4EW1A

High resolution structure of human glycinamide ribonucleotide transformylase in apo form.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
205
structure length
205
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWVKEEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Trifunctional purine biosynthetic protein adenosine-3
publication title Biological and Structural Evaluation of 10R- and 10S-Methylthio-DDACTHF Reveals a New Role for Sulfur in Inhibition of Glycinamide Ribonucleotide Transformylase.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 205
sequence length 205
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4ew1A00
2CFIA 1C3EA 4ZYWA 1RC0A 1RBQA 3GARA 3P9XA 4YFYA 3TQRA 4EW1A 4R8VA 1ZGHA 4EW2A 1RC1A 4TTSA 2BW0A 3O1LA 1YRWA 1GRCA 2BLNA 1JKXA 4QPCA 1MEOA 1ZLXA 5J9FA 2GARA 4TT8A 4S1NA 1MENA 1RBMA 1MEJA 2YWRA 4TS4A 4ZZ2A 4ZYTA 4YFVA 1FMTA 1RBYA 4Q12A 4ZYXA 1CDDA 3OBIA 4IQFA 3AUFA 1RBZA 3DCJA 4EW3A 1CDEA 1C2TA 3NRBA 4NV1A 1ZLYA 1S3IA 4ZZ3A 5CJJA 3KCQA 3R8XA 1GARA 4PZUA 4ZYUA 3TQQA 3LOUA 1NJSA 4ZYYA 5J63A 3W7BA 4DS3A 3AV3A 3DA8A 4ZZ1A 4ZYVA 3N0VA 4ZYZA 2FMTA 3Q0IA 4QPDA 4ZZ0A
chains in the Genus database with same CATH superfamily
4EB8A 4M8SA 3CT6A 1J9EA 1P6XA 1PWXA 1RLOA 2A3NA 3EE6A 4R1OA 4HAVA 4TV9B 3UMRA 3KELA 3AP2A 2B37A 3ZH9B 4CMGA 1Y6FA 2BI4A 2Z56A 2XE7A 3H42B 1KKUA 4K88A 4PTZA 1KJYA 1B6SA 1ZGHA 2J45A 1WHTA 4B4UA 3HBMA 4UXJA 2C20A 3MMNA 1YHNA 2H63A 4ZGWA 2W6IA 4RPCA 1JALA 4X60A 2C0QA 4ALLA 1IE3A 3M6LA 4B9EA 5FV4A 1V6SA 3BKXA 1EMDA 1NP6A 1SCJA 1B8NA 2RDMA 4FCWA 3V2HA 4MUKA 3AL3A 3O8BA 1VLVA 1GO2A 3BB4A 5JMOA 1D1TA 1MORA 3VKWA 1QO0A 3P4XA 2FPUA 4ZAGA 1XPJA 1UIMA 3CISA 4ZCLA 5CDYA 4QOJA 4PO9A 4RA9A 1BHQ1 5H16A 4TLDA 2V4UA 1JZTA 3VR5H 4BJHB 6LDHA 4LNUA 3RU9A 3DP9A 5ETJA 4EHLA 3BL5A 5KBYA 1GA6A 3OQBA 4GF5A 2VRCD 2WNSA 2ZE5A 2E6UX 2FW1A 4IBOA 5BQ3A 3PNQA 1EIWA 2ZDQA 2FVXA 1MABB 4B84A 2AUNA 1W2GA 3K94A 1KQ3A 5D3MB 1UXJA 4BQPA 2RC6A 1O7JA 4JBXA 4R05A 2NPFA 3PX3A 2YWEA 1UDWA 3FNBA 3TMYA 4GXQA 4D26A 4GKKB 4RWEA 4M9UA 4HFNA 2AW5A 2VH1A 2FZVA 1N6RA 3QOFA 4B34A 1IHOA 4L6AA 1TTHA 1G42A 2EQAA 2NTVA 3ZHXA 2EBFX 1WUKS 2N47A 3CLTC 3OX1A 2HX1A 4L3OA 4O5OA 4MKRA 3ES9A 5DNEA 5MDHA 1KFCB 3PYXA 3TZQA 4AS1A 1P1RA 4PIMA 5E9QA 4NNJA 4MUGA 5EE9A 5TQ0B 3ZU6A 1N8NA 4EG7A 1VZ2A 5BN5A 3BWVA 1ZAYA 1OXVA 2YWHA 3O3OB 4JKYA 1SUDA 1QFZA 4FFDA 3OE7D 3WGIA 4MW1A 2ZQ5A 2HM7A 4YXWD 1TXGA 4HAWA 5JARA 3C5VA 5LUAA 5AVWA 4RVGA 1E3WB 1TW2A 2AOUB 3KDSE 3G0DA 3C14C 4BDSA 1A1SA 3NX4A 2IP4A 1E0DA 2CMGA 1MO3A 3KPUA 4OO3A 4MVXA 2P75A 3DFIA 5REQA 1ECJA 1ZD3A 1ZJYA 1Z13A 2CZQA 2VRNA 3OIWA 4L27A 4YXFA 4R2KA 3L6EA 4AJ4A 2CV0A 1I7NA 1T1IA 1WWKA 1HYHA 3CJTA 4IJKA 3ZEAA 1AN0A 4B17A 5DEOA 1UF9A 3EIHA 3H5RA 4LDNA 3NHSA 3I04M 3NVMB 1J00A 1WV0A 3PQEA 2EGGA 2Z2JA 2H9AA 2Y6UA 3GVHA 3I1IA 4LF9B 1J8DA 2NP6A 5JALA 3CB4A 4FEYA 3L0CA 1FQJA 5BW8A 1QCZA 1NVXQ 1H2XA 5AW4A 3GFGA 1PG2A 4KRGA 4ERXA 3LLVA 5CYOA 1XEWY 1P7ZA 4IDCA 5EESA 3P8ZA 5HR5A 4C0JA 4E7OA 3EDMA 3OPYI 3QYJA 5I7FA 3H2BA 5FNVB 4YV0A 2X1MA 3JRNA 2YY6A 3AHEA 4AK9A 1JMVA 1PZFA 3F49S 1CR4A 4M37A 3WGHA 2PIAA 1DI0A 4RH1A 2ZSDA 3ELYA 2HK9A 1RQLA 2CL0X 3EVAA 3VPXA 4CUZA 3R9KA 1T15A 4Y1FA 3BSWA 2O2IA 2XMQA 5KDOA 4WN9A 4M0CA 3T3NA 1T2UA 1A2KC 1VIYA 2IPLA 3CBGA 1NVWQ 3LFUA 5TJ9A 5G4KB 4FR2A 4I1YA 1QF7A 1HC7A 4R8VA 3KSAC 1HT3A 1HEUA 1W59A 2IYYA 1P1JA 1K27A 4JWKA 2YXLA 5B6IA 1KJIA 2R1VA 5KSYA 1A9ZA 2AXPA 4J76A 4YQZA 1P8AA 1KZYC 4HSGA 1FXWF 1HQCA 2AJTA 4U7DA 1I7PA 3BXEA 1E9DA 2Y66A 3A4MA 2IZ0A 4G89A 4KVGA 5LC1A 5C7LO 2BFOA 2FQQA 5EZYA 1TYZA 4OFWA 4OJYA 4GMFA 4OQQA 1J70A 4LCEA 5G3YA 4LX0A 5I7SA 2CUTA 1H3FA 2YX1A 2A1UB 4XYBA 4JYZA 3EGXA 2ZRLA 3DH0A 3N8NA 4JENA 4X7RA 1F9AA 1OGJA 1FTGA 5CVCA 1CEEA 4YRTA 1L5GB 1BAPA 2QN3A 3TZ6A 5HTOA 1X1AA 2FN4A 2ZI7A 4ZZ2A 1Z25A 5KWEA 1QZXA 1X94A 1IM8A 3HJBA 3DOCA 1V16B 4OD0A 3S3TA 3NTVA 2AFVA 4OX9Y 1CUUA 3S28A 1ULZA 3CZPA 1NUTA 2PZ8A 5JEEA 1AZSC 1QRDA 3Q1KA 3AGPA 4HXYA 4WLUA 3GRFA 5D6OA 4B2LA 1HSZA 1JHDA 2V59A 3EDYA 4EJMA 2YHUA 1WVMA 3HUUA 2C82A 1F0YA 4F60A 3RC8A 3T3OA 2FK7A 5DFAA 3TO5A 3LW7A 1U8XX 1XYYA 2JLCA 2VNSA 3D7SA 3RC1A 3AUFA 3UMFA 3IULA 2BR4A 4NABA 2NADA 5CITA 5E3IA 3D7KA 5G1PA 5GJCA 3W78A 1OXTA 3FOFC 3K6SB 4ZT2A 3OFNA 4IS3A 4X5OA 3DZJA 5FBWB 3QU5A 3C6KA 3GWGA 2HWYA 3VSDA 3LT4A 2CF6A 2R87A 1O94A 3NTXA 1CRWG 5AM2A 2QM7A 2QJRA 3CUVA 2O2DA 3VRHA 2PTGA 4IPTA 4E5VA 5JO0A 1MFZA 1GQSA 5K1ZA 1AZWA 3KBBA 3UMGA 1Q0TA 2E18A 2XODA 3L1IA 1RJDA 3DOEA 4XVRA 1IH8A 1Q1QA 1SXJC 4XM1A 4B45A 1W9HA 2BT4A 2XWPA 5F35A 2Q5IA 5K2OA 3Q6NA 3VR5D 4HLUC 2AEJA 1UZUA 3ETNA 1WIWA 5JQGB 1XZAA 4DCNA 3IT1A 2KBFA 3ZJUA 2RGDA 1RQXA 1SC9A 2B4AA 1SO8A 2C1EA 3OOWA 1R3UA 2YFYA 1MC1A 4OVKA 4ZVKA 1CRZA 2QVXX 4I0WB 4POOA 1G6OA 2WZQA 2P4UA 2JGMA 1ISHA 1GPJA 2YWFA 4Q37A 4B32A 2Q0SA 4FNOA 5CFRA 5I7WA 1LC3A 3VU9B 4JL6A 3HLKA 1SELA 1N5JA 1LZKA 4MEJA 5FUBA 2A9QA 2B5OA 2NZ8A 1D1SA 1TFUA 2B1RA 3QUAA 4K5QA 3I9FA 1DX6A 1EJ0A 2OHHA 3H19A 1ODLA 1E9RA 1NBIA 2N1MA 1BHSA 2FOIA 3NO4A 4MSUA 5EXEA 5A6SB 2Q2WA 4KLZA 2DKOA 3VHRA 4RZ3A 1QP8A 1RWKA 1E0KA 2PUHA 4NBVA 1YULA 1U2SA 1BCRB 2XVMA 4QYIB 4ZEOA 4MZDA 2CD9A 3H2IA 3K9LA 5GWXA 2P79A 2ZIAA 4KIUA 4OMUA 5TE9A 4CQJA 2K4MA 3ZHYA 3B3QA 3QELB 5DGDA 3S2FA 4CF5A 1YKGA 1OFGA 3E1GA 1YQGA 5L3SA 2ZB4A 1DADA 4EEXA 3ZVMA 2GVZC 1OYOA 2W6PA 2Y9MB 3CKMA 2ZDGA 3DOIA 3IVGA 3K92A 5E6UA 5JXIA 3SWWA 1BXRB 2I5PO 5IH3A 5JJCA 2DY1A 2ZW9A 2YIDA 3FOAA 4DQDA 2CJXA 4G56A 2XVZA 3JAWA 4LG1A 3EW7A 2VSNA 3TBFA 2BW0A 4YRAA 3RIYA 4UZEA 1DXYA 1ZHFA 3N8HA 1XD9A 4DG8A 1SU8A 2R8OA 4QPPA 2HDNB 3DE0X 2M1XA 3F90A 3EF1A 4MMYB 4XWYA 3HVJA 3WADA 3AK4A 3FPJA 4A16A 4NOLA 3HB4X 5J9FA 2Q0HA 2O8CB 1IHDA 4M99A 2HJ9A 4QU5A 5YASA 1L5WA 2YS6A 1D0VA 4KCGA 3RFFA 1QSGA 1V5FA 1JR3D 2YH2A 2BMWA 3GP8A 2WTXA 1KRWA 3TLCA 2BF4A 3WBFA 3AYZB 1W47A 1XVTA 1NPTO 2C4VA 3E3OA 3LNTA 5JWRA 2PH1A 3GUCA 4KFUA 3HKDB 1AM4D 3E3NA 3RC3A 3PFFA 3CLTD 4H7KA 4P0TA 4ZCSA 4CG2A 1NA5A 1EUCA 2P6UA 3O3MB 4RORA 1IB0A 3BTSA 5CFQA 3QBDA 1NLYA 1PUXA 4GAEA 5TMPA 3DBRB 1QP7A 1ZONA 4LJ8A 1E63A 4LZWA 1YC5A 2P30A 2VLIA 4MICA 4N39A 4WGFA 1NW4A 1X7YA 2WPNA 1TYBE 3NHWA 2JZOA 3BWXA 1QH1A 3EOAI 3KJGA 5JY6A 2Y1GA 4IIXA 1ZKDA 4C0LA 3ZQ4A 3B6IA 2G5TA 2FUCA 3E5MA 3F4BA 1Z8NA 3N58A 4IS2A 5E8RA 3H86A 4CNBA 1VCOA 1U2QA 4GQBA 1ZHOA 3A6PC 1MRSA 3FMVA 3CMMA 1N3LA 3FCUB 3KSMA 4HAUA 2P91A 4KGZA 4KE6A 4U8GA 4UNRA 5DISB 3DV0A 2JIPA 4HAYA 3ZW8A 3WKAA 2Y4NA 2Y1EA 3OC6A 4RHXA 5KKNB 1ISGA 3D8BA 4GPEA 2REBA 3M70A 3RF6A 4NCJA 4XWWA 4K1LA 3P0IA 1ZM7A 1RAFA 4X7MA 2A86A 3HLYA 3C3PA 2BKVA 3K53A 4MW9A 4MV0A 3GLIE 3PLNA 3GR6A 4G0OA 3K9GA 2Z5GA 3TOXA 4WK2B 5HK9A 5DCLA 3R8FA 2NVUA 3U6KA 4RWZA 1JH8A 4JVLA 4RF5A 4HB0A 4DLYA 2PZGA 3MQFA 4LXUA 3VPAA 1U5BA 2QY9A 5IAKA 5B7QA 3TLYA 4DR6B 5DTRA 5T4HA 3OTIA 4DPLA 4E5SA 1B23P 4JI7B 4LEIA 4ZVTA 5GONA 4H16A 2NNWB 3I32A 1M73E 2AOTB 3J81A 4KQ2A 4A8JC 4BFTA 1NJ5A 1HNNA 2KE5A 1NONA 1CNEA 3AO0B 3BK2A 1PR5A 3AY6A 1KJ8A 1ZC4A 3C98A 1MMFB 3HGQA 4FDUA 4YGYA 3UPUA 1JHMA 4B79A 3R6WA 4MGZR 4KK4A 4TSKA 2YRWA 2QN1A 3MSXA 3MWGA 2CJYA 1YZLA 3PPWA 2PQMA 3A3OA 4CU2A 2DBRA 4JKOA 4N8DA 2Z5LA 3DLAA 4YJHB 4DPKA 3HDYA 2CXXA 1KDPA 1L2TA 1WABA 2AL7A 4O4HB 4EUKA 3I5YA 3DF7A 3AKCA 4PXYA 5JSZA 2OPBA 1DP4A 1HORA 1PS9A 1NQTA 3L40A 3KZCA 3VNBA 4KQHA 4MYHA 2ZR7A 3FTCA 3K0AB 3FCOA 4URWR 2PRSA 2WFMA 4O8ZA 1KARA 5FPSA 3BF8A 1JLLA 4N1AA 1MC5A 1JXMA 1NMYA 2Z5FA 4AF7A 3TTUA 3EIOA 4MH0R 4I66A 3TE6A 1E92A 2QS9A 2PYZA 3TLGA 3TI9A 1VBNA 3ZJVA 3PKJA 3NANA 2R1TB 3S99A 2H1SA 1BYUA 4WL0A 1YB4A 2BKXA 4JKIA 1MEEA 2ECOA 2PX3A 2XHEA 3S68A 4K87A 1E79D 4HL6A 1Y6ZA 3LBFA 4E21A 4KACA 2WUDA 1DDOA 3WLOA 3VO1A 2GH1A 4RU1A 3AW9A 4EFNA 4HYQA 4OB8A 1B73A 1XNRB 1G8YA 1ATIA 3NHBA 4MA0A 1DBPA 1T9CA 2FUNB 3QX9A 4DDUA 5CFPA 3L4KA 4E1AA 1WX1A 1ZG3A 2WJHA 1U2TA 1E2LA 4EFKA 2PSJA 3E03A 1KDZA 3H1PA 2P9EA 2GRJA 3QOYA 1DQRA 2XB9A 1TJ4A 4JL8A 3A6HA 5DDIP 2OO5C 5DCUA 4QJ4A 4IXNA 2IUFA 3C97A 3PXEA 4OFBA 3CB2A 4YJ3B 3N6RA 1AZTA 5UKDA 3LO5A 4J0GA 2HJHA 2OVFA 2XA9A 2Z1NA 1IDOA 3KOMA 1I0IA 2F1OA 1G21E 2BFFA 1IWOA 2PAAA 3I2JA 1JFRA 2C9MA 3JQFC 3M8KA 3MJRA 1P9RA 4L95C 4KR6A 4AKGA 3ZNNA 1F0KA 3X44A 1XHLA 4JJ7A 4Q1CA 1N6NA 4M36A 3DONA 1XP5A 5CIWA 3INNA 2D4AA 4R3UC 3MELA 3V9PA 1NR5A 2G9RA 1SQ6A 2LGJA 1KYWA 3H5IA 4EJSC 1TZCA 1UT6A 2XIJA 5FPHA 1GT91 2MR5A 3EVNA 5I7AA 4YRPA 3G7UA 1CR1A 4AP6A 3TUZC 3GLGA 2XNCA 4RHUA 1XYGA 4BRWA 4HNSA 3MWEA 1IZ7A 3DDZX 3CZCA 3WK9A 4CIAA 2NAPA 1G18A 3E27A 3VR0A 1JQJC 1K68A 3WLKX 3IHWA 4PX5A 1JMKC 1N75A 3IIEA 1AQLA 2IELA 2B3DA 3DMYA 3KFVA 1I2MA 4DV5B 1JR2A 3MXOA 4RA6A 1OWNA 4J0CA 3A6KA 1QMGA 3ISTA 1TUEA 3KEOA 2GTHA 3A9WA 1EP9A 1DHTA 4RKRA 1JIJA 2C5SA 4Z51A 1PVOA 5DX0A 3UTCA 2VHXA 5EWJB 2JFYA 1NRIA 2ZM6B 1PDVA 4U02A 3DSRA 4W8GA 2YZMA 4KQ1A 4D3ZA 3CZ4A 3NT4A 2G9QA 4OI4A 2FMTA 3GV0A 1AUXA 1FXUA 2P11A 3GOHA 1AB5A 5ER6A 1GP2A 5CB0A 6YASA 2ZJFA 1CB0A 5JH7B 2XPCA 1KMCA 1HV8A 5CLLA 1EK1A 1NWCA 1T0BA 2R1UA 4H0NA 5BRAA 5LN1A 3K8QA 1ZD5A 2H6EA 1RYFA 4I9GA 5GQSA 3FNGA 1V5EA 1R0ZA 1VMKA 1O9GA 2ZTVA 3W5IA 4BKUA 3V42A 4BQIA 2PBZA 1C7IA 2WHPA 4TKZA 4PFQA 3G2OA 5K3OA 4UU8A 2E9SA 1X8KA 4HDNA 4RD4A 1SBZA 221PA 3WISA 4CR8A 1GITA 1D4FA 4UCQA 5BVHB 3FLAA 2IT1A 4WTOA 1Y8RB 2CXTA 2FEOA 1GAEO 2BFBB 2RKWA 2W8BA 3LX5A 4C7OA 5FKJA 5I4KA 3PRJA 4CKEB 3TAUA 3BXOA 1E6UA 4DIDA 1OV4A 4L5IA 4E5UA 4FYKA 3BB1A 2D2FA 3A05A 2VHZA 3V8RA 2Z98A 3FN4A 3IC5A 1M66A 4RLFA 1D2NA 1I3CA 4K6HA 3SC2B 4QTYA 3F98A 4ZDJA 2GETA 5BMOA 4JLBA 3X2SA 3KJXA 4A6PA 4B3FX 4N0PA 1MO2A 3FOCA 1OJLA 2RAUA 2VVTA 3OZUA 5I8WA 4YIKA 5CLFA 1H3NA 3GLKA 4WW0A 2A9PA 3GJ3A 3EARA 2D1RA 3C5HA 3GH3A 2P2GA 4PNPA 4C4YA 1PL8A 2J32A 1Z37A 3PGXA 1A96A 1UJ6A 3G1TA 2J85A 3GRZA 1N3IA 4FILA 1L1FA 2J30A 4NFSA 3JQPA 4ZHQB 3ILVA 3R0ZA 2O1EA 1KNQA 3AMVA 4TWBA 1PJAA 2HKIA 3L1KA 3I42A 3N8KA 4ZO7A 3ZIDA 5JSHA 3TAXA 2Q4RA 4XDHA 4P82A 4Z9XA 1MB0A 1WP4A 2RI0A 4GWLA 1LQUA 3ROPA 4CQMB 2PFKA 5PNTA 3RTAA 2WW8A 2FHPA 3I9MA 3B1XA 4PLHA 4ETNA 5T3YA 2BGGA 1EK5A 4WZZA 1EBFA 4OHYA 2YYZA 1AKQA 1W5FA 2WAMA 4MPPA 3UHAA 4CM9A 1SZPA 2CNDA 2FRXA 1FY2A 3VR1A 1EE2A 4J16A 4JLJA 5CHYA 5CLHA 1DEHA 4DVJA 1OC4A 3HU2A 1GNPA 1OX5A 3ETCA 2W6NA 4OYHA 3T5CA 1FU8A 4X97A 4ZC1A 3KM0A 2Z3ZA 4MDFA 2OFWA 1HDZA 1P80A 2VTBB 3QFRA 3FZYA 1H9CA 3ER9A 3BGWA 1RCUA 4DMRA 4CEJA 5U9CA 2BUAA 2RJOA 4KGXA 5E4YA 4DQXA 2LIVA 5KYUA 1OUMA 1JQAA 3MT9A 1YI0A 5COQA 3HL0A 3WQBA 4GVPA 1HLGA 3V46A 2BYTA 3S1AB 1TAGA 4UAGA 4ZALA 4PG8A 5H4HA 5BXYA 4K26A 4KKXB 2VYVA 1NVVR 2D5LA 3DLBA 4Q6BA 1R5BA 1VHJA 4TMTA 1GXSA 3OQVA 1H3EA 3NAQA 3M3DA 1UKEA 2J33A 3T1NA 4WY2A 1XZPA 1M1XB 4ZDWA 4L73A 3KQOA 4FBGA 1SBTA 4Z3DA 1YU9A 5K01A 4CCWA 3VZCA 1ZSVA 1R9NA 4UFPA 2I80A 4XSVA 3ESBA 3V7FA 2FZKA 2XQFA 1NUHA 3AHJA 4DDWA 5GINE 4TV8A 1I30A 2WVAA 4YLEA 3EUWA 1CIVA 3ZLBA 3NAMA 4Y6LA 3DZIA 4LWPA 3GC6A 3D54D 3H05A 2RGUA 3G17A 2BTQB 3I0NA 3ZWKA 5JYBA 1YKSA 1A98A 3CO5A 3DE4X 3JQ6A 4FN5A 3NHYA 2G04A 1SHLA 3ZHCA 4DV6B 1EGHA 3CH6A 1CZNA 4O4JA 5IUKC 4CG3A 3SF0A 3A1NA 1B2RA 2GM3A 3FYUA 4XX1A 4DAEA 4D0SA 1ENZA 3HWWA 1SUWA 4UTNA 4PLZA 1Y3BE 3C3CA 5LR6A 2CFTA 2GVNA 1Y5IA 1LFAA 4FJ1A 2QRPA 1U0EA 3PQ8A 5B2FA 1VHQA 1D5WA 1DXOA 4HQFA 4RL6A 1BGXT 3JYOA 4RPJA 3H1BA 4TS3A 1MX5A 3HACA 2CDBA 2X9LA 2G72A 1JMYA 4JUFA 3V97A 4BE7B 4LXIA 3H9GA 3PD0A 1EFAA 1XA4A 2IRWA 4QJ5A 4LTMA 3HKEA 4C0WA 2ZSAA 5KYWB 4F7DA 2Y3IA 4GKAA 5KOJA 2OHVA 2BN4A 2V5VA 5F7JA 3EY4A 3V1MA 5BQXA 3WLTA 5JAIA 2Z9DA 1E2DA 2PZAA 3ANTA 3RU2A 3RT7A 3U40A 4KLNA 1R4MA 3DAFA 4JYCA 2VR1A 3NV9A 3KVRA 5K0TA 1Z12A 5A62A 4KBYA 4BVLA 1Y8ZA 5KX5B 1DB3A 3P9NA 3BSFA 1GPNA 3INTA 2F48A 1YR7A 1E8MA 4DMGA 3L7YA 3QFCA 4YAKA 1JEDA 2WM9B 3E5HA 3IUBA 2YRFA 4IFEA 2B4YA 3JW8A 1UBCA 3QUTA 2J9RA 4QOSA 2GS9A 4Z9AA 3UWSA 3ZQKA 3ZZ1A 5KCZA 1X7GA 3U16A 1JAYA 3DQZA 4F6RB 1T9DA 2DTXA 1E1NA 3GEMA 4GKVA 2BAGA 1FJGB 4RQBA 3L4JA 1TUIA 2ZWVA 5F3DA 4XEHA 2QTVB 4C05A 1Y3HA 4ED9A 2BGRA 3FDJA 4HGOA 3ZWCA 1EFKA 4EW3A 3FZEA 5K3DA 1W4CA 1N2XA 3DF9A 2V03A 3QWAA 5CXUA 5LNK1 3GUYA 2D62A 3EEFA 2QAJA 2RBEA 4DRXB 2CF5A 4Z4CA 4XVQA 1R4NA 1Z35A 3MNFA 1V2GA 1XRNA 4ZQEA 1VHDA 3LXMA 1E4VA 2ZJ1A 1N78A 2XWQA 5AVQA 4M2LA 1B42A 3NBKA 2C92A 5IASA 4L15A 3NHJA 3W2EA 1Q84A 1L9XA 2VJLA 4HWSA 3KS9A 4G5QA 5F33A 4LXGA 1EX1A 4I4TA 1DBVO 1FLAA 1IMJA 3MJ4A 1JJBA 4I1VA 5AKKA 4MR8A 4N40A 4WK6A 3OY2A 3KQKA 3BJMA 1NJ2A 4PPNA 4JBWA 3ZV6A 2ZJZA 3VR4H 2BONA 2B1JA 4Y98A 5EN4A 5C52B 4RULA 4DC0A 3JD4A 1WDLA 5CB4B 7MHTA 3IMGA 5BR7A 3AR8A 1WCYA 3JWGA 5EZQA 4UHKA 4NR0A 2Q2OA 3D6TB 5CH3A 1ZVVA 4FLFA 3IQFA 4DCVA 4CV0A 4K6KA 1GUZA 1HWYA 4FFOA 4Z9FA 3JQAD 5BVGA 4LWOA 1CJTC 1ODTC 1AKNA 1JU3A 2DCMA 2FN3A 2J07A 2XVYA 3SZMA 4BNXA 1M2WA 4Q7EA 4A23A 2GPBA 2ZRFA 3TKYA 1PTKA 3JSAA 4CR7A 1RADA 2V7XA 2YWBA 2BH9A 2AQKA 5JRJA 3IP6A 3UJ8A 2XDQB 4X3PA 4AQDA 1DC7A 4AO6A 1QIHA 3AF2A 1W73A 1QAMA 1CVRA 1JHAA 1AGXA 3KKMA 3BC1A 1RXUA 3C3KA 2EFJA 5ERYA 2YW9A 1O6GA 2YUIA 2V1XA 3PPVA 3TQTA 5GJBA 1M1NA 3DNPA 5F98A 2LKDA 4NKRA 5IKXA 1II8B 3O6VA 2H92A 3LPCA 1E66A 1T2VA 2WJ6A 3UJDA 4CEIA 2JAWA 2PO7A 3EXIB 3I92A 1XAGA 3UMYA 5IKOA 3T61A 1UM9A 5GONF 4BB0A 2H2GA 4S2EA 2PFGA 5IYZA 4F85A 3HO1A 1ODFA 1DIHA 4Z6KA 4RPKA 1G5FA 5IAOA 4HEA1 3CIOA 16PKA 3ZJYA 2PLRA 3LQFA 4ASUD 4CTOA 4X20B 2JFQA 4RZQA 4WECA 1PT5A 4GOJA 4EB6A 5AMXA 4I9UA 3LUFA 3RAGA 2OC9A 4L9RA 4MVJM 2QP3A 4RABA 5HKKD 1LLCA 5AO9A 1NF2A 4XFDA 3CG4A 3HCDA 1D2RA 3BG5A 2VHVA 1LSOA 1M34E 5CIQA 5ICMA 4IO1A 4CDMA 2QN8A 3ZEIA 2POCA 3GGOA 3PEVA 4FD3A 4F6CA 1H0RA 3A27A 4QGSA 4I5EA 3N2KA 4V0KA 3NZEA 2O3JA 4I1OA 4N8SA 2YV3A 1CHDA 1OFUX 3TOZA 3VHLB 5HOEA 1UAYA 2GJKA 3UMVA 4WX2B 4KYIB 1X3SA 2VJNA 4PX3A 4PF1A 4Z0TA 1NQOA 4K03A 2LCIA 1E3IA 1OR8A 3DVQX 3CONA 1HI9A 2LD4A 3CLRD 2W6ID 5DLPA 1VDZA 2V54A 3CZAA 3CNOA 2XNDA 3NP7A 2ILTA 4ITVA 4BNHA 1G55A 4QZVA 5EJ5A 2Q5OA 1FTYA 2GASA 2Q3MA 3HB5X 2XGGA 2PGAA 1J6UA 2CN1A 5JSQA 1CP3A 2RJ3A 3CIFA 4Q9LA 1DRWA 2NXEA 1M76A 4M76B 4P80A 2FCRA 3F8SA 4YJKA 3CX4A 4PBSA 2PS1A 1HDXA 5IJ9B 4DIUA 1SM4A 3UHFA 3A28A 3C5WP 3NDIA 4XB6B 1USWA 4QUEA 2WY2D 2XTNA 4QOEA 3QU2A 4QG7A 1M8KA 2W6JD 4GEGA 4HI0E 5EXPA 2GBFA 4IVQA 3FRJA 4NZYA 3TQFA 5JVDA 5CLIA 5EHXA 4CG1A 2HZ7A 2IDKA 3R24A 4UJ5A 4DILA 2HB6A 4GOOD 1P4JA 1XNHA 2QR2A 1Z82A 3OECA 2QNBA 3OZTA 1K97A 2BFMA 1KI6B 4HLQB 4TKLA 3QQPA 3OX3A 3SDBA 3OCWA 1ENOA 3EVDA 1L5MA 3N9IA 3WWCA 5BV1A 5J43A 3AHCA 1XTKA 3V00A 2ZYHA 2GBCA 2X7HA 4Z1OA 4KVAA 2DPXA 2ZTHA 1P4HA 2I1LA 4PAOA 2I4NA 4F5WA 1LK5A 3BXXA 4Q4DA 4E2WA 1FA9A 4F86A 2R84A 4BX8A 2X42A 1L7VC 2YZ2A 5LBTA 4BNDA 3U7GA 3RUAA 1CRLA 3FUWA 1ZK0A 2EW1A 3HEMA 3WK8A 1K1EA 1OOEA 1ZVQA 2Z2IA 5KNLA 2A67A 3IHLA 3ROFA 1G6Q1 4PEVA 2GNOA 1AE1A 2Y27A 1W30A 4OBBA 4B4KA 2R7AA 4YRQA 5IDXA 2D2EA 5K09A 4BMCA 1LCIA 1U7PA 5D85A 3BJIC 3V2GA 3OZWA 1TQ4A 1J7JA 4AJPA 2PUCA 1Q2UA 5AW0A 4FVTA 4X94A 1SPXA 1WY7A 3NBMA 1HNZB 3Q3VA 1QH8B 4XQ9A 3AFMA 4MQEB 4TN1A 1LSUA 2M6RA 5EERA 4PYKA 2ZUTA 2OLJA 1EM8B 1HQYE 1N5MA 2VYNA 3L7LA 4L72A 3GLSA 3MB8A 2GSDA 4JB2A 4BO8A 1Z45A 1GFIA 1QH9A 2D7CA 1R5OA 3DAYA 3P94A 1KO7A 1U8AA 2X9QA 3OZSA 4JLVA 3FR7A 3PEEA 4MIYA 4WLNA 1JYFA 2OZPA 4IWYA 4OB6A 3T5DA 3ICQB 2FZGA 1K92A 4YWHA 3W3ZB 3IIIA 2PKXA 3KO8A 1JDBB 4U6NA 3VR4D 1NF9A 2O8DB 1ZH2A 1KAOA 2J0UA 1Y3DE 1JBQA 2C88A 2P9BA 5J2UA 1PU2A 4MUYA 4FFRA 4QASA 1Y5LA 4OHKA 4MQLA 3V1YA 4BWVA 1R0WA 4JWTA 3HSYA 4IEFB 3UYKA 1T8WA 4M0PA 4HGYA 5LZ9A 1ADGA 4HUTA 3IAFA 1E99A 1XGKA 2ERYA 3FWKA 5IVIA 1Y9JA 2ANBA 2CC2A 4I9NA 2ZJ8A 1YJQA 1VPTA 4MB2A 4CHTA 5ECDA 5FHRA 4ZO4A 1E60A 2BR3A 2IW3A 2QRLA 1E7RA 1L5VA 1WD7A 3M5WA 3K9CA 3NTRA 1T5IA 1KJNA 4JQSA 3CRMA 3WQQA 4ZYXA 4LBZA 2B25A 5HBRA 5AI0A 4ZHQF 3HPRA 3FMOB 2X2OA 2Y6VA 3P2KA 3WYDA 4D6YA 4LHVA 3STYA 3LQ2A 1EZ1A 2GQ0A 5HILA 1TT5B 1VI6A 3A6JA 1SVUA 6NULA 3UK1A 3CUSA 3THYB 1YXMA 1TZBA 5IDQA 2PPVA 1R0CA 3NI2A 3O3CA 5KNDH 3EAQA 1VHWA 4HB4A 1EHYA 3JVVA 1UPTA 1FPQA 4R71A 2NLOA 2QQ0A 4MS3A 4K9NA 2YZ7A 2NXWA 3AT1A 2KM1A 4I8DA 1JBEA 4BO3A 2FMIA 3DTYA 5EE1A 2I6QA 2V8BA 3K8OE 1D2MA 1PV1A 1SFRA 2QLTA 3LQRA 3VU8A 1W4RA 4UTXA 1FNMA 3H4IA 2GEDA 4ZXPA 4MCAA 2AYXA 4AXBA 2YYYA 3WHLA 4A6XA 2PVCA 3ZC3A 5AKXA 1C0KA 2LIPA 3CRQA 5IZ4A 1BRMA 3QW2A 4F84A 3D2LA 1V11A 4FE4A 4Z1MD 3W7AA 2JGDB 1NJGA 2MMCA 4U9UA 4ZTBA 5IH7A 1PUIA 2WM3A 2VF2A 3O74A 1B6RA 4HPJB 1JHZA 5ALKA 5DXAA 1TEVA 3KD3A 5LLSA 1H23A 1Y4DE 4MUJA 1JDNA 1XQVA 4U6QA 3MRSA 3VHXB 1JTVA 2Q3LA 2QW8A 4BKQA 3ABRB 3NQ41 2P2NA 3IA2A 4C89A 1V2HE 1YI8A 3LQ1A 3PNBA 4INZA 4DGQA 1DX9A 1HOXA 5H82A 5COBA 9LDTA 5TC4A 3G0CA 3QXXA 2BFEA 3RKSA 3OFND 3IP5A 4WKCA 2N1BA 4GI1A 1JVBA 2VXYA 4TWZA 4WEOA 3I9OA 2VWQA 1LDBA 3KZMA 3TG8A 3AFOA 1O94D 5EIWA 1CT9A 1CE8A 4TUYB 3ZKWA 3QUCA 3FPLA 4P4SB 1U3GA 3PPIA 4R3NA 4IDPA 4OQEA 5FBHA 2HGSA 1CEXA 3O0DA 4DLSA 4OKSA 5JS1A 3GJSA 2XECA 2EVWX 1NVKA 5AJTA 4KRFA 2FFJA 1QGED 3FLBA 1E18A 4F21A 1RRVA 3M9XA 3P45A 2W90A 2WA2A 3MHPA 4XQEA 2CL5A 4CFYA 2CEKA 1R18A 2I2XB 4E51A 4BUZA 1W52X 4UE6A 3D81A 4F9FA 3HVIA 3FYSA 4DNQA 2YDXA 4ZRMA 3GRRA 1ZLXA 3W9YA 4KTTE 5AESA 3DYBA 4NYIR 4G1EB 4NU5A 3PYMA 5HG0A 4OF4A 2AZTA 1CUAA 1K89A 3MWFA 3NUGA 4CMHA 1RWPA 1N3BA 3KYCA 3RV4A 4FIDA 1YAHA 4ROTA 1LDNA 4NEHB 2G1JA 3PUYA 3I37X 2PKWA 4BKRA 2XWBF 2XXAB 5LB2A 1OVMA 4TMVA 4KE9A 3VQTA 4O4JF 4F2GA 4KO8A 3GLIA 1NQ5A 3M4XA 1HRDA 3RJTA 3RQIA 4HEHA 5BUCA 4AWXA 2OAGA 4TSRA 4EY6A 3ZE0B 1I32A 3T7TA 2PUBA 1SC6A 4PCLA 3MCAA 1AV7A 2QGZA 5KX5F 1VDMA 3MQ2A 4PG4A 2OCKA 4RVUA 1FSPA 4L85A 5DNAA 3T3DA 2FWNA 1E62A 3PDWA 4I1UA 5IAAA 1PJCA 2C9YA 2AFHB 1O5OA 3JZDA 4CV2A 3A4IA 2BWJA 4WNAB 3EG9A 3G59A 3TIIA 1AA9A 3ZDYB 2IWRA 2V45A 4QBFA 6ABPA 1ENYA 1Q0HA 2CHUA 3LWBA 4DIEA 4XPIA 1TC2A 1GVHA 5F77A 3E18A 4LF5B 1AUPA 1ONSA 4Q03A 4MEBA 1RWNA 2GRAA 4KIGA 3LWNA 4PTYA 3AWDA 2QD4A 5JMPA 1PG5A 4DVGA 4MYDA 4R2IA 2Y1FA 5EWMB 2QORA 1N33B 2O8NA 2I3ZA 3BTUA 4BZZA 2ERCA 5LQAA 1NZJA 4II3A 4V39A 5HJEA 2NUAB 4IOKA 1PK8A 1EQ2A 5KJ1A 4R0NA 4G4GA 5A4IS 2Q1WA 1UQRA 2DWPA 4D8TA 2X22A 2GEUA 2JJYA 1Q12A 3TTXA 4BVJA 3LZCA 4A1FA 4QBKA 4TYWA 4CT4B 2NU7A 2XUDA 3PQ2A 1N5LA 4BQFA 1IVYA 1J07A 9ATCA 2ZWIA 3MMZA 5J63A 3WLLA 4J0HA 2BRUA 3T7IA 5DI3B 2KLHA 3C1UA 3PVSA 4YUWA 5C9ZA 4PICA 1TM1E 2QBYA 5G0UA 3ODPA 4GPIB 4HO1X 3OQHA 3QVWA 2JHCA 4Z7NB 3MJTA 3HB1A 4M4SA 2PZBA 4JQZA 3SJUA 3ZCPA 4DABA 1KOJA 2H1IA 4Q5IA 4BC1A 1FX0B 3HCPA 4LDPA 1ES9A 3SSNA 3S7ZA 4Q82A 1AGNA 4F1JA 4NE2A 1BTOA 1B4DA 4CMJA 1GG8A 3GCDA 3OCZA 5DBHX 5KNDD 5J2TA 2YHIB 1SG6A 4C87A 1YCHA 3OIDA 4LYHA 3KKNA 1IHYA 1X80B 2O2EA 4QICA 2Z43A 2DT8A 3WAKA 2ZWAA 3O4IA 3JYLA 3W4KA 3FKJA 3CX7A 3O2QB 3ENKA 3HNPA 4F91B 4G5GA 2CXHA 4J16C 1NBAA 1WB5A 2OCIA 3RYCA 1GCAA 4WKOA 3S2GA 5JASA 2Q50A 1JL3A 1H93A 2FKAA 2VUHB 4OH7A 4D98A 3WP1B 3LMKA 4CXMA 4J0DA 1K7XB 2G08A 4R41A 3DOJA 4DAOA 1R8QA 1GTG1 3LA8A 3DGFC 1YRWA 4KZPA 4RFSA 1CUXA 2ZQZA 1SXPA 3PIDA 5IKEA 4ND5A 4AMUA 2AHOA 4ZI5A 1KI8A 1GRCA 1PSZA 1UOPA 1UWLA 3ANSA 3AR2A 4WWHA 4JLKA 4RKQA 1BA3A 2K2WA 3Q40A 1QHHB 5FXMA 1K08A 3ONVA 3BF7A 4QYWA 3HWRA 4Y2RA 2PQ0A 4W5NA 4PHFA 2REOA 2GCOB 2VHTA 5CXSA 2EKLA 2PLFA 3OU6A 1E3QA 1FFWA 4AJLA 1NJFA 1T5OA 1WP9A 3GZJA 4P4GA 3FFWA 3S40A 3GFRA 3UB3A 2J0EA 5KHLB 1ABBA 1ZIPA 3AFNA 3K1JA 5ILOA 2OE2A 5NLLA 1IBLB 2IEGA 5ABPA 2Z4SA 2OORC 2H4JA 4EARA 1OAAA 4OA8A 4EABA 2ZZKA 2DBVO 4RELA 3UFXA 1E3SA 1YBFA 4JGIA 2GZDA 4AT1A 3ZCTA 3DYVA 3NWEA 2QQ5A 4O8CA 4EVQA 4EG5A 3EXHB 2X5JO 4I9HA 4LQDA 3G49A 1ORWA 2R1ZA 5HFNA 4DM3A 1PJBA 3QPCA 1QZZA 5DBIA 4IXTA 1S8OA 1ULUA 2V3VA 4ZPXA 4IV5A 5KMGA 4EO4A 2PJUA 2XCTB 3CLUD 3I2FA 1D4ZA 1FTQA 1NRWA 1CQJA 2ZRKA 4HRXA 2QGNA 3D7MA 1ILEA 5DOVA 1WKCA 4OI1A 1Y6GA 1GQRA 5ED4A 1EGMB 1MC4A 5IYZF 2Q45A 2ASVA 3WLAA 3TW4A 3K6RA 5HF6A 2J6HA 3CXRA 3X1DA 3ZD8A 4RMNA 2M6SA 3ZHQA 5CLJA 5AUOB 3R9IA 3KL2A 4WESA 1OFIA 2ORED 1CETA 2WJJA 1Z5OA 2ZANA 5G4LA 5JCZA 1YVPA 1D7AA 1MOZA 2GUWA 1JQ5A 2ZUWA 1MB3A 3U4CA 2RFLA 4UM9B 5A2QA 1P2DA 1CZLA 2A5GA 3VOTA 3PTZA 3GHHA 1CG6A 3IUMA 1QZUA 2ACVA 1TQ6A 3SR4A 4DV1B 1IXYA 5BWBA 2XKBA 3N39C 5MN6A 4BP8A 2Q1XA 5KQPA 3PGJA 4PAWA 4PCUA 1UT5A 3TIVA 2WQ7A 3VAYA 1T9AA 3R3WA 3Q5EA 3ROZA 5IX8A 3CEHA 2QJWA 1HK7A 3OLYA 5ED0A 5IBRA 4YMUA 3KOWA 3LKZA 1T9BA 4QDKA 1EA7A 2ATCA 4EFMA 1N32B 1UWVA 3OICA 2V7EA 3UT5B 3LBAA 1UDCA 2J7PA 2X2EA 4GO1A 4JASB 2Z6UA 2X77A 5C46F 1R0LA 1IOWA 1ZINA 2HEGA 3IURA 3KEFA 4HUJA 1FQKA 4GRAA 2Z2XA 3N53A 1KY2A 2ANCA 3G68A 2FX3A 4I55A 4LF7B 3K35A 4QGFA 4Y0AA 1DOZA 3QQ5A 3T38A 1EUYA 3KZVA 2ZCUA 4B3BA 4V1CA 1R0SA 2O7RA 2H1RA 1QFMA 5AW7A 4HYTA 1XJWA 3O73A 3TS1A 1N2CB 2APJA 3JQ7A 3AEUB 1R27A 3MIIA 4Z4FA 2YVAA 3GB9A 4LJ9A 4JOSA 4LBVA 2WSIA 1Z0IA 1ORRA 4J1TA 5IZCC 1KSJA 2QQGA 2HL6A 3NG1A 3E3MA 2VXBA 5JVDF 4R1TA 1SBIA 3BIWA 1IRIA 1EFVA 3H5OA 3VBEA 5C5CA 3IMEA 3W5CA 2R8RA 5CDTA 1UC4B 3KZXA 1JDSA 1QLJA 3OT1A 5EPUA 1OQAA 1ZDMA 2VQ3A 1AHPA 3H6KA 1EJ2A 3GBVA 3ZQUA 1CC1S 2RHBA 4KBFA 1M1YE 4C0QC 1GDTA 3GJTA 1Y48E 5H68A 4RGVA 1Z0ZA 2GHIA 3GZTB 3ME5A 4L4UA 2XRYA 4MV1A 2KLBA 4ZMRA 2HCRA 5ITVA 2R6CA 3I8XA 3K2IA 2IU6A 3BD8A 3DHEA 1NHGA 2ODBA 3QEKA 4IH1A 3S2UA 1G1AA 4YP7A 3C6ZA 4IMPA 2PNFA 3CF0A 1F0PA 1H5QA 1GTZA 5GM1A 3DYIA 2X1VA 3GF4A 1F1JA 1QTNA 1OXMA 3LUKA 3QVTA 2NO9A 4FNAA 3WLPA 4N49A 2O7SA 5HMMA 2QLLA 4WXYB 2JI9A 721PA 2HNBA 1HMPA 3MTJA 4X1KB 4GI3A 1QQTA 5HS6A 4FHGA 1FDSA 2OYCA 4LRYA 1YZUA 2I6SA 4C3OB 2V4ZA 2JAOA 3P4YA 1Z17A 2RB4A 1O96A 2VC2B 2GDJA 4RMGA 3WDLA 2XUIA 4NRDA 5DRYA 4ZFNA 1EXVA 4QX6A 3P20A 1RSZA 1DBSA 1NLUA 1QHGA 3SCZA 5E9AA 3DVLA 1FLVA 1EYZA 2UZ1B 3QZUA 4K0RA 5BV8A 1ZICA 4HGRA 4Y6OA 3N2GB 1N4AA 5EWLB 1EA5A 2GPTA 1EK6A 1YDEA 3FHCB 4IZIA 2YWCA 4ZU6X 2QZZA 2BZ1A 3ORQA 1A4IA 1EVEA 5CNMA 3NOOA 2DKNA 5T6BA 2GYYA 2HU2A 2PZMA 4V0SA 3FHTA 4KREA 2MTBA 3WLNA 1ZR4A 3M5CA 5ARCA 4L5YA 4MWTA 5HJ5A 4M8IA 1SVLA 5J2UF 4UQOA 5AW9A 3AUTA 4CIWA 3HJCA 3OWOA 1NP7A 2OBNA 2WT4A 2YNMC 1WAMA 2R6ZA 1IEVA 2Y1WA 4KPGA 5HA5A 3FYHA 1T1GA 2VYQA 3MCVA 5IDYA 2PKCA 5EZ6B 4GDFA 5E4JA 1C3XA 1NQVA 1W8IA 3HCRA 3D8RA 1M6WA 2DY0A 1ZEMA 1NC1A 3KOOA 3MS7A 4H15A 1YH3A 5CGZA 4CWAA 5JYEA 3DVAA 2JFVA 1JEAA 2WE8A 1YIAA 5C18A 3LVFO 3G8CA 5DF1A 3HXOA 4IJUA 1FNCA 3HLTA 2GT1A 4MRRA 5BSTA 4C9BA 1ZXBA 4OLAA 5BN4B 1D03A 3R5SA 3DAOA 3LVQE 4RUKA 4UATA 3UF0A 4WMLA 2EV9A 4J7AA 1KO1A 3C6YA 4OL9A 1Y1QA 1H2FA 4IDAA 4TVBA 2X41A 2ADMA 2UYCA 5GAJA 3IHTA 2VCYA 1Y5RA 1W1WA 1N9GB 2IYNA 3C7KA 4CM9D 1D5CA 2EWVA 2VJCA 5JSUA 3FOZA 3KEQA 3M4ZA 4QARA 3H6GA 4OGLA 3X0DA 1XZLA 1Q14A 3SE7A 1Z8DA 2GLTA 1ESNA 3WFZA 3JWEA 2IS2A 3NKLA 4QGBA 4R9SA 4HNQA 3S1SA 1VKZA 2UUOA 4FMDB 1SUFA 3TVYA 1M6VB 3CS3A 2X0JA 4B3TB 3O4JA 4X62B 1RDFA 3DMDA 3W1WA 5JCXA 4OBXA 1W44A 4BB5A 1ZN7A 3G0OA 2UZAA 2YVKA 2ZJ5A 4N7RA 4D5GA 3OLCX 4PONA 3TDNA 1T9GR 5EIEA 2WWRA 1ECCA 1JHPA 1QVWA 2QM3A 3LYHA 1KDYA 4D99A 3PEYA 1U65A 1YRHA 4HZIA 3S0JA 1ZD9A 2DX7A 1AUOA 2R7LA 4QBIA 1T1JA 3P9KA 3ZI0A 3LDFA 3ZLVA 2MINB 2WKQA 4QXRA 3GFBA 1PEYA 2UDPA 4IY1A 3VKUA 5FIUA 4FYJA 2QV7A 4LK2A 1R7RA 3GO4A 1HKHA 3E35A 2W6QA 3G0BA 3N07A 3ENWA 3KOXA 1XTVA 3HUEA 3PI6A 3IBGA 4UHHA 1UOQA 2E48A 2Q5LA 4M6WA 2O5VA 1E3MA 1JU4A 1NFFA 3FUVA 2OXEA 3EQ8A 3BD9A 2O2HA 2FP4B 4LHWA 4NZOA 3SAJA 5BNIA 1QO7A 4M0FA 4C14A 1T2AA 2VWPA 1YK0A 3FJ1A 1R0XA 3DDOA 3Q72A 2QF7A 3LY5A 4TWAA 2QUAA 4Y30A 2B0JA 1YS6A 1PQ4A 2A1UA 1XTZA 1QAQA 4RTMA 1K8ZB 3EGDB 1O5TA 4RHYA 1YF3A 4NF2A 2XQKA 3FVRA 1C9KA 2MYNA 4FT2A 4ZK6A 4AJEA 1QDEA 1RZVA 2I6FA 4GMKA 4L8YA 2H1WA 3FOEC 1I3NA 2A88A 4GPZA 3PIRA 4TTQA 5AHXA 1V16A 1XNGA 1KS2A 3RU3A 1E98A 3QF7A 4MGEA 5JROA 3UV3A 3LE8A 3WQHA 1IRXA 1DQYA 2YJ4A 3PUJA 5KJFA 1PGJA 1FTWA 1CJBA 3IDOA 1N2BA 1SVIA 4BFCA 4DFDA 2G09A 3MPUA 1T36B 4N41A 3AR3A 5BP7A 1S2OA 3QVLA 1ZH8A 2MT9A 4RADA 4GI7A 5JXHA 1JKJA 3I6IA 1H2WA 1RRMA 4E09A 2CE7A 3L82B 1WMBA 3IQDB 2HHLA 1X0XA 4JB0A 3RFXA 1GN9A 4OQPA 5MGBA 3WYGA 1KZ9A 3HCWA 3NHPA 4UVEA 2H51A 3ANLA 4ER3A 4FFNA 4UHEA 2Q4EA 2W43A 2KBEA 1MXFA 3C3AA 4TKVB 5D5HA 1KORA 4FDMA 2XQJA 3LYAA 3CC8A 3E1SA 4P3KA 3VPDA 4KI7A 3IDFA 2QN7A 1TZJA 3BOSA 3ID6C 4B6GA 4M7RA 4EUFA 1PI3A 4AKHA 4OY3A 4R98A 3OZBA 2JCYA 3O38A 4H18A 2RH8A 1Z5WA 4MWGA 1K6EA 4Y6RA 2PRYA 3PC4A 2GXQA 2G06A 3R3UA 4I46A 4DC9A 3LXRA 1YDHA 4LZLA 5EZ5A 3SP1A 1KRXA 2P5TB 4ZCMA 1TKCA 5J4LA 2OL4A 2JLRA 2MR6A 1X1RA 2DWOA 4OLFA 4QPDA 3E4DA 2VP4A 4XDZA 1CY6A 2DXIA 3KYIB 1UAAA 3FDXA 2XKKA 1UBUS 3FI9A 2OWDA 4FXOA 1AK2A 1OH6A 1DEXA 4FFWA 2IQ5A 4P81A 1CULC 4IWXA 4BE9A 1WOYA 1CJCA 2HWUA 1BHO1 1B16A 3E7FA 3H18A 2ZSUA 2WHXA 1M34A 4P58A 2VG8A 7ADHA 4E7PA 1PGOA 3PBKA 2LZ0A 4QYXA 2I3AA 4HFJA 3PHGA 5CA0A 3QJ5A 3WGGA 3DTTA 2A0UA 3D4BA 1NVBA 4YJGB 3FPSA 2B82A 4O5AA 3I61A 5LXTB 1XXLA 4DDKA 4R7TA 2JK1A 2ZRDA 4UM5A 3S4YA 3GGPA 4BX0A 3THOA 5IN4A 1CR2A 1Z6QA 3MGCA 1EFCA 2FEKA 2IYOA 5FLXA 1U3FA 5EJ9A 4KL8S 2QE6A 5AXBA 1NXPA 1RW4A 1QVRA 4KK3A 1MX1A 4TZ0A 1BXRA 4B2IA 1HL3A 1SQFA 1LTKA 2P9CA 4ZKEA 4EHDA 1WMAA 2HXGA 3PX7A 4NTZA 1YB1A 1RRKA 4HDKB 3VVCA 1H1TA 2P0EA 2YVLA 3D6HA 1O87A 4I14A 3OH8A 1IZZA 3D0RA 2ZXUA 3ZLUA 3U2QA 2JI4A 1RACA 2Q6KA 5FULA 3P9QA 4LN1A 2WNHA 5CDSA 1IXSB 3H5VA 3U26A 3L4SO 4I3GA 4UXIA 4CF4A 4DLKA 2EFDB 2XYRA 3O8OB 4NK5A 5TX7A 5A7FA 3JD1A 4IHQA 4NK4A 1PWHA 3HYRA 3CF4G 4LHZA 5EJFA 5CD9A 5GZ1A 3S8YA 4Y0VA 4DN6A 1NVTA 1PHRA 2GEVA 4QQKA 1WBJB 4Y1RA 2NYUA 1OIVA 2PV0A 1EFHA 2IU3A 2TYSB 2QTHA 3OE1A 4KWCA 5AM1A 3STWA 4YQFA 1ETUA 3GH1A 3DCNA 4FS3A 4MW2A 2WWVD 3SX4A 5IXSA 4KQEA 1ZUIA 2YS7A 2V9PA 3LL4A 5E6RB 2CKDA 5EQJB 3QXGA 3V5NA 4IIFA 3RYTC 3M4YA 3DBRA 4XYEA 1DAPA 3ETGA 3SJAA 3CWZA 3P2JA 4O29A 3E61A 2ZVJA 2PSHA 1O89A 2WEKA 5A4MS 4QXAA 1J8YF 3R8XA 3VAAA 4L4SA 3VPFA 1TKRA 1XSEA 3ESAA 4MA4A 4JI3B 3UAYA 4BJ1A 2PX2A 1VGRA 1L5HA 5DCWA 3DL2A 4PNEA 4WUTA 3IOYA 4D41A 1JE1A 4QD3A 3COPA 3DZGA 1ZK2A 2ZLBA 1Y33E 2X19A 3SS9X 1U2PA 4DT1A 4GIBA 2PUGA 2XGJA 3HJTA 1WCWA 3PWTA 4PZLA 4X71A 2GOYA 3GMIA 4PZCA 3E8SA 2ID7A 3QI2A 5CJPA 3E9QA 3V34A 2VNIA 5BNTA 5HUQA 2DTDA 2NN3C 3TGLA 2DUJA 2VDQB 4O0LA 4FNGA 3KD2A 3WA6A 4UVIA 1C1DB 2QTMA 5K0FA 1MAVA 5DM0A 2QYSA 5T64A 2JGEA 3VH4A 1E6LA 4AN4A 1WZEA 3M1YA 3OSZA 2A94A 3LUJA 4FKMA 1H9BA 1V8FA 1NP3A 4C20A 5KINB 3M6VA 5KVCA 4GC5A 4WPGA 2XNDD 2W2OA 3GJ4A 2VPPA 3DBLB 5JCOA 4ZZ0A 1BC5A 2CXNA 1E3TA 2Q0QA 4UHCA 4D3YA 1A5TA 3Q7IA 4QLAA 2IBSA 4G0VA 4C7VA 2AFHE 3ONDA 4B33A 3H3FA 3RUDA 1K4YA 3H87A 1H5NA 2R25B 2R60A 4D25A 1XJCA 3K6JA 1T8PA 2W83A 4YN3A 3WVNA 1G38A 1E69A 1JHUA 5BPFA 2Q3FA 3V80A 2C07A 1I94B 2CXPA 1QX4A 2JL1A 5CBPB 1I2CA 2O5RA 3WR5A 1LU9A 4NMHA 3S29A 3WRXA 4QRDA 4ZOLB 3RRNA 3ZZ0A 4FFBB 2B8TA 1FDVA 1LBIA 1Q0QA 1R6TA 2V6GA 3FNRA 4H7PA 4M88A 5C1OA 5LP6B 2V3CC 1U63A 4AULA 3BWCA 3BH7A 3CHYA 4CN9A 2WBLC 4EHNA 4QU0A 1XALA 3FCYA 2QLMA 3MAJA 4UVDA 4NBNA 1W8DA 1QS0A 4CKCA 1DUSA 1WTCA 2CLOB 1O08A 3ZU4A 2QU8A 4US0R 5KUTA 1DEAA 2IHUA 3CVWA 1BD4A 2MSNA 1PFGA 1OBCA 2OC4A 3AOEC 5BSRA 3WFIA 2VQSA 2C03A 1MQ8B 3OPXA 4BNLA 4E2XA 1NJ6A 2OCDA 2C7OA 2FX5A 1Y98A 3WDSA 4YALA 1CS0A 2FETA 4ZP1A 3B1JA 3DM9B 3DV9A 3KVVA 5EIOA 2VXCA 1Z5UA 3GAFA 1UJBA 2Y93A 2Q5JA 2VPTA 4X54A 1MQ9A 3EXG2 1I6WA 3QUQA 4ML3A 4JP3A 3RTEA 3F73A 2GA9A 3JQQA 2X23A 3Q2OA 4UHDA 4ZOCA 3HM2A 1GFSA 1UK7A 2LTAA 2J08A 3PF8A 4OMDA 1MBZA 3D3JA 3JATB 2YMPA 3CH7A 4OQXA 2ROQA 3OLWA 4H0CA 3R23A 3CLVA 5JFGA 3UT0A 3NT5A 1XQ1A 4HGQA 1YR8A 4NARA 3I8OA 2AE2A 4FLMA 5A7HA 4GMDA 3UUFA 2VYND 3G9XA 1V8PA 2DR2A 2WHQA 1GILA 3IVXA 1T34A 5DH9A 4Q3CA 2P1RA 3PFBA 4CMCA 1PR2A 5CNJA 1MTOA 1OY1A 1QANA 3L0IB 2ECFA 4N6GA 2CXQA 1AH2A 1QQ7A 3W05A 4AG6A 3PQCA 5EHGA 7REQA 4EPWA 3AXSA 1R9JA 2A30A 3IPRA 3W6UA 4G9EA 2R5FA 4Y7DA 3M4NA 1NL3A 3WGKA 3EXHC 1LNQA 1E4EA 5GP1A 3BIJA 1TLLA 3GFVA 1A9PA 3T7DA 3TSWA 4CLRB 3AHIA 3R7DA 1C81A 2OGTA 1SXQA 1GPMA 1NATA 3RHFA 3R3SA 1G20E 3CF2A 4JS0A 4QSMA 5KYGA 1KQNA 1HM5A 2X14A 2XT9A 1S1CA 1C14A 2CCKA 4CKBA 4TLMB 4PX9A 1ZGAA 4QYMA 2ZE8A 4BLSA 3CSDA 1BZYA 4Q6WA 1XEFA 3BHMA 2PBFA 1MO6A 3IE1A 1O97C 2QXTA 2JJMA 3TVTA 2OGWA 2WE7A 4DDHA 1XCPA 4DNOA 3Q9SA 4F4IA 4HZGA 1KP3A 2PVPA 1E7SA 4CPDA 1PW5A 4BLOA 2QLBA 3IPLA 1ZUWA 4Y2JA 1VIVA 2FSPA 1K98A 3VKHA 1RQGA 1DV2A 4AN1A 3PGKA 4GR4A 2P6OA 4OUDA 1LWNA 2VHCA 3QWBA 4G9BA 3F3KA 3G8AA 2D5BA 4HSEA 4BOYA 2DSNA 3CV3A 2OQVA 3AR5A 3TLXA 2CXOA 4Z0HO 5FOXA 1J42A 4BCBA 3G0GA 1KP2A 1GL3A 1RC1A 2WYHA 3MLEA 3P27A 3AYXB 4GZ3A 3BMCA 2FX2A 4YRFA 2JLXA 3INRA 3RHZA 3HG7A 4CDGA 5TMBA 3WMFA 5KYKA 4Z53A 4HATA 4YV7A 1IY0A 2XRMA 4I81A 1SZDA 4KQIA 3KTAB 1ZBQA 3BL8A 4UNQA 1I1QB 2H08A 2A1IA 1AS2A 2D4HA 2LNDA 3KOYA 3KQSA 3QFSA 4KMOA 2XF2A 4RSHA 4YT5A 4H4CA 4BEWA 2QTBA 3R40A 1CRPA 1TU3A 1XZFA 2W22A 2FJPA 3PWSA 4DLXA 1QPGA 5CLQA 2HA6A 5K0BA 1E2IA 1TAQA 1KYTA 1C4XA 4RY8A 3WE7A 1TD1A 4D9KA 4F72A 2XBMA 1EGAA 4F3TA 4YFVA 1MN6A 3L7BA 1V5IA 3KZKA 2IEBA 1BKSB 2FW0A 3OPYA 1KI3A 4MROA 4ND8A 4DCPA 5BNFA 1XXHE 5TMDA 4QO7A 1FNSA 1QYWA 1XX6A 4O2LA 2ZQYA 3C45A 3TN7A 4B6SA 5IN5A 1KPHA 4B3XA 4YMTA 3NYWA 1U28A 4UMEA 1QIIA 1W2WB 3ZGLA 4Z8XA 2PKEA 1CUZA 4JMPA 2G0AA 3PC6A 4QFCA 5CPFA 3M6UA 4PS0A 3GEPA 1XDGA 5LJIA 3EYWA 3F96A 3LX6A 4ARVA 1SCBA 1WLYA 4RY0A 1N2CE 1IATA 1NVEA 3QEJA 5ALUA 3B6KA 4XWGA 1XJ5A 3PP8A 4W9NA 3GLVA 4ZO6A 2OP0A 3W6OA 1S4MA 4NJEB 4PWYA 4J1TC 4Q24A 4G5YA 5F64A 5FD8A 3RLFA 4B09A 2OBXA 1KI2A 3P5BA 4Q1AA 3RYIA 4JY7A 4Y6QA 1Q77A 3BWYA 3SGLA 4RH3A 3K15A 3P9ZA 4ER6A 1NXVA 3NGMA 4FCCA 2AEMA 4HNTA 2WJVA 3WWPA 5IFKA 4J0IA 1JR6A 4Q4HA 4KFCA 4O6VA 3HB7A 4RE6A 1RP1A 4N5DA 1X1BA 2I8AA 4LIPD 4TTAA 4WASA 4WK0B 5K8CA 2O3SA 3DHVA 3G2KA 2IV3A 4YV2A 4H4DA 4DXHA 4MQ6A 4ER0A 1U2DA 4LRQA 4A10A 1G0OA 1VHTA 1PQYA 3FFTA 2B69A 2H48A 1ZWKA 5EVJA 4BFUA 4B7XA 3UMJA 2CV2A 3EPKA 4IMRA 5CVTA 1UOEA 3B9BA 2JFUA 1PV2A 3U7IA 2Q62A 1EESA 2EJBA 2ZBFA 4FLEA 1RABA 3TXAA 1XMPA 4ZGBA 5AVRA 3DE3X 5C3UA 1D6JA 2FSIA 3I1YA 1AGRA 4BNWA 5LA6A 1N2ZA 3RBVA 3HR8A 4DMMA 3FFBA 5JEDA 2Q1YA 4C4RA 4EITA 4FUQA 5AKLA 1CQPA 3AVWA 2VK1A 4BO9A 2PWAA 2PMEA 5ALSA 1G9SA 3IOBA 2EERA 1ML4A 1E2FA 1WCIA 1D8TA 1H6DA 1ZA1A 3FGPA 3NETA 3KKZA 1QYDA 1VMIA 2L82A 1EZZA 3DCYA 3KIPA 3L7OA 3LPMA 4HH0A 3RWBA 3UPDA 4RPIA 3ZXUB 4ALMA 1JEQB 5AW3A 1R6XA 1YTLA 1XD8A 5EY5B 1KNXA 3V8MA 3W9BA 2JLSA 1WRBA 2ZPAA 5BXQC 5TVGA 1UBOS 3TE7A 2VQDA 4XRRA 1CKEA 5CT5A 1Z2NX 5EJ6A 2QAGB 3NYRA 1C9NA 3EVGA 4GYYA 4ABYA 4OPMA 2BM1A 2OXFA 3CUTA 2AKAB 3G8DA 4PYQA 3PDCA 4TWRA 3DJFA 3SC3A 1D6SA 2X4IA 3M6MD 1CY2A 3GQBB 4JVMA 4YRGA 2YFQA 3H1TA 4WXEA 5ITZB 3RT9A 4I50A 1UBKS 3UXYA 1O0SA 2A9VA 4MQUA 1YB7A 2BMAA 3DWGA 3TR6A 4U4AA 1U7WA 1O95C 1X14A 1U99A 4X8HA 5H4GA 1Z34A 1YS4A 2WU8A 3A11A 3N0WA 4C03A 4D81A 2WIAA 3RUPA 3GDGA 3TW0A 2VCEA 1FVHA 2LUOA 3C8ZA 1W1UA 2X3FA 2P3LA 1JSXA 5JHHB 4UNIA 4B3RB 1GZ5A 3K1TA 4MYTA 1TQ8A 2GA8A 4ZAZA 1Z83A 2QVLA 3OCCA 1TCAA 3MK31 1HETA 1VXRA 2GBIA 3GVCA 4Q19A 3KKKA 5LQDA 4M9QA 4TTRA 1XTBA 1ZM3A 2PT6A 4HNGA 3I5MA 4OKIA 3VGJA 1QNFA 4DUPA 1JXAA 2ZPUA 5CJ2A 2JLVA 2HAEA 3ORFA 3KJFA 4MQFA 1CQIB 4MR7B 1YRAA 1OLUB 1G2OA 4TLCA 1DO0A 1E8DA 1V43A 2G8LA 2IVZA 1NN1A 2G3YA 2RGNA 2H7XA 2EFGA 3L0OA 3L7JA 1R8JA 3QE3A 5KWVA 4OIFA 1GGMA 2FMKA 1EB8A 2C4KA 2DG2A 4GLBA 1AXGA 4W5JA 3UA4A 5L3QB 4WXHA 1E7WA 5GZ6A 1GNVA 4LJAA 3VDNB 2IXAA 2IVFA 1NTOA 1CF2O 3U9LA 3RIMA 3UC9A 1MPXA 1GT6A 1JVNA 2XMGA 1GIAA 3N76A 6PFKA 4ARZB 1ZP6A 1VJDA 1JVSA 2VSQA 2ZSBA 5IKPA 3F1KA 4OQZA 2AZXA 3Q88A 1QV7A 5LZ4A 1M54A 2WZDA 1HLDA 1UDAA 3E8XA 3IESA 5A3QA 3E0XA 4O2AB 5DWDA 1UMDA 1AQJA 3ZJ5A 1WL8A 1EUDA 1GUDA 4GMHA 2LR0A 3MM4A 4KRYA 5FF9A 1NULA 1DEKA 4AJHA 3AI3A 3G9UA 5CFMA 3GLHE 3DEZA 2OSBA 2XY4A 3BMQA 3FBWA 5KNCA 3AUUA 4AJ2A 4O4LB 4G3XA 4CCYA 1DJPA 4EDHA 4Z4IA 2PX4A 1W85B 4ZDKA 3SIPA 5K0CA 5DEIA 1O97D 4QXMA 1RQPA 2B3TA 1UZLA 3LPDA 4WZBE 3PQ5A 4WV3A 2XA2A 4BLTA 1DBWA 1X8XA 1TL7C 2B8JA 4Q05A 3F3MA 3OKPA 1NIPA 4JLMA 3RAPR 3U56A 5IVHA 1N5DA 2O2JA 2J31A 3L4BA 4REQA 4BP9A 3QG1A 4KQKA 4I9FA 2RGAA 1VP3A 3U5ZB 3PGA1 1C7ZA 4B6EA 1R5JA 1FZTA 2JBAA 2DBQA 2BMFA 3D3EA 2RK4A 4FOOA 2PJDA 5EKSA 2WMNB 1M1YA 1L4UA 4P36A 3KSZO 4X95A 3WNQA 2R96A 4FYVA 2CLKB 2XLCA 3IQZA 4IDEA 4B3GA 4NBKA 3EUFA 2O2GA 2BEVB 4IIEA 5SYMA 3ELUA 1L4EA 4N5MA 3WSTA 2GZRA 1DAEA 5GIPE 3WZ2A 2L2QA 5DYIA 5EHZA 2OG2A 1P9NA 3Q5DA 2Z1MA 1OPRA 2O0MA 1MOSA 5AJYA 2CUZA 2A4MA 3E7WA 3T5TA 3ZDQA 5C8XA 3ADCA 2DT5A 4JBNA 3RSCA 2DFLA 4LJSA 4OGGA 4UFNA 3T9EA 4EEZA 3VDQA 2EHJA 3OM9A 2DWQA 4OHPA 3M34A 1F3LA 2GWHA 5DB4A 4XQCA 3WXMA 5DWVA 1UXHA 3JTMA 4TMYA 4WOJA 1V4BA 4GI5A 2CLSA 4HWPA 4YH1A 4YRZA 5JBQA 4L0QA 2H0QA 3ONWA 2G9UA 2PMKA 2C2HA 1Z4PX 2BLNA 3WLFA 2VA8A 1ZOIA 5CHEA 4R3WA 1LB1B 2A14A 2HNAA 5LP6F 1XMIA 2XGSA 3JAKA 3U13A 3U5TA 4GPAA 3SHTA 4EHJA 5D8DA 2H1FA 4CF3A 2J7PD 1QYIA 3MFQA 2Q3EA 3GZNA 1I1OA 4RJIA 1AIPA 1KAEA 2SCUA 1II8A 1JU9A 2IGBA 2RBKA 3EBLA 2O14A 2WV7A 1GTSA 3NRCA 2QJTA 3THXB 4S1VA 4XVHA 3W5JA 1X0VA 1U0NA 5ANRB 1MB4A 1V7ZA 2ZIWB 1KZ1A 1QFSA 2GCEA 3DAHA 1C3LA 2QNIA 3DEFA 3EEQA 3O1JC 3QKRB 3RUIA 4J3JA 3WHIA 1QGUA 4ISBA 5C32A 1WR8A 2FMHA 4ND2A 3EQZA 2QUHA 4JUDX 4J94A 1X87A 1AHNA 3IL2A 2ZYUX 1YCGA 4Q18A 1SVWA 1FFCA 1G7RA 1YIOA 2ZOSA 1GPWB 2HPVA 4IGKA 1Q74A 5F76A 2EWMA 2J9FA 5ILQA 2BFNA 2D54A 1FZQA 3SX0A 2W2TA 4IQ8A 2W7TA 5AKZA 3SOPA 1G3QA 1HEIA 1Y4SA 4LOKA 1DKLA 3KB2A 2GD0A 4IVRA 3S2SA 2X0RA 2BZ0A 4BATA 3WGUA 3BBPA 3P7MA 3LCMA 2NV2B 2BP7B 4WBXC 1V4NA 3ZVKA 4XWKA 3A37A 1JV2B 4AYTA 2CV1A 1ZX1A 2RHOA 5MF6A 3TW8B 1DWPA 1WETA 2ZJOA 4D45A 1VM6A 4HDRB 3BGOS 3IV6A 3NDPA 3OJOA 2ZRHA 3JARA 1WXFA 3RG2A 3A70A 2FR0A 2XCOA 3OCVA 2OZLB 2ZVQX 2UYOA 3DMHA 1ECGA 5C8YA 3RS0A 1JSCA 2NV0A 4BDTA 1BO6A 5CAEB 3GJ6A 4HWRA 3TD9A 1T3ZA 4RVDA 4TTTS 1YZVA 1W88A 3LU1A 3NKFA 4LV6A 4ZYLA 3NYIA 2QROA 4XDGA 4EL0A 1ZGCA 1BDJA 5ALYA 3AI7A 1YBAA 2NG1A 2ZR9A 2OV3A 1F5NA 4N0QA 3HU1A 5TS2A 1E2GA 4EY7A 2UUCB 4N48A 1H22A 1QFXA 3SYLA 3Q7EA 3OOYA 5JTTA 2PGDA 1IY8A 1DX4A 3A1CA 1UCFA 3MGAA 4O02B 3TZKA 3ZCUA 1BH2A 2EJVA 4AJKA 5C34B 2FPGA 4XWOA 2IYSA 5EHIA 3MTAA 1KEZA 1YOVB 1DNPA 4BMOB 5FLKA 1S9HA 4HRAA 5A5GA 1F8GA 2B9VA 4W1SA 3UAXA 5T8KC 4AY6A 2DAPA 3Q7PA 3Q6IA 5WRFA 2CBXA 1HT2E 4MZXA 2XDYA 3VC2A 4A6DA 3HVRA 5JATA 4Q4AA 4UUQA 2VQFB 5LYJA 3HYNA 5JXJA 1KI6A 4L50A 3TPZA 1UFRA 2I1VB 1GWNA 4KRXA 4MULA 4ZPJA 5DLDA 4JEIA 2COUA 2PGIA 1MVOA 5FADA 3R20A 3G5UA 3RODA 4DBLC 3RBAA 3G2JA 3M2TA 5IW8A 5HRUA 3NEPX 3MINA 1YMQA 2WINI 4DM7A 1GSIA 3CFYA 2JFFA 8MHTA 5F1OA 4L0MA 5J4HA 1XYVA 1BDHA 4Y2UA 1FMFA 2R751 1C41A 3CW2A 1W48A 1L7QA 1R6VA 3MTGA 4A5OA 4JBYA 2VATA 4K9SA 1A5AB 1AVTA 4ZZIA 3IE0A 1EKXA 3IELA 4RDIA 1PJLA 1UPXA 2IYUA 3CZQA 3B78A 3O82A 3OESA 4PPQA 3BAZA 2XITA 1HOTA 1RQRA 3DAPA 4TLBA 2C9CA 4L4YA 4BMZA 2P62A 3ICEA 3UCXA 1GAXA 4M98A 1VSQA 2XKAA 1KH3A 2BY4A 2HBRA 1B00A 4Y7CA 4DLAA 4DCJA 2BMEA 1WQ4A 2RBGA 3W4IA 3AR9A 1M3SA 1S8AA 2O52A 1QQ5A 5LP6C 4LJLA 4RM3A 4AWBA 5AHWA 3L8CA 3BT7A 2OR3A 1QOZA 3CGGA 3ZE8A 1EFRA 4BQEA 3O94A 1XA3A 5TF4A 5KSWB 2O7NA 2A0WA 1JDPA 4EPXA 2DR0A 3Q0TA 2O8DA 4YRNA 4GQIA 2F17A 2H8GA 3SMVA 2MDTA 1K8XB 3B3JA 2C78A 2D0IA 2CHQA 3L5OA 4FWIB 4E94A 3RAFC 3QKIA 3IR5A 2R00A 2H00A 2J3DA 4JA2A 5H3CA 1N6HA 2ZS7A 4P34A 1TYCA 5ENVA 2BKAA 2CYCA 1KWKA 3WA7A 2CBZA 2EJCA 3BMOA 4JI5B 3STUA 3D0QA 1N92A 1KJ9A 1M5TA 4MRNA 4FYWA 2VTEA 3L93A 4I1RA 2A1TS 3VPHA 3O47A 2JBWA 4G0XA 3G2PA 2JIBA 1GQYA 1S3IA 4F7WA 4X93A 5TT1A 2AEEA 1DTSA 3KV1A 3R3JA 5SY6A 3OZIA 2F90A 3MG9A 4XRGA 4RTKA 3NBQA 1C3OA 4HVTA 1A9RA 3RH0A 1KTIA 2Q1SA 4M1OA 3LY9A 1Q16A 4CT0A 3WLJA 3VSEA 4DR4B 3E23A 4OHOA 5CA1A 4G41A 2KW5A 5AVKA 1PG0A 3I76A 1QCYA 3QXSA 4RIFA 4CKWB 1GOTA 1SIOA 1FS6A 3RGWS 2Z2ZA 2WUEA 2Q4BA 4HZUB 3URKA 1SKYB 4M1MA 3AERB 4Q1VA 5G53C 3TEJA 2VXOA 4HX2A 5JTUA 4NMLA 4ENTA 1GDDA 2CVOA 3QKSA 2CGEA 4O4IA 1X1CA 4W6ZA 3WLRA 1OTYA 2RSLA 3AZPA 3U44A 1XLUA 4PY2A 1SN7A 4GX2A 3DJYA 1KETA 1GAQA 3GCXA 1POWA 4OBWA 6REQA 4KPUA 3PI7A 4FX5A 5DHFA 5A9SB 1G8MA 2AG1A 5JDIA 1D9XA 1PNVA 1WQ1R 4IDGA 3RRXA 3X1JA 1J2EA 2VEDA 4JBIA 1CQXA 1E2HA 3FKQA 1TM3E 2ID8A 4QREA 5A0VA 2XRFA 3GJXC 1D1QA 2D1SA 5A05A 3VHXA 2L19A 3GEIA 4N12A 3UK7A 2OM2A 2E5WA 2AH5A 3JAMA 4AZ3A 3I2KA 2H8KA 3FW1A 1SG0A 4WXPA 1GY8A 1RE0A 1FDIA 3JASA 3IOEA 3KDAA 3LCVB 3TX6A 1ZIYA 1E6EA 4XGRA 2AN5A 5EIAA 3BA1A 3RNLA 2DPMA 5I7EA 4A15A 2O5EA 4NU6A 2BIFA 4AKSA 5LA6F 4ZI7B 3ZCSA 1ISRA 3IILA 5BURA 4KQFA 4U3JA 1IBMB 2JW5A 3T1OA 2DBYA 3RC9A 1PTJA 4KH1A 3WSWA 1WTAA 5AKIA 2MWMA 3D9QX 2WJWA 3RFCA 2RCNA 4YI5A 1A7JA 1BE0A 3KLOA 3WKEA 3VHQA 3FAKA 2W00A 1ZXLA 5I7UA 1E0AA 3KB8A 1RBYA 3BM5A 4RAOA 1SXIA 1Y7LA 5DM4A 3VNAA 4L3WA 1DHRA 1T8RA 2AZMA 4ZEXA 4JI1B 4D02A 2XUGA 1E2EA 1CUHA 1IM2A 2J4FA 3V4VB 5JNWA 1CDDA 2JRLA 5T41A 1I01A 4JXJA 3ICOA 4QTXA 3UWPA 3R41A 3OQMA 2IYLD 4HVAA 1BVUA 1SCIA 2GF2A 1YQEA 3K8ZA 3P96A 3GUZA 2X0KA 4HOYA 4XGQA 4EDFA 4CL8A 2ISQA 1OAKA 4CF6A 3IEKA 1G6HA 4FMBB 4JYAB 1P0FA 4PSDA 4D4GA 2B4KA 1RYBA 3QNUA 4CM7A 4I5FA 3GOQA 1NHWA 4OQFA 5HQJA 4KR9A 4EQZA 2PTHA 4ZANA 2K7FA 1IXKA 2GM9A 2XQIA 4LY0A 2CNOA 2BEUA 4HB2A 3MLBA 1HYEA 5DBEX 4AMVA 4EUEA 4TROA 3C6BA 2PSDA 2DPGA 4MJLA 3PFWO 4NZZA 4CLXA 5L40A 5M2QA 1E1RA 2CUKA 1XU9A 1JIUA 2VRBA 2EFEB 3H5AA 2O8BB 4LJ6A 3I2YX 2HTEA 1UKBA 1MW8X 3GA7A 4RL4A 5A0TA 2R5WA 5EMMA 1P0PA 1WHSA 2HO4A 2NO1A 4FEEA 4IR7A 1M83A 1XZIA 1ZLYA 4QNNA 1MAUA 5BOSA 5ITWA 2QB5A 1FMLA 4O2AF 1L1EA 4BFSA 5D86A 2FV8A 3HYSA 2ZB2A 4BN0A 4YRSA 1DIOB 2F1IA 3RVDA 4ZHSA 4P6VF 2NSLA 5H7XA 1NBOA 2FG7C 2JA2A 3QP9A 2AFHA 1IQ0A 5BQPA 4RJKA 2NSYA 5E1BA 4NCIA 5JYCA 3QVGB 5ECGC 1CB7A 5INTA 4O33A 3E05A 5DULA 4LMBA 4U2BA 3M3HA 5G02A 1DAHA 4AW9A 4UTVA 3T9CA 2WYOA 5BYJA 4TQUS 1LA2A 1QJ4A 3DC7A 4RY9A 5DW3A 1H4VB 5JZSA 3K0KA 3AU8A 4X0EA 4R2LA 4DJTA 5BWMA 1C0IA 3B82A 3PVZA 4DIBA 2OO3A 2ODAA 2Q5FA 1A04A 2RGCA 3DQPA 1F5SA 4RZ2A 2H7CA 4NPCA 3RJZA 1U28C 1EFUA 2ZJ2A 4OMFG 2GZSA 3RD5A 3K5WA 4EO9A 5EJEA 1UP6A 4LE1A 3AEQB 4FOSA 1YR3A 4R1LA 1JT9A 1D3AA 2ORWA 1XKQA 1ECLA 3ACBA 4GBED 3CJRA 2IIBA 4K9LA 3PDIB 3QU4A 3U3KA 2DHDA 3B60A 4MPJA 5DTEA 1C7QA 4IX9A 4MTCA 1EX6A 1G9TA 1MGOA 2Q9UA 5HSGA 4ZCRA 1LW6E 2YV4A 2ZULA 3AJDA 3AM3A 4E5KA 4W9NC 2CD7A 5LP1A 1FQOA 4IDQA 2NUBA 1X3LA 1J0BA 2FFRA 3BJZA 2VOEA 4IICA 5KQLA 2D3WA 4HK4A 1CF9A 3SBEA 3DLCA 3IXQA 4N54A 2XMRA 4QA9A 2ZRCA 4DMUB 3N75A 4U7GA 4AP9A 1JP7A 3EWNA 3LP8A 3FVWA 3OZ7A 4MWSA 5BSGA 1QBKC 9LDBA 1U9IC 3MCUA 4PLWA 5B58T 3WMRA 5JECA 1JTFA 4PNHA 1XRJA 3OF2A 3ETHA 2QLFA 1HZZC 5TEWA 4D8YA 4YUZA 3G6KA 3L0YA 4ZXFA 1U2DC 1E3LA 1PDOA 2GZHA 1G7SA 2WK1A 2E55A 1KQFA 2HJRA 2ZITA 4G5FA 3DLTA 4JQCA 4BO7A 2QAGC 1XD2B 2ENWA 4JVNA 3IKLA 4F5EA 5KWJA 1CZUA 5E9JA 5AHOA 5J59A 5THXA 4LZAA 1NMQA 4K2AA 4CMAA 4QUDA 4YDHB 4L6IA 2VSYA 2G9VA 4K8OA 4H7EA 4RKFA 4UOQA 3WB1A 2HGZA 2XJ9A 3DKRA 3A4LA 4HF7A 2FZ5A 2TMKA 4PBTA 4C4AA 1X2EA 4W7SA 4JI6B 1NY5A 1UEIA 4U9HS 2ZK7A 1G20A 2AKEA 3HDTA 3SIWA 2BGIA 5ADWA 4JBLA 4Q3EA 4QFMA 2XUKA 2XNJA 3KT8A 2K6GA 4XLTA 4NENB 1FP1D 5E1MA 2BGWA 1M6YA 1Z68A 2I78A 5EJAA 2ZTSA 1ZPDA 4D2IA 3OT5A 3D6NB 2YIMA 3V55A 4WE3A 1N1DA 5LDHA 1YBHA 2O8VA 4EG4A 1OZ0A 3I64A 4JHLA 5ALGA 1YZHA 1Y8QA 2FWJA 4C6RA 2IQIA 1JYSA 5A3SA 4DV3B 3WNBA 1U0BB 2GF9A 2NXJA 3K30A 4MAAA 2WJPA 4XH9B 1S3SA 3V8VA 4EHHA 1WUJS 2EDAA 2O2SA 2RHRA 5CDFE 2I34A 2P2YA 4X44A 2DOKA 1BOOA 1FVFA 3H2YA 3QLTA 4N5NA 1C3JA 3PGLA 4KMRA 4P86A 3BWEA 3GAAA 1Z2EA 1K5GA 3GGSA 1CY0A 3OOSA 4W6QA 1DIRA 3T1TA 2PUFA 5AK3A 1R15A 4GLJA 3CRW1 4TL8A 3R3HA 1TM7E 3UA3A 5HYVA 2QU7A 1ZUHA 3HN2A 4KXFB 3UJ6A 3DPSA 4HBGA 4N6NA 4P4NA 5I47A 2HU5A 1PNRA 1YONA 4JX8A 4PG6A 4J49A 1W19A 3I3SR 3MJFA 4GOXA 4UMVA 3A0RB 4BQQA 3GY0A 3UHOA 3LT5A 2JCXA 4G8DA 1KMHB 1XAHA 5D7NA 5A71A 3KFLA 1XA0A 4ACBA 1XZNA 4PQFA 3RRJA 3OFVA 3CEPB 1EG2A 1PGQA 2XUJA 2VUTA 1U2EA 2PM8A 4GP9A 5IT9A 2H59A 1J20A 1H4SA 1JJVA 2DECA 1JSZA 4LRUA 5ERXA 2CFIA 3EUEA 1NQWA 3JSXA 1AC5A 3P9SA 3TZLA 3FDZA 4E32A 5BWOA 4JP2A 2YV2A 4BIIA 1NOIA 4RJJA 2UXBB 4NV0A 2VAPA 1MD9A 2PWPA 1XMVA 2VDWA 2AG0A 4IINA 2I2AA 3THWB 2CLIB 2FJ0A 5C5DA 4AZ0B 2PMBA 3WY9A 1J0AA 2W2NA 4B48A 5C8YF 1XXHA 1YE5A 3IQEA 3GFFA 1K63A 1L8LA 2I3BA 2O4CA 2PX5A 4CTJA 1WSAA 2GZMA 2NO4A 1JI0A 1DEOA 1OI2A 1RVDA 3O9MA 3O8LA 1S2DA 2QLNA 2Y1DA 2QUZA 1KE2A 4Y2GA 4KN9S 4BECA 3K32A 3OX4A 3VH3A 3ZDZB 3OU7A 4HYEA 4NZMA 1JIIA 1XRMA 5I9BA 1V48A 1W96A 1I13A 1U2GA 2F3QA 4CRWB 1N2CA 2P8JA 3B52X 5FDFA 3U1BA 8ATCA 1RI5A 2X0DA 2C3UA 2GD2A 2B8NA 1SMKA 1ZAKA 2QN6A 4BVAA 4C0AC 5JAZA 4Q1EA 1MQAA 1U81A 4K9MA 1GZVA 4RD0A 3UGQA 2P9ZA 4G97A 3IOMA 2Q28A 4DJFC 2IKQA 3M6XA 1BWQA 1E3JA 3L4BC 5BSVA 2QSJA 1NOKA 1PLJA 2NIPA 3HA7A 4AZWA 2Y4OA 3GI1A 3UKOA 2AN9A 3MPOA 2CXUA 3PRHA 3VZSA 4M1WA 4HS9A 4CQNA 2QP9X 2YYSA 2ALJA 4KHZA 4AQ7A 1Y4UA 1C8LA 1NJ8A 3C43A 1TVKA 3KAKA 3PJDA 3R6TA 3LQ4A 2EBUA 3FSGA 4TTJA 4OJQA 3RS2A 1X7XB 4KAJA 4R54A 4ZJYA 4L8GA 1OLXB 2IWHA 1B0ZA 3F7OA 4G8CA 3HN6A 4BXOA 3GDWA 4HCJA 1VIMA 4EGAA 4R2XA 2OYSA 3NOVA 3LCJA 2QRQA 4UUOA 2IXGA 4WIAA 4MINA 1DBRA 2KSQA 3FUCA 2H1VA 4JU9A 4AO8A 4EJFA 1A9XA 5CCBA 4C3ZA 1KOGA 1U3CA 1KHHA 4O1HA 1C1XA 4ZAFA 4R2HA 2B2XA 1EX9A 2BUBA 4L5JA 4DLWA 1WUHS 3P9RA 4JAVC 3KAQA 5DM1A 1PJRA 4L7VA 4QRHA 3GHYA 3T8YA 4AJIA 1JYEA 5EIXA 5KNCH 3O8QA 2O20A 2XE8A 3UH1A 4ZI3A 3QW4B 4Y6GB 1JKIA 1QF6A 2DTEA 2HIGA 1KK1A 2E49A 4PX2A 4PZUA 1NV8A 2GNPA 3KXLA 1UBGA 4EI7A 4RO0A 2I7CA 1WXXA 1I7SB 1DKNA 2R4TA 2ST1A 3VU0A 3M1AA 1T5DX 3N7AA 2WPDA 2ZIXA 4HYYA 3L18A 3RAJA 1E32A 1G7TA 2HREA 2N0SA 3K0CC 4PXSA 1HFEL 2F64A 3H6HA 4KOEC 5KOYA 2NMVA 3E9ZA 4DARA 1OT5A 4UXHA 4B3SB 4JXZA 1ONOA 2VZ8A 3I34X 4KJXA 1U5AA 2BFAA 2ZSJA 4PZYA 4XI9A 5E6SA 4QOHA 1BU8A 1WVGA 3QHQA 4LY3A