4LVUA

Crystal structure of a putative short chain dehydrogenase from burkholderia thailandensis
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
254
structure length
252
Chain Sequence
b'DERYARYPSLAGRAVLITGGATGIGASFVEHFARQGARVAFVDLDEQAARALAARLADAAHEPVFVACDLTDIAALRGAIEAIRARIGPIAALVNNAANDVRHAIADVTPDSFDACIAVNLRHQFFAAQAVIDDMKRLGGGSIVNLGSISWMLKNAGYPVYASAKAAVQGLTRALARELGPFGIRVNTLVPGWVMTQRRLWLDDAGRAAIKAGQCIDAELLPGDLARMALFLAADDSRMITAQDVVVDGGWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxidoreductase, short chain dehydrogenase/reductase family
publication title Crystal Structure of a Putative Short Chain Dehydrogenase from Burkholderia thailandensis
rcsb
source organism Burkholderia thailandensis
molecule tags Oxidoreductase
total genus 96
structure length 252
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lvuA00
1YONA 3GAZA 4R1NA 2RAFA 2O3JA 3F9IA 3AI1A 3FR8A 1PQUA 3PWKA 1SNYA 2OL4A 5CDYA 3RASA 2GUGA 3JQ9C 5G4KB 4MVJI 1EEHA 4MDHA 4P22A 4CV0A 1NQOA 3ZHZA 3ZDFA 1MP0A 5TGDA 3WR5A 4DLBA 4WLVA 3TWOA 5L7YA 2NVUB 3KM0A 2JCXA 3INGA 2ZQYA 4JIGA 4R16A 4B4UA 5A04A 5DULA 1U9JA 3EVNA 1PWXA 3DBHA 1VL8A 2ZB4A 3G79A 3GVCA 2PLAA 4MVJP 2E48A 1N1GA 2EKPA 1DC5A 4OHUA 4E3ZA 4I5FA 1ZSNA 3K30A 1NPDA 4Z0HO 3JQ8B 1VL6A 3KYBA 4RCVA 2PZJA 3E9QA 4CUKA 4UUNA 5MDHA 3P2YA 4WUVA 1OAAA 1VM6A 4H3VA 3DZIA 1ZJYA 4L74A 3GEMA 2DTXA 5EN4A 4CMBA 2FR0A 4ND3A 1A7KA 3ROPA 3KV3O 1EZ4A 4R3NA 1L7EA 2PD6A 1UZNA 4U0KA 2Q2WA 3ZWWA 4IGEA 1W8DA 3LF1A 1IHXA 5COBA 3CSDA 3F6YA 4PVDA 1ISIA 2HQ1A 4XQCA 5CPBA 5TLSA 3O4RA 5GZ1A 5A1TA 4BO9A 1MUUA 1ENYA 1U2GA 3DZHA 4ZU3A 4PLFA 1PL6A 5JAQA 2BFPA 7ADHA 4O59O 2BGMA 1NTOA 3DDNA 5BSGA 4WLUA 1O89A 1EDOA 3I3OA 4AJ1A 1OOEA 3ITKA 5EESA 4J4TA 2Y1OA 1QRRA 2Q4BA 1U3TA 4WCDA 3D4NA 3GLQA 3H65A 4XR4A 4YRAA 4FOOA 3RUFA 5ENDA 4I08A 5EL0A 4OMUA 4R5HA 5A9RA 5KVCA 2O23A 5B37A 1F12A 3CUKA 2YDYA 2R6JA 4BO8A 3Q2IA 3K31A 4JBHA 4PLCA 4YXFA 1AXEA 5ICMA 3I23A 3NEPX 2DFDA 2FPGA 1RJWA 4L8VA 2JCYA 1K89A 3F4LA 2Y0CA 2NV6A 2WEKA 1GYRA 2CD9A 3I6QA 3MJ4A 4J6FA 1EMDA 3GMSA 3F3SA 2HMVA 3OA0A 1R4MB 4MP8A 4NBTA 1GYPA 1KERA 5IJZA 3GFBA 2XF8A 1HETA 1YXMA 1YBAA 4BOYA 3LF2A 4XZ3A 1LLUA 2I65A 3BIOA 1YL5A 1PTJA 4Z9YA 1E6UA 3JQGB 4Q9NA 4Z0TA 8LDHA 1PJQA 4E31A 1GAEO 3BAZA 3LC7O 4CM7A 5KVSA 2R2GA 5FYDA 1E3IA 1B2LA 2VHXA 4INAA 1AUPA 3BA1A 3QIVA 4UVGA 2Q46A 2GLXA 1SOVA 3GFGA 4J7CA 2NQTA 2FY8A 3GF4A 1T25A 4OGWA 1HDZA 2OP1A 4IM7A 4RPHA 4B8ZA 1LLCA 4J43A 5F1OA 2CFCA 4II3A 1TB4A 2PZLA 1RWBA 1VKNA 4JJIA 3GPIA 3OICA 2JFHA 4E30A 2YUTA 3GMDA 3PYLA 3GA0A 4BNWA 1C1XA 3C7CB 1HF3A 2QQ5A 4W82A 3BMQB 2D5AA 1LDBA 1PR3A 4TRMA 2AEMA 2NTVA 3ZWOA 2PA3A 1V3VA 5T57A 2FP4A 4CQLB 3H9QA 1E7YA 3PI7A 4ND1A 2OOSA 4R68A 5AYVA 3HN7A 4R69A 1R15A 1UZLA 3EHEA 2O3SA 3GRPA 1P1JA 1SB9A 5AXAA 2WTBA 1H6DA 4IDCA 2YY7A 1VJTA 1WP4A 4KUGA 4L76A 3RQSA 4BNXA 1I32A 3EMKA 2WYVA 3S55A 3ASVA 1E0DA 3GVXA 1M2WA 4N5MA 1DIHA 1RYDA 3ETEA 1JWBB 4E2YA 3ZHYA 4CMKA 4EZBA 1U3VA 4BO0A 4RPKA 1UUFA 2NACA 1JKFA 1H2HA 2FHSA 2AMFA 3C8MA 4EJ6A 3ENKA 4BO7A 1GCUA 3MEQA 3AI2A 1GL3A 5TJHA 4FFOA 3ETDA 1DJNA 2W8ZA 1PZGA 3W4KA 3WBFA 5HS6A 3ZWYA 5I7FA 4EGFA 1P9LA 5J23A 5T64A 2PV7A 4PVCA 5JAZA 4N18A 2VYVD 3KHUA 3VPGA 5I7VA 1EFLA 3FNHA 3MOIA 1H94A 2JAPA 5JW6A 3Q6IA 2VQ3A 1BXGB 2HSDA 3JD2A 4GGOA 4D43A 1AHHA 1P3DA 4ZQEA 2FMUA 3GUCA 1ZSVA 4W4TA 4MVJD 2Y05A 1DB3A 1I8TA 3JQFC 5I8ZA 2P5YA 3KYCB 3QWBA 1WZEA 3HADA 4IDDA 4B3HA 4E13A 3P19A 2W98A 1XDWA 4FCCA 4XB2A 3D64A 3GHHA 4N54A 4DVJA 4NG5A 2X0NA 5T67A 2V65A 5ITVA 1MX3A 1TT5A 1N5DA 4NPCA 4JROA 1MFZA 4XIYA 4J91A 4NZ9A 1M76A 4J7XA 3BZUA 1LUAA 1YRLA 1E6WA 1SEPA 3K92A 3WDSA 4BNFA 2HK8A 4MINA 1MXFA 4HWKA 4TWRA 1WPQA 3SLKA 4BV9A 4IY1A 3DO5A 4BNTA 3V2GA 2OP0A 1W73A 3F1KA 3QWIA 2Z95A 1ZK4A 2DBRA 2OO5A 5DNAA 4R1UA 4W7HA 4A5OA 2EXXA 2O2SA 3AUAA 1RPNA 5A3JA 2YQ4A 3D7LA 4CM8A 1PZFA 4WLEA 1Q2XA 4IIVA 3LT0A 4WCFA 3KVOA 2YHIB 4RO0A 3S2FA 4W7IA 4CM1A 3E8XA 4AVYA 1BDBA 5JAMA 2IYOA 4ZQFA 3WYBA 1HE2A 1EVYA 3G3EA 3M2TA 2G82A 4WKGA 1JVBA 3SC6A 3UW3A 3JQBC 4D79A 5IG2A 1EQUA 4QX6A 4Y98A 1DLIA 1H9AA 2QG4A 4PLYA 1DHRA 2F00A 2I99A 4R9RA 4EUEA 2VZ9A 4YA6A 1H0KA 3D1LA 3HDJA 4NJMA 4Q3BA 5JCJD 4XDYA 4FFRA 1X1EA 3RAJA 3OMLA 5CP8A 3GVIA 3SXPA 3WYEA 4E2WA 4CR7A 3ANMA 5B1YA 1B8UA 1OZAA 1R66A 2C7GA 3VC7A 1ISMA 1HLPA 1ZEMA 4J49A 1IPFA 1A9ZA 5L4NA 9LDTA 2O7SA 3CINA 3JQ6A 4CQMD 3NTOA 1RYEA 4I1IA 1QYWA 1PS0A 3IL2A 3DHYA 1ZK1A 1UDAA 2AQIA 1XQ1A 2I9PA 1ZUD1 1B8VA 2BKAA 3ZNQA 3JQAA 4KUHA 1UXJA 4H16A 3C7AA 1PGPA 4XYGA 4NU5A 1QYDA 5JBIA 3DBVO 1LC0A 2AE1A 4YAJA 1PQPA 3JD4A 4LRSB 5BSFA 4Q3DA 4UUMA 5JNLA 1E3JA 2ZYDA 5JY1A 1PX0A 2PNFA 4Q3EA 3DFZA 1HLDA 4U0JA 1PR9A 4LN1A 2Y1FA 2NM0A 1U4SA 1RM3A 2Y93A 1HE4A 3L4BA 1LSOA 4NR0A 1IULA 1YGYA 1ISGA 5JDIC 3GK3A 3WSWA 1HWYA 4NQZA 4RQTA 4U6QA 3TZCA 4E5YA 1OI7A 1ZXLA 4I5EA 3Q0EA 4K6FA 4UULA 1CF2O 3BHIA 1O8CA 1Y8RA 2D3TA 2UYYA 2YQ5A 3CE6A 1JAYA 2HK9A 4TQGA 3K5PA 1XR3A 3SJ7A 4CMJA 3JQ9A 4PLHA 3A06A 3I83A 3PYMA 3M2PA 3IOYA 1ISHA 5HS4A 2EW8A 2DBZA 4KQWA 4M1QA 1XEAA 2BF7A 4R51A 3EDMA 1EBUA 1C0IA 1UAGA 2G1UA 4OOEA 2GERA 3ZW8A 4DBVO 4TVBA 1PSDA 3JYQA 4W6ZA 5EERA 3O9ZA 5G0UA 5AXBA 4BO6A 4XJTA 3Q9NA 4K1LA 2IZZA 3OQ6A 2AXQA 1C0PA 3LT1A 4E5PA 1KC3A 3DAFA 3BHMA 1EQ2A 3B70A 5JMPA 3U4DA 3CKYA 4CV1A 1HEUA 4E33A 2DVMA 4ITUA 3MCVA 1ISFA 3H7AA 2D59A 2Y0EA 4MP3A 1N7GA 3BMOB 5JPIA 3JQEA 4LVUA 2J3KA 1DIAA 3DXFA 1XA0A 3O8QB 1U1IA 4CM5A 4TZTA 1Y9EA 3D5TA 5FI3A 3DWFA 5DCUA 5JSFA 4NIMA 3GVPA 1Y8QB 4GVXA 1WZIA 3I9NA 4M86A 1I01A 1YO6A 4YWJA 1ZK3A 2DUWA 4YTEA 4CM4B 5B4VA 2W90A 3QVTA 4J90A 4UUPA 1KOLA 4A27A 4OSOA 1NVGA 1SB8A 4BNMA 2GSDA 2J5KA 3DZBA 4R01A 3AY7A 3PHLA 5L9AA 4XX0A 1ZVMA 1JU9A 4YACA 1VJ1A 3ZCXA 3AFNA 1EDZA 1R6DA 4S3MA 1ULUA 4II2A 1R37A 3RUAA 3WTCA 4ESOA 4IMRA 2WWRA 4CQMB 3RD5A 3RC1A 5IAAA 3VOSA 3UKOA 4I8XA 5KNLA 1BW9A 4M54A 1UDBA 3VPHA 1VI2A 3DBRA 4YJGB 3RROA 5CG1A 1UP6A 2V6BA 1GUZA 3LK7A 5A5FA 2HMTA 1DO8A 4BQRA 1NQAO 2W2KA 1LLDA 3RKUA 3INTA 4PLVA 3U4CA 1NFFA 1Z82A 3ZWCA 4KP7A 2CVQA 2VUSA 1LDEA 5DZSA 1FDSA 1Q0QA 3DONA 3PJEA 2B4QA 2JD2A 4XEHA 2HJSA 2ZATA 3RBZA 3WX0A 2J3IA 2NVWA 3PHGA 4YT8A 3WGZA 1ONNA 3COSA 3AOEC 5JDCC 2YDXA 1O94A 1SMKA 3K8ZA 2H9IA 3AI3A 4JGBA 5GZ6A 2EP7A 4DTIA 4J0EA 4BMVA 4FGWA 4GAEA 3AY6A 3DTTA 3WQSB 3HJAA 3NX4A 3QJ5A 3WOHA 3GNQA 3CMCO 2IYPA 4CLDA 1XIVA 2BGKA 4BNJA 1WDKA 2QRJA 3VPXA 1EVIA 2AEFA 4XGIA 4JP3A 3VHRA 3QHAA 2VWPA 2DKNA 3D4PA 2QZZA 5JXWA 1NVTA 2CF6A 2IZ0A 2FOIA 2W2LA 3PZBA 4J4BA 1A7AA 4IBOA 3W1VA 2IZ1A 4E5NA 1HTBA 2I66A 3GZNB 3LSYA 3NT5A 4YJDA 3AM3A 3DZJA 3S2EA 3U0BA 2V6MA 2B4TO 3TOZA 2DC1A 4YJHA 2EW2A 2VCYA 3L6DA 3GEGA 3ADPA 3E5MA 3V8BA 1YS4A 3WJ7A 1PQWA 1G0OA 1MV8A 3DAGA 1CIVA 2G76A 3JSAA 3LDHA 1YB4A 4EJMA 3RSHA 1PJ4A 2JHFA 3OQ1A 4FOSA 2VRCD 3WIEA 1QORA 3ZU4A 4RV9A 1VLLA 1EK5A 1LSJA 4N5LA 3WSVA 2HJRA 4A26A 4HFNA 1NBOA 1T2DA 1TEHA 1YBVA 2A9FA 3GZ4A 4ZRMA 4CMHA 4DIFA 1R16A 3AUSA 4G65A 3L0DA 4LGVA 4AJIA 1U3UA 2Y99A 3PVZA 1HE5A 5JCXA 3FNGA 4CLOA 3FSRA 4LCJA 3KXDA 5A9TA 3UXYA 4OYRA 1HYHA 2J5QA 4CV2A 4FIZA 4JJGA 1PZHA 2YW9A 1CJCA 4CMIB 4ZRNA 2VUUA 4WECA 5AOVA 4AJJA 2B4RO 3C1TA 1Y5MA 3CZMA 4E2XA 3L6EA 2VYNA 3ETGA 1ONPA 4ROSA 2IXBA 2NQ8A 3LT2A 3ADOA 4YAKA 1KYQA 3ONEA 4KTTE 3SBOA 4XQGA 4MVJM 4JLWA 1Z73A 1X13A 1XELA 5GY7A 1UXIA 4XQ9A 1NPTO 2YV3A 4QT0A 1DOHA 3OF2A 3WS7A 3WGHA 4XRGA 4B3IA 4RVHA 3LVFO 1E1NA 3A1NA 2XXJA 4FJ2A 4HNHA 1SEVA 2DBVO 3OEYA 4XYEA 4AL4A 4F3YA 4LISA 4IINA 4R4JA 2X9GA 5ENVA 4BKUA 1GR0A 3ZV4A 4ALNA 3JQFA 5L4SA 2EF1A 3PGXA 2O3TA 5KJ1A 1PJ3A 1Q7GA 3PJFA 4YT4A 3AM5A 2DAPA 1MLDA 3WWYA 2B83A 4KWHA 5KJCA 3I4CA 1GPJA 1HDXA 3Q11A 1UAYA 2AG8A 1JVSA 5TT0A 3RUEA 2YFHA 3RCBA 2EHDA 3GN2A 5L4LA 2GRAA 4EBFA 3A28A 4BUCA 5DBFA 1HDOA 1T1RA 4BO1A 4HXYA 3GGOA 3GDOA 2LDXA 4PG4A 3PDUA 1LNQA 2PZKA 2WD8A 4BNLA 3JQ8A 3DBLA 4NK5A 2PK3A 2C7VA 2PH3A 4ZQBA 4LSWA 2I3AA 4RPJA 5TS3A 1EE2A 3OEWA 3F46A 1DHTA 5IZ4A 1KC1A 4UEOA 3PGJA 1U7TA 4M89A 4DQXA 1IL0A 2X22A 4JK3A 1XWFA 3GN1A 3PRJA 1U8FO 2A35A 3X2FA 4PCVA 3ZHBA 2C5EA 1HT0A 1C0KA 3H3JA 4D3SA 5DOVA 2P4HX 4NDNE 3LLSA 4IQ0A 1K0UA 3V2HA 4DYDA 3ZNNA 4DXHA 3JQBA 1F14A 3PTZA 1U4OA 3DZGA 2AHRA 3D3EA 5EPOA 3WFJA 1E5LA 1Y81A 3IUPA 1PWZA 1ZCJA 3EUWA 3FPLA 4IGFA 1R0SA 3RC7A 4R1SA 4BB5A 4WEQA 3QRWA 1OC4A 2GN8A 3KLMX 5I7EA 4B4WA 3DBHB 2C0CA 4F6LA 1DFIA 3C24A 2JFFA 3H8VA 4M55A 1E3SA 3N58A 3OP4A 4Q39A 3KEOA 2BFMA 3DMTA 4L4RA 4B4OA 3ON5A 2Y66A 2ZTVA 3MZ0A 3WMXA 2AQHA 2X6TA 4C7JA 3TZQA 3DTYA 3P7MA 3M1AA 3FI9A 4GSLA 2OBYA 4RZHA 1Y9AA 1I10A 4FC6A 1WLYA 2B36A 1BTOA 3HUDA 1KEUA 4N7RA 5A9SA 1J5PA 1LXCA 1ONOA 4HFMA 4WLNA 3R0IA 5C7IO 4MVJF 4U6SA 1PS9A 4HKTA 3C85A 5THQA 1BGVA 3JYOA 2Q99A 1KEVA 4RVDA 1N1EA 1B0AA 1C0LA 1Q7BA 4PG7A 2X5KO 4TRJA 1R4MA 2NLOA 4I9NA 1I24A 2WDZA 3KTDA 3LU1A 3E82A 2VZ8A 5DDIP 3D0OA 1EVZA 1K6IA 2QYTA 3ASUA 2GN4A 1YDWA 5JYDA 3OSUA 2EGGA 4TZKA 1CQIA 2VHYA 5GMOA 3GQVA 3WGOA 4TRNA 3JQGA 5JC8A 5TT1A 3C1AA 1NWCA 2H6EA 4CLHA 2VTEA 4PZCA 1BXZA 1E7RA 2Q50A 1ADFA 4PFJA 4TSKA 4BNYA 2ZB8A 4FC7A 4XIJA 5CEFA 4K26A 5CDSA 1LU9A 1WDLA 2BFOA 3IKTA 1EE9A 4FR5A 4RGBA 3E03A 2ZJ1A 4M49A 1U7HA 2GASA 2Q1UA 4XJSA 2BI7A 3VDQA 4CM6A 4EW6A 3BTOA 4OQYA 3LT4A 1JLLA 1VJ0A 3W8FA 4OOFA 1CDOA 3L07A 2I67A 2IE0A 3NRCA 3NJ8A 5G0SA 5A4DA 2DLDA 4P8RA 2Q49A 1FXSA 4R1TA 3VH2A 2HMSA 2WYWA 4H7PA 2EP5A 4H15A 4D0RA 3AOGA 4WLOA 3RVDA 3DZKA 1F17A 3BMQA 1FDUA 4BQPA 4BV8A 1D7OA 1AHIA 1E5QA 1UXKA 1A71A 3OJ0A 4C7KA 2C2XA 1DEHA 3TOXA 1R0KA 2JD0A 4AJNA 2JCVA 3O03A 4LRTB 1XLTA 3ABIA 3JD1A 4E12A 2RH8A 3GRKA 3ROQA 1R0LA 2Q1TA 5ER6A 4G2NA 3WQRA 8ADHA 1HYGA 2FPIA 4IDAA 3HN2A 4DMLA 5K6AC 5TIIA 4RLSA 3FPCA 4RZIA 3IUSA 2HRBA 4GLLA 4HNGA 2QRKA 4BNKA 1FJHA 3ZWAA 1B14A 3ONFA 2GNAA 3PWSA 4HV4A 5ILOA 3MJEA 2VN8A 3OECA 4FFLA 1DBVO 4Y67A 4NK4A 4EUHA 1N7HA 4GQAA 4GWGA 2Y1GA 3ZV3A 2Z5LA 4MO2A 3G1TA 1YQGA 1BXGA 2VT3A 4W9NC 3GVHA 2WJPA 4ID9A 1N2SA 2Z1NA 3OHSX 3DQPA 5DCYA 5K9ZA 4NHEA 3WGGA 3NJ4A 1X0VA 3A9WA 5JC1A 1KBZA 4CLRB 3D4OA 4RDHA 3KSZO 2P2SA 1EBFA 3ZN2A 5KKCA 5I9NA 1GPDG 1V0JA 3UH1A 2OFPA 3KYCA 2HK7A 3KLPX 3KYDA 3DOOA 3FNEA 3GY0A 4ND5A 1L1FA 2P4QA 2X9NA 3AOEA 1R4NB 5JDCA 1I2ZA 1T4DA 5EIOA 2P91A 2WE7A 2IEBA 5CHEA 3ZU3A 4Y6RA 3IIEA 5H81A 3NV9A 5EQDA 4XDZA 4J9UE 4BNNA 4AJOA 1JAXA 3QVWA 3ZWPA 1EVJA 4CMAA 4ZD6A 1NX6A 2FZEA 1KEPA 1A4IA 1HYEA 1YB1A 2OBNA 2X4GA 4A2CA 1OMOA 2ZIZA 3R3JA 5A02A 1RKXA 3UHAA 1TT7A 3JQAD 3ZWNA 1T26A 4NI5A 1O95A 2LDBA 3GPDG 4ALMA 4C4OA 2EKLA 1V6AA 3PDJA 1PZEA 2CY0A 1E6EA 1LSSA 3HZZA 2HMUA 2PD3A 4LMPA 2B5WA 1LDMA 3OBBA 3RBVA 4BNIA 1ENZA 4PRLA 1ZKMA 2IXAA 4P4NA 4WASA 1CQJA 3VDRA 4AJ2A 1I36A 4O6VA 4O63O 1DFHA 1WMBA 5JAIA 2ZCUA 1NM5A 3PFFA 4J2HA 4CUZA 1E3WA 1TA4A 2GYYA 4LSMA 1AXGA 4NBVA 4ND4A 3QVOA 2JFGA 1ZW1A 2C29D 2VNSA 1TXGA 2FPPA 3GNSA 3MJTA 4EI2A 1X14A 2ZTUA 3E9NA 4JJFA 4BNHA 1O0SA 3VTFA 3HQ4O 3NT2A 1Z7EA 2HO5A 1PJLA 1B8PA 2SCUA 4RQUA 3QWHA 1WDMA 5C7OO 1QKIA 6ADHA 1T24A 4GPD1 2XOXA 3LC1O 1YOVA 3N7UA 4E5MA 1AE1A 1XU9A 3IP1A 5KTKA 4QTZA 1T4BA 3PPIA 2CVZA 3RKRA 1E92A 1H6BA 5EQFA 3H6KA 4FD3A 4U8GA 4ILKA 4D3DA 2HCTA 1VKOA 5BR7A 2CSUA 3KETA 4Q3AA 3I9JA 3F5QA 1WWKA 1UXHA 2CVOA 4HFJA 4CM8B 2ZYGA 3PJDA 1C1DA 4LK3A 3ZHXA 2EWMA 4XYMA 1E7MA 4KQXA 4J2OA 2V6GA 1J0XO 1N9GB 3I9MA 1LJ8A 3DZFA 4GX5A 4MVJG 1HDYA 5AXDA 4FS3A 1UP4A 4URFA 3RC9A 3Q9UA 4N5NA 3E1KA 4S1VA 3DL2A 3BTVA 1HZJA 2E6UX 4BKPA 3AWDA 3FD8A 2Q4EA 4K9DA 4RF2A 1NWHA 4CMEA 3H2SA 4IJVA 2OORA 5T6BA 2BH9A 4QFDA 3UCXA 1ZO8A 2AQKA 4FFMA 3NDJA 2X0JA 4U5QA 3U3XA 3WWZA 1IB6A 2Y68A 5BSEA 3M6IA 2IDZA 1D4FA 5CDTA 4NJMB 2AEJA 1S6YA 3QSGA 3WXBA 5U4QA 3GDFA 4BNVA 1JWAB 3DB2A 3LLVA 1IZ9A 2VWGA 3AU8A 2VRBA 4YQYA 3C7DB 5KOIA 1I5RA 3HWRA 2PGDA 4DWVA 3WGTA 1F0YA 1I33A 3H9GA 4Y6PA 1BWSA 1ZJZA 1SBYA 4MIYA 1QMGA 3JV7A 4WNCA 3PLNA 4GX1A 5L51A 3ZNOA 4O0LA 5DT9A 3U49A 1ENPA 1BXKA 3AJRA 3ANLA 4IMPA 3H5RA 4W99A 4YYZA 1M66A 1GZ3A 1M6WA 5A5EA 1PJCA 2BI8A 4KDEA 4KWIA 3M1LA 1IZ0A 2BMAA 2FWMX 3WMWA 1NHWA 1QP8A 3W4JA 2ZCVA 2VUTA 3DEYX 4NBUA 5DF1A 3OFSA 1KVTA 4J9VA 1E7SA 3KSUA 3T7CA 5BSHA 1HDCA 4BO3A 4CPDA 2VTDA 2QW8A 3LYLA 3B20A 3CPSA 3U4IA 1JN0A 2X58A 2BRUA 4YAGA 5C5IA 5EMHA 2VWQA 1HZZA 3VKVA 4DQUA 5ILGA 4A7PA 5IXYA 3O8QA 5EINA 2POQX 3C1OA 5I9LA 2WSBA 3Q2KA 4Z9FA 5JO0A 1Y8RB 1H5QA 5CFZA 2O4CA 3BTUA 1KS9A 1MG0A 1IUKA 3BTSA 4DREA 4IZHA 3L9WA 1ZSYA 4BL5A 4WGGA 2TMDA 5JCJA 4KTVE 2O48X 2FRDA 3JQ7A 3OIDA 3TFOA 1NAIA 1UXGA 5G0TA 1XGKA 3BMNB 4OXKA 1JDJA 1FDWA 1ZK0A 2NWQA 4L0QA 2QZ9A 3KOUA 1JKIA 5B12A 1KY5A 1K5HA 4WEOA 2WE8A 2ZB7A 5T5QA 5IN4A 5IZCC 4F6CA 4NU6A 4RPGA 4CQMA 3A4VA 2PKQO 4OSPA 1NQTA 3TL3A 2X5JO 2FSSA 2B35A 3WGQA 3E48A 3MJCA 1DFGA 3L9XA 4YJGA 1X7HA 4JBGA 4P4GA 3ZV5A 2XXBA 4KMSA 2VZ0A 1VRWA 2YHUA 4YRDA 4BNZA 1ZMOA 2DTEA 2RHRA 3B1KA 2Y0DA 4D7AA 1PL7A 1U3WA 5THKA 4YBZA 2O4UX 3EZYA 4BKOA 4FN4A 1MFPA 3JYNA 4MIEA 4DLLA 4IDFA 1DSSG 3AW9A 3HB4X 1A27A 3DMYA 4BGEA 1ADCA 5I9MA 4E2ZA 4DQVA 1E3LA 4MVJE 3IJPA 4J0FA 3MJVA 1QSGA 1RM5A 5DCWA 3JQDA 1QYCA 2UUOA 2ZYAA 2XAAA 1YQDA 3RU7A 2X0RA 1V9LA 1NR1A 3G1UA 4HY3A 3KUXA 4AJEA 2CDBA 1ADBA 4E0BA 5JY6A 4R41A 1DIRA 2BGLA 4IS3A 3QQPA 3KB6A 4QSMA 5BQFA 3LZ6A 3PEFA 1H6CA 5KKAA 1Q1NA 4NFYA 4RF3A 5COQA 1YJQA 3TRIA 3VZRA 1GY8A 1XSEA 3BXXA 4OXNA 2JL1A 2O3UA 2VYND 3C3XA 3VH3A 4DC0A 4B7UA 1BW9B 1BG6A 3DBRB 4ZQGA 4BIIA 4EITA 5CEJA 4QO7A 2UV8A 3ANNA 3FTNA 4GH5A 1TVEA 4IIUA 4G5HA 3GZNA 3QV1A 4MVJH 2EV9A 1LI4A 4D0SA 3NUGA 5A03A 1E1MA 1YJ8A 5LDGA 4MIOA 2NVBA 4D41A 4TROA 4YEDA 3PK0A 2C82A 4ALKA 3OETA 4IJUA 5KCZA 1CERA 5TSDA 2RIRA 1LTHR 5B4UA 2I76A 1B3RA 2BELA 2B0JA 3GHYA 3H9UA 2CDCA 4PLPA 4FDAA 4OAQA 4PGFA 1Y6JA 2VHWA 4WLFA 2DBQA 1ZEJA 2CUKA 1KVSA 5U9CA 4GVLA 2VNAA 3T7EA 2JJYA 1C3VA 4KDFA 3RC2A 2GN9A 3UVEA 4HUJA 1T2CA 1PJ2A 3ZV6A 4BGUA 1P31A 3S2IA 5K6AA 3QWAA 4AFNA 2HMWA 1BVUA 5B4TA 3B6ZA 1DRUA 3RFVA 3RUCA 4I5DA 4OH1A 2CMDA 2R00C 4JQCA 2AA3A 2Y67A 3DHNA 4IDGA 4RVUA 1NXQA 3TZHA 3WJAA 3TF5A 4NFSA 3AU9A 1QV7A 2NADA 4OO3A 3PZRA 1LRJA 1N8KA 5JO9A 3UAGA 1LC3A 4YJHB 3K6JA 1HRDA 3DOJA 1ORRA 2E49A 5JE8A 1U5AA 2ZKLA 2WD7B 3NKLA 4YT5A 2P68A 4QQRA 4BKQA 3ZU2A 3GNTA 2OHXA 1B16A 5BNTA 1PGQA 3VTZA 4TMFA 4DYVA 2J3HA 1W6UA 4MPDA 1NASA 2A4KA 5L95A 1W4ZA 2FSVA 3A14A 1KVUA 3I4FA 3W8DA 1D1SA 4XA8A 4ALIA 4X54A 4AJLA 2AG5A 3UGKA 1YVEI 3D3WB 1PL8A 2O7QA 3JYPA 1VPDA 1MA0A 1IE3A 3BMCB 4GWKA 1SC6A 4YJFB 4J1NA 4TKMA 4WJZA 1I2CA 1H6AA 1M75A 1VSUA 2UVDA 4LW8A 3V5NA 3ROMA 2JAHA 2AE2A 5LC1A 1WVGA 1F8GA 1PJTA 4WPGA 4B79A 2QHXA 2X1HA 3JQCA 1AGNA 1HDGO 4J1TA 4RPLA 3TDKA 3I9OA 1LRKA 1LDGA 5C37A 1DXYA 3S8MA 6LDHA 3QA9A 4BHTA 2P9GA 4FGSA 4JP2A 1O5IA 3RFXA 3V1TC 5G4KA 3F47A 4Z9XA 4MJLA 4K6CA 5DOZA 4ZGWA 2NVUA 1Q0LA 2J8ZA 1RM0A 1DIGA 3VZSA 2E4AA 4R5MA 4RVSA 3E6AA 2GPTA 3KSDO 1NFRA 2ZTLA 1FDTA 5FF9A 3L4BC 2Q45A 2VWHA 1Z45A 1CEQA 1GU7A 5HA5A 4XGKA 2IRWA 1BVRA 1J49A 4L4XA 4G81A 5AXCA 5BNIA 3NGLA 3SC4A 3WLEA 4DL9A 1SZJG 3WNVA 4B7XA 5ADHA 1Q7CA 3ZWMA 2D0IA 3QVXA 5L7TA 4DPLA 3ORFA 1H93A 2F1KA 3GH3A 2WM3A 4PRKA 2VRCA 5F1KA 2EGHA 3WGYA 3EGOA 4GBJA 1DC6A 1JA9A 1GCOA 3NYWA 3OJOA 3WG9A 1IHYA 1NPYA 2RCYA 4BNGA 2JKVA 2QIOA 3K73O 4XKJA 2W4QA 3UN1A 3UOGA 4L73A 2P5UA 1NNUA 4FB5A 1I3NA 1ZNQO 1HE3A 2OUIA 2GF2A 2PR2A 4WOKA 1QYVA 2X86A 1YL7A 3G17A 1F8FA 1Y1PA 4KUEA 3DBLB 5HRUA 3RIHA 1QR6A 1UP7A 3CZRA 5ER9A 3NT4A 2GZ2A 4P4LA 2Q3EA 4L9RA 2O3RA 2FZWA 4ND2A 3HSKA 5BNFA 5LDHA 4FBGA 4CM9A 4BVAA 3KRTA 4PG6A 4I9UA 3MTGA 5H83A 3ZNPA 2YYYA 4RVGA 5AVOA 3FBTA 2D2IA 1H2BA 2Q2VA 4IQGA 4TVOA 3EAGA 1P0CA 4EEXA 1P33A 2HUNA 1OBFO 3FRJA 4PN3A 1IY8A 1ENOA 3TL2A 5HWSA 2Y1DA 2D5CA 4YDRA 1M6HA 2NU6A 2V7PA 2VT2A 1C14A 1X7DA 4Q3CA 3RUHA 4AJ4A 1WNTA 3H5AA 2H1SA 2Q2QA 1XG5A 2E37A 5JYEA 4ZICA 5U1PA 5KVQA 5COAA 1X1TA 1MB4A 4RF4A 2DQ4A 4E4YA 5FEUA 4DLAA 4MP6A 3WNQA 1DAOA 2ILTA 1GZ6A 3V2UA 4CUJA 1ZXBA 3W6UA 3HDYA 5JDIA 1SPXA 4AJPA 2GDZA 4WOJA 4ZJUA 4I5GA 3WFIA 4YAEA 5ITWA 3P2OA 1JTVA 2I6TA 4D46A 5G0VA 2UDPA 2D4AA 7MDHA 5HBRA 2X0IA 4WE3A 3QWFA 2DPGA 4UVEA 4GGPA 4A10A 5A9SB 3S1LA 1CRWG 5L45A 5L53A 3EYWA 3KZVA 3L6OO 4YB8A 5F3RA 3G0OA 1UZMA 1HL3A 1YH3A 2C5AA 3ULKA 4QEDA 2HLPA 3U4HA 4PIVA 3TZKA 3INRA 2DM6A 1EUCA 1LRLA 3HHPA 4JXKA 4BS9A 1UR5A 3RUIA 1XCBA 3LC2O 3E9MA 3TPCA 1GZ4A 3W6ZA 1JKJA 3HE3A 4IJKA 2DT5A 4NJOA 5F5NA 1IYZA 5T8KC 2VOEA 4D42A 5IFLA 5DBIA 3U62A 5A06A 5CG2A 5IXSA 1EK6A 2A94A 4UREA 5FWNA 4DIOA 1KVQA 1K6JA 1PU2A 2O50A 4CQLA 2X23A 2PH5A 5DP1A 2QRLA 3RJ9A 4PLZA 2GCGA 1P1RA 1P1FA 2YV1A 4BO4A 3NDRA 1E1LA 1LDNA 5MGBA 1NAHA 1DIBA 2PTGA 3PHJA 1YB5A 4CJXA 1GQYA 3F1LA 1VSVA 1VC2A 1VL0A 4UEJA 5IZCA 4XCVA 3F4BA 2OGUA 3FF4A 3FHLA 3MTJA 4OM8A 2YV2A 5A05A 3ZGYA 4RJTA 1GV1A 1WMAA 2NTNA 4Z3KA 1PJBA 3FBGA 3ZU5A 3HB5X 4DPKA 3MJSA 4CLXA 5AQ1A 3R3SA 3MOGA 4J4HA 2VHZA 4IQ8A 1K6XA 1ML3A 1UDCA 5G0WA 3VH4A 4B4VA 2IEDA 3RWBA 4CODB 1OFGA 2EEZA 3EY4A 3K9QO 1M67A 1FDVA 4ZHSA 2YJZA 4P38A 3ZZNA 1I30A 1N92A 3GDGA 4CLRA 3H4VA 4OXYA 4J1SA 4Y8VA 1C1XB 3CXRA 2Y1CA 1P1HA 4RLHA 4J16A 2EJVA 3WQQA 3I6IA 1PS8A 2TMGA 3T4EA 4IDBA 2BHLA 3IKVA 3EW7A 1R4NA 3QW2A 3PP8A 3FWNA 1ID1A 3OM9A 3NTQA 2PFGA 3CIFA 5DP2A 3OJLA 4YCAA 4ZVVA 3U5TA 3K2BA 3I9LA 3IDSA 2CF5A 5BT9A 4OJNA 4FSHA 4KOAA 4PG8A 3ROKA 3ZW9A 1TLTA 5KWEA 1HSOA 5ICSA 4IUYA 1LLQA 3WTBA 2AW5A 1MXHA 3IQDB 4TRRA 4PLWA 3TJRA 1LQUA 4HADA 3I5MA 4NMHA 3WLFA 3CEAA 4GX0A 1DC4A 2NUAA 1K3TA 4QUKA 4UVHA 4UVDA 3ENNA 3NDIA 4NBWA 4OKIA 5ES3A 3EK2A 2A92A 4XYBA 4YQZA 5CAEA 2JHGA 3I1JA 3SVTA 4E5KA 1NP3A 3RU9A 3H5NA 4DIBA 4LVCA 4F45A 2G5CA 5TRTA 4YRBA 3VAZA 4ZQHA 5CDUA 4Z3DA 3PWZA 3I52A 2EKQA 2GGSA 2WYUA 3HDHA 3AK4A 4EDFA 4FFPA 4QFCA 1X15A 2P9CA 4DMMA 5FFFA 4LCEA 4Q3NA 2B5VA 5JLAA 4JNKA 3DC2A 1R12A 3OH8A 2BD0A 4LMRA 5DBGA 2DFVA 3KYDB 3NAQA 3V1YA 4B8WA 1I3LA 1QYXA 3TSCA 2PKQP 3LQFA 2I5PO 3K2EA 2YHIA 3ONDA 2PWZA 4HP8A 5F1PA 4D3FA 4Z6KA 4GL4A 3FN4A 2CDAA 4IS2A 5IF3A 1T2FA 3K96A 1DRVA 4CMCA 3WIDA 4M87A 4O1MA 1CWUA 2BFAA 1LQTA 2HU2A 4CM3A 4YPOA 4B7CA 3AY3A 4K28A 1QV6A 1X7GA 5IDYA 3RJ5A 1TT5B 1P74A 3QLJA 4BKRA 2PGJA 1GYQA 2GZ3A 1H9BA 1T2EA 3SX2A 1T1SA 3GT0A 5HTOA 1U2DA 3GG2A 1DRWA 2R00A 3SLGA 3JCZA 1SO8A 4GMFA 4XR9A 1KETA 1LA2A 4BB6A 4JBIA 3AUTA 2YFQA 1UH5A 3OIGA 4PLGA 4XD2A 4CLEA 3PQFA 1P45A 1VE9A 2WMDA 2XPCA 4MOWA 4L75A 5L40A 5GZ3A 1N9GA 1XU7A 2GR9A 1GQ2A 3JD3A 2C2YA 1ADGA 2PKRA 3ZH2A 1BMDA 2Z1MA 2NU7A 3Q1LA 4ONEA 2X8LA 5IDWA 1E3WB 1QXSA 2VYVA 1T2AA 3UFXA 5I7SA 4WCFB 1PGNA 3WYCA 3EC7A 2J5RA 4ALLA 5JMWA 1WW8A 3WBBA 5TQVA 5JFOA 5TF4A 1UJMA 2BLLA 4MKZA 1YBMA 3VZQA 3BYZA 5KJEA 1YOVB 5L3ZA 4DA9A 1BHSA 3DMTC 4NBRA 2GD1O 4MVJA 4DUPA 1LEHA 1YQXA 4BNUA 2VHVA 4R3WA 2YZ7A 1GD1O 4NH4A 4O5OA 4E21A 1PIWA 1DDOA 1EUDA 4RL6A 4L4SA 4HX5A 3H9JA 1D8AA 5TJ9A 3FNFA 1NHGA 3T4XA 1ZMTA 2EIHA 4FJ0A 3ST7A 4BGVA 1C1DB 2UUPA 2OXIA 3PXXA 1OC2A 4IDEA 4UVIA 1KEWA 4GLOA 3FR7A 4Y9DA 3R6DA 1A72A 2HAEA 3R1IA 4WNIA 3PIIA 4F46A 2B37A 4EJ0A 1GQQA 3JQAB 1WXDA 1E7WA 4PZEA 1I3KA 4XQEA 4PG5A 2CZCA 5C7LO 5KJ6A 2O3QA 3H9EO 2QYSA 1GDHA 5CDGA 1ZBQA 1ZFNA 2NU8A 2JD1A 1P0FA 5KJFA 3PQEA 4GX2A 1J6UA 1EFKA 3PHHA 2VOJA 3JTMA 1HDRA 3IMFA 5EJ2A 3RBXA 4Y6SA 5I8WA 4BGIA 2NSDA 4J3FA 1B7GO 3BMOA 3IS3A 5LCXA 4AG3A 3O26A 3PLRA 5TX7A 1D3AA 4CR8A 2C54A 1Y7TA 2PD4A 1DPGA 1P1IA 5G4LA 3WICA 1E3EA 2HRZA 1V35A 2AQ8A 2D8AA 5JS6A 2ET6A 5K0ZA 1G6KA 3BMNA 3PJGA 3PHIA 2J6IA 3OA2A 1Y8QA 1PEDA 2NNLD 3B1FA 3BHJA 4CM4A 2ZQZA 2DPHA 3H2ZA 4GKVA 1B3BA 1LSUA 1PGJA 5CEEA 1Y5RA 2ZJ0A 3FCOA 1P77A 1SAYA 2G17A 2G0TA 1LDYA 3IP3A 3DOCA 3N74A 3S2GA 4HFRA 1GADO 3O38A 1I3MA 1U8XX 1J4AA 4WK6A 3UCEA 1X0XA 3RUDA 2W2LD 2RHCA 4NFHA 1NR7A 3GR6A 4CL8A 3RI3A 3JYLA 3QP9A 2OMEA 3Q3CA 3VZPA 4AJKA 1PJSA 3KBOA 1QLHA 3OJEA 4ZN6A 4J7UA 1GEEA 2P9EA 3E18A 1ISJA 2DU8A 1IPEA 3QY9A 1U5CA 4D44A 3V1UA 1ZIDA 4QECA 4D45A 3MWEB 3ICCA 4PLTA 3VKUA 4YAIA 3JQ7B 5CPFA 1P44A 3TNLA 3VH1A 4BMNA 3IAHA 4JN6B 1YDEA 4A73A 3I9KA 2PY6A 3GUYA 1ZH8A 3W4IA 3OJFA 1GEGA 1MG5A 2HDHA 4B3JA 4OL9A 3HG7A 1FK8A 2OZPA 2Q1SA 2DTDA 3GGPA 1Z6ZA 1V3UA 1V8BA 2GZ1A 5TC4A 1YKFA 1KVRA 1HKUA 1WAMA 1E77A 3G49A 1IOLA 3E5RA 2RH4A 3GC6A 3P5SA 4NNJA 4MKRA 1FMCA 1GUFA 4EEZA 4YVFA 2ZK7A 5L7WA 2B69A 4BMSA 1ZZEA 1ZK2A 2X9VA 3PYXA 5TNXA 5HM8A 3HNPA 3DAPA 4YT2A 2V6FA 3VPFA 2I3GA 2CNBA 1A9YA 4FPXA 1I2BA 3UICA 1P1KA 2W2KB 3U09A 1PGOA 3KO8A 4GMGA 3ZI0A 4RORA 3PFWO 2HKIA 3UCFA 5IN5A 1DLJA 1O9BA 4QXMA 1XHLA 3EZLA 3ZWBA 3FWZA 2C07A 4GI2A 5T8KA 3TN7A 3WB9A 1YWGO 2RBEA 1YE3A 3HFSA 1F06A 3RFTA 4AICA 1XQ6A 1L7DA 1JW9B 1NFQA 1I0ZA 3NTRA 2E82A 2Q1WA 1JQBA 3H3FA 4R54A 3WGIA 2EJWA 3VVCA 2J3JA 4CR6A 2X7HA 1BRMA 1Z75A 4TKLA 3HFGA 3VPSA 1NYTA 3CTMA 4FQ8A 1NVMB 1O6ZA 1EUZA 1B15A 1XYGA 3JD0A 1AN9A 3UUWA 4E6PA 1G0NA 2NTJA 1SCUA 2GO1A 4XB1A 4XGNA 3DFUA 1K2WA 3TFQA 4DRYA 2EERA 3STHA 1Z74A 1A5ZA 4ZA2A 4DBZA 4RF5A 2FR1A 4PZDA 4I9HA 4CMIA 4M8SA 3ZWVA 1SOWA 1E7QA 2WD7A 2Y1EA 1GUYA 2H5LA 1BDMA 3OQBA 4R9SA 5IDQA 4ALJA 1FF9A 1E1KA 1YL6A 1XKQA 2DUUA 1GFSA 3GG9A 2PGLA 5KVVA 9LDBA 1CYDA 1DJQA 2ZTMA 2C59A 4WCFC 1GV0A 4RDIA 3KEQA 2UAGA 2FN7A 2O2YA 3U9LA 1KIFA 2EG9A 2QX7A 3DHEA 3GGGA 1CETA 4OIMA 1KY4A 4UAGA 5H82A 4CL3A 2ZB3A 1W0CA 3ICPA 3D3WA 1DAPA 3L4SO 2C20A 1HSZA 2NU9A 1V3TA 3BMCA 4J1QA 3VVBA 4YR9A 4AJHA 4YJFA 4XYLA 1MGOA 1GTMA 4W9NA 3CH6A 4FW8A 4U7WA 1D1TA 1ULSA 4IPTA 3GEDA 4CMGA 3GOHA 3OIFA 3X2EA 4DC1A 4JX8A 1MC4A 3PQDA 4HBGA 4OKNA 4MKXA 4OQZA 1BSVA 5A3VA 5DN9A 1G1AA 4RVFA 4EUFA 1S7CA 4IZIA 4IXTA 4QO8A 2PZMA 3HDQA 1QG6A 2D1YA 5F5LA 4CLOB 4E32A 1U28A 3GAFA 4EYEA 4DPMA 3AFMA 3EVTA 3DR3A 4UUOA 4FFNA 5C3MA 4DGSA 3QE3A 3CMMA 4Z0PA 4CM9D 1HXHA 2FR8A 4CV3A 4IXWA 3IJRA 3TZ6A 1LBEA 3TQHA 4BO5A 3PIDA 3ZWXA 3NGXA 4A0SA 3AM4A 1Q0HA 1A4UA 3MWDB 4CMEC 4IJWA 5G2OA 3UF0A 2IODA 4A03A 4GKBA 4BO2A 2X5OA 4XWYA 3IC5A 1Z7BA 3ITDA 3L77A 1ARZA 5F21A 3FTPA 3F5SA 5IDXA 4XRRA 4UEKA 1DC3A 1TI7A 3W8EA 2GN6A 2H63A 3AUUA 1MC5A 3SJUA 1RM4A 3B1JA 5KIAA 4GSKA 5FI5A 1LX6A 1B26A 1NQ5A 4KZPA 3QVSA 3SEFA 3D5QA 4FJ1A 1QLJA 4JCOA
chains in the Genus database with same CATH superfamily
3GAZA 4R1NA 1N34B 4D26A 3F9IA 4EYOA 3KEMA 2VZLA 2O0HA 4MCJA 1JXQA 3Q8LA 3FPAA 3L49A 2QS9A 3ZZUA 2GFHA 1ODTC 3G8YA 2O0JA 2VQ6A 3B9QA 4GE0A 5I8PA 1V6SA 3DDUA 4MVJI 1NQOA 1Y8ZA 1KEEB 3ZJTA 2V4UA 3M6FA 3E61A 4WLVA 4DLBA 3KM0A 1UEIA 2JCXA 3INGA 2C57A 4R16A 4DYHA 3H2JA 5DULA 1TQDA 1ES9A 3ZGXA 5A04A 5AW5A 1UKVY 4FOLA 3AETB 3DBHA 1E9BA 2QJFA 2AW3A 4KXLA 3MK31 4OJYA 4DCPA 5BVGA 2E48A 1P0QA 3HO6A 1C30A 3B7PA 1D5CA 4I5FA 2R5WA 5DN6D 1RKQA 1ZSNA 3EZFA 2HA3A 1JXMA 3LCMA 4FDTA 4HN4B 3A4IA 4F9GA 1HZZC 1ZVJA 3IPXA 1J9ZA 4HVLA 5K8VA 1CHNA 1DCMA 3DC7A 3KT0A 3OZTA 3E9QA 3QGMA 4HEA6 1ZJ6A 5DLQC 4CUKA 5MDHA 3O7MA 2XNKA 2ZUSA 5CVTA 1SK8A 5SY4A 1OAAA 5B55A 4JC4A 5LYJA 3GEMA 1RBQA 1QM5A 2NUPB 3A1CA 4RTKA 3SIXA 4CTMA 2A5FA 4Q1AA 4LFCB 4EQ6A 2FPXA 3W3AA 3IVXA 4R3NA 2RB5A 4UJ5A 5JECA 1UZNA 1MPXA 2HU7A 3RWOA 3WL7A 1JDVA 4QOIA 1TU3A 2YN2A 3Q7EA 3CSDA 1ZHHA 3ODGA 2HIHA 2L2QA 2ZRBA 2XHEA 3DMHA 3TVDA 1FX1A 3IKLA 2O54A 4WZAA 1T3ZA 4BO9A 4BBPA 1DO2A 2YWEA 3EC2A 3DZHA 4XUCA 1JQ5A 2BGMA 1Z22A 2FX3A 2QMUA 3FMGA 3PDIA 1GGEA 1KA9H 1RRFA 2IBMA 1O89A 4V0MA 5AJZA 2ONJA 5BSGA 5IWAB 4QLBA 5DGXA 2C2WA 4U5XA 2DGDA 1KI2A 3IRUA 3ITKA 4MMYB 2XADA 1L1QA 1Q57A 3EIUA 3ZXIA 1KE1A 4QYWA 2W11A 1QK5A 1IUNA 3BGVA 4DADA 1ATIA 4UE3S 3I6YA 5C18A 3GLQA 1LPMA 4YAOA 4LZPA 1WXEA 2ZIGA 4M21A 4RFSB 2IHTA 3MLBA 2I8CA 4UZEA 3OPYA 1BN6A 2QVXX 3SMVA 4K9SA 5A9RA 2O23A 2E3JA 1R6UA 2QP3A 3NHPA 2F64A 3EVZA 4LFAB 4C2AA 3K70C 1F12A 3RODA 4DCGA 5LLTA 3AONB 3VSEA 2R6JA 4BO8A 5IW8A 3MGAA 3QMMA 4MIKA 3WP0A 1XC7A 4UCFA 4D0NA 3U40A 1AXEA 1ESMA 4JP1A 3VTAA 4AG6A 5EKXA 5LQKA 1ZVVA 3B2QA 1RLTA 1Q1ZA 3I23A 3KHSA 3NEPX 4IV0A 2C94A 3W9BA 5CFMA 1RJWA 5K0NA 3UHFA 3F4LA 4EI9A 2XE8A 4RKFA 4G86A 3VMFA 4J6FA 4JUBA 3G6KA 3FKJA 2C2MA 1P5FA 1RSZA 3P9KA 1R4MB 1TEZA 4JSTA 1CDEA 4QOHA 4F4JA 1WPRA 1QIIA 1CULC 3A36A 1MF7A 3IE0A 4BP9A 1YBAA 2J5BA 4EWLA 5CJ2A 1XF1A 2FEPA 2EZTA 2ID9A 3N39C 1N2EA 5IARA 3PUVA 1CG6A 5LBUA 4LE2A 1ZDMA 4Z9YA 3WZMA 1C3EA 1I2DA 8LDHA 1JF8A 4E31A 1XEXA 2BEWB 3B89A 4FYYA 4LDRA 3BAZA 3UM9A 1DJMA 5ILQA 4UBKA 1JG3A 5DSXA 4X44A 1ZI9A 1NJ1A 4FYWA 1CZHA 4CM7A 4WD3A 5FYDA 4DDMA 1TZMA 2I2CA 1R9GA 4NYJQ 4INAA 4UVGA 3CVXA 5K51A 4J7CA 2D5IA 4QODA 4ZEXA 3LY8A 3GF4A 5TMDA 4AT1A 5EJMA 4XW2A 5J5VA 3ZDBA 1XDZA 3EDRA 4B8ZA 2JCSA 2YQZA 3B9PA 3H13A 1X8LA 4LDZA 4F96A 4P34A 4J43A 4UHBA 3BFKA 1Q1GA 4P3PA 4C0AC 5GJWC 5B3AA 3KNZA 3UENA 2HSEA 3UQZA 3BSSA 3P20A 4JJIA 4HRXA 1XAJA 3GMIA 1Y34E 2IYSA 1G7TA 1WKBA 3GA0A 2LIPA 3OJWA 1C1XA 1OXKB 1RC0A 2A9KA 2N46A 1MIOB 3C7CB 1R0XA 3FKSA 3TZEA 3BMQB 1PR3A 2IU4A 1Z37A 1Z6XA 4QOEA 4IHJA 4MRSA 1RLOA 2GEJA 3CO0S 3IAM6 3TCKA 4DMCA 3MIIA 4ZDJA 1V3VA 5T57A 2XUFA 3RREA 4URZR 3KZMA 4CG1A 1E7YA 4KE6A 3LXUX 4WZAE 5CB0A 3L7DA 5LDDC 5SYMA 3ZD6A 3GPLA 4WWHA 3OIVA 3T41A 2DWPA 2PWBA 5TDHA 4A1FA 3RYCA 1J99A 2Y1WA 2CT8A 1RQGA 3BE5A 3I5AA 1SB9A 3I45A 4ZALA 2WTBA 1K75A 4BZQA 2CBZA 2OVFA 2PUFA 1WP4A 4JLBA 4BFLA 3EGWA 4L76A 5PGMA 3EMKA 3RU3A 1O6BA 3UXMA 4CBVA 2Z8XA 3LL7A 2V7TA 4YCMA 2QRQA 1JU3A 1XNHA 1M2WA 5DYGA 2YYSA 5FWXB 1JWBB 3CA8A 4AZTA 1WCXA 4CMKA 8ABPA 1Z28A 2NACA 2VTKA 3TLCA 2M6LA 3TLJA 5TMEA 2AMFA 1G5QA 2OR3A 3C8MA 4BBAA 1GGNA 2ZAMA 1GCUA 4LG1A 4RJLA 3LHSA 3AI2A 3LFUA 1GL3A 3MEQA 4RGVA 4F21A 4FFOA 1CSEE 3E7WA 1DJNA 5L3QB 1Y37A 2EP8A 1X7ZB 2W8ZA 3CRNA 4G1EB 3Q2OA 1BOFA 1QPZA 4NAHA 1FP4A 1P9LA 2AFHB 2PV7A 1T2VA 2PSEA 4BWVA 3VPBA 2H00A 3OEEA 1WSDA 2F3RA 1NW7A 3VX4A 3MOIA 3MCUA 4RH3A 2AXPA 1WG8A 2Q4OA 1EM8A 1JQDA 4MKIA 1QH8B 1XYYA 1D9XA 3JD2A 2XMQA 4D43A 2DG2A 3SFVA 5AHRA 1M5RA 1TF7A 4LMAA 2MMGA 3PC8C 3TG2A 2G28A 2AI1A 3EIQA 3W5CA 1ZSVA 3F0TA 2Y05A 4MVJD 5E1DA 5JSZA 1OWPA 2GBFA 2PDAA 3KDPA 5IJ0B 4KVFA 2PGNA 1JQJC 1S8OA 3DVAA 2P5YA 3FUXA 4BLSA 2GT1A 1WZEA 3HADA 4BX0A 4MLPA 5LLSA 2MSNA 3FYTA 8AT1A 4GOKA 5EA2A 1MX9A 1DUVG 1XDWA 3AVVA 1H85A 4D8UA 1PCXA 3DXXA 3GHHA 2ODEA 2VK4A 4N54A 2BW0A 1YRAA 1E1DA 4NPCA 1RRVA 3LAWA 4HWRA 4BWYA 3MERA 2NUAB 3AEYA 1MFZA 2P90A 4EO4A 1IQ0A 4XIYA 5JPCA 1UFOA 1XX6A 1LCIA 3FPKA 2V0GA 1M76A 4S1NA 4UOEA 4HNQA 1LUAA 5DJ5A 4D98A 1K6MA 1YRLA 2V7VA 3RIMA 1DCKA 4D9NA 4FD2A 4JHLA 3ZVNA 3WDSA 1W35A 4BNFA 3ZDCA 1KMIY 1N2ZA 3RAPR 1OTXA 2G83A 1T9DA 3DO5A 4QDOA 3SWWA 2COUA 4RNDB 3UWSA 1W73A 1Z56C 3DE3X 3QWIA 4BQFA 2DBRA 2OCIA 3DDSA 4C2UA 1G8JA 2OO5A 3K8OE 4W7HA 3LKDA 4RZ2A 3AERA 1SU6A 2ZJYA 2FTKE 1UM9B 2VKTA 4NTZA 3AUAA 2X0DA 4YCSA 1I4WA 3W8NA 1RPNA 1ZA1A 4M8LA 3D7LA 4MQUA 4TWJA 5A3JA 3I5YA 3MM4A 1PZFA 4ZARA 4H0CA 3FUUA 5CB4F 2ZZMA 1NZDA 4IIVA 5J2UA 4YMGA 3EHDA 1QCYA 2ZZNA 1IH8A 2QVZX 2OCYC 3CLTC 3CZQA 3MYYA 4G67A 1C8VB 5CM8B 4HWTA 4HLUC 3OZFA 4ZODA 4ZQFA 1V1JA 4RKRA 3G3EA 4L78A 5A5GA 3NM5A 1TMGE 1UWVA 1VHJA 2BP7B 4BJ6A 3UW3A 3WWDA 2QV7A 4AUMA 2ZRKA 2WVAA 5FBZA 3QE9Y 5JUWA 4QX6A 1DLIA 4EB0A 1RLMA 3BFXA 3QEOA 1YR9A 1RFLA 1J0BA 2AZ4A 2I4NA 4TTSA 4G1BA 4MVCA 1WMDA 3A6EA 2X40A 4B3FX 1KFEB 5KOYA 4FFRA 3GROA 3OMLA 2J3EA 2K6GA 3COWA 3KL2A 1UK8A 1HV8A 3WFZA 1QAQA 2DPLA 2PYDA 4UTZA 5C4GB 4ODIA 1GUAA 2WKWA 1ZEMA 3F3MA 2PCJA 2BEJA 2O7SA 4ENRA 3CINA 1BHJA 3ZJVA 4YMLA 1IN1A 1PUJA 3NTOA 2TS1A 4I1IA 3PEVA 3HFRA 5BWLA 5AJYA 1PS0A 3IL2A 3NC0C 5FOTA 2NU7B 2AQIA 4Q9LA 1A98A 2I9PA 2BKAA 3A2MA 3ZNQA 2IYLD 3FSGA 1VI6A 3NALA 4RY2A 1SKAA 1PGPA 3OMXA 4XTRA 1QYDA 1R1DA 2CLOB 2NV2B 4HQRA 4PHCA 1KEKA 1VCIA 3MGKA 4YAJA 1P72A 3IR7A 1E3JA 3EQ8A 1Y9JA 3QF4A 4Q3EA 1VPWA 4G1UC 3AJ9A 1HLDA 2X8BA 2VJYA 3P96A 3DVSX 3GLUA 2E18A 3K9NA 4MKGA 2R751 1RM3A 4DMFA 1XBTA 1HE4A 4OCZA 3NONA 3AL2A 4NR0A 1ZD4A 2BM8A 1Z4IA 2PHZA 1ISGA 1KJNA 3Q87B 4M0FA 2RGYA 4NMMA 4ENQA 2XUJA 2JIPA 3GK3A 2OVBA 4KG7A 2Z57A 3TKLA 2CDRA 3KOMA 5FI1B 4E5YA 4IG4A 3UB2A 3PC2A 1XFDA 2NT4A 4YRQA 4UULA 2PUGA 4F2GA 3E9YA 5INTA 2FHPA 3Q3EA 1W30A 1JYFA 5HIJA 3EZ6A 2UYYA 3IXLA 2PR7A 1GKYA 4OYHA 4TQGA 3SZ3A 3K5PA 3L8GA 3UYLA 2CXTA 5CLHA 3HV0A 5IJWA 3A06A 1PV2A 1TADA 3I83A 4JODA 2HA6A 4JVSB 3IOYA 5HZMA 3VDMA 3CKLA 1II8B 3KPVA 3O3OB 4YUZA 4KQWA 4M1QA 1XEAA 1QQ6A 2BF7A 4R51A 1VIVA 1C0IA 3LHKA 2V7GA 3OQHA 3WDLA 1OAOC 3PQ3A 1QCDA 4DBVO 4Z7JA 3ESAA 4IQFA 3TBHA 2XVYA 1R3UA 1CUHA 3HYNA 3JYQA 3DV2A 4MV7A 3FOEC 4TTAA 1I7LA 5G0UA 1XAGA 2BWJA 2GPAA 2W6QA 1RAEA 1SELA 5AXBA 4O2BB 1XMPA 3MVEA 4KMRA 2IZZA 2XYPA 2YASA 3EJWA 3OQ6A 1CBUA 2VDOB 2WF7A 2IDKA 3LT1A 5K3FA 2EZUA 3T35A 2GN2A 2RBGA 3BHMA 1UKCA 4PXSA 2FZKA 4QULA 3T0FA 3B70A 3N8NA 5JMPA 2J46A 2ASEA 3CKYA 3R7FA 4HGNA 1J0DA 3WK5A 3OHMA 1JEYB 1T1GA 3TW8A 1FS6A 2ILVA 1N7GA 3WK7A 1JT9A 2HSGA 3C5VA 4FKMA 2PUHA 5HKAA 1YZKA 1JR3A 2I62A 4LVUA 2ORIA 3WVNA 3HUFA 3MJFA 4L5IA 4EHDA 3O8QB 1XA0A 5AIAA 1MB0A 4Z54A 3B6EA 4CM5A 4TZTA 2ATCA 1AN0A 1D6MA 1I6WA 3DTVB 3G5LA 1FFEA 2XXAA 2VP5A 2J08A 1B74A 4C01A 4LFBB 3ILHA 5FI3A 2M98A 3DWFA 5DCUA 5JSFA 3O7WA 2F8TA 4GVXA 1WZIA 3A1WA 3CLHA 4KQGA 3RSCA 1FLAA 3TQOA 3WMEA 5B4VA 5K7SA 4NYIQ 1JRLA 4ZZIA 1YJ5A 1KOLA 1LVGA 4Y6QA 5A4IS 1SB8A 1N5MA 3IB3A 1P19A 2J5KA 3VGPA 3EISA 4YP5A 7REQA 4FINA 2LZ0A 4MYSA 2FE4A 2G67A 3PSAA 4FGZA 4MDEA 3PHLA 1ZVMA 4QUJA 4FKZA 5ULLA 4YACA 2REQB 3PXUA 4JJEA 5CMLA 4EJSC 4QUIA 1KK0A 4XCXA 1I6KA 4S3MA 3WTCA 8OHMA 1KTIA 3HVHA 4IVRA 4NOKA 4C2BA 5K3CA 4ZCMA 3FFTA 5IAAA 3WBKA 3H2BA 4DQLA 5D01A 1QZ3A 3OOJA 2W6ID 4F12A 6CHYA 2OGTA 1Q22A 4JQZA 4JY7A 5LQRA 1UDBA 4G3XA 4KNYA 3VPHA 4DRZA 1OIVA 3SI7A 1YHYA 4O4IF 5A5FA 1GUZA 3ZUPA 1Z8HA 3H97A 4XH9B 1NQAO 2JGAA 3BXFA 3KZOA 3RKUA 4PLVA 2P40A 2B20A 4G9EA 4ND8A 5TF0A 3A6PC 1CY6A 4KP7A 1U7PA 1CUEA 1LDEA 3B5EA 4LXYA 4IXDA 3N86A 3WRXC 1S2GA 2DH5A 2OZLA 3ZGLA 1Q6YA 2ZUWA 1WY5A 1JNXX 4GP9A 1Z6GA 1I80A 2E4YA 5EUQB 5HIAA 4LRUA 2NVWA 4GM4A 4HWGA 1VHDA 3Q3IA 3WGZA 1ONNA 3COSA 5C8YB 1EFHA 1NNI1 5JDCC 4KOEC 1JDNA 3CBQA 3OIUA 3OCZA 3BRCA 2QMEA 3QPBA 3K8ZA 2NXEA 1TF5A 2H9IA 4JGBA 4EFNA 2ERYA 5AKGA 1UJ2A 4MQ5A 1JG1A 2IYFA 4J0EA 4BMVA 4EHJA 3GUUA 4FGWA 4GAEA 1CS4C 1ZMXA 4H3SA 1XEWY 5B58C 3DTTA 3WQSB 1X19A 3HJAA 4HGOA 3D8HA 3QJ5A 5CH5A 1ZGZA 4XCQA 4CEJA 4TWAA 2Q29A 4A0GA 2IYPA 4H7IA 1XIVA 4YRGA 2PO5A 3VPXA 4EF5A 4XGIA 3TSOA 2V55B 4CT5A 5CVVA 2I6GA 4C0SA 2B98A 4AF6A 1M2EA 2VXBA 4KPUB 3GLHB 4DNOA 1MABA 5JZ9A 4LJ7A 3MAAC 2IZ0A 2CF6A 2FOIA 4OJKA 3P9XA 1T29A 2B8EA 4BE7B 3FFBA 3GZNB 1QK4A 3NT5A 1NXOA 5AJHA 3GNLA 4ZO8A 1RRGA 3GEHA 3HKEB 1AKNA 3HNOA 3U0BA 1N6KA 2OYRA 4TZ6A 5JYBA 1P2FA 4L5JA 2ZI7A 4ZCPA 2VCYA 3T7DA 4ARZA 4P6VF 1O9HA 4FLMA 3UKDA 1P39A 5K0JA 1A76A 2R6CA 1CY0A 4D8XA 3V8BA 4BVLA 1YS4A 1PQWA 4DA8A 2XMGA 821PA 1BS2A 5BP7A 1NMEA 2W2QA 3CJTA 2DHDA 2G76A 4RD3A 3RS5A 3G82C 4EF6A 3ZVKA 1HMPA 2Z98A 3AUFA 1PK9A 1CJVC 2XD9A 4JVNA 4YC7A 5GV7A 3RSHA 1PJ4A 1YULA 5DTJA 4BTLA 1TAGA 5JZMA 1L8AA 4CW7A 1E99A 1QORA 4JU8A 4RV9A 1VLLA 3ZEIA 1EK5A 1LSJA 1Y1LA 2R66A 3CF6R 3UATA 2EFJA 4HFNA 1NBOA 4RIFA 2J09A 1UIRA 4ZRMA 4CMHA 4DIFA 5DM70 3AUSA 2EQAA 4ZOLF 5F76A 2GZDA 3L0DA 2Y99A 3BWEA 3PUWA 4TT8A 3KVVA 3GRZA 5ERYA 4YV7A 1NP6A 2CMHA 4RK0A 3DDCA 1RRPA 4HAUA 3RT1A 4G0WA 5A9TA 3UXYA 3VNRA 4WBNF 4CV2A 1MVLA 3GWZA 4DGQA 2VBGA 1L4BA 1EFUA 1SU7A 5E0KB 2O0LA 4BQNA 3FLEA 2ES4A 4PHFA 1WXXA 4WECA 1YA4A 2B4RO 2E2WA 3C1TA 4NENA 2XBUA 2O19A 2VYNA 5IXJA 1R18A 3GDWA 1P7PA 1M9NA 4PYMA 3LGAA 3WJ1A 3AZOA 2IXBA 1GL6A 2AR7A 1P5JA 2NQ8A 3LT2A 4YAKA 1ISSA 4DLKA 2AYYA 2MOKA 3GZTB 1G2PA 3LXRA 4LNUB 1FFYA 3ZVRA 1TGVA 5K05A 1CB7A 4MVJM 5KSWB 2HFKA 5JNVA 1NF8A 2ATEA 4W1RA 3EMDA 5JEEA 4TLLB 4XQ9A 2LGJA 2COEA 2YV3A 3WLIA 4P92A 4J0HA 4OD0A 1YA6A 1LI5A 4MV6A 1PN3A 2H29A 3ESCA 1T6YA 3EXFB 2FG5A 2YIDA 3K8QA 3TB4A 3RARA 4B3IA 2PL3A 3DDHA 1VMIA 3ME5A 3VYWA 3PEWA 3Q4GA 3F5FA 1FSSA 1RZVA 3QNMA 5ESXA 3A1NA 5I3CA 1A5SB 1JDBC 2XXJA 3PC8A 5EGNA 4L1KA 1SEVA 3PUHA 3CNBA 1HDEA 1U2QA 1SOAA 4F3YA 2EZ4A 4BKUA 4D25A 1UBUS 4F3CA 5JS7A 5L4SA 3PGXA 4WY8A 2O3TA 5AESA 1PJ3A 1RYBA 2DAPA 2IUYA 1EQAA 2CLIB 4JLAA 3IUBA 4KWHA 1T8PA 4X6XA 5F77A 3I4CA 2VDLB 1GPJA 2QEQA 1Y98A 1ZN9A 3K6KA 3R5XA 3VOAA 3G8CA 3AG5A 3FZYA 1IPHA 2NP7A 4S2EA 2YFHA 2REBA 3RCBA 4Z2YA 2DR2A 1UPCA 1IEVA 4EBFA 3TW6A 2BBOA 2IYZA 3JX9A 2NO5A 3HNRA 4ZI5A 3E7XA 3A28A 3BEOA 1J1ZA 1UKZA 5EGSA 3VPDA 4CKWA 1DEKA 1YA8A 3FPGA 1TO6A 1SH7A 1OA1A 1I4OA 1HDOA 3HV2A 4WY2A 2IUTA 5DBFA 1LX7A 3DWIA 1KY3A 1L1EA 3TTTA 4BO1A 3ZY6A 3WGJA 5B1DA 4US0R 3OQNA 4PG4A 2JZCA 2CXPA 3PDUA 2XVAA 5K3AA 3CRQA 2WD8A 1W0KA 1ORIA 3O95A 3ZJ4A 3STUA 1RRMA 2ZXFA 1GRRA 2PK3A 3GGJA 3SCZA 2YZGA 4LSWA 3D4IA 4KN5A 1QF6A 3FCYA 5TS3A 2XBMA 2REXB 1DHTA 1KDRA 1GPBA 5IZ4A 1P8JA 4UEOA 1KI1A 4D9KA 3ZDYB 4ARUA 2I03A 2G70A 2QLTA 4DQXA 1F6BA 1IL0A 5JQGA 4M6WA 1E2HA 1I2MA 2F7SA 3GN1A 4BDTA 4PCVA 3M3DA 1OLOA 2C5EA 3V8QA 1C0KA 1Q1BA 2NZYA 1SG9A 4D3SA 3NHAA 1HEIA 1PEKE 3PUZA 4G07A 2P4HX 1DQYA 4PHGA 1U5BA 4Q3LA 4NDNE 3LLSA 4HLUA 4ZT7A 3QKRA 1K0UA 3K94A 2W7TA 3ZWDA 5BT8A 5LPNA 5FUWA 2A86A 3KJZA 3FVRA 5FWDA 4L3VA 3EPJA 2O8DB 1A8SA 1F14A 4G5XA 1WCV1 4P3YA 4KUGA 4REQB 1J8QA 4ZVOA 1REQB 3GLFA 2BLNA 4KDRA 2HBZA 3ZK9A 2FETA 2V4ZA 2GXAA 3EUWA 1A77A 4X93A 5BY2A 5IYZF 3Q9LA 2JGMA 2B2CA 3I72A 5DM60 4P3NA 3CY6A 5LKAA 4M22A 5BW4A 5CLFA 3R0XA 1BVYF 4WEQA 3QRWA 1OC4A 2GN8A 1VG9B 3TCNA 3KWLA 3W2FA 1DFIA 2FPRA 1PWEA 4JEHA 4MGYR 4V0QA 3DUFA 4C4RA 5LQJA 3N58A 5LXTB 1UPBA 3DMTA 4L4RA 3OSZA 1KL7A 3CFYA 3ON5A 3SHOA 3SFZA 4K8RB 5F7ZA 4B4OA 2AB0A 5G3ZA 4DIEA 5H8WA 4U2FA 2WA1A 2XUPA 2AD1A 3DEFA 2QW1A 3MZ0A 3WKCA 1YR1A 3QYAA 3V46A 1SWVA 2ZYHA 4K86A 2ACEA 5FTNA 5K4GA 2PH7A 3C7KA 3U19A 1MHTA 4XASA 2C5BA 2OBYA 3MLEA 3PNLA 3PXDA 4UAUA 4P82A 1WLYA 3ZE8A 1Y3AA 1TQ6A 2GTHA 2ZE7A 3HUDA 4QFMA 3SDSA 4BRUA 4RHXA 1V7ZA 4WLNA 3W78A 5C7IO 3R40A 3GPBA 3T5PA 3OLCX 4U6SA 2R2AA 5LA6B 4C6SA 2ALJA 3HVIA 2XYHA 1KU6A 1G3IA 1BGVA 5EJ6A 2H0AA 5DYYA 1KEVA 3FWKA 3O91A 5LIRA 2HR1A 4US2R 3G68A 1Q7BA 4XLTA 5KAMA 3U17A 1S89A 4UBJA 2Z9BA 2J9YB 4IZ6A 5D85A 4I9NA 4ERNA 4PSKA 2G06A 1ZIYA 2WDZA 3MOSA 1PHRA 2VNIA 1QIKA 5EZ5A 3QK7A 4OI4A 3ZGNA 1RWMA 1PJRA 4W5RA 2HBQA 2I6FA 1XU4A 2H2WA 2HCRA 2QN9A 3OSUA 3TD9A 3GFSA 1YF3A 4LJ4A 1SOUA 5J4VA 5H9VA 2GBLC 4G4SO 3UG6A 2R7KA 3JQGA 3V4LA 4E46A 5TT1A 2KS6A 4R0MA 4PINA 2GAJA 2H6EA 2WYIA 4PZCA 4C03A 3E4DA 1BXZA 3P0HA 2Q50A 4EPVA 1ADFA 4PFJA 4TSKA 1AKQA 2ZB8A 4BNYA 2OQVA 4ER6A 4XIJA 5CEFA 2RI0A 1LPOA 2E9SA 3JRWA 2ZRJA 4N3BA 1NBME 4K26A 3IKTA 1JWLA 2J41A 3NIBA 1I1NA 4FR5A 1JQ3A 3E03A 2VKQA 5ECDA 4BPRA 2WJ4A 1NSYA 2GASA 3HUEA 3ZYZA 2GKSA 3GW8A 1DXHA 1W59A 2GILA 2J3MA 1OAOA 3BTOA 1NXVA 4A5SA 1WQ4A 1R10A 3LT4A 4OQYA 5FCDA 4K5QA 1PUIA 5E7IA 1FE8A 1CDOA 3PGLA 1ELOA 2I67A 3AR2A 1NRXA 1DKQA 3NRCA 4AN0A 2FPGB 3CLUD 3NJ8A 5SZKB 2DLDA 3S81A 3LI2A 2P3SA 3QPVA 2HMSA 2H8KA 4H7PA 2QGFA 4HHEA 4EYGA 4DDHA 2EP5A 4G26A 4WXRA 4X90A 5BOSA 4BC1A 3Q88A 1XJQA 2HNAA 4G5RA 1JAHA 3P52A 1PNQA 1NI5A 2G9RA 4BQPA 4BV8A 3ICEA 1U1DA 1D7OA 2ZJ4A 1XXLA 4CU2A 2B4AA 4C7KA 4DT1A 4URWR 4B4DA 1HR0B 2C2XA 1DEHA 1VOTA 3GD5A 4KI7A 1R0KA 1DMRA 4O4HB 2JCVA 4P7GA 5DNEA 2YN0A 1DWPA 2FFBA 3PUYA 2ZPUA 4BEVA 5B30A 2D06A 4LRTB 2IYUA 3QELB 3UK0A 2Q0SA 1EVEA 3SSOA 2MSLA 3OLZA 4U1RA 2GA9A 4YRRA 4M0PA 4JT8A 2XGJA 2XRFA 1ICEA 1R0LA 1KEZA 3KSMA 4IFBA 4IDHA 3VA7A 4M9XA 1GNPA 1Z13A 2VPYA 5ER6A 5B1SA 5I7OA 5E0OA 1HYGA 3HJHA 3HN2A 1Z4MA 3CWQA 3ORSA 5K6AC 4N40A 4MWDA 2J0EA 2N1BA 2PT6A 3IUSA 2JK0A 2HRBA 2R48A 3L8DA 4G8BA 4PZAA 4RZIA 3C3PA 4QRHA 4RY9A 3RVQA 3GJ6A 1FJHA 4F56A 4C6TB 3TQFA 1I5OA 1WIWA 4D9MA 1ZC3A 1YHNA 4XVCA 3ONFA 3HP1A 3BGDA 4Y2HA 2GNAA 4IHQA 3WNDA 4ENTA 1VCOA 5AW1A 3R8FA 1ZR2A 4HDAA 3MJEA 2ZI6A 5KDDA 2P4EA 2VN8A 3PFIA 4QIHA 1THZA 2QUZA 5AK6A 2VVTA 3B3QA 1DBVO 2QN1A 1HNWB 4NK4A 4RZXA 1GDTA 3QEMB 1KH1A 4KXWA 5FTMA 4X7PA 2BV3A 2OK8A 4U7TB 3T54A 3UXEA 1N1DA 1E79D 2CE7A 1XQ9A 4IKEA 2A59A 4QJ5A 2VT6A 3AVOA 3CRRA 1H3NA 1KAGA 2BI4A 4W9NC 4GEKA 1MBZA 4WBXC 1X1CA 4BNDA 1N2SA 3JATB 5K9ZA 3THXA 5SY9A 1W7AA 1J97A 3WGGA 2DEUA 1X0VA 3HZRA 3BZWA 3S7TA 2FP4B 4J0GA 4CLRB 1EI9A 5EP1A 1FTYA 2GA8A 3WRXA 1EBFA 3QNUA 4DCCA 4D9JA 5KKCA 1O96B 5A1JA 4CF3A 1JX6A 4NAUA 3QLUC 2OFPA 3KYCA 5KMGB 1SBHA 5HYVA 3E27A 1CUBA 5JT1A 5JDCA 2R8ZA 2PLRA 3LE8A 1H4QA 4FT4A 4G01B 1NRIA 4TV8F 3K1AA 1OBCA 3UJ6A 4Y6RA 3IIEA 1CPYA 1Z7WA 2QTFA 2G07A 1SHJA 3NV9A 5EQDA 4J9UE 2HI0A 6PFKA 2YW2A 1E2PA 2UVQA 4P0PB 1BMFD 3LBYA 2JRCA 1EVJA 2IPAB 4CMAA 4JUIA 3QX8A 1SPBS 1L4MA 2X8WA 1M2VA 1RTKA 4X3CA 1FSGA 3LSTA 4WTOA 2OBNA 1EGQA 2X4GA 3D81A 1VSTA 3MXOA 3AEXA 3NXKA 3B5JA 4Q4JA 3VU9A 3HR4A 1TMOA 5B3JC 2PRZA 3MSCA 3R3JA 5E1OA 5ERGB 3MGBA 3ZWNA 3UHAA 4DV3B 1O3YA 4BE9A 1L7VC 2HH9A 6GPBA 3RU2A 2LR0A 1YRWA 4JT4A 1AKUA 2HWWA 2EKLA 4XDGA 2ECQA 3WB0A 4HDMB 1VZ2A 4EB3A 5KQMA 2J32A 1QRAA 5K8LA 2FG7C 1ESNA 1NI3A 5JZSA 1E6EA 3NOQA 3NIGB 1E2MA 4AMUA 2YMMA 2HMUA 4LOKA 3IAAA 3ZDAA 1A5TA 3QXGA 3ZXUB 4DKJA 2Z4SA 2WIKA 4QAJA 2IYNA 2BHRA 2CK3D 2WSLA 4CFYA 1KPIA 1ZKMA 2IXAA 4EO9A 3VDRA 3MTQA 2BDTA 3MRVA 4X20B 1EUYA 2XOEA 4LNHA 3BSWA 2YICA 3K7EA 4WESA 3UFBA 3EGXB 1SIBE 3JR3A 1AXGA 2CEKA 4FOPA 2VNSA 1ZW1A 4B47A 3M6MD 3CVYA 3E7FA 1X14A 5JPDA 1KMCA 4U39A 3BA6A 4WFKA 2VF5X 1O0SA 4H27A 3A1TA 3NT2A 1SVSA 2HO5A 1LW6E 4H0NA 3LTEA 2HU8A 4RSMA 3AUJB 4RQUA 5HF8A 1WDMA 2QZ4A 3BDIA 1XD2B 3SXUB 4G8CA 1IXZA 2HA7A 4B6JA 1P4AA 2P7HA 1XMQB 3AB7A 1YOVA 3N7UA 5GQSA 1G5PA 1AE1A 2NO4A 3C6YA 5LU9A 5KTKA 1UT6A 1D4OA 1XZKA 1H6BA 4YWHA 5D7NA 2RH5A 4V1CB 3O9MA 4FSXA 1P2BA 2YWBA 2V3WA 1BHQ1 1E2UA 2HCTA 2F9LA 1AV7A 7YASA 2ZT8A 3IOCA 1E4EB 1RE1A 2E6KA 3QVVA 4NCIA 4Q3AA 5BWMA 3I9JA 4IOKA 3IEMA 1SKQA 4M1ZA 3R9IA 1Z8DA 1L7RA 3L41A 1NF3A 5LJIA 2HK6A 3RSSA 4CM8B 1PZNA 3T1NA 1E3TA 1M2FA 1LVUA 2ZYGA 5EHQA 1C1DA 2C0QA 3ZHXA 1GXSA 4OB6A 1II0A 2QTGA 5LSAA 2GHRA 4BLVA 2V6GA 1J0XO 1RMYA 2DWQA 2HCBA 4IMIB 4NZPA 2B7BA 3SHWA 1DTEA 3C3EA 4FR2A 1BJTA 1RHMA 3D6MA 4RTPA 1I51A 1P6QA 1UP4A 1ZD5A 1V11B 3IAEA 4N5NA 1KDYA 3S28A 4C43A 2AJCA 1Y8AA 3A1EA 3DL2A 4MLDA 4EJMA 1YFJA 1DBWA 1DG3A 1M8GA 3L7OA 3RRZA 5HG0A 3SNHA 4DR5B 4JB0A 3BCSA 4CMEA 4JFAA 3H2SA 3CNNA 3FSEA 5T6BA 1PF7E 2BH9A 5J4LA 4B3TB 1PR5A 1U2GC 1CUSA 4Y1RB 3UIEA 3WWZA 4KE8A 5AVZA 1JI3A 4OATA 2RONA 1U0OC 2VK2A 2IHBA 3IA2A 3FPFA 3S6JA 4S1TA 4R6WA 2QSUA 4KO2S 1P1BA 5C81A 2YJTD 3KJIA 5JFGA 4OAPA 5U4QA 2JLSA 4BNVA 3LA6A 3A11A 1R8JA 3SZOA 3AESB 2B30A 1WKVA 3HWSA 1APBA 2H1WA 4YQYA 2Z83A 3DM5A 1WXFA 1NKTA 3M4YA 4OYYA 2WQ7A 3C7DB 3AP1A 1SHLA 1XQWA 3W06A 4ZDIA 2XUIA 1Q19A 1FTSA 2QJOA 4NWIA 3WGTA 1KQFA 4J07A 1C9MA 1F0YA 3HN6A 2FW7A 2BYTA 5KWSA 3QM1A 1MNQA 5IVPA 1UPXA 5LQCA 1QC5B 4WNCA 3VOTA 4EG7A 1GZ7A 1PFYA 4RYDA 1TYEB 4O0LA 1W49A 1G8GA 3BD6A 3HKCB 3ANLA 1X1SA 4I8IA 2Z56A 4LNAA 4QARA 4ZPJA 3T1YB 3K9WA 1GZ3A 1M6WA 2ASVA 4F06A 4YQFA 1TUBA 3H4MA 1PJCA 5MHTA 4DSOA 2EHJA 1IZ0A 2X0FA 3UJPA 1R0CA 3ABOB 3B3GA 1R8YA 1HURA 1TRHA 1L0BA 3GCDA 1KVTA 1ODLA 1Z2NX 3JSXA 3OIWA 2PQMA 3KSUA 2XH8A 3OZIA 4J9VA 1D2GA 1BU8A 4BO3A 4CPDA 5C31A 2V3CC 3LYLA 1KRHA 1NYLA 1O97D 2RGBA 3CPSA 1G4HA 2NU8B 1KNXA 2BRUA 1IXSB 4YAGA 1RZ3A 3TS1A 2V8OA 5C5IA 2C7PA 2VWQA 4NULA 1DT5A 3E9DA 3V7WA 3J81k 2R86A 1MAVA 3VKVA 4QT4A 5ILGA 4A7PA 1SXPA 1VMEA 1P1CA 2IQ5A 4TQ9A 1U8TA 4IVNA 2POQX 1ZD1A 5KHOC 3Q2KA 4TLCA 4Z9FA 1WJGA 1FPQA 2VP6A 1YQWA 3D7SA 2ANBA 3MTEA 3BC1A 4JT2A 5CT5A 3CURA 2PL1A 4RKYA 1MG0A 1PR6A 1W0JA 3E35A 1IUKA 2XGMA 5C1PA 5DWVA 2ERCA 1IOZA 1QV9A 2YWCA 3FCAA 1F2TA 5ALDA 1GKUB 2JEYA 1Y4DE 2O48X 4GNRA 3VSAA 4EMUA 1X77A 1ZGBA 3OIDA 2PPLA 2VAXA 2XSZA 3DLIA 3ZD7A 1I7DA 4Y6LA 1AKTA 4TMWA 1SUDA 5CM9C 2H59A 1JDJA 2BMEA 1ZUHA 2I2AA 2HZBA 2ZIXA 4LJSA 1JKIA 3NM6B 2ANCA 3PSHA 3SBDA 2H7XA 2JLUA 1PYOA 5FTWA 1YE5A 5T5QA 5IN4A 1O4WA 4F6CA 4DMUB 1VP9A 1YCDA 2BFEA 2IE8A 2OV8A 4HUQA 1LPAB 3PJRA 3UAXA 3KJQA 1N2JA 1AGRA 2B35A 3L7KA 5EJ4A 4TYMA 4Q9JA 4P4GA 2PBZA 3ZV5A 1A9PA 4X7RA 3KEFA 2YHUA 5A5VA 1WRBA 1O6GA 1ZMOA 2RHRA 4N5DA 1YB6A 5ETJA 4D7AA 3ZBQA 2G36A 4FI3C 1U3WA 4X91A 4F0JA 3EZYA 4CIXA 5M5BA 4C4TA 3AF5A 4DM7A 3AVPA 4BVBA 3EOAI 3BHNA 4IDFA 4EGQA 4ER7A 4I4TB 2QB5A 4BGDA 3P27A 4E2ZA 4HAWA 3CCCA 5K0CA 4MVJE 1MEOA 3RVLA 4B5KA 2J67A 2JASA 2C78A 4FMCF 4J0FA 5TQ2A 4YAUA 4XLZA 1QSGA 5JWOA 4W7SA 4FFSA 3EXHB 3JQDA 4B6GA 1U9IC 1JSZA 2YCBA 4G8JA 4GYYA 2X0RA 2J0VA 2CKDA 4HY3A 2XE4A 3KUXA 3S2ZA 1ODSA 2XR1A 4OSEA 1E20A 1L5HA 2R44A 4TS9A 1KKUA 2CDBA 5DMHA 2OV4A 5CA0B 4R41A 2R6ZA 2JGDB 3SEAA 2H1RA 3CH5A 4F6RB 5BQFA 4JELA 1DBRA 4CDNA 1MIHA 5KKAA 1OZGA 1A2QA 4KQEA 4F5EA 1FQOA 1GY8A 1XSEA 2PQ6A 3BXXA 4OXNA 2OCBA 2ZJAA 2D5LA 4YONB 3HYCA 3VH3A 1THGA 3QPDA 4JLWA 1I7NA 1CUFA 4KXMA 1L7AA 1S2OA 3DBRB 4FX5A 1QONA 2DP4E 4TLBA 5I9TA 1V5EA 2Q8PA 5CEJA 5CFNA 4Q7JB 5I4BA 2CFTA 2P0AA 3ANNA 1QZTA 3EODA 1DXOA 1BC5A 1JYEA 1TVEA 3I01M 4W5HA 3TE6A 2PMKA 3QV1A 3QUSA 3CLUC 3R7WA 2EV9A 2Q7XA 5K6TA 1ZMRA 4D0SA 3B48A 3PI6A 5A03A 3C3MA 1A9TA 2R6AA 4Y6OA 1XRMA 2QN2A 2Z6VA 1PVOA 3OVMA 5CW2A 2HX1A 2FMKA 2V1UA 2QZPA 3KDSE 3KEGA 2WWYA 2BM0A 4ZVPA 1XP8A 4AKGA 4GI5A 3PRYA 1FNMA 1JLMA 1J8MF 1J0EA 2PBLA 3DP7A 2OV2A 2YC2C 5IEJA 4EFMA 1MD9A 2R65A 5BVHA 5ADUS 3GX1A 2C4NA 5EAIA 5HKKD 4KGZA 2ZRNA 5B4UA 2VYFA 3KTOA 4C5CA 2JI4A 5FBLB 2VBIA 1ZW6A 5M2QA 1GVNB 5C7YA 4LUCA 1QUFA 3G8DA 3EDOA 1T0UA 5LIPA 2B1JA 3GHYA 2R25B 2C42A 4KVZA 4MLZA 1YR6A 3PTAA 4LV8B 3H0EA 4ZHQA 1KVSA 1U8UA 4IXNA 4PONA 4QLOA 4QVIA 3PICA 2XVMA 2HSZA 2UVPA 3RRMA 4LWPA 3UVEA 1PJ2A 4HZUA 3ZKWA 2G9UA 3RJZA 3S2IA 2O8EB 2WF8A 5HRAA 1SUCA 4AFNA 3KWFA 5K6AA 1A9XA 1CW2B 3RFVA 2B7LA 2KHZA 1HG1A 4BX9A 5DSZA 4HDCA 4UUBA 4HGPA 2CMDA 4JQCA 5F5XA 4ZAXA 4G1CA 1M72A 1P60A 1IUPA 3IYLW 4HC4A 2GWRA 5AKXA 1TDJA 5J5CA 1IZ8A 4D8TA 2LTAA 3CYFA 1GPWB 1R00A 1QV7A 1JV2B 2W6IA 2HXYA 3FUCA 4TLEA 5F51A 4NCKA 1RKUA 1YTLA 3SC2A 3SJBA