2QSUA

Structure of arabidopsis thaliana 5'-methylthioadenosine nucleosidase in apo form
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
247
structure length
247
Chain Sequence
EILRPISSVVFVIAMQAEALPLVNKFGLSETTDSPLGKGLPWVLYHGVHKDLRINVVCPGRDAALGIDSVGTVPASLITFASIQALKPDIIINAGTCGGFKVKGANIGDVFLVSDVVFHDRRIPIPMFDLYGVGLRQAFSTPNLLKELNLKIGRLSTGDSLDMSTQDETLIIANDATLKDMEGAAVAYVADLLKIPVVFLKAVTDLVDGDKPTAEEFLQNLTVVTAALEGTATKVINFINGRNLSDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 5'-methylthioadenosine nucleosidase
publication title Molecular determinants of substrate specificity in plant 5'-methylthioadenosine nucleosidases.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 75
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 3.2.2.9: Adenosylhomocysteine nucleosidase.
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qsuA00
1VHJA 2AI3A 1YBFA 4M7WA 5B7PA 3BGSA 1NW4A 5F78A 4NS1A 1Y1SA 2A0YA 1PW7A 1OTYA 4WKOA 3BSFA 1Y6QA 4DA0A 3DJFA 4GLJA 2OC9A 1A9RA 1Z34A 2Q7OE 1WTAA 1T8SA 5I3CA 4TXHA 1JPVA 1TGYA 1VFNA 3TL6A 4GKAA 3LA8A 3K8OE 4QFBA 2A0XA 4YO8A 4OF4A 1ZL2A 4TS9A 2ON6A 4DAOA 1Q1GA 4G8JA 5F73A 3ENZA 3F8WA 4BMZA 4M3NA 1ODIA 1Z5PA 3QPBA 4RJ2A 4D9HA 1CB0A 1A9QA 1RXSA 2H8GA 1Y1RA 5CYFA 4EARA 3FAZA 4LNHA 4L0MA 4X24A 1YQUA 4NY1A 1RXUA 3U40A 4OGKA 5EUBA 5K1ZA 1K3FA 1SQ6A 4IP0A 1VHWA 1XE3A 2A8YA 4WKBA 3BL6A 4DAEA 2QSUA 1Z35A 3KUKA 1V4NA 5C80A 4G89A 1TD1A 3PNSA 3P0FA 3OZEA 1CG6A 1PK7A 1PWYE 3ODGA 3GGSA 1T8YA 1TCUA 2HN9A 1V2HE 1A9SA 2ISCA 3KU4A 4QAQA 3OZDA 5KB3A 4U2KA 4BMXA 1RXYA 1G2OA 4F3CA 4DARA 3O6VA 2BSXA 5F7JA 1K9SA 1TGVA 4D8YA 5EFOA 1T8WA 1Z36A 2HRDA 3EEIA 4PNPA 4JOSA 4TTIA 1A9TA 4UC0A 1RT9A 2AI1A 5FAKA 3FUCA 1PR5A 1Y6RA 2QDKA 1YRYE 5CXQA 1SD2A 5CCDA 2P4SA 1JYSA 3OCCA 3UAXA 1M73E 1U1CA 3NBQA 4TYMA 1YQQA 3E0QA 5IFKA 4TXJA 2HSWA 2I4TA 3DP9A 2OECA 3KVYA 4ECEA 4QARA 1PR4A 3EUFA 3KVRA 4GMHA 4MARA 5F77A 4F3KA 3C74A 1SD1A 1JDSA 1Z5NA 1Z37A 1T8RA 2QTGA 4R31A 3OPVA 1PR1A 2IQ5A 3EUEA 3MB8A 4NSNA 3DF9A 3DDOA 3IEXA 4K6OA 2XRFA 2I8AA 3FOWA 4YNBA 4L5AA 1OTXA 4QEZA 4TTAA 4TXMA 2OC4A 1U1GA 4WKNA 1Z5OA 1PKEA 3OF3A 3LGSA 3KVVA 4GLFA 1YR3A 4L6IA 1JDZA 4LKRA 4L5CA 1LX7A 3BJEA 4OEHA 3IOMA 3EMVA 4LNAA 4KN5A 1FXUA 1ECPA 4BMYA 4F2WA 3INYA 4E1VA 4OJTA 1PR6A 3UAVA 1ODJA 1U1FA 1RR6A 1I80A 4JWTA 1A9PA 4QASA 2B94A 5ETJA 3UT6A 4R2XA 1RXCA 2QTTA 1Z38A 3OZBA 3UAWA 1JDUA 4F1WA 4FFSA 5JPCA 1QE5A 4D8VA 5EPUA 3O4VA 1ODLA 1ULBA 4DABA 1V45E 2AI2A 1ZOSA 1PR2A 3T94A 3D1VA 3PHBE 4L5YA 1NC1A 4I2VA 1OV6A 1V41E 1A69A 4H1TA 3OOHA 1LV8A 1JDVA 5F7ZA 1PF7E 4TTJA 3FWPA 1PR0A 4YJKA 4EB8A 1Z33A 3GB9A 5B7QA 2A0WA 5CXSA 5F7XA 1OU4A 3NM4A 3UAYA 1JP7A 5F7OA 4LZWA 5CYGA 5B7NA 4OY3A 1Y1TA 4D8XA 1NC3A 3ONVA 3FB1A 5DK6A 2PGAA 3UAZA 3DPSA 1ODKA 1RSZA 4G41A 3KHSA 4TS3A 3K8QA 1T0UA 3OZCA 1PK9A 4BN0A 1A9OA 1V3QE 1JDTA 4YMLA 1U1DA 1JE1A 2RJ3A 1Z39A 4F2PA 3PHCA 4MCHA 1N3IA 4DANA 1LVUA 5F76A 3LBAA 1Y1QA 2QPLA 2AC7A 3PNPA 3NM5A 3MMSA 1RFGE 3SCZA 1PBNA 3FNQA 4D98A 1TCVA 5IU6A 5CCEA 2OXFA 4PR3A 4TXLA 3E9ZA 5B7GA 1U1EA 1SJ9A 2HWUA 3E9RA 1B8OA 1C3XA 4LDNA 1B8NA 4M1EA 1VMKA 2GUWA 4MCIA 4DA7A 1ULAA 1OUMA 3NM6B 1RYZA 4WKPA 4DA6A 4OGLA 4P54A 3P0EA 1OVGA 1V48A 4JP5A 4WKCA 1JE0A 1RCTE 4DA8A 4QATA 1K27A 4R2WA 4TXNA 3OOEA
chains in the Genus database with same CATH superfamily
2VJLA 1WZUA 1WXIA 2HL6A 2YMLA 1JYFA 1PFUA 3L7OA 1WUIS 3R09A 3REFA 1XPUA 3ZDAA 3ZV4A 5CA0F 1RABA 5IJAA 1N36B 2FLVA 2P6UA 1IN1A 1I5OA 2R5FA 4RH1A 4OHWA 1ZUIA 2G25A 2RHHA 4TL8A 2EP7A 4B4VA 2W8ZA 4BO1A 1FK8A 3ISTA 1CR4A 4D5GA 5JWRA 1U2PA 1QMPA 2GCOB 4MUNA 3F5QA 4LJ9A 3VHXB 3FYDA 4NS1A 1CVLA 1JG1A 1G3MA 1U0HC 1Z75A 2G6TA 3CE6A 3FZGA 3LOUA 4GBMA 3CYFA 4PQEA 4AKIA 3AINA 4HG2A 4NAUA 4WEOA 3ZI0A 1VPWA 4IKOA 4DLLA 5DJ5A 1YWGO 1KSJA 2B82A 2GWHA 2ZVQX 3HACA 1X7ZB 3TQIA 4II3A 1SC9A 3CWQA 5FH9A 2WNHA 2BTOA 3HP1A 4ZP1A 1C0IA 1MJNA 1JQ5A 1GZ5A 3LP6A 2V7BA 4PRYA 4EYSA 4KUEA 1VB3A 1VFNA 3H5AA 1XVLA 1JJBA 2IF0A 1M1UA 3KT6A 2FW7A 3WMEA 4QXOA 1E0DA 1XWIA 4FYVA 4PFSA 2JVIA 4V0KA 2H2GA 4MS4A 4P2GA 4PVCA 3ZBPA 1MBZA 1SZPA 2W90A 3LQYA 4I8IA 4RIIA 5FEUA 1T1RA 1WVMA 4GUAA 2ZUTA 5DBEX 2Q8PA 2XI4A 4JUIA 2Y67A 5FWAA 3UPUA 4OX9B 5A0TA 5EP4A 1FP4B 1PV2A 1ZD3A 2O8BA 1UKVY 1U8FO 1XTZA 1C1XB 2SCUA 1QYRA 4I9GA 6Q21A 4GU5A 1DEKA 4RM3A 1KEZA 2QJRA 2QVXX 3C16C 4N4AA 4YCNA 1ZCZA 4M9SA 4DRXA 2HJSA 3A2MA 2DTXA 1ISMA 2ZCVA 1GLVA 3C3WA 1PW5A 1RI5A 3DVSX 3OQHA 2FP4B 4ZVSA 2KHZA 3UANA 1Z8NA 4PZDA 3WLLA 5AVUA 5K03A 1XXHE 1QOQB 4WCFC 3JALB 4OKNA 3WGVA 2HA3A 1B26A 2GJ8A 3TJRA 2WB2A 2X22A 4X24A 1EESA 5J47A 4WZZA 1YQUA 4CIVA 1GNPA 2P2ZA 1ZVMA 3HJCA 3OU2A 4YH1A 4AF8A 3ONFA 3PHHA 1HLFA 4CJXA 1ONOA 4GOND 1G5IA 3IMEA 1YIOA 1NN0A 5SZIA 2LGJA 2WAMA 4EUHA 5H9VA 5BV1A 1KYQA 1VE6A 4MQ4A 5JYEA 1U5BA 3EXIB 2J6IA 3UJ3X 1DQRA 3ZCTA 3OO1A 2A8YA 4ZO7A 1Q83A 3ZCPA 2OCBA 4J16C 1YNOA 4QRDA 1WUKS 4JWKA 1QB7A 1K92A 3KLNA 1BXZA 3ZHUA 2VTEA 3RM3A 5KUTA 1V7QA 5EC8A 4PYIA 2FHSA 3EQZA 3BMNA 3J81A 3ZX4A 4NEQA 1X0XA 3AU8A 4B85A 1KBOA 3BL8A 4WBNB 4MPPA 2C97A 1IIBA 2H16A 4F5EA 1E4VA 3JQRA 3UV7A 4X97A 2LIPA 4QPZA 1U0FA 2I8LA 1DQSA 3AHJA 5ALPA 1J06A 4I19A 1JMKC 3D8NA 3G85A 3H2KA 4QVGA 3TBHA 3HBJA 4HVCA 2V7VA 2IYVA 1EDEA 4N0MA 4NG5A 3G1WA 3I2YX 3P0FA 1OH8A 3QLVA 4ZCIA 1U2QA 4KXVA 1RM3A 1EXNA 5BRNA 3ERCA 1YCFA 2CXTA 3F3SA 5E6RA 1C9NA 1YCHA 4KXQA 1X77A 1AS2A 1C3EA 4LRTB 1EK6A 4HNGA 5DTJA 3OMXA 1U11A 3NYRA 1JPJA 3FJOA 4GVXA 1GSIA 2B6NA 1VSQA 2HDHA 4BMVA 3WAKA 2G5CA 2OAGA 5L7WA 3ZXYA 2C8JA 5AM2A 3SG0A 3G7SA 4B74A 1GGKA 1TCUA 4IJQA 1KMMA 4QUIA 4Y2QA 5GP1A 3GEDA 3CH7A 4PBSA 5CNMA 2NLOA 1Y9JA 3R5TA 3BDVA 2ZSHA 4MGYR 1UH5A 4C3ZA 3TZ6A 2XY4A 2PIAA 2VYND 3OP1A 3HYTA 3JARB 4YQFA 1MGPA 3TPCA 1I0ZA 4RETA 5EFZA 1YR1A 4LDJA 1K6XA 5MN6A 3EAFA 1NVAA 5IUKC 4HB2A 4CCWA 3U3MA 1RXYA 1R64A 4HEQA 3TNDA 3LK6A 2Q3HA 2PQMA 3TOSA 2XGOA 2ODAA 3ZQ6A 1OLOA 3G89A 3IO3A 2BHLA 5CIQA 5FQNA 3T5CA 4L3WA 4DYDA 4XWWA 3FSGD 4YAJA 3PZRA 4OQFA 5JAZA 3RDPA 3LGXA 9ABPA 2NPIA 1TAGA 1T8WA 2PLRA 2PS0A 3QUSA 1PSWA 4X41A 3UMGA 2QAGB 1DNPA 2NUAB 1ZS9A 4KQ6A 5J5VA 1HE4A 1NE7A 2ZYRA 2O19A 3WHLA 1OH6A 2CNOA 2J41A 1L9KA 1PS8A 4U39A 1JLLB 5DDIP 5TY0A 4A6XA 4ZFNA 1A9XA 1AJEA 4OV6B 2GO7A 4JOCA 3M9XA 1P17A 5EIOA 4CKCB 1RT9A 1H42A 3CEAA 4NS4A 2AEJA 4RAOA 3ZE8A 5HKOA 3KJGA 3JASA 1Q57A 4AJHA 2RSLA 4D43A 3WL4A 3TUIC 1G7TA 1WNTA 4EF6A 2N3ZA 3M4XA 2P5UA 1OWPA 2RAPA 2NUPB 1E4EA 4ARZB 5HOEA 5EMMA 2V9PA 2Z6AA 1GG9A 2J3QA 5CCDA 1C30B 3JAKA 1JDBB 1P0IA 3DH0A 1K89A 1XDZA 3QW2A 4OO3A 5DYYA 1N33B 2E7ZA 4U1RA 3T4EA 4EJSB 5JYBA 2YFKA 3WO1A 2WQZA 4RHTA 4RF5A 3QMVA 4DREA 3R8CA 3EBLA 5DULA 3G49A 4I1UA 8ATCA 3ILSA 3ETDA 2G40A 2X9VA 1SK8A 2H9IA 4QARA 4MUGA 3L8ZA 3S8MA 4AO7A 3DBHB 3HBAA 3ZGXA 1J8YF 1NGSA 3HN2A 5AVZA 2O57A 4F3KA 4ZHSA 2FFBA 3FUUA 4P3NA 1GDHA 1P81A 4IQ8A 1XDUA 1Z37A 3SGLA 1EIWA 3DAHA 3X2SA 4CIBA 4LJRA 4Q4JA 5I9BA 1S8FA 2P2DA 3RTBA 2GD1O 1PR1A 2PR7A 5BPHA 1N34B 5CHYA 1CXZA 5K3DA 4BEBA 3YASA 3BEOA 2RGXA 1KK2A 4KBFA 5CURA 4F97A 2ZE8A 1JLHA 2HIGA 2F1RA 1SUIA 3L8DA 1PNOA 3TRJA 3MT9A 1X7WB 3FJYA 3Q0IA 3VI3B 1HNWB 1J39A 3FOFC 2EZTA 1TA9A 2LR0A 4D9GA 3DTVB 1ZINA 3CX8A 5JNTA 1L8QA 3UUWA 3OQBA 3UHJA 1D7OA 2M9MA 3EXHB 2PGDA 3K2EA 1NVWQ 2H0AA 4O02B 4P7FA 2LXNA 1TQ8A 4C3VA 4D3SA 2EEZA 5JAOA 2XRMA 3W90A 3WZMA 1J25A 3PYMA 2XTAA 1KORA 3EMKA 4TLMB 1NVTA 4BVKA 3KQUA 1KOGA 2AOUB 2EFEB 3W3ZB 4C2BA 1XLTC 4I6GA 2ZIWB 1H9BA 3CUSA 2GYYA 3W2GA 2I9KA 2EKZA 4IV0A 1LFAA 4MDHA 1ACLA 2CLKB 4JIMA 3JWJA 5EUCA 3GN2A 5KYWA 1YZQA 4EHKA 5JTUA 1J99A 2NO9A 1W49A 1ZR2A 2QRUA 1FW8A 2H4JA 3LLUA 2R25B 1BHJA 1GQRA 4KUHA 1NP3A 1LSOA 1GN9A 4Y2RA 2WFAA 3RVSA 4G0OA 5T6MA 4WFKA 2IDKA 3FF1A 2O5CA 3P9YA 4XUEA 1DIRA 4R6WA 1W2HA 2BGUA 4NFHA 5KDOA 1NVUQ 1VL0A 3JS5A 5FWXB 2W7TA 3LQKA 3O0TA 4PRLA 3ROFA 1GVHA 4YUYA 1NSFA 1NVVR 3K9WA 3MJSA 3V33A 3UXEA 2PUGA 4N65A 1MV8A 3AQIA 3BCUA 1ZC3A 4HPXB 2B94A 5LBTA 3VYSB 4RKEA 2E5LB 1LS1A 2WMOB 4M0EA 2VPYA 5AI4A 5DSXA 4BNLA 4EYEA 4RE6A 1TYEB 3AL2A 1JXQA 3H1TA 2ZUWA 3P4YA 4GOLD 4OA8A 3TZCA 4EG0A 1VZ2A 5M5BA 6ABPA 1VBNA 2YZGA 1HE8B 3K96A 4ZO8A 5LDGA 2VUSA 3BFXA 2KBEA 4IR7A 1J24A 5FLYA 4RTJA 3Q98A 2Z1NA 2QMYA 1P2GA 4OYLA 1YV9A 3B5IA 4NYJR 4DKJA 4HGPA 1OB2A 1QV6A 1IWOA 1V7ZA 4TTQA 1H3NA 2RDMA 5HE9A 3BK1A 4HH4A 2Q7DA 4PYNA 4L8VA 2YN0A 3UWSA 1ZVVA 4N6GA 3C8MA 5ICMA 3BIJA 2R7AA 3SR4A 1II0A 4MA4A 2ILVA 5AI8A 3ND5A 1B1CA 1HT2E 3FJ1A 1ZKMA 2F3PA 4IYJA 1RHMA 1Z73A 4AIIA 5L4SA 2ZGVA 4MRNA 4RJJA 1A2QA 4D9MA 4FIDA 3IL2A 3BF8A 3PE4A 5KMGA 1YBVA 1KOLA 3NOXA 4UQLA 1SKQA 3L0DA 2WY2D 1Z0FA 1RP1A 1KZ4A 4P3KA 5IRCD 2H2AA 1RAFA 4X7MA 3OD1A 2X76A 3F5DA 1SC6A 2JAUA 4FFVA 1CR1A 3OQVA 4CMAA 4DN6A 5C3MA 3FYUA 3HUFA 2GKGA 1LDGA 1VJ0A 4XIYA 1D0SA 3SC2A 4Y2YA 3GC6A 4OQXA 3KEQA 1GQOA 3THYA 3EBOA 4GPBA 2HXGA 1O5IA 3E58A 5EWJB 1ZQ9A 3E8XA 2YL2A 2O2EA 4O25A 1U8TA 3ZJTA 1M1YA 3WMRA 4B32A 4CLEA 2HSEA 3QFTA 5K0LA 1E2HA 3PXUA 1XJCA 1Y1KE 3DLCA 2XSZA 4N5IX 4E13A 3EEQA 3OZCA 3ZNNA 2GK6A 5F1YA 4B82A 4BC1A 5K0TA 2WJ3A 1JR6A 4TL6A 3TD9A 5L51A 5CX1B 1U1DA 1AY0A 1MU0A 1PZXA 3NXSA 4MV7A 1R4ZA 1U6IA 2NU7B 1W87A 5L6MB 3U7GA 4AYXA 2UUPA 2WM8A 4O2BA 2OV6A 1DZ3A 2BGWA 1JFTA 3H9JA 1M6NA 3PUJA 4MUIA 4MVWA 1ID8A 2H85A 4CIYA 1UADA 2VTKA 4Z4GA 2A57A 2WKRA 4FX2A 1VE5A 3PCTA 4CTKA 5BNZA 1PUIA 2H1OA 1ECJA 1VXOA 1SFRA 4JJ8A 3O4IA 1JSZA 3VO9A 4EZIA 4I55A 2O5RA 3D6AA 1IXRC 1HWYA 2IDZA 4IQ4A 4JU9A 4MKZA 1H2YA 5JEEA 1KQOA 4KQGA 3DXFA 1SCKA 1W85B 4HFRA 3RAPR 2YS7A 1TVEA 4NF2A 1BYIA 2AC7A 2JLQA 1G16A 1G20E 3SDBA 3SFZA 3M3HA 4LVCA 4G9EA 4XFKA 4EB6B 3KLMX 4B3BA 1R5OA 4N12A 1QJCA 2F3RA 2VPZA 3EJ6A 1VI2A 2DSTA 3FNQA 3KDAA 1E3WB 5L3RA 4R71A 2BONA 3IQHX 4DL9A 1GTRA 1QF7A 1RM0A 1TK2A 4RCYA 1EDZA 3L6BA 5CCEA 1U0OC 4GE3A 3RRJA 1Y7TA 4J4TA 4BMCA 1OAOA 5TPZA 1GP2A 3EHDA 3K0FA 1UZUA 4EJ0A 3AFOA 1N7IA 2FR1A 2XT0A 4PR3A 4PYJA 3TGPA 3H05A 4J0JA 1AZWA 3KAQA 1GCGA 2I7XA 1I7PA 3TFQA 4B6PA 4YUVA 3A9UA 1Z4JA 1IK4A 2PX2A 1EP2B 3R41A 4M83A 2ZLBA 4EB3A 2NZUG 5D84A 3KDSE 3NPAA 3RYIB 4BVFA 1M76A 2ZCJA 3MGGA 4FILA 4HQRA 5JW6A 3SFVA 3LFTA 4REQB 3WLOA 3UAOA 2EOAA 5LSAA 4KQEA 5BWNA 4JIGA 1N1EA 5DOZA 2ZPTX 3IXMA 3ZDBA 5DBFA 2I78A 3DC7A 1M2VA 4YALA 3HB7A 4BRUA 1XZKA 4L2IB 4YMVA 3ROQA 4IQ0A 1TO2E 4DMKA 4RFSA 2X23A 3C4JA 3E9DA 3M1IA 3LXUX 1JA1A 2YWGA 2DECA 3DFIA 2ZYVX 3GA7A 4IIGA 4XGIA 4OG2A 3WB2A 4ZMSA 2XIQA 4A6PA 2WJJA 3IQIX 3QIAA 4UHHA 5FCDA 1II9A 1BKDR 1DSSG 3VKWA 5C7OO 4EFNA 4OI0A 1WG8A 1CNFA 2GK4A 2JFVA 4GGPA 4CEHB 1T6YA 2UDPA 2HHLA 2VJCA 1N1GA 2ZJYA 1KRXA 1R7RA 2Z2JA 3RH0A 1FRZA 3AVUA 4U3JB 3LO5A 1EB9A 2VXYA 1BN6A 4PAOA 4WECA 3WB1A 4L51A 3UV6A 1K98A 2Q6LA 3F46A 3RHZA 4EW3A 1YRAA 1JMYA 2VS1A 4AF6A 1H23A 821PA 1Z0UA 1B76A 1VKRA 3NAMA 3WOHA 1ZOPA 1X7YA 2B8TA 3KQYA 2NV6A 1ML3A 2VOJA 2X9QA 2Y1CA 5EESA 1GV0A 3SLKA 4D0LB 5KTMA 4CKBB 2FVYA 2QW0X 4Q1FA 4YJFB 4YMGA 3L02A 1YQXA 3CRW1 4O4JB 2AMVA 1F2TA 1EIZA 3CISA 2UV8A 4ZQBA 5JH7B 1ENYA 4WNAB 1CUJA 3ELDA 4RA9A 3MQFA 4BVGA 2YZ2A 3PJFA 2YICA 3N5CA 2IGTA 1J9EA 3A9RA 4C05A 2DTDA 3EG9A 4ES6A 1XDGA 5JJCA 3T1HB 5JSZB 3ETNA 2XWJI 1C1HA 4D45A 2WILA 2JD2A 4EJ2A 3T5TA 2D62A 4GVPA 3ZWCA 1XQVA 4IPTA 3CSDA 2G4LA 4I50A 4W1PA 3ORYA 1NW5A 4AI6A 4BBPA 1AXRA 1TT5A 3BHIA 1OWMA 3NDRA 3QGMA 4ZYUA 4GPAA 2EKBA 4F9TA 2WWWA 3MINA 2M98A 1PKXA 1KHHA 3TL6A 3CX7A 4FNGA 4IMIB 4ER6A 3HV2A 3W5CA 2QLNA 1Z5GA 3GD5A 4L3OA 4TTPA 2CHQA 3ADKA 4RO0A 4WY5A 4OXXA 2NUTA 1C80A 2ECFA 4KI0A 1KMHA 2DHCA 1NW7A 3OT4A 1FYDA 1N75A 3K0SA 1KFKB 1U3GA 3S68A 4ND2A 3N76A 4B8WA 1M6HA 5EXDA 1CB0A 2D0IA 2J5KA 1A8QA 3OD5A 5EE9A 3W5VA 3O8CA 4R7ZA 1VJTA 1M9NA 2QT9A 4B5KA 3JAWA 2QAJA 2ZITA 3DYIA 3QX8A 4NEHB 4IIBA 5KNLA 4B3TB 3DEJA 3C3AA 3DEZA 2HH9A 4CT4B 1VKHA 2BFMA 1IY0A 1E2PA 1JLRA 1QHYA 2FSVC 2OO5C 2VKTA 3U17A 3VOTA 4DLBA 2XB4A 4BDSA 5BV2P 4IJ6A 5J5AA 2Z2IA 5CLGA 4LNHA 1VFPA 3VR5D 4NJEB 3AR6A 3SZUA 1WMDA 3RSLA 1QFZA 3UOWA 3ZKWB 1TF5A 3CCFA 1THMA 1WSAA 4B4DA 1G8GA 1YR6A 2HREA 4HXYA 3PB3A 5TQ0A 4K7JA 4PLCA 1P33A 5ENDA 4ZXPA 3N2YA 3U7QA 1JIJA 4JT8A 1C7EA 2QZZA 4DR7B 3THOA 3PGVA 2BFFB 1Z0IA 2Z43A 3O3OB 4AD8A 2IYZA 2Q4DA 1G21E 2PH3A 1WULS 3B9QA 5ADHA 4C04A 2GF9A 3VU8A 5DISB 1PZFA 3E53A 1RNLA 1N8KA 4WFIA 5BYJA 1JU4A 2VWQA 1PFGA 3QY9A 4MUMA 1DARA 1OC2A 1CD5A 1NURA 3AMVA 5FHRA 4D42A 2D59A 3ENWA 1LS6A 1Q20A 1LBIA 2C0PA 3F74A 1IZZA 3T3EA 2CK3A 1AGYA 1E5TA 4GQBA 3T9AA 4R9RA 2QN2A 4HMPA 3UKDA 3NT4A 1WQ4A 2ZULA 5HVNA 3RAEC 1RBZA 1T9ZA 2BGKA 2I4MA 2XDWA 1QFXA 1G1AA 4DCCA 1P0CA 1PG0A 1SAYA 4CM1A 1TTTA 1DJQA 2DULA 4NBLA 5LNK1 2V7QA 1E2UA 1G20B 1K8YB 3RVMA 1MJHA 3O3CA 4QNRA 1Z5VA 3BB3A 1CUGA 5FOTA 5TC4A 1BC5A 1UC8A 4ZI7F 1T4GA 5B2EA 4ID3A 3AVTA 1PK7A 3MWFA 3DVAA 2AGVA 1YOVB 4CV0A 4RJIA 5JZVA 1ODCA 4O59O 5JWHA 3PE3A 1DCFA 4IYRA 4MK4A 2RH8A 4TWAA 3ZWMA 3IEMA 3MTAA 2P2GA 1IUKA 1EM8A 3PQ6A 5HJ2A 4CVNA 3C3CA 4P3OA 1K06A 4IDEA 1V2HE 1Z13A 4X8HA 2GN0A 3TSAA 3P0RA 4LQ4A 1RPAA 4NU8X 5GGYA 4G2NA 3EXAA 1E9FA 2EC5A 4O4JF 2WE8A 1XSEA 1Y3CE 4RD1A 4QUAA 2AV6A 2VJQA 3ANYB 3HRHA 4P0TA 4PGGA 4TMVA 5KB3A 4F8EA 4UDOA 3VKGA 2WAOA 5K05A 3NU1A 3JD0A 3A37A 2VNHA 1WDTA 1MORA 3N2GB 3BB1A 1TAUA 1KMCA 3K35A 1T1EA 1ZJ4A 1FUKA 4NJMB 1QRTA 1NYTA 4A03A 2O7SA 2OFOA 1OYWA 3MBIA 4LVUA 2PUDA 2F4NA 4UBOA 2BP7A 2YMMA 2NSLA 3CNEA 1E2EA 4I1OA 2E85A 1EINA 2FR0A 4EY4A 4RTSA 3ZV6A 2GCNA 2UVPA 2IZ1A 2P3QA 3IE0A 1A4IA 3EBPA 3AJDA 2V97A 1KKLA 3L9XA 4Q9LA 4ABYA 3ZJ5A 4YLEA 3TIGA 2Q5FA 2EVWX 5GV8A 1Y42X 1ZXLA 2FQ1A 3I76A 1JBQA 1QGOA 1XZLA 3C3EA 3I9NA 5KWJA 3CTMA 5KHLB 1ONSA 5IN5A 3KR2A 3EXEA 3ILVA 4PSUA 3VI4B 4P86A 1RZRA 2PJRA 1B23P 1V1MB 4IIYA 1FUUA 3FCUB 1HZZA 2VJDA 3VYUB 4F72A 1V6SA 1N2BA 3KJXA 2WUFA 3M6WA 3RIXA 2E5WA 2FW6A 1NLYA 2OZKA 4AZWA 2ECOA 1H4VB 4JQYA 2BEWB 3STTA 2RGRA 1QZXA 4BYMA 4ESOA 5GVRA 5J2TA 4H9GA 4ROSA 4EZEA 4PYMA 5LZ7A 2W4MA 1U0EA 2HBYA 2WVGA 3CRVA 2CUZA 1EP9A 3EOAI 1YQQA 2JATA 3E0QA 3V6LA 4BVLA 5IC4A 1RU3A 3ZWBA 3TRHA 5IC6A 4DDWA 3OG9A 1J6UA 3P2JA 4D99A 3OPMA 5LZ4A 4I3GA 4HWTA 4L9AA 4MMYB 2C5EA 3I4CA 3RJMA 1PDOA 3ML1A 3P2IA 1BGXT 2I2CA 1MX5A 1PR4A 1SBQA 1G8PA 4Q48A 4CL8A 1Z5UA 2Q3FA 3EQ9A 3RSOA 1QOPB 2FCAA 1F0NA 3ESZA 3OI7A 3LT1A 5CH8A 3O9VA 3KLBA 4D80A 5DH9A 2JLUA 5BMVB 1PT9A 5LB2A 2NG1A 1N0WA 5AJTA 3I05A 1BJRE 2J9RA 4TLAA 3FR7A 1RDFA 4NBTA 1V5WA 4EX7A 4M89A 4GPEA 4G5OA 4EQZA 5IBRA 4K88A 2A30A 5LOVA 4O5OA 4UHEA 3SQWA 3GUVA 3NBZC 1DXOA 1UBEA 3KL2A 5G40A 3GRKA 1ZBDA 1U3FA 1I2MA 1VLMA 1OOEA 4QA9A 3U7HB 4PZYA 1GL6A 4O33A 4BP1A 3FVTA 3JQ9C 3FDZA 1H2HA 1I2BA 1KC1A 4YNBA 4DR5B 4AZ0B 2EBWA 1VPTA 4MVJF 1LQ2A 1NLFA 2E4XA 3P5BA 4OQEA 4N3BA 1M2GA 4AC9A 1IJKA 4GM1A 1ZH6A 4L4XA 1Z5OA 4XARA 3UC9A 1IG0A 3JD1A 1PKEA 3BUSA 1HSZA 3CUYA 4ZVVA 2DFNA 3QG1A 1Z9BA 1C7ZA 4B87A 1Y81A 2CJYA 3ZZUA 4CCAA 4TV9A 3K4PA 1CC1S 2J9ZB 2E4ZA 1WL8A 4EI7A 1GZ3A 4RESA 2CMGA 3QXSA 1ZFNA 4BGIA 4MO2A 1MFPA 4L5CA 4LHWA 4V0LA 3BJEA 4B3FX 1VI6A 3H2GA 3M5WA 3LMKA 5IVIA 5FORA 5TQVA 3SR0A 4BNVA 4GI2A 1T4DA 1EA5A 3AERA 4CM4B 1Y82A 2XAAA 4GX0A 2X8BA 3Q9NA 2B0JA 2FZGA 3EFOA 5HA5A 4DJ5X 4OMCA 1F4LA 2JLXA 4UVIA 3O73A 2QYSA 3R3UA 4D96A 1MABB 4COOA 3I58A 4CDGA 1FYFA 1GRNA 4MEJA 2ZBEA 3KM0A 4RLHA 3K6JA 5F3WB 2OZLB 1UXGA 2G8NA 1PYDA 1RXIA 4RLQA 3EJWA 3IPLA 4HUQA 1D8AA 4X5OA 2R8ZA 2CKDA 2W2LA 3BWEA 2HV9A 4Q4CA 1RLMA 2X1HA 4J7CA 4ON9A 2HRBA 3MMPA 1BW9A 4K05A 1CF4A 4BMSA 1S7GA 1OJLA 2YV1A 1E96A 3DR5A 5JIBA 4FGKA 4N0DA 1PJZA 3SBXA 4P9NA 1JWLA 3G8BA 3UICA 4ALJA 1Y7LA 1UC9A 2XTNA 3G6WA 4IFBA 4BVBA 3OAAD 1GY8A 7YASA 2X1MA 2C5LA 5CLFA 2Y77A 1Z83A 2L18A 2REXB 3ECCA 4F1WA 4UM5A 4UTPA 1G4AE 3JWGA 4JOQA 1AK1A 1MKYA 2YVQA 4QU5A 5EPUA 3RSSA 1C9JA 4WLNA 2JFGA 5FUQA 1MTZA 2CNDA 3F73A 3ANXA 5K7SA 5KJFA 4KDRA 1RC0A 4P81A 1E2QA 4F1KA 2A4KA 4KDEA 1GJRA 3LUJA 1GL3A 4WOKA 5KNDH 4KYUA 1SGWA 2JLYA 2ZKLA 2XXAA 3IIIA 2D7DA 1QHIA 5LMUB 1UEJA 3GZNB 2V9ZA 3H16A 1DKQA 2DYKA 5ED0A 5E0KB 3Q2KA 1NC1A 2I29A 3U4IA 4GXRA 5LUAA 4F4IA 5ADVA 1S8NA 3L4SO 5EPEA 3JQAB 2HJ9A 1KZ9A 4EGQA 1TMYA 3LYHA 1ZJJA 3CJRA 1VPEA 2OBYA 4DNXA 3WISA 4YAOA 1JRLA 1T1IA 2E4UA 3PJDA 3TR6A 4EUNA 1QH8B 2QJFA 3Q9UA 4LZAA 1T9CA 3KZ1E 1Z4PX 3N87A 3S27A 5IFLA 1EEHA 4MW4A 4N9QA 2FP3A 1HV8A 1YSCA 2JFYA 3CS3A 3GZJA 1D2RA 3IVCA 4DR4B 4NDAA 3WNCA 2RGBA 4FUTA 4FTWA 1TVKB 4YRLA 3VH3A 3VYRB 1MG5A 5BMVF 2QQFA 1MRZA 1IBRA 2XTJA 4LZWA 4U7TB 3KYIB 4IMJB 5GOZA 1IQUA 2XDQA 3OWHA 3RRFA 3ICEA 2AW3A 1ZC4A 3TQOA 3KKQA 1BXRA 1QRAA 4EO4A 4YJ2A 2QAIA 1CQPA 4KMRA 3CLUC 2C3UA 4E07A 4ZA2A 3K09C 2WEKA 3COWA 3UJAA 4A1FA 1F7VA 1BAPA 1KJZA 2BFEA 2VYFA 3E18A 5KYVA 1V3QE 1PV4A 2F3QA 1VB5A 1HXHA 1L3BA 1BCRB 2P9EA 2Q4EA 1DV1A 1E99A 1SCDA 3L0IB 3BFPA 2O7NA 4G3XA 3SQNA 3TDMA 3MJVA 3UK0A 5C1OA 1LB1B 1RKVA 2EZUA 4GOMD 4GR9A 1HRDA 3QVXA 2ZSIA 4K03A 4RUKA 3W34A 1SG9A 4P32A 2NO7A 3IUJA 3RAFC 1NUPA 1LEHA 1XL1A 1DJOA 1K4MA 1UPAA 3KD2A 3LBAA 4ZJUA 4KQMA 3QHQA 3NNSA 4MWZA 2EF0A 5E7IA 1NPTO 1WD5A 3KSRA 4J3FA 4NP6A 1FXSA 4BLRA 1MB3A 2HJVA 1A8UA 1ZESA 4Q9DA 2Z4TA 1BS9A 3RVJA 4X3OA 4B71A 2JFQA 1PGNA 4Y18A 1Y1PA 3QKWA 4IVPA 4CQMB 3H9GA 2CJPA 5AHWA 2EX0A 4UATA 1M7HA 1RFGE 3E3AA 3FMGA 2PO7A 4AJKA 5T4FA 1H5UA 1QG4A 4QEDA 1NTRA 1RYYA 4DPLA 3QZUA 1TXGA 4UHJA 2OCIA 5G0TA 2VSFA 3PUVA 4IJMA 4RMNA 1EFLA 3U44B 3CA8A 5EJ2A 4KAXA 2F67A 2L42A 4QRHA 3WIOA 1DAIA 4Y6GB 1J90A 1TEHA 2G07A 4GYJA 2G1AA 3ZU6A 3DMTC 4MUBA 3F98A 3ZJUA 4A4DA 4E94A 2HIAA 4EA7A 1Q0HA 1YH3A 1TZ2A 4RSHA 4DDTA 3OT1A 2XVXA 1THZA 4LECA 3PFWO 3PRHA 3VNRA 2QXUA 4LYFA 1B8OA 2I33A 2BR4A 3S1LA 3PFKA 5IK2A 3TQRA 4HPJB 4NFLA 4X7RA 3VPBA 1CEEA 3O1HB 4YT5A 4ZVTA 4LY9A 5L8VA 4N0QA 4RVHA 5KWSA 3UV3A 1N5IA 2JCGA 3I9OA 3NHFA 3U1TA 2BT4A 3DS8A 2FY8A 3JQGA 4C4AA 4QLBA 4YO7A 1JTEA 2QG4A 5GAJA 1ZY2A 4C29A 1QIJA 3SZOA 1H6AA 2VJBA 1A7JA 3CURA 1FYXA 3PD1A 3AXSA 1J0DA 1DAMA 2EGUA 1R10A 4JR0A 3G5TA 4WN9B 4XM2A 2OB2A 4OYYA 3ZE7A 4DSAA 2QE7D 1LLDA 2OD9A 3QI7A 4D4IA 5TARA 1EGHA 1XA4A 4LXUA 3T7RA 4ZU6X 1T3ZA 4DQLA 2O4UX 1I3LA 2I3BA 2OWEA 1FMFA 2KPOA 2YS6A 3T8YA 3L8HA 4RK0A 3RC3A 5AM3A 4KSBA 5CFQA 2A94A 3GP3A 1SEPA 2WE7A 2POQX 3CN7A 2XECA 2ZETA 3NTRA 1Y9ZA 3VDRA 3ZIAA 4Z5XA 5KNDA 3B3AA 4JT9A 1VYTA 4KREA 4DC9A 3AESA 3E70C 2M2IA 4QX6A 2I6XA 4PLFA 3ZBTA 1ML4A 3UFBA 3GAZA 4QYXA 4IICA 3ZXIA 4KSYA 4Q1BA 1GZVA 3EPHA 3LHSA 2AH5A 1R0WA 4MEBA 1GGFA 3WQBA 3ZWPA 4AN0A 1UBRS 1RBQA 5J40A 4I4TB 1RWXA 5DFAA 1XMJA 3O8QB 1L7OA 3AUTA 4QDTA 3CF6R 4RGBA 1JMVA 2BZ1A 5E4JA 4Y2SA 4L76A 1C81A 3PC3A 4PSVA 4PZ0A 5A9TA 3SD7A 1EBFA 3I61A 3UG6A 3UJDA 3GUHA 5A4IS 2JFWA 1KJIA 2CMHA 5CFOA 1ISGA 1VHDA 4MI6A 2A1TR 3MTIA 3OFSA 3TM5A 1O89A 1KMQA 3O95A 1BCSB 4B80A 2R86A 5DGDA 2EW8A 2FWJA 2EZ9A 2VR1A 3DMFA 1EFCA 4IWXA 4LCEA 4WXMA 2FUG6 1GGVA 1Y6QA 2DQKA 3GARA 2W70A 3OCYA 4MQEA 1IY1A 4ER3A 2YIVX 4GMFA 2PSJA 2DFKB 2V7WA 1JA9A 3H9BA 2YYSA 5LYJA 4Q12A 2R00C 4DRXB 2ZT5A 4C7BA 2GPYA 2O1SA 2B7BA 3L8FA 3M89A 4KO1S 3U9LA 4BJ5A 3PGMA 1RZUA 3A0UA 1XF9A 4DWVA 5BN3A 4JI7B 1N78A 3BFVA 2HHJA 2H4HA 1O97C 2XXJA 1ADFA 3GMIA 2H7XA 3PRKE 4I81A 2I71A 2JZCA 2ON6A 3GDWA 2R79A 2OFWA 1WE2A 2P2LA 5EMKA 5FNVF 3VDMA 4UTNA 1BWSA 1B6TA 1G4UR 1M2HA 1RAEA 3D8RA 2QD1A 5BOVA 4X44A 1J0EA 4AFNA 5G3ZA 2QR5A 2VQ6A 4IJVA 4C4TA 5ISMA 4RJ2A 1RVV1 5KQMA 3WWDA 4AB1A 4Q7QA 3GUZA 2H18A 2ONZA 4KUGA 5EQFA 3DNMA 1T5HX 2B4RO 2R9VA 3HZRA 5FBLB 3TOZA 1Q0PA 2NSYA 3HFJA 4GEGA 4NECA 1D4OA 3MRTA 2IXTA 4L4ZA 1ZCFA 1IK6A 3QVTA 5A1JA 5IUJC 1JFSA 3B5EA 4EGFA 2AEEA 1X1CA 5KO2A 3KQSA 1WVIA 1AB6A 2QVCA 3MIZA 4GWGA 4J03A 4TRRA 1X80B 3EZYA 5L53A 1FOEB 1R9NA 3GNLA 4QODA 2XUFA 3DEAA 5AIAA 2GKOA 1RXUA 4MX8A 2O8DA 3BCSA 1MF7A 3T1NA 1YD7A 1BD3A 1WU7A 2HHCA 4QGSA 5KINB 1UPUA 3UK1A 3CMCO 3O84A 1ZWLA 4FCWA 4QFMA 5HGXA 3HUEA 3KQVA 2C03A 5C32A 3SZ3A 2VDQB 2WU3A 4QOGA 1Q5PA 1L4MA 5AXDA 3FM9A 4G36A 1M72A 1B41A 5E6RB 1ZLYA 1BQEA 3GQBB 3LSTA 2ZCUA 4KQ9A 2VHEA 1XRLA 2PS3A 3IFSA 1JR2A 1VLZA 3AR5A 4LOAA 4OXYA 4UVEA 2QMQA 3NTLA 1OLSB 1U2TA 2MSCB 1I6LA 3ED5A 3QPDA 4I6EA 3U3OA 3V8QA 3K1YA 1AB5A 3W5SA 4R68A 2GD2A 2ZJOA 3DEFA 4D0SA 4JU8A 1L4NA 3DMNA 4XGNA 2H11A 3HL0A 3G9UA 1DC4A 1KC3A 5ESWA 2IV3A 3PTZA 1HYGA 4D6XA 2PUAA 1VJCA 2HKIA 3DV0A 5GZ6A 2G1UA 4P58A 3CPJB 3KEMA 2R8OA 3VHRA 3LCCA 4BB5A 2DP4E 3GJ7A 3IV6A 1NSTA 1QUFA 1S2MA 3D5EA 5JE8A 5L3ZA 3VR4H 3T95A 4ZPJA 4ZRNA 3W5BA 1KSFX 3N8GA 1SUSA 1JNYA 3B7PA 2W8BA 1Y3FE 3LT0A 4MJXA 2JLVA 1IL0A 4OJNA 3WDMA 4PZAA 2ATCA 2G09A 1KZGB 1N9ZA 1PZEA 4RFLA 1UT6A 5C1PA 5CVTA 3HNRA 2ID8A 4OB8A 3MTQA 4IFIA 2C7QA 3KJEA 3WWEA 4C5AA 1TM4E 3RYHB 3KQTA 1TYCA 3C8DA 3GFRA 1PCXA 5INTA 1E1CA 3MSXA 5FBWB 2Y6VA 3T7IA 4HQFA 4NLLA 5ELLA 1ABFA 1WM1A 4XB1A 1YB7A 1DKUA 3EE6A 4YY3B 1PE0A 2FSGA 3NVMB 1EFUA 2FJ0A 3ZHCA 4BNUA 2VQFB 5C8ZA 1VZ3A 1XZJA 3DOHA 2A9VA 1A4UA 1VLLA 3OJ0A 1IB6A 2ZSJA 3N8IA 5A5EA 1UBOS 1U5CA 2EHJA 2AOVA 4MPTA 1UXKA 3QEAZ 4FMCF 1XKLA 3KKZA 5D86A 2E1RA 3T3MB 3HMKA 1OKKA 2DQ4A 4H15A 3L06A 4RGVA 2ZFUA 1GKIA 4U2BA 3NB0A 4UCWA 3A9VA 5E6SA 4HRXA 5TX7A 2REQB 3OZSA 3FPFA 1WP4A 1OU0A 1PFVA 3ZIUA 1SKYE 3VZRA 1W34A 3V4LA 1QTIA 3BHJA 1Z2DA 4C7JA 1M1NA 4Z0HO 5G0VA 3ZWYA 1SO8A 1QAOA 4TV8A 5A5DA 2HV8A 3ULKA 5IPFA 1LPAB 3IYLW 2WTUA 1RE1A 4WZ6A 5CW1A 2H7CA 3OE4A 1F38A 3JTEA 4LOKA 1H9AA 1DDGA 4QULA 1OX4B 3GG2A 1IJFA 3ZV7A 4MR7A 1W59A 1IZ9A 1MO3A 2IYRA 2VDWB 1QGDA 3KUCA 5KC8A 1T5IA 4KRXA 5ECGC 1Z8DA 2JA1A 5A7FA 3VYTB 1X1SA 3SJCA 2KS6A 1CP3A 5TB5A 1R18A 3IRVA 5EZYF 1K7SN 1XUOA 1VPLA 3BORA 4E2XA 2AQKA 2P6NA 2IE8A 3GR6A 4BLTA 4IG9A 1URPA 5JS6A 3DLHA 1Y7PA 3ZY2A 5K8IA 4HDKA 2P4SA 5JTTA 4OSEA 4ID9A 3OVMA 4B43A 3D81A 3H9EO 4MYHA 5B1YA 1PHPA 1SZJG 2WF7A 2QN3A 5AW7A 3R6WA 4LV8B 4EYOA 2RG1A 4HNQA 4MWTA 3ZY3A 4CIXA 1W8IA 2ZRLA 3FPGA 1DO2A 3ZCSA 1JYEA 1P4RA 3NRJA 2PGNA 3BHMA 3S2ZA 1NZDA 3LLVA 1UBUS 4MEAA 4FGWA 1W4AA 4OQZA 2VT2A 1IB0A 2WTEA 2DPYA 3C45A 1K5GA 2Q8NA 3PUHA 4DUGD 5FWDA 3NKLA 1R0KA 1J0AA 3EFEA 2G9RA 3BDIA 1JFFB 2YW9A 3A9SA 4Q47A 2W6IA 3S1AB 4HL6A 3OLCX 2L0XA 1YZGA 4QPPA 1DL5A 4S05A 1ZCAA 4I5FA 4ER0A 3GLIE 4GNRA 1T1JA 1AMNA 4G5YA 1G59A 3KSZO 4WXHA 4PGMA 4IOMA 5ENZA 2I2WA 3D4PA 2GQ0A 2ZRKA 4JNKA 4MRVA 2B61A 2RHJA 4CNQA 2AG8A 2OCDA 1MW8X 1D9XA 3DBRB 1YI8A 4KTTE 2X8WA 1O08A 3T54A 4QPDA 1N2CE 2OBXA 2VHWA 2B5OA 3DF9A 3SXPA 3HDTA 4YONB 3RIYA 1LCIA 2P9JA 1NRWA 4UBLA 4CEIA 4DMRA 2CYCA 4BMNA 5C8YB 2BUBA 4LRWA 3SC3A 4B31A 2AEFA 4E70A 1KI9A 1GNQA 3NYWA 3DZBA 4INOA 1OA0A 4TVKA 4G0VA 2V9CA 2NP6A 2B4YA 4KBGA 4KXNA 1BE6A 2ADMA 5IWAB 1J1UA 4Z49A 5KVVA 3IA7A 3TKAA 1VKOA 3Q72A 3OIVA 1NYRA 1HBJA 3OF3A 4AURA 3LGSA 1XD8A 4TKMA 3GUYA 3GJRA 3VR4A 3W3AH 1WCV1 4CE6A 1OPRA 5BQ5A 4AIRA 4XJXA 3LP5A 1VGVA 3ESCA 4JVNA 1ENZA 2BGMA 3CLUD 4F12A 1P3JA 5NULA 4YR7A 1EVEA 1RJGA 1X2BA 2LCFA 4TLBA 4P80A 3TPFA 2J9GA 1SRQA 3KYCB 1SG6A 5ITWA 1GDTA 1DWUA 2H92A 2G9QA 3MMNA 4OEHA 3EGWA 5ALEA 2IFTA 2I6FA 1XQ9A 5B5SA 4A16A 2DXIA 4JT2A 5EA2A 5EWMA 3R7FA 4YYZA 2WTNA 5LIPA 1JR3D 4F4DA 3NHSA 4ISBA 4L9WA 4P92A 1RKXA 3HDJA 3LC0A 3B9PA 1Q11A 3BJZA 3LLCA 3MT0A 3OC0A 1KJNA 1ICEA 1C7RA 2R8PA 3CW9A 1ST3A 2TMDA 4DZRA 4F2WA 4MZXA 2BFDA 2PZJA 4G25A 2ZE5A 2FMIA 2O5VA 3CEJA 3IJRA 2JAPA 1WR8A 4FMDF 2C4VA 3NJ8A 1GZ6A 2AF4C 2BISA 2H07A 2H9AA 2Q1XA 2WNSA 1XZNA 4JR2A 1D4ZA 4WW0A 4XH9B 1P2VA 1GN8A 1I4TD 4XIJA 1QF6A 4UOEA 1MDBA 1YF3A 2R5WA 3KX2A 1KKMA 4DCSA 2BHSA 4DPKA 1GA1A 3QUAA 3THSA 3R0IA 1M0EA 3I53A 1QV9A 2JEZA 5A4KA 5IEBA 1T2UA 3E2IA 4M53A 4EFDA 3B48A 1JGTA 5COAA 4XOUA 5E7MA 5JXWA 1AMOA 3KWFA 4Q9NA 1QE5A 4URUR 5GJCA 1WIWA 1CK4A 1Q1BA 3H8WA 3O4VA 4WSOA 5EINA 5BUZA 1FF9A 4GQIA 1UP6A 3P2KA 1P4GA 1UFOA 1RRMA 2BEKA 2Q2VA 3H2ZA 3GLKA 2Q2OA 4J90A 1V1RA 1YVUA 2J30A 2VUIB 2Y4NA 3QXHA 4HB0A 2RGEA 2X0DA 3V34A 1D5CA 3T3PB 3SC2B 3GFOA 2D7CA 3DCNA 5FOUA 2HM7A 4K1LA 4M1MA 1TDJA 6GPBA 4RQTA 1QGED 4I08A 2J3DA 1M1YB 2Y0DA 2YWDA 2PAFA 3D1JA 4IEFB 1TM5E 2I3GA 2H2HA 5DN6D 3VX3A 2QY9A 1V4BA 4HDRA 3LY5A 3TI7A 5J5CA 2YQ4A 3F7MA 4TWIA 4KR7A 1BX3A 3KQNA 2Q29A 4D9JA 2PHZA 3DOIA 1XL0A 1DKMA 3OOYA 4HY3A 2CJWA 1Z08A 2V5UA 4C07A 2X0FA 2HDWA 2BF7A 2A33A 4BO4A 3F8TA 1TAQA 3F9IA 1WZ2A 3FUWA 1Q84A 5KOJA 1R16A 2VJAA 3WLIA 1OMOA 1Y8RA 5B30A 3OZFA 3R5HA 2AX4A 5CYGA 1IDOA 1R0CA 3B6IA 3LHIA 1KDPA 2VHYA 2R8YA 2IHUA 2R6FA 2VK4A 2ZTHA 2F62A 3A9CA 4I55B 4JLWA 5IMBA 2ZRAA 4RKYA 3ZZ0A 1G8MA 1HT1E 4G26A 4JH0A 4YBZA 5EYPB 2D06A 1W0CA 2EFDB 3EGCA 1NY5A 5P21A 2OENG 4B0PA 2FG7C 3RIMA 4M21A 5F12A 4QOHA 2FSFA 1IQRA 2MYUA 4PYKA 2F8MA 3ED1A 4G07A 2GTIA 4Q7KA 3TRDA 1CY4A 5HFJA 2MR6A 3MGBA 2ZI5A 1NZJA 1YUBA 1RBMA 1OPXA 3C98A 4FCCA 1NUTA 1EHYA 4JAVC 5HW0A 3KYDA 5F9FA 1C4KA 3K0FB 2C4UA 4LYGA 4O6VA 3PFGA 4RMIA 4LISA 4XLLA 4B44A 4IW3B 4PX5A 1P19A 1OC4A 3OJXA 2E4AA 1SK9A 2OP1A 3K2QA 3U6BA 2XH8A 4F46A 1CQIB 1RQ2A 3RUPA 3AOGA 5JCJD 3K0AA 1XNJA 4CM8A 2VXOA 2FWIA 1J2EA 3TIVA 1W0KA 4NIMA 1LUAA 2WJHA 2O2XA 1A5BB 1QIGA 3QUQA 1H66A 1OIWA 1ZWKA 2F9MA 2VNKA 2DKNA 2ZBPA 2J3HA 2YWJA 3W3AA 4QXAA 3WLKX 3PX2A 4V1CI 4B3XA 3MMSA 3TWOA 1NXOA 2D6FA 1PBNA 1WJGA 3MCAA 1JXAA 2HF9A 1ZJ5A 2LKDA 2PBLA 4M8LA 3UJPA 3VZPA 2NACA 1SZCA 1O97D 2UYYA 3LVRE 4BN4A 4DPMA 1I1NA 3WIBA 4QQFA 5BSVA 3BL5A 2I54A 1YB1A 1DHTA 4A10A 1YA8A 5AKGA 4PNEA 2RK6A 3SEQA 1CU1A 4QGFA 3DQZA 2P9FA 1XD2A 4H3SA 3C6YA 3NETA 1N2CB 2DZDA 1M8GA 2FNAA 2XYQA 1V95A 2XAUA 3B89A 3IVMA 3N58A 1G42A 5J2UB 4JBHA 4LDZA 3WFIA 2W42A 1D2GA 4AUEA 5JR3A 2Z4SA 2JAOA 6LDHA 3K6RA 4XB6B 4OKSA 4KGZA 4RD4A 1E1QA 1L7NA 3QKSA 4ZEOA 5EAIA 4QDZA 2ZYSA 3HVJA 1T8PA 2FPPA 3E81A 3ISJA 4LDRA 4PPNA 1G5FA 1NASA 1ZM3A 5BR4A 3HU3A 3RUFA 1W4ZA 3CRMA 3HLTA 3NM6B 4D8UA 1X7YB 3NG1A 1J8QA 1OLXA 1XEAA 5AKYA 1U7XA 3S7ZA 1UJMA 2Q3BA 3B3QA 3OWXA 3LAWA 5EY5B 3ZU4A 1SXGA 1BRMA 5JWOA 4URWR 3WJ1A 2FPIB 5BSFA 3MCTA 3K0CA 4TWRA 2C7OA 10MHA 3KR0A 4NDNE 1Z47A 2MYTA 2X4GA 5REQB 3QJ5A 1TUBA 2IYXA 3I3OA 1SXJE 4DCGA 1SPBS 3PEFA 4EUKA 3CRRA 4ARAA 4JJIA 1Z06A 2OT3B 1DFGA 3EG9B 3TXXA 5FR1A 3ICPA 4E6PA 1NULA 1QH9A 3DJYA 3VTAA 1NMSA 3BXPA 4GP9A 5EPOA 5MFZA 5ALHA 1O6ZA 1Q6YA 4BRSA 2AR9A 6CHYA 3LQ2A 3PNQA 3G9QA 4RLSA 3BMCB 4IJKA 4GX5A 4BUZA 3ZY4A 4WERA 1L4LA 2R6HA 2GJ9A 4UMEA 4EFLA 2BGJA 1JG6A 4E30A 5JNUA 1K3TA 1ADYA 3HZHA 4O2BF 4Z54A 5IZCC 3ANMA 1JHUA 4DM4A 3HP7A 3L2OB 4ICIA 1NV9A 2CXNA 2PV7A 3KP1A 2VNJA 5ALJA 4D8WA 5GZ1A 4B76A 1PVOA 1RZVA 1B0ZA 2AZTA 4DIKA 3TK1A 4M1SA 4AQDA 2Z0MA 3Q5GA 2NUTB 4B33A 1KMHB 2ZPUA 4HTFB 3E7PA 5F78A 3ADCA 2CY0A 4AG6A 4YJGA 2ACEA 1NHWA 4R54A 4TQUS 5G0WA 4UNQA 1FS5A 2N46A 3GN1A 3ELYA 1WXWA 1XX6A 1WSBA 3NUGA 4RM2A 3GMSA 2P0YA 4BZXA 4U7JA 4GLJA 4JASB 1Z6YA 4PBTA 3WRWA 3VA7A 3WYGA 3ZD6A 2ZUEA 2NWQA 3R7NA 1W44A 2O8EA 3GDGA 5EWLA 4AY5A 2FPKA 4RPCA 5HCUA 2GR9A 4OHYA 1U28C 1WEHA 2C7BA 3CTPA 3I9KA 4B6RA 3TLCA 1H0HA 4AKHA 1NFFA 4FJ2A 1D4FA 1HORA 2HNBA 1ETUA 1NM5A 3JPWA 3LQFA 3OY2A 4ZQCB 1Q7EA 1Q1NA 5FOQA 5T67A 1NPYA 2C2ZA 2QQEA 1LVGA 2JIZA 1AKWA 1H2EA 5B3KA 4YCDA 1UKAA 2B1RA 3BXXA 2JIQA 3FA2A 4FT4A 4G8JA 5G4LA 4PNHA 4ADSG 3AR7A 4P4SA 4RF3A 1KBQA 4OOEA 3S2GA 1T91A 2Y1GA 3K7EA 2W6ZA 3L8CA 4IIVA 1KS9A 1E20A 1RWQA 2X7JA 3HADA 4Y1EA 1ZOLA 3DLBA 3I12A 3OSUA 5CT4A 3LUHA 2UUOA 2JJQA 1UINA 1V16B 2PZMA 4JKIA 4ZGGA 1XU9A 3PEEA 4E5KA 4BFTA 4URFA 1KNXA 2YVUA 1HYBA 3B8EA 4TT3A 4UVGA 4E3ZA 1HE2A 3DLIA 3PQFA 4LEIA 4KGDA 4DADA 1EWQA 1FSZA 3FSJX 2J48A 5TGTA 3KB2A 2DOKA 2IZ7A 4DFDA 1QVAA 1DAFA 1NW6A 3I5UA 3IHKA 4MSUA 5B12A 1PR3A 3O7WA 3TPZA 4OAOA 1Z0JA 2D0PB 4MW7A 4U8GA 4LCJA 3VNVA 2WD7A 3T0FA 1AX9A 3WDSA 4R1QA 1CW2B 1P72A 2NO0A 2W6QA 3GDOA 3LL7A 2XOKA 4M1TA 4OVKA 4BOYA 1MRNA 1NVEA 4KQWA 5AW9A 1T8TA 2OXEA 2DE0X 3KIPA 3KTOA 3QYJA 4IP0A 4EJSC 1RMYA 1T5SA 4Q4LA 3WMFA 4F3NA 5MGBA 4LGYA 1R9GA 2PLAA 1YZYA 2V7GA 2RHMA 4EATA 1XFAA 2AB0A 1VRVA 1QG2A 3MJTA 1YTUA 3EWSA 2M1ZA 3K32A 1JAIA 3QELB 3UXHA 4MCJA 3I23A 4H7DA 3AC0A 3EQ2A 1XVIA 1WB6A 4RK4A 3LDHA 1R3DA 3P97A 4P34A 1WHSA 4RHUA 3KB1A 2X6QA 5ALKA 1MOZA 2CMKA 2BN4A 1A4RA 2YFQA 4MUJA 1UJBA 3QVLA 2EQBA 4OJYA 3WADA 2PUVA 1Z6TA 1AK2A 2E48A 4Z99A 5LDHA 4O8ZA 1I94B 4BNDB 2Q1SA 2HBZA 4A5SA 1WUHS 3MWGA 1P2UA 2JBAB 3VR2A 1VKJA 3U4CA 3EN0A 3C7AA 3HYRA 3W6UA 5LXTB 3DXZA 4F4FA 3CNHA 3AF0A 2R84A 3OZEA 4QUKA 3GRAA 2Q2NA 1U31A 3BZUA 2O23A 1QKKA 3IQFA 4XFDA 5CGZA 2G1PA 3IO5A 4JITA 5HZHA 1NY6A 2JCVA 3HHEA 3UGTA 3KWLA 4WRRA 3ODGA 3ZDZB 4Q19A 1AE1A 4E5VA 4KQ2A 1G2QA 4R0VA 4I50F 1UWKA 1C3JA 3LUCA 1GD1O 4HAYA 3C7CB 4PSDA 3GJXC 3TW8A 3UXYA 1UQTA 3BWBA 3EXHC 3MERA 4WACA 3SM3A 4NQRA 1MXHA 4LVOA 1E2JA 5IJWA 4G23A 2VEOA 1JECA 1K97A 2F1KA 4YRNA 3LPLA 4JLVA 1Q7CA 2FOLA 2MSWA 3B5JA 3T06B 2CD7A 3QFHA 4IDQA 1Q3HA 1YJ8A 3OE7D 1C9DB 3GEGA 2ZWIA 4FHFA 3KAKA 1SBZA 3LUFA 4FIZA 5ERYA 5FADA 4F5YA 4CLOA 2D13A 1DKLA 1U9YA 3EXEB 1RS0A 4E1BA 1QRUA 4CCYA 2ZAMA 1T4BA 5J63A 5LZ2A 1K08A 1L5LA 1JTVA 2YRFA 3PXBA 1JG2A 1DVRA 4J29A 1YUNA 1TFRA 5H83A 2WM3A 2I34A 3CWZA 1CB7A 3C1TA 3DW1X 2OHFA 4HN2A 2JGEA 3U7EB 3ISVA 1OBCA 2H57A 3R77A 2C7VA 4HN9A 5GVSA 1K9SA 4MINA 2J67A 4I9HA 2APJA 4ENWA 3V1KA 3OSZA 5LP6C 2FZEA 4J2TA 4LI3X 2JI4A 2OAP1 2WLSA 1EUCA 2Z83A 3FMPB 3GDHA 5LQUA 1HE1C 1NVKA 2G70A 3DTTA 1FRNA 4C0QC 1ZCJA 4N41A 4GOXA 1JVSA 3WRVA 4C4YA 4CR8A 5IZ4A 1HMYA 3CSSA 1OLUB 3IOCA 4UU7A 2OLJA 3D0KA 2GVDC 4KVAA 3WBFA 4F4UA 4AYWA 2WVJA 3G8AA 1CUAA 1U8UA 2A0KA 3N59A 2B69A 3FTCA 3QM1A 1RYFA 4EUFA 1L1FA 5JSKA 1XNGA 3AIKA 2F3UA 4OM8A 5K4AA 5FUYA 1FJ2A 1V5IA 4OIMA 5SV2A 5DM70 3GMDA 4D97A 3BFJA 1YZ3A 4W7IA 2B2CA 4R6XA 1BXKA 4KRFA 3DLAA 3S5UA 2ZAGA 5GTDA 4LZLA 2HDNB 4ZQFA 5LOVB 1C8VB 2C59A 4I4NA 5CEJA 4CKWA 3FPEA 3AKYA 2GZMA 4DDKA 4G86A 3H5IA 1DRUA 1YKFA 3DUFB 4LRXA 2OECA 3TOXA 4BS9A 5BSWA 2XCQA 1SCIA 3HHPA 3LU1A 3JX9A 1FQJA 4TYQA 3FDZB 1IOZA 3FFAA 4V0QA 2QR2A 3R4CA 1TZCA 3AO0B 1JHVA 5H70A 2A78A 1G6OA 4NU6A 4M38A 3QSYA 1NIPA 1ZN7A 3OIDA 1TC1A 1L4UA 1NNUA 2AIRA 2CNLA 2OFXA 4HEA6 3HLYA 3LX8A 1CNEA 3JR3A 4FE4A 1L6IA 4PGAA 4ZO6A 4KE9A 4OJKA 4DT1A 3FI0A 3LC1O 4KXUA 4OH1A 1MB0A 3VRHA 4O08A 2J7PA 2P79A 2A35A 3P27A 1RD4A 1I6KA 2C1XA 3PYLA 1QH1B 4DLZA 5ELXA 1EK2A 5K0FA 7AT1A 1PG5A 2HTFA 2IYYA 1UFRA 2OV1A 4HTAA 4TWBA 4D4HA 1NJ1A 3Q3HA 3ZZ1A 3NWJA 4DLVA 1EFAA 4TVSA 1ZKDA 3ZPXA 2ZM5A 4JC5A 1RI3A 2JGJA 4UQOA 5CBPB 5LP6F 3I45A 3IKTA 3DDUA 3AERB 1PVDA 5DBOA 3CBQA 1DEAA 1BKSB 2ZYTX 3K9QO 4JZKA 1YR9A 1Y48E 2O3JA 1RCUA 1P4AA 2D5BA 3VH2A 3CZRA 3ICVA 1CRLA 2C95A 2AE2A 3I2KA 4JJ7A 1JIKA 3AJRA 4ZKEA 2ORED 2RHBA 3MPOA 5JADA 3CF2A 2ET6A 3JQCA 5DVZA 3ZNPA 4F7WA 2BJWA 3QJGA 2QPTA 4JQCA 3GCGA 1JDZA 4M37A 5KS2A 2Q4OA 1P8JA 3CH4B 4M8IA 4MW0A 1AH2A 4HDQB 4QGBA 5A6SA 2RH4A 2ORYA 2NVUA 4X8LA 3GLIA 1YQ9A 1USUA 3UH1A 3OETA 1XN4A 3HCNA 3K1ZA 4LG1A 5D7NA 1XTBA 1H65A 3RTDA 2IJGX 4E21A 2VXCA 4WJLA 5BYAA 1ZK0A 2MJLA 3AYXB 1R88A 2QTNA 1Q0QA 1W35A 2IUYA 1L7EA 2QL6A 1DIOB 4KFSA 1MIOA 5KYXA 4AUNA 2ZTMA 4IIJA 2FG5A 5HF9A 4E2FA 1W4RA 2DQZA 2WT8A 3LKZA 1RHRA 3P9XA 1PG2A 3QXXA 4BMYA 2YCLA 4CMBA 2AKAB 3R6GA 4UE6A 4AJJA 1MB4A 1AUPA 2PCLA 4OJTA 3EZ6A 3UAVA 4F7DA 2XSZD 5BNIA 4AJ2A 3ZUPA 4B6FA 3WMWA 1BJTA 1GAXA 2XQGA 3O83A 4XDGA 3E7XA 1OE0A 5ERXA 5J2TF 1T0PA 1X14A 3AP3A 3PIDA 5KQGA 3X44A 2L2QA 1GNRA 2D2VA 2IXEA 3O75A 4IHAA 4PO1A 5LUBA 4TVBA 4N54A 2AZMA 2OKCA 3PJEA 2OD7A 3CH5A 4GR4A 4Q03A 3H1EA 4QREA 4DBVO 4EEKA 3KPYA 4M9RA 2YZ7A 1YJXA 4E5SA 3QWHA 4CMEA 4ZCQA 2CL7X 3SE0A 1JPNA 1IPEA 1L4YA 2IOFA 3JZDA 4N5NA 1SIOA 4BO5A 1XVVA 2I1LA 1E1DA 2PRKA 1ECGA 1F48A 2CT8A 4D8VA 1WSWA 1CLEA 3AB3A 4LRSB 4C22A 4HNTA 4BFYA 1ZPDA 3KXKA 1BE1A 1SVKA 2BKAA 1HG1A 1EXMA 3BCHA 4DV3B 2Q2QA 4FSXA 1T5LA 4WMLA 3WYNA 3PVZA 2RCYA 1EKXA 4DV1B 1H8EA 1VLHA 3T94A 2BUAA 5KX5B 3JZMA 2V5AA 2XDQB 2PRSA 1PN3A 3P2OA 1UJ6A 3U3DA 4CLRB 5DN9A 4V02A 3UJ9A 5IJXA 4YJ2B 4ZQHA 5JRJA 5LOVF 1Z4NA 2EWMA 5BOSA 2FMFA 3C41J 3ITKA 3GJQA 4G4GA 4HWRA 4CM9A 3EEOA 5DM4A 1TUEA 3V1LA 4Q4HB 4BAZA 5TF4A 1CZKA 1V3VA 1ORRA 2QVLA 2ZWPA 4XJVA 4NYIR 1MFZA 4DV0B 2BFEB 1VIAA 4AY6A 2YYZA 3JD4A 3UPTA 2CXOA 1YFLA 1WEKA 1ZGCA 1P5HA 2PKRA 3H9UA 2E5FA 4BP3A 4I1SA 1Y6GA 1ISFA 1DTWA 2GAAA 2JGFA 3CUVA 2XNCA 3COPA 2C9CA 3Q0EA 5D85A 4ZAVA 2C9DA 4YRFA 2IUTA 4C01A 4RTQA 3USZA 3MVEA 4ZEWA 2EWWA 1YIAA 4BNZA 3NJRA 1W5EA 2JGAA 5ALTA 4IZ6A 2BFWA 1N2XA 5B7NA 4ZOLA 1Z22A 5CVVA 2Q5QA 4TV9F 3ZGNA 3ZHXA 4AZTA 4D8XA 1OYVA 2ZROA 4DSUA 2CGEA 3FDFA 4PAMA 3NIWA 2VH1A 2HEGA 4MS1A 4PY2A 4W8OA 5FNZA 3W9UA 3OOWA 4HAUA 2YVKA 2QR3A 2C4TA 2QXTA 1AKYA 1EX1A 2Y1FA 5CPBA 1JTFA 2IY7A 4REMA 1ZM9A 1T0UA 2GD6A 2O8CA 4ARVA 2SKCA 1TQ6A 5ECWA 3GFQA 3FPAA 1I1HA 2XUQA 1WPQA 3AR3A 3D2LA 4NMLA 5DBGA 4P33A 3W2IA 1L0BA 1JE1A 4HBZA 3PTLA 1JIVA 2PZEA 3E2PA 3E6AA 3DVRX 3FNRA 4M7RA 2VSNA 3ETHA 2IVFA 4YB8A 3G5AA 4JDUA 2B8NA 4WGGA 1ZRNA 4IJWA 1RE0A 3SJAA 1U9ZA 1WP9A 5HMMA 5ADWA 5LM3A 1DC6A 4G1VA 4PLZA 4MGKR 3VPAA 2Y9PB 4TSRA 3L07A 4XJTA 2ZE6A 5TV2A 2X6RA 1RIFA 3QVGA 3OZXA 2VDLB 1OQAA 1BE0A 4OSOA 5D7BA 1F9AA 5I7EA 5KBYA 1CVRA 3I0MA 3FG9A 3SJBA 3THXA 4OYHA 4E15A 2B98A 1C14A 4JODA 4ERNA 1JIUA 1FNDA 2QKYA 5AKEA 1N5JA 4H6XA 1Y6FA 5FTKA 2AL7A 1LW6E 5KQPA 5ESRA 4LXHA 3JQGB 4Z86A 3RFVA 1KFCB 2HQ1A 3UA4A 2AN5A 1H6DA 2E18A 4Y30A 5CTAA 3OPYB 3E61A 3H1BA 3THWA 1WA5A 3VNQA 4PS1A 1H2AS 3GFSA 4IGIA 1A97A 2GS9A 4Q4AB 4FFBA 4RVSA 2R6DA 1LSUA 3D3WB 1ZH8A 3HCFA 3R5KA 4YAWA 1GPYA 5LQDA 3IDSA 2WJWA 4LXGA 1YE5A 1IBSA 5AM5A 1JA0A 1A88A 1W96A 1OFVA 3KO8A 3KYBA 3N2EA 1ODTC 2I87A 2DR2A 5KQSA 4G0MA 2OYSA 1F6BA 4LZNA 1DGQA 2GBLC 1QIKA 1SJ9A 3CUUA 3TINA 1VTKA 5TMBA 4CMHA 5AOCA 3L1IA 4ZCPA 3JTMA 1RQGA 3AUAA 3LT2A 4ER5A 1VBFA 2C2YA 2PU5A 2GZAA 3DOCA 4UFOA 4HFMA 1PDWA 1VCIA 1XJWA 4Y1GA 3L4KA 2AN1A 3L8EA 3P52A 1K68A 1OWNA 1PL0A 3AR8A 3D6HA 4NU5A 4EP1A 4QYMA 4RIHA 2O54A 2I4OA 3BRWA 4ZEMA 5A2GA 2RKOA 5AI6A 4FHEA 4WY8A 5EJIA 1H1LB 4ZT7A 3NTUA 1P6QA 3UVEA 5A9SB 2R68A 3KKEA 2AF3C 5C2JB 3CW2A 1EH5A 5H7XA 1O6GA 1YQTA 1JALA 3NHPA 4Q15A 3OLYA 2JFZA 5JMWA 4C06A 1ZW1A 4YJ2F 5G4KB 4FZJA 2G1KA 3RBVA 1OFTA 4K40A 1AUVA 5AW5A 3REQB 1MUUA 4MNTA 4MJ7A 5TRTA 2BFBA 2Q5CA 4KWHA 2ANCA 3EDMA 1KPIA 3FY4A 3OY7A 2V0NA 1TFUA 3GAAA 3TFWA 3ZE1B 3BD7A 2IYWA 4KLZA 5E3HA 1FMTA 2CXRA 2PLFA 2BCGY 5FLXA 3EDYA 3FHLA 1KO1A 5FTMA 4ZYZA 3PWSA 3KZVA 1Y6JA 1N2ZA 4AECA 1ELOA 5JANA 2X3UA 1DIAA 1X92A 1CJSA 2VLIA 4ESEA 2PTHA 3E82A 1W93A 1RW4A 4EG3A 2CFCA 2ZRFA 3EY4A 5EHZA 3O92A 1R15A 3PQCA 2PLNA 2XADA 3RNOA 5CEFA 4MUXA 3K70C 4YRCA 2ASEA 1QVVA 4EDFA 1NW4A 2XR1A 1XB2A 2ZRPA 2ZJ2A 2OBNA 3ABQB 3NQ41 3NASA 2IWHA 1E89A 2UZ4A 4CM5A 5J58A 5FI3A 2P2SA 1I7SB 3H87A 1OTYA 3A28A 3E9EA 4D7AA 2I7TA 1MQ9A 3BSFA 3DTVD 2NP7A 3AI1A 3L01A 3E27A 1ZVKA 3H86A 4WH0A 1NVBA 4P22A 3Q7QA 2ILTA 3NP9A 5AVSA 1UL1X 1WTAA 2JBHA 2VHTA 3DL0A 2GAFA 1JLMA 4ENSA 2VK2A 3MOIA 5BQ3A 1J49A 5BYBA 2IT1A 5IDVA 1DLIA 2JFOA 1MPTA 1KIAA 3G2QA 3D3EA 3OT5A 4RHYA 4DJTA 3QE3A 5T4EA 4BKRA 2BFOA 3E4CA 1F3OA 1P1RA 1CQJA 4OF4A 3CF0A 1JU9A 2RB5A 2PR2A 3ZDXB 1A9ZA 5AHKA 5HK8A 2I4IA 4ZXFA 2X15A 4KIWA 4JT4A 3I28A 4LI0A 3SYMA 1K63A 2OSVA 1KYXA 1ZICA 2DVMA 3C8ZA 5DSTA 2IYEA 2V55B 3ZCRA 1Z5PA 2BHRA 4UNPA 1L5HA 2HRCA 5FFMA 3N70A 5KHAA 3CONA 2P9BA 2BGLA 4IIUA 2X9NA 5G2OA 2YHAA 2L19A 3RSZA 4NQZA 4H77A 5GWXA 1Y1RA 5DNUA 1K2VN 1G3UA 4HWOA 5HZMA 1XZ8A 3TD2A 3EHEA 3NIBA 1ZVJA 4LYYA 4TOIA 5ALRA 3AZQA 3E7WA 3OPNA 4EKYA 2GWRA 3WRXA 4J7XA 1GPNA 3HM9A 4CL0A 3I01A 2XX3A 8OHMA 1QYWA 5GJBA 3CKLA 4POAA 3WHPA 2VYNA 5CVCA 5HF6A 3VR0A 1R4MA 4ZYVA 4GSYA 1YNSA 4O4IA 2P9CA 3ORRA 4E31A 1RTTA 1GOTA 2FF7A 1M0SA 1D03A 2RBKA 4AP5A 4DUPA 4ZRMA 1WV0A 2WFZA 2W8BB 4LBYA 3WZ2A 1SIBE 2H4ZA 2AFIE 2TMKA 4AJEA 3PFIA 3DZ8A 1AQLA 4ZVUA 1EEXB 1QTRA 1KEEA 4JBNA 4NPCA 4HQNA 1XPOA 3ZD7A 5JCOC 1YVPA 4E0BA 4EY3A 1TLFA 3PHIA 4C4SA 4ZCRA 4FI3C 3DAGA 2ISQA 1USGA 4LMRA 1ONNA 3NH9A 1W36B 2CDBA 3I0NA 4QJBA 3MRSA 2GERA 2XNDA 4Q37A 5CM8B 1G8HA 1XZCA 4QG3A 5JVDA 2JAWA 4FFNA 1IN7A 3M9WA 3R3ZA 1VLVA 5AESA 1K8XB 1ZL0A 1MNQA 1R3UA 2R11A 3KHKA 5EJMA 1HURA 1CT9A 2NT3A 4K9QA 3KWJA 4ND6A 4S1OA 4E5UA 2WG1A 5K6AC 1E9SA 3L4BA 2R1VB 2XV1A 3G5MA 2A1IA 1CG6A 3NWEA 2WIJA 4PLGA 5CFMA 3HUDA 5I51A 4AZ3A 2JGDB 4FEYA 4X63A 2FW8A 5KSOA 5I01A 5J4LA 1YZKA 3NGMA 1UPBA 4J3JA 4LY6A 5SYAA 3R3YA 5I47A 4PYLA 2CFSA 3WSWA 4EFMA 1H94A 3Q1LA 3S2UA 4AX4A 4K86A 3IDQA 3EYWA 5LYJF 1XTVA 2R1UA 1PU2A 2I22A 1OBFO 1VSVA 3S29A 4J43A 4D3DA 4QPCA 3KTAA 1J2TA 3RUAA 2VKQA 4FD3A 1UIMA 2JIMA 2NW6A 1KVSA 4NJOA 4MROA 4L4RA 4GSKA 4MR7B 2HADA 3I1FA 2MSNA 1AC5A 4DCVA 1TMKA 3RQIA 4NCAA 2AK3A 3D5QA 4A3SA 4YT8A 4LQDA 5A06A 4FFOA 1CY7A 3QWAA 3VU0A 3LTNC 4Z4EA 4LBVA 2WYHA 2HZ7A 2ZUDA 4MGEA 3VQTA 2F8LA 3I04M 3X1KA 3MXOA 2OHJA 2R66A 3WKEA 5D3ZA 2E2WA 3HCCA 4OXRA 4ZI5A 3FCEA 1NI3A 3GNSA 2IPLA 4M4SA 2F59A 2P27A 4R83A 4RPGA 3U4QA 1FP7A 2BUCA 3M81A 4K8OA 5FFFA 3ANLA 4L0DA 4QOSA 2BI8A 1QE3A 1CE8A 4GL4A 5DK4A 5THXA 3UTDA 1YZFA 4CPDA 3I04A 2ZJFA 2CJXA 1X9IA 3Q8XB 2CZGA 3CT6A 3IURA 4ZV4A 1XVAA 1XV5A 2V4ZA 2A7QA 4Q0MA 2CCJA 3NGLA 1BMFD 2AQHA 1Y3BE 4L27A 2YBEA 3CZ4A 3U81A 4U7FA 5CAEA 1B4DA 2X5JO 5FOVA 5A3SA 3STHA 3T5AA 2O8DB 3EZLA 4UMDA 1ZGAA 1FIUA 2V5VA 1U8CB 4EJMA 1JZQA 4GYWA 2DWCA 3I6QA 3M5DA 3AVPA 1UJCA 4QUJA 3QBVA 2WWRA 4X7PA 2D2EA 1DPGA 3WWCA 1LWNA 1GQFA 5EKSA 4BU0A 3J7AC 2GEVA 5JQGB 5FXMA 1DU4A 5JCXA 3CCCA 5CYOA 4N1AA 1YDWA 4WY2A 3ZW7A 4KXFB 3WG9A 3T4XA 4L72A 3VXKA 3BMQA 3FCOA 1RQRA 2EQAA 2GBCA 1CRZA 2IYPA 3GRRA 4L74A 4L9SA 4ZMRA 1NPDA 2OOSA 3I6MA 1YDMA 5JMTA 3RSHA 3ONWA 1MAAA 1A8SA 4ZDJA 4UBIA 4B7AA 2IS6A 3BK2A 4ASUD 3WHIA 2XGMA 1BVYF 5LZ9A 3MC1A 1XRRA 3SOPA 2A14A 3IP5A 1B8PA 2YHIB 1BJKA 1SUPA 4WGFA 2HT1A 1EFPB 2H48A 3D0RA 4KDCA 2QRQA 1W5BA 5EJGA 1DBIA 1GXSA 2BTQA 3C74A 1BHO1 1RYDA 1J22A 1HDOA 4U9UA 3L0CA 2EX4A 2P9TA 3AL3A 3R6LA 1G0NA 4C3OB 2DY1A 2EAUA 2HBQA 4YAFA 1PX0A 3P9SA 1PT8A 4FJ1A 3VU9B 2X8JA 4D44A 5U1PA 5F1PA 3L40A 3LPMA 1PZGA 2AN3A 1U90A 2GBPA 2XQFA 3RT7A 3JVDA 1EJ0A 1YKGA 1ZGBA 1AHIA 3F6YA 3KJQA 3V00A 4HAIA 2DPMA 4U7DA 1ESZA 2HA0A 1LBSA 4ZANA 2P3SA 4B35A 3OJWA 2R6CA 2G7ZA 3GFBA 3UY4A 4EGSA 1H85A 3U31A 2I0FA 4IWNA 2QX4A 2QZSA 5ECDA 2J3LA 2IZOA 3J7TA 4H35A 2J8ZA 4FQ8A 1ZSNA 3L7MA 3R6DA 5D8DA 2VQEB 1U1GA 1AT1A 2BFDB 3NBFA 1IG3A 1DKNA 3RF6A 2REOA 1Y1LA 2YXLA 1M74A 3DZHA 3D4IA 4GLFA 1OWLA 4X1IB 3T1TA 4NFSA 4OFXA 2Q6VA 4TV8F 1F17A 5TJ9A 5BSRA 5TS2A 3UJ7A 2GLXA 2PDAA 1KP2A 2QUKA 3H1GA 5EMLA 5HE8A 5EZ5A 3WIVA 3O8OA 1P5RA 4TYYA 3COJA 1MAWA 3A3OA 4QFCA 1SULA 1KERA 2XUGA 1NF2A 1H9CA 3QA9A 3W5JA 3ZBUA 4DR1B 4GW3A 3JQBC 5DHRA 4I36A 1M7GA 1IBLB 1M1XB 3BERA 3D1LA 3OUTA 4DMHA 1M6YA 4BJ6A 3R5XA 2F4VB 1MLDA 4O1IA 4PHTA 2BSAA 3ECSA 2BM8A 3VX4A 3NH6A 1BWQA 1N2EA 4RTOA 1V1RB 1ODJA 4D92A 2QT1A 2ZRIA 1ZK4A 3QU5A 2G28A 3MELA 3NFYA 4N0PA 3ROTA 1CRQA 1IHXA 1TIBA 1FRVA 2PGXA 1R0YA 3UATA 4BWFB 5JS1A 2JCXA 2C42A 3U26A 4QASA 1GUFA 2JLBA 4RD6A 2TMYA 2VHUA 2OHXA 1P1JA 4CMKA 5IH3A 3L6OO 1P2TA 1F1JA 4UXIA 1IH8A 1N7HA 4ZGWA 3ZHVA 2Q0SA 3WQHA 3D3JA 2OLEA 2TRSB 2OCPA 4GLLA 4OHKA 4K6FA 1XHFA 3GELA 3OZBA 5EJ6A 4N47A 3RS0A 3RROA 1TKAA 1BX0A 5FOSA 5BW4A 4HFJA 2VFAA 4M87A 2A5DA 3NOVA 2XUHA 2NZVG 5TGZA 3GZ4A 3VC1A 3TLEA 1T3GA 2CJWB 4BNWA 2CKMA 1V3UA 3IJEB 5JBNA 5J23A 1ZXBA 2X0RA 1KETA 3VNAA 1GO2A 1R4NA 2WIKA 4FDVA 2OQRA 3MHPA 1X94A 2ZB3A 4MMXB 1Y8RB 3ROKA 3NDBB 2XDYA 2XD4A 1G0OA 1ZJ6A 2X8AA 4CLDA 3B36A 2CVPA 4UULA 4R2IA 4JP8A 5C7YA 4XPIA 2BEVB 3G0HA 3WJ7A 2DR3A 2PGOA 1SD5A 3WA7A 2BM9A 3VR5H 1YRBA 1QKIA 1IATA 2WMDA 2ODTX 4QTUB 1HZJA 2PWAA 1SQ0A 2C00A 4S1PA 3QPVA 3VVBA 3V8RA 2J32A 2WBLC 1MCZA 4PZCA 4XQ0A 4BLOA 4J76A 2QJOA 2A0WA 3UMBA 1FDIA 1NMYA 3GO4A 1MVLA 1VDZA 1EK5A 1C3OA 1E64A 3L43A 2GXSA 4MW1A 1VG0B 4ND8A 2NU9B 4NZPA 3QNMA 4RHEA 5JISA 4UM8B 3M6UA 4B2YA 3BTUA 2HQRA 5K01A 4AJ4A 2J7KA 5IK2D 3RHTA 2ZWOA 3KYDB 2B30A 4YRKA 5HQTA 4Z9XA 4UCQA 1JP7A 1XHEA 4OXNA 5PGMA 3U6KA 3KJHA 4NOMA 3L4EA 1Y1TA 4C7MA 3SE7A 4DOMA 4ZYXA 3PA8A 4GI1A 4IH9A 1E58A 1FBNA 1ZVQA 2DT5A 2IHYA 1AVTA 1GTL1 3MFQA 5B1IA 4BB6A 4D46A 4I4IA 2Z6QA 3HBFA 2ZIXB 2VSQA 1QIHA 1SA0A 3IT0A 5DM2A 1HL7A 2QU7A 3AI7A 1NYLA 3ENVA 4XWGA 4WCFA 2RMKA 1WUYA 3P2YA 3CEPB 3WRYC 3ZD9A 2OGTA 2PXAA 3G0GA 1PFYA 1OZGA 4EHHA 4BN0A 1PT5A 2HSGA 2QTAA 1QHXA 4KXWA 4R8LA 4IOLA 1MN6A 2QX6A 2Z3VA 1P4SA 1XF1A 4KI7A 2CEKA 5KNDD 3K70D 1OBHA 1YQGA 4OB6A 2I4LA 4XWAA 1HSOA 3A05A 1QGYA 3KOMA 3MGCA 2I55A 4OBXA 1KBZA 9LDBA 5P8WA 4U63A 3OTQA 4B3MB 2HT6A 2C8LA 2GFQA 4J16A 3OFVA 5IEJA 3MLEA 2OKGA 4FZ5A 4M0KA 2G4VA 3SKYA 4BFWA 3QF4B 3GJ5A 3WGTA 4I9NA 1I6MA 3ESDA 2XB9A 4CI9A 4Z4IA 2ZT7A 4P8RA 2WPNA 4QLAA 4DMCA 3NUZA 5H4GA 3OOSA 4LE1A 3SCZA 3DE1X 1YS4A 3OBIA 1P3DA 2CD9A 2H5IA 5EI5A 3NEPX 1AS3A 1TQ4A 2XJ4A 1YKSA 2C99A 3B1XA 3R0QA 1INLA 3A1SA 4QQRA 3WP0A 1E3DA 3X1XA 2OHIA 3P9RA 4H3HB 1HY3A 5EIAA 1B8UA 5CH5A 4HI0E 3EWAA 1T36B 3N8KA 1FZQA 5DYTA 3TGWA 2RH9B 4DGQA 4E33A 3IEVA 1BQ3A 3JRXA 1LD3A 2CV0A 3KLOA 3OHSX 1Q12A 3PCRB 4IQGA 3KB8A 1RVDA 2GF0A 4LJ6A 4X71A 2HK8A 2VP2A 1DMRA 4GI3A 1TZKA 4MXDA 1B42A 1E7RA 5DEIA 3RVKA 4ZGBA 4D4JA 3KS9A 5AVXA 3BWMA 1YBHA 1DQYA 1JVBA 3KKOA 1TO6A 4C0AC 4QJ4A 1ZX1A 3O3MB 1J8DA 5B58T 1XK6A 4LYHA 3ST7A 1GGEA 4BWYA 1ZRMA 3DCIA 2A9QA 1UP4A 4RA6B 3QTLA 3EW9A 3COYA 1N3BA 1OUMA 1RMTA 2MHCA 3H97A 4IO1A 1UKCA 5JYDA 3F96A 4FZRA 3GLGA 2O14A 2AG5A 2CLFB 4MYUA 4QHTA 2G9NA 5DI9A 1FDSA 3DFUA 3L05A 4AXXA 5LD2B 3LYUA 1SU6A 3U37A 4OGLA 2VDOB 3GRYA 5F21A 1FDTA 2BYTA 1PS9A 4LYJA 2NOAA 4KQFA 5HNKA 1T4CA 2AVNA 5MFPA 4IEEA 3O8RA 1Z63A 5FD8A 4FDUA 4B9EA 4JEMA 3DO8A 4D02A 5I3ZA 4ZO4A 4DLXA 5IXYA 5LIRA 4AN4A 1YGYA 4TUYF 5IULC 1ZQ1A 2Y6UA 4IXTA 1TEZA 1VMEA 2IYLD 2GYVA 4FSDA 4UUNA 2F8TA 3S0JA 3AQ4A 3T9EA 2UXCB 5GM2A 5JOQA 1KVTA 3EH1A 1SUFA 3NBKA 4QOFA 4L75A 1JQLB 1JG4A 1P73A 4B47A 4O4LA 3GPLA 3OJLA 3ORFA 4TM7A 2O8EB 5EWLB 3GVIA 2MR5A 3PDJA 4ZDIA 4WHMA 3EA5A 1U7HA 3KQL