4EW1A

High resolution structure of human glycinamide ribonucleotide transformylase in apo form.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
205
structure length
205
Chain Sequence
b'ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWVKEEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trifunctional purine biosynthetic protein adenosine-3
molecule tags Transferase
source organism Homo sapiens
publication title Biological and Structural Evaluation of 10R- and 10S-Methylthio-DDACTHF Reveals a New Role for Sulfur in Inhibition of Glycinamide Ribonucleotide Transformylase.
pubmed doi rcsb
total genus 65
structure length 205
sequence length 205
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2012-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4ew1A00
1C3EA 2CFIA 4ZYZA 4YFYA 4ZZ1A 4ZYWA 3GARA 3DCJA 1FMTA 1ZGHA 1RBZA 4ZYUA 4IQFA 2GARA 4TTSA 1S3IA 1JKXA 3AUFA 3AV3A 3N0VA 4ZYYA 4PZUA 1CDEA 1CDDA 1RBMA 3DA8A 3KCQA 5J63A 3TQQA 4ZZ2A 2FMTA 4TT8A 4NV1A 4ZYTA 1C2TA 1NJSA 2BLNA 3LOUA 1MEJA 3O1LA 4TS4A 5J9FA 4ZZ0A 4EW3A 1RC1A 1GARA 3P9XA 1YRWA 5CJJA 4QPCA 4ZYXA 4Q12A 1RC0A 3TQRA 4EW1A 3NRBA 4ZYVA 4DS3A 1RBYA 1RBQA 2BW0A 3R8XA 3W7BA 4S1NA 1ZLXA 3OBIA 4QPDA 1MEOA 1MENA 3Q0IA 4ZZ3A 4R8VA 4YFVA 4EW2A 1ZLYA 2YWRA 1GRCA
chains in the Genus database with same CATH superfamily
1XT6A 4URHA 2V03A 1TIBA 3NYRA 3PHJA 1NUHA 4QXPA 3TE6A 3FFTA 5DX0A 2QY9A 4DUPA 1UBEA 1KBQA 4LCBA 3WLKX 1I3NA 1I7NA 1TD1A 1G8PA 1Q3TA 2JAUA 4ZPJA 3X2SA 4ZTUB 5FKJA 4OU4A 1Q0UA 3FUVA 3KQPA 2HCFA 3ZHSA 1WP9A 1WNTA 2MOKA 2PWAA 5DW0A 2B94A 3VI3B 2GEVA 4KITB 4G0UA 3BG5A 3AVYA 3GEMA 2JASA 4BC1A 2JGKA 4EO4A 2A67A 1JFRA 4DTIA 4QO8A 2GPSA 1C9DB 3LQQA 4JUBA 1J2UA 3EVBA 4E5PA 5C9ZA 4GP7A 3K6KA 1ISMA 2PWBA 3CZCA 5K8UA 1SC4A 4IIUA 4BQOA 4IBOA 1XVUA 5L95A 1FP6A 1I2MA 1C81A 2EC5A 4F91B 3GPCA 4EW2A 2XQGA 2ZJ2A 1CSEE 1S4MA 1YH3A 5ALYA 4B3SB 3R41A 1YQDA 1WQ3A 3DBLA 3P2EA 2JEYA 1AZSC 2PZAA 1IBMB 3F78A 1GFWA 3GFRA 5JV5A 5JH7A 3EYWA 5ILQA 1WSAA 4TMXA 1GAWA 1GDDA 4DA7A 1XRRA 4F4FA 5B2FA 4W5OA 3UBTA 1N77A 4AJIA 4BO8A 3AVVA 4H0FA 3V4PB 3C3PA 5JH7F 1N6OA 4RH0A 4UNPA 4QAQA 1QH1B 3RW9A 3OPXA 3P9NA 2F3QA 4KRFA 3MN1A 1HQDA 2WUFA 3O1IC 4KGZA 4Y3UA 3RK0A 1UZAA 2DQSA 3TW6A 3ROXA 5JNTA 1AT1A 4UQPA 3T7IA 5EIOA 1YMUA 3I9LA 3NDBB 1R00A 2ZXEA 1NRIA 4OMUA 4P35A 1FUKA 1NNI1 1MNAA 2C7VA 2W2OA 2O50A 3HVHA 3LA8A 1GZUA 8AT1A 2OXCA 1COWA 4OJKA 3PVCA 3LXRA 1FX0A 1MG0A 2ZDHA 2IT1A 4IR7A 5CLFA 4KO4S 5LR6A 3QLJA 3BXOA 3ZJUA 2HSZA 3P9CA 2JKVA 4YHBA 2ZAOA 1EIWA 2ACVA 4EJMA 1YS7A 1THZA 5I3ZA 1DWOA 2IGBA 3MCWA 5DV9A 4Z1OA 1A5TA 1I30A 2RHDA 3LY5A 4UBOA 5C3UA 1RPAA 2IIVA 3S2FA 2IOFA 1OFHA 1P4GA 3K92A 4WECA 1M73E 5ELXA 2XRYA 3HMKA 5GY7A 3TL6A 5KBYA 5D84A 1DTWB 1GVHA 4CLOA 3P5SA 4LJ7A 3SC4A 1JFFA 2LTAA 2XWSA 1DIHA 1FC0A 4D98A 1B43A 3M5CA 1XZFA 4M6WB 3RJZA 2IVZA 3L43A 4BP9A 3KM0A 5JTUA 5ALPA 3ZY3A 2P9GA 4OK3A 2QJOA 2BY4A 2O2JA 1Y1KE 2Z9BA 2Z6VA 2JH3A 2XDAA 3DE7X 5DH9A 4OD0A 3VYUB 4KP7A 1LA2A 1QTRA 2P2CA 3KOOA 4GDMA 4CTKA 4IV0A 2OYCA 1CJVC 5T64A 4KR9A 1SU6A 2PD6A 2WILA 2PUBA 5AJHA 3IP7A 1N5KA 3W7AA 5I9IA 1LSSA 2QE7A 1B0UA 3PI6A 4ND8A 5TMEA 1NJSA 2WJ6A 3RKSA 2RGAA 5AICA 5F5XA 3VHRA 2FQQA 1CU1A 1SXIA 4EABA 4OQNA 1FNMA 4MUIA 1Z88A 5A7FA 1A9XB 3G2PA 2WNSA 4QULA 4R40A 1U99A 5KWEA 2WMYA 1F14A 3LT5A 3ZH2A 2O23A 4Y2SA 1NP6A 4LF9B 2WI8A 4DV5B 1R1DA 3TJMA 3UVEA 4XUCA 1RAFA 2PRJA 1DAIA 2ZJBA 2XYRA 4P7FA 4ESHA 5IWCA 4MS3A 3E61A 1U4SA 2ZRFA 3PNPA 1V7CA 2CKMA 4B3BA 3CWZA 2MINB 4S04A 3QU9A 3HI4A 2PZLA 3GIDA 5G1NA 2BVNA 3REFA 4EP1A 5E3IA 1M2VA 4IGEA 3QWAA 5A0VA 1Z6ZA 1M2WA 1RQGA 1U9IC 1Z2DA 4QARA 5AW8A 1KPHA 3MD9A 1LW7A 5A2GA 2GF2A 3U9LA 2I76A 1A5BB 4PGGA 3F3KA 3EZXA 3C8HA 5HUQA 4MCAA 1QONA 3ZE8A 3VDXA 2BHTA 4DILA 5T67A 3MCZA 2A59A 3VM6A 4BQQA 3K4PA 2ABWA 5C18A 3WBFA 1ZMOA 1N6HA 4UPVA 5CAEA 1QANA 3GFTA 4RC9A 4X1YB 4EVRA 1FFAA 2F1IA 3ENWA 3OKPA 4OBXA 1P2VA 1U3VA 2IUUA 5JAHA 5MN5A 1DX4A 1QLWA 2J85A 2QB5A 3BIWA 3DWEX 3MWDB 3LXUX 4FYMA 4G1BA 4O2RA 5CJ2A 4BV3A 4DM7A 5AW1A 4DJJA 1NLYA 1XAIA 4TT3A 4MRNA 4R84A 5KC8A 2RAFA 1MFZA 4QVGA 4EG6A 5AW9A 4RABA 2FDCA 3PDWA 1Z9BA 2OKCA 3SEAA 2I71A 4FZ3A 4C87A 3T7CA 2C5FA 3IVAA 4ITRC 1T4CA 2WWFA 3V1YA 3ZWOA 2BLLA 1RIIA 1F6BA 1GPMA 4GS5A 4AJPA 3QBEA 4KPUB 2YC4C 4Y2VA 4DJFC 3TFOA 1VHJA 5KQLA 1WXWA 3CS3A 3DE2X 5B1HA 1W5TA 3SKVA 1H9AA 2ZRBA 1WZCA 2Y92A 2ECQA 4IIVA 5B1IA 4C7KA 3OD1A 1ABBA 4DUYB 1XLTA 3L4KA 1GAEO 2WJVA 5KNBD 1XA3A 4G1MB 1DMRA 3COJA 2O54A 4JMLA 3BWEA 3MB5A 4N3AA 5FWAA 1XXHE 1Y5MA 3BAZA 3GVCA 2CE2X 2OG2A 5EXSA 3AL0C 1I4LD 3FOAA 3A9UA 1JSRA 5DMHA 1LRJA 5HA5A 1XELA 4KR7A 3CUWA 1R5NA 1SM4A 4XB2A 3W5IA 2JI7A 2ZRLA 1RYEA 4LJ6A 3UK7A 2JA1A 1NF3A 4D5GA 5LD2C 5P8WA 2SBTA 2XOXA 2CMKA 5A1JA 1MABB 2W2KB 4R7TA 3IAEA 4LNAA 4AYTA 4LZAA 2JRLA 2Q50A 5DJ5A 1NC1A 5EJ9A 1VB5A 3O03A 2G17A 1GYQA 1MX9A 3AESB 5AYVA 1ZIXA 3FWNA 2ZUVA 4R2KA 1Z5ZA 2OMEA 2YJ5A 5FI3A 1M34B 4ZO6A 5G0WA 1IZYA 1NY6A 2AZMA 1K9VF 4D81A 3G1UA 1M2VB 3UCXA 1KAHA 1WMSA 1JZQA 4PZLA 1JKIA 4PLTA 3JWEA 3LQYA 2EDAA 1BYUA 3BN3A 2EJUA 1K86A 1T0PA 5A4JA 4MWDA 1DBVO 1Z6GA 2UYYA 1U1FA 4UD2A 3UIEA 3ICVA 2PJDA 4U7PB 1NUSA 4YRDA 2HMSA 1SBHA 3ZKAA 3EEOA 2BMVA 2C5EA 2PX4A 4JASB 5CA0A 3SSNA 1G60A 2UYQA 5EIBC 1WTAA 4OXRA 2YDXA 3PA6A 3T9FA 3WRXA 3I01A 3GLVA 3MJDA 2QJTA 4RM2A 9ATCA 2NTYC 5BQOA 5KYKA 4YWJA 1HMYA 4O0LA 2YN4A 4LMRA 1MX5A 1THTA 2QMEA 5AVJA 3PIRA 4K86A 3MUFA 2JIZD 3C7DB 3GRKA 5AI9A 5K8TA 3QTLA 4E5YA 1UBUS 3NGLA 4ND8B 3LBHA 4FJ1A 5KJ6A 2JAXA 4G63A 3DDNA 4JQCA 4A8TA 2ZUTA 4BEWA 1OMOA 4XJTA 2ZI3A 4Y6OA 5ARCA 3UW3A 3A4IA 3Q0TA 5ESXA 3SQWA 1MNQA 2A1TR 2OV2A 5B5SA 4BKOA 1N5LA 1JIIA 3PU6A 4B43A 4DV0B 1QIHA 3K0SA 5LKAA 3PQ4A 5EMMA 1VMAA 4EKEA 3OZFA 5K3DA 5BN5A 5JJCA 2QTGA 3CKLA 3N74A 1JWLA 1PVOA 1KWKA 1J8YF 4PWZA 3EWNA 3C6XA 3D6UA 3M4JA 4LV6A 1MAHA 1DTWA 1G8KA 3HJCA 3KU1A 3DR3A 5B58T 1JECA 3FTCA 3RCBA 3BMCB 3Q7PA 4EA6A 1GLVA 2Z56A 1LBTA 5DFAA 2BOVA 1U7TA 2QXUA 2RGDA 2BELA 3MT7A 2B2CA 3OX1A 5FTJA 3HY4A 4C7JA 1P0IA 4FQ8A 2I1VB 4NYMR 4QT0A 5BQ5A 1EX1A 1ZEMA 1I7SB 5IJZA 1QHNA 2FPRA 5E1BA 3NBFA 2A9OA 2OCXA 1CETA 1YE3A 4F9TA 1KVUA 1SK8A 2PGIA 4EQ6A 4JEHA 4YCNA 5BW6B 4QUHA 2V9ZA 1UJMA 4TYNA 2DBZA 3DAPA 4OH7A 4XR9A 5EKUA 2QRPA 2AA3A 3VGPA 2WSSA 4NVRA 3LF2A 2RMKA 4ZQEA 3TCNA 1EH5A 2GZHA 3HDYA 1QB7A 3IB6A 3U4QA 2O8BA 4N7BA 2I03A 4WA8A 3I6BA 2CLCX 2FG5A 1E6LA 1Q7RA 2FR0A 4C7BA 3KQNA 2R8XA 4JC8A 1GGKA 3IEKA 1A96A 2QN8A 1Y63A 4NBRA 2CLEB 5KNCA 2XGGA 3QLVC 4L5CA 4FYHA 3RREA 3CEHA 4FBMA 2LE0A 3H5RA 1NP7A 1CJBA 3F6BX 4J7UA 3IKJA 1QO0A 3CX6A 1G21B 5JNRA 1LSOA 2PWPA 4E5NA 2QI9F 2GPTA 2Q9AA 4G4JA 2OYRA 4GXTA 2GNOA 2WSMA 4B31A 1CKEA 3R2JA 4JLSA 4DLNA 4LYYA 4HL6A 1EFKA 5E7JA 4GKBA 1G3UA 3T1TA 1GY8A 2BMFA 3WLAA 1N2CB 6AT1A 5KWIA 4ARCA 2JVIA 1SRRA 1B93A 1TZCA 3PF8A 1TAQA 3PR2B 5BSVA 2EKBA 2GILA 2WWIA 3DD1A 3VYWA 4DQKA 1HFKA 1PNVA 2P5YA 1LC0A 4WZBA 3F5FA 1NF2A 4I1VA 4MKGA 1N0WA 1YS6A 3CTMA 4RTSA 3BQ9A 3SC2A 3D43A 5C7YA 2ZTVA 3SK0A 2VH2A 2GXUA 3RT7A 5DNUA 5IH7A 1Z4MA 4WLFA 1SU8A 1V8DA 4BY9E 4JSTA 5ENDA 2O2EA 3AXTA 2CXUA 3MLEA 1SOMA 3PGLA 1ECFA 4JNCA 1Q84A 5CYOA 3EC7A 2BKLA 2NUTA 2YKGA 1I4WA 3NKLA 4HG2A 4LE1A 4JI4B 5AW5A 1ESCA 1J8QA 2QTFA 3IODA 1VCOA 3NS7A 2FJUA 3OMWA 4AMZA 3KJQA 1V11A 1Z17A 2QNBA 2NYRA 3BHJA 3E5MA 1JE1A 1FTQA 2Z95A 2OD9A 1MCZA 2AR7A 2JFBA 2Y93A 3IIIA 5EYPA 4DJAA 4EI8A 4R9RA 3CZMA 4N47A 4I8DA 4ZOBA 4AF7A 4ZYWA 1NW4A 3HMQA 2N3ZA 3KXDA 3I3SR 4QDKA 3B13B 5K0ZA 4C3ZA 1NBOA 3HRHA 2GCOA 5CIQA 1NOJA 1GZ6A 1UC9A 2J87A 3I92A 5J63A 2Q2VA 5JVDB 1UK7A 2QAGC 3STXA 3I1YA 3T3PB 3TXYA 1FJ2A 3O90A 1I7DA 4G0OA 4UU7A 3V1NA 2QGNA 4J2HA 4AL4A 1T5HX 3EIOA 3DB2A 4PYOA 1OQAA 2ADOA 1FNBA 1MZVA 2Q45A 2NT3A 2XD9A 2ZIXB 3C24A 1IWBB 2Z5FA 2AOXA 4DY4A 2P65A 1B8OA 2NZUG 1HSOA 3BF8A 5KVQA 1JFFB 3CPHA 1EUZA 3S55A 3NH9A 1P0MA 3ZDRA 2VDOB 2VL7A 1V2GA 3OZ7A 2IC5A 4HQ0A 4IGIA 4NPCA 3DTTA 3V34A 2PUFA 1QU3A 1WDWB 3GDHA 1YCHA 3I2KA 4MH0R 2FP4B 2AX4A 4ER0A 4R0MA 5F3DA 5EJ6A 4YK7A 1OXTA 1BQ3A 4TKUA 4KVFA 1G4AE 2OCKA 2ZUCA 1DO0A 3A14A 1PHRA 1CEEA 2A4KA 4IDNA 1V9SA 1UEJA 1LBQA 3M9XA 3MMSA 1ZITA 5CDGA 4DR1B 4BQRA 5U4XA 4XRGA 1RXEA 4XWYA 1O1YA 1AGPA 4N3GA 3ENZA 4XXHA 2ZJFA 1QVRA 3RU2A 1IEQA 2CFRA 1HDOA 5JATA 1RVV1 2DLDA 2GYYA 1Z68A 2P0YA 1G2OA 2XNDD 3HDGA 4IWXA 4R2MA 5L3RA 2AN3A 5FQNA 2D3TA 2QD2A 4G5XA 1HLPA 1JQ5A 4F2WA 5ICEA 2YMLA 3NTQA 2DWQA 4AZSA 4V1CB 5AJZA 4HRXA 1N9GB 3F1LA 5EQDA 4WKCA 1BWQA 2OHIA 1CUZA 3ORFA 4JB2A 4IJVA 2UZ1A 3NVDA 3KFXA 1JI3A 4CEJB 2APJA 4KNVA 4E51A 3JVDA 5E38A 2GBFA 1XHEA 1IPHA 2CNLA 3ISTA 1Z38A 4HAVA 4K81B 2JLZA 5GOZA 1PUIA 2VDWB 4PC7A 2OM6A 3TTTA 3ROFA 5JASA 4NDNE 3UW1A 4ZQGA 1FU8A 4DR3B 1XXHA 5C4GB 4WEOA 4RTQA 2H5LA 1XDGA 3TUIC 1RWQA 2KMLA 3HJHA 1E5LA 4TRMA 4C03A 4Q02A 4DMUB 5LCXA 3W2IA 3RK4A 1N0UA 3U4DA 4ARZB 3HXPA 1YQUA 4Q9HA 1U9ZA 2DWUA 4HQ6A 2ZR7A 1UK6A 2V74B 2NVOA 4WLEA 2Q2OA 5EUQB 1IXYA 3VU9A 4D0RA 1ISIA 3OU7A 2UUCB 3NFYA 4NU0A 4QTZA 2OV4A 3R7WA 5LMNB 5C1IA 4G0WA 1U28C 1VJ5A 2ZLBA 1JX6A 3IXQA 1QG2A 5BPFA 2JEZA 1ZNWA 2XDYA 3KZNA 5T6MA 1OCEA 2G77B 5IK2A 4JV5B 3ZU5A 1L4NA 3CJTA 2QLLA 5ERXA 5AM3A 5AVOA 4WMLA 2HDNB 3AP3A 3QYJA 4MS4B 5E7IA 2ID7A 2WB4A 3IQXA 1NVDA 1ECJA 4O2BA 2REQA 2EBFX 5ESRA 5IM5A 5LQCA 1L8QA 2O7NA 3VJLA 5KI6A 2VSNA 2GMWA 2YJZA 2VPQA 4M53A 1X15A 2CV0A 5FNVA 1AZLA 1C1YA 1Z56C 3LM8A 4FZVA 4C89A 3VX4A 3MILA 1DT3A 3FVRA 5DK6A 3ZWYA 2AFHB 5BN5B 3IELA 1CUWA 2HPAA 4JU8A 2GQ0A 5IEJA 3NWOA 3N2KB 3B1FA 1NNUA 2H59A 1V5FA 2W00A 3LC7O 1JDVA 4TUYF 3ZC3A 4BNIA 5JCPA 4FFSA 4YP0A 3T99A 3D8BA 5FHRA 3HYTA 5CP8A 3I4LA 5JJBA 1NZJA 3NBAA 2R8ZA 2ZYHA 3DA8A 1VRCA 1XLUA 2WKWA 3WIVA 1I94B 1H1LA 1QK3A 2COUA 1H5UA 2FZGA 2J0SA 3CO0S 4IQ8A 4QBTA 1HLDA 5BMVF 2Q3MA 3ZY2A 4AN4A 5CG2A 2LPMA 3LUAA 5HG0A 1I33A 4TMFA 4HF7A 4MP8A 4J9UE 3CNBA 1ZOSA 4YJFB 4KG7A 2E4WA 2ZI9A 3OQMA 4FSHA 3AFMA 2IHUA 3PQ7A 2OBXA 3ILSA 1FTYA 3FSJX 4OCZA 3ZWPA 5JQGA 1CTQA 2VQ6A 2DGDA 1BKSB 2GB4A 2PSHA 2B37A 3AFHA 4KOAA 2YMQA 4CTOA 5BNFA 4RFVA 3WZMA 3OU6A 3RAPR 3UK6A 3FD8A 4OB8A 4RAOA 1TADA 3SMQA 4AKEA 2Q6VA 1TAGA 1M75A 3GVHA 3H05A 4BB6A 2YVUA 3VKHA 1GTZA 1J1UA 2EWVA 4HNHA 4M60A 2FWRA 5LZ8A 1P6QA 4MV9A 3M9WA 5K01A 3WV4A 1J24A 2COKA 3C98A 4RL6A 1VG8A 1CF2O 2DOKA 3VR2A 4DR6B 4H1UA 1F2TB 3B36A 3ELUA 4Q05A 1W36D 2IYQA 2WZDA 3KSAC 1GIAA 2CJYA 1G20A 1SHUX 1TRKA 3DULA 5DM1A 4Z2YA 1S3IA 3FYCA 4XUEA 3E7XA 1W47A 1WPRA 4IVPA 5DYTA 1MT0A 5E2BA 2CNWA 4GXNA 5FOSA 2O0HA 4NABA 3N3BC 1WKBA 4OMFG 4YMTA 4M1SA 4EYEA 5BSMA 2VXYA 4M1ZA 4L2IA 2CSUA 1BXGA 1IHOA 4QU0A 2IP2A 3DMFA 3GLIB 2TS1A 4G1FA 5D7NA 2X8JA 4HBGA 5AKKA 3UT5B 3GJ5A 1KPIA 1NC3A 5EY5B 2JI8A 5FPSA 2IBSA 1B41A 3U31A 2D8AA 2QPTA 5CGQB 1OTYA 1Q16A 3I39X 5H5JA 2X0FA 4F4UA 1PYGA 3H4TA 3IMGA 2AX3A 5IKOA 3REGA 4CMIA 5C8YB 1Q0SA 1RE1A 4Q1EA 4U7GA 4GQBA 3EVEA 1QGYA 2FSVC 4A5SA 1V6CA 1PNRA 1UBLS 2I3BA 1FB5A 1C30B 3Q1LA 1NVMB 2PX6A 4ZGWA 3GLRA 1EUDB 1GWNA 3LCUA 4FKMA 4ETNA 2JLQA 1INLA 4UVGA 2FOXA 2WTUA 1K8ZB 1LPPA 2QDXA 3DDCA 3EZFA 3EWSA 4FC7A 1I1HA 4XYGA 4YMIA 3U4HA 2BGWA 5C1BA 1ZK3A 3PKIA 3GDGA 4UCXA 4CIBA 3AQIA 4HQRA 4Q7QA 1KDPA 2C1XA 3EMBA 3V4SA 4IEFB 5BSGA 2CLHB 3L8EA 4YXFA 4JI0B 3CBGA 3ST7A 4G1EB 4IJUA 1JA1A 1E1YA 1JLLA 1MJNA 3CB2A 3GF4A 5HJ7A 5DW3A 4AWAA 1JQKA 4EG4A 2QXYA 4LY3A 2QYTA 2G40A 1GPAA 2I55A 3TBFA 4EYOA 2EF1A 3QHPA 5CLLA 3WLFA 3HUDA 2GJ4A 1GGVA 4RDXA 2BFOA 2Y0EA 2V8BA 4RXMA 1FUUA 4E4TA 1UM9A 1G0OA 3OH8A 4YQZA 3RHSA 2FW7A 3NQ41 1L7EA 2DQ4A 5FEMA 5DM60 1J1IA 2GEJA 3ZNNA 4KTTE 4HH4A 4AKGA 2I6XA 2J5XA 4ZIRB 4B45A 1YVRA 2VDQB 2ISCA 3E22A 3F6RA 3SYKA 5HW0A 4B2YA 5LZ4A 1RMYA 1JBEA 4D42A 2DKFA 3CG4A 3EGXB 3ACDA 3VPHA 2CHEA 1XO1A 2V55B 3HI6A 4P36A 4RXUA 1DGQA 5E1MA 1H0RA 4B8YA 5JMPA 4US2R 2FX2A 4IIFA 3AKCA 3O26A 4ALIA 2Q46A 1ECCA 1YQWA 2PKQP 2AQKA 1O97C 3I76A 3TM4A 1NW5A 1CY4A 2HYIC 5HKKA 5LJIA 1ESZA 5KWJA 2H8KA 4PLZA 1SXQA 1A9QA 3IAFA 5TJ9A 1OUMA 4D4GA 4ZXPA 4DBLE 5ITZB 3MRTA 1VPWA 3BILA 1ISGA 1Z7GA 4FOOA 5EWMA 1G8FA 3KLNA 2O3SA 2V45A 2IEZA 3M83A 4IZHA 5J2TA 2XT0A 1NQUA 2VSOA 2WMOB 1NLUA 1XNHA 4EFMA 1FLDA 2JJ2D 5J47A 2A58A 3UMYA 3RV3A 5G40A 1JHQA 3H9JA 4NOJA 1OYVA 4CUJA 2XKJE 3W6PA 2ID4A 4FLEA 2B6HA 2AFRA 2H4WA 2HA2A 1YZGA 2WWHA 2OZEA 3QSGA 4P32A 3WBKA 4ROTA 4NMWA 4BXOB 2AFHE 4LV8B 1TYDE 4YR9A 5F7OA 4YCBA 1L5QA 4R5HA 2J3MA 1GNSA 1KARA 1NZDA 3ASZA 3G23A 4LYFA 5CVUA 5ECGC 5JCOA 3JCZA 1S01A 4MS3B 1ZIYA 2I65A 3ABQB 4ZI7F 3ODGA 1LI4A 2XBUA 4MYRA 4N7MA 4BNZA 3I62A 1M0TA 4P4TA 3WL5A 4C14A 2LWIA 4MV5A 2NW6A 2DFLA 4IUYA 4CIWA 1AXEA 2G9RA 1F4PA 4FJ2A 1N2HA 1QHXA 3GEHA 3BRWD 1PR9A 1DSSG 2GDJA 1JFVA 2YOHA 3FYUB 1E2IA 3KD3A 2CW5A 2R11A 3JPYA 2WEKA 4GOXA 5TB5A 1AG9A 1GSIA 2ADMA 2YX1A 2JRCA 4JSYA 4JITA 5SZKB 4P81A 4I66A 5T3YA 5U4QA 1AKMA 1RP7A 3V7NA 1O57A 1E98A 1WJGA 3EOZA 1O94C 4JUIA 2BF4A 1E6WA 2XODA 4HPJB 2H1WA 5COQA 4E94A 3SJ7A 1P0CA 1DARA 2WJAA 2X76A 3LKBA 5AW7A 4GI2A 4HN4B 4FP9A 3HDJA 4X1KA 3EJWA 2XR1A 4B6PA 3P9XA 5JH7B 4UHHA 3HNPA 3HC7A 3I28A 2Q7XA 3L6OO 4QO7A 4RVSA 4PX3A 1CZUA 3W2HA 3HBNA 3WMWA 4II2A 2HT1A 4G5SA 1IM5A 1H65A 4J6EA 4ND1A 4XPZA 3SP1A 3WHKA 5DM2A 5EOVA 3PR1A 1CG6A 5FI5A 4W1RA 4AK9A 2ZEJA 1C3EA 2FI1A 2NG1A 1TEHA 3P27A 3OOWA 3QKIA 4PZYA 5E7QA 4KQHA 4BS9A 3QXHA 1C9MA 4JENA 3O9VA 3N0TA 3A4LA 1PUXA 2WHEA 2ZDQA 2WPDA 5H02A 3MCAA 1GGFA 1O9GA 1X1CA 4EELA 1MP0A 4AULA 2VT3A 1TO6A 1UUFA 1J90A 2EWMA 2Q0HA 3IP5A 4IF4A 1TVKA 2NNWB 2YC2C 3AUSA 4MYTA 4NV1A 1KZ4A 3GIWA 1D4ZA 1YB2A 4HO1X 1CRWG 1WB6A 4H27A 3DG9A 1J5PA 1SUDA 2QAGA 5JCJA 3IJRA 3ZEAA 4JK3A 3SM9A 5AW6A 4NNPA 2HQ1A 3AR7A 3C3EA 2WUEA 5DASA 3TDKA 1NMSA 5IZ4A 2BISA 4PAOA 2IDMA 2BCJQ 4DV2B 1WXXA 2VHYA 1L1QA 3FB4A 3DBHB 1CUAA 1YZLA 1YS2X 3VNAA 4NFYA 5HRAA 2E6KA 5REQB 2HMYB 4TOIA 5C3MA 4WGGA 2ODPA 4I08A 3RBXA 4UMEA 3ODPA 2JJMA 3DOIA 4RHYA 2ATVA 4JJ8A 2G8LA 3D6VA 4G65A 4JYZA 2COEA 1MIOB 3OWHA 3T3IA 1XR3A 4I5EA 2QQEA 1IBRA 2Q0SA 4L3OA 3LSTA 4D92A 4CF6A 1YV9A 1ZJ5A 3R20A 5DYWA 1ETHA 5D01A 3S29A 4B4UA 5B3LA 1OFVA 1EFVB 1P9OA 3SC2B 1W5BA 3OZUA 1KJ9A 2WAOA 1H3FA 2XH8A 4PSVA 5EFZA 3R24A 4HX2A 1SCNE 2IPMA 3WHPA 4FBGA 4UBMA 5DMXA 1HDYA 3OTWA 1VSTA 2F64A 1IQUA 4HOYA 2XXAB 4O02B 4XSVA 1YBMA 5LZ2A 1DXHA 3ZGVA 4OLBA 2JKYA 5AESA 1WVMA 3B1ZA 3EXAA 3OESA 3R3ZA 4XW2A 5AI4A 1Z4NA 1SO8A 1WKCA 3T41A 2RHMA 2NVWA 3ZVNA 2XMCA 4F93B 2NYVA 2Z2JA 4QUBA 5E6UB 1A7JA 4L73A 4PBSA 1KZ1A 3PHBE 1YA6A 1R6UA 1Z35A 2BZSA 2X9QA 1I1NA 2F8MA 4UJ5A 1PR3A 5B57C 3WIBA 4JKOA 1QFXA 2DHEA 1EGHA 2QTWB 3IBSA 1U7WA 2NAPA 2QN3A 2NN3C 2GKSA 3BXGA 3E6AA 4GOLD 5G41A 5CXUA 3OZTA 3PJEA 1PGPA 5IKMA 2I2WA 3EGDB 1UFOA 2N46A 3VYSB 1QGZA 1ZBDA 2J4CA 4X5OA 1TX4B 2YZKA 4U7DA 1JR3E 1KH1A 1VFNA 4HLDA 1YZFA 1CFJA 3CVJA 3H8WA 4NAHA 4FNMA 4GEGA 5JNUA 2Q5FA 2O19A 2OV1A 2CCGA 3ZWKA 1ZMTA 4DB4A 2WKSA 4LMAA 1DQRA 2WJZB 4Q21A 4L15A 4PQRA 4A0HA 3GLFB 4G4IA 4NL4H 2I9KA 1XOIA 5IT4A 2Q0QA 2HHLA 3LBYA 2RBGA 1UC8A 1TJNA 3QBVA 2NSLA 4C0JA 1QVVA 4ENSA 5L4LA 2YHIB 3HVIA 3LUFA 2HJSA 3ORQA 4MDEA 2QEQA 3OJEA 2W5UA 1LI7A 2MSNA 4BDTA 4OGKA 5T4BA 1RC0A 1NVVR 2CDRA 4JU9A 5J5VA 4F21A 1YRAA 2F00A 1PQWA 3IMFA 1EE1A 4G8BA 4P54A 4YA6A 2BP7A 3RSCA 5JD5A 1R4MA 3H3JA 1SA0B 1U6JA 4Z5XA 1IAQA 1I9CA 3C74A 1K97A 3GLHA 1QOZA 2HNAA 3QUAA 4AIRA 1ZUNA 4PLHA 4I99A 3P4UA 4G9EA 4CVNA 3HJFA 3NHJA 4DR2B 1EP3B 2IEIA 5H70A 2HLDA 2HJ9A 4JIMA 3JALA 3PQ8A 1NW9B 3ISVA 2O14A 2FSSA 4DRXB 1J7JA 1N0IA 2JD2A 3KB1A 5CFRA 4K9NA 3HU5A 4BATA 5AVZA 1HV8A 4RX1A 5IBPA 3M9LA 3HDHA 2OV3A 3FM9A 3RVRA 2ZKLA 1VCIA 1O95C 4ZU3A 1KAOA 1X1EA 3A6HA 3P52A 4IVRA 3QH4A 4PAGA 5K3CA 4D4HA 3RAEC 1CXZA 2XWBF 3FBTA 3KSMA 4KJXA 5E9JA 1N8SA 4KMRA 3U62A 2ORYA 4KN9S 4YPFA 1BJKA 2IZOA 4AROA 4B84A 3LUKA 3EZNA 2WD7A 2JB9A 4RA9B 3ZJ4A 1JQBA 1JJ7A 3FLMA 4EJ2A 3CRZA 5F12A 4Z4FA 3H5IA 4QODA 3H83A 2PMCA 3II6X 3JD2A 4YO7A 2IS1A 2Q3HA 4HWSA 3T34A 4ESEA 1XAGA 2GPNA 3PB3A 4UHCA 1UXGA 3N75A 4FI3F 5GJWC 1IZ0A 5F1YA 3KT3A 1E7RA 4M9CA 1E62A 2OBNA 4FGLA 4R2LA 2P11A 3PP8A 4N3CA 1NBME 2AMFA 3KJIA 2QXTA 2XUHA 4BTLA 3A2MA 4R3WA 1LSUA 1V45E 4ILKA 4MPJA 4DZTA 1AKRA 1MB3A 4CT0A 5DBGA 3N5KA 4IO1A 5C7LO 2Y1FA 4HI0E 3WL4A 3KVOA 4IH4A 1DKQA 1OVGA 1VJ1A 4FFVA 3WIEA 5G4KB 5L3ZA 3KLOA 1KK3A 2X58A 3U9TA 4TZTA 1YK0A 2PT5A 1H3EA 3SBEA 4JZYA 1XE3A 3I0MA 3OEEA 5ALDA 3BSFA 2ZRPA 2NYAA 3LT4A 4E21A 1A8SA 5CB4B 2I1WA 3F5QA 2O3TA 1YS1X 2GCGA 4QG3A 1J6UA 2Q8NA 2VNJA 3ADKA 1Z06A 3B53X 4HAUA 3ZPXA 3A8TA 5EIEA 4XFKA 3Q15C 3HA2A 1YIOA 3FDXA 4FE3A 2H7VA 4S35A 4WFIA 4ZC8A 4HTAA 3ZCQA 1Q83A 5LYJF 1VDMA 1GPYA 2F8SA 1X80B 3SBXA 2V9CA 2EW1A 1KHTA 2JFFA 2P3QA 3QMMA 4HX5A 3UV3A 3WGUA 2N1BA 3KP1A 1T34A 1IY8A 1ODFA 1WUHS 1CUEA 3I9OA 4JC0A 4QOGA 3AVXA 1P0PA 1J2TA 3CU5A 3RVQA 7REQB 1UDAA 5IKPA 4QOFA 1HC7A 2BFBB 2E37A 4R54A 4TSFA 4XVRA 4Z7OB 2XA9A 1PK9A 1SBQA 4PC3A 2Z57A 3NOXA 3WLPA 3ONVA 3ETNA 5H7XA 2PKWA 2ZUUA 1GUZA 2OK8A 1KRHA 1U1IA 4O4IB 4CZ2A 5DO9A 1YZTA 4EATA 4GLOA 4TTSA 3S8EA 3S5UA 2Y66A 2IIQA 3AEUB 4GSKA 3WAKA 1RWVA 1USUA 3EQ2A 3FRJA 2PUVA 1SVSA 4OBWA 1N4DA 3DUWA 5G1OA 3RH0A 3N87A 1BE6A 2X3YA 4CN9A 1TECE 1Y1QA 1FTWA 1XD8A 3N7TA 4LQDA 3G2MA 4P86A 5B4UA 2Y0BA 4MVJP 1LVGA 4P5EA 1QF7A 2G0NA 4L5YA 5C31A 4B34A 3ZVKA 3RC2A 3MWEB 1TM5E 4RXTA 4CFYA 1AA6A 1PL6A 5A7HA 2XXAA 4P8RA 4G09A 4KQ1A 4CTNA 1X8XA 2C2BA 3I61A 2WG1A 2X0RA 4H7PA 4NMLA 1EUCB 2ZYSA 3DCJA 1XD2B 2DFDA 2IUTA 3B38A 1VCNA 2FHSA 1N75A 3IVMA 3ZYZA 2DFTA 1IUPA 1HRKA 4R1SA 1EP9A 5IJ9B 2YIJA 1F8FA 3KE8A 3L07A 1FSGA 5FPPA 1NM5A 2GN0A 1CQJA 5AHRA 1IVSA 4Q7MB 3QWFA 4BOYA 5JRDS 3UM9A 3Q3EA 1E20A 5JE8A 1SHZA 3L0SA 3KKEA 3QW2A 5ALRA 5AW0A 1V0JA 3IBFA 4KQEA 4YQEA 3FYDA 3TG8A 1E9DA 1QHHB 2B3DA 1CNEA 4B3JA 3LWZA 4MI1A 1P0FA 4IO0A 5EKSA 2C2MA 3ENVA 2PX5A 1GPKA 2PU5A 2PVCA 2XDWA 3PNBA 4BO0A 2HY7A 3TTUA 3TB6A 1K2VN 3SCZA 2PHZA 4BNUA 4XVHA 1M6HA 2IV7A 3O6VA 3L7OA 1Z4IA 4IH1A 4RIGA 3KYCB 5CNIA 2FSUA 3PFGA 2NZJA 2Y9MB 4GM0A 4ZVVA 3I45A 4M1OA 4CL3A 1YR7A 1JHDA 4ND5A 1R8YA 1J7KA 4P98A 1NBAA 3FWHA 1UMCA 4QGFA 1UJCA 2AXNA 3WQRA 1BD3A 1WSDA 2JBAA 2VP2A 1JR6A 1XZCA 1RIFA 4E31A 3ZGNA 4KO3S 2F43B 1FQWA 1LGYA 1RYBA 1QM5A 1XZJA 2FG6C 2ZIEA 4IIJB 3QXJA 4YEDA 4I3HA 4K5QA 2O2DA 4RY9A 2C8KA 4BV9A 5J3JA 2IEYA 4KE9A 4ZEOA 1NRJB 4RH1A 3GLGA 1W59A 1Y1TA 2RGNA 3LU1A 3Q85A 4OXKA 2ZIXA 4R8MA 3ESYA 3OT4A 1G1AA 1PU2A 1AXGA 1OAKA 2CN1A 1W46A 2PDAA 4B7UA 4TVOA 4BFXA 4RFLA 1AUXA 2B1IA 4HVAA 2D1RA 4TN5A 2PUEA 1A50B 1W76A 2HL6A 2Y1XA 3P9KA 4DREA 5KJFA 5JWHA 3EF3A 3B1KA 3AEXA 4QGGA 5FNVF 5EKXA 4TVSA 1HKUA 3ZK8A 4CQLA 2OWEA 1UKZA 1LDBA 3LT1A 1J9GA 1UBOS 2AJTA 3H9GA 5IJXA 4B2IA 4DWOA 5C35A 1GM5A 2JNWA 3OQNA 1R0LA 4X54A 1W29A 3AI7A 4WXPA 2LRHA 1QFMA 2E4YA 3OIVA 4EGCB 4PYIA 5K6TA 1KI9A 5AQ1A 3PR3A 3C85A 1SG6A 4HR7A 3W6OA 2V58A 1TA0A 3ET4A 5EHIA 1X7WB 2W6CX 2NO0A 1MENA 3OOHA 4JGIA 2AN1A 4NMMA 4IG4A 4N6GA 1Q77A 1Q6YA 2BM9A 2NUTB 1RC8A 2FSPA 1HE8B 4MZXA 3UG7A 1NT2A 1VFPA 1Q50A 1T8RA 1UOOA 5KYVA 1XCBA 4V03A 2UVPB 3A6ZA 2JHCA 4H16A 5ALNA 4OQFA 3LDFA 4RUKA 5IM4A 4RA6B 1PT6A 3QK7A 3TTSA 3ONFA 3TW4A 1U0TA 2JGIA 4LG1A 1Z62A 1DAHA 1ZD1A 1JLLB 1LBSA 2JJYA 2PIAA 3DO8A 3OECA 4MJ3A 4AP9A 4UW9A 4F3NA 3VR3D 4PIMA 1XAJA 4IHKA 2EZ4A 5DHSA 2AOTB 2WA1A 4A92A 4F6CA 4ZO4A 2QLFA 1RXUA 4R01A 4PG8A 3G7NA 1S9DA 1HNWB 3ONDA 4BO4A 5DHFA 2YRWA 4DMRA 4NCBA 4F2PA 1OKKD 2XRMA 2DERA 4BMPB 3P0JA 2UXCB 5FIUA 3AO0B 1IZ7A 3TH5A 4MHTA 4YCLA 5FTNA 4ZMRA 4L08A 1W0CA 1VJGA 1D4OA 3HLTA 3S2IA 1KYIA 4U2BA 3SQLA 3IV9A 4MVYA 1YR2A 3M1YA 4P3OA 3SR4A 1Y81A 2PMKA 1SKYB 3RBAA 4QDZA 4W1SA 4MKZA 1IG0A 1ZK2A 1Z7EA 5C4MA 5EL0A 2QDKA 1RQLA 1UBMS 3F49S 5KNCD 1KFBB 1OAAA 4IXWA 2ZVPX 2BFBA 2HU5A 3WMFA 3VZDA 1AK9A 5HBGA 1VOTA 3IUMA 2DCMA 1FW6A 3PYMA 4E88A 3T35A 3TEJA 3ANYB 4PSKA 1EB9A 3JXEA 4P80A 1E9EA 5E4YA 2VWGA 2AVNA 1UAGA 3ZGLA 4Y1RA 1OX4B 4ARUA 3T5DA 3ND7A 1Q0RA 3CLTD 2A5DA 2G82A 4LE0A 3LGAA 1F2UA 3PFBA 4YV2A 2C00A 2W2NA 3O75A 5JDCA 4CDNA 2OVFA 4V0OA 1U80A 2PXXA 4B6SA 1HYEA 4HMPA 4E5MA 4CCSA 1ZU5A 1J56A 2VUUA 1NYTA 2JGRA 1XJWA 3ZHQA 2KI5A 4RD0A 4RPIA 4NWIA 4HGZA 2ODQA 2VUIB 3UMSA 5BV8A 5IULC 1AQNA 4QYIB 3KJFA 4GP6A 3NP7A 4GMGA 4MJ7A 4NFHA 4PQFA 4RPKA 2EFHB 5CX1B 4Y2QA 5EXXA 3P94A 3UGQA 4F3TA 1XFDA 1M76A 1RJ9B 1S2OA 2OHOA 3QVSA 2SKDA 4NQRA 4UHFA 2QE6A 4WERA 3B8EA 1FMFA 1UBJS 1GNPA 1S2DA 1U1EA 5HNKA 3AY3A 4D99A 1HE1C 5CK5A 4DA8A 2DPMA 3OE7A 1PAUA 3DDHA 3TLGB 2XLCA 1KEKA 4O1MA 4LF8B 1UMCB 3A1TA 4M0MA 3VOSA 1TVCA 1PEDA 1QP7A 1GUBA 4R41A 1GILA 3HCPA 3PJGA 4UBLA 2ZYUX 1G16A 2WT8A 3GGGA 1KYXA 4BN5A 3W3AD 1A27A 5EKDA 3WLHA 3OEHD 4B3TB 4Z54A 5I9TA 1HT0A 5T4FA 1IPEA 4W82A 1OXMA 3W2EA 5G4LA 2JIZA 1ZO8A 5THXA 2HMTA 4EKGA 2VZ9A 2PRSA 3CUVA 2G36A 1KNQA 1Y7IA 5A9TA 2FUNB 4PO3X 3RVLA 5IJWA 1XJQA 4RNDB 2YFQA 3H7AA 5I7EA 4ZRMA 1IQRA 2CZGA 3VHLB 3CINA 3L6CA 4PPNA 5ENZA 2F6RA 2YY6A 1IDOA 1NXSA 2LV8A 3OX3A 4WNIA 3RUCA 1NVFA 3GGSA 4S3MA 3B1YA 1D9ZA 3LQ1A 2QR3A 3GVIA 3GU3A 1Y8QB 1PK8A 1PJZA 1Y48E 1AF4A 4P3KA 2F4NA 2JGNA 4HWTA 1L2TA 4M38A 4TS1A 5F7JA 5KYXB 2J33A 2GA9A 3NATA 1IH8A 4GBMA 1HT2E 3UENA 1VKHA 3OTQA 2DTDA 1YKSA 3CGWA 1ULUA 4J3FA 5TPWB 3ZHXA 2DT8A 4JA0A 3G8DA 4O25A 4ECEA 4RMGA 2J9ZB 2ZWOA 4C5CA 1NGSA 2W2KA 1ODJA 1RTKA 2ZSIA 1JNXX 4KDCA 2O8EB 1FTGA 4XLLA 1V16B 3W7VA 3I73A 4PLCA 2QRVB 1CUFA 2QTRA 3WA6A 3TWOA 1Z6AA 2F2TA 2DY1A 5CG1A 3EZ7A 3MWYW 1Z36A 2XXBA 4YROA 4D3SA 2WG2A 4HS9A 4V38A 4DCMA 2BZGA 3DDUA 2VSFA 3GNTA 4DYVA 4L4ZA 3L0YA 3FLAA 4TTVA 4XWOA 2ATEA 4JEIA 4BLUA 2B4AA 1DEHA 2YJ6A 3VHXA 2W71A 1I3OA 4DRYA 3OURA 3EGDA 3MZ0A 3EFBA 1RRGA 4IEIA 3KB2A 2LKDA 4KDRA 2XYVA 1YRYE 2QMYA 2JK0A 4W7HA 5AXCA 3VU9B 3U6BA 4Q7EA 4D0NA 2CUTA 4BQIA 2FEWB 2CJFA 2VTKA 4CU2A 3PC2A 2ZBPA 1WG8A 4KUEA 4JROA 4MI3A 1UJBA 4M1WA 2GKGA 3IUEA 5HOEA 1G0NA 3T9DA 4UBKA 1XPUA 1FPQA 2N9UA 3IEUA 2CBZA 2VBIA 3VR5H 2D6FA 2IHKA 1TGYA 1RLIA 4DE5A 1PVDA 3PUHA 1WHTA 4U5XA 2DH5A 1ZR4A 2QENA 2HXSA 2NAFA 2GEBA 3QFSA 4DCGA 4NQZA 4WKGA 1WMBA 2AUNA 4ISCA 4LE2A 2XQVA 3O8LA 3OZWA 5CAEB 4NCJA 4EZBA 5L4NA 3RAFC 4RCZA 1C4KA 4HYYA 1I4DD 2KPOA 3KDPA 4JVMA 4Q16A 5F4ZA 3NBXX 3TIFA 4CF4A 5TXGA 1YONA 5BWMA 1SHTX 5JG7A 2B1RA 1DDOA 2XY4A 3ZV4A 1Y3BE 3EXIB 3RTBA 2RGWA 4B80A 3SN6A 1Z5UA 3GRYA 4HB3A 1F8YA 1N9GA 3H1FA 3I5MA 3OQJA 1T13A 1ECGA 4HVLA 4L3VA 5DIFA 4WXRA 5IAEA 5GAJA 2XWQA 2C9DA 2EZ8A 1MT3A 2JFYA 3CN7A 4H6XA 4CYMA 5HKBA 4O4HA 1OH5A 3CURA 4L76A 3E8XA 4NBLA 5IK2D 2DULA 4XDYA 3AXSA 2HSDA 4HNUA 1OLUA 4XH9B 3I8SA 1OU0A 3Q88A 5JWRA 5ETJA 1NQTA 2VK4A 3NVAA 1AVTA 1S2NA 1WCWA 3PXDA 3DLBA 3PUWA 3PUYA 1CS0A 2YOGA 4YJGA 4CM3A 1O54A 5E4TA 5F2OA 2QBYB 4LJRA 4I6GA 4GZ5A 2GM5A 3DV2A 4H0NA 4ANFA 3DZDA 3SS7X 2Q07A 1U3GA 1XCPA 3OO0A 1Y4SA 4ZAFA 4EAAA 4ARAA 1PP4A 4AKHA 2C7GA 1TCBA 1II8B 2DPHA 3I1JA 1G41A 4GPEA 1LLFA 1TVKB 3MBOA 3QF4A 1JXQA 1JG2A 3G9ZA 3QVGA 5ENVA 4FYYA 3STVA 2JHGA 4UTNA 5CBKA 4LXGA 2W2LA 1YAJA 4KRXA 5K6AC 2CLLB 2QYSA 4JT2A 2FPMA 3HM9A 1E3JA 3LCJA 5I7OA 1AKVA 2Q5IA 3C2QA 1S3GA 2J6CA 3QIAA 5J1SB 2IZ0A 1OASA 5IJ0A 3O8QB 2QGFA 3NHAA 3CRRA 1PG0A 4KPFC 3IUBA 1QORA 1GV1A 1WUIS 2J1LA 2R4QA 4BU0A 1TU4A 2CUZA 2PGOA 4JJEA 2PS0A 4OIMA 1U3DA 1LPSA 1SOAA 2KYRA 3FOWA 4MW2A 5C51B 4FYKA 3N86A 3W4IA 1JLRA 1AMOA 4IJMA 1BS1A 1WXGA 2NLOA 5SICE 3RKUA 2I4TA 5F21A 4NAVA 2I99A 3NYIA 1FRFS 3BRWA 5C34B 1EDDA 4JI5B 1NPTO 1NBMD 2ZB4A 1JW9B 4DMGA 4DMMA 4E14A 5JQWA 3WLIA 4RVOA 5HYVA 1V4NA 5KWVA 4QUEA 4RDIA 1IATA 1ND5A 2O8NA 2C77A 1X87A 3T4PA 5KPDA 4FFWA 3HKCB 1IUKA 4KXXA 1MH1A 2YCBA 4GZLA 1RP1A 3NWEA 2O7RA 2UZAA 2X4DA 3SJCA 5CVCA 4BNDA 3FTEA 1COWD 2V3CC 3R9WA 2ZR0A 3FLBA 1EJBA 4W5TA 4PYLA 3T5BA 2B69A 2PPLA 3Q5GA 4RQBA 4BVGA 1HDXA 1GCAA 2BLNA 2FP4A 4YMWA 3SQDA 3TLGA 1E6UA 5FL7A 1F51E 4U02A 4OI0A 4ZAXA 1O96A 3WK8A 3B52X 3M1LA 4WZBB 1G42A 1XF1A 5COAA 1ZN9A 3G8BA 2AK3A 1FFGA 2JCYA 4AW9A 3EH2A 4IUDS 1QCCA 3W0LB 2GPAA 1ZGGA 5BN1A 2GZSA 1FU4A 2XUPA 1OYWA 1NVKA 1ZJZA 3N8HA 4G86A 4PG6A 4QYIA 2ET6A 4TXHA 3SX0A 3NNSA 3NAQA 1RI2A 2Y2VA 3CXUA 4PNPA 5KSYA 1KK1A 2HA4A 4TV8F 5HM8A 2EQ5A 1UQUA 2BCEA 4PAQA 1WZIA 3IP6A 3O7WA 2CFOA 1L6RA 1LFDB 4V3BA 1QQ5A 3ET5A 2IYTA 1P5HA 4KQ9A 5JWOA 4WFKA 3WOVA 3HA3A 1O6CA 1LJ8A 3QELB 2IYRA 2W9XA 1KP9A 1QGOA 3R3UA 3LYAA 2C2GA 1ZUD1 2R7AA 1UPTA 2ZSEA 3DE5X 5I9BA 5LBIA 3HACA 3NRBA 2PR2A 2WF5A 4GGOA 4R8KA 4UASA 5K3AA 5TR9A 3HO1A 3OZXA 1QGUA 1G8MA 2CJPA 3ZHCA 3PT9A 1JI0A 3S6JA 1E94E 5AOCA 4PF1A 2P2DA 4YT8A 4BCBA 2K4MA 1L5ZA 4BO7A 1V35A 4N5HX 1X8JA 5SY4A 5TT0A 2NZYA 2VJAA 5JSHA 1MVNA 4RIEA 3ZZNA 2WQZA 1FY2A 1LQUA 2HU7A 5IC6A 1H4VB 4YFYA 4N1AA 4RIHA 5CFMA 1NDQA 1TO2E 2JHAA 5JDIA 4L9WA 4MR8B 3PXCX 3I9MA 5DWQA 2RHRA 1L7OA 2K5UA 4UEKA 5CCDA 4L8LA 5KX5B 4URWR 1LDEA 4NCIA 4JNKA 1GYPA 2Y1KA 1U63A 3OLVA 5BOSA 3WLTA 3QFHA 1T1GA 1Z16A 2CNDA 2CUNA 4WXHA 3CHYA 3TCXB 3RT1A 1EEXB 3QKUA 2JLCA 4ZRNA 3FVQA 2QMUA 2Z6UA 1NIPA 1KIFA 3R0JA 3DJYA 4HB4A 2PS3A 2R7LA 5FA8A 4Q3KA 5HTKA 5FCDA 2IS2A 1JGTA 1UEXC 3C3JA 2ZYRA 5DSXA 1CNMA 1A0OA 4PONA 1UL1X 5EEGA 5K3FA 5A4IS 2VRBA 1MEEA 2NO4A 1LF0A 1IK6A 2UXBB 4DCUA 1E3LA 3N70A 1DUSA 4XOIA 1ZGJA 2X9LA 1C2YA 1EAYA 1SXJA 2XUDA 3P0RA 4FFOA 3FNQA 3RFCA 2QZPA 1MX3A 3ZNOA 1DWUA 2EKZA 3JYOA 4HXFB 3PCRB 2C5SA 1JEQB 2ZULA 4P1ZA 2EZ9A 3CCCA 3KUCA 5KKCA 5HTOA 1B4DA 3V8RA 1E1RA 2RGGA 2CSXA 1TZMA 4OM7A 3EAQA 3GDFA 5ELMA 4UUOA 3O8CA 1KVQA 5D1NA 4ZICA 5AUOB 4ETIA 4QXQA 3L4JA 4M8LA 3EWIA 4TLAA 1QG6A 4MEJA 5IKEA 1VA5A 1XZMA 2VUHB 3T4UA 3MMZA 4TV9A 4IAOA 5TLSA 2FEPA 1A7UA 5K3EA 3JQGA 4ZVOA 4J0FA 3ENNA 1T36A 4K05A 3PDIA 4H77A 1VIMA 4NYJR 3FFBA 3CUEF 2C78A 3DOFA 4M7RA 1ZPDA 2F67A 5DGHA 1KZ9A 3M8KA 3QA9A 4N6OA 3EFOA 1GV0A 1SCIA 3R6TA 1TAHA 4F1WA 2H1RA 3IX7A 2IHBA 3FJ1A 2W6PA 4HNGA 4RESA 1QFSA 1X14A 2H7XA 3V9PA 1GCUA 4RVNA 4KW7A 1BOOA 2AEMA 3B2EA 1Q95A 1U8TA 2BEWB 3K53A 5ITSA 3PUJA 3CLRC 1TJ3A 2ZJZA 3DWGA 1HGXA 1ID1A 2PG3A 4X6YA 1SIBE 7AT1A 1HA3A 2OAQ1 4GRIA 4H6VA 1JLSA 1VKRA 1K5GA 3AL2A 3LT0A 2ZR9A 2IBMA 4GX5A 4KVAA 1UPUA 2HADA 3B78A 1OYOA 2AS0A 4HNRA 2H2WA 5FP0A 1GL7A 2W2LD 2YS7A 2ZS9A 1E79A 1Z4PX 1UAYA 3CW9A 2XJ9A 3M6FA 1HDIA 3L8GA 4UE2A 3KSRA 4M0EA 4G0YA 2YOFA 3HWRA 4J1QA 2ENWA 2HUPA 2R6GA 3S2GA 5FO1A 3WRYC 1FS4A 3HCFA 3QTBA 4F7DA 2G1PA 1KO1A 2ZI6A 4BUCA 1L5VA 1OI2A 3Q2KA 4R81A 1PN3A 3L0CA 3CLSD 2BEUB 1VLVA 3MVEA 5CM9C 1T3HA 4RKQA 2NZVG 1TI7A 3BXFA 5AVQA 3KEFA 4DXHA 4EB3A 1TE2A 4GSLA 1QVWA 1TTHA 3KG2A 1SOUA 1JAYA 5K0NA 1E1RD 2ZWMA 3OF3A 3QY0A 3WDKA 1DC5A 4TMVA 2GXAA 1NJ1A 3PTLA 2H2AA 1SBCA 3C1AA 1GG9A 3UHJA 1H05A 1T0JB 3BBLA 3I4FA 4WV3A 5EXPA 4FB4A 3W8RA 1CUGA 2BD0A 1HI9A 1KAGA 1BHO1 4EG3A 4J0JA 3A0RB 2VJMB 3EYAA 2AFHA 4CNQA 4PLGA 4HHEA 3DB1A 3SF8A 2XE7A 2C95A 3KKPA 1AV7A 1U28A 2ADFA 4NPAA 4EJSA 3GAFA 3T5MA 4EHHA 5EZQA 4EW6A 3EDCA 5AHXA 1JVNA 3TLXA 1RQNA 3TMYA 4ENUA 5A3JA 3Q3CA 3U09A 3GT0A 3R5JA 3PUXA 2HTFA 2IEBA 3MBIA 4JLDA 4L4RA 2HLNA 2CKDA 2ZBVA 3FTNA 3PGKA 1L5GB 2BFAA 3KVVA 5K0EA 2B78A 5EHZA 4L1KA 4I14A 1DC8A 1F2VA 3JZMA 2UZ4A 4YMVA 2VHXA 1DC4A 3JQ6A 1BXZA 4L22A 4IICA 2WP0A 1BTOA 2VPWA 1JU3A 4KFRA 1GEEA 4C43A 1NATA 4NY1A 3K72B 4RJTA 3IDQA 5CBPB 2CBXA 4YLEA 3OUZA 2C07A 4M0LA 5K8JB 4X64B 3G6WA 3TDNA 2Q28A 2WIAA 2HDOA 3SWWA 1FNDA 4LMBA 3R6DA 4MRMA 5AHOA 1W581 4MUXA 3OUTA 4CEHB 3ZWDA 5BRNA 5IZCC 2DTEA 1HK7A 3N8GA 3HYLA 5JSQA 1SUCA 3N2GA 3F7TA 4C4ZA 2EG9A 2GZRA 1OZHA 2XJ4A 1YB5A 2CHFA 1Q91A 1T5IA 1W48A 2FWMX 4LQLA 5EERA 3ZVRA 2A5GA 3FKSA 2I2DA 3CZ4A 4KXFB 3UTCA 3G2KA 3FR7A 4MIEA 3DZ8A 2FN3A 2C8LA 4B8ZA 1PKXA 4CF5A 3QFRA 3ZXXA 1GPJA 3ZX5A 4G9BA 4M0KA 3TBHA 4KH0A 1Z0IA 4U6QA 4Q7KA 1WM1A 4DW8A 1MXFA 4R0VA 4EHJA 5KTTA 3DO5A 1GUAA 2W6OA 3H2HA 3Q8WA 4TSRA 3C3XA 4ER7A 1N33B 1G2QA 4CM4A 3UCFA 4Q3LA 1U1GA 1E2JA 4LHVA 4YRJA 1NKSA 1PG2A 1XN1A 5KYXA 1ES9A 3BJIC 4EECA 2VBCA 2JLBA 3VYVA 4OFZA 1BEZA 1ZISA 3H5OA 2O5VA 3FPKA 4JJIA 4F86A 1DCTA 2XXJA 4RQTA 2SHKA 3ZE6A 5DHTA 1M7HA 1DHRA 3TI7A 3ZU6A 1ZVKA 4WFQA 2ZUDA 1GU1A 1MQAA 3C1TA 3U4AA 5HRCA 1P2DA 2DPLA 3SMVA 4KX3A 3WL3A 5KJ1A 4P3PA 1Y7LA 2C57A 4QYWA 3EF1A 1OZFA 4UTXA 3FGZA 5COBA 3WL7A 3R0IA 1R6DA 2NU6A 3QNUA 5HOQA 3LUPA 3CONA 3HWWA 3PGJA 4II7A 1WXHA 1JDBC 4RELA 4RY8A 2BRUC 4EHNA 1F9EA 4QOJA 4ZGBA 3A3OA 4NENA 1ULZA 1TEXA 2HK7A 4M1TA 3H5VA 4D6PA 3BWYA 4D82A 1GGMA 2VJKA 5KNCH 2VDNB 1A4RA 1P7PA 4TKUB 3PHGA 3M4XA 1LRKA 5L7YA 5JAOA 2OXEA 3E9EA 2GI4A 3VR3A 4BLVA 4K46A 5FYDA 2C1ZA 4E22A 1KI2A 2NU7B 2VYVA 1FS6A 1V1RB 2IEGA 1PJ3A 2Y8EA 1Y3DE 3CF6R 4WT7A 1K4YA 4FEYA 1FVOA 1C5KA 3O3OB 5GQSA 4NXNB 1TZJA 3ADOA 1E5VA 3N8KA 3SEQA 3B8HA 1X74A 4ZK2A 1MEOA 1SC6A 1WETA 4TKVB 3KHUA 2PRKA 4GI1A 3O21A 1XDZA 4OQQA 4Q9IA 1SKMA 1ZRSA 3E8SA 1XJ0A 3VZRA 5JY6A 3PFWO 4GOND 3GMSA 4K6CA 1YJQA 2FMHA 5JALA 4X9XA 3ANTA 4D4MA 4J7XA 4Q82A 5JLAA 5C37A 3DMPA 1YR9A 3RU7A 2KM1A 4KAAA 4F4DA 2DBYA 2PU7A 4EGAA 4QUJA 1XJCA 2FETA 4DSNA 1T9HA 4ZV4A 1C7FA 1ID8A 4GOKA 4N03A 1QHSA 1E7SA 5FFNA 2E4VA 3OIUA 3RARA 2ZZKA 4GE0A 3LY7A 4L8GA 1WR8A 4Z9FA 4D9KA 2MHCA 5AWFC 1SKBA 1J39A 3FPCA 3A1WA 3G7UA 4R4JA 5JD4A 1W88A 2YDYA 1YFLA 3BWBA 1BJRE 1ORRA 3TLAA 1PNOA 4DDTA 3I42A 5D1HA 3COZA 3NBKA 3FKQA 5HJ5A 4DV6B 2M6LA 9LDTA 3K5WA 1CD5A 1FP4B 5AKEA 1ZD8A 2OHHA 3V4FA 1JHUA 1QS0A 2RGNC 3GLSA 4IG9A 1Z0ZA 1DOAA 4UVEA 1JIKA 3TZQA 3PNLA 3CUUA 1TU3A 4HDCA 1JFSA 1F7VA 4WINA 1W5FA 4R8RA 3IQFA 1E2HA 1EJ6A 3LT2A 4WBSA 4OUKX 1IMOA 2ODNA 2P79A 2YJNA 1S8FA 2ZE8A 3R8CA 2YQ5A 1YTUA 1OV6A 3HDVA 3K0AB 4FPXA 4AX8A 3I5XA 1XB2A 5ABPA 1R0YA 1L7QA 2AC7A 5F7ZA 2RAUA 4V1CA 4WBXC 2C5HA 1LWOA 1Z29A 3HBJA 1UDBA 1UEIA 3ZW9A 2MU1A 4MV6A 3JV7A 2ZQYA 1HZZC 3HR7A 3BMNA 4N5LA 2BR5A 3USCS 4C0BA 2J5BA 5BQXA 2QQGA 3PNOA 4HXYA 4MWCA 5BORA 2IZ1A 3MT0A 3TNDA 3ZE9A 4M46A 3H84A 1GRQA 1CUYA 4N8DA 4OF4A 4WY5A 4I9UA 5REQA 3EXHB 1KYZA 1DI0A 1W4AA 4JYCA 4PVDA 3TD2A 5IVPA 1ZOOA 2IVFA 4QRHA 2WZCA 4AM8A 3SKYA 3ED1A 3GG2A 5LA6F 3ENQA 3MGAA 3OQIA 1FMJA 3CRVA 4E5DA 3M4NA 1C1DB 3MD0A 1PG5A 3PUVA 4JP5A 4BJHB 1G6Q1 4XYLA 1CJSA 3SIWA 2FSGA 2AW5A 2ODAA 3AF2A 5AJXA 5L45A 1EFDN 2ID9A 4KBFA 4KVZA 2LKCA 3O4JA 3TLCA 5HUHA 4YY3B 2YNMA 5BUSA 3LO5A 3L2OB 4LKRA 3ESDA 5CT9A 2UYCA 1FFYA 2YINC 2YJGA 1ML4A 3BJRA 3ECCA 3TTWA 3CTPA 1RI4A 2GO7A 3GVPA 3K70B 1J06A 3NKFA 3HU3A 3KUKA 4BDSA 4H9GA 4U6NA 4Y30A 1QH0A 4JI1B 3W5CA 1KMQA 2VTVA 1QUFA 5FUBA 1JA9A 5CT4A 2XECA 3F9RA 4V24A 5EIXA 1OWPA 1C8BA 1VMDA 4RE6A 1SH7A 5G02A 3HPQA 3UMRA 3I23A 4IV8A 4AY2A 3H1GA 5E8RA 2TRSB 1OB5A 3QWBA 1K6EA 1UWKA 4QIHA 3SSMA 2ZVQX 2RHJA 2QM8A 4G5YA 3ELWA 4LEIA 1UPAA 1A5ZA 4JL6A 3RYCB 2PCLA 3QOXA 3OJCA 1XKTA 3TQFA 2IH5A 2HF9A 2Q62A 2FFAA 2BFFB 2ERXA 2WSIA 4XAQA 4N8EA 4ALKA 3ZW8A 4DLKA 1YD7A 3A6EA 4XB1A 3QVXA 1E9BA 3L0PA 3TZBA 1JLMA 2ZTHA 3ZXYA 2DF8A 1EINA 5HF9A 3RS2A 2JDIA 1TZBA 3LOPA 3EISA 3LX4A 1VHLA 2L0XA 5H83A 2VRWA 5FR2A 2C03A 4YUWA 1XZBA 4DWWA 3LOQA 4W5HA 4YT5A 5DKFA 5HWSA 5M7EA 1ZL2A 1T5SA 3QEMB 3E1KA 3FOFC 1UPCA 2LCQA 3G6KA 4HTFA 2G1UA 1RQ2A 2RI0A 3H99A 4K40A 4XARA 5HGJA 2X19A 1AIPA 3D6MA 5DGTA 1OH6A 1XEWX 3U6KA 3O92A 4AD8A 4F45A 3CJQA 3HHPA 2H08A 3K5PA 4MUGA 9GPBA 2BUBA 3LKVA 2IEDA 3LZDA 3JVVA 1XZGA 1SN7A 1GGEA 2ZIFA 1E5TA 1HUQA 1BVUA 1IEXA 3DAHA 3FWZA 4X6LA 2DLCX 3OEYA 3H8JA 3BAFA 1LPAB 4UULA 3EPJA 1G7TA 3QVOA 3GLTA 3NBMA 3M81A 4GMKA 5LZ7A 3AILA 3FDFA 1K3UB 2XMPA 3NHFA 3UAXA 1MVOA 4YRKA 3ZDZB 3X1MA 3BZUA 4EEXA 2G72A 4GE3A 1A98A 2BHNA 4YAJA 1KDVA 3U7EB 3RYFB 2I3AA 3VR5D 2ORIA 1SOVA 4LX0A 1JH9A 4U7TB 4CU5A 3QUBA 5H16A 1RADA 2WF7A 3AHEA 1U3CA 5DPMA 1T2CA 1IVNA 2QW0X 5E6RA 1ZWLA 2EVWX 1Q1BA 2PNFA 3D0QA 2UXDB 1WUJS 3NONA 2Y68A 4JKIA 1VBFA 2ODBA 3V97A 1KYTA 2FHPA 2QLJA 3F8TA 3AQ4A 3ZIUA 821PA 4H1WA 1MFPA 1X19A 2RBEA 3K4QA 1B7GO 3AF5A 4IWNA 3ROTA 1NVBA 3KK0A 3OP1A 5HF8A 2DP4E 2G25A 3DW1X 3S5JA 3VTFA 3UZUA 4ATNA 3J81k 3TD9A 1JB1A 5SZJA 1W52X 4YN3A 3QPUA 3EDOA 3WIDA 4H31A 3NHMA 2Y77A 4Q4DA 2P90A 3LLUA 1A4XA 2X1LA 3D02A 3K35A 2CNWD 1YB4A 4QREA 1P1HA 2VJCA 4XFDA 2CHGA 1G21E 1HO3A 2W2MA 3EIFA 4DJTA 1EWVA 2IYOA 3AUXA 4ZI7A 3KS9A 2XLBA 2ZUBA 4KODA 1U4OA 4JJFA 3EXIA 3C8UA 1OJLA 1ND6A 2QS9A 4NZYA 5K99A 1D7OA 1G20E 4UVDA 1UPFA 5LXTF 3BIOA 1EJ0A 1P0QA 2D4HA 1V2HE 1XPJA 2J8ZA 1Z63A 4P7BA 2KX7A 3F8WA 1CDOA 2V96A 4KQXA 1HDCA 1DIRA 1QBKC 4XZ3A 1W2WB 4CKWB 4REQA 3VC7A 2MSLA 3O95A 2X1HA 2NSDA 3L7DA 4HUTA 1FFCA 2E55A 2UYGA 1U8ZA 4M7OA 3VSBA 1P1BA 1Y8QA 2FWAA 2OCYC 5CB4F 3RHZA 2KQUA 3T38A 3E2PA 3N0XA 4PZ0A 3ORHA 1IBKB 3MNFA 1N3LA 2I78A 3PDCA 1C3VA 3FUXA 3FUUA 3NMUF 3BX1A 1S2GA 2D0IA 2QD5A 2VHVA 3E5RA 3GLHE 3JQ8A 3MJHA 3Q6MA 4WNYA 3EPHA 4MUAA 4ENQA 4Z4CA 4IV5A 2H06A 5AI5A 2WSLA 3GCDA 4MWBA 4DNXA 1FRNA 1A4UA 2QE7D 4K9RA 4MCIA 3H19A 1PQYA 4MGYR 1G2PA 3DOCA 4MVJA 1G6OA 1XMXA 5AT1A 4AY4A 3E82A 1JEOA 1X1RA 1E4EA 1H94A 1YQXA 1V8BA 1BU5A 2IOYA 1ARZA 5BR4A 4H6WA 4E1VA 3ONEA 3M89A 2XNHA 3LH5A 4PR3A 3A9CA 1R6AA 4DRXA 3E18A 3Q9SA 4F0JA 3Q2OA 2QIOA 2QRNA 1ORTA 4BKMA 3GN2A 4MICA 4URXR 2C61A 1Y7HA 3V8MA 1Z0UA 4S2UA 3CNNA 3TRHA 2EKQA 1EFPB 2P0AA 2P67A 4AUNA 3L8MA 2VLBA 1PT5A 2D2XA 1JIUA 2VJYA 2G5PA 2GHRA 2MR6A 2VUSA 4XDHA 2FSFA 5TEWA 2QF7A 3GG9A 2X7HA 1BS9A 1HTWA 1P2FA 3Q87B 4GBGA 4WPGA 2VLIA 5IYZF 2ZAYA 2BBOA 3F7OA 3VI4B 5K0SA 1FDUA 2BFDA 2TMGA 1SELA 1JHMA 1MAVA 1YHZA 1XC7A 3IOCA 3PS9A 1U8YA 3TE7A 1N2SA 2A33A 3LQKA 4Z86A 3A1EA 4QDTA 3C5VA 1WKVA 1Z75A 4QUAA 1HMPA 2XZOA 2PXAA 4BJ6A 1XEAA 1MVLA 3T3GA 5HZGA 4BVHA 5K0JA 1BDMA 1F12A 1RE0A 1XMJA 2VOEA 1NFQA 3FNGA 2J31A 3BB3A 1KJYA 3LD9A 3IAAA 4LXQA 2A0KA 2Z3WA 3RRFA 4CHTA 1QRAA 1ITZA 2QTTA 4ZZIA 5F3RA 3DZIA 4X3OA 4IIEA 4N0QA 5C7OO 2IYYA 4AJHA 2H1CA 2IP1A 1VJDA 2NVUA 2Y6VA 4NJMA 2M32A 4DDVA 3HYRA 3OOJA 3JW8A 4O63O 1ZCFA 3Q6IA 1MPXA 5EVJA 1EQUA 2YUTA 3LFHA 3RJMA 3PE6A 4HGQA 4QGBA 3FPLA 2YVQA 2EL9A 1R3UA 3TNYA 1RM5A 2WV9A 4C1NA 5JROA 1E4OA 3QV2A 2ATCA 1US8A 2HI0A 3QHQA 1KVTA 1TMGE 2I0FA 1P61B 5FEUA 1TUBA 5I48A 2IOFK 1ZC4A 2ORED 5DYNA 4A3SA 1KETA 1DJOA 4WK6A 3IOEA 1D1QA 2BW0A 2CL0X 2CYAA 3DL2A 3KTAB 1PJSA 4JBXA 4ALJA 1GNQA 3DVRX 3FF4A 5TARA 4B3FX 4RJ2A 3N1UA 3D6JA 3HEBA 4HRYA 4MI6A 5A6VA 3VA7A 3N7UA 3K6SB 1N36B 1UZUA 2V3WA 4PYRA 4IHJB 3QMVA 3K7EA 3LE8A 5CB6A 4KLNA 2WJHA 1C50A 3MERA 1QVAA 3UB3A 1I14A 1AHIA 5CR9A 1GG5A 3ZTYA 1QX3A 3TRIA 1OAOC 1TMOA 3JD4A 4W9MC 3OZRA 1E6CA 2FF7A 2ZE7A 2VNIA 3UICA 1F38A 5ESDA 3WWOA 4D57A 5B1YA 1C4OA 3GRAA 2P8SA 1P1KA 5J1TB 3X1WA 2GOYA 1POXA 4AQ7A 3E48A 2AJBA 3TTXA 1Y34E 2BMEA 1GZ5A 4HV4A 2D2EA 1ZL0A 3OOEA 3RI3A 4HDRB 1JKJA 2O2SA 1W73A 1TA9A 3S27A 3DBHA 4WUTA 2WVHA 1KO8A 3V4VB 1V48A 3JWJA 1ADJA 1QIMA 1PW5A 3GXBA 1X7ZA 3HGQA 4HH3C 5AI6A 5EPUA 5KKNB 1F6DA 3L8FA 3AEKB 2WRZA 3BGWA 4FWIB 4DEVA 4OP1A 1B6GA 3OQ6A 2C4UA 1WVIA 1WQ1R 2UYOA 3KVYA 4G07A 3WB9A 5LOVB 2G9ZA 4IEEA 2V7VA 1H5NA 3K1AA 5GINE 4OHRA 5CCEA 1F1BA 4RK6A 4BNXA 4BXOA 2Y0DA 4OM8A 4ENWA 1E64A 4GEKA 1G59A 1OZAA 5HGXA 1CRPA 2PBRA 3LYHA 2XYPA 1EDZA 2C0PA 4GICA 4U2EA 2BH2A 5ECWA 4TN1A 5TS2A 2H4HA 2HB6A 1Q92A 3QTTA 2C5LA 4W7IA 4D9JA 3PC4A 2OSVA 3QBDA 2QTZA 3HJGA 4I50F 2FPGA 5EHXA 2PWYA 3CUKA 3IO5A 2ZJYA 2X2OA 5A5EA 1Q57A 3BMQA 3LK6A 4QTTB 1H2EA 4JD5A 4IDAA 3F5DA 1E2EA 121PA 2FFHA 4JR1A 5DXAA 4C6TB 5JJKA 1E79D 3HCRA 3FNFA 4XIIA 3NHUA 1MGPA 3WGTA 3ML1A 4EGFA 2P91A 2PTGA 4LF7B 2PJUA 3OCYA 5EIAA 1U5BA 2PX3A 3CY6A 2FXVA 4LNUA 3U3DA 1GZVA 5F9HA 3RWMB 4PZZA 1F8GA 2AEFA 1QPZA 1AURA 1ZRHA 1OU4A 3T3EA 1X7DA 3IDSA 3E0XA 4BNLA 4FYWA 3KT0A 2BR3A 3OZAA 1S02A 4XM0A 3I9KA 5IS2A 5LU9A 1WPQA 3DM9B 1GU7A 1NBMA 2I33A 5EZ5A 4LZZA 2G83A 3HBLA 3ETDA 4C88A 1QHHA 3CH6A 4NH4A 1L4KA 3AF4A 3EXHC 3L7CA 1RJFA 3RFXA 3RWOA 5AI0A 3F5MA 4ABYA 4PSAA 2PANA 3P5BA 3QVMA 1NVUQ 4KXWA 3VV3A 3W5JA 4AS1A 1RKXA 3VU1A 2XV1A 2PH3A 4B3CA 2EU8A 3ICPA 4ZTZB 1DRUA 3VPAA 4IL5A 4JXKA 4R71A 3UJAA 1T9AA 2ODWA 5F23A 3K6RA 4QFCA 4CGZA 1ICEA 4C4YA 5IZCA 3WSTA 1YULA 3AB7A 4A10A 1XX6A 4A2CA 5GZ3A 2E4UA 1MGOA 1KI7A 1E8DA 2FA9A 3E2IA 5TMDA 4UXIA 2I2AA 2Z8ZA 4PZ9A 1E1KA 2XX3A 1D0SA 1T8YA 3U7FB 2AMJA 1V1JA 1AMNA 2QYOA 1SVLA 1CRLA 3EUAA 1T5LA 2R0QC 1T8UA 1PR1A 1X8KA 3J80A 3A06A 1DJPA 3WV5A 1EXDA 1RAHA 1YASA 4D8YA 3L7KA 3M7IA 1XQ6A 2QUAA 1LW6E 1SUFA 1FDIA 2FR1A 2NV2B 2WIDA 4HD8A 5FBWB 5LU8A 4NXMB 1E6KA 2XQKA 5F98A 1BVRA 3N2GB 3TQQA 3O0TA 1E2LA 1SULA 2GCOB 3RVJA 1W25A 4YUAA 2M6RA 5DXJA 2NU8B 3SVZA 3G5MA 3SLKA 3VC1A 2ZB2A 2C4MA 4QGSA 1A9PA 2FW6A 4W8OA 3UQZA 2QBYA 1U7UA 1M1ZA 5TQ2A 1PJ8A 1XTPA 2B82A 3DQQA 2BC9A 2ZT5A 3B7GA 1EX6A 4EI9A 5DI9A 4Y2PA 2QTVA 5DLPA 1ADYA 3QXGA 2FRVA 2WE7A 1NKTA 3M33A 2OCPA 3K71B 2QJWA 4R16A 3IP1A 3RRBA 2VRNA 4LXXA 3UXEA 4HDQB 3DCYA 3ZTTA 4EBBA 1KF0A 4M3NA 5ADUS 5FUMA 4P53A 4F72A 5LLSA 1S0UA 1BGXT 1USGA 2JGLA 4Q1BA 2WTMA 3K05A 4ZN6A 2FY8A 2IDZA 3IURA 3AFIA 4LFCB 2VXOA 4C3UA 2V7BA 3H3FA 1I10A 3EGEA 4P33A 1BJTA 3RRMA 4XA8A 1CLEA 1CQIB 1KMHB 2I3DA 4PC1A 5EHGA 5AHWA 4ZCIA 3W4JA 2H65A 2AJCA 1C41A 2QN9A 1AGRA 1LBIA 1ODCA 1XRLA 2CL5A 2GN8A 3DEZA 4BLSA 3H11B 1W0JA 1PZMA 3KYIB 5YASA 3ZOZA 1JUDA 4E7PA 2BKAA 3JATB 4GU5A 4PSCA 3SLRA 4JVLA 3ORSA 4RTJA 1M66A 4I9GA 4KH1A 3VPFA 2NXCA 1FDSA 1TYEB 3IHWA 2CLOB 5JMOA 3G5LA 2V6JA 4WUVA 4YP6A 1ZM2A 3C8ZA 3S2YA 4D3DA 2JH9A 7ADHA 1YF3A 4F4CA 5CW2A 1V1MA 1CDDA 1SC3A 3OE7D 4RD1A 4QZVA 3DF9A 5BNIA 1LH0A 4MLZA 4FIDA 4KE6A 4PG7A 2HF8A 5CA1A 4C06A 2WAXA 2J3JA 3LUDA 1ZH4A 3HADA 3HQ4O 4QICA 3QBTA 4DLTA 4IGFA 1BXKA 2G1JA 4RDCA 3SEZA 3KT6A 3U17A 4P7GA 1TW3A 1JLKA 3E9RA 4GPD1 3WICA 1QDUA 1QMPA 1N57A 3SHQA 1SQ5A 2GF9A 4X0EA 1RI3A 3NAZA 3L0IB 5AKJA 3RNOA 3ZU4A 3QVUA 4C7VA 1ZWKA 3FN4A 1BD4A 1BFUA 2PT6A 4OYRA 2HFJA 4IMRA 5TV2A 3AP2A 2E82A 3UPDA 4AJJA 1T35A 3WZ2A 5GGYA 1MO6A 4X1OA 1QKKA 1W1IA 2PBLA 1GZHB 2RGRA 1N5IA 3T15A 2HOQA 3P9ZA 1Z0FA 4G81A 5M3BA 4E2WA 1D4AA 1HOTA 4P93A 4Q37A 4K2HA 1FDTA 1Y7TA 3A6JA 4KRGA 3CNHA 2GESA 1C1XB 4HEA6 1SZJG 2QVYX 1HDEA 5AM1A 1KQGA 5ILOA 2QN7A 4IQ0A 3BF7A 1XRJA 4DLUA 4R3UC 3RB8A 4QD3A 1ICIA 1MKYA 1ZR2A 2CF5A 2CXQA 1R6XA 3GMIA 1R4MB 3LVQE 2O1WA 2ZROA 2XB2A 5ES4B 4RVDA 3EH1A 1ZXXA 3RTAA 2QQ0A 5KS2A 1DKOA 3QV1A 4FS3A 3C14C 4NEGA 3TYXA 1VECA 4X92A 5HUJA 1P6UA 4YECA 3PC8A 4I9HA 3HUTA 2NUPB 2YHIA 3PDIB 4UVHA 3NNDA 2FE1A 1Z28A 2M9MA 3D6HA 2CEKA 3THYB 2XKAA 1YNOA 5EJ7A 1Z8FA 4FDVA 1FBTA 2P9QA 3JARA 2OXRA 5AKGA 5AR1A 5GZ1A 4R31A 2O0MA 4M99A 5BR7A 1ZH6A 5C8DA 1AU9A 1R16A 2FYTA 2OGUA 2XCQA 3EN0A 4XIYA 4D9CA 3AERA 5KNDD 3RAGA 1EA5A 4WE3A 5ILGA 3UKJA 4CLEA 3NU1A 5CA0B 4AJ4A 1OLXB 2AI1A 3RIEA 1I2AA 3E9QA 2VHWA 4X1IA 4H1TA 2DU8A 4JJ4A 4EJ0A 5FTLA 4RTPA 2GFQA 5JZOA 1YQQA 3RYCA 5IF3A 3R9KA 2MYNA 1YKFA 3FPEA 4G36A 5AM0A 3TO5A 3ZGYA 3OIDA 1DMSA 4GX2A 3W6NA 3H2BA 3OM9A 5H3LA 2HRRA 1QYXA 1M2NA 4ZV7A 2YBDA 2OXTA 3SIPA 1SZCA 2PKYX 4J1NA 4REQB 4K7JA 3TEMA 5J23A 1T9KA 1ZG3A 2JFUA 1OROA 2YXLA 1HBJA 2CLSA 5CCBA 5FHQA 2R1VB 2AZTA 5CPFA 1E7MA 1CIVA 1BCSA 1Y1SA 4DMLA 3I09A 2GHIA 3Q3GE 1DDGA 1DCMA 4RKYA 1L1EA 2BN4A 4RF5A 5DYYA 2Y1GA 4ABTA 1UIMA 1YNSA 3DS8A 4RPLA 5M2QA 4HS4A 4C4PA 5E1OA 5HS4A 5FLEX 4RSGA 3ZD6A 4C2UA 5FUVA 3X1JA 3LP5A 2FCAA 2JFQA 2WYWA 4NOKA 5JXHA 1RD4A 1SUEA 2WVGA 3JD1A 4RZQA 5DM0A 5HKAA 4LOKA 5GV7A 1GAJA 4CM7A 2QVLA 1J2JA 1SBIA 3DTVA 4BX8A 1CQPA 3OG9A 4KLCA 4WKOA 4ND6A 4LNHA 16PKA 5G3ZA 3ZZMA 5KDDA 4MGZR 1OX6A 3OQBA 2V8OA 3KOXA 4AQDA 4X63A 2R6JA 3GHHA 2UUPA 2YW2A 2YASA 4M22A 4G8CA 3GOQA 5FFMA 2PZKA 3GAZA 5FUQA 1GZDA 3A2NA 2C5AA 4BQNA 3GAAA 3M5PA 4LRUA 1Z07A 1JZTA 3PX3A 4FZRA 5CUQA 5IUJC 1D2CA 2CGEA 3K30A 1PJ2A 2HHCA 3GARA 3MAJA 4Z4GA 1NG1A 5E6RB 3K6JA 4UOQA 3THXB 3CMMA 2QX7A 8OHMA 3VDMA 5LDDC 1BDBA 2FX3A 2RHLA 3IVCA 3V48A 3LYUA 3R6LA 3H7IA 1Y1LA 3K0AA 1S7CA 2B83A 2X3FA 3UHAA 2OV6A 2J67A 2ZTMA 5E6UA 3KQTA 3VR6A 4YIKA 4ZT2A 5KTSA 1FXUA 1PT9A 2MMGA 2E1PA 2ECOA 3H6HA 3ZX4A 3AJDA 3O83A 4GZMA 4GWGA 4RAQA 4RS3A 2ANCA 4JOQA 2OFOA 1RAEA 2YNMC 1R88A 3G5TA 2WJ4A 3CNEA 4ZYLA 3N0WA 4ON9A 2YIVX 1AGNA 4UBNA 4XFJA 3PTZA 3T7AA 3HLKA 2J3DA 5ANRB 3UA4A 1O6GA 4KFUA 1T4DA 4TROA 2NOAA 4PRZA 3BDAA 1A7AA 3DP7A 2AMLA 1L4UA 2D2VA 1JAZA 1W88B 4H2DA 4KIJA 1JH8A 1UADA 4RZIA 5F2EA 2MYUA 4MQFB 1SC9A 1BYIA 3TXAA 1OFGA 1ZRMA 2QMHA 5C8VA 2P9CA 4RK0A 1QTNA 3GRVA 1ZD3A 3KL4A 1HNZB 3FYUA 2JI4A 3D81A 3Q12A 3SBOA 1AQIA 3UJDA 3GVXA 1A82A 1UFQA 4B7ZA 5BN3B 3WYGA 3WHLA 4ZKEA 5FADA 1AKWA 4DDHA 1NU6A 4HFMA 1QRTA 3UYLA 5FPYA 4BTEA 1QO7A 4CMKA 4YMUA 3MWLA 5CVDA 4ZCLA 4BYGA 4CCYB 3HM2A 3U7HB 4P84A 1EFRA 3EBLA 2X42A 4P3YA 1ZJYA 1FUEA 3NG1A 4INPA 2A57A 5E6SA 1F0YA 1VGVA 4DKJA 3H2ZA 1H2HA 1PSDA 4PHFA 4NV3A 3EQ6A 5AUQA 3AY0A 5AUNB 4BNKA 4U4AA 5KSZA 5HQJA 1IN8A 3PQDA 4GC9A 4BLTA 4BNWA 2I6UA 5A9SA 3IUNA 3EDMA 1DPGA 3IPXA 4NOMA 5A4AA 2IPNA 4G4SO 1MH9A 1ZI6A 1P6XA 4ZU1X 4KXMA 4EQZA 3TGLA 3S40A 1NLFA 3TL2A 3ZBUA 4FMPA 4WDQA 3P2OA 2NU7A 1EFRD 4F4HA 1TEZA 1ZAYA 1CYEA 4EHIA 4D9MA 2QU7A 1KK2A 2Z8XA 4JQYA 1LK7A 3J7TA 5HKKD 3EUEA 3NV9A 2GYVA 1PWHA 1UKVY 4WK4B 4K87A 3RM3A 3RS9A 4EUHA 2QRQA 3LOUA 2KE5A 2NXWA 2PO5A 3ANXA 4NS4A 2GSDA 4DV4B 1QYWA 1PNTA 2RH8A 2UUOA 1JU9A 4D3XA 2LDXA 5GIPE 3OTIA 5BY2A 1ZN8A 4C0QC 3MQFA 4WWHA 3E3MA 3KL2A 1W49A 4DR4B 2J6IA 4HGNA 2W4MA 4MYSA 5FWYB 3REQA 4LY6A 1QTQA 2AD5A 2DQYA 1EM6A 1H8HA 3ETCA 2NUAB 2EGGA 1OLUB 4BCCA 2UVQA 5EZYA 4A6EA 3TX6A 1RCUA 3F7NA 1PWEA 3R3WA 1WX1A 1OT3A 2JZOA 3FPSA 3HKDA 5E9QA 1WSWA 2XF8A 1P2GA 1CP2A 1IZ8A 1DV1A 1U0GA 2FVXA 3K9HA 3Q2IA 2HO5A 2NTJA 5F5LA 3ULKA 1N5JA 1RHMA 1Y8RA 4D96A 1Q1AA 1R0WA 1GRNA 2Z3ZA 1IN6A 5ALEA 2V0CA 1U8UA 2IUEA 4CMEA 5BYAA 1VXRA 5J5AA 5FO0A 3WNCA 5DCUA 4QPZA 1L9KA 2BHLA 4LRSB 3N8NA 4ZOCA 1GA4A 4DA4A 4V2UA 1CY1A 4A6XA 1NULA 3WOHA 3SKXA 3R8XA 2V54A 3KNZA 5KNDA 2DLNA 4Z53A 1XTUA 1U81A 3KPWA 3M3HA 4JIGA 4HNAB 5FQOA 1B8NA 3HVKA 3LV8A 4IGAA 2HFKA 4HGRA 3SIXA 2VN8A