4EW1A

High resolution structure of human glycinamide ribonucleotide transformylase in apo form.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
205
structure length
205
Chain Sequence
b'ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWVKEEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trifunctional purine biosynthetic protein adenosine-3
publication title Biological and Structural Evaluation of 10R- and 10S-Methylthio-DDACTHF Reveals a New Role for Sulfur in Inhibition of Glycinamide Ribonucleotide Transformylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 65
structure length 205
sequence length 205
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4ew1A00
4TS4A 4ZYTA 4YFVA 4TTSA 4ZYVA 2BW0A 4NV1A 1RBZA 1ZLXA 1GARA 4EW1A 3Q0IA 1S3IA 3DA8A 1ZGHA 1JKXA 3LOUA 3NRBA 4ZZ1A 3KCQA 2YWRA 1C2TA 4EW2A 1ZLYA 2BLNA 4QPCA 1RBMA 3AUFA 1GRCA 3TQQA 4ZZ3A 4PZUA 2CFIA 1FMTA 3GARA 3OBIA 1MEJA 3W7BA 4R8VA 1C3EA 4EW3A 1RBQA 4ZZ0A 2FMTA 3R8XA 3O1LA 4ZYZA 1RC0A 4TT8A 1MEOA 4ZYYA 5CJJA 1MENA 1CDDA 1NJSA 4Q12A 4DS3A 5J9FA 4ZYWA 4QPDA 1YRWA 4ZYUA 3N0VA 4ZZ2A 1RC1A 4YFYA 3DCJA 4S1NA 4ZYXA 1RBYA 2GARA 3P9XA 5J63A 1CDEA 4IQFA 3TQRA 3AV3A
chains in the Genus database with same CATH superfamily
1S5PA 3VTAA 4I4IA 2P6MA 3VOSA 1DEXA 1UK8A 1S2GA 1T4BA 1YVUA 2KHZA 2X76A 4JGGA 2EWVA 3RF6A 3ZDCA 1TYEB 2BM8A 3OT4A 4PHTA 1M8PA 4DOMA 4L3WA 1KZ4A 1T6XA 4GZLA 4IHJA 4LZJA 1CUBA 5FBKA 2OV2A 4LHSA 1XFAA 1L5MA 4DAEA 2NXEA 4J4HA 2RE8A 2AYYA 2R0QC 1TO1E 2XHEA 2Z30A 4G6ZA 1OTHA 4K9MA 4PSDA 3OUTA 1DC7A 3QKSB 5KTMA 4ZK6A 1FJHA 3IQZA 4NZZA 2ZZKA 7MDHA 4PTZA 2FF7A 1RWWA 2GN6A 3NH6A 4IMPA 4FFMA 5A5FA 3QW2A 4BMOB 3L8GA 3TS1A 1A9XB 2W6NA 3JD3A 4XYBA 4Y1EA 3WICA 1L8QA 3A27A 4QRHA 2QLNA 5E4JA 3UMGA 2P2GA 1JS1X 1SG9A 4FKBA 3F3MA 4ZKEA 3KXKA 3H5AA 2P5SA 4FMPA 1M1YB 2V7EA 5C8YA 3CSUA 1R64A 4DPLA 2C07A 1G291 2VA9A 4JLAA 3W9UA 4UTOA 4KTTE 2FP4A 4D0RA 2DQ4A 4TKUA 4G5GA 2X6RA 2AMVA 2Y71A 5DCLA 5IW8A 4G84A 4RAOA 4IJQA 2EF0A 1RTTA 1DOAA 1FLVA 3IXLA 3TW6A 4RXMA 4L3OA 4N48A 2QRVB 3FHJA 5AKYA 5DK4A 3LLVA 3PR3A 4C4YA 4N5MA 4E0BA 1UXOA 1VHTA 1WU8A 4PVDA 5IC6A 5JS1A 3QX8A 5ICCA 1QYIA 2PSFA 4NMWA 3GRZA 1XNRB 4II7A 4QRIA 3LA6A 1C30A 3E53A 1W75A 2PGNA 1UJNA 3JR3A 3TIFA 1PYOA 4KBFA 3LP6A 3E0XA 4HQOA 1DB3A 1X7DA 3TRDA 2NX2A 5CCDA 3L46A 4AJOA 2JFPA 2I1WA 1NUPA 5CB6A 1UZAA 2WK1A 2H65A 2XWBF 3OE4A 4M6WA 4P4SA 2XUQA 3H1BA 2E4YA 4HQ0A 3LY7A 4F93B 3NHUA 4FHDA 2CJYA 3OPYA 16PKA 2BLLA 2QXYA 3AINA 1MNAA 4FWBA 1R74A 2CLIB 3D6HA 3RSGA 3CBQA 4ESVA 2JBAB 1BSVA 1P5JA 2BDUA 4MQBA 1AKQA 1N7IA 4LTNA 4ZJUA 3BXFA 2WF6A 3T7SA 13PKA 3BREA 1R0BA 1GKKA 4G5FA 3ORYA 1L7EA 3PZBA 3FCYA 5ESXA 5TS3A 2ODAA 3ZWVA 4PCVA 4FFWA 2QSZA 4FI3F 3U48A 2IY8A 4RZHA 3ZY5A 1NPYA 2GZMA 2O7RA 1Z8FA 3AMVA 1SMKA 3DL4A 5CEJA 5AK6A 1MC1A 2TECE 5E8RA 1T6NA 3E23A 4M1QA 4XPZA 1VI2A 1NBAA 2ES4A 3DDZX 4XIGS 3LD9A 3EC1A 3EXHA 3LPMA 4MV8A 1O95C 1XG5A 2BV3A 2XDQB 3I9JA 3JWEA 4KZPA 3R3SA 3WB9A 4BTLA 1CRQA 1PWZA 1FFXB 4IDNA 1U31A 5TC4A 4TL7A 4QGAA 3WRWA 2NZJA 3ADPA 3ANSA 4JLBA 2Y2UA 1E99A 3EA0A 2FFHA 5IBCA 2FFBA 3ESDA 3R3YA 1TVEA 3NASA 4ZOAA 3H8SA 2WV7A 5M34A 1QF6A 3EQZA 4IV5A 4QSHA 3I6QA 2B8WA 1NC3A 3F7NA 2GBFA 1FFSA 1F3OA 3DUFB 3M5CA 3RRXA 2HEGA 3MAAC 3NKFA 3MTIA 4FJ0A 4X63A 4NMHA 4IFBA 5FNZA 1ZMOA 1YJQA 2XTMA 3FFTA 3HDHA 3IFSA 1WLSA 3KKOA 3MMNA 3PVZA 3BHNA 3D9QX 5FNVA 3OMLA 1FTSA 4P7FA 3ROFA 5K8TA 4YDSA 4MA5A 2V59A 1QYVA 4BC0A 2PUGA 1UC4B 5LMCA 4G5XA 1O96A 1EMDA 3QMWA 4P3YA 3C1OA 2IXEA 1J0XO 3PHLA 4RPIA 5H7XA 2GBLA 3WLJA 1UIMA 1TF2A 1G20E 4YRIA 3LYAA 4CTKA 4OIMA 4LQCA 3KV3O 2WF8A 4QDUA 4QZVA 2GEUA 2ZTMA 3UG6A 3P8ZA 1JHXA 4C5AA 2WTEA 1ZRMA 1HQKA 4JT2A 4EI2A 2Z1DA 4LZPA 2BGMA 3WO1A 1G5RA 4BLUA 1VSBA 3W8DA 1JEYA 4M8IA 1ZUNB 3SU8A 1MABB 1XPJA 2JIZD 2ZUFA 1J24A 4F84A 1Q3HA 2B69A 2QRPA 3O2QB 4TTAA 3WLSA 4EGJA 2V7QA 3ZXYA 1KYXA 1O9GA 2FETA 1NSYA 3GFGA 1W48A 1XC7A 3NDRA 4IQ4A 1XQVA 2C5EA 4V2UA 3V4ZA 4BQQA 2RHOA 1AZLA 1OBCA 4QNMA 5FO1A 2Y0CA 4FQ7A 4XGIA 5CDGA 2IBTA 1YT5A 2VTKA 4MWOA 4TGLA 2QL5A 1T5IA 4I1SA 1CY8A 2ZK7A 4RHFA 2VXOA 3HUUA 5ALUA 3V2GA 2IELA 3AM4A 3YASA 2EEZA 4RPJA 1LI7A 1QKKA 4P3XA 4F4DA 1GQRA 3COVA 1WPQA 4S1OA 5TRTA 2BBTA 1LC3A 2C4NA 4EG1A 5KSYA 4B8ZA 4NU6A 4A6XA 3DL0A 5K3OA 1S8NA 1UZNA 2W7TA 5I9BA 3UJCA 1P0IA 2NW6A 3UK1A 3MRXA 3BFKA 1MP0A 2J3JA 5H3HA 5C1IA 2QVBA 1SKQA 2RHHA 1Y42X 1Q16A 5B58T 4OHVA 5CYFA 4RSRA 3TZHA 1CIVA 1FVOA 2BFWA 3C7TA 1EI9A 3TOVA 3PGXA 3TEJA 4L9AA 1SIWA 1ZDMA 4DLPA 4JIGA 3RK0A 2UAGA 3AGQA 3T6KA 3M3PA 3VH4A 1F0PA 5A4KA 5EZYA 3FZQA 5BQXA 4KO8A 1E2QA 3IUJA 4OL9A 1W4ZA 4O4IB 4C43A 1RJFA 5BQ5A 1OI7A 5ER9A 4DDTA 1WHTA 1SEPA 2I22A 2MOKA 4KMRA 1X8LA 3DMTC 4UAUA 5B1YA 5KINB 2WDZA 3J7AC 3G2KA 3SOPA 4WE3A 1OIXA 3ORQA 4V2IA 3WGZA 7AT1A 4M0FA 3DFIA 5D7BA 4MGKR 3NX4A 3Q85A 5DDIP 5DTMA 2CXUA 4TMFA 3UUEA 4GOOD 3ZDEA 2H8KA 5B12A 4NR0A 3IXQA 3FROA 3AM3A 3KJNA 3EPRA 4O1MA 4Y2TA 2JIRA 3HV2A 1PKEA 1ADFA 4RJKA 5DRTA 5CVJA 1Y7HA 5CLJA 1P4HA 1ISMA 1HQYE 1ZAKA 1J2TA 4Y9RA 4BFSA 3QYJA 4DV3B 4AI6A 4QBHA 1J2RA 2BDTA 1MRNA 3IE1A 1FNCA 5IDVA 1W5BA 1YR6A 4AICA 3GHHA 3R7LA 1QYWA 3W5SA 2LE0A 4UUBA 3CFYA 4RETA 2J41A 1Z2EA 1VFNA 3U3XA 3A4LA 1GPAA 1RYFA 1WXFA 4ETIA 1U0JA 1IXZA 1E62A 2ECPA 3C3EA 4MUBA 5C4MA 4PS1A 4GFDA 4XLZA 5LP6C 3AUSA 5E7MA 2AW3A 2HJGA 4RGQA 3MGGA 4KO3S 3D4BA 2WY2D 3TQRA 3NFYA 2VOEA 3G0OA 2DBZA 3KAQA 3MJFA 4MYCA 4BO7A 2FEXA 4E07A 1S89A 3QZUA 5AI0A 3VJLA 3KOMA 1F6DA 1V41E 1A76A 1ZKDA 3G79A 1CZNA 2P78A 3WJ1A 2AS0A 1TVMA 3VHRA 1F6BA 2WZQA 3A9RA 1Z5OA 2VIIA 3ED1A 5CT5A 2FQYA 1B2LA 2FWNA 4IKOA 4DVJA 4HDSB 4OQNA 3ZJUA 1P7WA 2PMCA 4JBYA 4RSHA 5JSQA 2YBEA 5JTTA 1JT9A 4W5JA 1X92A 1GU0A 5CBPA 1DFIA 1H2YA 1P39A 1P1JA 1X19A 1C1XA 3D3WA 5FADA 1YDGA 4A27A 5JALA 3R0JA 3DLHA 1ISSA 3GJ5A 2OP1A 2JB9A 1N8SA 4B5LA 3HK2A 3GZTB 5FV4A 1UC5B 3LYHA 5G4KB 3QLEA 4WLVA 1GN8A 2J6BA 3MN1A 1CVRA 2YWXA 3ZDDA 3DMRA 2ON6A 5KTTA 3KV1A 5ITWA 3D6AA 5AVXA 2B4RO 1QGUB 1AKEA 2KYRA 1E9BA 2I3GA 2NUPB 2OP0A 3X1MA 1GLNA 2GAJA 4WBNF 1P8JA 1VCNA 3E6AA 3LVFO 3TRFA 4YIHA 1DMSA 4OHFA 4QPCA 2O3JA 3U7RA 2XEDA 2WJWA 3R9XB 5FUWA 1FMLA 4BZXA 1YJCA 3I9KA 2PRJA 4HGNA 1KZHA 1E59A 4LOAA 3O4JA 2A0XA 3V4OA 2FK8A 4ZT4A 1IEVA 4G09A 1GU7A 3BICA 3TL6A 1XHEA 4KIWA 1H65A 3QLTA 3T38A 3V9PA 3BDIA 1T25A 2BP7A 1L8AA 1RKQA 1B7GO 2YXNA 3BAZA 4LZOA 1IQPA 4PN7A 3K0AA 3L5OA 5E6SA 5EXSA 4AWXA 3DKRA 2FYTA 2MIIA 4D4IA 3TE6A 1KR2A 3MPOA 4IHJF 3MWGA 1XIVA 1ZBDA 3EDCA 3GGJA 3L6BA 4QO7A 3QE2A 1Z7GA 3BYZA 3D8NA 4EP1A 2CNDA 5J2TA 3UYKA 2HIGA 3ZHZA 1ZI6A 3M49A 4JELA 4ALLA 4JQYA 4IPTA 1JLSA 2E55A 3ZH9B 4HUTA 4MSUA 1K7SN 1R0XA 4I4TF 2FOIA 2ZIEA 5DHUA 4B0OA 4DMKA 1REQB 4PX2A 3P5BA 1FNDA 1PLLA 4OUKX 2NAPA 1Q50A 2Z2ZA 4PW0A 1SCBA 5C8YF 2GN2A 1LI4A 2E5WA 3NWOA 5J9FA 1IIRA 1KAOA 3DL7A 4DT1B 1TW3A 3AL0C 2IU6A 2PBLA 4KJZA 1IVNA 1MJGM 1U9ZA 3BWYA 1JW9B 1D0VA 4IGEA 4NBUA 5JQGA 3AXTA 1NXQA 3AHEA 4MWEA 4XWOA 5I4CA 1U8YA 5IVIA 1FRFS 1XTTA 1ZL2A 2YWDA 3TSZA 3U44B 4AX8A 3DL2A 3C6MA 1WZCA 2ZXFA 3L4SO 4D5GA 1ZJ5A 1UJBA 4E03A 1BWRA 3DZ8A 3LHKA 1YE3A 4RF3A 4BTEA 4LF4B 2PQMA 2O9JA 1RP7A 3A6JA 1SK9A 4GX2A 4U63A 4NOMA 3CEAA 3Q72A 2R4TA 5AJXA 3V4RA 4FOTA 4RIHA 4CLHA 3OOSA 1G9TA 4C3OB 3SFVA 1ADJA 1T5SA 1KFEB 4A5OA 3ZW7A 5ELXA 1NXVA 2Z2IA 3H8JA 3LXRA 1CE8B 1BQEA 1ZH4A 2EKBA 4QUGA 3ZQ6A 4MK4A 5FF9A 4G97A 1Z33A 4O4JA 3K30A 3W5HA 1C3LA 1GFIA 4X3OA 4XFKA 4JHXA 2ZZNA 2BM0A 4OHMA 4AJ9A 2H00A 4A6PA 1WR8A 3KSAC 1KPGA 4LYFA 2XIJA 1R2QA 4RHYA 5B30A 4W1SA 4A91A 5K3FB 1LBQA 3IELA 4D8XA 3MYYA 4IFTA 5TIIA 4MEAA 4L0CA 4YP9A 3NV7A 5BSVA 1B0AA 1QE0A 1V95A 1XTKA 4LGVA 4LJYA 2I55A 5DHFA 1KERA 4BB5A 2QVCA 3CPSA 2I80A 1EHIA 4B09A 4ALNA 1LSSA 5AI9A 2NYVA 1BX3A 1WJGA 1XHFA 4B2LA 1YZQA 3U4MA 4M4SA 5TT0A 3HUFA 1KIAA 5AKLA 4ERXA 2EWMA 4P86A 2AG5A 1Z6PA 3F67A 3KUXA 4EITA 4MCJA 5EMJA 4EZIA 1A4XA 4U6NA 4OA5A 2CW5A 4IUYA 1D2RA 1DKLA 2WU1A 1W9MA 3AHCA 3HDYA 3KPUA 3PQDA 1K06A 1E5TA 3I58A 4WZBA 3CIOA 1UBEA 3LMKA 3GH3A 2HZ7A 3KM0A 1SCKA 3MRSA 3PDWA 5I4BA 3HA5A 4FDAA 2X0FA 3ER9A 1PFUA 3AIKA 3GRRA 4R7ZA 4YAEA 1W5AA 3IV7A 1FBNA 3WWDA 5U4XA 3GLGE 1F9AA 2PLWA 1I7NA 1L5FA 4TMTA 5FNVF 4LXGA 4NJEB 4XGNA 1A3CA 2W83A 3W34A 1UDCA 2JD0A 2V5UA 4I5IA 1QFZA 1SWWA 2ZSHA 4D82A 3E4DA 4RORA 5FJJA 1E4OA 3DEAA 3VZQA 1G2QA 2AEJA 1Q0HA 4WECA 3ZWXA 2IHBA 1R9JA 1E1KA 1XRPA 1MT3A 1HFWA 2DM6A 1L8OA 2F3PA 2GYUA 3EGVA 4GP6A 3F5QA 4QWMA 1GPJA 1K63A 2CCGA 3GY0A 1OMOA 5DT2A 3ZI4A 4ZAYA 3GGGA 4F72A 3JVVA 1DDIA 1KO5A 4LV6A 4YWHA 1ZIOA 3KRTA 3FMFA 4DLSA 5C1BA 3N3AC 3IEKA 5JZ9A 5DM1A 1IZ9A 5EGSA 3UJ3X 1YUBA 3UKDA 2ZSAA 5JROA 2E5LB 2WJVA 3STWA 1UC8A 4GEGA 4MRVA 3T7AA 4DBLE 3REGA 1RQ7A 2UVQA 3PRYA 3VTKA 3HJCA 4BX3A 2DT5A 1JLLA 1NJ6A 3IE2A 3KDAA 3CLUC 1CJKC 3M6VA 4LNHA 5DSZA 5K2OA 1HE4A 1YRWA 5HM6A 1TFRA 2ZJ2A 4CN9A 2NIPA 4CF5A 5DULA 3QELB 2FSFA 3O82A 3CUTA 3LHSA 4MKHA 3LUAA 1DV1A 4JLOA 4DTIA 1JHYA 2OGUA 4MS1B 4MPPA 3CPJB 4DWWA 3OFJA 1AZSC 4TUYB 3VUFA 5COAA 5K0EA 4L8GA 4OY3A 5DI3A 2I2DA 3JQDA 2C7PA 1SCIA 1L4NA 2W6ID 4GBMA 4W5NA 5JH7B 1W4BA 3U3OA 5DLEA 2R751 2QJFA 2LXNA 4Q37A 1OROA 1EFVB 1Z4IA 3ZIDA 4BDSA 3Q8KA 1T5OA 3UPTA 2H9YA 3LYUA 3B6JA 2ZJAA 2Y1XA 1CDEA 4GAEA 4RTNA 3TDKA 1UBKS 4G1MB 4YFVA 1VSVA 4BAZA 1ADCA 1FYVA 1EJBA 1YAHA 2W8BB 3HGTA 3Q5EA 4MWSA 5EZYF 3V8BA 4Q15A 1L4FA 4C4SA 1G98A 3HSYA 4JI5B 4BIMA 1RBZA 1WQ3A 1KJWA 1SVMA 4HN2A 4RVNA 7REQB 1WS6A 1ZN8A 4JJIA 1HOXA 1GNTA 3CLRC 5FR2A 4CI9A 3ICPA 2NO7A 3L6UA 4RAQA 4K05A 5F1KA 2PYIA 2D0IA 3DQZA 2E85A 1J21A 4CKBB 4PU0A 4JT9A 1CUVA 3H9BA 4DFDA 2JIOA 5A5DA 4Q4AA 1WDWB 4Y6PA 1BMQA 2AJCA 4GSYA 4WOCA 1DC5A 1M8FA 1O3YA 2XE6A 5T3UA 5G2OA 4EYGA 1D2MA 2E2WA 2JHAA 3D1JA 5E7JA 4II2A 4RQUA 2PYDA 3QXXA 1QQBA 2GK3A 1ZJZA 4M0UA 2VK2A 4N0QA 5KQLA 3ZKWA 2NSJA 3ZLUA 5TJ9A 2G9RA 3HPRA 5THQA 3MINA 2BR5A 4PR3A 4S1VA 2ZZMA 3NPMA 4PFQA 3V7NA 1NUAA 4M1KA 1NVGA 2F3TA 3LC7O 2JFVA 4EF6A 1AQ6A 1IY1A 3FMIA 3BS4A 3H11A 4P4UA 3AR8A 4KN8A 5FWXB 4EKEA 1G2IA 2UVPA 4UE6A 5I8PA 3A6GA 4L5BA 4LJSA 1J09A 4MROA 3O3NB 2X4LA 4ASUA 2C4UA 1VIAA 1G16A 1PT6A 2QB5A 4R51A 1Y4UA 3HY6A 2O2YA 5JSZB 5JXGA 1NQXA 3SEFA 4XCQA 3HJUA 5BV7A 3N58A 1V16A 4M1WA 4HKTA 2QKYA 2PX6A 4TLEA 5ALYA 1L5KA 3HU3A 2NUTA 3QKRA 4FD3A 2ZIZA 3BN3A 3ZWBA 3EZYA 5HRCA 2R86A 1Z0FA 2L19A 1ECLA 4JX9A 5T67A 5EMMA 6YASA 4G0WA 4UHJA 2RB5A 5GVRA 1Q1EA 2XH8A 4KX3A 3U0BA 3IMGA 2XYGA 5AHRA 1HZZA 1DJOA 3RGGA 4TVSA 2BFEB 4XDGA 1QR6A 3ADOA 2RJ3A 5EZ5A 1MO6A 2ET6A 1U3CA 4RTSA 3AU8A 2XTJA 3AFOA 4H7DA 4F7DA 3U4HA 2VTBA 4KGZA 3W6UA 5KSZA 2I4RA 1Q1NA 1FFGA 4XM1A 2PKRA 1RRPA 3PCXA 1I3KA 2GSWA 3BIJA 2JFUA 2WWGA 2ZBQA 3H3XA 1E9AA 2ID8A 4M3NA 4X1YB 3O21A 4LXUA 2JIBA 1UM9A 1Q0QA 1U0HC 3KL4A 3STXA 3UJ6A 4G2NA 3AKDA 4P80A 3T7JA 4WDRA 4Q4HB 3ABRB 2IPMA 5KKAA 2XR1A 4FNMA 2HBQA 1GPBA 4ZK2A 3E3LA 3WOVA 4MVXA 1OWNA 5C4GB 3WNVA 2P41A 2I6UA 2XA9A 3SHTA 5K0ZA 2FN7A 1MO2A 3KSUA 1UBTS 1P7ZA 4W8HA 4ENSA 5ALHA 4KVGA 4BQPA 3OZ7A 1BWPA 3GCZA 1PJQA 3BWXA 4NNJA 1ZIPA 2GTPA 1EQUA 1XLUA 4HVTA 4TXJA 5AK0A 4A0QA 2P67A 1ONPA 2R8YA 1KMCA 1G5QA 2BM1A 2YW9A 4HQLA 3PRHA 4Z1MD 1SXIA 1TEZA 2OTCA 2GOYA 2VZEA 2XUGA 4AJ1A 2XYQA 4YR9A 4LDNA 4QVKA 1KORA 1Z83A 3F9CA 5FEUA 3WBKA 1QONA 2P9TA 1ZY2A 1ZH6A 2FB9A 5I7WA 1ZU4A 1SBTA 1TI7A 5EEGA 1CF2O 3CSSA 3VR5D 4IDAA 3ICQB 2RHWA 1LX7A 1QH8A 4BBPA 4BP9A 4BFZA 1WVGA 4MI6A 5JQGF 3VNVA 1FYFA 1T35A 1A8HA 2YWRA 1X13A 2WHQA 3X2EA 1YE8A 1ZCAA 4BFXA 2O1EA 3DCYA 3E9EA 1PT7A 3DBLB 3GHYA 3URMA 4AKEA 4EYOA 1J1IA 2R1VA 3FFXA 3HQ4O 1CRZA 1NXOA 1VG0B 4HAUA 5DTRA 3AC0A 3U16A 1UP6A 2FUG1 4B4VA 5CIQA 2FVXA 5F9MA 3HUEA 5D86A 4P7KA 3RM3A 1QC5B 5C9ZA 1GGMA 4DKJA 3THYA 4V1CI 4IINA 2YICA 1PVVA 4BV2A 1DUVG 1FX1A 4NV0A 3DPIA 1QRRA 3E7PA 4LF9B 1YBMA 4ND5A 1OWPA 1P80A 2PGOA 3CYFA 4K28A 1DO2A 4XKJA 3TIGA 5BSEA 1C9JA 1KI1A 1XNGA 5D01A 3EASA 4O4HB 4TKVB 1WBBA 1JMKC 4O4JF 4MYTA 4MB2A 4HXFB 4S0XA 2G1JA 3F8SA 1MO5A 1ZUWA 2GF9A 2J6CA 2WFZA 1GQFA 3HWX1 4JFRA 4A1FA 4ALIA 1XWFA 3BSFA 3KS9A 4PZ0A 1NP7A 3RVOA 2DG2A 1PYDA 1X9IA 1KMHB 3E5NA 1ETHA 4G0QA 5T6BA 1KQNA 4D81A 4PYJA 1NJ2A 2WWYA 1OLSB 2DFTA 2GRUA 4MYRA 4ID9A 5CM2Z 1V11A 4Y98A 4BMXA 4ZCRA 3T7KA 2UYGA 4X93A 5JHGB 1Z4QA 3GCWA 1J07A 3VV2A 4BS9A 2WR8A 1I4WA 1X1SA 1VTKA 5JLJA 2UYHA 3LCRA 2BTQA 3OETA 1AF7A 4H18A 5B1IA 5JV5A 7ABPA 3GUCA 5DGDA 1BHQ1 3VNQA 5HGXA 3PC3A 5ALPA 1J8VA 1R6AA 4FMCF 4N0EA 1CDDA 5GONA 4Q12A 4A9AA 4C4XA 3F49S 2ATVA 4Q1VA 5IBPA 4D96A 2FY8A 1E5QA 1JE1A 4P6VF 3U7EB 2I03A 4WXHA 3SZ3A 4ZI7F 4R69A 5BNFA 3I72A 4LRYA 2E5FA 2BRUC 5AI5A 3QFRA 2HF2A 3CNHA 4FSDA 4ZOLA 4FC7A 5HZKA 1M0WA 3IPXA 3LA8A 3LFTA 5AVSA 5KIAA 4G0UA 3V97A 4WJZA 2IZ6A 4C3ZA 4D4HA 2C5HA 4Y6GB 1W88B 1H5NA 2ZS8A 3A6EA 2O57A 4FBMA 3UBTA 4BFLA 3G9QA 1MO4A 3KWMA 4H0NA 4GBGA 5JSHA 4R8RA 2Z8XA 3EAQA 5E2BA 2IDZA 2NV0A 3OF2A 4OVKA 2J4FA 4HS4A 4XIFA 1JXOA 1Y1TA 2QJRA 4U2CA 5TSDA 2WVHA 1X6VA 3DKVA 3V2UA 1LZLA 1QJCA 4W4TA 3UB4A 1KFKB 2D3WA 2E49A 2L42A 1A4RA 4EG5A 1FJGB 5AW2A 3BJMA 4TWZA 3K6SB 4BCCA 1QDUA 3ZQUA 3BH6A 1RYNA 2FFAA 1J8YF 3GXOA 1JHOA 1YUNA 3KEOA 5HEKA 3RODA 4QOEA 4TN1A 1P2BA 2K4MA 1WF3A 4Q9JA 3MG9A 2P6PA 2JGDA 2C96A 3CV3A 1OT3A 5DBOA 3UT6A 2G9NA 4MH0R 1XWWA 2PD3A 4ARUA 2XQKA 3PHCA 4NU5A 1QG2A 2CUTA 1JKMA 1DBWA 3Q88A 2OE2A 4DBVO 1B8OA 4KLAA 3GD7A 3VA7A 4M9ZA 2QTNA 3ESZA 4ZOBA 3ZQKA 4QJIA 2ZXUA 4O3MA 2JLQA 2XRYA 3B48A 2VH2A 4HYQA 4MQUA 2Q5IA 4HB3A 4JH0A 5K0NA 3U3DA 1RI1A 2CVQA 3PX2A 4UREA 1JHDA 4W1PA 4MIYA 3DEZA 4HGOA 2XF8A 3FPFA 4KXNA 2QRZA 3K4PA 2PWBA 4FONA 2PMWB 4UZFA 4KPUB 2OFFA 1C4WA 2Z8ZA 3WGIA 2GS9A 1P4AA 1L1QA 2QTMA 1I7PA 3F8WA 1ZQ1A 4HRXA 4YJ3A 4GDFA 2ZB4A 5KTYA 1EWQA 3UFXA 2CHQA 2R1TB 4B0PA 1E8MA 1YRHA 1WQ4A 2B1IA 5TR9A 4WXRA 4G25A 1MU0A 2FPOA 2IZ1A 4QG3A 1VM6A 1LI5A 4OX9B 3HR4A 1WXWA 2LBPA 5JHHB 5LQJA 5LLDA 2HSWA 2C83A 2HH9A 1WPXA 4L95C 2A14A 1U5CA 3QJYA 4FHCA 4AX4A 4ZICA 5ITSA 5CIYA 2JLUA 4P4LA 3TXAA 3ETDA 4GMHA 2PTHA 1E7WA 2ACEA 1OC2A 4RMHA 4EG3A 3IKMB 4GYKA 4R01A 4B75A 1LNQA 5KU7A 1GU1A 2QT0A 1UBOS 4K87A 4EFMA 5K6AA 1P1BA 2DKNA 5DXJA 3KT8A 1V48A 5LU8A 1G7CA 1GYPA 1Q15A 2Q4OA 2VDMB 1TZMA 3LCMA 2HQSA 3C7DB 3AF1A 5IARA 3BSSA 1GAXA 2XCSB 1ZISA 5DOZA 2EDCA 3I5UA 2VF8A 5KO2A 3WI7A 4LY0A 2IDMA 5KNBA 1KQOA 2X0DA 3QLUA 3EPKA 1TKBA 3N0RA 3TLXA 3MF4A 3GNLA 1H1DA 3QU4A 4I2VA 4K26A 2PZ8A 2PCLA 4PZ9A 5BUQA 1GN9A 2R8PA 4ROTA 2ZCJA 1IEQA 4F2GA 3R3VA 2DFPA 3P20A 3ECCA 1T3ZA 1WU7A 1L3CA 1SKMA 2Z95A 3BL8A 1RXUA 4GYJA 2Q3EA 4KI0A 4REQA 1QU2A 2JJ2A 3NOQA 4A6DA 1QKIA 2BGNA 2ECOA 2HF9A 5GIOE 2UUAB 2NV2B 3QF4B 4JA0A 3UIEA 2ADOA 1A5SB 1SVWA 1ZD4A 3PKIA 4MULA 4YRAA 1BWQA 1FC0A 1PFQA 3CA8A 3OQ6A 4ZV4A 1E9SA 2GHIA 4MV9A 2GKGA 1Z29A 1SPXA 1VHLA 1W2GA 3W5CA 2P6UA 2YV3A 2Z43A 2H4ZA 1B93A 3WXBA 1E79D 3S1SA 3PFWO 3PFIA 4F5YA 5KKNB 3PEEA 1QFJA 1Z15A 2N1MA 1M6VB 4QOHA 3R9KA 1GFWA 1S9DA 4EKDA 4RJJA 2V9ZA 4POAA 1RS0A 5LJIA 2CKDA 1ZIYA 1DKQA 4IJWA 2HNKA 3UUGA 4Q3NA 1AKWA 2GEDA 3BFPA 4LOIA 1UDBA 3UJAA 3L4KA 1EFPB 3F7MA 3I9MA 3OKFA 2C3OA 2NU8A 1SRRA 1TIKA 3RFXA 1C3OA 2ID9A 4BKUA 2WNSA 2Y99A 7YASA 1I1NA 1MH1A 3KTOA 1FUUA 2CMKA 3KEGA 1XVVA 2O0LA 2XAUA 4YP0A 4KC0A 3UUFA 4AVYA 5EE9A 4TMWA 4I6GA 5J2TF 3NO4A 4AY2A 4FN4A 2BGTA 3HL4A 2OCBA 4I55B 1BMFD 2A78A 2IT1A 4MP3A 4XTCS 1L4YA 1EX6A 1JVNA 1Y4SA 3TTSA 3FDIA 4EHAA 1JDZA 2ZAYA 3UB2A 4BNNA 2PS9A 2ZSIA 3EPPA 4K03A 4LF8B 1T3HA 3DPSA 2CNWD 5EYPB 2VHQA 2YFYA 3KZKA 2LIPA 4MRRA 1XKQA 3NGXA 1X7XB 1SVLA 1Y9ZA 2AVNA 1KYWA 1RQGA 2N46A 3ETLA 4GR4A 4X8MA 2ZP1A 5EG5A 2P2NA 1L1FA 3DTYA 3OQPA 4B17A 2ZTSA 1P17A 3ZDQA 1OV4A 3O31A 5CFLA 3FVTA 1RLIA 4QUDA 2NYUA 1AKYA 1OF1A 3AJ8A 2XBUA 5EHGA 5FIUA 4EWLA 4F4HA 5IJ9B 5ICEA 4CLXA 1NQ5A 4JI6B 2VJMB 3FTNA 2AUNA 3TECE 2ZCUA 3AY3A 3COWA 3EFOB 3C6XA 4YJFB 5DIFA 2H18A 3HXPA 1XL0A 5J59A 5HS6A 3GJ8A 3O0TA 1GL6A 3K0KA 1OGIA 3TIXB 2QG4A 4ACAA 1WCYA 4FX5A 2HTFA 3ZWKA 2WJYA 1Y0BA 4PNPA 3ZK7A 5I7FA 3WC4A 3K1ZA 2BGGA 1OJLA 2Q3BA 1U3DA 1OI3A 4X61A 1Z6QA 2GPYA 1YU6A 3CEJA 4LJ8A 4NESA 2D3TA 4J4TA 3X0DA 2Z6QA 5ALRA 3HFJA 4PRZA 1T0HB 1ULHA 1YRLA 3DOEA 5IVHA 4DADA 3RVDA 1UT8A 2G8LA 2GZRA 3EAGA 4U2GA 5DYTA 2C7BA 5ELMA 3GG2A 3O8DA 4AN0A 4BLRA 1ESNA 1LFAA 2B8TA 3WGNA 1E2IA 1DJQA 1N1DA 1SFRA 2QV7A 2BMAA 4YASA 1M72A 4B4DA 4CM6A 4CT4B 3EMVA 3DXFA 1KY5A 3M1YA 1XZ8A 1YR3A 4I1RA 3WSVA 1HLPA 4MW2A 3CBGA 4YDHB 3VUEA 4DSNA 4IDPA 2RK3A 3O90A 4JYAB 4RLSA 5CVUA 2GAFA 2VTEA 2G63A 4BB0A 2OHFA 5AUNB 1XD2A 5CLIA 1GUBA 3LW7A 1EQ2A 1TJPB 1GZ4A 2JKYA 1QRAA 4U00A 3SZLA 4AFNA 2IHJA 1DINA 1Y4AE 4N7RA 4TV8F 3WIVA 4WJKB 4EL5A 3QEAZ 3LY8A 1L5HB 3AEUB 1NYRA 4R0MA 4ZHSA 3GZ4A 4AUNA 3WL5A 4Q03A 1N9ZA 4PIMA 1KO1A 2HQ1A 4PSKA 2DLNA 2C2BA 3MB8A 1X7YB 5G3ZA 2R84A 2P0YA 4D8UA 3RARA 3SC4A 4MAFA 3O8BA 4OHBA 4E2FA 1Z9BA 3M33A 5A62A 4KUEA 3UWDA 4E22A 1EIWA 2WICA 1RLOA 4L75A 1FX0A 2C2YA 1MGPA 4WOKA 1BCSB 3GU3A 3SHFA 3UAWA 5I7SA 1KZYC 5CCEA 3S1AB 1GG9A 4IILA 3ZCQA 4UOEA 2M2IA 1JI0A 1V3TA 1VPVA 5K0BA 1OHHA 3B5EA 1U2GA 4K86A 2O6LA 4PO8A 2R4UA 2C2ZA 3U31A 3I4CA 2W4MA 4BFWA 3VR6H 4DCJA 1W36B 4UXJA 4HWOA 5GONF 4AMYA 4LY3A 2OCAA 1KXJA 4RX1A 1QGYA 1TT5A 1DBVO 1V2GA 2CXHA 5FAXA 1YCHA 1VIMA 3W9BA 1QQ7A 1ZD2P 2A1UA 3O9VA 1RXVA 3W8FA 2X3UA 1E3TA 1SVUA 4A23A 1C2TA 1M2HA 1Y1RA 3L0BA 2DMRA 2AE2A 2L17A 1ZESA 2X58A 3QRWA 4PPGA 1X74A 3M6LA 4GO1A 5ADHA 3FUXA 5GM1A 3RASA 5K0FA 4WUTA 3Q7RA 4KO1S 3QUSA 1GQQA 3LG2A 4CTNA 5BN1A 4U4AA 3K6JA 1ULZA 3UMRA 2QLJA 2R66A 2G9QA 3UFBA 5C1PA 3AK4A 1WCWA 2QPAA 2JCYA 1LK7A 3J7TA 4G8DA 1G1AA 1NN5A 3TD2A 2HLHA 1Q3TA 3IQDB 1KY3A 4MQ6A 3MCWA 1H3NA 5BWCA 1ID1A 5AW5A 1SVSA 1GUFA 2WIAA 4RENA 4TLMB 1TLTA 2R6AA 2V4ZA 3A28A 2DB3A 3IX7A 2D6FA 2R11A 4LBYA 4GVPA 4B3CA 1X1QA 4EDFA 1WDKA 2Q3DA 2YINC 4K46A 5KJ6A 3IKJA 5ALEA 5HCNA 1T1GA 1M33A 3DF7A 3OESA 4JJ8A 4ZPXA 3NMUF 2P5YA 4KN9S 5LXTA 1P5RA 1C3EA 3CWZA 4PLYA 4B84A 2ORIA 2Q0SA 1PTJA 3FPGA 1UFQA 3PI6A 3PLNA 3W77A 1FVFA 5ARBA 2CJXA 1IZZA 3IQGX 4X7RA 3UVEA 3WLKX 4CRWB 2FLKA 3WLQA 5GJCA 3UJHA 1VLHA 1O57A 1Z4NA 1ZXLA 2I9KA 2HD4A 3QV1A 3RAGA 1I2BA 5SY4A 2AOXA 3G6KA 3KL2A 1SHZA 2XWQA 3GLKA 2X5KO 4P5EA 2IH2A 2HW8A 3BWCA 1EUDB 4PRKA 5JS8A 1DLJA 1A7UA 1BRTA 1N1GA 3RS7A 2CDCA 4DR6B 1SJ9A 3C5HA 2NWQA 1SBCA 2HLPA 3SYKA 1UEXC 4A8JA 1U28A 3B3AA 4O2AA 1ABFA 4O8CA 5FAKA 2QMQA 3H0KA 3REOA 4YN3A 1UQRA 3O4RA 2FUG6 1PFYA 2GDJA 1VKOA 4HMPA 3QG5A 4FFBB 1GEEA 4ZZ2A 3VPBA 4CE6A 1HX7A 2ZT6A 4H1WA 2C61A 2H2WA 2FZCA 1HZZC 3DVAA 4JVLA 3VHXB 3SGLA 3FR7A 3ZNPA 4AY6A 2C1ZA 2H1SA 1BO6A 1FP7A 2F4NA 2AOWA 3HJNA 2EBUA 4WZAA 3AI2A 4ZT3A 3R7AA 2OA0A 3U49A 4YAUA 3GLIB 2LRHA 1PNRA 2AEFA 3CUSA 1MJNA 3L7OA 4ZEMA 1SO8A 1IUOA 1UKYA 2AJLI 4QFBA 5AW0A 1JKIA 3JALB 2QLLA 3FCXA 4GGOA 4UMDA 2WF5A 4YIKA 1WDLA 3BGIA 3H4TA 4WFIA 5D6OA 3SXUA 1GA4A 5IUJC 2HPZA 4YJGB 3KBOA 3PHBE 1ORWA 4LGYA 3W9SA 1DWUA 2KLHA 4ZQIA 1P77A 3F4KA 1QO9A 1EDDA 1ZNZA 1SIBE 2K6GA 3LFHA 5A6SB 1MQSA 4N4AA 4RY9A 5CAEA 1RLMA 4OATA 5FV7A 4RDHA 3KR0A 3VR4A 5CD9A 1U9CA 1U3UA 2WNIA 1YR7A 3BVPA 3UAZA 4YC7A 1EH5A 1SUBA 2YVQA 3H84A 4P93A 1DADA 4D9IA 1ULSA 4E21A 3FNRA 4RH3A 3LXMA 5JE8A 3C4VA 4EG7A 3AR4A 1Z73A 3IURA 4KRFA 3AH8A 3WNDA 4O6VA 1V1RA 4CBVA 3DE6X 1MRSA 1N6KA 4C0WA 1SPBS 3QVGB 3RAFC 4U7FA 4Y0AA 1PWYE 4NPHA 2WWWA 1T8RA 3FF1A 4E5YA 4PO1A 2VPZA 1M1NA 2C0PA 2WUVA 4C78A 3PUZA 1RVDA 4KV9A 4PANA 1B8VA 4G23A 2FGKA 3CVJA 2YUTA 3CJTA 1ZG3A 4ZD6A 4OQDA 2D1SA 2TS1A 2G77B 1UMBA 4JB8A 3PEYA 1T13A 1DU4A 3CH5A 1OR8A 3M5WA 5KYKA 1VYUA 2XGMA 2I91A 4YMGA 1EFRD 3F5SA 4X6LA 3S7TA 3OBIA 2I6QA 3PNYA 1RM3A 2VA8A 2R65A 2ZFUA 3E48A 3ZGXA 4OOEA 3IHTA 5FTNA 4DR5B 2GVZC 3AVWA 3GOQA 4C88A 1G20B 5B64A 5LQUA 1JFSA 4RWEA 1CZUA 4PPQA 3URKA 1BE6A 3ZN2A 2LW7A 5JNLA 2UV8A 3R77A 3HBJA 5SZHB 4ZYLA 4RHXA 4AS2A 2GASA 2VJYA 3FSGD 1SC6A 4PX3A 4RF4A 5INTA 3L07A 4JAVC 1GPNA 4BLVA 4GRIA 3KQKA 3PT5A 4D44A 2CBZA 2WM9B 4PINA 4GZ5A 1NP6A 1OLUA 1VL6A 1RU3A 2J3HA 2VRWA 1ISPA 3GRPA 4H16A 5D5HA 3H6GA 2IYSA 5F51A 4UNRA 1U1EA 3IQFA 3LLUA 1L4BA 1ZM4A 2QTBA 4XD7D 2XIQA 3JASA 2JLAA 2VYQA 2ZB8A 3MHPA 3S4YA 2C42A 5JSKA 3ZBQA 1AS0A 3EGXA 3X1WA 1MENA 1ABEA 4K1XA 4WBNB 4DS3A 1WP4A 2O7NA 3DOOA 1KJNA 3W8NA 4NHOA 2WI8A 1AU9A 2BEKA 4JJGA 5BSUA 4ZTBA 3X2FA 3PE4A 3LDUA 3MCTA 2XWPA 3SJBA 3USZA 4NYIQ 1QOPB 2D1QA 4MV0A 1W5EA 3IJ5A 5ITZB 2HJVA 4OCZA 1CERA 4NCBA 3QU2A 4PCAA 2AKEA 4OJKA 5EJ9A 2HCTA 5H4HA 3TSOA 5I51A 5IJZA 1RZRA 3RI3A 4IHJB 1SUIA 4MVJA 3FDJA 4C2UA 5IWCA 2C94A 3KYDA 2COKA 3JZIA 4HLNA 4FM9A 1IRIA 2Z56A 5JASA 1TOAA 3EQ9A 1J5EB 4QBKA 4ZCLA 1E7QA 4EMUA 1M7HA 3L7JA 1K9VF 4F71A 3IBTA 4I4TB 3BQNB 4HGZA 1A8PA 2B82A 3Q3EA 1GARA 2J3EA 5DNEA 1VZ3A 2D0DA 3FZGA 4Q4LA 2QN7A 5C8YB 3P9IA 2H9IA 2TMGA 3QPWA 4QEDA 5IN4A 3PD1A 3D7MA 3ZU6A 3VC7A 1PX2A 1QSGA 1XYVA 2FP4B 5B1HA 2IS6A 2FPMA 1NUQA 2OQRA 2PKQO 3NM4A 3RANA 1Z6GA 4ZDWA 2BCEA 1XQ9A 1U6IA 1EAMA 4C21A 1JH8A 2W00A 4M7OA 1F2TB 4JHLA 2YASA 4DB4A 3W4KA 3E5MA 4M22A 1XAHA 1R3DA 4XX1A 1HEUA 3PEUA 3QWAA 1OXTA 5ALLA 2GEVA 1J2YA 2YVUA 5FTWA 2XE7A 2P91A 3AW8A 4JVNA 5EUMA 1JPUA 2OO7A 1PDVA 3WDSA 3TWOA 4R7GA 5IT4A 4P0PB 1K3FA 2NM0A 1E3MA 2ZU0C 2V8BA 3AP3A 4CMKA 1NNEA 2XUKA 4KQEA 2JS7A 2J0QA 2I3AA 3FETA 1IN7A 4ZDIA 3FRIA 1XRSB 3AVQA 4P4SB 1MDBA 3C98A 4X8OA 2B9EA 1J33A 1EX9A 3OEED 3OPYB 1WHSB 1VQ1A 1ZN7A 1R6BX 2JI7A 1GTRA 1CUGA 1TM3E 4ZU3A 4Q3AA 1BS9A 1IY0A 1JG6A 2VHCA 2POCA 5KPJA 3EIQA 3HEAA 3IXMA 2CLMB 4U6QA 3QE0A 4LV5B 1FRVA 1LV7A 3WIEA 1LSOA 3A0RB 2QSJA 4BNZA 4KQJA 1G8JA 3FZNA 2J5XA 5BUZA 4PXYA 1KS9A 1EWKA 1U7PA 3O1IC 3AHFA 4J4BA 4JS0A 1UH5A 2NQTA 1NVUQ 4JUAA 4F1KA 4CR7A 2P9BA 1MB9A 1VE6A 2MHCA 3IL2A 1H0SA 3BT7A 5EXPA 2O0HA 5REQA 3FDZA 5FWYA 1ODIA 3EXHB 2FPKA 4NQRA 2DFNA 2IQIA 1MBZA 5IHXA 2JJQA 3P0EA 4R9UC 5CGQB 6REQA 2XCOA 4CMCA 1RPZA 1Q0RA 2ZSDA 1K3TA 3V8MA 1M0SA 2YH2A 4YEDA 1DT3A 4CODB 3KE8A 3VJKA 3EXIA 1KK3A 4UQLA 2Q6OA 4URYR 1A9RA 5AW9A 3KB2A 4DHEA 4AUEA 3IUQA 1RAHA 1NKVA 1F38A 3KPWA 1K8RA 4LVUA 4C7KA 1GXSA 4BAUA 1N6LA 4E5DA 5ILOA 2XKKA 3EH2A 6ADHA 3L0CA 3PC6A 2VPTA 4LJAA 1W47A 4F4CA 3K15A 1XN4A 2R6R1 3KKKA 2PUTA 2XOKD 2WD9A 2QN8A 3EC2A 3MWLA 4RVCA 4IIHA 3I01M 3SHQA 2A9KA 2Q5HA 4MKIA 4DMMA 621PA 4CF6A 1DS6A 1RI5A 2VSXA 2VUHB 4KO2S 5FNVB 5HF9A 5MFZA 5DYIA 1ZK3A 1QO0A 2CN1A 1EA7A 3EY9A 4RJTA 1KVUA 5L3VA 2AFIE 2C84A 1O96B 5FKJA 5FBLB 1ZCBA 3NWEA 4J0JA 2YVKA 2ERXA 2GD0A 2QZSA 4L9WA 5KYWB 4HNRA 1NNSA 1QLHA 2FPXA 1FTWA 1BXRA 3L0YA 5HJ7A 1Z63A 3EIWA 5LXTF 4OQPA 2HZBA 4NY1A 3T5DA 4QARA 5JDCA 1L3BA 4HMQA 1D2NA 4ZMSA 3HCWA 1SM4A 3PTZA 4OMDA 4WQMA 1P75A 3IQIX 3RK1A 4DV0B 1YHZA 5KQGA 2OAGA 2FSPA 4OBBA 4WLOA 3E35A 4OGWA 3RJTA 2L18A 4RKEA 2WJHA 2W9XA 1Z7YA 3PNBA 2Y6VA 2I99A 3OO1A 1S8AA 2IYPA 3E70C 1ZC3A 4P0TA 4ARIA 3B60A 4DWOA 2EGHA 3RJ9A 4G89A 3VR2A 3M6FA 2VAPA 4RPLA 1GR1A 2FR0A 3OIYA 1NRJB 1GTL1 1OXKB 1YK1A 4O2AF 5FLEX 3I64A 3SD7A 2BN4A 4RA9A 1KVQA 1XU4A 3OOHA 1GGJA 4FYPA 4I9UA 2YZKA 1M6HA 2X14A 1RPTA 3F7OA 4MVWA 4XOIA 4GHWA 3OKPA 3BIWA 4RNCA 1GPLA 4MAMA 3CZ5A 1ABBA 1TCAA 3SY8A 5AHWA 5A3JA 3DAPA 3QVWA 5BNWA 4DLWA 1R8QA 3GD5A 5JPDA 5KCMA 2O1SA 3F6SA 4S12A 4ZVLA 3T9DA 1CUCA 1O8BA 4MVJE 2Q4EA 3O2NA 4J9UE 2H5IA 2PL9A 2YS7A 2DTDA 4QAQA 4TT3D 2H0RA 1HT0A 5EMLA 1CLEA 2QP9X 2GESA 2JCBA 1ZGJA 1HZJA 4JP5A 5CHYA 1BGVA 1E63A 1PLKA 3TEFA 2X2EA 2GM5A 3G5AA 1UF9A 4IIDA 4DA7A 4TKLA 3S1LA 3WNZA 5JCZA 5CH8A 3GGPA 2W22A 5JCPA 2Q6LA 4Z9XA 3TXXA 3ZD8A 1D2GA 1G8PA 4PLZA 2XUDA 1U7HA 3IB3A 2GH1A 1AO0A 2YMQA 4M0KA 4DCTA 5HKBA 5HW0A 1TJ5A 2AWOA 3C97A 4BXOA 4KXXA 2QJOA 1KKMA 2DEUA 4WD3A 2J87A 3FTCA 2Z04A 5IVPA 5LQDA 2WHYA 3FLEA 1NQUA 3LDFA 2XUOA 3OZRA 3WV4A 1O5IA 1GCGA 4YT4A 2EOAA 4NYIR 1F1JA 2FSIA 2JBWA 2FN9A 3EXFA 4RK5A 5JNSA 2RKOA 3VU0A 4C2TA 4NQZA 1XDDA 2ZBVA 3FTQA 4LQLA 5ITVA 2CHGA 3DDWA 3H04A 4R54A 2D1YA 2QR3A 5J2UB 1T8SA 5GJVC 4BE4A 1U9IC 2X8BA 5KJCA 4IDFA 1GGFA 1XA3A 2FW1A 1EP3B 2YXLA 4E2ZA 1B41A 2ORYA 1CLUA 1D3AA 3EEQA 1VJ1A 5D3MA 4Q9LA 3T1YB 1K4YA 3T5MA 4ESEA 1BHSA 1DBSA 2W6JA 2O8EB 5FBVB 2RCYA 4GPEA 1JAHA 1Q0LA 1VMDA 3HCRA 1J5PA 3M7IA 4H2DA 5IBQA 2PRSA 5EIAA 1VCHA 5B1DA 3R5JA 2II6A 3M1IA 3GLGB 4CV0A 1JIIA 3DKPA 4F2PA 3NDPA 5FDFA 4HZUA 1KFBB 2ZRIA 3D2BA 3ESXA 2J3KA 3ZBTA 1N8KA 2ZVPX 3FW1A 4EQ6A 1H2EA 1E6LA 4MGZR 4ND1A 4PG5A 1HBJA 4BMPB 5KSOA 1M1XB 2A9JA 3IMEA 4RVHA 4YH1A 4IW3B 4B32A 2J30A 3EDYA 2PL5A 2AQ8A 5C53B 4ZVPA 3KJHA 4IKPA 2ZYSA 4QULA 3NIWA 1E66A 1PQUA 1UK6A 221PA 3AJ9A 2MSEB 3P71T 2Z4SA 1X1AA 2QD4A 4TS4A 1ZHFA 3A58B 4MPTA 5CBPB 1Q0TA 1L9KA 4W9NA 5G1PA 1G0OA 1TJNA 1THMA 5HMMA 1QZXA 2REQA 3K2QA 4CI0B 4A0SA 1P9RA 1Y1SA 3OHPA 4U1RA 3PC8A 1FF9A 3DDHA 2XLCA 1HL3A 1RHRA 4QDZA 2EW1A 2JLBA 3AI3A 1E3DA 1T0IA 2FX3A 1P2UA 3FSRA 5NULA 1M6YA 1R0LA 2G28A 2E3JA 4QBGB 2IYNA 3DP7A 4IEEA 3G89A 2JVKA 2Y6UA 5EJ2A 5TV2A 4CMIB 2O8CA 1AIPA 1IWPB 1F5NA 1RQXA 1FU8A 1PL0A 1TLFA 2Y27A 3B1VA 3AUKA 3R5SA 4UTNA 3G8YA 1G2OA 3MBIA 3KCQA 5EI5A 2DPHA 1KEUA 4HSEA 5F21A 5AH0A 3HBAA 1IATA 2BP7B 2D1FA 3JARA 1QQ6A 4HFRA 5FBWB 5JRDS 5E6SB 3C5EA 4DSOA 2ZJ4A 3AYXB 3E8XA 3HVJA 4MVJF 3SKYA 1UFKA 1TE2A 1K0FA 3AF3A 4AO8A 3CT6A 3KC2A 2ZIXA 3C3BA 1D07A 2V7PA 1KDZA 3VR4D 4X94A 2R97A 5EWJA 3IIEA 5GZ3A 3C3XA 3FIJA 2UYYA 5A3VA 1U0OC 3JQ7A 3JQ9C 4ZVSA 1RMQA 3U09A 3JQ8A 1EVYA 3OURA 1DQYA 4YT2A 1XMXA 5AW3A 3LSYA 2G7MC 2A4MA 2Q4TA 2V45A 4H27A 4J6EA 4MZDA 4PSVA 3ZWDA 3D7LA 3HB9A 5H3LA 4BWFB 4LY6A 4Q3DA 3W4JA 4DM4A 2BEVB 5F7OA 2W90A 1UANA 4AQDA 3A04A 3NOXA 5ES4B 5K8JB 4Z4EA 4CKEA 4YMVA 1XJ5A 3F9RA 2A33A 4H4CA 3ZVLA 4DF3A 3IVMA 3NPAA 4QJBA 5JQGB 3I4FA 1MAAA 4U2KA 1H5QA 2Y92A 2J48A 1CHNA 3GRVA 5JY6A 1N2GA 1RZVA 3ZOKA 1TVCA 3R8FA 1QRDA 3CG4A 4S05A 1FP4A 4BYMA 1QGAA 1EXWA 2XTZA 2GAAA 2J9GA 4HY3A 2WSLA 1NV8A 3HG7A 3RRNA 4RD1A 3VSDA 1KI8A 1U3VA 1XZQA 1PTJC 1RI2A 4C6TA 2AXPA 2YYZA 3KSMA 4BWYA 2LGJA 2F90A 4RTJA 3HXKA 4E5NA 3W2IA 3PGJA 1EVEA 2AMJA 1MB0A 2XQIA 4FYWA 4TVBA 2X77A 4JC0A 1MA0A 4QDKA 3SOZA 2DUNA 3RHZA 3C3YA 5D3QA 4C05A 1CEQA 3P4UA 4M1OA 2HGZA 4FBGA 4U9HS 5MN4A 4P34A 1MVLA 1OWMA 3CN7A 3KWJA 4OLJA 2Z58A 4GMXA 4Q24A 4X1IA 2GZAA 3L8ZA 3ZE7A 4HRYA 2B4TO 4A8JC 1N36B 1U28C 1ZW6A 2VVTA 1XEWY 5JC1A 1CULC 3CEMA 4Q3BA 1Y8QA 4KFRA 3B2EA 5CM9C 1C4XA 2V4UA 4X97A 3V2IA 1CBUA 4KREA 2C5GA 2XQGA 3ZI7A 4QGGA 3EEYA 4B45A 4F56A 3AV0B 4D8TA 1M6WA 2Z1MA 3FE2A 1KETA 1MCZA 1V96A 3L0DA 1Y1PA 3VSBA 4KSCA 4CFYA 1KFCB 4WCFC 1WIWA 1GL3A 1QIHA 5GP1A 1PK8A 3ASUA 5SYMA 4NYMQ 5F5LA 3WQBA 4B6FA 5J4LA 1U04A 1XCPA 3LVQE 4CLDA 3I2FA 3BZBA 3MUEA 1W0CA 4FMCB 1PF7E 3L02A 5HKKD 1MIOB 2AZTA 4W6QA 1MJHA 3CM0A 4BO8A 1U2EA 4M8KA 3QYFA 1E0AA 1OYVA 4Y8VA 5DGTA 2VRCD 1IOLA 1IHXA 1M67A 3UOAB 4ZI7B 4WZBB 3T3NA 3JYOA 1C3XA 5IT9A 4ER5A 1R15A 1YZTA 3Q9NA 2Q3MA 5FX2A 3HBMA 1CR0A 1V37A 3BK2A 1Z5UA 1NE7A 1ZHHA 4BO5A 1T0BA 1YIOA 2RBEA 5IDXA 2N75A 3HBFA 3ZK8A 1HEYA 2Q4DA 5CEEA 2B99A 2C7GA 2H59A 1PW7A 2JGMA 1QPGA 2Q21A 3DVQX 4LYJA 1GSHA 4MLCA 4UHDA 3WSTA 4B44A 2O3SA 4PG6A 1BHJA 1EUYA 1ESMA 4DR7B 2QN2A 4UDNA 4EYSA 1FYWA 3F3YA 2VTDA 4OB7A 1UINA 4F0JA 5HWSA 1RQPA 5CW2A 1EEXB 3CLUD 4TX1A 1I14A 2VSOA 1GZUA 1E4VA 1FYDA 5JWHA 2WUWE 5CDFA 1QHIA 1RZ3A 4MAAA 4NDZA 1IG3A 4AU1A 4K8RB 1CUDA 3RBAA 4JUIA 2WSSD 3ELWA 2WIFA 4YXWD 3RUHA 3MLBA 4C0QC 3LKZA 2W5UA 5BWOA 2X0EA 2WJAA 1JLLB 1LPMA 2Z4TA 3VNRA 4HNUA 1Z0ZA 2WOJA 3BBLA 3OC6A 5FFMA 1JSXA 3QK7A 5TT1A 4F1WA 5T64A 2O1XA 1B6TA 5A2GA 1W8DA 1JYSA 2ODWA 3A05A 2CUNA 1LK0A 1WMFA 5D84A 1CQWA 2GBGA 4UHEA 4S35A 3OM1A 1CG6A 3WYNA 2FCAA 1T5HX 2VJOA 5G0WA 2HV9A 4WFJA 3UF0A 5DI3B 3C8HA 3ENKA 3IDFA 1Z38A 2X13A 5CPBA 5I7AA 5LIRA 5KDDA 3DMGA 1ZOOA 2AR9A 2V6GA 3RPEA 1NG9A 3IP3A 3HTXA 2ILVA 1T9DA 4OFBA 2QUIA 4YV0A 1YS9A 4WERA 1XQYA 2P2DA 2NACA 1DP4A 3H1FA 2JAOA 3HLTA 3KNZA 3KTAA 3OLCX 4FOLA 2H29A 3IPCA 3N76A 4H59A 4KXWA 5KYGA 1TKCA 2JH8A 2QE6A 4F97A 3RC2A 4HQKA 3BMCA 3R3JA 4OBEA 3GUVA 4OXRA 2RC5A 4M8NE 1SBQA 3RSFA 4GL2A 2X9QA 1X87A 2Y77A 3W1VA 1QVAA 1H05A 3TL2A 2Q27A 2JLSA 1ZNYA 3INNA 3L5KA 3IBGA 3I62A 2RH8A 4QG7A 2BFMA 2MYUA 4QL3A 3WAGA 2CNLA 1C9YA 3E9DA 3U56A 2DH5A 3S0JA 1TX4B 2EBWA 4FHGA 1V8PA 1AUOA 1DWPA 1PL6A 1G5IA 1CYEA 5CLQA 4O3FA 4OJTA 1E1CA 2ZBUA 3PU6A 3AL3A 1TD1A 3P96A 4ZAWA 3R74A 1ODKA 3CWQA 4OI2A 2O2EA 4C0HA 1GNQA 1HE5A 4KUGA 1JAXA 4FYMA 3ZKWB 3RR2A 3I8SA 2JHPA 3MINB 4WH0A 1X7ZA 3GT7A 1PR2A 4IZIA 4N76A 3GEDA 4KVFA 1T1JA 5E9AA 3AR6A 5HIMA 2XMDA 1N7GA 4UAGA 4YVFA 1CRWG 4FT2A 2HA6A 5FQOA 3OCZA 3H11B 3Q7SA 3B1WA 2R4QA 5CP8A 4FEEA 1P1KA 1PYGA 1WUKS 4RJLA 3BJRA 1OLOA 3D6MA 1GHTA 2VT3A 1L9XA 1WSDA 3DV0B 3L7AA 4ANFA 4U7TB 4RZ2A 5C18A 2WSMA 1LD3A 3GPDG 5SZJA 1A98A 1LSJA 1HNXB 2H1OA 3GYGA 1VMEA 3DSRA 4V0SA 3ZGOA 3O8CA 1JDJA 1AKVA 2A58A 4M8SA 1W87A 2FEPA 3FY4A 5DN6D 3GLFA 1H22A 1T10A 3A1SA 3MGAA 5F98A 5BSKA 2W71A 5HIIA 5GJBA 4OD0A 2GLTA 4RHTA 5HRAA 2TYSB 4FZRA 4N47A 1OU4A 1V16B 3FDXA 3TQQA 5JSUA 5A04A 2PWAA 3B1FA 2X0JA 2GUWA 2VAWA 2NUTB 4HAWA 1TKRA 1RPJA 3L06A 1JZSA 2VT7A 3SX0A 1QTNA 2HMUA 2YZNA 4HH3C 2CNKA 3I2KA 4H1VA 3RC8A 5A3SA 1V39A 4FMBB 3TH5A 1M2VB 1LPOA 1YB7A 3L40A 2R5WA 5EFOA 5C3UA 2KPOA 1QO7A 5DGIA 4FN5A 3U1VA 1V4BA 1C9DB 1BA3A 2RK6A 3Q2OA 4G36A 4BP3A 4MVJM 1YS1X 2I2BA 3WKEA 4ZVOA 1ONBA 2O4CA 3C8MA 1HDIA 3L7IA 2CD9A 2LDXA 3A32A 2F6RA 4LRUA 3K0CA 5IMSA 3QH4A 3MGCA 3SQOA 2PX3A 2OWDA 2WTNA 1BU5A 1DQZA 1TAHA 3I9LA 4A16A 4R16A 2NTNA 3MAJA 1N2ZA 1D5CA 4HAZA 3WY9A 3ZDRA 1OXMA 5TVGA 1T3LA 2DR0A 1HYGA 3LCJA 1MG0A 2HF8A 4AN1A 1GTSA 1MEOA 1PJTA 3WHPA 4D0NA 4TPKA 5BYJA 4CLOA 3FKSA 4RMJA 3RW9A 4TWBA 3WB0A 3JPWA 5ADVA 4ARSA 1ZA2A 2QLMA 2YW2A 4RACA 5D1HA 5EKTA 5EXDA 4C5BA 3BB3A 1H6AA 1T0PA 1UBFA 5TQ0A 2IFTA 5BV8A 1UFOA 5IAKA 4XAQA 2CL5A 5BN3A 3M4YA 4WXPA 3ORSA 1EG2A 2ZBFA 4MTCA 4C89A 1L1RA 4YACA 3FYUA 3DHYA 4DCNA 3FAZA 3ITEA 4XPIA 4C14A 5CFRA 1ZD9A 2DPGA 5CDFE 4J9VA 1M54A 3E2IA 2AD5A 3P0RA 1TA0A 1Z35A 1L4EA 1VBFA 2CMDA 2CB0A 3TO5A 5IS2A 3VZBA 2ONCA 4RS4A 1HNNA 1E3LA 3MNFA 4LHZA 1EWYA 1U6JA 1ZQ9A 2MTBA 3DR3A 4S1WA 3T9AA 4BAGA 3OWHA 4ZHQA 5AKXA 3UMFA 4IJMA 5K3SA 4HDQB 3HRIA 4L3VA 4KKVA 1QH8B 2E21A 4LYDA 1I01A 5ESWA 5JG7A 3ZGYA 1YDMA 3TFOA 3WQQA 5HIJA 1NI5A 2VK1A 3PD0A 3DLAA 4MNTA 4N39A 3HEBA 2VNIA 3AKEA 2J33A 1E9FA 1PG0A 2YFQA 5IVKA 1ZO8A 4L0MA 3PHGA 5L6MB 1JHPA 5L3SA 1JKJA 2IL1A 1RCUA 2VR1A 2BC9A 4BNKA 2XVMA 1NNI1 5B53A 1Y1KE 2FJPA 1ZNWA 2PXXA 4NSNA 2I65A 1K66A 1PS0A 2YQZA 4HAOA 4IIJA 1J9EA 3N3BC 3THYB 1XTJA 4GRDA 5KCZA 2CLDX 1M8KA 1ORIA 1E60A 1FP6A 2PL3A 3DBOB 4AJ4A 1IXYA 3J81A 1XN1A 1MHTA 4TV8B 5A4IS 5JWOA 4K9SA 3OTGA 3KJIA 2Z5LA 4YJDA 5T8KC 3ADCA 5BOVA 1UBSB 4M46A 1U8FO 5JJIA 1VKHA 5HOEA 1OI2A 1QQ5A 3QVTA 4UNSA 4KKXB 4L6IA 3QOYA 3IP1A 5TPZA 1DRJA 3FJ1A 5H0IA 3H2HA 3ONEA 3AF5A 4KAAA 1N77A 2VF4X 4XI9A 2C03A 2ZSUA 3BGDA 1V11B 2GK6A 1STOA 4F11A 1XKLA 3QSGA 5FXMA 3TTVA 4EFNA 3JQPA 4U2DA 1LFDB 2O7SA 4IZHA 1U1FA 4V39A 1YR2A 2WD8A 2ZAGA 2BTQB 3E27A 4XSVA 3AX6A 1FDTA 3DM9B 1KY4A 3HUTA 1EVLA 4WACA 3FSEA 4EGAA 4MVJG 3CIFA 1PP4A 2GTHA 4LZWA 1MZPA 4R3UC 2WUDA 4N6GA 2VPXA 1IHPA 3FBGA 4AO7A 5B7QA 2ECQA 3FTFA 2HT1A 1V4NA 1GNPA 5GONB 1JJBA 3NGLA 3LDGA 3Q3VA 3FUWA 1RHJA 2VJBA 3TBKA 5FL3A 2J09A 4GVXA 3ENZA 4BNDB 4JV5B 3EVAA 2X5XA 4J0CA 3U4DA 5L4SA 5ADWA 2P0AA 1KF0A 1NDQA 2JFGA 2B94A 1D4ZA 3DE7X 3OF3A 2DBYA 4EYEA 1VPEA 1DQPA 4DABA 2WSIA 1NX9A 4QDOA 3EBOA 3MRVA 1VE9A 2CFTA 1N8TA 4K6MA 5E0OA 3P2KA 2CXNA 2ZGVA 3CRW1 1KJQA 4B2YA 2CXXA 4E31A 2AWNA 4GD3Q 3QKWA 2HO5A 1J5XA 2G7ZA 4BNMA 5KTPA 1MW9X 1IUKA 2G9ZA 3GUYA 5F76A 5I3CA 1BQ4A 1PK7A 4PAQA 4DNXA 4DUGA 2MT9A 3C16C 3N8HA 4NENB 5C31A 3TE7A 3IPRA 4WLEA 4FTWA 5AT1A 4BJ1A 5IAEA 1ZOIA 3HB4X 2X4GA 3PFCA 5DX8A 1G3MA 4C6HA 1PSZA 2C54A 1P5FA 2BFOA 4QTTB 3KSZO 2JGDB 5A9SB 4UBMA 1XTRA 4GH5A 4QAJA 4BLOA 3ICOA 3VKUA 2LCIA 2HBZA 3EUAA 2FW7A 2JH9A 1FSZA 3QOXA 3Q3JB 1YDFA 2J31A 1YJAA 1ZS9A 1GKIA 2ZR7A 1EFCA 4UDYX 2B6HA 3R6DA 5CLFA 4JVMA 3N8KA 1OVMA 1XKXA 2IW1A 5IC5A 4PPNA 1SZCA 3UPUA 3CB2A 3GIWA 3HCEA 2VP5A 4E88A 2RKBA 3ETNA 2QU7A 5FL7D 1SCUA 3D7KA 1H4TA 2J7KA 3CZMA 5IBRA 1UBJS 3E2MA 3M6XA 3FKJA 4DC9A 3CH7A 4FCTA 1E58A 1L0BA 2XZTA 3E58A 4J0IA 4W9NC 3VFDA 2EZTA 3NRCA 4P3OA 4TM8A 5FWDA 4DUYB 1FFWA 3A3KA 2WWIA 4NEQA 3THRA 5IJWA 2PQ6A 3UFXB 3V9AA 3TUZC 2NADA 4C3UA 2A84A 2IF0A 4FVTA 1V5WA 3CXUA 1E9EA 3Q2IA 1GAQA 2DSNA 2JJ8A 1I2DA 4HH4A 1FRQA 4AIIA 1XPRA 4Q1FA 3VR6A 1U8CB 4EYQA 5L40A 2BFDA 1OB2A 3PX3A 1JZQA 4MO2A 5KNDA 3NCTA 3NU1A 1WKBA 3GVPA 1QHXA 5H70A 1NVEA 3RAEC 1Y82A 1FDSA 3L93A 3NHSA 4R1TA 4YRCA 3RS8A 1FFDA 1K88A 2BLNA 2BGRA 5D7NA 1LB1B 3H8WA 5IZ4A 1GAJA 1XLVA 2IY7A 4YQZA 3WAKA 3VU9A 4RXTA 3NHZA 4K9NA 3EXG2 3JQAA 3PS9A 5EE0A 5EGNA 4ER6A 3F6EX 4QVGA 4TTPA 2ZE5A 4YB8A 4CG2A 4ZZ3A 3B82A 1XTIA 1R8XA 1ISHA 3ESAA 3ZHYA 4C0LA 4BLWA 3PXXA 1U0LA 2I4NA 3ESYA 3C8UA 2PSJA 3WGJA 5MN5A 3QY0A 5AFSA 1LTQA 2ROQA 1QDLB 3NBUA 2ZRPA 3OE7A 1N5RA 1TL7C 4N3AA 3ZY6A 3DBVO 3F47A 4COOA 4GGPA 1RHKA 3I12A 3JQCA 3HJBA 1ZD8A 4PSCA 5GOZA 4D9FA 4MW5A 1OILA 4AY4A 4FWTA 4QICA 5AUQA 4JOCA 4DCPA 1OGYA 2ZTHA 1OXBB 3GBSA 4WEOA 5JCJA 4URVR 1UOPA 2NQ8A 1R8YA 3AXSA 4F3NA 3JRXA 4REQB 3DNFA 2F8MA 3ZUGA 4QPZA 4GP9A 3S2EA 1XDGA 3G7SA 3I5MA 2P0EA 4ER0A 4XYLA 5IXSA 3M2TA 3IT0A 3GPCA 3TQOA 5MGNA 2G80A 3BHMA 5JS6A 2VKTA 2FMFA 3TNFA 4JLSA 3GC6A 3QIAA 3IAM6 1SQ5A 4N3BA 1PJ4A 4UHBA 1KEVA 1V3QE 1NLZA 3KQMA 1BXGA 3O2SB 1FTQA 1T9AA 1WMSA 2M1XA 3PQ5A 1ZJJA 2O2XA 2WIKA 5JBQA 5EJ6A 1NF2A 4WY2A 4R1SA 1TDJA 1M0EA 2DJ5A 3K70B 1CETA 1A0OA 1R9NA 1ADGA 3TNYA 4CM8A 3WA7A 3I6MA 2CE2X 4NBLA 1KMNA 1HDXA 3SS8A 4PSUA 4A0FA 1QHHA 5CCXA 4HLUC 1KDPA 3GJRA 2NP7A 3NM5A 1Y81A 3NUQA 4YGYA 3VOBA 3MTDA 3PHJA 1DKRA 1PZMA 1UPBA 2FPPA 3DT6A 4OHPA 4QFMA 1BC5A 1Z47A 4A4DA 4W9RA 4EAQA 4CF7A 2AG8A 3SXPA 3WBFA 4EUKA 4GOMD 3Q10A 1XBTA 1FP1D 1TNDA 4N01A 4AIRA 5F1OA 4XJTA 4GUAA 3WIDA 1ZK4A 1VE5A 3DO6A 1L5VA 1OKKA 3MVEA 4EG8A 2QQ0A 1H8HD 1ZRNA 5KC8A 4CCAA 1Z2CA 3TG2A 5K6RA 3OPXA 4OM8A 4DQDA 3N05A 1JSLA 4BQNA 1TK3A 1UQTA 2NU7A 4PYKA 4L9RA 4PIPA 3R41A 3ZXXA 3CEHA 2VXBA 1PX0A 2A67A 3AJRA 4MB0A 4YLEA 2DHRA 3CS3A 3X1XA 4CCSA 5K9ZA 1A9XA 4PLGA 4UBIA 2J45A 2JGRA 1JHVA 3KG2A 4X85A 5DK6A 4PNEA 1I13A 4RD6A 1QLJA 1U8AA 5K8VA 1PZHA 1KQ3A 3DYIA 3M6MD 3R1IA 3SP1A 2FZ5A 3VO1A 5DH9A 1O97C 2QLFA 3FOBA 4JQCA 4JITA 4JWKA 3P9QA 3KUUA 4QFDA 4WCVA 4KRXA 3RLFA 3TPZA 3O6VA 1XF1A 3PP8A 4MPRA 5KDLA 1RFGE 3SSAA 1OW3B 4UCFA 3V1UA 3A1UA 1PIWA 4MR9B 4O29A 4X24A 5HBGA 1NDUA 5ERXA 1V3UA 4JEHA 5J4VA 2HMSA 1NV9A 3BSYA 3UQYS 2HU2A 1NT2A 3BCHA 1U94A 2FJUA 3W7VA 2AOTA 2YC4C 4Z2YA 1I1HA 1J2JA 3SZRA 1HEIA 3DR5A 1D5WA 3DMFA 1QQAA 2W42A 5E8JA 3R09A 4ZHQF 2A94A 2B7LA 1FNMA 1OPXA 3CZCA 3N28A 1QHEA 5EIXA 3K35A 1DAGA 1B76A 4K3VA 1LPNA 3TLJA 3L01A 4BQIA 4EJ0A 2Q3HA 1KRXA 1ZI8A 4GI3A 5K99A 1THTA 3EQ8A 1MORA 2PVSA 1GCIA 5LNK6 5FOWA 1P73A 3UNXA 4YBRA 1WO8A 2QTCA 2JBAA 2P4EA 4Q93A 1NLYA 4URWR 2AYXA 3IUSA 3I2IA 3P2JA 3VX3A 5IHPA 3PUJA 2H5JA 4ZOQI 2JRCA 3D4LA 2P3LA 2KBEA 3LLSA 3EZ7A 3GGOA 4UUMA 3NYWA 2A0YA 4IIJF 2NO4A 3LLMA 4MARA 1P5HA 2R2AA 4X84A 4M49A 4ZT7A 2M6RA 2GJSA 3F7TA 4IOMA 3CUKA 3IDAA 1U4NA 3RKRA 3QE9Y 5A7FA 4HBZA 3SYMA 4EI9A 5KJ1A 2RAFA 3DWGA 5EJFA 1E7YA 3UC5A 3R6LA 2IYQA 1KDOA 1FFXA 1EZZA 3PUKA 4CR8A 4CEJB 1DJNA 1Q44A 3A3OA 3PQ4A 2YV2A 2C8JA 3L7YA 4K6KA 4ROSA 2O5EA 1BEEA 2EHJA 2HMAA 2ZRNA 5KYUB 3BA6A 5AI8A 3T7DA 5JAPA 3CRRA 4GWKA 2FR8A 3ABOB 3AVYA 2BCJQ 1FX0B 3OZGA 3BWBA 3KOXA 4TYQA 2Q6KA 2VQDA 3DFFA 4L07A 3NXKA 4YP7A 4XCVA 3FTPA 5KHAA 1AK1A 2I6SA 3DUFA 3UYLA 2AIRA 2C5BA 1JIUA 5DEIA 2N42A 2XZDA 1AV7A 3CF4A 2WAOA 3V32A 2JEYA 1GR0A 5F2EA 3V00A 2QX8A 2PH3A 1JHAA 2ZCVA 2ZRKA 4GT1A 4TN5A 5DW0A 4J29A 3RSQA 4DMLA 4ZCTA 4KWIA 1TT5B 2WMDA 2P4QA 2NPIA 1DQNA 2PR2A 3FKSD 2GPNA 4KQGA 5IG2A 4HT3B 1NF3A 2FKAA 4URHA 4A8TA 2FW0A 2HDWA 4GL4A 4AB1A 1RXIA 1L5ZA 3C70A 4WUVA 1PV1A 3K8QA 1I5EA 3WK8A 1H2HA 4KIGA 1OIWA 3PFHA 3KKLA 3OCJA 5AK3A 1FPQA 1Z8DA 4GI5A 3ZZ1A 3VVMA 5BNTA 4DV7B 1F4LA 4R8SA 1UM8A 1N6IA 3II6X 4DDMA 3IRVA 3K2BA 2YQ5A 4GMKA 2O7QA 2FPIB 1NKTA 5E6RB 1A7KA 5C7YA 3ZS9A 4HNAA 4YUXA 5A1TA 1LRJA 1OAOC 3L9XA 4I7EA 3FPHA 4IMIB 3R40A 4CU5A 4UUOA 3RIXA 4KQKA 5DHRA 1J0CA 1QIGA 5CXXA 3GJTA 5ERGB 2PJUA 1W76A 3L1KA 3WLFA 4GKKB 2WU3A 1MA3A 1VJCA 3C1UA 3HVUA 4XYGA 4WOBA 5LXTB 3A4VA 3T4PA 4RVOA 4ECAA 2PZLA 5BURA 2VDJA 5DN9A 1KP9A 5AM5A 5C5CA 4MA4A 2R79A 3O47A 2K7FA 3CVWA 1ECGA 3AJAA 4JR0A 5L3RA 5TMDA 4IIFA 4CKCA 521PA 2KE5A 3VOTA 4B48A 5IF9A 1W19A 4P0QB 1EGAA 3OC0A 2H2DA 4JKOA 3T12A 1A1VA 3AEZA 2VAMA 2AYZA 3CUUA 4LC9A 2Q9CA 2J4CA 3A3YA 3DT9A 2JIQA 1E1QD 2CHVA 1IZ0A 3KK0A 2EJCA 1RCTE 1NY5A 5HRUA 1SEVA 3F6PA 3RVPA 1CS4C 3PRJA 1S96A 2QOEA 3K0HA 4JX8A 4DNQA 5JAOA 3IDZA 2Y76A 1TQ6A 3AF0A 4XTRA 4O2AB 5AVOA 3P27A 5EJ7A 3EGCA 3D4IA 2VDNB 2ATCA 4QT4A 1WY7A 1EP1B 4LYEA 3MJHA 4U7WA 5TPZD 2AQHA 3TD6A 4MPJA 2ZKIA 4LX0A 3U4QA 3DVAB 4E70A 3ZWWA 1MAVA 2BJWA 2QD3A 3I53A 4HO1X 1WX1A 4JBLA 3G5TA 5ALJA 1AN0A 4B3MB 1J42A 1J1UA 4DCOA 1C3JA 2JDIA 1F5SA 1RRCA 1W4LA 1CRPA 3UK7A 4DEYA 3MTBA 1K4MA 1HT3A 3A7DA 2RI1A 4HC4A 3QLJA 2EP5A 4RVSA 1COZA 4LNAA 1OYYA 1GYQA 2CC2A 3M3DA 2NZVG 2XNJA 4KJXA 3SXUB 2MMGA 2I1QA 3L2OB 3AVUA 5T4BA 1EE1A 1Q74A 1N3YA 2RHDA 2RARA 2VPPA 2WB4A 3H86A 3OZVA 3RG2A 4MQLA 4W5RA 4EJMA 2DTXA 1PEKE 1P60A 2ZBGA 4YCSA 2ETXA 5CVVA 4KR9A 5ANRB 4YWJA 5IDWA 3PTAA 5HP4A 3IIKA 3L6OO 5CAEB 3CR7A 4B33A 3K1YA 3U26A 1TM1E 1T2EA 2I78A 2QUJA 3ORHA 4BFCA 5BMOA 3PE3A 3HI4A 1SUEA 3NJ4A 1JVBA 3P9NA 4ZEVA 2FX2A 5FH9A 3RNLA 4CM9A 3HNRA 1U6KA 4J16C 3S70A 2NU6A 4MJLA 2D5LA 1Z5PA 3I0ZA 4LE2A 4C07A 4ZTUB 4B3BA 4PZLA 1YJXA 3AQ4A 4M1MA 2DT8A 4QUHA 1RXEA 2O3TA 1MKYA 4UZSA 1V1RB 5JYDA 2KQUA 3DDNA 4X54A 4AUKA 1G5HA 2BM9A 4IRXA 3AF6A 4HQ6A 1CUFA 4K9LA 5C8DA 1JQBA 2C57A 1DC8A 4HDSA 5FTMA 4YUAA 1BX0A 1TM4E 1M1NB 1NYTA 4RMIA 4X90A 4XGRA 3WGHA 4D5EA 4YREA 4FZJA 3B70A 1OBVA 1SN7A 2XE8A 3JSAA 3MD0A 3I92A 1G63A 4TM7A 4H6PA 4I1OA 1PUXA 4IIYA 2Y9PB 1Y5MA 3QFSA 5FPKA 1E2PA 3MELA 1G41A 1OPRA 1YKSA 4CKWB 2X23A 2QTTA 5G4KA 4DIUA 3ENNA 3ITKA 2W43A 5BSFA 1UMBB 1EFDN 2GBCA 3AZOA 4HB4A 3QU9A 2FSHA 4ZO6A 3C3DA 4BKOA 1Z36A 5JPIA 1X94A 1TVKA 2FFQA 2C3PA 1QGUA 3DE4X 2A6PA 2OLEA 4U0JA 2JEOA 1GQYA 1BYUA 3QXGA 1C8VB 5DYNA 4AK9A 4A2WA 4F6RA 1IYZA 3BAFA 1JHMA 3NHBA 4R84A 2BR4A 2FLWA 1Z2DA 3JV7A 1FVXA 4X1OA 4X41A 2IHNA 5KQMA 3KYCA 1FUKA 3QVUA 3AR7A 1HLDA 4G24A 1XGKA 3P2YA 1F20A 3PQFA 3V3TA 4Y7DA 3IDSA 1G3UA 3V46A 2B37A 2R7NA 2EQBA 4JLDA 1KOLA 2IH4A 4BEVA 3QXHA 1ZA1A 4PC7A 5EHNA 4DNFA 5LKRA 3HXMA 1OLUB 1ZL0A 1DAFA 1YVRA 4U5QA 1AUXA 2JFNA 3L4EA 3PJDA 3WLHA 1U3GA 1RQLA 2Z5FA 2ZWMA 1KTIA 3T5PA 3FHCB 2OFXA 2YV4A 5CK4A 5L7YA 3LDHA 1A9PA 5IM4F 1GKYA 3PC4A 4Y1RB 2IUUA 2XT9A 3AJDA 4GYWA 5B3LA 3HU1A 4KHPB 3TKLA 1ESCA 1V5IA 4B4UA 5F7XA 4D4GA 2PK3A 3TUIC 4QBFA 2JI4A 5KNDD 3DFZA 1O4VA 1I80A 3RE1A 4RK6A 1OD6A 1P3JA 1RACA 3C48A 3OUUA 1REQA 1O2DA 4D98A 3MIIA 2R6HA 3EQ2A 4AJKA 5K0LA 3L92A 1QFMA 1KVSA 1X77A 3TRIA 1KS2A 2OXEA 5CH5A 1Q83A 2GYWA 4DT1A 2Q1SA 1PWHA 1OFUA 3JQAD 3MTGA 4R98A 4ZXPA 1WBJB 3LY5A 5CW1A 4C87A 1JDSA 2ALJA 4KXUA 3QOFA 5AJTA 1HFEL 2IYTA 2V98A 4DSZA 1M34A 1KOJA 1JLHA 3LDAA 2Y0BA 5JXIA 2WILA 4ZA2A 4D42A 1OH8A 4DMUB 1Y6FA 3U7HB 2ZITA 4K6GA 1E89A 4MLPA 1M1UA 4OYLA 5FWAA 3TFQA 4EJSA 2ZI9A 4ON9A 1I4DD 2EZ4A 3S81A 5KWEA 2G08A 5AHXA 2ZJ5A 3OOYA 3G7UA 2FXVA 4EAAA 4IIGA 5E2AA 1E5DA 4L6AA 4D25A 3O8QA 4PLPA 3B51X 1U8XX 1F4PA 1GUAA 3KOYA 1GPKA 3CRQA 4HDRA 1Q91A 5EVCA 4PO3X 4CCYB 3OZXA 3DFUA 3U61B 5KREA 3N7UA 3EJ6A 1W581 1YIDA 4WFKA 2XYVA 4CQJA 1UDAA 2D06A 4Q7QA 5CFPA 1IZYA 1HXHA 1T9GS 1M6EX 4DARA 3VDNB 2RHTA 2QRLA 2HADA 3BD9A 3KFXA 1VPLA 2C1EA 3A1VA 1FPMA 3TK1A 1E2UA 4P82A 5LQCA 1TZJA 2DHCA 1WZIA 2W11A 3JR7A 3AEQA 2P1ZA 2VT6A 4S1PA 2K2WA 4D4MA 5K3FA 4IR7A 1QIDA 1IPFA 2QZJA 3CJQA 4P54A 5A0TA 1K86A 2BEWA 5DCUA 3LLCA 2YX1A 2Q5CA 4BCDA 4BMSA 2JCVA 1X8KA 3KKZA 2QRJA 5AM0A 1U4SA 3UOGA 4BB9A 5FUXA 1Q0PA 3D0OA 2C2OA 2C9DA 2C9ZA 3D64A 4L4SA 4KK4A 2C9YA 3PUHA 1MQ9A 2AC2A 2YUIA 1AXEA 2HOQA 2R6FA 4JASB 4PHGA 5K8CA 1SAYA 1D7AA 1V9CA 3B9QA 2YOGA 4NONA 1P6XA 1NHGA 4PRLA 1BE0A 2PZJA 3I1YA 1N0IA 1YDEA 1J0AA 2R9VA 4PQGA 5JZVA 4AKIA 1YTUA 5FOQA 1GZ3A 1OKKD 2VQ3A 1KEZA 5DWDA 4LWPA 2QBYA 3IBCA 4GQAA 3QKTA 4QXQA 3B3FA 2Q29A 2QT1A 4MYUA 1SZPA 3ETHA 2C2KA 3NVMB 4R8MA 4ETWA 4NU0A 4NXNB 3RHTA 1SD5A 3FUTA 3ZCTA 2YWJA 3O4GA 1BCRB 1AC5A 1JEEA 3GDFA 5EIBD 2IXTA 3QE4A 3H1GA 2P9GA 4M1SA 4N12A 4RLQA 5HGJA 3QP9A 4XASA 5C7IO 6ABPA 3DAYA 1GADO 3HYNA 1FDOA 3TFWA 1X1RA 2FUCA 1P2GA 1Q7BA 6REQB 3CR8A 2EZ9A 1IJEA 1YVDA 2PQ0A 3BKXA 3KKEA 4N7JA 4U5XA 3O3MB 2GILA 2JAQA 1C7EA 3KR1A 1ECJA 3WGGA 1N75A 4CM4B 4QVIA 3E5RA 3EXIB 3QJGA 1JLKA 4YI3A 3VKHA 4CIAA 5KZMB 3K71B 1LS6A 3JYNA 3V4PB 4GR9A 4ZQBA 3S3TA 5B2FA 1EEHA 1R4MA 2B2NA 1K7CA 3H16A 3PJGA 2Q5JA 4IYRA 4F8EA 1C9NA 1GXSB 4ABYA 4QOIA 2E9SA 3OEHA 1ZSYA 4QRDA 3X1YA 2YIMA 4BO6A 3A3NA 3AZQA 2AMYA 2F59A 3ZWCA 3QPDA 4J7CA 4C0BA 1JALA 4UCQA 3AEXA 4G1BA 2O07A 2VJKA 5ILGA 4NABA 2QI9F 3HA7A 4OOFA 1KEKA 3KQNA 2VP0A 1PE0A 1A95A 3LS2A 2IP4A 3GLHE 1LJ8A 4BNIA 2AZXA 4MVJP 4G5SA 3BILA 2HUNA 3WK5A 1XV5A 3A10A 1BXRB 4Q9NA 2JBHA 4LHXA 1A9SA 2FDXA 4TUYA 3W79A 4B6SA 3PNVA 3D6TB 2CF5A 3NHWA 1YKFA 3SJUA 4C4PA 1AQJA 5F73A 4D1YA 4V3CA 1EFVA 2EKLA 5IKOA 4ER3A 1P9LA 3GJSA 2XECA 3ZWOA 2OCPA 3N2ZB 3I9V6 2PXHA 3EZGA 5EKXA 2YMLA 4GI7A 4ZCSA 3AIIA 1TAGA 3KHTA 4MUJA 5AOAA 1BJKA 4PXSA 1N1EA 1I2ZA 2W8BA 2YHSA 3P9XA 4YMIA 3AFMA 2ZVJA 3RIMA 4M21A 3V7FA 2BMEA 3TLGA 4Q1EA 3ZIAD 1TM2A 1JR4A 4KSYA 1P9WA 3PYMA 8GPBA 2C7QA 1UJCA 1IMJA 3BBPA 3KTDA 4BO1A 4CMGA