2PZAA

Nad+ synthetase from bacillus anthracis with amp + ppi and mg2+
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
279
structure length
279
Chain Sequence
MTLQEQIMKALHVQPVIDPKAEIRKRVDFLKDYVKKTGAKGFVLGISGGQDSTLAGRLAQLAVEEIRNEGGNATFIAVRLPYKVQKDEDDAQLALQFIQADQSVAFDIASTVDAFSNQYENLLDESLTDFNKGNVKARIRMVTQYAIGGQKGLLVIGTDHAAEAVTGFFTKFGDGGADLLPLTGLTKRQGRALLQELGADERLYLKMPTADLLDEKPGQADETELGITYDQLDDYLEGKTVPADVAEKIEKRYTVSEHKRQVPASMFDDWWKLAAALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords NH(3)-dependent NAD(+) synthetase
publication title Structural adaptation of an interacting non-native C-terminal helical extension revealed in the crystal structure of NAD(+) synthetase from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 111
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 6.3.1.5: NAD(+) synthase.
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2pzaA00
1N2IA 3C8ZA 2QTMA 1O5TA 1PFWA 1N77A 2A1UB 4EFKA 1ULHA 3GUZA 1U7DA 1KKUA 1WXEA 1VBNA 3QTBA 2A84A 2V0GA 3DPIA 4J76A 2XRYA 3H99A 2H29A 1M8FA 2J4DA 3FHJA 3CVYA 4XFJA 3D6VA 1K4MA 4X0EA 3IOEA 4KPUB 5KWVA 3RJZA 1N2EA 1OWPA 3HMQA 4MULA 3P0JA 3RHSA 3U1VA 3VGJA 2QUKA 1KP3A 1TYAE 1O96B 1M8KA 1J70A 1KP2A 4EG6A 2ZP1A 3COVA 4MW2A 5TEVA 5K0SA 1MAWA 3TZLA 4KR6A 1ZH0A 1LI7A 4E1AA 4PBSA 3KT0A 2X1LA 1YUNA 3P0HA 1NUQA 4JYZA 3ZJUA 2CFOA 1TYBE 1B6TA 1O97C 3IMEA 2H2AA 1F7VA 3IMCA 1COZA 1UFVA 1IFXA 2E21A 2QTRA 1N2BA 3AG6A 3FDXA 2QTNA 1KAQA 2QUIA 1QRUA 1O6BA 1M8GA 1OWOA 1H3FA 3FNRA 2CUZA 3IUBA 4MVCA 1XNJA 3FG9A 3COWA 4G6ZA 2GM3A 2J5BA 4U7JA 4F4HA 4J75A 5H16A 1GN8A 3GMIA 4DDKA 3MLBA 5DK4A 3N2YA 3AIIA 4DE5A 2HZ7A 2X0KA 4ND6A 5HG0A 1K92A 1V8FA 1GZUA 3OP1A 4Q16A 2PZ8A 2YWCA 2D54A 5J59A 1WY5A 4MW0A 3HGMA 2NZ2A 4L2IA 2PIDA 3Q10A 1YUMA 3A04A 3MMXA 1WJGA 1O0CA 1GTSA 2DEUA 4MUIA 3A4IA 1WXFA 4R0NA 2JA2A 1QJCA 3AG5A 2EJCA 3MUEA 1JIJA 3DO8A 1WKBA 3CVUA 2AKEA 5DB4A 5KCMA 1P7PA 4OJMX 1N1DA 1VL2A 1PG0A 2CSXA 1O96A 1WXGA 4GRIA 2G36A 5LM3A 3TQOA 3QE4A 4WSOA 4UZEA 3FOCA 3G6KA 1ZJWA 1O0BA 1EXDA 1TYCA 2Z08A 4A91A 1G59A 1M8PA 2DXIA 1NP7A 1GAXA 4ZCRA 3ELBA 3SZ3A 4EGAA 4EG5A 1S4MA 4MW5A 3TNJA 1JIKA 1H3EA 1OBCA 1X8XA 3FH0A 4Q93A 2CT8A 1O95C 3Q12A 2B7LA 1JEEA 4L2IB 1JGTA 2C5SA 3OTWA 1U3CA 3ZJVA 3IUEA 3UMVA 2IJGX 1N2JA 1G8FA 1IQ0A 3NBKA 3M5WA 3Q4GA 4G5YA 2DERA 1EJ2A 4DDMA 1PFUA 3A2KA 3KT6A 3TQIA 1NUPA 4HJRA 2XRZA 3N05A 2QJOA 4ZT3A 2CYBA 1G8HA 1QU3A 1KR2A 4DJAA 2HGZA 1XJQA 2PZAA 2J07A 2NSYA 3BL5A 2CV0A 3PNBA 1O95D 2QUJA 1LI5A 1NZJA 1MJHA 1JEDA 4ZCQA 1YIDA 3N9IA 4QRDA 2GKSA 3IOBA 4ARIA 4CQNA 3CR8A 1GTRA 3AFHA 2VXOA 1QRTA 1K97A 3ZXIA 3ZIUA 4MWDA 3E27A 5IHXA 1HYBA 3RK1A 1EUYA 2OV4A 4YP5A 5HUJA 4TS1A 1EUQA 1QNFA 1FYDA 4YBRA 1Q19A 2HMAA 5TEWA 2GOYA 1IHOA 3IDFA 1TEZA 4NATA 5TS2A 3CVXA 5FO1A 3F3MA 3H9BA 2WB2A 4ZT4A 1J1UA 4I6JA 1XNHA 4MUEA 1T6ZA 4XFDA 4R2MA 2Z3VA 2IP1A 4FZJA 3X1KA 1IQRA 2CV1A 1JIIA 4JZYA 2D13A 4YMIA 4JFAA 2QUHA 4ZCSA 2CV2A 2I1LA 4PBTA 5BNZA 4AQ7A 5J5AA 1ILEA 1MOPA 1T6YA 1EFVB 5H7XA 1SURA 1QQTA 2CYCA 1H1TA 2R5WA 4KR9A 1T9GS 4XSVA 1QRSA 4KKVA 4QBTA 1I2DA 3P52A 1U7XA 3PNYA 4EG8A 4JXZA 4AS1A 1X6VA 1LW7A 3DV2A 3UY4A 3PNVA 3MXTA 2A4MA 5KHAA 1KQNA 3ILVA 4BWVA 1DNPA 1NUTA 4KR7A 1D2RA 1G8GA 4MWEA 2AZXA 4HK4A 4I6EA 3LOQA 3UOWA 3IOCA 5K0TA 1MAUA 4HJXA 1PFVA 3ZUGA 3FWKA 4GU5A 3S3TA 2TS1A 1KORA 5TGTA 1R6XA 1MB2A 1N2HA 1KH1A 2CYAA 1EE1A 2DUMA 3ND5A 3P0IA 4NAUA 1R6UA 1Q11A 4CDMA 2JAXA 2ZUEA 1VBMA 3SEZA 3FY4A 2YXNA 3TZEA 3CLTD 4MW1A 1M1ZA 4NDAA 1WQ4A 1YIAA 2A1TR 1F4LA 1NYLA 2PFSA 2J09A 3DLAA 4MW4A 3N8HA 3SZGA 3TS1A 4R2LA 1A8HA 4U63A 2YWBA 3ZJTA 4I6GA 3I05A 2E89A 2A7XA 1OBHA 3IVGA 4YP7A 3FETA 4MAFA 4ZT2A 1Q15A 3G5AA 4MVXA 3VRHA 3RFFA 1QTQA 2A1TS 3CVWA 4MLPA 4MUHA 2BTEA 3AKZA 1J09A 3ND6A 4MUFA 1Y42X 3AL0C 1J21A 1ZUNA 4RPIA 3IH5A 3FIUA 1M83A 2E18A 1TYDE 1EFVA 2V0CA 4ZT5A 3VU8A 1OWNA 2X1MA 3KFLA 1I6LA 1Q77A 1JZSA 1YI8A 1WXIA 3IMGA 1IQUA 4YP6A 3UK2A 1IRXA 1T6XA 2O8VA 1WOYA 4OUDB 1R6TA 1V47A 2WSIA 4MQ6A 1I6MA 3G59A 1NUSA 1KAMA 5JBNA 1F7UA 1U3DA 1ZH6A 3KT8A 2DLCX 1KH3A 5LLTA 5LFAA 1GPMA 2YY5A 5IJXA 1N78A 3SYTA 3X1MA 1RQGA 3ZXSA 2D5BA 4H3SA 3HFJA 1WZ2A 4RUKA 3ZGZA 4ZT6A 4ARCA 5EKDA 3LCJA 2AG6A 1F9AA 1PG2A 4QREA 1CT9A 3SDBA 4UZFA 1PFYA 1N3LA 2A88A 3H05A 3NBAA 3NV7A 1TFUA 3UC5A 1T9GR 4EF6A 2WQ6A 4DDHA 4MVWA 2BYTA 5AHWA 3X1JA 4MW7A 2EL7A 1O94C 4ZCTA 1MBZA 3D6UA 4K0RA 1FFYA 2QJTA 2PG3A 4MW9A 5DASA 2IELA 3CVVA 1EFPA 1JECA 2O5RA 2ZUFA 2VTBA 1N75A 3CLRC 4ZCPA 4EG4A 3INNA 1K4KA 1YULA 4PBRA 2DETA 1NUUA 4MWBA 2J08A 3CLSC 1N2GA 2Z09A 3ISJA 3SEQA 1KH2A 5FO0A 2QJFA 4EG3A 2PXHA 4NZPA 4MWCA 3IVCA 1JZQA 3LE8A 1J1ZA 3RBAA 3L92A 4MW6A 3SP1A 4PY2A 1O97D 1O94D 3RK0A 3CLTC 1VBKA 5J58A 4NX2A 4EG1A 2X3FA 4DNXA 3K32A 1IVSA 2DPLA 3KT3A 4F3RA 1N2OA 3QTTA 3CLRD 1OWLA 4CT0A 4WNYA 2OQ2A 1KQPA 1MB9A 2JANA 1VLHA 3CLSD 2A1UA 4DLPA 3JXEA 1GLNA 3IODA 1NURA 4OUDA 4U8HA 1U0BB 3CLUC 1KQOA 1IH8A 5HUHA 3IVXA 1QU2A 3PXUA 1JHDA 1H3NA 3H97A 1JILA 1MC1A 4KPUA 4S1OA 3COYA 4JXXA 5DEOA 1NSYA 3CA8A 4HPWA 3L93A 1EFPB 4MUGA 1J20A 5F23A 1WQ3A 1BS2A 2VTBB 1XNGA 4CDNA 1JMVA 1OWMA 3ND7A 3HL4A 2WQ7A 4MUJA 1NI5A 4ND7A 1OD6A 4K03A 3CLUD 1WXHA 2RD2A 4MUNA 2DR2A 3COZA 4P2BA 3A05A 2A86A 4EG7A 2E0IA 1TQ8A 3PRHA 4MUKA 3MLAA 4NAHA 4G5FA 4ZT7A 3FI0A 3GLVA 3HV0A 3HZRA 3K9WA 5FNZA 3H9CA 1I6KA 1M8JA 1MRZA 4MVYA 2PZBA 2RE8A
chains in the Genus database with same CATH superfamily
1U81A 4EGCB 5KCZA 3BOSA 5IWAB 4NYMQ 2Y05A 3PQ3A 3ROXA 1FYEA 3QJYA 1MFZA 1B76A 4O4LB 1C8BA 3PXGA 3V6MA 3U49A 1W8IA 3K1TA 4IFIA 2VPPA 3SZRA 3P1JA 4G5RA 1HKHA 3I6YA 4CETA 3SYNA 4R54A 2OILA 3NPAA 3KR0A 2VYND 2RMKA 4CQMD 4UNRA 2OK8A 2IRWA 3HKDA 2HQRA 3WKBA 4BB6A 1DKPA 1M7GA 1Y37A 2NTVA 4Q4LA 4W8GA 4YUVA 1WA5A 4A23A 1PF7E 1L0BA 4C2AA 2F3TA 5IANA 4QG3A 2PT9A 5EHQA 4FDMA 3NDJA 3U7QB 3IDZA 2D5AA 1TK2A 2XF8A 5U1PA 1F2DA 1CWUA 3T94A 3VGJA 1CB7A 3WNCA 4DBLC 1KI6B 1K5HA 1XG5A 5FBWB 5FUWA 5AUOB 3BKWA 3CY6A 3FFXA 3IAS6 2I6XA 3BB1A 1N6PA 4OP2A 1YCGA 2CXXA 2CXPA 2Z6VA 4C4TA 4D9JA 1LI7A 4LFAB 2YWEA 5TQ2A 1GPWB 3O4IA 4ZXPA 1IY0A 1LPOA 3NXKA 3Q0IA 3QIAA 5EE3A 2VNSA 3VFDA 1UODA 2AG1A 1JAYA 3R5KA 4FKMA 4A8HA 1FYWA 3IAHA 1HT2E 3HR4A 9ABPA 2C4MA 3F90A 3JQCA 2D7CA 2UZAA 2ZW9A 4V38A 4XRRA 2XZLA 1YKGA 2R751 5DTRA 2HHAA 2OBFA 4JMLA 4LYDA 3IMEA 3NCTA 3S1AA 3TTYA 4EKIA 4KBYA 3HCPA 3OLCX 4W7HA 1JI0A 1ZKMA 1JXQA 3IMCA 3UB4A 3CUKA 3OT1A 5T4FA 1IFXA 1R0SA 4OQXA 1QIDA 3GMTA 3JVUA 1EK1A 3LDGA 4BVHA 4Z2AA 2JLYA 5MFPA 3BF8A 4LNUB 4NZMA 1LPNA 1QRUA 1NVTA 1ONOA 2OMEA 1M8GA 5DVZA 1RAHA 3HPQA 4B4WA 3IT0A 4BUJA 1SCAA 4IDQA 1XNJA 1FZQA 1SCUB 3AB3A 1UKBA 2J5BA 2O4CA 3RR2A 1UBOS 2CJFA 2EQ5A 3ABRB 2FZLA 3JAWB 3HN6A 3P97A 3C6QA 4J75A 1MORA 1T0HB 4HH4A 3EGXB 3I6IA 3EBOA 3O21A 4CYMA 4DM3A 3IAEA 3EVGA 3ETHA 5K6RA 2FEKA 3AFIA 3KOWA 3L6RA 4Y2GA 2HZ7A 1TIKA 1CUJA 1OKKA 4ND6A 4YAWA 2IYAA 3GDOA 3UWMA 1QKIA 1JFFA 5EIBD 4D43A 4UFPA 1TGVA 5GJBA 2G76A 3AX6A 3HBFA 3MSXA 1JKXA 4PX3A 4Y9SA 5FPSA 3TNDA 1AXGA 4IXWA 2QUBA 2HWUA 3KVRA 4RKQA 1RZRA 3PNLA 3GUVA 2C5GA 3KSZO 2R11A 5E9WA 2H1OA 5K45A 1CUSA 3RSOA 2JFWA 4B0OA 4Q7QA 4AUNA 4G1UC 4C30A 3R7DA 3G49A 3H87A 1W1WA 4LOIA 1HYHA 5EJ2A 2ES4A 3RARA 1LPAB 4MMXB 3I4CA 1JS1X 4GPIB 1H9CA 3U7IA 1ZC4A 4OIMA 4Z4IA 4ARBA 3CT6A 2E4ZA 2LCFA 3K0CC 1NNLA 2WOJA 3AEKA 1RRCA 4G81A 1AQUA 1ZGHA 3MUEA 4PR0A 4KO2S 2R9VA 1PK9A 2UYHA 3ZG6A 2PAAA 4YRRA 4CKWA 5EIEA 1H1LB 3L07A 2E4XA 1O6FA 3R0QA 4GWLA 4NV0A 2RE8A 3E1KA 3LO8A 5F35A 5B5SA 2BFDB 3DAYA 5IYZF 1Z0SA 1ZH2A 3FCEA 3SR4A 4B3BA 1LSJA 3OAAA 3PNOA 2H5IA 5LMUB 1ZKDA 5DLPA 2NO1A 2HA4A 5C5EA 5BQ5A 5IKOA 2C31A 4NYJR 1YB5A 4N0EA 2BR5A 1DKNA 4RSRA 3D8RA 5ECYA 2BE9A 3Q3JB 3A0RB 3LNTA 2V65A 5AIBA 3N2NA 2I8AA 5CM2Z 4D44A 4JBHA 3SF0A 2HRDA 3QNMA 1HPLA 1M6YA 4EJSA 4QOFA 1S2LA 1P5JA 4F60A 3ZZ1A 4TQUS 4I3HA 5FDFA 1YE3A 2GFQA 5LZ7A 1N7HA 2IZ6A 3H0KA 2FWJA 2NO7A 1F3LA 1WS6A 3AHCA 5E4FA 1VDZA 3B2EA 4LSMA 1Y3BE 1KK1A 1PL7A 1PTJC 3K9GA 1CP2A 1U3GA 2QQFA 4AX4A 3ZJVA 1TRHA 2DFPA 4P3OA 2UDPA 2IJGX 8GPBA 2ZBDA 3AUFA 1XD2B 4M1OA 5E6RB 3KJIA 4ZYVA 2J48A 5AK3A 3AF5A 4BLRA 1PFUA 3D0KA 4Q82A 1DAEA 2QXTA 3NAMA 4MJXA 4R9UC 1T5OA 1FXUA 2Q99A 1NUPA 2XB6A 4A2WA 2QJOA 1QF9A 5A7HA 2ZRIA 1Z6ZA 3LVRE 4LOLA 3KJEA 2CW5A 4G8BA 4YJFB 4EB0A 1C7ZA 4QOGA 4J7XA 1KO5A 1QXSA 4CM8B 5D3QA 3GLSA 2D0PB 3NKLA 1O95D 4AKGA 1U63A 3TM5A 3G0DA 1C1XA 1HQDA 1T0UA 2VRNA 4AMBA 1JI3A 2CNWD 2G9ZA 3CG4A 3OFJA 4O4IF 1R0CA 1B93A 2XSZD 5LQAA 4EYGA 3BJZA 5KYWA 4KXQA 4WCDA 3DUFB 2B4YA 3NWOA 3ZV3A 2YXBA 3I01M 2Q2QA 2FMIA 2WLSA 2HV8A 2P4SA 4B82A 4B76A 2B35A 3H2SA 3MZ0A 3RKRA 3R23A 2BM1A 3MELA 1HYBA 1JN0A 4FR0A 1EUYA 5DZSA 3V8QA 4E6EA 3OPQA 2IHUA 5IW8A 4MKZA 2G1JA 3TMKA 1V1JA 1G16A 3IT2A 5F98A 1T10A 3QLVC 1IONA 2ZBQA 1VMIA 3BRSA 1ZU5A 1NBWB 3B7WA 4JJ7A 4YQEA 1E5XA 1DEKA 3ZHSA 4E32A 2BSQA 3BMCA 3I6MA 1VL5A 3ZXXA 5CG2A 5FBVB 1WBDA 3D4IA 3O73A 2K2WA 4WERA 2W2MA 2AW5A 2II6A 4UCWA 4UHDA 3VR5A 3EXEA 1NYRA 2Q1XA 5JCJA 5JD3A 2DP4E 5FO1A 1C2YA 5KQPA 4NCXA 3U44B 4A8JC 1FP4A 1P4SA 4EF4A 1XQWA 2OC4A 2R47A 1MVOA 1ULTA 1XNHA 3U7JA 1H2RS 1N6IA 2OC9A 1R0LA 3HFGA 3MS4A 4B74A 3NXSA 4Z99A 1RYFA 3RROA 4KO4S 1RXEA 1RFGE 4PC2A 1P0MA 4LHXA 3GBVA 3WZMA 5U9CA 2J3EA 4JD5A 3U4GA 4KW7A 5ADVA 4KXWA 1F5NA 3PJGA 5GM2A 3KB8A 5EXSA 2CJPA 5KMGA 2Q1TA 4YLGA 5A71A 4YRBA 2QRZA 1S2DA 3ICWA 5CCEA 4LYYA 3Q40A 3W5AA 2WSSA 4FE4A 5C53B 4AZVA 5A9SA 2EFGA 2VDLB 5HZKA 3U56A 4XSVA 3ME5A 3FAZA 1FJHA 4TZ6A 1D2NA 1EXVA 1G21A 4Q4AA 3THWB 5B58C 1QCDA 4XEUA 1MEJA 2OBLA 3RQSA 2FDCA 2XHEA 1HNNA 1T36B 4HBGA 2XGSA 4MV0A 5UKDA 4AY3A 3V4FA 3DL7A 2GO7A 4AS1A 5K3BA 3CF0A 3BAZA 4G0XA 3IKJA 1IM8A 1VTKA 2YDYA 1IZYA 4UNNA 3WNDA 3DMTC 3D7RA 2G80A 2QD5A 1J8FA 3V7FA 1JPNA 2HMTA 4GLBA 4MWEA 3UXMA 4S12A 1YFZA 1GILA 2FR1A 1NJSA 1TLFA 2A1IA 1QQ5A 1LS6A 4YPFA 2Q8PA 3ZQJA 2OFPA 4FGUA 4UM9B 5DF1A 1ONSA 1IY2A 3RIYA 3EW7A 1MZPA 1A9OA 1CDZA 1ML3A 1UH5A 4CV1A 2C9BA 1OLUA 1PJRA 1YDHA 4KRYA 5DHFA 4BPBA 1Y9EA 5AXBA 1YMQA 2WYUA 3RFXA 1LFAA 2O9JA 2EFDB 1K2WA 1LSUA 1RPJA 2VP3A 3B82A 3ODPA 4OK6A 3K3PA 4P3YA 3AKYA 3OLWA 4MI6A 4R6XA 3ZWOA 4Q3BA 4Y9DA 1WVMA 1GGJA 2BZ0A 1QCZA 1CUYA 3TF5A 5I7HA 4RD3A 1E63A 1IUNA 3LT4A 4RGYA 3V4OA 1PT7A 3RQIA 3VJRA 1CKEA 2PKCA 2V7PA 3A7DA 3DBHA 3I6BA 4XGRA 5GP1A 5LOVB 4NDAA 4QEDA 2QR2A 3ER6A 1P0PA 4PHHA 1E4VA 2W90A 2YVLA 1ZJZA 2P27A 1W93A 1CIPA 2E7ZA 1IBCA 2HDOA 2JAHA 2PFSA 3BXOA 3HKCA 4RF4A 1PJBA 4AURA 4ZYLA 1G4UR 1OR8A 1V7PC 1X74A 3OE5A 3CM0A 3VKHA 4EKEA 4K6FA 2F8LA 1CV2A 1QBGA 3TB6A 1NHGA 3JYOA 1DXYA 3HO6A 1XV5A 4CQJA 2IYRA 4QT0A 2AS0A 1W85A 4ENPA 4HNUA 4ISCA 4NCNA 4W9RA 2OOSA 3ZI4A 1Y0BA 1NPTO 2ATVA 2I33A 1ZD1A 2RAUA 2R0QC 3ND6A 4KE9A 4KLZA 1SUSA 2O2GA 2GEKA 3UB3A 5AKJA 3K9CA 3N8NA 2XDQB 3WV5A 5E3IA 2OCAA 3E5RA 4FIDA 3WQBA 3GX1A 2GJ9A 1LDNA 4DANA 3TJMA 1GCAA 1DKMA 3ZHRA 4ZT5A 1SCIA 1LSSA 4PWZA 3GVPA 3TOVA 5FADA 5AVKA 2QSJA 4WVFA 4QOIA 5B7QA 2ZRCA 3G0OA 2V45A 2W83A 5C8XA 1YUBA 1A4IA 1E4YA 4UU8A 4J1TA 4X93A 3TJRA 2VZ9A 2P65A 2GKOA 2Z8XA 5TF4A 3RD5A 1Z63A 3NRJA 4MMZB 5E8JA 3MXOA 3NT5A 3DVRX 1FDUA 4RCVA 4TL8A 2V8BA 3A1FA 3B1FA 1V8DA 3A28A 3EWNA 3NEJA 3O4GA 4X71A 3Q98A 4M9QA 3KKNA 5E6SB 4Z4FA 3ZK7A 2D0IA 3HN2A 5ALHA 4KOEC 4QTYA 5FHQA 5GM1A 1CNMA 1NIJA 2PFKA 2WMNB 1SXJC 1OYYA 2D0DA 2FGJA 2SECE 5FI5A 7YASA 4B6QA 2C29D 2R84A 2AEEA 1LH0A 2GDZA 3M81A 2PUDA 3SYTA 3OZVA 2R8XA 1SWVA 1JKIA 3DTVA 3QHQA 1ZVJA 3SHQA 4JI4B 5KJEA 1YOBA 5BYKA 1MP0A 2OG2A 1TTHA 2WPDD 3B6ZA 4URVR 2BI8A 4WV3A 1YZGA 4O4IA 1QX4A 1PK7A 3NH6A 4W9NA 1XYVA 3F46A 2ZB8A 3IR6A 3EMVA 1CT9A 1J97A 1E96A 2N47A 3AJ8A 4QYIB 1T9GR 1T9CA 5B1DA 3Q6IA 3ZDYB 2WQ6A 2YHIB 3K15A 1G8YA 3QVSA 1WZUA 2E87A 2WAOA 4IV0A 3LPCA 4N5DA 4G1MB 4F7DA 5AKXA 3R6WA 4FW8A 1WP9A 5AWFC 4E13A 2PTHA 3EIUA 2CCGA 4J4BA 4LXQA 3UATA 3N2GA 2JRLA 3AEQB 3C0KA 1T24A 1W34A 5T7BA 2HWWA 1SOUA 4PZYA 4CRWB 5BV8A 4FX2A 3QOXA 4KQWA 1AGPA 5DHAA 2GPTA 4J16A 1POXA 3TRJA 2YYZA 3VVLA 1P1KA 2PBFA 4NOLA 4KFUA 3GJYA 2ZRPA 3HUFA 4ZK2A 4XD2A 4A36A 1IBSA 3ZLTA 2JIMA 4WTOA 1W36B 2WUVA 1QVAA 2FVYA 2J46A 4DA7A 1XVLA 3KQQA 5ALYA 5GJCA 1VE1A 1XRPA 4O02B 4TYPA 3F2VA 3PXAA 5ABPA 4IMPA 1TO6A 2AFVA 3REQB 1H0SA 4JQZA 3DM9B 2XMRA 3VC2A 4QDXA 4AMZA 3BK7A 4DCSA 1I7NA 1OZFA 1LCIA 3K32A 3O8QB 4QHTA 3OX4A 3P9IA 1KL7A 1AXRA 3LBFA 5K0JA 1X1TA 3OCCA 5TLSA 1BGXT 1K8YB 1KI2A 5J2TB 3SIPA 3AR4A 3GLTA 1F5SA 4OQ4A 3BMNA 1QZUA 2EF0A 1DXHA 2QRHA 2VC2B 1MB9A 2QTLA 1JTEA 3CLSD 5IT4A 2JVKA 4LGMA 3UYKA 4N5MA 2FOIA 1M3SA 4NCJA 3EC2A 3R76A 5KPDA 3DBOB 3G13A 3TW4A 5HS4A 2GCEA 1RIIA 2Q0XA 2WLTA 3Q0EA 4W5JA 4FFRA 1VC2A 1HH4A 1DXQA 4XGQA 4PZUA 5ARCA 2ID9A 4YTEA 4TLLB 4Q05A 1R12A 4KEAA 1JJFA 3NGMA 3IPCA 3IURA 2ERCA 5GWXA 4CM3A 4MSUA 4JXXA 3RF6A 2WDZA 4MIOA 3HB5X 3QQPA 5IABA 1K6EA 2C9MA 3GZNA 2FWNA 5HKKA 2VP6A 1Y98A 5FIUA 3OQMA 1H4TA 5BSFA 4H1WA 4KZPA 2O7QA 4C88A 2OO5C 1JHZA 2PR2A 2ZANA 1WDLA 2ZIFA 1V3TA 3K2BA 3QVJA 5HF9A 2IZ1A 2A59A 4M99A 4DQUA 3GLIB 1QC5A 3P9QA 1T8WA 3IAS1 3TLEA 4BFZA 4LPSA 4UHKA 4EG7A 1M54A 4YLEA 3ZHZA 5FA8A 3ZU6A 5G0WA 2OV8A 2K7ZA 2A5YB 1E6MA 4G5FA 4GPTA 4QKQA 1VI5A 1K7EB 1KEPA 3HCFA 4DLRA 1TFRA 4XTRA 4CT5A 1TA9A 3DCIA 1RRMA 3NUQA 1AV7A 1RYZA 4JNKA 1FFHA 1W6UA 2AIRA 2AQHA 2BCGY 2O1WA 5DK6A 4HWRA 3REGA 1WCXA 5B1YA 2OGTA 1W48A 4RPHA 1U9JA 1VA4A 3OD1A 1U8AA 5EL0A 1OYOA 4L73A 2XI4A 1OV4A 5EJGA 5EYPB 4O1IA 1N77A 4OU5A 4EFKA 4IFEA 2VQ3A 3BK1A 3TIXB 3ZY2A 5DYYA 5T67A 2DYKA 3BIOA 2VCEA 4YP0A 3K70C 1H2FA 4I4CA 2VKTA 2XECA 1JT2A 3DPIA 4ZVTA 2Z57A 1V8ZA 3R77A 5BQPA 3D6TB 2BMEA 4WQMA 4RA9B 1EHYA 4GGOA 1PJZA 3TZHA 4CIXA 5IJ0B 1E2NA 3SIWA 1O89A 5J2TF 1U4OA 4AJPA 1P1RA 2V6MA 4W99A 1RHMA 2OESA 4F2DA 4Z7QB 2Q3EA 4I5GA 5B7NA 3LY8A 3UICA 1YB4A 3GLGB 1E1QD 4MULA 5E0OA 2BDUA 2DR2A 4JVMA 1CVIA 1EQAA 1U0JA 3U5TA 4IDGA 5LWQA 2I3BA 4CKXA 4WZBA 3LC7O 2V1XA 3CSSA 2PCLA 4JT8A 2BEKA 5AVOA 2DQZA 1YI1A 4JDPA 4EG0A 4COKA 1A2QA 2UVPB 3ZNQA 4J0FA 4M0FA 3EASA 5MN5A 3PE6A 1YUNA 4L3WA 3IA2A 1RI4A 1CHNA 1GLGA 3OQIB 1Z3CA 4UDYX 1GM5A 4Y3UA 1YQWA 1PX2A 1X80B 2OORA 2ZSHA 1M6WA 1L5KA 1F1BA 3EIFA 3K16A 5IF3A 4BAGA 2O0JA 1NR5A 1AUVA 3LQQA 2C2BA 4DNOA 2XNDA 3JQ7A 3DEKA 2ZLBA 3BE4A 1SQ5A 2MSNA 2QY9A 2ZVPX 1GEEA 3C7AA 2COKA 3CF2A 4UAVA 4A7PA 2B8NA 1XR3A 3G7NA 4RK4A 4RZUA 2OWEA 2NAPA 2HAEA 1KBOA 3SJBA 1NX6A 2WJYA 3AEUB 1TMYA 4PHGA 4C6RA 2P9CA 5AVWA 3KELA 4Q1EA 4BMPB 5IBCA 4YMSA 1HORA 4P54A 2VRCD 3QKUA 4UMEA 2AXNA 1HDGO 1HE3A 4YDSA 4DA0A 1BGWA 2QA5A 2AMFA 2PRZA 1IWBB 4DAOA 1E7YA 4L8VA 2GM3A 4PC7A 2E4UA 4TKZA 1Z2EA 2F3SA 1DUIA 1XF9A 3R6GA 1DJOA 3CX3A 4G0NA 4QUIA 4WXYB 2B82A 3OEED 3R6LA 1A4RA 1JJVA 3HS3A 3PG5A 3GLFE 5F3WB 3N2YA 4JBYA 4JC8A 4PRLA 3UWDA 3W8EA 3EYAA 3DOCA 3H6GA 3DVAB 3HZOA 2W0SA 4F97A 3HYSA 4GMKA 2HF9A 4QELA 5HG0A 3KV1A 3KR1A 5T4EA 1CEXA 5KOJA 2DY0A 1PWYE 4HYYA 4XLTA 1DDOA 3L8YA 2QNRA 2VHEA 2P9QA 1Q0UA 3A4YA 3QE2A 4IVQA 4I1YA 4EB6B 3B60A 2H2GA 2PIDA 3PFWO 1GNQA 1DIGA 4CT0A 2C7QA 2JLVA 1H42A 1DTWB 2WZQA 1WJGA 3FDJA 1LLCA 3M3HA 4UTZA 4C29A 1O0CA 3WHLA 4ZODA 2XJ9A 4QU8A 1V7ZA 3LUPA 4XX0A 2IX3A 5FFNA 3C7DB 4GE3A 4NE7A 1JU9A 1NAHA 3NUGA 4L4YA 5CVTA 1DEAA 2DSNA 2VLBA 3PGKA 5IC6A 3PTAA 4YV2A 3OU2A 4Q00A 3D3EA 4CIWA 3P27A 3CVUA 1ZD3A 1GG8A 2PV7A 3T3MB 2ILTA 1PWEA 3UMYA 4EHLA 4MYCA 2XLCA 3K2IA 1UJ6A 2NVOA 3CZRA 1GA6A 1N5MA 3ND9A 1U0RA 1O96A 1PSDA 2HA7A 2Q5IA 3E9MA 3P9SA 4X1IA 4ZCIA 2I0FA 4GNKA 4X3CA 3PQ8A 3WIUA 2DBQA 3EZ6A 1JVSA 3D3JA 2J67A 4F6CA 3FOEC 2V6BA 3F7OA 1U0OC 1WF6A 3G6KA 4LRWA 5HJ7A 4HRXA 3ZDEA 1FX0A 2ZT7A 5CT4A 3C1OA 2B1JA 2NUAB 1Q0LA 5B3JC 4KX5A 4UOQA 2C98A 2DXIA 5JAQA 1X0VA 1XMIA 2IKQA 3QPAA 3RFVA 4ECAA 2PXCA 1RVDA 1CJSA 3F0TA 1DAFA 2O20A 5ENVA 4K6OA 4TTQA 5JZMA 1PWXA 5KU1A 2XUKA 5EIHA 1N8KA 1I7PA 2IU3A 1GEGA 4L3VA 2PA0A 3L0OA 5JV5A 1YS7A 1W581 4F92B 1P45A 1NTRA 1U7ZA 3MQFA 4FI3F 3VH2A 3Q12A 2BCJQ 1XEAA 4ZRNA 1VYHA 2YL2A 3AUTA 4QU9A 1W0KA 3VJKA 3RRZA 1YNOA 1JBKA 4BMSA 3JARB 3LGXA 4B4OA 1BEUB 1R5BA 3DDOA 1FX1A 2BKUA 4NBSA 2ZYVX 3O31A 4QBFA 2ZUWA 4X6LA 5HJ2A 8MHTA 3CX4A 1XTIA 3UF0A 5G4KA 1JMKC 2ZWVA 3AU8A 3CYFA 3RVSA 2EFEB 4DV3B 3B9BA 3R3JA 1NN5A 1SUBA 3V97A 3E18A 2YIJA 5M7EA 2VDNB 3EB9A 4J3NA 3H11B 2WWTA 3BL5A 4FGKA 5C37A 3HBLA 2UZ3A 3QU2A 4CGZA 1NZJA 1KDRA 4KQKA 3X1DA 1NM5C 1E2JA 3PT9A 1MQSA 4PIVA 4U2EA 3TX2A 4P6VF 1V2HE 2HF2A 1JQLB 3B2QA 3QF4B 4FINA 4GW3A 4JJEA 4LI3X 3R0VA 4PZ0A 1GTG1 2B5WA 3HJUA 1E92A 1L1EA 3Q7QA 3ZPXA 1XEWY 4EDFA 1BYUA 2HDNB 4GIBA 3TEMA 1K97A 1NP6A 4YRJA 3I62A 3IDAA 1TZBA 5KX5A 2BFWA 4C78A 1U94A 3RK1A 1T9KA 4X44A 1FB5A 2IDZA 3RUPA 4JEMA 2Q1SA 4YACA 4MIYA 5LZ5A 4LGYA 4WZZA 4CKBB 2EOAA 4AY4A 4DCVA 1TZ2A 4IDBA 2ZSBA 3BSYA 3E0QA 4UVGA 4IYJA 1T1IA 2AMJA 2C2WA 3ZIAD 2QVBA 4I50A 2WTEA 1IHOA 3ZVRA 2BGGA 1X8KA 4FYJA 5IZCA 1I3CA 4C9BA 4IRMA 3DA8A 3X1XA 4GAEA 3R3ZA 5CVCA 4K0KB 1X1SA 3LGAA 1UXJA 3JD3A 4XVHA 3TW6A 1CYEA 5B1SA 1M34B 3NPMA 3QEKA 2O8FB 1DFHA 1NBOA 1BGVA 1G42A 3CWQA 1AKMA 4RKFA 1KE1A 1O08A 1TJ3A 2R5NA 1AGYA 3AM5A 2P6NA 2V97A 1IZ9A 2IEBA 5D01A 5AVYA 3LUBA 1EGVB 1L7EA 4FFNA 4UNIA 4DC1A 5CLFA 4IX9A 3INYA 1JSLA 3S40A 1MZVA 1UMDA 2NADA 1PZXA 2C95A 2QLJA 4DVJA 2FZKA 3FYUB 3RS8A 4YI5A 5C8ZA 4RKWA 5J2UB 5C7IO 1T6YA 4MQFB 1C0IA 5JNSA 5CVUA 2NU8B 4KR9A 1T9GS 3BRWD 4QDUA 5EUCA 4G0VA 1Q83A 1T2CA 3RYFB 3EIWA 3PFIA 3NNDA 4WX2B 3L8ZA 2A6PA 4XPIA 3EPJA 2X58A 4KTTE 2BFFA 3PI6A 3KUXA 1GUAA 3RLIA 4JJZA 1DBPA 1E2EA 1H85A 2YW9A 5F52A 5IH3A 1H4QA 2FWAA 1AT1A 1MCZA 2QXYA 3THYA 2QUZA 4FONA 5JOQA 1GR1A 2GXUA 1ND6A 4DCJA 1I1NA 3TR0A 4BWVA 3ANXA 1XCLA 3TLYA 3HBJA 4DIUA 2VH2A 3FD8A 4CFSA 3H5WA 2GDJA 3ONFA 5AKLA 2VAMA 3OQ6A 2Y77A 3K0AA 3M6UA 5A3JA 3DZJA 2PL5A 4KNVA 4NMHA 1KIMA 2ZKLA 4WFIA 5E1DA 5BW4A 3GMDA 4NENA 3RG2A 3H8WA 4QJIA 1RQNA 3E4CA 3NGLA 1EUZA 1C9DB 1DS6A 1UIRA 1U3TA 3HA2A 2D62A 4QQ8A 2MHCA 3C6YA 3IPXA 4S1WA 3JATA 2JAXA 2ZITA 3FY4A 2WYVA 5JDCA 2Y1OA 3GPLA 2ODNA 3DV0B 3R20A 3TZEA 5B4VA 4CMBA 2PPLA 4QFDA 2NO4A 3VX4A 3WGOA 4XM1A 2OXEA 1EZ4A 3TH5A 3RB8A 1L5RA 1B2RA 1IDOA 4EM6A 4W6ZA 1FFDA 2BRUC 2V4MA 3EFOB 4L4RA 1J25A 2AI2A 3BHNA 4R2HA 2QL7A 1PBNA 2Q2NA 3KDAA 1NXQA 2C9DA 1Z0KA 3JQAB 1DAPA 1S3GA 4EJMA 4X8LA 1OU0A 1AKTA 1Q21A 3OURA 3BGDA 4B3IA 1W44A 1WMEA 3VNVA 4CW7A 5JHHB 4D96A 3JWHA 4BV2A 4Q9LA 4O2BA 2RI1A 3DMPA 4UEQA 4ZDWA 4Q15A 2WZBA 4M98A 4UZSA 1JBEA 3C3DA 5JD4A 1V6AA 4TMXA 1O1YA 4FU0A 5AKGA 4POAA 3KP1A 3WGQA 2MINB 4XYBA 3DLIA 4MUFA 1XCBA 4Y18A 4DIFA 2VPXA 5J2UF 1EZZA 3HJGA 4HR7A 2B8TA 1GYPA 3U80A 5FWXB 4RPIA 5FAKA 2UUAB 1JQ5A 4G0YA 5JMOA 2JCBA 2E18A 5JSYA 5AO9A 4DFDA 3ROMA 5CXQA 3C7CB 4C08A 3AESB 3NHLA 1E66A 4J0JA 5A1TA 5KKCA 1F9EA 4E3WA 1S2IA 5EESA 1I6LA 3FHTA 2VP4A 3AV0B 3R6DA 3PQ7A 4YAGA 4HVAA 3W8RA 3BWMA 4N3NA 3DGFC 3V9AA 4HQKA 4CEHA 3LYAA 5JY6A 5FTMA 1PX0A 4CMHA 1S96A 4MPPA 4PYKA 3P9NA 4BU0A 3I39X 4DA4A 3KX2A 2BGRA 3PNSA 4OQZA 2IZOA 4BNJA 5BN3A 5ITZA 4UBNA 3QHAA 3WB0A 2VDMB 4IIVA 3UJ6A 4DM7A 2P35A 1FNCA 4FE3A 1YE5A 2O2ZA 2XQJA 3M6FA 4B6PA 1K7SN 5JS7A 1DO2A 4OKNA 1UBJS 1TK3A 2WJ6A 3JZFA 3LC0A 4OFXA 2AN4A 1XLTC 1KJ9A 3M4YA 3OECA 1NFFA 2B83A 3LF2A 4HRAA 4I9GA 2OV1A 4R9NA 1KAHA 1XRQA 3Q2IA 4L0DA 2ECKA 9GPBA 3RT9A 4YC7A 4ZT6A 2IZ5A 3GWZA 4KIWA 4OK5A 2QSZA 1NVDA 5AXDA 4YPVA 2ZE5A 1CZOA 5DGHA 2J9RA 4LJYA 3MLEA 4UUQA 4Y9RA 2L18A 5ALGA 5T8KA 3DGEC 4KC0A 2WWFA 3BVPA 1JALA 1Z28A 3BFJA 4FYMA 1IN6A 1EAYA 1OIVA 4TZTA 5IEBA 5JZVA 2XZDA 5TB5A 1ZRSA 3UJAA 3MCAA 3PIDA 2WWIA 4IZIA 1HDOA 2OLKA 3S68A 3VYUB 2C2GA 2I65A 2B9VA 4MCJA 4DV1B 3R6TA 3QEOA 4MW7A 2EL7A 5FORA 4D0GA 3IB6A 4YP9A 3UOGA 1CCWA 4H17A 4I14A 3FJYA 1JU4A 5LQSA 4BX3A 3A6FA 4D8VA 4ETWA 1AX9A 4ERXA 1VFNA 4BEVA 1N1MA 2KSQA 1J2TA 3QJ5A 4TMYA 4B9AA 3HUEA 1QOZA 5LDGA 3ZWNA 1FJGB 2JVJA 4HNQA 5G41A 3PJDA 3TZCA 2ZS7A 4B6RA 4J2HA 4QDZA 4R8VA 2OWDA 3LP6A 1R0RE 2GQ0A 3G5LA 1JZQA 2BFCA 3X2SA 1L5VA 4URXR 5L3VA 4LGVA 3WQRA 1CY6A 1G9TA 4PY2A 3O7WA 1O94D 3KB2A 4BX8A 3MM4A 3MK31 3W5SA 1L8QA 1NI3A 4H6XA 2PMEA 1LVGA 3D3KA 4OK3A 4QBKA 4YDRA 2WD9A 1AO3A 3E48A 3VDNB 2SHKA 4ZI7A 2AC4A 4YV1A 4KRFA 2B98A 4BJHB 1DO0A 3CLRD 4HTFA 1T8RA 3COPA 3ZWMA 3KPJA 5LZ9A 1UMBA 3I42A 5ALWA 2ONJA 4ZDIA 1V26A 4G5QA 4YAIA 1QVRA 4BN0A 3JXEA 1P1CA 2OYCA 2X4DA 4AY6A 4OUDA 1KKLA 4PTZA 2OPHA 1PVOA 2IXFA 4M3NA 5CNJA 2J3DA 4HEA1 1D7OA 4MKIA 4QPNA 5EFZA 4H08A 1EGHA 2NZ8A 4S1NA 5AW8A 2B25A 3OE4A 4ON9A 4CHGA 2EJWA 5ALNA 1LDEA 3I2KA 1MKYA 2IU6A 10MHA 1XZLA 1KS9A 3RUCA 1BXGA 4ZQEA 5DEOA 5EJ4A 3E58A 3NV9A 4PS0A 1RHQA 5ICFA 4EA7A 1DIOB 4O2AB 4DUGA 2VJPA 1AF4A 2VQSA 2H1RA 4I5DA 1R4ZA 4K9RA 1KJ8A 1BS2A 2NVUA 1QGOA 3T1TA 3PEUA 3PPIA 4ZWNA 1M0TA 2JHPA 5CR9A 3WDSA 3MJRA 3C97A 3TLMA 1WMDA 3AK4A 1PJSA 1UBHS 4MQEB 1OI7A 2EBFX 4R1SA 2XXAA 2ZXEA 3CLUD 4ESHA 4BQPA 3COZA 5EVJA 4YMLA 4BWFB 1A27A 2XB8A 2L2QA 3B6MA 2JHCA 1XTZA 4UEJA 1KRXA 2H1IA 4EVIA 1Z7WA 3MLAA 4A73A 2XQGA 2NP6A 1H23A 4AKEA 3W90A 3KLOA 2DMRA 2JGJA 2J9FA 4WLOA 4RS4A 4J1QA 3B6JA 3L8HA 4JVLA 4R7TA 4OX9B 4I7EA 2W6JA 2ZAYA 1K5DA 2X1HA 3Q7IA 2JJ1D 4B3MB 3H9CA 2YJ5A 4R2XA 1L5OA 2ZDGA 5FRDA 2IU0A 3RGGA 3UOWA 2CMDA 4KQ9A 1KTIA 1KA9H 3RUFA 1KYWA 3C8ZA 1I3LA 4R51A 4QQFA 3ZVKA 3HABA 4LBZA 4MP3A 4LXTA 4NV1A 4RF3A 2AEJA 2XUZA 2PUBA 1KC1A 3UJBA 2OZVA 4PYLA 1J0DA 4KH1A 4O1HA 2HQ1A 5DGXA 5HTKA 1Z6XA 4CQMB 2FP4A 3WB1A 3EPRA 1CDDA 3PFFA 4UATA 5KOHA 1FCJA 2H29A 3BHIA 3DW1X 4R9VA 2I54A 2XXJA 4GH5A 1SPXA 4X6UA 2Y1EA 5DNCA 1AO0A 1FIUA 3OFSA 3B1YA 5G3ZA 4IS2A 3CVVA 4OHKA 3H1GA 1K4MA 1LBIA 1M2EA 4G25A 1HT1E 3RJZA 2P2SA 2HK6A 1U3FA 2JGDA 3I4LA 3O1IC 4I19A 4P4SB 3JAKA 3W5HA 3L0CA 8OHMA 4CM1A 5KEIA 2YC2C 1MDBA 4HPXB 3CNOA 4R1LA 1Z0DA 5CM8B 3TBKA 4P7BA 1NE7A 4XGIA 4XWOA 2JIZA 3MFYA 1AIPA 1JWLA 3F73A 4M76B 2YY7A 3E8SA 1E2GA 1MO6A 3CZQA 4MA5A 4WT7A 4BVBA 1Z62A 4Z0HO 2NU7B 2A5JA 1RI2A 2WWRA 4KGXA 4PINA 5EOVA 4B4DA 1USIA 3L6CA 2NYVA 4BNXA 5MF6A 3FFBA 1U80A 3W7VA 1TQ2A 1PTKA 5JQGA 3B1VA 1BE1A 4OJYA 1KETA 3PPVA 2AT1A 5CDUA 1L7OA 2VNIA 5FL3A 2OD2A 3JV7A 4PWYA 1XU9A 1T29A 2I03A 4JYCA 4F96A 3KTAA 4QSHA 2AN1A 4KWCA 4OI4A 1OV6A 5E6UA 5AI0A 4K6GA 2Z5FA 3N2KB 2AVNA 2PFGA 3EDCA 2PKQO 2QTRA 4IJVA 2AFRA 2J0SA 4TV8A 1KAQA 1H2EA 1SIUA 1YZLA 3V7NA 2O14A 1L4EA 4EUSA 2R6DA 3C2QA 3COWA 4ZO9A 3C1TA 4DLYA 2YV3A 4E07A 1LB1B 2CHVA 3K9QO 3T15A 1L5MA 4L16A 1UF9A 5IJAA 3U7HB 1A8PA 1I0IA 3W8FA 1ZK1A 4UEWA 4Y7CA 4Q9DA 4B44A 5DTIA 1TADA 4GOXA 4LYJA 1EFDN 2HLNA 4EUNA 4BHTA 2X41A 3FWYA 5EJFA 1M6VB 1Z68A 1K92A 2P7HA 3H3JA 3QF7A 5THKA 2O54A 1UJMA 3LQFA 1AA6A 4EB8A 1UOPA 3HACA 4CFYA 1WE2A 2HJRA 1GG2A 5DSTA 2GTIA 4ENWA 1CVRA 1NLUA 3LJKA 1DWPA 4TM8A 1P9LA 2F64A 4L2IA 1RJGA 1XMPA 3M6AA 1SHTX 4GI1A 4PTYA 4LRYA 1RU3A 3OT4A 4J7CA 4MKRA 1ISPA 4PCAA 4EHAA 2RHHA 3DOJA 3SC4A 2BKAA 5HQJA 5DE3A 4LHWA 1BWRA 4F9TA 2X4LA 3P2YA 4X8MA 3RSZA 4KWHA 3UB2A 1E3IA 3GA0A 3P4UA 1XTPA 5DXFA 1Z22A 1TIBA 2JI9A 4CKCA 4OH7A 2PZEA 5DI3B 3S2EA 4FDUA 1OGJA 1Z7BA 4EVSA 2YHSA 2ZRGA 2GEUA 4YS6A 1NBMA 1YQQA 2FPOA 4Q1DA 3F6CA 1H2BA 5DM70 2MJLA 2FPIA 1G5QA 4NVRA 2PU5A 1PTJA 1ZXLA 3TQOA 5BV7A 4OJNA 4CLXA 5A5DA 2VK2A 3NTXA 4HB4A 4JIMA 3R7SA 2OHXA 3USCS 3SFVA 2P6PA 4WKCA 1LQ2A 4O5OA 2GR9A 3OIVA 5DHSA 4AZWA 1F60A 1YQXA 1X38A 2ZIXB 4J9VA 4JLOA 2QPOA 1I30A 1QF7A 1RJWA 4L5JA 3TIFA 3OT5A 1FDOA 3BE5A 3GARA 1CEQA 3GFTA 3L8GA 4JKYA 4S24A 4LY9A 4HGYA 2Y2UA 2A9OA 3BERA 2J30A 2ZKIA 4J94A 4LZOA 4P8RA 2YN2A 4RW0A 3LPAA 3B5IA 1VIVA 4FW9A 4LK3A 4O4JB 5KSZA 3DF7A 1QNLA 2YMMA 3A3NA 1OX4B 4TLCA 3RVQA 3IKMB 3R3XA 4YAFA 5KNBA 4X7RA 4CXMA 5CGQB 1Z82A 2QRVA 2G40A 5KNDA 1J2UA 2BUCA 1L7AA 4Q93A 2H7VA 1L5FA 2VSNA 4Y7DA 3ZV4A 2PXXA 2FMTA 3F5MA 3WIEA 1J0BA 2C5SA 2ZJ4A 1E4EB 1IPFA 1D8AA 1K7FB 1OT5A 3GW8A 3OUTA 3PYMA 2IYWA 1Z75A 1UEXC 4OM8A 3DL4A 4C76A 5GY7A 4GL2A 3AOEA 1SH7A 1DADA 1PZFA 3V8RA 3Q4GA 1NF9A 1ATIA 1TM5E 4L76A 3VPFA 1QFYA 2FG6C 2Y6UA 3VMFA 2AR9A 3FF4A 2NUPA 4NFSA 3ZK8A 2GLTA 1A8SA 3KVYA 3LLMA 3E7DA 3IQXA 3PUWA 3R3HA 1ZG3A 2Y6VA 1YVEI 3QLVA 3PC2A 4M46A 5A4IS 6CHYA 1A98A 4OBEA 1LFDB 1N2SA 3B1KA 1TJ4A 2NSYA 3EAQA 3KUDA 1U2SA 1C0EA 3KOZA 3SIRA 2AE1A 4U3JA 1PQ4A 2PQ0A 3W6UA 3E82A 4ARZA 4OFZA 4ZMSA 1JEDA 4BVAA 1R0KA 1UKAA 1YIDA 3DOOA 4X20A 2PBRA 4A8JA 3G1TA 1YOVB 1V6SA 3FBGA 4JBXA 2F1RA 2QRPA 3VPCA 3ONVA 2JJMA 2VYFA 3JASA 3QSGA 3FNBA 2L17A 1V1RA 1HC7A 1X15A 4JWTA 1N0HA 3ZIUA 2EHDA 2QP4A 4OAQA 4Z7JA 3NAZA 3ULKA 1GAJA 2B21A 2H7YA 3D8HA 3MTGA 4MPDA 3H18A 5CW1A 3EHEA 5GONA 5TQ0B 3T5DA 4CEIA 3OE7D 4WL0A 3LHKA 4N18A 3FRIA 4LV6A 4Q5IA 3H5AA 1Z5OA 1FYDA 2IZZA 3WLOA 2GJAA 2VQFB 3QWHA 1RMTA 4KSBA 3AUAA 2WY2D 3ZCVA 4E5VA 1MQ9A 3L1IA 1R4AA 4BO3A 3GCDA 1OVGA 1TD9A 1SCKA 2G82A 3N58A 4P80A 5G0VA 2H4FA 5IDYA 3EE6A 3ZWPA 1QS0A 2VDOB 3CVXA 1RPTA 2HHLA 2NXNA 3LUGA 4E5KA 4DJTA 3RNLA 4C0QC 4ZV7A 3R75A 1MX3A 1VG1A 1SQ6A 4OIFA 1BMFD 2OV2A 4IL5A 4LBVA 2WF7A 3FGZA 3MMPA 3N5KA 2JJ2D 1MFPA 2AOVA 2OZKA 2Z3VA 3QRWA 3PFKA 3QEJA 4FE7A 3DMTA 3WMXA 1D0VA 1YASA 2I3ZA 5BWOA 4O4JF 1O57A 4FWTA 3X1KA 1R0WA 2NXJA 2JNWA 3WSWA 1PR5A 3T5BA 5J5AA 3T38A 4BOYA 2Q5EA 2JZOA 1MOPA 1E6KA 5DLQC 3TSOA 2OCIA 4S0XA 1II8A 2FK8A 3SXUA 4ASUA 4TT3A 3LQYA 4UJ3A 3OFND 1CK4A 1Z2AA 2E5FA 2ATCA 4I08A 1DG3A 1R5NA 1Y1RA 2O5VA 3ZBUA 3T5PA 1QQAA 3AVXA 1QPZA 4B4UA 3MMSA 4KXVA 4BQSA 1HTTA 2JFPA 4HFMA 3OZRA 3H16A 2NAFA 2YHUA 2GPSA 4GMDA 2V7WA 1NV8A 4TWJA 1EVQA 3RGWS 4BN4A 2GVZC 2Y8EA 4OHMA 2OB1A 2VDVE 4B09A 4MGZR 4ACBA 4JXZA 4MTCA 1X6VA 3GFRA 4FYXA 3DV2A 4GOOD 4L15A 4GOMD 4C3ZA 1M5RA 3PNVA 3I2FA 3PX3A 5EGSA 2O4UX 1PGNA 1ZICA 4ZVPA 3NHAA 1G8GA 3S1SA 1D5WA 4I6EA 2RK4A 3IS3A 1RSZA 3FWKA 4HQLA 4IMJB 1YRBA 1QV7A 4BUCA 2DCMA 2J33A 4NYJQ 3QKTA 1Z08A 4ME6A 1G291 3QEBZ 3FFTA 3DBIA 1ZVQA 2ZRAA 5AFSA 3F71A 2ZJ6A 1SQGA 5ICCA 5LJLA 1WMSA 3DO6A 3V00A 3ZWBA 4TLEA 1OX6A 3O82A 1BU5A 3URKA 4BMVA 5BPHA 4G1CA 3TD9A 3VKFA 3PIIA 5JCXA 2CUTA 1IK4A 5FWYA 1EB8A 1CIVA 1T34A 1JX6A 2O2DA 1UOQA 3ZV5A 4DPLA 2AG0A 5HGXA 4TMKA 3R7AA 2JLWA 2PRJA 3IP6A 4UW9A 5FYQA 1NN0A 3SNHA 3D6NB 5I7SA 2N0SA 4AD8A 1EJ0A 5ILGA 3SZGA 1AKNA 1QH1B 2A5GA 2QMZA 4JJFA 3H9UA 3ZE7A 4OF4A 5CFNA 3LZCA 5CA1B 1G5IA 2CWWA 3B51X 5EVCA 1QE0A 3GLUA 5BR1A 1ZVVA 3EDRA 4OBXA 4K9OA 4FPXA 4MVXA 1HMYA 4G5OA 1A5AB 2O2SA 4BYMA 1MG0A 4XYMA 4FN4A 2GA8A 1RZ3A 2Z6AA 1BW9A 4GVPA 1VL0A 3RIXA 1Y3AA 1SXJA 4MCAA 5FB3A 1XQYA 4Z4GA 3DVQX 3PDIA 1NQUA 1I3MA 1SWWA 5JH7B 1RAGA 1M83A 1U8FO 2ZBFA 1E8DA 1N9ZA 1QIMA 1TLLA 1TYDE 3G6WA 4DKXA 1TTTA 2QI9F 2GRAA 3K9BA 2I2CA 4US0R 4UASA 4BKQA 5HILA 3LC1O 1WCIB 1IRIA 1WD5A 4L51A 3EZ2A 3OM8A 3PC3A 1Z5ZA 3SS7X 3UMJA 2XGJA 2F8TA 1J8MF 2GBIA 1TT5A 2XCQA 2AUNA 3LWZA 4PQRA 3NEYA 4Y2QA 1DX9A 2OP0A 1A50B 3BMQB 3F8SA 1IRXA 4QTXA 4BNYA 3BZWA 4FMCF 3GHYA 4PPQA 3O4JA 2CE7A 4AT1A 2NXEA 4BWGA 5EFOA 1PFQA 2CVOA 4EDHA 1SUPA 2JATA 5D85A 4XVCA 2ATIA 4Y8VA 1ZU4A 5I8ZA 4P5EA 3RBXA 1NG1A 3GNTA 5HWSA 1PL8A 2IVFA 2W22A 3KT8A 5I9BA 3TM4A 3QKRA 1Q7BA 1U0NA 4JLWA 5K6AC 1YJ8A 3M5DA 3OI7A 3OQBA 1QWOA 4FS8A 4IRXA 4ND2A 5LFAA 1GPMA 1NGSA 5M29A 4Q03A 1L9XA 4I3FA 1A9RA 2DGDA 3Q7PA 3DHEA 3ZVLA 1Y1QA 4BIMA 1R5OA 2XCLA 1Z26A 3DHVA 5F21A 2DFTA 1RYEA 2C94A 4TQ9A 2C04A 3G9ZA 1NW9B 2AR7A 4IKOA 1BXKA 4UZFA 4MNTA 4AYWA 5I5EA 1RVV1 3CX6A 4FCVA 4OXRA 4TVSA 4I4IA 2NUTB 3VDMA 1YJXA 2CJWA 2NGRA 5F3RA 5ER6A 4E88A 5AVSA 4G0WA 1P4HA 1NYQA 1H6BA 2JAQA 2CLIB 4JGBA 4E7PA 2W8BB 3TVYA 4B6SA 4F04A 4MB6A 4PS1A 2CDRA 3DWFA 1QYVA 1V1MB 2EERA 3KYIB 5CA1F 2JEZA 1B6RA 1WBBA 3G85A 3UHAA 2EQBA 2QTVA 2R6AA 2MT9A 3UUFA 4KAJA 4ITRC 4ZCPA 2IV2X 3T12A 5I7OA 1AQLA 4QFMA 5ICEA 1H0RA 1L7XA 3CGWA 1VKNA 4IOJA 2VUTA 4AG6A 1ZCJA 1AUQA 1WSWA 2AMLA 1KZ7B 2ZRLA 1TA0A 1PU2A 2I4RA 3K4PA 3ROTA 3U7FB 3HCEA 5EHZA 2I3GA 2JKVA 4RCZA 1IK6A 2W58A 1BX1A 2PCJA 4MYDA 4E22A 2ZPTX 1J6UA 1Y4DE 1GSIA 2HSZA 3JWIA 4KWTA 1XRRA 4MI1A 4DBVO 1O97D 3QPUA 3VMMA 4NHOA 5FI0B 4BRSA 1FDWA 3WYAA 5CFRA 4PGMA 1KFJB 1LK0A 2FW9A 2G9VA 3OD5A 1XZKA 1MR3F 3T7DA 4AC9A 5JJKA 4KITB 3ET4A 4X97A 1XDBA 5BUSA 1JVBA 4E03A 2XNKA 1F8YA 2OO5A 4IMRA 5AOCA 1DBWA 1XZMA 5LYJF 1CIJA 1WUHS 2M9MA 3H86A 2I8LA 2OQ2A 4ZYYA 4MQUA 2FTKE 3IAXA 2Q2OA 1KK0A 2VWQA 4ZU6X 3MUNA 1WUKS 2QEQA 5DSZA 2O06A 4CIVA 5F9HA 4HLCA 3H75A 1U0BB 1QGUA 2VHTA 4ZFNA 2QAJA 3ETDA 5MGNA 3MAAC 1U1CA 4WKOA 2FUEA 5LD2C 4N6OA 4YREA 4TXHA 1MB3A 4I4LA 4O5AA 5L45A 1TU3A 4OHZA 1DKLA 1KYZA 2HU7A 1DX4A 4X1KB 2UVDA 1QU2A 1ESEA 1WHTB 5JI2E 1FS4A 4DV4B 4A27A 3R5FA 3G7SA 2ZPAA 4R2JA 2B1QA 421PA 4KMMA 1XF1A 2QSUA 3N2IA 1NJ8A 3TQCA 2VWHA 2YFQA 3GVXA 3OEYA 4WESB 4AP5A 1Q7RA 1U99A 2BR3A 1Z29A 4EPYA 4KHPB 3IESA 4BTEA 2WVGA 2VA9A 5K8UA 3LLVA 5JW6A 3HDJA 2I6TA 2P9ZA 3K73O 1T8UA 4QEKA 2NXWA 3U39A 4CJXA 2LKCA 4A5SA 2A0YA 1E3MA 3IPAA 4N9QA 5IJ9A 5HBRA 2ETXA 1K9SA 3AB7A 3AY7A 3SE7A 2ODBA 5LBTA 3WZLA 1ISIA 3OZGA 2OCBA 4H77A 3IDSA 3C5HA 3AR8A 3PRHA 1JAIA 1WDWB 1EBFA 4M1MA 2PU7A 1SB8A 1AQIA 2XAAA 1AMOA 1RAAA 1OHHD 2PGDA 5B6IA 5I7VA 2QVGA 2MCFA 4RD2A 2OV3A 3LP8A 3DE5X 2B8JA 4ZT7A 3T7JA 1RACA 3E3MA 4JBLA 2ZIGA 3B1WA 1WEHA 3CX8A 4X90A 1QBKC 4RESA 3GH3A 1Z0FA 2XD4A 1AS2A 1I1HA 1I5RA 3A2LA 3K53A 3P2IA 4DGSA 3BXHA 4QUGA 1FQKA 1Z6AA 1I2BA 3JQPA 4B8YA 4E15A 3HM9A 2CSUA 2JD0A 3ZR4B 2FE4A 1V9CA 1PFWA 4MS4A 5ALOA 1CFJA 3VPSA 4TTJA 4FGSA 3LRPA 13PKA 1GL9B 3E35A 2TMGA 4OL0A 3VOBA 3H17A 1ISJA 1KKUA 2YOHA 5GGXA 3KQUA 1SQ0A 3CS3A 1HG1A 1MMFB 1T3SA 5LKRA 2MOKA 1E7WA 5DTEA 5HPYB 2GZSA 2XUAA 4IO1A 1M8FA 4C7MA 5KTPA 2R00C 1KEKA 2J4DA 4QHSA 4RO0A 1FVXA 1I4OA 2FPLA 2IW3A 3T0FA 1DAGA 3V4RA 2J6CA 3JWJA 3LUJA 4LV8B 1G63A 2BHRA 2IUSA 3B6IA 2HJVA 4IJWA 1JR3A 2WJ4A 3VU9A 3OJXA 1HE4A 1C1YA 4HQRA 1JLRA 1N32B 3PJRA 5FNVF 4ND8A 2E49A 3GELA 3AB8A 4L85A 4JUDX 4JODA 1V5WA 4NWIA 3ADCA 3NI2A 3TXXA 1DXOA 1O54A 2O2YA 1SN7A 2JLCA 4Y6RA 3I52A 4H7PA 5AW3A 4RPLA 1ST3A 3DPUA 3SN6A 2HMSA 5CVEA 1CE8B 2CFOA 1ZMXA 3QH4A 4FFOA 1P1BA 2AX3A 1NW5A 1QONA 3T3HA 2C4VA 5BN1A 1NJ5A 4DBZA 3K35A 4TWIA 2O0MA 3EEQA 5AICA 3KKKA 2H2AA 3ZDDA 2R25B 4YJGB 2PK3A 5TGZA 1UBSB 1U04A 3BS4A 4MGHA 4TV9B 1ZN7A 1KZ9A 1XQXA 2E21A 1C3OA 1T3LA 5T6MA 1HRKA 1DJPA 1E3WA 2BFPA 3SZUA 4WJZA 2FQQA 4XDHA 4MVJD 1O6BA 1LXCA 1MTZA 1JQ3A 2ZB7A 4HOYA 3WK4A 4A8PA 3ORQA 4U2BA 2IE0A 3L41A 4BMCA 2W70A 4BATA 1C7QA 2FOXA 5DHPA 5SZKB 4RHTA 3KHSA 4QFCA 1KJJA 5ALFA 1Q1NA 1JR4A 5EUQB 1DUVG 2N1BA 2ZU6A 3LK6A 1TA4A 3B9QA 4OFWA 1VECA 5K03A 3CW2A 2QN1A 1WDKA 2HNKA 2XT9A 1EE9A 3SX4A 3O5AA 5C4GB 1Z0UA 2WFLB 3RADC 2EAUA 2OM6A 3EZYA 4G65A 3KQNA 1VKRA 4C4XA 5HQTA 1B14A 1PQYA 4WY5A 3T1OA 3JQ8A 3W3AA 4JDUA 4FGJA 4ID3A 3VKUA 4FHFA 3ZU5A 4AX8A 2OUIA 4PPFA 3K4HA 4MW0A 1KI4A 3PBKA 1QHHA 4MQ4A 5K3FA 4CF5A 3TMAA 5DCLA 1Y82A 4O4LA 4N40A 4N5IX 2V9CA 2AMYA 3DWGA 3T7AA 4NJMB 3F2IA 5B3JA 2DEUA 3E9DA 1KMIY 5FPQA 1XLVA 4IKEA 1G20B 1QOPB 1WMAA 3I04M 3W5JA 2AJBA 3MBKA 4JB2A 2J7PD 3RU3A 2O23A 3VPDA 5JYEA 1JR6A 1K88A 1Y5IA 4F12A 1S5PA 1XJCA 4OJTA 1GNRA 3LVBA 4ZOLB 1Z7EA 4WLVA 3UC9A 1RQ7A 3DFZA 4NH0A 2ACEA 3D0QA 3FBWA 3OX3A 5HE8A 2X4IA 3BH0A 3S7TA 4J49A 2YXDA 1DIAA 2O3JA 3UVEA 1EX1A 2Z95A 2GHQA 4DPMA 5FL7D 4V39A 4RTJA 3T34A 3AM4A 3T9EA 1T0JB 2G36A 4OQDA 4PSVA 1RKBA 4GI5A 2FRXA 3TTWA 2XE8A 3FUCA 4BN5A 4Z4CA 4HUTA 1HK7A 2P9JA 3K6KA 3L9XA 2FRDC 1VG9B 3BIFA 4MV7A 3WL8A 4B1FA 5K8VA 2Q4DA 1XX6A 5CDFA 1KI7A 5EHXA 1OROA 2W2NA 4KLNA 3K09C 1O0BA 3CN7A 4ZOBA 1SXJE 5KC8A 3I28A 3WYCA 1G59A 1M8PA 5FOXA 3GDFA 5H59A 2XX3A 3IV9A 1B42A 3NVAA 3ZWWA 3C4QA 4EG5A 3FMFA 1KJYA 2X6QA 1Y9DA 2O8EB 2DR3A 4NCAA 2PL1A 3PXBA 1M2VB 2ZI6A 3AI7A 1GNLA 4IQ0A 2P8JA 1QO0D 3THXA 1NM5A 3II6X 4IDHA 3NORA 4BO0A 2Z1NA 4X61A 1QZTA 3PGA1 1MJ5A 4IG9A 5LYJA 1T2FA 2QX6A 3SLKA 4PSDA 4YWHA 1W0JD 4LNUA 2VF7A 4OEHA 2MSDB 3C1UA 4JA2A 4MGKR 1IXZA 2HT6A 3L8CA 2WVAA 4DDVA 4CWAA 4WNIA 3LT5A 2WTAA 1VMEA 1SCUA 4MDYA 3CH7A 2Z4RA 1U9CA 1VKHA 3CQ9A 4X8HA 4F2WA 2CWDA 2W5UA 2N3ZA 3C98A 5LDHA 2D1RA 3G0CA 1LF0A 2JAOA 3EGXA 1QVZA 2FFQA 1JHOA 1Y9JA 2ZYRA 3H1AA 2XYHA 3HUTA 1E62A 4FSHA 3T3IA 4DIKA 4H7DA 1SGWA 3HHPA 2EWVA 4IAOA 2IHBA 3TSAA 1XJQA 4Q21A 5A5VA 1WV0A 2VJBA 4UTXA 3T99A 2Y1GA 1O8CA 5DNVA 1E0KA 2XXBA 2RHDA 2Q2VA 3HCNA 2I9PA 1I1OA 1U8ZA 3RRBA 2BMJA 1QYCA 2O0KA 4O08A 3VPBA 1WSDA 1Q7GA 2RBGA 2PKQP 1RNLA 1JIUA 4XVQA 1ONNA 4C0KA 3OTQA 4IJ6A 4J0DA 4ZOLF 4QU5A 5JAHA 1R15A 1NBIA 3LD9A 2JAUA 1VL6A 3N0XA 4LF9B 3OZDA 1PEDA 1RRPA 1ZIXA 5J4KA 2XUDA 5CJPA 4ACAA 2ZCJA 1JT9A 1C7EA 2ZYGA 5HGJA 1XTRA 5AXAA 5ICSA 5C51B 2PS1A 2JDID 3OQJA 1GJRA 3C5WP 1TD1A 4LXGA 5EZ6B 4TLAA 3H04A 5EXXA 4DMCA 1TT7A 5AKKA 1XDGA 3D4LA 5TS2A 2BFDA 5IM4F 4JNCA 3T95A 2Q8NA 5CBPB 2WB2A 3JD4A 1IHPA 4XJTA 4I6JA 2QORA 5FJIA 5HM8A 4C3VA 3MT9A 1S8OA 3OJWA 2WKSA 3R3YA 1C4KA 5A3VA 1DI0A 4KLAA 2P2NA 4XARA 4FTWA 5ALRA 2WE7A 4A0QA 2CKMA 1ANKA 1MX1A 4NU5A 4JLSA 4PZPA 3ONWA 3RVBA 2AV6A 2OD9A 1C3LA 2F17A 2QUHA 1C4XA 3KB1A 3QPVA 4IXDA 4UULA 4ZCSA 4LJ7A 3WMWA 3WLSA 1ILEA 1ZN2A 3AVYA 4MIEA 4D9BA 2XQFA 1EFVB 1QTRA 3IP8A 1BH6A 5JHGB 3IKTA 3R3UA 4RMIA 5FUYA 3KXKA 1P2FA 3L1UA 3PI7A 4H7EA 4C22A 2C9CA 1KKMA 4PQFA 4LHZA 2IYTA 4EPXA 5IFLA 3KVNA 1ZCZA 4YHHB 2F90A 2AUMA 1RP1A 3PNYA 3P9KA 1U3WA 2GN2A 3TZ6A 3KQKA 4KQ2A 2I91A 4ZQCB 4CKEB 4WLUA 3DEHA 1XAIA 1XD2A 3OWHA 3EH1A 1GAWA 1OIWA 1SOVA 4HSEA 1DAHA 5E6RA 1YJQA 5HIMA 2YBEA 1LW7A 2APJA 4OGKA 4QC2A 1SBNE 2JLXA 4PNPA 1DAIA 4Z9XA 5BRNA 3YASA 1D4FA 3HCCA 3ILVA 3ZLJA 4YXWD 1Q3TA 3QVTA 2CFCA 3FZYA 1R9GA 5EIWA 2FOLA 1EM8B 2X8BA 3IHKA 5AH0A 5DYIA 1SO8A 5EIFA 3A6HA 4LZZA 4ZU1X 5FA6A 4DRXB 5JO0A 2CZGA 4CM8A 1NWHA 1A69A 2BDTA 5DHQA 3PLAE 1E64A 3QJGA 4KN6A 3AHIA 2XIJA 1KORA 2PS9A 2QM0A 4RD4A 2B34A 5TGTA 3PD0A 4ZANA 1M1NB 1Z36A 2CEKA 1DKUA 6ABPA 4Z1OA 2CL0X 2H5LA 3NATA 1RWWA 2A14A 4W82A 1C29B 1FYVA 1PKEA 2QW0X 3NYQA 1CUHA 3FE2A 3BWXA 3LYLA 4BV9A 1E60A 1HEUA 3G1UA 1YDWA 2CDBA 3GLHB 2POCA 3OZ7A 3A14A 5MDHA 5KPJA 5F7ZA 4DR3B 2DHEA 3UOAB 4AL4A 2KYRA 1DUSA 1X1RA 5TARA 3WR5A 1MAHA 3ZHTA 5C8YA 4B46A 4DY6A 4QYWA 4KVFA 2WG1A 1OREA 3WP1B 4I2NA 1H05A 1NYLA 3N8HA 4AZTA 1A72A 1L6RA 2JFHA 4I8DA 5BP7A 2QTBA 4NKRA 1FMFA 1DZIA 1JJ7A 2FPGB 3DFKA 3OCZA 3SS8A 5AVRA 4FKBA 4O63O 5JNRA 4BB5A 2WIAA 2HOQA 4A6DA 4ALNA 1NXSA 1Z5PA 2H07A 3NBQA 4L9RA 3T9DA 1VE6A 3SC2B 4MAFA 3KV3O 4JXJA 3A1VA 4M1WA 4FFLA 3PL5A 3VRHA 4MLPA 4S1TA 1NRJB 1IN8A 4MV9A 3AKZA 2DKOA 1SU4A 3UUEA 3LHFA 4F93B 1JFVA 5D5QA 3ZWQA 2YXLA 3D2LA 1ZK4A 2F1KA 3HA3A 1YRHA 3WLEA 2PGNA 2ALJA 3I73A 1O4WA 2DTDA 3ETGA 4GZ5A 1XLTA 4OLJA 1FSZA 2DPMA 2W2PA 4NARA 3M33A 3I8SA 1QYRA 2P79A 2XE6A 4JP2A 3FROA 2I1WA 4CTJA 4KPYA 4COOA 1T9BA 1E9EA 5REQB 2WTBA 5EXTA 2EKPA 4IXMA 3SXJA 4TVKA 1IBRA 4HAVA 2AL7A 4YJ2B 3THWA 3DQPA 3ICOA 3BXEA 4NBUA 4WZAE 3WYNA 1OPRA 2Y67A 1XP8A 2XYGA 4FEEA 2ZAOA 4GT1A 1URPA 2YXPX 4KFTA 4PLCA 3FVTA 3IEVA 5IKPA 4Q34A 3LVQE 2VPYA 5KTKA 3H1FA 1I01A 2NZUG 1JDSA 1KAMA 3FMPB 4N4AA 4WAUA 4RZXA 5B6PA 3U16A 4N7JA 2J5RA 3FKSD 2ZAMA 4HZUB 3D7SA 5IAEA 5GV8A 2C4KA 1PS0A 4MTLA 1DFIA 4ENSA 1C0PA 2BEWB 2LKDA 4WLNA 2JLQA 3ZE9A 2VJMA 1T1JA 3O1HB 1FXSA 3A1TA 2EKQA 2DRIA 2HTEA 5F51A 3HFJA 2VH5R 3TRIA 1FTYA 1ACJA 2DVMA 4YAEA 3WXBA 1E6EA 4YFVA 5EP4A 2Z30A 1GRCA 2VZ0A 2ZJ3A 2OUKA 5LDDC 5F33A 1BJKA 3G2NA 1ULBA 1G2IA 4LCJA 1PLKA 2GEBA 4GVLA 1FUUA 2KS6A 5TPZA 2GVDC 2G1KA 1PG2A 4BXOB 4FNGA 2ISCA 4QUKA 4TKVB 3SDBA 3V2UA 4TTRA 4BQQA 5FR1A 4NL4H 1EWYA 2CVPA 3C41J 2ZRQA 2X0EA 1OTXA 1T4MA 2KI5A 3CRZA 2A9PA 4JI7B 1KI9A 1UIMA 4CODB 1ZUNB 2ECPA 3ZXUB 4FMPA 3SQLA 2AOTA 1X87A 4A16A 3NHRA 1E79A 2QL9A 1UQTA 2FEXA 2VDKB 3RJ5A 3EXFB 3KHKA 3Q5EA 4A0SA 3K0HA 4EA9A 2XOXA 2O5RA 1F48A 3AJEA 5LB4A 4BNIA 1AVTA 5C8DA 5K0ZA 2PWPA 1XKTA 5PNTA 3W04A 1MO4A 4FYPA 4CE6A 4X94A 1W73A 2BGMA 2X0DA 3VISA 5KINB 3QVGB 2FB9A 3FFWA 2HB6A 2K5UA 3AHFA 1N2GA 1JQBA 3NC1C 1JQDA 5KYVA 1KI1A 3A2NA 4P0QB 2JD1A 4FFMA 4N3BA 2H3HA 3HY6A 3BN3A 3WL4A 3GFPA 3PGLA 3IVCA 2NPOA 3NFRA 2HY7A 2I66A 4RY9A 2VBGA 2ASEA 3SS9X 5B1HA 2AG5A 3ZEIA 2PLRA 2ARKA 2P7IA 3PICA 3T9CA 4PZZA 3V2GA 4PV7A 4BKOA 4BKPA 3NC0C 1H69A 4DB2A 3A58B 4RFSB 3QEMA 1NVXQ 1V35A 2XDQA 3IXQA 4FFBA 3DT6A 4X7MA 3HJRA 4I4NA 4AYTA 1I4LD 3HA7A 3L0ZA 1HETA 3QTTA 4F3RA 4GKJB 4BB9A 1QDLB 3PYLA 1Q1QA 3L4SO 4G1EB 4Z6KA 4O3MA 2CVFA 2HF8A 2NLOA 3E7FA 1I3NA 2A9FA 3EK2A 3L7BA 5EMMA 5F73A 5K0NA 2H85A 3C3KA 2O3UA 1ZONA 5E9QA 1GA1A 4RPJA 2PWAA 1HNXB 3IA7A 1IB0A 4M37A 3MT8A 1R10A 1WZNA 3ILSA 4AUEA 1NURA 2FQ1A 1CG6A 1M6EX 3P7MA 3TNLA 3RYIA 2VP0A 3HB9A 4HMQA 4GSKA 2IVZA 5DX0A 2VP9A 1O58A 1W6RA 4JSTA 4Z9FA 4EGFA 4V03A 3MNFA 4YQZA 4BGDA 1CVLA 1P9RA 4YY3B 5AM0A 1SBYA 3EISA 4KLRA 3TQSA 2JGKA 3PKZA 4P3XA 4C4OA 4C7BA 3EQZA 2I7TA 3A8TA 1X9GA 2C7VA 1TAHA 3O7MA 4XSHA 3UMMA 1DCFA 1EFPB 5D7BA 4KBFA 5HHTA 3C7TA 3KL4A 4L5YA 2KMLA 3UK6A 2NX2A 4OQPA 1KZYC 4U7PB 4M86A 2ZYUX 5CJ2A 4XGKA 1TX4B 1K6MA 1OSNA 3H5VA 4CUZA 1G4AE 1SXGA 4C7KA 4Q6BA 4FHCA 3R2JA 3CWZA 2B7BA 2E0IA 5BSWA 4MUKA 4RKYA 3LCCA 4HLNA 1NFRA 5IVIA 5GV7A 4YR7A 2P9YA 2XDAA 5HKOA 4EW6A 2OD7A 5E7MA 2JCGA 3PPWA 4GLOA 5DOVA 4XOUA 1U31A 2J9YB 2XZOA 1ZR2A 5HKAA 3E9YA 1U2RA 2FWRA 4FD2A 3DOEA 4E5YA 1RE0A 2HLPA 4OXIA 3V4SA 2IXAA 4YMVA 1CX9B 1JEQB 3KFVA 3EQ7A 3I72A 3L1HA 3EUFA 1FS5A 3RTCA 2QRQA 4Z1MA 4QPPA 4XYGA 4W7SA 1FDTA 3C48A 5CYPA 3RSLA 5EWMA 5FPTA 2X7XA 4OXNA 2MYTA 3QUSA 4P5DA 2YVAA 1MW8X 1CUEA 3MRTA 7ADHA 1N5KA 2I7DA 5HNKA 2GO1A 1U9IC 4AJ9A 3I9FA 1KQFA 3ZOZA 4U2DA 1V11B 4G5HA 4BFYA 3R5TA 5A03A 2JFBA 4HWPA 2YICA 4REMA 3NHKA 4OQYA 3O8NA 3I32A 1XL1A 2OFFA 4B79A 1ZL0A 3CZ9A 1IXKA 1L7MA 2DBYA 1Y6ZA 1E3TA 3ESCA 1KP3A 1REQB 4FYWA 3X1WA 3H9JA 3U4AA 5JVDF 3COVA 4D4IA 4MGIR 2RBKA 3C7KA 3MCUA 3RJMA 4UNPA 3G2KA 2JJQA 4D74A 4KR6A 3EA4A 2IYPA 1X1AA 4PBSA 5G4LA 5DBGA 2FHSA 2P2GA 4RABA 4RHFA 1A2OA 5FD8A 4LJKA 4OATA 2ZM6B 5JT1A 5DGDA 2RCNA 4WBNF 2DWQA 3KYDB 4XDZA 4ZCLA 4JYZA 4TYWA 1RQLA 4UBLA 2IBTA 5B30A 5LSAA 4HH0A 2FFBA 2OR3A 3GG2A 3QOWA 3KVVA 1JFLA 1XMVA 4KFRA 4G24A 4MRSA 3L7AA 3QU7A 4NOKA 1TAGA 3SG0A 2W2XA 3L6OO 3HLKA 3V33A 2OXRA 1CUWA 1JQJC 1EUCB 2AA3A 1X0XA 4P4LA 4IR7A 1T2DA 3OIUA 3VNSA 1B6SA 5DTMA 1ZBDA 2QTNA 2YV1A 2YZGA 1JFTA 1FFAA 1CQZA 3Q0TA 5AW9A 1BD4A 3KJGA 2BJWA 5IXSA 3BRQA 1H3FA 1BFUA 1HG0A 5DM2A 3JR7A 1H9AA 1BNCA 1JA9A 3GLIA 3ZD9A 3CXUA 1B0UA 4F4HA 2A67A 4V24A 2PYIA 4BVGA 2WYHA 4LV5B 1L1FA 5LVAA 4NFLA 1NSTA 2GCGA 1AMNA 3MINA 1ZNZA 1F2TB 2BIFA 3AIIA 3W1VA 3PP8A 4DE5A 7REQA 3CSUA 1KNXA 2WHEA 3OETA 1DCTA 3OZTA 1N2ZA 2JVIA 3EC7A 5BSRA 2MTBA 3S8MA 4CLHA 1FUKA 1PAUA 5DN9A 3ZZUA 4QDJA 4EF5A 1IJFA 3FZQA 3OTOB 4G07A 3L4KA 1GRVA 2PGOA 3OEHD 3OOHA 5ECDA 5FBRB 4PYJA 1P74A 3E22B 4QQKA 2GH1A 5FBLB 3BWCA 5JY1A 2I2BA 1MAAA 5FOSA 5HF5A 1OLSB 1ESZA 2QS9A 3K30A 4MAMA 2GESA 2JAWA 1Q91A 3E53A 4RK1A 1RWBA 3HP7A 2OAGA 1G8PA 1E6LA 2EJCA 4MYUA 2BBTA 1AKVA 3SBDA 4LJ9A 4K9DA 3QE0A 1XUOA 4JCOA 4PLVA 4R3NA 5KCMA 3AHEA 3BBLA 1V3QE 3GLGA 2PA3A 1QUFA 1L5SA 1VMAA 4E5SA 5TMPA 1ACMA 4JGGA 4KGDA 1SCJA 4LVCA 4OQQA 3DTNA 5LM3A 2ECFA 1FBTA 1TKRA 2DT8A 3AFMA 4QD3A 5ED4A 3QE4A 4GM4A 2LPMA 4HAOA 4WSOA 3EG5A 2PSSA 4L6AA 3KM0A 1X2BA 2G9QA 1F6DA 5FV4A 1ZGAA 2EZTA 2JIQA 3KOXA 4IGEA 2CGEA 2ZSIA 4WK0B 3JTMA 1XJ0A 2ZSFA 3MWGA 1KR5A 1R3DA 2I29A 3R40A 1X80A 1T3HA 2HA2A 4H7HA 5KNDD 3ETJA 3NWBA 5AVZA 2QX8A 4AZSA 1AHNA 2NPIA 1EXWA 3ASVA 3ZZ0A 4F5ZA 3TNJA 2PUTA 4BZQA 3H0EA 1IIRA 3P2KA 4CEJB 2FLWA 4B3SB 2D00A 4OGGA 4O4HB 1KY3A 4YGYA 3UKJA 2YIDA 1UM9A 4C1BA 3CPEA 1XU7A 3EJWA 2LV8A 3PFNA 4RK0A 3FSEA 5TVKA 3GCXA 1FSPA 4JVSB 4TMZA 3VR0A 5JAOA 3EIQA 1VDMA 2ZB3A 1QHSA 1D5CA 2I1VB 2IYOA 2X6RA 4GXNA 4D97A 1KFCB 4PVCA 1L8XA 4QGHA 1N3BA 5E38A 3JZIA 5KTSA 4DLSA 3HRIA 4IZOA 4MZXA 1T4BA 1HLFA 2ID8A 1GPKA 2R97A 2FN8A 4YRSA 3FVQA 3DDWA 3MD9A 4PW0A 5L3RA 2AC7A 3H9QA 5HZHA 2ZBGA 4RJIA 5HR5A 3KVOA 2G63A 1LSOA 3D8UA 2HADA 4QWMA 4EB3A 5LLDA 1KSHA 4HAIA 2J85A 2WG2A 4YJDA 4R1OA 2JGLA 2YVUA 5LC1A 2OQIA 5T57A 1KFBB 2MYPA 5I8WA 2NMVA 4TTPA 4YT4A 1EDEA 3OLYA 5K8JB 1N57A 3OAAD 1DTWA 2VXOA 2BMDA 3IUPA 5F2NA 3M9XA 3OVMA 4HNSA 3HYNA 4BQFA 1O3YA 4MWDA 3R7WB 3IEUA 5GGYA 4EJ0A 4K9QA 1CY8A 1J2EA 2XWPA 5EERA 5F76A 5EJ6A 3AGPA 2QENA 4D6XA 4HD8A 1ZM4A 4C6HA 3VVCA 1Q19A 4BLPA 5BMOA 4OHCA 4NIMA 4TX1A 2RHCA 3WRYA 4JL8A 2IL1A 4RTQA 2IOFK 4OMDA 2XT6A 2HFKA 2NWQA 3I1FA 4IQFA 4MA0A 3I9LA 1BOOA 2EVWX 3OKAA 4JP8A 1NVGA 1TJYA 5B55A 3ZHQA 3EQ8A 4BX9A 3BH7A 3EQ9A 2ZETA 5JVDA 2PWYA 3ONEA 2Y92A 2PSJA 3U4HA 1GU1A 2VK8A 1V3VA 2IS6A 1KK3A 3MRVA 3HB7A 1L7BA 3S29A 1GUYA 1FBNA 2W0MA 3ETNA 2IP1A 2NUAA 3FWZA 1L4NA 3I23A 1N5OX 3RV4A 3ZY5A 4MS3B 5KUTA 2OMKA 4M0DA 4NR0A 1TMOA 4QTTB 5LQNA 4U7GA 2CV1A 2IPMA 2C58A 3EVFA 2CFTA 3IQIX 3N8KA 1Y4UA 4BAZA 3WOHA 4L9SA 4O4HF 3JVEA 1E2UA 1OASA 3SE0A 1PRYA 2CZQA 3I9V6 1EDBA 4UTVA 5I7FA 3I5YA 2GILA 2CYCA 2RI6A 2WD8A 2V9ZA 3A3KA 3L77A 4Y1EA 1GZ5A 2DSTA 3MJHA 1XU4A 3IULA 3RRJA 5I7RA 1QGYA 5KVQA 3CEAA 4EBBA 2XUPA 3CKMA 3NTOA 5LUAA 2D5IA 4D8TA 4XKJA 2CDCA 3VSBA 2QPTA 1Y6RA 1RXUA 1K0UA 1R18A 3MCZA 1WZIA 5TRTA 2H2WA 3QE9Y 5EXDA 1PYGA 2PLAA 2VBIA 2GK6A 1AN9A 1Z15A 2HO5A 3FOZA 4CM9A 3GGGA 4RXTA 5KHAA 2PKEA 4UD2A 2O8NA 1CUGA 5LXTA 4BO7A 4MVJH 4C0JA 2AFHB 3IXMA 1UJNA 3I45A 4I1IA 3ZW9A 4ZTUB 2CD7A 3H11A 5P21A 1Z5WA 3DZKA 4IDDA 1G6Q1 1EEHA 3DWEX 1ZI9A 3AF6A 4D2IA 2VHYA 3L0YA 4EHFA 3E6AA 1THTA 4ZGWA 1JEYB 5BVHB 3HCDA 5FKJA 1IZ0A 3G9UA 3VR5D 2ZDHA 3EUEA 3O8OB 2ZWOA 3QF4A 2P0AA 5HA5A 1T1RA 3GC6A 2VNKA 2YWDA 4KO8A 4HAZA 4RQUA 3B78A 5DOZA 1R6UA 1RMQA 4PONA 3TOCA 1Q11A 4AJOA 3S5UA 3KOYA 3ZD6A 1EUDB 1E1NA 1FTNA 3IP1A 1IYZA 1Q7CA 4Q3NA 4X7BA 1WR8A 4IVPA 5K9ZA 3PQ5A 1XMOB 3FZGA 1LU9A 2B6NA 5GMOA 4B7AA 2HSEA 1GDDA 1W5BA 3D54D 2W6CX 5BVGA 1OB2A 3A6PC 1M1ZA 2FX3A 1FQWA 1OXXK 1H65A 1U0HC 4FT2A 4OHUA 1R7RA 3D8SA 5ILQA 1YZHA 4PLWA 2A1TR 4AIRA 4AKSA 4CKBA 3MWKA 3DEJA 1Y89A 3KEOA 4EY4A 4KXMA 5IS2A 2CHUA 1A8HA 2D1FA 5P8WA 4RYLA 3UHOA 3PC7A