1CLEA

Structure of uncomplexed and linoleate-bound candida cylindracea cholesterol esterase
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
534
structure length
534
Chain Sequence
b'APTAKLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLNGQKFTSYGPSCMQQNPEGTFEENLGKTALDLVMQSKVFQAVLPQSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEIGSPTIFPPAQMVTKSVLMGKPIIHVAVNYRVASWGFLAGDDIKAEGSGNAGLKDQRLGMQWVADNIAGFGGDPSKVTIFGESAGSMSVLCHLIWNDGDNTYKGKPLFRAGIMQSGAMVPSDPVDGTYGNEIYDLFVSSAGCGSASDKLACLRSASSDTLLDATNNTPGFLAYSSLRLSYLPRPDGKNITDDMYKLVRDGKYASVPVIIGDQNDEGTVFGLSSLNVTTNAQARAYFKQSFIHASDAEIDTLMAAYPQDITQGSPFDTGIFNAITPQFKRISAVLGDLAFIHARRYFLNHFQGGTKYSFLSKQLSGLPIMGTFHANDIVWQDYLLGSGSVIYNNAFIAFATDLDPNTAGLLVNWPKYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALMTNPSSFFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHOLESTEROL ESTERASE
molecule tags Lipase
publication title Structure of uncomplexed and linoleate-bound Candida cylindracea cholesterol esterase.
pubmed doi rcsb
total genus 187
structure length 534
sequence length 534
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1995-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cleA00
3QBJA 5HF8A 5ALEA 1SFRA 4ITVA 4AXBA 5BWBA 5ALFA 1I6WA 1HDEA 4IQ4A 1VKHA 2K2QB 1VE6A 3AIKA 5LLSA 1QIJA 4GDMA 1DTEA 3IULA 4LIPD 4P9NA 1EK2A 5J3JA 1UXOA 5HFAA 5LZ8A 5FP0A 3RARA 4TGLA 1LPAB 5D6OA 1GGVA 3ZI7A 3ZLTA 3WKCA 5BWCA 4G8CA 2XQKA 3W05A 2ECFA 4DNQA 2HRRA 1CUIA 2HU8A 5AM1A 2JIDA 2VJAA 3D2BA 4YK7A 2OG1A 2VAVA 2QT9A 3K6KA 5YASA 3TEJA 3BWXA 2BJHA 1TKRA 3QPCA 1MNAA 1YR2A 4BDSA 5HF9A 5F4ZA 1YASA 3I2JA 5CURA 4QDOA 1H2YA 4P92A 2P8SA 3PFCA 5EIHA 4Y7DA 3BJRA 2QRUA 3R3ZA 1WOMA 4G8BA 4O08A 2I78A 4UHEA 3WKAA 2UZ0A 3C6BA 1MAAA 3WJ2A 3KSRA 5CT6A 3L1JA 5KREA 2YASA 2WIDA 2FX5A 3DYIA 4BAGA 2XUKA 3KDAA 5K5EA 3H0CA 4TPKA 2GYWA 2OGTA 2XQIA 5CH5A 2Y2VA 4EBBA 1CUBA 4EHBA 3RM3A 5IH7A 4OPMA 3M3DA 3WIBA 4QWWA 1PJAA 2Z3WA 1RP1A 3YASA 3CN9A 2PU5A 1BU8A 3FSGA 1U8EA 3I2KA 4G9EA 1EA5A 4IH1A 1QLWA 2WFLB 4H7IA 4FFWA 2B20A 3DD5A 1EXWA 2XUGA 5C8VA 1WB4A 2ZYIA 5ALOA 2RHWA 1S8OA 1U4NA 2DCMA 4GW3A 1CUCA 3W9BA 4GWLA 1XZFA 2VT7A 5ALXA 1DWPA 1JMYA 4J0DA 5AI9A 4C01A 1QTRA 1FJ2A 1O6FA 1GPLA 1F6WA 4QWMA 1A8SA 1MJ5A 3WIOA 1R3DA 5LIPA 2CJPA 4YX9A 4WDRA 2G63A 5LZ5A 5K3DA 5A71A 1JI3A 3SWWA 3W9UA 3A6ZA 4J0KA 3C6YA 4L9AA 4MQMA 2WU4A 2EDCA 1QTIA 4KE9A 2JF0A 3VJMA 2Q0XA 3MUNA 1WB5A 1XZAA 1LPSA 4W1RA 5FUMA 4FWBA 3JWEA 1YA4A 4U2CA 4MYDA 3E4DA 4OSEA 1C7IA 2J4CA 1LPPA 5AM4A 3H17A 2PVSA 1G66A 5CT4A 1LLFA 1H2XA 5I7UA 4AX4A 1BRTA 2W6CX 3WYNA 5AKXA 5ALQA 1Y37A 3C6ZA 3R41A 5ALVA 1XRMA 1XFDA 2PSHA 3QMMA 4ROTA 4ZI5A 4EUSA 2OGZA 3GA7A 1XRNA 3G8YA 2BUBA 2Z8XA 4X71A 3I1IA 3BE8A 4B85A 2GYUA 3TGLA 4MWSA 1LNSA 5DTJA 1QIFA 1K5PA 2HM7A 1NU8A 4ZXFA 3FOBA 2WUGA 3C70A 3LLCA 1VJ5A 4NVRA 1D07A 3C8HA 3WMRA 3AJAA 5ALGA 3HSSA 1ORVA 4OB7A 4WFIA 3F96A 2HA6A 4Y2RA 2CZQA 1G4HA 2V9ZA 3KWFA 4FHZA 3WQHA 4Q3KA 3A2LA 4UHDA 1G42A 2GZSA 4AB1A 1UK9A 2VEOA 4UBJA 2OAEA 1XKLA 4HVTA 3KXPA 4OCZA 1WHTA 1CFJA 5C8ZA 3FLAA 5AKKA 1F0NA 4IH9A 2QUAA 3LIPA 3WLAA 3QVMA 4OB6A 5HF6A 1QIIA 5ESRA 4F21A 3S2ZA 1THTA 3SC2A 3DQZA 3CXUA 4CG3A 5AP9A 3FVTA 4PNZA 4UFOA 3FSGD 1CUFA 1PV1A 2XMGA 4JNCA 4KYVA 2WSLA 4RE5A 2QOEA 1R9NA 3Q0TA 2O2HA 1W1IA 2PSFA 5JYCA 5D3KA 1TCBA 2CMFA 4BYMA 2ONCA 3FYUB 5JASA 4QEKA 2D5LA 1LPBB 3WL8A 3DYVA 1HPLA 4A23A 3BL8A 1BN6A 1K4YA 3A2MA 3UUFA 4UBNA 1DWOA 2RI6A 3IDAA 4K5QA 5HK8A 3ZLVA 4OD0A 5HQ3A 3F98A 3WWPA 3TJMA 4H7JA 1XZKA 1QIDA 3I6YA 3JYHA 3FLEA 3I6ZA 2EDAA 1E3QA 2LIPA 1Q0RA 4B84A 4ZV7A 4ETWA 4C4ZA 4M0MA 1VA5A 1TK3A 3QM1A 1BEZA 5K3FB 2XQJA 3V1MA 4C4XA 5AK3A 4I19A 4C4YA 3WA7A 5ALYA 4PV7A 4Y9SA 4JUIA 5EIEA 2VA9A 1XQXA 2XDWA 3OC0A 3AZOA 2HU7A 3C45A 4GHWA 2XUDA 2XI4A 5FDFA 4L3WA 4Q3LA 3VJLA 4BTVA 5CH3A 5K3FA 3IURA 3O9VA 3FYUC 4N8EA 1XQVA 5T4EA 1FFDA 1EVEA 4B9AA 1CPYA 5EIAA 4CCYB 5AI5A 1XZGA 2WUFA 3DKRA 4V2IA 4W1QA 4L0CA 4AZ3A 4KE6A 2HU5A 4G8DA 1AX9A 3STXA 4K2AA 4JYPA 4WFKA 3HLKA 2WFLA 4DTCA 2Y2UA 2PSDA 4Q3OA 5JATA 1TCAA 1LPMA 4KACA 4TVKA 1XZJA 5KWIA 1AQLA 2ZYHA 4BRSA 1GXSA 4E46A 2OAGA 4MYSA 2H7CA 4X92A 2IIVA 1A8QA 3O4IA 2XLBA 5CW2A 2H9YA 2Z8ZA 1B41A 3G9ZA 1CUWA 1DINA 2XMDA 3D4LA 4X90A 5E2IA 4AMZA 3QMWA 4UFPA 7YASA 2VF2A 3WK7A 4QE3A 1ZI8A 5AH0A 5BOVA 4WDQA 3N2ZB 1DU4A 4W1SA 4GI1A 3KWJA 5LZ7A 4K6HA 1HL7A 3FNBA 2BFNA 3V48A 2QTBA 4FNMA 1E8MA 4XX1A 3OTQA 1K8QA 4ZREA 3ICVA 3G0IA 4C87A 2YXPX 4Y2JA 5AIAA 3IUMA 2HFJA 1CUXA 5AM2A 2QM0A 1ZD2P 3AZQA 1JU4A 2GYVA 3VDXA 3EQ8A 1QIKA 3D2AA 3PDCA 1JMKC 2FUKA 4A16A 3NWOA 5ALUA 1DQYA 3WL6A 2XUOA 5E4YA 3AINA 4FBLA 4X91A 5ISMA 1XZCA 4U2EA 4BE4A 4KAAA 2I3DA 5AOBA 4BTLA 3DCNA 2X8BA 3WL5A 2HA7A 1C4XA 2E3JA 5A2GA 3C5WP 1Q83A 2CEKA 3G02A 5ALDA 4BVLA 1R50A 4EY8A 5CXUA 5EHXA 1YSCA 5DYYA 3WKBA 4X85A 4U2BA 4UHBA 5EHQA 2H7XA 4UBOA 2WHQA 3G0CA 4LYDA 4DNOA 5ALTA 5CXXA 2HADA 5LKRA 4INZA 5AI8A 4AN0A 2BGNA 4FKBA 3I6MA 4DGQA 3V1KA 4LXGA 5AK5A 3WZLA 4PF1A 2JEZA 1CQWA 2XMBA 4GBGA 2AJBA 1H22A 4DSZA 2QKYA 4GXNA 1R4ZA 2JGMA 4BC1A 2XMZA 1YB6A 3IUJA 4EY4A 4OYLA 4F60A 1QONA 4HRXA 4L72A 1XZBA 2PL5A 4EY6A 5T4FA 4H18A 3FCXA 2G5PA 3GUUA 1VXRA 2QXTA 5AK4A 4OYYA 2OCIA 5HKBA 2WU3A 5C81A 5T4BA 5JAOA 2QMQA 3U0VA 4BP8A 1XRLA 4FBMA 1HQDA 4BP9A 5IKXA 4OU5A 4KRXA 3OG9A 4UHFA 1QJ4A 1BCSA 3G0BA 1L7AA 1PFQA 3AILA 3C43A 1HBJA 1H2ZA 5C8XA 3T52A 2XMCA 1UKAA 3GBSA 4KRYA 4F0JA 1BROA 4Y2QA 5A7FA 2GBGA 3X3HA 2R11A 2C0QA 2QS9A 1ACJA 1XZLA 5HKAA 1CVLA 2IITA 3DOIA 4QDUA 5AKHA 3BXPA 1U2EA 1TAHA 3R3YA 2R8BA 4MWTA 1THGA 2HA0A 4PSCA 2B4KA 4X97A 4K6GA 3RK4A 3WKEA 1XKTA 2B61A 1GZ7A 3OURA 2VJCA 1CUHA 1MN6A 5JIBA 3DEAA 2VJDA 3ANTA 5FPQA 3DL4A 4J0IA 4B9EA 5AKYA 1MPXA 1L7QA 1R1DA 1UK6A 2J3DA 3FCYA 2WIJA 4FTWA 1CQZA 1HKHA 1RYYA 1W6RA 2H7YA 3PE6A 1YB7A 3VVLA 1SCQA 4MXDA 4B0PA 3PUHA 1QE3A 2VAXA 4X6UA 1CRLA 2H1IA 3H2GA 5JZBA 3QPDA 1IMJA 2Y6UA 4MEBA 1C7JA 5AKEA 5EHNA 3F97A 4GEGA 4QZVA 3O95A 3GZJA 3BIWA 3UMJA 4E14A 1VLQA 4UBLA 2ORYA 2ZYRA 1ZI6A 2OLEA 4FLEA 1ZI9A 5HK9A 5AHXA 4BAUA 3IBTA 5JZSA 1W75A 4FLFA 4DNFA 1FFBA 3E1GA 3O0DA 2RIPA 1XZMA 3E0XA 1FFAA 3VXKA 3HC7A 4HXEB 3BIXA 4X6XA 5DNWA 3M81A 3G9UA 1RWQA 1AKNA 3A70A 1TQHA 2XQGA 1E5TA 4X93A 3C8DA 5DLPA 5ALHA 3HYSA 1FFCA 4H0CA 2XB6A 3ZV7A 1H23A 4YPVA 4W1PA 4WY8A 1AZWA 4OUKX 4NZZA 2XUIA 3LP5A 4CIAA 5JARA 2C58A 1ODCA 2RHTA 1J2EA 2OCKA 2JGLA 4ZGBA 1EB9A 4ARAA 4QLAA 1NU6A 5E4TA 1TRHA 1EHYA 1XQYA 4G4JA 2OGSA 2ACEA 2QR5A 1CR6A 4XVCA 5DWDA 2OXEA 2D0DA 3LCRA 3M82A 4H77A 2QXUA 1CUYA 3VISA 5DTIA 2EEPA 1A88A 3G7NA 4WFJA 3BDIA 3V9AA 1CLEA 3DJYA 3ESAA 4JEIA 1ZJ5A 3D0KA 1YCDA 3O4HA 3K9BA 6YASA 2Y1KA 1AUOA 3A2NA 1N5MA 4MJ3A 5JAPA 3H04A 3L1HA 5AI0A 4H35A 1IVYA 1CUDA 1VA4A 2XMSA 3DNMA 4CCYA 4M0EA 1CUGA 1ZIYA 2PUJA 5HCUA 4BRZA 2NW6A 3DOHA 5JD4A 3WK4A 4EA6A 5DYTA 2O7VA 3VKFA 4AO8A 3F8SA 3KOOA 3ESCA 2FJPA 4PQEA 1K63A 2PKYX 4J3JA 4Y2YA 5ALLA 4K6KA 3HABA 2QJRA 5AM0A 3D2CA 3R3VA 1SOMA 1H2WA 1WPXA 4QA9A 2AJDA 3WK9A 2WIGA 4U2DA 4HXGA 3WK8A 4UFNA 2VSQA 5ALMA 2ZVDA 5AO9A 2WQZA 3C6XA 1E8DA 2GBIA 4BCDA 4J0JA 1MX9A 5A62A 1W52X 1G5FA 2XT0A 4HRYA 1EDEA 5AI4A 1QOZA 3TRDA 3W2TA 4D9JA 2HA5A 1Q84A 4UUQA 5JAUA 4BZZA 2HIHA 4J03A 2FJ0A 2RONA 4M0FA 1CUVA 5FOQA 4UBIA 4N5IX 3AIMA 2WFMA 3FYUA 2WFZA 3SK0A 2BKLA 4W63A 3WWDA 3NOXA 2J4FA 5AICA 3EQ9A 2PM8A 2QZPA 3OM8A 2DSNA 3M83A 2DQYA 1CEXA 4BB0A 5LYYA 2X76A 1BN7A 2XE4A 1WCYA 4JYMA 4JH0A 4Z49A 3O9MA 1CV2A 4N8SA 4OU4A 4B81A 4HXFB 2WHPB 5T4HA 1N8SA 1EDBA 3I1YA 1J1IA 2WILA 4BBZA 2CUTA 5K3CA 1JFRA 1Y7HA 2VT6A 5AKZA 4BC0A 1LZLA 1E89A 3H19A 2J3QA 5K3EA 4XIIA 2JEYA 4H7DA 4WCVA 4G4GA 1CUEA 2XQFA 3B12A 3F67A 2IX9A 5AK6A 1LBTA 3WYDA 1AMNA 4Q82A 2WHPA 3QH4A 4X94A 3QPAA 1BS9A 2C5FA 4LHEA 5CT8A 4CI9A 4E15A 1VE7A 3UUEA 1QIHA 2OCGA 5KBYA 3WWOA 3WK6A 1MAHA 2GZRA 5AKLA 3NUZA 5SYMA 1J06A 2AJCA 5A7HA 2BAGA 1GKKA 3R3WA 1VZ3A 4BATA 5ALKA 4X7BA 4F5ZA 1YS1X 2CB9A 5ALSA 1LPOA 3LIIA 4IHAA 3WWEA 1DT3A 3GFFA 4HZGA 3IB3A 1VZ2A 5IVKA 4Q1VA 2C7BA 1AURA 1EH5A 4RE6A 2WIFA 2AXEA 2WJ3A 2ES4A 3I2IA 5K3BA 1SC9A 1ZOIA 5EGNA 4QLOA 1ZGBA 2PUHA 2ZJFA 3ZPXA 3FAKA 3RLIA 3W04A 5CTAA 2Z5GA 4Y2TA 5IVHA 2VJBA 2PX6A 3Q8WA 2XUPA 3WWCA 5JADA 1MO2A 2WG0A 4EZIA 4KR0A 1JJBA 2WM2A 5HF5A 4UHHA 3IUQA 5IVDA 5AOCA 2WHRA 1P0MA 5JAHA 2PPLA 5DYWA 1QIMA 4XWGA 4AMYA 1P0IA 3CCCA 1AC5A 1ZIXA 1MX5A 2HL6A 2HRQA 2WTMA 3G9XA 1EVQA 3I2GA 5ALPA 1F0PA 3STTA 1JKMA 4CG1A 4G1FA 2Z3ZA 3I2HA 1A7UA 1UKCA 4BE9A 1EB8A 5ALNA 1XZIA 4J7AA 4GECA 3U1TA 5AM3A 1A8UA 2ROQA 3IVMA 1JJIA 5I9IA 5FV4A 3O4JA 3R0VA 2V98A 4MEAA 1MNQA 3ZLUA 5D3ZA 3HZOA 3C87A 1X70A 5HZGA 1IUNA 4I4CA 4GLBA 4WJLA 1N1MA 1ISPA 3PICA 5AKIA 3DDUA 1DT5A 2OQVA 2XMRA 2JGKA 2WJ6A 2ZJ7A 1R9MA 4LKOA 4LYEA 4PO3X 1AGYA 4Y2PA 4I3FA 2CBGA 4RNCA 4KE7A 1ZD5A 4AO7A 1E66A 1FFEA 4G4IA 4FMPA 2YYSA 3WL7A 2RAUA 1QGED 1JU3A 1OILA 1UK8A 4AZ0A 1JT2A 3H1AA 5EHZA 2V97A 3FVRA 4PSDA 3CCBA 4H7EA 2WG2A 4B7ZA 2PSJA 2JBWA 5AJHA 5K3AA 5JD5A 3BF7A 3V1NA 3FBWA 4Y2VA 3D3NA 4P93A 3K2IA 1ZGCA 3GROA 1N5RA 3R3XA 4DMFA 3I2FA 1UOOA 5FLKA 3ANSA 1QIGA 2HHAA 1LZKA 1VOTA 1GQRA 2O2IA 4G5XA 4KEAA 3FLBA 1E8NA 3WKDA 1XLVA 5LZ2A 1IUPA 4ZWNA 5HQ3B 3STUA 3PFBA 2XUHA 1LBSA 3RKSA 1QZ3A 3HACA 4BCBA 2C4HA 5JANA 3BF8A 1ZICA 4UBMA 3EBLA 1EDDA 1CUZA 5LZ4A 4KAFA 5FPPA 5DNUA 3W06A 1JJFA 1EK1A 1XQWA 4BVKA 5C7YA 2I03A 4AO6A 1QO7A 1P0QA 3AUKA 5E4JA 1TCCA 2GBCA 5EFZA 2OQIA 1UT6A 2GBFA 3DLTA 3G0GA 4OB8A 1BEEA 5CH8A 2WKWA 3AIOA 3R40A 4CG2A 1ZD4A 1WPRA 4EY7A 3DS8A 2JGFA 4YASA 5ALJA 1KU6A 2ZJ6A 2XUAA 4C6HA 4J0HA 3PF8A 5CMLA 2HA4A 4Q34A 5FXMA 3GELA 2O7RA 3ZWQA 2ZYSA 5BV7A 5AIBA 1MT3A 2PSEA 3ICWA 4MQLA 1CUAA 4ZV9A 4LXHA 4DMCA 3H2KA 3VVMA 4X95A 1QIEA 1DX6A 3HRHA 1YA8A 1ORWA 1UK7A 4B80A 5DNVA 2WUDA 5KWJA 2PBLA 3H2IA 1W4LA 1OCEA 3IIIA 2DHDA 4X00A 5LP1A 2B9VA 3SX4A 5AKGA 5AI6A 3HJUA 4PW0A 3WZMA 1XZDA 2XUQA 1SCKA 5AM5A 1O6GA 1UZAA 1CIJA 1GPNA 4PSUA 2WUEA 1YS2X 3NGMA 4G9GA 1ETHA 2QJWA 3DKKA 4DSAA 3O4GA 4B6GA 5AOAA 4DMHA 5D7BA 3JW8A 4KAJA 2BUCA 3EF3A 1UFOA 1W76A 3G0DA 1KEZA 2C0PA 1QO9A 5AKJA 2QUBA 3V1LA 1VXOA 4ZRDA 4FLMA 1WHSA 3S8YA 1WB6A 1MX1A 2WTNA 2VATA 1B6GA 3L1IA 3AFIA 1DWQA 3BJMA 5LZ9A 1XLWA 2YH2A 3ILSA 3WJ1A 4B82A 4HTAA 1IUOA 4IH4A 4CIBA 1TIBA 4S0XA 4A5SA 4U2FA 1M33A 4AQDA 4QNNA 4RGYA 4Y2SA 4H7KA 1DQZA 2G5TA 3T4UA 1EINA 3QMVA 2QVBA 1WM1A 3ESBA 3OOSA 4UBKA 5A6VA 3STWA 2ZSHA 4KE8A 1U65A 5CT9A 3E3AA 4HS9A 4C88A 4N8DA 2BGRA 5ALRA 5EI5A 1T4MA 1R88A 1OXMA 5A7GA 3B5EA 1IZ7A 2HFKA 2BUAA 1QFMA 3PI6A 5DJ5A 1BE0A 3H2JA 4LXIA 1Q0ZA 2WG1A 1EX9A 5ALWA 4FDMA 2AJ8A 1XZEA 2WIKA 3R3UA 5IVIA 1XLUA 3MVEA 1CUUA 4E11A 3I28A 3PF9A 4WY5A 2XUJA 3KD2A 4BVJA 4CCWA 3WA6A 1MTZA 1P0PA 3BDVA 1SCIA 3IA2A 1UKBA 3IUNA 1NX9A 4RPCA 4H7HA 5ALIA 2WLSA 2VTVA 2VQ6A 1CUSA 4XJVA 1LGYA 1KU0A 3QITA 4QDTA 3QYJA 1GPKA 1F8UA 3AZPA 4W9RA 3HEAA 4UHCA 3WK5A 2O2GA 2PU7A 1BCRA 3H1BA 1XRRA 2ZSIA 3WI7A 4J0GA 3H2HA 3MGAA 4BZWA 1GKLA 4UPDA 5FRDA 3C5VA 1T2NA 2DR0A 2G4LA 3ESDA 4KJXA 2WJ4A 1HLGA 1Y7IA 4BDTA 4FFVA 4DYHA 3VJKA 3F9CA 4X3CA 4N5HX 2DFPA 1XRPA 4NMWA 2XLCA 4DM7A 1YAHA 3EIOA 1CUJA 1QFSA 5LKAA 3CN7A 4C89A 1XRQA 4IO0A 2RGUA 3D7RA 2XMQA 5H3HA 2DHCA 3DL7A 2V96A 3STVA 4ARBA 2W22A 4NS4A 4EB0A 4Y2UA 2HDWA 2AJLI 2JGIA 5FKJA 3D59A 4FOLA 4QDZA 5CBKA 1ODTC 3HXKA 4X6YA 3PUIA 4DMKA 4Q05A 4EY5A 2XUFA 1UOQA 1GT6A 2OPHA 1L7RA 2JGJA 2Y6VA 5ALZA 4U2GA 5JD6A 4QDXA 2JGEA 1XZHA 5SYNA 1GQSA 4BCCA 4DNPA 1X2EA 2C5GA 3H18A 1ZD3A 2ACKA 5CRIA 1Z68A 1USWA 4B83A 4DIUA 3ED1A 5HFNA 4HAIA 3OPMA 1FSSA 5I8PA 2X5XA 4J0CA 1EI9A 1IZ8A 1MU0A 3P2MA 5JALA 3STYA 1X2BA 3B3QA 4B0OA 4Y2XA 3MUOA 1ODSA 2HA3A 2DHEA 2DQZA 2OCLA 3EQ7A 3QZUA 2HA2A 5CT5A 3D5EA 2BCEA 3LS2A 1YAJA 1ZJ4A 5JZ9A 4CFSA 3N0TA 4H7FA 2CKMA 3FWHA 1ACLA 3HI4A 1XROA 1UOPA 1K6EA 1J07A 3FYTA 3G9TA 4DLNA 4P08A 4FNGA 1LPNA 2I3ZA 4AN1A 1UWCA 1DX4A 4BAZA
chains in the Genus database with same CATH superfamily
1A7AA 1WQ4A 3C48A 3HDJA 2GKSA 1KBOA 5HF8A 4YAUA 5ALEA 3LRXA 1JHQA 2EZ4A 3MFYA 4D6YA 1NT2A 1G3QA 1F60A 2Z4TA 4TV8B 5HKLA 4RTMA 4UHJA 5DVZA 1A71A 1BKDR 2A4MA 2DKOA 3RTGA 1T8SA 2FUEA 3DMNA 3OZBA 3O83A 1DDOA 3IPLA 5BWBA 2GO1A 3JQEA 4WVLA 3C3AA 4D0RA 3MRVA 3TRKA 2C9BA 1U99A 2QQEA 3CUUA 4JROA 4NABA 2MMGA 2NP6A 3AHGA 1VKHA 3OZVA 2QJFA 3OM1A 3VHXA 1VE6A 4AUEA 1YZVA 1OMOA 1KR2A 2LUOA 4R9UC 2ZYWX 1CY7A 3MMSA 4WHMA 3D7SA 3FKSD 4Z9BA 4PZAA 3IULA 4HWKA 4Z54A 5BN4A 4B7AA 4QHYA 4M99A 3TD9A 1K0UA 3BQ9A 1PEAA 2DM6A 2ZJ2A 3HHEA 2O0JA 2WY2D 2QD4A 2XZTA 3DB1A 4ND8B 3U7EB 4Y9DA 1KPHA 4LYHA 2PJZA 1OREA 3R9IA 3EA5A 4BV8A 2UVPB 2HWUA 1D5WA 4DRYA 3FRJA 1LPAB 1W0KD 3AERA 1NWHA 4DCGA 1T1JA 2M6RA 4KGDA 4C2UA 2OBBA 3I05A 1J2TA 1SHJA 3QOFA 4FZ3A 1F20A 1N0UA 5AUPB 5AUQA 3NYIA 4G86A 2JZCA 1PL7A 3MIZA 4XD2A 1YDWA 3ZLTA 1OHHA 1F51E 4EDHA 3IQWA 1B1AA 2F3RA 2OC9A 3W05A 3G82C 5IANA 2KX7A 2CXSA 1XDUA 2ECFA 2VJPA 5I9LA 5M34A 4MJLA 1CUIA 3CLHA 2GYYA 3LL7A 4MRMB 3FHJA 3THXA 1EE2A 2XCSB 2WVAA 2HU8A 5AM1A 1NRJB 2JIDA 3W6PA 2R8OA 2YWHA 1VP9A 4A0QA 2P1ZA 2VA8A 3K6KA 3PR3A 3WGMA 3O8BA 4UVDA 2BONA 3TEJA 3CR7A 1KI8A 1ZSNA 2IIQA 2R44A 4U7DA 1SUPA 2GD0A 5HF9A 1UJ4A 4QDOA 4S1WA 3KYJB 5F76A 4B4WA 1M6HA 4RY2A 4REMA 4D41A 4YRTA 2H4YA 4KO3S 3U13A 1ZL2A 3O3NB 3TB6A 2VYCA 1X19A 5FR1A 3F5DA 1W35A 5IMBA 1RC8A 1PR0A 5D87A 2W8BA 1SVOA 1OFGA 1D1SA 5DNAA 4ZVPA 3HXOA 4DN6A 3P71T 1Y3IA 2CWDA 2H9IA 4NBWA 1GO2A 4C6TB 3WSTA 5IT0A 3RYCA 2O59A 1U3UA 1WXQA 1ZK4A 5JC8A 4JC5A 2GXSA 1UBEA 3D7NA 3KOUA 1WOMA 2B1QA 3CRZA 5KVAA 4B3SB 3X43A 3VSBA 4DB4A 2NTEA 3TD6A 4QVIA 1QDUA 3PFFA 2RAPA 5CYPA 1PJ3A 1N92A 2CUKA 2XNDD 1M1NB 4KXNA 2D5BA 3FX2A 5DN6D 4BN5A 4DJAA 2Q2QA 3P4YA 4IRMA 2UVPA 4XR9A 2ZI9A 4BVFA 3EARA 3DC7A 5JC1A 3TLBA 3WKAA 4O2BF 4YMGA 1E9EA 1T4DA 4P4LA 3VKGA 4PLFA 4S24A 2W2LD 2WAXA 5CB6A 4RF2A 3TTYA 3P45A 4XIGS 4BEJA 2TMYA 2PFGA 4IMRA 1UODA 5CT6A 1ML4A 1PCXA 2LR0A 4EVQA 4Z3DA 3S44A 5CA0A 2YASA 1P8AA 3DYIA 4JI8B 4BAGA 4QULA 2VWPA 3H0CA 1KE2A 3TQOA 3FTEA 2ZWOA 2DRIA 3DDOA 3KCQA 3QKUA 1O0CA 4WZAA 3UHJA 4NTZA 2X2FA 2OGTA 4QXQA 1GPH1 3BXFA 1X7YB 4NE7A 1AT1A 2XQIA 1TGYA 3F5SA 5A1JA 5ADUS 2FEMA 3S29A 3LK6A 1V9SA 2PXHA 5J40A 1O6CA 1TVEA 3I6BA 5IH7A 4XH9B 4OPMA 3BH0A 2J9FB 1P5HA 2V6JA 4RA6A 3M3DA 1C9NA 3RUDA 3VYTB 4GNKA 3WIBA 5LD2B 4QWWA 4G3XA 3R5TA 1DG1G 1IFXA 2E6UX 2J6CA 3R5JA 5AW1A 1UDCA 3KJQA 3RVMA 1ZUNA 3CN9A 2CSXA 5JCJD 1R5NA 5LU9A 1OX4A 3L6DA 2QROA 5KYUA 3TFQA 1PYGA 2ZSUA 3UMYA 2QRZA 4ND4A 4K03A 2QRQA 1RLOA 4CVNA 2P9JA 5KKCA 4WIAA 3RSOA 1L4HA 2W5UA 1KOGA 2HHJA 4ABTA 3GEIA 3U6KA 4FCTA 2K2WA 1EA5A 4G9EA 4NU8X 3MTDA 4P36A 1QLWA 4QATA 3AF6A 5LUBA 4IHQA 2UUBB 4Z7NB 4H7IA 1N5LA 1P5ZB 1VI5A 2BHNA 1MZPA 4CE6A 1RQ2A 4DR7B 4LRWA 1ZOOA 3FCSB 1SXIA 2BC9A 3LLVA 1QG4A 2GJKA 1M2GA 1A5ZA 1BXGA 2NV6A 2WYVA 4DC9A 4AP6A 2ATEA 2ZYIA 5AJZA 5ALOA 1MG5A 3LGXA 3QLVC 3QUBA 2JH3A 2JAPA 4YMHA 4RPJA 4A8JA 3WGYA 3WDSA 2ZDHA 2HCJB 2VDQB 4MEJA 3B53X 1BE6A 2XTZA 3ZU5A 3W9BA 4E5VA 4ER5A 3T99A 2IYXA 1RRKA 2XE7A 4L5CA 1RXUA 5B1YA 3HPRA 4G0XA 1T9DA 3DQQA 3H0EA 4OHYA 3RFUA 2IUFA 5DWQA 2BMDA 3HSKA 3TI7A 4ZYUA 2IE0A 1Z39A 3ENZA 1QTRA 2DWCA 2KW5A 3GGJA 3SEAA 1YL7A 4BGIA 5P21A 2PGOA 1GPLA 4HO1X 3X1DA 1F6WA 4NCKA 2X3YA 3DMTC 1GZSA 1A8SA 4QWMA 3ZWXA 3R5KA 1Y48E 1N2EA 2DTXA 2YWFA 3HKEB 4WECA 2PJDA 5KTYA 3TWOA 3KRTA 4FUQA 4DR3B 1JDSA 1XEXB 3ZWAA 3AL2A 1H9CA 2CJPA 4IOJA 3UMCA 2A59A 4J94A 4OL9A 1PT7A 5NLLA 3RUIA 3ILYA 4GDFA 2ZT7A 2AG1A 3MHTA 5A71A 1JI3A 2C5LA 5ESDA 4MMZB 1E5XA 1NONA 3ROPA 1CBUA 3W78A 4OHVA 3W9UA 3A6ZA 4CM4B 3K2QA 1EWKA 2GILA 4MQMA 5CFZA 2WU4A 1M75A 1LH0A 1OVGA 2EDCA 3D8NA 4KE9A 3RRXA 5JMWA 3P9QA 1QJCA 4NYMR 4QRHA 1XZAA 2CW5A 2VCEA 1TQ6A 5BMVA 1C3VA 3HB9A 2WMOB 1TEXA 3KLPX 5FUMA 4R98A 5EG5A 3D43A 4MWZA 2NIPA 1P72A 1ZQ1A 2QE6A 3PHLA 1XU7A 1HTWA 1YA4A 3JVVA 4R1MA 1CDZA 1K3FA 3KVRA 3Q3EA 4U2CA 4MYDA 5I7SA 5L9AA 4QFBA 4RL4A 2XOXA 3UNXA 1C7IA 5L4LA 1LPPA 5KYWA 2NTJA 2ODTX 4E1VA 4NARA 4DV0B 3GVXA 2JI4A 1I24A 1TF7A 4D2IA 4EGQA 5L6MB 5KYNA 3AESB 3THRA 1R9GA 4IYJA 2NM0A 2YJTD 1TTQB 3QWHA 4TVOA 3W5BA 1GGMA 2PUEA 1JXQA 2D2VA 1BRTA 3TRJA 4DXHA 3WYNA 1UZUA 3C5HA 1Y37A 1DP4A 3A3KA 3PCXA 4GP6A 5EJ4A 5AVSA 4JUDX 3KYCA 1Q6YA 2P0EA 1CR4A 4UMVA 2QTAA 1UP7A 1RQLA 5AVUA 3PRYA 1JR4A 1NBAA 2PX4A 2VXOA 2W2QA 3DW1X 3BHIA 3GA7A 1O4VA 4MUYA 3EDMA 3D8SA 4QYIB 4W9NA 2B5OA 3WLLA 1BWSA 3PHIA 5EQJB 1OH8A 1RPAA 3SVTA 4BY9E 4X71A 1OWOA 1QGAA 1Z6YA 4N5DA 4HX5A 4NBNA 4ERXA 3AR3A 2XCOA 1PHRA 4V3CA 5IKOA 5KUTA 2M98A 2D8AA 1PDWA 2CXQA 4V0QA 1V1MB 1TM5E 1I10A 2IDZA 4QUJA 4R16A 2B83A 3BMCB 4HGRA 2B92A 3WSWA 3DHWC 3KFVA 5IDXA 2E37A 2C7RA 1N2HA 4AJJA 4J7XA 4B8YA 1K5PA 1PJ2A 2AFIA 3OF5A 5DHSA 2R00C 2NU9B 1DJOA 3SVZA 2XRZA 4F3TA 4MCJA 2P2CA 2B94A 4IUBS 1NBHA 5JXWA 3SD7A 4PTLA 1G6KA 3NAGA 3C70A 3X1JA 3EVFA 4CMJA 3EPPA 1VJ5A 2FFQA 3FR8A 4NVRA 3DE7X 4LDPA 4I6GA 5E6RB 1D07A 1JSLA 1PD0A 3A6DA 3AFNA 3I04A 4NPAA 4Q3EA 1YBHA 3C8HA 3QY0A 3SI7A 3UATA 3HUUA 3WMRA 3AJAA 4IW3B 4BVGA 4HTFB 2R8PA 1H2AS 5EWJB 1U0HC 2QJTA 3DE1X 1OH5A 1IIBA 4P3XA 4IIHA 4OB7A 3VZSA 1XB2A 3JQ9A 3A1NA 4BNYA 2HW8A 4AZVA 2Z5FA 1Z13A 1XTUA 4FKZA 4U02A 3TW0A 5EMHA 1XWWA 3FZQA 2VEDA 3OE1A 1Z7EA 1VYTA 3KWFA 2GF9A 5KMGB 2PG3A 4N9WA 3A2LA 4A0RA 3F9IA 1SIWA 4NSNA 4QXPA 5CLQA 3L4BC 2E2WA 2VQSA 5FI5A 4M9UA 1MC4A 2C84A 1FZQA 2HCBA 3N74A 4MUFA 1UK9A 2PV0A 3TRIA 4ASUA 3GW8A 3GFVA 3O0TA 2A78A 5K20A 3MRTA 1AE1A 3UB3A 2J41A 3DBHB 1ULBA 3FTNA 1IDN1 3KM0A 1TM2A 4ARSA 1FRFS 4WGGA 1XKLA 3BVPA 3KXPA 1JR3A 1Z22A 3I9OA 1H1LA 4QTTB 4WESA 4UM5A 3SYLA 4RKYA 2Z08A 5FBKA 1YHYA 1V2HE 3I9V1 1R0CA 1LF0A 3PWSA 4OI2A 1F0NA 3H8SA 1P4SA 3ZHTA 3WXBA 4QDJA 1NLZA 2Q5JA 2OYCA 4OB6A 1X7ZA 1VB5A 3H75A 1QIIA 1RTTA 3ECAA 4KL8S 5ESRA 1ABEA 3AI2A 1A76A 3ESYA 3ORQA 4CDMA 3IXMA 1THTA 1ZGJA 2AWOA 3NNDA 4HK4A 4DABA 2PUAA 1KYVA 1JGTA 1R0SA 3MWFA 2QY9A 2HSGA 3CXUA 1QWOA 2B8WA 2Y05A 3C15C 3IYLW 4KQ1A 4PZCA 4WBXC 5T8KA 4UFOA 4MGZR 3JQQA 1DQNA 2XMGA 1PV1A 3E23A 4O2RA 1XRSB 4RVCA 3F7TA 4XCQA 2VNKA 3CF4A 1XMSA 4L4RA 3RRZA 1GTG1 1IHUA 1UMCA 3SXUB 4YR7A 3OZ7A 3IGFA 5EPEA 2MJLA 3Q0TA 1TA0A 4HNAB 4XGRA 1DKRA 3T7DA 2F3SA 4IDNA 5KQSA 4OQNA 4B75A 1FW8A 3DGFC 5D3KA 4H0FA 4LJYA 1LNQA 1TEHA 4HFMA 3SOZA 3RAJA 4B6SA 4R1QA 2XKKA 1LWNA 4XPZA 3ANNA 1RAHA 2CMFA 5DU2A 4BYMA 5DM60 2ID7A 3FYUB 3KEGA 2BGJA 2OV6A 3SKVA 4CTJA 1H0HA 3GUHA 4D4JA 4DMMA 1UDAA 3HJHA 4E13A 1O58A 2PT9A 1JDVA 3WL8A 2PX2A 4MAAA 3DYVA 2JC3A 3B6IA 3F7NA 2GBLC 1J8FA 1QS0A 1W6UA 3JWHA 3BFPA 2VHXA 4HGZA 2FH5B 1DDIA 1K4YA 3CVJA 5L4NA 2OUKA 1PNRA 1ZM4A 2ZR9A 1M1ZA 3G5TA 1S4QA 3U3DA 5BSHA 2Q1YA 3EZFA 3IDAA 2M1XA 4RV9A 5FI1B 3O82A 1M34E 4OD0A 3ZLVA 1P4GA 2VQEB 4H7JA 2ZREA 2IT1A 2X2PA 3PNYA 3D7MA 2B8TA 3FY4A 5EJ9A 2JJYA 3FLEA 4HH4A 1QBKC 1P2SA 2WZBA 1G19A 2EDAA 2OC4A 3FFBA 3A58B 3OWXA 4CTKA 5A5FA 2DBQA 1M7GA 1GT91 1Z4LA 2JA2A 1X1RA 2UV8A 3JWJA 4KLAA 5C34B 3S5UA 1SXPA 1VL2A 1W1WA 1SXJC 3THYA 5G41A 1T1RA 4F86A 1W85B 4E5PA 5JSFA 4ZV7A 4LXTA 3P9CA 2G80A 2EYQA 5E38A 1XCOA 4MV1A 1OF1A 4HDRB 4D92A 1O0BA 3M7IA 1O57A 4U00A 3OEYA 3UAYA 1TK3A 3QM1A 3DEHA 3E5NA 1ZR2A 1BEZA 4EFMA 1JG4A 3B8EA 2ECKA 3ISTA 4YT2A 1UBNA 3MZ0A 2XVXA 1A9QA 4C4YA 3IP6A 4DCCA 5IAJA 3WA7A 3JCZA 4DG8A 1JQBA 1NN5A 4PV7A 2C8JA 4J9UE 3SXPA 3QLTA 3TMYA 3CZ5A 1WDKA 2YXNA 3CUVA 4AP9A 2RK3A 3K0CC 3GDOA 3WL4A 1QYWA 1V48A 3Q9NA 1QOPB 2PLRA 1I3NA 1RWPA 3FYCA 1JEOA 1IN6A 5HBGA 2NUBA 3COPA 2B4TO 1WSBA 1HE5A 2JG3A 3F6CA 4U3JB 2FG6C 1TYAE 2HWWA 2VN8A 3BWVA 3H6GA 4Q3LA 3S99A 1KIAA 2VSXA 1CSEE 2QX7A 4LTDA 4ZT7A 2YWGA 2AW3A 2HMWA 1F9EA 4B32A 4QFCA 3STHA 2QRVA 4LZZA 2ZJ3A 3BA1A 2ZBQA 3FDFA 4N8EA 1XZPA 2H48A 4HNHA 1FFDA 4EB6A 4EAQA 1ST3A 3ADOA 2NPIA 4MROA 5B53A 5EIAA 1ECLA 3CKMA 4O4IF 1XXHB 4US2R 1NOJA 2XZLA 3HA2A 3O8CA 3BB1A 3W34A 2HIAA 1LDGA 1OLXB 4TTRA 3EX7C 4W1QA 3VH2A 1S9DA 4XJXA 5FWDA 3V4ZA 4EJ6A 3U60B 3I23A 4UCWA 1YI8A 1UPUA 3E6AA 4JOCA 3HLKA 2CFCA 2VZ9A 1BDBA 1PS8A 4N7MA 4IIUA 4QT0A 5BV0A 1Y4UA 3PYMA 3W3AD 1TCAA 3LBNA 5LOVF 4KACA 4NNOA 4TVKA 3UUWA 1NQTA 2GCNA 1EX6A 2XF2A 4A1OA 1AQLA 1YU6A 1Z56C 2CFRA 2JGDA 3W6ZA 5JSUA 3QU5A 1M2FA 1VSQA 2H4JA 3DNPA 4E46A 4JY7A 4BLWA 1UFQA 2I1QA 4OXXA 2PBZA 1C7EA 2DEUA 3EYWA 2VPXA 1AHNA 1VI2A 1YZYA 4PO8A 4ND6A 4X92A 1O1YA 2PWZA 2O0KA 1BWPA 1JLKA 1TMGE 2XLBA 5BUSA 2H16A 5THKA 4UM8B 4RX1A 1U1DA 3MJHA 1R0YA 2RMKA 1DINA 4FWTA 1GZDA 1SHUX 2PGXA 3LA6A 2IXGA 1GD1O 3FF4A 3LUHA 4X90A 1KORA 3FKSA 1NKVA 3WLTA 4AMZA 3VKHA 3OPYA 2X0JA 2VF2A 1EMDA 4D4GA 5GINE 1YRLA 1RCFA 4MJ7A 1TC2A 3JQRA 2JRCA 1UPAA 2R66A 3L4SO 2PD3A 2Z9DA 3S27A 2VP2A 4RYLA 3KSMA 2UUOA 1IC6A 1GN9A 1DU4A 3P2OA 4B2IA 5EPUA 1XRJA 4D8TA 1Z4KA 3UBTA 1E0SA 1Q0TA 1XJQA 2XBMA 5EZQA 1DAFA 3DTVB 3IR5A 4K6HA 1KOLA 1NUUA 3CURA 3GQBA 4IDHA 4L5AA 5FQOA 3UMFA 2AIRA 5BNTA 4CF7A 1QRTA 3G2QA 2FMTA 1L9KA 5DEOA 1PRYA 2FFAA 4QLBA 3D31A 1H6CA 1LJUA 1TJNA 2C20A 4NESA 4Y6OA 4DCNA 1Z6ZA 3Q5GA 4P33A 1GUZA 4WOJA 2FQYA 4XX1A 1XUOA 4FW9A 4AIIA 4BBPA 2AXQA 4Q66C 4L5IA 2ZDGA 3RH0A 5IN4A 3U5TA 1Z07A 2ZG6A 4L1KA 4RF3A 3IH5A 4EJ0A 3ICVA 2D62A 2G0TA 4Y2JA 4NECA 1GTSA 4YPOA 4MPPA 4QHSA 3UJDA 1ZZGA 4FGWA 3OIWA 1I7PA 1BXRA 1SBTA 2QG6A 1NW6A 3M6FA 3OE4A 1JU4A 3L07A 1G21A 2PCJA 3CGGA 3TLJA 3WMXA 3EQ8A 3FTFA 2R7KA 2XAUA 3NIDB 3O1IC 4RTLA 3AVUA 4KFRA 2QZ4A 1PSWA 5SY9A 1Q1ZA 1YS4A 4A16A 3D3EA 4P8RA 2YHIA 4C04A 2OD7A 3KIPA 5ALUA 4P4TA 1OZGA 4RPLA 2Q4BA 5DGTA 3VPDA 1PL8A 3ROMA 4BQNA 3CEPB 3QQPA 1TQ8A 4FMCF 4WLOA 3VZBA 2Q3LA 4B79A 3DDWA 1R15A 3PPVA 2FOLA 4BE4A 1B23P 4HMOA 3FWPA 1QHYA 1YMUA 2I3DA 3MYYA 1P3Y1 3ICOA 2XWPA 3KALA 3B6EA 3DCNA 3IUEA 4YAWA 4NU0A 1XNRB 4GLLA 3ODPA 4CF4A 4YRZA 4HDKB 1JB9A 2HD4A 1KFCB 2FRDA 3VNBA 3C5WP 3G02A 3P96A 1L5WA 1DRUA 5EKDA 5I4CA 5CXUA 2OL4A 2YHSA 2A33A 1SHLA 5EHXA 3PV0A 4K2HA 3VC2A 3E9NA 4NOJA 1EXVA 3EODA 5IT5A 1EZ4A 4ZEVA 1KDYA 1SCUB 2JKYA 4R8KA 5DYYA 4CGYA 4BNUA 4IWYA 4LGYA 3L0SA 1U7XA 4H16A 1S2OA 4FONA 4LV5B 4NDZA 3ZWNA 1OWLA 1PVOA 1UCFA 4IUCS 3OC6A 3HYTA 4NQZA 5LA6F 3V6MA 4EW1A 4M9CA 3RUCA 1QVAA 1E9FA 3W1WA 3EZNA 5EXSA 3BFKA 2HMYB 4M1QA 4EJ2A 2OENG 3I09A 4MVWA 2O4CA 5FPTA 4FNAA 3FGOA 1S2LA 4EMSA 1HDZA 2DPHA 4UEKA 1CY6A 4NG4A 3Q7IA 2WT4A 5HDQA 1UBMS 2DWOA 3SX2A 3TIXB 3LX4A 1YI0A 1FXUA 3GLHA 3FWYA 3WDKA 1W1UA 1MOQA 4UCQA 5LWQA 1MO4A 3T1NA 1I7DA 1MB9A 3E9DA 4QNRA 1DFGA 2GWRA 2WJGA 4IGIA 4XYMA 5AI8A 2BGNA 3W5IA 1WMSA 2OECA 5GADl 2TSYB 4H2DA 1KPGA 4A0FA 2QF7A 1HNZB 5CP8A 3I45A 4GYYA 4LXGA 4CM9D 1T9GS 1T9ZA 1QZUA 1PLLA 3HP7A 4KFCA 4Q18A 1LVHA 4B3RB 3I34X 2JEZA 4JVSB 4GBGA 4MI3A 2AJBA 1UINA 4KH0A 2FCRA 1LB1B 4RV5A 2B8EA 4DSZA 1L4NA 3ZY6A 4BV3A 5BYAA 1R4ZA 2VDJA 3BRWD 3A1TA 4R9RA 3K8YA 1SOUA 3IAHA 3UQZA 3VOAA 4WZAE 1LV8A 3GDHA 3D4NA 4HYEA 5ARDA 4HDKA 3WNZA 4AS2A 3HEMA 1YJAA 2IU0A 3OQOA 3U48A 3B1VA 3DZFA 1SOWA 5LSAA 2D3WA 2BP7A 3KX2A 5CVDA 5TS3A 4EEKA 3ZNQA 4LF8B 1W4ZA 4S05A 3T0IA 4UNPA 5ECYA 2A1IA 2Q9CA 3IV9A 2ZT5A 5J58A 3ESXA 1IDOA 1BWQA 4PHHA 1HR0B 2V7BA 4O8ZA 4RK7A 3WJ7A 5IULC 3AM1A 4LDNA 2H59A 1KYTA 3JAWA 4P7FA 1Q2UA 3E22A 1JAHA 4ZDJA 2HGZA 1SXJA 2D1FA 3WTCA 4DDWA 1T9AA 3OO0A 1W5AA 1LLDA 1ZEMA 2GO7A 2VDPB 3EDYA 3KKMA 3SYNA 3Q41A 4TYPA 5BT9A 4XFDA 1X7WA 2QMQA 3FSRA 3HUFA 4XYGA 3JZMA 4OU5A 5DHUA 2EAUA 1PUJA 4M1SA 5JCPA 5HQJA 4AY2A 4OI4A 5FJJA 4PVCA 2FWJA 4F97A 2I7DA 2ODBA 3BD7A 3PE4A 4KV7A 4YNBA 3VKVA 5HYVA 3DOCA 3KZVA 5L4SA 1RR6A 1COWD 3KVNA 1JEYB 2O1SA 1SKQA 1A96A 1NUPA 1OC2A 4NZYA 4V0LA 2IS2A 2BELA 1NN1A 4LY9A 4KPYA 1IRXA 3U9SA 3ROQA 1H2ZA 1SKAA 3ZG6A 5K45A 3T5DA 1EDZA 2P4HX 1ESMA 4LRSB 3AYXB 4KV9A 3MWLA 1HRKA 1JNXX 1ZIDA 3HRKA 4KBFA 1UKAA 1YS6A 2FFHA 3WQSB 2QAGC 3F4BA 4K46A 5D2CA 4LCBA 3TDKA 2GZHA 5KTTA 3ONWA 4N01A 1XBTA 2R2GA 4D9GA 3SDSA 2R11A 2GPBA 1HDCA 3G1WA 3AT1A 2E1RA 3G85A 2AOVA 2OHHA 2QN9A 1XZLA 3C6MA 4PO1A 4Y98A 5DX1A 3VDMA 4EGSA 1QF6A 1BVUA 5TVGA 5HKAA 3HP1A 1JIXA 4BVBA 5AKHA 4BMPB 3AQ4A 2X0EA 1DG3A 1Z25A 2X13A 2UYYA 3MILA 1J9ZA 1LBQA 2FYTA 2R8BA 3QV1A 3A7DA 4MWTA 3UB4A 4D9HA 3JQ7B 1Q1NA 1THGA 2HA0A 1T9CA 3TR5A 3OLXA 4IJWA 4XKJA 3IO5A 1U3TA 3AKCA 3DM5A 3W8FA 3LUDA 2I4OA 4B3CA 2AEMA 4HC4A 1ZCJA 2HK7A 1KHTA 1KVUA 4PGHA 1CK4A 2B1GA 1RM3A 2GDJA 4JSTA 4XD7A 3BHNA 1CDDA 3OEED 2EC5A 2Z56A 3RT1A 2PZKA 1L4MA 4KTVE 4MX8A 1GSHA 1I2MA 5JIBA 1Z26A 3PJRA 3DEAA 3PWKA 3L93A 3V7UA 1Q1AA 1QQ5A 1MC8A 1UPXA 1WWKA 3AY7A 3NWEA 4PLGA 4B9EA 2Y0EA 3IJ5A 3MFQA 3S70A 4AF8A 1YRYE 1WL8A 3ONNA 4HZUA 1OW3B 1ZNYA 4PYNA 3FCYA 4FTWA 4ZVOA 2JFVA 2C8KA 5K9ZA 1O89A 2A5GA 1HYQA 3JQGA 4R8LA 1M7HA 1NV8A 4XDZA 3FTPA 4YRQA 3FKQA 3P26A 4BHTA 4MH0R 3MB8A 4DR6B 4MXDA 1VB3A 1G17A 4B0PA 4CQNA 4RV4A 2HCTA 1QE3A 4X6UA 4C5BA 3Q9LA 1ZRNA 3RVKA 3B5JA 1IMJA 2Y6UA 1I6KA 1U0TA 3GA5A 3PC4A 4QHTA 5HCIA 3H5IA 5LDHA 2XE6A 3ZHUA 4CM1A 2C5EA 3FUUA 1Y63A 2GAAA 1DNPA 4K87A 2KLHA 5KTPA 4FINA 1NE7A 2F62A 5EHNA 3TG8A 3D81A 3RQSA 4UPEA 2PGLA 1WAMA 3MA0A 3EAFA 2DJ5A 4QTYA 1P75A 4QBGB 2G06A 5IASA 2Y1EA 4OGFA 5HUQA 4DV5B 3RNLA 4BO5A 3WE7A 5E7JA 1V0JA 2FFBA 3BEDA 3IP5A 2V7TA 4HLQB 4AS3A 2I3BA 4AY3A 4RZIA 1D2EA 5JLAA 4LMAA 1EFAA 3GFGA 2XNCA 1NZFA 1D1TA 3LBYA 2W2VA 3EMDA 1F2DA 1JPNA 3UMJA 1I9CA 1BA2A 2QRGA 1PE0A 3RIMA 3ZNOA 1Y1QA 2G9QA 2NUAA 3JYQA 4C7VA 2ZYRA 4DAEA 1BX1A 1ZI6A 1BRMA 4DXAA 3VNUA 4BZXA 2HRCA 5JV5A 1KYZA 4Q3DA 4ASUD 5CVUA 4BX2A 3ZY3A 2Q1WA 4UVIA 4L3VA 2EHDA 2J08A 2KB0A 4NFYA 4DMGA 4F6LA 2GUGA 2HRBA 2AMJA 2GNAA 2QWXA 2BMEA 1VHLA 2P4QA 5IDVA 4L8LA 5A3VA 1JR3D 1SVMA 2YJ6A 2GFHA 4DYVA 2Q2OA 3V55A 4RHYA 3BMNB 3A6FA 2VPYA 3EGIA 2CCKA 3NAMA 3PFGA 3WP1B 1S7CA 5F12A 4BO7A 4LE1A 2FW8A 4RLFA 5DPMA 2WIAA 1NDUA 2QVLA 1LA2A 3FNEA 5J4YA 2YS6A 3D8HA 3NU1A 5DLYA 3S2YA 1QP7A 3C1AA 2IF0A 4QPJC 4F2WA 3OLCX 5J2TF 5JWOA 4GOOD 4LNAA 1MEJA 3KVYA 3M6VA 3AX6A 3GYBA 4K9SA 2XGMA 3EC7A 3ZK9A 3K9FC 2XQGA 2JAUA 4C0WA 1E5TA 2CLEB 3IQIX 4JT9A 4QPNA 4X93A 5DLPA 4MV9A 4CMEA 1IN1A 3BK2A 3LBHA 1C9EA 4GVXA 3GJYA 5B5SA 3I0ZA 3EXHC 3TLAA 4EPYA 5KKNB 2ZJ4A 5ALHA 2QPAA 1FFXB 3AEQB 1FFCA 2CF6A 3RUEA 1CB7A 2A30A 2O4UX 4WBNF 3A31A 3ZV7A 4JBLA 1RRPA 2OFXA 2XSZA 1AM4D 2HUNA 2UAGA 3D3JA 2B34A 4QIHA 1QO0A 4NMMA 3FDXA 3VVBA 4EEXA 5K6TA 1U9IC 3R5HA 4Q7MB 4DJ5X 2CLKB 2CNKA 2PBRA 3HCCA 5CM8B 4N0EA 3CNBA 3PJGA 2FJUA 2J0UB 4NZZA 3UQYS 1MA3A 4JJAA 1MXHA 1RXVA 1L4EA 1ZXBA 2Z1DA 2PA0A 3F74A 2RHTA 3NEYA 2QX9A 4GPZA 1JEYA 1C4KA 3MM4A 5LA6A 3BQNB 4HQ6A 5KNCA 2NGRA 1K8YB 4NULA 1DO2A 5EXEA 3M70A 4NG5A 4ARAA 5FB3A 2FEAA 3NHUA 1T43A 3R7AA 1X6VA 3VPXA 1CQIB 1NU6A 4JWKA 3H0KA 3FOZA 1G18A 1PNVA 2LXNA 1TK2A 2I2BA 1ZP6A 3S2FA 4C0HA 1EHYA 3WGNA 4CT0A 2BMFA 4H3HB 4M1YA 3HJAA 2OGSA 4WESB 1ZN8A 5E3JA 4BNTA 2C2ZA 2C54A 1PV4A 2QR5A 1X9HA 2CFIA 4B3GA 4MW9A 3COZA 1EVZA 2E82A 1FVHA 5KO2A 1A1SA 3FNFA 4IOMA 1KH2A 2P5YA 3ZH2A 3M82A 4P3KA 1RHJA 3WYGA 3ZYZA 2QXUA 2BT4A 3BCUA 3EEBA 3ZD6A 5B6JA 3VISA 5JBQA 3H05A 1WUTA 4UMFA 4TLCA 2EEPA 1PZGA 3EY4A 3REQA 4L5BA 3G7UA 1A88A 1QQ7A 2B1JA 3CJTA 1XE3A 2V7QA 2IGTA 2WM3A 3M4YA 3JY6A 3VTZA 5IDWA 1IXSB 2R8XA 2VQDA 3G5UA 5BW6B 1KMNA 3DTVD 1JYSA 2ZXEA 4R3NA 4YI5A 1Z5UA 1JEEA 1WR8A 2IIPA 3P2YA 3M6XA 3SEFA 2YWXA 4MVCA 5A4MS 3O4HA 1JG7A 4KP7A 1YCFA 4O4LA 2J3EA 1RKXA 3I9KA 2VHJA 1DEKA 3SLGA 1JVSA 1N2OA 3AJEA 3H5VA 5IARA 3RVRA 1AUOA 1RW4A 2HJRA 2QDXA 1FMCA 1HH4A 2ASVA 2ARKA 2PO5A 4RFVA 2XCUA 3I4FA 4BQSA 4CW7A 2IYLD 1CUDA 1VA4A 1XYGA 2Q8NA 1RWKA 2XMSA 3PRKE 4G0ZA 5HKOA 4B44A 3TECE 1CUGA 1ZIYA 4C07A 3Q85A 4TWIA 2VRWA 3AUJB 3C1UA 3ZBQA 3KAJA 4AJKA 4BMCA 2OP0A 2XNKA 3HVUA 4YAFA 4DCTA 4M49A 4UDYX 2OV3A 5JDCA 4WPGA 1IB6A 3UMBA 5IF9A 4TV9F 4KI7A 3PJFA 4EECA 1X3LA 4FYJA 3DOHA 4K9NA 3MQ4A 4K40A 4ACBA 2P6MA 2JCGA 5B3JC 1PJSA 3P0IA 2G0NA 3REFA 2WMNB 4IF4A 4U5XA 3GLHB 3CUWA 1Y4ZA 2Z09A 4IPTA 1R64A 4KN9S 3TH5A 4AO8A 6AT1A 1CZRA 2GJSA 4XD7D 3ZVNA 3CINA 4ME6A 3LXXA 4TLLB 2R1VA 4M55A 1V1MA 3WMGA 4PQEA 4G89A 1Z8FA 5C3UA 5DNCA 1KY2A 3FG9A 3HBJA 6REQB 5CFOA 3A6PC 1CNFA 2P9HA 4Y2YA 4UNRA 2GN9A 4G0NA 5B55A 5JJBA 2IW3A 2P0AA 3RW9A 4K6KA 4C4SA 1Y5NA 1EEXB 5HIKA 2X3UA 2X15A 3JSXA 4PAOA 4BFWA 4DA0A 4JP2A 3D2CA 4L51A 4D6XA 4L15A 4C0JA 1A69A 5FUXA 2IS6A 3P4UA 4NENB 4OK3A 2QMZA 3ZWCA 2WIGA 2QIPA 4D79A 5K0CA 2ZJOA 3F7OA 1CJKC 2GCOA 3NANA 1AF4A 5DDIP 2X1LA 2N47A 5AO9A 1NMYA 1QKKA 1YBMA 2BRUC 2WQZA 3UCFA 1E8DA 2GBIA 2ILTA 3G5LA 5A9RA 3CPEA 2CB0A 3WWYA 3SQWA 2GTPA 1JQAA 2BMJA 4EARA 3U4AA 1PSDA 3EJ6A 5H4HA 2BE9A 2WZCA 1QHXA 3L40A 2Q3CA 2VJQA 4W5RA 2F3TA 3R6TA 1EDEA 1FVOA 4OH7A 2HWKA 3SXJA 3K9HA 2WF9A 5HG0A 1XD8A 3QNUA 2FHPA 4LDQA 4KXLA 5TMEA 3TRDA 4C3UA 3RRYA 1KI2A 1U8FO 2W58A 4C7MA 3RB8A 2LD4A 1XGKA 5JVDB 3TEMA 5K0ZA 2AUTA 1Q84A 1P62B 2JLSA 3DHYA 3AKDA 3JRXA 1KY5A 3C6QA 3PL5A 2J7KA 3PT5A 2HIHA 4JP8A 3KDPA 2ETVA 2X2OA 4YGXB 3SFTA 2CXOA 2FJ0A 2RONA 2G71A 4M0FA 1ZMXA 2WV9A 2BEVA 3KXLA 4RPKA 4EUNA 4U0JA 5ITSA 2F55A 2OG2A 1G21E 4BXOB 3AEKA 1AA9A 3HN6A 1W5BA 2CXTA 4UMEA 1YTLA 3PHBE 4I1IA 1RZUA 2F9FA 4XTRA 2G4VA 2H4XA 2OHOA 3B9QA 3JZIA 5IT9A 3AIMA 4B71A 3R7LA 2WFZA 2HK6A 3AB8A 2JDIA 5A9SA 1TL7C 2IIBA 1K89A 4K9LA 4BMDA 2GERA 3JRNA 4Q93A 4W63A 2WE8A 3WWDA 2BTQA 4MB6A 4YA6A 1HQYE 2QX8A 3MAAC 5AVRA 1GZVA 1W4BA 3RSHA 3FNRA 3CFYA 3BK7A 2QVGA 2A9PA 2G72A 1SIBE 1YV9A 5LMUB 2PGAA 2O8FB 1BD3A 4INPA 3OTOB 4BMNA 3M83A 3OETA 2FSUA 3LMKA 2XYVA 4W6ZA 5TPWB 1MV8A 3H2YA 3LNTA 3UJCA 2ZIXA 4MVJA 4BB0A 1RJFA 4JI2B 5IG2A 1E32A 1KZ1A 3T3DA 3UWSA 3ZIAA 1E94E 3IX7A 3P8ZA 1YIOA 2AMVA 5I8ZA 3FMFA 4DS3A 1XTPA 4E94A 1U5BB 2Q3DA 1I5RA 2J3KA 2R7LA 4D3DA 5HWSA 1U63A 3R7DA 1CDEA 1C1XA 3PDHA 3QRWA 2I8CA 4WACA 4HXFB 2PZBA 4QOJA 1J8QA 1N8SA 3V8RA 1I5OA 1PFGA 2C7PA 5CCEA 4D97A 3OIFA 3VGPA 1IAQA 4MINA 1MD9A 2PUFA 2PD4A 2JIQA 2NXJA 1QGUA 3FUCA 2ZPAA 4JU9A 4TROA 4BLQA 4ZDIA 4N7BA 5FUVA 5K3CA 3NBXX 1W36D 3VMFA 1U2QA 2PL1A 1Y7HA 3DEKA 1M6WA 2VT6A 3FF1A 5KQLA 1UJMA 2O1EA 3ZDRA 4QYXA 5K3EA 1E89A 3H19A 4KR3A 1JFSA 3I9NA 2XYRA 1L7DA 4EQZA 3H16A 1QB7A 3QU2A 2VPWA 4LOAA 2QYSA 3B12A 3HR8A 1VIMA 2WNIA 1NOKA 4JVNA 1QP8A 1SWWA 3K1AA 5GVSA 2IDKA 3PB3A 5E3HA 2W37A 2IQ5A 3UTCA 1W8DA 3V4RA 3SQXA 4Q1FA 3EH2A 1JPJA 1Q15A 2AHRA 2IHJA 2QLMA 3E5MA 5AW6A 4L8GA 2OTCA 3NASA 3K8ZA 3GNQA 1SJ9A 1FDUA 3EF0A 3P52A 1JUDA 2ATVA 4PHCA 4LF9B 3ES9A 2B69A 2C29D 3QPAA 5DX0A 4RA6B 4QL3A 1AS2A 1IPFA 1DAGA 2FW9A 5AJWA 4URYR 4DG5A 4IBOA 4L27A 1QZXA 5CT8A 4E09A 4Z0TA 3KZKA 1XVTA 4Q9HA 4WLFA 4E15A 1U0GA 1VE7A 3FCOA 2R97A 1EG7A 2X19A 1QIHA 1R0XA 3LQ1A 3UUEA 2VVTA 3K1ZA 1U4SA 1X7GA 2O5EA 3PD0A 6ADHA 4D4KA 1MAHA 1N3IA 1ADBA 2GZRA 5B6PA 2FHSA 1J7KA 1M72A 3NYRA 3ZV3A 3H1TA 4R68A 5SYMA 4EKNB 4FFNA 3DE3X 2AVNA 4M54A 3VR4D 4B8WA 2BF7A 3C0KA 3VHLB 4RU1A 4FEEA 4KXVA 3F5FA 3NETA 4L02A 2QA5A 1KRXA 4FR0A 1NC1A 1EIZA 2QTCA 4PLCA 3K71B 2NZJA 1G8SA 1J0CA 1ZA1A 3OLQA 4IHAA 1YOBA 2XVZA 3CBGA 2HMAA 1LTQA 2VDOB 2PXXA 4G1CA 5DW3A 3QLJA 4TXHA 5I7AA 1DT3A 1E2HA 4FYMA 2XDQA 3PWTA 4DLUA 3VU9B 4D57A 4IRXA 1Y6JA 1T24A 1MG0A 5LVAA 5IVKA 2FMKA 3JTEA 4ZJYA 3T3EA 5KQMA 4WZBA 4PU0A 4YQFA 4LZLA 2X6QA 2B4QA 1AURA 4JLWA 1EH5A 4RE6A 4XDHA 1CJCA 2GPSA 1PGPA 3IAAA 1JSXA 5FQNA 4BWYA 2RE8A 2CXPA 4U39A 3EW7A 1G8KA 2GMWA 3GLQA 1L7NA 2JJ2A 5CA1B 1CQJA 3S2GA 3KPJA 2FPKA 4ZEMA 3IJRA 4WY2A 4E12A 4YMUA 2HV8A 5I4KA 1PFKA 5IZCA 1YR8A 1Y1LA 3AM3A 1CZHA 1J99A 3IELA 5EWLA 5JRZA 1L5ZA 4XPIA 2PXCA 4L2IA 9MHTA 1G9XA 2PUHA 4OATA 1FP6A 1GPAA 3PNBA 3OD1A 3KZCA 4C0LA 3PL1A 2CCJA 4YO7A 3IP7A 5FL7D 3DCIA 1WHSB 4RPGA 3Q8WA 1ECFA 2FR0A 1VLLA 4LRQA 3RU3A 4FIDA 3WWCA 2PS0A 3CW9A 3ROXA 2EW2A 1NUSA 2WG0A 1W9MA 4JJGA 4AIRA 5EKUA 1JJBA 4P3NA 5EHIA 1XU4A 1F7UA 2EJCA 2REQB 3IVGA 4AF6A 3IUQA 4M9XA 5ED4A 1GSOA 2IYOA 3D4IA 5AOCA 2NTVA 3F73A 4CEHB 2C83A 2P9GA 3TINA 2WHEA 2PPLA 1R4NB 1CR1A 1DHTA 2FGJA 2ZAGA 4US0R 4WOCA 1JR6A 3L4KA 4EW2A 4J1SA 3UB2A 3W5SA 4DLLA 3MS7A 2QY6A 4EITA 4RZSA 1P0IA 3Q7RA 4KQJA 4IVRA 3HXPA 1NYLA 2H2FA 1MX5A 4WUVA 4I1UA 5JISA 1FSPA 4OHPA 4I5GA 2G9ZA 4X3OA 1LVGA 3L7AA 2WTMA 1DWUA 4PS0A 1HE2A 2EFGA 3MD9A 3UTDA 3GLUA 1E6WA 3ZHXA 1RI1A 4K6MA 1BXZA 1F0PA 2IEZA 4MWCA 5G40A 5GJVC 3TQRA 2RH4A 3VHXB 2WPDA 3H99A 3WBJA 3GPLA 4ZA2A 4YCNA 2V0NA 3D0OA 3I2HA 3PNPA 3N8HA 3LBIA 4W82A 3L7LA 4ZT5A 3AHIA 3SJAA 2GCEA 3HO6A 5ICFA 3ITNA 3ND6A 4MRRA 3R24A 4M8NE 5HOQA 3VHQA 3C4JA 3WGKA 3EZ9A 2PV7A 4OQYA 1G20A 3QKTA 3TTSA 3W5UA 3ZWDA 4U6QA 4YUVA 3MWDB 2O2DA 3F8TA 2EBWA 1W96A 2LKDA 3NM4A 4GSYA 3NHAA 4MIKA 4PRZA 3ZE0B 2X40A 4BB9A 4H6XA 1V7ZA 1E3TA 4IIJB 3B51X 1JJIA 4JLPA 4NZ9A 4UTXA 4WINA 5KJEA 5FV4A 3UJBA 3ML1A 4V0NA 4I6JA 4HNUA 1N2BA 3TSCA 3KO8A 2FZ4A 3V5NA 3SMQA 2QTTA 4LOHA 3G5AA 2NXCA 1S2DA 1W5TA 2YVUA 4KRFA 3IQHX 2NO4A 3QEMA 4YUWA 5AVJA 2EZ8A 2NSLA 1SG0A 1MNQA 1THZA 1W2HA 2HH9A 2JEOA 4F46A 2RCYA 2WAAA 3HZOA 1JZQA 2YY6A 1NG1A 3HNRA 3IV7A 3FD8A 3M49A 4DLWA 4XI9A 5HZGA 1H69A 1QYXA 4I4CA 4JJ4A 3GZNA 1JBKA 3BBPA 2EL9A 1K6JA 2SKEA 3PTZA 4RDHA 2NZVG 2QBYA 3K5WA 3JV7A 3SHWA 3U7QB 4JT2A 4WJLA 3IKVA 2ERXA 1FE8A 3LI2A 2UZ3A 3EZ2A 1G55A 5DBOA 5H02A 1DAKA 3QIVA 4PYKA 1ODJA 4CKCA 2BD0A 2JGNA 13PKA 2PZLA 3Q1KA 4TYQA 4CV1A 3Q8MA 1C9KA 3ICEA 2IYTA 1VM6A 4DARA 3ANYB 3DDUA 2XA1A 1ONPA 3AF4A 3JR7A 4Z4EA 3PQFA 4K05A 1IBCA 1PR5A 4ND7A 4QJ5A 2JGKA 1AKWA 1UPBA 2JGRA 3PLNA 4MKXA 2H4ZA 3VSCA 4CETA 2DULA 1PS9A 4KCGA 4K9MA 4U7GA 2ZJ7A 4CN9A 1D4OA 2HLNA 1GNVA 1AGYA 4IICA 3AHCA 5I6DA 2Q9UA 4X1KA 4Q00A 2GGSA 1S9HA 3K0BA 2ZM5A 4KPFC 4MP3A 4LY0A 2IF2A 2AZXA 4NWIA 4EF4A 3BDAA 3IVXA 3PHCA 4JU8A 4GBJA 5DHTA 1G98A 5MFPA 5IWAB 2PT7A 4C06A 1N6NA 3ENNA 2XGSA 1V5IA 1ZLXA 1C5KA 1BJTA 1JH8A 4KXYA 2EKQA 2Q0HA 3OPYB 5LYJA 1FQKA 4O1HA 5BRNA 1UK8A 3HDTA 5EIFA 5REQA 3VKUA 3NDBB 3AH8A 5DYIA 1WQ3A 4CLXA 3LHIA 4G5OA 1SB9A 1EFLA 1R4MA 1ZWLA 2C1ZA 2H4FA 4G67A 4PSDA 4QQFA 4ZVSA 4CLOA 1NXXA 3VX3A 3LHDA 3SG0A 3U56A 1P39A 1ZGAA 2PSJA 1NW4A 2K6GA 3IIMA 4QELA 4R54A 5K3AA 5I4BA 3PRHA 1PFUA 3GCZA 4CF5A 2YHUA 5FPYA 2R4QA 4LZJA 1Z5PA 5H80A 5GZ1A 3CUSA 4P93A 3HN7A 4AJOA 3IHKA 4DR4B 2YRFA 2OORC 4L8FA 2O5RA 3GROA 3GP8A 3I0MA 4B2PA 1U28A 2WKRA 2Q5FA 5LNK6 3W77A 1BU5A 2R6AA 3GK3A 4U0KA 4DMFA 3DXXA 3I2FA 3OCCA 1CJBA 4LYJA 4F3CA 5DI3B 1XO1A 3RC2A 4I50F 1PZNA 3CZAA 2XOKD 3OIGA 1POXA 3R2JA 3HH8A 4J2TA 5ECGC 2FUNB 3UCEA 2W90A 4YV7A 8AT1A 2P6RA 1E2UA 3OHSX 5LL6P 4FMDF 4HQLA 5D51S 4AWAA 1U8TA 2AL7A 3FLBA 1KC3A 2EKPA 4PZDA 4GRAA 3DXYA 3AWIA 4UEOA 4RW0A 4ZJZA 2WOOA 3D6JA 3PUXA 4XYEA 1M74A 1SH7A 1T25A 3ULKA 2XUHA 4U7WA 2X9GA 1KFEB 5A4JA 5ALXA 5A0TA 1X94A 1VJGA 2JJ2D 4YRDA 1QZ3A 4YRRA 2HO4A 3DXZA 1L5MA 3G3EA 3HACA 4R0NA 5G1OA 2PKRA 3BZUA 4PC7A 4YRAA 1KGSA 1X1AA 3RR2A 5JS7A 4LFBB 2H00A 3BYZA 1DQPA 1TMYA 4UBMA 1ADCA 4C4PA 3KSAC 4PZLA 2W70A 3RSZA 1YRHA 4EO9A 1FYEA 2AD5A 3KQNA 4FGKA 2QM7A 5PGMA 3T9FA 2EP5A 3P20A 1I3OA 1SXGA 1IBKB 3DOJA 1TVMA 2HJGA 4GXQA 4U7FA 2PRJA 2WMDA 4FSXA 3BJEA 5EE9A 5DNUA 3NO4A 4X1YB 3KTFA 1JJFA 4DIFA 5AJTA 1EK1A 4B2LA 5DT2A 4BVKA 2I03A 4KPUA 5C7IO 1WTAA 3CLKA 2QPLA 3KB1A 1R4NA 3HCEA 4L4ZA 3VOBA 2CUZA 1SUIA 3OQHA 3H5RA 1P77A 4FP9A 5KAMA 3RADC 4F7WA 2MYNA 3H4IA 3B6MA 1YGYA 2YZ2A 3L05A 5DSTA 5E8JA 4IKOA 4ALJA 1IIRA 4FI3F 2G9RA 4KBYA 2ZYGA 1E3DA 3T5AA 1E3EA 2A1TR 1BGXT 1M2OB 5EEHA 4PZEA 4CG2A 2WAOA 1Q22A 5BWNA 2YQ4A 1K4MA 3DS8A 3KJEA 4DR5B 2FW0A 1V8DA 2OK7A 5HHTA 2JGFA 2NACA 2ASEA 1ADFA 3A4YA 3ETCA 2EJUA 3GGSA 3NRJA 4MLPA 2CNWA 1NJ6A 3INRA 1X39A 3U4DA 1SY7A 3BXGA 3QMPA 1KO5A 4ZI7A 2WWFA 4C6HA 4J0HA 5HX7A 1FIUA 1GADO 2X9NA 5IJ9B 4Q34A 4EI7A 4GX1A 2H9AA 1TYZA 4ZT6A 5FXMA 2X0IA 4E7OA 3WBBA 3VR6D 1GQOA 1EM6A 2ZKIA 3EG9B 3P19A 1UZMA 4LYAA 3V1YA 3ZWQA 1J09A 4BNDB 3MGBA 5A1TA 4JLUA 2O19A 3KQVA 3QPWA 1E2NA 2Q50A 1WMAA 2V8OA 2ECPA 4NONA 3CKLA 1IHYA 3ICWA 4N41A 1WXIA 4DLTA 3A3OA 2BRUA 1BOOA 2I4NA 4P3YA 2YFYA 4J0FA 4K0RA 1EFCA 3EK2A 4LXHA 3H2KA 2GPAA 4TSFD 2PH5A 1IK4A 1LQTA 1UDBA 4X95A 5CXSA 4UDXX 1MR3F 3EJWA 3PGJA 1BE1A 1T2CA 1UK7A 2J9GA 4V03A 2MSLA 4L9SA 4Z9XA 2YIJA 2AT1A 3QWIA 2WUDA 5DNVA 3J81k 1JWAB 2HLHA 2P6NA 3F6EX 3FVWA 5C8YB 3SC3A 5JZBA 5KWJA 3L0OA 1W4LA 4KR9A 4K6FA 2OZVA 5L3QA 2JLCA 2ZAMA 2DHDA 3IIIA 3WHKA 4F71A 2N42A 5B6IA 3W5CA 2MSWA 3KKZA 1Q7RA 3QJYA 4G5FA 5LP1A 2GAIA 2NU6A 1TPYA 2B9VA 1D2NA 3DV2A 4KC0A 4BUJA 1JEAA 2BBWA 4KNWA 3T7RA 3NIWA 4IDCA 1WVIA 1E3WA 1GLVA 2CXNA 1PR2A 4L07A 4OAPA 1JG3A 3IUBA 3ND5A 4TUYF 1HY3A 3KKQA 4CKWB 1D2CA 2QL5A 1E2DA 3W5AA 6CHYA 5BP7A 1SCKA 2GTIA 2RGBA 4ENRA 1Q77A 1QHSA 4NIMA 4GYKA 2DC1A 3MT0A 1I0IA 4GWKA 4XUDA 2FE1A 1O6GA 3NM5A 4OHXA 2JAXA 4O4JA 3UW1A 4C0BA 4H15A 2V9CA 4X1OA 2Q4EA 4RNDB 1HA3A 4IM7A 1DPGA 2XUZA 3NGMA 2O2ZA 1HLPA 4G9GA 1BIFA 1NQ5A 1OR8A 1XAIA 1XCBA 4MKFA 5DM4A 2VI5A 3EXEB 2C96A 2NZ8A 3PFNA 3DZHA 4B6GA 5JEEA 1WZNA 1HM5A 4U7HA 4C6TA 1E6CA 4KAJA 1JX6A 1JHAA 5COQA 1KBQA 5H83A 4DTIA 4XYLA 2P77A 3ND8A 2PAFA 5FD8A 1X1EA 2BFEB 2V6GA 1Q17A 2ZUBA 3CE9A 2F43B 3CO0S 3KJZA 3LC1O 4CDRA 1L8QA 4F2DA 3FCUB 1M73E 2FF7A 3E22B 2BW0A 3NNNA 4D9NA 1DKQA 2C0PA 3VJLA 4DIMA 1FJXA 1QO9A 1NF3A 1VHWA 4KOAA 5AKJA 5BQ3A 5BVHB 5JXGA 2OHFA 4TRJA 4HDNB 4K81B 3NDIA 4IJMA 1Y5RA 2RARA 1KFKB 4XUGB 1EUCB 4B87A 4FLMA 2YZNA 3DLBA 5AHOA 4K9DA 1ZMRA 1SCNE 5KMGA 4OAOA 1WB6A 2X9LA 3OO1A 5HKKD 4EYSA 3WLSA 4ETNA 5JFTA 1YFZA 2EWMA 1PZMA 4AROA 3AFIA 3W5DA 3BJMA 4LBZA 1A8HA 1E2FA 1OAKA 2CK3A 4ZKEA 3BM5A 4DBZA 1AH2A 1E9CA 1GFWA 5JCJA 3EUAA 4X8HA 5LFAA 2YH2A 3FSJX 3V46A 5F9HA 4B82A 1B0UA 1PT8A 2QSJA 4NK4A 4OQZA 1E0AA 4CMEC 1CQJB 2AXNA 4YLGA 1NVUQ 1OLOA 2W6ID 3MCAA 2XBLA 4ZOBA 1MAWA 3T3PB 2AGVA 5ERYA 1A04A 1DRKA 5TMDA 2OZPA 3ZHOA 4KQIA 3VPAA 1LSJA 2YJGA 3IE1A 4OUDA 4TL9A 2D7JA 1PGOA 2E4ZA 4RCZA 5FL3A 3UHAA 3DZKA 4A5SA 1L7OA 3QU7A 4U8HA 2K4MA 4LVUA 4ZYYA 1CNMA 1H2HA 2V03A 3BOSA 2A84A 2FU5C 3LRPA 4INJA 4QJBA 5DM0A 1RZRD 1M66A 2ZWMA 4QNNA 3DKIA 1N75A 3WOHA 4BP3A 1EWRA 4D9CA 3CPJB 3TCKA 4PCAA 3M5WA 4AMVA 2G5TA 1BNCA 2YINC 1GIAA 4FNOA 5FPHA 5IXSA 5JY1A 1X14A 2J3JA 2ORED 2XIQA 3V6LA 5A6VA 1QH0A 2Y1FA 3STWA 1RKVA 2R5FA 5AUNB 1DXQA 2CDRA 5CVEA 3EVAA 3A14A 1J0XO 1MKYA 3AP1A 4M8LA 3MMXA 2V74B 5IUKC 4KE8A 4DRXA 3CX4A 2QUJA 5CT9A 3E3AA 1DELA 4FVTA 1JBEA 1DLJA 2UYQA 3LCMA 2BGRA 2V4ZA 1U0EA 5I51A 2XCIA 1TI7A 2J3LA 3WYBA 3GMDA 5KYWB 1IE3A 1OXMA 2RHMA 4G1MB 5A7GA 4B35A 3L0DA 2QU8A 4PSKA 3H1PA 3OY2A 1YHZA 4ODIA 2I5PO 1IZ7A 2REXB 2YWEA 1R8YA 3FCCA 3VU1A 5KYGA 1ZY2A 2VAMA 3G49A 3H5NA 5DHPA 2DFTA 3ONEA 1PJCA 2BUAA 4NH4A 5ECDA 5FBHA 3ZYCA 3KQUA 1G7TA 3ZIDA 3QX3A 4GNRA 2GN2A 7REQB 2AN3A 2QPOA 2VPQA 1BO6A 4LTMA 4AJPA 2OCBA 3Q88A 1A5AB 2FFRA 3PXUA 4PGAA 4BU1A 1M7BA 1ZEJA 2SKCA 5DGXA 4LXIA 3TLKA 4MA5A 5CA0F 2WG1A 1PWYE 1EX9A 4MW5A 4MUAA 4URUR 3UKJA 1TJPB 3EA4A 1Y7TA 2AJ8A 2BLLA 2JHPA 2NOAA 3KS9A 1JJ7A 5GQSA 4PYJA 3RJ5A 2C2OA 5LPNA 3NXKA 2WIKA 4J6EA 3UY4A 2I54A 2I4RA 4GMDA 3AR6A 3R3UA 4RXMA 1G5TA 2W48A 3U4GA 1U80A 1WTCA 2WU0A 2H0RA 5IBRA 1RMYA 1R6BX 5AD1A 2W4MA 2Q6TA 1PX0A 3ZHYA 4PY2A 2OOKA 1L0BA 1NW8A 5LD2C 3CUTA 1H4TA 1U3FA 1OA1A 3KD2A 4LK2A 4BVJA 4CCWA 4OP1A 4DBVO 4EG8A 4GPTA 1FX0B 1RLTA 1TF5A 1V8BA 1BMQA 1MTZA 3N7TA 4CEJB 2IY8A 2AZTA 1P0PA 3O8LA 1RRMA 4K1LA 4AU1A 3CLTD 4N3GA 1PQ4A 3IA2A 1E9SA 2CVHA 2F17A 2I2FA 2O06A 5IJAA 3UWOA 2AYYA 1UQTA 4QAQA 3OWHA 2R6FA 1HOXA 1XQ6A 5DGHA 1NX9A 4RPCA 3VO1A 4H7HA 2O8FA 3GCGA 3NAQA 1L5OA 4C76A 1IATA 4EK9A 1K92A 1N9KA 1N7HA 3RS2A 3DEZA 1MOPA 3DOEA 3DTTA 2R5NA 2I1VB 5CDTA 3NBAA 2QZJA 2AC4A 1ZESA 1DO0A 3BRSA 5K6AA 2GD1O 5JCOA 2DHRA 3E7DA 1L5QA 2O2GA 3WK5A 1NIJA 4KPGA 3SQNA 4WEQA 1RE0A 4M8IA 2G1UA 1LC0A 1NW5A 2PR2A 4JT8A 1EBUA 3GRCA 2C2BA 4MB2A 5DT9A 1NUAA 1X8XA 4EPTA 5C51B 1FTWA 4B5LA 1ZH8A 2JFBA 2OE2A 3KSUA 4AYTA 4JQZA 2OHGA 3BKWA 2E89A 1JVBA 3QEJA 3MGAA 4PYQA 4OHKA 2GEBA 1FQJA 3G8CA 3HADA 4P4NA 3AFMA 1PJTA 5T41A 3N07A 1PJ8A 3MRSA 1WZIA 1I4OA 1M10A 3C5VA 3PSAA 2XEXA 4NHEA 2V4MA 4X7MA 1AN9A 2C3YA 4D1YA 4L6IA 3OU6A 5EPOA 4OXYA 3IV6A 1HLGA 4FC6A 2OZEA 3NUGA 2MYUA 4A36A 1YF3A 4EO7A 3UOGA 1Y7IA 2B4RO 3KYDB 3O90A 4MHOA 1XXLA 2FK7A 4DRXB 2Q41A 1QR6A 4BN4A 4KWCA 4PEVA 4V0ME 4EUHA 5B58C 4N47A 1JPVA 3A9VA 2VYND 2DFPA 1MTOA 1JRLA 3OF2A 3U31A 4TYWA 3IAM1 1HLFA 1XRPA 2B6HA 1L5GB 1RVDA 3MJFA 1ODIA 3Q8LA 2YZMA 1IUKA 2O8DB 4MPTA 1K97A 2QMYA 2VH1A 3EC1A 4XYBA 2FG7C 3GP3A 1CUJA 2X1VA 4ZQFA 3O31A 5K2MA 3KV3O 4P7BA 1DUVG 2PHZA 1U7HA 2ODWA 4QTXA 3FPAA 2C2GA 4K9KA 1E5QA 2PYDA 5CK5A 2YIDA 3H5LA 1IK6A 4Q19A 3TBFA 3ZI4A 2F9MA 2POCA 2XMQA 3G2PA 3X1YA 4HEHA 4EKGA 3WIDA 3WRWA 2DHCA 2D2IA 1W93A 1O5IA 1V7QA 1XTJA 1KWGA 1EYZA 1NOIA 3STVA 4DA8A 2HHCA 4L9RA 4OBWA 2CLHB 3X2FA 4ARBA 1Z2AA 5LBTA 1L5KA 2IYRA 3A4NA 4QSHA 1PG0A 2XYQA 5KVSA 2EP8A 1N5OX 5J63A 2HSEA 4U7PB 2X4DA 5EP4A 1HFEL 3VAYA 1M67A 1U9ZA 1VG9B 3RS9A 4CHGA 2J09A 2OKCA 1UWKA 2QLBA 4LOKA 1MW8X 1ODTC 3HXKA 4WNCA 3ELBA 4HOYA 5DH9A 1OWMA 5JI2E 4KKVA 3VAAA 5K8VA 2I8LA 1YQEA 3ASYA 4S2EA 1YQQA 1U5CA 3OJEA 1JHVA 1V3VA 2SKDA 2Q62A 4XIJA 5JT1A 3WDLA 1QF7A 2F3PA 1M6YA 1GLNA 5C9ZA 4OHBA 3ETGA 2HSWA 1H2BA 4G0UA 4ZCMA 3SBOA 4J90A 5GM2A 1E2KA 1K5GA 1CY2A 2JGEA 2QT1A 2J33A 4CLRA 1ZHOA 5SYNA 2BEKA 3VR1A 3TTTA 3OPVA 5EWLB 3AEZA 1NYTA 1RLUA 4ZGGA 3I5UA 4CM3A 3CVXA 4AY5A 1OKKD 1NTRA 3DL2A 3AM4A 4I8DA 3D6HA 5CRIA 5G0SA 2H2GA 4L8YA 5ILQA 4YRJA 3V4VB 1FQOA 2V5VA 4IEEA 5K01A 3LFHA 1C0IA 3EH1A 1Q7TA 5MHTA 1GGFA 3BCRA 2Y93A 1P2FA 4IJKA 1W29A 2VUIB 5LQNA 1Q12A 4M83A 3CNHA 3PUJA 1E2BA 4OU4A 1I01A 1WS6A 2KLBA 1O96A 3CF0A 4Z53A 3PDIA 4R40A 1DAPA 4B3DA 1ZN9A 2RH8A 1WZ2A 1CB0A 1N2CA 3LNCA 5JALA 4YJ2A 1WY5A 4KQGA 4RVSA 2AEFA 4J16C 4MVJI 5ILGA 2XVAA 1IOZA 1SB8A 4X44A 3AY0A 2PYZA 2HIMA 1PP4A 2BEJA 3E8SA 4OYRA 3ZQUA 1UADA 4YT4A 3K4PA 2HNKA 2M6SA 2AR9A 3QVSA 4Y2XA 3ELYA 2Z2YA 1CERA 1TEVA 2ETXA 2YKGA 4TQAA 1VPDA 2IZ5A 2DJIA 4PZZA 4ZQGA 4F2PA 1GAWA 3WRYA 2A7XA 3EQ7A 1QVZA 1XMPA 4J1TC 3PUZA 4IYRA 1ZAYA 1AK2A 3ZE9A 1X0VA 3W5VA 2HA2A 2JVIA 4QBFA 5JZMA 3SYRA 5EUBA 2BCEA 3QLUA 4RHTA 3EUFA 2W71A 3B6ZA 4TZ6A 5KZMB 3Q0EA 2CKMA 2NYVA 2X8JA 4GXRA 1FU7A 1PNOA 2RHRA 1P81A 1KZ9A 4OGLA 3L1UA 2D1TA 2GKOA 1ACLA 1SBNE 2X41A 3BD9A 4JVMA 5FUWA 1C4OA 4G5SA 3VX4A 4AVYA 4Q7EA 4AJIA 5CLJA 5HJ7A 1SUSA 1ICIA 3HB7A 5ERXA 1WDWB 1WHTB 3CEMA 3FFXA 5SYAA 2Q7OE 5LN1A 5AVWA 1PX2A 2C88A