2PZAA

Nad+ synthetase from bacillus anthracis with amp + ppi and mg2+
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
279
structure length
279
Chain Sequence
MTLQEQIMKALHVQPVIDPKAEIRKRVDFLKDYVKKTGAKGFVLGISGGQDSTLAGRLAQLAVEEIRNEGGNATFIAVRLPYKVQKDEDDAQLALQFIQADQSVAFDIASTVDAFSNQYENLLDESLTDFNKGNVKARIRMVTQYAIGGQKGLLVIGTDHAAEAVTGFFTKFGDGGADLLPLTGLTKRQGRALLQELGADERLYLKMPTADLLDEKPGQADETELGITYDQLDDYLEGKTVPADVAEKIEKRYTVSEHKRQVPASMFDDWWKLAAALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NH(3)-dependent NAD(+) synthetase
publication title Structural adaptation of an interacting non-native C-terminal helical extension revealed in the crystal structure of NAD(+) synthetase from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Ligase
total genus 111
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 6.3.1.5: NAD(+) synthase.
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2pzaA00
3AFHA 2GOYA 1G8HA 3RJZA 4KKVA 4EGAA 1J1UA 1O96B 3A4IA 1GPMA 2J07A 3GUZA 1X8XA 1WXGA 1F7UA 3IVCA 2HGZA 2Z08A 4KR7A 3FWKA 1OWOA 2ZP1A 2X3FA 2EJCA 1O97D 1Q11A 4QREA 1TYAE 4TS1A 1ILEA 1P7PA 1NSYA 1T6XA 2H29A 5IJXA 4EG3A 2I1LA 1J20A 1PFVA 4R0NA 3GLVA 4U63A 1WJGA 3CLRD 5H16A 1O0CA 4EG4A 3N05A 1N2OA 4MVCA 3L92A 1TYDE 2QTMA 1N2IA 3H9BA 2JA2A 4DNXA 2X0KA 1OWPA 5TS2A 1VBNA 1N2EA 3KT0A 3H99A 3DO8A 4OUDA 3IMEA 3L93A 1JEDA 4HPWA 1EFVA 4MUHA 4QBTA 3TS1A 4ZCRA 1V8FA 4PBSA 1IQ0A 3CVWA 1T6YA 5H7XA 1GN8A 1NI5A 1R6XA 1O5TA 1JIJA 3CLSD 4RUKA 4X0EA 4G5YA 2YY5A 4NZPA 3X1KA 4MUFA 2PZAA 1JIKA 1O97C 3FY4A 2A1UB 4PBRA 3LOQA 1GTRA 2CV0A 1XNHA 3P52A 5FNZA 3OTWA 3G6KA 3UC5A 3FHJA 4Q93A 1S4MA 2J08A 3ZJVA 3ILVA 4WNYA 3JXEA 3N8HA 1SURA 4A91A 1I6MA 3CA8A 4KPUA 1WY5A 3AIIA 4I6EA 2QUKA 1EE1A 1NUPA 4JZYA 3KFLA 2CFOA 1M8FA 5EKDA 3SZGA 2DEUA 1WXHA 4EFKA 2V0GA 1OWMA 3FDXA 4ZT2A 1N3LA 5TEVA 4MWDA 3FH0A 3IH5A 4ND7A 1QRSA 4GRIA 3MMXA 1NYLA 2C5SA 2A4MA 4DJAA 3A05A 3KT3A 1QU2A 5JBNA 2VXOA 4EG1A 3ND6A 2J5BA 3H05A 2A84A 3Q4GA 3IUBA 1QTQA 1KR2A 2GKSA 3IUEA 1YULA 1LW7A 2QUHA 1K92A 1N2HA 2D54A 3IOCA 3MXTA 3UMVA 4E1AA 3INNA 1O95C 4WSOA 4MWBA 1G8FA 4R2MA 1KKUA 2YXNA 3VRHA 1KAQA 3NBAA 2IJGX 4ND6A 4BWVA 2HZ7A 5TGTA 2X1LA 3ZJUA 1ZUNA 1MAUA 1O94C 4G6ZA 2B7LA 2NZ2A 5LM3A 4JXZA 1KH2A 1COZA 3ZUGA 3RBAA 4MUJA 2QJOA 1T6ZA 3DPIA 1I2DA 1ZJWA 4CQNA 1N77A 4MVXA 4EG6A 2CYBA 3I05A 1IQRA 4MVYA 1WXIA 4KR9A 1FYDA 1KP2A 4EF6A 1R6TA 3CVYA 3SYTA 3BL5A 1JZQA 2G36A 1WXFA 3SP1A 3HZRA 1WZ2A 1QNFA 2Z3VA 1IVSA 2A7XA 1MOPA 1Q15A 1EFPA 1EJ2A 3N2YA 3IDFA 5K0SA 1NURA 1OD6A 3K9WA 4MW9A 5K0TA 1KH3A 1VBMA 4K03A 4OUDB 3SEQA 2H2AA 2DERA 4U8HA 2DETA 2A1TR 1EFVB 1MJHA 2PIDA 1IRXA 3PXUA 1MB2A 4YP5A 1YUNA 3IODA 3S3TA 4MW4A 4FZJA 1G8GA 2YWCA 1KQOA 3COYA 2O8VA 5DEOA 4CDNA 4JFAA 4KR6A 1YI8A 1BS2A 1I6KA 3MLBA 2WSIA 1KORA 4MULA 4MW0A 1F4LA 1PG0A 4DDMA 4MW5A 1B6TA 2D13A 3PNBA 1F9AA 1WXEA 1YIAA 1U0BB 1JEEA 4YP6A 1VL2A 1U7DA 1JHDA 1OWNA 3CLRC 3MUEA 5J59A 2ZUEA 1OWLA 4YP7A 3G5AA 3SZ3A 1EUQA 1KH1A 3VGJA 2WQ6A 4ZCPA 2EL7A 4I6JA 4NAUA 3DV2A 3PRHA 1ZH0A 4KPUB 5BNZA 2CUZA 4QRDA 1TFUA 3ISJA 2JANA 1JIIA 4PBTA 3FETA 1TEZA 1GLNA 1JGTA 1M8KA 3TZEA 4DE5A 2TS1A 1Q77A 1GZUA 3HV0A 4UZEA 3H9CA 1EUYA 3CVXA 2JAXA 1KQNA 4EG5A 2DPLA 1J21A 2CV2A 3IMGA 3COWA 3FOCA 4NATA 1G59A 4ARCA 4K0RA 1N2BA 3P0HA 2V0CA 4H3SA 2CSXA 5FO0A 4I6GA 3CLSC 3Q10A 4JYZA 3D6UA 1KAMA 4OJMX 1TYCA 2E18A 3HGMA 4J76A 1TQ8A 1WQ3A 3H97A 1A8HA 1UFVA 2CYAA 3FNRA 3CVVA 1WOYA 4ZT4A 3N9IA 3LE8A 3NV7A 3DLAA 4ZT6A 1NZJA 2R5WA 4RPIA 3G59A 3CVUA 1VBKA 3VU8A 1MC1A 1Y42X 4MW6A 1GAXA 2E89A 4ZT3A 1Q19A 3AKZA 2CV1A 3TNJA 3SEZA 4EG8A 1QJCA 4MW7A 1MB9A 2A88A 2PZ8A 3U1VA 2IP1A 2CT8A 1D2RA 2PZBA 1TYBE 1PFWA 3HFJA 4MUKA 4YMIA 1MBZA 1NP7A 4HJXA 3ELBA 2BYTA 4AS1A 1N2GA 3QTBA 1DNPA 4XSVA 4MUGA 1K4MA 4MW1A 1QQTA 1NUTA 3P0IA 5HUJA 1OBHA 1RQGA 4L2IA 2DLCX 3PNVA 1YUMA 1PFUA 1T9GR 2J4DA 4MLPA 1N75A 4Q16A 5F23A 3CR8A 4MW2A 3A04A 4U7JA 2VTBA 4F3RA 3QTTA 3A2KA 2DR2A 1MRZA 4MUEA 1WKBA 3KT6A 2DUMA 4YBRA 1H3NA 1NUSA 1J1ZA 1NUQA 2DXIA 5AHWA 2QTNA 3TQOA 3C8ZA 1H1TA 1EFPB 4MUIA 2AG6A 4AQ7A 5KWVA 3IOBA 4DDHA 3TZLA 1PG2A 1O96A 1U3DA 2OV4A 2PG3A 1J09A 1IQUA 4NDAA 3UY4A 3AG6A 4EG7A 1KQPA 2D5BA 2Z09A 4HK4A 1MAWA 2RD2A 2GM3A 4DLPA 2XRYA 1ULHA 5LLTA 5TEWA 3AG5A 3D6VA 5J5AA 4HJRA 1PFYA 3UK2A 2QUJA 1F7VA 1GTSA 3HL4A 4UZFA 4ZCSA 1K97A 2QJFA 4R2LA 1WQ4A 3ZJTA 1M8PA 4NX2A 3COZA 2WB2A 1M1ZA 5J58A 3K32A 3GMIA 3SDBA 4MVWA 1YIDA 1N78A 1M8GA 3CLTD 3ZXSA 3IOEA 2WQ7A 4CDMA 3RHSA 1JZSA 3X1MA 2AZXA 5FO1A 3AL0C 3HMQA 4NAHA 4MWEA 2E21A 2A86A 2QTRA 4ARIA 1ZH6A 1X6VA 3ND7A 4ZCQA 3E27A 3RK0A 1JECA 1J70A 4J75A 1QRTA 3CLUD 3ZXIA 3RFFA 4XFJA 2BTEA 4CT0A 3IMCA 1N2JA 1V47A 3LCJA 3Q12A 2RE8A 2HMAA 3M5WA 3X1JA 5LFAA 1M8JA 2O5RA 5KHAA 3ND5A 1XNGA 4ZCTA 1R6UA 2A1UA 4MQ6A 2ZUFA 2PXHA 1O95D 2E0IA 1IH8A 4S1OA 4ZT5A 3NBKA 4DDKA 2QUIA 4GU5A 1CT9A 1H3FA 1VLHA 3ZIUA 4PY2A 3COVA 3IVXA 4JXXA 1T9GS 1NUUA 1O0BA 4MAFA 4ZT7A 4MWCA 1O94D 3CLTC 1K4KA 2PFSA 1N1DA 2IELA 3UOWA 1OBCA 1FFYA 2YWBA 3ZGZA 1XJQA 5KCMA 3RK1A 1IHOA 1LI5A 3QE4A 1I6LA 2CYCA 5HUHA 1XNJA 3KT8A 4P2BA 1HYBA 1KP3A 3TQIA 1QRUA 3CLUC 5DASA 1U3CA 1U7XA 1JILA 3OP1A 3MLAA 3FG9A 1EXDA 5IHXA 2OQ2A 2AKEA 2A1TS 3PNYA 1LI7A 2NSYA 3FI0A 4L2IB 3FIUA 2J09A 1IFXA 1M83A 1JMVA 4XFDA 2XRZA 1O6BA 1QU3A 2VTBB 4F4HA 5DB4A 4G5FA 5DK4A 5HG0A 3P0JA 3F3MA 4MUNA 1H3EA 3IVGA 2QJTA 2X1MA
chains in the Genus database with same CATH superfamily
4PYJA 1WCXA 3OOEA 3TLZA 3BQ9A 3OESA 3VVMA 5B64A 3DBRA 1P2SA 3GJQA 1B43A 2B8TA 4OXIA 5JOQA 4NFSA 3EMDA 1E1NA 1RAAA 2XDQB 4DQKA 4RPHA 4MR9B 2J07A 4PHHA 1GZDA 5JQGB 1OGJA 2FWIA 3HY4A 5HMMA 2HGZA 4LZPA 1NBAA 3FWKA 1OWOA 1V5GA 3WYNA 3E9CA 1FFEA 3EFEA 4AJLA 2RH4A 3I9V6 3PC3A 1PO7A 2GMWA 4CKZA 5CYOA 5DXFA 2NV6A 2PYZA 2WFLA 2WR8A 5GP1A 3V42A 1RXEA 2WD9A 5H16A 3UGQA 3HVHA 3LLUA 4COKA 3V55A 2BFFB 4TUYB 5CXSA 1E1DA 1JSXA 3SLGA 1QH1B 1W9MA 4MV8A 1FFAA 1UKVY 1KY3A 2GBIA 2HNAA 1Q3KA 3MSXA 4FGZA 4IR7A 4DM4A 1TAHA 2A3RA 3LG2A 4HYTA 1JHRA 5BV1A 1W5FA 2BFOA 4CMEC 2F55A 1UJCA 1H6DA 1HDIA 4HXEB 2V5UA 1LNSA 2Y0BA 2Z83A 3NHKA 4DCJA 4Z8XA 4AIRA 2AFIA 4AMGA 1SKMA 1PE0A 4U5XA 1YDMA 3KT0A 3LKDA 3F49S 3PX3A 1Y7LA 4CCWA 4ISBA 4JA2A 1E92A 3TCNA 4CM8A 3B8EA 3L93A 4AN4A 2D5LA 3NUGA 3O8NA 4UUBA 3QFHA 2E4VA 3R7WB 4BL5A 2P5SA 3KB8A 4B83A 2YJ6A 1LLCA 3TS1A 1RXCA 2HHJA 3S1LA 1R1DA 1C0PA 1VYVA 2ASVA 2C61A 2FZKA 2JBAA 2ZTSA 3HXKA 2O7NA 3O38A 4FNGA 4LXTA 4RPLA 3U44B 4NG5A 1G4AE 2F9FA 4H4EA 1TVCA 2D8MA 3DBHA 5H7XA 3HVIA 4R2IA 4RSHA 1PBNA 3RRJA 2E3JA 4IXTA 1O5TA 4CTKA 1MG0A 2E85A 2ZANA 2EWMA 3FCYA 5FADA 2QE7D 2IYAA 2VJOA 3I64A 3KUKA 3VYRB 2QTTA 4MMXB 4OHBA 4Z9FA 1KOGA 3JYOA 4O4JF 3RRFA 4QDXA 1J97A 3JYNA 4EUHA 3MVEA 2EDCA 2Q6KA 3B6IA 1FX1A 3DV0B 3LOQA 2QLNA 3EXHA 1GTRA 1YQXA 1QMPA 3QBDA 3UXYA 1WE2A 4N8SA 2D6FA 3LGXA 3W3ZB 1O5IA 1NR1A 2A0FA 3LA6A 3R6WA 4TKUB 4ABYA 5HQJA 1R0ZA 3L0DA 3IQEA 1SJ9A 5BUQA 4XWTA 1O54A 5ALLA 1SVOA 1U3VA 2ZUCA 1NXTA 3JXEA 1SFRA 1R8JA 1ZIXA 2WJ3A 2QM3A 4X7MA 3MT0A 4NBSA 3ISTA 5HGJA 2NPFA 1H6CA 4UARA 4DLKA 5D8DA 2XXAA 1FP2A 2XLBA 3Q41A 2JLVA 4ZKDA 2WTXA 4CQMB 2EJVA 3G2MA 4I6EA 4RO0A 3KBBA 3RRMA 3KBOA 3UBMA 2JJ1D 2YZGA 4RD6A 3L18A 1E2UA 3QG1A 3C8UA 3BMQB 3PCRB 1D3AA 3HKBA 4H59A 4RZQA 3BGSA 1VZ3A 3NOOA 3RGWS 2I76A 3AB8A 4QJ4A 1IBLB 1E61A 3BORA 5EWLA 4ZT2A 1K0FA 5ALVA 1H85A 2WWHA 3WX0A 5A7GA 1RYBA 2HRZA 4B3IA 2Q07A 1A2QA 2AN5A 3GGOA 4FZ3A 4FB5A 3FNQA 2Y2UA 2Y93A 1EDEA 2DYKA 2FZ4A 3AX6A 3HB9A 2DH5A 4G36A 5A1TA 4PZZA 3G5MA 3N2IA 4L3WA 5AVVA 3WP1B 4BQNA 4DV4B 2ALJA 3ZE6A 1XTUA 3CEJA 4Q3LA 2OM6A 3NORA 1CDZA 3R5HA 4TTSA 1TT7A 4UNNA 3M3DA 2HD4A 3AVOA 3PHLA 5E6SA 2AYXA 5AKJA 3R3HA 4I55F 4ENRA 1QIGA 1LW7A 7REQB 1Q7BA 4C0QC 5I48A 5FPTA 3FDZA 4YREA 5BSRA 1K92A 3FZYA 4CM6A 1FFXA 4ICIA 3TOSA 5CG2A 1BCRB 1SN7A 3N5KA 2Q3LA 1UKYA 3LV8A 2JFYA 4FC6A 5L4SA 3A1FA 3NHJA 1G8FA 1FUKA 1IG3A 3KALA 1U2GA 4PIPA 4ZC1A 4QRIA 2GF9A 3RW9A 1FUIA 1KAQA 2H11A 2O6LA 5ALKA 4MICA 4Q3AA 2JG3A 3A3YA 2GJSA 1DJNA 5AP9A 1SOMA 1FYFA 4X65B 4A36A 1EGAA 4LXGA 3T5DA 1WV0A 3X44A 5E6UB 1NX6A 4RSRA 3NONA 1G59A 3CJQA 1G17A 3DXYA 5SY4A 4WESB 3TLXA 1O6FA 3LPLA 3NBYC 1WTCA 2BY4A 3ZKWA 1E2DA 4B74A 2D7JA 2F8MA 3NWEA 2XWQA 2OK8A 3C3DA 1EGQA 4C4TA 3HU1A 2R66A 4Z4EA 1Z07A 1EYZA 1GILA 1EI9A 2ETVA 3DR5A 3OEED 4AMBA 2V7BA 4B3DA 1TZ2A 1CJMA 3QI2A 5KNBH 4FOSA 4KLRA 4FQ5A 1ZGZA 1EWTA 2CYBA 4OYLA 2HCRA 3B2NA 1KGDA 3I05A 3PB3A 5JO9A 2IWRA 4ASUA 1JB1A 4C89A 1NE2A 2E37A 3FOZA 4YPOA 3JATB 3TNFA 1WCIB 3LT5A 1XTPA 4RV5A 4JWTA 3SMQA 5BSKA 2B6NA 1BS1A 3ICCA 4JU9A 4OKNA 5JFTA 3D2AA 2BEUA 4OUKX 4IG4A 2ZIAA 3Q3JB 5FTMA 3QNMA 3RS4A 1AT1A 2Q6OA 4HQRA 1J8YF 5DBHX 3HZRA 2QXYA 2QTVA 2RCNA 4WZBB 1EK1A 1QFJA 3C7DB 4KW7A 3V32A 3SG0A 5JI3E 4QVIA 4EA7A 4UBKA 1VXRA 4H7FA 1RXIA 3FX2A 2C2KA 1SBQA 2CVOA 3I83A 4LEIA 4YLGA 1E9AA 1TVKA 2CLOB 2HSJA 5BT8A 2W6NA 4RWZA 5LA6F 1JA0A 2VUSA 3UF0A 5IC4A 2XY4A 3OFSA 5IT5A 2X4LA 2PTGA 1ORWA 3RUDA 3WKBA 1QCDA 1TRKA 2XVXA 4LTNA 2ZIWB 1ZGHA 3K30A 4UU7A 3NIBA 2C2MA 2LCQA 5AVZA 4GBJA 1IRXA 4E1VA 2SKDA 4YP5A 4YROA 2WM9B 1BXGA 4QU8A 1FQWA 1IJFA 1Y9EA 3IIEA 4IILA 1ZOOA 1Z4LA 1X1BA 1G55A 4GPZA 2FB9A 3PE3A 1PSWA 1S9HA 2EX1A 4OV6B 4AWXA 1BHJA 2FDCA 3LWBA 3WGUA 4UFPA 1EM8A 3HCCA 2C9OA 1JI0A 3DMYA 3I32A 3M1AA 3NYQA 4IIXA 5U9CA 3ZHRA 4GAEA 4IM7A 4G89A 3VJMA 3BMOA 2JFQA 4JLSA 5EERA 3UXMA 5LQCA 1ORRA 3G1TA 2ZQZA 3GRCA 3A1VA 3OTHA 3GMTA 4ROSA 2RMKA 1WXEA 3D3WB 1W0CA 1FXWA 2JBWA 1OWNA 5KYKA 1L1QA 3OMWA 2H54A 3MUEA 3OSZA 1EE9A 5J59A 1OWLA 2Z2IA 2HHLA 3PK0A 4M1ZA 4CKWA 4PN7A 3AHEA 2B8NA 2ZB2A 5CTAA 5B2EA 4IOKA 4MZXA 1YQTA 4R1UA 2YS7A 1VGVA 2FPPA 2OMEA 4QIHA 2VF2A 2QN2A 5TDHA 4AQYB 3VX3A 2WHQA 3DAOA 3UW3A 3IHKA 1NONA 3FETA 2BSQA 1CFJA 2R11A 1WULS 2XQFA 2I99A 3QLUA 4DCCA 2MMGA 1N92A 4JI1B 2ORYA 4A0GA 3KDPA 2W5UA 5BQ3A 3JQAB 1WV1A 2BVNA 3D02A 4U2CA 2JAXA 4AK9A 4W9NA 2W90A 2Z1NA 4NCJA 4BX2A 5DGDA 4LY0A 1JQ3A 2V7QA 4NFHA 4TTAA 1MQ8B 1OZ0A 3LBYA 1U8AA 4I0WB 1Z2DA 2GEUA 5G4LA 3S2FA 3REQB 1E79A 1W8DA 2DWQA 4IKOA 5GQSA 1DO8A 2V0CA 1HQKA 3RF7A 5FO0A 1Z2NX 3RKRA 1UPBA 1WDMA 2CKDA 1F0PA 1J07A 4GC5A 4PCUA 3TSAA 3RODA 4HLDA 1YB2A 3A6DA 2AXQA 5DBFA 3TUIC 5FKJA 3TLEA 4GXTA 4ZYXA 2VRCA 3TMYA 3ZI0A 4AF7A 5C52B 3GGJA 2GKGA 1W0JA 1QTIA 4ZP1A 1NFRA 1CUCA 1QYDA 4FKBA 3VR3A 2VJCA 1XCLA 1Z62A 1H93A 5KVCA 2FTKE 2GCOB 2GF2A 5KYVA 1NZJA 2Y0EA 2B1IA 4KMOA 4YGXB 4MYTA 2BT4A 3QXJA 3QPUA 1EXMA 2WKQA 4EW6A 4Y2PA 1Y42X 2XITA 4R31A 2NVUA 3HB4X 3GYGA 4ZEMA 3O75A 5EXEA 4D9FA 5AVYA 1TUBA 4WZAE 1KAOA 1MO6A 2AVDA 1SELA 2HJVA 4FMCF 4QNRA 3TD9A 3AFMA 5FPSA 2PZBA 1EB9A 2AFHE 4UMFA 4TV8B 4RA6A 1AKYA 3AQ4A 2V9PA 2NU6B 4OQ4A 5NLLA 3P4XA 2M98A 5JV5A 1MRNA 3WGQA 4MIYA 5JMPA 1XMPA 2ASEA 2PX5A 4B76A 3O7MA 5JAQA 3I9KA 3BAFA 4E08A 1NUTA 3AF2A 1GQ2A 5JHHB 1WRBA 1HE3A 3K8OE 4JT8A 3H8SA 1ZK2A 3W5CA 1VL0A 2QMYA 4KAFA 2E1PA 1BKYA 4P92A 2WJAA 3GG2A 2PGJA 1BXKA 3QTTA 2Z9BA 3DDHA 5T3UA 2CVQA 1Y5NA 2H7VA 5DE3A 3TJRA 1XMOB 2QU7A 3GUHA 4Q3KA 1NUSA 1PT8A 2LD4A 1Y3IA 1CXZA 2QGNA 3C48A 3OUTA 4JJ8A 2A3NA 1T24A 3WLIA 4A6XA 2ES4A 2ZM5A 1M6NA 3NTRA 3QGMA 1PX2A 4PYIA 3GB9A 5TF4A 5AWFC 5F9HA 2J6CA 2F3RA 4G37A 3SKYA 1E8NA 4X24A 1N7IA 1PG2A 1CF2O 2ZJ4A 3MD9A 5CB0A 5IJ9A 1VP3A 4LRTB 1TD9A 1F14A 1X7HA 2R6ZA 4AZTA 3AW8A 1C3JA 2A0KA 1ZKMA 3NVAA 4OF4A 1AUQA 2ADOA 4G07A 1Y8CA 4MR7B 4YAWA 4B7CA 1C81A 2IUSA 5E4JA 2AOUB 3IIIA 5DTQA 2AI1A 3BCHA 3P5SA 5IXJA 4P3NA 1I3OA 1ZINA 2XMGA 3D6VA 3EDMA 3KPJA 3WB9A 2CFCA 3L49A 2XF2A 2OAGA 3L1IA 4K9PA 3JV7A 3EXEB 3GNSA 3R5TA 4UM9B 2HREA 4KIGA 1M8PA 1FPMA 1X3SA 5KVQA 4BQPA 3AHDA 4MQ4A 3WIBA 4TRMA 3W2IA 1P1BA 1WAMA 1CY6A 4BLUA 5BOSB 1DG1G 3OT5A 1S8OA 4CLOA 3IERA 3IP6A 3WA7A 3RUHA 5BOSA 2X41A 4L0QA 4F86A 3ZY2A 2OXEA 4NMLA 2MSKA 3CLTD 2CCKA 3FYUB 4AKGA 2WYVA 1K6XA 1N6HA 2X2EA 3HMQA 3N0RA 3BC1A 3ZWQA 2W2LD 3L01A 1Y9DA 1MD9A 4ARIA 1IZ7A 1T5HX 3LOUA 2WD7B 2VSOA 1UZAA 1TQDA 3DEYX 1NPDA 3VPHA 4CKXA 2DH6A 3HCDA 3PGXA 1MN6A 1KHHA 1SRQA 2IEIA 4AMYA 3DBOB 2R4TA 3F9CA 1P5ZB 3RFFA 3FNHA 1G0OA 3QWHA 4CLEA 4BNWA 5ULLA 1G8MA 1U0EA 1JAZA 2YH2A 3L6BA 5BW8A 2H0RA 2ILVA 1ODCA 2IXBA 4QDUA 4B17A 1OBOA 3ITDA 3JR7A 5B6JA 1NDQA 1ML4A 4L4SA 5KHAA 1GL6A 1L8QA 1K7YA 1Z5OA 4HR7A 4E12A 4I9FA 5DLQC 4PAWA 4W5OA 1YB7A 5JCPA 1YZTA 2VLIA 3FHOA 3UJCA 3ZHYA 1CDOA 3VUFA 2JLYA 3T0IA 1PEAA 1SCUA 4ER0A 1Q83A 4ZZIA 2OHJA 4H7PA 4P80A 2BEKA 5KJCA 5G3YA 4E5KA 1ZMXA 3REFA 2BKAA 4I50F 2PMWB 1IY0A 2QUIA 1CZHA 2WKPA 4W4TA 5EL0A 5FI0B 5KOJA 3DKVA 5KVVA 4R69A 4MPRA 3IL2A 1I80A 2KWIA 4DOMA 3COVA 3L05A 3NH6A 1U7HA 4ALIA 4BQOA 2QD3A 3ASVA 1K89A 3MFYA 4OK3A 4Q7MB 5L7YA 2Q5QA 1J8DA 1HE4A 1N1DA 1LWOA 4QECA 4YAJA 2APJA 2CJWB 4P1ZA 5IHPA 2G76A 4G0XA 1BHQ1 4D9NA 2PGNA 4D4KA 1XCJA 5JTUA 4P36A 3W5JA 1E58A 3ZGNA 2Q4OA 3RK1A 3W06A 5DOZA 2PMFA 2R1ZA 1KP3A 1YZQA 4RETA 3QW4B 3DTVA 4BFCA 2EF1A 2G3YA 2XKJE 4TTQA 1JLLA 1QGED 1T4DA 2L2QA 2HK6A 1Z29A 4D6PA 3KXDA 4OAQA 3URMA 1G5QA 4TZ0A 5KWJA 1JIVA 3R3YA 1AHIA 2OUKA 2XMDA 3RTDA 4WCFA 3VPSA 3T8YA 2OQ2A 4CMHA 4CMCA 4ON9A 4E5PA 3G2OA 4EH1A 5HCIA 3GFBA 5DGTA 1NVMB 2I3BA 4P3PA 4RMIA 3A6EA 3NOXA 1RWXA 2LKCA 2WU8A 1V8PA 3D2LA 2R68A 5AFSA 3KD2A 2W42A 2VA9A 1OU0A 3FI0A 5CM9C 1KP9A 3VPFA 2FEWB 3MTIA 3OO0A 5CDYA 1OXXK 3K9LA 1H8EA 3QV2A 3A6JA 3EGCA 3OFKA 2WSMA 4F4HA 2QLLA 5BSTA 1BGVA 2V3CC 3P9KA 3F3MA 5FBHA 3SF0A 2OORC 4XUDA 3R9XA 2VLBA 4TXHA 2OZLA 2DTXA 2FUG1 1AQIA 4TVKA 3UFXB 1HDXA 5DSXA 2DY1A 3IUNA 2DKOA 1ZAKA 5CNKA 1T9BA 4YRFA 3ZLTA 4H7EA 2WZQA 2RB4A 1LPPA 1S3IA 4G09A 4RVDA 3AVVA 2EFHB 1CC1S 1HG0A 5JAOA 3A32A 3OM1A 4ZV9A 4IQGA 1N6IA 1TW3A 4XVUA 1PUIA 4OHVA 4KO3S 1EEHA 1K06A 2JJQA 3F78A 3GZTB 5ALHA 3VHXA 1JHQA 3DMDA 4UAVA 5EJ7A 4RQAA 2ZTHA 3VO1A 3QVGB 4LRSB 3RVKA 4CEHB 2ZI9A 3DAGA 4N76A 3AR8A 3E9QA 4QC2A 5DSTA 2QBYB 1GG9A 2WLTA 1DX4A 3PC8A 1T9AA 2XEXA 2AOTB 3K9CA 4XPIB 3WRYC 3CLRD 3RPEA 1EKXA 1RAHA 1XZPA 4H7HA 4KV7A 4UNIA 4CU5A 3PQFA 4X6UA 3Q8KA 2AEEA 1PBTA 2VP5A 4PLWA 1YFLA 3KL4A 2PGXA 2ZPAA 3QUTA 2IH5A 3C3EA 3LL4A 3BD6A 3NHYA 3QHAA 2EP8A 3TRDA 2YW2A 2M6RA 1L5VA 4GOKA 3ESQA 4PNPA 3ROGA 3JVIA 1N6NA 2V7UA 1VSQA 3L8CA 2IP4A 3ZE8A 2DMRA 2OPBA 3AONB 2NZJA 2IPLA 1QV7A 2I3DA 4BPBA 1VSVA 4XVQA 5BRJA 3TLBA 3RBVA 3ZZ1A 1J4AA 4JXJA 3OX2A 3FPFA 2WMDA 2PMKA 1JG2A 4MUHA 3TLYA 4M8LA 4PPFA 3LFUA 2EBFX 4IQ4A 2WJHA 2WZBA 3IAM1 4Q7QA 1V8FA 2OGTA 4A8PA 1QKJA 1DE0A 1VKOA 5A6SB 3KHSA 3HR4A 1N3YA 4I1RA 4FX2A 4UM5A 1E3LA 5EZYA 4OFWA 2ZWOA 2XE7A 5GJWC 4YPVA 2O0MA 2RHWA 3DL4A 2B92A 4X0EA 3DL7A 1TO2E 2ZDGA 2KI5A 2P2LA 5TMBA 3K0AA 3NTQA 3R09A 3I9JA 3LY7A 4KN8A 3TLCA 3DFMA 4WD3A 3HBFA 5YASA 3E81A 2BR3A 4OBXA 5JAMA 1W36D 4LHVA 1YZGA 1U7UA 3WWYA 2P2DA 2MDTA 2QD2A 4IQ0A 3K0CA 1W52X 4ND5A 5ALOA 5EWMA 2MWMA 1V5WA 4DNPA 4Q93A 1S4MA 2EKQA 2H9IA 4NBWA 1DLIA 5IANA 3FZQA 1K68A 1UPUA 2CNBA 1IMOA 2QT0A 3PHCA 1V9SA 2BGIA 3SE7A 3V5NA 4TWZA 5SY6A 1Z3IX 4UM9D 2IX9A 4MRMB 4KLZA 4ZVTA 5T8KA 4OOEA 1HDYA 4JBYA 3CNLA 4UDXX 4PSUA 5K5EA 2MSDB 3M3PA 3Q87B 1OAAA 1SO8A 2IDMA 2XQIA 3C24A 1SEVA 3PTLA 4MYSA 5IKOA 1Y9AA 3QVLA 2CK3A 4U2BA 1DU4A 2EL9A 1TJ3A 3D6TB 1PZXA 2EWVA 2JCBA 2JIZA 4RYLA 2BGWA 1ZM4A 4NZZA 1VE3A 4TLEA 3MW8A 3WYBA 1AMOA 2FEAA 2V54A 2X4DA 4DXDA 3BGIA 5JWHA 2W71A 4HV4A 5KAMA 3QYFA 5AKEA 2GFIA 1RMYA 1J0EA 3LQYA 3ROMA 4JBNA 5LWQA 1FUUA 2XBLA 3HA3A 3KT3A 4EHHA 1ZX1A 3PRYA 3ZGVA 3TRHA 2F3PA 1TTPB 4HGPA 4JBWA 3T3EA 4Z7QB 4ZEOA 3OU7A 1Y8RB 2QV7A 2QAGB 4MI9A 3WGKA 3VVLA 5A6VA 3IOCA 3S40A 3STWA 2R8XA 4UEJA 3R5SA 3H6KA 4IWYA 4JB2A 3HWSA 4J4BA 3U62A 3H7AA 1R0CA 3V2UA 3BB3A 5BMVA 2UYCA 1NWCA 1U3WA 2MYNA 2Q0QA 2GPTA 3SDZA 4U7WA 1N6KA 4HUQA 2UV8A 3NASA 1TLFA 3EFBA 5I9SA 3K6KA 4F2WA 3OAAA 4W8GA 2A5FA 3ZWKA 3VNVA 1AF4A 1BYIA 2OLKA 3TRKA 1N1EA 4HX2A 5CFNA 1H9BA 2FK7A 2X7XA 5IKEA 3UYLA 3B7PA 3EC2A 3SIWA 4RV4A 3LTEA 2OAQ1 4OA8A 2C2OA 5ARDA 3UCFA 3AKCA 4AJPA 1AV6A 4BO4A 3ODPA 3A3NA 5BVGA 1SEPA 2WMOB 3W6OA 4PAOA 4EKGA 3RRZA 1N9KA 2IYWA 2ZE8A 1P9WA 1YKSA 2HPVA 4IINA 4LSGA 3DTYA 2HKIA 2G1PA 5CPFA 3ZI4A 4CT5A 4BNTA 1B0AA 2H1RA 3IAM6 4KR9A 1HDEA 4DLZA 1FP1D 3LLSA 4QU9A 3BE5A 4HNGA 3BA6A 4R9SA 5DLYA 3UJ9A 3ANLA 2ODBA 1W1IA 2BRUC 3D7KA 2QI9C 3RS3A 4A6DA 3W1WA 4BP9A 4ZARA 2YRWA 4RZHA 5C9ZA 3HKEA 5ECDA 3S2SA 1AB6A 4KBYA 4OKSA 2JFUA 3AI2A 1Q0QA 2FN7A 3D5EA 1YHZA 2MHCA 1EJ2A 1EGHA 3EFOB 2JHFA 3HB5X 3FTDA 3K0HA 3AVQA 3K70B 4DIDA 4J0FA 1VBMA 3RYIA 5DRYA 3ND9A 3SF8B 1JKJB 1G8AA 3BMCA 3EQ6A 4YC7A 1O2DA 3K7EA 4TKMA 1J2YA 4GX0A 1PR6A 1CS0A 4X44A 3EXFB 5CURA 1TCVA 5AVJA 1P1RA 1IATA 3E9DA 1KTVA 1CVLA 1XZBA 3GJTA 3NHFA 4GUAA 3T9BA 5HS4A 1TC1A 2ZBQA 3EXFA 1SXGA 3CS3A 2VC2B 1DXQA 2F1RA 3E3NA 3AUFA 1J2JA 3E35A 4RXUA 4AKEA 3KSUA 4EYEA 1CY8A 3JQBC 1KIMA 4NOLA 1RRFA 1BS2A 1FTSA 3MM4A 4H18A 3WKCA 1XU4A 3TGPA 3WGOA 3CX7A 3T3MB 1ZICA 2ZE6A 1UZLA 4JBGA 5FR2A 1AGPA 2N9UA 4AUEA 5INTA 4WXPA 4O4LB 3ZDRA 4RK6A 2PT9A 4EJMA 4NBNA 3VR6A 5JXIA 4MITA 2CUKA 2QTZA 5K51A 4HEHA 4M87A 5IT4A 3R7DA 1E3JA 2B2NA 3T3NA 4YP7A 4ZKEA 1TZJA 3E70C 1V3TA 3I4FA 4OEHA 1WF6A 3Q5GA 2ZIVB 1HTTA 1P74A 1F3LA 2Q0XA 1QC5B 1W25A 1W93A 3KR2A 4PXYA 1KJ8A 4OX9Y 2J3LA 3GVCA 4O33A 1PV4A 4DA8A 2YJGA 4MO2A 4UFNA 2G5TA 4CM4A 3N6VA 4F3YA 1XMXA 1X7YB 1DI0A 3OEYA 3TZEA 3JZAA 1JX6A 2BFAA 4BB0A 2H52A 2JKZA 1GSHA 1UPAA 3DB1A 2LZ0A 3ZEAA 3M49A 1X7YA 4PSVA 2RFLA 2NUAB 5C80A 4D4MA 2H07A 2IL1A 2Z6UA 3ACBA 2Q46A 3DG9A 2XB4A 1H2ZA 2FOXA 2LBPA 1HT0A 4OGKA 4NATA 4P5PA 3K71B 4UW9A 1JW9B 1AUPA 1J0BA 1Z7WA 2BZSA 3LY5A 1Q91A 4HATA 4YACA 1R0RE 3CNOA 2J9YB 1X1QA 1TYCA 3CBGA 1UJ5A 4BFTA 1Y34E 4OK5A 4QGAA 1XTZA 3GJ0A 2WJPA 3LA8A 4OSPA 5AHXA 4AY2A 2IF2A 3NDIA 1XD8A 3EDCA 4JJZA 1JWBB 2NSDA 1DHTA 2VF8A 2PKQP 4KWIA 4OQXA 5FBQB 4E6EA 4EFNA 3PPYA 1K5DA 5DULA 1GZ4A 3PHJA 1UMBA 4Y98A 3L4KA 3ZE9A 1GGMA 5FJIA 1N6LA 4BNFA 4B3JA 1B8VA 2OV3A 3EZLA 4BVGA 4EITA 3W6ZA 5PNTA 2B4RO 5ITZB 1R66A 2V97A 1E69A 1SVUA 2ZYRA 3B5EA 1CZUA 4KXYA 4MW6A 3VU8A 1U7OA 4R1OA 3B5JA 3X1YA 1DC5A 3L1KA 3NJ8A 4DNFA 1EJ6A 2B6HA 2JIMA 5K0BA 5HUQA 2A5LA 3CB2A 4H6WA 4XWKA 2R1VB 1H8HA 4F5DA 2ONCA 2O0HA 3EHDA 3OQ1A 5CK5A 1DGQA 1X42A 3DL2A 3KP1A 1R0WA 2PKCA 2Q49A 5AKXA 4ETIA 1AKTA 3OT1B 3TXAA 4TKVB 1C4OA 1MBZA 3WL4A 2Y76A 4HAZA 1YR3A 3N2ZB 1PL6A 1SD2A 1TCBA 3B1KA 1U2PA 1XJ0A 2HU7A 3P0IA 3CIOA 1WXWA 4Q48A 2D1SA 2NSLA 4RADA 3TXYA 5ABPA 5I51A 4DRZA 1JDNA 4K81B 5E4TA 1GA4A 4JSYA 1N75A 3PUHA 3RTEA 1JWLA 3AERB 1S8NA 5IH3A 1ODKA 1UC9A 3R9IA 3SSNA 2QF7A 2WIGA 3A2KA 5JCOC 4ND2A 3LDAA 5JYBA 4EM6A 3UEOA 2OV1A 5GMOA 4RK7A 2ZR7A 4Y2HA 3IP7A 2R4QA 4I2NA 4PC2A 3SQXA 1FTWA 3WK7A 1E6UA 1TA0A 1HEYA 3DCIA 2QP4A 1PS0A 4A8JB 3U4DA 3TPZA 1DIAA 1KDVA 1O6GA 1VLMA 1M2OA 3VH2A 4AP6A 2ORIA 3IURA 1AU9A 2ZOSA 5ERXA 4NNPA 4Z3DA 1O96A 4A8JA 1M2EA 2AQKA 1Z5PA 3FGOA 1ISGA 3NAMA 1GPNA 1GNQA 1X9GA 2DFKB 5KNCA 1T8WA 1F1JA 1CY0A 4N41A 1IQUA 5AM2A 1WEHA 3F6RA 5T6MA 2G8LA 2J3HA 3DZGA 3ICVA 2J9RA 1NUHA 1P0MA 1VLVA 1YWGO 4HSGA 2G9RA 3RBZA 2OBMA 5GOZA 3A2NA 1KPIA 3L1HA 2GM3A 4YAFA 1ZNWA 4DZZA 1ADJA 1L8XA 1QHXA 1RLMA 2JKYA 4TVOA 3UMSA 2C20A 1ISFA 2GCGA 2RH5A 3ABOB 2QUJA 2ZREA 4JC8A 3GRYA 1Y33E 4MGHA 4V0QA 5FNVF 1U9CA 1RBZA 4QVGA 3KKZA 3NW9A 1HO3A 3RSLA 3CMCO 3RS2A 2V6FA 4KV9A 4C78A 2A30A 5JWOA 2VPWA 3NM6B 2O3TA 4POAA 5IM4A 3KO8A 1XMVA 1AQLA 5BN5A 3FNEA 4JLWA 2C9BA 4BMYA 3NAZA 5B4VA 4RU1A 1PGOA 3RYTC 1EEXB 2AIRA 2QTGA 2P3OA 3K1JA 3K9BA 3DCYA 1TFRA 4PZ9A 1V37A 3O5AA 1Z6AA 4BIMA 3BREA 1N57A 4Z9AA 6CHYA 2E21A 1LPOA 2NZUG 4HNAB 3MQ2A 3RT7A 4BNZA 4QDTA 1C3OA 1QF7A 1V7PC 4B0OA 1S8AA 2FPWA 1TT5B 4YMVA 3G0HA 4JT2A 3MLEA 2XJ9A 3DLCA 3OIFA 4GVPA 5HF8A 5KMGA 3IP1A 2PS9A 5GWXA 3CNBA 4Y1FA 3RNLA 3RT1A 3NEYA 2VWPA 4WLVA 4YJKA 4GKAA 3A3KA 3AUAA 1HYGA 3SMVA 4DBZA 4Y1RB 4FI3C 4KG7A 1P17A 4XLLA 2WHYA 4OD0A 3RSFA 3RC9A 3STTA 3WK9A 3DDSA 1EJ0A 3IJEB 4MK4A 3T6KA 3TMAA 4EYQA 4Y1RA 1BZYA 2AJDA 2OENG 3TSYA 2ZIGA 2PGLA 2AJTA 5EMMA 3E7DA 1LPMA 3O1HB 1W6RA 1BWQA 1NJSA 1NXPA 3TQSA 2ZJYA 4G24A 4L9SA 4EBBA 4D3YA 1CT9A 4KH1A 4X85A 4FGLA 3WRXC 3EVTA 4PGGA 1OXSC 5T67A 1PUJA 5A9TA 3H0EA 1YH3A 3GEDA 3GL9A 5J2TA 1FJHA 3WL5A 4OLHA 1Z47A 3B8HA 2F8TA 2QT1A 3CRZA 3ONEA 3GLFB 3I2JA 3IPXA 3UWMA 2YWDA 2GN0A 1YL6A 5E95A 5JSQA 1OBCA 2H1CA 2I0FA 2G7ZA 3ZY6A 5B12A 4Z4QA 1FFYA 2FEKA 4PW0A 3N70A 4HAXA 5K4AA 4BFWA 3EA5A 4P5DA 4C7BA 2PPLA 3LRPA 3CKLA 1QHYA 4RESA 1LI5A 1U1GA 1DL5A 1DAKA 1IJKA 4W6ZA 4QODA 3VHLB 3LDFA 5HPYB 1SZDA 3FTCA 3GN1A 5DASA 3VNSA 4A2QA 5K4HA 3EDRA 5T3YA 3IIJA 3AL2A 5J1SB 3QNWA 4QYXA 1P75A 1RADA 4V2UA 1IYZA 1QYIA 2IW1A 1NM5A 3HADA 4PLFA 1YCDA 4BLWA 1XQXA 1TW2A 1ZKDA 3HXTA 2ZB8A 3JQ8A 2YUIA 2BR5A 3GCGA 3K6JA 5CHYA 4ZAFA 3ZWYA 3LLCA 4FYVA 4B4VA 3K0SA 4GOLD 4KUEA 3VZCA 1WA5A 4L2IB 1KK3A 2Z6AA 4I99A 4BQRA 3OQOA 3AUXA 3C6QA 3CF6R 2AR0A 3K0EA 2Y1KA 3H9QA 3U7QA 4JZKA 2XRZA 1DFGA 2Q7OE 1NJ2A 1FMJA 2H5IA 4G5FA 4XUEA 1I4DD 2VK1A 1XTKA 4XDGA 5DB4A 4GP7A 5FIUA 4BQIA 5KTMA 4J3NA 2BD0A 2NU7B 3T5BA 5C8VA 1KF0A 1RKBA 4PRLA 1Z0FA 1WCWA 3U49A 3F6YA 3IMGA 2WKWA 3TO5A 3WQBA 5DXJA 1ONSA 1QYRA 1ZIDA 3RKUA 3RASA 3OZBA 3EGEA 2FP3A 2Q9AA 4HB4A 5H1YA 3EF3A 4KKVA 1NUAA 4BNDB 2F9MA 2XQJA 1C3VA 4N0MA 4RJLA 4V3BA 1I6WA 4D9JA 1SKBA 2C88A 3HB0A 2BEJA 1DKNA 3A4IA 4LDAA 1ZM3A 2NV2B 2PR2A 4J4TA 5F51A 3IR7A 1VMKA 4NR0A 1OVMA 4ZOLA 3I9NA 3VR5A 5FAXA 3OKCA 1GPAA 3OU2A 2CCGA 1ZGCA 4RFVA 3RAPR 3WV5A 3ZIDA 5LMUB 2TMGA 1W5AA 3LSYA 2EJCA 4EYGA 3R0QA 4YCNA 4I3HA 1KBOA 3Q85A 4G0ZA 1WXXA 4BNHA 5J2TF 1PTKA 1ZOLA 4NYIQ 1PFVA 5FD8A 2CHFA 1HT1E 3IEIA 3KZCA 1DAGA 1M10A 2B8EA 4AG5A 1LXCA 4HBGA 4DDWA 4FCTA 3H65A 2DKFA 2PMBA 1RIIA 4JNCA 4FSDA 2QMOA 4QKQA 1IN8A 3PEUA 1RYEA 2OG1A 1P2VA 4S3MA 1QPZA 2GFQA 3CF0A 2E7ZA 1NOJA 1UZMA 4WLEA 2J0EA 4XI9A 4DNXA 2VHZA 5EINA 1T2UA 3M5DA 4MV9A 3AR7A 3WO0A 4UDYX 4GMFA 2Y1FA 4V02A 1Q74A 3O3MB 4NC9A 5JCJD 3O8DA 1X19A 2ZT7A 1MT0A 4OUDA 5FPHA 2CHUA 2LNDA 5FYDA 3RWMB 1WMAA 2K7ZA 5B53A 2HW8A 1T36B 3BGDA 1ACMA 1D6JA 5AK5A 3ZGOA 4Y30A 4UQOA 2OA0A 1IXRC 3G23A 3UIEA 2B1QA 4TXJA 2YWFA 2QOEA 3DYVA 2HIHA 3K1ZA 3D4LA 5EPOA 1YACA 2RGUA 2H9AA 4KJXA 4ZV7A 1PNQA 2Y92A 2GJKA 4HAUA 4LSWA 1W76A 2BKVA 2Q21A 2KJQA 1EQAA 1PHPA 1FDVA 2DPHA 4G5YA 5B7GA 5HJ7A 3QVWA 5HIAA 2AX4A 1CUSA 5ALZA 2X0JA 4LJYA 4GKVA 4LF8B 1R0YA 2ZVPX 5BYBA 1ML3A 1Z12A 1GUDA 4F4UA 4CLRA 5K0CA 3N7UA 2Q41A 3LIIA 2VQDA 3BZBA 3PR1A 3U48A 3ASUA 3SZRA 4OGFA 1OH8A 3FKSA 3PF9A 4KR0A 3ZD6A 1MQAA 2GSWA 1RE1A 4URZR 4YX9A 4EJSC 5JECA 1NNUA 2B98A 2QZSA 4X97A 3UC5A 1QH9A 3PENA 3O21A 4AM8A 3Q3HA 3LC2O 1K3TA 1A4XA 1SA0B 3ETCA 3A28A 2PO5A 4MVJD 4EY3A 3IAS1 4RVCA 2D5IA 1WQ1R 2PMCA 1EXVA 1RU3A 2IXAA 1WY5A 3AK4A 3QNUA 2YVUA 4YMTA 3MTDA 1FNBA 4DDVA 1XLVA 1MFZA 2HOQA 3FDIA 3U4QB 5JZ9A 2Q0HA 2HCBA 3WYCA 2ZJ1A 3EUAA 1NVEA 2RBKA 2IYVA 1SQ0A 2C7VA 4PR3A 1N2CA 4ZAZA 3BRCA 2OKCA 5H83A 1J8QA 1YGPA 2C92A 3NG1A 2D1FA 3OO1A 1X7ZB 4FNAA 4RH0A 4GI5A 5T57A 5A4AA 3L6RA 1AQJA 2ZZKA 4JSTA 2A4MA 4N03A 4DJAA 4WKBA 2F43B 1NPTO 3F2VA 1GHTA 3GLHA 1YB5A 4O08A 1C4KA 5B1DA 2ZR9A 1W85A 1US8B 2GLTA 3QUCA 1RRPA 1UWVA 5DOVA 4J7XA 2G9NA 3LQKA 3ADDA 1GDHA 5AW3A 4Y6RA 5TVGA 5LQUA 1OI2A 1IRIA 1TJ4A 1CB7A 3GT7A 3I9FA 2EAUA 3IPRA 5JYCA 2FWBA 2XNJA 4OHMA 1FTQA 2QQGA 1UFOA 3UA3A 1GAEO 1NRWA 1FNCA 1LLDA 3QE0A 4LRWA 1WLYA 2H65A 2R6JA 1I4EB 2CDNA 2W2XA 1KKUA 2ZUUA 5F77A 1K4YA 1OH7A 1ZVKA 3K3PA 2ODAA 3TR0A 2ZJFA 2ZT5A 1QGUA 3SFZA 2VRBA 3BIXA 2CD7A 3R0XA 2WFMA 4CF4A 2ZG6A 1MNQA 2X1LA 3IQIX 3QIAA 2R1UA 3NRBA 1U7WA 2ATVA 5F2NA 1NVBA 4UBNA 1L5GB 4W7IA 5ICEA 5LIRA 1T5TA 3RBAA 5EN4A 1T2VA 2FSGA 3ZOKA 4Y67A 3LK7A 5DNEA 3M9XA 3ZQ6A 3L77A 3NIDB 3TLJA 2FFRA 4KHZA 1BVRA 3Q5EA 4O2BA 1T6NA 4TRNA 3ZCQA 2YTZA 3P97A 2ODNA 1EFCA 2EGUA 5K3CA 3A25A 1LQTA 1EFRD 3RTBA 5CVUA 5JXWA 4ZEVA 3TFWA 1M1NB 1CJCA 2GLXA 2GWHA 1KI8A 1CUWA 1FYDA 1E62A 1KP2A 1RPJA 2BAGA 2I1VB 1ZC4A 2WJVA 3C8MA 3KPYA 3Q3CA 1I1NA 4UASA 3U81A 2C4WA 2F3TA 3VM6A 3W9UA 5JSZA 4HTFA 1QOZA 3I92A 5EKXA 2ZJ6A 1IVSA 3PEEA 3KLNA 3KELA 2DUWA 4POOA 3IVAA 4M0MA 5JD3A 4HPJB 4AXBA 2UVDA 2V98A 4GZLA 5JSYA 3VZSA 4LIPD 4UM7A 3X0DA 5ICSA 3AEYA 1A7AA 3NP9A 4I1PA 2QP9X 5EJ9A 1XEAA 2HB6A 3ULKA 1PK9A 1AG9A 2HCTA 2V3VA 3UMRA 3R7FA 5A2GA 2H2AA 2A1TR 2BW0A 2JHAA 2YHSA 5ADWA 4FWBA 1VDZA 4DR1B 4UE2A 4JI4B 4PNHA 1YQGA 3S7TA 4BU1A 4BFVA 1L8AA 2IPOA 2ZEJA 1DTSA 1P81A 4PRZA 1T8UA 4GI3A 5BSMA 4RY0A 4RPKA 1UPTA 1I4WA 1P2BA 3FGZA 4XA8A 3QPWA 4GOMD 2ZAMA 4J0HA 2P1DA 2P9QA 3BULA 3IV7A 4IOLA 2W0SA 4L75A 1U0LA 4M83A 1CY1A 1XXHA 2H1SA 2DKNA 4UUPA 5LBIA 4DLAA 1FU7A 1QPGA 4C1NA 4JQSA 5A06A 4DSZA 1CEXA 1RXSA 2BFBB 5HKOA 2CN1A 2VJQA 1FOEB 4YI3A 1K6IA 2HQSA 2ISCA 4Z5XA 2ZSJA 4Q6BA 1TU3A 1F9AA 4LBVA 5IW8A 2OYSA 1U0BB 1YUBA 4DWWA 3ROTA 3NXSA 4OOFA 3V7NA 2ZBRA 4HNUA 2UUBB 3Q88A 4ZU3A 3UKDA 4FEYA 2CL0X 1GGHA 3ZDAA 1IBRA 1DC7A 1KH1A 1FTNA 2O8BB 1UJMA 3ABZA 4I6JA 3C4VA 3GAAA 2GWRA 4WBNA 1SY7A 4XLZA 4K9QA 4BJ1A 4ESVA 5KYUA 4PPGA 1HK7A 4PX5A 1BKDR 1JHXA 4O0LA 2ZZMA 1QK3A 5HTKA 2KPOA 4K05A 1KDZA 4CXMA 3HC7A 1NQWA 2Z2YA 2C5GA 2QQFA 2VPXA 1E1KA 1SUFA 2BGLA 1HZZA 1SXJE 1YRHA 4DE5A 5ICGA 2H5LA 4QYIA 4NCHA 1QDLB 1DQRA 1UXKA 4F7WA 1IWBB 4XB6B 3G2QA 5FDFA 4RD2A 4RVSA 4BVKA 2IHKA 1T6BY 2O20A 3K4HA 4AC9A 3IAEA 3GD7A 3ZUPA 1DJLA 5KVSA 3ZHXA 2DY0A 1J9EA 1N6RA 4GYWA 3KAQA 4LC1A 4CIAA 4LV8B 2JFGA 1L4NA 1U7PA 3P0HA 4KI0A 3FCAA 4I6GA 4LAFA 3L8HA 2JLWA 1MDBA 3Q9NA 4LISA 4WL0A 3EYAA 1N1MA 4QBIA 2XNDD 4QTZA 4XSGA 4J76A 2ZSHA 4AJ2A 5C8YA 4YY3B 2H63A 4IDCA 5JO0A 2P6OA 5T6BA 3QKRB 4FYYA 4TZKA 4U2KA 3U1BA 4IHJA 2NO4A 3G13A 4EPWA 1B0UA 1YRWA 2PV7A 2G06A 1HORA 1YQ9A 2BLLA 3AR5A 3CVVA 2QDKA 2IC5A 2PA3A 4MQLA 1XYGA 2CB9A 2P9EA 4FR5A 4JUIA 1OX5A 3E0XA 1KFEB 3THSA 4O4JB 5IZ4A 1LVGA 2O8DA 1TKRA 1FDTA 3JRXA 3SSOA 2HYDA 3F71A 3MFQA 3RC8A 4N7MA 3LT4A 5DI9A 2DT5A 3AEQB 2E89A 2A9PA 2AZTA 2Z8XA 3BMXA 3CE9A 3LPMA 3CJRA 3TAXA 2W0MA 3PDHA 4LOHA 4PQRA 4R8LA 4Z9XA 2M6LA 1X1EA 2DBYA 3IB3A 5EXSA 3IBCA 1CF9A 1M3SA 4BV3A 4RGYA 4WASA 3L7MA 5ALIA 4E7OA 1GQOA 2HX1A 1OGIA 3PGJA 1M0SA 1F2TB 4QXOA 4WJLA 4AS1A 3MJRA 1DNPA 1I36A 3FSRA 3IAAA 4MUGA 2JAHA 4CT4B 3UHFA 3ETHA 1XZGA 4DXAA 4HNHA 1Z7YA 3WLOA 1YS1X 4GKJB 4B3FX 5DTMA 4IO0A 4FHFA 3HJCA 2IVZA 2XUDA 4MUEA 4GLFA 4DWJA 4JGIA 5IVIA 2HF7A 5LP6C 3GV0A 3TQHA 1LC3A 3HCAA 3RWOA 5DHQA 2DXIA 5AR1A 4URUR 1RJ9A 1AKUA 5FTWA 3GFOA 3U7GA 1T5LA 3VSDA 4QXAA 4J2HA 2G5CA 2RGGA 1GSIA 3W7AA 3R6TA 5AVXA 1JFSA 1PJAA 1RCFA 1YS2X 4NENB 2B35A 3C8HA 4OXNA 1Y63A 3DFFA 3OPNA 1Z4QA 1EFDN 5JWRA 1V3VA 3TPCA 2HHHB 3FMVA 4I55B 4EG7A 3DQPA 4LUCA 2V7WA 5JAHA 3VOAA 4TWBA 1EVLA 3GP5A 4Q82A 5FORA 1I1OA 3OKAA 4PG6A 4LGYA 5FV7A 3WHIA 3WIVA 5KKNB 2BFCA 1WF3A 4YP0A 1BOFA 2E87A 4JBHA 2IH4A 4Q4HA 3ZDZB 4PYQA 3CSDA 2QQEA 1ZK4A 1M5RA 1GAWA 4O2LA 1EDDA 4TYMA 1HURA 1WMSA 1E0AA 3ROZA 4Q9AA 2OB1A 5TNXA 1GTSA 5KKCA 1NL3A 1CY7A 4CV1A 4F6RA 2NU9A 2J67A 3H2GA 4MUYA 3COZA 4P54A 1A2OA 3IUQA 2BHLA 4ZVNA 3WS7A 3EMKA 1TADA 4FKMA 4HMQA 4CVNA 3F74A 2H2FA 1OIXA 2H2IA 2N0SA 2PWYA 2YJTD 5DF1A 2GFHA 1IONA 3ZY3A 1Y1PA 3OIWA 4Q3EA 4UXHA 4XEUA 3MJFA 3PLRA 3G2NA 4KGXA 1N78A 5DLPA 4QGHA 2W83A 4IVRA 5FOUA 1BVHA 2YVQA 3N0VA 5AVOA 1ZOPA 1E3WA 3X1MA 3ICPA 4QOFA 1HQCA 4EFLA 3RE1A 2GHIA 2QRQA 3QZUA 1ZIPA 4NAHA 3UJBA 3VDXA 4WBXC 3ZVRA 4Z7NB 5ICCA 2A86A 1BE0A 2C2HA 3DXXA 1TZMA 4DR4B 2GUWA 2IHNA 1YA4A 4KP7A 4B3BA 1RACA 3FDFA 4JUFA 4M60A 1OB2A 3V00A 3LX5A 1IC6A 3UMJA 2CMHA 3R5KA 1U94A 5ALRA 5DBOA 3BXHA 3S5JA 4YGYA 3TIIA 2BTEA 1HNNA 2FZEA 3I3SR 3ZYCA 2HMAA 3M5WA 4D42A 2NXWA 1XYVA 4DHEA 4Y2GA 3KJFA 3P4YA 3THYB 2J9GA 3EPJA 4JX8A 1DB3A 1VL1A 3ZZ0A 3I2GA 4AROA 4KO4S 1TLTA 1XSEA 2IPMA 4QXMA 2NUTB 1R8SA 3WXMA 2N42A 1O95D 2BFEA 3NHWA 4EABA 5DK6A 1TQHA 3R41A 3R5JA 4IFEA 4JUAA 3I5AA 4CMEA 3JASB 1EWQA 3E8XA 1CD5A 1IN5A 1LBEA 2QEQA 3A7DA 3B20A 5E7IA 4EG0A 3EUEA 3JS5A 1MAAA 3GNQA 2FPLA 4LYDA 3UNXA 5IKPA 2QQ0A 3VR4H 3WE7A 4B32A 4EMSA 1DQYA 4MAFA 1GKKA 3ANMA 3BBLA 4Q5IA 5IAJA 3PD7A 3U61B 3G2KA 1I30A 3LQ1A 1PSZA 1U3GA 3LHIA 1A82A 4PS1A 3HBNA 3OICA 3R4VA 4TLMB 4WUVA 5LOVF 3ZVNA 4I5IA 1UPXA 2OP1A 1IXSB 3VPGA 4TVBA 4DA6A 3WOVA 4GQAA 3TDNA 5HJ2A 2XZDA 3AZPA 3BSWA 3II6X 1PT5A 5JC1A 2ZRCA 3A6LA 4C2TA 4LHWA 4DNOA 4PVCA 2FX2A 3F6CA 1IUOA 3ZWPA 1Z7EA 3TQIA 2WA1A 1GPYA 1RZUA 4FEEA 4IH4A 4KE9A 3GJ8A 3R7AA 3WISA 5CEJA 2VP6A 1MXFA 1Z74A 5GZ3A 3X43A 2EZTA 5SY9A 4EVSA 1AVTA 1VPDA 3T7CA 3NLLA 5AW4A 3J7AC 1RXYA 1MB3A 3S28A 3V34A 3BFVA 1P29A 3W78A 2XOEA 2YMQA 1UC5B 3L6UA 1QO0A 1I2CA 3H19A 1UJNA 3PWSA 4NYJR 3S1AB 1Y1KE 2FW9A 1MU0A 1KAHA 2C2ZA 3EAFA 4E51A 2XUGA 3VU3A 4X62B 2QKYA 3NM5A 3WL7A 1Q0UA 3QU7A 2XGOA 3N86A 4TWJA 3QF7A 3SEFA 1RZRA 5EKUA 3N2EA 4YUXA 3FWYA 1YMUA 3CCBA 1PJTA 1SU7A 1SK9A 2QM7A 1EBBA 2WJYA 3D9QX 4DLYA 3PITA 1Q7EA 4DBVO 3L84A 3S29A 2GZMA 2X1MA 1IVNA 1KI3A 1SBCA 1O8BA 1YIOA 3CUKA 2NSHA 3KKEA 1XN4A 4GOOD 4HWKA 2OXCA 4JQOA 3NRCA 3MAJA 4KPYA 3KSAC 1WUHS 2BWJA 5AM1A 1RM0A 1B26A 5AOAA 1EVYA 2B7BA 2H2DA 1WOMA 1NV8A 2IFTA 5KU7A 3MCAA 1RP7A 2C3PA 2ZYVX 2GHQA 1KDRA 3H1PA 3ZOZA 3IJRA 1R4ZA 1W96A 4P8RA 1DWQA 2C5FA 1KXJA 3NTUA 3N59A 2WWGA 4C5AA 3OF3A 3H8VA 5CFQA 2R1TB 1IHPA 3TZ6A 3GWGA 4O6VA 1QAOA 3BTSA 3LP5A 3OLVA 3PT9A 5CYGA 1SAYA 3WGGA 1UXOA 3QP9A 4IRUB 2XTMA 3YASA 2VBIA 3S2GA 4D6XA 1USWA 1S2DA 4WKCA 1MIHA 4EG4A 1HE1C 4HLNA 6ABPA 3P9SA 2I71A 3KCQA 4GZ3A 4DM3A 3LFTA 1AGRA 3EOAI 5FA8A 3ZIAD 4EUNA 3SC6A 4EGJA 3CX4A 3OZ7A 1Z4NA 4HNRA 3EAQA 3ZC3A 2CNKA 3OLYA 3SX4A 3MBOA 3T5CA 4M7WA 3UYKA 1XELA 3NC0C 5K3SA 3RYHB 2ZSUA 1EWVA 4ZHSA 1RZVA 4QLOA 1PGNA 2YFQA 5AI4A 3RYHA 1RRGA 1ELOA 2YIDA 3DPUA 3IHWA 4XFJA 3CEHA 4LX8A 3TIGA 5TLSA 5IDXA 3KETA 4L5BA 3ADPA 4RTNA 1U8FO 3IXMA 3CY6A 3O2JA 4HY3A 2A9RA 2WJ6A 1B93A 4FDUA 4LY3A 4PBSA 3RS9A 5HM8A 2PKWA 3HKDB 2JFHA 1Z83A 3WAGA 2IY9A 3H3FA 1DCFA 4AQDA 5G0WA 3DHYA 4MXDA 3DOEA 5KB3A 2PQ2A 1CY4A 5DHTA 4TMFA 3GEMA 4LI0A 3KRTA 4U4AA 1RPTA 2IK8A 4MCIA 3OT4A 1WZEA 3OLZA 3VKWA 4EUEA 5HQ3B 3LWNA 1O97C 5L45A 3NC1C 1RLTA 5FLKA 3OZTA 3V1YA 2C7RA 2W58A 5C37A 1PLKA 4ZOAA 1HXHA 2CNOA 4UKDA 5K03A 4CFZA 1YA8A 2CBXA 4B71A 1NR5A 5FNZA 5JVDB 2QD1A 4C4ZA 4YLYA 1MMFB 4RJKA 3ZQ4A 2RGYA 1F12A 1P7WA 3PXGA 2F8SA 4PPNA 4LF5B 4DANA 3LTNC 3VMMA 2O2ZA 2O2IA 5K6AC 1GWNA 4MIKA 4CMAA 5LYYA 1PVDA 3TQCA 3OQNA 4XIIA 2PYIA 1ECFA 4XWGA 3BEDA 3ZTTA 3EPKA 2XUQA 2R86A 1X39A 2BUBA 1LU9A 4O1MA 4CTJA 4HRVA 4I08A 3QF4B 1AMUA 2ZM6B 1MV8A 1SG6A 4RTQA 2CFOA 4PZUA 3SZGA 1FRFS 1FFWA 2ABWA 1NVGA 5A05A 2XT0A 4KX5A 4WQMA 5CX1B 1U5BA 2DFPA 2VEDA 3ZYZA 1V45E 2C8VA 4FZVA 4LS3A 4R1SA 1VSBA 1XIVA 1UT5A 3FHCB 3GGCA 4V0RA 3ZWNA 5AUPB 1E2EA 2WAXA 3SWWA 1DEAA 3EBOA 1USVA 2HI0A 4AWAA 4LF7B 3I04A 4INOA 5FHRA 1QQAA 1JXAA 2DCUA 4IKPA 1N8SA 3MMXA 3UO8B 4DQDA 1U3UA 1LZKA 4RCZA 5BNIA 3R23A 1BXRA 3I2IA 2GAOA 3K05A 2W93A 2R44A 4IH1A 5IFLA 2HF8A 1IBMB 3TOVA 1K6JA 3BL6A 5KQRA 2HQBA 2A84A 2RGCA 1P1FA 4Y0VA 3RLFA 2VDVE 4D9EA 2FWAA 1ECBA 2HBRA 1Y3FE 5C7YA 1HL3A 5FWXB 3PG5A 2W2KB 2XCOA 4LYJA 3BVPA 3TFQA 2VYCA 4HN9A 4RDHA 4CN8A 3GF4A 3IXLA 3LKVA 3OPXA 1C14A 2KSQA 3WLJA 5K45A 1KZGB 4K88A 4G0PA 3I04M 3A9WA 2COKA 5EZ6B 2HLPA 1AK9A 1A9XB 2Q9BA 2ZLBA 3OQHA 4OL0A 5GM1A 5ESRA 3PXEA 1P91A 4NJEB 4CEJB 4ND6A 1PLJA 3GROA 2FHPA 1RWNA 2E5LB 3FCEA 1FW6A 3ZJUA 1XJCA 4LYAA 1XTIA 1NBME 2AL7A 4HMOA 1A9PA 4R3WA 4QUHA 3WMRA 1O94C 2P77A 2B7LA 3PDIA 1E8DA 1M54A 1NVUQ 5I5GA 3TLMA 5IM4F 3U4HA 3E5MA 1COZA 2VP4A 3OH8A 5K3FB 1G2IA 4E4RA 1FSSA 3PSAA 4CM9A 3DPIA 4YJFA 2OBYA 1ADCA 5K3BA 1N7GA 4YONB 4KVFA 5A5FA 2FF5A 5JATA 5IC5A 3MC1A 1NN0A 1FY2A 2OHHA 4FB4A 2C4NA 4XWYA 3UAXA 1OFUX 2BTOA 3TOXA 4M9SA 2UDPA 5EIBC 3TKAA 2W6OA 3SK0A 4W1PA 3HKCB 2IV2X 4EB6A 2WF6A 3RS5A 5KU1A 2OBFA 3EEIA 1KI7A 1DEHA 4M9UA 5I8ZA 3QUQA 4LZJA 4NDNE 2IH2A 5I7RA 3RYCB 1HR0B 2BGGA 2RKBA 2C4KA 2A7XA 3NU1A 5DT9A 1A2KC 4B4DA 1VPEA 4FLMA 3AWDA 4Y7DA 2G0TA 4Q34A 1CUAA 1EFPA 1SULA 2R6GA 1EBFA 2ZBVA 4M49A 5K0SA 2AG1A 3DZCA 4ZDWA 4EEZA 1E9BA 4WAUA 3K0FB 1LTKA 5EQFA 4LXYA 1QIHA 3HH8A 3DJYA 2WDPA 4PCAA 4ZXFA 5HKLA 5I5EA 3VOBA 5BN3B 5EYPB 5JZVA 5GM2A 2QHXA 5JASA 3TM5A 4DABA 1BQ3A 4KQEA 3DOIA 1UUFA 2YBDA 5F78A 3FLBA 2WUGA 1DCMA 2RI1A 1G1AA 3GMDA 5EWJB 5I4KA 3KQKA 4LTDA 5TQ2A 3T1QA 4QPPA 3DVAA 2NUPB 1YBAA 2P2ZA 1RJGA 1J39A 2RHTA 4NG4A 2WG0A 4W9MC 5AKZA 2EQ5A 2O8VA 3ZDDA 2DPXA 1S3GA 4Q24A 4DC9A 1B16A 4OL9A 1NDUA 3ED5A 3ZGLA 2O2CA 3CH4B 3LHSA 2X8WA 1I10A 2I1QA 2I29A 4DRXA 4W7HA 3LUGA 1NE7A 4QTUB 4DDMA 2MT9A 2HK7A 5IBCA 3V9AA 1EUYA 2MSLA 4I8IA 2IBTA 5HG0A 1OIWA 4A2CA 4A27A 4OM8A 1OLSA 5DIZA 1G41A 1PUXA 2DC1A 1TEHA 3EQ2A 5H9VA 4A8HA 4UXJA 4BZZA 2ZUEA 2HJHA 1N0IA 3G5AA 1UFQA 1QQBA 3C74A 3IBFA 3MBIA 3RHZA 2I6UA 4GX5A 4PZEA 3TG2A 1DADA 4XOUA 3LZCA 4X90A 1PNRA 1ZH0A 2CUZA 3HFGA 4QRDA 1JDUA 2QROA 4OATA 3WJ1A 4NCAA 2C4MA 3UJNA 4JX9A 3KVNA 3VDNB 5IH7A 2G4LA 5JEEA 2P2GA 4JQYA 3FR8A 2PRZA 6GPBA 3BXOA 3RVLA 1LS1A 3ZBTA 3SU8A 2TS1A 4ZHQA 2A8YA 5JAPA 2TMYA 4KXQA 2Q5EA 2P9ZA 3AM3A 2HSGA 1TAUA 1SRRA 1KNXA 1YR7A 1Y7HA 2VJBA 4LOAA 4OQEA 4F9TA 5I45A 5KYNA 2PUFA 4RELA 3OX1A 2IS2A 1E3MA 2CCJA 2CV2A 2JJ2D 3AXTA 3HZOA 4PC3A 3TJZA 4U1RA 2JAWA 2J0UA 1YFKA 3TKLA 3AU9A 3LUKA 1AXEA 2O8NA 1Q44A 2VNHA 1IM8A 3CLSC 3D6UA 3ZVKA 3KOOA 3BWEA 2VQ6A 3DWGA 3KB6A 5I7WA 2Z04A 3GG9A 2WJIA 3K16A 3HUDA 4KDEA 1CIJA 2QYHA 1CRZA 3H97A 5TF0A 1M2VB 2Y0PA 1LSOA 2F1JA 2REBA 2VSXA 2W6ZA 9LDBA 3I4CA 1JFTA 4CKBB 1ADBA 3IVMA 4ZO4A 1QO9A 2XWBF 4UUAA 2VRNA 3T94A 5CA0F 4EDHA 4JR2A 1LPAB 3KOXA 4D9IA 4QG3A 1W2GA 3B9QA 3IEXA 5HOQA 2R5WA 5CBPA 4X93A 1G291 4IQFA 3N28A 5E7QA 4C08A 1ZW6A 3E53A 3P7MA 3GNTA 2FWPA 4C03A 1TJPB 3OEHD 1MO4A 1QM5A 2AC2A 2Q1SA 3K9HA 1Z6YA 3GI1A 3NBUA 3OURA 4JUCA 3ZW8A 4BHTA 4KXWA 2YC4C 2ID8A 2HN9A 1PL7A 5B58T 1M1UA 4IGEA 1KVQA 2JL1A 1OC4A 3UG7A 1V11B 4PLTA 2W11A 3CZRA 4J90A 3OQVA 5JS7A 3FNBA 3JAWB 3Q9SA 3SYNA 2C95A 1VPTA 1ZK0A 2G5PA 2BFMA 4FOOA 3TTUA 3ZZTA 2G80A 3SGLA 4ZJUA 1K4MA 4O4IF 5D5PA 5HUJA 3O93A 5EIFA 1GCOA 1RRKA 2JC3A 2R6FA 1VIDA 3PWZA 4NJMB 3TAUA 3DLHA 1KMHA 5HHTA 4X61A 721PA 1WZNA 3FGNA 2WWYA 4N0PA 1WKBA 2BJWA 4LXUA 2FPSA 3GZNB 3IV6A 5D5HA 3GRUA 2XUAA 4MWTA 4O3FA 3SQLA 4DB2A 5JJLA 4KSYA 2QD4A 2O05A 1ODTC 3U7HB 1N8NA 4RPJA 1NVVR 4QDKA 1HDCA 3WMFA 2MJLA 2PAFA 5CGQB 5BP7A 3ZPXA 5L4NA 1YZUA 3WLFA 5CAEB 1BG6A 2EW1A 3QUAA 1RRMA 5FYQA 2OYCA 4B3MB 1K8YB 2MIIA 3CKMA 3NBFA 4NESA 5CW2A 2Q8PA 3V4OA 2IZ5A 4Q15A 4ZWNA 4QTXA 4NDAA 1GNLA 4EPTA 5DTEA 5DNYB 5G02A 1DJOA 1A9SA 1X0VA 2OR3A 2CMDA 3BZUA 1CRWG 1DBRA 1A97A 1GPUA 3A9RA 3RJ9A 3UH1A 5B6PA 4XTCS 2IX3A 3O8RA 3ZTYA 2RD2A 4U7TB 1QV6A 4JI7B 2I4IA 1XDBA 4WZAA 4L16A 2J30A 3AEXA 3GP3A 3UK2A 2WG1A 1F7VA 1N0WA 2GZDA 3DF7A 3MIZA 1RE0A 1K97A 1PU2A 2AFHA 2BMDA 2QJFA 1K98A 3NT5A 4O1HA 4WLNA 5K4GA 1JPJA 5IZCA 1E0JA 2FPIB 3T7EA 2B5OA 5F3WB 1ADGA 1AZTA 2ZRFA 4YQEA 2C57A 4MVWA 4UTPA 5CNIA 5DYYA 2EF0A 4FCWA 3VU9A 3PHBE 1JNXX 3ZXSA 2IHVA 4AYWA 5J9FA 4P7GA 5FO1A 2ZFUA 1D0VA 2JZCA 2NQTA 2QMQA 2GEKA 3DFUA 3R20A 4JJGA 4L50A 5THXA 2H1HA 2IRWA 3DZDA 3RAJA 5A9SA 3MRVA 4PIMA 4J1TC 1B14A 4L6AA 4QHYA 1MVNA 2GQ0A 3SBXA 1JQ5A 1U2QA 3QEJA 4CQLA 4ZDIA 4CR8A 1WKVA 1S0UA 5HKKD 1WG8A 3BUSA 2X8LA 1DAMA 4IHKA 5GGXA 1RWPA 2HWWA 3K8ZA 3OE1A 1T8TA 3VTKA 1PJLA 4ECEA 4HP8A 3WLEA 4FD3A 3QJGA 3KWFA 1CRQA 3OOJA 3UJDA 1ECCA 4F1KA 3H0KA 2WTUA 1D7AA 3WRYA 2FP4A 3PU6A 2XGMA 4JH0A 4R9VA 2XXJA 3P9CA 3TVDA 9MHTA 1UBLS 3D0KA 3EIHA 5E2BA 3NYIA 5BRNA 5E1OA 4MMYB 1ABEA 2J6BA 1R9MA 1POWA 4E5YA 5HIIA 3TD2A 1O87A 1SIUA 4MEJA 1Z34A 2NPIA 2P1ZA 2P62A 2XOKD 2DGDA 3DE3X 4WECA 2AT1A 2E48A 2ROQA 3T7SA 4J1SA 3L7BA 3E23A 5JSKA 1Z2EA 2B0JA 3PUJA 1LF5A 3UW1A 4FFWA 5C4IA 2VS1A 1UBMS 1F8GA 1GTL1 3M0EA 4W8HA 3VZBA 5LQKA 2J8ZA 1Y6RA 3SXJA 3UT0A 2P0EA 2QSUA 2X5NA 1AO3A 2G1KA 4N5LA 2YICA 1U9ZA 4N9QA 5A0FA 1GQRA 3H2JA 4BDSA 4D0LB 4D97A 1U8XX 3SYKA 3WV4A 3AI3A 2GESA 2JGEA 5JIBA 1OSNA 5J63A 1ZHHA 4HS4A 2IEZA 5KCMA 4MRSA 4RZSA 3FLMA 3KKLA 1GV0A 2GK6A 4XDHA 2ODPA 3C6ZA 3D0OA 1S2OA 4NZ9A 1V7QA 1VGQA 1XHFA 2Q1XA 2QW0X 2R8RA 3Q9UA 4P2BA 1Y4AE 2BI4A 4UE3S 4FEAA 4BNKA 3GRFA 3MCVA 5G40A 1TX4B 3HCFA 3TIVA 2WF8A 2WKSA 3R3XA 4GMHA 3R75A 1K5GA 5TQ0A 1TU0A 3BDAA 1ZU4A 1KYZA 2BI7A 2JGAA 4Q00A 2BEWA 1E89A 3VSCA 4JYPA 5LYJF 3UMGA 2PSFA 1LI7A 2XE6A 3DMRA 1VI5A 4LDQA 4WZBE 3ZLUA 2QN9A 2X5XA 1GU0A 3T7IA 2ACKA 1X1RA 2A9FA 5DWQA 1E4OA 1IFXA 4P3KA 3AW9A 3SR3A 3FVTA 3R3UA 4BGVA 4BRSA 4XZ3A 1F8UA 8AT1A 5LXTA 1U65A 2JD0A 4U7PB 1NF2A 1R4MA 4Y2JA 5KNBA 2X22A 1QP4A 3RV3A 1VE7A 1DJPA 3FSGA 5HJEA 4WZZA 2FF7A 3DFIA 5BSVA 1PR2A 3L7JA 4TT3A 1GVHA 5C0OE 2VNSA 3N2GA 4QUIA 3RREA 1JTFA 4NFYA 3TBHA 2EJBA 5ALJA 1EDOA 4RMGA 2QIOA 1CULC 4DMUB 4ABTA 1T0PA 2ZULA 3HEAA 3PQ6A 4E5VA 2C96A 3HHEA 4HB0A 4HGOA 4JITA 4QYWA 3TNDA 3ES9A 3PP8A 4GX1A 4Z1OA 5A4DA 4IP0A 3G9TA 4X20A 2P35A 2QRNA 4B3HA 5H9WA 4FFDA 3PXCX 1JEYA 2G1UA 1G3MA 3ITNA 1N5JA 1O97D 4XVHA 1Q7TA 1P7PA 1CUYA 3LXRA 4KDFA 4PYKA 2YVKA 1MR3F 4G1FA 4FE7A 5LBUA 1AGYA 4JLVA 1NXXA 2FH5B 3HN7A 3LO5A 2AOXA 3HP1A 3EXHC 4IDBA 1OI7A 2QG4A 1SBTA 1DEKA 2PL1A 2D0PB 2ZKIA 1SQFA 4JA0A 2OKGA 3OLWA 1QZXA 1CUZA 4JV5B 2NOAA 3WI7A 1Z2CA 3E61A 1QIJA 3K31A 3PDWA 4RLFA 1YR8A 4WT7A 4DJ5X 2P2NA 2JA2A 5ER6A 1KGSA 3E7PA 3O26A 4NE2A 1T2EA 2B4AA 3IA2A 3T3GA 3UATA 2YWGA 1ZN8A 1U8UA 4HDKA 3AP1A 2F9LA 1RHRA 3WL8A 2JEOA 1C4WA 1XKXA 2WP8J 3H1TA 3C6BA 2ZSKA 2P4UA 4ZQIA 4F2PA 4ARUA 4UBJA 4HPWA 5DV9A 1X7WA 1Z39A 2B36A 3FUUA 4LBZA 1GKLA 3D64A 4MWGA 3QXHA 1KZ7B 5K1ZA 3ZHQA 5L3SB 3C3WA 1SMKA 1NG1A 1C30B 1PFGA 1JG1A 1C41A 1PNTA 4MS4A 3TB6A 1JDBB 2JZOA 3GXBA 4WKOA 4Q4JB 2QVLA 1PK7A 5LB4A 4CJXA 1ND5A 3MUFA 3URKA 3I6IA 3OPYB 3W0LB 2WNSA 3ZHTA 1NI5A 5I4IA 2BGJA 1CUGA 1A0OA 1KNQA 3ETDA 4QX6A 2QG9A 4K9KA 3CXUA 1OKKD 1XGKA 3LDHA 3C8DA 3L8YA 2XUJA 3L4SO 1H1LB 4MUFA 4O1IA 3U4MA 4B6PA 3T54A 4JVLA 3WY9A 1T8SA 4EI8A 5REQA 2A1UB 2VJMB 1P7CA 1CR4A 1RHQA 2BRUA 2XUKA 3NALA 3QELB 3OIDA 1Z13A 2Q6TA 5HGXA 4YO8A 1H94A 2VJMA 3WRWA 2UYYA 1I5EA 3CZPA 3JYLA 3QFRA 5ALPA 4MAAA 4B7ZA 1Z45A 3W2FA 2XCSB 1CEEA 1JJAA 1AKWA 3HWWA 2IT1A 3H5LA 2EX4A 1SIBE 4DC0A 4WNYA 4A26A 1MVOA 5LR6A 3K92A 2AEMA 2YCLA 2ZRLA 2JATA 1E18A 2XVZA 4FOPA 2WFZA 3AEKB 2ATXA 5LNK1 3K9QO 4JODA 5C81A 3ENKA 4UCXA 1LS6A 1GG5A 3FOWA 4ZK2A 5CCEA 4QQKA 1P45A 5CLJA 1Y89A 5FNVB 5JT1A 3IRVA 1JP7A 3GLRA 3UT5B 1IN6A 2PXAA 3TFOA 3SS8A 5BNTA 4E33A 3ZVLA 4LSMA 4B75A 1QTNA 5BWBA 1TZCA 2M32A 4FN4A 1N3LA 2QNBA 2O1WA 5LJLA 5CM2Z 3JQBA 2MSNA 1SCJA 4OTZA 1HEIA 3V2IA 1G2PA 4GRIA 2BF7A 2W70A 1PJQA 4LYGA 1D1SA 2GD6A 1MV5A 2QMUA 3KOZA 3USES 1LLFA 3NP7A 5LVAA 1BD3A 4MVJF 1DWOA 2ZTUA 4DAOA 3DUWA 1MC5A 2WF9A 1PD0A 1KKLA 3F7NA 1MA3A 3UAWA 4C14A 3FYDA 1JLRA 1SXQA 5DTJA 4GBMA 3VSEA 4GKBA 3ZH2A 2QUAA 2F7SA 2PVPA 4OM7A 3MWYW 2POCA 2AK3A 5LMCA 2G4VA 3IELA 1ISMA 1R4AA 1RBMA 4LOJA 1G3IA 4E1AA 3S8EA 3KC2A 3ROKA 6ADHA 3VGPA 4TL7A 2YW9A 2OXIA 1L9XA 3CG0A 1OFUA 3JARA 1L7XA 3KJGA 4K6CA 1CV2A 2HQOA 4LE1A 4C4RA 4EGSA 4C05A 1PJ2A 1VQ1A 2XPCA 4EHNA 2PTHA 1EVJA 4G0UA 2QN7A 2AMJA 3I30X 3ORYA 3HI6A 2FSIA 4G5SA 4Z4HA 3DONA 1TU4A 4YMSA 3WQSB 4F92B 3ZUGA 3QFSA 2QI9F 5FOSA 1RRVA 2KHZA 3IAHA 2X8JA 4WA7A 3AR9A 5D85A 2CF5A 5GPBA 4YWHA 2O14A 2YJZA 4LC9A 1P6UA 2P6RA 4G81A 3P1JA 2CLEB 2QX7A 3VNQA 2WPNA 3VR2A 2KBEA 3Q3IA 3BXFA 2INGX 3H86A 5DDIP 2ZPTX 5AI9A 3VJRA 5IF9A 3EY9A 1KMQA 2IPAB 2WJJA 3CZ5A 3UHAA 3WBFA 4UHJA 4BVEA 4Z7OB 1RQ2A 3N75A 4Q02A 1GU7A 3GA7A 3JVDA 4N0EA 1ZIOA 4LJAA 4QL3A 1DOHA 2EU8A 4B6GA 1WO8A 2G36A 4G8CA 5T4FA 5IASA 4XCVA 4RKYA 4OGGA 1OBFO 4P6VF 4BVLA 4IMRA 4LCEA 4OPMA 1VRWA 1YQQA 4B5LA 4CGYA 5DNAA 2OOKA 3H1FA 4D3FA 4L9WA 2Z1MA 4MRPA 2ZK7A 1ONPA 3MCWA 4BVAA 2TSYB 3L6CA 4LRXA 3T3DA 2FG5A 4TLCA 1YBFA 5EUMA 4X1KA 4EPYA 3EEOA 1U2DC 4NCIA 4W9RA 5A1JA 4R83A 5D6OA 3WL3A 1EFVB 1RCUA 3O92A 4L22A 1GJRA 1QZUA 4YFVA 4BPRA 3OZDA 2ZCVA 3QLUC 3EEFA 4GZ6A 4BUCA 1Q0HA 1RMTA 2VBGA 4I4IA 5D86A 2UZ1A 3EVFA 5AXCA 4HRXA 4F2GA 4YV1A 5LNK6 3FHTA 4W9NC 2XBUA 4COOA 2PX0A 4K8RB 4QATA 1XUOA 3FI9A 1ZY2A 1QORA 3ZK8A 4AN0A 4BBJA 4C7JA 3KWJA 1XZJA 3OSUA 4YMLA 2JASA 3HXOA 2G67A 1ZGJA 2QZZA 3WG9A 4EB3A 4F5WA 1Q20A 3AVPA 4ZU1X 4JS0A 4Q6WA 2QZJA 4N6NA 1KMIY 4ZI2A 2OZPA 4GWGA 2J1LA 4UNQA 4DCUA 4Z7JA 5IN5A 3LKZA 1TQ4A 4GOND 1JL3A 4FJ0A 1TDJA 4LJ4A 3IEUA 4MQEA 2EBWA 1E4EB 3ABIA 4DIFA 3WGVA 2JGDA 2D3WA 2R5FA 4G0MA 4R8VA 5IJWA 3DJFA 1E4EA 2NZYA 2O2XA 4AKHA 3GRPA 3VDMA 3AHCA 3LLVA 5E9AA 5FV4A 4JJIA 4NBRA 5F98A 5JEDA 4AZ3B 5BNZA 1C9KA 2NP7A 1G6Q1 5DI3A 2Q3BA 1XZNA 2BMEA 3LYLA 3OKPA 3BWBA 3H11A 4IW3B 4AUMA 4CIYA 1W44A 4AZ3A 4CMIB 4V0ME 4JMPA 2W4QA 2E4YA 2XTAA 4NH0A 1WDKA 4ANFA 3M6WA 2GEDA 3V8BA 1OY1A 1F5SA 3OBIA 2OSBA 4EHAA 2D06A 4HDRA 4EB8A 3HM9A 1ESDA 2IE0A 3CVXA 3GDOA 6REQA 3V2GA 2IYSA 1D5WA 1JLKA 3MG9A 2RG1A 4DT1A 4DR6B 2WTAA 2ISQA 4E15A 3KJIA 4OAOA 1MF7A 3FNIA 1XCPA 2EHDA 1KJYA 4F9GA 2JDIA 1GPDG 3J81A 4N01A 1DC3A 3NJRA 4JYZA 1Q1QA 4L5CA 4PLVA 4OJMX 2Q3FA 4MX8A 3UK7A 1CY2A 4E31A 4EF5A 5CEEA 1IOLA 5FLEX 4B82A 2GF0A 2IW3A 2X19A 2W98A 1RP1A 2ZYUX 5H80A 2VXCA 3IDOA 3UAGA 3CUVA 2CVZA 1KFJB 2YX1A 3GUUA 1PHRA 2GYVA 3UK0A 1FL9A 3LE8A 4ZT6A 4ZVRA 5BYAA 5FPKA 3O47A 1C1YA 3FPAA 4UOZA 1PLLA 3VPAA 1HT3A 3CX3A 3RD5A 4AP5A 2AKAB 4DY6A 2EIXA 3KQQA 4Z53A 3L3BA 1JKIA 2JFVA 1KMMA 4PRKA 2GSDA 1EE2A 5A4KA 1V9LA 3CN7A 3LAWA 5CT5A 3DZBA 1KU0A 3JAMA 2FMXA 3D1LA 3E1KA 4F4DA 1K1EA 5FI3A 1REQB 4LMPA 4QAQA 2Q5LA 3DNMA 5HR5A 4MS3A 3B53X 2JRCA 3EFHA 4PQEA 3U7IA 3UUEA 3PIRA 1REQA 4HJXA 4MRVA 5AK0A 4A16A 3U60B 2JVKA 5FHQA 1VG1A 2DWPA 1OBHA 2PH1A 2J3MA 2DLCX 5HA5A 4HVTA 1FFGA 1T9GR 1S02A 2C00A 1SIWA 4PICA 3ESCA 2CY0A 3JVEA 2GK4A 4G5XA 4MW2A 3ZK9A 1DBIA 4IF4A 4OI2A 1X13A 2FRDC 4YUYA 2DR2A 2LVBA 4YBRA 2VZ9A 4N3NA 2EFCB 4D46A 2QDXA 1RJDA 1N7JA 3RANA 1TMYA 2QTNA 4ZO9A 1TA9A 1ZRHA 2PWAA