2PZAA

Nad+ synthetase from bacillus anthracis with amp + ppi and mg2+
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
279
structure length
279
Chain Sequence
b'MTLQEQIMKALHVQPVIDPKAEIRKRVDFLKDYVKKTGAKGFVLGISGGQDSTLAGRLAQLAVEEIRNEGGNATFIAVRLPYKVQKDEDDAQLALQFIQADQSVAFDIASTVDAFSNQYENLLDESLTDFNKGNVKARIRMVTQYAIGGQKGLLVIGTDHAAEAVTGFFTKFGDGGADLLPLTGLTKRQGRALLQELGADERLYLKMPTADLLDEKPGQADETELGITYDQLDDYLEGKTVPADVAEKIEKRYTVSEHKRQVPASMFDDWWKLAAALEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NH(3)-dependent NAD(+) synthetase
publication title Structural adaptation of an interacting non-native C-terminal helical extension revealed in the crystal structure of NAD(+) synthetase from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Ligase
total genus 111
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 6.3.1.5: NAD(+) synthase.
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2pzaA00
3A4IA 3ILVA 3DV2A 3DPIA 3ISJA 1EJ2A 3N9IA 4ZT7A 4JYZA 2QUHA 2QJTA 1JZSA 3CLUC 2BYTA 2WSIA 4JFAA 3G5AA 1J1ZA 1YI8A 3N8HA 1ULHA 2HZ7A 1KAQA 3GMIA 1K97A 4JXZA 4NAUA 3VRHA 5LM3A 1U3CA 1GTRA 4L2IB 3CVXA 2C5SA 2PFSA 3IODA 1QNFA 3CVWA 3ZJTA 2H29A 3IVGA 3IVXA 2HGZA 1IQUA 2A84A 2QTNA 5KWVA 1TYDE 4ZCQA 1VBKA 1T6XA 2A1TS 1KH2A 4MWCA 1D2RA 3DO8A 4MUFA 1EFPB 3P0IA 3TQOA 3UC5A 4QBTA 1VBNA 2A4MA 3K9WA 1PG2A 4HPWA 3SDBA 3AKZA 1IQ0A 1M8GA 2CYCA 1GN8A 2QTRA 2D13A 3CVYA 3OTWA 1NZJA 1KH1A 1MOPA 1J20A 1SURA 1PFYA 5DEOA 4KR9A 2ZUEA 4OUDA 1EFVA 1N1DA 3ZXIA 3P52A 3FHJA 4R0NA 5TS2A 3P0HA 1O0BA 2QUKA 3MLAA 3IUBA 3NBKA 1F7VA 1IVSA 1OBCA 1F7UA 3SZ3A 4PBTA 1PFVA 2D54A 1WZ2A 3FDXA 1JGTA 1I6LA 4CDNA 2DERA 1MBZA 4WNYA 2QUIA 3HMQA 3ND7A 1O5TA 5HG0A 1TYCA 2EJCA 1N2OA 1G59A 3A2KA 3H99A 1VLHA 1ZH6A 3IOCA 1OD6A 1S4MA 3MXTA 1UFVA 5F23A 1Q19A 1JECA 4CQNA 1QU3A 1V8FA 4PBRA 2VXOA 5DK4A 1N77A 2WB2A 4DJAA 3KFLA 5K0SA 4DNXA 2JA2A 3H05A 4QRDA 3SEZA 1TEZA 4KR7A 1MC1A 4DDMA 2QTMA 1XNGA 1JEEA 1RQGA 3IDFA 2A7XA 3DLAA 1M83A 3IOEA 3Q4GA 4R2MA 4RUKA 1J1UA 1K92A 2E21A 1U7DA 3I05A 2CT8A 2DPLA 1TFUA 1M8KA 1WKBA 2ZUFA 2J09A 4AQ7A 1QRTA 3CLRD 4U7JA 1BS2A 2CV2A 1O94C 4DLPA 2OQ2A 1YUMA 1R6XA 5FO1A 1N75A 2ZP1A 3AG5A 1N3LA 5HUJA 1YUNA 3M5WA 4OJMX 2YWBA 4MUGA 1EE1A 3SEQA 4BWVA 2DETA 1P7PA 1H3FA 3IMGA 2X1MA 2J5BA 3AFHA 4RPIA 2RD2A 1G8GA 3F3MA 1Q11A 2V0CA 4OUDB 1EFVB 1M8FA 3HL4A 4I6JA 4MVXA 3X1JA 4ZCTA 4QREA 1G8HA 1N2EA 4MW2A 3LE8A 3N05A 4ARIA 3FI0A 1OWMA 4HJXA 3FY4A 3IVCA 4TS1A 1GAXA 1WQ4A 3P0JA 2J07A 4UZFA 1IQRA 1MAWA 3FNRA 4MUEA 3S3TA 3FWKA 4ARCA 3IH5A 3UY4A 1MRZA 3G6KA 3NV7A 3TNJA 1O97C 4MUNA 3PRHA 1K4MA 1QRSA 1LI5A 3H9CA 1NYLA 2NZ2A 2A88A 3N2YA 2E0IA 4EG3A 3LOQA 3ELBA 4KPUA 1O94D 1Q15A 4EF6A 1F4LA 2PZ8A 1JIJA 3U1VA 1GPMA 1R6TA 1T9GS 1PFUA 2A86A 1OWPA 4EG7A 4J76A 4NDAA 1N2IA 3COVA 3TZEA 1X6VA 3H9BA 4MVWA 2V0GA 3HV0A 4F4HA 1XJQA 2DR2A 1J21A 2WQ6A 2DUMA 1FYDA 4P2BA 2GKSA 1ZJWA 3SZGA 5H16A 1WJGA 2XRZA 3TS1A 4EG4A 1I6MA 3LCJA 3PNYA 2YY5A 2WQ7A 2PIDA 1X8XA 1KR2A 3D6UA 4MWDA 1F9AA 3FG9A 4ND7A 4DDKA 3HFJA 4EG8A 4K0RA 2DLCX 2J4DA 2QJFA 5K0TA 2CV1A 4ND6A 1KQOA 3KT0A 1WY5A 3IMEA 1O97D 2G36A 3PNBA 3RFFA 3CLRC 3D6VA 1QJCA 5JBNA 3X1KA 5J58A 1NURA 4X0EA 1M8JA 1NSYA 1QRUA 3IOBA 4YP6A 1QQTA 3ND6A 3KT8A 1N2JA 3HZRA 1NUTA 3UK2A 5FO0A 1XNHA 1PG0A 2JAXA 4YBRA 1O6BA 1QU2A 1KKUA 1YULA 5FNZA 2RE8A 2A1TR 1ZH0A 4XFDA 3OP1A 1TQ8A 4Q93A 4K03A 3CA8A 1JEDA 2XRYA 3Q12A 5AHWA 1J09A 5TGTA 1EUQA 1MB9A 4KPUB 3ZXSA 5J5AA 5J59A 4MUKA 5KCMA 3IMCA 3GLVA 1R6UA 4MWBA 1N2BA 1YIAA 2OV4A 2GOYA 3RBAA 2VTBA 1N78A 2QUJA 4ZCPA 1NI5A 2X1LA 3X1MA 1MAUA 1WXIA 1JZQA 4EGAA 1OBHA 2CUZA 5TEVA 1JILA 3ZGZA 1G8FA 1CT9A 4MVYA 3MMXA 1LI7A 4JXXA 1K4KA 3CVUA 2PXHA 3CLTD 4R2LA 4CDMA 2A1UA 3VU8A 4MW0A 1JHDA 3RHSA 4MW9A 1T6ZA 3UMVA 1O96A 3FH0A 3ZJVA 1WXHA 3SYTA 4MW4A 4MWEA 1B6TA 4MLPA 3COZA 4EG6A 3A04A 1JMVA 1Y42X 1KQPA 3RK0A 4MW1A 4AS1A 2TS1A 2I1LA 1FFYA 1A8HA 3CR8A 4GU5A 4HK4A 1IHOA 3TQIA 2R5WA 4MQ6A 3NBAA 1QTQA 2HMAA 3RK1A 1KP3A 3E27A 4YP7A 4KKVA 4HJRA 4PBSA 2DEUA 1U0BB 5HUHA 2Z08A 2IJGX 4ZCSA 3AL0C 3PXUA 3A05A 4I6EA 5EKDA 3CVVA 1TYBE 3G59A 4XFJA 4EFKA 3MLBA 4ZT2A 2O8VA 4NAHA 3FOCA 1H3EA 4Q16A 2VTBB 2CYAA 1M1ZA 2E18A 2O5RA 4I6GA 3PNVA 2YXNA 1EUYA 1IH8A 3ZUGA 1NUPA 2GM3A 5DASA 5BNZA 1XNJA 4MAFA 1OWLA 4WSOA 1DNPA 2CYBA 2YWCA 3ND5A 4S1OA 4G6ZA 2Z09A 5DB4A 4NATA 4NX2A 1LW7A 2PZAA 1I6KA 4ZT5A 4MUJA 4G5YA 1I2DA 4MW7A 4KR6A 3KT3A 4GRIA 4JZYA 1NUQA 2PZBA 4MULA 1U7XA 3BL5A 2AG6A 1KH3A 1M8PA 1WXEA 1WQ3A 2B7LA 3C8ZA 3INNA 1WOYA 2A1UB 1VL2A 3L93A 1COZA 1KQNA 1EXDA 2H2AA 2CV0A 2EL7A 1VBMA 1YIDA 2JANA 1KP2A 3CLUD 2AKEA 1O96B 4EG5A 2NSYA 4MUHA 1T9GR 3CLTC 5LFAA 3ZJUA 1NUUA 3COYA 2E89A 1WXGA 1U3DA 2X3FA 3SP1A 4MUIA 4YMIA 5IHXA 1GLNA 1N2GA 1WXFA 3CLSC 3ZIUA 4UZEA 1IRXA 3TZLA 4NZPA 4H3SA 2IELA 4ZT3A 1OWNA 1JIIA 1JIKA 2CFOA 3H97A 5LLTA 1NP7A 2X0KA 1KAMA 4U8HA 3HGMA 4F3RA 2CSXA 4MW6A 3K32A 4CT0A 5H7XA 4L2IA 3KT6A 3COWA 3JXEA 3QTTA 1TYAE 4ZT4A 3AG6A 3IUEA 1H3NA 1OWOA 3Q10A 3VGJA 4ZCRA 1J70A 1NUSA 1PFWA 5TEWA 1O95C 4A91A 4MW5A 3MUEA 1T6YA 3RJZA 4DDHA 3QE4A 4G5FA 4EG1A 1N2HA 4U63A 2BTEA 1EFPA 4J75A 1ZUNA 2D5BA 3GUZA 1MB2A 1Q77A 2Z3VA 4YP5A 2PG3A 3FIUA 5IJXA 1V47A 2J08A 3CLSD 1GTSA 1IFXA 4FZJA 2IP1A 1MJHA 2QJOA 4XSVA 4E1AA 4ZT6A 3UOWA 4PY2A 1ILEA 1H1TA 3FETA 5KHAA 3AIIA 4DE5A 1KORA 1GZUA 1O0CA 3QTBA 2DXIA 2AZXA 3L92A 4MVCA 1HYBA 1O95D
chains in the Genus database with same CATH superfamily
4MP6A 3DBRA 3T7JA 1PGNA 5THQA 3ETNA 2WSBA 4BFXA 2QY9A 1JDVA 4MITA 3N58A 2ZSBA 4FJ0A 5KYXA 1PTJC 2RHGB 2QSJA 3CRVA 3JZAA 1LTHR 5BQPA 3H8VA 3LAWA 5L3SB 2XB6A 3BF8A 4GBED 2RGGA 1AS3A 3H2SA 4CFSA 4W5OA 1VSTA 2BMDA 2G06A 2GJ4A 3DP9A 1OAOA 2CDRA 4EFDA 3Q3HA 4DSUA 4UCWA 1KIMA 2XEXA 4Y2VA 5DHAA 3REQA 1U5BA 1WVGA 3GMIA 1QVVA 3E22A 1QMGA 1RJFA 3M2PA 3Q41A 4KXWA 3DKKA 5DOZA 3SC6A 3LDHA 1SXJA 4BJHB 2IXBA 1V37A 2OZLB 4NQRA 4N48A 2D1TA 5D7BA 1EG2A 2NZWA 4E03A 4EH1A 5A3RA 3UAGA 1DKNA 1UMDA 4M54A 5ALSA 4A8HA 1HQYE 1MOSA 3GRUA 4XIFA 5KYWB 4M89A 5HGJA 1ZUD1 3GNLA 3HN6A 1GTG1 3HPQA 3CUKA 3OE5A 4GI1A 4BFWA 1F14A 3FOZA 1GYPA 2IY7A 3AETA 3K8ZA 4KO2S 3RABA 2X6RA 3DBLB 4DLXA 2FSUA 4E94A 5LN1A 5LMCA 1EESA 1XB2A 5JO9A 4KPYA 1AIPA 1EVYA 3MXOA 1RXVA 4YRGA 1UWKA 3CWQA 2O0HA 2XUJA 3GDGA 4IIJB 3ENZA 3V4OA 3FXAA 2VEDA 3V7FA 4FM9A 1T5LA 2X5OA 2ZWIA 2XYQA 3C3CA 2V96A 1UBRS 4IXDA 4DNPA 5JO0A 1OFUX 2ZAOA 1YZUA 3IERA 1GN8A 2C61A 5D00A 2VCEA 3IFSA 4C4RA 3GEHA 1E61A 3T7AA 3T7SA 1YDFA 3JALB 3OJLA 4F60A 2GPJA 4JKOA 1S2NA 1TIPA 3M3DA 3QELA 4Q37A 5HW0A 1U11A 3R44A 5E4TA 1VRCA 1N1DA 2HO4A 3ZXIA 1K9VF 1VE5A 3NRJA 4H31A 4MUXA 3ADBA 4Y1GA 1QPBA 2GN8A 4NOJA 3AR9A 2QE7A 2Q6OA 4BMDA 3OQOA 5CEEA 1OXVA 1LZLA 2PKXA 3MS4A 1VPDA 2BCEA 3IQGX 1YZ3A 4TKVB 2RHBA 2SKDA 1Y9DA 3IUBA 3QUSA 3LVQE 3NT4A 3BGOS 3SZ3A 3Q7SA 1UPTA 2G1UA 4HAXA 3ZZNA 1FB5A 4QGBA 2DERA 2HO5A 1USGA 1RLMA 4NC9A 2QGZA 1EFUA 3I37X 5K6AC 2EZUA 3OSUA 3KPJA 2CNBA 3CH5A 4BFLA 1N2OA 3A2KA 3TSYA 3WGOA 5AM5A 3IAUA 2IPXA 5IJZA 3HABA 2OPHA 3RSCA 1WSWA 4PLGA 1YJCA 4KDFA 4PF1A 3OZWA 4QODA 2R8BA 1O2DA 1EX7A 5AXAA 3FVTA 1UMCA 5P8WA 4X8OA 1A9XB 4LYYA 4B79A 4ME6A 1OH5A 3GD7A 5U4QA 4ZIRB 3CGWA 3MINA 3QVXA 3TXAA 2BFWA 1W73A 2NZXA 2X7JA 3O95A 3RF7A 4YROA 2RBGA 2R751 4LJLA 4BMOB 1RKXA 5CH8A 1DFHA 3LUHA 3W6PA 4QX6A 1XO1A 3SF8B 4DIKA 3QKTA 1W4ZA 4NPCA 4BX9A 3TUIC 4DB2A 2AZ4A 1P1KA 2ERCA 3KJIA 2ZUFA 3AERB 2MWMA 2ONYA 5LOVF 3ABQB 2PUBA 2Z1NA 1B42A 1AHIA 3E5RA 1C8LA 3JYLA 1TUEA 4YUVA 2P8SA 3IEUA 3W2IA 4DLTA 1JDNA 4IGFA 3G2LA 2O0MA 4M83A 4AJ9A 1DDOA 3I1YA 4BWYA 2DETA 1P7PA 1E2NA 4I50A 2XGGA 4RV5A 2J5BA 1B2LA 3IX7A 1Y5MA 4IS2A 2FEOA 5C3MA 1FP2A 2ZBUA 1GRVA 3IPLA 1SB8A 3HJAA 4I6JA 5AK0A 3Q1KA 3ZGYA 4HNHA 3IT2A 5DXAA 1KYIA 1MR3F 1KVUA 2IYYA 2YN4A 4D6YA 4AMVA 2N9UA 4C7KA 5K0JA 5BYJA 3OQ6A 4OIFA 4UC0A 1WMDA 1W44A 3BWYA 3V1TC 3LLUA 4HAUA 1JLLA 3B89A 4FHFA 4F4JA 1YRHA 1C9YA 4E1BA 4YLYA 3ZD7A 3ZHUA 4KRFA 3ZK7A 4BRZA 4N6NA 2DLDA 3SOPA 4L4XA 4FGKA 5LP6C 3TRIA 1MRZA 3C3YA 3HXPA 3VJKA 1ECJA 3ACDA 1IHUA 5IDVA 4JYAB 1JIQA 4PZUA 5JAIA 2ORWA 3KEQA 4AD8A 2YWFA 2OORC 1W49A 1GGEA 5JSQA 4UQPA 3JSXA 3JVDA 1P91A 3LDFA 2PU5A 2V55B 4JP1A 2GASA 1JSZA 2LRHA 1QLWA 5BW8A 1C30A 4FYMA 1I4DD 4EF6A 5GZ3A 3BWDD 1WHTA 3V6LA 4BBJA 3FNIA 5DBIA 4DXDA 2EWMA 3S27A 1PFUA 2OILA 1JDTA 4GI3A 3ZJ5A 1X8LA 2DWUA 4IF6A 1DUIA 4D0NA 5HIAA 1DXYA 4DV2B 4OYLA 2D2VA 4PXSA 2ZROA 3TZEA 5DM60 1K4YA 1R8JA 5A9SA 2P9GA 3FZYA 2P9TA 3HV0A 5TX7A 3DZ8A 4FYHA 1HZZC 3ENVA 2OFFA 4F4HA 1D6NA 3GG9A 3KXIA 1ENYA 4GNKA 3ZGOA 2A3NA 5AIBA 4B2YA 1A5BB 1H2WA 3UAOA 5LQAA 1C8VB 2AC7A 2I7CA 5ALYA 3V2IA 1QQ7A 1DKRA 2BI4A 2BN4A 2XITA 3QEMA 4H16A 2I3BA 3ON5A 5H16A 2XRZA 3LK7A 4EG4A 4XWKA 4ZQIA 3F6BX 1Z5UA 2C9CA 4K9KA 1QF6A 1VKRA 1GKIA 2FLWA 3NUQA 3PD1A 1QGOA 3QVMA 4KVZA 4BNGA 5TT0A 2OHOA 2VH1A 4OBEA 4DDKA 1IM8A 4J94A 3PJRA 5DSTA 4NENA 1T4BA 4WK0B 3WO0A 4RZHA 2PH7A 4FT2A 2GN2A 2BMAA 1H2BA 1E66A 2WDPA 1K06A 3PE4A 5DU2A 4P22A 4A2PA 2D1RA 3CS3A 1Z22A 3ZCPA 1A0OA 1RXYA 2IHKA 2CF6A 4U00A 3OAAD 5A4DA 3IP6A 2KX7A 3GCZA 3JD2A 2G70A 4ON9A 4WMLA 1DEKA 4ZI5A 5C4MA 4V1CI 1PX2A 2NUBA 3UJBA 2G3YA 5DIFA 1HQDA 3C3JA 5KJFA 2XMBA 2ACKA 1XDSA 1OF1A 2J41A 1II0A 4BKPA 5JCZA 4WZBB 4CYMA 2QA5A 1W7AA 4C0SA 1UZAA 5EZYB 4KWIA 4A0HA 2NUPB 1UAAA 2HSGA 2GD0A 1XZNA 3BPSA 3KLBA 1VGQA 3L18A 2DU8A 3CUYA 3EY9A 2Q9UA 4Q82A 1I30A 4XSHA 3VH2A 2ZIFA 4YJ3A 3ZDRA 1FYFA 4N7RA 4UNRA 2AN5A 3LWBA 4NCNA 3TVYA 4X71A 3A70A 1G60A 1GA6A 2HIGA 1ZCJA 2BGJA 3HY3A 4TTPA 4YJHA 2YINC 3B12A 2YASA 5CLLA 5I9BA 1YTUA 3BULA 2ACEA 4HRYA 4TRMA 4FC6A 1F0KA 4PRLA 1EUQA 3W7VA 1UBMS 3UANA 1MB9A 4KPUB 1MQ8B 3A2MA 3PI7A 3QF4B 4QUIA 3TO5A 4YIHA 2APJA 3OOHA 5E3IA 4GBMA 3QU4A 2CCJA 3CKLA 3I34X 2PWZA 3Q6IA 4L28A 4N8SA 3WGUA 5K8TA 3CKKA 3T54A 4ISCA 4ICIA 1L7AA 3BZUA 4I7EA 4HWTA 3M4YA 4PNHA 4TWAA 2YZMA 2VO1A 3WIEA 3W5JA 5K1ZA 4Z7JA 1XMSA 1OKKA 4HAZA 2QUJA 3DMGA 3EXG1 4TWRA 4ZCPA 3GWZA 3OUUA 3TIGA 4WNAA 6LDHA 1YOVA 1K66A 2ZBQA 2GAIA 1ZGAA 2P9EA 3AFIA 4GD3Q 4KHZA 2IV3A 3R40A 4V1CA 1NU8A 3G85A 4LHYA 2I6UA 3INTA 4CNQA 3KQMA 1ZBDA 3KQOA 5ARCA 1W75A 4NAVA 1DCKA 1ZM3A 1B41A 3NEYA 4R1MA 1G8FA 1B8NA 2WJIA 1YR3A 2PJUA 1E7YA 1RMQA 2ZVDA 3QLVA 5H9VA 2XNDD 2I4OA 4PINA 1LPMA 3FYTA 2REQB 3OJWA 1R0ZA 1SIOA 5TE9A 2QX9A 2YMMA 3BXOA 1ZGBA 2XADA 3L02A 5B58C 3QWIA 4KE8A 3VU8A 4S2EA 3W9YA 5HYVA 3QE3A 2O1XA 4UBKA 2GZ3A 3EEFA 5FA5A 1D1QA 3BYZA 1SUCA 4KZPA 5JYBA 4MMZB 1VYTA 3CURA 2E4XA 3AEUB 3FR8A 2B4AA 1KZ6A 2CXTA 2A9VA 3MRSA 4ASUA 1LLUA 3HGTA 4RBNA 5DX1A 2OUIA 3BHMA 4K28A 4OP1A 1CZRA 1TZJA 2DAPA 2DWOA 3PSHA 4MLPA 4OHZA 5EIXA 1DC6A 1C80A 1J8FA 2CVZA 3STVA 1Y42X 4ZA2A 5HCNA 3VO1A 5K0NA 1SZCA 1JNXX 2BZ1A 3RK0A 3DDWA 4MW1A 1OZGA 4NJOA 1QRRA 2VJCA 3H9JA 2R68A 3C87A 2I1LA 3L05A 4XB6B 4CM5A 4DIDA 4ANFA 3LFUA 1WPQA 2BKLA 2XZDA 3RRXA 3H5NA 4HK4A 4LUCA 1GKKA 1QAMA 2B21A 1BXRB 3T1YB 3RI3A 4OHYA 2GH1A 2IOQA 3E81A 1NP6A 2J8ZA 3ONFA 5C53B 5ES3A 2V6GA 1DCFA 2VAVA 3P94A 2EEPA 4HJRA 3D02A 3JAWB 1TMYA 3ZIAD 5CEJA 2IJGX 3JQEA 1S8FA 4ZCSA 3AL0C 4I81A 1L4YA 3M1AA 5AXCA 1GLGA 2JS7A 3LBFA 1SKUA 4GMGA 4C4AA 2UYCA 4DL9A 1BGWA 2Z30A 5DT9A 4X94A 2XQJA 3RSGA 2IIPA 4JLJA 1P33A 4ER3A 1G291 3ZHSA 5ADWA 4JDPA 4IMPA 2IODA 4MUYA 1H3EA 4Q16A 3LA6A 4GEGA 3K6RA 4V0OA 4KRGA 2JGRA 1FZTA 1QP8A 1TUBB 3U7FB 4L6IA 3K71B 4CTMA 4B3MB 4WFJA 4B4UA 3DW1X 3DMYA 1T2EA 1KC3A 1UEXC 1AQLA 1EUDA 3D8SA 3KJFA 3NHYA 5IBPA 1LDGA 3VV2A 4Y6QA 5AVYA 1SUPA 2OV1A 2VHUA 1N8NA 3UA3A 1D6JA 3DLHA 1LW7A 1IXRC 1KI2A 3F5QA 4UHHA 4DIMA 5IN5A 2M98A 5J5VA 2DPHA 4Q7JB 3CXRA 3HWX1 3HMKA 4NBLA 2I65A 3WR5A 3WLRA 1YQEA 5EWJA 4DYVA 3LWNA 1XCGB 1SVIA 2AG6A 2GNOA 1KDRA 4IOJA 3JY6A 1K86A 4RK5A 3VI3B 2B7LA 5CVTA 3T9AA 4JKYA 5BNWA 4WPGA 3JU3A 1NLZA 1VIMA 1SUIA 4Y1EA 4EY4A 1BDBA 3QY9A 1VLMA 4YRAA 3H5RA 2EGUA 3P8ZA 1RJDA 3ZKAA 2GWHA 4NJEA 4RE6A 3O8LA 5JT1A 1AKUA 1PJQA 2J85A 4F2WA 2E3JA 3UWPA 1XRNA 1S3GA 3A9WA 3I64A 2CJYA 4URHA 4AC9A 2GK3A 3VZRA 1R15A 3K35A 1I1QB 3MAAC 2V1XA 3HE3A 3FN4A 1VMIA 3FRHA 4JP3A 2GHQA 4P36A 2ZSHA 3M7IA 3QA9A 3UJ7A 3S8MA 2PN1A 4ZRDA 2V6MA 4BVAA 3QU7A 3IT0A 3JTMA 1YFKA 3V4FA 3CNNA 3ODGA 1C1XA 1U5AA 3HYSA 3AJDA 1DC4A 2IEIA 3K8OE 1QVWA 3LD9A 4PG7A 5DGHA 2H1RA 2FN8A 2VNSA 3RKUA 4TMVA 3RSSA 4LZNA 2E49A 3A1NA 4W7IA 1NMXA 1J99A 3PV0A 3DEHA 4C7XA 4F3RA 3W77A 1R8SA 4ECEA 2YW2A 1Z82A 3K32A 1C3EA 3EG9A 3UW1A 1C81A 2TMYA 1BG6A 4ZI7A 1WE2A 5I8WA 3GGPA 3AW8A 4HUJA 3COWA 4EB6A 1FJ2A 4L5YA 3T1OA 3IQHX 2UYQA 1UM9A 3NOVA 3CSSA 2EHDA 1IZZA 3OEED 4W1QA 4KMMA 1A7JA 5J63A 4IFIA 4IMIB 1WDTA 4IIEA 2GTHA 1JT9A 1Y8CA 2RC6A 4OQNA 5EE5B 5GADl 2EX4A 4B6OA 1KDTA 3D3WB 4DA4A 3FPJA 2QTLA 1AGRA 2DFLA 2VJLA 4B47A 2YWRA 4WN9B 5EGSA 4JT8A 1OJLA 1I3CA 3WL3A 1FLDA 1C3OB 1IOWA 1FSZA 1XV5A 2QW8A 1HDGO 3LSTA 3AY3A 4H6PA 2WHPA 3O4HA 4PZAA 2H9AA 3NATA 4FDAA 1NASA 1D2GA 3KEFA 1AX9A 2NTJA 3PKZA 4Q48A 4Q3KA 2R7NA 3PP8A 1CJTC 3PCXA 2L2QA 4XDYA 5IFLA 1XA4A 3KEOA 2GN1A 4FX5A 4CR6A 5L7WA 1YACA 1G5HA 2N1MA 1AOXA 1NM5C 2QNRA 2VKQA 1W8DA 4OV6B 4WLNA 2OHIA 4CLRB 2BTQA 2X0NA 1NJ1A 3K1AB 2V9PA 1RNLA 2EZ4A 1PE0A 3HZHA 1XQYA 3E3LA 3U81A 1ZW1A 2F43A 5LXTA 2G08A 3N2IA 3QTBA 2W2KB 2QUAA 3TDMA 1DGQA 2EFJA 3FGPA 2IY9A 4NYIQ 5BVHA 2WJWA 1CE8B 4IBOA 5HEKA 4GC5A 2PVCA 5F3DA 2AZXA 2R84A 3D5EA 3HV2A 2Q46A 3LO5A 4LBYA 1CW2B 1NSTA 1XMXA 3C97A 3NASA 2IU6A 4ATNA 1PZXA 2J67A 4B2LA 5IJ9B 4RTPA 3QQPA 4HGNA 1Y5LA 2BISA 3BJEA 1DVRA 4J2TA 1YZTA 1AKWA 2BF4A 2O14A 3EA4A 4IG4A 4N7BA 4QYXA 4JYZA 3THWA 3I32A 3JQBA 2GAJA 2AIRA 1MGOA 1YAHA 1RQPA 1BMFA 1W0JD 1VCOA 3GEIA 3BMQB 3OHMA 3WGNA 4NV0A 5C8XA 2BFPA 3EXHC 1XCBA 4NCJA 3TEMA 1CIVA 4TL7A 2CKDA 4R0VA 3IOMA 3BXHA 5G1NA 821PA 1A1SA 4EJSC 1X87A 2R8XA 5J5CA 1A9SA 3K6SB 3NHPA 2R0QC 2CUKA 4HEQA 5DBHX 4EB0A 3SFTA 3EPHA 1ECBA 5CU7A 2GZDA 1Q14A 4QHYA 5H0IA 2QMOA 1AQJA 4ZK6A 1IQUA 1QHHA 3EBOA 2VLBA 1ZSVA 3ROXA 2WA2A 4BP3A 1QX4A 2P3OA 4OFXA 5FV7A 5AW0A 2WJHA 4ZVRA 1WV1A 4U2FA 4NYMQ 4D9JA 3ASUA 2XZOA 5KTPA 1PUJA 3S55A 2AA3A 3JQPA 3Q7QA 4TV8A 4KXYA 1BEZA 1MVLA 3JASA 4L4YA 4B8YA 2FRDC 2IYOA 2D5IA 4IWXA 4ZZ3A 1SELA 3GR6A 4M9ZA 5AKHA 4NBTA 1XKQA 1JR3A 1JHUA 3VKVA 5GJVC 1J20A 2O2YA 2PNFA 1CQZA 1SA0B 3DXZA 4JXJA 4AWXA 5BOSB 4MGZR 3WXMA 5DCUA 3KL4A 4AZSA 5HQJA 3HB0A 1HRKA 4UOZA 2GESA 5CFRA 1KY2A 1I7DA 1WPXA 1DT3A 1LXCA 3TVTA 4Z9FA 2RKBA 1AV6A 5I7HA 1EINA 1IN4A 1JDUA 2BHNA 1H1LB 3L1KA 3OETA 3C6BA 5AKZA 2XKBA 2YHUA 4WJKB 5EWLA 4BVBA 5JXIA 1PK9A 1XQ9A 5K0EA 5JS2A 5H70A 2DVMA 2PEYA 3IXLA 4FFBB 3WWEA 1DJMA 1B16A 1I5OA 2G9QA 2V0NA 1AB6A 1ML4A 4HVAA 5JVDF 1UFQA 2J31A 1M6NA 3E5HA 1L3IA 1MC4A 2V59A 4CIAA 4C2TA 2F48A 1B7GO 3GJ4A 3Q0IA 2D8AA 2DFDA 4I4CA 4AZ0A 3IMFA 3H99A 2ZGVA 2P0EA 4EMBA 3D7LA 3B20A 5BSEA 3IDQA 3MJSA 3EQ6A 3PYLA 4TV9F 3T5AA 2ZRDA 1B76A 1JLMA 4EJ0A 5H82A 1HR0B 2EGHA 3UG6A 2AOUB 1JECA 3BMOA 5AKYA 3ZGVA 1N77A 1UBFA 2Q0SA 4ZVNA 5J4LA 3CB4A 1T3SA 3ENKA 2GEDA 1G3RA 3P9RA 4QM7A 1S8OA 3D0KA 3SEZA 4KR7A 2J0QA 2MOKA 3DZBA 4OXQA 4XM0A 4D99A 5A4JA 2HX1A 4AJ4A 3OFND 4MB6A 5FFNA 1YL5A 4AJEA 2XGSA 4RUKA 4ZCMA 4JFRA 2F8SA 3QGMA 5DHSA 1CY7A 3N8GA 1XL1A 3MGBA 5LBTA 1W4LA 3WIBA 3C6MA 4E22A 2Q5CA 2D3WA 3E3OA 4IDBA 3QTLA 4F8YA 1UPXA 5ITZB 4GOOD 4ZI3A 1XKTA 4OJMX 5AI6A 1QK3A 1TTPB 4XWGA 2IIQA 3A9CA 2YWBA 2EHJA 4PEVA 3B6IA 1CUXA 4CE6A 2W83A 1P5JA 1N8SA 1ZKMA 3NM4A 2AOXA 2OLKA 2X5KO 1Y80A 3ANTA 5CYGA 2CHFA 1YCGA 1UC8A 2VK1A 3GRPA 3QVGB 3R23A 4NNPA 4O5AA 5CVUA 3AZQA 5JYCA 2QD5A 3BJIC 4L7QA 3V4SA 4C0BA 1K6EA 1MOQA 2BD0A 4AO6A 2CVQA 5IX8A 4PQYA 2CL6X 4YJFB 3UB3A 3SXUA 4D97A 3KJQA 5LUAA 2G4VA 4Z9AA 1GARA 1MIHA 2TMDA 1ZXBA 4JJ8A 3FDZA 3O26A 4P4UA 3HTXA 1C9NA 2HLNA 4G0VA 3PEUA 1VB5A 4HP8A 1T36A 1JG1A 5KSZA 2BGTA 3GGDA 2XNCA 2V3WA 4MUEA 5DHQA 5C37A 2O2SA 4S05A 5KOIA 4FYPA 4EYEA 4WBNF 4XGNA 3M4XA 3SYRA 4U6SA 1ZQ9A 2F3QA 1GQFA 4HB4A 5JD3A 1E6LA 5ADUS 1V2GA 1XPJA 4F5ZA 6PFKA 3E9YA 5EIBD 1U5CA 2BKXA 1YRLA 3K2BA 3KYCB 4Q34A 2CVOA 5M7EA 5ENDA 4EATA 2AV6A 2H8KA 1M1UA 2Q0QA 1MO3A 3DGFC 2IHZA 3ZWVA 5HKBA 5DP2A 1EVJA 1Q15A 2VP4A 3OOWA 1JIJA 1XAIA 4R2KA 1TECE 4A3SA 4AJLA 4DA9A 2GTIA 3I62A 1NXXA 2C92A 3DC2A 3LX5A 2A86A 1OWPA 4ENTA 1G8KA 2FFJA 4J76A 4GDMA 1X1SA 4GZLA 4NDAA 1W4RA 4RHEA 3ZWAA 3I9NA 2JCGA 3DEIA 1EM6A 1NPYA 4HQOA 1KAHA 4P80A 1E2HA 1N7GA 4FFOA 3IEIA 3GXOA 1S2OA 5BSHA 3DJYA 3WWPA 4QSMA 1JKMA 4Q3OA 1REQA 4KW7A 1PQPA 4FFWA 1RT9A 4XPIB 3THXA 5ADHA 2WF5A 5EXPA 2FEAA 1LVGA 2G09A 3N70A 3UJPA 4F93B 4IAOA 4DRZA 3PPIA 1GGJA 4C4ZA 1F9AA 1P6XA 2ZT5A 3OZAA 3N0XA 4J7XA 5LP6B 4K0RA 1GP2A 4ZVVA 5J1SB 5I3ZA 1PS9A 3ICWA 5K8UA 1HG0A 1UKEA 4D56A 1Y4SA 3KT0A 1OX4B 4NU6A 1QGYA 3WGHA 4FVTA 1V8DA 1HE4A 3RFFA 4EGQA 1MFZA 4F0JA 1QJCA 4JQCA 3A6GA 2A0FA 4XTRA 4C1NA 2B1QA 1RADA 4WKNA 1U1FA 3N59A 1QRUA 2YWJA 1P2VA 1BE0A 1VLVA 4Y7CA 1GUDA 5IT0A 3IBCA 2ZUCA 1A5ZA 1IMJA 2I6GA 5EXDA 1LV8A 4B7AA 4CKCB 4Q4JA 1GPKA 2W5UA 2R8PA 1FS6A 3IE0A 5TGDA 4U7HA 1P62B 1VHQA 1RXUA 3C5HA 3DE0X 3W6OA 3CH7A 2QRNA 1EX6A 4IIHA 1T1RA 1XRMA 4Z0HO 2RE8A 2QTTA 1VG0B 1Q5PA 3GLGA 621PA 3NRBA 4CCSA 2G77B 3GV0A 3OP1A 2PX0A 4M1YA 4QRIA 5DYNA 2OCIA 4FILA 1MX5A 5U9CA 1TI7A 3ST7A 3TBKA 3ZDQA 1R3DA 3ZLTA 1J09A 3EVNA 2RHMA 4GYYA 4N54A 4QARA 2PV0A 3STUA 1MW8X 4RCVA 4DCJA 1L5QA 4KXUA 1DQRA 5FAKA 1HDIA 2A59A 2WWWA 5J5AA 5K3BA 5JD5A 4KACA 2QQ0A 4DA6A 2JFHA 3T4XA 5A4KA 1EEXB 1SFRA 3SNKA 1LC3A 3A0RB 2O2ZA 4Q66C 1A2OA 1GGVA 2FFBA 3FNEA 4HWKA 5CAEB 5KC9A 2X2EA 2BH2A 2ONKA 2PMBA 3F6SA 5F4ZA 4Y0VA 4LG1A 3CH6A 2F4NA 1Z9BA 3RSLA 1GTL1 1QHIA 4G25A 3GQVA 3HB5X 2WYWA 4KGXA 4HFMA 3OCVA 4ZVKA 4BAZA 2XVAA 3C3KA 3DUFB 2AFVA 1POWA 4CM4B 5A9TA 2JF0A 1J8DA 4R1LA 4U9HS 2Z43A 1UKCA 3ZD9A 3RKRA 1Y8ZA 3U2QA 2R5NA 2QI9C 1X8JA 3EFOB 3CLTD 1SXJE 5AYVA 1QIGA 3OFKA 1S9DA 5KSYA 1QZ3A 2XVMA 2AR0A 4X00A 4B3RB 3F6CA 1PZEA 3GYGA 2P0AA 2QN7A 3OX1A 2G8NA 3H8JA 3QF7A 4HDQB 1KS9A 3PCRB 4G0PA 4HKTA 4UBNA 1QGZA 3ZW7A 4D4HA 3DLBA 1U2GC 4A8JC 1E98A 3R0XA 4GPD1 5SZIA 4P81A 2XTMA 4JBXA 1Y98A 2FWAA 4OF4A 4XAQA 3RTEA 4PNPA 2RBKA 3LT0A 5IU6A 2C4TA 4Q9IA 4DBVO 3BX1A 5KEIA 2KMLA 1VFPA 1NDQA 2JLBA 4R6XA 2Q5IA 3T7EA 3UW3A 3W5UA 4BDSA 4DIEA 2QSZA 4RVFA 4EUFA 1M66A 3ADKA 3RARA 1E1MA 2H1HA 4Z49A 3B48A 4RW0A 1WVMA 3UATA 2P3QA 5J2TB 2AUMA 2XRFA 3QUAA 3ZHTA 1FFYA 2PRSA 2JI9A 1E3QA 1CJUC 2HEGA 4FYKA 4FD2A 3FIJA 2ZI9A 2CHVA 2NAFA 3H1AA 5ALUA 4B3IA 2DECA 4RTRA 3ICPA 2HMAA 2YBEA 4CRWB 3E4DA 2QTAA 4CQLA 2IL1A 3GLQA 3JVVA 1I2ZA 3DA8A 2FWIA 1U0BB 3T5BA 2IPOA 4D9EA 4AI6A 1MHTA 2I2FA 3MTAA 2OXCA 3ZN2A 5HOEA 1TZKA 3O90A 5FPKA 1YCHA 2FPRA 4B3TB 3ML1A 5EHZA 3CPHA 1KFJB 2FMIA 2SNIE 1GQSA 3C16C 4PPQA 2B0CA 1GCGA 4GL2A 5ALRA 2KYRA 1PR5A 3DL2A 1QWSA 3K9LA 3G2NA 4J91A 3S8YA 4OQPA 3DFIA 4JQOA 3A0UA 1U2QA 5I5EA 2PT5A 2X19A 1HNWB 5DM2A 1JKIA 3HUTA 1XNJA 1KMHA 4ZP1A 4YXWD 4MMXB 4YXFA 1ZUIA 2EIXA 3LYAA 4LWQA 3SCZA 1K7EB 2HA0A 5J40A 2OXTA 2XHZA 2PX3A 1S2MA 2P3LA 5FI3A 1QP0A 4I3FA 2PX5A 3UA4A 3NTLA 3A9UA 4GRIA 4DUYB 2I55A 2IYVA 4O3MA 2HPHA 3FYDA 2W2QA 1OYOA 4O4HA 3SJBA 1VHDA 2ZUUA 2Y1OA 2AS0A 3IAHA 3AVUA 4JVOA 1VL6A 2XXBA 4M8KA 1KOGA 1YA6A 1V7CA 1FP4A 1WEKA 2AC4A 2TECE 5K8VA 2GHRA 4JVLA 4CEHB 3EVAA 2RCYA 4MWOA 4OXKA 1ZHHA 5FPQA 2JIRA 3A8TA 1YH3A 4YAUA 3RFCA 3SC3A 3G6WA 1ADCA 4XR9A 1JLSA 1XEXA 3NDPA 4R2XA 1T9GR 3CIOA 2PSHA 1FDUA 1P1JA 2I8CA 2YFKA 2MJLA 2HN9A 2HMTA 1YFJA 2JFQA 3AGPA 1L7OA 1RRKA 1Z74A 1TLTA 5DX8A 5LPNA 4RPCA 3O2NA 4CKWA 3K53A 1XVUA 5T3UA 4IDNA 2I67A 3L46A 1KYTA 4FUTA 2XNHA 1FJGB 3GFFA 3PUXA 1NRIA 4HY3A 3FFBA 3X43A 2IELA 4DIFA 2NNWB 2OXFA 2BMFA 1SHTX 2R1VB 3K0CC 1L4KA 2X0KA 3G2QA 3S1LA 1R6BX 4D80A 2OCAA 1E77A 5JEEA 5G02A 3VC2A 1XZHA 3L9WA 3EZLA 1AUXA 3DT9A 1J0CA 3TCKA 3AUFA 4I1YA 1T3GA 4PZDA 2BFDB 4ZT4A 3WHIA 2CVPA 3I52A 3HYLA 1P7WA 2FYTA 4M86A 4Q3LA 2WIBA 1V9SA 1NBMA 3O8QB 1O95C 1ZH2A 3FNGA 3U61B 3MUEA 4KDRA 2HMUA 1PNRA 4FZ3A 4C0KA 2PQ6A 4G9BA 4P2GA 4G0OA 4BO8A 2XUAA 2D0PB 3ETDA 3V8PA 2PEZA 4QGHA 3I2KA 2HLDD 2CVFA 4UU1A 1JMKC 3UH1A 3PBKA 2O3RA 1U2DC 4G5RA 2QM0A 5T41A 4FIDA 4R9UC 2WWRA 3RJ9A 1R5BA 4GE0A 2D5BA 3RVLA 5CA0F 2PA3A 1WWKA 3I92A 4IJVA 4RTJA 3ROZA 2NT4A 3LQQA 1F2TA 3GK3A 2KM1A 4X8LA 1IM2A 4RY0A 5CCXA 3IAS1 2NV0A 3UHOA 2R1TA 4BXOA 1U2PA 3CLSD 4JSYA 2B4KA 2XUZA 1G2OA 3Q3CA 3SKVA 4FZJA 2RBEA 2JDIA 4BE4A 4DOMA 2OTCA 5J2TF 3DVLA 4HYQA 1B00A 4CF3A 2AQ8A 3KCQA 1L9KA 4XSVA 4AUMA 4QM6A 1HX7A 4FIZA 4OA8A 2ZS9A 1KERA 3QVWA 3V4PB 3R7FA 3Q5EA 1E2DA 1PJZA 4KIGA 2M6LA 4FYXA 5BUQA 2L0XA 2ROQA 1TCVA 2YYAA 2IZOA 1IBKB 2JIMA 2XGMA 1JJAA 4GYWA 2Y4NA 3MLEA 1C0IA 1M7BA 5E6UB 5IASA 2FSIA 4XUDA 3LKVA 3PTZA 1ZNZA 4IDEA 2JFNA 1Q92A 5FL7D 3LMKA 2HCFA 4JAVC 3OC0A 2GXSA 4PQFA 2Z5GA 4OSOA 1NJFA 5DJ5A 2FQXA 1IAVA 3N9IA 2ANCA 2C8LA 1PCXA 5GONB 3R9IA 4Q0MA 4RV4A 1U1GA 1UANA 2VT7A 3D3QA 3QUCA 4K9LA 3E7XA 1TM5E 3I6IA 3SHQA 4EPYA 5CPBA 2X9QA 2VHWA 4H9GA 5JATA 3DVRX 4R81A 4IJQA 3D2BA 4JLWA 4HLDA 4IGKA 1YI0A 5DHRA 4YLGA 1FDTA 4PG4A 3U0VA 3WVNA 4AYWA 1THGA 4F56A 4HDMA 4XGKA 1OC4A 3M6AA 1RHKA 2SCUA 4JMLA 4I5EA 1KHTA 1XRQA 3UMYA 1JH9A 2GJSA 4FDMA 1MX9A 1THMA 3J81k 3EEYA 3VHXB 4O02B 2AJBA 1ESCA 1W0KD 2VRWA 2NTYC 1O5IA 3QVOA 2DH5A 2ZXUA 2CFIA 4OHXA 4I0WB 1W5TA 1UBEA 4RSGA 5TNXA 4XTCS 1Q21A 1X0XA 4LDZA 3KHTA 3OM1A 3WLIA 1Q0HA 3FZEA 3R7SA 3VKUA 3WIDA 1KIAA 3H6HA 3IQZA 1W5SA 2W6PA 1KSGA 4B3CA 3DFUA 5AM0A 2YFYA 1MENA 1YU9A 4BP9A 1PWXA 1QKKA 3BXXA 1R0WA 4O4LF 3T5PA 2G72A 2X0DA 3TQQA 3GLKA 3SDBA 4X3CA 4DUPA 3SQDA 1HH4A 1SXJC 3PNQA 5HIJA 1MO6A 1QC5A 3E3MA 1NT4A 5H68A 2ES4A 2WWXA 1QOPB 1E3TA 2WUFA 3H13A 4O08A 1MLDA 2EATA 2BUAA 2W70A 3QVTA 1PGQA 2ECPA 4JQZA 1SOVA 1KWKA 4M0MA 3EXHB 1P7CA 4D3ZA 3UJ3X 1SZJG 2Y0EA 1J9ZA 3NVAA 3ZH2A 4BEJA 2ORED 4ZOLF 2PD3A 3VUFA 2VA8A 5D7NA 1JG7A 4EJSB 2NP7A 1TZ2A 3GCXA 3RS2A 2GJ8A 1BEEA 1KXZA 3IPXA 4YJ2F 2BMVA 1S3IA 4F7DA 3L4SO 2D7DA 1QE0A 2H1SA 3BXEA 1B8PA 4H7PA 4QDTA 3IR5A 5CXUA 3ILHA 1JYEA 4N03A 4PX2A 5ANRB 5REQA 3SKXA 2D0IA 5DGCA 4FKZA 5A0TA 3ADOA 2NU8A 3HMQA 3CINA 3SVZA 3ZDYB 5LA6F 2GFHA 3OPMA 1Y3FE 1U3TA 2B6HA 4UE3S 3L82B 1NDHA 4NRDA 4DGQA 4JX8A 3EZ2A 4KCGA 3FCOA 5JVDA 2OBFA 3G5TA 1FFSA 1XTBA 1S9HA 2CK3A 3PYXA 4MDHA 4DPMA 1M0EA 2W6CX 4LQ4A 2GK4A 1RRMA 2PWYA 3ZY2A 4B6SA 4MO9A 3LT1A 1ZLYA 2WB2A 1QIFA 2VNKA 1TM4E 2WJ6A 4TQGA 3IUPA 2BKUA 2WA1A 3IP8A 5A05A 1SN7A 3PPVA 5EMJA 3H3JA 5F5LA 4OFZA 2VYND 1W36C 4IIDA 5KPDA 1JJFA 1Q74A 2YS7A 1Y6JA 3S5JA 5DGIA 4ESVA 3ED1A 2AFIA 521PA 3BWEA 3A1WA 3KL2A 3IDFA 5TQ2B 2Q3EA 5G4LA 2A7XA 4NMMA 1M83A 3RT1A 4TMWA 4Y2TA 4B44A 3AVXA 1QO9A 1Z4JA 1JT2A 4EEZA 3R5TA 4WK4B 1YD7A 3F9IA 4XIJA 3THRA 3KTDA 4HLCA 3QXXA 4KQCA 2HUNA 1TC1A 1ODFA 3DHWC 1YZYA 1CYEA 1AK2A 5GINE 4GRAA 4YO7A 5M29A 4MPDA 2CSUA 3NAGA 3IIEA 3G0OA 3O0TA 3T7CA 3R7DA 4BWVA 4BEWA 1WKVA 5AI4A 1OXMA 1GRCA 1LPAB 3RUEA 1Z0SA 3I0ZA 3NKFA 1SM4A 3EWIA 4N5DA 2W2NA 5E1OA 1P1CA 1FQJA 3G7NA 1M8FA 1NVGA 1T5SA 4ZV9A 4RM2A 4ZCLA 1G8HA 4F6CA 4P4SA 3RS4A 4MA5A 2XMSA 4BLPA 3H0EA 3O6VA 5TPZD 3T3NA 3NFYA 1L7DA 1GZSA 1X7DA 3N87A 4EYKA 1RJWA 2EG5A 3AJEA 1HSZA 1ZVJA 2XE7A 3U3ZA 5ICCA 1XTVA 3E2PA 1CLEA 4QJ5A 4AW9A 3AEKB 3COPA 2MHCA 5IC5A 3E53A 1D0IA 4W1RA 3DCIA 4GSLA 1AKYA 2B34A 3P0JA 4O1HA 4PLHA 1MAWA 5HZMA 2BCGY 3ZHYA 3DBIA 2ATCA 1T2CA 1FFHA 1U0HC 3P9IA 4B76A 3G6KA 2FWPA 2ODWA 2OZPA 1AMNA 1VTKA 1VG9B 3ANSA 2PXAA 1CUVA 4JVMA 3GQBA 4NR0A 1IXZA 4D0RA 4M8LA 2H7XA 3BFXA 2TMGA 1RCTE 2CD7A 1NLYA 1ORHA 4YVFA 1AQ6A 1G6KA 1X7ZA 1SVNA 3B1WA 2EWVA 2LCIA 1UJMA 2IVFA 3H0CA 3NTOA 2CL5A 3OICA 3PDWA 5AWFC 3RGGA 4OYYA 2QBYA 3BE5A 1EXVA 4GOND 4FUQA 4PG8A 3TKAA 1XAHA 2DGDA 3KB6A 2C3YA 1SIBE 2ID7A 4REQA 1IG3A 3IUSA 4I1UA 3A3OA 3B1XA 5I8ZA 4QUJA 3BVPA 1JHQA 4H3VA 3H9BA 4M8NE 2GUWA 4BNIA 2Q1TA 3NIWA 5MN4A 5IDQA 3DO5A 1RYEA 1JFFA 5ILOA 3H4TA 3QENA 2WJPA 1ZU5A 1J21A 3ESAA 1PR2A 3F5DA 1MA3A 4BAUA 1CJBA 5JI3E 1Z5OA 2XYPA 3K2QA 4FW9A 3A7DA 3EVEA 4QQ8A 2ORIA 3PLNA 2CHEA 1OFHA 1NFQA 1KZ7B 1ZJWA 4O2AF 3TJZA 1JFSA 2QT1A 1O9BA 1UBKS 3PFBA 4V0MA 4CV1A 3ZCTA 3LCJA 1KEEB 2JEOA 1N1EA 3PNYA 1QMPA 1NR1A 2D5LA 5EVCA 2PIDA 5KC8A 1QDEA 5B6IA 4RH1A 3K9FC 1L7XA 2ODTX 2VF7A 1PL0A 1VKJA 2C4VA 2JG3A 2HJSA 1Q22A 1EYZA 3AI2A 1G0NA 1U0OC 2FPUA 1J39A 4XX1A 4KV7A 1TCCA 4YCCA 4EI2A 3KPVA 2VZLA 2RHRA 1DAKA 4Q47A 4A4DA 2ZRJA 1NXSA 3CLHA 2BKVA 8MHTA 3W5AA 1L4UA 1NURA 2FMHA 2WWGA 1QHYA 5ISMA 1U1CA 3KD3A 4CEJB 2WKRA 3HU1A 2OO3A 1IBLB 2QAGA 4JJZA 4L0MA 4O1MA 3KQWA 5K3EA 2YJZA 1OHHA 2ZJ3A 1KK3A 3MTQA 1F5SA 5FO0A 3PJEA 4O29A 3MRTA 1RMYA 2JLXA 4MWSA 3NANA 3ODPA 3ABSB 4YBRA 3U7QB 3PDUA 1NQUA 4ZVTA 8AT1A 1ZN8A 1JE1A 1QANA 3EEQA 4E30A 1E2EA 2UVPB 1QU2A 1ZIYA 1CB0A 3IVRA 4JNKA 2VDNB 4HG2A 1WMEA 4J7AA 3NV9A 4DSOA 2AVDA 4CQJA 4CM8B 2PUAA 1E2QA 3KHSA 1L2TA 1Y81A 3CA8A 3PRJA 4GT1A 4OHRA 2V65A 3RFXA 2H1CA 4ZRMA 4ZC8A 1ULTA 3WKDA 1O08A 1P19A 1N57A 4BQEA 3ZXSA 4TUYA 5C35A 3GHHA 4H1HA 5EP2A 3MHPA 3UCFA 5B7GA 2JGMA 3ZU5A 2H11A 3O8CA 4LDRA 2XCQA 4XLLA 2HMWA 4BO7A 4FGJA 4L8GA 1FTYA 2IPNA 4ALIA 2VQFB 1MAVA 3CNQS 1F8YA 3PFWO 1DC3A 1H6DA 1JUDA 3R3HA 2QNBA 4NBVA 2PRZA 3PC8A 3THSA 1NI5A 1QE3A 3GRAA 4RACA 5CB0A 1CQPA 2BDTA 3KS9A 4KQGA 5G1OA 2DM6A 5JALA 1HDRA 3T38A 4B6PA 1VGRA 2VH2A 3PGA1 1CCWA 3BD7A 1GXSB 3OY7A 2FEWB 1GYRA 1F12A 4K6GA 5F2OA 3V00A 1GFSA 2COUA 2X9GA 1BD4A 4PAMA 4HWPA 1GAEO 3QBEA 2P1DA 3S28A 2JFUA 5KQLA 5GIPE 1UOEA 1U63A 3WBJA 1LI7A 1IN5A 3A1EA 3D8HA 4PC1A 4C4PA 1DWUA 3H86A 1ZL0A 4EO7A 3EIFA 3OLXA 3BT7A 4EJ2A 2N1BA 3CW9A 5F35A 4LJ9A 5LMUB 4LE2A 2PK3A 1MO2A 1TYEB 2Z95A 3BFPA 4V0SA 3UF0A 3TIIA 1JKJA 1MJ5A 3HGQA 3U1BA 4Q9NA 3EGOA 4WOJA 3NDJA 2GN9A 1YXMA 5BSMA 4YPFA 4F6RA 1GG9A 2P40A 1PV1A 3GCGA 3GT0A 3PRYA 5K8CA 1DB3A 3BSFA 4PXAA 4V38A 2YQ4A 3BS4A 3I6YA 2IEZA 3T9CA 2RHHA 1XDGA 4GLOA 4KTTE 1XKLA 1EXNA 2YZNA 3PHJA 4ARVA 4HNUA 3BRWD 1TAUA 1N9KA 4L76A 4BEBA 2ICAA 4QC2A 3GIWA 2OBXA 1KQPA 1MD9A 2K2WA 2A5LA 2RGAA 2VHJA 2W2LA 3ECSA 1KMIY 3L6OO 3QLVC 1IVYA 4GG1A 1ZOLA 4KI7A 2VJMA 5CK4A 5KNCD 2GKOA 4A1OA 3UHAA 4OK6A 3KVYA 5ALGA 4JNCA 4J90A 1PWEA 3CSUA 2XD9A 1YQUA 2H7VA 1JR3E 3ZY6A 1PYDA 3ICCA 1Z73A 3L49A 1ONSA 3W6ZA 5A5VA 3DMTC 1QLHA 5EP4A 1U8EA 2OCPA 3E27A 1ETHA 3INGA 4Y18A 4YP0A 2OM6A 1B26A 4PBSA 3VR5H 3NU1A 4D8UA 4BQQA 4MRAA 2HDNB 3FF4A 4HWSA 1JBQA 2QM7A 4B6JA 1HSOA 4JJ6A 1S1MA 1RQ2A 3IHWA 3VNRA 4CL2A 1OFTA 3MPOA 4L9AA 4M49A 1MPXA 1OT5A 4I6EA 4KNWA 1UOOA 4UCQA 1XCPA 3VI4B 1JQAA 2QN1A 4XFJA 4NZOA 1DIBA 3OKCA 1XRPA 3LOPA 5G0SA 2O8VA 1ORWA 4XZ3A 2VHTA 5DHPA 2P8JA 4B31A 5K9ZA 5TJ9A 1X2BA 3IEPA 3NEJA 5L4LA 1VE7A 3MCUA 3KPWA 5K3SA 3PNVA 5ESXA 4NH0A 5BSTA 3VBEA 4A8JB 3QXSA 5EA2A 1Q84A 4LVOA 1RZRD 4KXXA 3WQSB 4CIYA 4MAFA 1LRJA 1UUFA 3EZXA 4XYBA 3KUUA 3ND5A 5C5CA 4G6ZA 1W35A 3EODA 1YDGA 4MCJA 2IYAA 3ZD8A 1BMDA 4RWEA 3QMPA 3JWPA 1Z4QA 3UO8B 4MUJA 3VOAA 3WWOA 2GMWA 1J5EB 4DWVA 1U1EA 4HGZA 2QT0A 4ROSA 4DV1B 4GDFA 4PLWA 4IHJB 1U2ZA 3GO4A 4MULA 4NXMB 4LZOA 2B94A 4EUNA 2HRRA 7ABPA 1Z7GA 3IBSA 3BSSA 1ZH4A 3OX2A 4O3FA 1KQNA 3WHLA 3V1YA 4BLOA 2AEJA 1GN9A 2YC2C 2Y68A 3HDQA 5BRJA 3OA2A 1LDNA 4LECA 1ACLA 1M1YA 1Z62A 2G63A 5HF5A 2X2FA 4IMRA 1RRPA 1HLGA 2NPIA 4YALA 5LYJA 4AQDA 2X2PA 3TMAA 1ZRHA 1SKQA 2FDXA 2N46A 2NW6A 5FWXB 1QS0B 4OXIA 3GFGA 2X3UA 1ISGA 5EYPB 4YMIA 1VDZA 3BE4A 5LMZA 3NNDA 2P65A 1PEYA 4YHHB 4R2WA 4LRWA 1JHPA 2Y93A 3ITEA 4P4GA 4UZEA 4L73A 3TZLA 5KIAA 1Z25A 4BS9A 4UD2A 5C7YA 4HNAA 2GS9A 2HDWA 2YJNA 1JIKA 2Y6UA 1HFEL 1L5FA 2BMJA 2YOHA 1FRQA 4M9SA 3K1YA 1AD2A 4Y6GB 3QOXA 2FJPA 4DLBA 2Q3CA 3FFXA 3VU9B 4UQLA 1W5EA 1AHHA 4RAQA 3B3AA 4QPNA 3JXEA 4U4AA 1EQ2A 3C98A 5DZSA 3X2FA 5ARBA 4MWZA 1OWOA 2Z4TA 3BM5A 4WCFA 4MV4A 3ZE9A 4RK0A 1VL1A 3VJRA 3SN6A 1JJIA 1N25A 4KN6A 4Y1RA 2WVJA 3LL4A 3VR2D 4EMTA 1QQBA 3EUEA 3G2OA 4MJLA 1Z0UA 4L6AA 3TVDA 3AWIA 5I9SA 2OESA 3OJ0A 1XZEA 3ONWA 1T43A 3NBXX 3HCNA 5JD4A 2X7XA 1Z16A 2CBGA 1BH2A 1SD1A 2LD4A 3FBGA 4GPZA 1DTWA 4QPDA 4D3XA 1R0LA 3BIJA 1G98A 2FPPB 4J75A 2NUAB 2ERXA 2HSDA 2C2OA 2WAAA 3VM6A 3WZMA 3ZNOA 5BWMA 3HKDA 3KBBA 4L78A 3AKYA 8ADHA 2IV7A 1JXOA 2DSNA 3C5CA 4JYBA 4P32A 5G53C 2VUUA 3ORYA 3M6FA 2H4JA 4NBUA 4NS4A 5LZ2A 4WNCA 2ZVPX 3P9CA 2GPBA 3SGLA 3V8RA 5JAOA 2ZI5A 4TYQA 2UVQA 2OV2A 3KYJB 4HGOA 1L3BA 5FWYB 3WMGA 2XTZA 4ZEOA 1BHO1 1EZ1A 3LW7A 3DXXA 2TYSB 2Y2UA 1PD0A 5HTKA 2YUTA 3PQ5A 5C34B 2W6JA 4RGVA 2PT6A 4I9HA 5JJCA 1TM2A 4JJIA 4IV8A 3CNOA 2DCMA 2HHLA 5EZYF 2A5GA 3AU9A 3DTVD 3M1YA 5ALQA 3T41A 5CH3A 4G8BA 1A9YA 1B15A 3A4IA 3G9ZA 4G3XA 2JI6A 4F12A 4ZT7A 4JKIA 1YB1A 4R1TA 5L3QB 1FNMA 4DMKA 3KDSE 4WJLA 1E6MA 4C06A 2WSIA 4ZOEA 2JAQA 2OXEA 4XIYA 2C5GA 3IT3A 1Q12A 3OG9A 2CNWD 3DEJA 4D9FA 3NIGB 2H2FA 1UK8A 1Q1AA 1T2FA 2NXEA 2ZTHA 1UDRA 4K2HA 4FHGA 4TVBA 3HVRA 3T5MA 1ZQ1A 5B6PA 1PX0A 4MGEA 5I4IA 2H9YA 2VAWA 4Z3DA 2GEUA 3GLFA 4RFSB 4ZREA 2D62A 2GDJA 3E84A 1ULBA 2H4XA 4GPAA 2AE1A 4JUIA 4EJFA 4WZZA 1E92A 2ZE7A 2C4KA 3RW9A 3TJRA 2IDMA 2GF9A 3A27A 3KU4A 3Q2OA 3L7JA 5BR4A 2WMOB 4MSUA 4FB4A 5C32A 1E5LA 1HUQA 3O2QB 4JEMA 4B4WA 4DZZA 5HQ3B 1DJPA 2JFPA 4IYRA 4WLOA 1LTQA 4KSCA 1VIAA 1T6XA 4YRNA 1HXHA 2XR1A 1OGIA 2ZBPA 3OLVA 5DOVA 1F1BA 1K75A 1CDEA 3L0DA 3A6JA 1JR4A 2FQYA 3NWPA 1V5WA 1XTPA 4K1LA 4RIHA 1SC6A 5BORA 5I7AA 5IT9A 4U2GA 1A1VA 1UKYA 2A4MA 2DWPA 3K9WA 1U9ZA 4HWOA 3TQTA 4L51A 4OY3A 4LHZA 3A9RA 4CM9D 2PHZA 4R8VA 5KKNB 1CWUA 2IYRA 5IAGA 1RZVA 1DC8A 2O8BA 4UM5A 5JI2E 2Y1EA 1MOPA 3BILA 3TRDA 1CS0A 5JU6A 2RONA 4FDLA 2P7IA 2O3QA 2FWBA 2Z2JA 3HN7A 3OE1A 3GLIA 2ZUEA 2AD5A 1GPJA 1KEPA 5IF9A 2KS6A 1JDSA 4UHBA 5B3JA 1WF6A 4C07A 2FP4A 1TU0A 3OCXA 3BCHA 1RAFA 2IYZA 1VDMA 3T5DA 3ZK8A 2I5PO 3QI7A 1GZVA 2ZSFA 2FA9A 4QQNA 1ZC4A 4IDOA 3S1AB 3I53A 2ISCA 4QSHA 3TIVA 3M33A 3UWSA 1W4BA 4PPNA 5L3ZA 1KRWA 4PBTA 3WLOA 1HYQA 1Y6ZA 1DIHA 1GPUA 3DPUA 5DF1A 2X76A 4F3YA 3U19A 3DBRB 2W2OA 1MBZA 4D4LA 2CJWA 1TT5A 2O4CA 2P9HA 3DVSX 4YJGA 3V4RA 2ZPTX 2OCBA 5F78A 5KYXB 4GUAA 4CKEA 1TYCA 4C3ZA 4F1WA 4HYTA 3QU9A 5KHOC 1CUIA 1N2ZA 2QZ4A 3B9PA 3LVBA 1VLHA 1ZH6A 3P2OA 5E7MA 4F91B 4QXAA 1ORDA 1ZG3A 2C8JA 3KFXA 3P9XA 2WJ4A 3CW2A 1U5BB 4PRKA 3REQB 2FW6A 2C9OA 3E22B 4UFNA 4PBRA 1DHRA 1XZ8A 3UHFA 1SXJB 2C58A 4CI0B 3N8IA 2ZE6A 2VBFA 3KHUA 4DNXA 2I2CA 1PJRA 3EGVA 1UMDB 4M1ZA 4WKPA 1PVOA 2IS2A 2JGJA 1ZJYA 4DLAA 3LDUA 1HMPA 2QV0A 3DYVA 4P31A 1NBOA 1DBIA 4Q3DA 1I13A 2QTHA 3KIPA 2AK3A 2HEIA 3GFRA 1S89A 4BL5A 1EK0A 3PWSA 3AETB 1WLYA 2FWMX 2Q2WA 2QF7A 3TLZA 5ALLA 3L7DA 3ZHZA 2HF2A 1T1GA 3IV6A 4UM7A 4ESOA 1YB4A 3HBLA 3VTFA 2PGIA 4Q7QA 2AZMA 4V24A 1RYYA 1U6IA 1QRTA 2J09A 2EFDB 1WUTA 2GYUA 2QD4A 3CXUA 4Z2YA 4DR1B 3EJWA 1Q6ZA 3KZOA 5EFZA 5PNTA 1BGVA 2BKEA 2W2MA 4MOWA 3TZHA 4CPDA 4FYYA 1EX9A 5FO1A 3IR7A 3NTVA 1A5AB 1ITZA 3BUSA 1GTZA 1X8KA 3MCVA 4KR2A 3VHQA 4ZOAA 4ZO7A 4EHLA 1H2XA 2DPMA 1SNYA 2VA9A 2IK8A 2VS1A 1UP4A 2JFWA 3IB6A 3NT5A 4REMA 4DW8A 1M7HA 3ZE0B 4E5NA 2H1WA 2QENA 3CX8A 3OAAA 4RADA 1M1XB 2JA1A 4HSGA 4DTCA 3F3MA 5KVAA 2PTHA 5K3OA 3QELB 5K03A 2IOHA 2JFYA 3H19A 5JJBA 1T9HA 1JAYA 3K0FA 4KLZA 3L5OA 5AKKA 2EKZA 3AF1A 2WHEA 3KR0A 4MW2A 4CM3A 1S7CA 1P1HA 1CULC 3FCEA 2WIGA 4FONA 2FQWA 2VXBA 3IVCA 1SBZA 4TS1A 3KKQA 1RIIA 4MXDA 3LQYA 4EUEA 1O9GA 1SG9A 3EPRA 4HXGA 4Q01A 3N39C 3EH2A 5AK4A 3U9TA 3NVKI 4DLNA 5KS2A 4R0MA 3FBWA 3PEYA 3NV7A 1WCXA 1P0IA 3C3BA 1FYXA 3C8MA 1P2FA 3L7NA 4JT9A 4UBJA 4YREA 3TTTA 3WFZA 2DUJA 1QRSA 4RDHA 4CG0A 4H17A 4DLWA 3QX3A 2I2DA 1RQRA 2AEFA 3NP9A 5IAAA 5FHRA 3R2JA 1K3FA 3LOQA 4HDSA 4C4YA 1AMOA 4FWTA 4P5PA 1KDVA 3TCNA 5EHNA 4G89A 5EZSA 3M81A 3C0KA 4RTNA 4TZ0A 2QN6A 3ND8A 1GU0A 3FM9A 4Q12A 2ET6A 5FUVA 1ZJ6A 1UMCB 2IZ7A 1XVVA 2PTGA 4P3YA 1P74A 1ZSYA 2ZT6A 4QUBA 3KQSA 5COBA 3MINB 1ABFA 2OSVA 3ESRA 1ABBA 3WYCA 1HNXB 3N2NA 1DIOB 1WABA 1I51A 3KPYA 2ZS7A 4R8KA 3S70A 1GR0A 3CEMA 3G49A 3VPHA 4XLTA 3JZMA 4ENUA 2XA1A 2JJ2D 1EG7A 2QX4A 1RYMA 1CDZA 1L8XA 3N3BC 1WJGA 1V1JA 2JAWA 3HJHA 3MTBA 3EEBA 4M7WA 2XNDA 4RKFA 1BCSA 4Y3UA 1RDFA 2YY5A 3G17A 1ZGGA 2F1OA 3HB4X 4YRDA 3IAXA 1KR2A 4IQ4A 5BT9A 3DDOA 4ALJA 1U90A 4QG3A 1V3TA 1Z68A 2D7JA 5TLSA 1T29A 5JQGB 5K0TA 2CLMB 2ZUWA 1KTVA 1G7RA 1KMNA 1F0PA 3CN9A 4QLBA 1ZGCA 4I50B 3EW9A 3C1AA 1L7EA 1NBME 2IUYA 3EZYA 3QEKA 1OR8A 3WE7A 3EIHA 2QR3A 1E9DA 1SXGA 1V8OA 1F20A 3I1FA 3QHQA 3Q0TA 4AY6A 2Q5LA 3P5SA 3EXG2 2OV6A 2NT3A 3V4LA 1U2RA 4KITB 2F1HA 3DM5A 3MB5A 3DF9A 1JLLB 3LU1A 1E62A 1GA4A 3U9SA 2H0AA 2LDXA 3HJTA 4OLBA 3WDSA 4OO3A 2FN9A 3SZLA 3WWYA 4L8WB 2Q2QA 3X2EA 4A27A 3ZCSA 2JAXA 2Q4DA 1RRVA 5F7OA 1X80A 1O54A 3LPMA 3LLMA 3LYHA 4I9NA 3JZIA 5DNUA 1DDIA 5DLEA 5H02A 2YHBA 3D8BA 3DOJA 3C3WA 2AOWA 3FNHA 3NNSA 4M36A 1QUFA 5KDLA 1GADO 1ODKA 1YC5A 3R0ZA 4EIWA 4LY0A 3QWAA 3T1HB 5L3SA 3RRFA 3ZIAA 4M1WA 2DBQA 3IKTA 4JVNA 4Y6LA 3FYSA 4RULA 4AMGA 1DQSA 3L7MA 3EE6A 4MWTA 4D79A 1FSFA 1C30B 1ODCA 5J59A 2PIAA 3F1LA 3IMCA 5IZCA 1DIAA 1WHTB 1JWBB 3QEBZ 1LSJA 3F78A 5HGXA 1GTMA 2MSWA 2ZJ0A 2B1JA 2GOYA 3PUIA 4NV1A 5AXDA 4KAFA 1JS1X 2AI3A 1KI4A 5KYWA 1U02A 5A9SB 4U1RA 4BNHA 1JYFA 1K89A 5TEVA 1E20A 2PKQP 1NYRA 1SVOA 2Q4RA 4GICA 4IILA 1CIJA 5HDBB 1LWOA 2M6KA 3R9KA 3AHHA 1H6AA 3KAKA 4GLJA 2AMYA 4CGYA 1JH8A 1NJ2A 2NQ2C 3QEMB 2CEAA 4QO8A 3OLCX 1ULZA 4P93A 2IBTA 2WAYA 1PLJA 1EBFA 1RAIA 3QKRA 1LU9A 3NGMA 3MS7A 5IP5A 3FSJX 4NENB 3RGWS 4QDKA 3Q7PA 3TR0A 1EI9A 4TWBA 4S1PA 1G66A 2C0PA 3FDIA 4PX9A 2CBZA 3PR3A 1YZLA 2XECA 4EWLA 2IXFA 1WD7A 3G7SA 3ZKWA 3KXPA 1O58A 4TTTS 3QYAA 2H5JA 3MIIA 2HXGA 2P5YA 4F1KA 4G41A 5AR1A 4BNJA 4ECAA 4J0HA 2REOA 1W87A 2RH9B 4TS4A 4ZOBA 3Q88A 2VN8A 1QXSA 1L5SA 4HAOA 2FH5B 4NYJR 5H4GA 3K0HA 4OA5A 5F5NA 4ZVSA 4B83A 2J7PD 3DFFA 4C3OB 1BKDR 1OLSA 4RK1A 2GM5A 3UAWA 3ER6A 2E82A 4YYEA 4S12A 3MSCA 4IMJB 1EWTA 2GNPA 2VHEA 5F1KA 1ZIPA 3HVJA 4I99A 5DWVA 4XWTA 2Y1DA 3MWGA 3FVQA 4QYWA 4R31A 1ISPA 4YJ3B 4QL3A 4ZZ2A 4YT4A 4OX9Y 1MFPA 1RYDA 3B7WA 3EMBA 4LOIA 4H4CA 5JARA 1O57A 3TFWA 2P9ZA 1LS6A 1TO1E 1D5WA 5FOVA 4YJHB 3HCBA 3OOYA 5CYFA 3VR0A 5EKSA 2GF0A 3HP7A 2D59A 3STXA 1L7VC 1VKHA 2X2OA 4N5NA 5CJ2A 3ROTA 1CR1A 2NTVA 2ODPA 4D8YA 3OEEA 3FAZA 1UQRA 1HDEA 1QGAA 1DWPA 5EKDA 1I7NA 3ICVA 4JOSA 4S35A 1FDSA 2X0JA 5FTKA 4EFKA 1C7EA 3QITA 4MYRA 2P75A 4LQLA 5DVZA 3DBHA 4GIBA 4PPFA 4QNRA 2O5RA 3FF1A 4QFMA 3O31A 4JR2A 4NONA 4NOKA 4QLOA 4WNAB 5JMTA 2P78A 1IATA 1PR0A 4EVSA 4Z1OA 2O5EA 3K9QO 4WSOA 2PYZA 4BVGA 3B3FA 4MUMA 4V1CB 2QRGA 1I3MA 1X77A 3F7OA 4LGYA 1NLFA 4L3VA 4NATA 4EFMA 5CJJA 4N9QA 4ZT5A 4DUZB 1RZ3A 1NW9B 1ZDMA 2IIBA 1ZIOA 2QYHA 4GOMD 4GXRA 4DGSA 2ZI6A 5BWOA 4JROA 2PZBA 4H3KB 3PQDA 1DJLA 2VJAA 4MV6A 2Y2VA 3KXLA 4N49A 1EDBA 3GEDA 4TSRA 5JFGA 1UPUA 5NULA 1SXPA 2F3UA 1GNLA 2GPNA 1WOYA 3GYBA 4IUBS 3VPXA 2HMVA 3C3DA 3DS8A 3GP3A 1VJ0A 2JZNA 2JLAA 3LC1O 3PJGA 1U9CA 2HL6A 1E64A 4PGGA 3F3KA 5CB6A 4MV0A 2M6SA 2UYHA 1N5RA 2AFIE 2V6FA 2YHSA 2AKEA 4CLXA 2R6CA 3LG2A 5FBHA 3WJ7A 3WMEA 2FJ0A 5ALNA 4Z4FA 5TS3A 4QGSA 2ODEA 1OVMA 3DBOB 1DUVG 3I3SR 4AROA 3RRNA 3GFPA 1Z08A 4KVGA 1U3DA 2X3FA 1KRHA 4BC0A 5CP8A 3NXKA 5EWMA 4WOBA 3R5XA 3B6ZA 3EG5A 3FX2A 2OOKA 5ESRA 5SZJA 2PZJA 3D0RA 1ORVA 3G8CA 1W0JA 4FNAA 5DTRA 4R1NA 3NAZA 1XU9A 4QFBA 1R6VA 1HNZB 1Y3BE 4X6XA 1GRQA 3U3DA 5LZ9A 3HDVA 2QVCA 2VPZA 1NG9A 1ZK3A 1H94A 1PDVA 1OFUA 2J0UA 3CONA 3HGMA 3ZU3A 3RHFA 2CSXA 3GARA 1FTQA 1SBHA 2E4ZA 2FSHA 1VYHA 5A5FA 1MDBA 4L2IA 2QJRA 4EHIA 5TXGA 1XEWY 2OHXA 3EUFA 2JI7A 1NRJB 5FYQA 1J1IA 4A91A 1VL5A 3PEFA 2J9RA 4GPIB 1UJCA 2F1RA 1I0LA 3CPSA 2W42A 2QHXA 4OD0A 4WKBA 1U31A 4CU5A 3E2IA 3N86A 3PE3A 1UKZA 5LYYA 1LPPA 1E9FA 1IZ9A 4TWJA 1ZM7A 4E4YA 3FPBA 1UXHA 4HI0E 1KJZA 3JQRA 2QTZA 3U49A 1VHTA 1JW9B 2IGBA 3WXBA 2FZLA 4YRIA 5BVGA 1E2GA 1EUDB 1FNDA 1OMOA 3OF5A 3Q6NA 5A06A 5G4KA 3V8VA 4PQGA 5LP6F 2C9MA 2WJYA 1V48A 3W5IA 1E4OA 4IIFA 3RVDA 1GTSA 2J08A 2A58A 5FPTA 4JUAA 1DINA 5EWJB 2MYTA 1GCUA 1SC9A 4AS3A 1NQTA 4MLCA 1I1NA 1Q1NA 4KXNA 4UVEA 2H16A 4YP1A 5MGNA 5KHAA 1GPWB 3MFYA 5DEIA 5JYDA 2XOXA 1KORA 2WINI 5E1MA 1SUDA 2Z98A 2GWRA 5AI8A 4E7PA 3EC7A 4RSHA 4BGUA 4DSAA 3U56A 4NJEB 4RORA 5A0VA 5HS6A 2HTFA 3GW8A 3O8BA 5HQTA 1RLOA 4HMPA 1XVIA 1UC5B 4BVFA 2ZLBA 3TAXA 1E6EA 3C4JA 4MPJA 1RFGE 1K2VN 3LY9A 4JOQA 4U2EA 2B5WA 4V0ME 2AMLA 2MYUA 5F1OA 4IO1A 2PH5A 4KQJA 4QELA 2WJ3A 2ZB8A 5HSGA 4ER0A 3G9XA 2C2MA 3H1GA 1C1XB 3GB9A 3T6KA 3V6MA 3EH1A 4PPGA 2Q8QA 4RJ2A 4QOJA 3ZI7A 2ZYAA 2DTEA 4FFNA 4MV5A 3KSUA 4OM8A 4DREA 1AG9A 1FK8A 4JC0A 1KRXA 1KEZA 2VC2B 4U5QA 2FHPA 3EG9B 3G8BA 4M98A 1E2BA 1U3CA 4ZI7B 1WSBA 3EGCA 1C9DB 3Q72A 1GTRA 2OT3B 1EHYA 4L50A 4EB6B 3AESA 1VJTA 3FWPA 4C05A 5IN4A 3O47A 5LD2B 5CFQA 3R8XA 5JMWA 3SVLA 1XTTA 2DRIA 2FOXA 3IVXA 4FYIA 4KRYA 1XPOA 4FEYA 2HJRA 8LDHA 2WSMA 3WP0A 2PUWA 2QRLA 3A26A 3TB4A 1DWQA 2YWHA 3E7FA 1E79D 5K6RA 2YRXA 2ATVA 3BBPA 4BBZA 3E9NA 2XY4A 5CNJA 1MJFA 4S2UA 1VZ3A 4ND1A 5LKRA 1XKXA 4MQFA 5ECDA 1FDOA 4AY5A 4QDUA 1R0KA 5SY6A 3JR7A 1PJ4A 2WHPB 3G23A 4LKOA 1VBNA 2X15A 1PG2A 1ND5A 1Y7LA 1H5UA 2V7WA 3G5LA 3IGFA 4AMYA 4C3VA 1CEEA 3DHYA 1M8GA 1R74A 2WJVA 2BFCA 2XIQA 4FR0A 4REOA 4JP2A 3KZVA 3I23A 3WLTA 4XA8A 1NSFA 1H9BA 3FLMA 4BC1A 1HEUA 1DG3A 1IY2A 4H7KA 3I9KA 4IR7A 5DN9A 3I2JA 3GRCA 3WKAA 1MT3A 4E2WA 4JB8A 3LQKA 3LHKA 2VBCA 3FTEA 2BTQB 2EC5A 4P0PB 3Q7EA 2D5AA 1XTSA 2GZSA 1W76A 1M3SA 1L5YA 3B70A 2F4VB 3WJ2A 5A5EA 2XMPA 1YJ5A 3GLRA 2F43B 1YONA 3B9QA 2QUKA 3OFVA 4RPGA 3UAVA 5BVHB 1AXEA 2ZDGA 2XDAA 2UZ0A 1KVTA 5C7IO 4Q1VA 1TZCA 4EHKA 3ZUPA 1UKBA 2QLFA 1YK0A 1JEOA 1BXGA 2WSYB 3FDXA 1C1YA 1I6LA 2HSWA 3CT4A 1JEQA 3K4QA 1GZHB 4G5SA 4KFTA 3WGKA 4CM1A 4BLUA 4F3KA 5JCOC 2O54A 3A1SA 1INLA 3THWB 1F0YA 2ZYDA 5H8WA 1B6RA 4MINA 2ID8A 5AW4A 1RZUA 1DKLA 3UENA 1TTTA 1J2EA 2GEJA 1U7UA 2SHKA 3CE6A 4MI3A 2HQOA 2I3AA 2I99A 2RB5A 5L8VA 4BQIA 1UDWA 4WLFA 3GL9A 4FCTA 1XCMA 2FCRA 3SLKA 4F5DA 1DT5A 1NW8A 4AO8A 3IDOA 2QEQA 1MABA 3K0KA 1NOIA 3UG7A 2JLWA 2SKCA 1GUAA 2JNWA 3I9V6 4NF2A 2E6UX 4JWTA 2FK7A 1Y4ZA 1G8SA 1R10A 1SC1A 3WNVA 1I5EA 3CUWA 2CWDA 1N92A 1QHHB 3PFNA 2OZVA 2I6XA 3IJPA 3DLAA 3Q4GA 4K87A 3PXCX 3FCUB 3ZY4A 1U7DA 5EZQA 2HHHB 4LK3A 3I05A 3U16A 1VKOA 1U98A 2MSDB 1FP1D 1PT9A 2H06A 1WIWA 5IUJC 4H0NA 1EFHA 3GF4A 1RHUA 4ZQFA 2Q3HA 1WOMA 5COQA 1OFGA 4TV8B 2ZP1A 5HUJA 2C2ZA 3WISA 2BR4A 3JASB 5EE0A 2EJUA 1QG6A 3LQ2A 2Y1GA 1QCDA 1RWBA 3QRWA 1XMJA 3STYA 2IP4A 4NCKA 1GL9B 3DLPX 2RK6A 4OMCA 5HXAA 4ZVUA 5I47A 1SVUA 3KE9A 3MWEA 4A6EA 1MG5A 2NX2A 2WNHA 4NJMA 4BX0A 3ESDA 1AZWA 1JN0A 2HA4A 4LYGA 3FAKA 2B30A 5KVVA 3CZ5A 4QREA 2B8JA 4QYTA 3ZNPA 1HT1E 3DOHA 3IOYA 5GAJA 4XSGA 3TWOA 1N8TA 4R16A 3U6KA 2PU7A 3N05A 1Z29A 1E6UA 4Z0PA 4LF4B 1OWMA 2WICA 1QFSA 1HLFA 1TKAA 1VIYA 3R3VA 5D3MA 4ZYLA 3T61A 3C3XA 2Y71A 5AW7A 4PIPA 4X60A 4COOA 2J07A 3GH3A 3NETA 1RYZA 4S1WA 4C04A 2QXUA 2HB6A 2X8AA 2BRUA 2VSQA 2KPOA 3FCSB 1WDMA 4MP3A 5EWLB 1T9CA 1IJFA 2PCJA 5TMDA 1Z5GA 3PDJA 5LDHA 5LLDA 4MPRA 2B8TA 3TE7A 3LECA 1LBHA 4ZJPA 4P5DA 4HX5A 4AKSA 3PRHA 4H7JA 4CCAA 1RC0A 4EJSA 2C29D 2ZIEA 4OL0A 4M99A 5I6DA 5JWOA 5C52B 3ZWOA 4IFEA 5IT4A 2ID9A 2P9JA 3OH8A 2A88A 3N2YA 4AZ0B 1TTQB 4KO4S 4IHAA 2RGUA 3A6LA 3JVEA 1PJAA 1T8TA 2D2XA 2OHJA 3PGMA 1MA0A 4Z4GA 3BMOB 4GI2A 3UMCA 1M1YE 3FOEC 2JAHA 3KJEA 3H2HA 5CDUA 4TWIA 4LFBB 4RHUA 3OURA 2D0OB 1PLLA 4HTAA 3K0EA 1A8UA 4BMPB 1D5CA 1WUKS 2JJYA 3WGYA 4OFBA 1NOJA 4IDCA 3DFKA 1URPA 2DTDA 4KSYA 2OQRA 3WKEA 3TK1A 3E03A 1GAQA 3OZRA 1GG2A 2ZBFA 4ALMA 2H1VA 3SDZA 4N39A 4UNNA 1HTTA 4EHHA 1QYCA 5KNLA 2GCIA 2OFPA 1FL9A 2QXTA 1E0DA 2OK8A 2YXLA 4Y2YA 1R50A 1TVEA 5NLLA 3T3OA 1W46A 3AM4A 3D7NA 2YX1A 2WHRA 4F96A 1ODLA 1ID1A 5EHXA 1ZL2A 2WU8A 1Y3IA 3OZVA 5EKXA 2Q9AA 1W29A 4J1TC 3TPZA 4DZTA 4LXIA 1CUHA 2OM2A 3MWYW 2GPAA 1Q1ZA 1PTKA 2BR3A 4RESA 4EO4A 3H5WA 3Q85A 4F2HA 1M8JA 1B8VA 5ICEA 3OPVA 2VFAA 3SXUB 4MI9A 4M53A 1G4UR 4RD1A 1C4WA 4QVIA 2I3DA 3FDZB 1DCMA 3ZQ6A 4OQZA 2AXNA 4YDHB 3ADCA 5KSOA 2GEKA 1NY6A 3KQVA 3VDQA 1I9CA 4UAGA 1QORA 1EJBA 1RSZA 3FUUA 5GONF 1U1IA 2ODBA 2W00A 1P2TA 3Q6MA 3U7EB 4Q00A 4EX6A 4KVAA 3AY6A 3CJRA 2QVBA 3E18A 2XLCA 5IMBA 2A1TR 3N7TA 2VYCA 4LOHA 1JI0A 3D8UA 3O1LA 5E0OA 4XVHA 4KNYA 1CY6A 2ALJA 1N6LA 1UK9A 1ZOSA 2CE7A 2DQZA 3KWFA 3NWOA 2QW1A 1VJ1A 2XRYA 3VDXA 4EF5A 4YQFA 3P9YA 4EEKA 3EDMA 1BRMA 4HNQA 4AG6A 1HL3A 3DC7A 4WK6A 2YXBA 4FYJA 4CDGA 5DBFA 1E9AA 1HFWA 3MMZA 2OEPA 2R6JA 3GHYA 3KJNA 2Z6VA 1KF0A 4YV0A 5TB5A 3B2NA 3EVCA 2A0WA 5JW6A 3LC0A 1Z88A 3MNFA 2YVKA 3G0BA 1UBUS 3FLBA 4M0LA 4CZ2A 1LLQA 3B6EA 4HB0A 5BQ3A 3K6SA 4QXMA 2QY6A 1CFZA 3LQFA 3TR6A 4B2IA 1FDWA 4OU5A 1SBQA 1N78A 3AR6A 4QBGB 4QUGA 2IT1A 1FBTA 2RKWA 4QKQA 1WXIA 3K30A 2JGAA 2VQSA 4CM7A 1XLUA 4YXWA 1TNDA 1FQOA 2FOLA 2XCOA 2B8WA 4Q15A 3E4CA 1BYIA 4UU7A 4AKIA 4K3VA 1REQB 3F3SA 1KP9A 3NC0C 3RAPR 3SQLA 1OOEA 3I61A 3THXB 3B82A 5CHEA 1QIKA 4P3OA 1UEJA 3ZWBA 1YQTA 3UV7A 2H85A 3I1IA 1VCNA 4F85A 4UBLA 2E4YA 4EQZA 4WXPA 2PKYX 3ANYB 5HILA 3NHJA 4TN1A 3EFBA 1W94A 1NJ5A 3CZ9A 4TVSA 1CR6A 5BYKA 2P6NA 5KTRA 3GLFE 4DANA 2FZ4A 3E1GA 1MQAA 2TSYB 3W4JA 1CJMA 1R88A 1RVV1 2AFRA 4FOTA 3ZCQA 4AYTA 2R1ZA 2JC3A 3PC8C 4M7RA 1YMQA 4IXTA 2CKMA 3ZXYA 3ORRA 3PGJA 3D3EA 4MWEA 3HXKA 2YHAA 4JEUA 4FOLA 1T3TA 5F2KA 2NUTA 3SM9A 1QCYA 4PYNA 3NJ4A 1DKOA 3X1ZA 1NKVA 1WP4A 3GEBA 1JFRA 1J9GA 1ZS9A 4Q4JB 1QO0D 3QKUA 2CWWA 3E9DA 4MIKA 3OZDA 2I7TA 2D1FA 2BGIA 3GLHE 3R75A 3TAUA 3T7RA 1W581 4A73A 2OGUA 1IOVA 1CF2O 4V0LA 5IANA 3EX7C 1JKXA 1M75A 3PUZA 4UJ3A 2Q0XA 3TF5A 3NDBB 2G04A 3GLGB 4DCTA 2FUKA 3LIIA 4GPBA 2ZTMA 3IMKA 1KEUA 3GLIE 1H65A 2YHIA 2GZRA 2EEZA 3SJCA 4BNUA 1O1YA 2H8GA 3UMGA 1ZWKA 1KAGA 5DKFA 2Q3MA 1T2NA 3LY7A 5G0UA 1J0XO 2COEA 4GR9A 3WMRA 4CG3A 4EGJA 3RVQA 3CVVA 1P3JA 1N7IA 2B82A 1PFKA 1X1RA 3WAGA 2JD2A 2YRWA 1X94A 1YZNA 4Z9BA 4C76A 1XNRB 3PL1A 4KIFA 5CX1A 1WKCA 3T0GA 1XRJA 2YV2A 3QWBA 3N7AA 5CVEA 2ZRGA 6NULA 4I6GA 2OZEA 2ZRCA 5EHQA 2QDXA 1NP3A 4ID9A 4M9CA 3WLQA 4KFCA