2QSUA

Structure of arabidopsis thaliana 5'-methylthioadenosine nucleosidase in apo form
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
247
structure length
247
Chain Sequence
b'EILRPISSVVFVIAMQAEALPLVNKFGLSETTDSPLGKGLPWVLYHGVHKDLRINVVCPGRDAALGIDSVGTVPASLITFASIQALKPDIIINAGTCGGFKVKGANIGDVFLVSDVVFHDRRIPIPMFDLYGVGLRQAFSTPNLLKELNLKIGRLSTGDSLDMSTQDETLIIANDATLKDMEGAAVAYVADLLKIPVVFLKAVTDLVDGDKPTAEEFLQNLTVVTAALEGTATKVINFINGRNLSDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-methylthioadenosine nucleosidase
publication title Molecular determinants of substrate specificity in plant 5'-methylthioadenosine nucleosidases.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 75
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 3.2.2.9: Adenosylhomocysteine nucleosidase.
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qsuA00
2HRDA 4WKOA 5F7OA 1JDZA 3OZBA 1Z38A 3ONVA 4YJKA 1A9SA 1SJ9A 4M1EA 1Z5OA 1JYSA 1V41E 1Z34A 1NC1A 2OECA 4LZWA 4TTIA 1Z39A 1PBNA 1RXCA 5B7GA 5EPUA 5CCEA 5JPCA 2ON6A 2H8GA 3EUFA 3PNPA 1I80A 4DA7A 3OPVA 4TXNA 3LGSA 4DANA 4F1WA 4OEHA 1VMKA 2RJ3A 1RYZA 1Y6QA 4M7WA 5C80A 3KU4A 5F7ZA 5F77A 1Y1TA 3KUKA 2A0WA 5CXSA 1NW4A 4TXMA 2PGAA 1C3XA 3OZCA 3SCZA 4LNAA 3OZEA 1TCVA 1K27A 1V2HE 4F2WA 3GGSA 1B8OA 3E0QA 3OOHA 1YR3A 2XRFA 3C74A 3QPBA 3DF9A 4G89A 1U1FA 4F2PA 3EUEA 5CYFA 1M73E 5IU6A 5I3CA 1XE3A 3P0FA 1LX7A 3BSFA 4RJ2A 3U40A 1A9QA 5B7QA 3ODGA 4LDNA 1Y1QA 1Z5NA 3E9ZA 3UAVA 1N3IA 1G2OA 2QPLA 1RT9A 2AI3A 4R2WA 3UT6A 4YMLA 1T8WA 3KHSA 3DDOA 1PR2A 4YNBA 4TS9A 2OC4A 1PR1A 1PW7A 3BL6A 4R2XA 3OCCA 1T8RA 1PK9A 1OTXA 1Y6RA 2A0XA 4OY3A 4JP5A 1T8YA 4D8VA 3KVVA 4PNPA 4BN0A 2OC9A 1V45E 3NBQA 2I8AA 4WKCA 4BMXA 1B8NA 3LBAA 4KN5A 4I2VA 2HN9A 1A9OA 4QARA 5B7PA 1YQQA 1U1DA 4G41A 3LA8A 4TXJA 4DABA 1Y1SA 4BMYA 4QFBA 4D8XA 4DAOA 4WKPA 5EUBA 1ULBA 3DP9A 4WKNA 4H1TA 1OVGA 3NM6B 4D98A 1V48A 1TD1A 3OOEA 4NSNA 1TGVA 3GB9A 4OGKA 1ZOSA 4TTJA 3KVYA 4D8YA 3DJFA 3O6VA 3PHBE 1FXUA 1Q1GA 1VFNA 2QDKA 3FNQA 3BJEA 1RCTE 2BSXA 3TL6A 1ULAA 3EEIA 4L5AA 1PF7E 4TS3A 5IFKA 1CB0A 1ZL2A 4LNHA 1K9SA 1ODJA 5ETJA 2AI2A 4L5YA 4QASA 3D1VA 3KVRA 4L0MA 4QATA 4OJTA 1SQ6A 4L5CA 4TYMA 4L6IA 2A0YA 4WKBA 4X24A 4DARA 5CCDA 1JPVA 4JWTA 3K8OE 2Q7OE 1PR0A 1U1EA 1V3QE 3FOWA 5CXQA 3INYA 4EARA 1T0UA 1YBFA 4TXHA 3NM4A 1PR5A 1TGYA 1LV8A 4G8JA 1RXSA 3FAZA 2HWUA 3UAZA 1YQUA 2ISCA 4DA0A 4F3KA 4TTAA 3P0EA 1Z37A 3IEXA 1A9RA 3UAXA 4EB8A 4NY1A 1Y1RA 1JDUA 5F78A 1RSZA 4GLFA 1Z36A 1VHJA 1YRYE 1Z33A 2AC7A 2QTGA 4MCIA 1A69A 3O4VA 3OF3A 1PR4A 2A8YA 3ENZA 4F3CA 4K6OA 2HSWA 1A9TA 3T94A 4GMHA 1U1GA 3PNSA 1JE0A 4DAEA 1PK7A 3UAWA 5F73A 1SD1A 3E9RA 1T8SA 4GKAA 1Z35A 4DA6A 1V4NA 1JE1A 3FUCA 4PR3A 3PHCA 5F76A 5K1ZA 1JDSA 1JDVA 1ODLA 4R31A 4MCHA 3MB8A 4IP0A 4BMZA 1RR6A 4FFSA 3NM5A 1Z5PA 2AI1A 4JOSA 4NS1A 5DK6A 2QSUA 3EMVA 4QAQA 2QTTA 3K8QA 3FWPA 4LKRA 5B7NA 1LVUA 2B94A 3BGSA 1JDTA 4U2KA 4YO8A 5F7JA 1OUMA 3UAYA 1WTAA 1ECPA 4ECEA 1OV6A 1A9PA 1U1CA 4OF4A 4P54A 1PKEA 2GUWA 1PR6A 4QEZA 2IQ5A 4D9HA 5KB3A 5FAKA 2I4TA 3FB1A 1CG6A 1PWYE 5CYGA 1JP7A 1TCUA 4OGLA 4UC0A 2P4SA 3OZDA 1RXUA 1SD2A 4GLJA 3IOMA 4M3NA 1RXYA 1QE5A 1ODKA 4MARA 4DA8A 5F7XA 1K3FA 3DPSA 1OU4A 5EFOA 4E1VA 3F8WA 3MMSA 1NC3A 1RFGE 2OXFA 1OTYA 1VHWA 4TXLA 1ODIA
chains in the Genus database with same CATH superfamily
3PQ8A 4HGQA 4N5NA 1YIOA 5E4TA 1ZOPA 2JGFA 3ORFA 4Q9KA 1B14A 2GKGA 4YLYA 1MB4A 1W34A 3GCZA 1I14A 4LWQA 2IUFA 1RI5A 2AJCA 5CU7A 5J63A 3W5SA 1L9XA 2FJPA 2V6MA 2I03A 1SUPA 4UNSA 1WMAA 3RVLA 1FFXB 1ZH4A 4CNQA 3MPOA 1LUAA 4HJXA 1XA0A 4OHZA 5L95A 5EHNA 3OLQA 3OVMA 1DNPA 3RUDA 4UUMA 5ES3A 1GRRA 2GVZC 2X3FA 3KALA 3OT1B 4GLLA 4R2JA 5F33A 2FXVA 4F46A 2BKXA 1U7HA 3WNBA 4HNAA 4HX9A 4YMUA 5SZIA 4MUNA 4WJZA 5AOVA 2QTVA 1JFSA 1A8HA 1R12A 2GR9A 2J4DA 1I4WA 1LC3A 2Q3JA 2QTZA 1J24A 4H7IA 1UEIA 2CF6A 4DQDA 3MCZA 2BF4A 3ND8A 1R66A 1S8NA 4ZYTA 1QE3A 4S1NA 5TIIA 2Q4EA 2VPXA 1PV2A 1E7QA 2QX9A 2RAVA 2ZUDA 3K1TA 3ZU3A 5K0BA 3ZLJA 2JGAA 2H51A 3LGSA 3B6ZA 3QELA 2IHYA 4A1OA 4UBKA 4B76A 5CXUA 4E94A 1Q92A 1O87A 4S2EA 3WGJA 1V7QA 3HM2A 1DQSA 2IU0A 1HA3A 2VK8A 5LA6B 1VMKA 2ZATA 2VPIA 3VISA 1HTWA 1MKYA 1ODFA 3EOZA 3MTQA 4F4JA 2X86A 2C82A 3NKLA 5J59A 3OM9A 3OJOA 3R9KA 4YT5A 1M6EX 2PKQO 5DM0A 4DIBA 4JKYA 5DX0A 3HCWA 4YUVA 1XR3A 1TYBE 2XA2A 3KAPA 3E9CA 1EWRA 2FK8A 1OY1A 4QQRA 4TXMA 3SU8A 4ALJA 4TZ6A 2QX4A 1R8QA 5F21A 1W73A 1ORTA 1CULC 2I55A 3HG7A 1APBA 1XRMA 2PYDA 4GAEA 2FUEA 4GZ5A 3ZJ4A 3MGCA 4WRRA 2B1QA 3V6LA 3A4YA 1I24A 3BMOB 3EVGA 3WO1A 3T95A 1FNDA 2A57A 4F2HA 3EH1A 1W5SA 1NJ6A 4V0OA 5HPYB 1T24A 2RI6A 3AL2A 4LK3A 5DM60 2BTEA 3EDMA 4H17A 2G5PA 2JFQA 1YR3A 2XRFA 2Y1XA 2Y1WA 4FCWA 3GJ3A 1BXKA 5ES4B 2XMZA 3CNOA 2KHZA 3DOCA 3AHGA 3N9IA 4O25A 3CZ5A 1XZCA 1Y82A 2ALJA 4ITUA 5B57C 4Z0TA 1Y5RA 2FU5C 3HHEA 1DIRA 4Q05A 3RYFA 4RJTA 3R6DA 3ZCVA 3Q7QA 3AF1A 1BOFA 1GXSB 4RABA 5TPZA 2J5RA 3OFJA 3JASB 1AQ6A 4REOA 4LF4B 4PSUA 1L7MA 3ISTA 1IZ0A 1DAIA 3PG5A 5I3CA 1EIWA 3CWZA 4ZVKA 4RD6A 3PXCX 3K05A 1SGWA 5BURA 1T4MA 2ZBEA 1EJ2A 1JKIA 2P1ZA 3D6JA 4IIEA 3PUIA 3TK1A 1M8FA 3Q8XB 3DL4A 1UBRS 3EXIB 1GZ4A 1WHTB 3VYSB 3ZHRA 4RCVA 4B6OA 2R3SA 4M98A 4YGYA 3KSAC 3NW9A 2X9LA 2BFEB 2BMJA 2IXAA 2IOQA 1J9GA 1JYEA 3IMFA 3K6JA 1T8WA 2LBPA 1SBTA 1FVFA 2ZBFA 5LDHA 3SZ3A 4Q47A 3V1MA 2MSNA 4BUZA 1HNZB 4KQMA 4BVAA 2Z1NA 4HZGA 3KOYA 3SXPA 4UOZA 4DUGA 4K81B 5E2AA 3ZHOA 1XRQA 1UC9A 3BFPA 1TX4B 3TE6A 2H54A 4NIMA 2DVMA 4JX9A 4A0QA 1DDGA 3VFDA 2WW8A 4RQUA 4EG0A 5ESXA 1OTXA 3UB2A 4C0AC 2ZDQA 1G5HA 2O8DA 1TM7E 2ZYDA 4JP5A 1U7TA 4FMDB 4I6EA 4YAEA 1J0CA 5G02A 4D8VA 2FEOA 3PEUA 1FMTA 4OYLA 2QVGA 1ZK2A 3KZOA 2FFJA 4ZO7A 3TD6A 5LQAA 2OD7A 4QREA 4QNMA 3A37A 1VCHA 1AKTA 3I01A 3D6AA 4G3XA 3PF8A 4NU5A 3GCGA 3RG2A 1RZUA 2W2KA 3HS3A 1AQNA 3MCUA 4O2LA 2CXPA 3EG9B 4MWOA 2I7DA 3PSHA 5D7NA 2OPBA 3HY3A 1EX1A 2ZJ3A 4LY3A 2CF5A 4GPAA 4KAFA 1Y7TA 4IJVA 5KVSA 5DXAA 3N0VA 4NLLA 1T2CA 4BVBA 2HIGA 4UBOA 1N8KA 3Q10A 3E5NA 4OQYA 1R6DA 3V97A 2P35A 2V55B 2I1QA 3NNSA 5IPFA 1HWYA 3Q12A 5TJ9A 4J3NA 3JQFC 2GT1A 3JX9A 5T7BA 1HMPA 4LIPD 1Y1SA 1T5HX 2R2GA 4MUKA 4RVFA 4BVHA 2PO7A 4I0WB 3DBIA 1M2JA 1R4NA 3U7QB 2CYCA 4CGZA 2V5UA 1CJVC 1XWIA 3I2FA 3MUOA 4CMJA 5KPDA 4L5IA 1XLWA 1PV1A 2VA8A 4GU5A 1J5PA 2REQA 1FJGB 1YR7A 3CR7A 2M98A 2QTRA 4RHFA 2PZFA 3CV3A 1G19A 2FW8A 4KNYA 1TT5A 2I29A 4FEAA 1KDRA 2RBKA 2I3DA 4YCBA 1WSBA 4BXOA 1ISJA 1N9GB 4QUIA 3R0ZA 5SICE 1CK4A 1WU8A 4EYEA 1BVUA 4BN5A 4PN7A 4LF7B 5DEOA 1QHYA 3NIBA 3HL0A 2E1RA 4Q66C 4Z0NA 4FLMA 4ZN6A 2ZT7A 2OO7A 4PIPA 4RA9B 5BNWA 2WWXA 4TSFD 1ZL0A 5DISB 3ZS9A 2AN9A 4OXKA 4B8YA 4DCTA 4J6FA 4S3MA 4CM8A 2I22A 1C7FA 4MVJF 1J5XA 2PXHA 2HMTA 4XASA 3EHDA 5AM1A 2IEBA 2C99A 3O7MA 2GM4A 4EA9A 3GB9A 3HJRA 1FW8A 2XIQA 3DKIA 3UWDA 4DV7B 1KDYA 4OXXA 4G6ZA 1X38A 1YZYA 4B4DA 2DHEA 1E99A 2A1TR 5K8TA 3QX3A 4HB3A 5AHWA 2Y3IA 4C03A 1TK9A 5B6PA 4Y9SA 2ZB8A 4KXLA 3SYTA 2C57A 3FUVA 4RD2A 5E7JA 1X7GA 4BE9A 1ZH0A 3RHTA 4TRRA 1BXZA 2V9ZA 3MIIA 4KN8A 1V1RA 2BIFA 3QWHA 1RADA 1XEAA 2OT3B 1DWQA 2PSHA 4LMAA 4ZRMA 1LQTA 1LWOA 2ZB3A 3QMMA 1XDUA 5T64A 1J23A 1ILEA 3BD6A 3KD3A 3PNLA 5KNLA 3D43A 2PE5A 5BWOA 3ENVA 4URUR 4P82A 4Q1DA 3VKVA 1NQUA 2SHKA 3R3SA 2Q07A 1N0IA 2ZR0A 5LLSA 3OPYA 4Q0MA 4N5MA 3CMMA 1LNQA 4QU0A 1ZH8A 3X2FA 3R6LA 4OJTA 3MWDB 1KDOA 3VNAA 2WWIA 3L7NA 3VJLA 2OG1A 2QK4A 4RV4A 2P4UA 4L5CA 5IAJA 1EP2B 4A8PA 4OD0A 4RS3A 4ID3A 1SN7A 1B42A 1T6YA 2ZLBA 5JPDA 4LYAA 3KSRA 1BMQA 1E3WA 3IAXA 4MP8A 4ZYYA 1XCPA 5B1YA 2J0SA 2P4EA 1L4KA 3HXKA 1BXRA 4BFXA 4BGDA 4ZCSA 4KPUB 1JPVA 1ODCA 1W1UA 3BOSA 1LI5A 3R76A 4CDNA 3NTLA 4I4LA 4KHPB 1E2PA 4ZAFA 4KR9A 2WKWA 2JJ1A 5B3JC 3CT4A 4LBZA 3B2EA 2M6SA 3MEQA 3T7EA 1CF9A 2HA2A 3G9TA 3H9BA 1PIWA 3P26A 3VKUA 2WVAA 4P0PB 2JLQA 4RPLA 3W9BA 1V6AA 3PLNA 2GN1A 3VSDA 1JF8A 2A35A 2QG9A 2RHOA 4KYIB 3VPCA 2VYNA 1Y9ZA 3N2IA 1KJJA 4JL8A 2X23A 1JEDA 4WBNA 4FX2A 4DNQA 3OP4A 5A5DA 3HUFA 1RXSA 4MJ3A 3A3PA 1V1JA 4R7TA 1RXWA 1JG6A 1PJLA 4U8HA 3ERCA 1E9RA 1W48A 1J8MF 4UCXA 4MEBA 1IN1A 1KO8A 2CK3A 3ILHA 1PSWA 5JS8A 3VH2A 1QR6A 3FKQA 1ZN2A 2I4LA 1VRWA 3A9SA 3DC2A 3H3JA 1IZZA 3NQ41 1CSEE 3AINA 1YMQA 1OR8A 4JUDX 4BGVA 4R6XA 1B1AA 1Y8QA 4XR9A 1FF9A 4YUWA 2PWZA 3OIUA 1E5QA 4L1KA 4BVLA 4TS4A 5BQOA 5FPYA 3COVA 1YR9A 4N3GA 5K0FA 1YJBA 2GFIA 3BWDD 3QE3A 1UM9B 4E0BA 4I9FA 2Z5LA 4B8ZA 1IOVA 3QZUA 4UPVA 5I45A 1K06A 2B69A 1DFHA 4K0RA 1E8MA 2YN0A 4YJ3F 4E4YA 2IDZA 2QV7A 4WD3A 4GLBA 4JL6A 4ES6A 5A4KA 1YB6A 3FCSB 4NMWA 3TL3A 2IPXA 1A1SA 1L7QA 4YP5A 1O7JA 1UQRA 1YRYE 1E7YA 2Q5JA 3R0VA 4TKMA 4BFCA 3EIQA 5LZ9A 1WUYA 5JH7B 3MS2A 4WZAA 1UBTS 3SNKA 5CAEA 3I0NA 3VHQA 3KZVA 3WP1B 2XMGA 3G0BA 1E7RA 1B15A 3IT3A 2IH2A 1P0FA 2DC1A 2RKWA 3H6GA 2R8XA 3BFXA 5FKJA 3H5AA 1DLIA 2C4KA 1KHHA 2EJUA 3BDIA 2G7MC 1ABEA 2IYPA 3F71A 1ISPA 4DUGD 2VP4A 4LOKA 5E1MA 4R5MA 1SQ0A 5B58C 1OH6A 1VL0A 2D5BA 3IXQA 4ISBA 3P94A 4V0LA 2RGCA 1XXHB 2JI6A 2RKOA 2VSNA 3PV0A 2VRCA 3SZGA 1XU4A 3FBTA 3N87A 1LZLA 1UEXC 3H13A 5ITWA 4OUKX 3DGFC 2DBZA 4M53A 4RVSA 4ZAZA 4Q01A 3DONA 2DBVO 1Z4NA 3UPDA 1QGOA 1LVHA 1TVCA 2WA2A 2B9VA 4WQMA 3ISJA 5ELLA 5CEFA 3OQOA 1XTZA 3Q6MA 2RB5A 1VLQA 2HLPA 4TWJA 2Q45A 4XDZA 5F9MA 3K20A 3UEOA 3RVMA 1P7VA 2HD4A 1HPLA 2VP6A 1PGJA 2FHSA 1AF7A 1L5FA 3NJ4A 4QPJC 4H7KA 4QUHA 3BHIA 3CTMA 3FHLA 2XBMA 3QKUA 5AKKA 1T1RA 3C3DA 1I9CA 3JALB 2WDZA 5TDHA 4QM7A 2HRRA 3AWIA 1MB9A 4ZCLA 2GZ1A 3FWKA 5TVKA 2WB2A 2C1XA 9LDTA 1KY4A 3LK6A 3O4GA 2EJCA 3WIUA 1PTJA 3B6IA 4V0MA 4RD4A 3IB6A 5KTTA 2ZR9A 3BWBA 3QBTA 1ECJA 1UM8A 4J49A 2MCFA 4X94A 1TADA 1RYEA 3CM0A 2E5LB 1BS2A 2XQKA 1CUDA 3P2EA 5J1SB 4MLZA 1FSPA 2C58A 4XZ3A 1FA9A 3GMSA 1KAHA 3LT2A 3CRNA 3Q5EA 2OGTA 3LF2A 3R0QA 2Z6QA 1FYWA 3NT2A 3BXOA 3BGSA 4B46A 4FGSA 2VJYA 5JECA 4EECA 1LRKA 5P21A 1Z5ZA 4PX5A 2GBLC 3TIIA 4TVOA 3HVKA 1SCJA 3QRWA 5COQA 2OMKA 4L8GA 3U4QA 4B45A 4I4TB 2XXBA 4OHXA 1E96A 3S8YA 2JH9A 2YINC 2NU9A 3EAGA 5JSZB 4AN1A 4AKIA 1T29A 4ZZ3A 5FUBA 1OILA 4QHSA 1IN6A 4X7PA 2C4HA 5FTWA 3O73A 5JDIA 3OTGA 4M83A 4DG5A 4P4GA 2DPLA 4FBGA 2C3OA 2IYZA 4GI2A 1GUAA 4KFSA 4KXVA 2XT9A 3K6SA 2COKA 2O0MA 1ES9A 1G4HA 2CWDA 2J9GA 3E18A 4IX1A 1KJIA 3TQCA 3WQQA 1E0KA 5JY1A 4NJEA 4OG2A 4X66B 1UJ5A 3ZDAA 4UC0A 3QPWA 2WJPA 2QLBA 1XG5A 5AW9A 3ULKA 1ZK3A 5HDQA 1XZAA 1J8FA 2OUKA 1M2VB 3AV0B 1SUDA 1X0VA 3FKSA 4QQ8A 5JYDA 2C7RA 5K6TA 4MRAA 1TKCA 2FEMA 2FA9A 4YIHA 3ANNA 1DAOA 2WNSA 3I04A 1W35A 4COOA 5JV5A 3QJ5A 4ZZ1A 4QFCA 1GA4A 3FPBA 3AIKA 5GV7A 1EUCA 1DKMA 1ZIOA 1ZSVA 4KGXA 1VL1A 5B64A 2HCFA 2I66A 1ZUNA 3OT4A 4HYQA 5CVUA 1PWEA 5IF9A 1XEWX 3T6KA 2GK3A 4QXMA 3ZV7A 2AX3A 2JKVA 1C41A 1V0JA 2IZOA 2OILA 4RTSA 1NVDA 3B3AA 4HVLA 3I28A 3O1JC 1GVNB 5ESDA 1EBUA 2X7JA 5LIPA 4YI3A 5KU1A 4EMBA 3H0KA 1IWBB 2XX3A 3HBAA 3JYHA 5G1NA 3ZU4A 1JIIA 5DNAA 4A7PA 4EW6A 3EDQA 3G2IA 5CVCA 2O2ZA 3ZHTA 3JAKA 1AKUA 1IJKA 4YA6A 4BNLA 4KAAA 3FPGA 1KJNA 3H8SA 1Q7CA 5H82A 4DMLA 1BKSB 4EG4A 3TCNA 1Y4DE 3OX3A 4TV8F 3UJ8A 2OYCA 3WFJA 1P9RA 1R15A 3QEKA 3KG2A 3LVQE 1L5VA 4WLUA 4BFYA 3H2KA 5JARA 4NBTA 5KMGA 4BO7A 1H05A 1WZNA 3G59A 3EULA 2X5JO 2YOGA 4CCYA 3WL4A 5L3ZA 1N2ZA 3HA5A 2XJ9A 4M9ZA 4OSEA 3BC1A 4MV6A 1G98A 4CF4A 3IOYA 2HQBA 4D3YA 2CVOA 1P6QA 4RACA 4BZPA 1DFGA 3DMYA 3JARA 2W70A 1O9BA 4NKRA 3MGGA 3WJ1A 1HDIA 1T34A 3P9XA 3WIOA 1XZHA 2PUEA 1OWNA 5JUWA 4LA4A 3SC2B 2G7ZA 3BIWA 4R1UA 1RYHA 4UDNA 5AK0A 3CC8A 4F1WA 4DM4A 4AC9A 2CD9A 4QO8A 2FMKA 2VQ3A 4G56A 4LW8A 2C9DA 5FJIA 3RRZA 2C5FA 5I8PA 3CUWA 3QPUA 3SR0A 2CK3D 2RJ3A 3CSDA 1AZSC 1LBHA 4EUFA 4QFDA 3GW8A 2VHEA 4BU0A 1RLUA 4WFQA 1TEHA 1ENPA 4TV9A 5DSTA 3KUKA 4YJ2A 2A0WA 2CFCA 2R9VA 3A6KA 2IBTA 3WK4A 4CEIA 4TS1A 1G291 1FW6A 3R5SA 5K9ZA 3U13A 1S6YA 4KFUA 5DHSA 1II8B 3DDCA 4GPD1 3SBDA 4E2FA 3QMVA 5MHTA 3EEFA 3ZWMA 1UWLA 3OO1A 4GOND 4Y2PA 3MZ0A 2R5WA 3DLHA 4MJLA 3V9PA 4OXQA 4BMNA 1GSAA 3OE7A 4LJKA 5JCOC 2FFBA 1XJ0A 2C92A 4HDSB 4PXSA 2VDMB 2ZG6A 4O6VA 2O8VA 1TQ4A 2CV2A 3BSSA 5LQSA 1NDHA 2OBLA 5BR7A 3WLMA 3WRXC 1Z6XA 3OZFA 1YS9A 1LTHR 5BOSB 3V4LA 1T5DX 2P11A 1FNMA 5JQGB 4J4HA 2A4MA 1F0KA 2E6UX 4GP9A 1F6DA 4E7OA 3LPCA 1YVDA 5CUQA 5JXHA 4HRVA 1XE3A 4KFTA 1OI2A 3TR0A 3TX2A 2EAUA 3VU9B 2PA3A 4KE6A 1LBEA 5JRJA 2MTBA 1FQOA 4G4GA 3GEDA 1J0AA 1J49A 1Z2NX 2EZ4A 3T12A 4X54A 4JSYA 4N0QA 4D5EA 2BR3A 2H07A 2VRCD 4FSXA 4RSRA 2XXAA 3LHKA 2QQEA 5JZMA 4LDNA 1B1CA 1EGQA 1Y1QA 3ZCSA 5H4HA 4EHLA 1C9MA 4FU0A 2ZANA 1LQ2A 3RTAA 3Q0TA 1M0WA 4UPDA 4CMIA 2X2OA 4M88A 1JIXA 2EWVA 4PPFA 2FW1A 3WB1A 4OMUA 3KJQA 4C21A 3HNOA 3BGWA 2H4WA 2QYTA 2OCKA 2ECFA 2QRKA 1EB8A 3B12A 3EXHC 3Q3IA 5THXA 1CRPA 3A14A 3Q2KA 5HMLA 1C0PA 3LNCA 3AEXA 2SCUA 2V7GA 3NHJA 3C45A 4AMVA 1J1IA 4ZQBA 1H9BA 2QWXA 3BL6A 1Z6PA 3KLPX 3PJFA 4RELA 5J2UB 3W06A 5A3JA 4W6QA 1TO1E 3JYPA 4QDOA 2XYHA 4L0DA 3D2LA 2GEVA 3FWHA 5KJFA 2PGJA 2QLFA 3A6LA 4QTXA 2QB5A 1INLA 1J7KA 2QVCA 3AXTA 1EP1B 1NOKA 3H4MA 4UBIA 1U7ZA 5E8JA 5E6UA 1V43A 3IUEA 2PBLA 3WGHA 3O4FA 3PTZA 3Q9SA 1OFIA 2TSYB 3K9CA 3PNBA 4RV5A 2DUMA 2IX9A 4HQNA 3SSOA 3TVDA 4ZKDA 3ILXA 3W2IA 4RKRA 3V1UA 4P93A 1X7YB 2VHYA 4O4LF 4Q4JB 4BN4A 4YRIA 4CQLA 5JS6A 3UT0A 1G63A 1FUEA 3H5IA 1H0SA 2Y93A 4G81A 1LJ8A 3SHQA 1S4MA 4J16A 1N2JA 3PKJA 4PQEA 3V80A 4AZWA 2WU4A 5JS7A 2ADFA 4CV3A 4C01A 1JEQB 2CKMA 5E1DA 1NXVA 2EWWA 1ZM7A 2VH5R 1JI0A 2X8AA 1U1DA 5K6RA 1P5FA 1FZTA 3Q8WA 4CLOB 1Y6GA 3OFND 4BKPA 2H11A 4ER7A 1NLZA 1W581 3AY0A 2QVLA 4Q9AA 5CX4A 3P0IA 1X1RA 5DBEX 4EPRA 1OLOA 2XMDA 1RAHA 4NS4A 2NSYA 2I6QA 3TEMA 2OZLB 1ZW6A 4DL9A 2G83A 3RPEA 1KOFA 4BWFB 4DY4A 3EPHA 4QRHA 2QI9C 2PT6A 4QOSA 3T4PA 1ZGAA 5LA6F 3NTVA 4EHNA 5MN5A 1FTNA 2R65A 3RUIA 1IB6A 4AZ0B 4YUYA 4BLSA 3GLTA 3PFCA 4FKMA 4PO3X 1EZ4A 1FSGA 3FKSD 2AG5A 5JG7A 4ZOCA 5AVOA 3GMIA 2HU7A 1NW6A 5I7AA 2OYRA 1YDHA 4WT7A 4FYXA 1BDJA 1E58A 3EBPA 1GEEA 3HYLA 2COEA 2YY7A 1QFJA 5C1OA 4KX3A 4HBZA 2JFUA 3VOSA 2V54A 1B73A 4GI3A 3ZHZA 4BYGA 1J21A 5EWJA 4WV3A 3JQBA 1E18A 1NM5A 3NHYA 4U2EA 2W71A 4Q6WA 5DV9A 4ER3A 4OX9Y 4DADA 1XU7A 5CJJA 3CNQS 5AQ1A 1OQAA 1AMOA 4YT8A 3S2GA 1E8DA 3MILA 4G24A 4GIBA 4ZAXA 3TAUA 1NLMA 4YMHA 3CLSC 1OKKD 1M8GA 2LW7A 2XMCA 3CRW1 3Q87B 2JLWA 1CV2A 1OLUA 3FF1A 1QF9A 4L9RA 1NT4A 2ZRQA 1YCGA 6LDHA 5KVCA 2X8JB 3HH8A 2VDPB 4J4BA 4WMLA 4Y2QA 1FXUA 3I62A 1SHLA 4PLFA 3CLSD 2E89A 3PYXA 3C3EA 3A0UA 1XTKA 3IEUA 3KFLA 4V1CI 2I4IA 1HZZA 2LE0A 4KWIA 2PLRA 3NHRA 4YBZA 5FHRA 3ITKA 221PA 2ZT5A 3HB4X 2DE0X 4MQFB 4NFHA 4E88A 5ALNA 3SWWA 4WOBA 3MA0A 1Y1LA 3MS7A 4RY2A 4U6NA 2HGSA 5NLLA 5KYKA 2RH8A 3PGXA 5GJBA 4ZEMA 5JSUA 1HYEA 4HQOA 3N7TA 4QOFA 5HKAA 5JH7A 4GBGA 2F3PA 2V4MA 4FEYA 5EJ4A 4MR8B 2NU6A 4E5NA 1ZCBA 3HCPA 4JV5B 4MW2A 2Z58A 1FNSA 5EXDA 2FSVC 3OA2A 3CN7A 3IKVA 3VVLA 2WFLA 1FBTA 3VO1A 1L7BA 2JASA 4CIVA 2V7QA 3ZDZB 5H59A 1KJQA 4FB4A 4BP3A 1UXGA 3L0DA 2J8ZA 4OP3A 3EE6A 4L6IA 3X1WA 1JSCA 3ZZTA 1WETA 4UATA 4KKVA 4WLNA 2AN3A 3Q3HA 2ZE5A 2ZDHA 5E9JA 3CRMA 3EZ7A 2H1IA 1FRZA 1RC0A 3C3AA 3LM8A 5HUJA 1M0SA 2EEZA 1GFWA 3BTVA 4RL6A 5ALDA 4ETWA 5KBYA 2Q7OE 2VDQB 2PUFA 1G8MA 1T6BY 2OO5A 3AX6A 2C5GA 4P80A 2VZLA 2NYVA 4G5SA 3AUTA 1JEYA 5AW2A 1R6XA 3SF8B 2J3QA 3ZWBA 3R7BA 3CYFA 1JS1X 2FRVA 4XKJA 3UJNA 3L6RA 1Y42X 3WGUA 3RREA 5CB4A 4ENQA 1CUZA 3AW8A 4FFPA 3U16A 3CMCO 1RJEA 2CB0A 2E1PA 5JJLA 4CKCB 4YPVA 1NLYA 1RCFA 2IUSA 5CHEA 3OHSX 3WNCA 3DKRA 3AERA 4QO7A 3UK1A 2ZR7A 3OE7D 4BO6A 3W04A 1A9XA 3ZOKA 3EK2A 1KARA 2IZ6A 3AC0A 3HSYA 4H7FA 5AKIA 3N8HA 1Y89A 4UTOA 1YQUA 2B8TA 4A26A 2BY4A 2O1WA 4I5DA 4BNDA 4FSDA 2QPTA 3W77A 3WMWA 4HH0A 2IZ5A 3PX2A 4JJ6A 3ESCA 4AJNA 1MX5A 2QF7A 3MMNA 3C1AA 2CFRA 3P9NA 2QAGA 2IIVA 3DWIA 3GELA 1C50A 4PFQA 5AVJA 3WB0A 1JXAA 3RW9A 4YRLA 2AZDA 2VKTA 4EG5A 3P4YA 1L9KA 1RSZA 2Q4TA 1DKUA 2SBTA 1EP9A 2ZRGA 4GVLA 4LGCA 3UWSA 5ICMA 1CW2B 4EJ6A 1RAIA 4X92A 3CW9A 1BS9A 4GPZA 2YJ3A 4CL3A 5C18A 3GLGB 3FSJX 4GVXA 1EE9A 3TTUA 3GJ0A 3GUVA 1UBSB 4EEZA 5EMJA 2QTGA 4H7PA 1CP2A 4BC1A 3GPLA 3TQSA 4OGFA 3AIOA 3O4VA 4YFYA 3ZYZA 2GJAA 3BL8A 4UM5A 4DC1A 1K68A 4EQ6A 4HNVA 4KEAA 4ZI7F 2V7EA 2H9IA 2A3NA 1X7DA 1OZHA 3ROZA 2C5HA 3GLFB 1DWUA 4KSBA 3V8BA 16PKA 1L7AA 2AEEA 1J0XO 1TQ8A 2JGKA 2XOEA 2WT9A 3GFSA 4U39A 2V1UA 2XYGA 4II7A 1BFUA 4H6PA 4FFNA 5CT4A 3PUVA 4AUNA 4M7OA 4F06A 2G1PA 2GEUA 1Z6YA 4F93B 1E3JA 5DNYB 4K03A 2NQ8A 4F5ZA 2WZQA 2D5LA 1PE0A 3TTTA 1U1GA 1V16B 3QG5A 4CVNA 4DAEA 1FL9A 1TZCA 3MINA 3B5JA 3R3HA 2JZOA 3LI2A 4M37A 4XOIA 3S5UA 3TLGB 2FW0A 4ZK2A 1EINA 2B7CA 3ICVA 2IYVA 3GDOA 3TDKA 3ESXA 2H1FA 1TAUA 1SD1A 1S8OA 2ODEA 3PUHA 1H5UA 1SWVA 3OT5A 3QX8A 3FOCA 3P0JA 4KX5A 1QAQA 5DLPA 3J81k 1UPUA 5M29A 3B9BA 2MMCA 3CNNA 2MYTA 4JLWA 3LLSA 5LC1A 4XJSA 2W2MA 2PG3A 1NUQA 4DUZB 1V4NA 5F5NA 1V5EA 3FUCA 4X00A 4PR3A 2JHCA 4XSHA 1ZGZA 4I55B 2GD2A 3D8HA 4YPOA 1ZISA 3CPEA 2V7BA 1Z0KA 3MJEA 1G0NA 1Z07A 3ZWDA 3CVVA 2W0MA 1Z5PA 2FPWA 1KMCA 2G8NA 2GJKA 2RGNC 2WM2A 2ZUVA 4PIVA 4WN9B 5FADA 5EUQB 3KQTA 1NZFA 1Q77A 1I36A 1SQGA 2UZ1B 4Z3KA 1R8SA 2AT1A 1ZNQO 2P69A 1BX0A 3IAM1 1M2HA 4YDHB 3RI3A 4IDHA 3UWKA 4RL4A 4ZCTA 1ZGCA 3DMRA 1CR4A 5AI0A 5B4TA 4FXOA 2PU7A 4D8WA 1NVMB 3WHIA 1RLJA 1L1EA 3F7NA 3FNGA 1II0A 4PC2A 1E4EB 3HPQA 1QLHA 4P36A 3SZMA 4UQLA 3WRWA 2BFWA 2HXYA 4ZRDA 3THYB 2G5TA 4UTXA 2IDKA 3GQVA 1PJ3A 3LHIA 1UT8A 3LCCA 2BFOA 3RJ9A 2GBIA 2A58A 3IOBA 3DH0A 1OPXA 3H1GA 4JGBA 3V8QA 4CI9A 4LUCA 2AGVA 3S2EA 3QU7A 3HGMA 1SY7A 5IXJA 4Y6LA 3THXB 4GWKA 3PK0A 4PZUA 1MJ5A 2PSDA 3ZNPA 4GPBA 2Q3HA 3KPYA 2GWHA 4NYJQ 4IO1A 1QAOA 1U0JA 2UYGA 1CG6A 1BWQA 3EY9A 4ZEVA 3AILA 3KKMA 1IOZA 1F4PA 3FJYA 4Q93A 4YQFA 3VC1A 4UAVA 4TUYF 3TZ6A 3ZJ5A 4PHGA 4EHJA 4M0MA 1BFKA 1E9BA 4HNUA 2P4SA 3GRRA 2OCBA 3ON5A 4JBWA 2AF3C 3QGMA 1E2DA 3CTPA 3GRPA 4X1YA 3MTDA 1EDBA 1VCNA 1K9VF 3CB4A 5E9AA 3TRIA 2PD3A 2ZITA 2H7CA 2J09A 3L49A 3EIUA 1TF5A 1X70A 3LLVA 5JS1A 4M3NA 2J3JA 3H4TA 4C43A 2B8JA 4IDFA 4R2HA 3ZKWB 5F9HA 3VHXA 4N7BA 1Z7BA 5M04A 2X0RA 3CZRA 3JCZA 2GXQA 2VAVA 4GT1A 1Q0RA 4R05A 5BORA 4D5GA 2JGDA 3C6KA 5LU8A 4U7DA 4D25A 1R5BA 3IHLA 1WXHA 3SC4A 1NIPA 1FYFA 1QC5A 3NNNA 4CG0A 2YKGA 1NI3A 1MABB 4DJ5X 3EBLA 1RFGE 3EZLA 4XB2A 9ATCA 2WV7A 2HJWA 2HMUA 3QEBZ 1YF3A 1F5NA 5CG1A 5ESWA 1FYDA 1WCIB 3AHIA 2YASA 2YMLA 4UBLA 4GMXA 4J1TC 5JH7F 4OQXA 2GEKA 3ZIDA 3B1ZA 2BFNA 5CJPA 3ES9A 2Z0MA 1USGA 4TT8A 4K05A 3JVEA 2CXNA 2BHTA 5AICA 2JAOA 4M1EA 2IRWA 4OTZA 2N46A 4JB3A 3LGAA 4RF2A 5CHYA 4QUJA 3R7AA 1WCXA 5KX5A 4L8VA 5IJWA 2CJFA 4X1IA 2ECPA 2VSYA 3G3EA 2I3BA 3HXTA 3E3LA 1JR4A 2ZJAA 1MQ8B 4Q1BA 4WI1A 4EHAA 2F3UA 1DVRA 4QWWA 4ITVA 1VXRA 1U2TA 3L1HA 3DYBA 5JAIA 2ZTVA 1IK4A 1GTL1 1NRIA 2HSGA 3W7VA 1IBKB 5JPCA 2P4HX 3DKVA 4J0DA 1ABFA 1JEJA 2AE1A 1Z63A 3GLQA 1GZ3A 3K1ZA 2CYAA 3LO8A 3NV9A 4M1SA 4NZMA 5FT9A 1OB5A 1Y9DA 2WMOB 2D1YA 2ADOA 4CMCA 1QTQA 3TO5A 1FBNA 2PX2A 2ZRKA 5BT8A 5K0ZA 2B25A 2AN5A 2R62A 4HYEA 4JDUA 1I51A 2HA6A 4ND6A 2PYZA 4BHTA 3TBKA 2POQX 2PCLA 1OYWA 2UXCB 5LBUA 5A6SA 4Y0VA 5B2ZA 1KSHA 4KE8A 4L72A 1IOWA 1PG0A 2WHPA 2HIHA 3WHKA 4M7WA 3T7RA 2JFOA 2IH4A 1SHKA 2DGDA 1T5SA 4KIFA 4RDXA 3G89A 2QVBA 4F9FA 2WUGA 1LLDA 4B35A 1RCUA 2Z57A 4HLNA 2PK3A 2WUVA 4NENB 4AS1A 1E0AA 2P4QA 1CEQA 1E7MA 5CEJA 2BGMA 3QOYA 1M7GA 1B93A 2PZJA 4D4HA 1C30A 1KPGA 3BK1A 2CLDX 3IIIA 4P98A 3L7JA 2V58A 5CB6A 4CIBA 4NE7A 1NNSA 4FGZA 4MYTA 2KS6A 5L6LB 1MAVA 1OWMA 1VCOA 4QOEA 3WSVA 1NV9A 1A2QA 3PPWA 3BGVA 4L9SA 3I5UA 1WD7A 2OXRA 2ZR8A 2IVFA 1F2VA 2I54A 3U0BA 2VCHA 4YRJA 1RS0A 2GM3A 1VCMA 2CLMB 2O50A 3ESDA 4QGFA 4Z9FA 1TJ3A 4YXFA 5A3QA 2DZDA 1M54A 2ZVQX 2VHCA 3WLAA 1PZGA 3H6KA 5E6SA 4L15A 1KL7A 3UHOA 3IXLA 5DIZA 4GFDA 1RYNA 3IBTA 4KMOA 1VKZA 1WF6A 2PKYX 3RVKA 3ZY3A 1Q6ZA 2I78A 4IOLA 5BSWA 4PNHA 4UNIA 3WA7A 3R5KA 1TTHA 1VDMA 3OJ0A 1QQ7A 1Y5LA 2C9BA 2WF5A 1XQ9A 1IE3A 1Z5WA 2GZDA 1W6UA 5AI6A 4ENPA 1XZMA 1CE8A 1LX7A 1OZAA 3BSFA 4B4VA 1J9EA 1OH7A 4IFIA 2H29A 2QRVB 3OO0A 2OXEA 3AG6A 4RKFA 2HPAA 2WA1A 3L0OA 3J81A 3O4RA 3F9CA 3RUCA 1D09A 1Q50A 2QX8A 3E9ZA 3J7TA 2ZVJA 3R1IA 4O29A 4ZXFA 4DLZA 2XZOA 2QPLA 1LPOA 3KETA 3R8FA 1ECLA 4BC0A 2IHZA 3DM5A 3MAJA 3EAQA 3VKFA 3BREA 4C5BA 2JFVA 1BGXT 2XCQA 4W6ZA 3VZCA 1LPBB 1OZ0A 3K0HA 4MW4A 5ALEA 1Y6FA 2QTLA 4OQMA 2QVXX 2VHVA 4P7FA 1V3TA 1L8OA 1C9EA 3IUYA 3C6MA 2HXSA 1VZ2A 2YBEA 2Z2IA 3KQLA 1UZMA 4Q4LA 3E6AA 3Q3CA 5HM8A 5A5VA 3C8HA 5TR9A 5DTEA 5BVGA 3NTQA 2UUBB 1HRDA 1DBRA 2GZSA 1DQNA 4QYWA 4DC9A 2A0XA 2JGNA 5IH7A 1FRFS 2FX5A 2RCYA 2JBAA 3CCCA 3PVSA 1FS5A 1BFDA 1W88A 2XNKA 4A23A 2PFGA 1H3FA 2Q0HA 3CLHA 2Q5LA 4DR1B 3DF7A 4OQPA 4TVBA 1L4UA 1ZJJA 2GHRA 3GCWA 2NUAB 2BTQA 2WE7A 3RNOA 2O06A 3DTVB 1UBUS 1QHGA 1RJFA 1T2EA 1VSQA 3HCOA 5FNVA 4WBNB 1KEEA 3FGPA 1IM2A 4XM0A 4GOLD 2MR6A 4LY6A 4Q3LA 2OSBA 5E1BA 3UBMA 1BMDA 5JD4A 3JQ7A 2IYQA 4G0XA 2YY6A 2C5AA 4BO4A 4ZHQA 3M49A 3KTFA 4C7MA 1COWD 4DCJA 3H18A 4HKTA 1GAJA 4E13A 3FOBA 4PAWA 4RF3A 3GRUA 4HMPA 2A0FA 3FR8A 4X1KB 2A5JA 3T06B 4C4XA 3USCS 1H93A 1OI3A 3T1OA 3W1EA 3HCEA 3AJRA 4HC4A 4XOUA 2MINB 1M1YA 1VPTA 4R2LA 4TX1A 1BE6A 1IU9A 2QT0A 3Q3GE 2VCEA 4BUCA 1W85B 2ZSFA 1E1MA 4PTYA 1DBIA 1FRNA 4C0JA 1T15A 3AUAA 3HDYA 2OAP1 3AEQB 2O4CA 5DB4A 3SSNA 1E1CB 1WS6A 2ADMA 4AWXA 3PNVA 4DN6A 2PL9A 4L8LA 1IXKA 4REQA 2GS9A 4BE7B 5BUSA 4I9GA 4ZAWA 3F47A 3MC1A 5JCPA 5HVNA 2BFCB 1ICEA 1MV5A 1XQ6A 1XT6A 1KZYC 2BM0A 5HTOA 3MOIA 1SXJA 4N3NA 3OTWA 1T3LA 2QVYX 3WXBA 4DJJA 3SN6A 4FYKA 1BU5A 2H0AA 1OZGA 2FE4A 1D2RA 3FYUA 3GY0A 4IWYA 4H9GA 4JB8A 4J4TA 3PDIB 4HZUB 3JQPA 3ZGZA 3QJYA 4JI4B 3C87A 3IUQA 2O3SA 2WKSA 3PDCA 1P1JA 5GOZA 3W78A 1CQXA 2GF0A 3LYLA 3NYQA 1TAGA 3AEKA 1K63A 2UVDA 1V35A 5JLAA 1MXHA 2G6TA 3E4DA 1FFEA 4DLTA 2R47A 4NSNA 4RM3A 1ADBA 3FYCA 1XROA 1DDIA 1SUFA 2YRFA 3JXEA 1G16A 3HDHA 4RD0A 5HM6A 1O0BA 4MDEA 3JZMA 2E0IA 4D02A 1WZUA 2C8VA 4YCNA 2HJHA 4AMZA 3CLTD 1SR8A 3G23A 3N8IA 1Y5IA 1ATIA 3PI7A 3PX7A 2FK7A 2YQ4A 1VLHA 2BAGA 1P4SA 1T6NA 1P39A 3DYIA 2P2DA 3Q6NA 4OUDA 2V1XA 2VI5A 4URXR 2I6TA 1VJ5A 5JQGF 4HV4A 4C6TB 2DPMA 1POWA 4IDDA 3WMEA 2FDXA 3AESB 4J1SA 4MUAA 4RPKA 5JSYA 3GVIA 5C7OO 1F2UB 1L4FA 1O8CA 1ZUD1 4FKZA 2QZJA 2RH9B 1O2DA 1EDOA 3DHEA 2WJIA 3LLUA 3L18A 3PC8A 3AOEA 1ZL2A 2FKAA 3T41A 4QU8A 1I5OA 3BA6A 3IP3A 1OBHA 3R5FA 4P4NA 1R4MA 4PW0A 1U8CB 3BB4A 1UODA 3N2LA 4U5XA 1OFTA 2B4AA 1HRKA 1W9HA 2CVFA 4NZZA 5EJMA 4D9BA 2YWDA 2OBMA 1J8QA 4JU9A 1KMMA 3HP1A 5BQPA 1NVVQ 1NA5A 2QTNA 3CNEA 5ECWA 1XCJA 2M6KA 4ZD6A 4UU1A 1RWNA 4YAJA 3IBCA 3ZX5A 4EPYA 4F1JA 5JC1A 5AW5A 4CQMA 4LY9A 3B1JA 1JA0A 5CLGA 3AHDA 3H1AA 2FW9A 1AT1A 3HCNA 1BWPA 1VJCA 3SZRA 5J2UF 2R8YA 5MFZA 1M2WA 3IJ5A 5FBZA 4E5YA 1ZY2A 2PMCA 2V45A 4FP9A 4BYMA 3UANA 3VC7A 1KZGB 3ER8A 3AL0C 2HI0A 2XCIA 1X80A 2JVJA 5CM2Z 1PFUA 3AB3A 4AO8A 4XWKA 4MUXA 3A25A 4QRIA 1V3QE 1OXVA 3LUCA 3WHPA 1A2OA 2GAIA 2ZRIA 3IQHX 5HIKA 5BWCA 2O6LA 5CXQA 2DFTA 4L3VA 3WGQA 1ZYUA 1PT7A 1RQ2A 4HD8A 2YS6A 3WGNA 3IODA 1DIGA 4LFAB 1HDZA 1L3CA 3LBNA 4FD3A 4N1AA 5KTOA 4RTLA 1PRYA 2GAAA 1FUYB 4PX2A 4FYYA 5IARA 3OY2A 4GX1A 3IHKA 4AN4A 2UYYA 1JHAA 1LV8A 1RI4A 4M1ZA 4YRMA 1XQWA 2HTFA 2ZE6A 4EYGA 3PC4A 1XCLA 4UTRA 4DLNA 3TJMA 1D03A 3UAZA 2CEKA 5FQNA 3TNLA 1GZUA 3QKRA 4MS3A 5CVJA 5DMHA 2V97A 1WV1A 3EXHB 4MUIA 4Y1GA 5TVGA 2OEPA 2PZAA 2ZYIA 2UVPA 3G8BA 4FJ2A 4JBHA 4R9RA 4BEVA 4BO9A 4H3KB 3H5OA 4RULA 3D4NA 2B8EA 1M2FA 3MIZA 4PO8A 2O0JA 3BIFA 3EVCA 3IUJA 4P32A 4ZA2A 5GTDA 1N5DA 5JAPA 5KCZA 2HLDA 5P8WA 1A9RA 3SK0A 4UOEA 1JIVA 1OHHA 1CJUC 3DFKA 3HXPA 1L5LA 3OI7A 3LX5A 4QGBA 5KSOA 4IIHA 5ALQA 5HA5A 5AVSA 2KYRA 2AIRA 3CVOA 1VBKA 4MWZA 5C8YA 3G6KA 3T1HB 1EX7A 1YZVA 3L4SO 1PJ4A 3HC7A 2PX6A 4RYLA 1KDZA 1YRQA 2GA9A 4E33A 5CB8A 1W7AA 2CZCA 2J6CA 2HDOA 2AV6A 3PA8A 1KC3A 2JIRA 4KXNA 1SBHA 1JDBC 3UK6A 3B6KA 1TVMA 1R8XA 2HQSA 2Q1UA 3VBEA 3JQAA 3AI2A 3PJGA 4OJKA 1XTRA 1YFZA 2ZYAA 4B87A 3NTRA 3UK2A 3GLVA 4HATA 3AKZA 3TCXB 3ENZA 1JXQA 4P9NA 1NKTA 1GJRA 2XI4A 3DZIA 3ILYA 4ZEWA 1XX6A 3WLKX 4D4JA 4RLQA 2J9ZB 2MT9A 1N57A 5AKHA 3QV2A 2RAUA 1U3GA 2QL9A 3ANLA 1KZHA 4H3HB 2O5CA 4OJMX 1NW9B 2A4KA 3DNPA 1U2QA 2ZWVA 1LEHA 4GMHA 4KFRA 2IXEA 3D0OA 4N7JA 2ZOSA 2H0QA 1FX1A 2FN7A 1K5GA 3EWSA 1KP2A 3AWDA 2W8BB 3MQFA 3P2MA 4FCTA 4HDMA 4IQGA 4JBIA 4EEXA 3IYLW 1JTEA 2J3MA 2RJOA 2M1ZA 3LP8A 2FPKA 3BGOS 1MUUA 1SU6A 1Z2DA 3MW8A 1JKJB 3LWZA 5CRIA 2ZB4A 2Z2JA 3WWYA 4EI2A 3AM1A 1XPOA 1X1SA 1P1BA 4CPDA 1J22A 1W0JA 3RJ5A 5JFGA 1XDDA 1C7IA 3PXDA 5JD3A 2WIGA 5IWAB 3HM9A 5E6RA 3ZHYA 1M8KA 3KVOA 1L5HA 3DXYA 4DA6A 4DJAA 3THSA 4FW9A 2W2VA 3UMMA 4MV7A 2V96A 2A7QA 2I2WA 2OFXA 2EERA 3KD2A 1DZIA 1Z0UA 4GXRA 4QU9A 4U5QA 4FFSA 1K7YA 4ENTA 1KP9A 1N2EA 3JAWB 1AQYA 2NU7B 1ML3A 1PQUA 1SOAA 1FDWA 1LSSA 3EW7A 4KR7A 4L4XA 2F1KA 4OAQA 4PS1A 4UJ5A 5C0OE 4BP9A 2WSSA 2E87A 2QSUA 3CX6A 4OHOA 5K0JA 3N28A 3SX4A 3P27A 4KGDA 4QE3A 3UJBA 5FYDA 3SDSA 4B71A 4CIDA 4CKEA 4D3FA 2QTTA 4BGUA 3RSOA 4QEKA 3RVQA 4B4WA 1CVIA 2VYQA 3BFJA 3PR1A 5GP1A 5C31A 1PJ2A 4TLCA 2RE8A 1DRWA 3O2JA 4O4JF 1UMBA 1W5FA 1KETA 4U7WA 2ZEJA 1QJ4A 4E3WA 4WJLA 4OJYA 1GARA 5G53C 2JLUA 1DFIA 3ZTTA 1YR2A 1ADCA 2ZBPA 1GGHA 4MW6A 5L3SA 1SCDA 3I39X 5LYJB 1Z08A 4FFBA 3L8HA 2PTHA 4KR0A 4OQNA 3TJZA 5E38A 4EG8A 2QM0A 1SKYB 3DD5A 3SQMA 3D5QA 2VWHA 4YRCA 1SXJD 1Q1BA 1CERA 1M66A 1SCNE 2WFAA 4QEZA 3LOUA 4WBSA 1DOAA 4B3IA 2BBTA 4BO5A 2GN6A 3I9KA 3E7XA 4PBTA 4BJ1A 4EX7A 1G6HA 3QWAA 4QJIA 4DKXA 1T36B 2P9FA 4YR7A 1BEEA 3HZHA 2YC2C 3NT5A 2R44A 3KQWA 4IUCS 4JI0B 4CV0A 1CRQA 6REQB 1E6WA 1G8PA 1L5QA 2ATEA 5MN4A 1E4OA 4ZJUA 1EE2A 2O3UA 2XCUA 3W5IA 1IL0A 1GA6A 3MM4A 3TFOA 1NQTA 2C9ZA 3B6MA 5BW8A 5D5HA 4HQRA 2QJTA 3OQHA 3FCYA 3T1QA 1UIMA 2GZMA 2G77B 5EWLA 4ENUA 2XVYA 4L9AA 3R8XA 3WGLA 5GV8A 2O57A 3BRWA 3UJ7A 2L42A 3D8NA 1LH0A 1GDHA 1U8YA 2IXTA 4CEJB 1ZI6A 2PL3A 4ZCPA 1DO0A 3MN1A 4J75A 4CV1A 1LQUA 3BWCA 4J43A 3CPHA 1ODKA 1K3FA 2O8CB 5CG2A 1NX9A 1RZ3A 4GHWA 7REQA 1N1GA 3FM9A 1LK0A 2WTEA 4NARA 1T26A 2C00A 3OF5A 5ALVA 2JS7A 3GRVA 1UFVA 3QP9A 2PUTA 4MUYA 5C1PA 4AZSA 4G4JA 1NBOA 2GBGA 2EFDB 2I6GA 2WJJA 1P75A 3DW1X 4INJA 2ACKA 1DAPA 1X8JA 2GNOA 4GC9A 2R7KA 2I6FA 4HX5A 5DYYA 3U26A 5FPKA 4U1RA 4BCDA 4CIWA 4GL2A 3W90A 3HU1A 1QFSA 2C2ZA 4FNAA 3A31A 1N5IA 1AQIA 4WFKA 5IJ0A 3AK4A 3EXG1 2JEZA 3V4FA 4HDRA 2NVUB 4QTYA 2NAPA 3INTA 4CG2A 4EW3A 3CSSA 2ZXUA 1JBEA 1NC1A 2BI8A 2VH1A 3ANXA 3IP5A 3NJ8A 3ONFA 3SIRA 4DSUA 2G9VA 3JQ8B 4WOPA 1OASA 4V39A 3MD0A 3UJHA 1KSGA 1KGSA 5CB0A 1Q84A 5C3MA 5A5GA 3L40A 3RSSA 4BNNA 2HF7A 3ORQA 3W2GA 1PZMA 1ZJ6A 1D1SA 3CUUA 4K0KB 1F2TA 1GEGA 1MTZA 1VA5A 1L2TA 1QIFA 1VIMA 2GPNA 3H19A 3R5XA 2ZUCA 4MS1A 4RKWA 5IANA 2BCJQ 5J43A 3PNPA 3COSA 4G2TA 4EI7A 1AZLA 1N2CE 2HEIA 3O31A 4LDJA 1UOQA 1X1EA 2XTJA 2PDAA 3BF7A 1DC4A 1LU9A 3NLLA 4RBNA 4YMTA 5EMHA 4I55F 4P33A 1MA3A 2QUHA 1CJSA 3C3BA 4G0ZA 3MAGA 1OC2A 1XZFA 4DPKA 3B9RA 3CUKA 4GUAA 5UKDA 4ND4A 1A4RA 2YZNA 1EFVA 3D6FA 1P0MA 4IMIB 2WWFA 1NKSA 4UXJA 2GNAA 1FPMA 5L3VA 4JT9A 5HCIA 5AUQA 1GNSA 2ZSJA 5C5IA 2FEAA 2NZXA 4NYMQ 4XYBA 1XOIA 1XTVA 4DA9A 4LVCA 3G7UA 7GPBA 4HXFB 1MDBA 1XK7A 5A0FA 4PRLA 3RUPA 2HU2A 2HLDD 3HNPA 3GJZA 2ARKA 3DOOA 4Z4EA 3B1VA 1VGQA 1YGYA 3ZE0B 1EM6A 1OHHD 3AQIA 2YWEA 2Q1WA 1XQYA 3EGDA 1JT9A 1G5TA 2ZTHA 4LNAA 4EELA 3NYRA 1GZ6A 4GZ6A 2XMQA 2Y0BA 2HZ7A 2FF5A 5G4KB 1TCVA 3V8RA 4PGFA 4CW7A 2OR3A 4CM6A 2ZW9A 3IE2A 1BGVA 1TMYA 3NDIA 1J0EA 3UH0A 1B8OA 1HQDA 3OOHA 1E2JA 2HBYA 2JVKA 1SMKA 2R6ZA 2WF6A 3PPIA 4B1FA 4BX2A 4YCLA 3HSSA 4BTEA 4X20B 2GASA 2XAAA 2FPSA 1EFPA 3ADPA 1QP8A 5ALXA 3B5IA 4MKIA 5JSKA 4Z53A 2ZYTX 4DOMA 1FVOA 1PQ4A 3RVNA 1I7DA 1LNZA 1MA0A 2Q1TA 3RTBA 4DT1A 1GZVA 5KZMB 2EDCA 5AJYA 2WU3A 4QXOA 2LCIA 1ZCFA 1AKMA 3P0HA 3O7WA 2Q8PA 4MEJA 3TKYA 5EY5B 3FNRA 1QYIA 3OD1A 4CL8A 3ZLVA 1B4DA 3D81A 4GRIA 3SYMA 2RIRA 3U40A 3A8TA 3LZ6A 5D3KA 5HQ3A 1Z16A 1NUAA 3MMXA 2ZIAA 4PFKA 4I14A 1RVV1 4PC7A 4RPGA 4LTNA 3WX0A 4AY3A 2R6CA 2WZCA 2XNDD 4S35A 3BMNB 1LF0A 4Y2GA 4D6YA 1JHUA 3KXIA 4RZ3A 1S2LA 2HREA 3N2GB 4LXQA 3FBWA 4DSAA 5J3JA 2BSAA 4R2WA 5T67A 3M6FA 3VJRA 3T34A 3W6PA 1T4BA 1X9HA 1XTTA 3N2EA 2JJYA 4PPQA 1C0IA 3C5VA 1XAHA 5LQUA 4RENA 2ZYUX 3ZY6A 2ONYA 1U98A 2NSHA 1TEZA 1VPEA 3N1UA 2OWDA 5EHXA 3NVKI 3EARA 4J9UE 3F73A 2IY8A 4F60A 1IXSB 2IITA 3AZOA 2C2WA 1CVLA 4GYKA 1O58A 3FETA 3KLBA 3TSAA 1MJGA 5FPHA 4RE5A 4XGIA 1Y4ZA 5C1BA 1Q0LA 3HB0A 2WSSD 4L4RA 4CIXA 1JSRA 3OG9A 4INPA 1R9GA 1QRRA 2QOEA 4LGYA 4XIGS 4AMBA 3ASVA 3H0EA 1L5NA 2VTVA 2WSMA 2HV9A 2KLBA 1VKJA 3JWHA 2K2QB 1ND6A 5MN6A 5IUKC 2AOUB 3L8ZA 3OCZA 4GGPA 4HAWA 3DVLA 3KE9A 1ESCA 3HA3A 1GAEO 2WNIA 2WLTA 3THWB 4RMHA 1NY6A 4KO4S 4NOKA 4DNPA 3L92A 3QLEA 1L5WA 2XRZA 4R71A 1QOQB 4HDNA 3W6UA 4YVFA 1J33A 2H9AA 3EJ6A 5F3DA 1UF9A 4PZ9A 4AG3A 2AL7A 1X9GA 3JQ9C 2VT6A 4F3NA 4GOOD 1P2FA 1G8KA 4ZYVA 1CUCA 2Z56A 3N0XA 5MF6A 1QV6A 3M4NA 1K88A 3HEBA 4NL4H 1I13A 4PN3A 4TXJA 5A4IS 3COJA 1F7UA 1D6SA 3B70A 1C0EA 4BVGA 3USZA 3KKPA 4EY4A 1OIVA 4J0KA 4S0ZA 3SICE 1RI1A 5IJZA 4FVTA 3W7AA 2O7NA 1NJ2A 1NLFA 3HUUA 4J2OA 2JG3A 1O96A 4WNAA 3SYRA 2Q8QA 1VIYA 1GAWA 4BMVA 3E9YA 4BBJA 4LMBA 4YAIA 4HUJA 1NI5A 5KC9A 3S8EA 5JALA 1WBJB 5L45A 1PJCA 1R88A 3GQBA 3WAKA 4DWJA 3S1SA 3M6UA 5TQVA 4IMPA 1YI0A 2XYRA 4GOMD 4MMZB 5ARCA 2I2CA 1C7ZA 3M2PA 4DREA 2O7SA 4RGYA 5FXMA 1R0XA 1USVA 3TOSA 2JD2A 4E46A 4NPAA 3KEGA 2HQOA 4D98A 2YOFA 3FPFA 1VSTA 4PLHA 5GONB 1KE2A 2IPOA 4INAA 4WAUA 2HT1A 4MMYB 4F5DA 2FF7A 3TTVA 2QT9A 2PX8A 3DEAA 4YY3B 5HF8A 3H16A 2BR5A 3CW2A 3PEFA 4P8RA 4G5XA 1FUKA 4DCNA 2B9EA 3L01A 1UMKA 3RS7A 4F5EA 2GK6A 2DAPA 5FBWB 1XYGA 2DR2A 1PUXA 1RE0A 3V5NA 3GLHB 3PFHA 3PVCA 4R4JA 4M8SA 3KU1A 4H1WA 3GJ4A 3K2IA 1GLNA 1U7OA 4YWJA 3VC2A 4IMRA 4ZOLB 3KVYA 3NOOA 2X0KA 1X0XA 2HIMA 2LRHA 3DJFA 2HO4A 3K6RA 4R1PA 3O6VA 1F17A 2IOYA 1QDUA 4RCZA 4DQ0A 4F56A 1YQ9A 2YYZA 1T1GA 4U0JA 1DX6A 2QDKA 3HA7A 2NZYA 3C4VA 1VLLA 4PXAA 3Q7TA 1UZLA 1LPPA 4RZHA 3AHHA 3I37X 2PZEA 4IZIA 3K70C 1QYRA 1K08A 3FPHA 5BSGA 2VPQA 4NYMR 4A92A 3DXFA 2X4IA 3C6QA 4G0VA 5C7YA 4W9MC 3EBOA 4IXMA 4CF6A 1KBZA 2D06A 4GLOA 5CW1A 3REOA 3UA4A 3EEYA 3K70D 1HNWB 3FN4A 3M3DA 5I3ZA 4UTVA 4X8HA 1QDEA 2FDRA 2F1JA 3Q7IA 3O1HB 2XWQA 1GPAA 3EISA 3WRYC 1AHPA 3OP1A 5B36A 5KHLB 1GUYA 1T1SA 4NV0A 1GITA 1TIPA 4I4NA 2VKQA 4X8OA 5DGXA 2P75A 2WT8A 5THQA 3DB1A 2O8BB 1UBOS 1I6WA 3NHFA 3QY9A 1SUCA 3SE0A 3IEMA 3M6WA 4RH3A 5AVKA 4S1TA 1ID1A 4O1MA 1I2BA 4OFXA 3GLIB 2W2XA 1MR3F 1T0BA 1EBBA 1PZNA 3EPRA 3L4KA 3MJHA 3FMGA 5BV2P 1RWWA 4H6WA 3W2HA 2PD4A 4IV0A 3UG7A 1MO6A 4DG8A 4FDTA 1CNEA 4I08A 3HVUA 4G1MB 5FORA 2V3WA 5K0NA 4JKOA 4Q03A 4YCSA 4O59O 3IBSA 3AKYA 3VH4A 4ILKA 4OPMA 3A0RB 4IILA 2ZP1A 4MP6A 5DOVA 3CCFA 3L6UA 1BG6A 1DL5A 2R6AA 2VYVA 4O2BA 1UC4B 4EARA 5J4KA 1OOEA 4V03A 3QU2A 5K3OA 1K7XB 4WBNF 1RIFA 1X39A 2Y9PB 4YP9A 4BMDA 5EXTA 4F97A 3NIGB 3ASZA 3JD0A 5FPQA 1WA5A 3GJXC 4RQTA 1P1FA 2OCPA 4LC9A 1XL1A 1EXVA 1JNXX 2ETVA 1YRHA 1IXZA 2WIFA 1XU9A 2JARA 5EIBD 1J25A 2HRBA 1K5HA 4R8KA 4F4UA 3DZCA 2GVNA 5JTTA 4C0LA 2FY8A 3DFIA 3KPUA 4F3KA 1E2EA 4UHDA 3OSUA 3WP0A 2QLLA 1T3ZA 2B2CA 3AIIA 4A8HA 3IQWA 2JFNA 4G4IA 4LF6B 3KYCA 2G07A 2H4ZA 5TQ2A 1U94A 2K6GA 1EVQA 1XNGA 1MRSA 2M2IA 4GYWA 1W5AA 2HNKA 3PUZA 3HABA 4TT3A 2W2NA 1FVHA 1Y8RA 3FPJA 3KZMA 4FQ7A 3IQGX 3SEQA 9ABPA 1CUAA 3RF6A 5AW0A 3BJMA 5A0TA 1N2BA 1P5JA 4J0JA 3W8NA 4GLFA 5B1HA 1GPKA 2HH9A 1Z36A 1VHJA 4ND5A 1BSVA 2J31A 4QQNA 2ZZMA 1ZM3A 3ADDA 1ZITA 4I1SA 3MJSA 3AVQA 3HGTA 2LIPA 1CU1A 4HMQA 3GUYA 1W4ZA 1YHZA 4MCIA 3DVAA 1H2XA 2QP9X 9MHTA 5KWEA 1ZN7A 4M1MA 1JQKA 2A8YA 1CQPA 2QD2A 3T7JA 2Q3MA 1U5BA 2IOHA 2OHGA 2Q1XA 4NJMB 4NHOA 1SCUB 3EPPA 1GRVA 5FPPA 1N6LA 3I4LA 3QH4A 4JWKA 5ENZA 2C3PA 4EK9A 3ICWA 2ZSIA 2C42A 3GFRA 2J3IA 2B7LA 2XWPA 3GLSA 4MI6A 4K88A 3IR6A 2XUHA 2X0EA 5JNTA 1TU0A 2AOTA 4OIFA 4WNCA 1SXGA 3C8MA 2AK2A 3H2JA 3LC7O 4MVWA 4C78A 1YRAA 4CF5A 1M34B 3S6JA 4DDUA 1ATZA 4HTFB 4M1OA 3L8GA 4KO2S 4PONA 4E7PA 4I3HA 2F4VB 1XALA 1J06A 2H4YA 3EYWA 3PPXA 1X86B 4UM9D 3RH0A 1TEXA 1UINA 3D8UA 1A2KC 5D3MA 4D79A 4RXUA 4N8EA 4D99A 1TYZA 1VJRA 5ICGA 5GZ3A 3LRPA 2XEXA 4E5UA 2GN2A 4LCEA 1RMQA 4WY2A 2O0LA 4IG4A 3NHKA 1CC1S 4O4IA 4YREA 3WOVA 4HVAA 2GD6A 3ADCA 2FG5A 4R1SA 1E0JA 3WNQA 2YFYA 1VJGA 3FVWA 3L7OA 1U90A 3GIWA 5JNRA 1EFDN 3JD1A 5LD2C 2PT9A 4H1HA 4RY8A 2WDPA 1PAUA 4GI7A 1A82A 4ETMA 5H4GA 3TOXA 3NBZC 2PZKA 2A6PA 4L73A 3ZGXA 3ITDA 2FN3A 4X61A 3LAWA 1Q22A 3HFGA 2PCJA 5FUYA 5TT1A 4GG1A 1YJQA 1C1YA 1G42A 3ENWA 1SOUA 4HGNA 4AKHA 4I2NA 3WDKA 3L93A 1KZ7B 4E15A 2FSPA 3TXYA 1JKXA 1TMGE 1XRLA 2OCAA 2X9QA 2ZU6A 1WMDA 3P19A 3IBFA 3L8MA 4HAIA 4Q7LA 2FQQA 4H1UA 4YC7A 4GYYA 4YO8A 3ZWOA 1QVZA 5IHPA 5IK2D 3LGXA 5LU9A 1DXQA 1UH5A 3UAYA 3NRJA 1EFRD 1ZA2A 4ECEA 3RSFA 1KZ6A 3B20A 1O6BA 2D59A 1VXOA 2RSLA 2JIBA 4OI2A 1EM8A 1VQ1A 2OMEA 4AZ3A 1JHVA 4Z9YA 4EAAA 3L6DA 2OG2A 2XKJE 4DDTA 1T0PA 3EMBA 4JZKA 1XEXB 2H4HA 1AXRA 2FWJA 3WLSA 1FYXA 1GZDA 3C3PA 3UG6A 1GNLA 2QLJA 1QO9A 4B6EA 1PTKA 1X9IA 4DNXA 4EYQA 5FAKA 4B81A 3CX8A 3O74A 5IC4A 3TZLA 3IRVA 1ZI9A 4NESA 3VR1A 3CH5A 4NWIA 5DI9A 5EPEA 3VSBA 3F6RA 4X84A 4RCYA 2GBPA 1JAZA 2OM6A 2O2SA 1I0IA 1LSUA 1YVUA 2WJHA 3KKQA 4KG7A 4R1TA 4DSZA 1HFWA 2UZ4A 3GZNA 4NATA 1Z8DA 1R4AA 4QUAA 4DIDA 3O8QB 3UB3A 4CR8A 4V0NA 1DLJA 4D1YA 2PJUA 3R40A 4MS4B 4RTMA 1MX3A 2VDLB 4CI0B 2ILVA 5JZVA 3PQ2A 1N8NA 1FK8A 3WZMA 1AHNA 3C7DB 1ZR2A 3SIPA 1DB3A 1KFBB 2QUKA 2XR1A 5ILQA 4NJOA 2P5YA 5A71A 1DOHA 3QF4B 3EH2A 4Q9HA 5AVUA 5C52B 4OMFG 3FAKA 4TYQA 1FFAA 1YH3A 2ZYGA 3HKDB 4W9NC 3VSAA 2H1RA 1NR5A 4DQLA 3EEBA 4QDZA 3T1YB 1ULHA 2WWHA 4L0QA 1FU8A 2VH2A 3I34X 4CEHA 5DTRA 2YBDA 2JHPA 3MBOA 1BXGA 4EGFA 3N8DA 3B60A 3LKVA 4LPSA 2JIPA 4DV4B 2O59A 3E53A 2PPVA 1PYDA 1Y9JA 1N2CA 4DV2B 3UC5A 3IIEA 4AQYB 1OB2A 3A4LA 4R8VA 1G3QA 3MRSA 4I3FA 2CBZA 4PANA 4O08A 3VVMA 3CRZA 3UJCA 2J1LA 1M2EA 3TLEA 1AN0A 1LW7A 4FC6A 4HAVA 4QICA 2CLLB 1CF2O 4MVJA 3H2YA 3RRNA 1X3SA 4DE5A 2KW5A 3WBKA 1MC8A 1DDOA 2ATCA 2PUVA 3L7DA 2OLKA 4MLDA 4V02A 4BLOA 1H22A 2IFTA 4TYNA 5AXBA 1G38A 1J2YA 3ACDA 3L41A 1T2VA 5FBQB 3ZU6A 3K0SA 5EIAA 1BQ4A 1YASA 3RRBA 4MWDA 3U1BA 5AKZA 1MGOA 3GNLA 1P1IA 3WICA 2X4DA 2EZ8A 4TMYA 4US0R 2HAEA 3DPIA 4I1UA 4LVNA 3VNVA 3TVYA 3PRYA 4UBNA 2DSNA 2QI9F 3SZOA 4ILEA 2R8PA 4BQQA 2COUA 5AJZA 2ZJ8A 3VU1A 1FJHA 2AFIE 2LNDA 1ISMA 5IVHA 4MZXA 1T6XA 2VYVD 4HN9A 4BNWA 1JDBB 1W93A 1MG5A 3C5EA 3O0DA 1O97D 2CV0A 3D7MA 4MR7A 2QTBA 3WBBA 2AMVA 4EGAA 1X8KA 5CBPA 4LYJA 2VN8A 1BE1A 4PX3A 1P2UA 4W5TA 4CFZA 4BQPA 3HYNA 4FWIB 1NVBA 2Y1GA 2J67A 4K3VA 5HILA 4NCXA 1A2BA 2PMBA 5DBFA 4CG1A 5I9TA 4EL5A 4LX0A 1PSDA 3M6AA 1D9XA 5CK4A 5ARDA 3EYAA 1RYZA 5D1HA 1MH1A 1OI4A 4G4SO 2BDEA 3ZXYA 3RWBA 1P62B 1YVPA 2BGIA 2XVAA 1U63A 3SC3A 1JN0A 3SLKA 4EZBA 4PZEA 4YHHB 1F3LA 1JLKA 3TYXA 1VA4A 1P4AA 2XQJA 4ME6A 2PGAA 1RWBA 1KNXA 4PIMA 3K2EA 1AGRA 1DIHA 3B89A 1L4GA 1ZC4A 2ZIUB 2R6R1 3P5SA 3H1EA 3M4YA 2CWWA 2PLNA 3IUNA 4TKVB 2VWGA 3LT1A 5FTMA 1Z4JA 1E6MA 1ZJ4A 3BHJA 2GBCA 1JPJA 2EKPA 2W0SA 4R81A 3VYRB 3OLVA 3OZEA 2Z98A 1UP6A 1JQEA 1FB5A 2F9LA 4D80A 3FRJA 2PUGA 1KZ9A 2PVSA 1O95C 3ZWXA 5EJ6A 1MZPA 3LECA 3R5HA 4J3JA 2OLJA 3A28A 5LYJF 4F12A 3U61B 2J46A 1X8XA 3B78A 2IEDA 4QFMA 2GDJA 1DEAA 4PO9A 2JFWA 3E1GA 3RTDA 1OAAA 2OCGA 1R0BA 1TKBA 3L4BA 3MTIA 1UMDB 5EYPB 3T7CA 1X1DA 4KQ6A 1YTLA 3FRIA 2DETA 4MQ4A 2EATA 3M1LA 2RGBA 5EMNA 3TZHA 3OC0A 4F8YA 5TY0A 2GCOA 3ZE1B 1YAHA 3K2BA 4Y0NA 2ONKA 3NHPA 4MQLA 1AU9A 1JV2B 2B21A 3RBZA 4K2AA 1Y8CA 5LVAA 4XIYA 3WJAA 5AKGA 4PINA 1QU2A 1AA6A 1A9QA 1N25A 1MNQA 2FFHA 3A7DA 3FBGA 4Y3UA 5FDFA 1WHSA 2XUDA 3H11A 5CYPA 3CLRC 3C7CB 5SYMA 2RK6A 2WMNB 2IXBA 2GXUA 3Q72A 4ND1A 5EE1A 5I8ZA 4KQ2A 4RDCA 3RUFA 4A27A 1SCQA 3MWFA 1KK0A 1SC3A 3DZFA 2H7VA 2VR1A 5KYGA 1TL7C 5CTAA 3UT6A 4EM6A 3ONEA 5J5CA 5F4ZA 5L3QA 3OHPA 3HO6A 3I9MA 1DAKA 2VJLA 3BF8A 4WUVA 2P40A 1JEAA 3GAMA 5JAQA 4UHCA 2I65A 2BEUA 4DNOA 1PR1A 1KRHA 2DWQA 3BMQA 4TTVA 2C20A 2JI8A 2QENA 3NCHA 3HR4A 1JQBA 3QVWA 4EG6A 4U7PB 2QM3A 2Q5EA 2DR0A 5D2CA 2VTBA 1G6OA 4OB7A 4DM7A 1E9CA 2F43A 4V1CA 1QWOA 4XARA 4GE0A 1ZNWA 1KFCB 4YCJA 5HZGA 4Q7MB 4BLQA 5L4NA 2PJRA 1FDUA 3RYCA 4G1EB 5BSMA 4RGVA 1ADGA 4Y2XA 4BFZA 3UAGA 3KOXA 3U7GA 3JQCA 2QR3A 4IF4A 3A6GA 3EQ6A 3P4XA 1OC4A 4JK3A 4JHXA 4A2QA 5B5SA 4CQNA 5A0VA 3AJEA 3B3GA 3VPHA 5I7EA 4DV1B 1E9AA 3WV5A 3QVJA 5JADA 1RRVA 2PR2A 2YVQA 1X87A 2QQ0A 2AF4C 2ZU0C 3BK7A 3FA2A 4YRFA 4AJ9A 4BNKA 4EVIA 5AOAA 1KK3A 4MLCA 1QVWA 5LQNA 1PQWA 5C51B 3NOQA 4N7RA 1QNFA 1HNXB 2BFMA 4HXEB 3OHMA 1Q95A 4NAUA 4Q5IA 1F9AA 1T3GA 2DBQA 2PNJA 4AF8A 3H65A 1A9OA 2HF8A 3TINA 4LHYA 5AI5A 3QTLA 1UBEA 1VE1A 3GJ7A 3OIGA 4HXYA 1NBMA 4LNUA 4P3XA 1US8B 4ZDWA 1JMVA 2ZUBA 3H2HA 3KYIB 4PO1A 3SQDA 3FPLA 4FYVA 3V7UA 3GDHA 2PM8A 3F67A 3NC1C 1AKQA 4RGQA 2Y67A 4JX8A 1RJ9A 1XCGB 1XN4A 2PAAA 3Q7SA 3GEEA 3QXHA 4MV8A 1U0HC 3IE1A 1YZGA 4JXZA 2WYVA 3UZUA 4FYJA 4J7CA 5L9AA 3LX8A 4J7UA 1XNQB 1E1RA 2O0HA 2ETXA 3T3NA 1IDN1 2FSFA 5I5GA 3QE2A 2CFOA 1E61A 4E6PA 5JMOA 4DR4B 2YUTA 1ST3A 3N6XA 4L50A 3OA0A 2HX1A 2P5UA 5A04A 3O21A 4WZBA 1CZRA 4FB5A 3FVRA 5EZ6B 5DHTA 3I2HA 1PQPA 1YI8A 2B78A 3AUXA 3LX6A 2Z8YA 4FIDA 4LJAA 1IN8A 5TPWB 5L40A 4BNGA 1I3NA 3VTFA 2Q5QA 3IUBA 4MQEA 4NNOA 5KOHB 2NO9A 4ZT5A 2QPOA 1G7CA 3KUDA 3NYIA 1U28C 4FT2A 4Z4IA 5EEGA 3EWNA 4WIAA 3TQTA 2PGOA 2VPTA 1FDVA 2FNAA 1MZVA 5KYNA 4FOLA 3AVYA 4RMJA 5DN6A 5BY2A 2W42A 1NBHA 3QOFA 1HFJA 2ZROA 1IBRA 4IGFA 2P9ZA 1VL6A 4Y9DA 1XGKA 3QLVA 4GOKA 4IF6A 2P3LA 4EKEA 5JHGB 3WGIA 4DIOA 1U0NA 1K97A 3NX4A 4PLZA 3RYHB 4YMGA 3LNTA 5DIFA 1TPYA 1B41A 3IMEA 4F04A 2ZIEA 4MVJD 4F3YA 3UMVA 3KFVA 3DOHA 3OFVA 3VKWA 2EX1A 2CJXA 1KIAA 4JASB 1XPUA 1O9GA 4XXHA 5BN5A 5F4BA 2V8OA 1VMDA 3ICQB 4EKYA 4R83A 2EZTA 1WXIA 2IHVA 3DE6X 4PC1A 3WLHA 4B6SA 2AZXA 621PA 2BE9A 2JFHA 1VRVA 2XQVA 2DWPA 4FLFA 5FD8A 2A9FA 5U9CA 3N76A 5CIYA 3TW8B 2HNBA 4ZVPA 2H2HA 4WESB 4LAFA 1ZH2A 2Q4OA 1V9LA 2WF8A 4BRZA 3E8MA 4F6RA 1C8KA 2PBZA 4L75A 3A1EA 4US2R 3DULA 1DWPA 1G0OA 1P4JA 1XD9A 4NICA 4GR5A 2DTDA 1ZJWA 1PEYA 3JZDA 1EJ0A 2XDWA 4LQDA 2Z3VA 1KH3A 2GEBA 1MX9A 3LVFO 4B6JA 2WOJA 1USWA 4QECA 1SHTX 3BXXA 4CLHA 1FJXA 3M6MD 3N59A 5DWDA 1GPLA 1LI4A 1NJ5A 3ANTA 4RHUA 3O94A 2J48A 2WQ7A 3N0RA 4U00A 2VT2A 1W2WB 1KQOA 2W11A 5KYXB 1R16A 1YT5A 3CINA 4QUDA 1NVGA 2FSIA 2P5TB 3E7FA 4BZWA 2FPUA 2QN6A 3L7KA 3ETEA 1E79A 3GEMA 2Z1MA 4FNOA 4TV8A 3M34A 3T9CA 5JO9A 2BDUA 4TPKA 4UD2A 1TUBA 2KE5A 5EVCA 3M2TA 5DXFA 4IIBA 1H9AA 1RAFA 2VJAA 2FUNB 3IXMA 1PGQA 3OPMA 5LFAA 3UKOA 1LLUA 1ZUHA 3A2MA 5JD5A 1GPDG 4JJ4A 3UV3A 3T9EA 4OLAA 3RSGA 1CR1A 1CRLA 3Q41A 4GP6A 1KMIY 4RIEA 4YMWA 3RC7A 1VJDA 1U8FO 2GRJA 2D7JA 4JJEA 4MQ5A 4A8TA 2JAWA 3TOZA 4E07A 2WP8J 5JBIA 1TA4A 1WO8A 2QN2A 2RGAA 1XZQA 3PEYA 3BH7A 4OHBA 2CNWA 1HDRA 4MYDA 1VSVA 4NYIQ 4AT1A 4ZVNA 4CLRA 5BN4A 4Y1RA 1QYCA 4WVFA 3KSZO 4L2IB 3REFA 3FDFA 1NWCA 5K3SA 4I50A 2J3LA 1ZINA 5IG2A 2ZYSA 1CNMA 2Y2UA 1Q0UA 1QHSA 1R4ZA 3AQ4A 4MSUA 2NPFA 5AD1A 1KI6B 3R0IA 3OJFA 1RYMA 1CJTC 1JR3E 4NY1A 3TZBA 3DEKA 5LMUB 1WY5A 3MJDA 4PF1A 2PVCA 5IKPA 3OU2A 1G2QA 3D6MA 3HDVA 3IP7A 3JPYA 2BBOA 3NPMA 2D2IA 3UATA 3I1IA 1NI4A 3CPSA 4HWTA 2QJWA 3N2KB 4UVGA 4EFLA 5KS2A 2O3JA 2XY4A 5IF3A 2HZBA 3X3HA 1XXHE 1X42A 4A91A 1P4HA 1BW9A 4DMGA 4S24A 4JUCA 5EAIA 3UMRA 3GOHA 2VDWA 1NULA 3I76A 4I5GA 4DYHA 1BCRA 2I76A 2FWMX 2JZNA 3QHPA 3ZWQA 3QI2A 1LGYA 3OF3A 4EABA 3HKBA 1WSAA 5GONF 4MW1A 5K0SA 3SQLA 3S1AA 1EA7A 1KZ1A 5FI3A 2IYAA 1PEAA 2C78A 2VQ6A 3AB7A 3K4QA 4IDNA 3SE7A 4ZCMA 3VYTB 4K6OA 4OA5A 5H9VA 2HSWA 1D2CA 4B83A 1U0BB 2NV6A 4FR5A 3K9NA 5C8ZA 1BMTA 3FWYA 1QSGA 1BVRA 2OCLA 3RS4A 4RNCA 3CR3C 1YR1A 1ULTA 3EMDA 1CBUA 5BPHA 1YZQA 1J07A 2AN1A 3PS9A 4NZ9A 5CDHA 3BZWA 4XQEA 1TJ4A 3KLMX 4ZOLF 5A4FS 1DCTA 3FYTA 3IP9A 3CGWA 1W49A 3G5UA 3PFFA 3WL7A 4EJ0A 2FX2A 4GDMA 4M38A 1AY0A 1C7EA 1FP7A 1QO7A 3HI6A 1W8IA 3D1LA 1A4UA 4DBLC 1NURA 1ZNXA 4XB6B 1QG2A 1XJ5A 5LJLA 1U80A 4R8SA 2ZTLA 3IV6A 3KB1A 3QVVA 3ZE7A 2DFLA 1RYDA 3QKSA 2PGLA 3ZIAA 4DMCA 1WU7A 1Q74A 2CVQA 4LWZA 4FOPA 3LPLA 4R8MA 2RG7A 2PX4A 4K9SA 8ADHA 2FQ1A 1LBQA 1T9DA 4YJDA 1NASA 3R75A 3BULA 3EXFB 3UUGA 3VSEA 5BVHA 4KBYA 1WV0A 3WAGA 1NBMD 3DL2A 4QAQA 3E9DA 4K9OA 2R48A 1QUEA 3RS0A 4C9BA 4E5KA 2JCBA 1UKAA 3CLKA 1HK7A 1DKLA 1GPMA 2VXOA 5BWLA 1GU0A 4U2DA 1REQA 4R0VA 4YACA 3LQYA 4MRMA 1A4IA 1JL3A 4N7MA 5LP6A 4LDQA 4NV3A 3NAGA 4B85A 3QNMA 1TT7A 5F35A 3ZQJA 3P8ZA 1TE2A 1I01A 4HYYA 2P9YA 1JH9A 1E1RD 4KR2A 1UOOA 2C2HA 4MICA 3GVCA 3PB3A 4M1KA 1AM4D 4MO2A 4CMKA 1TOAA 3B9PA 3IPYA 4MHSA 3TD9A 5FTKA 2GMWA 3EGVA 3N86A 1P1HA 1GPYA 1Z0FA 4CTOA 2GN9A 2GTIA 2WYUA 4TRMA 4IIJB 1IEQA 3ACCA 4OGWA 3GDWA 4Q4DA 4W7IA 4CLEA 2ZUSA 1YS1X 1FFBA 2YN4A 4J2HA 5E1OA 1FFXA 2VHTA 3GZTB 1A88A 4KQJA 1NQWA 3O2SB 2R8EA 3C16C 3CJQA 5DYWA 3GP8A 1LBIA 3AVUA 2V3VA 3OT1A 3SF0A 3A36A 3ZWVA 1B8PA 3ZD8A 2QBYB 2C0PA 2Z30A 2A94A 2OUIA 4Q82A 4KBGA 1WIWA 2JFZA 1LFDB 4FJ1A 1N2OA 5F1KA 1Q1NA 3UUWA 3TLMA 4DG9A 1Z0IA 5DHQA 6GPBA 4ESEA 1L4HA 3R3UA 5DN6D 1QPZA 3IBYA 2AFHE 4M2LA 1P9LA 1E9EA 3BH6A 1RC1A 3RSCA 1YFLA 3DTTA 2YVLA 4J0HA 5DYIA 1YOVB 1SD2A 1K8XB 1CUWA 2KJQA 3DBOB 2QSYA 3O9MA 3MJCA 2HQ1A 3KQVA 4D2IA 4IIDA 2Z95A 2JFGA 5LA6A 3ZDXB 4MPJA 3T1NA 1JQDA 4LHZA 5I51A 2ZI7A 4MARA 3OQNA 3O8BA 5JSQA 3DAFA 1YQGA 1O57A 2FPIB 1M1ZA 3RAEC 3PDHA 3WKCA 5JHHB 1XZPA 2G1AA 2QSJA 2A9RA 1WTCA 5AVRA 3FTDA 1I32A 2C31A 1S3GA 5A3VA 2OXFA 1P9NA 1IEVA 1JX6A 3E5MA 4GNRA 3QA3E 4JU8A 2OV3A 2PN1A 4TQ9A 4JQOA 1UJ2A 4L5JA 2O8FB 4JVSB 3UJDA 3IT2A 3F6PA 3O4JA 3OTIA 2JEYA 5HCUA 2OHFA 4NBWA 3W9SA 5JVDB 4M1WA 3QBDA 3KV1A 3BMOA 5ECDA 4FK8A 4IVQA 2Z9DA 2FZ4A 3PTLA 2J0EA 1KKUA 4G5RA 5ERGB 3F3SA 3WL5A 2BZ0A 4LDAA 3IE0A 1S9DA 3L7AA 4BPRA 1DUVG 2I3ZA 4XWOA 1PV4A 2DPGA 2P0YA 3PGKA 4B3SB 2WIDA 4LE1A 4R1QA 3PFBA 1PN3A 4A5OA 1FLAA 1QH8B 1XPJA 1P80A 3RTGA 1TLFA 1YU9A 3ABQB 4JYZA 1Q6YA 2YW9A<