2Z98A

The crystal structure of azor (azoreductase) from escherichia coli: oxidized azor in tetragonal crystals (the resolution has improved from 1.8 (1v4b) to 1.4 angstrom)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
200
structure length
194
Chain Sequence
SKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expansion of Substrate Specificity and Catalytic Mechanism of Azoreductase by X-ray Crystallography and Site-directed Mutagenesis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords FMN-dependent NADH-azoreductase
total genus 75
structure length 194
sequence length 200
ec nomenclature ec 1.7.1.6: Azobenzene reductase.
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2z98A00
1QRDA 3NHUA 1RLJA 1AZLA 2ARKA 1FLVA 3K20A 2Z9CA 4YAUA 2QX6A 3KAPA 5ULLA 4C76A 1XI2A 5LJLA 4QOFA 1B1CA 1FTGA 2MT9A 1QHEA 1AKTA 2Q62A 3B6IA 5B3KA 5F4BA 3ZHOA 3OWXA 1QR2A 3F2VA 1F4PA 1AKQA 1AKVA 2OHHA 2Z9BA 4H2DA 3TEMA 4C0XA 2BF4A 3NHJA 1AKUA 1GG5A 4D02A 1QBGA 2Q9UA 2M6SA 2FLVA 3B6KA 4ZVKA 5NLLA 1TIKA 1BVYF 2B3DA 2BZSA 3N39C 3R6WA 4QOHA 4ZVLA 4ZVNA 1RLIA 2ZKIA 3ESZA 4GR9A 5B3LA 4LTNA 3NLLA 1OBVA 2QX4A 4GI5A 1YCHA 3F6RA 3OVMA 4QOJA 3OX3A 4BMOB 3L9WA 1C7EA 3KLBA 3HR4A 1FUEA 3TE7A 4HS4A 1CZHA 3FX2A 3B6MA 4F8YA 1DXQA 3OWHA 3U7IA 4ICIA 3FW1A 1YDGA 1FX1A 3UXHA 4C14A 1CZUA 3SVLA 2FVXA 3EYWA 5A4KA 1J9GA 2FZVA 2BN4A 3N3BC 4U7HA 4C0WA 3EDOA 1T0IA 1CZRA 5EA2A 4BMPB 4DY4A 1J8QA 1H66A 4Y9UA 1CZLA 1WSBA 2X2OA 3GFRA 4YQEA 2FOXA 2MTBA 2V5VA 1ZWLA 1KBOA 1D04A 3NHRA 1AMOA 2R96A 4Y9RA 1AKWA 1D4AA 3NHWA 1YRHA 1CZOA 2QR2A 2OHJA 2QX9A 3GFSA 1TLLA 4XDGA 4PTYA 5TGZA 3UXEA 2BPOA 1FLAA 1XYVA 2QWXA 4FGJA 1OFVA 1OBOA 6NULA 2MOKA 4LTMA 3GFQA 5LVAA 4PU0A 3NHYA 1DXOA 2WC1A 3NHSA 3FVWA 3OX2A 4LA4A 4N9QA 1JA0A 3LCMA 3W78A 1SQSA 2D5IA 1SG0A 2KLBA 3B6JA 5NULA 1RTTA 1T5BA 2QMZA 2V5UA 4FX2A 3TZBA 3QFRA 4S24A 4LAFA 3OJWA 2X2PA 3HLYA 4ESEA 3NFRA 3NHPA 3RPEA 1E5DA 2RG1A 3GAMA 5EMNA 4LTDA 1CZKA 2OYSA 1FLDA 2OHIA 4YAFA 5LJIA 4N82A 1DX9A 1XYYA 4PTZA 1I1OA 4QOIA 2FCRA 4YALA 2BMVA 5F12A 3S2YA 1V4BA 5JROA 1D03A 3K1YA 1J9EA 3LT5A 4R81A 3O2NA 5LBTA 4DIKA 4FGKA 1CZNA 1AHNA 4OXXA 5LMCA 1ZWKA 3NHLA 3ES9A 2AMJA 4YAOA 3FJOA 4Y7CA 4YAWA 4ZVMA 4HEQA 1XT6A 2N1MA 3ESYA 3F90A 3JSXA 4N65A 1X77A 3NHKA 5EAIA 2R97A 3G5MA 2FDXA 3N3AC 4J8PA 4QOEA 4XDHA 2M6RA 2Z9DA 1VMEA 2HNAA 1JA1A 3O73A 2QMYA 5FA6A 5LBUA 4CF6A 3L9XA 4H6PA 3W79A 5LLDA 3NHFA 2F1OA 2Z98A 4M0CA 1ZX1A 3KEGA 4QODA 1KBQA 1YKGA 3KAQA 4U7FA 3OX1A 3P0RA 1FLNA 5FX2A 4CETA 1YCFA 1NNI1 2MWMA 3ESXA 5FUQA 2A5LA 4NULA 3OJXA 2FAXA 4U7GA 5F51A 2FX2A 1FVXA 1YCGA 1J9ZA 3W77A 4DILA 1AG9A 3FNIA 5BUCA 2W5UA 2XOEA 2QX8A 3QE2A 2KQUA 3D7NA 3QFCA 4GQIA 4NLLA 1H69A 1AKRA 1C7FA 4FGLA 1YOBA 2FZ5A 2HNBA 2XODA 2GSWA 3F6SA 3U7RA 4QOGA 3W7AA 2V9CA 1RCFA 3HA2A 1BU5A 2HPVA 1WSWA
chains in the Genus database with same CATH superfamily
1ZSVA 1HSOA 4PV7A 3U7HB 4OREX 2DQSA 2HR1A 4JI7B 2Q4DA 2JHPA 4G0WA 1ESDA 2BBSA 2QUIA 4ISCA 3B6IA 3IQIX 1EX9A 4GXQA 3MEQA 4KPFC 3TNJA 4DMLA 1CQXA 5MDHA 2XAUA 1FQKA 2Z8YA 2Y9PB 2IEAA 1TCUA 2QTGA 3ECAA 1TZBA 1R37A 3HDTA 5LQMA 1N33B 2NZUG 2O6LA 1GNLA 4I9NA 4J75A 1K3UB 1PGOA 3NP7A 3UJBA 1E7RA 1A95A 2R7AA 2X8JB 4K0KB 1Z4NA 3ZDDA 5LKAA 4JY7A 2ZBQA 2B4KA 3MA0A 3W2IA 1QLJA 4IOLA 3U39A 3OX3A 4NH0A 4H4EA 3G5LA 3W6UA 1YDWA 3HJUA 1EUZA 4I81A 4LXUA 1B42A 5EGNA 4P4NA 1Y1LA 3ORHA 4N5IX 4TOIA 4ZT3A 5EJ2A 3NBYC 3DCNA 1OFIA 3T06B 3TYXA 3ISVA 1FFXA 3HBAA 2F8LA 2DR0A 2A4KA 2WWIA 4C7MA 2HRDA 2WINI 3VAZA 2ZRMA 2J4DA 3N8KA 2RJ3A 5AUQA 5KNDA 2QK4A 1A2QA 5EL0A 1I1QB 2B0CA 2QLFA 4CIYA 3KL2A 1GHTA 1MXHA 1RRKA 1A96A 2HF8A 5AKJA 3W1VA 3WBFA 4CCWA 4U7DA 1H9CA 3SXJA 1CZOA 5C5CA 5JECA 4WFIA 2CB0A 1L7OA 1XJCA 2IEZA 3HJNA 3CZQA 4XYLA 3JAKB 2HLDA 2NT4A 2XDWA 2OLEA 4D3FA 1J25A 4Y6PA 4BVEA 1A8IA 1ESCA 3D31A 1NONA 1BE6A 1Q0UA 2B4AA 4ITRC 2ICAA 3MJFA 4BNHA 4NBWA 3ILVA 4KQFA 2DCUA 4PZYA 3TQOA 3VJMA 3KYCB 4AD8A 2PHZA 4HADA 3AF4A 1V96A 2EHJA 1NTRA 2OXTA 1G38A 3AR9A 4H6VA 2WIBA 3CLRD 4LF9B 3BRWD 1BD4A 1YJAA 4ZKDA 1QIJA 2XQKA 3L84A 2WT4A 3I34X 5FPPA 1KIMA 4YRTA 3JD3A 2R4UA 4ZZ3A 3KJFA 5CIQA 1C1XB 3C5EA 3FPJA 2FEMA 3K7EA 1ULUA 1T8YA 1UBSB 3HYTA 1G42A 2D2XA 2N1MA 4HNAA 4LSMA 3L8ZA 1V45E 1ZFNA 1Y89A 3A1SA 4DG8A 4FKZA 3PQEA 4CCYB 4A15A 3MD0A 3V1KA 3CKMA 4C21A 4IDQA 3NCHA 3I39X 1HE2A 2OHVA 1GFWA 1KZ6A 2ZU0C 1BE0A 1UMBA 3CBGA 4GL4A 4YRSA 5AM5A 2JH8A 3C4QA 1FFHA 1DZ3A 2WHQA 3ILXA 3L7OA 4BAUA 2OGSA 2Q6LA 3W5SA 2JLZA 3V80A 3LIIA 1NVXQ 1RWKA 5ED4A 1NNI1 4GP7A 1QE3A 4CM8A 2Q3HA 4N0MA 2H0RA 3QG1A 4M1EA 3KTFA 2WF7A 1HO3A 1P6UA 4EM6A 1HR0B 1QOQB 3PLAE 5K8TA 4TN5A 2OLJA 2X6TA 2XNCA 3KU1A 5BVHA 1E2JA 3KYJB 4PXAA 3SJBA 3IURA 1X38A 1O94C 2MSNA 4QNNA 5H1YA 5I7AA 4ZEMA 2B5VA 4R16A 1P9LA 5A9SA 1RXVA 1FLVA 3F0TA 4TWBA 2PRSA 5CIYA 4U1RA 2GN8A 1NV8A 2J85A 2Q6OA 1UJMA 3JWIA 5IBQA 5E6RB 4B17A 4MJ7A 1YVRA 2GCOA 4BJ5A 2GYWA 4JLOA 1UK6A 4KKXB 1LPAB 1A8QA 3HU3A 1RKBA 3D8SA 1THGA 4GZ6A 4KG7A 1FFCA 2DY0A 1ADYA 2SBTA 3C7CB 1U7DA 1VE9A 3HNPA 1XDSA 2PLAA 3K4PA 3KALA 4JAVC 3V00A 3W2TA 3C3DA 3IB3A 4RVOA 1ZM7A 2OP1A 4V0OA 3BH0A 5FR2A 2O5RA 2HV8A 5B7GA 2WR8A 2QUBA 4R01A 5JS6A 1FSSA 1UBCA 1XAJA 1O97D 1Z6AA 3TLCA 1LTKA 1C3VA 1ZESA 3AX6A 2B61A 1PJ2A 1FX1A 1EFDN 3I0ZA 1O6GA 4UBLA 3SJAA 5L3QA 5L7WA 1G17A 3SX2A 4EFKA 2VP6A 3QZUA 1PR1A 1Y3HA 3O75A 1K7FB 1V3UA 1M1YA 1VL2A 3EB9A 2XKKA 3VNBA 2HQOA 3JARB 1MH1A 1WXFA 5BY2A 1YRYE 1HLDA 1HEIA 1NKTA 2O1XA 1K89A 2JHFA 1KZ9A 2EQBA 2VHVA 2FOXA 2HTEA 3GFOA 4QXAA 5IVDA 2QL9A 5B57C 1AGNA 1XMJA 1ZC4A 1E2PA 2FKNA 2WJVA 4K1LA 4KZPA 2K5UA 4HFMA 3FGOA 5JQGF 4XRRA 3GRCA 2DPLA 4I55B 4RYLA 1QZUA 3L6RA 4ZMBA 4DPLA 1UWKA 1EXDA 3ZJVA 5HRUA 4E13A 2WFLB 4M7RA 5LUBA 3DXZA 1ZH8A 2HKIA 4K9DA 4GR5A 5DBHX 1E6KA 5EE0A 2ZAMA 1QFMA 1R0KA 3R77A 1UKBA 5C8DA 5CVTA 4FFRA 1DEHA 5JJIA 4A8JC 2FW7A 4EB0A 1CRLA 1L5QA 3SVZA 1EHCA 2PMWB 5EJFA 1TUEA 1UT6A 4Q9IA 2M98A 3QBDA 3DT9A 3IVGA 3M83A 2CFTA 3O7MA 2QMOA 3K0FA 1MAUA 1CQIA 3UZUA 4OM7A 4C4SA 5L95A 4CKEA 2OUIA 5DNCA 1ETUA 1SCAA 5CFOA 3AZOA 4WXRA 2P5TB 3NYWA 2NQ8A 2Z30A 2FSPA 3DHNA 2PZBA 5BW4A 1YXMA 2NO6A 3S40A 4HPWA 3T3GA 1JSXA 5KEIA 4I3HA 4B9AA 1OJLA 1WV0A 2OR3A 2PKRA 2R65A 4L16A 1I4OA 2C96A 2PXXA 4Q7EA 4QEZA 1YB4A 4MUFA 1D4ZA 2VJNA 4WLUA 4ZQEA 3U1BA 4JQZA 3TLBA 5FOWA 1XFAA 2KJQA 1NF3A 3FBTA 2QL6A 4G09A 3OPYA 1BO6A 5AK4A 3K1AA 1IZ7A 3UJ3X 3YASA 3FUXA 1CYDA 3BXGA 1OZFA 3ZDRA 2H2IA 5DXFA 1D0VA 4Q02A 3EIQA 2XB8A 1KH1A 1XLTC 2BF7A 3KK0A 3OTHA 4M1ZA 4JLPA 1JZSA 1Y6QA 1EBFA 2HA5A 2Q0SA 2Z1NA 1XEWY 2IXFA 3MILA 4JLUA 1ODJA 4MVCA 3ZWYA 5C4MA 2ZJOA 3JALA 4EJ6A 1YKGA 3TL2A 3V34A 4QT4A 4Z49A 5HJ5A 2JF0A 1XTVA 2GARA 1KPHA 2WKQA 2QF7A 4KO2S 4DHWA 2C4TA 5K4AA 1WZUA 1QZXA 1EHIA 4CYMA 1ISGA 1IOZA 2VSYA 2PQ0A 4YRKA 4NBTA 1J4AA 3DAPA 5AKGA 2I0FA 3CR3C 1ABEA 1XZMA 1C4WA 4N5DA 1UF9A 2WYHA 4H3SA 4IHJA 3VYSB 1QC5A 1WS6A 4GZLA 3UFBA 3SYMA 2FPLA 3DBRA 4ND3A 4P4UA 4P5EA 4E5KA 4E4TA 5CVJA 3CUTA 4CR8A 1L4YA 4IUCS 3NANA 4DY6A 5FI1B 3GU3A 2C78A 2ZI4A 3WBJA 3WY9A 4K6HA 1BDJA 2AFIA 3T4PA 1KJWA 1F06A 3BF7A 3C5VA 2B83A 4PLHA 3WDSA 5AVYA 2ZTSA 2CLSA 2HPAA 5I5GA 2YJTD 5DW0A 5JADA 3VGPA 3NX4A 3KP1A 5DPMA 1CUHA 1Z2DA 4LWOA 1QR2A 1MAAA 2ZAIA 3VX4A 3ZX5A 1V1JA 3KB8A 5DNUA 4ZCRA 1KQPA 3QELA 5G40A 4DE5A 4TTPA 1JKMA 1NSTA 1U99A 1XZAA 2JKYA 3CPHA 1PUXA 5E38A 1WZEA 2XSZD 4I1OA 4LXIA 3WKEA 1AD2A 1CDEA 1JPVA 4H1VA 4DQUA 2WSBA 1SVMA 2Y05A 3FOBA 4NZOA 5CW2A 4Q5IA 5ILOA 1A72A 2FN3A 1E5LA 1NF8A 2IHYA 3HUDA 3RS5A 4DA9A 1XV5A 5JAQA 1IG3A 2DP4E 3N1UA 3H9JA 4FDUA 1IK6A 3QKSB 2O7QA 3LNCA 3DDZX 3F78A 3L8YA 3OZTA 2R84A 4LCEA 4JQSA 4WIAA 1C29B 3ANXA 3EBOA 3V2UA 4F7WA 3PR3A 2GVNA 1EK1A 4ZO8A 1WW3A 4JVSB 4JBXA 1E9AA 3EZ9A 4BZQA 1KFKB 1YZUA 1SD2A 2R6ZA 2OOSA 2VT3A 4LYGA 2DFVA 1ZHHA 4TMKA 4MYSA 2H11A 3OI7A 5ICFA 5B1EA 2X7JA 5BWMA 4S05A 3DEYX 3PNBA 1EIWA 2I66A 2AMYA 2VUHB 4BLOA 3TBKA 1Q92A 5AI0A 3QFFA 2CNDA 4L9WA 5GONB 5U4QA 3G49A 4TXHA 5HMMA 1LPNA 1OQAA 3OHMA 4QPZA 2WIAA 1KU6A 3CTMA 4C2TA 1CUCA 2D1SA 2R8ZA 2WF5A 4OMCA 5MN5A 5FUVA 3ZGZA 1EGAA 3A3PA 2X2PA 3QHQA 1T4BA 1T4GA 5EUBA 3VO2A 1TUBA 3PU6A 2WQ6A 3AUKA 4FR5A 4XD7D 3L7LA 2YW2A 3O9MA 2SCUB 1U3GA 4P98A 1SUPA 1NM5C 1XZPA 4HXFB 5C51B 1Q3TA 2OHIA 5G1OA 3INTA 1R8YA 4NMXB 4P36A 4JC4A 1ZRHA 2FP3A 4HJXA 3QKTA 2HSJA 4LDPA 3RVPA 3JZMA 2FVYA 3B2NA 3GR6A 1IRXA 1CZNA 1UXKA 3UMCA 2BC9A 2C2MA 1A4IA 2QQFA 1PJTA 1X87A 4TSFA 4F5YA 2WWHA 3OCJA 3F3MA 5A3SA 5E3HA 2O8EB 1M7BA 2PFSA 3FR8A 2FPXA 2X0EA 2NVUB 4DLLA 5FUXA 1TKCA 4NYIQ 3VDXA 5HRAA 1TM1E 2D59A 2IBSA 3KZMA 3N3AC 3F46A 1DQYA 4RL4A 1PE0A 2I54A 3C85A 4UUPA 5AK3A 3RIMA 3H1PA 3W4KA 3WLAA 3PRJA 2R0QC 5CD1A 1R7RA 3FJ1A 1KMHA 2KSQA 1PLKA 3M4ZA 4HMOA 5D1HA 4A1OA 4EPVA 1JAIA 3CX3A 2NNLD 4G41A 2Z6AA 1QLWA 1BH6A 1YSCA 5CRIA 1I80A 4LBWA 4RSHA 5J4VA 2PM8A 2Y3IA 1SOUA 1M7HA 4M55A 4OI1A 4AZSA 1CY1A 1QJ4A 3DTYA 3C3YA 4EPTA 4HDMB 5EIHA 3L4SO 3WO1A 1NLZA 3AW8A 2RIRA 3I05A 3RI3A 4K9LA 1JIUA 1OLUB 4LWPA 1YOBA 3OLXA 3FI9A 1EFVA 1NATA 1UXIA 4CUKA 4XM2A 3A6LA 3UGTA 5KDOA 3DTVA 4LK2A 3U6BA 4Q19A 2GJAA 3D4PA 3BTVA 4ZQIA 3S2EA 4OLJA 1LBHA 2NLOA 2E89A 2YVLA 4N48A 1SY7A 3OQHA 1M6WA 1P2VA 4LZJA 2IOFA 2C4MA 2O2EA 5LJLA 2ZSAA 4G5HA 1E1QD 3ZE0B 1CY8A 3ZN2A 2QZSA 1YIOA 2XOKA 3EPRA 4IWYA 3KPJA 2Q2NA 5C4GB 3EGEA 4HAXA 1AKUA 5LU8A 5T64A 1JG4A 1JEYA 3KJGA 4ARIA 2PNFA 3NQ41 2IIQA 1J8YF 3N28A 4FFDA 4NU0A 3GH3A 1RLTA 4BQIA 2YHSA 2HXGA 1FXWF 4C0HA 1CXZA 1B3RA 3BSFA 3AHDA 3GFVA 2IYFA 1P1JA 2VVTA 4HX2A 3CF6R 4QUIA 3BOSA 3C4VA 1D5WA 4GXNA 4TV9F 4WMLA 4Y6OA 5FNZA 1H3NA 3I6BA 2AEFA 4C14A 5AW4A 2FWBA 3LOUA 1IOWA 2ETXA 4OQLA 5ALXA 4Q48A 5EEHA 2EYQA 3AJDA 1N78A 2JDID 3MWEA 4TRNA 2C0PA 4GYJA 2ERXA 3E5HA 4PNHA 2I8AA 3EUAA 1G4HA 3VVCA 1ZW1A 2B8JA 2PX4A 4RK1A 2HJGA 1FDRA 3R6DA 4PYKA 5DTRA 4NJMB 5H3CA 1Y1RA 1F4VA 4HX9A 1U80A 4TMZA 4MQEA 3U4GA 5LVAA 1U2GC 4LSZA 4EDFA 5JQGB 3I2GA 3RADC 1MAHA 1YHZA 1G5IA 1ORVA 1BQEA 2BHSA 2PFKA 3A3OA 3LJKA 2O4CA 1ZS9A 3L7BA 3QFTA 4P7JA 4Q05A 1YR2A 1SOVA 2O8CB 2EX0A 2KPOA 1Q21A 3R7SA 4OH7A 4HUTA 4MB2A 2QT1A 2BHRA 5ALFA 1CR2A 4B76A 4UM8B 3FKSD 4E5SA 1H2AS 2IDJA 2G1PA 3JQAD 1CUUA 3P32A 3RFFA 1F1BA 3R5FA 4RC9A 1N2CA 1FYEA 1VL8A 5FBVB 3ZXSA 2BEUA 2C2GA 4QOIA 4YEDA 3QJGA 5HIAA 1NVTA 1S89A 1OT3A 1R12A 3ZNQA 1WE2A 2EXXA 4DA8A 2QD2A 3CEMA 1WUYA 2R62A 3HWWA 4A3SA 4EPWA 1J1IA 2ZREA 4RF5A 2NQ2C 3WFIA 4A4DA 4E5NA 3TTTA 3Q1LA 3NC1C 1OASA 1DBQA 3H5NA 3SLKA 1BMFA 1W47A 3PZBA 3WTBA 3D7RA 1KYTA 3K9WA 3D3JA 4KQ2A 1AIPA 1U8TA 4ZGWA 1R88A 4WEQA 3VFDA 5K05A 4RTRA 4WUVA 4BC1A 221PA 3KLMX 3KEGA 4WZZA 1DMSA 5CUQA 3U48A 4CMIB 5TGTA 5AJVB 1CR6A 3AWIA 4PNZA 4DSOA 1D2EA 1E5QA 3L0BA 3BT7A 2D3TA 1WHTA 4O1HA 1YJ8A 3ZBTA 2V7TA 5DOVA 3EZYA 5CG2A 3FYUA 2KQUA 3UA4A 4Q9KA 5BPHA 3FSEA 2AFHB 2C98A 5EE9A 4RTKA 5FWYB 4GVXA 1H1LB 5JANA 1SK9A 1W85A 2XVXA 2P6UA 5KYXA 3O8CA 3PSHA 5SICE 3FGNA 2D74A 4PO9A 5B7PA 2CKDA 3H2HA 3RKUA 1PV4A 3PXEA 1O87A 4HMQA 1N9GA 3DC2A 4Z86A 1OBFO 1ZGGA 3IDAA 3K8QA 2QHXA 3Q8MA 1ODTC 2BBOA 4KO1S 2H16A 3NUGA 1N1DA 4LGCA 1C4OA 1RP7A 5KCMA 1LDNA 5JBNA 4MV5A 4JLKA 4LJ8A 4EABA 4W5RA 5BMVA 4RHTA 4R1NA 4LMBA 2NXEA 1UMDA 1M2WA 1N8KA 3C39A 1DAMA 2BI8A 1QUFA 1E62A 2AYYA 4UHBA 3WYBA 2O3UA 3A2KA 2PJDA 4QD3A 2PZFA 3H5TA 1NVBA 4OU4A 5HTKA 2ZEJA 4KTTE 1ZOPA 5LP6C 1J23A 5AUOB 2XXAA 4AY5A 4YRGA 3IEMA 2E55A 5JO0A 2D7CA 5TS2A 4H4DA 3EA0A 1H94A 3HDGA 2PUFA 1IBSA 4UTVA 1UXGA 2QAIA 3LLVA 4HG2A 4TLDA 521PA 3L49A 1L4HA 3FRHA 3ZWAA 3DZGA 1E5VA 2I2BA 3KQMA 1J07A 1NPTO 3DZ8A 4UKDA 2AOTA 4P81A 1GCOA 2EKPA 2XWJI 3PWSA 5DNWA 1LV8A 4ZANA 1K5PA 3U13A 3UMBA 4F8JA 3ZOKA 3VO8A 4DCCA 3HXPA 4LUCA 3EGVA 2QN2A 4HSEA 1P62B 1QH1B 5KIAA 2GN1A 5F3RA 5HKBA 3MIIA 1AS2A 4CNQA 3ICOA 3R8XA 2W7TA 1RQXA 2VRCA 3QUCA 2BGGA 3E82A 3H11B 4FYWA 1MORA 1CF2O 5A7FA 2AQ8A 1HDCA 2H52A 2V7EA 5G53C 3TCXB 3VR6A 4E7OA 3IO3A 2WA2A 5E2IA 1V16A 5EJ8A 3ZS9A 1OTYA 3SIRA 2V5UA 2DPGA 3FNFA 2G04A 1G6OA 1Y37A 1F60A 1GT91 3NAGA 1T5HX 3NBMA 2ZAYA 3IQDB 1QFXA 2OXEA 4JZYA 3WHIA 3GAMA 1XQ6A 2I6GA 2X4GA 5JJBA 2I65A 1LCIA 1BHSA 2C3UA 4XQEA 2V3CC 2HQSA 2XGMA 3I4CA 4EYEA 5K8IA 3WS7A 5J2UA 1CC1S 3RC9A 4Z0HO 3V8EA 5JDIC 1UKYA 1X1TA 3OQNA 2NN3C 4LG1A 1Y1TA 5H68A 3ZHQA 1KI3A 2FPRA 4N01A 3DV9A 4PIMA 1UPXA 2FXIA 2FG5A 3OM9A 1RRVA 4V0LA 3IJRA 4JU8A 1IEQA 5D3ZA 1JPUA 1S96A 1XCPA 4NBRA 1A8PA 4XVCA 3B9PA 1M9NA 4MQLA 2YVQA 3AM1A 1NQVA 1F2TA 2BGMA 2PKEA 4RK5A 1CUZA 4UULA 2CXTA 3N7UA 1JA1A 1CQWA 2WOJA 3HI4A 3BBLA 4J0HA 4TN1A 4W1RA 3TL6A 3K72B 4ROSA 1Q22A 1X7XB 5EE1A 3WI7A 2FFJA 4P80A 1P31A 2HAEA 4J1SA 4XPIB 2VAVA 5KTNA 3ZQKA 1W1WA 4DUYB 1IHDA 1NXTA 1P5ZB 1ZD1A 5DT9A 3AL3A 1GAJA 3I09A 2HMUA 5JY6A 1SR8A 2JGAA 1MRZA 1MZPA 2QL7A 4KQIA 2Z3WA 5G1PA 3GELA 3V7UA 4OATA 4KSCA 2QUKA 1OV6A 4HATA 2G76A 3RTDA 1Z18A 4YJFA 1I2ZA 2XNJA 5FTJA 2OHFA 3P7MA 3L43A 3E9EA 2FWNA 3T5DA 3SNHA 1PYOA 2DU8A 2R86A 2NUAA 4Q3DA 1XDZA 4F06A 3HN7A 5DX1A 3KC2A 1P2SA 1PG2A 1AB5A 4FNOA 3F2IA 3T35A 1WPRA 7ADHA 3ZWNA 3VR4D 2BR4A 2QI9F 1V1RB 1VMAA 2GEUA 1KPGA 3BMCB 2YRWA 3CWZA 1WB4A 3EQ6A 3SQMA 3T1YB 4BX2A 4GT1A 4N5LA 3IR7A 4CEJA 5JOQA 2Z9BA 1SRRA 4LVCA 2ZIVB 3UOGA 4GLOA 1BXGA 3TLGB 4MJLA 3OZAA 3JQFA 4JJZA 4H08A 3WX0A 4BVAA 5J2TB 5FNVF 1H1DA 2X9QA 2FPKA 2VS1A 3BMOB 4XX0B 4F3TA 2C9ZA 4O4HB 1UKEA 1V5WA 1Y3IA 5KJ1A 3OFVA 2YWXA 3BFVA 3ZU6A 2B6NA 3M49A 2DHRA 4D3ZA 3AHEA 4I50B 2WWYA 1NUTA 1C1DB 2M6KA 3SHQA 3KOWA 3TB4A 2I2XB 1FOEB 3U3MA 1PT8A 2VO1A 2DWOA 2H1WA 1MEOA 4JR0A 2GJ8A 2HRRA 3WK7A 3VJRA 2ADOA 1Z2PX 1PDOA 2WLSA 5E3JA 5BW8A 4LFBB 5DTJA 4RA6B 5LBIA 2PGJA 1VLMA 2AMVA 4P31A 5FWNA 1AUXA 1N34B 3RBZA 1RLMA 3AXTA 2XNKA 1WG8A 4M7PA 4NX2A 4DMMA 2B5WA 3F8TA 4FS3A 4C78A 4WCFB 1Y0BA 4RWEA 2FNAA 1OUMA 4C7KA 2V8BA 1HL3A 4P6VF 5C2JB 2C2WA 2ZSUA 1PCXA 2A0WA 2ZUWA 3DW3X 3LPCA 1Q50A 3ZE8A 3ZHZA 4Z7JA 4R6XA 2F9MA 1WHSB 1V37A 2A58A 3COSA 3S4YA 4BEVA 5DSXA 1PNQA 1YZVA 3RSCA 3W7VA 2N9UA 1N6LA 2FPPB 2RHBA 4V3CA 5AHWA 1PVDA 4F3CA 4UVGA 4DBLE 2IXDA 3LRXA 1I10A 3WL6A 1LBSA 2QTRA 2B25A 4JNKA 3W05A 1KZGB 4EPYA 4Q1EA 3UAWA 5HDBB 2ZXUA 1E3TA 4OIMA 3QOYA 1Z0IA 1GYPA 2GM5A 2P79A 4NI5A 1A88A 2GPNA 3OLWA 4BKQA 3OHSX 1NBEA 3PDJA 1OLXB 5BOSA 4K9PA 3M4YA 2YWFA 3JQ8A 4N3GA 2B0JA 1GNRA 4QQKA 2CZCA 4TUYF 1G0NA 2INGX 3RREA 1J0CA 4BMXA 4Z53A 2Y9MB 3E35A 3T4UA 2ZIXB 2QUHA 1E9BA 1FNBA 1OX6A 2ZWOA 3I64A 1NY6A 5G0VA 3MB5A 5K3BA 3C1UA 5IRCD 1KH3A 2HYIC 1J8FA 4EUFA 2YUTA 3U3RA 2R6HA 4AQYB 2EFCB 1HMYA 2JFFA 4RVNA 4D8VA 4Z3OA 1G7SA 3H5AA 3R1IA 5FRDA 1J2TA 3CF0A 16PKA 1THZA 2UAGA 3O21A 3AESB 3G0DA 3PXAA 5AQEA 2HXSA 5IN5A 1WKBA 4RVSA 3STYA 3V46A 1UC8A 1SQFA 2J4FA 3PNKA 4DAOA 5KX5B 1M6HA 2W5UA 2X2FA 4PZUA 1SCUA 4L3OA 5I47A 3C6XA 4X6XA 5FPQA 1S7CA 3D6VA 3E9NA 4DLWA 3CWQA 1B8UA 1Q1ZA 1RMYA 3VPFA 2O2HA 4RKRA 4AUEA 1ZZGA 4O2AB 2WZBA 1H9AA 3DDUA 3AI3A 1E6CA 5FPSA 2P9GA 1MP0A 1E8NA 4EYGA 5EN4A 4IS3A 2E6KA 1A9TA 2GM3A 3ENNA 4QUDA 4DANA 1OX4A 2HN9A 2Z09A 1FW8A 1V7ZA 3CU5A 3RSGA 4DYVA 5F23A 4I9UA 3ABRB 3CLSC 1ZA2A 3G02A 4GBED 4MKHA 2OO7A 3R7WA 3MJCA 1RFGE 4MCJA 2G5GX 1T6ZA 4BNUA 2F4VB 1X92A 4O4JF 5CDFE 5EVJA 3VDRA 4LOIA 2D1TA 5CVCA 3TSAA 4H1WA 2W2NA 4IF6A 5A7HA 1IPEA 1SVSA 4B84A 1UEXC 4YVFA 5EJGA 3UUFA 4HVLA 5LKRA 1AQJA 5DOZA 1U3TA 2TYSB 1VI6A 4MRAA 4BLUA 3AEUA 1JHVA 3DUFA 1ZO8A 3JQ9A 1ZVQA 1PN3A 2QVGA 3FSGA 2J1LA 2JRLA 4DA4A 3IUQA 4P4SB 4AKGA 3ZJTA 4MXDA 2P4UA 1POWA 2ID7A 5CA1B 2OSVA 1GGVA 3E9CA 1FDVA 1GP2A 4C0WA 5K4GA 2DSNA 3I1FA 3S6JA 3TXYA 1SU7A 4GDMA 3VRHA 2TMDA 3EQ9A 4G8CA 2JCYA 1P7PA 3B89A 3LP5A 3ND7A 5FOTA 5L4NA 3RWMB 1W30A 3TD6A 1EBBA 2JFVA 2ZR7A 3PEUA 3TAUA 2FDCA 5AVRA 2XKJE 3WHPA 3WKDA 4HLCA 4EF5A 3K09A 3NRCA 4PSKA 3DFMA 3X44A 3UJ8A 4P54A 1FIUA 1JRLA 1LBQA 2COUA 2RHMA 4LVOA 3TNYA 4L50A 1NJ2A 3BWBA 1V5GA 3BTOA 4BAZA 5IJ9B 3U7GA 5KTMA 1ZN7A 5AVOA 4ZZ0A 1DFHA 1SHLA 4LJ4A 2NZXA 4H1HA 4JP2A 2IWHA 2R9VA 2Y1DA 3DE7X 3EZXA 4AJ2A 1XYGA 2ST1A 1RQLA 1WKCA 3DZBA 3WYNA 4YMHA 1JWLA 1L7AA 3LHFA 2Q3MA 1GQFA 1EM6A 1MT0A 3BEOA 3NOQA 2I8LA 4EO7A 2PH3A 3C4JA 3KQSA 4N54A 1QCZA 2BONA 2IT1A 4EI9A 4E09A 1YQQA 5KYWB 3ESRA 1GNTA 1Z4JA 1NIJA 2GS9A 5CFZA 3AF6A 2FPWA 3LT5A 1M2VA 3OT5A 2QP4A 5DYNA 4GX1A 2R60A 1TMKA 5CP8A 4XM1A 3U7EB 3KR0A 2WU8A 2O3SA 4Y2YA 1LDGA 2X4IA 1FBNA 3QKIA 4ONEA 5ECGC 4RACA 4R9SA 1D9ZA 3AUJB 4ZHQF 1KDPA 3UUWA 5K1ZA 2CXSA 3NHKA 5EAIA 3CF4G 4U3JA 4Y9DA 1JBQA 4HN2A 1MC1A 3KOMA 1UAAA 4UUNA 1MOSA 2RGNA 3D2AA 3LBAA 1KBQA 1XGKA 2REQA 4ZEXA 2Q3EA 3A36A 3ZK8A 4C01A 5JCZA 1FLNA 5JXIA 2JIBA 3VC3A 4G4IA 3QQPA 3PE3A 4RANA 3HO6A 3TLMA 3T6KA 2Z5FA 1YJ5A 2PLRA 1TMOA 5DK4A 5IABA 3KKLA 1MPTA 2IYXA 3WNBA 3FF1A 5LP6F 5IEBA 4Z3DA 3QKRA 2QRVA 1JZQA 1V47A 1OI3A 2J6IA 3ZCXA 1QANA 5KCZA 1GEGA 2KS6A 5BNZA 3QWAA 3GLQA 4DRXA 2H1FA 1TF7A 3PP8A 3V7NA 5DM60 5DTEA 3I9FA 4L8WB 4Z1OA 3K32A 1E9CA 4EYQA 1LD3A 5IBPA 3AIIA 3CJTA 4PZPA 4RHCA 1JX6A 3TVTA 1WCWA 2DSTA 3DA8A 3CYFA 4QSMA 4WERA 5IKOA 7AT1A 1RE0A 4DMFA 4PHHA 5JHGB 1HG1A 1G2OA 4OQFA 4MPJA 2PY6A 4P3OA 4J0IA 1NN5A 4RLFA 3HBMA 3TAHA 1JFSA 3FCUB 1ZAYA 3DZFA 4FZ3A 4CF3A 1K1EA 2CC2A 2JAOA 2I9KA 1VJ1A 3F6YA 4ZVQA 3UJHA 2JFGA 3THYB 1DWOA 1JIKA 4L02A 2W6IA 4ZCLA 1PT5A 3MMPA 2ZPAA 1FXWA 4KPGA 4R2HA 4UAGA 1XE3A 4XI9A 4ZVVA 5J5CA 1WNFA 3KV3O 5K51A 4HV4A 1FYDA 2HA3A 1GDDA 3DFIA 2GCNA 4IDDA 3MLAA 1M8GA 1FP6A 4HCJA 4NCBA 2QR5A 4BNTA 4LY3A 1Q6ZA 3OZRA 4RMHA 1VM6A 1DX4A 2B7BA 3IX7A 5JNWA 1TJPB 2AYZA 2J3LA 1A7UA 2ZJ0A 3A9WA 4ZI7B 3NBQA 3UXEA 2A0KA 1QP4A 2AJ8A 4G4SO 3E7XA 4QPCA 1WDWB 4Q7JB 5A9TA 3C48A 1JECA 1NGSA 1JYSA 1XVVA 5NULA 4PQRA 4DABA 3N53A 3MSCA 3PD1A 4X95A 3TDKA 4MW0A 4RUKA 3LT0A 4X3CA 4C6TA 2HREA 5FLXA 4FM9A 1EZZA 1D8TA 3PUWA 1B7GO 2QJOA 1FQOA 1QZ3A 2JA2A 2Y1XA 4PYQA 5ITSA 1EFKA 1TDJA 3GXOA 4K88A 5JS8A 2KM1A 5EE5B 3ITDA 2A30A 1OLOA 3GGJA 2X9NA 4OY3A 4IEIA 1DDIA 5EJ9A 4JMLA 1D1TA 1D8AA 2GPYA 2VTVA 3ZQ4A 1Q7RA 2GDZA 4NF2A 2MSLA 4W9RA 4ZQFA 3UW1A 3HDJA 2VQFB 1XAHA 1YDFA 2O2YA 2V0GA 3ADKA 1QG2A 5EXTA 3VKUA 5FQNA 4PC6A 2QRLA 5BYJA 1E79A 1A9YA 2NM0A 3KPYA 5CX1B 4YUVA 1FFGA 2R6JA 1XTKA 1ZVMA 2J0EA 1C7RA 2Z3VA 2NSJA 3LDFA 4TRMA 3P9IA 1QHGA 3BXOA 4NL4H 5IJ0B 4QHSA 2JGFA 3GN1A 4FFBB 1PAUA 4MS4A 1USIA 4QTYA 1Y34E 1RRFA 2BAGA 1SVKA 2B4RO 3U0BA 4AJKA 4NONA 1X7HA 3DMHA 5DM4A 2P9ZA 4QGFA 2ECKA 3LUKA 3T5GA 1NN0A 2HWUA 4NVRA 4RBNA 4CTNA 4QC2A 1T13A 5E0OA 3VM6A 4UHDA 4G65A 5A6SA 3P9SA 1P9RA 3UHFA 3ZVKA 3BL5A 2JLVA 3GIWA 4M1YA 1OTXA 4DR7B 3OE5A 3EH1A 3NBFA 4F3NA 2VTEA 1SVLA 1PQPA 4PC2A 1E20A 4L57A 4C4XA 2E1RA 1JN0A 3M81A 1PGNA 4EI2A 1DAFA 2EBUA 2JGIA 2X23A 4KQ9A 3JQFC 2B6HA 3TD9A 1VBFA 2DFPA 4RK7A 3WHKA 2VPTA 4XSGA 4C0SA 4L6AA 5SYMA 1GLNA 1LZLA 3TSYA 2B30A 2BP7B 5KOJB 3JQGB 2A86A 3F8SA 1A8UA 3ASVA 5GWXA 4MQFB 3OLYA 5AK0A 3BM5A 3Q8KA 2OAP1 4GPEA 4WLVA 2MYNA 3WNVA 4DCUA 5JC1A 4TMYA 1UBLS 4ND6A 1C9YA 1BXKA 1BDHA 3IGFA 3KCQA 4NJEA 4RGQA 3S2SA 4AO7A 5FFFA 3U56A 1YA4A 4UTPA 2QNBA 2EBFX 2A9QA 4PQYA 3U81A 4N76A 5C8ZA 1TEHA 4BTVA 1NJ1A 3RKSA 4CQMD 3CVUA 1VZ3A 1GAEO 3SJ7A 4N6GA 4M3NA 4YGYA 3VTZA 2HPZA 4RCYA 4CKCB 2IHZA 4JYBA 1SA0A 3JQCA 4NOMA 2G9NA 3IV6A 4EYKA 1KMNA 1TZKA 3ILYA 1XDUA 2J67A 5KTPA 4RV9A 3T34A 5MN4A 2ZRIA 2ACWA 2CLCX 2CNWA 3M3HA 3MWDA 3RJ5A 4OHYA 2J9FA 2ES4A 3CH7A 2LNDA 1UADA 1XJ0A 4WY2A 1Z5GA 1UH5A 2ZVJA 3PF8A 4RD2A 2DTXA 3PF9A 1AXEA 1P1CA 2CLDX 2XD9A 5IZCA 4DIBA 5CM9C 3AUFA 4A5OA 2XXJA 1OR8A 3PFHA 5FLEX 2FJPA 3H65A 1WUJS 2CWDA 5I7WA 2EJTA 1H6DA 2O3TA 4FB5A 1E8DA 2XNDD 1Z4KA 3WA6A 4C4RA 5K0ZA 4ZRMA 1UDBA 3TGPA 2VUTA 1OI4A 4QFMA 4E70A 4ESEA 4MWTA 5EMMA 1U7PA 2VWGA 4FP9A 2VZEA 1MX3A 4HY3A 5EMNA 5IUKC 1MEJA 2IHTA 4OBWA 3G2MA 2P11A 4CMHA 4CDNA 1RQPA 2BFFA 1WR8A 1W4BA 2WJGA 4G1FA 2BISA 4WT7A 4Y2JA 1NDHA 4PNEA 1TF2A 3B1WA 1ACJA 3CNNA 3N86A 1NVFA 4M7OA 1AHNA 5AT1A 5BWLA 2DECA 5IT4A 4YT5A 3R5KA 2OAEA 4TWJA 1KK2A 2IJGX 2VYVD 3CLUD 3MTAA 5FYQA 3U37A 4E0BA 2X6QA 2CFSA 4EG4A 2RHGB 3H8JA 3Q85A 2WJHA 3W2FA 5GVSA 4M9ZA 4C3OB 2HHHB 1PFWA 3WRWA 4C2AA 3PEEA 4HB3A 3LY7A 4TL9A 4OQ4A 3IVRA 1HT3A 1YVEI 3OM0A 3TI9A 4F12A 5CFMA 1VG1A 1QG4A 2OKCA 3REGA 4BNKA 1DG3A 1OAOC 1YRLA 1YBFA 1SBHA 3EUEA 4H7IA 1X8KA 4IYJA 1TCCA 5J40A 3A1DA 1HC7A 4JP5A 4IIJF 1EYZA 3WWPA 2AJDA 1GUFA 3TTXA 2P2ZA 3WQRA 2GBCA 2QRUA 1YMVA 5THXA 5DYTA 3SU8A 2NZVG 1NJSA 3GI1A 4RIHA 2E5LB 2XVYA 3MOIA 4CQLA 2Y66A 2YFYA 1YQWA 2PWZA 3MAJA 3VNRA 3SC2A 3A4IA 1PYGA 3D81A 4HWSA 1R0ZA 4DUZB 2K2WA 2CV2A 2NU6A 4INJA 1G8GA 1M8FA 2FGJA 1L7QA 1RI5A 1QYIA 4JBYA 3RUEA 4LC0A 1U8YA 3D3KA 1GPAA 3E6AA 2YBDA 2P65A 5K5EA 3JY6A 2JVKA 1DIHA 5TB5A 4RDXA 3UW3A 1D6JA 5INTA 3P2YA 1KJIA 1VSTA 4FMPA 5EZ5A 1A97A 3QRWA 5TPZD 3AVTA 1JI3A 2I76A 5CBPB 3PCTA 3RAFC 3I5MA 2Q29A 1K27A 2IXGA 1J09A 1BVYF 1KAEA 2Z04A 3BCUA 3G9XA 4KWHA 4B8YA 1CUYA 1U2TA 5GJCA 4TWRA 1NVWQ 1A9XB 3W2HA 3EXHA 3B2QA 4FLFA 4CRWB 4UBIA 1UWLA 3AP3A 1REQA 2IIPA 4FOLA 4ACBA 5JAIA 1ZU4A 5K3DA 5TPWA 4URVR 3FA2A 3FUUA 2VNJA 2ILTA 1H2BA 4LKRA 4IJKA 1A27A 1IIRA 1E58A 2X9GA 1FP1D 2I6UA 4KB5A 2CE7A 2X7HA 4DLYA 1YTUA 2QV0A 2I78A 3IUJA 4HBZA 2BY4A 5J1TB 5KJFA 2QLNA 5KQRA 1XNRB 1S8FA 2HCFA 4RETA 1S2NA 1QMGA 2H5IA 4IIJA 3TBHA 3ECSA 3IS3A 4D0NA 2FQYA 3WQHA 4G56A 2FFQA 4J7AA 4AQ7A 4FOOA 1HL7A 2CJPA 3H1FA 1V11B 4II2A 3FUWA 4MW4A 4Q12A 3FGPA 5EHNA 4G0YA 2PUJA 3TECE 4F3YA 4D42A 2QQ5A 1P60A 2IEIA 5TY0A 3TRIA 3QE4A 4JDUA 1MQ9A 1P4JA 3WRYA 5A2QA 2QENA 3CZAA 1XD2B 4B5LA 1UT8A 1XF1A 3C98A 1QFSA 1XU9A 2QVXX 2Y1FA 4TSKA 4WDRA 2L17A 2CVFA 2Y1OA 5ESDA 1DKRA 1SUIA 2A84A 2QJWA 5EP4A 5AICA 4PO1A 1YJQA 4B3XA 3ND9A 4BFSA 4MUMA 5I7SA 1QF9A 2CYAA 1PZEA 2ZB3A 3AKZA 4O59O 2G4LA 3Q9LA 1MMFB 4ZI5A 1DFIA 1GQSA 1R5JA 1SHZA 2I1LA 3NRBA 1D7OA 4QDJA 4Q9HA 1W4RA 4P33A 4B2IA 1QO9A 3AIKA 3DVRX 5I8WA 2GT1A 4L4RA 4CF7A 2P2GA 3CE9A 7MHTA 1DC7A 4YRDA 3L6CA 2CLFB 3HCPA 1U1FA 4J0CA 4I1SA 5B4UA 3DXYA 1UOPA 5GONF 3MYRA 3DEIA 3X0DA 4GLBA 2CXQA 5EJMA 2DJIA 4MKIA 1OLSA 5FUBA 2ZIGA 1I13A 2VTDA 3EDRA 3H9UA 3JWGA 1Z4MA 5ADUS 4QQNA 2YY5A 4BRZA 4CMEA 1L5OA 3GNTA 1RXIA 3FMPB 4MUBA 2COKA 5D3MB 2XMBA 3O0DA 4YP1A 3A4NA 3AM5A 2MWMA 1LWOA 1QDUA 1Z2OX 2B34A 5CB4A 1UDRA 2C5GA 5TVGA 3ABOB 1PR9A 5K3OA 4N6NA 3H5WA 4B6PA 4JOCA 1KETA 3R9IA 3NGXA 3TCKA 1NMZA 5EG5A 1BDMA 5ADVA 2J6BA 2I7DA 2FPMA 1XO1A 3DO5A 1TU4A 2BJVA 5BOVA 1AKRA 3WZ2A 4H16A 1NXXA 5A2GA 1WMAA 3ZPXA 2HNKA 3I9V1 4JSRA 4AJHA 4ZYTA 1AN0A 2IYZA 2J87A 1PZXA 3BE5A 3HMKA 1X1SA 4QOSA 3EFEA 2ARKA 2IK8A 4YJHB 1O0CA 1CE8B 2YBEA 1TQHA 3PHLA 3F8WA 3HDQA 1A5BB 3KD2A 1ZGZA 4RX1A 1RBZA 1XI2A 5IKXA 5F9FA 2NQTA 1AC5A 1Z17A 3B6ZA 3FIUA 3ID6C 4C05A 5K2OA 4FZVA 3BXXA 1CUSA 2FMFA 5DCWA 5EWMB 4AMBA 4OMUA 4PHFA 4WQMA 3V9AA 5JQWA 3CVYA 1A4XA 1THTA 2HTFA 4ETWA 5KHLB 3DOUA 3K9BA 4X5OA 2AF4C 3LG2A 5DI3A 1NRXA 1PLLA 3OCXA 2ZKIA 4UD6A 1LPPA 4YQYA 5KVCA 1PDWA 2OAQ1 2BGKA 2EKQA 3R20A 5KTOA 5AI9A 1B3BA 4EEZA 1Y3BE 4FOSA 1P81A 4QDTA 3WBBA 4M8SA 1BMDA 4CL0A 2GF2A 1AUQA 3U9SA 2R8OA 4GECA 5E1BA 1K3FA 3PICA 1C9NA 3DVAA 1P7WA 3VC1A 4FN4A 2IYYA 2NXJA 3LQ1A 4O2BF 3T61A 2CNBA 1V8FA 1N92A 4DR5B 2ATIA 1NXPA 2P4QA 4FQ5A 1I6KA 3QM1A 4R1PA 4RHEA 3LUBA 5HIJA 3TTUA 3ZV4A 2V8OA 2ZVQX 2YJ4A 4EW3A 3V32A 2J0SA 4TYWA 2FW8A 1XTIA 2V6JA 3BEDA 1Z6GA 1DJQA 2IUEA 3A1WA 4KW7A 4UM5A 3KYBA 3OOSA 2PFGA 2GGSA 5I5EA 2B92A 2QN3A 2HSZA 3S2GA 2QP9X 5EJ6A 3OWOA 5IUNC 5HQTA 2O14A 1RAAA 4GIBA 4I1IA 2JS7A 4GXTA 3L6UA 3PR1A 2MSDB 2R2AA 4L95C 1LDYA 2LWIA 2R00A 2D5IA 4QU9A 2OXCA 4JLAA 1I7SB 4ZARA 1ZEMA 1CJSA 1CHNA 4FW9A 1GDTA 1FNSA 1V5EA 1I1NA 2F55A 1P44A 1Z2NX 5AHOA 2FJUA 4CLXA 5IT0A 4YFVA 3RS8A 3AQ4A 3IEUA 4HQNA 4G6ZA 2AOVA 3AVUA 1VI5A 4UUAA 5H3HA 3PTZA 2OYCA 4J9VA 4NESA 2OBXA 3L82B 4DJEC 5FEMA 3RSQA 2WNHA 2CEKA 4BWGA 3RIGA 2AWOA 5B1SA 1XPRA 1EGMB 5KOHB 3U7JA 4JOQA 4Q15A 1X0XA 5IDYA 1LDEA 1KVUA 1A2BA 1B2LA 2QGZA 3AF3A 3BORA 4DZRA 1KVSA 1XDDA 5HUQA 3VJLA 1E1KA 2O8DA 4F85A 2DT5A 3IUPA 3SS7X 5F9HA 1P4AA 1YS9A 4DT1A 2FUG1 2WRZA 4HNQA 5TF4A 3LU1A 3W8EA 4DZZA 2NIPA 4CF6A 1EM8A 1DLJA 2QU8A 3GCXA 3HEAA 4M22A 2ORYA 3AZPA 3NZEA 4QODA 3V7WA 4XRGA 1PR3A 5TQ0A 1TW2A 2PANA 1J90A 2BZ1A 4WXEA 3IBYA 3IXQA 4MX8A 1VBMA 3D43A 4ZGGA 4XAQA 2I7VA 3LP8A 1XLUA 3OU6A 4RKEA 4B48A 1JYFA 3D8UA 4R05A 3RRZA 5KWIA 2I6TA 1EEXB 4QA9A 3KPUA 4E3ZA 1EU1A 2WDPA 1IY1A 1WU8A 2VAPA 3W7AA 3CUKA 2H1VA 4C87A 1BU5A 4K7JA 5FLYA 4L2IA 1SHJA 5FCDA 3C8DA 1M8JA 2C07A 5F2OA 4HDSB 4K6GA 1N9KA 1U2SA 3ORYA 4FE7A 5IH7A 4DMKA 4HDAA 4QYTA 1K6EA 1D6NA 3KR2A 1G21A 3Q5EA 4HPXB 3DULA 3V2GA 1FTYA 2NSHA 4LXGA 3QHAA 2F43B 3K0SA 3TJRA 2PX6A 1CSEE 4AJJA 4EVSA 2ZIFA 4WXPA 5DBGA 2RH8A 4NEHB 4AS3A 3B3JA 2XCIA 1VJRA 2B3DA 4CM4B 4RF3A 1XRQA 3REOA 4ZICA 4UZFA 4WOJA 1N32B 3L8CA 3USZA 1B8VA 1VGVA 1LFDB 2C82A 4ZP1A 1W76A 3RU9A 3ZNPA 3PTAA 3KAJA 3NU1A 2BD0A 4NY1A 1YE5A 1VA4A 2O4UX 2Z2JA 2JGDB 3IVMA 5BW5A 3OZWA 2QLTA 3Q0IA 2OO5C 1PWXA 1U1EA 5T5QA 3DKPA 1XTQA 5GJVC 3WDKA 3ZNNA 4Q0MA 5FBZA 4HNVA 4XIFA 4FBMA 1M6VB 2C84A 2CXUA 4IEEA 2PSJA 5TDHA 3L1IA 2CBGA 3LCUA 3M9WA 2WKPA 1RXYA 1OGYA 1RYYA 2JI9A 2V5VA 1ZUNB 3AP1A 2VBFA 3Q2KA 4W5NA 2XCQA 4M1QA 3DQZA 2X1VA 3NBKA 3BF8A 4JB3A 1V9LA 4LE2A 1QQ7A 1R0LA 2JGEA 2Q1TA 2UKDA 5FT9A 1O0SA 4DRZA 5JS7A 3QFSA 3LT4A 3BCRA 3EGOA 3EDYA 2YJ3A 3EA5A 3FMGA 3G8AA 2B99A 4K2HA 2TRSB 2YS7A 2G8LA 4U7JA 1BC5A 1FSGA 1KVRA 5AI8A 3VC2A 3W1EA 2VUIB 5L3SA 4LDJA 1Z74A 3ZCRA 5JS1A 2ATCA 1NR5A 1DBIA 2XZDA 1GZ3A 2F3RA 5AYVA 4O4IA 1AK9A 2AI1A 1HRDA 2FP4A 2I2CA 3BMQA 4BQFA 1JU4A 3KQOA 3LOQA 3MGBA 5ALGA 3U26A 1P29A 1C1HA 1KAGA 5KU1A 3OKPA 4HNUA 2J5XA 2NACA 5DRTA 1UCFA 1W8IA 2GEVA 1CQJB 2YL2A 3FCEA 1IN5A 3IP9A 3NWPA 2R6DA 1HE5A 4DV1B 2WKWA 4WOKA 5LYJF 4XCXA 1XVAA 4NP6A 2XGOA 2BUCA 3GLIA 4KXFB 4QQ8A 1W0KD 4XWWA 4FPXA 3AWDA 1EUYA 1CP2A 1KOJA 1UZUA 4KXNA 4P3NA 3WLHA 1Q1BA 3H7AA 2P4SA 4YV1A 3EW9A 2Y1GA 2DQYA 1OI2A 2XYQA 3C45A 4BYMA 1I01A 3L5OA 4I66A 2RGEA 1E77A 1QOZA 4S3MA 4YI3A 1O6CA 1DAOA 1LBTA 1VHJA 3A2LA 4MTCA 3T0IA 3WIBA 1B15A 2J33A 3O3NB 4EQ6B 5BUSA 1GN8A 2VHUA 3R4VA 4Q7MB 3V8BA 3WISA 4AECA 5HZHA 5JNLA 4LF4B 3UJ6A 1OJ7A 2D2IA 3K53A 4D4IA 4DJFC 2WJIA 2A94A 1LI7A 2D0PB 2GHQA 3G5AA 5HK9A 4GE3A 1QAQA 2FW9A 2AOUB 3H7IA 4K8RB 2ONJA 4ER6A 4G0VA 4GDFA 1B2RA 5AW0A 1T3SA 3E18A 2VJLA 2YNMA 1SIUA 3OQBA 1C7FA 3ZVLA 1R10A 3IELA 4JI2B 4OLBA 4ZCSA 5J47A 1P77A 1YIAA 3WNZA 4JLJA 1N5MA 3SCZA 3QU9A 4KR3A 4QU0A 1ZL0A 2VYNA 2OXRA 3FSJX 3NV7A 3BD8A 4YRLA 1DEAA 2ZULA 4KQGA 4HF7A 4ZIRB 5H82A 5HGJA 1Z39A 4W6ZA 2AJCA 2VHCA 1KIAA 4H3KB 4W8GA 1FMTA 1NJ8A 1CJUC 4GOMD 5DI9A 1P80A 3R3WA 2IF2A 4KSYA 4WZBA 2J9YB 3KDSE 4ZAWA 4RENA 4J0GA 4CM1A 1E1RD 4HN9A 5KYNA 4PW0A 2CD9A 3I61A 2IZ5A 3NHBA 3D4NA 4J94A 4CCYA 1AXRA 4CBVA 1OV4A 4XWKA 1U3FA 4C5BA 1FNNA 5EPEA 1O9GA 3KUKA 1IHOA 2J08A 3T3DA 5T6BA 5LQDA 2IYNA 2VXCA 1MQ8B 3I1IA 3P9KA 4LXTA 4PVDA 3E48A 3ZI4A 4IV0A 3FHJA 4X1KA 5TC4A 2L82A 1FXUA 1B1AA 1QCCA 1TPZA 2YHBA 4ARVA 1DUVG 4DC0A 4KAFA 1SXIA 1T2EA 2DTEA 5HCIA 4F92B 4N5HX 1II8B 2IDKA 3A4YA 4Z51A 3T9EA 1NNLA 2E7ZA 4GX2A 4WCFC 4QXOA 2FUG6 2O1SA 4JL6A 3FTEA 2PSDA 4TS3A 2HL6A 5FUYA 2WICA 4ZV9A 5CITA 4B7CA 5KSPA 5A9SB 2OV2A 2UZ1A 1ULZA 2DH5A 1XD9A 2QP3A 4W5WA 2CNOA 2V59A 2JLAA 4AZWA 4NARA 3R6TA 4PYIA 4WKGA 5CLIA 1M5RA 1V1MB 1DC6A 3B3GA 2RHOA 3U1TA 1PZNA 4PLZA 3IAFA 1E2GA 1SULA 3EVAA 1Z7GA 3QOXA 1GSIA 2NTEA 2P91A 3I92A 2WTAA 1R64A 2XBUA 2C2HA 2NGRA 3IP5A 3G0HA 1KEVA 1GTZA 3HU2A 1WDLA 5JCOC 2Z2XA 3D64A 2VOJA 2YOGA 2QD1A 3EBLA 3FLEA 1VPDA 2GB4A 3KTAA 4NHEA 4XYEA 3H0KA 4B6EA 1F7UA 3UKDA 1IZ0A 2O7RA 2OBMA 1XRJA 4CLRA 1VJGA 3C3MA 1BEZA 3D2CA 3DE3X 1S2LA 1T9GS 1URPA 4IQ0A 5HXAA 3ADCA 4AI6A 4P1ZA 3UWMA 4N41A 2R751 4R81A 3QF7A 4RA9A 3H5VA 1T9KA 2Q0XA 2ZRAA 5K0CA 3Q12A 1R5OA 1Y1PA 1XXHA 3K5HA 1GEEA 4C30A 3ENQA 5L45A 1U98A 1DB3A 3CH6A 2A5DA 3CNOA 3T0GA 1ZK0A 3CGWA 3H6KA 3L1HA 1UDCA 4KXXA 2W2MA 1IOVA 4RKYA 4IUYA 3TEFA 3WYAA 4I55A 2VP3A 1O3YA 1GGJA 5KDDA 1T5IA 2DHEA 3D1JA 2WFLA 1NPDA 1GO2A 2ZYGA 4MCAA 4WK4B 4DN6A 5A1JA 4AN1A 3GO4A 2VDOB 3OM8A 1E9SA 2VNAA 3ESQA 4FCCA 2PT5A 4LJYA 2UUOA 1LEHA 2GJSA 1QHYA 2QXYA 2XNDA 5FB3A 2VK2A 4NULA 4DQDA 1XOIA 4HVTA 3PEYA 2PX8A 4HQ6A 1YCGA 2YN0A 4PX2A 5B37A 1WLSA 4L4ZA 3RFCA 5JD5A 5CD9A 1XAIA 1PBTA 3RUAA 4BTLA 4PTLA 1SCIA 1Z5UA 5AESA 1LDMA 2H2FA 3OPQA 1F8FA 2YWHA 3GCGA 3GIDA 3I0MA 2PD3A 4LBVA 4JMPA 2Y0DA 2ZZMA 2RI1A 4CIDA 2F3QA 2IHNA 1UBNA 1JBEA 1JKFA 2D00A 2P9QA 4TKLA 2BDEA 3RUPA 4IIHA 1DDOA 3M5CA 2YINC 4FMDF 1T2AA 1Z35A 5ERGB 3OCUA 3HXOA 3M3PA 3NP9A 1FSZA 2TMKA 3K1AB 5CH5A 1LLCA 2BZSA 2RI0A 1L5VA 3HTXA 3O84A 3DBLA 5DYYA 3GLGA 2YV4A 4C6SA 3AW9A 4MMXB 1OBVA 1F6BA 1YS1X 4Z9AA 5JSYA 5KX5F 3GJXC 1K6MA 3NOOA 1PZHA 1Z73A 4R98A 1V25A 2OP0A 4RXUA 2AKEA 1YZNA 1E4OA 2HCJB 5ALPA 4YJ3F 2WU1A 3UIEA 2C83A 1PYDA 1NP7A 2W0MA 1V8OA 2ZE8A 4J4HA 4Q1VA 5AVJA 4H7JA 3K31A 4G3XA 3ER9A 2P2LA 1CV2A 1T0IA 3AHGA 2RK3A 1N2BA 1IOLA 1UL1X 4MAAA 4FILA 5IYZF 1Z5OA 4CKBA 5PGMA 3W0LB 4OKSA 4IHJB 5IMSA 2GPJA 2V65A 4DIMA 3EEFA 1NFFA 4TVBA 4AJIA 3AVVA 4E46A 2W00A 4GI3A 1X2EA 1H8HA 1QTIA 2AFIB 4NMLA 2X8LA 4PS0A 2IU6A 1ZPDA 1GPLA 3VHLB 3QYFA 4KCGA 1PFYA 1QP8A 4ZZ1A 1G59A 1GG9A 3MOSA 1KC3A 3PJGA 5LZ7A 3ROXA 4S1WA 3D3EA 3GUCA 1CRWG 4UQOA 3RFTA 1TKAA 4XXHA 2LPMA 3OFSA 3BGSA 2OD9A 3QW4B 3SFTA 5LUAA 1T8PA 3CF4A 5JEDA 1D0IA 1YR3A 3IUYA 2X1MA 3CNBA 2YWGA 2QLLA 4Q1BA 4DIEA 1H22A 1NWHA 2OYSA 1XG5A 5BV0A 1EDOA 4ZK2A 1NIPA 1RYBA 1IL0A 2J5KA 2BMVA 3ACBA 5F1PA 1G19A 2QVZX 3V8QA 3OZSA 2PL9A 3WOHA 3AOEA 4YS6A 2JD0A 1J7KA 1ZISA 3NHLA 3QLUA 3VZQA 2VDVE 4NCJA 4XARA 1K8ZB 3KAKA 4C5AA 2VDWB 2PIDA 2C77A 4UNQA 3DD1A 3WWCA 1KRHA 2CMFA 1NBAA 4DJTA 1ECGA 3OAAA 2G6BA 2IZ1A 1K6JA 3PDUA 1X19A 4DMCA 3EXFB 2GN2A 4S1VA 1X14A 2QMYA 3WLNA 1JTEA 4WXYB 3S2ZA 4YPVA 2CFOA 2F7SA 3R23A 3HCDA 4LJ9A 4WVFA 1YBMA 2QDKA 1PU2A 4G26A 3SF0A 3H2BA 3PNMA 3EIEA 1RPJA 3PUJA 4RTNA 1QGUA 2G3YA 2Q3BA 3AV0B 1C50A 1TAGA 3CBQA 3OZCA 4AMZA 1NBOA 5SZKB 3JRXA 3L6DA 3A1CA 2A5LA 2FDRA 3T3HA 3KELA 4C3VA 2CHQA 3ODGA 3SQOA 1XALA 2H08A 5HZGA 1EAYA 1JHPA 2MYPA 1JALA 3GAAA 3BULA 4GQIA 3P4XA 3KQTA 3WWYA 4ZHSA 2NO0A 4PANA 3AJRA 3ELDA 3JQPA 5FOUA 1N5IA 1YDEA 1E3IA 4JA2A 1B74A 3F4LA 1KXJA 1AX9A 1P3DA 1RD4A 3RB8A 1A9RA 3SXPA 2XITA 3R76A 1KZ1A 1BE1A 4F4FA 1CJTC 2B2NA 4D26A 4MEJA 4LDAA 4G9EA 1SCQA 4HNRA 1XRPA 2HDOA 4RFSB 5B3KA 2IPNA 4DRYA 1IWOA 1DQSA 1U8XX 1QX4A 4IGFA 4NFSA 4W7IA 3VZSA 2DLNA 2EC5A 5K8UA 2FHSA 2PWBA 2NAPA 2XMSA 3T4EA 1ORDA 3A6EA 3O26A 4CMCA 3SEAA 4F0JA 3ZIUA 1OKKD 4GI2A 1K0UA 5EESA 1L7VC 1YZ3A 5KVVA 4F04A 1IBRA 2WSSD 4NRDA 3P2OA 4WN9A 4ARAA 5K45A 1KQFA 2IF0A 3BMNB 9ATCA 1YCHA 3DO6A 3DJYA 5ELXA 1BROA 1KMHB 1QIMA 3RS2A 1FTNA 1P1RA 3KLBA 4HDQB 1Z0UA 2YV5A 1DXHA 4RNCA 2VFAA 1OXSC 4ZODA 2F9LA 3RUDA 2EG5A 2QG4A 2CN1A 2EFGA 3KXIA 4AP5A 4NCXA 1ODIA 3P27A 4BX8A 4BMCA 5A4DA 3G23A 1V8DA 4IG9A 4N7JA 3JV7A 1OLUA 3L0YA 3JQAB 4Q4DA 4WD3A 4HL6A 3TSZA 5JNUA 5HCNA 1EFVB 1ZWLA 2EKZA 5ECYA 4UTOA 3ZCPA 2ZBVA 2GVZC 2LIPA 2YHIA 3C3BA 3K0KA 5IU6A 5KYKA 4M0UA 3MK31 4F9EA 1S2MA 5LR6A 4IEFB 4L85A 4UHFA 2C03A 3VMFA 4ADSG 2JG3A 4OLFA 4KX5A 1OY1A 3ROKA 4P32A 1QH8B 3AEQA 3K8ZA 4PFKA 4QYWA 3HSKA 3SZLA 1F17A 5BWBA 2VKQA 2QUJA 3MM4A 3QEMB 4J0QA 4YJGB 3SZOA 4C6RA 1DGQA 3FCYA 4NAUA 4GVLA 2E4YA 3NDRA 5DIFA 1E6MA 1RTTA 4ECAA 1Q2XA 2RG7A 1CK4A 1CJBA 1VLJA 3VVMA 4BBPA 1HK7A 3HLYA 5A71A 1VL0A 5CA0A 2WPDD 1TVKA 3OCVA 2Z8YM 3KZOA 5D87A 1HSZA 5IT9A 1SVNA 3HSSA 2Y0EA 4RYDA 2ANCA 2QAGC 2QQEA 1KI6B 2FUEA 5EIEA 1PFQA 3AKDA 4MHOA 4FTWA 3MINA 2Q6TA 4NOLA 1ONBA 3BCSA 4LHEA 4HYTA 1DOAA 4HH4A 3DAYA 3RW9A 2W2VA 4R68A 4HP8A 3JXEA 1QVWA 4O25A 3A3YA 3GEIA 4CLDA 1HZZA 2I4NA 3V6LA 1FYWA 3OTOB 5LDDC 4XQCA 3PHJA 3CLTC 4PC7A 1N3BA 1WQ1R 3OE4A 4G0XA 4NEGA 4HQFA 3VYVA 2GBPA 1XZGA 3FPLA 1UBEA 4KBYA 4MKZA 4FHGA 1W4AA 5EC8A 2OV6A 4N7RA 4B4VA 2H2GA 4B4UA 2YNMC 2WJYA 4FBLA 2AWNA 3ZY6A 2FSVC 4PHGA 3WIVA 4B4KA 5JQGA 5EJEA 5LQCA 4IH4A 1QGYA 3T5CA 5AW7A 1CERA 1PR0A 4UOZA 4MGZR 3ROGA 1ICEA 1LS1A 2GM4A 3O93A 3IXMA 1E9EA 3SNKA 3IVAA 1Y3CE 4OEHA 4U2FA 4IYRA 3REQB 3RRBA 2YASA 4FS8A 4QXRA 1QF6A 4TVKA 1T1RA 1BWQA 2C5LA 2JRCA 2WNSA 4MS3B 4D9GA 2XD4A 4E12A 2I4IA 1KZ7B 3V97A 1QU3A 4DNPA 3X1XA 1SBZA 2JJMA 3KQPA 3ZCSA 1MB9A 1XRLA 4KE8A 3R8CA 3NB0A 1TRKA 2YRFA 4HUQB 4FSHA 4GHWA 4GS5A 5JTUA 1MD9A 3TNFA 2BE7A 3EXG1 2GHRA 2ONCA 1J5XA 3LZ6A 3VXKA 2JKVA 4FBGA 4LHZA 4NAVA 4YCNA 2SICE 4LMRA 4Z9YA 4C0JA 1G8SA 1QVVA 3RQIA 1R8SA 2Y1LA 4KC0A 4R9NA 3ORFA 5HRCA 3IEKA 3MHTA 1U7XA 3B1YA 4P4GA 1PQWA 4LHWA 4BP3A 4Y2TA 4CMAA 5LMUB 2VXOA 1KL7A 1MLDA 2WUEA 3EDQA 1C7EA 3NI2A 1F2UA 4LIPD 5E7JA 5JRJA 3KLOA 4CMIA 3LGXA 5DWVA 1DXQA 2A59A 1XROA 2R1VB 4DJAA 2V3WA 2WHPB 3MUOA 1L5FA 2BM9A 2FVXA 3TSOA 3UAYA 3F1KA 1WHTB 3DQPA 2VPWA 3N74A 2DBQA 4IMJB 3BD7A 4L5YA 4FR2A 4M76B 1ZGHA 5T4FA 4A2WA 4DEXA 4DB2A 2JEZA 1IM2A 2XUKA 2XTJA 5A5EA 5C5EA 2ZJ8A 3PL1A 2D7DA 2GYYA 3MUFA 3QENA 1H1LA 4BV8A 1DCKA 4JEIA 1CD5A 3NHRA 4XCVA 1IDOA 4DCMA 4ZI2A 3UEOA 4HAIA 1TTPB 1L7BA 5CCEA 5AO9A 5EQFA 2OHJA 5CLLA 1N9GB 3DONA 3EIFA 3U7QB 2E37A 4L22A 4C1BA 5JV5A 3B8EA 3NWBA 4AJEA 4AYWA 1YU6A 4P7BA 3N2KB 3TLEA 2HEIA 1VDMA 1KJJA 4N7MA 1AUVA 2ZANA 5GY7A 2A0FA 2J3HA 1PT7A 4G36A 4MWSA 4PPYA 1BGVA 4XQ0A 3TZBA 3B1FA 1E1DA 3RF7A 4E88A 2JZNA 1WXIA 5A4IS 5JW6A 3GRYA 4QQFA 1ZUWA 5JH7F 3FDXA 4YMGA 2G5PA 2YY7A 3OZBA 2CUTA 5E7QA 2L42A 2JIDA 4MRVA 5FH9A 2E1PA 1LKZA 2FZKA 3AF5A 4UOQA 3KT8A 5HBRA 4GWGA 2VCEA 3KR9A 3BSWA 1OREA 1QO0A 5HQ3A 2A2ZA 1EXWA 3LK7A 4MUKA 1Y9JA 1VCHA 4HYQA 4MW5A 1KTVA 3B52X 3M9LA 1QB8A 2WP0A 3E9ZA 4FGZA 3QXSA 5K8JB 2IC5A 2V6BA 1IN1A 1NOIA 3G88A 1ENOA 1A1VA 2CHVA 1KO8A 5IPFA 1LNQA 1P1KA 2P40A 4P35A 3CM0A 3KFLA 3ZS8A 4BJ6A 4BVKA 3A6JA 4OHZA 3K6JA 3BWXA 2UYQA 3L5KA 3NIDB 2XUPA 4MVYA 2CK3A 2X0JA 4UATA 4HAYA 3V8RA 4CG0A 4H0CA 5JJLA 2AJLI 2HI0A 3BL8A 3CE6A 1JHAA 2WAAA 4C5CA 1HG0A 5HCUA 4M88A 3R6LA 2YDYA 2QTLA 1AMNA 5P21A 1I2AA 1NV9A 4RU1A 4XOUA 3T3EA 4BS9A 2IHJA 4ASUD 1ZI6A 1K75A 2C42A 3G17A 4MNTA 5FUWA 1N1GA 2ZP1A 3BIFA 4CG3A 2X5JO 3SQLA 1SO8A 1VJTA 4IPTA 3P9ZA 1SZJG 1T26A 1GJRA 4XEUA 4GYYA 2GSWA 5FBQB 3UK6A 3EAGA 4LBZA 3ORRA 2JEYA 2WUWE 2B21A 5COQA 5G0TA 3D6FA 4EWLA 1H2XA 3OX4A 2YIJA 2D62A 3QOWA 4KR0A 2H5EA 1ADBA 3GJTA 4GPAA 5ESRA 3PNQA 5J2UB 4FD3A 1GRQA 5E3IA 3N7AA 1H2YA 4J76A 1RRMA 3LUHA 3MTGA 4E32A 1WETA 3R7NA 1K88A 1F3LA 4JL8A 5KTYA 3LKZA 1E6EA 1LTHR 3BHMA 4MK4A 4CQMA 1ZBDA 3OE1A 7REQB 2XA1A 4Y1FA 1W5BA 4PZLA 1E3MA 3NKFA 5KWJA 2OFPA 3UGKA 2W22A 1W0JA 3C3CA 4RAOA 4YUWA 3GDOA 1ZVVA 2SKEA 1AXGA 3EWAA 2Z8XA 2IW1A 1HTTA 2QM7A 3FX2A 5B6IA 4BWFB 1HFWA 2E82A 1LSOA 3FW1A 3N70A 3W1WA 4D2IA 4QLOA 5ALRA 1NJGA 4ZVUA 3SX4A 3KEOA 4KIWA 4ETIA 4FYXA 1R50A 1Z36A 2C0CA 3O8BA 3ABIA 5A04A 4QJIA 1EIZA 2FSFA 3NEYA 3RVLA 3A14A 5F64A 2JLRA 2VQ3A 3OUTA 4RLSA 5AW5A 1E0JA 4X90A 4CTMA 2CSXA 1Z68A 3ETGA 1HQCA 2HU5A 2XDQA 3TFQA 4EPRA 2TS1A 4C0LA 2VRBA 1G20B 2REBA 3I04A 5K3AA 1Q77A 1ITZA 1FLAA 1W35A 3PGJA 1V1RA 3QLEA 1N2GA 2FG7C 2OHXA 4BBAA 5ALNA 1IONA 5J63A 2ZRNA 3I73A 1Q1QA 5LOVF 1FB5A 1I0LA 4EY7A 1NG9A 3Q8LA 1E9DA 5ALUA 3ZHXA 1UBJS 2PXCA 1OYVA 1VKHA 5KOIA 1ESMA 1I4TD 3FWPA 2IDMA 3V48A 3HKBB 3BMOA 1LRLA 1O94A 1POXA 2AKAB 3GFBA 2EJVA 4U2KA 2WYIA 4A36A 4PAGA 1V2GA 4JEHA 4O4HA 1IM5A 2I6XA 4NPCA 2G07A 4OHWA 2F00A 4KACA 1RQNA 1ULHA 3K6SB 4MO2A 3RDPA 3THWA 5TEWA 1QS0A 3PPYA 5AVQA 4DG5A 2O52A 4H7DA 4TTTS 2HLHA 2X5KO 4V0KA 4P83A 5EWJB 5FV4A 1IY9A 1RSZA 5AJTA 1WOYA 3KM0A 5DP2A 1KZHA 1O4WA 4F97A 1O57A 4KXMA 4AG5A 2IBMA 4JEMA 4FYIA 5J5VA 5AVVA 3TN7A 3A31A 2E87A 3DT6A 3A06A 3TB6A 4DCJA 1U8UA 3ILHA 1QVAA 4DJJA 5KZMB 2BFPA 5BQPA 4EA8A 4L76A 1HTBA 1X0VA 1J70A 3KHKA 4FWBA 5CT8A 4CV3A 5FBLB 3GNQA 4BP8A 1ICIA 1LFAA 1MNQA 1TYBE 3W6PA 4BMYA 4QVIA 1X1AA 1JKIA 2ZUCA 4WCFA 1NNEA 3GYGA 2B35A 1KY2A 2GPWA 4FCVA 5BR1A 4CETA 1RCTE 4QYIA 2PRIA 2GPSA 1ZIXA 2RHHA 2C7QA 4DLTA 1PUJA 4D57A 5TF0A 1RWWA 2CF6A 3WL7A 2QYSA 1NSFA 1NI4B 4GG1A 3THRA 3UAXA 2FPPA 4LHSA 3KR1A 1F5NA 3GXBA 2PAAA 3DMRA 1WSWA 5J3JA 1QRDA 5K3FA 5CH3A 5EZQA 5ENDA 3UK2A 1YVPA 4LRUA 5K20A 3TXAA 3K8OE 1SIBE 5BWNA 1MN6A 5ULLA 4TZKA 5CAEA 1ZXBA 2C5FA 1UBFA 2QMEA 1OLXA 1U65A 5I8ZA 1B73A 1XMXA 3PQ7A 4KU4A 3TEMA 4DSZA 1J0BA 1UBHS 2NV2B 1YRWA 1ZIYA 1QG6A 3OJLA 1E98A 4H0NA 4W9NC 5BN5A 3EXIA 4K6CA 4HRYA 1GILA 3AUXA 5KYGA 2B69A 3KUXA 1PFKA 2XWPA 1QRTA 3N2LA 5TX7A 3UQYS 2E2WA 3IAS6 5DLYA 2EARA 4RY2A 2RB4A 3IBFA 2UZ4A 2J3EA 1VP9A 1MR3F 1BN7A 1W4CA 2V6GA 3B1KA 3PK0A 5LB4A 3SSAA 3V1YA 5JAOA 5TPZA 1L5KA 5CMLA 2AA3A 4BQEA 2AZDA 5JMOA 2AZTA 1UJCA 2J4CA 3PC2A 4KPYA 2X0NA 2HU8A 3G0IA 4HC4A 4JJEA 2OD2A 4XR4A 5A4KA 2FZVA 2O0JA 1M2HA 2HHLA 3NTVA 3T7DA 1R6UA 2XOXA 5CBKA 2ZB7A 3T7TA 4M9XA 2EZ9A 2DWQA 2VYND 4D0GA 1EWVA 1M67A 2BYTA 4EKGA 4R1LA 3SYKA 3OTGA 4K9KA 4V0SA 3BD6A 1K8QA 2XVMA 2XDYA 1LB1B 3WB1A 4EI8A 3TZ6A 5AVWA 1FJHA 1W88B 3C6YA 4XSVA 4CV1A 3GV0A 4XGNA 4UDXX 2LIVA 1O7JA 5FHQA 2V7WA 4S35A 5F5XA 3DP9A 1BKYA 1KJNA 1DRJA 2ISQA 4RF4A 5I7UA 1HDXA 2PYIA 1BCSA 3GGPA 1E3WB 2WTUA 2W6NA 3ON5A 3GDGA 4W5QA 5FTKA 4YIHA 4ZCQA 2BLNA 4OCZA 2WJ3A 3G2QA 1O08A 5LCXA 2QRPA 5P8WA 2D1YA 3TNLA 1ZN8A 3R7AA 4CPDA 1Y6ZA 4RDIA 2PMCA 1P2DA 3ZBUA 5HFNA 3U4IA 2YWRA 3F47A 2ZS7A 3DAFA 2WU4A 4L8FA 3R7DA 1FFDA 3DLHA 2BI7A 4BB0A 3P19A 3VR3A 1DTEA 3AFHA 2PJUA 3BK7A 3H2ZA 3U3XA 2FTKE 5EKDA 2MYTA 1C8BA 4XLZA 3GPBA 4HZIA 1NQXA 2PBLA 4YDHB 2I33A 4JCOA 2OB1A 4PSVA 1WUKS 4TT8A 2R8PA 4XZ3A 3M1YA 4P5PA 4TXLA 4BOYA 5TEVA 4OI4A 5CXSA 1HX7A 1EUCA 1V6CA 3C5CA 1WO8A 2NZJA 3V4SA 2F8SA 1MOPA 3KKMA 1H0HA 3HYSA 5CJJA 3LBNA 4FNAA 3U5ZB 1YR7A 3X1JA 1YI0A 1KO7A 2JFQA 3BJRA 4LRYA 1KXZA 1AQYA 3K9LA 1OXVA 2Z98A 3BB1A 3AETA 1XN4A 3DKVA 4P5DA 2ZJ6A 4D4GA 4E3WA 5A4JA 5LM3A 2J41A 5IM4F 1SZPA 3NVAA 4QBKA 1I2BA 3GOHA 4CXMA 3AJ9A 4KREA 3HUUA 4O2AF 4Q00A 4KN6A 4U7GA 4GRDA 2PUBA 4JP3A 4F91B 1W59A 2VJKA 4XVHA 4CMKA 3R7FA 3SDSA 5JNSA 3DLIA 1FY2A 4W1PA 3LY9A 1YZYA 3AKYA 3RARA 1O2DA 5AM4A 3RHFA 2G7ZA 5ERXA 1HLPA 5DHUA 4I4NA 1PV2A 2I91A 4OO3A 2C8LA 3HL0A 1JPJA 2OBFA 1KE1A 1BG6A 1RAHA 2QX7A 1MJHA 4Y9TA 5IK2A 3QLVA 1FNCA 4YDRA 2RCNA 4YP5A 3AY0A 3K5WA 5E4TA 1KDYA 4NU8X 3VO1A 3W7BA 1TTTA 4FZ5A 4FFNA 3PT5A 2F1KA 2RHTA 3GRKA 4XR9A 1ZRNA 5EKXA 3ZDFA 1V5FA 1WRBA 4P0PB 4DIFA 2RHDA 1TM2A 1EWYA 4D02A 4HVCA 2XUDA 4J3FA 2Q4TA 4WGFA 5CVEA 3ZKAA 1G21E 3BTUA 3OHPA 3K2BA 3AU9A 1EZ4A 2X13A 3C7KA 4R84A 1SC1A 4C3ZA 3PFBA 2QZZA 5KC8A 1QTNA 3T3PB 5HS6A 5U4XA 1U0BB 4GMFA 1JBKA 1CPYA 1VECA 1TM3E 2Q9BA 5BXQC 4JUBA 1WXDA 1KEWA 2EQAA 3CLRC 4H17A 3C2QA 3K0BA 4KNVA 4KQXA 3GNSA 4YRPA 3TKAA 3O7WA 1RZRA 4DLNA 2NO9A 4Z4QA 1ZM2A 5U9CA 1L8LA 2X22A 4C4OA 4XIYA 5AIAA 5ERYA 2O0MA 3QF4B 3QMPA 4OHVA 2R47A 5CLGA 5HOEA 5CH8A 1VCMA 4F71A 5T6MA 3VUFA 2MSEB 3EMDA 4CU2A 2NOAA 1L3CA 2VWPA 2D0IA 2J31A 1ZUHA 2O2JA 4Q6WA 3WFZA 1XIVA 4HDOB 5J9FA 2FQXA 2H48A 3MFQA 4LXYA 1MABB 4XKJA 2BKUA 2DETA 4EYSA 2ZSFA 1GM5A 4MUJA 2NUPA 3A4MA 3LDAA 3I1YA 2R8RA 4OQDA 4FFPA 4A73A 2OV8A 3IQEA 2XX3A 3BFXA 3FFAA 2PV7A 4F2HA 2D6FA 1RP1A 2W9XA 1N8TA 2WC1A 3DG9A 4CIAA 3UPUA 1YL5A 4CN8A 1US8A 2Q8QA 2QW0X 3I2HA 3MCZA 4Q93A 4I55F 3TIVA 3WLSA 4AZVA 4TVSA 4YECA 3R3ZA 4EUEA 3BYZA 1HURA 3I58A 2UXDB 4C4ZA 4MI6A 1UWCA 4GR4A 3R44A 3ZWPA 8LDHA 2DBVO 3I6QA 4PLVA 4WKOA 5K0GA 2X15A 3QXXA 1U3DA 3MOGA 1W9HA 4GSYA 3RV3A 4LNUA 2ZJAA 1RJ9A 4UU7A 1TCBA 3O3OB 3AM3A 4BKMA 1Z83A 4S1NA 4Z5XA 3THYA 1PF7E 2FCRA 3J81A 1CHDA 4RMNA 3MCWA 1SFRA 4XJSA 1KQOA 3M6IA 5KREA 2CUKA 4PXSA 3TUIC 3EXEB 1QYXA 3EVZA 4Q1AA 1EINA 4RABA 4BLTA 4FYKA 3CJQA 3EVTA 4WZAE 3GFGA 1KA9H 4IDNA 1YB6A 1Q0QA 1QQTA 4EMBA 4L0DA 4FLMA 4RZXA 4BLRA 4QAJA 4EHIA 2ZUVA 1EWQA 1EK5A 3HV2A 4L0MA 4C0BA 1NL3A 1XXLA 4Q24A 4XYMA 4NJOA 5D2CA 3RTBA 4P7FA 5AVXA 2BSXA 2DUJA 3T54A 5D6OA 5IHXA 3V2HA 1T8UA 4QJ3A 1ENZA 3VU1A 4F2DA 4WADA 3G7UA 2IXEA 1EUDA 4C6TB 1QVRA 1Z75A 3WGOA 3IC5A 4O63O 3H5OA 2QYTA 4RIGA 3HBJA 5BSWA 3MXOA 3IR5A 3MSXA 5LOVB 3G2HA 3DOHA 4MRMB 4PN7A 1ESEA 3ZDAA 2F8MA 4GSKA 3FDJA 2QXUA 3EPLA 1Y3AA 1E61A 5DCYA 4EITA 4CEHA 3AFNA 4M4SA 1ACLA 1I7QB 3DE0X 4UHEA 3QPVA 3ELBA 4FMCB 4IO0A 3O8OB 3ZHOA 2C1EA 2Z2IA 7MDHA 2O0KA 4RCZA 4MRSA 4J2HA 2Y77A 2LP4Y 2YKGA 3MC1A 1WZ2A 1RWBA 5IJWA 4YMUA 1YO6A 1RZRD 4CQNA 2O5EA 1OD6A 3HJTA 3EVNA 4YAIA 4NH4A 5H02A 5E9QA 5A3VA 2XQVA 1UMCB 5FIUA 1T4CB 4AMGA 1RWVA 1GZ4A 4MS4B 1UPCA 3TE7A 3CRVA 4BO7A 1LC0A 3AEZA 3NETA 2E4ZA 3I6ZA 3G7NA 4R8LA 4JBNA 1YDGA 4D3XA 1ODSA 4QWMA 1Z7EA 4MVJP 4NPHA 3CLVA 2FR8C 2C2KA 4D7AA 3GLHB 1OFGA 1RXSA 3GLHE 4OHUA 2FWJA 3SMVA 4IDGA 4OQPA 4MR8B 1EBUA 2G1JA 1I4WA 2JK1A 2KLHA 2MTBA 2ZM5A 1BS9A 3AF0A 5EIWA 1TAHA 4M1OA 5KAPA 3KBBA 1CUBA 3SD7A 4GPIB 1GXSB 1SPXA 2J6CA 4MUGA 4OB7A 1HEYA 3ZCQA 4IP0A 3U3ZA 1IPFA 1J1ZA 2KW5A 3GD5A 3HB7A 3LPMA 2QD4A 4U5XA 4RZSA 4V39A 1EP9A 2NUBA 1JU3A 2VSOA 1AVTA 3JQGA 4KZKA 2TMYA 1X42A 3IT0A 1LLQA 1Z3CA 2Z08A 3H17A 4MQFA 2G40A 1ULTA 3I5AA 3VI4B 2W8BA 2ODPA 3OM1A 1N6RA 2FSUA 4G1BA 4UMEA 4WVLA 3E9DA 4MUIA 3ZU4A 5EHQA 5KQSA 4GBMA 2AXEA 4RPGA 2JIMA 5JWOA 4D46A 1CS0B 1IC6A 3W5DA 4XWOA 2FZGA 2HZBA 5EKUA 4GH5A 1C1YA 2V98A 5KNLA 1NYQA 1KZ4A 2P1ZA 1JAHA 1Y9ZA 2V7UA 3JYQA 1IBMB 4G67A 3TDNA 1RWNA 2J0QA 5CYGA 4RTMA 1UODA 3E7PA 1KEEA 3CUEF 3B53X 1JSCA 3E81A 4BKUA 3HGMA 2Z6QA 5IJXA 5JLAA 1OB5A 5FA8A 2VSXA 4HH1A 1Q44A 4OQXA 5I9LA 4F3RA 3IE0A 1RRGA 2DLDA 2UUAB 3MJSA 2MU1A 2WFMA 3SZUA 5B7QA 1LA2A 2C5HA 2NZ2A 2CXRA 3A6GA 4DMHA 3O8QB 1F8YA 1FU7A 2JJ2A 2G9VA 3P4UA 4YO7A 5IBCA 1G3MA 3DKKA 3L46A 4UUQA 2BMFA 2KI5A 2OZKA 2XGGA 3AUUA 1X3SA 3KAQA 1DADA 1B26A 5A0TA 4FZRA 2PJZA 3OZXA 4N3CA 1U2QA 3HUTA 3AMVA 4RF2A 4L8LA 4X6Y