF4C 4GOXA 5KTTA 1M54A 2Z09A 3JYPA 2I91A 1JEAA 5A1JA 1EVLA 3A0RB 5AJWA 1UANA 4B3IA 1Z2CA 2R0QC 2J4DA 1T9HA 2AQIA 1U7TA 1U90A 1VJGA 2IHVA 5TPZD 4CCWA 1JSXA 2IOHA 2GCIA 1SUEA 3N7TA 5IKMA 2M6LA 2BELA 3JWHA 3KVVA 1YTLA 5C0OE 3W6ZA 1M2VA 1TUIA 3JATA 4OAPA 3AVWA 4IIJA 3MYYA 1JFFA 4YACA 3UWKA 1AHPA 4R2XA 3D0RA 4K9LA 4CM3A 1NW3A 1TXGA 2HKIA 2F8TA 2Q9AA 2DFKB 1US8B 2ZJ2A 2NPOA 1P61B 1Z5NA 5ABPA 3ILYA 4ZDIA 4BCDA 2VAXA 1TMOA 3LT2A 1HT3A 1Z3IX 2ZOSA 2R87A 5ALNA 5ALYA 2AW5A 2VZ9A 4BQNA 3NTRA 2NSJA 3K4HA 3S29A 1U6JA 3UVEA 2HRZA 3BN3A 2A78A 3U4HA 5FUQA 3IAXA 3W5VA 1XZQA 1Z2NX 3T99A 3OZGA 4UDOA 1AJEA 4I14A 2GX6A 3NYQA 1K7YA 3GUYA 1ESCA 4RKYA 3WLOA 3IQIX 2B94A 1BKYA 2W2TA 4OI1A 4BGEA 1Y48E 2BMWA 2OOKA 4HCJA 2L17A 3QWHA 4NS4A 4C03A 4OYLA 3VBEA 1MIOA 1H4VB 2NV0A 4LKOA 2REQB 2D54A 3THWA 2VG8A 3GMTA 1PFUA 2W2NA 4JEUA 4A27A 5EIAA 3PFNA 3L8MA 1AHNA 1DC3A 1EFUA 1Y3HA 1CY2A 2CJWA 2PRZA 2ZBVA 1ZK4A 2ZKLA 3LIPA 3NDIA 5GZ6A 2LPMA 4EGCB 4IGAA 5IVPA 3AVOA 3CINA 3S8MA 1N5OX 2FV8A 1AQNA 2JGIA 4OKIA 3OESA 3BEDA 2P9CA 1M6HA 4IW3B 4D8YA 4Q4JA 2JGKA 4MVJP 2R11A 3GLRA 3EZYA 2KHZA 4TTSA 2NMVA 2C8LA 5DSTA 4RJLA 2ZS8A 2CLMB 1KP3A 2J33A 4GMXA 4Y6QA 3BMOB 5ALWA 5FLXA 3KQPA 1DAKA 4NABA 3H1AA 4KX3A 4UPEA 1L4KA 3W4IA 3OQOA 1MUUA 3ANSA 4KXUA 4E31A 4BECA 5LNK6 3L1KA 4HNVA 3DT6A 1V5WA 4NVRA 3LGXA 4MUJA 1VIDA 3TCNA 4GVXA 1CFJA 4HAVA 3X2SA 1H42A 3KTAB 2BE9A 3F6YA 3VR2A 1H22A 4WA8A 3W5JA 3I2KA 4H60A 4DAOA 4QO8A 1KIFA 4HWRA 2FPSA 1NBAA 4LDQA 1RXWA 4HDRA 3AJEA 1NATA 3C4JA 1L5KA 4GNKA 2WMYA 4FFRA 3WKDA 5A3JA 5C4IA 2P0EA 1B6GA 1V43A 1OREA 4P4TA 4R41A 2JAWA 3LP5A 2Z2YA 1D2CA 2YWRA 2JRLA 3C6XA 3V5NA 5ITZB 3ENWA 5AVQA 4D6XA 4ER5A 2VJBA 1PS8A 6NULA 1OU0A 2ZT8A 4XIYA 4FXOA 5ALZA 3GU3A 4NBTA 4XVRA 1WDWB 4W5NA 5CHEA 4HZGA 3FSEA 1XD2B 4W7SA 5K3CA 2HHCA 4WOPA 3ZC3A 1MJNA 3TMAA 5LP6A 2QN1A 2W2XA 1JR3D 1NQXA 4B8WA 4I3HA 1ACLA 1XUOA 4HFNA 4Q4LA 5ARDA 5E1DA 4ARIA 4JI8B 3GI1A 1E5DA 1TLTA 2HIHA 5LQAA 1QGAA 2JD2A 2C54A 1V4VA 3OZWA 5HDBB 4CF7A 2HF2A 3LFHA 4HEA1 3LUAA 3NFYA 4YO7A 3VNQA 4AECA 2PKQP 1Z4JA 4FDLA 4W6ZA 3E3NA 1XN4A 1UBJS 5B7QA 2NUBA 3R4VA 2NSLA 4FM9A 1GTZA 1S2DA 1XMXA 1XJ5A 4PG8A 3MWEB 1MA3A 1QQ6A 4KB5A 5EI5A 2P2DA 3HXTA 3JQ7A 2FW1A 1QKJA 3TNFA 5HNKA 1JQLB 2IFTA 5EG5A 2IV2X 4CDRA 3CFYA 5KC8A 1WEHA 3L41A 5BN5B 1BQ3A 3WYCA 5C8YB 3TF5A 4WFJA 4GR9A 3RADC 3IT1A 1SN7A 2VUSA 2Y6VA 3FRHA 3IEIA 1TQ4A 1YACA 1PEKE 3E9YA 4KDCA 1VZ3A 2D3WA 4EJ6A 4GOMD 4QGSA 2AJTA 3KR9A 1RKUA 1CYEA 5JI2E 4DDWA 1GPWB 2VAPA 1P73A 3FTPA 3SR0A 5JC1A 1U5BA 2A3RA 4AKTA 2DSTA 4RSGA 4DNOA 2R6CA 1FYVA 4XX1A 3WGVA 2I2CA 5EVJA 2PGXA 1R4MA 3WDSA 5BRAA 3EZ2A 4LV8B 1TMYA 1H2HA 3INYA 4PRLA 2GJSA 2QWXA 4INJA 4XWGA 1YR7A 3UAOA 4RGQA 4GO1A 3M5CA 1S8NA 4L8FA 4WBXC 1T35A 3KOXA 3FBTA 3OY7A 3S55A 2XUOA 1LY1A 1O5TA 3UT5A 5B64A 1I7DA 2FF5A 1MRNA 1OGYA 4JN6B 1FPQA 1VMKA 2P3QA 4LGMA 2XPCA 3R7FA 4TUYF 1ZMTA 2GZAA 5TX7A 2EP5A 4IZOA 2IZZA 3D6HA 2BR3A 1FBTA 3GRUA 4W9NA 4FNAA 1P9RA 5EIHA 1KSGA 4QUGA 3BMCA 4BFTA 5CA0F 1V41E 3OHMA 4LJRA 1K3UB 2WILA 1NL3A 1Z6ZA 2UZ1B 3UCXA 3TQOA 3S68A 1MU0A 5A04A 1K06A 3NKLA 2FJPA 4Q02A 3JQ8A 1KOLA 1TVKA 2YVKA 1YJCA 3JV7A 3F7TA 1TYZA 4U9UA 3AEYA 3OOHA 5AQEA 2AZXA 2R6DA 4ZI7B 3RAFC 3QFFA 4KQ9A 4RS4A 2EFYA 1KZ4A 9ABPA 3WB0A 4RH1A 1UJNA 2AJ8A 1SUWA 2ZWVA 1BKDR 2PG3A 4N0QA 2XMRA 3R5FA 2YNMA 3B1WA 4DKXA 1Q12A 1KA9H 5BSEA 1ZS9A 2Q5LA 4Y67A 3RR2A 4AD8A 3EQ8A 3CCCA 4HL6A 1P80A 1E3WB 4XI9A 4YCSA 4X1YB 1ZI9A 3G49A 1V9SA 4RZUA 5FBZA 4AROA 3D3EA 4M36A 4G9EA 5EIFA 1QGUB 5EXXA 5KCMA 4R0VA 4RTLA 3FCEA 3THXB 2HIGA 2WYOA 2YKGA 5LMUB 4DFDA 1TM2A 2NPFA 4HN2A 5FLYA 1F06A 1U2DA 4KXQA 2RGEA 3EHDA 1FTWA 3NHBA 4R7TA 3RVNA 3VZSA 1XD9A 2HGSA 1L7MA 1XZCA 4O4IA 2YRFA 4G37A 4TRJA 5FX2A 2N1MA 1C8VB 1YFZA 4KE8A 4QLOA 5LDHA 1Y4UA 2GN1A 3D0KA 1AGPA 2DP4E 4N39A 4EHDA 5CDHA 3SC2B 3LC7O 2QTVB 2A57A 7REQA 2HDOA 4I81A 5K8CA 2JGNA 4Q9DA 2GZHA 3NEJA 4OP3A 4BLRA 4DUZB 3BF8A 3RYFA 1Y5IA 5F1OA 1W52X 3BTSA 3VAAA 3H8SA 3GJ0A 5JG7A 4XB1A 3IVGA 1QKKA 2JPDA 3DPIA 5GJWC 3M83A 1Q44A 1K5GA 2NWQA 2XRMA 3A4LA 1A72A 3OA0A 5E9JA 3G3EA 4PN3A 3GCGA 1MB0A 4PZZA 3EMBA 1WXIA 4YT8A 4O2BF 3HUTA 4RD1A 3PFHA 1EFTA 1Z4MA 3NNDA 4NEGA 4XB2A 1AUQA 1LPNA 4OBBA 1N8KA 3FVRA 1QUEA 3TCKA 5GTDA 1VYVA 4PFJA 3R44A 4PYNA 2WJWA 2QTGA 2GRUA 2PZMA 2A67A 4UCXA 3OZCA 1YO6A 2RONA 3KCNA 4YJDA 1QS0A 2ERYA 5F5NA 1RHRA 2OBBA 3K0BA 2HA0A 3L8HA 1RIFA 5BSHA 2PKWA 4LJYA 4KFCA 1U0BB 4DB2A 3DFMA 3BXZA 1JR3E 1IZ0A 1DJNA 2A3NA 2WYUA 1KPHA 1PV4A 2C4MA 2CLKB 2VCHA 2ZWMA 1WLYA 2HUPA 3AUUA 3FYHA 3NEPX 4K05A 4MR7B 4YMSA 2RK6A 3DDOA 3O3CA 4PC2A 1CDEA 1B8VA 1Z7WA 2FE4A 2RHRA 3I2HA 3BE5A 4GGOA 4EPTA 1J09A 4X41A 2RAUA 1KAHA 2Y1CA 1O89A 3TZLA 1Q74A 1FS4A 2QENA 1RLTA 2O1EA 4J07A 2PKEA 4JOQA 5CNJA 1G8MA 2FW9A 4K03A 5EZQA 2ACWA 4EB8A 3HUEA 1OY1A 4XVHA 1TF5A 2E55A 2WD9A 5DGIA 4JLJA 2VPIA 3OZDA 2XXBA 2ONYA 4I1YA 3NBXX 4GWGA 2OMKA 1KEKA 5B3KA 2AOTA 3C3MA 3UMSA 1FFGA 4UUMA 5BQ3A 1N34B 4H7PA 3H1GA 4HPJB 3NP7A 2LCIA 1MJGM 2BFOA 4M6WA 4X8HA 4RZ3A 3U09A 2EQAA 1Q0PA 1UBTS 2G40A 1JDBC 1PK7A 1WBDA 4QXMA 4CM8A 2VR1A 3KTOA 5I47A 4UD2A 4DYDA 2O23A 3TZKA 1U3WA 5LU8A 4FGZA 3E48A 4TX1A 3SC3A 2KX7A 3IB3A 3R40A 4CMIB 1B76A 4ZAWA 3EDMA 1FNCA 1TD9A 4WQMA 5BW8A 3ICWA 3CMMA 1NP7A 3LRXA 3O82A 4YS6A 1RYMA 2V45A 1QHNA 1NBME 2C3MA 1ZWKA 1VLHA 3ESRA 4MJXA 1UP4A 4UMEA 1YCHA 2WTXA 2SCUA 1GCUA 4RACA 3VKUA 3GRAA 3JQCA 3LU1A 3RNOA 3OPQA 4DMHA 3PT5A 1GOTA 2QW1A 1FRNA 4ZAXA 3VSEA 5K6RA 1CV2A 2WKPA 1V3QE 3ANNA 3GGSA 1CC1S 3KJZA 16PKA 1XN1A 3H04A 4JBXA 1UINA 3V7YA 3JWJA 3FUVA 4D4MA 1JHQA 3OE5A 1TE2A 3FHCB 3NRCA 3W77A 4BWGA 2BDTA 2W2OA 3ZI7A 2IP4A 5E7JA 3GX1A 1T5IA 3B82A 1MO6A 3KXKA 1XAIA 4G0NA 4HX2A 5FR2A 2OHJA 2QIOA 1AB5A 3CLTC 4MWTA 2I3GA 4Q05A 4B6FA 5HGXA 5DM0A 1KH3A 3KWFA 5LVAA 3S7TA 4XD2A 1RZRA 1V5FA 3RU7A 4CU5A 3T3NA 1IY0A 1HQKA 4CUJA 4RKRA 1KFKB 1N6LA 5D85A 3BCSA 3CIOA 2MJLA 2V6IA 3KS9A 3IR7A 1RYZA 4IDNA 4V0SA 5CH3A 2EVWX 4A8HA 3ACBA 4DLTA 3KTAA 2V98A 3DWIA 1GR1A 2PAAA 4CR7A 3CEAA 3ZOZA 3OUTA 3OOYA 1DAIA 3W3AA 3SJBA 3NONA 2AG0A 2PX6A 1VHTA 2RGXA 1K3TA 1FQKA 3OJ0A 3HLTA 3PEEA 3Q9NA 4K88A 2ZYTX 3H9GA 3NIDB 3P2EA 4CLRB 1XZBA 3H5NA 1AKQA 1UXJA 1J9GA 1M73E 2G70A 5FLKA 4EKYA 4ZYUA 4AY2A 2JLRA 2XSZA 2I71A 1OBFO 2L18A 1A9QA 4NG5A 3DOCA 3O75A 1T0JB 3G8YA 1ZM9A 1B43A 5EESA 1J70A 1SM4A 3HGQA 3JW8A 4L6IA 3WBKA 4DMRA 4ZTBA 4G2NA 4YRJA 1UMBB 2B2CA 3IOBA 3I5XA 3AU9A 1XQ9A 3OZSA 3EDOA 4V38A 1RXUA 1NR5A 2Q3MA 5JYBA 1JI0A 3M9XA 3TSCA 1X94A 1RAHA 3L1HA 1VSQA 4JVOA 3QE9Y 4Z49A 3RM3A 1CR1A 1MKYA 1X70A 3ZHXA 3CVVA 4Q37A 3TXYA 2QW0X 3IT2A 3HBAA 5T67A 2I55A 3IT0A 2XYQA 3ZXYA 3KPUA 1PV1A 3TKAA 4DMGA 3FZGA 4QHTA 1CZLA 2JI9A 2E2WA 3MJVA 3T1OA 3D4PA 5MFZA 1KY5A 3WAGA 1KARA 4LBVA 4X71A 3L5OA 4BX2A 4CKCA 1TK2A 5AUQA 4IQ8A 3STYA 5HFNA 4CHTA 4LCEA 4DZRA 1K4YA 3VPFA 3ZJUA 3BICA 1K6JA 4NH0A 3LCJA 2QJWA 4QWMA 5D5HA 8LDHA 4D82A 2ZPAA 4OYYA 4QULA 1ZAYA 5IAOA 3U4MA 3D6VA 3IMKA 4GMDA 2YWCA 4HB4A 3MOGA 4AJ9A 1AU9A 1WMDA 1WHTB 5K9ZA 1KQOA 4YP6A 2I1VB 4MJ7A 2EHJA 3I34X 4PRKA 4UNIA 3WBFA 1J8FA 5KTYA 1QZ3A 1OE0A 3WB1A 1YDWA 2JEOA 4GR5A 4A0HA 1RYNA 2BEUA 4JP8A 1FTSA 3BKWA 1JHRA 4MRRA 4WUVA 1IBMB 3QEMA 2RGCA 1G64A 2V3VA 3TCXB 3UMMA 2ZJYA 3EXHC 3A2KA 3NJ8A 4IR7A 2ZJ3A 5KOJB 3ROTA 3B6ZA 4EJSB 4PG6A 2YHSA 4R1TA 2J4CA 2JC3A 1UMKA 2F7SA 2V0CA 3WRYC 2ZYAA 2WIFA 4EGQA 1KAGA 4E7OA 2FPLA 2VYND 3ADCA 2CNBA 2AI3A 1E1RA 1DC4A 4TT3A 5FBWB 1WVMA 1IG0A 1NOKA 4H3KB 4MVJF 4P54A 3T4EA 5FNZA 3P20A 2J0EA 5HS6A 2MOKA 2WWVD 4DLXA 1VJTA 3E5NA 4LRSB 3PEYA 2QTLA 3DO8A 4ZU3A 1T8UA 3G79A 3F9RA 1S8AA 2WJIA 3FF4A 2ZUBA 4JCCA 4OLFA 3VR0A 5JNVA 4Z53A 5HRCA 5BYBA 4MW4A 5BQXA 1H8ED 4D9EA 3X1KA 2PGIA 1N2EA 4DBLE 1Q95A 4G0UA 5EYPB 2RE8A 3NAGA 2RHBA 3SQDA 2AR7A 2FXIA 3K53A 5AXDA 2J7KA 1Z5GA 2P11A 2OXIA 2F55A 2NAPA 2RHWA 4G67A 4I36A 3EG5A 2FSFA 5CX1A 5A5DA 1JT2A 1GZ6A 3G7NA 4WVLA 3U7EB 5YASA 1PW7A 1YJXA 3BK7A 3QMWA 1I2DA 1RWPA 1E9FA 1ADJA 4GDMA 4Q19A 1M1XB 1DP4A 2AFHE 4QFBA 3JD3A 4B74A 4TMTA 5FYQA 4LYDA 4KP7A 3B7PA 4F97A 1Q17A 2PWYA 4GE3A 4B84A 5JHHB 4J2HA 3ZWWA 3ADBA 2I03A 3F0TA 5D6NA 1J0BA 3V3TA 3VNVA 4UU1A 2JJMA 2Z04A 4NULA 1YUBA 3D4NA 4G5FA 5JHGB 3FVWA 2RHMA 2RSLA 3K92A 5AXBA 3STUA 4U2DA 2VKQA 4F85A 2AF3C 3RVPA 3QUAA 4G85A 4PE5B 1SVNA 3H2SA 4X1YA 1ORVA 1NQAO 2R66A 4WINA 4YUYA 3KZXA 4LNUA 4RCZA 3G0OA 2P1DA 3BJMA 1W5SA 3OEHA 1PQPA 2OECA 1RRCA 2O5EA 1Z62A 2ZQYA 2FWIA 3NH6A 4U1RA 3SXUB 1OU4A 2NU8A 3MGBA 4MGKR 3I61A 2ZUWA 2WWRA 4MA5A 4A3SA 5H3HA 1QB7A 4BMVA 5AXAA 1CKEA 3TVDA 5EKDA 5A2GA 3RVJA 4FLEA 4EUFA 4JC8A 3GEEA 5WRFA 4KZPA 3WSWA 1MVOA 1Z33A 3IV6A 4JJGA 2P4HX 2V0GA 2OFPA 2WJ3A 2ZETA 2QD2A 3K0AB 1W5TA 4H18A 2H9AA 5CRIA 5DV9A 4DPLA 5EWJB 2P4UA 3CX7A 1RD4A 3CE6A 3KZVA 5CVDA 1SPBS 1X13A 2OTCA 1KR2A 1U1IA 2Y1EA 3H8JA 5REQA 4S24A 1E7YA 2LCFA 4CLOA 1MT0A 1YC5A 4ENTA 2JFPA 1YC2A 1EBBA 3DB1A 2ZM6B 3BD9A 4EA9A 1V45E 4M7RA 3Q7SA 1GTVA 4O33A 2FQ1A 3SEZA 2GPSA 4E6PA 1LK7A 1P7ZA 4AZ0B 3C6ZA 2JH3A 2JK0A 1EP3B 1J0AA 1BQEA 2F1RA 1MDFA 1W96A 3MT8A 5B6PA 1BXKA 3HCFA 5JS8A 2XMBA 2VUIB 2QLFA 2QRNA 1GLGA 5K0LA 1SK8A 1M1ZA 3WK7A 3VNSA 5C35A 1UP6A 3A1SA 2X77A 3FAKA 3BWMA 3L8ZA 5EPEA 4F9EA 3SVTA 4TM7A 1A27A 4HNQA 3QVKA 2Z4TA 4MVXA 2V58A 5A5VA 3MELA 4FT4A 1JG2A 2Y1DA 3CLTD 1VA5A 4X20A 4HDMA 3TYXA 1JAYA 8MHTA 4OSPA 4YCJA 2WIGA 4MIYA 3WTCA 4L0MA 4BKUA 4DDUA 3UBTA 2XJ9A 3O93A 5ALGA 5NULA 3WRYA 3DEJA 5IF9A 2DU8A 2X4GA 2YJZA 2HV8A 3OZBA 5JCZA 1UXGA 5J4KA 3BIJA 1O3YA 3GV0A 3PENA 4J7UA 4LEIA 3FTEA 1KF0A 3K0SA 3Q10A 1Y98A 1L5SA 2QT9A 3K35A 2D2FA 2PYZA 2JEYA 4FOSA 5I01A 1ZH6A 2XMCA 3ROEA 5DK4A 3F3MA 1HT2E 3ZBTA 3FHOA 4K1LA 4ZJYA 1B2LA 3WLHA 4YGXB 2IBMA 4X66B 1MIHA 2HT6A 3DEFA 3RT1A 1KQGA 3BXOA 3HDYA 5BYAA 3P9QA 4DYHA 5IT9A 1RZUA 2ZZKA 2C92A 4LDJA 2X7XA 3WLJA 2E5FA 5C1OA 3HFJA 3WNBA 1XNHA 4BNJA 3AOGA 3N70A 2EFJA 2A9RA 2Z9BA 5FO0A 2QUKA 4M6WB 3R5XA 1P7PA 5K0BA 3H5AA 5HUQA 5HIKA 1C81A 2VWGA 4EB0A 1G5TA 1FDTA 1XD8A 3KAPA 3PNQA 3RC3A 4ZYWA 3V8BA 2R8YA 1J8DA 5IBQA 1R6BX 2Q6OA 3AUYA 3L8EA 1HLDA 5D3MA 4COKA 4KQCA 1R0LA 3WO1A 2QTRA 1C3LA 1U3CA 3SE7A 1PJQA 4EKIA 5IUKC 4D9BA 1M76A 1NHWA 1I4LD 2P6MA 5F9FA 1FDIA 4DV2B 4GC9A 1H3NA 4OD0A 5E8JA 3HKBA 1X1TA 1YB1A 5CK4A 2HADA 2B37A 2YVQA 2JFYA 2H1IA 1TMKA 4FFLA 4P3XA 4TV8F 4M89A 1NMEA 2JHGA 2XD9A 3JQAA 3EXHA 4D9JA 3DOOA 3EEBA 3EFOB 4Y0AA 3W8FA 4KCGA 4XJTA 3HKDB 1SY7A 2GGSA 4J3JA 4MKGA 3CO5A 1DQSA 3IO5A 2GFQA 3FWKA 2IY7A 4BO3A 3S40A 1A7JA 4PVCA 3ZQKA 4ND3A 2ZXEA 4QAQA 1NRXA 3KXDA 4DCMA 1J07A 1D8TA 1ONPA 3QVWA 4M0FA 2E82A 4UDXX 3TLGB 3H83A 3VYSB 3EA0A 3C3DA 4E46A 2RGNA 3L77A 3AZOA 1JDPA 3ANMA 3EH2A 3K05A 4GGPA 5JAIA 3F73A 4FWTA 4ID3A 4NNJA 3SEQA 5IG2A 1TJ3A 5G40A 1NSYA 2G8LA 2XKBA 1HDYA 3EF3A 4UKDA 2IPOA 2ISSD 4E51A 4LOAA 4Z51A 4PHGA 1W581 5H3LA 4E4RA 3LV8A 3N2NA 4WLVA 4XDYA 1P39A 2IU6A 5CGZA 4CL3A 3X1MA 1A4UA 3Q5EA 1DBSA 2IYFA 2RGYA 2CLIB 4BVEA 1UBMS 1TLLA 5C7LO 3ZQUA 2ODEA 3O9VA 4OFZA 4MDYA 2QXUA 4R83A 4OUDA 2FEPA 2ONZA 3IJRA 3RAPR 1EWRA 4GRDA 2ZRKA 3R7AA 3PXXA 1VFPA 2FA9A 1EVQA 3ZY6A 5BT8A 3UPTA 1R9GA 1ISJA 2BFCA 2ZPUA 3PC4A 4K9SA 1P60A 4R0NA 3RYIA 1GV1A 1SBQA 4PCUA 3DMNA 2XOXA 4MITA 2ODBA 2BH9A 4ABYA 2EFEB 5CB4A 3FOZA 4M9UA 3QPCA 1CJSA 4Q4AA 3AI3A 4XGRA 2VDUE 4GPBA 4EHIA 2QRMA 3BMNB 2CHGA 3GRVA 1EXMA 1WZIA 1XAJA 2AEEA 3WWEA 1B41A 1KBOA 4AMYA 2EZUA 1QTNA 1WB5A 2AC7A 3PQ8A 4CKXA 3KXLA 4D74A 4EZIA 3JY6A 3WLPA 1XO1A 4BCCA 3TZHA 1YU6A 2C3UA 3QW4B 7ABPA 4FYXA 4UNQA 1T8YA 3AEKB 2VAWA 2GPBA 1VP9A 1KRWA 2CFIA 2VDOB 4J7AA 4MQ4A 1ONSA 1RKQA 3I12A 4R05A 4NCNA 5CP8A 3PEWA 2V8BA 1H8HD 3D6FA 1ES9A 2GM5A 2XF8A 1MABB 2XUAA 3REOA 4FOLA 5HBGA 1F2DA 2D2XA 4JJ4A 3N2GA 1WMSA 4GT1A 1GT6A 4PINA 2Y0BA 1R4ZA 3I8OA 1GL9B 2H85A 2IEZA 2R8EA 2GXAA 4O5AA 3VH4A 5BQ5A 4KQFA 1I3LA 3AEQA 1UOQA 1YZYA 3MUNA 2VXYA 3B8EA 3WFZA 1B42A 1EEXB 4IS2A 2YWXA 4O2BA 1BX3A 5BV1A 1FJXA 1EJ0A 1LX7A 1C7QA 2C5SA 3AG6A 3FKJA 4AP9A 4KPGA 5HKLA 3O26A 3FIUA 2RHTA 3LF1A 3RS3A 5DNYB 4TTJA 4R1MA 2AMVA 5HCUA 2GZ3A 2PLRA 3ZV3A 2F4VB 2GLXA 1LI4A 2TS1A 4ROTA 5KOJA 4N8EA 2AOWA 2I9KA 3K4QA 1E0JA 4RY0A 4PR3A 1T13A 1Z38A 4EG1A 3HDQA 3K31A 4GKVA 2HPVA 3CX8A 3L4BC 5EHGA 3U7JA 2QI9C 1Z4OA 4PQGA 3LDHA 3RK4A 4N47A 3RVMA 2O4CA 1G4HA 1HE1C 1V39A 1ODFA 4FX5A 2P30A 3K0CA 4GS5A 4AZTA 5DGDA 4BFWA 3AHIA 2WDZA 3L6EA 3NGLA 3OJOA 3DO5A 3EUAA 4L02A 4N4AA 1NUSA 1RHJA 3K9BA 1PJCA 4Y7DA 2F1KA 3WIOA 2PUHA 4B3DA 5JJCA 3HADA 4DKJA 3X3HA 2PRYA 4JJIA 5CJJA 2WINI 4TLMB 2C9ZA 1SKBA 1UPFA 2LWIA 2VJNA 3I8XA 5ERXA 4KV7A 1SXGA 1L5GB 5LP6C 1NE7A 2CWDA 2R85A 1CZOA 2YN0A 2V74B 4QXRA 4QHYA 4ZPXA 4BU0A 2Z8YA 1E1CA 1BVRA 1RJDA 1X7ZB 5F64A 5G2OA 4WCDA 2PWBA 2WPDA 2HCRA 2WU1A 4C0SA 3FYCA 4FZJA 5AH0A 4ZANA 1EVZA 1RE0A 1WCWA 4UBOA 1P17A 4L4XA 2Q9UA 4JL6A 2W2PA 4W5WA 2Q5JA 5JS7A 4DC9A 2ETVA 3K09C 3PXDA 1IK6A 4RVSA 3EG9A 1TK9A 3UHAA 5TPWA 3O0TA 1MX1A 1W25A 3A1NA 4OU4A 4GNRA 3AR6A 1OAAA 1XF1A 1JDSA 4DJ5X 4QRIA 3QPUA 3ZDYB 4B3BA 1J99A 1P1KA 2VDJA 5AKLA 4KSYA 1RRMA 2FW8A 3FWPA 5JMPA 1ISGA 4KQGA 3IMCA 2Q3JA 5AIAA 1L5HB 1KYQA 4UNPA 1BWQA 1U7ZA 2IUFA 1KZYC 1O97C 1RM3A 1MO2A 3HNRA 1ORHA 4G8CA 1U0FA 1V8PA 1O0SA 1GY8A 5G41A 3SKXA 1AZTA 1NKVA 4H6WA 1YMUA 2ZXFA 1ZW6A 2ANBA 3GWGA 3PFIA 4BE9A 1ZK2A 1ZOLA 1EVKA 4X95A 5CPFA 3UGQA 1E2NA 2OQRA 2RI1A 1E1QA 3KUXA 1RABA 4TL6A 1MOPA 5JARA 1HM5A 4HNAA 4PAQA 5BSVA 4DPMA 4XQGA 1PBNA 1B8NA 2BUBA 2PMWB 2VUUA 5LUAA 1B2RA 1GL6A 2GYYA 4WLEA 1M83A 4CMEA 2WJYA 2ZJ4A 4UU8A 1YULA 5FFNA 2DJ5A 1FVFA 5REQB 2EBHX 3W1EA 1MZVA 3IP6A 4JQZA 2JIBA 4FZ3A 3LTEA 1PWYE 1IQPA 1OXVA 4LK3A 3LQ4A 1I3NA 1E4YA 4NAUA 4PLVA 4WFKA 3ZHOA 4B7CA 1S4QA 3O8OB 5ICSA 1S3GA 1U4NA 3HU3A 3KFXA 2IKQA 4R3NA 1E6CA 4DJJA 5L51A 3QMVA 3D8RA 1SH7A 3K0KA 2P9HA 3L0YA 1B93A 2WIAA 4MW5A 3E22B 2R6HA 1SIWA 1XHEA 1KETA 3GJZA 4JP1A 3DFFA 4LYAA 1Z37A 3RS5A 4LZAA 1RQNA 4B82A 1SGWA 5KNCD 2C2HA 4PZ0A 2FSSA 1UC5B 1ZFNA 1P7VA 1U9IA 2GJAA 3BFXA 3AF1A 3CF4A 4JODA 3WRWA 5B4UA 1QYXA 2P6PA 3EF1A 4GXQA 4X20B 1F1JA 1N5JA 2VNJA 2WFAA 3L8FA 4P82A 4YRPA 2W6IA 3PJFA 3VBCA 1VHQA 3TX2A 1OTXA 1VJRA 5KTOA 3GPLA 2QRVB 3C74A 3GDOA 5EP4A 3H6GA 3CSDA 4TYWA 5EMLA 2NM0A 2VT7A 4F3TA 4XIIA 4RW0A 1QHHB 4O59O 4BVJA 2G83A 5J2TB 3TQQA 1ATZA 1K92A 1Y3CE 2P2ZA 4OJKA 4BQQA 5HBRA 1K63A 1Z13A 1YJQA 3WDMA 3W7BA 1FFEA 2XLBA 1G5RA 1V6CA 2NUAA 5G0SA 4BO6A 2ORVA 1L6IA 1M1UA 4ICIA 1XVIA 1XXHA 4IDFA 5F12A 3VR3A 1DXQA 4K9KA 4PZAA 1NUAA 4R6WA 3GFVA 1J2YA 4UBLA 1BCSA 4ZEWA 3UICA 3WNQA 4CM9D 1BWPA 1XZAA 4HTAA 4CIVA 2ISCA 3HUDA 4YUXA 3FMFA 2GWHA 2ROQA 3UANA 1ZQ9A 2WAYA 4EGJA 3U19A 2QRKA 2P5SA 4IVNA 1UXHA 3RF6A 3SDBA 3KALA 4AYWA 4BNFA 5JTTA 1X8JA 3CZMA 4BRWA 4XW2A 4ALLA 2D5AA 3ECAA 5C8VA 1I9CA 2IYSA 1G20A 2OLKA 1YQQA 4NF2A 3ROKA 4OMFG 3TPFA 4U6SA 2R5WA 5F1PA 2V5AA 3GELA 3S7ZA 4BO1A 3NIFB 4E0BA 3ONFA 4PX2A 3ZJTA 3PQ4A 1R5BA 3I42A 4B87A 1F8UA 3LT4A 1R0SA 2BFAA 5H16A 1Q84A 1Z0AA 4EKDA 3U5ZB 5TY0A 2QUAA 3GY0A 2FRVA 1DGQA 3WYDA 5C1BA 2QBYA 3VJRA 3L93A 5E0OA 4U0JA 4EI7A 3H1BA 3ROQA 3ZDXB 4F2WA 3NBAA 1E58A 3N0RA 4NMXB 5D3MB 5DNEA 3RC9A 2IXGA 3TSZA 1I4EB 5AKKA 1Q0UA 2EYQA 1MEOA 3BUSA 3TR0A 1ZM4A 1U98A 4HK4A 4I55F 1AS0A 4QUJA 1KE2A 1VE1A 1K7EB 2IXBA 1KI6A 4QXPA 1RZRD 4XYEA 2IDMA 1U3TA 2CFCA 2Q0HA 5EQJB 2ZR7A 1YS7A 1VQ1A 2GN2A 2PTHA 5EWLB 2BSQA 1CP3A 3OF3A 2HJRA 4C29A 3M34A 1GUZA 4NCXA 3Q8LA 2FR0A 1DC8A 1FLNA 1RNLA 4HRAA 1OX4A 1BNCA 3L05A 3SF8A 3FCYA 5C8YF 5EMJA 1YB5A 4GPTA 4BQSA 2Q7DA 4CRWB 1OPXA 3JYNA 4P35A 3S8YA 3IILA 2OGUA 3K6SA 4HDCA 1TU4A 4QUBA 2AQ8A 3U9TA 1NYLA 2X5KO 3AHDA 2G9QA 1QNLA 3BK2A 3E7WA 1UZUA 2R1ZA 3KYIB 3KOZA 4PANA 1I13A 1R0CA 1KFBB 2AG8A 2GN0A 2WFLB 3AGQA 3C6MA 3K73O 3ZWBA 4C0BA 4CF4A 1A8SA 1HLGA 1XZPA 1RXIA 4WNYA 3OQ6A 4LXXA 1NXOA 1PSWA 1W4CA 3H99A 1GG5A 1H9BA 3KETA 1QOZA 3TSOA 1NW9B 4CMHA 4DR7B 1P18A 1V7ZA 1VPDA 2BEWB 2R6R1 4PIVA 4GUAA 1FRQA 3DW3X 3ND9A 4XJSA 5L3RA 1CJMA 3VHLB 3ZU2A 3VPSA 3KXIA 5A4AA 3C41J 2JIDA 1OLXB 4K7JA 1F6BA 2DY0A 2GFHA 4Y7CA 1QDLB 5JMWA 1F17A 1O6CA 3IKTA 2Y05A 5BUCA 2C98A 4YRZA 5IYZA 3KYBA 3PJRA 2JLSA 1C7RA 1EHCA 1B0ZA 4CTKA 1JDBB 3D9QX 5E6UA 2BP7A 1EFRA 4TQAA 1X2BA 1XA4A 4ZREA 1Q7BA 1G20E 4YP9A 4BNNA 4KIGA 1ZISA 1PDVA 2IYVA 2VHTA 1B1CA 2BUAA 3EF0A 3CPJB 4IVQA 4Q3KA 3U80A 1IUKA 1QQ5A 3TWOA 4EK9A 2HREA 4ZCMA 3OQBA 2A1TS 2CXQA 4PZLA 1D09A 2WD8A 1PSDA 3N6XA 1OLSB 3P9CA 2BHSA 2HSGA 4INPA 4AJLA 1GQYA 2R6FA 2WFMA 4Q3CA 5LKRA 1WDKA 4ZRDA 2Q50A 1EFPA 1D0VA 3HJCA 5KWSA 1FTNA 1X1CA 1YHNA 1SB9A 3BMNA 5AK4A 4ZTZB 2R1TB 4Z86A 1GA6A 5GINE 3AF2A 3AR9A 4LRTB 3DJYA 4ZQHA 1PGNA 4TMKA 2H7XA 4PQYA 1JSLA 1SVUA 3EGXA 3RS9A 2PTGA 3EZGA 1R0ZA 3QYAA 3HXQA 3A26A 3P9ZA 2BLNA 3H1FA 5J3JA 4MRMB 1GAJA 2H5LA 3ICOA 3O8LA 4MVJE 5BW6B 3S99A 4ED9A 2ZJ6A 3DLTA 1NUHA 3AR5A 1MABA 3LC2O 3PNYA 5DXFA 2XITA 5I48A 2F3QA 1L4MA 2Y1OA 3UEOA 1T6ZA 3E0QA 3RG2A 4BQEA 4LTNA 5ES3A 1S01A 4C0LA 3W2GA 1EUQA 4RFVA 4PXYA 5EJMA 3HB4X 2GEUA 1SIOA 4FZ5A 1VI5A 2WJHA 5DWDA 4RSRA 4ZDWA 3VKVA 2VRCD 1BOFA 1F6DA 4IDDA 2PT7A 1XTSA 2C2WA 3ETEA 4HNSA 4L9AA 3UWSA 1O96B 2FJUA 3M81A 5ELLA 2H5IA 1CQXA 4N0EA 4P36A 5K51A 2ZB2A 5TQ2B 5TLSA 4I1RA 2XZOA 2J0SA 4RVUA 3U44B 4RFLA 2BHNA 5J63A 4E5NA 4GVPA 3FJYA 1Z7YA 4RSHA 2ZIFA 5IAEA 4DEVA 5KINB 5KDDA 3NHRA 2HJWA 3AW9A 3FN4A 4I50A 4M49A 2HGZA 2DTEA 3NBFA 1FK8A 3BORA 2B20A 1N3YA 4CCYA 1U9CA 2AMFA 1TO1E 4JQSA 4HF7A 3UN1A 1KK0A 5JBIA 2PVCA 1ZC4A 3ITKA 2HWUA 2JGLA 4HLDA 4RVFA 4L72A 2KM1A 3PD1A 2CYCA 1XBTA 1N1DA 3GA5A 5ENZA 3TTVA 5K7SA 4RTOA 4M9QA 3AFHA 3C7DB 5COQA 4I55B 4EHAA 1W2WB 1I51A 3P94A 3WDLA 4F9GA 1G2QA 2X8LA 3DQPA 3JX9A 2EG9A 2R00C 2FW6A 3JD4A 3ROZA 5JYEA 3KYCA 4MYCA 2ZRLA 3WHPA 4OG2A 4JI5B 4ZEVA 4WY5A 3BBLA 4MQUA 1AUPA 1PZGA 4HPWA 1E64A 4N0DA 3VAYA 1I8TA 1NDUA 5EHIA 2OG1A 4ZOEA 2H2HA 2AK3A 3VSDA 2G09A 3WK8A 4K6OA 3MWYW 5ETJA 1U2QA 2JI4A 2TRSB 3NO4A 4QT4A 3R3HA 2ZBEA 1GQRA 3DOUA 3QJYA 1YZFA 3R6LA 4ZVKA 4LDNA 4D80A 1AKVA 4ETNA 4JI0B 2WW8A 2FR1A 3TAUA 1I30A 2IGTA 1TJPB 2YDXA 2ODPA 4E4TA 3A6FA 3WSVA 3LDFA 1QOPB 4HH1A 4DIEA 1XPOA 4ZIRA 5TPWB 4LXGA 2QU8A 4ZN6A 4LN1A 4PONA 4W7IA 4PBRA 3GFOA 1LV8A 3FNHA 1AKYA 1C9MA 1RM5A 1Q0QA 2O0MA 4N01A 2CXRA 4FZVA 1IZ7A 1C7EA 3D2LA 2GEVA 4DC0A 2EOAA 2VHQA 2WVJA 4DVGA 3J80A 3VJLA 3N76A 2B92A 4AJOA 4IXWA 3SJUA 3QVXA 4GC5A 4B5KA 2ZUUA 1A3CA 1EX7A 2AHRA 1X9HA 2GD2A 4K3VA 5ER9A 1ZI6A 4CETA 2FN3A 4JQYA 1QRSA 3OHPA 4ADSG 2C1XA 3R0QA 4FFOA 3VR3D 1ZGGA 3I9NA 3NIBA 5KYYA 2EERA 3VR4A 3VX3A 2JCBA 2B1JA 1SCAA 4RA9B 1TD1A 1J2RA 1JLRA 1V96A 2VJMB 2ZB3A 1HZZA 1RP1A 1T6XA 2HA3A 2OD9A 4H59A 4UAGA 4XGKA 5EE3A 4D56A 1BGWA 1SFRA 1X7YA 3A4VA 3FNIA 3V1YA 2GMWA 1QGYA 1N6PA 2P62A 1M2HA 2V7GA 5E1OA 1N25A 1UKBA 2I8AA 1W85A 1L7AA 4M1YA 4Q39A 2M6KA 3P9SA 3E70C 1NE2A 2FWRA 4MV6A 3TQFA 1P1JA 3TW8A 5JRJA 5K4HA 4A15A 2BGWA 1STOA 3AV3A 4KXVA 4CG1A 5IM4F 3U3XA 2VP3A 1MAUA 2RC5A 1X87A 3E22A 2EJUA 4JX9A 4CT5A 1U28C 5BV8A 2HMYB 2XBMA 1UR5A 1U63A 1KHHA 1NYQA 2CFSA 2ADMA 1I24A 1N6NA 4KO4S 3SQWA 1R7RA 1F2TB 2BZSA 4WKNA 3S3TA 1PQYA 2QN2A 3UV6A 5AOCA 1GSHA 3G2MA 4DSZA 1F0PA 1PE0A 1PR1A 4EH1A 1J0EA 3TDMA 3E84A 3LUKA 1WMEA 3A3NA 5CIQA 4TLEA 3B36A 4EFKA 5CA1F 3A9VA 2V6JA 3CH5A 5H9VA 3UMGA 2WG1A 2Q1WA 4ZODA 1QH8B 1HYGA 3D3WA 1W6RA 4TV8B 4C76A 2QD3A 1JG1A 2WMDA 2X0IA 4XSVA 4OJNA 1G5HA 2ZRQA 1E60A 4BNVA 3SFZA 1MXHA 1N9KA 7AT1A 2PBLA 5L95A 1LVGA 3J7TA 4MW2A 3ZK7A 1KJIA 2CUNA 4DB4A 4IQFA 2BV3A 3DQQA 3FOAA 3LVBA 4X1IB 3MJRA 1WUJS 1Z4PX 1JIQA 4E2WA 5JNWA 2C5FA 3RRMA 3OM1A 4ER7A 6ABPA 4QTXA 1D03A 1YE5A 1KU0A 4N8SA 2AL7A 1FP4A 1BHO1 4UAVA 1KMIY 5DULA 5I4CA 1E2KA 2Q4EA 5K0EA 2PGOA 1USKA 3Q8WA 4WBNB 3UQYS 4DOMA 1ZUNA 2FEKA 3QSGA 3QLJA 3QVGA 4WZZA 3R7SA 1HQDA 2HMSA 1VDZA 1MMFB 1QSGA 2AW3A 4C43A 1H6CA 5HA5A 5P8WA 4OHBA 4H6VA 5BWLA 2ZI7A 4W82A 4DUYB 3T1YB 2IXTA 1H05A 3H3XA 4RD6A 1AV6A 2AZMA 2V7VA 4FE3A 3CM0A 3F2IA 3I3SR 4OHWA 1Z07A 2HI0A 4CLEA 4EYOA 2GZ1A 4U39A 2GEFA 3Q3JB 4UULA 2I7TA 2EYUA 3COYA 3F1LA 1U0HC 2VA8A 4KWEA 4RPCA 1NUPA 3GEPA 3M6XA 1Q3KA 1M33A 4FN4A 2XOKA 2FX2A 1T25A 1JA1A 1QFJA 2V55B 3CZPA 3Q12A 1ZLXA 4NOMA 1HEYA 1CIPA 1JQ5A 1N2ZA 1QBKC 4MHSA 5E8RA 4AKIA 1UPUA 4UQPA 1HK7A 3CYFA 1P2DA 1DRJA 3GLFE 4JHXA 5HPYB 4DHWA 5KSWB 1KI6B 1AV7A 3M6AA 2PQ2A 3R4CA 4IKPA 3HR4A 3HZZA 1U0NA 1BHJA 2Z30A 3TD2A 5KYWA 2PMEA 2YR0A 2W2KB 4ND5A 4YUZA 1CQJB 2PR7A 3SBXA 3H84A 5CFZA 2R4QA 2CLSA 3SF8B 1Z4IA 3WNVA 4ZMRA 8AT1A 3OBBA 2HHHB 2X7HA 4OQZA 4KJXA 3UATA 4PPYA 4DRXA 1UOPA 5C1DA 2JA1A 3SLRA 2XRYA 5JIBA 2VH5R 5HKOA 2PU7A 1OILA 4D4LA 4Q47A 1B8OA 1QHYA 2NZWA 4MYTA 4PG7A 1C14A 4XE5A 1KH2A 1QH0A 1ENPA 4RF2A 3VKWA 3OP1A 3UXYA 3L8DA 3FBWA 3PA8A 2QW8A 3WFJA 4TMWA 3K9FC 2BEWA 3DDSA 3FOWA 2X6TA 3KJEA 3N8IA 3O0DA 2WUDA 1N2CA 4NCKA 2PY6A 1NM5A 4MR8A 3A2MA 3HCEA 2OLEA 1DPGA 1C4WA 5L6LB 5I7SA 1U7PA 1E1LA 3FIJA 3IPCA 3LH5A 3MTAA 4UNSA 3IH5A 3GG2A 4UVEA 5F5XA 1FIUA 1QH1A 5LU9A 3QTTA 4LWZA 3UUGA 4LRUA 4TZKA 3N5CA 4TV9B 2IPMA 4PBSA 1UJ2A 2CNOA 3H5LA 3TQIA 5IW8A 3BGOS 4HNUA 4ZI2A 1Y9AA 2FZLA 3UAZA 4D3YA 4DQLA 4AJHA 3CUTA 4Q34A 4YAFA 2VK1A 1OLSA 4C1BA 1M7GA 3VSBA 2OCAA 3LCUA 4N9WA 2XQVA 3QEKA 1QHEA 1ZOPA 3CISA 2F64A 3HCNA 1XNQB 2CDRA 3HWSA 5AHOA 5EZYA 3T7KA 4R1QA 1L1FA 5HS4A 4WLOA 2ZBDA 4FCTA 3LX5A 2OB1A 1Y9EA 2BR4A 3GLQA 1MEEA 1W36B 3KB6A 1G63A 2XQKA 1MVLA 2F62A 3HA3A 4L7VA 4TKUB 1Q1ZA 3AUJB 3D0OA 3FTNA 3TBFA 3U4AA 1H4QA 1YI1A 3IJ5A 4R2HA 1F4LA 1ZJYA 1Z6QA 5BNTA 1QGOA 4KH1A 4O4LB 4MRMA 5KJ6A 1B6SA 1WA5A 4MOWA 4KR7A 1N33B 4LAFA 3KQMA 5JECA 1E7MA 4AIIA 4DR2B 1DCKA 3H4IA 3NWPA 1K9VF 5AUOB 2W2LA 1R8YA 1DQPA 1U1FA 4J94A 3KZKA 3TLXA 4G9BA 2C4WA 3RHTA 3ORRA 1G98A 2ZUTA 2ZBRA 6LDHA 4OHMA 3DBRA 3KIPA 1BXZA 2GXUA 3ML1A 3S1SA 3GEGA 1FYFA 1S9DA 1UFVA 4MINA 2V7EA 3KTFA 4DWWA 2ICAA 3PITA 1UF9A 4KN8A 4LYEA 3KPJA 2JLAA 4PYRA 1YZLA 1NXQA 2NUTB 4G25A 4MZDA 4WZBB 1B3RA 4DLYA 5JJKA 4P6VF 1ANKA 1SCIA 2GAAA 2HWKA 1VCMA 5TQ0A 3UK1A 1Z0KA 2V4ZA 4HOYA 1QIDA 4OU5A 1GPJA 4NJEB 3D02A 1ZDMA 1PGQA 1W75A 3KV1A 2XGSA 5FNVF 4R8RA 1ULUA 2XXAA 1BS1A 1KL7A 1CULC 5F2OA 3LUGA 3KQTA 2OCYC 4K87A 1WUKS 5H02A 1MTZA 2XTNA 4L8LA 3QPDA 5JWRA 1YKGA 3K1JA 4CR6A 3TG8A 1QAOA 4JLMA 5JAZA 5IMBA 4BO4A 1U8XX 4BLWA 3BL8A 2GZSA 3E8SA 1CRZA 1T6BY 2PA0A 4QGFA 2CV2A 2PYDA 3H05A 4DCGA 4DLBA 2P2GA 2QG9A 4I1OA 1E8NA 4O0MA 3K6JA 4CTMA 3F5QA 4I55A 2K2WA 2O3SA 3F6EX 4CEHA 1AMUA 1PJ4A 2BMJA 2QTNA 3AFIA 1JEJA 4Y1FA 5G4KB 4YCAA 2YS6A 4MKRA 3TOVA 5KMGB 4LF6B 4BOYA 3H9QA 3OPMA 1T0BA 1GUAA 5FL7D 1JF8A 1U8YA 4ZT4A 5ECDA 5K8UA 1NP6A 3VC2A 1E9AA 1G59A 3WZMA 1LDBA 2GJKA 1MX9A 4RGVA 4RPHA 4EABA 2WVAA 2P2CA 4U7PB 3ZTYA 3OQHA 2XWQA 3UBMA 4E2ZA 3NWEA 1UPAA 4N65A 1SXQA 2OHFA 2HLHA 4U7FA 3KDSE 1KERA 4KVZA 1V8DA 1VSBA 2AN5A 1A9SA 4N6NA 1IWBB 3V34A 4DBVO 2YWGA 1OZGA 1QZXA 4CUZA 1M10A 1TT5A 3UFBA 5GJVC 4HZIA 5G1NA 4DCVA 1PS9A 2ZTLA 4KMMA 1II8A 1Z4QA 1W2HA 3CUVA 1TCUA 2YQ5A 5C3MA 3CUWA 5KC9A 3DGEC 1XCLA 3V42A 1OYYA 3HB5X 1QIKA 4H1HA 3CEJA 4D4GA 2E4WA 1PNTA 1DHRA 1SR8A 3M9LA 3ND5A 3S4YA 5IDWA 1CEYA 3WL8A 3CH4B 3DGFC 3BJRA 1NVEA 1T3ZA 2BGKA 4CEJA 3KUCA 5DIZA 3C98A 4Q9AA 4M8SA 4F4JA 4YRGA 1OB2A 1KVRA 3ZTTA 4PR0A 3UUEA 4E2XA 3OSUA 1D0SA 3PHGA 4DL9A 1O95A 2OV3A 2OYSA 3IOYA 5HQ3A 5CYPA 2W6JD 3GLGB 2JKYA 4ZT6A 1CE8B 1D7OA 1VG9B 3KT6A 3OQIA 4M83A 3WV4A 5IDXA 1OXXK 4MQMA 2P2LA 3GPDG 2LTAA 1C8LA 4B32A 4G5QA 5KYYB 5ERYA 3FTQA 3DV9A 1UBRS 2PZBA 4FYMA 1NMXA 5JAMA 4ND2A 4CI0B 3PLNA 4LYGA 4W1QA 2QX6A 4DBZA 1OX6A 2VJMA 4MS1A 1Z0UA 3LW7A 4F4DA 2XNJA 3LVQE 3OWXA 1LPBB 1WG8A 1YIOA 1ZK3A 2FR8A 3G5AA 1RBQA 2BM9A 1MIOB 4LXUA 1TCBA 4S12A 3HKEA 2HN9A 2Z95A 1L4BA 5AQ1A 3TW8B 1NONA 3RUEA 3Q3CA 3BREA 3BRQA 4N40A 2D6FA 3ZU3A 1T2FA 3O4FA 4KO1S 1Z7EA 3A37A 4A91A 4UARA 4EGAA 3ZG6A 1TAHA 1ZCJA 4XWKA 2E6KA 1RLUA 3Q7QA 3RTGA 1YIDA 1SOUA 4BFUA 5I7AA 1W88A 4HDSB 1QC5A 2A0UA 5LBUA 1F2TA 2Q2QA 1HQYE 3IPRA 5IK2A 4O4LF 2QQGA 4EMSA 4J6EA 5D8DA 5DX1A 4QYXA 3M6VA 3MGCA 1HURA 5K01A 1G1MA 1W19A 1L4UA 2IZ0A 3L6RA 1NR1A 3JZDA 3L9WA 4P4GA 5TARA 3F3SA 1TYEB 4EHNA 3ZK9A 1T24A 2C83A 4QDKA 3WY9A 1IAVA 1QG2A 5FTLA 3MYRA 3VU3A 2CZGA 1DNPA 4TWIA 3INNA 3LI2A 4IIJF 1IN6A 4BJ6A 2YS7A 5FUXA 1YJ5A 4X1IA 1O5OA 2MINA 1HMYA 2YXEA 2EBFX 4GEKA 5DBGA 4EELA 1Q0LA 4QG3A 5H3CA 1KEWA 1E2JA 4LJ9A 2M2IA 3IUSA 1V3UA 4NCHA 1US8A 4H7DA 5I4BA 2H54A 4RU1A 1SXIA 3HBNA 4DSUA 1NJGA 3LYHA 2H92A 3PFFA 2Y93A 2RHGB 4MWOA 1OBHA 4GXNA 2DPXA 5CCEA 3F5FA 4LC9A 4C2BA 2BRUA 3EY4A 1GUYA 3OTIA 2EZ8A 3KSZO 4CODB 3EFHA 3F6CA 1KTIA 4ZKDA 2YQ4A 3S44A 4CEIA 1MZPA 1Z47A 2V7TA 4Z8XA 4Z3KA 1MPTA 2M6RA 3MTIA 4F04A 1TM7E 4GH5A 1SOWA 1N8TA 1XD2A 2O7RA 2CHEA 3AFOA 3DKVA 4KFRA 1IJEA 5BV0A 6ADHA 1B0AA 1ISIA 2C7QA 4HUJA 1P44A 2OGWA 1M8FA 1LNSA 4MV1A 1XF9A 3BH0A 5IXJA 2QLBA 3HU2A 4V2UA 3RJ9A 4YCCA 1XZIA 1YCGA 1DELA 2ILTA 4FEEA 4ZZIA 5CDTA 4F4HA 3KEOA 1XTVA 3LUJA 4ZCPA 4YJ2A 2PL3A 3BE4A 4HAUA 4G8BA 5DCLA 1A8HA 1ZUD1 3WXBA 3CR3C 3TNYA 4PYKA 1CFZA 3PQCA 3Q0IA 3THRA 2L69A 3W3AD 1XNRB 4X0EA 1YB4A 5ADUS 1IPEA 1FXWA 2W2KA 2NU9B 2UXDB 4A0GA 4X85A 1SXPA 4WXMA 2FCAA 5B3JA 1T8PA 1JX6A 4TWAA 5HM6A 1W0KA 4MEBA 2Y99A 1L4LA 5IYZF 2PPVA 3ITDA 1NNI1 1XZMA 3SYRA 3VYTB 5JD5A 3LUPA 3OE1A 2O54A 1E1NA 2GN9A 3BGIA 4X8MA 3VDXA 1NVMB 1ZGBA 1U7OA 1PO7A 3CZAA 5D6OA 1EK5A 5D01A 4OI2A 4B43A 4BMDA 3MIZA 2RDMA 1W0KD 1EWQA 1P5FA 1PL8A 3OCJA 3KKLA 1ODJA 4A2CA 1QJCA 4JB8A 4RNDB 4C01A 2WWWA 2J87A 3FSJX 3G1TA 3JYHA 5JSUA 2VTBA 3U60B 4R2JA 3ECCA 1B4DA 2LD4A 1YS6A 1E2FA 2Q6KA 4R8MA 2BUCA 3DEKA 3R8FA 1QE3A 3O1IC 1Z8FA 4HDOB 2EWWA 3TZ6A 3UT5B 2UUPA 4AW9A 3EDQA 3MWLA 4F3RA 5K0ZA 3PFKA 2HQSA 3KBOA 5IAGA 1GKUB 3I64A 4Q0MA 5PGMA 2I2DA 4FMDF 1NMZA 4YUWA 3C48A 3IBCA 1B00A 4JVNA 2P1RA 1QWSA 3O31A 3DE2X 1K2WA 4KQHA 4XQ0A 3OMLA 1M0TA 2EP8A 4MNTA 1JIJA 1IOLA 2DC1A 3ICPA 5LA6A 2IT1A 3F1KA 4NBRA 1DQZA 5AHKA 2FZCA 1U7DA 3BB3A 3RLIA 3L0PA 3W90A 4LMAA 1O97D 1NR7A 4X7MA 1JKIA 2OL4A 5DI9A 2VQSA 4F2GA 1NM5C 2BJHA 3ELUA 5EZYB 4C0QC 2MSLA 3W78A 3IHTA 4R98A 2FRDC 3ZE8A 5ICEA 1D4OA 2GVZC 3EC2A 1G2OA 3R7LA 1PT9A 3RSFA 3HY6A 5FOVA 1I1QB 2E1PA 3WAJA 1K5HA 1BO6A 1L5NA 4TVBA 1IZYA 1RXCA 1KKLA 1HRDA 2B3DA 3RT7A 2Q1UA 4F8YA 5C8YA 5BN5A 1RYFA 4L3OA 5IUNC 2WG2A 4AK9A 3KQHA 2PE5A 2WWFA 3LLUA 4UE3S 4CKEB 1PFYA 1MOQA 5TXGA 4F86A 1QO9A 2NT4A 5F3DA 4Z4CA 2VOEA 1JEOA 2BGLA 4B71A 3AWDA 1XDDA 1EFRD 3O91A 4RHCA 5KSPA 1GVNB 3FLMA 1IMJA 1U1CA 1X9GA 1QGUA 5H4GA 3H0EA 4LTDA 3GQBA 1J23A 4NZNA 3ZKAA 2G4LA 1EM6A 1ZD3A 4J1TA 2WZDA 5AKGA 1TM3E 1YZTA 2BZGA 1DRWA 2YX1A 3ET5A 5FBVB 1RWWA 5JXGA 2V8OA 1J42A 1IY9A 2O48X 5BSKA 3HHPA 1PQ4A 1BS2A 4L76A 3TL6A 3BB4A 1VE5A 4QFCA 2VAMA 5A4IS 1CB7A 1KNXA 3G2KA 2UYQA 4RVHA 4CNBA 3OCVA 4EL0A 4MO9A 3UJCA 3SS8A 5EFOA 4DY4A 1GPLA 2QT0A 1XCMA 4CXMA 4I6EA 4UZSA 1KBZA 2Q5IA 5KSZA 4HH0A 4EG3A 4Z7JA 4ZZ3A 5KQGA 3L7IA 2E0IA 3DMHA 3FETA 2P41A 3AHFA 4RLFA 1LQ2A 3OIYA 4G0WA 1PUIA 2ZIVB 1WZEA 3S70A 2WHRA 1SXJE 4JI6B 3RUCA 2JS7A 2OB2A 4QDZA 1S2MA 3MAGA 4RJ2A 1KYTA 2AT1A 3CLUD 4QQKA 2H31A 4QTUB 3R76A 1L4GA 2PRSA 1Z35A 3BWDD 2ZSBA 3U6BA 1SCDA 2C42A 2BGUA 5EKXA 3JQ8B 5A02A 3GT3A 1NBIA 1TW2A 3HEAA 3IP7A 2B36A 3QY9A 3FMVA 1A9RA 5I9BA 1G18A 5GZ1A 2WJAA 3TRDA 4KITB 1Y7HA 4FNOA 4DDTA 1XK6A 1ZYUA 1ZH8A 3ILVA 5FKJA 4V0KA 5AUNB 1LJ8A 3WZ2A 2WSSD 2NLOA 4NYJQ 1OLUA 3CJTA 2FK7A 3LVRE 1YMVA 3L79A 4K9MA 1PV2A 4F45A 3ZX4A 4G5XA 3T52A 1F1BA 4IJ5A 1DT5A 1JEDA 1XCJA 5JE8A 3WFIA 3LHKA 3I83A 5A7FA 2WUEA 2IITA 3IDZA 2WA1A 4YCLA 4QEZA 5B3AA 1PQUA 1T9BA 1J8QA 1YQXA 2Z5GA 4XZ3A 1P4AA 3TMKA 4GP9A 3OPYI 3DHNA 4HD8A 2VDWB 3KPWA 1VLZA 5K1ZA 4JASB 1F2VA 1XWWA 5DT2A 3EOZA 3TFWA 1GUBA 4LC1A 4IM7A 1IBKB 5IMSA 1DO2A 4ZVUA 4LECA 3ZEAA 2H4HA 1RJFA 4P53A 5KTPA 3I5AA 1FSZA 1ZQ1A 2CVZA 3R23A 4IUYA 4BP9A 3HE3A 3NP9A 1K8RA 3PU6A 3SK0A 3LCMA 3K16A 4EVIA 1L9KA 1RW4A 3GLGA 1UM9B 5E3JA 3RYHB 3C43A 4XWOA 3RU9A 1CDZA 4D6YA 1ULZA 2KWIA 2WSMA 4MI1A 3SC2A 5E2IA 4XUCA 3TOCA 4CN8A 5F9MA 3D7LA 4YXWD 2NV2B 3I09A 3GNSA 4TSKA 3MCWA 5FL7A 3GWZA 1H6AA 1UJBA 4Y0VA 4LFBB 1CNMA 3O2JA 5CDGA 1C7FA 5FTWA 2RAPA 2GJ8A 5FV7A 4DVJA 4EA8A 1U0OC 1FBNA 1QIGA 3CG4A 4BV3A 1T9GS 4KNWA 5LXTA 1RRFA 3HKEB 4JI2B 3QPVA 5IBPA 1Z4LA 4LXIA 3GEBA 3ROGA 1YRLA 4BBPA 4TYQA 1Y89A 3VNRA 3A8TA 3I45A 2CW5A 4RWZA 2ATVA 3SNKA 3UB3A 3UPDA 1DUIA 2ZGVA 4GX5A 4PQFA 4JJZA 2WU8A 2BF7A 3UWMA 3RBAA 3V3KA 1HL7A 4HHEA 3DKIA 1O9HA 1U2RA 4UEKA 2CVQA 4BLUA 1QOQB 2D00A 4P3NA 3PQ6A 1E59A 3HS3A 4UUOA 4HDSA 4D25A 3ZHQA 3AH8A 4PC3A 1MVNA 3NBMA 3PHCA 2Z08A 3ZH9B 1PLKA 2I6SA 1WD7A 4RSMA 2LGJA 3UAXA 1CLUA 4MR7A 1GR0A 3DL4A 5HRAA 2FPIA 3JD2A 2DEUA 3K5IA 5LCXA 4CM5A 1WF6A 1E0KA 4QHSA 5BW5A 5A03A 1EEHA 2RAFA 2OAP1 3BWXA 4J9VA 5AOVA 3ZWNA 4WK4B 2X2FA 4XIFA 3H86A 4LGYA 3O47A 2B8TA 4YT4A 2VHVA 1C2TA 2O06A 2YC2C 2OXRA 2UZIR 1OCEA 4WECA 5DI3A 1XTJA 4DSOA 4WGFA 4Q6WA 3WP1B 3P2IA 4LS3A 1Y7TA 5K0FA 2D8MA 4AWBA 1GSIA 1NV9A 2ZAIA 4Y18A 3RHZA 5F35A 3BRWD 5TEVA 2R8XA 1D2EA 5J5AA 2I8LA 5JT1A 2FN7A 4CFYA 2VPQA 2OO5C 3M4XA 4RETA 3TNJA 3L06A 5BPHA 4B35A 3GLKA 3GFPA 3L3BA 2HA6A 3HB0A 3IHLA 4UZEA 1FEZA 3U7QB 2WTBA 4UMDA 3AF6A 3RIYA 1TL7C 1J2UA 2AC4A 3CW8X 2B7BA 3KKEA 3KNZA 4R2IA 3ZW9A 3PHLA 1TAQA 1FP6A 2QP4A 4ZI7F 2IU4A 2V7PA 3VMFA 1U94A 3OKAA 1NY6A 4CEIB 1M0EA 1XTZA 1L8OA 1WKBA 1Q7CA 3DDUA 3UXHA 4ZJZA 1RWXA 4E32A 2P3SA 5I7FA 4DIOA 4URXR 4LF9B 1HE3A 3NUZA 1XZ8A 4Y9RA 4DV4B 3A1WA 3LWBA 1DJLA 1NURA 4QZVA 5CCBA 4V0RA 2YV4A 4DA6A 3OTOB 3COJA 2ZVJA 4DMLA 2O3QA 1XYYA 1DKPA 4KFUA 4PC1A 3LBIA 4RESA 5HF9A 1X1QA 4YV0A 1ULSA 5AKJA 4FMPA 1BX1A 2G1UA 2ATEA 3RSQA 2P0YA 4ZDKA 4I9UA 2B7CA 4IF6A 3IE0A 5ER6A 4MCHA 2NU9A 4MEAA 1QIIA 1VPEA 2MR6A 3MQ4A 1AMOA 3FFXA 1UODA 3QIAA 1WSAA 2NU6B 2V65A 3ILXA 3BQ9A 2ODTX 1T5BA 3HWX1 3A11A 3I1FA 4FR2A 4MGHA 1QRUA 2VSQA 1YR1A 1PFGA 3GHHA