2QSUA

Structure of arabidopsis thaliana 5'-methylthioadenosine nucleosidase in apo form
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
247
structure length
247
Chain Sequence
EILRPISSVVFVIAMQAEALPLVNKFGLSETTDSPLGKGLPWVLYHGVHKDLRINVVCPGRDAALGIDSVGTVPASLITFASIQALKPDIIINAGTCGGFKVKGANIGDVFLVSDVVFHDRRIPIPMFDLYGVGLRQAFSTPNLLKELNLKIGRLSTGDSLDMSTQDETLIIANDATLKDMEGAAVAYVADLLKIPVVFLKAVTDLVDGDKPTAEEFLQNLTVVTAALEGTATKVINFINGRNLSDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular determinants of substrate specificity in plant 5'-methylthioadenosine nucleosidases.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords 5'-methylthioadenosine nucleosidase
total genus 75
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 3.2.2.9: Adenosylhomocysteine nucleosidase.
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qsuA00
4EB8A 4IP0A 1JDVA 5F73A 3SCZA 4BN0A 1ODJA 3DP9A 3KU4A 5IFKA 3U40A 4X24A 2AC7A 4OF4A 5F78A 5F7OA 1TGVA 1TCVA 1V3QE 1YQUA 4FFSA 3P0FA 1OVGA 3FOWA 4L5YA 3OOEA 5EUBA 4TTAA 4KN5A 2HWUA 1U1FA 4F2WA 3OOHA 4QEZA 1RCTE 4L0MA 4L5AA 4TXLA 3TL6A 3EEIA 3UT6A 4M3NA 1JPVA 1OV6A 1K9SA 1SJ9A 4LNHA 3NM6B 3BL6A 3PHBE 1RYZA 2I4TA 4BMYA 3KHSA 4F3KA 4DA0A 3UAYA 4YMLA 4DAEA 1PR2A 4K6OA 1PR5A 1ZL2A 1RSZA 1V41E 1PWYE 1Y1SA 3UAZA 1RR6A 4QAQA 4JOSA 3NM5A 4TXNA 4R2XA 1B8OA 3MB8A 4F2PA 1ODKA 5JPCA 1QE5A 1ULBA 5KB3A 3T94A 2QSUA 2OXFA 4M7WA 2AI3A 3UAVA 1Z36A 2RJ3A 3DPSA 1YQQA 3KVVA 1Q1GA 1T0UA 1Y1QA 4TTIA 2AI2A 5K1ZA 4JWTA 3GGSA 1T8RA 4ECEA 3NBQA 3LBAA 4LZWA 4G8JA 1Z5PA 3FWPA 3GB9A 1V45E 1XE3A 3BJEA 1ODIA 1JDUA 5I3CA 2A0YA 5CYGA 3BSFA 1VFNA 1ECPA 2QTGA 1OU4A 1CG6A 2IQ5A 3OCCA 1Y6QA 4I2VA 4BMXA 5F7ZA 5F77A 2HSWA 2P4SA 1TD1A 4G41A 3OF3A 3E9ZA 5DK6A 1M73E 3C74A 1ULAA 4DA8A 3LGSA 1Y1RA 5FAKA 2H8GA 3OZEA 4OGLA 5CXQA 5B7GA 1WTAA 3IOMA 4F3CA 4TXJA 4GLFA 1VHWA 1A9SA 4UC0A 4DABA 1U1EA 3INYA 4RJ2A 4U2KA 4LNAA 4M1EA 4YJKA 3D1VA 2XRFA 4LDNA 1JP7A 2QPLA 1Z35A 4D8XA 1PR6A 3BGSA 2ISCA 1Z5OA 3OZBA 1VMKA 1K3FA 5B7PA 5CCDA 3FB1A 1U1DA 2A0XA 4WKCA 1NW4A 1PK7A 4GKAA 5B7NA 3ONVA 1TCUA 1RXSA 1PR0A 1YBFA 4MCIA 1Y6RA 5CYFA 1PW7A 1Z33A 4DANA 5F76A 5C80A 1LVUA 5F7XA 4EARA 4TS3A 4YO8A 3IEXA 3QPBA 3KUKA 4G89A 3UAXA 1C3XA 4H1TA 4GMHA 5B7QA 3EMVA 2HN9A 1FXUA 4DAOA 4R31A 1LX7A 4QARA 1LV8A 1JE1A 1PBNA 1A9TA 4PNPA 1NC1A 2AI1A 1I80A 4D9HA 5ETJA 2I8AA 1Z5NA 2OC4A 3F8WA 2HRDA 4DA7A 4TYMA 3K8OE 2A8YA 4TXMA 1N3IA 4JP5A 4OEHA 2QTTA 4DARA 1U1GA 1JDZA 3O6VA 4WKNA 1TGYA 1A9PA 3FUCA 5CCEA 2B94A 5EFOA 1JE0A 4R2WA 4OY3A 4TTJA 4D8YA 3KVRA 4L5CA 3K8QA 1B8NA 4F1WA 5F7JA 3KVYA 4MARA 1PK9A 3DJFA 3PNPA 1OTXA 2Q7OE 1T8YA 3ENZA 1JDTA 4LKRA 4DA6A 2ON6A 3E9RA 1PF7E 4YNBA 3OZDA 1CB0A 3NM4A 1SD2A 5IU6A 3EUEA 3OZCA 1RFGE 4L6IA 1T8SA 4QATA 2OECA 3FAZA 3E0QA 4PR3A 1RT9A 4D8VA 2QDKA 4NSNA 4OJTA 1Z34A 4D98A 4TXHA 3MMSA 4WKBA 3PHCA 3LA8A 1A9RA 2PGAA 4BMZA 1PKEA 1JYSA 1ODLA 1U1CA 1SQ6A 5CXSA 1V2HE 1A9QA 3UAWA 2OC9A 4WKOA 4WKPA 1Z39A 1A69A 2BSXA 3OPVA 1K27A 1G2OA 1SD1A 2GUWA 3PNSA 1T8WA 1YR3A 3DDOA 1PR4A 4MCHA 4NS1A 1OUMA 1Y1TA 1RXUA 1Z37A 1V4NA 3ODGA 1Z38A 4E1VA 1YRYE 3P0EA 3DF9A 4GLJA 1A9OA 1V48A 1VHJA 2A0WA 1JDSA 4QASA 3O4VA 4OGKA 1RXCA 4QFBA 1NC3A 1PR1A 1RXYA 4TS9A 3EUFA 5EPUA 4P54A 3FNQA 1ZOSA 1OTYA 4NY1A
chains in the Genus database with same CATH superfamily
2W6JA 1XIVA 3MJSA 5JDIC 5GVRA 1DQSA 2X1MA 3SI7A 2GBGA 4RK7A 5BVHB 3UIEA 3A6ZA 2OBFA 3C70A 1OLXB 2J7PD 3WLOA 4E5MA 3IIKA 4M7PA 3W9SA 1IXKA 1EWTA 4F91B 3PHJA 4I1PA 4L9AA 4X20A 4YIHA 4IDCA 3NJRA 3KPUA 1BA3A 1ZJ4A 1G59A 1T25A 4DJEC 2WKRA 1YK1A 3LQRA 4LQCA 4UDXX 5K3AA 3TZ6A 1VPDA 2VQ3A 3PCXA 3D0RA 3AKDA 1OXVA 3LXXA 2UYHA 2WSIA 4DEXA 4HXYA 4NESA 3T5CA 4CQMD 4F5YA 4QLOA 4P5DA 3P96A 3AIOA 1LK5A 2IX9A 3NDRA 2YHBA 4ZZ3A 1ONBA 1I9CA 2P5TB 1N8NA 3G9QA 4L8FA 3DO8A 2I6QA 4BLOA 1MU0A 4JEMA 4PQEA 5DDIP 3WYNA 4DR7B 1Q2UA 2VQEB 1PS0A 2X0IA 4MRVA 4P4UA 2W2XA 2FCRA 3FX2A 3T7CA 5AW5A 3SE7A 5JZBA 3W2IA 3GMTA 1LWOA 5CA0B 3BXXA 4D8TA 1A9XB 1C3VA 2QE7A 3DFMA 1IM2A 4NPHA 1MHTA 1F14A 1RRVA 1GV1A 2O0LA 4PPNA 3UT6A 3USCS 3PZRA 4H0NA 2R87A 1E9EA 3SC2A 3DDZX 3PC4A 4S1PA 1IL0A 3HKDA 3LBHA 1FX0A 2DZDA 1C50A 3MK31 4OVKA 1Q22A 2BKEA 2IZ5A 3F7MA 4QLAA 2C59A 2PV0A 3D4PA 3FHCB 5B3KA 3GJ5A 3U39A 4BVEA 2YHUA 1PBTA 2FPUA 1SRRA 3PNYA 3O2QB 4EAAA 1CX9B 1KSGA 3E9QA 3ZLUA 1GUDA 2FEPA 2NSYA 3A70A 4NHOA 1ZL2A 4F9TA 2AA3A 3V8VA 4BVHA 4Q03A 3LIIA 4AN0A 1RKQA 3IVMA 3UTDA 1J8MF 2XNDD 4LEIA 1EFLA 2P41A 4M0CA 5EUQB 5GJVC 4BAGA 1X3LA 2YCBA 3GEHA 1Z0JA 1A5SB 1GGJA 2VWGA 2XHEA 3CC8A 3QU5A 4GWKA 3C6QA 3THWA 3P71T 2IZ0A 1ES9A 1Z7BA 1J2RA 4N3BA 1UK7A 1SBHA 4Y9RA 5JYBA 3OLVA 2OHOA 4C78A 4E7OA 4DLTA 5BRJA 3AI1A 1QOPB 1WXEA 3C15C 2X9QA 4RFSB 1ODKA 2YINC 5K3FA 2BISA 4YHHB 4PC3A 4PQGA 5JPCA 1YASA 3H16A 3ZDYB 2HEGA 5JCJD 3C6MA 1BGXT 1E5VA 4KG7A 3H4VA 1YQXA 4UD2A 4QECA 2WVJA 3UV7A 2C07A 2C1EA 2O23A 4H60A 2OXFA 4JL5A 3TRKA 10MHA 3UUEA 5GGYA 4BQSA 1U4NA 4A36A 4W9NC 1XWIA 3PX2A 3IL2A 2VLBA 3K1TA 1XN4A 1VDMA 2RJ3A 1ZOIA 3JQEA 2WYUA 1GPKA 3O47A 3SC6A 1NNSA 3SX2A 4FMCB 3NIFB 2Q3LA 4G0ZA 3PJRA 1DAFA 1E62A 2ORVA 5BWMA 5JE8A 3T9EA 4X7RA 1H42A 3CLTC 4G1UC 1J23A 4DCVA 2LDBA 4Q7EA 1XKXA 3C7DB 1S7GA 3O3NB 2V96A 3T7JA 4HAIA 4YRNA 4WZAA 2E48A 1FS6A 4OX9Y 3EXAA 2OL4A 2VTVA 2JGMA 3NTRA 3REGA 3TLMA 1I5RA 4NBKA 5JNRA 2IX3A 1RQLA 1T3SA 3K9FC 1LI4A 2RHRA 4QL3A 1WMSA 1XHFA 1UKZA 3PUIA 4L57A 2P0AA 5JHHB 3PA6A 7ADHA 5CDFA 5KWJA 4W5NA 1UEIA 4EHBA 1HYHA 2GEVA 5EERA 2XUAA 3LSYA 4AJ4A 3G8BA 1UBJS 2X8WA 4KO8A 2BKLA 3HZRA 1DJPA 3FTPA 3G8AA 4IRMA 1QU2A 3DGEC 3IPLA 3F5QA 4L8LA 3GPDG 3R7DA 1P9NA 4H6XA 5C1DA 1RXWA 3E9NA 5LVAA 1FXWF 3U3JA 3AHDA 1ADYA 3D02A 3UHAA 3WP0A 4XWAA 4I6GA 2QTMA 1H5QA 3LW7A 3IPYA 4IXTA 2IY9A 4QDZA 2PG3A 1RIFA 4DR5B 2W0MA 1FXWA 1PZMA 1Z0DA 2AQKA 1CJVC 2QQ0A 2G4CA 5F7ZA 3S5UA 4DXDA 1NQVA 2YWHA 2AMVA 1AG9A 3GWZA 4I50A 2ROQA 4ZCTA 5JNLA 1GZSA 4JGBA 2P78A 4M6WB 3HMKA 3ROPA 3TSWA 1VHQA 1I7LA 4DTIA 5HWSA 3AT1A 1Q5PA 1XDDA 1ID1A 1KIFA 4K9RA 1YI8A 4AY4A 5I7FA 2PKQP 2PKCA 3PFWO 3QIAA 3QU2A 5D6OA 2QRMA 3BICA 4MIOA 4X60A 3O8LA 3PUKA 2IITA 3VC3A 1H6CA 2IOFK 3P2IA 3HC7A 4EJ2A 3AYZB 4IRXA 1KEEA 1MRNA 2J31A 5HQ3B 4QOGA 1G5TA 5HZGA 2OFFA 4Y6LA 4KUEA 5BNFA 2W2KA 5C7LO 3GLHE 4EFLA 1Y7PA 3FPSA 1Y1RA 1TB4A 4JP8A 4OSOA 1GQSA 3WC4A 3ADDA 5JECA 1I24A 3F7TA 4KX5A 1B4DA 4GH5A 4F4IA 2SCUB 4CLOA 2PUDA 2V6MA 1U8TA 1ULZA 2AFIA 2Q1SA 2MR5A 4N03A 1JG4A 4JB2A 1V8FA 3A2MA 2OBBA 2IU4A 1WTAA 4HUJA 1MQ8B 5LP6C 3FTNA 3I04M 4ZQEA 2ID4A 3LNTA 2VCEA 1QVAA 3EEOA 3G0HA 1X94A 2FXVA 2QPTA 3GG2A 5LZ5A 2EF0A 4IDDA 2H1RA 4DBLC 1N2SA 1N6PA 4R8LA 5I47A 2QUIA 4IV5A 4LRYA 4N7BA 4F1JA 1Q6YA 2FA9A 3WKCA 2JPDA 2JGDB 1G9TA 3S81A 3O90A 1KI7A 3HR7A 4DIBA 2QTVB 3BMOA 2TRSB 4XXHA 3INYA 3AUAA 2RGUA 1H9BA 3QVMA 4CF4A 5AKYA 3DZIA 2JIMA 2JLAA 2VDPB 1TYAE 3ID6C 4YP9A 3QHPA 4XQGA 2PX2A 2R96A 2O8DB 3PD0A 4WSOA 3P97A 1X38A 1JEAA 5KYKA 2F3SA 3B60A 1XMIA 3FJ1A 3PNLA 4PX9A 4D8XA 4GR9A 5HF5A 4EZBA 4BLTA 2DHRA 1EWQA 5TJ9A 1ISMA 1QIHA 2WLTA 2MSCB 1NL3A 5B6JA 4PV7A 2I1VB 3OZBA 3H3JA 4UTXA 3DE6X 4N54A 4S0ZA 1KFEB 1Y7TA 3GT7A 2UZ3A 2N46A 3BWYA 3N2EA 2VDQB 2HSJA 3PF9A 4MPJA 4PSUA 4C4ZA 4NOLA 3SP1A 3O9MA 5A1JA 2P6UA 3CISA 1NJ5A 1Q95A 2XUDA 2C95A 3E81A 3VM6A 3HM9A 4Y6RA 2E5LB 1SHLA 1GILA 1VL0A 3GAMA 1UC4B 3GW8A 3LJKA 4FMDF 4RHUA 4Z9AA 4OGGA 3KK0A 1V39A 3RC3A 5JY1A 2OOSA 1UOEA 3C7TA 4GM0A 1SXJA 1YZTA 1MB3A 5HXAA 4QNMA 2GD1O 4UM9B 2GBLA 3FCXA 2QY6A 1RLIA 2HC9A 1HKUA 1RYEA 1U0EA 1XXHE 2AS0A 2D13A 5AYVA 2IDKA 3RVQA 2DTXA 1MLDA 1X80B 5J4VA 2JHFA 3EZGA 3ZY5A 3JR3A 1P3DA 2ZE7A 5KHLB 3JR7A 2AYYA 5EYPA 4PVCA 2DBYA 2MSDB 1V43A 3ZCUA 3FIUA 3MJ4A 1RS0A 2BEWA 4LVNA 1GZDA 3THOA 3O4IA 4AJKA 1Q1QA 1FDSA 1TMYA 3WLTA 1M2KA 2JLBA 5JAQA 1R0CA 1GVHA 3DOJA 1KZ7B 4I8DA 1QVWA 4S0XA 2ZBPA 2VRNA 5CLFA 5ADHA 4XFJA 2FW0A 3VJMA 2VKQA 2CEAA 3TYXA 2ZSHA 3EMVA 2EDCA 1I0IA 3GNQA 4LY6A 4OAQA 2VPQA 2BFAA 4JITA 3VU8A 1RC8A 3HWWA 4QPNA 5BV2P 1G66A 4HNQA 4MYHA 1B15A 3IVXA 1HDRA 3CWCA 2I54A 2X7HA 3QTTA 4N3AA 2B1GA 3H3XA 3ORQA 1L7BA 1K5GA 1QH9A 1VB3A 4K9KA 3C1OA 1JEQA 1NUTA 1OXXK 1OBVA 4RDIA 1RMQA 4RX1A 1QF6A 4K86A 3DZFA 2C98A 3F1KA 4IYJA 4G26A 2X23A 3L8EA 3G89A 4LWZA 5F52A 4XARA 5JSFA 3DXZA 4NK5A 3I5AA 3TL3A 5CB0A 5I9BA 3O8QA 3PFKA 2DFDA 3JQ8B 4O4HA 3R6DA 3UK0A 3TKAA 1WSBA 3T3DA 2EBWA 3A26A 1SKYB 3W3AD 4NV1A 1H05A 3BMQA 4Y1RB 3GFVA 2Z4RA 1T1IA 1G5IA 2YZKA 3TVYA 4ERXA 3MYYA 4EL0A 5JWOA 5G0SA 4PAMA 4EI2A 1JYEA 3U56A 3SIXA 3EEBA 4Y9SA 2HA5A 2Q1WA 2WSSD 4YXWA 3UCXA 4A7PA 3WSWA 2B2CA 3CJRA 2ZJ6A 3DDHA 1ZIPA 4MIYA 1TZCA 3K8QA 1XDWA 5C0OE 3LHSA 3MGGA 1JU3A 3R23A 3RBVA 5DM2A 1W0JA 3ZOZA 2BGJA 1YS6A 3HFGA 1XLVA 4J4TA 3A28A 1L5WA 1ZFNA 3CB4A 1YBMA 3ZW8A 4QKQA 1E2LA 4W9RA 2XZOA 4EL5A 4QM7A 1CYDA 3PUVA 4KPUA 4CL8A 3NLLA 2HI0A 5JRJA 4A8HA 1KP3A 3LFTA 3LDFA 5CH5A 2EL9A 3BB3A 3O8CA 1TOAA 3PD7A 3R0XA 1ZR2A 2OORC 5BN3A 3C8HA 3OPYB 3J7AC 1DJLA 2ZI4A 3PLNA 1UJ4A 3WE7A 4E6EA 2CFOA 1OX4A 1UDAA 2C8VA 4WINA 3ZQJA 1PQ4A 2OCLA 2P7HA 2PGNA 2C20A 3E5MA 4ZI2A 2JJ2A 2ONJA 2I6TA 4Q00A 4AN4A 1TQHA 4J07A 5J58A 3KVOA 1K98A 1EHCA 1O8CA 3ST7A 4LJSA 2OUKA 4M0KA 1QAQA 1E1RA 3IQGX 4EA7A 1QG4A 2VPXA 2BJWA 3CGWA 4PHFA 2Z9BA 3UG6A 3W2TA 4DN6A 5IU6A 1K7CA 2JLXA 2G3YA 5ESRA 1DBQA 1WUYA 1NQWA 4KKXB 4G0XA 3TIFA 3TNFA 3MOGA 1RJDA 2I03A 4YAGA 4JXKA 2QXYA 3TQCA 4ZHSA 3P9SA 4XQCA 3AL3A 1G291 2YHAA 3L6RA 3X2SA 2CNDA 3AV0B 1EVIA 1W25A 1RT9A 4XX1A 3DKPA 4UCXA 5ELMA 4UD6A 2GPSA 2CJPA 1XVIA 3WZLA 2DWOA 4NZMA 2BPOA 2EQAA 2B0JA 3S5JA 1V35A 2CL0X 2MSNA 1I30A 3MMSA 5HQJA 1Z0FA 3L9WA 3R2JA 3RTEA 4NZZA 2X8JA 3VH3A 1RD4A 4WCFC 1KZHA 4TWZA 3ZKAA 2HQSA 2IOHA 5TXGA 3SVLA 3RSLA 4MWOA 1ZZEA 1DDIA 4OUDB 3PGKA 5D5HA 1SNYA 3OEWA 4MCAA 4ZJZA 2FVXA 3CO0S 3RV3A 4OYHA 2W8BA 4C08A 3AOGA 3KKZA 4XLTA 3GA5A 5L53A 3QF4A 3WJ2A 4CMCA 3BXPA 4CM5A 3L05A 1K4YA 4WWHA 3SKVA 3BMXA 3N87A 1M67A 1LFAA 1V1MA 3G3EA 1WIWA 1SKAA 4M4SA 3DLPX 3P4UA 4CKBA 2CWWA 4DLSA 2PGJA 4TSFD 3LGXA 4MRPA 3KXIA 3LWZA 3QEJA 3M6AA 5JS8A 1NTOA 1UKYA 1GNTA 1VIMA 2H1FA 1XJ0A 4LZAA 2GZRA 4OQFA 4RY0A 4ZO9A 1BX1A 1QLJA 4UUMA 4EENA 4JMPA 4TLMB 2VEDA 5CT6A 5H8WA 1CF9A 3G5AA 1ZS9A 2FLWA 4EUKA 2VF8A 1UKAA 4LVOA 2P69A 3MWDB 4RLFA 3VU3A 5CB6A 3ESZA 5D3ZA 4QTYA 5K0ZA 2YHIA 2KB0A 1U2EA 4KNWA 4EQZA 2REOA 2XVZA 3DYVA 4J1TA 2DHCA 1C5KA 3U31A 2O8EA 4POOA 4BO1A 3UHJA 4B4WA 3PNKA 4ZO7A 1PZEA 1RKBA 4GOLD 1Z28A 1HSOA 1WBJB 1EK2A 2Q3FA 4HGPA 1T3TA 1PG5A 5LYJB 1G38A 5BQ5A 1WD7A 3LY7A 2EX0A 4J49A 3S44A 3W8EA 1Z38A 1G7CA 1NR5A 2C2GA 5F3RA 1UFOA 3EIXA 13PKA 1BFUA 4LVCA 5EMHA 2X5KO 1YUMA 2AKYA 2YN2A 4TTRA 1Y98A 4NKRA 3HXOA 1TQ6A 1YIAA 3Q3CA 3HWRA 1Q1NA 1XPUA 2E4XA 1GNVA 3B2NA 2B4KA 3OJLA 4CG1A 5IRCD 1US8B 4RAOA 4C0JA 2GD0A 4R05A 4EG0A 4MGIR 3DLAA 5AHOA 4OREX 3DV2A 3FNFA 2XNJA 3MLEA 2DUMA 1KGSA 3KTAA 4Q3LA 1L7DA 1BTOA 1CZHA 1U1IA 1G1AA 2ZIEA 5K6TA 2ZGVA 5JADA 3FDJA 3A6KA 4PZPA 4UBJA 4JLAA 3L43A 2JFXA 5AJYA 4C0KA 3TTTA 2AF4C 1Z18A 2RAUA 2W4IA 2Q1YA 2V5VA 3NTXA 1CZLA 5DRTA 1Z26A 5EIFA 2Z9DA 1SUBA 1RKXA 3KZKA 1RJFA 4L85A 3L1UA 4P83A 3ZDQA 4EPYA 3LQFA 4DR1B 2AH5A 4E12A 1Z74A 2N1MA 5JANA 4JJ4A 4I1YA 3WL4A 3AJRA 5HJ5A 2X3FA 4LPKA 3U40A 2BELA 3DVAA 5MFPA 5HKAA 3IESA 2OCYC 1FJGB 1O0BA 1N2OA 2VR1A 1KY2A 1YZKA 5G41A 5LU9A 2O1WA 4Y9UA 3EB9A 3M6VA 2HH9A 4ZQGA 1FS5A 1RAAA 2ESRA 1GEEA 3AFIA 3D8BA 3V33A 3VR2A 1EP3B 4CEHB 4E1BA 2IOQA 2Q49A 2XYRA 4KXQA 3RGGA 5I7VA 1NUHA 1S8OA 5F4ZA 3TQSA 2ZYRA 3UAOA 4IJUA 2HLDA 5H7XA 1JXAA 3HKCA 3R75A 2FPIA 3CZMA 3P45A 2VCYA 3B7WA 3FUVA 2B9VA 3IR5A 3FUUA 1NR1A 2C0CA 1YKSA 1WVIA 3VVMA 4KR6A 1KXJA 2CXPA 3I34X 3IPRA 5THKA 1KE1A 1SU4A 1UQUA 2QORA 3FZQA 2D2IA 2DVMA 4I1OA 4B4OA 1L1QA 5IT5A 4MDEA 2XKJE 4WH0A 5GMOA 5ILQA 5B1EA 2J0EA 5KYGA 1YTUA 5JV5A 3O95A 1TMOA 3LKDA 1NF9A 2P2ZA 4CTKA 4QO7A 1TO2E 4OQMA 1TF2A 3HYTA 2NU9B 3V4LA 1OFGA 1DRKA 1KOFA 2GKGA 5DZSA 4B81A 1P2VA 3VR5D 1SCQA 1B0AA 3V2HA 1Z3CA 1DX4A 4PCUA 1TLTA 2HV9A 5GY7A 3QKRA 2PXAA 4RDCA 4R9VA 1BZYA 1UP4A 2JHGA 2XTAA 3WRYC 1SUPA 2XVMA 3EIEA 5AUNB 4YRZA 3DXYA 2ZWPA 3C5VA 4B6EA 1BKYA 2W00A 3DTVD 1EFTA 5DCYA 3IJRA 3LU1A 3F1LA 5DNVA 4B3TB 1P5FA 3GMIA 5TR9A 3ZQ4A 3QX9A 1NMEA 5J3JA 4M55A 1RZRA 3PDIA 1O1YA 3RD5A 3ZJUA 1F0KA 1K89A 3KQYA 4CM8A 5JNVA 1EXVA 3U6BA 3L4EA 1W4BA 4JBWA 4Z53A 4TV9B 1ID8A 2RHOA 3OZAA 2VT2A 3PC8C 4R9SA 4RANA 5GOZA 9MHTA 3L46A 4ZOLA 5TQ0B 3V42A 1PAUA 3T5BA 4WCFB 4NZOA 3GV0A 2F43B 4LC1A 5T57A 2QKYA 3R4VA 3FSGA 4FEAA 2V03A 2ZIFA 2XMCA 2HJWA 4L07A 3RAPR 2C3YA 4ZMRA 3GBPA 2Y76A 4CL0A 2YASA 3FTEA 3RG2A 1XTIA 4JJ8A 4E11A 1QDEA 1R74A 2ZBGA 4QGSA 2JLZA 2R48A 3W4IA 3LUAA 4RETA 1QE5A 4RZHA 1D2EA 3ZLTA 1I1QB 4OQYA 2JATA 1XZLA 4W6QA 1KI6B 3T41A 5BN5B 1U6JA 1NW5A 1BDBA 2W22A 2FDCA 2L69A 1MA3A 3Q11A 1CY6A 4DXAA 3UAVA 1QYWA 1DUVG 2WUWE 3CH6A 1FE8A 4J9UE 1XZBA 4X6UA 1KPHA 3GLGB 2PZJA 5F3WB 1C3OA 2XEXA 3DPSA 5AUPB 5LBTA 1NXVA 1W36C 4DZZA 3D3WB 1G7TA 4RKYA 2P0YA 2PWBA 1ZHFA 1SHUX 2R8EA 2WICA 3KNZA 5E1BA 4C4OA 3QOWA 2CBXA 1AU9A 1SRQA 2BFCB 1X7HA 4W8GA 4MQBA 5DBIA 3CT6A 3LFUA 4UBKA 5JCPA 3WISA 1TYDE 3L9XA 1YIOA 2R9VA 3N05A 1Q0UA 4OHFA 2B7CA 3TIGA 1QFZA 4U6SA 2DPMA 4KXMA 4A0QA 4CG3A 4G0VA 3MIIA 1X7ZB 1OGYA 3I5YA 3DBRB 4U7JA 4A4DA 3ORSA 3VR1A 2I1LA 4GYYA 4G1BA 4OBXA 5C7YA 4QT0A 4TV9F 3VNBA 1P4SA 1E7WA 1YVEI 4MRRA 3ZUGA 2GYVA 3MBIA 2XIQA 2G9QA 3EA4A 2Z3WA 3ROZA 1U9IC 3S7TA 4C3ZA 4N76A 2XZTA 1EZZA 2CBGA 3NONA 4NAHA 4D96A 1BDHA 4Q9KA 1TVCA 4HGZA 1F8UA 1AGNA 1AKTA 4PSCA 4R98A 5DLPA 5JZVA 1CJSA 1TQDA 2OY0A 1TYZA 1ORWA 1CG6A 3RYIB 1P1IA 3W5BA 1K06A 2AMYA 3LUCA 1R4AA 1S6YA 4ZK2A 3CUWA 1A2OA 2C82A 2DH6A 1NVBA 2VJOA 3RU9A 1W1IA 2L0XA 1P91A 3OF3A 1FVOA 4XKJA 3E27A 4JIMA 2BFBA 2WWHA 4DQXA 4ZI7A 3GJ7A 5AVTA 5ALNA 1S3IA 1M6WA 3KKOA 4RCYA 3IULA 4TUYA 4IHJA 1TJ4A 4GMKA 4MYTA 1KC3A 5CRIA 2I7XA 2A5DA 1X74A 4E2WA 1AA9A 1NMSA 5C5DA 3MNFA 2YXNA 1N9ZA 1THMA 1I3NA 2Y0EA 3AV3A 4INZA 3ZDFA 3EGWA 1TW2A 4K1LA 4D0RA 1AQUA 3SIPA 1Z06A 1DAPA 1Q0LA 2ZYIA 4O02B 5D3MA 4N6NA 4PRKA 5DCUA 4DIDA 3WYFA 3DMPA 4TMVA 1RWPA 2REQA 1IDN1 2PGOA 3AESA 3KCNA 2WF7A 4YDHB 5EHGA 4D9NA 4ZCRA 2CVFA 4FEEA 2Y1FA 5KOHA 4CQLA 5ENDA 4F2HA 3VYSB 4DSTA 5ALVA 4QOSA 1AK1A 3FKSD 3VAAA 3X1DA 4U5QA 1R9GA 4Z4HA 2R6GA 3FDXA 4YQFA 4DNPA 4FIDA 4U00A 4I5EA 4C6TB 4JNKA 3OAAD 1J5EB 4RQUA 2PLRA 2ZTSA 2AV6A 2CVQA 3ULKA 4JLJA 3DKKA 4GQBA 3HCBA 3U3RA 5CFZA 1GPBA 2MYNA 4XVHA 4YDQA 2CUZA 2P5UA 4OUKX 3ETHA 3JQPA 3QE9Y 3FTDA 4R41A 2Q0QA 2AZDA 4IJMA 4A82A 4L2IB 3QOXA 3TGLA 1KFBB 3QLVA 4HRVA 5ALPA 5I9SA 3B3FA 3STVA 5C3MA 3MGAA 3V4ZA 4K28A 2PQ2A 2XJ4A 3R6TA 4IMRA 2JLCA 5ERXA 3IOEA 2AE1A 3V1TC 3MCWA 1BDIA 1ADBA 4JP3A 5LCXA 2ZE5A 1OIXA 1PJCA 3DZDA 3CKKA 3IVGA 3JSXA 4OBBA 4DILA 1NVGA 4PO8A 2RHLA 3WGYA 4JI1B 2VL7A 4OAPA 5DGCA 4J0QA 3AVWA 5KEIA 3CA8A 4FNGA 3OZIA 4R7TA 4Q9LA 4E15A 3D9QX 3H2YA 2VZLA 5IJ9A 1TM4E 3LUKA 3W9UA 3FUWA 1TJNA 3AHJA 1ZGCA 3HKEB 5CB4F 1TZJA 4Y1GA 4F04A 4N7JA 4Q7KA 3ZGYA 3TZCA 2ERXA 1YONA 1HDXA 2PKXA 1W4AA 1Q92A 3B82A 2HJGA 1JG2A 4NJEA 4C88A 1SXPA 2RKWA 1I0LA 4US2R 1E3LA 2X8BA 4PBSA 2IDMA 4JN6B 2ZAOA 3KB2A 4UDNA 5LYJF 1ST2A 4S3MA 1ADCA 5E9AA 5JAZA 3FOBA 3JQQA 2NTNA 1AS0A 4NC9A 8GPBA 1AB6A 3M70A 3BIJA 3H8SA 1OH7A 2XWSA 3UJAA 3ZEAA 5CA1F 3ZNPA 3HACA 2DCMA 3PYMA 2DQYA 3MF4A 1XZMA 1Y80A 4PYKA 1QIIA 1T3ZA 4WXRA 2GTIA 2C9DA 4HQFA 4WAUA 3KDAA 3QX3A 3A6FA 3NYWA 2JFBA 4ZGGA 2DR3A 4R2JA 1NXWA 1EP1B 3VVCA 2NXCA 3NCTA 1V11A 3BD6A 1EWRA 4IF4A 5HK8A 5BSGA 1GQFA 3KKPA 3UJ7A 1Y3DE 3HVJA 1CY2A 4TKLA 5F64A 4NCXA 4JLBA 1JU4A 4LXGA 1I6WA 5BQFA 4RAQA 3H5AA 4D41A 2IEZA 1TKCA 5AVKA 3GXBA 1SVKA 2P5YA 2P9HA 2WB2A 1OT5A 4PZYA 5FTNA 4AG5A 1ONNA 3ZV5A 1SIUA 2IPMA 2IYWA 1EU1A 3TAHA 1YXMA 3NFYA 4I36A 4DV4B 1EB8A 2FE1A 4FW8A 4F9EA 2VBCA 3I6IA 3QMPA 3QYPA 1CQJB 1UBMS 2ZU6A 4BTVA 2QSYA 3GT3A 4QDKA 2A1TS 4LXTA 1KQ3A 4P2BA 3HJFA 2J3KA 4EEXA 2GCOB 4ZYXA 3IPXA 4N0MA 3R8XA 5A02A 3D8RA 1XU4A 3A6DA 1Q3KA 1WXQA 1A2BA 5JZSA 1PV1A 3E3MA 3O26A 3R44A 4CEJB 2N3ZA 4P2GA 2ZJ4A 3LLVA 1KDYA 1GOTA 5DMXA 5FWXA 1PQUA 2R86A 5DNDA 2Q6KA 2ZCUA 5E6RA 4ENPA 1VCIA 3BE8A 1FDIA 1BHQ1 1VJDA 4HDQB 1QRDA 4J7XA 1HSZA 2XGMA 4BNDB 4JYMA 3RI3A 1W9MA 4EZIA 1IQUA 4KXLA 2V97A 4XVCA 2C77A 3KWFA 1KEWA 4RTJA 4P0PB 3KVRA 3VR4H 5EMNA 4BNTA 4LV6A 4CTMA 1QZUA 1B7GO 1KJ9A 2HU7A 3S27A 1FYVA 4BXOB 3A4YA 3TOZA 2JAWA 2WBLC 4ZRNA 4BO4A 5JS6A 4TKUA 2I4RA 4L4XA 3JASB 3QLJA 4NBSA 1RNLA 4AX4A 3E84A 4KR2A 3SS7X 1HGXA 2PJZA 2C7VA 2GTPA 4KOEC 4NQZA 5DTIA 1NXTA 3IP3A 1DXQA 1NW7A 1OLXA 3E9YA 4YACA 5KYXB 1PJBA 1LSSA 3KB6A 4E5UA 3UWPA 1OWLA 1FOEB 2B2XA 1EUCB 2GBPA 3FZEA 3MELA 4IVRA 4PGFA 4R6XA 1D8AA 3BIWA 1PEYA 2Z43A 3WXBA 1HDGO 1JHAA 3TIIA 1A8QA 2JCSA 4FFBA 4LK2A 4B3BA 4ENTA 3OTOB 2G04A 3B9PA 3BL5A 4CTJA 1FVFA 2FB9A 3OZDA 4X63A 3MC1A 1BAPA 1WQ4A 2X0KA 4HEJA 5M7EA 4H7IA 1AQNA 3UXHA 3QXGA 4EQ6B 2AG6A 3GHYA 3CEAA 5AK0A 3PTAA 2CDAA 3ZDEA 4DIKA 2BI4A 2Q4BA 2DFLA 2H2IA 2OECA 1FMFA 2VJYA 3CM0A 2HHHB 3V7NA 4CDGA 4DCNA 1E7YA 1A4RA 4YJFB 3WB9A 5CA0F 4CIWA 2IEDA 3HABA 2I62A 1NVTA 4LDJA 3PPIA 1XOIA 1E5XA 3F97A 2D00A 3CY6A 3ZC3A 1GRVA 1VDZA 1VL5A 3BGVA 4YRTA 3U7GA 3L40A 4P34A 3L8CA 1Z34A 2HCFA 5CA0A 2VBFA 2IVFA 2GBIA 3AHIA 1Q7RA 3ABQB 2OWEA 4FCTA 2OCDA 1JG6A 2P91A 1UFVA 3IQFA 4NU8X 4WKBA 3K2IA 4D5GA 4V0KA 1L5FA 3SC2B 1AKNA 2Y68A 3DV0A 4FSXA 1UFRA 3NOVA 4C14A 4CKZA 4M9CA 4BMOB 2XAUA 1ZM9A 3WA7A 1RI4A 3CS3A 2Q0SA 2O7SA 3LT2A 5DIFA 4ZQIA 3A1NA 4QJ3A 5BQ3A 2Z2JA 2EBUA 2O3SA 4UMEA 5G1OA 3RVKA 2Y1XA 2Y0BA 3AP1A 2WF5A 3CIOA 3ENWA 4IHAA 2PH3A 3RE1A 2Z5FA 2V5AA 5B3JC 3W2HA 1A2KC 2ZXEA 2NVBA 4P82A 3C3BA 3CLUC 3LL7A 2I87A 1Q91A 1EX7A 3L4BA 3OIGA 4QOEA 4XB1A 5L3QA 3TB4A 3L4SO 1XCGB 2BHSA 2MT9A 3KOWA 3FYSA 3SZGA 5EJ4A 1RXIA 1CKEA 1CY0A 3K0CC 3WDMA 4AJ1A 4C7BA 4Z4FA 4YAFA 1RTTA 4B75A 1E3WB 3OIDA 4FP9A 2OE2A 1F2UA 2IYYA 2O20A 4WKOA 3N0RA 3T0GA 2WTUA 1WU8A 4H7DA 3E3LA 5I7HA 1N0HA 1GUAA 2VNIA 2PRYA 4RGYA 4WTOA 3WFZA 2ACWA 2A9RA 2R47A 1HUQA 3D6AA 4J9VA 2ZT6A 2ERCA 2QRKA 2OCKA 2V7UA 2I29A 2Z2ZA 4LBZA 3CZCA 2PZGA 4OMUA 4XSHA 1GFIA 3BWDD 1G8MA 4TZTA 3BA1A 1C8VB 3CFYA 1VCMA 1Z37A 2A92A 3CLSC 2BMDA 1BS2A 5EWMA 3ROXA 2PL3A 3PE3A 4X95A 3HBAA 3M5DA 4O2AF 3N59A 1Q1AA 2R5WA 3PXXA 2BMFA 3B5IA 3RYCA 4F4JA 1M8FA 1QC5A 1T9CA 4FYIA 4WNAA 3SEZA 4NCBA 5HZHA 2VTEA 3BULA 5A0FA 5KSPA 3AG6A 3G82C 4HEQA 4PAOA 3ZE1B 4PONA 1AZLA 3FPLA 3K0HA 2PD4A 5AW1A 1UZNA 1WB5A 5CM8B 2C57A 4ER6A 1Y0BA 4MKZA 5ILOA 2LKDA 2JCBA 1F6BA 3MS4A 3WNBA 1PKXA 1GDTA 1P6UA 4XWWA 2XMZA 2Q3HA 4PLFA 4QFBA 5DFAA 1HQYE 3BX1A 3HFJA 4CF7A 3L0DA 4GIBA 2JFPA 3TL2A 4ZVMA 7YASA 4LJ8A 2BBWA 4AFNA 3TR5A 5PGMA 1V7PC 3F6SA 1XPOA 1K0FA 2GWHA 3NRBA 1M8GA 2E4ZA 2HA0A 4G5RA 4Q05A 1VPEA 1G5PA 2ZI9A 4O4JA 1TT5B 3ZV3A 5K0GA 1ZOSA 2WUFA 4CU2A 1W6RA 5IAOA 1KMNA 1YOVA 3FPFA 1UK8A 2QUHA 1PL6A 2HHLA 1NF3A 3HNRA 3W5UA 1P44A 1BOOA 1JLLA 2P0EA 1NXXA 2J5BA 2WTMA 2HA7A 2WUGA 1D04A 1MV8A 2NTYC 4DOMA 4HGRA 1F5NA 2H92A 2HA2A 4BFXA 1L9KA 1QIJA 1WO8A 1Y8CA 3KSZO 4AD8A 1NVXQ 1NLMA 1FTGA 3UBMA 2QIOA 1JIIA 4X24A 1HQDA 4B32A 1TCVA 3I23A 3G0IA 1Y1KE 3RIMA 2G5PA 1EGMB 1FPMA 1NY5A 3Q7TA 3DHNA 4HAOA 4TYPA 3TAUA 1BXRB 1EWVA 3UJDA 2VA9A 1EM8A 3ELDA 4EP1A 3OJEA 4HNGA 4K7JA 2BBTA 3H5IA 2QN9A 3FCSB 3UY4A 2PFSA 1V4BA 3ZVMA 1F3OA 2XXJA 5IVKA 3T06B 1Y7LA 4XE5A 1GL3A 5KTMA 1E6EA 1HE5A 4WBNF 4ER0A 3O7WA 1EX1A 3ZDAA 3WO1A 1C1YA 3IP5A 4FK8A 3UXEA 4G5HA 3JTEA 5J43A 1K5HA 5ED0A 4ZI7F 3PICA 4RTSA 1BHJA 2RG7A 2II6A 5ICSA 1FU8A 1LB1B 3IE2A 5TGTA 5DXFA 4URHA 2CLLB 5LU8A 1M66A 1P19A 4M0MA 4X00A 2JFOA 6YASA 4MUHA 1CJCA 3QEAZ 3I6ZA 4BL5A 1R7RA 5CGZA 2IZ6A 1U0RA 4X41A 2FG5A 2ZJ1A 1ZXLA 1QK4A 4CLHA 3TLYA 3F6BX 3F6EX 4FYMA 1KJNA 1TQ8A 2EEZA 2EKZA 2FUKA 2YJNA 3RS3A 3SFTA 1LK7A 1WUTA 4IIDA 5ALSA 5DGDA 4BDSA 1DNPA 1XAGA 5IVDA 4D3SA 4OHXA 1XQ1A 3UAYA 2WY2D 4DA0A 2CL7X 4QXPA 4DQKA 2WT8A 2XXBA 4CMIA 5E7JA 2O8FB 3MRSA 4K6OA 4KQ2A 3QVJA 4IXMA 1IEWA 1MEOA 1F8FA 4F21A 3Q1LA 4F4HA 3OSZA 4PFSA 3U2QA 4TSFA 3ESCA 4HX2A 4S12A 4Z49A 4P53A 4COKA 2PMKA 4OQ4A 1H2XA 3F6YA 1C7RA 1I7NA 1TC2A 5H02A 1VBNA 3U7EB 1EUDA 3QPWA 4Q16A 4QXOA 5FTLA 4OHMA 2XRZA 5F9FA 1GPUA 4UATA 2FY8A 4BX8A 4R2XA 2H31A 2HDWA 1E2QA 2RGGA 3JYQA 3NEJA 3L6EA 1KSFX 4KH0A 2W6QA 4ZANA 1WMDA 2VTKA 3U9SA 3ZNQA 4AF6A 3TLEA 1SGWA 1CE8A 4GOND 1XQVA 5K8UA 1GTSA 2EIXA 2DBZA 2X3YA 2YNMC 4JC5A 3ZHZA 1GR0A 1W0CA 1QF7A 3BMCA 4WOBA 3HY4A 2Z2IA 4D79A 1YU6A 4AQ7A 2FZCA 5KIAA 4P0QB 2QNRA 4BLPA 3FOFC 3HVKA 1W1WA 4CQJA 3P9XA 2QL7A 2TMYA 1IWOA 2CHVA 2UUPA 4G65A 3C3YA 3T15A 3U7QB 2ZYUX 5FUMA 5DX1A 4E7PA 1I7DA 3GGPA 3HMQA 1F9EA 1EJBA 6CHYA 4MHTA 3VPGA 4H3KB 3V48A 2HF2A 2O3UA 1QYCA 2HDNB 3G2QA 2ZI6A 1LA2A 3L7LA 1GPDG 1RACA 3Q41A 3V7UA 4S1OA 4OSPA 4B7XA 3TOSA 4CDRA 2Y6VA 3ME5A 1FRFS 1L4HA 3DEHA 3IIMA 2I22A 3TM5A 4XI9A 5F2NA 2VXBA 3O31A 3ADCA 4BQNA 1U6IA 2ODQA 3GZTB 4KH1A 2X14A 3RAJA 2WINI 4H3HB 1O97C 2ZR8A 4XVQA 1Y5NA 4URZR 1T6XA 4I1UA 4QEDA 5AK4A 4DC0A 2YV2A 4I9UA 4TZ0A 3Q5DA 3FCCA 3KQMA 5FA8A 3AYXB 2ENWA 3WLPA 3TIXB 3BL8A 4WASA 5ENVA 4FWBA 5IT0A 4EPXA 1M7HA 4ZCLA 1F0PA 3FAKA 1ODIA 1E0JA 1TU3A 4G4JA 3DEZA 1JDUA 2HCTA 1FB5A 2RC5A 1PK8A 4BX0A 1JEQB 5ADWA 5F2OA 2NSDA 2JZNA 1C7EA 1EFRD 1WABA 2GA8A 4UAVA 1E9FA 2IQ5A 3D6FA 1GTMA 4BAZA 5HGXA 1H8HD 3ABOB 3GJTA 4Q7MB 5AOCA 5BR4A 2BBSA 1J99A 2HSWA 2QENA 3CX3A 3LUDA 4EBFA 1SCDA 4EB0A 1QH1A 1WDWB 3CKMA 3QXXA 2IH4A 3D0KA 3MB5A 5ALGA 1QQ5A 2F1KA 2WMDA 1G16A 1ZWLA 4EJSC 3HN2A 2X0EA 5JCOC 2R6JA 4B48A 4J0KA 3ZY4A 3EVDA 3ZZMA 1CZUA 4MW7A 4UOQA 3ELBA 2JGIA 3AM5A 4X6LA 2QN3A 4A27A 5LMUB 4KXFB 4GNRA 3RPEA 3EMDA 3AUUA 4HNHA 5JD6A 5JXHA 3ERCA 1QGDA 3OZWA 5HKOA 3VOSA 4IIEA 4CMJA 3A10A 5A1TA 3ZQ6A 2J6HA 1DC8A 2IELA 4R69A 2XNCA 4EEKA 1YDEA 5A06A 5FAKA 2WD7B 2BGKA 5FPYA 3IP9A 2CSUA 3L7BA 2AOTB 1TKBA 2PJRA 1Q12A 3VTAA 2XUKA 5EPEA 1NBAA 4D57A 2P77A 1PGJA 2AZMA 4JI3B 4E0BA 4LI3X 1O2DA 2ADFA 4NR0A 1GTZA 3DWFA 5EQJB 4KE6A 4CMAA 2BMAA 3PWTA 2IHJA 2NZ2A 4OHVA 4PG5A 1II9A 3A6JA 3GFRA 3PVCA 3VSAA 3ZE2B 3EPHA 4K0KB 1WQ3A 2FHSA 3IOMA 2PYZA 3DULA 3FSRA 4RD2A 1EXWA 3B13B 3UOWA 3MXOA 3RBZA 5CBKA 2IBSA 4YR9A 1FVHA 1IG3A 1ZL0A 1OZGA 3ND9A 4YIKA 2DR2A 1AGRA 4PC6A 2RKBA 1DOZA 3TWOA 3ZDCA 4GMGA 1RKUA 3NHYA 3U7FB 3HO1A 4LHZA 2J85A 1NSYA 1I14A 1O4VA 3ZJ4A 1Z12A 4ODIA 2AFHA 4WV3A 5FWYB 2C04A 3V4PB 4AB1A 1EAYA 1WKBA 4GDFA 1R0LA 3MBOA 4YUXA 3ZV7A 1RWMA 2XMRA 2EFEB 2VBIA 3QUCA 1EKXA 1Y3FE 4KLAA 2FMXA 1MAAA 2IEAA 2CDRA 1IZYA 4I4LA 5DB4A 3P9ZA 4BEWA 2NT4A 4FC6A 1XDSA 3R5XA 2ISCA 2OT3B 2OYCA 1XEAA 2GM9A 4RMNA 2AKEA 4RACA 4IINA 1O94A 2PUWA 1GGMA 3GLQA 1PLLA 2JRCA 4MOWA 2DLNA 4NI5A 3WL8A 1L4UA 1U1DA 5F23A 4DCJA 5BPHA 4EJ0A 2A1TR 2FFQA 2FLVA 3EQ2A 3KBOA 4RJIA 3L7AA 1RYNA 1L5KA 1QIKA 5CIWA 3SLKA 2JAHA 3AJEA 3CPJB 4L4YA 1MV5A 5C4GB 3IQHX 4BGUA 5E4JA 4NLLA 1TX4B 2OD9A 5G53C 3WYGA 4P3OA 4M0LA 1UXGA 1H65A 1U94A 3VHXA 4XEHA 3GNTA 3ADPA 3G23A 5ES3A 1C30B 2EGGA 3CG4A 3N2NA 2BFMA 4MCIA 5FFMA 5EOVA 1G17A 3I4FA 4GQIA 4K26A 3DUFA 5AESA 2JLQA 2NSLA 4AWBA 5K0EA 1LSOA 1JR4A 2PRIA 3MTDA 1FUKA 5F76A 1C7JA 4EELA 2PS0A 2VUTA 4FYVA 2X0NA 1PFVA 5K0LA 1Z2EA 2HU8A 1UJBA 4YMGA 3GLTA 4AZVA 2W9XA 3I72A 3EYAA 4L51A 2FRDC 3MWEA 3N7TA 4H1TA 3NBMA 1ML3A 4FUQA 1SXIA 4RTKA 2G0NA 1D4OA 2HSGA 3FVQA 5B7QA 5LYYA 4CM4B 2QUZA 1N2EA 1FXUA 3D8HA 2KSQA 3IJEB 4CBVA 2WJZB 2V54A 4Y9TA 5ADVA 1T34A 1UMKA 3DVQX 1VJ5A 4S35A 2JAXA 5BW5A 3EDCA 3UGKA 4DY6A 1QIMA 2XW6A 4EYQA 2PXCA 2W2MA 1T6ZA 5INTA 1XD2A 4RK5A 3H7AA 4JZKA 4EBBA 2CSXA 1D2RA 3B6MA 4KO4S 4ER3A 4ZYTA 4O8ZA 3AB8A 1OJ7A 1U2RA 1XG5A 4EUFA 5BN4A 1WMAA 3I3SR 3LUJA 2N1BA 1R0SA 3ETNA 3LP8A 1X0XA 4UNPA 5C2JB 5TE9A 4IQ0A 2GJ4A 2O4CA 1SC9A 3D1LA 4ND4A 1JS1X 3U6KA 2V58A 5BUCA 3SZUA 2YW2A 1IN5A 3GJSA 3G5MA 5GAJA 4DARA 2B4QA 2E5FA 4X71A 1LXCA 3VZQA 3N86A 3SF0A 4MV9A 3W5IA 1G21B 3G7SA 3M4XA 5CURA 2WEKA 3F71A 4BNJA 5KOJB 1JE0A 1L4KA 5J2UB 4B83A 5CDYA 4YMSA 2PLAA 1M5UA 4YMUA 1UAAA 1Z6AA 3W2EA 2ZQYA 4ZU3A 5SY9A 4D8YA 1GG8A 4K8OA 2GKSA 1MAUA 3F0TA 4AZ0B 4HGNA 1QKKA 4JELA 4RDHA 3T4EA 4NVRA 2HZBA 2PWYA 2MWMA 2H4JA 3RC1A 3RFXA 1I1HA 1MFZA 3DTTA 5EE5B 1M2EA 4M88A 4LE0A 4MARA 2W0SA 2O7RA 2E49A 4NHEA 3GP8A 1HWYA 4NBTA 4DREA 4DDHA 2R8ZA 2A35A 1G3MA 1QNFA 1VE1A 3AR4A 3I5MA 3NO4A 4JDPA 5AM0A 3S1AA 3T38A 1P1RA 5I7WA 4AY6A 4Q24A 5AVRA 2C83A 3SXPA 5K6RA 3TVTA 4OOFA 2NYVA 2YRWA 1DJQA 1YK0A 5TQ2B 3AHFA 2PSFA 3RROA 3GLKA 1Q7EA 4D8WA 1RRGA 4O4IF 1XTJA 4IJQA 3VSEA 4YNBA 3K71B 2GPNA 1K7FB 5ES4B 2GM5A 1LW7A 5A5EA 3NM4A 2VHWA 3ENKA 1KMQA 1KMHA 4JOCA 3U4AA 4HT3B 3CE9A 3EUEA 4P08A 4LOHA 4C76A 1NXPA 2AXPA 1KC1A 2Y1KA 3OECA 5JOQA 2Y6UA 5FOWA 5EQDA 1VKJA 2R5FA 3UB2A 3P27A 4IS3A 1Z8DA 3RNLA 1PVVA 5E6SB 3LX4A 4QATA 3KQKA 3T3IA 4HB0A 1GZ4A 1LDBA 2E5WA 1GFWA 1OYOA 3PS9A 3AUSA 1SXJE 4BNHA 2RARA 4EPTA 1INLA 4TRJA 3PI7A 3PRHA 2VC2B 2PPLA 4IDBA 3NHPA 5G2OA 4DBVO 5JAIA 4B85A 4R1QA 1OAKA 2BFFA 1NRIA 3HE3A 1XVVA 4ZOBA 3WLQA 4U9UA 2VZ8A 4ZO8A 3ICQB 3EDQA 1FFGA 4TXHA 4DLRA 3GD7A 2NU9A 2O8CB 3M4YA 1A71A 4GVLA 3HJTA 3FLEA 1EFCA 4HXEB 2FFJA 3JATB 2RJOA 1W44A 4F8JA 4PLZA 4LF9B 1CFJA 5FV4A 1TA0A 2R8BA 4N6OA 5TS3A 3ROFA 1VQ1A 1YZFA 1A27A 5LA6B 2UUBB 1HLFA 5BMOA 2A9KA 1JECA 1X13A 2CCJA 2SNIE 2WJVA 4FI3F 2W83A 4O0LA 1RRCA 4OPMA 3PT9A 5IXJA 3R9WA 4QAJA 1F8YA 2RCYA 2B8JA 3QLVC 4EABA 1MQSA 1PJRA 3Q6IA 4XJTA 1OWNA 1LZLA 1ODLA 3DYBA 4EUNA 2BBOA 2B1RA 2DT8A 4CM8B 3ER6A 1SQ6A 1WSWA 4C43A 1DTSA 4O4LB 3KR0A 1ZC3A 1ZM7A 4B2IA 1G5FA 4BMNA 4X1IB 1SPXA 2P2CA 4ZOLB 1FX1A 4XD7D 1OASA 4K3VA 1O6BA 1G3RA 3AEUB 2A0KA 1I3OA 3FPAA 1S4QA 3UAWA 5K0CA 1I13A 3AM4A 3GC6A 3CEHA 5EHIA 2BTOA 3UKJA 1B1CA 2BY4A 4EM6A 5IYZA 5K4GA 5TRTA 5A3RA 5B6PA 1P75A 2P65A 5JWHA 1ZDMA 4ZVTA 1ZUNA 4LGCA 3PNSA 1AKEA 1NM5A 3I28A 1FTSA 1RC0A 3C1AA 3GLHA 4MS4A 3UMBA 3IKJA 3RVLA 5GJWC 1T2UA 4PLCA 5A7GA 1KH2A 3GJ3A 1B14A 1THTA 3B8EA 3GFBA 1BRMA 4FZRA 4LXXA 3TLKA 3G2PA 1GZHB 3P0HA 3PR2B 4R01A 3W05A 2RGYA 4BMDA 5AKIA 2WOOA 4X45A 3ESAA 1X1QA 1J22A 4YFVA 5LQDA 1N5IA 1NV8A 5E9WA 3ABRB 4Z1OA 4RY9A 1P2FA 3VZCA 3NWEA 1CHNA 1TEHA 4E1VA 1P7YA 2P9ZA 2EDAA 3P0EA 4MV7A 1QIGA 1DMSA 1UM9B 4NCKA 2VWQA 1P9LA 2SBTA 2QZJA 4X20B 3UJ6A 1NSTA 4ITVA 1TYCA 1WLSA 2R1UA 3IEIA 3N8IA 2EWMA 4X7BA 3O8NA 4B3RB 3KL4A 3HGTA 3R41A 4ZGBA 3WGKA 1S89A 1JAXA 2IPOA 1JPUA 2A9PA 1PL8A 2FPLA 4MKHA 1KEUA 4B6QA 3HADA 2QJTA 4R1SA 3ZWQA 3IA2A 3KQWA 2V3VA 1II0A 4QFMA 5JISA 2QJWA 3F9IA 1EVKA 2EBFX 4KE8A 4QUAA 2E1RA 1WW8A 2C1XA 4Y2XA 3VR4D 5FA5A 4JYPA 5EPUA 4DCCA 2OV8A 1KKLA 3PGLA 3EQ7A 3RRYA 4E5PA 3BHJA 4AI6A 2FX2A 1N8TA 3H0EA 3VKFA 2XB6A 3RC8A 1PGOA 3NEYA 4IP0A 4M7OA 4J29A 5K4AA 2VHXA 3KXDA 2I5PO 1QAMA 2Z8YM 3WJ7A 3KSBC 1WMBA 3WLEA 1AGXA 4KO3S 4ND8B 4DDKA 1L5MA 1TVEA 2BGTA 3EY4A 3PEEA 2JBHA 3RSQA 4CE6A 2IYVA 5JPIA 2V9CA 5IFKA 3T9BA 1PEDA 1SA0B 1ABFA 5DYYA 3T3NA 5KYUB 1NBOA 5F9MA 4K81B 3EUWA 2DKOA 3HB5X 5MN4A 2VSQA 1R0BA 4B6OA 4C9BA 1MGOA 2BN4A 2CXNA 4OB6A 4CI9A 1WW3A 3R5KA 4Y2TA 2R1ZA 4B87A 1YQUA 2V7WA 3EFHA 1MJ5A 3DW3X 2AQIA 4IXDA 3BC1A 2AUTA 3Q7SA 4X9XA 3VH4A 2Y0DA 4KIWA 4TLEA 2OAEA 4A23A 4M83A 4YONB 3P2YA 3OZXA 3KETA 1E0AA 2YH2A 1CQIB 3OOSA 2FPXA 4B44A 2XTJA 5JFGA 1DEOA 1QGYA 3LUGA 2REQB 1E66A 3MPUA 2ZRIA 1Q14A 3FWHA 4GAEA 4DUZB 1CZKA 1AA6A 16PKA 4KYIB 4GGMX 3B8HA 4OSEA 4XUEA 5FOVA 1E1QA 2HRZA 4XM0A 3T7TA 2YIVX 4G0OA 1OV6A 3W3AH 1XEXA 2EW1A 1E1YA 4ID3A 3WIUA 2W6ZA 4GXNA 1N3YA 1W5FA 2F9FA 3O2SB 4MV4A 4G0WA 3D7NA 3PLRA 3AEQB 1RYZA 5C1IA 5TSDA 5D51S 4BO6A 4GXRA 1VM6A 1PT6A 4LV8B 5LLDA 4B4VA 4S04A 3AVUA 2PM8A 4J7CA 1MX5A 2O5EA 2JASA 2J7KA 3JCZA 4PGMA 4MR9B 2QM7A 4I8IA 2J08A 5BNIA 3VO2A 4UTOA 2PU7A 4A2PA 1ZNZA 3GCWA 4ARCA 2R6DA 2OXTA 2BEUA 2GXUA 1K3TA 4LGVA 4XLLA 3DOCA 4YRKA 3SICE 1QPBA 2EEPA 1G4UR 1SCUA 5L8VA 1G2IA 3FPCA 4GP7A 3DT6A 5LP1A 2UUCB 4QSHA 4P81A 1QZTA 5FLYA 3VR3D 5EJMA 5AVSA 1I36A 1E8MA 5DU2A 5B55A 4XFKA 1PUJA 1MX9A 1UK9A 2YJTD 3A2NA 4XJVA 3VDRA 4KPYA 1FLAA 2BDTA 3ES9A 4RENA 4LYFA 3MB8A 1XFAA 3LF2A 4W9MC 1VG9B 4HQOA 1D8TA 4QTXA 2ZYTX 4PTYA 3Q3JB 4C3OB 1MABA 1ZCFA 2DRIA 4XUDA 5TB5A 1PQPA 4GC5A 4P31A 1K8YB 5BMVF 4A8JA 2D5BA 4NJEB 1J90A 1KY3A 2QLMA 3DKVA 5DRYA 3KD3A 4ZREA 1BHSA 1OCEA 4ETNA 3OSUA 3SZRA 4B3GA 1QH8B 4L6CA 4PQFA 3FDIA 3K70B 3Q98A 4HYYA 4EKEA 1T2NA 4IILA 2O2GA 4GD3Q 3DMNA 4MEAA 4PC1A 5AJVB 5B57C 1YQQA 3B1YA 5AVQA 3C4JA 1GSHA 3AM3A 2LRHA 1MAVA 3K0SA 5EE3A 4B6FA 5DN6D 1KVTA 1RP1A 2PEZA 2DPLA 1F2VA 1Q0ZA 3FWZA 3KWJA 3PQFA 5BXQC 1PJ8A 3M1AA 2JIDA 4OBWA 2F3UA 5LA6F 2QA5A 2BE9A 3GQVA 4DCSA 3I2IA 4QJBA 4ECEA 3DO6A 3REQA 5MHTA 2XSZD 1E32A 4RADA 3AB3A 4RXMA 5BUQA 4PVDA 3B70A 3ESQA 4IKOA 2ZVPX 2YUTA 5C8DA 1LFDB 4G8JA 1DQPA 3HJRA 1G5QA 4MW1A 3ZWBA 5ICCA 1HNNA 5TV2A 1YSCA 2HT6A 1D2CA 4Z86A 5A2QA 3N0XA 4ZT7A 1YRHA 2B30A 3RCBA 2QYHA 1X7YA 1Q0SA 1UPCA 4CHTA 2CKDA 1NQ5A 2GN8A 5I9LA 3B7PA 3NGXA 1O03A 1SXJD 3GVXA 3WFIA 2FGJA 3CLSD 2F8MA 2V45A 3SF8A 3N5KA 1ECPA 4JLKA 2H1CA 4J4HA 4V1CB 5KTNA 1KZ9A 1PGNA 2GCOA 4KQ1A 3LRXA 1XQ6A 3VYRB 1OJLA 1N25A 1XK6A 1XU9A 3LSTA 3OT1A 4BMXA 4O2BA 4CEJA 2WHRA 3L1KA 2EW8A 3L8GA 2W98A 1O96B 3IODA 1YZVA 5COAA 3ZKWB 4Z54A 4CODB 2H0AA 1VIDA 5JG7A 4EB6B 1R37A 2AE2A 4WEQA 3P52A 3PI6A 3ETJA 5HZMA 1O95C 1AHPA 2O48X 1H22A 3ET4A 4LECA 2KI5A 4MS3B 2OXCA 4P7BA 1FYWA 4TWBA 1NOKA 5AK5A 3ZHTA 4CWAA 4DAOA 1XVUA 3GBSA 8ABPA 3H13A 3CZ5A 5IT9A 4YAOA 2QTVA 2WIKA 2WHPA 4IH4A 2PRKA 3WIBA 4OYYA 3A9TA 3K9HA 4O3FA 1W8DA 3VOBA 1PYDA 2NUAA 4Q37A 1NNEA 4GWLA 2VP6A 4YR7A 2IUYA 4QGGA 3C3DA 4MQFA 4KNYA 1T9DA 4MVJM 3GAZA 1I4EB 3OZEA 4HOYA 2HO4A 1TYEB 2Q5LA 5SYNA 4ACBA 4IEEA 4P84A 4C29A 4IEIA 4OGLA 3BXZA 2J9FA 2P9FA 3DAHA 3FYDA 1W35A 1VLMA 1GZUA 2H11A 4MWEA 4NIMA 1JIXA 3NKVA 3PXUA 5DTQA 3C48A 3UYLA 3CB2A 3RJTA 3WYEA 9LDBA 1FDTA 1FUEA 2G83A 4WI1A 3TSYA 1TUGA 1CR0A 2IYUA 3CVJA 3GUYA 4AJEA 3GA7A 4RF5A 5KDLA 1OV4A 3WQQA 3SAJA 4OGFA 4H7EA 3C14C 4JL8A 2GRAA 1S8NA 3F74A 4KXXA 2FKNA 5L4SA 2IWRA 4UHBA 4RMGA 4UNQA 2VTBA 1U1EA 2J3EA 3WDLA 4LCBA 3HXTA 2F3RA 1TVKB 4LNAA 3VYTB 2CDCA 4R8KA 4OHZA 3OHMA 3SFVA 3X0DA 3MSXA 1OA0A 3K96A 3T1NA 3K5HA 4DYDA 2DG2A 4D97A 1V7ZA 3GFFA 4LHXA 3EDOA 3EPKA 5EYPB 3WL5A 2J9ZB 4OJYA 5COBA 2B20A 4XWKA 4XYMA 4DT1B 1A96A 1P5ZB 2YFQA 4H4DA 4XEUA 2W2TA 5A6VA 4KRFA 3G5TA 4N3GA 3EC1A 1BNCA 1MVOA 1UMBB 3LBFA 5DBHX 2XUHA 4G0PA 5TS2A 3TZKA 2I4LA 3NXSA 4U9IS 2ZRPA 3SHWA 3PFIA 1SMKA 3H4IA 3NTQA 4O29A 3DV0B 4E4YA 4ZVOA 2WWGA 3ZU3A 4EPRA 5GVSA 1B93A 4PSDA 1KRHA 4XCQA 4YECA 1DBPA 4NU0A 3WZMA 5BQXA 5AKKA 5DISB 5IC6A 1I3KA 2MIIA 3BXOA 4RY2A 5E8RA 2GEKA 3RAGA 3TQOA 5BR7A 3IQXA 4N8SA 3N74A 3NOXA 4RJLA 3I9FA 4MWZA 4PC7A 4IRUB 4ZMSA 2FN4A 3TG8A 3L1JA 2ZIZA 2FNAA 3OT5A 5A6SB 3FYTA 2A1UA 5CYFA 4G5YA 4F8EA 3NOOA 1PT7A 1E1QD 4RM2A 4QDJA 3O8OA 5E6UB 1KL7A 1Z4NA 4MA4A 2JAQA 5HS4A 3JQ8A 4JL6A 4YT8A 2BD0A 2PXHA 4FMPA 1NNLA 3VDNB 1YVPA 1E3WA 4GXTA 4FFOA 5FWDA 4NCJA 2AW5A 1M6NA 3BWXA 3B1JA 4GX0A 1Z6GA 2GARA 3TK1A 3L0YA 4LF7B 1RQPA 2C4WA 2Q5FA 5B2EA 5CW2A 3CO5A 1D6NA 3D4IA 2HQOA 3AR6A 1WB4A 1E2DA 3IP7A 3G5UA 3D6JA 3M82A 5IAAA 2XZDA 2ZUDA 3P9KA 4ZAGA 1WKCA 2J3LA 3DEAA 3DDNA 1IUOA 4KYVA 3N2LA 4L95C 3GT4A 4JBLA 4JT4A 2BGNA 4R2HA 3COZA 2W4QA 2AJDA 4J2HA 4BNUA 4C2TA 2BUCA 2ZTVA 1JJIA 1QO9A 4I4CA 4KHZA 4PG6A 2IU0A 1GCGA 2VJPA 2C54A 2FN7A 4FT4A 5E3JA 2KPOA 3UGTA 1QG6A 1LV7A 2AUMA 3T3EA 2EFJA 1FDUA 2L17A 4ZOEA 3P2MA 5IFLA 4ARZB 1OX4B 4LQLA 5JZMA 1F0YA 2QTTA 3BZUA 4DLVA 3LDHA 1OHHA 1QZXA 1I1NA 4J0EA 2OCBA 1P73A 2XQIA 4TM8A 3OO0A 4HVTA 5HBRA 1K7EB 2O2SA 2WILA 3B2QA 1OVMA 5FTKA 4DBZA 5K0JA 3SBXA 5AW8A 1VBKA 4AL4A 5E38A 4C4RA 1XROA 2OO3A 4NAVA 3TQHA 5TPZA 1T4CB 1DZ3A 3FF4A 3WRVA 3GLFE 1U63A 3KVYA 1VE3A 2FEKA 5THXA 1ZSVA 3FVWA 5FOSA 5KC8A 2WZDA 1WPXA 3SIRA 2AFIE 4OKNA 4FE7A 3W1EA 4B4KA 5LZ9A 4E21A 3F96A 2BH2A 1E4VA 3SD7A 4Q4JB 1ADJA 1Z63A 1C0IA 1YFLA 1AGPA 1T8YA 3BE4A 4Z7OB 5KX5A 1EFUA 4U5XA 3ZBTA 4LTDA 3ZCTA 1TTQB 4C22A 4G1MB 2MMCA 3L41A 1LDYA 4JS0A 4L50A 3V3TA 4DZRA 4ZCQA 1IXSB 4G1FA 5TF0A 2FCAA 1U2GA 4RH0A 4HDNA 3BDVA 4MAMA 1E9VA 1AQ6A 2VNSA 5EWLA 1SO8A 1MO3A 1SBCA 2GK3A 2AN5A 5T4BA 3LLUA 4PO9A 3TW0A 4X65B 1N34B 2D7JA 3GELA 2W8BB 3I73A 1F0NA 2EFYA 1MO6A 1VI5A 1PT5A 1B2RA 2HIAA 1USKA 2ZWAA 1QTNA 4C03A 3DCNA 3ZDXB 4I9NA 4PU0A 3OF5A 3GNLA 3HHPA 1XKTA 5JVDB 1MJHA 2F1JA 3N2IA 4QTZA 3QKIA 1QJ4A 2RONA 3RSHA 1CNMA 5FHQA 2KS6A 2XPCA 4M1ZA 4O33A 1DKOA 1R6AA 2O14A 1C7IA 1HXHA 3SHQA 5CNKA 2C5EA 1LS1A 2ID7A 2JVIA 1ZH0A 1W8IA 1SQGA 4V0NA 5L4LA 2D62A 1FMJA 1E7SA 3KKEA 4AECA 3C5EA 4MYUA 4BWVA 4MKIA 1T9ZA 4Z1MA 4Q1DA 4B40A 1UXOA 3NR2A 4K9PA 2WHEA 2ZSJA 3ENQA 4MRMB 4IF6A 3VBEA 3ZZUA 2IE8A 5C1PA 3OPXA 1GXSA 3HYLA 4C07A 1AS2A 1OREA 1EHYA 2Q8PA 3N0WA 3QW4B 1JIKA 2FWJA 4CMIB 5JXWA 4KBYA 3KJGA 4CEIA 1R4MB 3HYRA 1SY7A 5FL3A 4E03A 3THSA 4Y18A 2D5AA 3ICPA 5TLSA 3VJRA 1DIGA 4X7PA 4ISCA 4LCJA 4OP1A 4EJFA 1K9VF 5AOBA 1LNSA 2FZVA 2AUNA 4DCUA 4LSWA 1NIJA 2EU8A 2XE7A 1QTQA 1XYYA 5H83A 4AS3A 3DCIA 4EI7A 1A8PA 1Y9ZA 3I4CA 1WRBA 2TS1A 5CM9C 1I2AA 2J45A 3FLBA 3Q3IA 4GBMA 4FYYA 4J7AA 4QYXA 5AI4A 1DO0A 3U7IA 3IALA 2J1LA 3IV9A 1U8EA 3PHLA 5JNUA 1KAEA 3I2GA 4U6NA 1JSLA 4X1KB 2ARKA 1Z2NX 1SBNE 2KQUA 1X8XA 3HJUA 3K0KA 2Q1UA 2RCNA 3KFXA 1MGPA 4WY8A 3NNSA 3WNQA 3OZGA 1V3UA 3Q8XB 1M2WA 5AVJA 2RH4A 2C58A 3DO5A 3HZZA 6LDHA 5I5EA 1MEJA 3CR7A 1F60A 2J6CA 2FZEA 4HV4A 2KWIA 1TFRA 1NT2A 3B6ZA 4ZQFA 3TZBA 1ZNXA 2RGDA 4ZHQF 1RXUA 4UZSA 2Z3ZA 4W5HA 4LYAA 3DDWA 2PKEA 4JLOA 4ALIA 2VF7A 1KY5A 5IZ4A 3ODGA 4BYGA 1GDHA 5AVVA 3GPBA 4FM9A 3HU2A 4LV5B 1XDUA 2EJBA 2OZLB 1G3UA 4PANA 1FMLA 5JASA 3DOEA 2RBGA 1YRYE 4A2WA 3D6UA 3DF9A 4O4LF 1MORA 2JFQA 5J2TA 3FF1A 3TI7A 3ZXXA 5CDGA 2VNHA 4D25A 1LTKA 2C29D 3NGLA 1F7UA 4DUGA 1QP4A 3EQZA 3O75A 4BO3A 3WWDA 2J0UA 1JEEA 2O8BB 4TGLA 1GPLA 4DE5A 3BWMA 4CNQA 3C7CB 4PZUA 5EXTA 3M6WA 1HK7A 5JDCA 4DHWA 3DTNA 1J2JA 1G6KA 1ZH4A 5IG2A 1NI4B 4P33A 4UAUA 1U9YA 1W52X 3PG5A 2OBYA 3CN9A 3LM8A 5LIRA 1CQWA 2CUNA 2J87A 4L8WB 4LYGA 3OQOA 3PXCX 3L0IB 4P54A 1H66A 2QAIA 2ZUEA 4MLDA 3WMFA 4TWJA 3TMYA 5JJBA 4PGAA 1J2YA 4PZZA 4G0QA 4JY7A 4BJ5A 3AK4A 3D7LA 5BURA 1AKWA 3RU3A 4EG1A 5B6IA 1LLDA 3MT8A 4RE6A 2C4MA 1A9YA 3VR6H 1VP3A 3HB7A 4BN0A 1KRWA 4M54A 1S2IA 3KBBA 3KU4A 3NWPA 4DJFC 1EQ2A 3UHFA 2YTZA 1QH1B 2ZRKA 3HA3A 2RK3A 2Q5EA 1OWMA 2HQRA 1I9GA 1GFZA 1CIPA 1V3QE 5D2CA 4AYWA 4R68A 2HJRA 3L7JA 4RCVA 4TRMA 1J0AA 2EKQA 2HKIA 5LQJA 2VG8A 2QT9A 4WZBA 4C2AA 4H31A 1XNRB 2RE8A 1HG0A 2VHQA 1KYZA 1P5RA 3ILVA 1POXA 2FEXA 2O1XA 3EEQA 4N5HX 4TYQA 2J9XB 2VS1A 3RVBA 1C14A 4DR2B 1M83A 2WWXA 3V2GA 3OOHA 1PHPA 1ZSNA 4R84A 5HCNA 4ZFNA 4PGGA 1P18A 4QXAA 2O0JA 3VYWA 2BUAA 4OXQA 4DMCA 1KQGA 4EGFA 1CK4A 2HHAA 1DIBA 2ZRLA 1ZJYA 4V0LA 2VYCA 3TTVA 2X4LA 3TL6A 4DUPA 1XLTA 2AJBA 3EZ9A 3HCAA 3NHAA 4W1PA 3VI3B 2CXTA 3AL0C 5HX7A 5HFNA 5KYYB 4FS8A 4YYEA 5IDYA 2P6MA 5LB4A 1K9SA 1FVXA 2QMEA 1KO1A 2V6BA 4EIWA 2VPWA 3QNMA 2YUIA 2P6PA 1FY2A 1VG8A 3E15A 3JAWB 3LBYA 5ELXA 2I4TA 1FLVA 3KHSA 5D1NA 1IONA 1B0PA 3KM0A 4F3KA 1KOGA 2I66A 3AQ4A 3EZLA 2B92A 3LCJA 4LSGA 1AUXA 5FCDA 1GRCA 3HM2A 1NF2A 3PGVA 3GLGA 2YIJA 5IM5A 1N2CE 3DKRA 3EIQA 4E2ZA 5A4IS 2I2AA 4JK3A 3AWIA 3SJBA 3W6ZA 3ZIDA 1Y5MA 1Z47A 2QYSA 3HDVA 4JNCA 4BQRA 3OTIA 4RVDA 4C5BA 1ZR4A 3QMVA 1QVZA 4IO1A 4E2FA 1AXGA 1QP7A 1N9GA 4NK4A 4UKDA 3BRWA 1OGIA 2GERA 4HP8A 4IQFA 2WMNB 4X85A 4NYMQ 1H23A 2BFCA 2E7ZA 4AJLA 4D9EA 3P26A 4Q66C 1JX6A 1U6KA 4B3XA 4RD1A 4B35A 4MGZR 5DN9A 1A8IA 3BUSA 4DA4A 1HX7A 1HG1A 1KTVA 1QV6A 4ND3A 3UJNA 1FJ2A 2ECQA 1B8OA 2WF8A 3K1AB 3MT7A 3PFNA 4F2PA 1EH5A 1RE1A 4JC0A 3SY8A 4FR0A 5HDQA 1E5QA 2QN7A 4FZ3A 5KNDA 2TMDA 3K6SA 3DBRA 4BEJA 1ULBA 2JS7A 2YJ4A 3WK6A 5KB3A 1CP2A 3YASA 3TIVA 1D9ZA 2PUJA 1BEZA 4N5LA 3N6XA 1Z15A 2M1XA 4P80A 1D0SA 3VHXB 3BCHA 1HMPA 3FNBA 4EKNB 1CY8A 2ZWOA 1CUXA 4I8XA 3OZTA 2E89A 3G0OA 2POQX 1JSXA 4U7TB 1V5IA 4ZZIA 1KXZA 2W8ZA 1T0UA 5CVJA 3TD9A 3TXXA 4B3FX 1GTG1 2GXQA 3FDZA 1Y1PA 5KQRA 4DKJA 1RJGA 3V34A 4F6RA 1VGQA 5CB4A 1U7WA 3ANSA 3EAFA 3GGSA 3SS8A 2QMUA 4MQEB 4QTTB 3Q7IA 2IYPA 2IYOA 2PSDA 4GUDA 1T3HA 3VR5H 1H8EA 4AWXA 4CV0A 5C8YB 2IY8A 4JLMA 4B9EA 3ET5A 5U1PA 3MWJA 4MVCA 1CR1A 4M21A 1R50A 5K8VA 3RRNA 2JARA 1MHPA 4L72A 4UEQA 3BJEA 1HYQA 5LUBA 3SGLA 2QN2A 4JYZA 3CJQA 4TN1A 1BDMA 1EINA 3IILA 2XECA 4X3CA 4CTOA 5JYDA 5HIKA 3U5ZB 5I3CA 3GXOA 1P2BA 4D80A 2C96A 5K3DA 4CT0A 1J8YF 1T1EA 1QRRA 2IQIA 2QLTA 4H16A 4PLYA 5TQVA 3RKSA 5KYWB 3GOHA 2RMKA 1NRJB 4ZC1A 5FUVA 2NU6A 2HADA 1PSWA 1PWHA 1U98A 2O0MA 3JQ7A 3PQ6A 1P0CA 1MX1A 2BC9A 2OR3A 4HF7A 4I2VA 1PJAA 3IAM1 2C3PA 2JJYA 3H7IA 5BV8A 5I01A 3QFRA 2FUG6 1ZCAA 3QPVA 4NQRA 2VDMB 1FLDA 5EUMA 3WSVA 4RZSA 5CDTA 3T3OA 3M1LA 2Q62A 1C29B 3SZOA 3P19A 3Q88A 3V2IA 4QC2A 2PL1A 2JD0A 4ONEA 3HPRA 5FV7A 3KUXA 3ZS9A 3W5CA 4JGGA 4MVJA 5I7UA 1FIUA 2VT6A 1E64A 1U90A 2WWFA 5EMKA 1AURA 4LOLA 2AEMA 3RDPA 2OSVA 1NY6A 2GN1A 3JVIA 3QKSB 3RQIA 3GU3A 3SEAA 2FW1A 5E95A 3PQCA 3LL4A 3EJ6A 1UUFA 3ML1A 4IFTA 2RC6A 3CR8A 5AHKA 1X9HA 3F47A 3KR9A 4IZIA 4P32A 2O52A 4JUDX 3T8YA 5CXQA 2K6GA 3D43A 2JH8A 2ACVA 3W8RA 4S2EA 1XA0A 2PL9A 3RS5A 5CX1B 5J9FA 1E92A 4RFSA 4B2LA 3FTCA 1O3YA 4FE4A 2BKXA 3KEGA 3DMYA 1E6KA 4HNVA 3FXAA 5BVGB 1UPUA 4NH4A 1DKPA 2BFOA 4H7KA 3B2EA 4PLGA 3FCYA 2FWMX 3HNPA 4COOA 1WCXA 3CVXA 1ITZA 5SZKB 1LQUA 2ID8A 2FW8A 2VQFB 2VWHA 2YIDA 5DWVA 4YJHB 1YQ9A 4CG2A 1M0SA 2F1IA 3M5PA 2W58A 3D3QA 4UUBA 4Q1VA 1JA9A 4UC0A 2HK7A 4NNOA 2HUPA 1C4OA 3UUWA 5AD1A 5B5SA 4IX1A 3WRXA 2X7JA 5CJJA 1P1FA 3U0BA 4YMTA 2YV4A 3VYUB 1YQWA 1E2NA 3AIKA 3ZDBA 3RT7A 1QXSA 1Z7GA 4NCAA 5DTJA 4BU1A 2OLEA 4ZXFA 2MSEB 3LI2A 3OX1A 5GZ6A 2AD5A 3QVLA 4F9GA 3DV9A 2VQDA 4TRRA 5TNXA 3U49A 3A04A 5JC1A 5BR8B 2Z0MA 2B37A 3UT0A 3ZG6A 1RXEA 2GAAA 2LP4Y 1K3FA 5TPWB 5A4KA 1XCJA 2IYAA 4B3MB 2JZCA 1YGYA 4BQIA 4ZEMA 3HKBA 1VXOA 5DBFA 2RHMA 3P7MA 3GVCA 2H9IA 1NW4A 5EXPA 4DCTA 2R1VB 2EBHX 4WOKA 1KYXA 4B79A 1R0YA 3C8UA 3T61A 2GBFA 4QD3A 2Y2VA 2I71A 3OFKA 3QLUC 4BB5A 4H08A 4K9MA 4Q6BA 2DPXA 4O8CA 4F6LA 2QRNA 5BUZA 2CFIA 3A2KA 5B7NA 4EVIA 4X1YB 4XM1A 4D56A 2W4MA 1DFGA 4P86A 4U3JA 1BXGA 1Y8RA 4BAUA 4ZCMA 3RRJA 1QDUA 3VU9B 5FHRA 1R0XA 4WBSA 5ICEA 4UXJA 3L7MA 1ODTC 1QR2A 3R5SA 3ZWDA 2PUGA 1SWVA 3ELYA 5DTEA 4R71A 5TY0A 5ALJA 4NU5A 5JYCA 5L3QB 3V1UA 2AOUB 3IO5A 2CJWA 2EZ9A 3A7DA 1ABBA 4JHXA 5ALHA 5JQGF 3OO1A 5FPTA 5ALYA 1KYWA 3TG2A 4WBNB 5CK4A 3MJFA 2FZGA 1D1QA 3ITKA 1HYEA 4R2LA 4Z9BA 3REOA 4EKYA 5JBIA 1EFDN 4JAVC 2FEOA 4QDUA 5TVGA 4AX8A 1O94C 2XCTB 3B12A 5HE9A 1SUSA 3FSJX 3PYXA 4X92A 5LQAA 1UBRS 3OKFA 3MJDA 3ZGNA 3I9V1 5KNCH 5KQGA 2EFDB 1IZ0A 2WJIA 3BJZA 4MICA 4TPKA 3UF0A 4J0HA 2XNHA 3W04A 1L8AA 2VJAA 4OQDA 1YB6A 4MTCA 2RAPA 4FXPA 1K2VN 2CKMA 3LPDA 5D00A 5J23A 1L4NA 4H7PA 3GH3A 2QUKA 3P4YA 4IG9A 4MR8B 3LOUA 3NDBB 2GK7A 3CWZA 4M38A 3AR8A 3I6MA 3TBHA 2OXIA 2CLCX 2I7CA 4JLDA 4XVRA 2WJPA 3ZWNA 5A03A 1UM9A 4PZDA 2IPXA 1EUCA 2OESA 1CY4A 4CLRB 2C9YA 4YUAA 4ZZ1A 4F45A 1TJ5A 1F8XA 2WG2A 4HQRA 5A5DA 2O54A 3QWFA 1MPXA 1UBUS 3O6VA 1KBQA 1TGYA 3AX6A 1Z4MA 3FUCA 3BHMA 2AYXA 2ZYWX 4MRSA 4KQWA 4YJGB 3NYQA 1EUZA 1MNQA 5DI3B 3VSCA 3WQSB 1DTEA 5KOIA 1F20A 3SYNA 2OG1A 4MR7B 4BNVA 1E4EA 4YMVA 4MW2A 1B26A 3T95A 3TSOA 2PT9A 3TZLA 1IZ9A 3JQ9C 3K0AA 4OHUA 7REQA 2XZPA 2E4VA 4OHPA 1RAHA 3S4YA 3U17A 1KQFA 4D7AA 4C20A 2WWYA 3GMSA 1NYLA 5EJFA 3HG7A 4UU8A 2JCGA 4BN5A 2XUOA 2YZ7A 2DHDA 1IY1A 1BJRE 1QOZA 2HIMA 2WW8A 4YJDA 5D8DA 2ILVA 1NBHA 2DUJA 2H08A 5JCOA 1FEZA 1HBJA 3D64A 3WS7A 1SA0A 2YWCA 5EPOA 2QQ5A 3QEMB 4ZMBA 2R25B 2YJ6A 5KYUA 4YJ2A 1KH3A 3P2KA 1PYOA 1V26A 1RQXA 4BATA 4K2AA 1E7RA 3L6CA 5SY4A 5IM4F 3VR6A 2H7YA 1U7TA 2ZYDA 1DEHA 1Z0UA 4UULA 4UHFA 1GNLA 1HO3A 3TX6A 2HFJA 4FEYA 2VPYA 4AJOA 4BLQA 2QMZA 1W36B 3DMRA 4ENSA 1E3JA 5BY2A 1QBKC 3H0CA 5ALQA 1KORA 3RHFA 1CUYA 3JARB 4RVCA 5DPMA 1TJ3A 1PJ4A 2BDEA 4E30A 4C06A 2EF1A 3NUZA 1RVDA 1VYUA 1DCMA 5BMVA 4QFCA 3W06A 5JJ5A 2QNBA 1UIRA 3GPCA 4KOAA 5FF9A 2HFKA 3IUEA 4QHYA 1KJZA 4I46A 3RARA 1BE1A 1F3LA 4QQKA 4F97A 3OTQA 1SCAA 2O2ZA 3BMNA 4PO1A 4QLBA 1GQYA 1P7ZA 4QULA 3TLGA 3FA2A 2L2QA 4UMFA 2PRZA 1JKIA 1VE9A 2AWOA 1QMGA 1YIDA 3HN7A 5T3UA 4HLCA 3QWHA 1KDOA 3H9JA 1D4ZA 3F3YA 1J42A 5KJFA 1YMQA 4LWQA 5TMBA 1JG1A 3WJ1A 4QUBA 1GSIA 4KGZA 4OQLA 1C0LA 2BMVA 2JIRA 1E69A 3IIJA 3WL7A 5AI0A 1N6HA 3VO9A 3B85A 1EUQA 3Q3HA 2B4TO 2WTNA 7MHTA 3E7PA 1SUAA 3ZH9B 1GGVA 4V0OA 1PFGA 1Q16A 2ZRMA 4YJ3B 1LPNA 5A7FA 2GJ9A 4X6YA 4L74A 3TZQA 1NJSA 1U1CA 3RYCB 2CMHA 2PL5A 2L19A 2WJ4A 3OE5A 1IEVA 3VHRA 4LGMA 2EP5A 1SCUB 5BWCA 4GL4A 3Q7EA 3KWLA 3GOQA 3ZWOA 2K5UA 3T7RA 4GP6A 4EKDA 1A9QA 2EOAA 5EJIA 5DT2A 1Z17A 4HWOA 1GA4A 8ATCA 1Z73A 3QX7A 3ZCQA 2IIPA 2GEBA 3CW9A 2XB4A 4EX7A 5JQWA 2M32A 3HA7A 1DS6A 2C9BA 1M2JA 3KS9A 2YVKA 1DDGA 1SD1A 1FMCA 4PW0A 3RREA 1T9KA 2BGLA 3FJYA 1X70A 3AKCA 3ENVA 3ND6A 4G2TA 2VPZA 3GR6A 2ZYSA 3N7UA 4H1VA 5TJHA 4AYTA 1A72A 3AILA 1XNQB 1D0VA 4DMLA 4UNIA 5BRNA 2DEUA 3UKDA 3FBTA 5FYDA 2NVUB 3QVGB 1MUUA 5TEVA 4QWWA 1QHYA 2ZRJA 2MR6A 4Z0HO 5DNAA 3TLXA 4QOFA 5A62A 3U0VA 1CB7A 4YT5A 4R83A 3SU8A 2FUEA 5EJ6A 4UOEA 2G4LA 2V3WA 3HDGA 4WOPA 5L9AA 2YZNA 3QSYA 3GFQA 4YP5A 4KWCA 5B4UA 3VJKA 1U3CA 1VB5A 3V32A 2JG3A 1I2CA 4BNMA 1M6EX 2GNOA 1NVKA 1ORIA 1ZD8A 2FEWB 2X8LA 1XCOA 3FPGA 4XVUA 3F8SA 1YQTA 1OI2A 1RABA 1OTHA 3DYIA 1W2HA 3ZI4A 4K9OA 4RZIA 1XV5A 4ENUA 1X8KA 4U0KA 4MWTA 1BVHA 3F73A 4GOKA 4R2IA 5FR2A 4GOMD 3IURA 5A7HA 3SQXA 3X43A 4O0MA 3DD1A 4ZCSA 3A3PA 2J59A 3UV3A 1RWQA 3VKHA 3C6XA 3QSGA 1IB0A 2XGGA 3D6NB 2VNJA 4Q19A 1TPZA 2HWYA 2PWPA 2H1IA 3R9XA 4B4DA 1MTOA 2IEYA 1U0LA 3KHKA 3OT1B 3HBMA 4O2BB 4O2RA 4HPWA 1FSSA 4PZLA 5HCUA 3NP7A 2DTDA 3B1XA 4LX0A 3ZKWA 4EB6A 1GKUB 1YZLA 4AW9A