2Z98A

The crystal structure of azor (azoreductase) from escherichia coli: oxidized azor in tetragonal crystals (the resolution has improved from 1.8 (1v4b) to 1.4 angstrom)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
200
structure length
194
Chain Sequence
SKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FMN-dependent NADH-azoreductase
publication title Expansion of Substrate Specificity and Catalytic Mechanism of Azoreductase by X-ray Crystallography and Site-directed Mutagenesis
pubmed doi rcsb
source organism Escherichia coli
total genus 75
structure length 194
sequence length 200
ec nomenclature ec 1.7.1.6: Azobenzene reductase.
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2z98A00
4QOGA 4Y7CA 1ZWKA 2R97A 3FX2A 3SVLA 1YCHA 3ESZA 2AMJA 4U7GA 2X2OA 5ULLA 2QMYA 5TGZA 1AMOA 1CZHA 5BUCA 1V4BA 3NHLA 1AKUA 3W78A 1H69A 3OVMA 4LTNA 2OYSA 1QHEA 1X77A 1FX1A 3EYWA 2BMVA 4ESEA 2QX6A 1E5DA 3GFRA 1T0IA 3OX3A 4ZVKA 1WSWA 3ESYA 2QMZA 2ZKIA 2FCRA 3NHKA 1CZNA 2HPVA 3NHWA 1ZX1A 4H6PA 1I1OA 4S24A 4U7FA 4R81A 3N39C 3NHFA 5LJIA 5FUQA 1XT6A 1FLNA 5EMNA 3R6WA 1AG9A 3P0RA 4H2DA 5F4BA 4YAWA 1CZLA 3GFSA 2Z9DA 4LTMA 5B3KA 4ZVLA 4YAUA 2XODA 2Z9CA 1KBOA 5LVAA 4GI5A 3ZHOA 3FW1A 6NULA 1OBVA 1AKTA 4F8YA 2GSWA 3L9XA 4ZVNA 4C76A 3W7AA 3N3AC 1QR2A 4FGLA 2Q62A 3B6KA 2FZVA 2MTBA 1AKWA 4ICIA 3OJXA 4J8PA 4XDGA 2FX2A 5LBUA 3HA2A 3F90A 3N3BC 4BMOB 1AKQA 4CETA 3KAPA 1D03A 4PTYA 4QOIA 2B3DA 1WSBA 1YRHA 1ZWLA 3S2YA 3NLLA 5LMCA 4QOEA 4M0CA 4LA4A 3K20A 1DXQA 3TEMA 4YALA 1XYVA 4GQIA 1CZKA 2A5LA 3OWHA 3OX2A 4DILA 3KEGA 1C7FA 4FX2A 4DY4A 1DXOA 1QBGA 2V9CA 4D02A 3NHUA 1SQSA 5B3LA 5EA2A 2FOXA 2OHIA 4GR9A 3F2VA 1BU5A 3HLYA 1QRDA 2N1MA 3NHJA 1AHNA 1JA0A 2Z9BA 4NLLA 3LCMA 4PU0A 3JSXA 1AKRA 2Q9UA 2QR2A 4HEQA 5LBTA 1J8QA 1J9GA 1XI2A 4YAFA 1NNI1 3OJWA 4DIKA 4N65A 2MOKA 4C0WA 3FNIA 1FUEA 2ARKA 3K1YA 1AKVA 4PTZA 4NULA 2KQUA 2Z98A 1YOBA 5A4KA 1B1CA 1CZRA 1C7EA 2FDXA 1F4PA 4N82A 5NULA 3FJOA 1TLLA 2QX8A 3NFRA 2BN4A 2W5UA 4FGKA 4BMPB 2D5IA 1CZUA 4Y9RA 2QX4A 3D7NA 2F1OA 3F6RA 1OFVA 3B6IA 4CF6A 3FVWA 2M6RA 3UXEA 1RLJA 3TZBA 4YQEA 3NHSA 3NHYA 2BPOA 3OX1A 2KLBA 1XYYA 5NLLA 1OBOA 3RPEA 4YAOA 3KLBA 4ZVMA 3KAQA 1D04A 4OXXA 4QOJA 2FAXA 4FGJA 5EAIA 4QOFA 2BZSA 1FLDA 1YDGA 4C0XA 1RCFA 3W77A 5LLDA 1RLIA 2FVXA 1J9ZA 5FA6A 3B6JA 2R96A 3EDOA 2V5UA 5F12A 2RG1A 2WC1A 1J9EA 3QFCA 2HNBA 4Y9UA 3HR4A 3F6SA 3B6MA 1YCGA 1DX9A 2HNAA 4C14A 4LAFA 2QX9A 1GG5A 3W79A 2FZ5A 3NHPA 3GFQA 1AZLA 1KBQA 3ESXA 4QOHA 2OHJA 3QFRA 1T5BA 2MT9A 1SG0A 2MWMA 3ES9A 5JROA 1TIKA 3O73A 1YKGA 1VMEA 3GAMA 1JA1A 2FLVA 1YCFA 3OWXA 4U7HA 4HS4A 2OHHA 1RTTA 1FVXA 3UXHA 3L9WA 1BVYF 3LT5A 5FX2A 3O2NA 1FLAA 2X2PA 4QODA 3U7IA 5F51A 2XOEA 1D4AA 3NHRA 4N9QA 2V5VA 1CZOA 5LJLA 3TE7A 1FLVA 2BF4A 4XDHA 2QWXA 3U7RA 1FTGA 3QE2A 2M6SA 3G5MA 4LTDA 1H66A
chains in the Genus database with same CATH superfamily
2VAVA 1N0HA 2AYZA 2ZBFA 1PL8A 4I5GA 4A03A 4XVHA 4BO7A 4JZKA 4FINA 1BGXT 1FYEA 5ITSA 3DE3X 1KRWA 3VI3B 3RYCB 2P2NA 3F67A 4K28A 1EVEA 4PX5A 4ZI7A 2ZIEA 1GL7A 2IRWA 2MMGA 2IWRA 2WKRA 1BS2A 3WV4A 3PX7A 1AHHA 4ENPA 2PKCA 3LCCA 2IPOA 4MLCA 1AKNA 1EM8B 2AFHA 4FX5A 3VISA 4PLHA 3VVLA 2YH2A 4CIVA 3EWNA 8MHTA 4D46A 4L3OA 1D6NA 4O4LB 2FSUA 2YV2A 3E70C 2J41A 3GMDA 2E85A 4BNYA 3SY8A 5AVWA 4DV6B 3D6JA 1W88B 3DXZA 3T15A 3ZZTA 5JJBA 3K5WA 3ZTYA 1U2GA 1XVUA 2I3GA 2I67A 3OEHA 2IHZA 1LPNA 3OG9A 2QTMA 3ERCA 1H85A 1NUQA 1EX6A 1Q0LA 2XDQB 4PM4A 1GFSA 3NJ4A 1M54A 4IIJA 1DXHA 3P2OA 2IU0A 3EXHA 1Z4IA 5BUCA 4PYRA 1YS7A 5FOWA 3AUYA 2L19A 2OCAA 3KOZA 1KEEA 3TJZA 3GGSA 3FPCA 3QP9A 4N3GA 4E13A 3R74A 3NVMB 4BUCA 4AMBA 4CMBA 5CA0F 4QSMA 3B36A 4QXRA 2A9QA 1KH2A 1MBZA 3L7CA 3PGVA 1OT3A 5CJ2A 1U1CA 4DJDC 4EW2A 1PNOA 1UBGA 3D43A 4DLWA 4I4TA 2V3CC 5JCOC 3HPRA 5TXGA 3O74A 3FFAA 4YRDA 5FKJA 2W2MA 3VR5A 1JALA 5LA6A 1UC4B 1SB8A 1F9EA 1OC4A 3A31A 3ABQB 4QRHA 4F3NA 5FTLA 2QVZX 1QC5B 3HRKA 1DFGA 1L8AA 3MLEA 4MZXA 3RH0A 5TPWA 2O2GA 5CDFA 2VJPA 5C8YB 1ZCJA 1W6UA 5EGNA 5FEUA 4C0QC 4QM6A 3V80A 3I72A 5DW3A 2NUAB 3F6EX 4QEDA 1ECPA 3Q12A 5IFLA 1EDBA 2P3SA 2QLLA 2QMZA 3O4HA 2P0EA 3ZH9B 3ZK7A 3EIUA 4C7MA 4AY3A 3Q85A 3N7UA 3BEOA 2PZBA 4MWGA 6YASA 4GEKA 3AOGA 3EIXA 1Z2EA 1IMJA 2DPHA 1MQ8B 3AK4A 1SBCA 1SUDA 2PU5A 2XE4A 3K1AA 3T6KA 4DVJA 4DYDA 2PH3A 4EGAA 2PBRA 4Q7QA 3G68A 1UC5B 2CDBA 1CJTC 3N39C 2XT9A 3AI1A 1S2DA 1R18A 9MHTA 1KK2A 4OGGA 3HDGA 4RLHA 2BM1A 5A04A 1NW4A 1O6ZA 3IVGA 4JFAA 1N5IA 1FCJA 3ROTA 4UHKA 4TYQA 2PX0A 4MWZA 1MGPA 4ND8A 4LOJA 4A0HA 1SPXA 2QV7A 4YI3A 3DFIA 2NU8B 1BX1A 1DFHA 1IM8A 1SY7A 3E9EA 4DIMA 5A62A 3CH6A 4TN1A 4B3RB 3LZDA 4O4HB 3MYYA 1NC3A 3QELA 2Q4EA 3E9ZA 4RIHA 2HDWA 3RFUA 4LHWA 4TVSA 4NYJR 1T36B 2VSOA 5J2UA 3L1KA 2QLFA 3IAHA 2NM0A 4C7VA 1G63A 3KAKA 1Z33A 3E8SA 4IIEA 4NBUA 1J97A 2HHHB 5KSPA 1H9BA 1WV1A 1WB6A 3KKQA 2QTNA 3PTLA 1K06A 1U7HA 2ADFA 4DCPA 4LCEA 1N0WA 4WPGA 1PP4A 5BMVA 2QJWA 1F8YA 1S8NA 3QKRA 5EWMA 1MA3A 3GNSA 3MGCA 2X2EA 1TTQB 4GP9A 4KXXA 4RHTA 4Q1AA 4YHBA 1K89A 6NULA 3N8GA 4QPZA 4I1UA 1II8B 2D7CA 2HJRA 4MPJA 1P2VA 4R9VA 2B36A 3AY0A 4TUYB 3U3DA 1NHWA 2JBHA 5ADUS 5CNJA 1ZNWA 4DQVA 1Q1AA 1JEEA 4C4XA 5EI5A 3T54A 2I4IA 5BVHA 1QFYA 4BMNA 2Z6QA 1DAGA 1JBEA 1FL9A 1NAIA 3DHYA 3T3PB 2QSZA 1GKIA 2DPGA 4P5EA 3A3KA 3OZEA 1LKZA 1TCBA 2PBFA 3TMAA 3KSZO 3GLGA 2JNWA 4DV7B 2O2YA 2QRKA 2YASA 3BSYA 5TMEA 4CL2A 1NMQA 2VF2A 1EE2A 1X86B 3DKKA 5JCJA 3F5DA 2V03A 1J56A 5JBIA 3BJZA 3H2KA 4GC9A 4MW9A 4YRPA 1EWQA 3WO0A 3GEBA 4R3WA 4X1KB 1O94D 3TQIA 3A11A 3TGPA 1H1DA 1MKYA 5J3JA 2IZ6A 3MWYW 1ZD2P 3ML1A 4WL0A 2QD5A 4ATNA 3ZWAA 3KTFA 4DR5B 4UW9A 4GQBA 1DDOA 3A2KA 4H6VA 5CTJA 2WJAA 3ENNA 3FYCA 1BG6A 1JMVA 2OZVA 2GM9A 1F38A 4UU8A 1PR2A 3ELUA 2ZYRA 3BCSA 4C0SA 3HKCB 2EFHB 1ULBA 3ZDCA 2VHQA 1UMDA 4PC3A 4PVCA 3H2JA 2W93A 4QOIA 4B35A 2BELA 1TF7A 1XQXA 2BWJA 2ODAA 3HMKA 4UKDA 1L5YA 1DV1A 3WP0A 2ONZA 2X86A 1YFLA 2HLDD 1R4NB 1USGA 4FQ8A 5KYNA 1HF3A 3NHAA 4Q01A 4CHGA 1U0SY 5CBKA 2FZKA 1TQHA 4M8IA 1CEXA 2C2BA 2OFWA 2ZU6A 1E1NA 3LVBA 3LWBA 3KQLA 3ESCA 1Q1EA 4MKRA 2F4VB 2Z5VA 2FNAA 5AKLA 1IZ9A 4H1HA 4CKWB 1UZLA 2PH1A 4F3KA 1RWWA 1DV2A 1H6DA 4NZZA 4FE3A 2O0MA 4OSPA 2VZ0A 3TEMA 2WTMA 3PHLA 3GLIA 3D5QA 4M38A 1TO6A 1X1AA 4I55B 4A16A 1OX6A 2G4LA 2VF7A 5DYWA 4IZHA 3AKZA 5ARBA 4TQ9A 1DT3A 3IURA 3T06B 1G8YA 4UCQA 3KKNA 5IN4A 1NBIA 4DY4A 4B45A 1DXOA 2ZJYA 3WFIA 3WJ7A 2QUBA 1D2HA 1O5IA 2O50A 3NHUA 2BT4A 4W9MC 2ZZKA 1AK9A 2FOXA 3AUKA 4C87A 1I7NA 3Q0IA 5CW1A 3AM1A 1IK4A 2OHIA 4GXNA 3EISA 2KYRA 1W8IA 4BNKA 1QVRA 5BOSA 1M2NA 4G1FA 3HO8A 2E4WA 4F96A 5ISMA 4RQBA 1QQBA 1U8AA 2ZT5A 2PVCA 3JYOA 3LGAA 5CCXA 1MO5A 1RAFA 2XMQA 3EN0A 1Y3DE 4X92A 2C42A 4GPZA 1HT3A 2J6HA 3L0BA 3GMSA 3ZWKA 1G8FA 5JUWA 2P9TA 1LSSA 4MYSA 2HA6A 2GVNA 1T4GA 3NV7A 4AQDA 3HRHA 1VSUA 4QQKA 2MHCA 3W2TA 1W52X 2QPAA 3GL9A 4NLLA 1VJGA 3LRXA 3U1BA 4P3PA 3BSFA 3E58A 4J1TA 4GMGA 1TJ4A 1WF6A 1Y7TA 3HVJA 2VPIA 5H02A 4ARUA 4PN3A 1KO1A 3KVRA 1Z45A 3QMWA 2QZ4A 3QUCA 1MABB 3T61A 2R44A 2JLXA 1HDIA 2IGBA 4Q9KA 3ROMA 5EYPA 2YIVX 3PC7A 2IY7A 4Y2XA 4KH1A 1AV7A 5E7MA 1ILWA 4HX9A 4IHKA 4G0UA 4CLOB 2GAOA 3JASB 4M54A 1Z7GA 4MWBA 5FHRA 4DGSA 1W48A 2WJGA 2P3LA 4UUPA 1Z5ZA 4HK4A 4O5AA 4GLFA 3U6KA 3K6KA 1UFOA 2HWYA 2NYAA 2XOKD 5HK8A 1YQTA 1V71A 3O9MA 3TW0A 2OGSA 2JLZA 1JYFA 2EJWA 2R1VB 2XCIA 2WSIA 4RFSA 3HXQA 4NE7A 5FUMA 3KFXA 3KSDO 2CFOA 1TVKB 4CEHB 4QGBA 1A9XA 3EDYA 1UOEA 1A9RA 4TWAA 1HUQA 4HKTA 4IZOA 3NJRA 1IDOA 4B7CA 2JLVA 2GZRA 2RHWA 3BDVA 3DONA 1VIDA 3A1DA 2NUPB 3T9EA 1DADA 4KR0A 2Z95A 1Q12A 3GJ7A 4CUKA 3PWKA 4LGMA 3NFRA 2E5LB 1KZ4A 3R5SA 1QV9A 1HDGO 1E2BA 1L6RA 5I7EA 1TECE 2A0UA 1Q16A 4J1SA 1NL3A 4BLRA 1YULA 3L6BA 8ADHA 1LBEA 5IASA 3GEIA 3IEKA 5CTAA 5IBPA 2ID9A 3AEQA 4RF5A 1ZRNA 3ET4A 4KWIA 1XDDA 3KK0A 1E92A 5LZ5A 1NDQA 3TKAA 1DKMA 3GGCA 5EIAA 1AUXA 4FFBA 5B1IA 3U4HA 2PNFA 4QYXA 4L5AA 2HIGA 3OM0A 1TRHA 3DZHA 3L5OA 4ZVUA 4HH3C 4QBGB 3S27A 4AS2A 4EEKA 5FWNA 5L3VA 3M4NA 3IALA 3MWLA 3FWYA 2UZ4A 3THWA 1FF9A 1CERA 3QWBA 2VVTA 1EFDN 5ITZA 2Q50A 1UPAA 4L4YA 1G3MA 3ZY5A 2EFDB 5HFJA 2PJUA 2ZATA 1L0BA 4P2BA 4QFDA 4PX2A 4CM9A 3OZRA 1VE9A 2WKPA 3HB4X 4KSCA 5KKNB 3HJGA 2VJNA 3SBXA 4FN4A 1T8PA 3DZIA 1D5WA 1RP7A 2Q0QA 4LBZA 2BSAA 2O52A 1GT6A 1KFCB 4KG7A 4Q4JB 1QHHB 1ZM4A 2CVFA 5DTIA 121PA 3A6LA 5CB4A 2G88A 3TYXA 4DC9A 1EUYA 1Z0ZA 3KAQA 4YJ3F 2GZ1A 2NUBA 1AGYA 4HVTA 4M6WB 1IULA 2XA9A 3PITA 1T9GS 2XHEA 4AZ3A 1Z88A 4O25A 2XUKA 3A1VA 1U2QA 2RONA 3FNRA 3DZCA 4UFOA 4BWFB 1B74A 1EXWA 1H6CA 4HZUB 3AHCA 4C0XA 3VDNB 2WYHA 2VRWA 3EVAA 1PR3A 3OPYI 4ZVRA 3RLIA 1P7WA 1KRXA 1QHNA 5DIZA 4FR2A 4HGOA 5THXA 4QU0A 1TMGE 3KE8A 4I1IA 1V1JA 1VPLA 5ENZA 1FB5A 4RLFA 5AT1A 4J03A 1RMTA 5EUMA 2RARA 3AF1A 1TPZA 4BNWA 1O58A 3CKKA 4OQ4A 1P9OA 4NOJA 4Y0AA 5DEOA 1M72A 3G85A 4KZPA 2KJQA 3LM8A 1JJFA 5CH5A 4ZT6A 2IV2X 4B32A 4R2KA 1U2DA 2XB6A 3CLRC 1UEJA 3HEBA 2IKQA 3BS4A 4DJ5X 3QFCA 3NR2A 4KNYA 2RGAA 4IDBA 1N5LA 1T29A 4GZLA 4D44A 3H75A 2J6IA 2HWKA 5EIXA 3X2FA 1U3UA 2PUDA 4M9UA 1OOEA 3ZHRA 1T3TA 1Z73A 1GCGA 3S99A 3SN6A 1D6JA 1QMGA 3OIGA 3QBTA 2PZMA 3DV0B 4GYKA 4KYTA 4Y2SA 1WABA 2WTNA 1OKKD 3SF8A 3DBHA 1ZXXA 1E2GA 5FPYA 4ZHQB 3H8SA 1T4MA 1Z0DA 3AGQA 3F4KA 1YVEI 2GVDC 4J0DA 5LQMA 1AZLA 1XEXA 4M99A 2QN7A 3TRIA 1KBQA 3REQB 4EHHA 1DRWA 4QULA 3H1BA 3LLVA 3CLUC 2I0FA 2NWQA 1RHRA 2HHLA 2KMLA 2XSZA 1I3CA 2WZDA 1QQ7A 3Q6NA 4ND2A 3RVDA 3TZCA 3UMGA 2RIRA 4PIMA 2UZ3A 2ZVJA 1RZRD 1RLOA 2GZAA 4K6MA 2ZLBA 4ESHA 3Q10A 4XB1A 1N0UA 2SKDA 4AMYA 1K7CA 3OQHA 3C3WA 4TVOA 2YUIA 4UM5A 4UTZA 1PG0A 1DBQA 1H4VB 1DVRA 1VB5A 1WXQA 2ACEA 4B8WA 5G53C 3AM5A 3OH8A 5EKSA 2DY1A 1ORVA 4DQ0A 2C2KA 5HA5A 4D9BA 4PYMA 4HGPA 1JG3A 4HWGA 3L7AA 4V0LA 1KI8A 3ZNNA 3NKLA 2P3OA 1UM9A 3OA2A 3MSCA 3OCWA 2B4TO 4LZLA 3RRMA 3RU7A 3V1NA 2P1RA 1GWNA 1U3DA 3I9MA 4ZD6A 4F46A 5KJ6A 2ZTUA 4WAUA 4ZI5A 2V6MA 3GWZA 2EX4A 4MI9A 5FV7A 3ASUA 3O3CA 2IDMA 1JV2B 3FWKA 3FOAA 3DMDA 1RTTA 2VI5A 3IEVA 2YZ7A 2R6ZA 1HRDA 4KQEA 3X1XA 1L7NA 2CXRA 2J9YB 2VH2A 4NF2A 2YY5A 1GA6A 2A57A 3C3AA 3G0CA 3P9KA 2QROA 1CWUA 1SKYB 1HEIA 2BFDB 3O2NA 4G86A 2AOVA 2X2PA 3AKYA 3D64A 4JEIA 4IJ6A 4KR6A 3PZRA 2J3QA 3BGIA 521PA 1RR6A 5DCUA 1AQNA 3D0KA 4DG9A 4CDGA 1JFRA 2JHAA 2OBMA 5F51A 3WGZA 2HKIA 5JALA 1ADYA 2BFCB 4F92B 4R2XA 2C3UA 3HG7A 4ETIA 1SUEA 2EZ4A 1P62B 3F6BX 3R6DA 3W4KA 1UBRS 4EQ6A 4X6XA 1PAUA 4ZQFA 3S5JA 3HNPA 1JRLA 1IUNA 3TJMA 1KWKA 3DEHA 3ZWYA 2G3YA 2BFBA 1ONNA 3C74A 5FTJA 4EX6A 4BNTA 1AM4D 1E1RD 3MRVA 1U1EA 1YOVB 2TMGA 4TLCA 2CDRA 4H0NA 4IV0A 1GFIA 4NE9A 1UJ4A 2X23A 2ATIA 3BIOA 1QIJA 1YBHA 2DPXA 2ZT8A 2CMFA 3FM9A 1W4ZA 2QGFA 4EG6A 1JAHA 2G0TA 5A7FA 3CN7A 3FWPA 3IB3A 3IV7A 3KYIB 1U0RA 2NTYC 4OP3A 4AM8A 1F8FA 3BRWD 2FTKE 5SYMA 4YQYA 3QMMA 1HQCA 4LV8B 5AXAA 1XLVA 3UMMA 4KSYA 5C80A 1WPGA 2L18A 2G77B 2G5CA 4N0DA 2UKDA 2VATA 4E3WA 1GGVA 2BCEA 3SP1A 2HL6A 4EKIA 5K8TA 3L6CA 2OCLA 5I7VA 2VTKA 3I42A 5ER9A 1IB0A 1DHTA 3DZKA 5I7FA 4K03A 5FPPA 5DT2A 1GKKA 1Y8CA 5FQOA 2DUMA 3FDIA 1OB5A 4JD5A 3ZGXA 3S4YA 4LBYA 2IOQA 2AI3A 4WXYB 1HE1C 2C4WA 4JIGA 1NJ6A 3FUTA 5ESXA 3UJCA 1GVNB 2NTEA 1J49A 4TMFA 3W78A 4X66B 8OHMA 5EQJB 3P0EA 4RL6A 4NJEB 4WT7A 1REQB 2YKGA 2QQGA 5LZ9A 3O9VA 1SR8A 1USIA 1WTAA 2JHPA 3PIDA 5JE8A 2IQ5A 3C5VA 3WLQA 1P7ZA 3WXBA 7AT1A 4P9NA 3I2YX 1K6EA 1LC0A 1QV6A 2QSJA 3LVRE 3DWIA 5JY6A 1ZH6A 3MS7A 1QP4A 2VJLA 2GPJA 3A3YA 3LUBA 4RV9A 3SZMA 4WIAA 3TE6A 4BQRA 4JFRA 1LPSA 4IXTA 2DHEA 4K3UA 3EDMA 2QEQA 1PT8A 2AMFA 2QTCA 4I4NA 4MV9A 3TLAA 2VAPA 4BEVA 1E5DA 3FUWA 4RY0A 2GTIA 3COZA 1F8GA 3GFRA 1WHTB 3LQ1A 3QTTA 4J1NA 1G5HA 3R77A 3E3AA 4GNRA 1Y5MA 1XTZA 5IVIA 1MP0A 1G7RA 4GD3Q 4J16C 4XVCA 2JG3A 3O26A 2JAHA 1JQEA 2I29A 3A9SA 4QPNA 3BB1A 4K0RA 4GP7A 4M0PA 2WJ4A 4EKDA 5DFAA 3ZHXA 2BONA 3NHKA 1W29A 4HMOA 4G0WA 1LUAA 2HJGA 5IF9A 4TM8A 3MOSA 4WJKB 1M2JA 4BNDB 1ORIA 5EJFA 3LYLA 3N05A 4WJLA 5J9FA 4OYLA 1KQPA 3H5LA 4MVCA 3G8DA 1DWQA 2QZZA 3EVEA 3ZKAA 2OM6A 5B58T 4G5FA 4F3YA 4HZGA 4IS2A 5JLAA 3KO8A 4U6NA 1S2NA 2ZIFA 5JATA 2ABWA 3ZOKA 3EZ2A 5LQKA 2UUCB 1KC1A 3RYIA 3UWMA 1USWA 1YAHA 1GAWA 2W90A 3V5NA 4NEQA 4IDDA 2OUKA 1UJ2A 1DEKA 5LU8A 4O2AB 2HQBA 2GUGA 4NDAA 4Q4HA 5FA5A 3SDSA 4AF6A 3BT7A 2PRIA 4EYQA 3RFTA 2YYYA 3MFQA 2I1LA 3GFSA 3ZY3A 4E4RA 5KOJA 2FGJA 3QH4A 2YWJA 4ZU6X 1V11A 4PVDA 2XHZA 4H18A 3UFBA 3D7KA 1PZEA 3KCQA 2FF7A 3LBHA 4DUYB 4LGVA 3HQ4O 4M3NA 3S28A 4QJ3A 2ZRBA 3HXPA 4MGEA 2H2AA 3I39X 4FFWA 2JDIA 3D5EA 2PLWA 1GNLA 3IOCA 1I36A 4L5BA 5ICGA 3ZD7A 1EIZA 4R7ZA 1QOQB 4X6UA 2HA3A 3WB0A 2AXPA 4BU1A 4PXSA 1C0KA 3FOZA 3QLEA 1MO3A 2ONJA 1DQSA 2WM8A 4PEVA 5FNVB 4FIDA 4M36A 4OQYA 3EIHA 4LIPD 2EU8A 2G5PA 4NU0A 5BN5A 1SVMA 1WUTA 3LJKA 3PP8A 3ZHTA 1P60A 2IU3A 2XA1A 2IWHA 5LZ7A 1BMFD 5K4HA 1G3RA 1XCJA 3I34X 4I36A 2YHIA 5EESA 3U4CA 4R0MA 3KVVA 2XZLA 1RQ2A 3E81A 1K5GA 4LXHA 2VHTA 4RC9A 1JQJC 5CNIA 4YJHB 1Q0ZA 3K53A 4CF5A 5EIOA 5I7UA 4W7HA 4UMVA 4D9MA 1CJVC 1MJNA 1YKFA 4I81A 3NKVA 4X24A 1W1UA 4MSUA 3AFOA 1DG1G 3B9PA 3M0EA 4O2BB 2FSPA 4JEUA 1WNFA 1C7JA 4WLOA 3WSVA 5CW2A 1DOHA 3IPAA 4BZXA 1T6YA 1Z7EA 4HFNA 5EFOA 3ACCA 2PS9A 3WMEA 1YDWA 2F43B 1CD5A 2J3DA 4TS3A 1SHUX 2BFFB 2C3PA 3JWGA 3OEWA 4CIYA 4RKQA 4HVLA 2F1JA 3LG2A 3ZHCA 3QMVA 3G9QA 3K6JA 2E37A 2V7VA 3MGKA 4NMXB 2B1QA 2UYHA 5C4IA 4G41A 4XB2A 3TLZA 4CL3A 2FX2A 2XUAA 1BNCA 3GFOA 3D59A 3L3BA 3GDFA 4PNEA 1U8FO 3OJEA 5AW1A 4XE5A 1GYPA 1GL9B 4CCWA 5CB0A 2I4OA 2XBLA 4TLDA 4L8LA 4DT1A 1P74A 1XCOA 3CZQA 4URUR 2QTTA 2V0NA 2MSEB 5DKFA 3ZLTA 2PJRA 1JHXA 3IKVA 4FC6A 4ZDKA 1OLSB 3P0IA 4UCFA 1JTFA 3UV7A 3ZV4A 4BMZA 2P5YA 1ESMA 4AZWA 2BI8A 3LXXA 1KY4A 1C50A 4LYGA 2GZDA 4MO9A 2PWBA 4TXNA 2ZCJA 1J20A 1ZWLA 4UMEA 4MWSA 3S2FA 4MUXA 4BKPA 4X20B 3RTGA 4AB1A 2JPDA 3WIUA 2CHVA 4LJAA 4XPIA 2P2SA 3RK4A 1EM6A 1LTHR 2Z2KA 4R9NA 4ZT2A 4K46A 5I45A 1SA0A 2I66A 1OXBB 1Q44A 3I32A 4P5DA 1NQTA 1VSQA 1ZGZA 3JD2A 4DSOA 3NIBA 5BYJA 5IK2D 2B9EA 2ZVDA 3GCXA 4B3IA 3OLCX 4WACA 1OBCA 2ECQA 4QT0A 1XKQA 1VC2A 4IJUA 1QK5A 4HEHA 3FVRA 4BLQA 4JMLA 3LZCA 2QSUA 4E7OA 2NAFA 3GPDG 4U63A 4D4GA 3OPNA 1DEXA 5IZCC 4DWJA 3E5RA 5LP6F 3PV0A 2FP4B 2DQSA 1QM5A 1Z3CA 4FCCA 5DU2A 4C6TB 3ZVKA 5BQOA 1QZUA 1EGMB 1JS1X 5AQ1A 3JAWB 3L43A 1NT2A 3IQDB 3JCZA 1Z7BA 2WILA 1V5FA 2HDHA 2PNJA 3PI7A 4DPLA 2IIVA 1GY8A 3LGXA 4YYZA 4Z1OA 4LYHA 6AT1A 1JZSA 1UBKS 1XFAA 4FT2A 1DIBA 3AUJB 1YR3A 3K9HA 2OT3B 4Z3KA 1AQYA 4GNKA 3Q6MA 3T1VA 1KYVA 1W85B 4Y2JA 3EIWA 2BUAA 5IJZA 1IDN1 1G5TA 3BF7A 4HX2A 4RZSA 1XAIA 3CRNA 1Q0RA 4A8JA 3UJ7A 5JECA 3C14C 1Z8HA 3E2PA 4H3KB 5FBVB 3B1FA 1AKRA 2A5JA 1L5HA 1UJCA 2O2CA 3M3PA 4AY4A 1KEKA 1RWVA 4G65A 2DHDA 3FA2A 4EF5A 1I9GA 3AIMA 3NWOA 4GM1A 4YMIA 1QGAA 2IQIA 3G17A 1X7ZA 1YDEA 4PZAA 1JDTA 1WSAA 3HSSA 3R3JA 1PFWA 5CXQA 3ICQB 1R74A 3WNQA 1LZLA 3SZGA 3AUTA 5K5EA 2VNJA 4B6SA 3EC1A 3EF1A 2Y92A 3C6YA 1U5AA 1WDTA 4G5HA 2H17A 5DCLA 3VPXA 4AG3A 4DWOA 1E59A 2QM0A 1OX4A 4DMCA 3Q2IA 2IOFK 4KXLA 4B2LA 4DEVA 2BGNA 3AY7A 1SUPA 2BSXA 1W0JA 4FMCF 3OO1A 1H5UA 1KJ8A 1B43A 4OQLA 2B7CA 1PGQA 4XX0A 1K0UA 5B4UA 5GGXA 2EFJA 4DF3A 4G8BA 2IP1A 1EVIA 1JFFA 1HT1E 3I9JA 4PLTA 1XQVA 1PUIA 3WB1A 4KIWA 3JZIA 4A2PA 4RNDB 4R01A 3V1LA 3HC7A 3D3WA 2CHFA 2J5RA 4YO7A 4YT8A 1H94A 2Q6IA 3AI7A 3SQNA 2QX8A 1N78A 1J39A 3O8DA 3FTFA 3H04A 3CE6A 3RAPR 2BEVA 3O0DA 2O5EA 2GILA 3B82A 5PNTA 4GBGA 2AR9A 2NXCA 3G0BA 1QIEA 2C78A 4B3FX 5F35A 1CRQA 2A84A 2W9XA 3I6MA 4YLGA 2E18A 3OO0A 1UBTS 2DCMA 1DAFA 4FZRA 3H4IA 1IQRA 1N6KA 3BRQA 2VKTA 4RBNA 1CYDA 1L4MA 2QK4A 1JI0A 4M9RA 1E7MA 1DTWA 2F67A 3F6CA 3HJHA 2Z2JA 1U4SA 3Q7TA 3EPJA 2GBPA 3JR7A 4CMJA 1OAOC 2JFGA 1EPUA 3JVIA 4Y1EA 5M5BA 1YBAA 1N7IA 3TZBA 2ZI4A 4LHXA 4RZHA 2F3RA 2YVUA 4PY2A 3AKEA 3FOEC 1N2CE 3QX9A 4UEOA 3ETNA 4W5NA 2QAGC 4W5RA 2OGZA 1KU6A 1YMUA 1FNDA 3OX1A 3ANNA 3QUTA 4DA6A 4JP8A 1HC7A 1NE2A 1UPCA 4M1EA 5AJZA 1I7SB 4ENVA 4GWKA 1T35A 1T0PA 4RD3A 2FUKA 2H5EA 3I52A 2WIFA 1KZ7B 4R5HA 4Y2QA 4HAYA 5REQB 3UY4A 4E2YA 1OB2A 2Q5CA 1MJ5A 2CDAA 3ISTA 4U2CA 3TOSA 1ESZA 3N0WA 2F1RA 3KLBA 1PJBA 3RJTA 1HV8A 2WOJA 1SUWA 1UZUA 2GD1O 4HYYA 4F6CA 5JBQA 5A7GA 2O8EB 4PSDA 4BJ5A 2G36A 2GN8A 4K9OA 3WXMA 4PSCA 4U2FA 1VYVA 1U9JA 1V9CA 1SUIA 2FMIA 3I4CA 4ILKA 5TF0A 2F9MA 2WDPA 3GGPA 5CT8A 2HMVA 3HCCA 4DSTA 5B37A 2OMKA 4ZTBA 1QYCA 1DKRA 3FOCA 1N2IA 3UJ8A 2HO4A 4Y6PA 4AJ9A 2BEWB 4X63A 4TLLB 1JR6A 4LHEA 3G0HA 3NBAA 2X6QA 1XU9A 2ZT7A 4ILEA 3SIWA 3H5NA 3B6EA 3GN1A 2VOJA 4OM8A 1JFSA 1J9ZA 4MGKR 4R6XA 1VSTA 4S1OA 4PQYA 1ZJ6A 1U8ZA 2G09A 3LMKA 1GHTA 5MGBA 2DAPA 1RYNA 4MUMA 3SXUB 1YR8A 5IVPA 2XMDA 2J1LA 4TV9A 2R96A 1N0IA 3AFGA 3KL4A 4HFMA 4ZO4A 1UP4A 4HVAA 4ZGWA 1ZOSA 3L7YA 4KMOA 4ZCLA 1FY2A 4REMA 4CMGA 3O3OB 1GYQA 2QPTA 2W6MA 2A0FA 1TADA 3PDJA 3PQEA 4JSRA 4XWGA 2UYCA 2FFBA 1JLLB 1JMKC 4Y9UA 3PNQA 3OEHD 4G1VA 3QJYA 3KT0A 2GYVA 5T8KA 3RYFA 4FKBA 5HKKA 3NI2A 4FCTA 1KAMA 2X8LA 2QN1A 3EQ6A 1O6CA 2VAWA 2BGLA 2GERA 2HI0A 3Q5EA 5KQSA 1QBKC 3GW8A 3HP4A 3CZ4A 3LV8A 4G0QA 4WLFA 2QD4A 2CLMB 2NACA 3LQYA 2Q1UA 4KQHA 1QP7A 1JDUA 3SC2B 1ZBQA 4MEAA 1B7GO 3EGIA 3RKSA 2BEKA 5LYJB 1PX2A 1XZBA 2EATA 2J08A 4FM9A 2BHRA 1JJ7A 2Q45A 1IFXA 3AVWA 1MFPA 1E9FA 5BPFA 1D4FA 1SRQA 4LXXA 4Q02A 2JH9A 3OCZA 4QOHA 4YMHA 3T5BA 3UENA 4EFMA 5BSEA 4BC0A 1JXAA 3GC6A 5E38A 4QFBA 4UHDA 2VF8A 1RQPA 1XKXA 1A9YA 2WYWA 1KAHA 2FQYA 3CWQA 5HHTA 5IDQA 4QG3A 3CZ5A 5ENDA 1DBSA 2C57A 3WGLA 1M1YB 4G0YA 1RP1A 4N5LA 3W34A 2Q2QA 3SFTA 1JWBB 2Q8PA 2YN0A 4L3WA 2H5IA 3QITA 4YUWA 3NHZA 1JA1A 3WK7A 1RM5A 3W6OA 4IIFA 3L4KA 4G97A 3V4VB 2Q21A 1IHXA 1ONPA 2V55B 3OWXA 2C00A 2OLJA 1G4AE 3MBIA 4EY8A 4DV1B 2QI9C 4EL0A 1FFSA 1EDEA 2X22A 4UHHA 3R9IA 7REQB 3P0FA 2EWMA 4IJ5A 3VSCA 1JHZA 3EQ9A 3WS7A 1YZVA 2G1PA 5CVVA 1CT9A 4N8EA 3WL8A 4DLSA 3KT3A 5GY7A 2MR5A 2FSVA 2V7WA 4J0FA 4ZAGA 1E1MA 3I2JA 1ZVQA 2KPOA 3NP7A 3C3EA 4ZO7A 1ZEJA 1NYLA 5CLGA 3MB8A 4G0PA 4HDAA 1BWQA 1J2JA 4V3BA 1Y6GA 4WW0A 3IESA 1D7OA 3CWZA 3HUDA 3TFQA 5AVZA 2NZVG 2V7EA 1CZOA 2O5CA 1W30A 1TYBE 2BM0A 2ST1A 4TSFD 2DTXA 2WP8J 4OI2A 2C9MA 3TE7A 1KYXA 1CBUA 2O1WA 4Q66C 2O8BB 4G5XA 1C30B 1TM5E 5JADA 3H5TA 3ZE2B 4O29A 4AIIA 2QM8A 3V1YA 5A02A 2GDZA 5ECYA 1EI9A 1F0KA 3NBUA 2XB4A 3INGA 5AVOA 2QLTA 1JVNA 2TMDA 1BDBA 4H1WA 1JAXA 3W7BA 1LDEA 4JDUA 4MV3A 3ZJVA 2R97A 4QLAA 1PG2A 2Y1GA 3DDSA 4R9UC 1VG8A 5BSRA 2CC2A 3BMOA 3VDQA 4IJQA 3IC5A 2XGJA 5AVRA 3R0XA 5K1ZA 1NJSA 2FMKA 2XT6A 1UMBB 3DEAA 4F7WA 2PYIA 4OL0A 2GK4A 3ZHZA 2I2BA 1E32A 2ZRMA 3C7CB 1NN1A 2IEAA 1O7JA 2HADA 5DPMA 3CTPA 2X2OA 3MINA 3N2KA 1EJBA 4F3RA 4M9XA 3TR0A 3GZNA 3FXAA 3VNQA 5DH9A 1PQYA 3GHYA 3PQ5A 1GGMA 1S5PA 1SD5A 4HYTA 4LHSA 4D9EA 1C5KA 3EH2A 1V4VA 3OICA 1Z2DA 5JQGB 4LOIA 4PBRA 3QW4B 3BKXA 2BR4A 1K6JA 3M49A 4RE6A 2YUTA 4IICA 4KFCA 3JAKA 1KQFA 2AS0A 2PMCA 1K4KA 1CZHA 4FEGA 1AUQA 4NDZA 1LBHA 2FZ4A 5SYAA 4MKGA 3FB4A 3VNVA 3DBVO 1UMKA 1Y3IA 2JB9A 4P3XA 5I5GA 3H1AA 1VZ2A 2Q2VA 4ALKA 5JCJD 5KNDA 1ESCA 3JVDA 3B12A 4DZZA 3AI3A 1JIVA 1NXPA 4OH7A 4MKZA 3BVPA 4HRYA 1NN3A 3OZVA 3D6MA 3DZBA 1Y3BE 5TV2A 4OP2A 1SHKA 4J3NA 3TJRA 1NLUA 4KNVA 3R76A 3FHLA 2JAQA 4GX5A 1TO2E 3EYWA 3O82A 4EA6A 3KQHA 1B00A 1S7GA 3IQZA 4F1JA 1FSPA 4H3VA 3DE4X 2EIXA 3BIJA 1UMCB 2W6PA 3ILXA 3E7XA 4M8NE 1SVLA 1YRYE 4E15A 5DTMA 3RM3A 4YBZA 1NP6A 4YVFA 5ALMA 3SYMA 3P0HA 2M2IA 2HEGA 2YS6A 1Q6YA 1RHUA 1ZOLA 3QEKA 4JUBA 2ZSAA 5GVRA 4OI0A 4AROA 2DMRA 3C8ZA 2ODTX 5BR4A 4JIMA 4X85A 3MCZA 1U8YA 2Z04A 3DMHA 4OHZA 4COKA 2FCRA 3WGNA 5MFZA 4N03A 5CFQA 1OLUA 2C5GA 1ISSA 4DCTA 3PFCA 1A27A 2AF3C 1KIFA 1R0RE 2Z5GA 2RDMA 3G2JA 1BMQA 1SJ9A 2WAAA 2REQA 3WRXA 4ZI7B 2CF6A 2HY7A 2IS4A 1ZOPA 1EHYA 2AFHB 4FFOA 1S3FA 1E7SA 3IO3A 3I2KA 5DCWA 1XMOB 1UXOA 1PQWA 1GAXA 1SUBA 2FHSA 5EQTA 3E3NA 3V1KA 3F8TA 5BURA 1GQRA 3HEAA 3P0RA 1IWBB 2RMKA 4ZXFA 1UCFA 1G9XA 3IOYA 3FLMA 2RGRA 5A5EA 3S2SA 3ZDXB 2DHRA 4ZZIA 1VPVA 2XB9A 4GE0A 5B3KA 4I2NA 4D80A 5E95A 4V0KA 3T5MA 5G02A 4L1KA 5AW0A 4WA7A 4BQNA 2OSVA 2Z5LA 4IIJB 1Q0UA 2FG6C 4RMIA 1TU0A 2XR1A 2IYUA 3CGWA 3EXHB 1MQAA 2X1MA 3F46A 4DMRA 1KEEB 1LPAB 1SBZA 4UOEA 2V6BA 3T7KA 1AGNA 1FTSA 3VUEA 1A8IA 4L57A 4XQGA 3M9WA 1TYDE 3NDPA 2YVKA 3WKAA 4DJEC 3R23A 3M6LA 3SE7A 4A1FA 4RDXA 1OD6A 5JBNA 5JR3A 1WB4A 4CLHA 4L9AA 4EY5A 4PQRA 4I4TB 4X00A 1SOVA 2VPXA 4DBVO 5IUKC 5ITVA 4LBVA 1XTSA 5SZHB 2WRZA 3GQBA 5J5CA 3TWOA 5TC4A 5LA6B 4EQ6B 3DR3A 3D0OA 5EL0A 2WUEA 2DWQA 2VHYA 1FYFA 4GX1A 1C8KA 4QXOA 1ECBA 5TPWB 4LY6A 1E3JA 3JD4A 5CR9A 4OFXA 4MX8A 1CQPA 4XTRA 3D2LA 5F76A 3CH5A 3TX6A 2VQEB 3UPUA 1Q0PA 3UMFA 2LKDA 2X3FA 3KR2A 3N8IA 3OZIA 4B2YA 5JNRA 3H4TA 2GM4A 3LHDA 3F4BA 3N3AC 3LF2A 1WKVA 4GRDA 5BNZA 2WU3A 4HXEB 1TEXA 3BH7A 3EGCA 2EIHA 3OE7A 4WLVA 1NBHA 2AJLI 3N0RA 3H05A 3SX4A 3C48A 3K0BA 2XDAA 2BGUA 2BFEA 3AL3A 1MRSA 1WLYA 2DRIA 3MWEA 3OC6A 3QYFA 5GJCA 3K1AB 2WUFA 1RWQA 5CT5A 4BAGA 5KTMA 5C53B 3T3EA 3T7IA 1DJPA 1E4EA 3OCCA 2ODBA 1JQBA 1E3EA 2CXNA 3A2MA 3CSDA 2FUCA 3NOOA 3RC9A 3QI7A 5BWMA 5I4CA 3QWIA 3H0EA 3KV3O 1Z12A 3EAQA 3EQ2A 3ICWA 4DQUA 4R6WA 4G8CA 1WRBA 5FUBA 3AFNA 1RXWA 2HA2A 3I5MA 4ND8B 2GKOA 1ZI6A 2QTWB 4P3OA 4P38A 1YFJA 5BSKA 4ZN6A 2H1CA 3OFKA 1P1RA 4GM4A 4HLNA 4KV9A 1O6FA 3AT1A 1VHWA 3SJAA 1TIPA 1HXHA 4Z4IA 2I8LA 2RC6A 4TQAA 5L3SA 3M4JA 2Q7OE 2X7XA 3QELB 4EPVA 1D03A 4FWTA 3FROA 1XCGB 2AFRA 5KB3A 1YMVA 5IJXA 3DXXA 2C5EA 3BM5A 1H2FA 3PXCX 3UUWA 2R8ZA 1QGDA 1P4AA 5DRTA 4R2LA 3HACA 4J0CA 5KYVA 3DO6A 5HRUA 4LVOA 1P8JA 3FE2A 4ZTUB 1U1DA 2ZT6A 1N5KA 2RKWA 1QHXA 3FKJA 2RH5A 3NLLA 3QXHA 1XJWA 5BMVB 1G8JA 3FOBA 1ENYA 5EWMB 1YU9A 2DLCX 2Q6KA 3NVKI 2ZRQA 3PFGA 2IL1A 4LC9A 4G1BA 4MS1A 4Z0TA 1U2SA 4F9FA 1FVHA 2QVLA 1ZC4A 4IGAA 4CM9D 2JHFA 1OI4A 2QLBA 1YS1X 1Z6YA 3RSFA 3NAZA 3ZH2A 3U26A 4BIMA 5JH7F 4JI8B 2WT9A 2A5LA 3OHSX 3OWHA 4DLUA 2FWPA 1Y3FE 1I0IA 3ZGZA 1I5OA 1TK3A 1VKHA 2O2IA 4JX9A 1QVZA 2W37A 4JVLA 5BVHB 1JPJA 4Q9HA 3WLHA 1PDVA 4KACA 3EC2A 1APBA 2D5CA 3MUNA 1VI6A 4ZOLA 4FU0A 4N49A 1V3TA 4KOEC 1JEDA 1T2DA 4PWZA 1EFTA 3LY9A 3RUEA 4ER0A 1P2SA 1P31A 1J0DA 1ZINA 4BLUA 2DFNA 4B3SB 5D6NA 3DW3X 1MG0A 4OF4A 3W2IA 1BHO1 3KOXA 4EG3A 4E5KA 1EE1A 1SC1A 5EKXA 2IIQA 4NR0A 4HTAA 1H0SA 2ZULA 5KJCA 5IBRA 2C84A 3NHJA 4K5QA 4PIVA 4Q93A 4X0EA 1Z06A 5IBCA 2JVIA 4EYSA 4W8HA 2G07A 1Y3CE 1YNOA 2C8KA 2H7VA 2JI4A 2XNDA 2YY6A 3B70A 3FGZA 5BXYA 2DETA 1GPDG 3OESA 4FXOA 4YAJA 3IBTA 1KZYC 4YCJA 4DMHA 5DNEA 3JQ9C 1B41A 2DR3A 4LVCA 3RS3A 1U0TA 3OTHA 4RVCA 1E5LA 1NW3A 1P0IA 1NQOA 2I8CA 4JU8A 4RVOA 1NNI1 1UMDB 3CLTD 4I9NA 4BRSA 1X3LA 3CONA 2HBRA 3GFGA 4KO2S 4L51A 3RUPA 4Y98A 3MS4A 4KYIB 3QKIA 4EOGA 1Q0TA 3QPAA 5IG2A 8LDHA 2FPSA 2FN8A 3U4QA 4Q3EA 4D8VA 4BNMA 4RTPA 2PFKA 3S1SA 1I7LA 1AKVA 2IV3A 2VF5X 2W00A 5C8YF 4FONA 1R9NA 3FWNA 3ROQA 4MWTA 2B4AA 1QYWA 2P69A 4TWIA 4A6PA 4N48A 1JXMA 1FZTA 3RASA 5C7OO 1SU8A 4IVQA 3L02A 4UU7A 5CYFA 4XQ0A 1YHNA 3ROZA 1E4OA 2WB4A 2BP7A 3BDAA 3STTA 1AURA 1XG5A 1W4AA 2ILVA 2ZETA 4MTCA 4U8GA 3GLIB 1M34E 2ZI9A 3P9NA 3P27A 4BTEA 1EHIA 1QO0D 2I1VB 4FHFA 3LA8A 5E6RA 1OXKB 4TS9A 2XSZD 4B0OA 3SQXA 1DC4A 3IT3A 3PJGA 3BREA 2DG2A 2JS7A 3VZRA 1WJGA 3H5OA 1T0UA 4CTNA 3BHNA 1TLFA 4C78A 2CVPA 2W6ID 1J1UA 2H1VA 4BMPB 2ZGVA 4K7JA 1C9JA 4MVJI 2YY7A 5T7BA 1VJDA 3DDHA 1XAJA 3QXJA 1QYVA 5BOSB 4Y2TA 3Q72A 4OO3A 1SVKA 1PQPA 4CTJA 4ZEXA 4RKEA 4ZV7A 221PA 4YREA 4O4HF 1ZH4A 2A9KA 2OHGA 2ZUVA 4WX2B 1G20A 4KXVA 2JAUA 4NNOA 4CF6A 3DO5A 3B1VA 3LY7A 1UKVY 2NVBA 4WOJA 4Z1MA 1WZEA 5KYWB 3GRYA 1VDMA 1SZJG 1ZMBA 2JI6A 3A1TA 4HWSA 2Y76A 5DHSA 3UXYA 2GXAA 2H1OA 1CDEA 2JFYA 2GASA 1FJGB 1Z2NX 2PAFA 2PQ0A 2ZBUA 5JNSA 3EMVA 3G0OA 4LQLA 3VC1A 2JH3A 1EX9A 2EV9A 4G56A 5AM1A 3UVEA 1S02A 4DWVA 1W36C 2W6QA 4GYYA 1TAUA 4RTKA 1YJBA 1NRJB 1W59A 1UBHS 4LYFA 1N6RA 2EHDA 4NOMA 3W7VA 5K6TA 2CHEA 3IYLW 1UFVA 1VQ1A 1P19A 5HCNA 1J2RA 1W1IA 4TUYF 5MF6A 3I28A 3W8NA 1U90A 1IQ0A 4X7BA 2Y1XA 3C45A 2VP2A 3BJIC 1FA9A 2XYHA 2KWIA 3G8CA 3NUQA 3QE3A 4TLAA 3BCHA 1Z6TA 4JX8A 2DBYA 3IUSA 1E5QA 2IC5A 5A0FA 2G9VA 2LRHA 1PJ4A 3QVJA 4H7KA 5DCYA 2QTZA 1P5RA 1FSFA 4RFSB 3K0KA 1Q2XA 4XGKA 3TTYA 3UCXA 1S9DA 4EENA 3C15C 1AGRA 1DNPA 4OG2A 3RAEC 2OKCA 3U5ZB 1I3LA 1L7BA 2GARA 3KJHA 2W2TA 1QUEA 4IMPA 4D8XA 3D2CA 2ZAOA 3D7RA 4HTFA 4CKYA 3PHJA 3FCEA 3ANSA 1DI0A 3L05A 4EFDA 3SSMA 4MZDA 4GF5A 3BQMB 3SCZA 2XAUA 3L4BC 1RPNA 3LUHA 2VAMA 4UCXA 1QDEA 2WYOA 1MPTA 1XTVA 3PXUA 2WJHA 4IR7A 5LU9A 4EY4A 1NNEA 2AT1A 1BVRA 4NHOA 3C7DB 4RCVA 4YN3A 4U2GA 3MWDA 3AEQB 5BQPA 2JK1A 3ZWPA 4NCAA 4ZYXA 3PPIA 5KTYA 1YZTA 3AUXA 2Y68A 4DABA 2X1LA 1KI9A 1I6LA 3T7JA 4FFBB 1SOMA 5MFPA 2D8MA 2ZRNA 4HEA6 3R7LA 4QPPA 2XD4A 2ZPUA 3GG9A 1HLPA 4DARA 3UWDA 3DF7A 3HCWA 3H5WA 4HQFA 2ODNA 4N1AA 2DFVA 5ITZB 3AJEA 3G23A 4MKHA 3I0MA 5IFKA 3I8XA 5A0VA 4N39A 1A7KA 1RRKA 2Z58A 4BMCA 4CDMA 2W6JA 4LXTA 2VDRB 4ZOBA 4P0PB 1V2GA 1IZYA 1NOKA 4TTPA 3WWYA 2G76A 2CMHA 3SS8A 3C3JA 3EGXA 4M37A 4X8OA 1V8FA 2PVPA 2V9ZA 4D0LB 4MYCA 2J09A 4HI0E 1L5ZA 4DMKA 3DVSX 1ULZA 3QFRA 3EVFA 2WP0A 3I30X 4R2MA 2HIMA 3MB5A 5CB4B 2IS2A 3CEAA 3EEBA 4I55F 1IEWA 2DTDA 3OD5A 2B1RA 3AESA 3IUNA 1EGHA 5LQSA 1FXSA 4GVPA 3UUFA 2OB1A 5DTQA 4M0LA 1V1MA 2FMFA 4AZ3B 5C3MA 3O73A 2YJGA 3IVAA 3RSZA 5DM60 4BE9A 3F6PA 3IO5A 4QA9A 4PE5B 4ZOCA 5FPHA 3VX3A 2YWBA 3A3PA 2OC9A 3BCRA 1FFXA 3C8HA 5FH9A 3D6FA 1KJJA 4HDCA 5JNUA 2I6UA 4ZVQA 1Z6QA 3L8HA 2ALJA 1ZI8A 2J3EA 2JD0A 1TAHA 3PEVA 3RSGA 4AJNA 3QU4A 4IV5A 5CFZA 5JANA 4U7HA 2PU7A 3AL2A 3ORRA 3OTIA 1VGVA 1YTLA 1OGIA 3ADDA 5M04A 5I7HA 3CVXA 2R25B 4D6PA 1EP1B 3ICPA 1BFKA 1VIMA 2HC9A 5EJAA 2EBUA 4WNIA 1AQJA 3WLOA 2BR5A 4UHJA 1DHRA 4PSUA 5JY1A 4DIOA 4EG8A 5FPSA 2LZ0A 5KIAA 2OAGA 4LY9A 4LXQA 2V98A 2TYSB 3AV0B 3FRIA 1PS0A 2ZJFA 2WM2A 3IP1A 4HZIA 4QARA 4RESA 1IAQA 5HMMA 2XOEA 4JUFA 1ATZA 3QVVA 1NWCA 4WY2A 3GGJA 3L2OB 3SOPA 4L7QA 3C87A 6LDHA 4L4RA 1Q15A 2BLLA 1U28A 1QFMA 5HTOA 2R1TA 4JT2A 3FCYA 1UC8A 3OFJA 3TLMA 2A8YA 5BRJA 3GLKA 2XDWA 2ID7A 2IEZA 2QG4A 3I92A 4N41A 2XBMA 1Z63A 3WYAA 2QF7A 4LG1A 3LC0A 3SF8B 5H59A 4YBRA 2C5LA 4C7XA 3WMWA 3HCNA 2DF8A 2WUWE 3OFNA 3VR4H 4E70A 1NUSA 1XEXB 2QI9F 3H1PA 3NYRA 1T9GR 4MS4A 5BSTA 3ZGNA 3SVLA 1SELA 4ALJA 2QR3A 1ZN2A 2HXSA 1DFIA 1NMEA 1TAGA 2A1IA 1SG6A 2I7VA 2R68A 3KM0A 4W1PA 5ALWA 2VH1A 2ZDHA 3ILVA 2GRUA 4F2HA 2LCFA 3IS3A 2QJTA 5LD2C 4U7GA 5CM8B 2CUKA 3MQ4A 2XGOA 3MW8A 4MGIR 1IXKA 2BJHA 3I53A 4NJMA 1VECA 1RZ3A 3E7DA 3M33A 4BNLA 2C07A 5HXAA 5ABPA 2HSWA 1WTCA 2RC5A 5ULLA 4OFZA 1Y80A 2XWBF 1ISHA 2AI1A 2BZ1A 4K40A 4IDAA 1TQDA 1C7IA 2NV6A 1Y9EA 1Z35A 1ZQ9A 2FW9A 2KI5A 1QIKA 3GFVA 2OZKA 3LHFA 2BEUA 1U8XX 4NZPA 4UULA 4XVRA 4ZU3A 5EWLA 1B3RA 1BCRA 1UM9B 3UMYA 1ORDA 1OH5A 1FBNA 1BJTA 3B48A 3ZQJA 2NUTA 1NKSA 1SCJA 2FMUA 1YDHA 3PXDA 3HDYA 4EQZA 3G9TA 3RKUA 5J43A 3ICEA 1NATA 2YCBA 1QGOA 5FI3A 2E49A 3EOBI 4I1VA 2PS3A 3M9XA 4C88A 3PDWA 1H4TA 1D9XA 1QMPA 2QE6A 1XNQB 3G7UA 4PC7A 3HBMA 4YONB 1W19A 4CKEA 3FWHA 4ARIA 2VA8A 2YOHA 2VJAA 1U7ZA 1Z6XA 2REBA 4FJ0A 5D5HA 4IUYA 1JPNA 2ZR8A 1KO4A 2UYGA 3DYVA 3R5KA 2G8LA 3R0VA 1U7WA 1SCIA 3QJGA 4RVNA 1TTPB 1UBLS 2GAFA 3S2ZA 3SGLA 2C20A 2JGEA 3V7NA 3A26A 4BKRA 3IEMA 3BD8A 2AWNA 1XELA 2H63A 1P18A 2GZSA 3A9VA 1JLSA 2B8NA 4FKZA 1PD1A 2F4NA 3A37A 4DLYA 1ID8A 2C4VA 1HFJA 4FGSA 4KGZA 2XLBA 4EHNA 1DBWA 4MP8A 1B3BA 3EFBA 1A71A 2BFBB 5IM4A 1U3FA 1KSHA 1NIPA 1T5HX 2WD8A 1FE8A 1FFHA 1TW2A 3B5JA 3NYQA 4JLDA 1EUCA 3TTUA 5K3DA 5THQA 4BJHB 2BGJA 2D1RA 3EZXA 4RLQA 4BB6A 1VE3A 1QHSA 4PC6A 1PLJA 4U7FA 3Q3JB 4OXQA 1AB5A 2HZBA 2W11A 3VDMA 1TF2A 3ZQ6A 2ZJOA 4PLFA 1OAAA 3SOZA 2X8BA 4OOFA 3F8SA 1JVBA 1XD8A 2APJA 3P2MA 2AFIE 2ZJ5A 1U7OA 3L46A 4IOMA 1DKUA 1WZ2A 1R12A 2FQ1A 2UUPA 3DGFC 2RK4A 2WUDA 4OQMA 2B4YA 3LRPA 4ZT4A 2Z5FA 4B4DA 4F38A 1LLFA 4QFMA 1J7JA 2WM9B 3GI1A 3NOVA 4MVJE 4MHOA 1N57A 3ZDQA 4WZZA 1V96A 4ND4A 2OHXA 4A8PA 4I1RA 3GB9A 2WVHA 3JW8A 1LK5A 1R5BA 4QQRA 3VO9A 1POWA 4BC1A 4XOUA 4A91A 2HLPA 3MMNA 4E5YA 2OD9A 4IUCS 4DDHA 1R37A 3E2IA 3BWYA 4IJMA 2Z4SA 4YECA 1M2OA 4XUGB 3RIGA 3AZOA 5CITA 1H9AA 1SXJE 2QXYA 5DGDA 3HB7A 4YUAA 4RAOA 1M6YA 4Y67A 1R4AA 4QDOA 4EKYA 2VYQA 1V95A 3O47A 2V0CA 1M6VA 1C1HA 3ZE9A 1T34A 1E6LA 5SY6A 4CE6A 3IKTA 1COWA 4XB6B 4ZVNA 3KSUA 1ST2A 1D6MA 1ESEA 2KE5A 3EIFA 3PC3A 1SCAA 4ZHQF 5H3CA 2D0IA 1N34B 2AKAB 2DQZA 1UWKA 3IIMA 3OU2A 3T8YA 4BX9A 5JW6A 1IBCA 4W99A 2O3UA 2J46A 2JJMA 2QTLA 1ZD3A 3OTGA 2WG1A 1MOPA 3AEUA 3I1JA 5HDQA 3S7TA 3W7AA 3WLKX 4ZMBA 2YV3A 5MN4A 3E9NA 1SVUA 2J45A 2A2ZA 3E9QA 2BR3A 1KAEA 2R6AA 2C29D 3JQFC 2MYTA 4BO9A 1TU3A 3ZY2A 1W581 5A4AA 3CNHA 4ECEA 1Z8NA 4C2TA 3ZHBA 1V43A 4IO0A 1W0JD 4DUGD 3K0FA 2RE8A 1FPMA 1O77A 1OXVA 2FZVA 3VH2A 5F9HA 1WXWA 3ETCA 4BOYA 4KBYA 3O9ZA 5D2CA 3RS0A 1DDGA 3B3AA 3FLAA 3OLXA 1NXSA 3KL2A 3OUUA 3NBZC 4O3FA 2Y0EA 1RTKA 5IVHA 1R27A 4KB5A 3I76A 3NC0C 2WMYA 1DAEA 4KXYA 4WESA 4D4LA 3VKHA 3L04A 1D8AA 1XA0A 4B7XA 3R5JA 3RYIB 3STXA 1WOMA 3V4SA 3BAZA 4GKBA 4N5MA 3VV2A 3SEFA 1SU7A 2V4ZA 3LK6A 1W4RA 4MW5A 3CR3C 4EYGA 5C5DA 1EJ0A 3GUYA 4Q4HB 5ITWA 2XKKA 2R66A 4ZA2A 2VJOA 4G0ZA 4Y0VA 1B15A 1G8PA 5DE3A 5KOJB 4GKVA 2I7CA 3OHMA 3MCTA 4B6JA 1B26A 5JDIC 1V11B 3ZHSA 3COYA 5JSZA 3ITEA 4ER3A 2PLNA 2WNIA 3G7SA 4NYIR 1TD9A 3ZV3A 4XDZA 1JQDA 4K6OA 4QTYA 3QYPA 2AH5A 4KR2A 5EQDA 1IOLA 1HH4A 2HWUA 3N5CA 4M7OA 1KTVA 1QONA 2ACVA 3I2IA 3ZDFA 4MMXB 3Q5DA 5IC5A 1SCNE 3P94A 2OORC 5AVVA 2H06A 2QSYA 4I4LA 4P58A 1A8HA 1ADBA 1Y8RA 5HILA 1NONA 1N32B 4H6XA 1JHOA 4PFKA 2DWOA 3F3YA 4OFBA 1J2EA 1F2TA 2EYQA 2H7CA 1N5JA 3LQFA 5TT1A 3CZRA 2YHIB 4CR6A 4KHZA 1C7FA 2RHHA 4HAIA 4BB9A 5C0OE 4D42A 5BUQA 2JATA 1QWSA 1SKUA 5G1OA 4GC5A 5F2NA 1MC4A 2CXHA 5EA2A 3LWNA 3IR5A 5DN6D 3FOWA 2XX3A 4NH0A 4QTXA 1KFEB 3WYFA 1W6RA 2P9HA 3GZJA 1WXDA 3OQJA 4ZPXA 5DOZA 1USKA 3MWKA 4MCAA 5ALNA 3SD7A 3TUZC 3WZ2A 5JVDA 3UW3A 4F8JA 4TMTA 3F2VA 4JLNA 4EMBA 5MGNA 4L5YA 1B16A 2NQ2C 2QUHA 1PKXA 2REXB 4M9ZA 4JLVA 4JR2A 4WBNA 3TCKA 2VSNA 2BYTA 4G5OA 4GVXA 2KB0A 3FPEA 3QBJA 5FR2A 4HH4A 2QJFA 2QUAA 3KS9A 4DDMA 4L8WB 3L1HA 3MM4A 3BFPA 2WVGA 3R9KA 5JCPA 4J1QA 1X9IA 4DL9A 5IDXA 3PQ8A 1DMRA 1XPJA 1SHTX 3GRRA 3LDGA 5F78A 5KDOA 2YRWA 4MJLA 1BZYA 3A4TA 1RM0A 4G9GA 4DT1B 4GMXA 5DM2A 1ZVVA 2HRQA 4EWLA 1FPQA 4EY7A 2DFPA 3HSYA 1VLVA 3NCTA 4ZKDA 4L9RA 4CQMA 4C0WA 1NSFA 1PS8A 4PZ9A 2B7LA 3LLSA 4XVQA 3LQ2A 5HUHA 2J9ZB 3O8LA 5IYZA 1XCPA 3EFOA 1JQ5A 5JWRA 4W8OA 4ZJZA 5HKKD 4XPIB 5HWSA 3IPRA 1OWNA 1ZQ1A 5TMDA 5J4LA 4URZR 1PTKA 5GZ6A 3IL2A 3LTNC 3F1KA 4KITB 4EHFA 3HJBA 4LS3A 5I3CA 1RVDA 4ZQGA 1FJXA 3N2GA 2H48A 5BWNA 2NPIA 2R6FA 3OQIA 2DHQA 1DOAA 2JGMA 1G18A 2ZITA 3FDZB 2YW9A 2XW6A 3FMVA 3C3XA 4QU5A 2Z83A 1G7TA 3NAQA 1PS9A 3K5PA 3LVQE 4P0TA 4UTXA 1EFRA 1FU4A 1JR2A 1XTJA 4KO4S 4QXPA 1TLLA 2VP3A 3I83A 2FJUA 4K9PA 4OHPA 2WKQA 4QNMA 4UE2A 3DL2A 4LK2A 5AKIA 5TQ2B 4AF8A 4DSUA 2BN4A 2GZHA 3OZWA 3AXTA 4FGKA 5DBEX 5C34B 2Q07A 1XMPA 5HP4A 3AW8A 1U3VA 4PF1A 1ZO8A 4QBKA 5FTWA 5KTTA 1PFVA 3BBLA 2H7YA 5AQEA 4G01B 2CK3A 1U3TA 1MGOA 1TFUA 1QGUB 1YS6A 3T7TA 2F1OA 4O2AF 4Q7MB 1JKXA 5H5JA 4WFQA 1JN0A 4S2UA 1K5DA 1RFGE 4UAGA 3MRTA 4R1NA 2P9GA 3DVLA 5E1OA 1JLMA 3OU7A 3COSA 3ZQUA 4IIXA 5AJYA 5H9VA 1I24A 4V03A 2EJCA 1RRVA 2D1SA 3A1UA 1YAJA 1K0FA 4OXRA 5G3YA 4A8JB 2J3MA 4G5RA 2D1TA 5EZYB 4NV0A 4HH1A 2JA1A 3FZYA 4PYIA 4DIUA 4RH3A 3EW7A 2YR0A 2BL4A 1JDZA 1DAOA 1E9DA 1TF5A 4OQZA 4UBKA 3AEYA 2WPDA 2LXNA 1UDXA 5U9CA 2O8NA 2XXJA 1XYYA 2GMWA 1X7ZB 3QY0A 1PZXA 5FNVF 1R0WA 3AMVA 4LEIA 5JSHA 3TW8A 4MIOA 4YAOA 3BRCA 1ZICA 2OPHA 1Q7RA 4IXDA 3UGQA 3VC7A 3VR3A 3E0XA 5E0OA 4J4BA 1EMDA 1NFFA 3WBBA 1ZESA 4RL4A 4RD2A 1UDWA 1OX4B 3N8HA 5IJ9A 2C7RA 3ONNA 5K8CA 2R4QA 5CH3A 4IQGA 4BP3A 3CS3A 1P81A 4WXHA 5GAJA 1YZQA 4PSVA 4XLZA 3QFSA 3WIDA 1A7AA 3QFHA 4XX0B 2IXFA 3TM5A 3KZCA 2DKOA 1Y42X 2PIDA 1EUQA 4EUEA 2O06A 1SCUA 2JEOA 1NMYA 3OFSA 1FQWA 1PJ8A 1N6OA 2IFTA 5FRDA 1JFFB 5C1IA 3ED5A 1LQUA 4YCAA 4RTNA 3OI7A 3NVDA 3FUXA 4GSKA 4CKXA 3B53X 4MVXA 4XEHA 4KXNA 4E5VA 5BYAA 5CB8A 2E4YA 3RBAA 3MBKA 2UZIR 3GJ0A 4PGAA 3D3WB 3I2GA 5K0LA 3TN7A 3EGWA 1THZA 1Y1LA 3RJMA 5COBA 5ALZA 3TLKA 1ISFA 1HMPA 5A9TA 3DC7A 1KH1A 5BN1A 2RG1A 3WK8A 2YHSA 1B6SA 3TSCA 3K8YA 5BSVA 5LMZA 4W5TA 4GM0A 5AKGA 4G6ZA 4IFTA 1HE4A 5HF9A 4FKMA 1E1DA 1W5EA 2VYFA 4X93A 1K7YA 3TOCA 4DWWA 4ZYLA 4B4KA 3RJ5A 4M1MA 1XL1A 1QFJA 1DBRA 2E1RA 2BBTA 3F6SA 3B6MA 3NIFB 4FE7A 1YCGA 2DQKA 2EX1A 1BEEA 1AGXA 1A2BA 2HNAA 1UJBA 3I1IA 2QZPA 2B1GA 4ZCPA 4EI2A 2O2ZA 2X8WA 4LFBB 2PBZA 4YO8A 3CG0A 3COPA 4UZSA 1JKMA 3SM9A 1A4RA 1UZAA 3N53A 3HHPA 3NHPA 3WNBA 5KNDD 1VBNA 4UUOA 4MP3A 2VK2A 3IT0A 3DOIA 1CY8A 4YRTA 4AWAA 2X2FA 2HF9A 5LQJA 4M7RA 3LH5A 4RABA 5D3QA 1U9IA 2J7KA 1VL5A 2NTNA 2PZJA 2V6JA 1RHQA 3QTLA 4R7TA 3V2HA 4PV7A 4XH9B 1X7DA 1U0BB 2I7DA 3IAXA 3IQFA 4KQ1A 4LMBA 2W7TA 3V7UA 2HRZA 1ZR2A 1B2RA 4XLTA 4R9SA 3WIOA 3T12A 1TIKA 4ZK2A 6GPBA 2MYPA 1ZMOA 4MRPA 2JGAA 4RV5A 5DBIA 2WA2A 4RPLA 2DLNA 1YUMA 3JX9A 4IQ4A 4AICA 3BE6A 3MGAA 4R8VA 3D2BA 3UMJA 3JV7A 2HMWA 2X9QA 2ZTSA 4NQRA 5C46F 1TM2A 2DULA 1YKSA 5T64A 3VH3A 4PYOA 5ALRA 3W6PA 2WD7A 1H8ED 1S3GA 2IIBA 2LWIA 3O03A 3ZCTA 3AY6A 4DLLA 1JQKA 3OQ1A 1N3LA 2D1YA 3UJ6A 3CF4A 4A8HA 2W8BA 3IP3A 4HGRA 2X58A 3PFFA 4I8IA 3M6MD 4DLXA 3IV6A 1VA5A 3NWBA 4UNQA 1X0VA 1XZJA 5AW2A 4YASA 1MDBA 2ZB2A 3C97A 2H4FA 3LE8A 3LT5A 1MB4A 3QF4A 4ZZ2A 2RJ3A 5DT9A 2V45A 2CYCA 4TV9B 2NPOA 3HYRA 2OKGA 3IEUA 1I80A 1JZTA 4JJEA 4HNVA 1XNRB 1Y7LA 3EZ9A 3E84A 4JYCA 3GMTA 4RHEA 1YGYA 2R8BA 4ZT7A 2HCBA 2V5VA 4CNBA 5EIEA 4ME6A 4FD3A 2RGNA 1WDKA 3RFVA 2F48A 2JFUA 5BOVA 3AVVA 5EJMA 1FJ2A 3RFXA 3RYFB 1UBOS 3U4AA 1HNWB 1CE8A 4P7GA 4TYWA 3D8RA 3EMKA 3CCCA 5F5XA 4D2IA 2XH8A 4AVYA 1UFQA 3KJEA 5G3ZA 3TZ6A 1HKUA 1Q3KA 1TL7C 2R00C 2WWGA 1LDGA 2ZRDA 5J4VA 3DFZA 4J49A 5AVQA 1DC8A 4WK2B 3PC2A 2PRJA 3UBMA 5HKAA 1RYZA 3TVTA 1E9CA 2GPBA 1H2EA 2E4ZA 2W71A 2DX7A 3AEZA 3F5FA 1HQKA 1WEHA 1JSCA 2HQRA 1L4YA 3NB0A 2H7XA 5BY2A 1U5BA 3H2YA 2YBEA 1JYSA 5CEFA 1CDOA 4OJQA 4LSMA 3GRKA 3VTKA 4B3BA 4WTOA 1KVUA 1R1DA 2R85A 1NE7A 1CETA 2MSDB 3DZJA 2YTZA 2O20A 3E61A 3KPVA 4H16A 4OA8A 5CDHA 2PSFA 3HBNA 3MEQA 3PQDA 2Y0DA 3EQ7A 3BTVA 4QC2A 4B31A 3QWFA 1HNZB 4U9HS 1A5BB 1W4LA 2WNSA 3BWMA 3CMMA 3FGOA 2VN8A 4F45A 5CG1A 2BRUA 1AGPA 2I4TA 5FP0A 3GUCA 5HRAA 3PLRA 3HHEA 2PGAA 1DEOA 1X70A 3O83A 1ECLA 1JU4A 2ZWPA 1WUYA 1XPUA 4WZBA 1W4BA 1KEVA 3CLSD 1NRIA 4GUAA 1QGYA 1EVLA 5HIIA 1OZHA 3A04A 2BY4A 2ZRKA 2X9VA 1RC0A 3FNFA 2HBYA 3GGOA 4P3YA 1TZBA 3GJTA 1GO2A 2Q4RA 3GIWA 5ALGA 2ZREA 3RSHA 1LVUA 2OYSA 2G28A 2K2WA 4Y9SA 1KBZA 2ATXA 2XOXA 3K05A 5HF8A 4B6GA 1FOEB 3BMQA 5KQGA 1UFKA 2WT4A 3W8RA 1M74A 1WU7A 2C9ZA 3EY9A 4FI3F 3W8FA 1ZXBA 2OXRA 1N92A 4LZAA 3A2LA 4MVJM 4N0EA 2OXIA 1C3OA 5HBGA 2BZ0A 3ENZA 2IYLD 1UDAA 4JCCA 2UXBB 3PCXA 4CLEA 1RSZA 3H3FA 1KMNA 4D3YA 1LTQA 2DXIA 4IHJA 4CMHA 4JLOA 1NHGA 4UXJA 3ZZ1A 1Q21A 3C16C 3D0QA 1E89A 5ILQA 1RJWA 4JB0A 2IYVA 3TI7A 3U80A 1RE1A 5C52B 1USUA 3HWX1 4BVLA 1YB7A 1HDXA 2L82A 1FP6A 3M8KA 2E7ZA 3P32A 1OHHA 4ROTA 1UXIA 4KK3A 4GU5A 2VXOA 3DVAA 3RU9A 4EB6A 1WX1A 2FFJA 9GPBA 4M9CA 4HVCA 1L5NA 1SO8A 3IX7A 4S0XA 5A6SA 2G83A 4A6DA 2BAGA 3NG1A 1Q1BA 4R8MA 3PXGA 3BMOB 3KYCA 3QNWA 1KKMA 4C9BA 2AX3A 1ONBA 1W44A 2BDUA 3OE5A 4Y2GA 7MHTA 2GCIA 2IUEA 3RT1A 4MUIA 3K32A 5FUQA 1G8MA 4OIMA 1QB8A 1XT6A 3G59A 4OHCA 1DX4A 2GEUA 1ZGAA 1Z6GA 3EEYA 3KPJA 4Q05A 3SC3A 2ZSHA 4AURA 3NASA 3N2KB 1ISJA 3IAM6 1ECCA 1T8SA 2Q5FA 4OQXA 2VBCA 3GZNB 1Z5PA 5KJEA 4C2AA 3QLVC 1J22A 2D3WA 5DYYA 3UOAB 3HB1A 2HWWA 4GI7A 2CLEB 3HKBB 5K4AA 3HBAA 4G5QA 2YV1A 4RY2A 4ZVLA 1UT5A 4Y6RA 1U0OC 2ORVA 4HN4B 3HCOA 4ISCA 1CUJA 1RYDA 4ZCRA 3JAKB 3TB6A 2EJTA 1NBAA 2G04A 1QKKA 3KOYA 5K6RA 5DM0A 1H6AA 5DXFA 1JSLA 1CJBA 3DEFA 2Z43A 2QL9A 1GUBA 3QOYA 4GWGA 5HM8A 4FB4A 1GQYA 3H9GA 2R2GA 5KVCA 4CRWB 4QBIA 2B99A 3EK2A 5ELLA 4L4SA 4B5LA 1ODLA 1GN9A 1T4DA 2Y8EA 5AIAA 3D4BA 3VHXB 3T99A 1R9JA 3BGDA 3VR4A 5KVSA 5FUVA 3RSQA 2XNDD 1CS0A 1TK9A 2ZBVA 1JDBB 1M33A 3PGXA 4IVNA 1DRKA 1SKYE 1UINA 4WRRA 2AOTA 1F5SA 1ZA1A 3DBIA 5J59A 3V34A 1L9KA 1SRRA 3MPOA 2QTGA 1O0BA 3OT1A 5LYJF 2O2HA 2PSEA 1CQXA 4BE7B 4YMUA 4EO4A 3FAKA 2ZWVA 2FWAA 2VKQA 3D3KA 4BFUA 1YF3A 4CFSA 1OU4A 2PE5A 1KH3A 1GNVA 5CNKA 3DC2A 1NYRA 1YHYA 1RBQA 1KF0A 1XDGA 2GTHA 2NT3A 3DMNA 3DOOA 4LOLA 4TRNA 2P9ZA 2FN4A 2XITA 3C3PA 1HMYA 3OLVA 4J16A 4AMGA 4YCSA 4PLYA 3MUFA 5DW0A 5L40A 2IW3A 5KYTA 3D3JA 4RDHA 2IDJA 3QYAA 4XCXA 5T3UA 2FX3A 5JZVA 1OLUB 1RADA 1FUKA 1LX6A 1PSZA 2C98A 2ZJZA 2H2GA 4MVJG 4UNSA 3MQFA 5E0KB 3MXOA 1XP8A 2EL9A 1DC3A 2VZLA 2YJ6A 3B6KA 3H8JA 4KJXA 4RZ2A 4ETWA 5B4TA 3QGMA 2W6OA 2P2DA 2REQB 2X19A 3ISVA 5K9ZA 2HHAA 2BTOA 2ZIXA 3DB2A 2PEYA 2YJNA 3IP5A 1A7UA 1E9EA 3C6ZA 4LCBA 4QGSA 4W9NC 3DO8A 4OK3A 3KB6A 4E2ZA 1EFHA 4K1XA 1B14A 5HCIA 3S5UA 1E1QA 3U44A 3E8XA 2Z2XA 4A10A 4HJXA 4EATA 1D4OA 3DE5X 3PKIA 5LBUA 3ZWCA 4BDSA 4D6YA 2Q1SA 3CXRA 1CUYA 4XAQA 2D6FA 2QT0A 4RVGA 3E15A 3BXOA 5EJ2A 3VPBA 5JASA 1NVFA 1FTQA 1OCEA 1AKQA 3ZWNA 4W9RA 5ALSA 2XMSA 3WC4A 1LFDB 3VVMA 2DPLA 2QR5A 4CETA 1VKRA 4X60A 3ZWWA 2WHQA 4HRVA 3Q40A 4EVIA 3GX1A 1DAMA 1F1JA 1NFRA 1YRHA 3RC7A 4PXYA 5FQNA 3SIPA 4B8YA 4R3UC 3IXMA 1UBEA 1N6HA 2R7LA 3A4VA 5SICE 2V4UA 3EARA 2QN2A 4MR7B 3DDZX 1LLUA 3MTDA 3N2IA 1NJ2A 5TLSA 5E4JA 3JAMA 2CLFB 3Q8LA 3S0JA 4I9UA 1IUOA 3G0DA 4H3HB 2IT1A 3WGHA 2FQXA 4BFYA 4Z1MD 4R71A 1K9SA 1OILA 1II9A 1Y98A 2WSSD 5KKAA 1P2UA 2FEOA 2HSDA 2OV4A 2FGKA 3R7AA 4F5YA 1X19A 1M83A 4GYWA 5AXBA 1CZKA 2O6HA 1CNFA 4Q9IA 1GGHA 2YJ4A 4ID9A 5HJEA 1O6BA 2PO7A 2O8DA 4KGDA 1IY8A 3GCGA 4LF4B 2JLQA 4M9QA 4OLFA 5L4NA 1ZITA 3T7RA 2CLOB 4PSKA 3X1MA 2BW0A 4DM4A 4O63O 5EJ7A 4AN4A 4FMBB 4TL8A 2JHCA 2QYOA 4I4CA 3EBPA 3WE7A 4X54A 4GOKA 2A3RA 4LJSA 5K2MA 4EM6A 4XQ9A 1SXQA 2I6TA 1ZVMA 2QRHA 2ZRJA 5TT0A 4F06A 4XJXA 4S05A 2EAUA 4RTRA 1E9BA 2IP2A 2XWSA 1SVNA 4J7CA 2BFEB 2H1WA 1EHCA 1YA6A 2AQIA 2VSFA 3GVCA 1R10A 3MWEB 5E3JA 5BSMA 5JQGF 2W70A 4FDVA 5K8IA 1IEXA 1FYXA 1M5UA 2LTAA 1E4EB 3GFPA 1F17A 3GLHA 4HC4A 4YP5A 2AOUA 3JYQA 3OQVA 3PE3A 1NVWQ 4QPDA 1YD7A 1XLUA 5HJ5A 3TW4A 4HUQA 4TKLA 1THTA 1YT5A 2ECOA 2Z3ZA 1IN1A 1NC1A 4K6KA 3C6MA 4GQAA 1SXGA 2Y0PA 4W4TA 5F7OA 2Q1TA 1Y6RA 1F0PA 1W5AA 1DEHA 2IYYA 1P5FA 5EN4A 3BGSA 4YXWA 2X7HA 2GK3A 1RHJA 3OZDA 3V9PA 2P6UA 1WDMA 2FW8A 2IPXA 5GJVC 3CX4A 2E9SA 2R6JA 3H1GA 1K08A 1E64A 1Z74A 1K6IA 2JARA 3NBQA 2VZEA 1IWOA 2WJJA 3N1UA 5KX5A 4LI0A 2OK8A 4QE3A 3AU9A 1HZJA 2FN3A 5BW6B 4O0LA 5EXXA 5L7YA 3RG8A 5IU6A 1WY5A 1TO1E 1JGTA 3K0CA 2X0DA 1N8NA 4RIEA 3WL4A 4AW9A 5DI9A 3WY9A 4QTUB 4CG3A 1I5RA 2MJLA 4MS1B 3D4LA 3WWCA 4FDLA 1SMKA 4BPBA 5CLJA 4YRKA 1YOBA 1BSVA 3ZCXA 3GWGA 4C5CA 1CZRA 5T4FA 5C5EA 1R88A 5HOQA 3IIIA 1GSAA 2JEYA 2W6JD 3MPUA 1XWWA 1XP5A 2YNMA 2PX5A 1VBMA 2C0PA 3IAS1 5ECGC 4DYVA 2GPYA 1E1LA 4MH0R 4F1WA 3DD5A 1Z4JA 2HNKA 3CR8A 4L08A 4ZI7F 5IZCA 3R24A 3ESQA 3HFRA 5KCZA 4WJZA 4AJ1A 1TM3E 4ZOLB 4P53A 3CVJA 4BLSA 3MQ2A 2WA1A 5AW8A 3IE1A 1TCAA 3VOBA 3AR7A 4ZRMA 4HEA1 4EJMA 2XQGA 1DX6A 5FYDA 1K86A 3KQUA 2RAUA 1OFVA 4PBTA 3S70A 3V4RA 4M0MA 3Q7SA 1Y4AE 1AH2A 3B6IA 1SZPA 3TTXA 3FBWA 5AVYA 3PQ6A 2RI0A 4OMCA 2SKCA 1WEKA 2VF4X 4IIJF 1A88A 1FFAA 2VDQB 2CLKB 3GH1A 1VGQA 4MULA 1UC9A 1XWIA 3ETHA 2P35A 4MQEA 5I6DA 1EFAA 1T8WA 1VJRA 1FFBA 1XDUA 5IKXA 1JWAB 2BPOA 2I4MA 3LQQA 3VGPA 1A95A 1C0LA 3LNCA 1DIOB 5BW5A 1NMZA 3G5AA 4BATA 1HR0B 3EDCA 5JSUA 1AHIA 5NLLA 2B2NA 1TZMA 3S55A 4MUBA 1TCCA 1OBOA 3R0IA 3PNPA 4I4TF 1RPTA 2JF0A 4O1IA 1NSYA 4M1OA 4TTQA 4WLNA 3RIMA 3ZV6A 4BFZA 4ZV4A 2C5AA 3VZPA 1QF6A 2XF2A 2R0QC 2NAPA 1ZKDA 8ATCA 3A9RA 4WVFA 3IQHX 5LA6F 4UTNA 1Z22A 2EP7A 4UM9D 5K0EA 4FMPA 4MI6A 2J0VA 1NF8A 4OKSA 2B5VA 2V7QD 3CKYA 5DBGA 4MV7A 4EGFA 2ASEA 1RYEA 5CX4A 4Z7QB 1NRWA 1YC2A 2D0PB 4B7AA 4ZQHA 4K26A 1WY7A 2VRCA 5ALLA 2W22A 4UBJA 4XX1A 1G21B 3GPCA 2QN3A 2BP7B 4DM7A 1C3EA 1JHVA 1PEAA 2QENA 3GT3A 4PO3X 3RF7A 2WF7A 3AHDA 3M82A 3OFND 4V1CA 3ZVMA 4KR7A 3BMXA 1M1UA 1GFZA 2NN3C 4JQCA 5B2ZA 5IULC 1MZPA 2JBWA 3R7SA 2P2ZA 4BUZA 5E6RB 2LW7A 4S04A 3BGVA 5FADA 5D3ZA 2X0JA 1Z5OA 3EDOA 1H2WA 1F8XA 1O89A 2JLSA 4JLWA 4Y9DA 2P67A 4D4KA 4NY1A 2I6XA 4OU4A 2ZR7A 4YJDA 4D8WA 3DE2X 1GZ4A 1B2LA 4YY3B 2JCGA 1PCXA 4HO1X 3ETDA 5AFSA 5CG2A 1NPTO 3DE6X 5AOCA 3ZY4A 4CT4B 2OFOA 4MWOA 3M4XA 4P0QB 1CJSA 2Z2ZA 3KOMA 4GPEA 1Q0SA 4ITVA 1U8EA 4IBOA 3ADBA 1G20B 2YMLA 1ZRMA 5TQ0A 4PG8A 1SBYA 2O54A 3Q15C 4IJWA 2N3ZA 4BZPA 2IXBA 2QD3A 1N6NA 1YZFA 2OVFA 2VJCA 3PDUA 2QNBA 2Y0CA 5FT9A 5J2UF 2GFQA 3BA6A 3EJ6A 2UVPA 4M0EA 4OXKA 5CD9A 5BW8A 1DARA 3JR3A 1H22A 1VE6A 3DWFA 3BEDA 5FI5A 3RGGA 4EHIA 1V9LA 1YZYA 1M2FA 2OHVA 3STWA 5BMVF 5JI3E 2QAGA 2UUBB 5EUCA 1NJFA 3FBTA 3UHJA 4UEJA 4D5GA 3ZIDA 2ZRFA 1N8SA 4FR5A 3CZMA 4PC2A 1R6TA 5EXSA 3WL3A 4R69A 4AN1A 2AK2A 4RE5A 4XFDA 3RANA 3COVA 2BVNA 4ZQCB 2DWCA 1CEYA 2Z1DA 4KTTE 3G2KA 3SR3A 3G6WA 1CEEA 3E2MA 4DTCA 4CM6A 4IX1A 1QO7A 2A0WA 3HNOA 4Z51A 1NVEA 2BKLA 4URXR 1MXHA 1NKTA 1WZUA 2AG5A 1HK7A 4FYXA 1FP4A 2NO9A 1VHDA 5HUJA 3HCDA 1LDMA 2PKEA 1D3AA 2C1ZA 2W4QA 3NWPA 3GJXC 1BAPA 3DLTA 4HS4A 3VJMA 2RHOA 3CFYA 4DSAA 2GF2A 2H1IA 1IY0A 1IONA 1NF2A 5L95A 3MGBA 1GJRA 4PSAA 4F5WA 2G1JA 1J5PA 3T5AA 3L0IB 4HTFB 3NT2A 4AUKA 4IIHA 4D25A 3PQ4A 5HJ7A 5EVJA 1C14A 3L18A 1FDIA 1M6EX 4ZP1A 3PPVA 4B7UA 3PRKE 1XWFA 4HQ6A 4HCJA 3WMXA 1YH3A 4NEHB 4WKOA 1E60A 2XLCA 3NHRA 2C61A 1F2UA 2Q9BA 5LOVA 3MWDB 2IPLA 3GLFA 4PPGA 3FIUA 1IBRA 1GNTA 1RS0A 4NESA 4D96A 4ZXPA 4RJLA 1T0HB 4GLOA 5JG7A 4MQ4A 2YQZA 2CYAA 2O7VA 2XUGA 5TEWA 2PX4A 1XVAA 2P0YA 2BE7A 2X9LA 3PRHA 5D5PA 3V4ZA 1XB2A 1A2KC 1UUFA 2FZEA 3CLVA 3QVSA 4IH9A 4RZIA 5LMNB 3ZE6A 4OGFA 4XUCA 4RAQA 4CM4B 5ILGA 1V8ZA 1H66A 2VUSA 3OOYA 1QFSA