4LVUA

Crystal structure of a putative short chain dehydrogenase from burkholderia thailandensis
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
254
structure length
252
Chain Sequence
DERYARYPSLAGRAVLITGGATGIGASFVEHFARQGARVAFVDLDEQAARALAARLADAAHEPVFVACDLTDIAALRGAIEAIRARIGPIAALVNNAANDVRHAIADVTPDSFDACIAVNLRHQFFAAQAVIDDMKRLGGGSIVNLGSISWMLKNAGYPVYASAKAAVQGLTRALARELGPFGIRVNTLVPGWVMTQRRLWLDDAGRAAIKAGQCIDAELLPGDLARMALFLAADDSRMITAQDVVVDGGWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxidoreductase, short chain dehydrogenase/reductase family
publication title Crystal Structure of a Putative Short Chain Dehydrogenase from Burkholderia thailandensis
rcsb
source organism Burkholderia thailandensis
molecule tags Oxidoreductase
total genus 96
structure length 252
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lvuA00
4AJNA 2PH3A 3E9QA 5A03A 1PS9A 1YKFA 3HB5X 5CPBA 1ZZEA 4E5MA 3ULKA 3VH1A 1WDLA 2B83A 2VUUA 2ZJ1A 3TN7A 2H1SA 2GASA 3PZRA 2GZ3A 4OSPA 2Q1WA 3DB2A 4N5LA 2CF5A 1B26A 1KC1A 4TSKA 3ENNA 4AJKA 4J2HA 5H81A 5CDGA 3PYXA 1UDAA 5G0UA 5G0VA 2GN8A 2P5YA 1XG5A 4O59O 2J3HA 2O4CA 4CR7A 4GAEA 4WPGA 4XX0A 5KJ6A 3KEQA 5TIIA 4TRJA 3GMSA 3QWHA 3SJUA 4PLTA 4YQYA 4B3HA 1VJTA 4CM8B 4TZKA 4PVCA 1RYDA 1QLHA 4HBGA 4LW8A 3DHYA 2PD3A 1KVTA 1UXJA 4XKJA 2EW8A 2P4HX 1SNYA 1GL3A 4RPJA 1AUPA 1OZAA 1GU7A 3OBBA 3A4VA 1ULSA 2EWMA 1H0KA 2FOIA 1XLTA 3CSDA 1GR0A 3RBXA 1ADBA 1GUZA 3DBRB 4PZCA 4KQWA 2Y0CA 5JXWA 3PQFA 4CMJA 1J0XO 2EW2A 4B7XA 1W73A 1RM5A 2UAGA 3BHJA 2EF1A 3F4BA 4G65A 4H3VA 4OKNA 1SC6A 2NUAA 2C0CA 4DIBA 5C7LO 2YHUA 4N5NA 2PH5A 1UAYA 2Q2VA 3HDJA 4IXWA 4BO6A 2ZB4A 3B6ZA 3Q1LA 3GZNB 1PS0A 5U1PA 4E31A 3E1KA 3H5AA 2O3SA 4WUVA 2D2IA 2EEZA 1R15A 4I9UA 1H93A 4K6FA 4X54A 1FJHA 3ETDA 1H6DA 1GEGA 4ND4A 3ZU4A 6ADHA 3IP3A 2FRDA 1U9JA 4RF4A 5CAEA 2WDZA 4ZA2A 1R12A 2PZLA 1JU9A 1PJ3A 5AXAA 3SC6A 3WX0A 3C7AA 4BQPA 4QO7A 3G3EA 3GA0A 1YQDA 1O9BA 2Z1NA 4U5QA 3H5RA 3DWFA 1X1TA 4JBGA 5LDHA 4IPTA 4EEXA 4UULA 4S3MA 2Q50A 3EZLA 1PQPA 3TOZA 2IEBA 5TS3A 3WGTA 4JK3A 1JAYA 4BNWA 3LQFA 1A72A 3HADA 2EIHA 3AU9A 3ROQA 4WNCA 2E82A 2DVMA 4TRNA 4PLYA 1QV6A 5JPIA 1T2CA 3K5PA 2VZ0A 4KUHA 4CLRA 2BFOA 3WYEA 1GCUA 3BTSA 3E48A 3BAZA 1GQ2A 3H6KA 4CUZA 5ICMA 4M54A 1M6HA 5CEEA 3RIHA 1PZEA 3AUUA 1NR7A 3N74A 3KM0A 4XGIA 3OIDA 1H94A 4DIFA 3HNPA 3E6AA 4HKTA 1K3TA 4RVUA 4E12A 3IC5A 3HJAA 4FJ2A 3E18A 5IDYA 2PKQO 1GFSA 3U4HA 3JYNA 2WD8A 3WYCA 1HDOA 1J5PA 4BB5A 1OC4A 4YT8A 4D7AA 4W9NC 1NAHA 1E6WA 2BGKA 5A9TA 5TGDA 1K2WA 1X7GA 3E9MA 1MP0A 3BHIA 4R1SA 4R1UA 3VZQA 1HZJA 3WTCA 4CQMB 3KO8A 2JCXA 4U7WA 3GG2A 4FIZA 1P1HA 4LISA 1VSUA 1E7SA 1QR6A 5JDCC 2ZB8A 5KTKA 2EJWA 3JQAB 4IS3A 3AM5A 5DZSA 4A73A 4OGWA 4G81A 1ZKMA 4RORA 1HDGO 1U8FO 3GRKA 5GZ1A 4J91A 2R00A 5L7TA 1KEWA 1EK5A 4KP7A 3VH4A 4YRAA 3RUFA 5K6AC 1F8GA 2Q2WA 2OP0A 3MOIA 3H7AA 4R1NA 3ZWNA 2EKPA 3X2EA 3RC2A 4FS3A 2B35A 4CLOB 3ZHZA 3KYCA 4INAA 3WMXA 2VHXA 1YH3A 2CNBA 3DXFA 1U4OA 1ONOA 1BDBA 2I3GA 5A06A 4DLBA 1E7QA 3LT4A 4IJUA 5EINA 3KETA 5CEJA 4PZDA 4ALLA 3E9NA 1I3KA 3VDRA 1CRWG 1M67A 5EERA 5L51A 2YDYA 1JDJA 1DJNA 3ASUA 4YYZA 1P77A 1U28A 2QHXA 4DLLA 1T1SA 1CETA 2QRLA 2PZKA 4JJGA 3BTOA 1NQ5A 2WSBA 2XXJA 4NBTA 4A10A 4KWIA 5GMOA 2YZ7A 4PG6A 4R41A 3WGIA 1Q7CA 2P5UA 4UVGA 3HQ4O 4PLWA 3TZQA 1I01A 4AJ2A 4CM3A 1K6JA 1TXGA 1Y5RA 5A9SA 4OYRA 5AQ1A 1TLTA 1R6DA 3ROKA 5T67A 1ISHA 1DJQA 1N5DA 3DMTA 4BNZA 2HK7A 1R0LA 3AUAA 4M89A 1KERA 1YONA 4DC0A 2NQTA 4K1LA 1NP3A 4IDGA 2G5CA 3PK0A 1GZ6A 5L40A 1E3SA 4W82A 3NV9A 4L9RA 2UUOA 2FMUA 3CPSA 5I8ZA 3FF4A 4YJHA 5JMPA 2PZJA 4UUMA 3ETGA 2AMFA 2Y67A 4O0LA 3QVTA 4OQYA 2Y1EA 3K8ZA 1A9ZA 4E2XA 2DBVO 3QJ5A 2CDCA 4J3FA 4P4GA 5CPFA 1N9GA 4QFCA 1B8VA 1MUUA 1Y8RB 4CM6A 1EK6A 5HRUA 4YCAA 5ILOA 3I6QA 4C7KA 2VQ3A 4ILKA 3V2UA 3GVIA 3IKTA 1CYDA 2LDBA 4YQZA 5DOZA 1AXGA 4AJOA 1E1LA 3A06A 3BHMA 5IG2A 1P33A 3O9ZA 4JBHA 4G2NA 1JKFA 1SEVA 1B8UA 1Y9AA 2AA3A 2AEFA 3O8QB 2X0RA 3ZWXA 2QYSA 1VL6A 3RD5A 3VTFA 1M2WA 3LC2O 4GWKA 5BSHA 1AN9A 3MOGA 2JAPA 3PHJA 4JROA 1U8XX 2AEMA 2RCYA 4XR9A 1UZNA 2C7VA 1E7YA 4D0RA 5K9ZA 4RVGA 5BT9A 3M2PA 3FCOA 5AXBA 5KOIA 4HNGA 2PK3A 4QTZA 5JAMA 3OJLA 1XWFA 4BKPA 4J9VA 3PXXA 3ITKA 1DHRA 4AJPA 3NTRA 3PYMA 3AM3A 5HM8A 4YT2A 4XYGA 4OJNA 4J4BA 1V3TA 1TT7A 5TJ9A 4BO9A 1EBFA 3JCZA 4IIUA 4YT5A 4L4RA 4XWYA 1DO8A 3HSKA 1LSJA 2QQ5A 4BGEA 3PGXA 2I66A 4ZQBA 1YBVA 2BGMA 4D42A 1CQIA 3HDQA 1Z73A 2IRWA 2EKLA 3QVOA 4IJKA 1ZFNA 2Y93A 3TDKA 1E6EA 5GZ3A 4M1QA 1I2BA 3WGOA 1B0AA 2RH4A 3PZBA 4I5FA 4J16A 3CIFA 1TI7A 2D0IA 3FNEA 3GAFA 1C1XA 1D4FA 1M76A 1W0CA 2BI8A 2C82A 5JS6A 4P4LA 2BKAA 1C0KA 5FFFA 3OA2A 3DOJA 2FZEA 3ENKA 2PGDA 4BMNA 3PQDA 1IZ0A 4DPKA 1U4SA 2FWMX 2X5JO 3TJRA 5CEFA 2UDPA 1B3BA 1ZO8A 1DSSG 2JL1A 4GX0A 4J7XA 1M66A 1TB4A 4PZEA 1H6AA 4YJFA 1DFHA 4CUKA 4O63O 1LSOA 4XYMA 5ILGA 3RCBA 5JDIA 3F47A 2X9NA 5MDHA 2NVUA 1LDGA 3OSUA 2FN7A 3W8EA 4A7PA 3NTOA 3ZWBA 5KVSA 1JVBA 4F6CA 3HFSA 3F5QA 1ZMTA 4FJ0A 3ZW8A 4I9NA 4MIEA 1QKIA 3F5SA 1EDOA 1DRUA 4RDIA 5T8KC 2ZTUA 4HXYA 4WEOA 3OJ0A 5AXDA 1YOVB 1JWBB 3GK3A 4LSWA 4KUGA 3BA1A 4L0QA 1ADFA 1NXQA 3RU7A 1BVUA 3WMWA 2NU6A 4Y6RA 3JQ9A 2NTJA 3I4FA 4BS9A 4BO8A 3I52A 1EFLA 3D0OA 3QSGA 4P38A 2NADA 4ZRNA 1XSEA 2VWPA 1H2HA 1P1IA 2FY8A 4CMEA 2EG9A 4E33A 1U7HA 1YXMA 3GNTA 4BO4A 1WZEA 4JGBA 2I65A 5L45A 1GY8A 2P68A 2O2SA 1I3NA 3JD4A 4NBRA 4NZ9A 4E32A 1N7GA 2PR2A 1MC4A 3I9LA 2HUNA 2NVBA 1P74A 3WJAA 3V1YA 3DZGA 2DBZA 1Q7BA 3FPCA 1R4NB 5JE8A 5HBRA 1T26A 2VRBA 1N92A 4JJIA 4NH4A 3W4KA 3RQSA 1N8KA 4TWRA 1PGJA 1LRLA 3FR7A 3QVXA 3NGXA 4GGOA 2WYUA 4CM9A 4FOSA 3JYOA 1TA4A 1I24A 3D5QA 3PIIA 1PJ2A 3D3WA 3ZGYA 1PWZA 3A1NA 2EERA 4BNTA 4DTIA 3ZNOA 1DPGA 4Z6KA 2PWZA 3LK7A 4L8VA 1E5LA 1OBFO 3RFXA 1YJ8A 3DONA 4CV1A 2CSUA 1MXHA 4OH1A 2QZZA 1U3TA 4LGVA 3OMLA 4EUFA 2Y1DA 3TPCA 3GDGA 3QWBA 2XF8A 5JCXA 3CZRA 2D8AA 3VOSA 1CF2O 4RPGA 1VL0A 1ARZA 2VWQA 4CM1A 3A28A 3UHAA 3U0BA 4E4YA 1LXCA 1HSZA 1YB1A 1U5AA 3DBLB 2WM3A 1X0XA 2EP7A 3CEAA 5KJFA 4CLRB 5J23A 3RUDA 3VPFA 1VE9A 2ZQYA 3OJFA 4CL8A 4EI2A 4MINA 1XEAA 2DFDA 4NK4A 4WECA 4EJ0A 3DBHA 3W4JA 1B14A 1HLPA 1LA2A 3IP1A 1K5HA 1KVSA 3BMCB 4W7HA 2UUPA 7MDHA 3FNGA 5C5IA 3K96A 4DLAA 1DLIA 1EVIA 2X6TA 1E6UA 2GERA 3KV3O 1ISIA 1H9BA 3IUSA 3KYDB 4ROSA 3P19A 3OQ6A 3C24A 5IN4A 1Q1NA 2HMTA 2ZCUA 4N5MA 1KVRA 5JNLA 3OIGA 4NIMA 2C20A 1S7CA 1SBYA 3GDOA 3W8FA 1LEHA 4WLOA 3R3SA 1YBMA 3U49A 1JWAB 4FFPA 4Y8VA 4W7IA 4BNNA 4GQAA 1R37A 2NVWA 3OJOA 1ZBQA 2HMWA 1Y8QA 3MJSA 5KVCA 1PZGA 1IE3A 1E1NA 3N58A 1V35A 3FI9A 1O0SA 2IYPA 4XYLA 3I9JA 2JFFA 2OFPA 5IZCA 2CFCA 3PLNA 2LDXA 4CMHA 5G0TA 2ZYGA 1KY5A 2JHFA 4OOEA 4YAIA 5AVOA 4YRBA 2GN9A 3KYCB 1QMGA 4I9HA 3SLKA 3ZW9A 3TZKA 4IGEA 2NQ8A 3AI1A 5CG1A 4JNKA 3RFTA 4UVIA 1JKJA 4PRLA 3D1LA 3VVCA 4EJ6A 4XGKA 1YB4A 5ITVA 4IDCA 1ZUD1 4L75A 3WBBA 4D79A 2P4QA 5KJCA 3IIEA 3AI3A 1PU2A 5KVVA 5FYDA 3HWRA 3ST7A 2P2SA 1XHLA 1GYRA 2FR8A 5F1PA 2JAHA 3F3SA 1W6UA 3AK4A 4FN4A 3ZNPA 4EYEA 3LVFO 2VOJA 1P1FA 3KSUA 3H4VA 4B79A 1ZEJA 3ZWPA 5BNIA 5TT1A 2DT5A 1D3AA 1VI2A 2HQ1A 3GN2A 2HRZA 5DBFA 4ZICA 2E4AA 3GVCA 1BXGA 3OECA 4PVDA 4FR5A 5FWNA 3PWSA 1GQYA 3DAFA 1LI4A 1WWKA 1A5ZA 4PLFA 4TVOA 3DAGA 4EITA 3U09A 2HMUA 5EMHA 2HRBA 1U3VA 1E3WA 3OM9A 3SJ7A 4D44A 4B7UA 3V2GA 4Q3NA 1E7WA 4FSHA 1XCBA 1LDEA 1LDMA 1NTOA 3QA9A 2DU8A 4R69A 5CHEA 4GSLA 5IDWA 4DXHA 2EP5A 4BGIA 2X7HA 4CV3A 1VKOA 2YW9A 4AJ1A 1P31A 4FCCA 4R4JA 2Y66A 2F1KA 3AOGA 2AQIA 3CMCO 3MZ0A 1IHXA 1ZMOA 2WD7B 3Q9UA 1PL8A 2Q1TA 1UP6A 1N9GB 1EUZA 1O8CA 2OBYA 4ZD6A 2OL4A 3UCFA 2VNSA 3TRIA 5HS6A 3NT5A 2VHYA 1U1IA 4XJSA 1DIAA 3JYPA 4YDRA 3S55A 1MC5A 1Y6JA 1KBZA 2EGGA 2O7QA 4JJFA 3TFOA 1IUKA 4IM7A 4CM4A 4OSOA 3RFVA 3PEFA 3BMQB 1FDUA 1JW9B 1K6XA 1QYXA 1VJ1A 2BH9A 1ADGA 2QZ9A 5TQVA 4HWKA 4DYDA 2DBRA 3GLQA 2GLXA 3IJRA 3LT1A 1PJSA 4RVSA 3WLEA 4BO2A 2VTEA 4P8RA 1YVEI 2J6IA 3AY6A 3H9JA 2GDZA 2HK8A 4GGPA 1VJ0A 3GGPA 5A9RA 4QO8A 3PJDA 1LRKA 1P9LA 3H9GA 3IKVA 4BGUA 3AOEA 2UV8A 2PV7A 1I2CA 2C29D 3ETEA 2OZPA 3C7CB 4R3NA 5DCUA 1ADCA 3BMNB 3ZV4A 4FPXA 3VPSA 1QLJA 3JQ7A 3OQ1A 3PI7A 1UDBA 5A4DA 4KOAA 4CUJA 1FDWA 5COAA 3JV7A 1XU7A 3RUHA 2VHVA 4OMUA 5I7FA 5CDUA 2G76A 4LN1A 2BRUA 3DZKA 2ZTVA 4H16A 1ZXLA 3RUEA 1T4DA 1HYEA 2PGLA 2Q99A 3KEOA 1E7MA 3U9LA 2Y1OA 1BHSA 2PNFA 3HFGA 5IDQA 3LT0A 3S1LA 2Q2QA 4NBVA 3L77A 3LT2A 3ZV3A 4OQZA 3VVBA 3JQDA 3PVZA 2A94A 4Q3BA 2G82A 4WKGA 4MPDA 4RZHA 1LJ8A 4PCVA 1C1XB 3RROA 4B8ZA 4D41A 1A4IA 4NDNE 4ZVVA 4UREA 5HA5A 4D3SA 5F3RA 2WWRA 2ZTLA 1R4MA 4BQRA 3RJ9A 5A3JA 4CQLB 3GVHA 3K31A 3QVWA 4GPD1 4BNMA 1HKUA 5I9NA 1NM5A 4HFNA 1B3RA 3AM4A 1GD1O 4UAGA 3TZ6A 5G4KA 3DL2A 4MDHA 2ZQZA 1KY4A 4K6CA 1PJCA 1RM4A 4I08A 4IBOA 1IYZA 2P9EA 3DR3A 5L4LA 3E5MA 2BELA 4FC6A 2X23A 4OL9A 3FTNA 4BO1A 2Z5LA 4L76A 4MP6A 1V0JA 2Q1UA 3JQGB 3T7CA 3GN1A 5BR7A 2O4UX 1V3VA 2FPIA 3RWBA 4U0JA 3GOHA 3N7UA 2NVUB 1IPFA 4TVBA 5F21A 4CMBA 3I1JA 1B2LA 2J5RA 3B1KA 2B5WA 2CZCA 5JC1A 3A9WA 1J6UA 1SB9A 1BGVA 3SXPA 1C0PA 2PZMA 4MP8A 1UUFA 1ZIDA 5JYDA 1HDRA 4GBJA 1P0FA 1VKNA 2D5CA 4OIMA 3I9OA 4Z0TA 3JSAA 4OKIA 4E21A 1NWCA 1CERA 4DQUA 1BTOA 4W6ZA 4LVCA 5L7WA 4PLPA 4DPLA 3H65A 2YV3A 4O5OA 2OOSA 2NWQA 1Q0HA 2JFGA 2YV1A 2Z1MA 3U5TA 1C1DA 3ZWOA 3GUYA 3WDSA 1EVJA 2ZKLA 3QHAA 4IDBA 3WSVA 4BNLA 3VDQA 4J4HA 4YT4A 1BW9B 1EQUA 3JYLA 4M86A 3WWYA 3QLJA 3JQFA 4IXTA 3BMOA 3JQ9C 3Q0EA 4AJEA 2WE7A 1A4UA 1UXGA 2YUTA 5FF9A 3WJ7A 3STHA 1UH5A 3GHHA 3ZN2A 4ALMA 4MVJD 4XQGA 1DC5A 3NT2A 1ZVMA 2I76A 4JQCA 3L6DA 2PFGA 2PA3A 4XA8A 1RYEA 4YJGB 4BNGA 1B16A 2X4GA 3WICA 1HETA 1NFFA 3CH6A 2X8LA 3GH3A 2W2KB 3BIOA 3T4EA 5HS4A 3R1IA 4I5DA 2PGJA 2CMDA 2VT2A 3VZRA 4HUJA 3RAJA 5JY6A 3RKUA 1T2EA 1R66A 2EXXA 3EAGA 4I5EA 4TMFA 4BV9A 1P0CA 4J90A 3I9NA 5LCXA 3K92A 3ZCXA 1N7HA 4JN6B 1X7HA 1ONNA 1L7DA 4CR8A 4WOJA 4OAQA 3HN7A 4PLHA 4ALJA 3OFSA 3HDHA 2DQ4A 2I5PO 3ANMA 3VTZA 2Q46A 4ZQHA 3LF2A 3MJEA 4XR4A 1QYDA 3C8MA 4C4OA 2X22A 3PDUA 1LLQA 3GG9A 1DC6A 2Q3EA 2O2YA 1ULUA 4WCDA 3GPIA 4FFLA 3F9IA 1YL7A 4MVJP 4Q3EA 2HKIA 4BKRA 5CP8A 1T24A 3UN1A 3PLRA 4KMSA 4WOKA 1R0KA 3EVTA 1VL8A 5C3MA 3TZHA 1RPNA 2V6BA 1OOEA 1FDTA 3C1AA 4CPDA 2IODA 1BRMA 4WE3A 1V8BA 3ONDA 4MVJE 5F5NA 3E5RA 3PHGA 4XZ3A 5TC4A 2POQX 2CDAA 5KKAA 4AJIA 4MO2A 3HG7A 3GMDA 3ZWVA 3PWZA 4CV2A 4FDAA 3RUAA 4WLFA 4HADA 4MKXA 4EEZA 4XGNA 4WCFA 2YHIA 2WEKA 1YB5A 3HUDA 4E0BA 3GQVA 4J0EA 4NJMA 1B15A 1S6YA 1LQTA 1SB8A 2YQ4A 3L07A 3UKOA 9LDTA 2VZ8A 4UEKA 4I8XA 4URFA 5THQA 4AJJA 1NQOA 1C14A 1R16A 3H9UA 4J7CA 3GR6A 2HSDA 1VC2A 2PD4A 5ICSA 3EY4A 3L4BA 1NVTA 5I7EA 2BMAA 2Q4EA 5DOVA 1GZ3A 1PEDA 1DIHA 1CWUA 1H5QA 2I99A 3K2EA 1MFZA 2AG8A 1U7TA 4DYVA 5L95A 4BVAA 1DOHA 2O48X 2IZ0A 4OM8A 4KQXA 4Z9XA 4JCOA 2VZ9A 1ISJA 1UDCA 4GX2A 3LLSA 4J9UE 4IY1A 5A3VA 4BKOA 3I9KA 1GYQA 2VTDA 3D4OA 2FR1A 4R51A 2GR9A 3K6JA 3FN4A 5ENVA 4BNIA 1NQTA 5LC1A 4ND3A 5BNFA 4MVJI 1MX3A 2QW8A 1KIFA 4IUYA 3AY7A 2QYTA 1OAAA 4W4TA 1K89A 4ZQGA 4YAJA 4DQVA 4UEJA 2Q1SA 3ITDA 5T5QA 3Q3CA 1N1EA 3UOGA 4B4OA 3OH8A 3GZ4A 3H2ZA 4DREA 5JAQA 3P5SA 1NQAO 2JD1A 4YR9A 3AFNA 1GZ4A 4CMAA 5KJEA 1FXSA 4XB1A 4CM7A 3DZJA 4XQCA 3S2IA 2OUIA 3FWZA 3H3JA 1X1EA 3M1LA 3NDIA 2CVOA 4J43A 5EN4A 3UICA 4OXYA 4EBFA 4CMCA 4Y67A 3SC4A 4FB5A 4AICA 3CXRA 1BXKA 3ZV6A 4XCVA 4IQ0A 3CKYA 4FJ1A 4CMKA 4GSKA 4MVJF 1XR3A 1ISGA 1WLYA 1FDSA 3ZU5A 3I83A 1E3WB 3WYBA 4JBIA 3BYZA 4IDEA 4OHUA 3ROPA 3ZHBA 1QYWA 4RQUA 1U5CA 5BSFA 3UGKA 4DBVO 4FBGA 1Z82A 2ET6A 3RUIA 3WWZA 2GCGA 1A7AA 1YDWA 4Q3CA 3D3EA 2YDXA 4WK6A 1AGNA 1PJQA 1NPTO 3ONEA 1LX6A 4NBWA 5C7IO 4ALNA 4BKUA 2V6GA 4EW6A 1HE5A 4BNKA 1WDKA 2X5KO 4WLVA 3NRCA 4YXFA 5B1YA 1T2FA 3DFUA 4R68A 1H9AA 1D1TA 1YGYA 3KVOA 1KC3A 2FSVA 5U9CA 3B70A 1NFRA 1YWGO 4QSMA 5JC8A 4EUEA 3OHSX 6LDHA 2ZYDA 1VSVA 1XDWA 4RF2A 1GPJA 4TQGA 1SPXA 2DUWA 4GMGA 3KHUA 4F46A 4MOWA 1ISFA 2VRCD 3DTTA 3GVPA 4CM8A 1BDMA 4J1SA 1HE2A 1PSDA 1HLDA 4NMHA 4W99A 3LSYA 5JBIA 4ZHSA 4R54A 2OHXA 2PTGA 4BGVA 1DAOA 1KEPA 3U3XA 1D8AA 4BO7A 3OEYA 1PJBA 1IB6A 3GAZA 1AHHA 1HYHA 2JD2A 1SEPA 3TSCA 3DTYA 3WQSB 3JQ7B 4B4UA 4KUEA 1ONPA 4CLDA 5HTOA 3JD1A 3H2SA 4KTTE 3V1TC 3K2BA 5B4TA 2C2XA 3ZU2A 1P1KA 3DBRA 1LQUA 4AL4A 5JCJD 5ER9A 1ENYA 4HP8A 2A4KA 4PLVA 3WGQA 3U62A 1JKIA 2R6JA 4DRYA 5L9AA 3UW3A 3PYLA 3AW9A 4BMVA 1DBVO 3INRA 3GEGA 3JTMA 3UFXA 5DP1A 1RKXA 2TMDA 1YL5A 3GZNA 1NVGA 2Y1GA 3W6UA 1JQBA 4ALIA 1LDNA 1TEHA 3SLGA 3AI2A 1SCUA 3JQ8A 4I5GA 3RU9A 1O5IA 5L3ZA 2CVZA 4A03A 1X7DA 2Q49A 1W8DA 3P2YA 4LRSB 3NAQA 4MVJH 3WB9A 2W8ZA 4BOYA 1XELA 4Q3DA 2YFHA 1R4MB 3ZI0A 4EJMA 1YL6A 5KKCA 2BF7A 3VKUA 4MJLA 4A26A 4ZQFA 1DXYA 5DT9A 2BFPA 1HRDA 1L7EA 4BB6A 5DCWA 3FNFA 3HB4X 4PLZA 3FD8A 3QWFA 3PGJA 3RBVA 4UVHA 2AQ8A 1I0ZA 2CY0A 2W90A 1TVEA 5ITWA 4L73A 1NWHA 1X0VA 2W2LD 4CV0A 1Q0LA 3WXBA 4KDEA 2NU8A 3I23A 5EQFA 4IMPA 1A9YA 3UVEA 2UYYA 2ZCVA 4R3WA 2W2LA 1HF3A 3SVTA 5AYVA 1XYGA 2AE1A 4ZN6A 1F17A 2QIOA 1DEHA 1NYTA 3DZFA 4WLNA 5EIOA 4HY3A 2HCTA 4RGBA 5DBIA 4BL5A 3TQHA 2J3KA 4W9NA 4WASA 2WMDA 2AXQA 2YJZA 2CF6A 4JP2A 1HDXA 1QSGA 5HWSA 3PJFA 3ZDFA 3AJRA 3PFFA 5G0WA 2JFHA 2E6UX 3MJCA 3D7LA 3BZUA 5JDCA 4DUPA 3LDHA 1PS8A 4L74A 1F8FA 4Q3AA 4CQMD 3CZMA 1UAGA 4JX8A 4OOFA 1YS4A 2QRJA 3S2GA 2VUTA 1PL7A 1RM0A 1TT5A 1PGNA 2NU9A 3WOHA 4CQMA 5L53A 4MKZA 3RUCA 4Y98A 2VHWA 2HJRA 5IJZA 5ADHA 3JQAD 1LLDA 4XQ9A 1DDOA 4PRKA 2AQKA 1Y5MA 3QE3A 4R9SA 1BMDA 1XGKA 3ZWYA 2ZIZA 4D43A 1EEHA 1MG5A 3WFIA 4IDFA 1T2DA 2O3JA 4DL9A 5I9MA 4U6SA 2PD6A 3GGGA 4D3FA 3EMKA 3E82A 1AHIA 4BNVA 3LZ6A 5G0SA 2X58A 3WSWA 5EJ2A 2WJPA 3WS7A 3EW7A 5B12A 1EDZA 1ZCJA 2D5AA 4NR0A 4BO0A 4C7JA 2X0NA 2RHRA 4F45A 1DRVA 3IS3A 1GAEO 3FBGA 1O89A 1QP8A 4M55A 4CLOA 2AQHA 1E3LA 3GPDG 5L7YA 1UP4A 5KWEA 3RC1A 1DHTA 1FF9A 1JVSA 3ZNNA 3RASA 1G0NA 2IEDA 4PLGA 4BKQA 4I1IA 5JSFA 2IYOA 1MV8A 2CVQA 4NHEA 4DQXA 3WQQA 4FFMA 5F1OA 4PN3A 5EQDA 2W4QA 1LNQA 4HNHA 1NNUA 5CDTA 5JAIA 3R6DA 1Z7EA 1C3VA 1ID1A 5K0ZA 4J2OA 1PWXA 1Z6ZA 1ZJZA 5AXCA 4RO0A 3WNQA 1I32A 2O23A 1PGQA 3WR5A 1DFGA 1VPDA 1BXZA 3VKVA 2B69A 4CMIA 3DZHA 4XRRA 2Z95A 3K9QO 4DGSA 4EZBA 3H9EO 3PJGA 5IXSA 1NBOA 3KTDA 1E77A 4E5YA 3ZV5A 1CIVA 3C1TA 2VUSA 3OQBA 1XIVA 2R00C 1HEUA 4PFJA 3QP9A 3OIFA 1HDYA 1M75A 2GGSA 2C5EA 1EQ2A 5EPOA 5IDXA 5JY1A 2YHIB 2OORA 1YRLA 3SX2A 3G1TA 4YA6A 5B4VA 5A02A 2CD9A 1O94A 5FEUA 1GUYA 2C59A 2FHSA 3EGOA 1LLUA 3F1KA 1E92A 2RAFA 3IUPA 3PQEA 4HFJA 1PJTA 4PG4A 4GL4A 3VZPA 3C85A 3INGA 3DO5A 4PGFA 1QYVA 1HSOA 1LUAA 3NTQA 3O03A 4YEDA 3AY3A 4E3ZA 5A9SB 5C37A 1NVMB 1U2GA 4II3A 2GUGA 3IAHA 3QWIA 1HTBA 3NGLA 1Y8RA 2C7GA 4ZJUA 2RIRA 5I9LA 1Q2XA 3F4LA 1VLLA 3ONFA 3ZWCA 4NQZA 2DC1A 5TLSA 2VYVD 3LU1A 1SO8A 3Q6IA 2ZB3A 2X86A 1EMDA 2JD0A 3LLVA 2D1YA 4RL6A 1F14A 4U8GA 4DBZA 4BO3A 1UR5A 2VYVA 5DN9A 4XB2A 1X14A 4YJHB 3MJ4A 1KEVA 3JD0A 4NFYA 2NLOA 4CODB 4UUPA 1N2SA 3JD3A 4J6FA 4RVHA 3VPXA 1GDHA 4P22A 3DMTC 3WG9A 4QQRA 1V9LA 3OICA 4A0SA 3I9MA 2V7PA 3L6EA 1GUFA 1RWBA 2V65A 3GDFA 3P2OA 2V6MA 3JQBA 1P3DA 1PGOA 4BNFA 1OMOA 3M1AA 3UAGA 5DDIP 4B4VA 5IF3A 4J1QA 1XA0A 1WP4A 4RVFA 2G1UA 3C3XA 4ZU3A 1QV7A 4KZPA 3AUTA 1HZZA 2EHDA 2B37A 3PPIA 4E2YA 2DLDA 1EUCA 4YAGA 3WGZA 2B36A 1ENOA 1YDEA 4YWJA 2X9VA 1Z7BA 1A71A 1NR1A 2HMSA 1PZFA 8LDHA 3MJVA 5EESA 2C5AA 4U0KA 5A05A 1A27A 2A92A 4OXKA 5GZ6A 4HX5A 1NHWA 5ES3A 2YYYA 4KTVE 4TKLA 1ZK3A 2Y68A 3D5TA 4PIVA 4K26A 4TKMA 2AHRA 2J8ZA 3TWOA 3C7DB 4F6LA 5KNLA 4NU6A 1WVGA 1JN0A 1K6IA 3HE3A 5EL0A 2Y1FA 4QT0A 1KVQA 4U6QA 4DPMA 3G1UA 3SEFA 3A14A 1MFPA 3FR8A 4ND1A 2HJSA 3ZWMA 5JMWA 1WW8A 3CMMA 2EV9A 1LRJA 5H82A 5JFOA 4BHTA 1HL3A 2AG5A 2O7SA 1IPEA 2Q45A 5TF4A 3H8VA 2OBNA 3VH2A 3JQCA 5DCYA 1ZK1A 4DC1A 2ZK7A 3B1JA 5T8KA 1RJWA 2OMEA 3X2FA 2BFAA 3IDSA 4XD2A 4GWGA 4BNYA 4P4NA 4XEHA 1H6BA 3GUCA 4FD3A 5B4UA 4FOOA 3RC9A 1NFQA 4ND2A 3T7EA 4EUHA 1PQUA 1ZXBA 1MLDA 2A35A 1BSVA 3NKLA 3JQEA 3SBOA 4AJLA 3VAZA 5AOVA 5L4SA 4GLOA 4J1NA 3VPGA 5CG2A 2GYYA 3QV1A 3QIVA 4IINA 2ZYAA 3LF1A 1YOVA 2I9PA 2X9GA 4ALKA 3ASVA 4GI2A 4GVXA 3GFBA 1DLJA 4DA9A 1ZW1A 4Z0HO 4J7UA 4ID9A 1XKQA 4JIGA 4YRDA 3RVDA 2GF2A 3TL3A 3WIDA 1P44A 2BLLA 1ZSVA 1A7KA 2G17A 1P45A 4M49A 4LMPA 1KEUA 4YJFB 3IL2A 1K0UA 3WGGA 3Q11A 3V2HA 3ZU3A 3ON5A 3ORFA 3KUXA 4NBUA 5LDGA 4AJ4A 4M87A 4OXNA 3UUWA 2DTXA 3UXYA 1T4BA 1V6AA 3O38A 2HU2A 2O3UA 3JD2A 1NHGA 4NI5A 4D45A 2IZ1A 4FFOA 2PLAA 3L9WA 4S1VA 1OFGA 1ZK2A 4NPCA 2YY7A 2P9CA 1I30A 1PX0A 1GPDG 2RBEA 4MVJG 3GHYA 1SOWA 3JQ8B 3MWEB 3EDMA 1R4NA 3NYWA 5JDIC 4LCEA 5C7OO 3NDJA 3MJTA 4TROA 3V5NA 3DBVO 4EDFA 1G0OA 2JJYA 4BUCA 4E2WA 3GEMA 3PTZA 2ZB7A 4OO3A 1T25A 4R5MA 3W4IA 1SAYA 1PGPA 2I6TA 4QECA 3I6IA 1YQXA 1QORA 4AFNA 3G17A 4Z9YA 3OA0A 4XYBA 2FZWA 4CL3A 4IS2A 1GTMA 1GEEA 4PG7A 4XJTA 4YBZA 3DOCA 3JQ6A 3M6IA 1YJQA 2IDZA 5DNAA 1JTVA 1IZ9A 3F46A 1MG0A 4NK5A 4H15A 2WTBA 4FFNA 1ZK0A 2CUKA 3EUWA 4CMEC 3C1OA 3CINA 1O95A 2XPCA 4LMRA 3DBLA 4MVJA 3QQPA 3O4RA 1G6KA 3IJPA 3K30A 4ONEA 3DMYA 1WZIA 2B4TO 3D3WB 4CLEA 1BG6A 4XIYA 3ROMA 2J3JA 8ADHA 2O50A 1I36A 4IQ8A 4J1TA 3BMCA 3EHEA 2DFVA 2VCYA 3HN2A 4N54A 3G79A 1Q7GA 4H7PA 1CJCA 1GV1A 3RSHA 4ITUA 1OI7A 1QG6A 4O6VA 1NAIA 1EBUA 1EE2A 1PZHA 3DC2A 3PRJA 1T1RA 4LSMA 1I2ZA 4DVJA 1MB4A 1QYCA 2A9FA 3Q2IA 1LSUA 3KYDA 4FC7A 3FBTA 4PLCA 1LBEA 1C0IA 3S2FA 1TT5B 3UH1A 2GN6A 3KSDO 2B4QA 4QXMA 2FSSA 3NJ4A 2J5KA 4D3DA 4E5PA 4ZGWA 5T57A 3AFMA 1Y81A 3ANNA 3DBHB 4CLXA 3ZH2A 4NJOA 4Z3KA 1CQJA 4RJTA 4YAKA 3KBOA 1GQQA 3F1LA 4GLLA 1EVZA 4IQGA 4QUKA 1NX6A 5A5EA 2HAEA 1E1MA 2VYND 2WYWA 1LU9A 4B4WA 3WTBA 3PFWO 1SZJG 5TT0A 1PJ4A 4WLEA 2Y1CA 3PP8A 1JA9A 3QVSA 2VYNA 3W1VA 4Q9NA 1I3MA 2VWGA 3Q9NA 2VWHA 1ORRA 3OJEA 3RBZA 1XQ1A 1Q0QA 4AJHA 3GY0A 3HDYA 3UF0A 3RKRA 1Z75A 3L6OO 4N18A 1O6ZA 2AW5A 2GPTA 4RPKA 4AVYA 1IOLA 4IZHA 1Y8QB 1OC2A 1HWYA 2VOEA 3FPLA 1GYPA 1PQWA 5MGBA 2SCUA 3EZYA 1JLLA 3VC7A 1LDBA 2FR0A 4MIYA 3LC1O 4HFRA 5TX7A 2UVDA 3GT0A 3T4XA 4HV4A 3I5MA 1MGOA 3TZCA 3NT4A 4BNHA 4CMIB 4LK3A 4RV9A 2R2GA 1E1KA 4RZIA 4RLHA 4Y6PA 1BVRA 3NDRA 4IJWA 3KLMX 4FGWA 4CR6A 1QXSA 5KVQA 2XAAA 4DMMA 1UXHA 2AE2A 3LYLA 3NX4A 3P7MA 1XU9A 1VRWA 2EGHA 2I67A 5I8WA 4D0SA 1DIBA 3FTPA 3DOOA 3KRTA 2VNAA 4IGFA 1F0YA 5DF1A 2XXBA 4Z9FA 5IZCC 5I7SA 4GKVA 5DULA 3E8XA 2BFMA 3GEDA 2NTVA 9LDBA 1WAMA 3MCVA 4WLUA 1SOVA 4BNUA 3TF5A 4TRRA 3GC6A 2TMGA 1VM6A 4GX5A 4BNJA 2C07A 3F6YA 3JYQA 3R3JA 2Y0DA 5JO0A 4QFDA 3VZSA 3M2TA 1ZH8A 4KDFA 2BI7A 3H5NA 2FPGA 2WD7A 2EJVA 2H5LA 5COQA 4Y9DA 1BXGB 4WJZA 3FSRA 4QEDA 3G0OA 2GD1O 4PG5A 3CE6A 2DPHA 3IOYA 2NSDA 3NJ8A 2RH8A 1LDYA 3TNLA 4J0FA 1LTHR 5GY7A 2QG4A 2B5VA 1B7GO 2DTEA 3KSZO 4DMLA 2BD0A 1UP7A 1I10A 3CTMA 3H9QA 5JW6A 3BMQA 1EVYA 4ZQEA 2OO5A 4N7RA 2VN8A 3E03A 1Y9EA 1ZK4A 3WNVA 3COSA 3QRWA 1Y1PA 4IIVA 4RPHA 1CDOA 3PDJA 4Z3DA 5ENDA 4G5HA 4XDZA 1YQGA 1KETA 3HZZA 2HDHA 3FNHA 4E6PA 2E48A 1E3JA 2RHCA 5JYEA 4UVDA 4YVFA 3WIEA 4YAEA 1IHYA 3EYWA 3ZWWA 4NNJA 1M6WA 1NPDA 3BMNA 1HDZA 3DZIA 5BSGA 5BSEA 5BQFA 4UEOA 4CM4B 3ANLA 1NPYA 4YJDA 4XYEA 5DP2A 2DM6A 1PTJA 1EUDA 2D4AA 2GO1A 4Y6SA 2H9IA 1H6CA 2B0JA 4B8WA 3JQBC 1XQ6A 4ND5A 5T64A 4GKBA 1ENZA 4J4TA 4WGGA 3DZBA 3QY9A 2VRCA 1I5RA 3L0DA 1DB3A 2EKQA 2FPPA 4IDAA 4DIOA 2W98A 4EGFA 3ADOA 4FQ8A 2OGUA 4J49A 3PHIA 4BO5A 1U3UA 5A1TA 4M8SA 1G1AA 3QW2A 3ZNQA 4RVDA 5G4LA 4BNXA 1ENPA 3W6ZA 2H6EA 3Q2KA 2NM0A 2E49A 3IMFA 3DFZA 3AU8A 2DAPA 4CJXA 1WXDA 3B20A 4GMFA 3VPHA 4CQLA 2I3AA 4E5NA 2O3QA 3EVNA 1MA0A 3NUGA 3AOEC 4IZIA 4ZRMA 4UVEA 3BTUA 2HK9A 5JCJA 1GADO 1F06A 3QWAA 1Y7TA 1WDMA 3I4CA 5IN5A 4BIIA 1E3IA 3PHLA 3TL2A 4B7CA 3D4PA 4WEQA 5ER6A 4K9DA 3JQGA 2Y05A 4XRGA 4RQTA 3OF2A 5B37A 1DC4A 1EE9A 2VT3A 3VH3A 1DRWA 3ZHXA 1YO6A 3PIDA 2WE8A 4RDHA 4F3YA 4A27A 4A2CA 3BXXA 3CUKA 5JLAA 3OEWA 1PR3A 3TOXA 2AEJA 1DAPA 3MTGA 5TNXA 3TFQA 3EK2A 1RM3A 5G4KB 1IULA 3D64A 4MIOA 1B8PA 5KJ1A 1W4ZA 1F12A 4II2A 2NNLD 2YV2A 4LCJA 2NACA 4CMGA 3AWDA 2P91A 1ZSNA 2Q4BA 3MTJA 4GVLA 3ICCA 1IY8A 3L9XA 2D59A 4KWHA 5CDSA 4CLHA 4FFRA 5TRTA 2E37A 3DAPA 1BW9A 1SMKA 3MWDB 5CDYA 2NV6A 2NU7A 3UCEA 4JXKA 4E13A 2BHLA 1FDVA 4R9RA 1HT0A 3U4IA 1X15A 4QX6A 1E5QA 3MEQA 3GGOA 3WGHA 4CM9D 4YJGA 3W8DA 1JAXA 1R0SA 1HDCA 2DBQA 2W2KA 4PG8A 4RCVA 4K28A 5COBA 3OETA 1PR9A 3PJEA 4Z0PA 2IXBA 1CEQA 3INTA 1C1DB 3KLPX 3PWKA 4RPLA 1ML3A 5T6BA 4MKRA 4RF3A 3ABIA 3WQRA 3GVXA 4TRMA 1P1RA 3BMOB 5K6AA 1GV0A 1DIGA 2GZ1A 1AE1A 1J4AA 4RF5A 1T2AA 2O3TA 5THKA 2DTDA 2Y99A 4LVUA 1UZLA 2V6FA 1WNTA 3JQAA 2JCVA 1V3UA 1LSSA 4TZTA 1NASA 2XOXA 1Z45A 2P9GA 3AUSA 5BNTA 4YPOA 4FW8A 3FHLA 2X0JA 3UCXA 1FK8A 3VHRA 1HE3A 5JAZA 1ZNQO 1PL6A 1ZEMA 1BWSA 1E7RA 3JQFC 4A5OA 1KS9A 4YTEA 2DUUA 3S2EA 1IL0A 4GH5A 3G49A 3OP4A 1DFIA 1X13A 2X5OA 1WMAA 2PY6A 2BGLA 1KYQA 7ADHA 3DQPA 3WLFA 2WYVA 4RLSA 2X1HA 2IE0A 3KOUA 5H83A 3L4SO 4AG3A 2O3RA 4UUOA 3S8MA 2FP4A 4E5KA 2GN4A 2VHZA 3IQDB 1P1JA 2HLPA 3ADPA 4R01A 4UUNA 2GZ2A 3B1FA 3H3FA 1D7OA 5G2OA 2OXIA 4Q39A 2ZJ0A 3ICPA 3ZZNA 4DWVA 1I3LA 1KVUA 4O1MA 3DDNA 2JKVA 4YACA 3HHPA 5A04A 2GSDA 2X0IA 4B3IA 2PKQP 4MP3A 1ZJYA 1I33A 5FI5A 3I3OA 2YFQA 3DHEA 3R0IA 2IZZA 5JO9A 2GRAA 4B3JA 4FGSA 1N1GA 1PJLA 1C0LA 2C2YA 4BMSA 1H2BA 5A5FA 3U4DA 4WCFB 1ISMA 4GX1A 1U3WA 2C54A 1WPQA 4NJMB 1AXEA 1LC3A 3GRPA 2PKRA 3PHHA 4HFMA 5CFZA 5U4QA 3GNQA 3DEYX 2DKNA 1KOLA 4IJVA 2D3TA 3GF4A 5IXYA 4NG5A 3RI3A 4NFHA 2B4RO 2H63A 1PIWA 2NTNA 2F00A 2DPGA 4WCFC 3O26A 4NFSA 4JP3A 4R1TA 1WMBA 2QRKA 2HMVA 1YE3A 4L4XA 1YBAA 5TJHA 2G0TA 3WBFA 2J5QA 1DIRA 4IDDA 1GCOA 1UXIA 2Y0EA 3D4NA 1UZMA 5DBGA 4CM5A 4ESOA 2J3IA 3V8BA 2HO5A 3RC7A 1FMCA 1U2DA 3O8QA 5IZ4A 1MXFA 3V1UA 1UXKA 4D46A 1E3EA 5TSDA 4WNIA 3L4BC 3ZHYA 4E30A 5IAAA 1D1SA 1HYGA 4JLWA 1ZSYA 4R16A 2IXAA 2ZTMA 2JHGA 4XDYA 5L4NA 1EFKA 3GNSA 2ILTA 3U4CA 4E2ZA 4MVJM 4BV8A 3RJ5A 1I8TA 1E0DA 1Z74A 3GFGA 5FI3A 2GNAA 2OP1A 1LLCA 1L1FA 2CDBA 2JCYA 3KZVA 4XIJA 5IFLA 3K73O 2ZATA 4R5HA 3KYBA 4IMRA 3DHNA 4LRTB 4YB8A 5I7VA 5KIAA 3KXDA 5F5LA 1QRRA 3BTVA 4NU5A 2YQ5A 1LC0A 1DC3A 1EZ4A 3FRJA 3FWNA 3KB6A 3WFJA 3NEPX 1HE4A 4XQEA 5F1KA 3WGYA 1UJMA 1HXHA 2QX7A 5KCZA 3ZWAA 3EC7A 1J49A 4L4SA 3LC7O
chains in the Genus database with same CATH superfamily
1VJRA 3RRYA 2PH3A 2CHUA 2FPMA 3EDQA 2H0AA 4G63A 5A03A 5JHGB 1DBWA 4KXLA 1QNFA 1YFLA 1WHSB 2OCDA 1NLYA 1Z5NA 2ECQA 1WDLA 1ZN2A 2B83A 3PITA 1P5ZB 3TN7A 2GZ3A 1QU2A 3L7JA 1Y6RA 2E9SA 2I6GA 4N5LA 3HLTA 2TECE 2G07A 4YAFA 3TQOA 4JYZA 2FEOA 4NV0A 4I8DA 1F2TB 4J2HA 1P6QA 3ZJVA 4X8MA 5EMNA 5CDGA 3ZCRA 1V2HE 2H2GA 4ZTUB 3O4JA 5G0UA 2BMFA 4DNOA 2ZYWX 4HQ6A 4KC0A 2P5YA 1EHYA 3EPPA 3KVNA 2ZJFA 3CKKA 4O59O 4A2PA 3WWEA 4FMBB 2O4CA 3LCJA 4GAEA 4XX0A 3KLOA 2P9BA 5KJ6A 3Q3EA 5TGTA 4EMUA 3GMSA 1Y3DE 5TQ2B 2IZOA 3H6HA 1VJTA 2C2HA 3D0KA 3DDCA 4R8KA 4TZKA 1RYDA 3G9UA 3C6XA 1ODLA 2G0NA 5JFTA 3DLBA 1E9FA 1G98A 2FSVC 4GR9A 4D74A 1UMBB 1OLXA 2C9MA 2E85A 3LBFA 3PT5A 4HQLA 4Z53A 1ONSA 4XKJA 3WWDA 4MV8A 4LF5B 4HGPA 1SNYA 2RG7A 3FDJA 4DIMA 1TOAA 2UXDB 4JJZA 2E5FA 1R9GA 4YMUA 4JJ4A 2W58A 1BWPA 4JJ8A 4BCCA 1ULSA 2EWMA 1H0KA 2V9ZA 3AFIA 3RYIB 2P1DA 3CSDA 2Z2YA 1ACLA 4QOJA 1P2VA 3R7WA 3A6GA 1ADBA 4ASUA 1GUZA 3L7YA 1CP2A 4PZCA 3I6YA 4RCYA 3RYHB 3Q9LA 1TRKA 4L3OA 1RM5A 2DJ5A 2Q27A 2UAGA 3F4BA 4M7RA 2JI9A 1E9VA 1N2EA 3QUBA 5C7LO 2HADA 3ABRB 1NSTA 1JFLA 1U7UA 3OZDA 2HL6A 2FUG6 3H83A 5BURA 5DNUA 4RTPA 1LV8A 3B6EA 4BO6A 1VKRA 1WLSA 2V7QD 3B6ZA 1TAUA 4N0PA 3GZNB 3HB1A 1AV7A 3KUUA 3UJNA 1PJRA 4QTXA 1H42A 2GYVA 4JS0A 4E31A 2H1OA 3E1KA 5KI6A 2DR3A 2EEZA 5DTQA 1R15A 3WKEA 2EJBA 5GONB 2D1QA 3GJ6A 2YV5A 5KREA 1SXJA 4EKEA 3LTNC 2RJNA 1KQ3A 4TYNA 2Q4OA 3CA8A 1GEGA 1YRQA 4C4TA 1B4DA 2H65A 2FPOA 1VCHA 3DXZA 4ZDWA 3OLQA 4P4TA 2DQSA 4Q9JA 5T7BA 1XTJA 1O5OA 2QAJA 2WTUA 2Z8XA 2NO1A 4ZA2A 7YASA 2JIPA 3ZC3A 1GGEA 2PZLA 1PJ3A 2BP7B 3BILA 3D2CA 1NW6A 4XB6B 4F71A 3OC0A 4ROTA 4BQPA 5L3SA 3G3EA 3GA0A 4OFWA 1LPBB 1O9BA 2JAXA 2OCKA 3JPWA 3KUDA 4R05A 2Z1NA 4U5QA 5BY2A 2ODEA 3LIPA 4F38A 4JBGA 2J4FA 1V41E 3DE5X 4B71A 4ESEA 4B0OA 4S3MA 5KWJA 1YQWA 5A4KA 5EWJA 2BKXA 3BH6A 3EZLA 3LH5A 4HAWA 5LIPA 3TOZA 1M73E 3W77A 3WGTA 3ORRA 2WAMA 4JK3A 4FK8A 4H35A 3HADA 2EIHA 1F4VA 5IJ0A 3AU9A 4ZI3A 5FBRB 4HNTA 2E82A 1W25A 2GFIA 3QYJA 1SQSA 1UKBA 4TL8A 2W0SA 4TRNA 5CU7A 4ER3A 1QV6A 1QQTA 4YAUA 1KZ1A 1AOXA 1UQTA 1ULHA 4O2BA 4QOSA 2CEAA 1UZAA 4OVKA 5JS8A 2VRWA 4K9QA 2D2XA 4KUHA 4ZMRA 1RWNA 5KU1A 1C50A 3BUSA 3WYEA 1Y34E 1GCUA 2ZRNA 3MXOA 5F5XA 2AKEA 1X2EA 1RT9A 2ZEJA 2QORA 3BZWA 4GICA 4HX2A 1SXJE 4QJ5A 1VGQA 2GX6A 3FHTA 1UC5B 2AZDA 4YV1A 1UBMS 5KWSA 4KN9S 5AK0A 1P19A 3BDAA 3NEYA 1OV6A 4HKTA 1OIWA 1K3TA 2ZWOA 4YJ2A 3N75A 2X41A 4FW9A 4FJ2A 5JALA 4QNRA 5IDYA 4G5FA 2LXNA 2AZTA 5CX1B 3WYCA 1WUKS 1HDOA 2GB4A 2JAUA 2R3SA 3VX3A 1OC4A 2JDID 2JFZA 3VJKA 1NXVA 4D7AA 3SQWA 1GPMA 3RC8A 5TGDA 3UJPA 5D1NA 2VJKA 3B2EA 4V1CI 2HX1A 4R1UA 1ZQ9A 3CX8A 1ACMA 2X0KA 4PC2A 2RB4A 1CCWA 4TWRA 5EIHA 4E51A 1WIWA 2JCXA 1DMSA 5J58A 1K86A 3EMDA 1AO0A 1P1HA 3GFOA 4RIHA 5HF9A 1R8XA 2VP2A 4PQFA 4EB3A 4CKCA 2ZB8A 3AHHA 3ZHSA 2D5LA 2GMWA 2GCNA 3GGJA 2EFGA 2BDTA 2C5SA 4A73A 3CLUD 3U7QB 1ZKMA 3PDWA 5GPBA 2G71A 1FDRA 4AYTA 2RHBA 1TCVA 2JRCA 2RC5A 4M0MA 1NURA 4Y30A 1BQ4A 4MB0A 1OXKB 4Y6QA 1ZUHA 1XZDA 1TYEB 3H4MA 5F73A 1G3RA 4ADSG 4KP7A 2PIAA 4TS1A 3VH4A 3RUFA 2PMEA 5CURA 5CYOA 3WGLA 1FFEA 2W8BB 1F8GA 2Q2WA 3I1IA 3GFVA 4HDCA 5KNCH 2H4FA 2EKPA 1PO7A 3X2EA 4KKVA 1FVHA 3RC2A 4FS3A 3TUJC 1NMEA 1CG6A 4CLOB 3HU5A 3VUFA 3ZHZA 2H31A 4FXOA 4D81A 2VF7A 2IBSA 1BH2A 1G5FA 1RI4A 1C7RA 4MKGA 1U4OA 1ONOA 1TMKA 2FW6A 4MVWA 3ZK9A 1E7QA 4QU8A 3E7PA 5KPDA 1A76A 4LUCA 3B85A 5IAKA 5CB4A 2P9FA 4E4RA 2BEWA 2GPJA 1IN8A 3U6BA 2QMZA 3K20A 5BVGB 2XIJA 4AZ0B 4LI3X 3P45A 3SBXA 1EXVA 4ZVNA 3ACBA 2UYOA 1H1LA 1EFUA 4ZZ2A 3RSFA 2CVFA 2GVNA 4PNZA 1QIMA 3WK4A 2PLWA 2PGAA 2PZKA 2QRLA 4ZOBA 5DTRA 4KFTA 3WAKA 4P82A 1BCRA 4KWIA 2QRVA 2WB2A 2YX1A 3WGIA 4QRHA 4LRXA 1YHNA 1L7NA 3HVKA 4X44A 3HQ4O 2DFTA 1I01A 1YA8A 1X94A 2GCPA 3FMFA 2LZ0A 3PFCA 4GPAA 4EZEA 3U7JA 1N0IA 2DWQA 1L5LA 5DHSA 5FUXA 3G0HA 1NXWA 3BDVA 3ROKA 1DJQA 3QSYA 2PMKA 5E4YA 2GM5A 4BNZA 1IOWA 3HXPA 1T4GA 3AUAA 4HC4A 1KERA 2SNIE 3O5AA 2D54A 2WHXA 4ECEA 4QPCA 1KXZA 1DKNA 1NP3A 2V45A 4BVLA 3ZK8A 2YXLA 4UHKA 2P9YA 2K2WA 1E3SA 2RGDA 2VJDA 3ANTA 1AU9A 3DWIA 2WPNA 3ETJA 4L9RA 4W82A 5HIIA 3AB7A 3SIPA 5I8ZA 1QP7A 1RQLA 3U13A 3FF4A 4YN3A 5JMPA 3BEDA 2PZJA 4P5PA 2LBPA 4PGAA 4JH0A 3OE4A 3DT9A 2J46A 4GU5A 3QVTA 3R3VA 4OQYA 3WKAA 1A9ZA 3DBIA 3IA2A 2QUKA 1ZW6A 1I94B 1B8VA 4AURA 5E4TA 2J9RA 4LTDA 5EKXA 4ESHA 5C8DA 3GJYA 5ILOA 5HRUA 4MV5A 3DTVA 3E2IA 3V2UA 1CYDA 4HQOA 2BIFA 4W8OA 4YQZA 4H3HB 4MGYR 4MW5A 1FJ2A 3C4VA 4NKRA 5FEMA 4TKVA 5BWLA 1E1LA 2HV9A 5HQ3B 3BHMA 1P33A 1RRPA 1EQAA 2CL5A 1N2IA 4G2NA 2IZ7A 1JKFA 5LQSA 4BFCA 4BQSA 2AA3A 3E70C 3WIBA 2QYSA 1IOVA 4OH7A 4B4DA 1KRHA 4Q4JB 3RD5A 5EA2A 5E6SB 4RY8A 2YV4A 3BGOS 2VATA 1AN9A 2XTZA 3EEIA 3L7NA 3MOGA 3PHJA 1U2GC 1VIVA 3CG4A 1UZNA 1KZYC 4V0QA 5CDHA 4MUIA 4MV1A 1IMJA 1U65A 1YZLA 4BVHA 5JQGF 1GLNA 3PR3A 5BT9A 3LUKA 5AKJA 2QGNA 1W44A 4QDOA 1QGOA 1L4NA 1R5OA 3FCOA 2PX8A 4QJBA 4MQEA 3L8YA 3NALA 4ZOEA 4QTZA 5KYWB 1Y0BA 3C6KA 3VJMA 3CIOA 5TR9A 4O5AA 1C1YA 5EMJA 1XEFA 3KFXA 5IX8A 1P62B 1TTPB 1HRKA 3AM3A 5EXXA 1A8QA 4QDKA 5TQ0A 4YT2A 3Q7EA 4XYGA 5AK4A 3WOVA 1WKCA 4D9CA 3GU3A 3LKDA 1AQLA 2QQ0A 2VBFA 2EZ4A 5HUQA 3N53A 5TJ9A 1T4CB 5CJPA 2BKLA 1E3MA 1Z0IA 2XCIA 1U0FA 1SKQA 3L1JA 3PC7A 3JVEA 4MULA 5I9NA 1DO8A 2BR4A 4YASA 1RAFA 4BGEA 3PGXA 3NBQA 1W1IA 2DSNA 2ZIXA 4L95C 3RANA 1EIWA 4AQ7A 2J09A 1B6SA 1CQIA 1YMQA 3HDQA 1Z73A 4D4MA 2IRWA 2TYSB 1URPA 121PA 2QL7A 2Y93A 3A4LA 4HB3A 2PCLA 5HF6A 2D0PB 3TX6A 2IYUA 4COOA 4R6WA 1T0UA 1TI7A 3FIJA 1U9IC 3FNEA 3GT7A 3KKQA 4N6GA 4ZK6A 1LX7A 4LXGA 2E4WA 1TGVA 1W30A 1OFUX 2XVXA 2HSZA 3REQB 4DCMA 4NAHA 5JS6A 1DOAA 1PBNA 1KNXA 2ZULA 3ECSA 1JDUA 4WFKA 4JVOA 2VK8A 4BZXA 3FYUA 4GGMX 3M81A 5C4IA 3QVGB 6CHYA 4QQKA 5K4GA 1F2UA 4BXOA 4BMNA 2GJ8A 1NW9B 2OK7A 1F0PA 1NI3A 4XDHA 5CB0A 4RFSA 5J4KA 4WY5A 4DPKA 5FV7A 4UHFA 3K4HA 4D9IA 3OAAA 1U0BB 2P30A 2R48A 2R6GA 3TPFA 5K6TA 2J87A 1DSSG 4TTJA 1FDIA 2FMKA 1M1YA 2JL1A 3MCTA 4HNAB 4S12A 1RYYA 4E5DA 1M66A 1TB4A 1H6AA 1QIEA 4N3NA 1DFHA 4O63O 5ADUS 4XYMA 2X2FA 4D4KA 5ILGA 4YRSA 1DEAA 5JDIA 2H1VA 1ZR4A 2AUMA 1HNWB 1JDBB 1LDGA 5H9VA 2FN7A 3W8EA 5CFNA 3KT6A 3NTOA 1SG9A 4MW9A 3SVZA 3QTBA 4I8IA 4K81B 4YPVA 1JKXA 2EW1A 1UWLA 1T5HX 1ZMTA 2ZUCA 3F5QA 5JJIA 2AHOA 1U1DA 3D8TA 4I9NA 1SUCA 2DSTA 1QKIA 1PFKA 4HXYA 1CVIA 4KUGA 2R87A 3BA1A 4L0QA 3TTXA 1ADFA 2G4CA 1BHJA 2FP3A 3HRIA 1QFXA 3IDFA 2QW1A 5ALZA 5K8VA 2YMMA 1J90A 2VTBB 3UJ9A 1J06A 5JD4A 5SV2A 2P5TB 3I4FA 3X1YA 2A5DA 5LQUA 1CY4A 2PVPA 3QFHA 3FJOA 4DMRA 4DLXA 2YZ2A 1PYOA 5HCNA 1QQ7A 4A0RA 1HFWA 1H0HA 4TTRA 5LQKA 1EM8A 1OT3A 3OJXA 5TMBA 3EQZA 2FY8A 3T99A 1IFXA 5D5QA 4COKA 4Z4FA 3THYB 1KIMA 3AERB 2O5EA 3GNTA 3C2QA 1MAVA 2NUBA 1BE8A 4ZANA 5FAXA 3S27A 1WZEA 2A57A 2RC6A 1M1YE 3SPXA 2P68A 4Y3UA 1I3NA 4EG8A 4NCBA 2C4NA 1N7GA 4XVQA 3WVNA 1NJ2A 3GRVA 3AEKA 3VSDA 3JVUA 1KI3A 2HUNA 1P74A 2BFFA 3KNZA 1IAQA 3BAFA 3C3JA 3DZCA 3VPAA 3DFMA 2DBZA 3E7FA 2B92A 4UBLA 3FPCA 5EUCA 3BK2A 4IIDA 1T26A 2RAUA 2G08A 2VRBA 1BYUA 4MRNA 1IQPA 1MRNA 2F3QA 3RQSA 4PFKA 3W4KA 5FPHA 1N8KA 3G5LA 4RKWA 4Q05A 1CD5A 5AW6A 3IRUA 4OHPA 3FYTA 2SECE 1D04A 3NGXA 2RSLA 1MRSA 1J00A 3BGIA 1WPXA 2OY0A 3LM8A 4FOSA 4B74A 5IYZB 1QBGA 2PAAA 3PICA 1BAPA 1XCMA 2I3ZA 3D5QA 4YNBA 1E96A 1PJ2A 5JSKA 1MEOA 2GAFA 4PAWA 5EJEA 2CCGA 4U2CA 5DX1A 2X8AA 3RVNA 1E5DA 4L8VA 1D0SA 2CNDA 2HF7A 4FYKA 2FQQA 1U3TA 2AXEA 2BGTA 4Q01A 4WI1A 721PA 3HL4A 2B99A 2Y1DA 3GDGA 3PSHA 1UJ5A 3GEBA 3FVQA 1CF2O 2E87A 2I2FA 4NRDA 4RPGA 4Z7QB 3NETA 4C3ZA 1C9KA 1QG2A 1CLUA 1U2ZA 2GCOA 4A8HA 3CKMA 3HCOA 1G21B 2ZR8A 4YDSA 3R7BA 4E4YA 1MQ8B 3T7AA 1W36D 4IFBA 3AXSA 1KEKA 3B7GA 5I7UA 1SXPA 5KJFA 1O3YA 1M2NA 5ESDA 4EQZA 2QUIA 4RA9B 4QGFA 1SIUA 1ZITA 4GZ3A 1RWKA 3ESRA 3KCNA 4M4SA 1N1DA 5D3MB 4BYGA 4EI2A 1K5GA 3B78A 4NK4A 4MVXA 4NZYA 4RH0A 3SJUA 4EJ0A 1GTRA 4RGYA 1OGIA 2CNNA 4YREA 3TIGA 2C84A 3W4JA 4MQ6A 1IMOA 5ALWA 3LCRA 5FBWB 2NSLA 3LBIA 1K5HA 2IKQA 3FUXA 3BMCB 1UPAA 2JANA 2WINI 3VU8A 4LZAA 1WXGA 1DGQA 1M5UA 1V16B 2IY8A 3K0EA 4H1VA 1HLGA 3D02A 4AMVA 4RD1A 2BSQA 2J3QA 1TQDA 1HDIA 3ZYZA 3KYDB 4QNNA 4ROSA 4PBSA 1ISIA 1H9BA 3IUSA 3SZ3A 5KYKA 1KJ8A 3P19A 2YCLA 4EY6A 2M1ZA 4HDKB 4N5MA 1KVRA 1FQJA 4FE4A 3SS8A 5KOHA 2PLNA 5JNLA 4KQIA 1R8JA 2C20A 3DV9A 2B8TA 3RODA 3FGNA 4PO3X 3U49A 4WKPA 1E2PA 3OEHD 5ALUA 3AINA 4FFPA 3MS4A 4W7IA 2J0SA 3NVKI 5HJ7A 1S3SA 1R37A 5I5GA 4L3VA 3HY4A 1X87A 2OZVA 3OJOA 4KFSA 5IJWA 5LMNB 3Q8MA 4A0HA 2HMWA 4QFMA 1R8SA 5ERXA 3OOWA 2JJ1D 1A4RA 4BV2A 5KVCA 3U80A 4HRXA 4JWTA 3LKVA 1XJ5A 3N58A 4R40A 1V35A 1Y8CA 3B9QA 3FGPA 1YULA 3EGEA 2C0QA 5DGCA 3HZHA 2W00A 3WIVA 1PT9A 2G8LA 3RVSA 4BE7B 5C5DA 4U3JA 1TYCA 5KSYA 4FDVA 5FO0A 4E07A 2OAEA 1EFTA 1N57A 2HIAA 4GD3Q 1T9AA 2LDXA 2NO9A 2RIPA 2P3SA 3IVXA 1W52X 1KY5A 4W1QA 1LZLA 1F8UA 1EA5A 1IBSA 5KMGA 5AVOA 4YRBA 1LFAA 1PFWA 2GN9A 1R2QA 2OAQ1 3SLKA 1Z3IX 3P97A 3PXAA 5AOCA 3ZW9A 2DQYA 4IGEA 3OFKA 4FXPA 3QU4A 2HUPA 5ELXA 3ZJUA 2Q3FA 1F4PA 1EXDA 5CG1A 5JAPA 1KP2A 1JKJA 4Q9IA 2KLBA 5A3QA 7REQA 5LOVB 4K9PA 2OHJA 5BSMA 3LGXA 5B1SA 1H1TA 5ITVA 1ZVVA 2D4HA 3R3YA 1GNTA 1QKJA 4IDCA 1EVKA 3HNRA 4JR1A 4L78A 3VNAA 2Z6UA 3N2KA 4GWLA 4QYTA 2P4QA 3SZLA 4LF4B 3G0IA 2ZR0A 4M0FA 2ZUUA 5KJCA 3TPZA 1WXWA 3MK31 3Q8LA 2LD4A 4GS5A 3UZUA 4RAQA 4PQYA 2V74B 5FYDA 5TEVA 4QLAA 4YCBA 2OHOA 4KR2A 5F1PA 2JAHA 3F3SA 4EYEA 5C4GB 3RV4A 3Q8KA 2VOJA 1P1FA 1SZDA 4DR6B 3ILVA 4EYSA 2GEUA 4NZNA 3PD1A 5KNCA 3NQ41 3THXA 2IU3A 1ZMBA 1DQPA 1UEXC 3OO1A 5BNIA 1SELA 3MYRA 1EFPA 1QJ4A 1Q3HA 1JQKA 1Z47A 2EBWA 2HQ1A 3N87A 3WK9A 5E6UB 4F85A 5JTTA 1EG2A 3OECA 4FR5A 4G1FA 1HEYA 4NCAA 1GZSA 3CVOA 3AGPA 3EJ6A 1GSHA 4A6EA 1A5ZA 2A5YB 2YJ5A 1ECCA 3DAGA 5FPTA 3MGKA 2HMUA 4U2EA 2O2JA 1OXMA 2HIMA 3OM9A 4KVGA 3R75A 3QVMA 4D44A 2ZQ5A 3V2GA 2OE2A 3RS0A 5K09A 1E7WA 3X0DA 4FSHA 1TPYA 1NT2A 621PA 3HY3A 3QA9A 4R69A 5FAKA 1T13A 4GSLA 1EP2B 3HCCA 2BZ0A 2EP5A 4BGIA 1G4HA 1ND6A 4Q4LA 3MBOA 2GWRA 1VKOA 4TWAA 3WHIA 2PUTA 4AJ1A 1H9CA 3N07A 1QPGA 2QIPA 3ZGOA 4C1NA 3NTUA 3RVQA 3AVUA 2F1KA 5FWYB 3OT1B 2G83A 3MT9A 3MZ0A 4PM4A 1RADA 1IHXA 1UOPA 3LGAA 3QUAA 3OO0A 1WE2A 2PWBA 4EB8A 4YCLA 1HX7A 5K0FA 1CRQA 3WKCA 2DXIA 1N9GB 2OBYA 2GJAA 4D56A 4EHFA 4Y2VA 1I13A 2VDKB 2OL4A 4OHWA 4ZV4A 3TRIA 1JR3D 3R5SA 2P4UA 2NG1A 1MIOA 3DOFA 1OPRA 4QXAA 3QVJA 5HEKA 2O7QA 1Y6JA 2P2NA 3EIXA 5JSYA 1KJQA 2UYCA 3OPQA 3BMQB 1JW9B 4YJKA 2XRZA 5EP1A 4OIFA 2C4VA 5ALHA 2WA2A 5JSUA 2BFEA 1GTZA 4HWKA 4YLEA 4TVSA 4ERXA 2GLXA 3FCEA 3MMZA 2H1WA 2IEAA 4AIRA 1T3ZA 3W2FA 4BO2A 2HT6A 2VTEA 4P8RA 5B55A 2J6IA 2Q3MA 3KB1A 1VJ0A 1YACA 1XCLA 5EVJA 3RH0A 4ZCTA 3PJDA 5A9RA 4M1OA 4JQCA 3MRSA 1Z7GA 3AOEA 2XHZA 2UV8A 1N2ZA 4IH1A 2O0KA 1ZNWA 3ZX4A 1SVSA 1G1MA 3LDUA 4R3NA 4KPEC 4YP6A 3HR8A 2XRYA 5FP0A 3FSEA 1WXFA 3T1OA 1C3JA 1EAYA 1OZFA 5FOWA 1ZINA 3KPYA 3PI7A 1GPNA 4NTZA 2HCRA 1OTYA 2RB5A 3H1BA 4RABA 1XE3A 2MINB 2VHVA 4OMUA 5I7FA 3CEMA 1MB0A 1EUDB 2HBYA 4LN1A 4WVLA 2C5GA 2II6A 3WHPA 2PZ8A 1PNRA 3DZKA 4H16A 4NONA 3HV2A 1UL1X 1T4DA 4WL0A 1T43A 1Y7HA 2IHVA 2W2VA 2ZIWB 5BQPA 4BWGA 5D5HA 1KH2A 2ZDGA 3ACCA 3KEOA 4RD4A 1R0XA 1AZLA 2GA8A 3K09C 1XWWA 4HZUA 3U9LA 3D8RA 4OHYA 4LECA 3LT0A 1ZICA 5HIMA 4V1CA 2FW1A 2ZAIA 3LT2A 4YCCA 3JZFA 3WL4A 3JQDA 1GNPA 3DLPX 3TKAA 3M6XA 4WKGA 1LJ8A 3LP8A 4PCVA 4B8ZA 1PTJC 2V3WA 4G24A 4PZAA 3ETCA 2ATIA 4ZVVA 4UREA 3RIMA 4GI7A 5F3RA 1ORDA 1XTQA 1AKTA 1WMEA 4BQRA 2F3RA 1S1MA 4NENA 1Q91A 2P2DA 3K31A 4GPD1 4IHKA 1KGDA 3AB3A 4M1SA 4NAUA 4UNQA 2XT9A 2OKGA 4HFNA 4ENSA 1KXJA 1GD1O 2JI7A 5D2CA 5ALVA 4OQMA 1D9XA 4ZDIA 2QV7A 1PF7E 2ZQZA 5JSHA 1RM4A 1DJLA 2IHNA 3F6BX 3MAAC 4FC6A 3VJLA 2M6KA 1VKHA 1H2RS 1P1CA 2QUJA 4TM7A 5K0TA 1W75A 2WWIA 5H8WA 3GN1A 5BR7A 3IR6A 4DB2A 1O6CA 4Z3OA 2O4UX 1E89A 3FY4A 4IOMA 5AUOB 3OLXA 3QKRA 3RWBA 3DEHA 3VNUA 2NSYA 3N7UA 2XVMA 4K9LA 1IPFA 4XWWA 3W8NA 2Q0QA 4WZBB 4CKXA 1U2PA 4KH1A 3RADC 1CHNA 3A2NA 2MYTA 2CZCA 3KQVA 3A1EA 3BGSA 4H6XA 5KUTA 1N2CA 1KAQA 2VL7A 3D81A 1VI5A 1USWA 3PEVA 4Q1DA 3DW1X 5TPZA 2VKTA 1ZD3A 3EGXA 3UMRA 2PWAA 4D97A 3RS9A 1Y80A 2D5CA 1YGPA 4BNDA 4OIMA 2J0QA 1YJAA 4Z0TA 3MA0A 4NDAA 4Y9UA 3JSAA 2V0NA 4GC9A 1NWCA 5DE3A 3UJ6A 5DEOA 4BC1A 4I55A 1TRHA 4AK9A 4B3BA 1A7UA 1VJDA 3HUUA 4BFXA 2P6RA 2YZMA 2YV1A 2K7ZA 3U5TA 5TDHA 4YLYA 5SZKB 4LY0A 2P2LA 1QTIA 2P35A 1VLJA 2F3UA 3WSVA 4YT4A 3DQQA 4JEUA 5BWBA 2G7ZA 3QLJA 3HEMA 3HP4A 4AJEA 1ND5A 2DHDA 3M5DA 3GD7A 4DMFA 3KJEA 2NU7B 1H2FA 1GFWA 2YUTA 3I30X 4EZIA 1Y9JA 1IC6A 1G41A 4IOKA 4MR9B 3ZN2A 3QK7A 4MVJD 4XQGA 2Z4TA 3NT2A 1ZVMA 1E32A 2P79A 3JAWA 4P53A 4B17A 4YR7A 1N2CE 2OD7A 4NV1A 1OYOA 4CHGA 5DIFA 2W2KB 3RS7A 1KDOA 3DEKA 3JXEA 1XO1A 3R1IA 3VR4D 1T9HA 3T5PA 1V8PA 4HUJA 4JA0A 3VR3A 3CSUA 3AGQA 3EDOA 3RKUA 3F4KA 1VZ3A 3HCRA 1E2GA 4BLTA 2BBTA 3LRPA 2YJTD 4FR0A 4AG6A 5DWQA 1N7HA 3FCYA 3N2ZB 4D4JA 3PRYA 4BMXA 1ZR2A 2HSEA 1ONNA 3Q7TA 3QOXA 2ADMA 1YJCA 3E3MA 3SC2B 2CFOA 3OFSA 2D74A 1OH7A 1PZMA 2BKVA 2GJKA 2BISA 2VNKA 1V95A 4JWKA 4ZQHA 1QHIA 2JATA 1CJTC 3VTZA 2Q41A 5L3VA 1XEXB 2X4IA 1IHOA 2WABA 2X22A 3NG1A 3VYWA 4C01A 1PAUA 1K3UB 1PD1A 1QZZA 1QIJA 2J9XB 2W22A 1M1UA 3PE3A 1ULUA 1TO6A 1EG7A 3GPIA 4UBMA 3WP0A 4DJTA 4X1YB 5ICGA 2N0SA 4LY3A 4CE6A 2IPLA 1D07A 4WOKA 5IMBA 4HH1A 1VL8A 2X4LA 3IUQA 1QH1A 4YRZA 2P8JA 1IHPA 2BCEA 4QYSA 4X3CA 2VHJA 4BLRA 2ZDQA 1GM5A 5BN3B 1FDTA 2C9YA 2PUGA 2PEZA 1GG5A 2OC9A 3C1AA 1MEEA 4JFRA 2IODA 1BRMA 3OQIA 2ZSFA 4WE3A 5EC8A 5F5NA 1Z0SA 2WZBA 3E5RA 3NPAA 3BF8A 2G67A 3EXIA 2POQX 5ECDA 1KAGA 1T8RA 2CDAA 5LA6A 3SNKA 4AJIA 3GMDA 4IW3B 7GPBA 4DR3B 2A7XA 4FDAA 3RRXA 1QF6A 3OZWA 1E3QA 4L27A 4EEZA 1J39A 4FHCA 4XGNA 3WNBA 3B7WA 4GEGA 2WJIA 4RDXA 2F67A 2OBLA 1KJYA 2YZKA 1KY3A 4QDUA 2YQ4A 4TV9B 4WOCA 4ZZ1A 4CEJB 1H8HD 2BZ1A 2XRFA 4P5EA 3B6KA 9LDTA 2CNKA 2VZ8A 2XCTB 1MJHA 2XUKA 4AX8A 1KOJA 1QFMA 4FZVA 1RPJA 3EF1A 1VCNA 4MLCA 2G36A 2FJ0A 1QPZA 2QF7A 1JILA 2M6SA 4EHDA 2CT8A 3RYCB 1QDLB 3CLSD 2PWYA 4KE6A 4RSGA 2FMTA 1F51E 3LUPA 1MR3F 2TS1A 1VC2A 3M4JA 1FYWA 2W11A 4TOIA 5IF9A 5I7EA 1WD7A 1LK0A 1XTIA 4LG1A 5DOVA 3CC8A 3CKLA 2Y77A 1PEDA 3EOZA 1RKUA 1H5QA 2VPWA 4W5TA 1MFZA 3UJBA 2C0PA 2QG9A 2AG8A 1U7TA 4QLOA 3U31A 1EDEA 1L5QA 1Z37A 4UM7A 2O48X 4IHJA 4OM7A 5EXSA 4L9SA 4EGSA 4JCOA 2UVQA 3BM5A 3CG0A 2O2CA 1N6LA 2FXIA 8MHTA 1KAEA 2WM2A 2BBSA 4IY1A 4BKOA 3ZDXB 4FIDA 2YASA 1XZBA 1GT6A 2AYXA 3I9KA 1ECLA 1JFVA 1TMYA 2YINC 2CV0A 3TH5A 3K6JA 3FN4A 5ENVA 4YRPA 5E38A 3S1AA 3FTDA 4BX0A 5LC1A 4ND3A 5HJ5A 2RAPA 3LW8A 1ZOOA 1KIFA 1O5TA 1BE1A 3AY7A 1DJPA 4ZQGA 3UJCA 3ITDA 2H9AA 1F6WA 3I0ZA 3LQRA 5T5QA 3DLHA 3GCWA 2Q28A 3QPBA 5ECYA 4P9NA 2DFLA 2JIZD 5AW9A 1S2GA 2EQBA 3OX4A 3WI7A 4F8YA 4ZAYA 5FRDA 4Z7JA 4Q3KA 5KJEA 2IPMA 3H2IA 3BF7A 3D6FA 3NDIA 4JJ6A 3M1LA 2C5BA 3BFXA 2E1RA 2R7KA 5EJ4A 4UDXX 3SC4A 5GIPE 2C7OA 1A9XB 1VBFA 3LUJA 3CXRA 2JF0A 1ORIA 1Y1LA 1L5HB 2H8GA 4RU1A 4J0CA 3ZV6A 2XCSB 4IQ0A 1YQEA 2ZVJA 3T6KA 5B7QA 5I6DA 3A04A 4CMKA 1IHDA 1SU8A 4DE5A 3AEZA 3SR4A 1TAHA 4FYPA 2M32A 4HBZA 4RJJA 1XKXA 3M82A 5BP7A 1U8AA 1FDSA 3WJ1A 3VV2A 3B38A 4EY8A 3R44A 4LMBA 1KMMA 3ROFA 1X8LA 4IDEA 1KMHB 3QW4B 3O7MA 1MO6A 4LOJA 3UWPA 3ZHBA 5EKDA 2V1XA 4D82A 5BSFA 1NGSA 3RUPA 4FBGA 3U0VA 3JWHA 2HQRA 5C8YA 5D8DA 2WYOA 3RUIA 4BASA 4B33A 3WGVA 1JEYB 3UAGA 1JHMA 1A7AA 4IZOA 1P9RA 1KYWA 3NHZA 4BN4A 1GGVA 4LSZA 2Z8YA 2NPFA 4BPRA 1AGNA 4DDTA 1FMTA 3BXOA 1QOZA 3C6YA 2A5GA 2HCJB 2QUHA 4CT0A 5C7IO 4BKUA 2V6GA 3AVWA 3H87A 2HB6A 1XA3A 4JP1A 5J5CA 3TLZA 1N3LA 3LHFA 2VPQA 3NRCA 3TRKA 1A9RA 1RQPA 4V0KA 3Q3GE 3TG8A 1D4AA 3FWYA 1H0SA 1TO2E 1V7PC 1ZMXA 1F2TA 3W05A 5LQDA 2AOTB 2GVZC 3F78A 3KVOA 1KC3A 4ZCMA 3B70A 4EPRA 1YWGO 4EUEA 5FBZA 4MRVA 1RMQA 2LCIA 2O8NA 2NUTA 4P80A 1OAOA 1QB7A 6LDHA 5KQPA 5M04A 3IALA 2PRIA 2D2FA 2XMPA 1Z4NA 3SYNA 1SPXA 1SD1A 4KFRA 1P7YA 4WZAB 1DG1G 3AF3A 5J2UB 4M7WA 3BE8A 4F46A 1GNQA 5B58C 3SQXA 3STWA 2L18A 2WSSA 4I4TA 2FZVA 3LWBA 1X7ZB 4S1OA 3ZI4A 2PYDA 3ZTYA 5JOQA 1HE2A 2BZGA 1J2RA 4NMHA 4JI8B 2QQGA 1ZUIA 2ODBA 2OHXA 2PTGA 4BGVA 1I9GA 4RD0A 4TYWA 1UMBA 3W1EA 2FUCA 2EVWX 3DDUA 3TW8B 2ZTSA 1X2BA 3I05A 3GAZA 4TTVA 4JZYA 1L4EA 4Y0NA 2CWDA 3DTYA 4B4UA 4FT4A 2BF4A 2PSHA 3ZS9A 5HTOA 3JD1A 1Z17A 3K2BA 3R2JA 2C2XA 4ZU1X 2P3OA 3AYXB 2Q7XA 4HYEA 1LQUA 3RYHA 3QU2A 1IRXA 1BGXT 3Q6MA 4HP8A 3EW9A 3OE7A 4PQGA 3U62A 2R6JA 2Q9BA 4LNAA 1P7VA 4N3AA 4DLTA 5I48A 4UW9A 4QGHA 2PJUA 4TYQA 3PXEA 2Z0MA 4LWZA 1BMTA 2XXAA 3LO5A 1DBVO 1VPTA 3ZR4B 3GEGA 2CXNA 3DLIA 3JTMA 4W6QA 2TMDA 3NH9A 4UMDA 5DP1A 5SY6A 3GJ0A 3GZNA 4EDHA 2ZXUA 5ALKA 2R1UA 4DCTA 2OBFA 5J59A 3SQDA 1W5FA 1PL0A 1DAEA 4A4DA 4CQNA 1G9XA 4ZV7A 4F2PA 1SUWA 1CY8A 4JYMA 5GONA 3RU9A 4EOGA 3EEQA 3IKLA 4FFVA 5L3ZA 3SHOA 2A9QA 1G5PA 2B5OA 1WUTA 3P2YA 4FI3C 1JDVA 1L5FA 4H18A 4M6WB 1DX9A 4RIFA 4AP6A 2XMBA 4EF5A 3C6QA 4JOQA 4UPDA 2YFHA 4DHEA 1I6LA 1ZIOA 1J8DA 3E8SA 3QLEA 4PFQA 1QVWA 3IX7A 1IZZA 1YL6A 2XTMA 5BYKA 5KDDA 1DQSA 4KBYA 4Q9LA 3VKUA 4AW9A 1JHYA 2BP7A 4A26A 3FMVA 1DXYA 2Q7DA 2I2CA 4JUBA 3HDGA 1HRDA 3NUQA 2Z30A 3FNFA 5CR9A 3FOEC 3UOAB 3O74A 3FD8A 3K0BA 4BECA 4OP1A 4UVHA 1JHVA 2OT3B 2JGFA 4BGDA 2CY0A 4UU1A 1TVEA 2RK6A 2HA6A 2ORWA 4H4EA 2J0UB 2QD1A 2DE0X 2Q4RA 2JAOA 4Y1FA 4CV0A 4Q34A 4KDEA 4K8OA 3N7TA 5ABPA 2HM7A 5EQFA 1XTTA 1N4DA 1OWOA 1RVDA 3G2KA 4JJAA 2ZCVA 4DV7B 1S01A 3VZDA 2BFNA 3NM5A 2GTIA 2XCQA 3AP1A 1W48A 5EHGA 2HSWA 3SVTA 2R44A 4ZJZA 3ILXA 8GPBA 1XYGA 3I5UA 3QNWA 1FC0A 1F17A 2UZ3A 1DEHA 3DZFA 3OCYA 3P9YA 5EIOA 2NXNA 3FAKA 4HY3A 4RGBA 4DCUA 2REBA 4RTLA 4TS4A 2ZITA 1G42A 2J3KA 3H1GA 4M76B 4W9NA 2WMDA 2N46A 3RRFA 3OIVA 5DI3B 3CEPB 1KL7A 3IEPA 3QX9A 3BBPA 1CQPA 2EL7A 5CLLA 2YKGA 3QUQA 1QFSA 5CT8A 3C6BA 1L7BA 3AJRA 4Q4AB 2R1VB 4PYKA 4Q7LA 2VJBA 2ZRPA 5HYVA 2BGRA 1XLVA 1R0YA 1UBKS 4F5ZA 2FRDC 5JDCA 1AIPA 5IVHA 4L74A 1F8FA 1RMYA 1QVRA 2XUZA 3C7KA 3H3XA 3CCFA 3N2NA 1K7YA 3B51X 4GW3A 5CX1A 1WB9A 2BKEA 3FVWA 2ZS9A 3FUWA 1KGSA 1NMSA 4FNMA 4JX8A 1TDJA 4L22A 4RK7A 4LIPD 3R0QA 4WXYB 4PYJA 1AGXA 2MSEB 4XM1A 3RW9A 1KO7A 1GVHA 2WTXA 5CM8B 5ALDA 5L53A 3LGSA 5ADHA 4GFDA 5TY0A 3L1UA 2P4EA 2JLSA 1DDOA 4BIMA 3DCIA 4D6XA 2AIRA 1Y5MA 3U6KA 4I4NA 4G37A 4LJ9A 1I3OA 2F62A 4D43A 4OTZA 1W0JD 4Q1FA 4CKBA 4QG7A 4AT1A 3KOYA 3QXGA 3QYFA 2JFYA 2HCFA 4BNVA 1Y42X 1F1JA 1KO1A 1CFZA 3EVCA 3U7QA 1XPOA 2HR1A 5JJBA 1ZH2A 1CRZA 1YRBA 1TM4E 2MT9A 3WSWA 4KN6A 2X8WA 4OHKA 5AKHA 4UXHA 3EW7A 4PPNA 3T3GA 1A95A 3IJEB 2GK3A 3QE4A 5B12A 3MG9A 2IYZA 2O07A 1GAWA 1KK0A 2WKPA 2I87A 3T94A 1SBNE 2QM0A 1P7ZA 3EMVA 2H0RA 3T3PB 2UYHA 1W1UA 2ZRLA 3IS3A 4M55A 1O89A 4CLOA 3PJRA 5KWEA 1NNSA 3GPDG 4ZRDA 5I47A 5JWRA 2WWTA 3ZUGA 5IANA 1IUOA 2IXGA 1Y6ZA 2Z5FA 3I5AA 2VUHB 2YYSA 1G0NA 2IEDA 3FYCA 4PLGA 4W8GA 4ZVSA 4BKQA 1Z6TA 4ZZ3A 5JSFA 2AMVA 1RC1A 2IYOA 2WTEA 5JTUA 4NHEA 4DQXA 4Q3LA 2J3EA 3AIKA 4LJAA 4QU0A 3WQQA 1GDTA 1ZISA 5EHNA 1ODFA 1Q1ZA 1YRHA 3A4MA 3DB1A 4F84A 5JNRA 5EQDA 5DM70 3NTVA 1NNUA 3DBOB 4G8CA 4O4LF 5BVGA 5CDTA 3RSLA 4KWEA 1A8IA 4WXRA 4AZ0A 2C03A 1K8ZB 2XF2A 4J2OA 4P32A 2ZWMA 5AXCA 4RO0A 4ZQCB 1L7OA 1ZOLA 1I32A 2Y92A 3TMYA 4MXDA 3OLYA 2AOUB 4AM8A 3OI7A 2GD0A 4EABA 1VPDA 1HK7A 1OXVA 3KZXA 5ALJA 1QO7A 1V4BA 2B69A 2C3YA 4JDPA 1CHDA 3DZHA 4KAAA 5GOZA 5LBTA 3QGMA 1GZ7A 2GAAA 3M9XA 2G5TA 5IXSA 3TKYA 1MC8A 5C1OA 3GRFA 1GPWB 4A1OA 1L4KA 2SICE 5C81A 4KR9A 1BNCA 1ZD5A 2I4OA 1R0RE 4UBKA 3CNQS 2Z58A 1C0EA 2VUSA 1XIVA 2FU5C 2PQ6A 3M33A 4MH0R 4POOA 1HEUA 4HVAA 3WL5A 4AKSA 4U7HA 1M75A 2WSYB 4FHFA 5TMPA 2CE7A 4EFDA 2YHIB 3B3QA 2OORA 2IXTA 3CLRC 4QLBA 5B64A 1GTVA 1XCPA 3G1TA 2I1WA 2IIVA 1MIHA 4PX9A 4YA6A 3HYRA 3RK1A 3NBMA 4U7GA