4LVUA

Crystal structure of a putative short chain dehydrogenase from burkholderia thailandensis
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
254
structure length
252
Chain Sequence
DERYARYPSLAGRAVLITGGATGIGASFVEHFARQGARVAFVDLDEQAARALAARLADAAHEPVFVACDLTDIAALRGAIEAIRARIGPIAALVNNAANDVRHAIADVTPDSFDACIAVNLRHQFFAAQAVIDDMKRLGGGSIVNLGSISWMLKNAGYPVYASAKAAVQGLTRALARELGPFGIRVNTLVPGWVMTQRRLWLDDAGRAAIKAGQCIDAELLPGDLARMALFLAADDSRMITAQDVVVDGGWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Oxidoreductase, short chain dehydrogenase/reductase family
publication title Crystal Structure of a Putative Short Chain Dehydrogenase from Burkholderia thailandensis
rcsb
source organism Burkholderia thailandensis
total genus 96
structure length 252
sequence length 254
chains with identical sequence B
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4lvuA00
3PFWO 2HMSA 1CJCA 1A9ZA 2YUTA 1HDYA 1R15A 5JDIC 1U5CA 1Q0QA 3OICA 3ON5A 5K9ZA 5LDHA 4JX8A 4TKLA 2EW8A 1SNYA 3PXXA 5HWSA 3AM5A 1D1TA 1RYEA 4O1MA 5TQVA 2CVZA 3E18A 3JYLA 3TNLA 5DOVA 3NT4A 2ZCVA 3PDUA 4AJPA 5ITWA 1SEVA 3C7DB 4WLNA 3DFUA 3K73O 3OHSX 1P44A 1GZ6A 2C5AA 3AM3A 3B20A 4JP3A 4YDRA 2Q4BA 1XA0A 1QYCA 2BHLA 4CQMA 3E82A 5HTOA 2QZZA 3U3XA 1UR5A 1LA2A 3BMOB 5G4KB 3U4DA 2X6TA 3JSAA 1PSDA 1C1DB 2UVDA 3CXRA 4D0RA 3ZNPA 3M1AA 1ISIA 1ADBA 3S55A 1DRUA 3STHA 2WTBA 4OKIA 5U9CA 1KEWA 1KIFA 3D4PA 3UFXA 2QRKA 3G0OA 5DP1A 3GUCA 4J2HA 4ZQHA 3TRIA 5JO0A 3GZ4A 5I7FA 2LDXA 1LSOA 4YR9A 3JQ9A 4MKXA 4OQZA 1U3WA 2I67A 1YRLA 2VOJA 4J7XA 1Q2XA 3B6ZA 4L8VA 4R1UA 4YVFA 5KTKA 1M6WA 1NFRA 2B35A 3IKTA 1ZKMA 1MG0A 2BRUA 4FGSA 5T8KC 3K96A 3H4VA 1GTMA 3O26A 3K2EA 5IDXA 4DC1A 2GN4A 3FF4A 3VTFA 3WR5A 2OO5A 3PK0A 4AJ2A 3QA9A 4J7UA 1V9LA 3A06A 5TGDA 3WB9A 2RCYA 2OXIA 3V2GA 2F1KA 2NUAA 2NVUA 3F1KA 4O5OA 1P31A 2YY7A 4D41A 1JQBA 2B5VA 1GQYA 3A14A 3JD1A 5TJHA 1EQUA 2B69A 4Q3CA 1O5IA 1VL0A 3UVEA 3ZGYA 4E5YA 5TRTA 3NX4A 3LLSA 3H5AA 4OKNA 5EERA 2BI8A 1DOHA 1A5ZA 1QR6A 1F06A 1G6KA 4HX5A 2ZJ0A 3UAGA 2ZJ1A 1P45A 4TRJA 2WYVA 3EVTA 2O48X 4BKUA 3DBRB 1V0JA 3AUSA 3M6IA 2B0JA 5TF4A 3BHMA 3T4EA 3I9OA 3RUAA 4JROA 1HLPA 3ZDFA 3FWZA 4PZCA 3JD2A 3LT4A 4CUKA 3UH1A 1TT5B 4LW8A 2GD1O 3RKRA 2Z95A 2VHWA 2YDXA 3OQ1A 1H94A 1YB4A 4JBIA 2VNAA 1DC6A 4CM3A 3GVXA 1TB4A 3EDMA 3RC2A 4E12A 5B4UA 3AY7A 1LDMA 3GHYA 4YQZA 5IZCC 5KWEA 3IKVA 1PZGA 1KEUA 2EKQA 2AEJA 2GSDA 1VM6A 4BS9A 2PTGA 1ENYA 1TT7A 2JFHA 3EMKA 1JVBA 4E3ZA 2C54A 4D3DA 4D42A 5L40A 4B7UA 5EMHA 4CMIB 1UXKA 2YZ7A 1YOVB 5L51A 3C85A 1GU7A 2VRCD 4BNYA 4I1IA 5K6AC 2OBNA 4DXHA 5B1YA 5C37A 1WZIA 3KUXA 2VZ9A 3A1NA 3RUDA 3WYCA 4BGVA 4B4VA 5F1OA 3QRWA 4O0LA 1X13A 3DOCA 3INGA 1AXEA 5HBRA 3S8MA 4Q3BA 5AXBA 3HUDA 1ZVMA 3WLFA 4BL5A 4QXMA 3IP3A 3ADOA 2ZB7A 2RHRA 1T1SA 4RGBA 4MDHA 2HMVA 1P1JA 2OP0A 5CDGA 2GNAA 2ZQYA 3ANLA 1Y81A 1M66A 4B79A 4PLVA 3OIDA 3ZU2A 3V2UA 1B0AA 1FDWA 2FR1A 2CY0A 5DNAA 3G1TA 1CWUA 3WGHA 1CYDA 1PGQA 4WPGA 3K2BA 4BGIA 1SC6A 2P68A 3VZSA 1Z74A 3GZNB 3JQ7B 4J3FA 1DB3A 1FDUA 2J6IA 1EVIA 4XZ3A 4OHUA 3O8QB 2D2IA 1B8PA 1XELA 5FI3A 3GVIA 3OJEA 2O3RA 1ADFA 3ADPA 3VPSA 1IL0A 4BNUA 1ISHA 1EUZA 2BKAA 1Q0LA 5JC1A 3PHIA 3QVOA 2TMDA 3KYDB 1P9LA 3EK2A 4D46A 2C0CA 4EITA 3VOSA 2FHSA 3MJCA 3VH3A 1P3DA 5AYVA 1E0DA 3PHGA 5I7SA 2Y1GA 1MXHA 1YWGO 1EUDA 3C1TA 1HL3A 3DZIA 4WECA 4P4GA 3TF5A 1Z73A 3HNPA 3ZV4A 4J90A 4RPKA 4ALJA 3GA0A 1O95A 3HQ4O 1NP3A 4LISA 2JL1A 1YBVA 4TZTA 4DLLA 3CZMA 2HK9A 2OGUA 1E6UA 3K92A 3OQBA 4CM6A 2X23A 3ICCA 4ND5A 1X7DA 2B4QA 3L9XA 4IJKA 4X54A 3D1LA 4XJTA 5KKCA 3SVTA 2EJWA 3PJFA 1G1AA 4XD2A 1Y1PA 1IUKA 2UAGA 1DEHA 1HDXA 2G76A 3MTJA 1K3TA 4DIBA 2Y0DA 4Y67A 3WQQA 4OXNA 1GPJA 1FDSA 1XR3A 3LC1O 4CM8A 4GGOA 4KP7A 3QWHA 1C1XB 4PGFA 3AU9A 4JIGA 4GX5A 3QWIA 3ZW8A 4GPD1 3GF4A 3NDRA 3UW3A 3ZH2A 4BNVA 4CM9D 4GX2A 3F1LA 1N5DA 4J43A 1LSSA 2CVOA 2ZTMA 2X1HA 4G65A 4GWKA 1N9GA 1BG6A 3KRTA 5FEUA 3INTA 4CV3A 3PLRA 1R4NA 3LVFO 4Q3AA 5EJ2A 4IDAA 1OBFO 4CLRB 1K6IA 4BO2A 4MIYA 3DZGA 2D1YA 4LCJA 3OETA 1PJ3A 1E1LA 4Q39A 4YT5A 3TZKA 4QECA 2AQIA 4MVJM 5IN4A 1VRWA 1YL7A 3RIHA 3SJ7A 4GAEA 1WDMA 1ORRA 2WYWA 1DC5A 4U5QA 8ADHA 2NU8A 1WMAA 1EE9A 2OBYA 3CMCO 3GVHA 4XQCA 3RC1A 4ALIA 3ZHXA 1PGOA 4OO3A 2J3IA 3GNSA 1KYQA 3PP8A 1VI2A 5TNXA 3WLEA 4ZGWA 4XQGA 1V3UA 4BQRA 2ILTA 4EDFA 4YJFA 4Z6KA 3F5SA 1UUFA 1JWBB 1RWBA 1YH3A 1CETA 2E48A 4XDZA 3WGGA 2Q2VA 3GDOA 3F47A 2O3QA 3PZBA 4KMSA 4ZRNA 3T4XA 4NBTA 4XCVA 4BNIA 2Q1WA 1KETA 3IJRA 5G0VA 1YJ8A 2O23A 2YHUA 3PYXA 3NDJA 5COBA 4R51A 4CM4B 2QZ9A 1MA0A 3JQAB 4KTTE 3D5QA 4S3MA 1UH5A 3TZ6A 3UHAA 2X5KO 2W2LD 4I5EA 4N18A 3SLGA 5CDYA 3TWOA 2BMAA 2CDAA 1IPEA 3DL2A 4MINA 2BF7A 3TPCA 1ZMOA 9LDTA 4BB6A 1EMDA 4CLOA 1JDJA 4RVDA 4XRRA 1SEPA 3KETA 3IOYA 3PLNA 3CZRA 3EHEA 3FWNA 5KJ6A 4CL8A 2VQ3A 3KYCA 1Y6JA 1Y7TA 4OSOA 3WFJA 2VWHA 4MP6A 4UEOA 1QXSA 3DDNA 4JLWA 2O2SA 4BMNA 3OJFA 4CR6A 2DPGA 4FW8A 5COQA 1KOLA 3GRKA 4R9RA 2FR8A 3EZYA 1QMGA 3GEDA 2B37A 2HKIA 3PQDA 4J4TA 2O3TA 2P4HX 3VC7A 2VWQA 3EUWA 7ADHA 1DJNA 1BW9A 3I1JA 2Q1UA 4MJLA 1C0LA 1NPTO 2PZLA 3ZWWA 3SEFA 2X9NA 3H9JA 1LX6A 2X86A 4AJKA 2VN8A 4RPJA 2VYVA 5KNLA 3IC5A 4XB2A 2W2KA 3GFGA 4RVUA 1HDCA 5DF1A 3W8DA 2NTVA 5B4VA 4B7CA 5L7TA 1E1MA 1HE2A 4U0JA 2PV7A 1LQUA 1QORA 3GH3A 4I8XA 1PS9A 3N58A 3RFXA 4HKTA 1UP6A 5G2OA 3GNTA 1Z6ZA 3FHLA 1V6AA 1LU9A 2I65A 4AJEA 4CMJA 5IG2A 4CUJA 5L4SA 4P38A 1IPFA 2NU9A 2YYYA 1ZK2A 3VH2A 2B36A 2PNFA 4FFRA 4AJ1A 5JAZA 2ZB3A 4QFDA 1ZO8A 1VKOA 3WGOA 5A9SB 3MOIA 3DEYX 3KLMX 2Y1EA 2QG4A 1JKJA 4QEDA 1HDGO 5DCYA 1D7OA 1N2SA 2P9CA 4GKVA 5A5EA 2I76A 2WM3A 4MVJH 4PLWA 3L4BC 1J6UA 3V1TC 2EERA 2A9FA 5LDGA 5JE8A 3DAFA 3L6OO 1UAYA 1ADGA 3CIFA 4DRYA 1LQTA 2F00A 2R00A 4CMBA 2GCGA 2NWQA 3ZWYA 5A04A 4CUZA 1E7WA 2XPCA 1GUYA 2WD8A 3SX2A 2XXJA 1GZ4A 1H6DA 5COAA 2Q4EA 3JQBC 2PZKA 1YJQA 4I5GA 3DBHB 5DDIP 2Y1FA 1HXHA 2Y1DA 4M49A 2CNBA 1ENZA 3LQFA 4K9DA 4ND3A 3X2FA 4AJIA 3FPLA 5A06A 1ENPA 4CPDA 3PWZA 4FOOA 2Z1MA 3X2EA 3G49A 3HFGA 2V6BA 1D8AA 3ZHYA 4CLHA 1NM5A 4NBWA 4L76A 1HEUA 4AG3A 1I3LA 1T1RA 5AOVA 1R0LA 4PG8A 4E32A 1SMKA 4RPLA 4BO6A 1P0FA 3O9ZA 3DHYA 1J4AA 3JQFA 1YKFA 3DMTA 1R4MB 4XYEA 1JVSA 4DUPA 4PVDA 4J2OA 4RF5A 4H7PA 4ZQEA 3V5NA 3EC7A 1LC3A 1XGKA 3KBOA 4AJNA 1DRWA 4PG7A 2PH5A 1E3WA 3B70A 3JQEA 2D5AA 3GG2A 4J1QA 4Q3EA 4PLHA 4MVJF 3DB2A 3UGKA 3QLJA 3QIVA 4ZHSA 4U7WA 3C8MA 1LJ8A 1QV6A 1I2CA 3GN2A 3IJPA 3GHHA 5EINA 4BO7A 4E21A 1VLLA 1XDWA 5T6BA 1F0YA 4BV8A 4E30A 3IS3A 1OZAA 2V6GA 4C7KA 3OIGA 3VZQA 4ITUA 3DBLA 1PS8A 3WSVA 1XWFA 1JA9A 2ET6A 3PHLA 4W6ZA 3N74A 4OXKA 3CH6A 4BKQA 5ICMA 2EIHA 2FSSA 1U28A 2XXBA 2QRJA 2Y93A 3H5RA 1GD1O 3L9WA 5I7EA 4HXYA 1HZJA 1QSGA 2YFQA 3PWKA 2Y67A 4GGPA 3OJ0A 4CMCA 5IF3A 3B1FA 1JTVA 2PA3A 4R1NA 1A9YA 3DZBA 5GY7A 3M1LA 4IJWA 4PZDA 5JMWA 4OH1A 4M54A 3O4RA 4XRGA 1KVUA 4WASA 3FR8A 2OOSA 4IUYA 4L73A 4IDBA 4NPCA 4XR9A 3FTPA 2Q46A 1TXGA 4NI5A 1NYTA 1FDTA 3ZWMA 4NR0A 3WS7A 4AJOA 4OOFA 5JCJD 4UVIA 1IE3A 1KEPA 2JCYA 3CTMA 5MDHA 1K2WA 4TRMA 1B8UA 4FFNA 4R69A 5A5FA 5HS6A 1BVRA 4KQWA 3NTOA 4DWVA 1ZMTA 2DM6A 5JYDA 1H6CA 2XOXA 4AL4A 4ILKA 3WOHA 5TLSA 1MFPA 4U8GA 1LLUA 4ROSA 1I2BA 1H2HA 3KZVA 3S2FA 2WE8A 5G0SA 1HDRA 3KSDO 4FJ1A 5JCXA 4AJHA 5C7LO 2NVBA 3OJLA 4N54A 3GVCA 2J3JA 1Y5RA 3DOJA 5IJZA 1DAOA 1LUAA 1T26A 2WEKA 4WEQA 3WG9A 4RDIA 3OIFA 1TLTA 4B8WA 4IY1A 4CM8B 3OBBA 1X7HA 4LSMA 3D0OA 3OM9A 4WLVA 1HYGA 2XAAA 1Y8RA 4FFMA 4E13A 2ZCUA 1YQDA 3ONFA 5T5QA 4UUOA 2EKLA 4K1LA 2CSUA 2IODA 4EJMA 1N9GB 4XGIA 1PU2A 2V65A 4URFA 5F21A 4OYRA 3BHIA 4BNKA 2Q1SA 3P2YA 4MKRA 1PGNA 3NAQA 4IQ0A 1Z7BA 4DQXA 4WE3A 1YBMA 4RLHA 4IBOA 4HP8A 3KEQA 5KJCA 4J0EA 4W9NA 1ML3A 1AUPA 2OFPA 1IHXA 4KUGA 3KHUA 1KY4A 4NHEA 4EJ0A 1Y9AA 1BRMA 3GDFA 3PRJA 1XU9A 4DREA 5DULA 1H9BA 2Y99A 3BAZA 3GPIA 4PLZA 4NDNE 4R68A 1NTOA 4WK6A 2JFFA 3KOUA 3SBOA 1B8VA 3JD3A 2VTEA 4KWHA 5I9LA 1NPDA 4NQZA 4YYZA 4YJFB 1CEQA 2YV1A 3F3SA 5T64A 1LRJA 1MXFA 2AG5A 2DVMA 4GMGA 4R1SA 5BNIA 1O9BA 1T2FA 3HZZA 4YBZA 3AFNA 4J1NA 3NTQA 2OMEA 1JKIA 4F6CA 5HRUA 1QLHA 1ONOA 1PJ4A 2EV9A 2AE2A 4XQEA 4EBFA 5IXYA 4Z9XA 2DUWA 2Y0CA 3RFVA 1BDBA 2X9VA 4BO9A 4CLXA 1IOLA 3RASA 2DUUA 5TJ9A 4ZD6A 1H0KA 1B7GO 3D5TA 5C7IO 2PK3A 4LGVA 4PN3A 3IMFA 1N92A 3E9QA 2GN8A 1ZIDA 2IDZA 4UUMA 2J5KA 4N7RA 1F8GA 5T57A 1ZBQA 4E5MA 3GR6A 2DBZA 1LLDA 3JQ8A 2DTXA 2BH9A 2ZATA 2PD6A 2EEZA 3CE6A 1P0CA 4D44A 2Y05A 2AQKA 4FC7A 1G0OA 5L95A 1ULSA 4RVGA 3WYBA 2VRCA 2G1UA 3KYCB 4I5FA 4XGKA 1B14A 1I30A 5U1PA 2CD9A 3F9IA 3RI3A 5KJEA 3I5MA 1XQ1A 1ZXBA 3F4LA 3ZWPA 3U9LA 2QX7A 3SXPA 1AGNA 4R9SA 4BNZA 1ISJA 4D3FA 5L4NA 2IXAA 3SC6A 3LC7O 3EW7A 4NJMA 2HRBA 1QRRA 1U8XX 2DBRA 3OMLA 4YJGA 3ZW9A 1U4OA 5C3MA 5HM8A 1YDEA 1IZ9A 4DA9A 1BW9B 1PS0A 1E1KA 1ZK4A 3K30A 1B2LA 3FD8A 4BNHA 2DTEA 3ZWCA 1UZMA 2FPPA 3HG7A 3JQAD 1LSUA 3AOEC 5GZ3A 1RM4A 4YPOA 2W2KB 3Q9NA 1GAEO 3GGGA 3WIEA 2DLDA 5BSEA 5ER6A 4P4NA 5THQA 2E37A 4Z9FA 4Z3KA 3LF2A 4EUEA 3E6AA 3QJ5A 5B37A 4FOSA 5JO9A 2P2SA 1DIAA 4I9UA 1WZEA 5CG2A 2YV2A 4A0SA 2BFOA 3WGQA 4CQLA 1O8CA 3PIDA 3UF0A 1Z7EA 8LDHA 3TJRA 4NBRA 4NIMA 3IQDB 5KCZA 1HYEA 1I3MA 2P5UA 2E82A 4WKGA 4BNMA 3C24A 1PJSA 1Q7CA 4IS3A 1C0PA 4FDAA 3A4VA 4IQGA 1YQXA 3OQ6A 2DPHA 1EZ4A 1JN0A 1R0KA 4G81A 2GZ1A 4JBHA 5ER9A 4GLOA 1SAYA 3E8XA 4HWKA 1LI4A 4AICA 4MVJI 2X0RA 3EVNA 2I6TA 2RH8A 3JV7A 3V8BA 2NLOA 3WJ7A 1GEEA 1YONA 1VPDA 1LC0A 3RUHA 2PD3A 4LMRA 1I33A 4R5MA 3VDQA 3VDRA 4EW6A 2JJYA 1LDGA 3B1KA 3HB5X 3R0IA 1J0XO 4H3VA 4NFHA 1B26A 3OSUA 4JJGA 2AG8A 3EGOA 1S6YA 1Z82A 4TRRA 3PEFA 4CM9A 2JHFA 4RJTA 1PWZA 3L4SO 1CQJA 4FFPA 4L9RA 4TSKA 4D43A 5EL0A 5EIOA 1BGVA 3DZHA 2YJZA 4IGFA 4BO3A 3GMDA 4EJ6A 4HNHA 3GK3A 1GV0A 4TZKA 2WJPA 3VH1A 3UCEA 3JTMA 4GLLA 3AY3A 4Y6SA 3VZPA 1E77A 4IZHA 1XQ6A 4ZU3A 1BHSA 3JQ9C 4NFSA 2CF6A 2DBVO 2ZYDA 5L45A 5CPFA 4UVHA 3CSDA 1SPXA 1F17A 1GFSA 1E3WB 2VHZA 3D3WA 3UICA 4TVBA 2OL4A 1GUFA 2FMUA 1NFQA 4FN4A 3VVBA 1ZXLA 1BSVA 3PJDA 4WJZA 1HE3A 4BO0A 2E6UX 1FMCA 1DLJA 3PVZA 1P77A 4JGBA 2FRDA 4J91A 4IGEA 4FFLA 5DP2A 5TT0A 1A27A 4TMFA 1XKQA 3WTCA 3W4JA 4YACA 1X0VA 3DQPA 3K31A 2JCXA 1PJQA 2BGKA 1SB8A 3KB6A 3W4KA 3DBLB 5ICSA 1UZNA 4N5NA 4DBVO 5AXAA 1LSJA 5L3ZA 1EVYA 4M8SA 3BTVA 2PD4A 3T7CA 1B15A 2P9GA 1UP4A 4RQUA 3TDKA 1P1KA 4M1QA 4D3SA 4N5MA 2ZQZA 4XB1A 1PZHA 3QVTA 1A7AA 1Q1NA 2YQ5A 3BIOA 1KEVA 1MLDA 3ONEA 2W2LA 3K5PA 1LDEA 2JD2A 1GQQA 4XA8A 3CKYA 4W4TA 4QTZA 3U4CA 3A9WA 4AFNA 1OC4A 1UXIA 4E0BA 2DBQA 2PWZA 5F5LA 5CG1A 4WCFA 5ILGA 1T2AA 1QYWA 5JMPA 5TS3A 2GO1A 1WDLA 2ZYGA 3WWYA 2PKQO 4IXWA 1WP4A 2V6FA 4PRKA 4RVFA 3AFMA 1O6ZA 2HK7A 4WOKA 3GAZA 5EQDA 1EBFA 1N1EA 4RCVA 1IHYA 4YJHA 4WCDA 4ZRMA 1D1SA 3H2SA 4Q3DA 2O50A 1BWSA 1DFHA 1Y8QA 5AXCA 3VZRA 3AW9A 2D8AA 4WLOA 2X7HA 4RPGA 4JQCA 1H6BA 1E6EA 1EK6A 1PTJA 3D4OA 3G1UA 4HBGA 1IZ0A 4PFJA 4H15A 3O38A 5F3RA 1V3TA 4QQRA 4BVAA 2EJVA 3PYMA 4GL4A 2X0JA 5BR7A 3NDIA 4J0FA 1LBEA 3WBBA 5DOZA 2H9IA 2O7QA 1YQGA 1R12A 1BXGA 3NT2A 2G5CA 2OORA 4BNJA 1Y5MA 1WDKA 2IYOA 3WXBA 5KKAA 1QYDA 3ROQA 5CHEA 1JAXA 2PLAA 3NJ4A 4NU5A 4DQVA 4E6PA 1NQTA 1NASA 3VKUA 3LZ6A 4FD3A 4W7HA 5H83A 3VPGA 1LNQA 1WAMA 3L07A 3BMQB 2GZ3A 3M2TA 4RVSA 2GASA 1Y8RB 3PWSA 1EFKA 2X0IA 4EZBA 3P7MA 4MVJP 2R2GA 4NK5A 2BD0A 1U3UA 1L7EA 3DHEA 3QQPA 4OMUA 5TT1A 5KVQA 2RH4A 2Y1CA 3PHJA 2VUUA 2B83A 2IZ0A 4XEHA 3FN4A 3PIIA 5CFZA 3RU9A 3I9LA 3VPHA 4RVHA 1D4FA 1C14A 1K0UA 4CMAA 4YRBA 1EBUA 2VNSA 2I99A 7MDHA 4Z9YA 3BMNA 3AU8A 1NAHA 1E3IA 3JCZA 1TI7A 3F4BA 1QG6A 4J49A 2HMWA 1U1IA 3ETDA 3MCVA 4FS3A 4N5LA 1C1DA 3I3OA 4MVJE 3R3JA 1HLDA 4TRNA 2P4QA 4FB5A 2GDZA 1T25A 1PJCA 1R6DA 3LC2O 3TFQA 2EHDA 4MO2A 4GSKA 2J8ZA 3ZNNA 4B3JA 1NQAO 5JAMA 3UCXA 1EEHA 1LXCA 4PLFA 4R16A 4UVDA 5EN4A 3U4HA 4CV1A 2DTDA 3U09A 4CQMB 2X5JO 1UDBA 3GOHA 3NGXA 2W90A 2A94A 3HDJA 4R5HA 4Z0PA 1YL6A 1A7KA 1HWYA 1NVGA 3RQSA 2Z1NA 3H6KA 3EZLA 4R54A 3TFOA 4XWYA 4E2YA 4B3HA 2JD1A 3RUIA 1GPDG 4CMGA 3T7EA 2C29D 3ASVA 4BNTA 4YQYA 1O89A 1CRWG 5ENDA 3JQ8B 2IYPA 3FPCA 1HETA 2HSDA 1E7YA 1YDWA 5FWNA 2ZB8A 2HO5A 1Z45A 3COSA 5F5NA 4XYLA 1S7CA 2FPGA 3I6QA 2JAHA 4NFYA 3AJRA 2WYUA 1R66A 1E1NA 1UP7A 1KVRA 4BNLA 2C2YA 4ND4A 3OFSA 5JW6A 1QV7A 1XG5A 3DTYA 4B8ZA 4C4OA 4FFOA 3HB4X 3R3SA 4YT2A 4BB5A 3GAFA 2QHXA 4PLYA 4D7AA 3IUSA 1UXHA 3ZZNA 4BO4A 1PX0A 4IM7A 2HMTA 2X0NA 1XIVA 3G79A 5HS4A 3Q2KA 5A05A 2NVUB 4FQ8A 1SOWA 3LT2A 2JFGA 3CMMA 4P4LA 4J7CA 1PQWA 1LRKA 4YAIA 1EUCA 1BXKA 1I5RA 1N8KA 4BKRA 2O4CA 2EW2A 4HFJA 3I6IA 4F6LA 2E49A 2JKVA 2QQ5A 3I83A 2X9GA 4PLTA 4KTVE 5BSHA 4A10A 1ID1A 3MWDB 1GDHA 1I0ZA 4ZQGA 3V1UA 3LYLA 4KDFA 4O59O 3WGYA 3CINA 2VOEA 4I5DA 1NWHA 1ARZA 3ITKA 5TIIA 4B7XA 1ENOA 4BOYA 3ZHZA 1YOVA 3SLKA 4KUHA 1HZZA 4A7PA 2CVQA 2I3GA 4R3WA 4XYBA 2W98A 4NMHA 2WSBA 5HA5A 2BELA 2C7VA 5A02A 2NTNA 5ENVA 5I7VA 4PG6A 4ZVVA 1GR0A 1SZJG 5JY6A 1K5HA 2BFPA 4LSWA 4YAEA 3SC4A 1QYVA 1ADCA 4PG5A 4PG4A 1ISMA 1GYPA 4QO8A 4TWRA 4CMEA 1PL6A 3FI9A 4GQAA 1X14A 1XHLA 1I24A 2P5YA 4Q3NA 1P33A 2JD0A 2DFDA 2G0TA 1CDOA 3GT0A 3ZN2A 5B4TA 4B4WA 5I8WA 5A03A 4HUJA 2PZJA 1KC3A 3ENNA 3LSYA 3JYNA 1NQOA 1B3BA 5KVSA 3GPDG 3OF2A 1ZH8A 3QWAA 3QWBA 3VHRA 1DXYA 2QIOA 4E2WA 3U4IA 4MIEA 3HDYA 4WGGA 4AJLA 4EEZA 2YFHA 3HDHA 3QW2A 3HWRA 3GG9A 2W8ZA 3S2IA 2E4AA 3LT0A 2Q99A 3BTOA 3DMYA 3I23A 2C20A 3MEQA 1FF9A 4RORA 1WNTA 5AXDA 2EKPA 4II3A 2HU2A 2IRWA 3JYQA 1DIBA 1JKFA 1AHHA 3AUAA 5THKA 2FZWA 1WW8A 4F3YA 1MG5A 4M89A 3DONA 2EWMA 4W7IA 4J4HA 3PYLA 4FJ2A 2QRLA 3KYDA 4MVJA 4YJDA 5FF9A 5JDCA 3A28A 1PR3A 4NZ9A 3ZU5A 3GGOA 5A4DA 1U2DA 2NSDA 4LRTB 4NU6A 1M6HA 4RDHA 1MFZA 2C82A 1U5AA 4WEOA 4FGWA 2Y0EA 4TVOA 3AUTA 5JDIA 5JFOA 4CM7A 5KJFA 4ZQFA 1UDCA 4BQPA 1DHRA 1H2BA 4TQGA 4AVYA 4GVXA 5JAIA 1SO8A 2YHIA 2VCYA 4P8RA 2R00C 3GVPA 1JU9A 4YWJA 4BGEA 2YV3A 5BSGA 2EF1A 4ID9A 2EGGA 4S1VA 2JAPA 5KVCA 3RROA 1LDBA 1XLTA 3LK7A 1GYRA 1K89A 4Y6RA 3U0BA 2CDCA 2GLXA 1HE4A 1E7SA 4OIMA 1U4SA 4BNNA 3MJVA 4YRAA 4IJVA 4GWGA 5ITVA 5F1PA 1ZW1A 4ND1A 4YA6A 1IB6A 1QYXA 2FZEA 4YB8A 3H9QA 1L7DA 1R37A 4IDGA 2XF8A 4NG5A 4AJJA 3WGIA 5G4LA 4C7JA 4NH4A 1D3AA 4JBGA 4WNCA 1FK8A 1ZUD1 1A72A 3JYPA 2UDPA 2C07A 3JQDA 5JS6A 1E3EA 2D5CA 3UCFA 4ZICA 1HSZA 4QT0A 3RAJA 4FSHA 1T4DA 2O2YA 2QW8A 3JD0A 4HY3A 3S2EA 3JQFC 3DMTC 1HE5A 1NPYA 1DFIA 3UOGA 2AEFA 4HFMA 4CODB 3VH4A 1YXMA 3MZ0A 4JK3A 2CFCA 3L6EA 5I9MA 5CDUA 5IDYA 3AI3A 2UUOA 4IDCA 2ZB4A 2B5WA 3G17A 3R1IA 4U0KA 3ROPA 5T8KA 2Y68A 5ES3A 3RVDA 1YGYA 2GPTA 4E33A 1ULUA 2J5RA 4JJIA 3KSUA 4YJHB 1BTOA 1PQUA 2W4QA 4DC0A 2SCUA 3QVSA 4WLEA 1E3SA 1R4NB 2EP5A 2VYND 5CPBA 4GSLA 5TX7A 4RV9A 1Y8QB 4J1SA 1P1RA 4U6SA 5JC8A 4W82A 2AEMA 5L7YA 3Q6IA 2LDBA 4DIOA 2PZMA 5G0TA 3TSCA 2PH3A 4D45A 5H82A 3KTDA 5G0UA 3AWDA 5JXWA 3JQAA 2JCVA 3QY9A 1DRVA 3C7AA 4M55A 4XIJA 3VVCA 4B4OA 3GGPA 1BXGB 2B4RO 1T2DA 4Y6PA 1W8DA 3UUWA 1RM3A 1DIGA 2VHVA 4GH5A 1P1FA 1I2ZA 4P22A 1H9AA 5AQ1A 1PEDA 1FXSA 2D4AA 3B1JA 3Q1LA 4WNIA 1NBOA 2VHYA 3WSWA 5DN9A 4BV9A 5BSFA 1EVJA 4L74A 5FFFA 4DGSA 4GX0A 3C1OA 4YXFA 2Q45A 4OM8A 4OQYA 3MJTA 3CUKA 3CEAA 3FTNA 4IIVA 3RBZA 2FN7A 3QVXA 4FIZA 1GY8A 4QO7A 1DAPA 1OOEA 5CAEA 1U7TA 2RAFA 3PGJA 4YT4A 5IZCA 5DCWA 1BMDA 2H6EA 1DJQA 3LT1A 3PZRA 4K6FA 3JQGA 3ORFA 3E48A 2NACA 3MWEB 2C59A 5C7OO 1KY5A 3Q11A 3EYWA 2V7PA 2CF5A 2FWMX 1YB5A 2V6MA 2PR2A 2GR9A 3ZWAA 1X1TA 4BMVA 4CV0A 1H5QA 1B16A 1DIHA 4CLOB 1JAYA 1E3JA 4UAGA 3L0DA 3MJ4A 4RL6A 2GGSA 3ANMA 5K6AA 2GF2A 2QYSA 5BT9A 1XU7A 3W8EA 2FP4A 3DO5A 3ONDA 3BMNB 4CM1A 1MUUA 3DHNA 4L75A 3QE3A 5KOIA 4NK4A 1UJMA 1YS4A 3Q3CA 1TEHA 1AXGA 1M67A 2GUGA 4RPHA 5IDQA 2Q1TA 2OUIA 1VJ1A 1MGOA 3OEWA 3IL2A 1KERA 4TKMA 4QSMA 3PJGA 4J6FA 3TOZA 2A4KA 3BZUA 3EY4A 2YDYA 4PRLA 3TOXA 3VAZA 3AI2A 1O94A 5L9AA 1OC2A 1HF3A 4Y9DA 2DQ4A 5KIAA 3SJUA 1DIRA 3TZCA 3DTTA 3H7AA 4JXKA 4MOWA 1HYHA 1RJWA 3GMSA 1T2EA 4FPXA 4G5HA 4DLBA 5CDTA 3OH8A 3KSZO 2FY8A 4IDDA 5A9SA 5JAQA 1RM5A 1CQIA 1Q7GA 1ZSNA 4XDYA 3W4IA 2BFMA 3GNQA 1LDYA 3CPSA 1F14A 1IY8A 4I9NA 1PL8A 4L4SA 2EP7A 1RPNA 1UXJA 4O6VA 1XYGA 5DCUA 2EG9A 1ZK3A 3Q9UA 3PPIA 4INAA 1MP0A 1PJTA 1M2WA 4E2ZA 2QYTA 2UYYA 3WQRA 3KLPX 2DFVA 3FNEA 3HHPA 4OOEA 1EVZA 1ZFNA 4BHTA 4W9NC 4CL3A 5T67A 3ZI0A 3MJSA 3U5TA 5EPOA 5BNFA 3GDGA 3DBHA 3WBFA 4IDEA 4R41A 3FCOA 9LDBA 4IINA 3KM0A 3KV3O 4J1TA 5CP8A 5DBFA 5IXSA 4DL9A 3D64A 1ZCJA 4BKOA 4BNFA 2ZKLA 2PGLA 4IMRA 3AM4A 4FC6A 2Y66A 1F8FA 4II2A 5DBIA 3WMWA 5KVVA 5TSDA 4CQMD 2EGHA 4EUFA 1OFGA 4BO8A 3JYOA 1U8FO 3DC2A 3I52A 3U62A 4A03A 1R4MA 1XCBA 1EQ2A 1ZZEA 1PR9A 1R16A 4PLGA 3ZV3A 1NVMB 2D3TA 1E7MA 1WLYA 2AQHA 1ZNQO 3NKLA 1KVQA 1VJ0A 4KUEA 3S2GA 3WNVA 4B4UA 3FSRA 3GEGA 2VT2A 3DOOA 2PY6A 4A26A 2BLLA 4FR5A 3LU1A 3FBGA 4K28A 3NEPX 3WDSA 1F12A 1ZK0A 1U2GA 5A1TA 3D3EA 3TL3A 2Q50A 3PDJA 3WIDA 4ALKA 3AI1A 3LF1A 4PLCA 5IAAA 1H6AA 4YRDA 4RO0A 1ISFA 3GC6A 4Z3DA 4K26A 3W6UA 3KVOA 2HUNA 3H8VA 4WUVA 1NVTA 2AW5A 4BNWA 3ETGA 3L6DA 2FR0A 4ZQBA 4CLEA 5B12A 2IE0A 4E4YA 1CF2O 5U4QA 2HJSA 5J23A 1PQPA 1MC5A 4AJ4A 4LCEA 1X1EA 2AA3A 3D7LA 1X0XA 1NFFA 5CEEA 2WWRA 1NR1A 2AXQA 3IDSA 3QWFA 4WLFA 1PJ2A 5EQFA 4OAQA 2P91A 4O63O 3ULKA 5ILOA 4IIUA 2Z5LA 2C7GA 3KEOA 1E7RA 2NADA 2OHXA 3WWZA 2WD7A 2BFAA 4W99A 3RSHA 4UVGA 1QLJA 2NU6A 5G0WA 3ENKA 4NBVA 3NRCA 4KQXA 1NX6A 5F1KA 5JSFA 4Z0HO 3INRA 4M87A 4R1TA 1HKUA 4PLPA 4UEJA 1GL3A 1LEHA 1VSVA 3DFZA 2B4TO 4DPLA 1Z75A 4YAKA 2H5LA 3U49A 1ZSYA 3IAHA 3Q0EA 2VZ8A 1YO6A 4HV4A 2G82A 2P9EA 3M2PA 1GADO 4BO1A 2VZ0A 3QHAA 4WLUA 5IDWA 3E5RA 3C3XA 1FJHA 3WICA 3RJ5A 3MOGA 1HSOA 4EGFA 3RBVA 3ZNQA 3RD5A 3PHHA 4E5PA 4XQ9A 5K0ZA 3E1KA 4A73A 3V1YA 4E31A 1EDOA 1C0IA 1YBAA 3ZWBA 5CEJA 3ROMA 2HMUA 4CJXA 4E5KA 3UN1A 5JBIA 5JNLA 4JP2A 1PJBA 3FRJA 2OP1A 3OEYA 2Q3EA 4GI2A 4WOJA 3ZWOA 4BGUA 1E5QA 4J4BA 3RKUA 1U3VA 5LC1A 1KS9A 2YHIB 3E03A 5JY1A 1EK5A 2X8LA 2AHRA 2GRAA 3NUGA 1KVSA 3RJ9A 3NT5A 1GCOA 4IPTA 4KDEA 4CLDA 5CEFA 3BMCA 4XKJA 3GRPA 1E92A 1ZEJA 1WVGA 4Y8VA 1W73A 2X5OA 3QP9A 4CR7A 1NHWA 3E9NA 3OP4A 1OAAA 2RHCA 4HADA 1WMBA 3FBTA 4HFNA 2O7SA 2POQX 1V3VA 2ZTLA 2PFGA 5H81A 1KVTA 3HJAA 4UEKA 2NM0A 1OMOA 1UZLA 4R3NA 1DSSG 2FSVA 1W0CA 3DAGA 1I3NA 1AE1A 3H9EO 3FR7A 5C5IA 3UKOA 3F6YA 5GZ6A 5A3VA 3TZQA 3ZCXA 3N7UA 3RCBA 3KO8A 1N7HA 1ZJZA 3MTGA 1V35A 1PWXA 3PI7A 1M75A 4J9VA 4L0QA 1SCUA 6LDHA 2HJRA 3FNHA 1IULA 1UXGA 4OJNA 1LTHR 4HNGA 2O3UA 3QVWA 4CMKA 3RUCA 1BVUA 1RKXA 4MIOA 4NBUA 3ABIA 1MB4A 4DMLA 3RC7A 3L4BA 2I3AA 1UAGA 1QKIA 2O4UX 1BXZA 4DBZA 1ISGA 2EXXA 3VKVA 1K6XA 5KJ1A 4MVJG 2HRZA 2NQTA 3ANNA 3VPFA 1NQ5A 3UXYA 4EEXA 4EUHA 3GQVA 1PGJA 3AK4A 3JQ6A 4DTIA 5A9TA 3DZFA 4G2NA 1Q0HA 2NU7A 1I32A 2JHGA 3PQEA 3RU7A 3WX0A 3GUYA 3JQBA 2PKRA 3ZWNA 3GLQA 4BNXA 4D79A 3ZV5A 4J16A 4XX0A 4DMMA 1I10A 1DHTA 1VE9A 4QX6A 3BMOA 2IZ1A 5G4KA 5CDSA 3H5NA 1PL7A 4IDFA 5I8ZA 1E6WA 1B3RA 3IP1A 1E5LA 4BUCA 3GFBA 3OJOA 1NWCA 1RYDA 2CZCA 2RBEA 4E2XA 4PCVA 4OXYA 3ZWXA 1YE3A 1EFLA 5JYEA 1OI7A 3VTZA 3MJEA 3DR3A 1R0SA 3FNFA 4WCFC 3WTBA 2HDHA 3RUEA 4BO5A 1P1IA 2AQ8A 4CV2A 1E7QA 2I5PO 4H16A 4ZA2A 3ROKA 1VSUA 4YAGA 3AY6A 3JQGB 2A92A 1O0SA 1XSEA 2NTJA 2CMDA 3HN2A 3P19A 4RLSA 2PKQP 5AVOA 2R6JA 5IFLA 1KC1A 4R01A 1MX3A 4LVUA 2H63A 4DQUA 2NNLD 3I4FA 4A5OA 4IQ8A 1GQ2A 4LMPA 2ZTVA 1I36A 1VL6A 1IYZA 5L7WA 2WE7A 3HSKA 4EYEA 4ZN6A 1QP8A 4M86A 1GEGA 3H9UA 4F46A 2VRBA 2X4GA 1K6JA 3PFFA 2BGMA 3GY0A 5I9NA 1Q7BA 4CMHA 3DBRA 3BTUA 2Q49A 1GUZA 4XIYA 1A4IA 3HN7A 4NJMB 1LLQA 2HLPA 4YJGB 3O03A 1GCUA 1WWKA 1N1GA 4CM5A 5IZ4A 4Q9NA 1TT5A 3IUPA 5IN5A 1HDOA 1AN9A 3EAGA 1ONPA 2GN9A 1MC4A 3VPXA 1JLLA 4RF2A 2VTDA 3WGTA 2GERA 5L53A 5MGBA 4FJ0A 3KXDA 4UUPA 2WMDA 4PIVA 2RIRA 4JN6B 4R4JA 2H1SA 4BNGA 4U6QA 1G0NA 2X22A 3ZU3A 2IXBA 5ADHA 3HFSA 3OA2A 1SBYA 4UVEA 3H3FA 3NYWA 4XYMA 1HT0A 3W1VA 1HRDA 4NJOA 2IEBA 4RZIA 2PGJA 3W8FA 5JCJA 4TROA 2BI7A 4CMIA 2HQ1A 2ZIZA 2ZYAA 3E9MA 1E3LA 4BIIA 5BQFA 4CQLB 1LRLA 4IS2A 2I9PA 1LLCA 3C1AA 3I4CA 2D59A 3P5SA 4B3IA 4OGWA 2VHXA 4ZJUA 4DIFA 3I9NA 1BDMA 1UDAA 5FYDA 1DO8A 4BKPA 2D0IA 3F46A 4NNJA 1TA4A 2DU8A 2Q2WA 1PGPA 4QFCA 3ZV6A 1MV8A 2UV8A 2VUTA 4GBJA 1NXQA 2FPIA 1AHIA 4K6CA 3TN7A 1WXDA 2J5QA 1TVEA 3S1LA 4JJFA 4ALMA 2O3SA 4ALNA 1HDZA 1PIWA 3DZJA 3K6JA 4KZPA 6ADHA 4PVCA 3WNQA 1C0KA 3I9KA 1PZEA 3DWFA 4I08A 4ND2A 1ZJYA 3I9MA 3RUFA 1U7HA 1H93A 2J3KA 1W4ZA 2VYVD 2DT5A 1N7GA 1DBVO 4FBGA 3TL2A 1ZK1A 3H9GA 3QSGA 3L77A 4Y98A 3GZNA 3IIEA 3JQ7A 1ZEMA 2HAEA 3KYBA 4DPMA 5GZ1A 3BYZA 2C2XA 1Y9EA 3O8QA 1ZSVA 1HTBA 1VC2A 2Q2QA 4MPDA 3K9QO 4JNKA 3ICPA 3PTZA 1WPQA 3ETEA 4LVCA 4MP3A 1I3KA 5L4LA 1VKNA 1ONNA 2VYNA 4DLAA 3AUUA 4GVLA 4YAJA 3LLVA 3OECA 2DKNA 3WGZA 2YQ4A 2IEDA 4ESOA 3ITDA 4CR8A 1DC3A 3R6DA 1KBZA 3HE3A 5DBGA 3PGXA 1X7GA 5BNTA 1P74A 3D3WB 3Q2IA 1JW9B 3ZNOA 1CERA 1J5PA 1T2CA 3TQHA 4IXTA 1DDOA 3BA1A 1DPGA 3ZU4A 4UUNA 3ZWVA 4ONEA 5A9RA 4IMPA 5GMOA 4YT8A 1M76A 2GYYA 2ZTUA 1V8BA 3ASUA 2Y1OA 3RFTA 4KOAA 4DPKA 1XEAA 3DXFA 4OL9A 3JD4A 1CIVA 3NV9A 3JQCA 4LN1A 5LCXA 1VL8A 2G17A 2WD7B 4BMSA 4PZEA 5A3JA 2IZZA 2VWGA 3H2ZA 5JPIA 1T4BA 2VWPA 3AOGA 1YL5A 3TZHA 1PJLA 1YVEI 2I66A 2YW9A 1GV1A 1C1XA 2NQ8A 1RM0A 3DZKA 2PGDA 4F45A 4DYVA 1NNUA 3GN1A 4I9HA 5FI5A 4XYGA 2ZK7A 4XJSA 2GN6A 3WFIA 4GMFA 4RZHA 4XGNA 4GKBA 1SOVA 4LK3A 3GEMA 2CDBA 3HADA 4JCOA 3H3JA 4DVJA 4E5NA 4ALLA 3BTSA 2A35A 4CLRA 1J49A 3WJAA 5TC4A 3C7CB 4XR4A 3QV1A 4MP8A 4UULA 4Z0TA 4KWIA 4WCFB 2AE1A 3RC9A 1X15A 5JLAA 3WMXA 2VUSA 1NAIA 1SB9A 1YB1A 2NVWA 3H65A 3V2HA 4UREA 1DFGA 2HCTA 2CUKA 2HK8A 3DBVO 2WDZA 4CMEC 4IJUA 1LDNA 1A4UA 1P1HA 2GZ2A 5EESA 3PQFA 3RWBA 4RQTA 3RBXA 2DC1A 1U3TA 3D4NA 1JWAB 2DAPA 3G3EA 3LDHA 4YCAA 3E5MA 2X58A 4L4RA 4MKZA 4GX1A 3NGLA 4IZIA 2TMGA 3DAPA 1DC4A 3BMCB 4LRSB 4YTEA 1EE2A 1PZFA 3WYEA 2O3JA 1VJTA 3BXXA 4A2CA 1GYQA 3PJEA 2BGLA 3BMQA 4QUKA 1I01A 5DT9A 3ZHBA 3I9JA 4YEDA 1L1FA 3ST7A 3HDQA 3AOEA 1FDVA 4RF3A 4CM4A 1NHGA 3FNGA 2NV6A 3K8ZA 1C3VA 3P2OA 1T24A 2UUPA 3WQSB 4DYDA 3F5QA 3BHJA 1U9JA 2OZPA 4OSPA 1W6UA 2C5EA 1I8TA 4MVJD 3W6ZA 4A27A 3OA0A 4D0SA 2J3HA 3NJ8A 4EI2A 1GZ3A 4FCCA 2AMFA 5JDCC 4L4XA 5DZSA 4RF4A 1NR7A 1EDZA 2FOIA 1DLIA 3NTRA 1A71A 2VT3A 4HFRA 4J9UE
chains in the Genus database with same CATH superfamily
3FSGA 3NO4A 1CJCA 1A9ZA 1K97A 2YUTA 3W3AA 4LRYA 2BEJA 2Q7DA 3D3NA 2BN4A 2P1DA 3NEYA 1CJSA 2X41A 1SUDA 2EW1A 3ON5A 1G4AE 5K9ZA 3IBTA 4D8TA 2EW8A 1JSLA 1SNYA 1EBBA 4PQEA 4BMDA 5HWSA 1RYEA 4AQ7A 5EWJB 1UOOA 2IOFK 2WF8A 1UZAA 1YOBA 2WJHA 3FUXA 4BAUA 3DDWA 5TY0A 3FY4A 5BMVF 3SEAA 3P0FA 1ECCA 3FMOB 3R5HA 4O1IA 3CVOA 3RNLA 3PDUA 4W5OA 2C2HA 4JLVA 2EJUA 2VEDA 4FN5A 5FA5A 5I5GA 4EFMA 2BOVA 3C7DB 3DYVA 4WLNA 1WZUA 4YDRA 4ES6A 4JP3A 1VGVA 3NTXA 3E82A 3FJYA 1X8JA 3PRYA 5HTOA 2XZPA 2QZZA 3U3XA 5ALEA 4BV3A 3L1VA 3PNSA 4UJ3A 1VKRA 4XX0B 4GRDA 1RBZA 3BMOB 4UHCA 5THXA 1RTTA 2NZVG 2X6TA 2SECE 1M8FA 2QGFA 1PSDA 2BI4A 1C1DB 1TUBA 1NULA 2UVDA 3I39X 1U8UA 1NLFA 3DGEC 4MW0A 3A1EA 4ZI7F 3I6MA 5HQ3A 4LJRA 3O47A 3NAGA 3VFDA 1GQSA 2NO5A 5FD8A 1XXHE 1CF4A 1ADBA 1PWEA 3STHA 2WTBA 3H1BA 4PFQA 5ARCA 5JXIA 1T6BY 1T0BA 1TW2A 1OY1A 1QIMA 4RHYA 4YECA 5KYNA 2IOQA 1KP2A 5KOJB 2YOGA 3UZUA 2QRKA 5DGCA 3G0OA 3KQMA 4GOND 4J2HA 2JCBA 5AESA 3R7LA 2FJPA 3TRIA 1ZNYA 4QBIA 5JO0A 3GZ4A 5DE3A 1MBZA 5BMVA 2YICA 3UTDA 3A3OA 5AW7A 3JQ9A 1P2DA 4RGQA 1UKYA 2F90A 4NV0A 4TX1A 4WVLA 3T9CA 2F1IA 2I67A 4PYQA 1Q2XA 4L8VA 3CR7A 5KTKA 1M6WA 2BRUA 1MG0A 1I7SB 3IQZA 4O8ZA 4ZAZA 3K2EA 2Z8YM 4OPMA 1XCPA 4BFSA 2OKCA 1XFDA 4QUIA 3VTFA 4LGCA 3WR5A 1R9NA 1OXUA 3WHPA 1NV9A 2Q5JA 4FE7A 4J7UA 3A0UA 4MGIR 5TGDA 1ECLA 3WB9A 1CY7A 2RCYA 4HWOA 1SCBA 2NVUA 4M1EA 1QNFA 3P9KA 2OXIA 3SF8A 4ZI7A 1JQBA 1GQYA 4JBLA 5B53A 4A92A 1SVWA 2V7XA 3HWWA 3BWCA 5EXSA 4D9HA 3QI7A 5BWBA 4QA9A 3MTIA 2CXQA 3LLSA 3H5AA 4HUQA 2XMGA 4HQNA 4OKNA 5AVZA 1PT5A 4R98A 2B82A 1QR6A 1G6KA 2KB0A 3FA2A 3LNTA 2ZJ1A 1P45A 4TRJA 4C3UA 5JADA 5AKKA 2XMSA 1DARA 4FYWA 3RK1A 5FR2A 4C0SA 1FQJA 3NFRA 3NIFB 4QHSA 5EZ5A 1H66A 1TK9A 3N2EA 3SSAA 4WKBA 3T4EA 2WBLC 4Q7MB 4B82A 2WMNB 4JROA 4HC4A 3TH5A 4PZCA 2OCYC 3LT4A 4B81A 2J4DA 2GD1O 3SJZA 3C3JA 4LHEA 3RKRA 3KKZA 2VK4A 3NM4A 2Z95A 4Q4HB 4XM1A 1LK7A 1Y3BE 1I7DA 1AGPA 1W2GA 1KDVA 4LDJA 2ZTHA 1QKKA 2RARA 3EXHB 4FMCB 1UBFA 3LHDA 4DTCA 4ZVMA 4RTRA 3GCWA 3EDMA 3GVXA 2BZ1A 2RC5A 1DAMA 1LDMA 3AY7A 1Z5ZA 3V8EA 1AHNA 1FYDA 3IKVA 5TQ2B 3RS7A 2PSDA 5DM1A 1KEUA 1KJ8A 2EKQA 2ZRDA 1JJAA 2AEJA 2BEUA 3ZIUA 4BLPA 3K1JA 2B21A 4GPZA 3SDSA 4R1PA 1CZKA 1SM4A 3GUHA 4K5QA 3AHHA 3T38A 1Z68A 3QY0A 3VR1A 2CLKB 2QP3A 3ZHCA 1AC5A 1X7XB 4BS9A 4E88A 1XRPA 1Y34E 3NHYA 2I7DA 4LKRA 4NAVA 5L40A 1M2HA 1XV5A 2C54A 3KEGA 2E85A 4MW2A 5D85A 5EMHA 4B2IA 1BCSB 2QP4A 3CLTC 3RIMA 3TNFA 3TUIC 5F98A 3CLHA 1YOVB 2C5FA 1PO7A 2V5VA 4RDCA 3G9QA 5IXJA 4ZI5A 4PHFA 3SFVA 1M1XB 4I1IA 2NO4A 4W5RA 3WL3A 2D0PB 3IT2A 2X9LA 4INPA 3KYJB 4XTCS 3WHLA 5B1YA 2OQ2A 3X1XA 4EKGA 2BFNA 5F1OA 4CT4B 4QC2A 3DOCA 2QTRA 1TDJA 5TVKA 4A8PA 7REQB 4UTPA 2QTMA 3HUDA 4Q4AB 4MQ4A 3OZBA 5TPZA 2NYUA 4R2XA 1F3OA 1XTRA 3P2IA 4RGBA 1KMCA 4PHHA 3TBKA 2NZWA 5AKIA 3M4NA 3F71A 4DIKA 4R0VA 3LH5A 4EKEA 2OP0A 4LI0A 3BXHA 4U2DA 4EUSA 2ZQYA 5CDGA 2EQAA 4P84A 1VBNA 1U2SA 2CK3D 4K6KA 3BXOA 3OIDA 3ZU2A 2OGTA 1B0AA 2J0QA 5JU6A 3EOBI 3B53X 1GGKA 1ZUNA 2CY0A 3P94A 3UFBA 4CI9A 2J0EA 2D6FA 1PGQA 3N2YA 4N5DA 1AQUA 2AEEA 4IUDS 5ENZA 3ROFA 4WPGA 1FJ2A 1TD1A 3G8BA 3KJFA 3R9WA 2XCOA 4ITVA 1T15A 2A86A 1Z74A 4QQFA 4Y9RA 4FLMA 1ZVVA 1I5OA 2VF5X 1JMKC 2VHEA 4DA0A 1Q2UA 1EVIA 4NONA 4OQLA 3TQFA 2I80A 4OHUA 2WT4A 1CUFA 3K7EA 2FMXA 4JD5A 3F78A 4NSNA 1XELA 1CD5A 2VT7A 4K9RA 5FI3A 2X8JB 3IPLA 3AVQA 1J0EA 4W6QA 3UJ9A 3MRXA 2O3RA 3TLEA 3SQOA 1Z07A 4UUQA 4BNUA 1EUZA 1EIWA 2BKAA 1Q0LA 2OSBA 3KYDB 1G8PA 4ACAA 4D46A 3A1UA 1GDDA 3CUWA 3MJCA 3IALA 3V8VA 2XV1A 3EGXA 3CGGA 5J63A 3WQBA 2NUPA 2Y1GA 1H3EA 1Z6YA 1HQYE 2VDOB 2W0MA 2WF5A 4WECA 3L0ZA 1V45E 4P4GA 5LZ4A 2Q0QA 5AKJA 1PTKA 4H18A 3L1UA 1WY5A 2QE7D 1NP3A 1JDZA 1R8QA 2JL1A 3T5BA 2IPLA 1MAHA 2FXIA 2I6GA 4UHEA 2JIZA 5EJFA 4X1YB 2V8BA 4BAZA 1ILEA 1EJ6A 1MJFA 3K92A 4MHOA 1UT8A 3ICCA 3M9XA 3SVTA 4X54A 5KKCA 2BT4A 3PJFA 1FC0A 1QGYA 2WSLA 5GQSA 2WLTA 1Y1PA 1IUKA 1FYEA 1L3CA 1QYIA 2AC4A 3I2JA 2Z43A 4UBJA 3V4RA 4QG7A 4LIPD 1P6XA 1GFWA 2RB4A 1D2EA 4OXNA 2EJBA 5E8JA 5K0GA 1XR3A 1FDSA 5FYQA 4GGOA 4KP7A 3QWHA 4HVTA 5K4HA 4JIGA 3E1SA 3Q88A 1OBCA 3VBEA 3ETNA 3CUUA 3ZW8A 4GPD1 1XEFA 3UW3A 4JYCA 3F1LA 1N5DA 4RDXA 3RR2A 1RRGA 2A30A 2HQBA 3GNLA 5D3QA 4GI3A 4P4TA 2F62A 4G65A 3TE6A 2BHRA 1BG6A 2HA2A 1U2GC 3INTA 4I3HA 3TTYA 3PLRA 5IU6A 2VUHB 1QK5A 5BN5B 4D0NA 1B8OA 3I12A 2IZOA 2YL2A 4IDAA 4LS3A 1MH9A 1CRZA 1VBMA 1JGTA 3ECCA 4QDTA 3DZGA 1J9GA 2XT9A 4G5YA 4LCJA 4BO2A 4YT5A 5HIJA 2H1IA 1KJNA 1WEHA 2ZSUA 2AQIA 4S04A 5IN4A 4C7MA 3L7KA 2DSNA 3QPCA 4HDNB 1CLEA 5B36A 4PYOA 3T0GA 1Q6YA 3MQ4A 5EKTA 1DWOA 4QVIA 4OBWA 3ZDEA 1M6EX 2FQYA 1WMAA 4DJJA 1J21A 4XQCA 4ALIA 2WIDA 5KTTA 1PGOA 3EXFA 2OCBA 3WLEA 5TNXA 2VF7A 1NW5A 4KO3S 3HY4A 4KITB 2HCBA 3R5KA 1XTKA 4WW0A 4XQGA 2NXJA 3PEWA 1VHJA 2C3MA 2NYRA 4C2BA 3RS9A 2ZWPA 4MS1B 1P6QA 4Z6KA 3F5SA 3R5TA 3O84A 3EJ6A 2B25A 2Q2VA 3F47A 2O3QA 3GDOA 3PZBA 4HDRB 1JR3E 2Y27A 1IJBA 1E3TA 2B1JA 1QH1A 3IJRA 1KETA 3EEBA 5FOUA 1YJ8A 2H7CA 5KOHA 3EDOA 2CHQA 1KXJA 2XY4A 1AA6A 5HP4A 2CFRA 3W2EA 3NDJA 5COBA 4BNDA 4NAUA 4KR3A 1FFDA 2QZ9A 1MA0A 2R79A 2W43A 3G23A 4HMPA 1Z4IA 4I1SA 5DFAA 5KBYA 2OPBA 4JVNA 2X5KO 5DHTA 4CNQA 2PQ6A 4N18A 4MLDA 4KYVA 1BOFA 2B2NA 4I81A 2CDAA 1Y0BA 1DQSA 3ZQ6A 1EEXB 3TPCA 4BZPA 5JATA 4M53A 3SOZA 4FXOA 2YXLA 1GNVA 3QH4A 4U1RA 3NBMA 3V7UA 4L5IA 4UUBA 3KETA 1KFKB 2C7BA 3PC4A 4D4GA 3CZRA 5KJ6A 1CP2A 1ACJA 1J0AA 2ZRKA 3P4UA 3AR6A 2ZRBA 4B71A 5JD6A 2D3WA 4OSOA 1FUUA 1Y7TA 2BMWA 3ISVA 3B38A 4MP6A 1YRQA 3P9QA 4AP9A 4DW8A 2WM8A 3T06B 5HF9A 1E6CA 2A9VA 2FPSA 3JVEA 1O4WA 2PGNA 4IFBA 3U1VA 4EKNB 5IRCD 3DH0A 2NQ2C 1U80A 4EP1A 4A8JC 3OJFA 1HOTA 1P4AA 4FW8A 4CW7A 4QUDA 2ZYSA 5KO2A 3GRKA 4O4IF 4OQPA 3RARA 1WVIA 4DEVA 5B3JC 1LZKA 3GEDA 4NQRA 2B37A 2JHPA 2BJHA 1HMPA 4N0MA 1G8AA 1ZD8A 2WJVA 5G02A 1N0HA 4D3XA 1UC5B 1V8FA 4YMGA 3QOFA 5HKKA 2L69A 3K09A 3I1JA 1G5IA 4MJLA 2H57A 3ZWWA 1NPTO 4KSCA 2YINC 3VO9A 2D2EA 2X9NA 3BD9A 4KFTA 3TKAA 3Q72A 1V95A 1LX6A 3L7CA 4M37A 2IH5A 4MKFA 2Q2OA 2VYVA 1D1PA 1WTAA 2HXYA 4IYRA 1K3UB 3U19A 2C4TA 2WMOB 2FEPA 3GFGA 1GPAA 1T9ZA 4FP9A 2WHPB 4YMWA 3TPFA 1HDCA 1T8TA 1U3DA 3KELA 3W8DA 4MWTA 1WTCA 4PONA 5KNCA 2Q3DA 2PV7A 2UYQA 4MQUA 4QPNA 2XGOA 1TM2A 3FKJA 2XECA 4I8XA 5D1HA 4G5RA 4N7MA 3Q12A 4HKTA 1X8LA 5G2OA 1IBLB 3Q7SA 3FHLA 3RSGA 1M6VA 5GV7A 3UFXB 4K9SA 4C0QC 4C4AA 2HT1A 1CEEA 3SZGA 4CMJA 5H5JA 5IG2A 4O4IA 3CZPA 2PHZA 3EN0A 1MX1A 1IPFA 2NU9A 3C5CA 2YYYA 3G8CA 4FHEA 4KRYA 2PNFA 4TV9B 4FFRA 5JAZA 1BU5A 1P0PA 1PLKA 2Q7XA 2ZB3A 1ZO8A 3GJ3A 4QFDA 3U31A 4YCBA 1CEXA 3MOIA 2RSLA 3HLYA 1H69A 2YIVX 3KLMX 2QG4A 4FYYA 5HOEA 2ID7A 4PZ9A 3WK5A 4EHAA 1HG0A 2EC5A 1D7OA 1JHQA 3GD7A 1P72A 1VIDA 1KYYA 2P9CA 4F3KA 4D8WA 3I64A 2XWJI 5F7JA 4CIAA 2OECA 1N6LA 4AY4A 5KKNB 4G25A 4HX9A 1QTQA 4MYRA 4ND8B 3CRQA 3L4BC 3DTVD 4NOLA 4RCZA 2EEPA 2A9FA 3H13A 3ONNA 5HE8A 3D8UA 2HCJB 2AFIB 3N05A 3MAAC 2QN7A 4KGXA 1S2NA 1ADGA 3CIFA 4DRYA 2R00A 2F00A 2XYPA 2NUAB 5JJ5A 4JT8A 1AQJA 4NCIA 2MYPA 5A04A 4EKYA 1IJEA 2IZ5A 4B3MB 2HX1A 3AHGA 3KAKA 3BL8A 2XEDA 4PBTA 1I1OA 4MQEA 3LIIA 4BB0A 4RMIA 4RQAA 1CUIA 2ZM6B 3JQBC 4I66A 4KN6A 2JA2A 2CL7X 3TSAA 2FEMA 1P6UA 3QNUA 4GUAA 1RDFA 1E99A 2R4UA 1HXHA 2VDJA 2FTKE 2YXNA 2VSXA 4LOIA 1JLSA 4OFBA 4M49A 4YBRA 1WY7A 1XK7A 2DF8A 1JHOA 3MJHA 2VDQB 2QRNA 2JH3A 3O93A 4E14A 4ND3A 3IPYA 2OYRA 4HGYA 4LF9B 3G88A 2G9QA 1ENPA 3FFTA 3P9NA 4HGOA 4FOOA 1IAQA 1WSBA 1Z6PA 2AMJA 4HXGA 4LG1A 3SR4A 3P20A 4KG7A 4BCDA 1OIXA 2XCQA 4CLHA 4NBWA 1PL0A 1Z2AA 1T1RA 1RLOA 2ADFA 2IY7A 2RK4A 4RPLA 3UMBA 3QYPA 1PT6A 2M98A 4BO6A 2UUAB 4S35A 3T95A 1YK1A 3I34X 3ND9A 1J4AA 3PGVA 4WY2A 5LMUB 4NE2A 1R4MB 1H4QA 3GEIA 4K9PA 2ECPA 1QHFA 3A3YA 4RF5A 3IXMA 3T1QA 5IT0A 4QZVA 1D2NA 4MWSA 1QCCA 3KBOA 4AJNA 1DRWA 3MRVA 5I48A 1R0WA 2BFCB 3BHNA 4KN9S 2XHEA 1JR3A 4Y18A 4CCYB 2QX4A 3OMXA 2HV8A 2PMKA 3BXPA 1GUAA 1RIIA 2PUWA 2QMYA 3QLJA 2VSYA 4Y9SA 3NR2A 4Q47A 4D0GA 4U7WA 2PUDA 3C8MA 3M6MD 1ES9A 1MQ8B 1QV6A 1ZM7A 2HXGA 3LLUA 4KQCA 4OYLA 3BFPA 4QUJA 5AM5A 1VZ2A 1XDWA 2PVSA 4BO7A 1F0YA 2FPLA 1D2AA 2WTXA 5LQKA 3VKHA 4L0DA 5CDFE 1OZAA 3FYUA 2IGTA 4C7KA 1JA1A 3DBLA 4MA4A 3FPGA 3Q7IA 3NATA 4KQ6A 1PS8A 1J2TA 1VHDA 1KSJA 1XWFA 2BLNA 4M1TA 5CVUA 3T9EA 4DMFA 3RW9A 4NJEA 1FPQA 4L5BA 4OXKA 3PQ3A 4Q3KA 4QWWA 5SZIA 5K7SA 3EZ7A 2ZVJA 1X7ZA 4RY0A 1DC8A 3CNOA 3L0SA 2EIHA 2JCGA 3N86A 5FBRB 2QRJA 5BW8A 1YS2X 3EG9B 4BE4A 1MW9X 1DP4A 5IF3A 3OJ0A 4GOJA 1ULHA 1E2QA 3J80A 5HGXA 1K6EA 3VR3A 3DLTA 2VT6A 1AKNA 4B43A 1Y4ZA 2R5NA 1E89A 4BUZA 5KHAA 1J09A 3OPMA 5M04A 2HA7A 4O4JB 1WQ1R 4M54A 1CR2A 1SXJB 3R8CA 4YCSA 4IWXA 4S1WA 4XRGA 3T3OA 3EXAA 4WASA 2YN4A 3W06A 1RD4A 3V8NA 4R71A 5K0BA 2JGDA 3EGCA 2NU6B 2JZCA 1ODFA 4G0NA 1MJGM 2I2FA 1H2EA 4IDBA 4OHRA 5IM5A 4YDSA 4EGCB 2O2XA 3IP7A 2I3BA 1AN0A 2AFIE 2UZIR 3FTPA 4J3JA 1FL9A 3F98A 4YRGA 2WD9A 1KE2A 2YHAA 3GFTA 1NYTA 3ZS8A 1FDTA 5CNMA 4CHGA 3ZWMA 1VPEA 3UT5A 3WS7A 3V6MA 1RKBA 4KR2A 2QMHA 2YHSA 2OKGA 3T3DA 1OLSA 4UVIA 3IA7A 1IE3A 1YZGA 2JCYA 5MDHA 1K2WA 3EWNA 4KXLA 5KX5B 1SXGA 3QBTA 4QTYA 1DL5A 4FHFA 2ZI4A 3KQLA 1DAGA 1T1IA 4KQWA 5HS6A 1Z4NA 1Z8DA 3FNBA 3H9BA 1ZMTA 2DM6A 3F6EX 1UBMS 2XRZA 1Z12A 1BXRA 2FFBA 2WSIA 4LNUA 4EYSA 4HTFB 3D31A 4EGSA 1GAWA 2JVJA 1MFPA 1SCDA 1EGAA 1XTPA 1PQ4A 2V9PA 1DJMA 1LLUA 2H5JA 3DQQA 3KEFA 1L9XA 3X1MA 3KZVA 1MC1A 4AJ9A 4TM7A 4KYUA 5TVGA 4MS3A 1BHQ1 3M33A 4HWRA 1PBTA 3D43A 4JB8A 4LPSA 4LE2A 2G77B 2R7AA 4Q9IA 5EWLA 3OJLA 4US0R 3FBWA 2X1MA 3EULA 1EP1B 5EJEA 1FVFA 4EJSA 5FH9A 2ZUTA 3T7AA 2R1TA 5IJZA 3ADDA 4YRJA 1TM3E 3NVKI 1F1JA 2JIOA 1T26A 3OZGA 4QASA 2PSHA 4WEQA 2ZYRA 3KS9A 1EI9A 4RDIA 5IK2D 1B0PA 1XJWA 1DXQA 2R7MA 3H5OA 4IY1A 4CM8B 4LZOA 2JGAA 4LSMA 4EK9A 3OM9A 2HC9A 5DN6A 4ESEA 2XAAA 4XPIB 2P2LA 6YASA 2ZCUA 4FXPA 4KO1S 1U5BA 4YGYA 3UYLA 4PIPA 3OLWA 2A5LA 5A6SB 3UTCA 1Z2PX 3FDZA 1F2TB 1FRQA 4EGFA 1PU2A 2QX9A 5F21A 1UBUS 4AUEA 1AHPA 1KJZA 1J0BA 2Q1SA 2XYVA 3BE5A 3GO4A 3P2YA 2O8BB 2AT1A 1YCGA 3NAZA 2JGFA 1PGNA 3T6KA 1Z4MA 3INYA 5DTRA 2ANBA 2I03A 3DVAB 4IBOA 1ESZA 4HP8A 2XUIA 4RHUA 1CFZA 1ML3A 4K2HA 3CVWA 2P77A 1OR8A 1Q74A 3MC1A 5TMEA 4KUGA 5DJ5A 3LO5A 5BQXA 3OM8A 3DMHA 1Z7GA 3BL6A 1TA9A 4EJ0A 1Y9AA 1KO1A 1R2QA 2WYOA 3BRSA 4MX8A 3NOOA 3A6HA 4G0MA 5T4EA 1E6KA 2NU8B 3WV4A 2OZLA 3FETA 2C9DA 4KXMA 2VPPA 2Y99A 2HRQA 1YF3A 1M0SA 3VAYA 2RGBA 4NDNE 3NDBB 4QBHA 3TTXA 2JFFA 3KOUA 2W6ZA 4KI0A 3QLVA 2VP9A 2HPZA 3Q3VA 4HD8A 1LNZA 1I4EB 2I8AA 3R40A 2QRGA 5T64A 1LRJA 3QKUA 1R50A 1MAWA 5F5XA 2XR1A 4WV3A 4J1NA 2AIRA 3GGCA 3DL7A 3EH2A 2O2ZA 3IVRA 5HRUA 2XYHA 4EBFA 1UMKA 4XQEA 3TLBA 1POWA 2V54A 1L5VA 1Q7RA 1BDBA 3DKPA 1QG0A 4YJ2F 3RASA 2SKEA 3BFJA 1DBQA 2DUUA 2OM2A 4JHXA 4ZD6A 1WUHS 3T5TA 2MSDB 2ZUWA 5J43A 1XUOA 4FDUA 1SC1A 2DWQA 2G80A 3LVRE 3DJFA 5HZKA 3WWOA 4LGVA 2CB9A 4NATA 3IMFA 4RY9A 1N92A 3UY4A 1Z6XA 2WJ6A 2ZRCA 4KLNA 1G6HA 1ZIDA 4JR1A 4IWYA 4UUMA 4YRCA 5T57A 4MROA 2KBFA 5LZ7A 4ZO6A 3U7RA 1A9TA 4M99A 5CX1A 4AWAA 4AY3A 5GADl 1FNSA 3F49S 5G1OA 4XFJA 3C4VA 3VZBA 1ST2A 3H0KA 2ZATA 4YX9A 3C3AA 5A71A 5K0LA 3ZHSA 3U3RA 4DSNA 4HK4A 4N39A 3ZC3A 4H3KB 4Q18A 4FC7A 3HKEA 1G0OA 2GZMA 1RQXA 1ULSA 4O2BB 4RVGA 3WYBA 4YUVA 5HKBA 4KKVA 3KYCB 4AY2A 3BK2A 4I5FA 2JIRA 3HCBA 3HKDB 3G0BA 4R6XA 1RJDA 4E7OA 3DE4X 2UVPA 2G0AA 1ZXBA 4KGVA 1XMOB 1YC2A 5CLHA 1NGSA 4L2IA 2QX7A 1O9GA 1NP7A 2WWXA 3SXPA 3TLZA 1AGNA 2WW8A 2C77A 1PD0A 4YJ2A 4EL5A 3KQQA 3GQBA 1TM7E 4ARBA 2IXAA 5E9AA 4D3FA 1T35A 3G2NA 3ZW9A 1U8XX 4HJRA 5LBIA 3QMWA 2QR2A 2ZANA 4TLLB 1OASA 2FZVA 1E2MA 5EIWA 1P39A 1PS0A 1ZK4A 3K30A 3O9VA 4OFXA 3FD8A 2XUJA 4BNHA 3F8TA 3PG5A 1RADA 1RI2A 3WP1B 3ZWCA 4BZQA 1UZMA 1GCIA 3EASA 4X60A 2YXDA 4X92A 3NG1A 3NH9A 4ZEMA 1LSUA 3LM8A 3H2GA 3IUEA 3OTHA 4RY8A 1RM4A 2HHCA 3NTUA 2QXUA 2QLFA 3Q9NA 4RYLA 4DYHA 1ZN2A 2LBPA 2G3YA 2DLDA 2C2BA 1AK9A 2Y0BA 1AQNA 5EZYB 3BAFA 3RSQA 3AJEA 4AUNA 5THQA 3OU2A 1U9CA 2H48A 3UJAA 3K8OE 1VYHA 1ZVQA 2QUBA 3LF2A 4Z3KA 3KPYA 3HYRA 5JTUA 2ZT7A 1LF0A 5JO9A 1OCEA 4BQEA 2LZ0A 1DIAA 4OL0A 5T3YA 4YP1A 2WPDD 4P0QB 1VBKA 2ZJ3A 2FUNB 5GIPE 2BFOA 4LVOA 3WAJA 1BE6A 1O8CA 1F4PA 3KD2A 4KIUA 3F6RA 4ENSA 3DVQX 3UF0A 1BEEA 4RK6A 1MENA 1VG0B 4HT3B 2IZ6A 4NBRA 1NI5A 4TUYF 2ZRPA 1HYEA 1I3MA 2P5UA 3B2NA 3DCJA 3I2GA 2Q3CA 4FNAA 4I6GA 4BNMA 1L5GB 2K6GA 4ZP1A 1C0PA 4FDAA 4MVCA 2OK7A 5FA6A 3HC7A 3NBAA 1B4DA 3VJMA 3PS9A 2ODPA 1RYMA 3DT6A 4YI5A 3VVLA 1JN0A 1GLNA 1M1NB 1XCMA 2QLMA 4G81A 4QJBA 3RJMA 4YI3A 3WLPA 4JBHA 1UM8A 4CBVA 1N2OA 3E8XA 1YDFA 2QNRA 2VPIA 1T2NA 4WN3A 1LI4A 1DKOA 4WJKB 4AICA 1R6AA 3V1NA 4HAUA 4J0KA 3QUTA 3ZTYA 5ESWA 2I6TA 2RH8A 4MW1A 3V8BA 4AF6A 4BLQA 5EIXA 1Z3CA 4DUYB 2WOJA 1XHEA 2VI5A 5KYWB 3VNVA 1LC0A 2I22A 4I1OA 5EJMA 4ZVLA 1VMDA 4EY6A 5LIPA 1UJ5A 4LMRA 1LBIA 4TXJA 1UBLS 3VDRA 5JJLA 2OCDA 3ORSA 2WWYA 2JJYA 3KLNA 3KIPA 3O2JA 3ZKWB 4EUNA 4WBNB 1ML4A 2QQGA 5IVDA 3ZDDA 1TQ6A 1DAKA 1HURA 2E2WA 3NHMA 1Z0AA 3PRKE 2WK1A 2XUPA 1OGIA 4TUYA 1RQPA 2FMKA 3FWKA 5LDDC 1NP6A 3NKFA 4RJTA 1R6XA 1CQJA 1E0SA 1S8OA 3AHFA 3GPCA 3OEHD 5EL0A 1A69A 2IT1A 1M0EA 5C80A 1BGVA 3DZHA 2YJZA 4IGFA 4EJ6A 3GMDA 5K3BA 5JVDA 4GLFA 5HZHA 4HNHA 1RRFA 1JEYB 3EA4A 3NU1A 2ATCA 1P0IA 3EVDA 3GK3A 1E1YA 2WJPA 3PXEA 4Z2YA 3JTMA 4GLLA 4MJXA 1U7ZA 5JNSA 3VZPA 2MTBA 3THWB 4EPRA 3GLHB 2ZJYA 4WT7A 2C8KA 3HCWA 1SXPA 1AKWA 5CNJA 3RHZA 4F9TA 4YCCA 1RNLA 3EQ8A 4K9MA 4P3KA 2BPOA 2QN9A 1M73E 3MELA 3DV0B 2VHZA 2L18A 3A1SA 4JENA 4A9AA 4L8WB 3EH1A 4RSHA 3U4AA 1GUFA 1BHO1 2LGJA 2HADA 4BO0A 1BSVA 1C2YA 1J8QA 1NKSA 3I76A 3PFIA 1LGYA 5D87A 5BRAA 3PVZA 3L4EA 5AVTA 2IS6A 4EB3A 3B9RA 2FRDA 1RHQA 1U1FA 5DP2A 2PEYA 4K46A 5TT0A 1A27A 5AJYA 4I4IA 1J97A 1XKQA 4YACA 3CX8A 1X0VA 5F73A 1GSAA 1U2TA 3DEZA 1ZQ1A 4JQZA 3K3PA 2HTFA 4HZGA 4HYEA 4OGKA 3W4KA 4DJTA 3UA3A 1CKEA 1QHHB 4EHBA 1AGRA 1QS0A 2P9GA 2JVIA 3FCEA 5DBEX 2X2PA 1P1KA 2YCBA 2BJVA 2O57A 3Q87B 4H0FA 3TDKA 4E07A 1SRQA 1OLOA 2GEVA 3IQFA 1JLHA 1CDEA 1PZHA 3CW8X 3VRHA 3WL8A 1XEXB 3VMFA 2G5PA 3D6VA 3ONEA 4DRXA 3SQXA 3MSCA 4BFTA 4ZVTA 1WXHA 2H3EA 2JD2A 4X1IA 2XRFA 4V2IA 3K4HA 5IW8A 3A1FA 1CR1A 4IEEA 4R83A 2I87A 3Q3EA 4QTZA 4YCJA 2JF0A 3CQ9A 2H16A 2VF2A 4AFNA 4BVGA 5FL7A 1OC4A 2J6CA 4E0BA 4CKCB 2PWZA 1TJNA 4N9WA 5F5LA 4LXGA 5ILGA 1WR8A 2JI6A 1LPPA 3W6NA 1Z8NA 4RPIA 4D4JA 4WZAB 3L6CA 3UJHA 1AKMA 2QDKA 2ZYGA 5HK9A 2VQSA 1A97A 2PKQO 1WP4A 4HDOB 1VLQA 2V6FA 3JWPA 1QRUA 3KHTA 4QQ8A 7MHTA 1A2BA 5HJ5A 1E9SA 2BMJA 3SOPA 2G4CA 3N8GA 4KN8A 2FDCA 4GT1A 1Z88A 2WF9A 1MO3A 4LYYA 1BIFA 1SC9A 2BZGA 1QFJA 1PSZA 2Y9MB 1BE1A 3GJ0A 3PA6A 2JLWA 5P8WA 5AK6A 3U26A 3IILA 3QG5A 2FUCA 3GP3A 4MUFA 1YS1X 4Z51A 4LF6B 2FSUA 4Q3DA 1L5KA 5B2FA 3ZJVA 1Y3IA 4URZR 1Q11A 1U0TA 2D8AA 5DLDA 5EJ6A 1L7QA 2XIJA 4CTJA 4HBGA 4C2TA 4JT4A 5F3RA 3QLUA 2PGOA 3DHWC 4RSRA 5ERXA 2RHLA 3UBMA 2EJVA 2DQKA 2R9VA 1T9GR 1M2KA 1NVUQ 3T4PA 1X7YA 3TCKA 1Q84A 2E5LB 3LO8A 1HYBA 3EQ6A 3EFBA 2P9YA 5KNBD 5BR8B 4ZWNA 1KHHA 1P7YA 2A0XA 4QM6A 2O7QA 1L1EA 3T9FA 5IBQA 2F4VB 1ZAKA 2NMVA 3FDXA 2IQ5A 3K2IA 1OXMA 4MWBA 1D2GA 4KVAA 4UD2A 2OORA 3NYQA 1Y5MA 2QGNA 4KDCA 2AWNA 2IYOA 3WXBA 4F38A 1SXJD 4KBGA 2ZRQA 3HYTA 5JBQA 1PV1A 1KYVA 1KEKA 4PGMA 3ROQA 1CU1A 3AEKB 5CHEA 4EYQA 1JAXA 1QB8A 5DHUA 1PW5A 4E6PA 1EA7A 2X4LA 2WJ3A 2ST1A 1KZYC 2RKOA 3QF4A 3EGVA 4P3PA 3NC0C 3VKUA 1NT4A 3S7ZA 4LRWA 4RVSA 2GASA 3PWSA 3W2FA 3T7RA 3WZMA 4DNQA 5A62A 4Q03A 1LQ2A 2W6OA 2MCFA 5B2ZA 1BGXT 4NVRA 5FX2A 2BD0A 2FSHA 2HBZA 1K06A 3TG8A 1CZNA 1MQ9A 4OI4A 5JSKA 3RAEC 5GPBA 4HLCA 5FWXB 2Z9DA 3H11B 2WB2A 2ZBRA 5M5BA 3VKGA 3SY8A 4RZ2A 3PHJA 4F4HA 3EQ9A 1QH8A 1M1UA 1W5TA 1SWVA 3QLEA 3TLMA 2YYAA 5AUOB 1NVVR 2B83A 2IZ0A 3F97A 4XEHA 4ASUA 2NSHA 2WVHA 3FN4A 2QMOA 3VU9B 1UM9B 4RVHA 1D4FA 1C14A 1S02A 3IQXA 4HN2A 4F5EA 1K88A 1U2QA 4YRBA 4FUQA 1EBUA 1SQ0A 1JDTA 2I99A 4EY7A 2J3LA 3A1CA 5DHQA 3QVJA 1JHZA 4ZU6X 4LHYA 3CIOA 1QQ5A 2DHRA 4Z9YA 4MQMA 1Y4DE 1E3IA 4XX1A 4UU1A 4NS4A 1I6WA 3I42A 2CXNA 4EX6A 3WXMA 1YMQA 3ETDA 3MCVA 4WK2B 1BRTA 3RJZA 3I3OA 2HFKA 3DSRA 2HOQA 4LI3X 4MVJE 1G8YA 4N0EA 3C6XA 3BXZA 4DQ0A 4ZOQI 5KI6A 5E7IA 3NALA 4H3SA 2EL9A 4J0JA 4TRNA 3ET5A 3AHCA 1JHRA 3DAHA 4K81B 3W5JA 4EW3A 2QM0A 1LI5A 2OAEA 4DR5B 1Z47A 3DM9B 1R8JA 5FPSA 1HLGA 4CWAA 4WZAE 4GSKA 2J8ZA 1K9SA 3ZNNA 1CUXA 4RESA 1BFDA 1SQGA 2R44A 3F6PA 3IEXA 3M6UA 4FSXA 4H6PA 4UASA 3ZE6A 5EN4A 1QVWA 4B2LA 4CV1A 5C9ZA 4LF5B 3U09A 1G8SA 3RIEA 3PC8C 2QRPA 2ZE6A 3QFCA 4BX9A 1HUQA 3N5CA 3C41J 1GFIA 1UKVY 1YI1A 1KK2A 4H4DA 5LOVA 2XCSB 4HH0A 4YRMA 3SZMA 1MVOA 1HWYA 3H6KA 2C5LA 3E2IA 1B42A 2PCJA 3E22A 4WY5A 5FOVA 3TFOA 2W6PA 2QZ4A 3AINA 4B3HA 1NVAA 3RUIA 1TUBB 1GPDG 3SDBA 3ASYA 3Q9LA 4CMGA 2JLZA 1WB5A 4UHBA 521PA 2XTZA 3SHVA 4BNTA 4IAOA 1UC4B 3CNNA 4Z4HA 5AKYA 2W93A 2XNJA 3E27A 1TZBA 1MJHA 2PQMA 3JQ8B 2IYPA 3OIUA 4MUEA 1HETA 2H7VA 5ENDA 4Q19A 5H8WA 4KPYA 2WAXA 2ZB8A 2H59A 1CHNA 2HO5A 3FMGA 2DGDA 2RHTA 4H7HA 1ZJ6A 4KGZA 5FUXA 4EUKA 3ZDXB 1EDEA 2FPGA 4XWKA 4GKJB 4X8MA 3AJRA 5BMVB 3KQUA 1DT5A 4OUDA 3KKPA 4Z8YA 1T0IA 3W79A 3MD0A 2UZ4A 1X9GA 4FHCA 4BNLA 2CLMB 2CXSA 1WLSA 4FDMA 3OFSA 3CUEF 2O59A 1QNLA 4L95C 1VYTA 2Q29A 4K6HA 2NT3A 2WJIA 1L7OA 3DTYA 4B8ZA 4DQKA 4FFOA 2VQDA 3IOEA 3R3SA 5D1NA 1FFBA 2FJUA 4FGUA 1PFVA 3LQ2A 4LYGA 2GMWA 1T8UA 3ZZNA 1PR1A 1TRKA 2PR7A 4X1OA 3UT6A 5LQCA 1UKBA 2W8BB 1TLFA 1SKBA 1UQTA 2AVDA 1J25A 2ODNA 2X7JA 3Q2KA 5A05A 1NUPA 2QT0A 2NVUB 3SF8B 4WGFA 1KBQA 2Q41A 3AKYA 3M4XA 2ZIUB 2ZM5A 1EFTA 1GGFA 4RK4A 3AP1A 1LRKA 4YROA 1EUCA 1Z83A 3PQ6A 4C1BA 1YUNA 4JI4B 4HUQB 1JSRA 5FTNA 1I5RA 2QD1A 1TMOA 2TRSB 3ACCA 4BKRA 1TJ4A 1COZA 1Y82A 2G5GX 2P9HA 4MQFA 2AR9A 1TNDA 4QIHA 4C0AC 1RQ7A 1TMYA 3SR0A 1SKMA 3O2SB 4IGKA 3CBGA 3QX9A 1XKXA 1CQZA 1RZUA 4KXXA 4Q1VA 4KK3A 2E49A 2QQ5A 5HRAA 1X1SA 2ZJBA 1XEWX 1I80A 4PLTA 4AMGA 3QSYA 1UMDB 2GEFA 3V1UA 1P5JA 1IEWA 2JFZA 4KDFA 1L5LA 3E4CA 5KSYA 2XDAA 3E05A 4I5DA 1NWHA 2IYEA 3ITKA 2QX6A 4B3FX 1XZFA 1ENOA 5E7MA 3RLIA 4BOYA 5LWHA 3P45A 1HZZA 1LBSA 1KORA 3WLAA 2CVQA 4JLOA 4MB0A 5KQLA 4NMHA 4EKIA 4QRDA 1LKZA 3IXLA 3QU4A 2ZVPX 5I7VA 1S5PA 2FK8A 4PG6A 4TMYA 4G0XA 4ZVVA 3TKLA 3V97A 5ARBA 2H4FA 4YAEA 4LSWA 1L3IA 3SC4A 1QYVA 1SK8A 2OHIA 2RI6A 1GYPA 2Y4OA 3TEFA 4DM4A 3WRYC 4KPUB 4BECA 3TS1A 4GQAA 1F8UA 4TTRA 4XGRA 5I01A 5AVKA 3KDAA 1XHLA 2ACWA 2P5YA 1P33A 3GDWA 1IVYA 2XQJA 2DFDA 5G41A 3OSZA 1CDOA 2VNHA 3SPXA 3F90A 1GKIA 3RRJA 7AT1A 5L3QA 1W4AA 2H3HA 1NNI1 2GEKA 5DYGA 1O97C 3NHUA 3L40A 1HY3A 4FCTA 4HUJA 4CETA 5IWAB 3PL5A 2ECFA 3GPDG 3OF2A 2GF9A 1HE1C 1YJAA 1ZH8A 5A3SA 4MJ3A 1GUBA 1UBTS 3UQYS 1Z6AA 4N3NA 3ESBA 1B93A 3B1WA 4WGGA 1JU3A 2RI0A 2I0FA 3LZCA 2YFHA 4JZKA 4MMZB 4Y0VA 3A04A 2BFBB 3QW2A 5FNZA 4L57A 1K5DA 2E4AA 3LT0A 4D99A 3OQOA 2C20A 4G86A 3A31A 3JALA 1NUQA 3AW8A 1XMJA 2YBEA 3PRHA 2HU2A 4GPIB 1Z62A 5KZMB 4DY6A 1AHHA 2XOKD 1TKAA 1U8AA 1WW8A 4JVSB 1IXKA 2JJ2A 4F3YA 3PENA 1FA9A 2RG1A 4GSYA 2CJXA 3O91A 1T6ZA 4MVJA 4FJ2A 2QRLA 4LWOA 5FUMA 3PEUA 5FNVF 5T7BA 5FF9A 1VPWA 2FF5A 3QKRB 4XXHA 3IAAA 1RKUA 1ZUNB 3BGOS 3ZU5A 3GIWA 3PD0A 4CKZA 4R2MA 5DISB 1TAHA 4L5JA 3MILA 1SIOA 3W7AA 3D4BA 1DINA 4WEOA 2Y0EA 3BWEA 1AZTA 2ASVA 4BTVA 1G63A 1XZNA 1DO2A 1UIRA 1NBMD 2CJWA 2VH1A 4IDNA 4YK7A 1DV2A 2A9QA 4U6NA 3GJ8A 4DDTA 2HO4A 3L2OB 4ZCIA 1H2BA 2PRJA 3EPHA 1BQ4A 4GVXA 5JAIA 1H3FA 2ZBPA 1CZOA 2BMFA 3MWLA 1EWVA 2IWHA 3VR2A 3W3AH 1EPUA 2EF1A 2YW2A 5KAMA 2JAPA 4YUXA 3A9SA 4KMRA 1E2GA 3D2AA 4DNFA 2A59A 2ADMA 3AF3A 3QKSA 3U0BA 5IUJC 1RT9A 2GLXA 3Q10A 1HE4A 4QOJA 4WX2B 1S89A 3SE0A 3EGXB 4OIMA 1SVIA 2PJUA 3OY7A 4C03A 2IA5A 4IJVA 4YRAA 1HL7A 2CNWD