1PFGA

Strategy to design inhibitors: structure of a complex of proteinase k with a designed octapeptide inhibitor n-ac-pro-ala-pro-phe-dala-ala-ala-ala-nh2 at 2.5a resolution
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVVKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Strategy to design peptide inhibitors: structure of a complex of proteinase K with a designed octapeptide inhibitor N-Ac-Pro-Ala-Pro-Phe-DAla-Ala-Ala-Ala-NH2 at 2.5 A resolution
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 99
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2003-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1pfgA00
1WSDA 1S02A 3VV2A 1R64A 1BFKA 1AF4A 1UBNA 2PWAA 2E1PA 2X8JA 2Z2XA 3DDZX 4AKSA 3Q5GA 2WUWE 1OYOA 1P7WA 1TM1E 5JXGA 2PYZA 4C3VA 4DWWA 2WV7A 1KE2A 5B1DA 3BPSA 3F7OA 1KDYA 2SNIE 5JXIA 4ZARA 5JXJA 1C9JA 1WMDA 2W2NA 3I37X 1CSEE 2QTWB 1MEEA 5ARCA 3GT3A 4WOBA 1C9MA 3DE7X 2X8JB 4CFYA 3D43A 2Z2YA 4M1ZA 2Z58A 4OV6B 3TI7A 3OSZA 2W2PA 2W2OA 4HX2A 1SCDA 1THMA 4H6XA 4NE9A 3A3PA 3A3OA 1SBCA 1BFUA 1AV7A 3P5BA 4NMXB 3DVRX 5SICE 1P7VA 1SCJA 1EA7A 4AKTA 1Y3FE 1SIOA 1GT91 2DUJA 1SCNE 1GCIA 2PKCA 4WOCA 2P4EA 3WHIA 2W2QA 1TM4E 4FONA 3BGOS 4OMCA 1WMEA 3DE0X 1KDVA 5AMXA 2WUVA 1Y3DE 1IAVA 1SUEA 1SH7A 1SUAA 1AK9A 1NLUA 1SIBE 3CNQS 1VSBA 3H42B 1PJ8A 1SIUA 3PRKE 1TM3E 1SBTA 3GT4A 1ZVKA 1TM7E 3WQBA 2SBTA 3VHQA 4HVLA 3BX1A 1LW6E 1SBIA 3HJRA 3DWEX 3LPCA 3DE6X 2WWTA 3DE4X 1GA6A 3AFGA 3TI9A 1SCAA 2B6NA 2IY9A 5AVJA 1Y1KE 1AQNA 4Z2AA 3T41A 3Q40A 5I9SA 1SUPA 1TMGE 1SBHA 5FAXA 5B1EA 1V5IA 1SELA 1R0RE 3EDYA 3WIUA 3ZXXA 3ZXYA 2ID8A 4KG7A 3AJ9A 1C9NA 1MPTA 1P8JA 1S01A 4KPGA 1OYVA 4LVNA 4DZTA 1SN7A 1A2QA 1S2NA 4JP8A 1Y3BE 1BE6A 1Y9ZA 2ZWPA 3LXUX 1YU6A 1TK2A 3DE2X 1Y4AE 3QFHA 5JXHA 3PTLA 1T1GA 1Y4DE 1Q5PA 3DE5X 1BJRE 1EGQA 3QMPA 5FBZA 2IXTA 1NDQA 3A3NA 2ST1A 1SCBA 1Y34E 4H6VA 3VSBA 4C3UA 1Y33E 1T1IA 1SUCA 1IC6A 3DW1X 3I34X 3SICE 5K7SA 3I2YX 2W2MA 1GA4A 1KDZA 3DE3X 3VTAA 5ARBA 1YJBA 2Z2ZA 2PRKA 1SVNA 1YJCA 4B5LA 3DVQX 1SUBA 2Z30A 3GCXA 5CW1A 2V8BA 1PTKA 3AJ8A 1ST3A 1TM5E 2Z57A 1ZVJA 1SPBS 4MZDA 3DYBA 1GTL1 1SBNE 1T1EA 1GNVA 1JEAA 2SICE 5FFNA 2DP4E 1Y3CE 5AQEA 5ARDA 2PWBA 5AVKA 4DJ5X 3EE6A 2G4VA 4YN3A 3SQOA 2HD4A 1PEKE 2HPZA 1GNSA 1Y48E 1NDUA 3EIFA 1GTJ1 2XTJA 3GCWA 5JMOA 1WVMA 2XRMA 4LVOA 1WMFA 2TECE 4CG0A 4H6WA 1PFGA 3UNXA 3CO0S 3DE1X 3F49S 3LPAA 4KB5A 3DW3X 4CFZA 1ST2A 2SECE 2ZRQA 2PMWB 1SUDA 1AVTA 2ID4A 1V6CA 1XF1A 3D9QX 1DBIA 3LPDA 1DUIA 3DVSX 4NE7A 4BWGA 1GA1A 1AH2A 1GTG1 4J94A 4RYDA 1TO1E 3F7MA 1YJAA 2Z56A 1HT3A 3VYVA 3WIVA 3I30X 1KE1A 3TECE 1BE8A 4ZOQI 1BH6A 1TO2E 1CNMA 2PQ2A 4I0WB 4K8RB 1OT5A 3L1KA 4OMDA 2ZWOA 1R6VA 2GKOA 3QTLA 4GI3A 1C3LA 1TECE 3VV3A 2DQKA 1AU9A
chains in the Genus database with same CATH superfamily
3U7QB 3K72B 1V8PA 2NYAA 4QXRA 2FQXA 4BBZA 1U0FA 2FMIA 3UGJA 3BTSA 3CUVA 4ZHSA 4ZRDA 3H7IA 4UC0A 1T5HX 1I36A 1OHHA 5E2BA 3FM9A 4IXDA 2BZ0A 1NHWA 2X8AA 1PJAA 2RCNA 5F52A 2QTNA 2IODA 5EIXA 3CVJA 4K2AA 4AKSA 5JSQA 4A6XA 4KWIA 1P9RA 3P97A 5AW9A 1SAYA 2OCGA 4J91A 5DOZA 4EHJA 2Z5GA 2JHFA 1L4LA 3IEVA 2PD3A 3O4RA 4YS6A 2Q3DA 1PFKA 1N2CA 3G2MA 3IUSA 3T54A 2BGLA 4C3VA 4GZ5A 3IP1A 5L95A 5BOVA 1RLOA 3L84A 2WG1A 3QBJA 4JA2A 4N8SA 2HTEA 3BPSA 2GBCA 3SIPA 1KAQA 3AR4A 1YZ3A 4HGNA 4Q3LA 3UJ3X 5HIAA 2GPAA 1ZCJA 2ZWVA 2ZB2A 5JALA 1KI4A 2BE7A 1U81A 2G83A 4RMNA 3UWDA 1HORA 4M0KA 1FNBA 2YHSA 2YNMC 3AQ4A 3QLVC 1VIVA 3Q0EA 1INLA 4QO7A 2H0RA 1JYSA 4DLZA 5HXAA 5FO0A 3I32A 2WIJA 2J1LA 5IK2D 1X3LA 1KFEB 1W4ZA 2JHCA 2P62A 2Q6IA 2VYND 3MGGA 4KFSA 1VE7A 5JXWA 3A2KA 4K9MA 3JD2A 4V0SA 4YV0A 2C9OA 4D8VA 3R9XA 4NTZA 2E4YA 1ZWKA 2HQ1A 4KOAA 1J20A 1U6JA 1ZG3A 2V7BA 1NMSA 3K9FC 2GZHA 3A9TA 5IJXA 4P84A 3K9BA 1V8FA 2JGIA 4TSRA 3SF8A 4C6HA 1OB5A 2AQ8A 1TVKA 1GSHA 2HUNA 5IC4A 2B83A 2HDNB 1Z15A 4G8BA 4AY4A 3SYLA 3KD3A 1GSIA 2FW8A 2Z8XA 3GA5A 1NXOA 1LLQA 2FW6A 1R5OA 1Z4LA 2XMZA 4D6PA 5B12A 4COOA 3DEYX 1JEEA 1XNGA 4LHEA 3FI0A 1NU6A 1R6DA 2HC9A 4ZAVA 4ZYXA 5J2TB 4I4TA 5IVDA 2FMTA 3KYDA 2I4NA 4CIXA 2FHSA 5KS2A 2UXBB 1FRFS 3DMDA 3DVLA 4EFNA 4IPTA 1EUCA 1QBGA 2BCGY 1SKYE 3ZV5A 3WAGA 2GYWA 1XFDA 3GBSA 4YEDA 3RVRA 3KU1A 3STWA 2Z4TA 1GN8A 3DXFA 3CNBA 3O2SB 4P4LA 1WB9A 4BNIA 4E5MA 2VL7A 1NVMB 4QPCA 4H6XA 1A9RA 4CKBB 1N3IA 1PL8A 1FFGA 2CXXA 4TM7A 3QXSA 5EHQA 2FXIA 1EK5A 2Z5FA 1PQUA 1BEEA 2ZRDA 2RGDA 3DCYA 3PSAA 3DVRX 4G1CA 4P1ZA 1Z82A 1XO1A 3PD0A 1FP4B 4FDLA 2C2HA 2ZVJA 3KVNA 4EYGA 2IUUA 3EQ2A 1DAMA 3N8GA 4OLJA 1W30A 2GPWA 1BX3A 1Y37A 1HT0A 2R85A 2CCKA 3SLGA 3N05A 3DKIA 2Z1MA 4FCCA 2JH3A 1SIOA 3TZEA 1GT91 5LFAA 4FR0A 3RAPR 3I73A 2WW8A 4RNCA 1VPEA 1VE9A 1FNMA 1E9VA 2DUNA 2GCPA 3ZGXA 4TS9A 3AEQA 3CZ4A 3EVFA 1ZVMA 1P2VA 3JQ7B 1W52X 3GL9A 1G9XA 4MVXA 3IIMA 1LLUA 4DGQA 2DEUA 2F17A 1TM4E 4Q4JB 1KU6A 5G4LA 1YRYE 3UM9A 4WASA 4G4SP 2RONA 4GI5A 4LEIA 5BN3A 4HJXA 1JKMA 5AK6A 2H92A 3HFRA 1HE3A 4S12A 4DRZA 1WMEA 2R1VB 1W5AA 4K5QA 3PXUA 4ZHQF 2C9ZA 1XELA 1T3ZA 2XB6A 2XOKD 1T0IA 4GZ3A 1N2XA 5C4MA 2DBVO 3GGDA 4OLAA 2VPYA 1P7PA 4UDXX 3WNVA 3UKDA 1GUDA 4A7PA 1P2FA 1Y3DE 3DF9A 5D00A 4QDTA 1BRMA 1T35A 2X5NA 4NQZA 1I7LA 3BF8A 2XUGA 3TRJA 2DWCA 4ALKA 4Z4HA 13PKA 1VJRA 1QS0B 4GX1A 1TKRA 4BFZA 5DNAA 4CEJA 3U48A 1XDSA 3EVTA 4MUGA 1EDEA 5CVDA 1EFCA 3HBJA 4EA8A 3GD7A 2PYDA 3U4CA 1TM3E 1CIVA 2GVZC 2MSEB 2HMTA 4RV4A 1RWPA 1O2DA 3UWOA 4ILKA 1ZVKA 2I29A 2HTFA 1ZIYA 4ZPXA 2C2OA 5T4HA 3RI3A 3EULA 1Z22A 3B1YA 1DC4A 2X3YA 3WKDA 3WQRA 1QHYA 5ADUS 1GL9B 2OB2A 5D85A 2A9RA 3BX1A 4C5BA 3VA7A 1GU7A 3KQSA 1U1IA 5EFOA 4YQZA 1G3RA 2J3EA 2VNSA 1TGYA 1G16A 4MI1A 1PYGA 2A0XA 2GD1O 3JQ9A 4Z9FA 5FBKA 2WWVD 1E96A 2JZNA 3VQTA 4RZIA 4RX1A 2EW2A 3EIOA 4WVFA 1LC3A 2H63A 3RUDA 1PJRA 1R4ZA 3RHFA 1SVUA 3GFFA 3WAKA 2B4YA 3LY7A 5JSZA 3CY6A 4NK4A 1VPWA 5BWCA 3INTA 2FQWA 4ZO8A 3FPGA 1P75A 3LRTA 2VTBB 3NOXA 3F71A 3HS3A 4M0UA 4UPDA 1DC7A 3RBAA 4HY3A 4P5EA 3QELA 4BU1A 4N7RA 4XJVA 1K27A 4NF2A 5AW0A 2NTEA 2ZE8A 4BVHA 3M6XA 5CD1A 2RH5A 4N6OA 1UT5A 4AXXA 4ID3A 4ZQEA 5E1MA 3ADDA 1E79D 1OKKD 4ZVNA 1TZCA 4ARZB 1D8TA 5I7UA 2UVDA 2X77A 3F4KA 2BKLA 1KZ6A 2AN3A 2RC5A 3FTDA 4P83A 1NN0A 1FLDA 5FOSA 3JAWA 3MW8A 4NZOA 5LYJF 5DBEX 1NN1A 4JQYA 5KNCA 4GO1A 3JQQA 5C8VA 4FGWA 4AW9A 1IY2A 3DBRB 1QFMA 1B76A 3F9IA 3GRKA 4ZI3A 3MWFA 1FYWA 2JLUA 3ROXA 3OOHA 1P91A 2V6GA 3C8UA 4GP9A 4XB1A 4RGQA 1OXBB 2NZWA 1EQAA 1RQGA 2LW7A 4I5DA 4L5YA 4RJKA 1LPSA 3LHKA 4O4LA 1MNAA 3MZ0A 1ODIA 5EIFA 1JG1A 1U2ZA 1IY0A 3QYPA 5EEGA 2FTKE 5EWJA 2DQZA 3AHJA 1YI1A 1YZQA 1PGOA 4JELA 3EGIA 3DOJA 1ZL2A 4G1EB 2ZAYA 4LMBA 3L2OB 3UAZA 2EP7A 3PQFA 3TSAA 1WW8A 4G0WA 2VJPA 1AKRA 4O2LA 2VNJA 3KWLA 2QMOA 5B3KA 3NYQA 1TO6A 3KEMA 3SS7X 4H0NA 2JVIA 4E4TA 5L9AA 1S2DA 4JT8A 3KVOA 5IJ9A 5LP6B 4GMXA 3MWKA 1T2NA 3W5JA 3AESB 1GZSA 2XMRA 1NNI1 2CVQA 3I72A 5EY5B 3HO1A 3L92A 3OETA 1XTJA 4IHJA 2G1KA 4E2FA 5JFGA 1VL8A 4KWEA 2D0OB 3PC4A 3DL4A 2ZS8A 2W2XA 3GJ4A 2D7CA 4PFSA 1VJDA 2I7CA 2QRPA 3LZ6A 4IO1A 3D8UA 5BWMA 3OQ1A 4JOSA 3C2QA 1MG5A 1WB4A 3WMEA 2ZPTX 4HDRB 1T91A 5MF6A 1KZYC 1Z2OX 1Q11A 4YGXB 4CIDA 1Z75A 1KSHA 2CL6X 1XFAA 3RU7A 4G24A 4RD1A 1H3EA 3EZ7A 3R5JA 3R9KA 3SR3A 4DLWA 2R5WA 5I3ZA 4M1MA 2HADA 1C3OA 2ZT6A 4TMYA 1LK0A 4DNQA 5LQMA 4LJRA 5DT9A 2ZZMA 4PFKA 3EH2A 3HNOA 4TV9A 2OYRA 4ERXA 2EQ5A 1QYCA 3A1VA 3N8IA 2YJ6A 3GPBA 4M1YA 2I03A 1RXYA 1TMKA 3QA3E 4G84A 5C4GB 3FWZA 4MWGA 3T9EA 1IZZA 3C7KA 1VP9A 2CBGA 1BEUB 1DO0A 3F9RA 5JOQA 1LF5A 2YN2A 3UJ7A 1ZH0A 3KVYA 3S2UA 2Z83A 5ELXA 2HMVA 3I04A 3U19A 2B4KA 1XUOA 5GZ3A 1V8OA 2DTEA 4DLUA 2WZDA 1T1RA 221PA 1KJJA 4BV2A 4D4KA 4TT8A 4W82A 1IZ9A 3BMNB 3DV0B 3IIJA 1AQUA 1GPWB 2PQ6A 4DJFC 4JU9A 1ZKMA 3HB0A 1T6XA 4DY4A 2LWIA 1UP6A 3SYKA 1T24A 3WSTA 4NP6A 3OLZA 1OZFA 2OSVA 4DR4B 2X6TA 3ISTA 4BRSA 3A9WA 2OA0A 2N75A 3MWYW 1QK3A 3TOZA 2UDPA 1U5BA 2V8BA 4PLPA 2I6QA 5HRCA 2AFHB 3H11B 1BX1A 3RS4A 3I6ZA 5DH9A 1NURA 3WR5A 3JWGA 5FBWB 1Q17A 2VI5A 1H2BA 2Z57A 5ANRB 4PSAA 1I7QB 4TWZA 5CDFA 4DBZA 3PHHA 2QLFA 5DRTA 1V5WA 4Q15A 4OUDA 1L4EA 2GNAA 2REQB 4LJ7A 1OI4A 7AT1A 1JJBA 1DJPA 4KDFA 5C32A 1YE8A 2KLHA 2FJ0A 2WJIA 3DZ8A 4G5SA 3I76A 1QJCA 3D6MA 3CG4A 5AI8A 4BGVA 3ZLTA 3F0TA 1P2DA 1KEUA 1RJ9A 4PIVA 1Z0FA 2W2KB 1ZK3A 1XPJA 4Q12A 1EFDN 5FULA 1ODCA 3OEHA 3OCUA 4QYIA 4L6AA 2BGKA 1F20A 5B36A 3AR3A 3AR2A 1UC9A 2PS1A 3H75A 2XDYA 3FPLA 3L8DA 4GP6A 4OHWA 1E5DA 3LVRE 2CHUA 3FDIA 3B5IA 1MENA 5DI9A 3WBFA 5J9FA 2A9PA 2YQZA 4J1QA 5F2OA 1MC1A 8ADHA 1KTVA 5TMDA 3UHJA 3GCWA 2GXSA 2C2XA 1J8FA 2QEQA 3P0EA 4IM7A 4LOHA 4BO7A 5ITZA 4D7AA 1T9HA 1J99A 3CF2A 5EKXA 3O8OA 4EUSA 3OEWA 3DCIA 1WF3A 4P4NA 1Z0DA 4QJBA 1QKIA 1MIOA 2YH2A 3KV3O 5DVZA 2PKYX 5J5CA 1NM5A 4JJ7A 2AYXA 1W46A 1OH8A 4KPUB 1T0HB 4BQEA 4GPD1 2A5JA 3VZQA 4D96A 1OA1A 4J0FA 4C6TB 1BDHA 1WXXA 1C4OA 1U4OA 3GQVA 4K6KA 1R8XA 5JH7A 1ORIA 1X1DA 5LC1A 3VMMA 2W6JD 3INGA 2W6OA 4UAJA 1XQVA 4DPLA 1WUYA 3OTWA 4P3YA 1U9IA 3NHFA 4HQ0A 3I8OA 1C29B 1UT8A 2DBRA 2SECE 2P6UA 3DS8A 4IJKA 4PTZA 4Q6WA 3IBSA 1BWQA 4YAWA 1D6MA 3W9UA 5JECA 1Y8QB 2B7BA 1I2DA 2PMBA 3OX1A 3Q72A 5GADl 3B1JA 1A4XA 4MULA 5JS2A 2HZBA 2JDIA 3QEJA 4FC7A 1GNPA 1UXKA 2P9HA 4HEA6 1Z7YA 1L5NA 4F7DA 3G8BA 6Q21A 1SXIA 1UZAA 1Y1TA 3CV3A 5AXCA 5ENDA 4IKPA 1D8AA 3MCWA 2XVAA 3PENA 4KIFA 4F3RA 1A2OA 3EXIA 1PLJA 4MV3A 1DUIA 2X2OA 4R3NA 4TVKA 3FHOA 1AS0A 4D41A 4DSAA 2PJZA 1N0UA 6ADHA 4JC0A 3TGWA 2QNIA 2VQFB 1MKYA 3NALA 3UK0A 3VH4A 1OA0A 5EP3A 3CXRA 5I8PA 2OYCA 5H3CA 1RMYA 3ZH9B 3GFQA 3O91A 2JLZA 1GTRA 2O2JA 3WLPA 2VJMA 3SS8A 4HUQB 3CH5A 3RYIA 1BDJA 1L7QA 4RTSA 1JDNA 3GU3A 3K1AA 1CZLA 1OAOA 5L6MB 3TPFA 2JATA 5IAOA 2ZRJA 2D2XA 2OAQ1 3OJWA 4TXLA 1GZ6A 1D2MA 2NUBA 2ZKLA 3EMDA 2OGUA 1O5OA 5I9MA 3SXUA 4AUEA 3NVAA 4Q6BA 5F78A 5K4GA 1VPVA 3VO1A 3BXHA 3Q87B 4OQMA 5CDTA 4FIZA 1UWKA 1DKPA 3KDAA 4EUNA 1KFBB 5LKRA 1RLJA 2VP6A 3U3OA 3HSKA 1JU3A 1CS0A 3D3JA 4M0EA 4NWIA 2P9ZA 4WVLA 3DPUA 4UHDA 1JKIA 1DOZA 2GZMA 2OHXA 5P8WA 4F04A 1BCSA 3W1VA 2EW1A 1EPUA 2W2LD 3WGHA 3G79A 4B40A 4FX5A 1G8SA 5F3WB 3F6CA 1ZM2A 4KXVA 4I4TF 3BBLA 2X9VA 4XCVA 1FDUA 1WSWA 1L7DA 1IWPB 1IWBB 2O7VA 1X39A 1QQ7A 1UPBA 2Q0SA 3KFVA 3OZRA 3PEFA 2ZYGA 5GV8A 3JZDA 4QZVA 3HY4A 2FEWB 1MC4A 4UU1A 1YZYA 3N2YA 1TAQA 4DV6B 2DX7A 4FYXA 2HHJA 4QDJA 1R0LA 3NXKA 3MQ4A 4D80A 1JW9B 3LLSA 4MYSA 1L5OA 1J2EA 3NBMA 4NAHA 4QL3A 1O57A 5CIQA 1FP1D 3URKA 3ZK8A 1XZFA 2HM7A 3OEED 1RHQA 4E7OA 4TV8A 3V6MA 3L40A 4G0ZA 3UJ6A 3M5DA 5BV2P 1Y82A 2HU2A 1A1VA 3A7DA 1U0EA 3FMOB 2YICA 4PHGA 5GJWC 2H7XA 2A78A 3WZ2A 4LWZA 5TQ0B 3M83A 3SJCA 4ZVMA 4CIAA 4KPEC 3NHPA 4Q4CA 3EIEA 2Q4TA 2XXAB 4OHXA 2DBYA 4H3SA 4WNAB 4Q3CA 1QTIA 5CB8A 5I9LA 2HPHA 5HP4A 3DLIA 3B5EA 2VRNA 4F6RB 5FUQA 3ZDAA 1M10A 3U44B 2OZVA 4HRAA 4L9AA 4JGIA 4KE6A 2PD4A 4LOJA 4B79A 1TAHA 1Y7IA 1FFXA 2FJPA 5HFAA 2F8MA 3A32A 2BGTA 4OLHA 2HDWA 3P9SA 1M3SA 2HKIA 1D4OA 4D3XA 1QR6A 2NU9A 3V9AA 3CX4A 5LJIA 2R8OA 2UZ0A 3N8KA 2FPGB 4LY9A 1MJHA 1OFHA 1V3TA 2GNPA 4YO8A 4D8YA 2YW2A 3Q12A 2R47A 1R0KA 2EAUA 3OM8A 3M4XA 5CXSA 1YKFA 3VAZA 5A9SA 4DBLC 5CBPB 3X1JA 3O9ZA 3TRIA 4F9FA 4O2RA 3TMYA 5I7OA 2BM9A 1UBRS 2TMYA 3AG5A 4GLJA 5ALVA 4WJLA 5JASA 3OQNA 1YBVA 2D2IA 4U3JA 1Z5OA 2QVGA 3PEWA 1EXDA 1P1JA 1TW3A 1G18A 1CNEA 3N5KA 4YH1A 1MXFA 4NDAA 3FWNA 3R4VA 3HZRA 1N7JA 3H9BA 4RKWA 1ESEA 1TGVA 2HYDA 3EXFA 4ZCPA 3HB5X 1U28A 3JQFC 1ZI6A 1A5TA 4KN8A 1KRWA 2YXBA 1NF9A 1WULS 2YIVX 3SKXA 2OV8A 1FFHA 1T0UA 2BBWA 2B9VA 3HN6A 1SU6A 3WNBA 2OO5C 4QOFA 1NUUA 4OI0A 2W6CX 4KQ9A 3Q8KA 4M0FA 4DM4A 2ZSBA 3QOWA 4M6WB 1ZLYA 2H1FA 4FOSA 3S0JA 4NOLA 4BXOA 3JATB 2H5IA 3H5AA 4LXXA 3HYTA 4PCAA 1C0PA 3CNEA 4UQPA 4X8OA 1N7IA 3IHKA 4J16C 1HFEL 5IG2A 2CXPA 1HSOA 1K8XB 4RQUA 1KZHA 4WNYA 3KKZA 5HF6A 1J39A 1NW8A 1O03A 4UEKA 4NJEB 3O1IC 1SCDA 3MWDB 1CETA 4EG5A 4BZZA 2ZT7A 2CFTA 4EI2A 1ODTC 3UZUA 1ZY2A 2NPFA 4LOLA 2XGSA 1N6PA 2OSBA 3QITA 2LZ0A 3M7IA 4FCWA 4GQBA 1GY8A 1PR3A 5IZCC 1SUIA 2ZIEA 1ZA1A 4RZQA 2GESA 3ULKA 2EHJA 2R62A 2KM1A 1X7YA 5M04A 4YHBA 3IERA 4IDAA 4O6VA 1P1CA 2VK4A 1VMIA 3SPXA 4URUR 4EUHA 1C4XA 1FU7A 5JSHA 4MW7A 3ZN2A 2BHTA 4KI0A 2QUBA 1KK1A 3EOZA 3LQ4A 1G5RA 5AVWA 3K0BA 1WLYA 7REQB 2CLSA 1LBEA 1PU2A 2O1SA 1ZMRA 1AKUA 1DXHA 2G0TA 2PH7A 2WJZB 2A4KA 3EQ8A 4CN8A 4DW8A 1RZRD 3O8LA 3FJYA 3LDGA 4OMFG 4G9BA 4RZ3A 4X44A 1T43A 3RK0A 1W2GA 2NQ8A 1D3AA 4RKRA 4PPFA 3T8YA 4QOJA 4DV5B 1WKBA 2EU8A 4HXFB 4BLOA 4UOEA 4OPMA 3KLPX 4ML3A 4DVGA 5K8UA 5HS4A 1E2FA 5AESA 4X1OA 1DKOA 1WG8A 3REOA 3QUCA 3WV5A 5JTTA 3R3VA 4PLWA 3T3HA 5JJ5A 5B6PA 1NR1A 1LRJA 2XODA 3QU4A 1ZGZA 2D00A 2Y1XA 4G0XA 4HB3A 1R4MA 1J0BA 4MWOA 4O4LF 3RADC 4RIHA 1LJLA 1BYIA 4HDQB 2J7PA 4CYMA 1IB6A 4DHEA 4I5FA 3DBLA 5C5EA 4J0QA 3MLBA 3CUEF 1F0YA 1N92A 3O3NB 3AVTA 5F77A 1CUBA 1BN7A 1NNUA 1Q21A 5E1BA 5J40A 3B6ZA 4M0CA 1UC5B 5DBOA 2WA2A 5KYYB 5JZ9A 1SH7A 1N6RA 1ND6A 1TZJA 2DU8A 3T3DA 1BJKA 4EKNB 2JCVA 2PZEA 2YV3A 3UQYS 1O9GA 5A3SA 4CMCA 3OPMA 2WM2A 4HRXA 1GTMA 4OKNA 1VZ3A 1VRVA 1LX6A 4ZT2A 1T5IA 3Q1LA 5C3UA 5E9WA 5KNDA 2VP3A 1C80A 4HF7A 4IGAA 4LOIA 2VCYA 1TC1A 2PUHA 4EY3A 4IHJF 3GELA 2C5BA 1TM2A 1MC8A 1OVMA 3HFJA 4FHGA 1GZ3A 2QYOA 4XYBA 4FKMA 3DM5A 4A0HA 5C35A 5IDXA 5IH3A 4Y7DA 2VSYA 3TOCA 2OFOA 3UJCA 3G8AA 4UCWA 2D2EA 2Q4BA 1LBSA 4HDMA 4Z0NA 4F1KA 1ZXLA 1GU1A 1UKCA 1O95D 1RRKA 3G85A 3GOQA 3IAXA 3HB9A 3VX3A 4GXNA 5AM3A 5CIYA 3SQXA 2IF0A 2JAQA 2J9YB 3Q8WA 1J8MF 1IQ0A 2H4HA 3W34A 5AVRA 1YI8A 4NABA 4BNYA 4LBYA 1VIAA 5GOTA 1E2QA 2XTNA 1Y63A 3A4IA 1AQNA 1G66A 4Q9AA 4TV9F 3LQRA 4BNHA 4ZIRA 5JQGB 3GCGA 4QUHA 3I23A 2C2GA 2OENG 5H7XA 4EJ0A 1VC2A 4YQYA 2H8GA 3I2HA 4M8IA 1PI3A 3WL3A 5BYKA 1G3QA 1NJ6A 1XEXB 2BM1A 2LD4A 2ZETA 1KYIA 3A11A 3TEMA 4E32A 1SG6A 4W4TA 4WERA 4A2QA 1VJTA 3SJ7A 2CYBA 2OZPA 5H3HA 1MUUA 2A92A 2EXXA 2QLJA 3NC1C 5H3LA 1CUXA 1MIHA 1YRAA 2JD0A 2A9OA 2ACVA 2XTAA 4KUEA 1L5HA 3UC5A 1XR3A 1CQJB 3QBEA 1TKAA 3ZJYA 3RPEA 2IVFA 1TPYA 4RD2A 5L3RA 2UXCB 3P94A 4CKWA 1RADA 4MVCA 4OFBA 5LZ8A 4JVMA 1W1UA 5JAQA 3SZLA 4PLZA 4DNXA 2EG5A 1MFPA 5KQGA 5DM1A 3IVCA 3KJXA 3OX4A 2WJGA 3PNLA 1U2GC 1P4RA 2VPTA 3D64A 4DJJA 4H4CA 3FSGA 4KO4S 1E9CA 1M2EA 2JFZA 2GPBA 3RYTC 5EUMA 1AK1A 2CVPA 2P8JA 4LVNA 1PV4A 4WFKA 2H2GA 4TTJA 4C04A 1BDIA 4KLZA 4LCEA 1DIOB 3KRTA 1ZH6A 3DUFB 1R37A 3AOGA 4F56A 3C41J 2VSQA 2PMKA 3ABIA 3FLEA 1XMVA 4QAQA 5AUPB 2XUHA 3COYA 3UWSA 2O2EA 3H5LA 4CM9A 3B6EA 3ZZ1A 5C8DA 3BGDA 3MINA 2DCMA 2WWIA 4G01B 2XMPA 4Q00A 1QG4A 2Z8YA 3TLZA 2WFLB 4FTWA 5HZMA 4PNPA 5DYTA 4W8HA 5J3JA 3RSCA 1K5GA 3OBIA 4MVJG 3FHTA 4DIMA 3REGA 5DK6A 2PXCA 3AIIA 2FK7A 4FZRA 5DHQA 1Z6YA 4LJLA 1C7RA 4UCFA 3K96A 1Y8RA 4HADA 3AF6A 4JOQA 5L6LB 1UQUA 2R68A 1FRNA 4P93A 5B3JA 5BYJA 1YIOA 3IO5A 5I4CA 4WT7A 5K45A 3AUYA 1F8FA 1JQ5A 5EI5A 4YCMA 1TFUA 3TIVA 4PRZA 2I7TA 1I3CA 1GYRA 1P5RA 3DMHA 3MIZA 1QFSA 1MO4A 4V0MA 1H2AS 3IA2A 4Z4GA 4WK2B 2YMLA 1WUIS 5AKYA 2QTLA 4QVIA 1ABEA 4EJSA 5KQSA 1T15A 3NTVA 4IRUB 1FUKA 1E60A 3C5VA 3CYFA 4P92A 5H82A 4UXHA 5C1IA 5EXEA 3W05A 2X22A 1JFSA 4CKEA 4ZHQB 3P2MA 2YVUA 1HL3A 1DMRA 3BL6A 3DTTA 3ENNA 1A4IA 3O4IA 3C87A 3OIGA 2WZCA 4CKCB 1AHNA 5JH7F 1UDWA 2XVYA 2EF0A 4EBBA 1NVFA 4OVKA 4LRTB 1F48A 2F43B 4QLOA 4CDRA 2BLLA 2KX7A 3AY7A 1AKQA 3EXHB 1J07A 3HXKA 3IQHX 5EJGA 2HO4A 2UUCB 1I4DD 3IUMA 3L4SO 3DDWA 1RIFA 3T5CA 2YZ7A 2J5BA 1UR5A 4H08A 4BNGA 2W83A 2EJBA 5AKEA 4C29A 2CJFA 1K5HA 2GETA 2QAGC 5HQTA 4DXAA 3L6CA 3TLKA 3MQFA 3H2ZA 3NUQA 3QFRA 2WYWA 2ZJ6A 4Y2VA 1ZUNB 3AVQA 5DIZA 5LNK1 3OEYA 1KOGA 1P19A 1V1RA 2NTYC 3IOYA 1HQYE 5EHGA 1G98A 4LI0A 3N8DA 4N18A 1QHIA 3F5SA 3T4UA 3WLKX 4HXYA 4MO9A 4BNFA 1E5TA 4U8HA 1A2KC 2I7VA 3AJ8A 4UEQA 2A86A 3D0KA 1E1CA 5LP1A 2WHEA 5FWNA 3WTBA 1YCHA 2Q3LA 1G0NA 2WJHA 4MZDA 2JBHA 2C2ZA 1NV8A 2EX4A 2PR2A 3NHUA 1NQUA 4TXHA 1SK8A 5SZHB 1VJGA 3QKIA 3I1YA 2FE4A 3NUZA 3AGPA 2AOWA 3W4KA 3EZXA 5LD2B 1VJ1A 3HTXA 1USGA 2QB5A 1K4YA 4YMTA 1BKYA 3RO7A 3T35A 5JJIA 1FY2A 2DKFA 3M89A 1JHQA 5MHTA 1DJOA 5AVKA 4R8LA 4BATA 3KP1A 4CCYB 3DT6A 2N46A 2EYQA 4EHKA 3L6EA 2OFWA 3L1VA 4F2GA 3UY4A 2VKQA 1JR4A 5ALRA 5CITA 1BXGA 1MX5A 1HOTA 1VMAA 3P26A 2R79A 5H4GA 1E1MA 2JIZA 3K5HA 3W7AA 3AEXA 3OU2A 3KKMA 4B74A 3CR8A 4KV7A 3UCXA 2ZBRA 1RIIA 4BDSA 3B3QA 1TJNA 1N6HA 2QTHA 4UE3S 5AFSA 5BQ3A 2Z1NA 1IDOA 5DP2A 1NXWA 4RF5A 4DWJA 2XWPA 7MDHA 1N6OA 3P52A 4NDZA 4RMGA 2LKCA 4NEHB 3SDBA 3OT1B 3VOBA 4BNDA 5JZMA 3RFXA 2D7DA 3NHKA 4AK9A 5KDDA 4E08A 1IY9A 2DYKA 2OAEA 5KZMB 4QNMA 2RHTA 4H6WA 3U40A 4F6CA 1LSOA 3V00A 5BP7A 1U1EA 4TYNA 3GEGA 3OTOB 4AYXA 4F71A 2YHBA 4M1TA 4F72A 2HXSA 3CO0S 5C1PA 2VRCA 2HWWA 2Q2OA 3BD9A 4MIOA 5ER6A 1S3GA 4DWOA 4NYJR 2C9MA 3P0JA 1OLXB 4M88A 1FDTA 3JR3A 5EXPA 1F1BA 3PHBE 1NUTA 2GUWA 5G41A 4MX8A 5JNUA 3HY6A 1E6LA 1XCMA 4D3FA 4Y2TA 1RYDA 2O2YA 2ACWA 3P32A 1YZNA 4FMDB 1V3QE 3VR2A 4X64B 4CDMA 4D82A 4MS1A 1EFVB 5ELMA 1E3DA 2HWUA 2WT4A 1N8TA 1M8KA 1PJTA 1F2TA 1BKDR 3AT1A 2F62A 4M37A 4QU0A 4H59A 4IIDA 3NM5A 3VISA 4DT1B 5CH5A 4A73A 1LBIA 1AKMA 3AF0A 3I9KA 1FC0A 3G8YA 4DCOA 4ZDJA 2XT0A 3DONA 3DVSX 2YW9A 3BTUA 3KM0A 3EXG1 1ADBA 3HPQA 3PDUA 3NRBA 1WZIA 2O7QA 1UBKS 3DBVO 4IIGA 4CMGA 2BRUA 4DIFA 2KQUA 4JR0A 1I6LA 1UBCA 2W2TA 3ZHBA 2OHVA 4MS4A 5LOVF 3WLIA 1YJAA 1G3UA 2F64A 1B3RA 2XHEA 1SNYA 2WBLC 3N2IA 4LY6A 2X7XA 2XX3A 1CPYA 1Z4QA 1NGSA 4Y6LA 3UJ8A 1CUFA 3OCWA 1H4QA 2BSXA 1IHXA 3ZYZA 3X1DA 2LR0A 1ECJA 1ZGAA 4HCJA 4MVJM 3NOOA 5F5XA 1BIFA 1U8ZA 5YASA 2H85A 2HBRA 3I8SA 3AHFA 3M6IA 3DC7A 1UFOA 4E5YA 2VLBA 4MUXA 1YB6A 2ZIAA 3IUJA 1QPBA 3SQMA 2ACEA 4C1NA 3B20A 4OBBA 2PV7A 3G9UA 1LRLA 5BVHA 1JQEA 1RWBA 3R74A 4DABA 1TF5A 2EZ9A 4AC9A 1YD7A 2YZ2A 1HI9A 2ZUWA 3I42A 3ISVA 3IV6A 4H7HA 4XX0B 1K6IA 3V7FA 3VRHA 4EG3A 1GRQA 1I2MA 3A04A 1TYZA 3BJZA 2CF6A 1A1SA 2FOLA 2A6PA 4XVQA 1CXZA 3LX5A 5CEFA 1KWKA 1N77A 4K6FA 4KO1S 2ADOA 3E5HA 4J03A 4XR9A 4W5HA 4NMWA 1TU0A 1E2UA 1ZQ1A 3JVIA 3R09A 1WSDA 1DC5A 1IUPA 4B2LA 2NVUA 1V48A 4G41A 3SHWA 1QP4A 3DMGA 2ZUCA 3LECA 4LBVA 3ZCVA 2PGNA 1CLUA 4TWBA 4DA6A 4AZWA 4MEBA 3A6DA 2Q5JA 2I34A 2DERA 1OLSA 1WB5A 4LJYA 3W79A 4G5OA 3QWFA 5CCDA 1OAAA 2YWGA 4KQIA 2JIDA 5C31A 4AZ0B 1Y8ZA 2VDOB 4PSVA 2AG5A 4MKRA 2G9VA 3EZNA 4N5LA 1D5WA 1RSZA 3ADBA 1XKLA 3FWYA 1WZ2A 4CBVA 4Z99A 1YHYA 4IH9A 1U0JA 2GD0A 4J0GA 1XRMA 4QJ5A 3D81A 3NBUA 4Q7LA 4BKOA 2J3HA 3AM1A 2J3JA 5EHZA 3FYUC 2ZJOA 2J6BA 5ERXA 3IODA 2ZSIA 1W4BA 4L6CA 2HA6A 1L9XA 1KDYA 3U2QA 3HO8A 4IWYA 4ZYUA 4YJ2B 1SBZA 5LN1A 2C5AA 5L3SB 2XMCA 1FTSA 3VUFA 1QK5A 1ZU4A 2X19A 3EXHC 2H07A 4B3JA 1JHOA 2WKSA 3EEOA 3LT5A 3M4ZA 2JGRA 2C5GA 1VYVA 4NZPA 2QR5A 4MRPA 3BDIA 4MKIA 1CZUA 3P2EA 3QE2A 1R66A 2ECKA 2O3JA 3D8RA 2ET6A 4Y18A 5H70A 2QYTA 4QLBA 2GK7A 3GT3A 1YB5A 3FD8A 5IDWA 1F12A 1IVSA 2DXIA 1P4SA 3T0GA 4U8GA 1FOEB 1G8HA 3VHLB 4JI4B 5I48A 1E2BA 4ZOLA 4ZCSA 5GMOA 4XUEA 3UFXB 3QE9Y 3PQCA 4OATA 5BNWA 2OV1A 3OHPA 5IMBA 4DF3A 4M1ZA 1U6IA 3NX4A 4JC5A 1LDEA 3L7MA 4EZBA 1RQNA 1X8LA 4EIWA 6NULA 2WT8A 3LCRA 1EXWA 4R1PA 1N2CB 5GZ6A 1CRZA 1CWUA 3R7LA 4DA8A 2QLLA 4BE4A 2W37A 4BP3A 4BTVA 3MOGA 1Z6XA 1IJEA 4C4SA 3SOPA 3O8RA 4N5IX 1B73A 1FVHA 4YP6A 4CF7A 2DLCX 1I2ZA 1THMA 1YFZA 4ZO7A 2Z9BA 3AB3A 4OXXA 4PRLA 1N1MA 4OK5A 5DNUA 4MUKA 1F9AA 4GLBA 3O95A 1PS0A 4V0QA 1DX9A 4LAFA 3BSFA 4J4TA 2PBRA 5KPJA 5TS3A 2DECA 5A4IS 1OFGA 1HKHA 4B1FA 2Z5VA 3HU2A 5B7NA 4LF4B 4I1RA 3MB8A 4JLOA 2CMKA 3R9XB 3ZR4B 1E3LA 1XTQA 3A3KA 3EPLA 5HIIA 3RIYA 3ZI4A 6PFKA 1ZRSA 4XGRA 3ICQB 1HQKA 3OUTA 1KEEA 3R0ZA 4YMWA 4XARA 4QULA 1RVV1 3NNDA 4M1QA 1A8PA 1JDBC 1HLPA 1X2EA 1Z2AA 1NFRA 3K1TA 2FMHA 4XLZA 2CXUA 3MTJA 1SIWA 4M0PA 3BILA 3ZU4A 2MINB 3ONNA 1J09A 3ITDA 4ZOBA 3ZV3A 3WOHA 4I4TB 2CUKA 3KYDB 3UA3A 3D5QA 5TIIA 3EVAA 3M1AA 4S1PA 4QRDA 3DWFA 4WBSA 4UBMA 1DL5A 2DFVA 1XMJA 1ZUHA 2GAIA 1FE8A 1U11A 3KBBA 4MGZR 4A16A 4K28A 5BQXA 4JROA 2PZMA 3LF2A 4RCVA 1X80A 2PRZA 3AETA 4TSFD 3UT6A 1P1RA 1XTPA 2H4YA 1AUOA 2VHWA 2ORVA 3FBTA 3R6TA 1AHPA 3VNUA 4U63A 1QZUA 2VDKB 1SUAA 1R2QA 2HCBA 1MRSA 4TYYA 1O6BA 3PC6A 5FUXA 5JY6A 1SIBE 3FF4A 4D3YA 4F3TA 1UMDB 1UFVA 2Z6AA 1M6VB 4L08A 2J3LA 1JSLA 2JAOA 4LYHA 5AOBA 4UDNA 1Q1NA 2HCTA 1SR8A 2NV6A 2NU7B 2ZGVA 3QQ5A 3U4HA 3G88A 2ZTLA 4BRWA 4F6LA 4Y2XA 5TS2A 5K05A 2WWRA 4UJ3A 4FQ7A 2PPLA 1YQGA 4C87A 1EWKA 3G7SA 2VT2A 4M9SA 4D9NA 1FXSA 1OWPA 2W48A 3Q3VA 3C3EA 4RHCA 1GG8A 1RZVA 1LA2A 5HGJA 4EFKA 4RY9A 1JYEA 3AHIA 4RBNA 1V43A 4LN1A 2HQOA 1QG2A 3DAYA 2VQDA 3EFBA 3OZVA 5ILGA 3S2SA 4CKZA 3NP7A 4NLLA 4AX8A 5LQKA 2E6KA 2WYHA 4LWQA 1NJ2A 2ZPUA 3K0FB 4U7FA 3UK7A 5BVGB 1I4WA 3R3SA 2FN8A 1KMHA 1OQAA 3OZXA 4P4SB 2VJOA 4AFNA 4KR3A 3RHSA 3NP9A 1Q57A 2P9BA 3P2KA 3SBDA 3UAWA 4PSCA 4C88A 3CS3A 4BVAA 4IWNA 2J5XA 3NYRA 1PSWA 4XJSA 2BI8A 4QPDA 5HFJA 4OXKA 3HP1A 2BMWA 2WNIA 1T5OA 3IXLA 1JXOA 2ZVDA 1EVKA 3IAEA 1I6WA 1SUPA 4WL0A 1EUYA 1JGTA 2IV3A 1SBHA 4L8FA 1N75A 3CW9A 3QKTA 2F8SA 3IAM1 1GAJA 3H9GA 3HUTA 3N76A 2O8EB 1FCJA 1V5IA 1ZBQA 2LGJA 4X1IA 4OQZA 2UVPA 1AGPA 1KVTA 2SKEA 1JFVA 1R0RE 3WRYC 3ONWA 4HB4A 5HG0A 4CEJB 2I2FA 5AKKA 3T1YB 4X85A 3ZGLA 1JXAA 4LHVA 2BDTA 4LYGA 4N5HX 5EZYF 3ETDA 1NP6A 2H59A 4KYUA 3MUFA 3OD5A 3MXTA 4S3MA 4IQFA 4G85A 5K3FB 3FCAA 3H0KA 3SC6A 4UBLA 1EQUA 2AI2A 2Y1CA 4YNBA 3RFCA 4B75A 3HCOA 3KQKA 1FZQA 1N8SA 1UDBA 2Q9UA 3ORRA 2YRXA 4Y1EA 3LTNC 2FSFA 3L4BC 2X0KA 2Q1YA 1JSZA 2IOFK 2DQSA 2I76A 2K5UA 3JQAD 1JLLA 1RYHA 2MMCA 1CUCA 1GPH1 4II7A 4PRYA 4R83A 4XB6B 4KDEA 3TH5A 4OOEA 3BRQA 4AO6A 2I54A 4LJSA 5DOVA 3HY3A 1PLKA 4FFRA 4GC9A 3T9FA 5J2UA 5J4YA 5KYKA 4CM6A 1K9VF 2HO5A 3T5GA 1X7GA 1KJNA 2HHLA 2AUTA 2JL1A 2GFQA 3MFQA 4FZVA 2RKBA 3W5BA 1GDTA 1KI6B 4RK7A 5IXSA 4LBWA 1RHMA 2HK9A 4WXEA 4JJZA 1BE6A 1OMOA 1QB7A 3EA4A 3IDSA 4WLOA 4JFRA 3WZLA 2QUHA 5CVJA 1L7NA 5FHQA 1MN6A 4X91A 4UCXA 3AI1A 4FEGA 2WOOA 1GV0A 5HK9A 1YTLA 2JG3A 4TKUA 1RJGA 4HQNA 1F8YA 3KR0A 3RUCA 3HRIA 1V16B 5DLDA 5E0KB 4LGCA 4ARSA 3L8HA 4H6PA 2VHUA 4OL9A 4TXMA 1JB1A 1MC5A 3KQVA 4ZQFA 3W6NA 3R5KA 5C1OA 1GXSA 1GZ5A 2YMPA 2W7TA 4FX2A 4OGWA 1RXUA 4Q16A 3V8NA 3Q8LA 4NJMA 3BXZA 1FLVA 2NZXA 1KC3A 2QSYA 3AC0A 1XCLA 3OZDA 4L4XA 2BHRA 1BE1A 1QG6A 3HVIA 4GX0A 3RRNA 4AICA 4J6EA 3L7CA 4CI0B 3HU1A 4UTRA 5ADHA 5G3ZA 1RLIA 2RH9B 3VSBA 4X65B 4FYKA 3FFAA 1L4GA 3TVDA 4UNNA 4B47A 5AUQA 2O8FA 1N9KA 5GONB 1JHMA 2JIOA 4H16A 4RPKA 1IC6A 1QONA 2PS9A 1R50A 4C7XA 1X9GA 1CUHA 3EEYA 4RAOA 2P9FA 5DHAA 4LVUA 4ZRNA 5TY0A 3VKFA 4EL5A 5C1BA 2FSSA 3AEUA 4XDHA 4EYQA 1K7FB 1SOVA 1U1CA 1VG0B 1Z39A 5EWJB 3CE6A 1AQJA 3SICE 5ES3A 2G1AA 1Y7TA 2FG5A 2NSHA 2RIPA 2YJZA 3GEEA 4O2AA 2HIHA 4CUZA 1VLMA 4CM8B 3NIBA 3SMQA 4ZYWA 1ZGCA 1X9HA 3WNCA 4M0LA 3NKVA 3ZBUA 2HA0A 3MMNA 1N5DA 3OZWA 2Y77A 1WPGA 4ND4A 4PONA 4PXAA 2CLMB 2BZSA 1I7DA 1BA3A 2G63A 2UYGA 2XY4A 4BWYA 5JZVA 1VL0A 5EHNA 1EZ4A 3NTUA 4YCSA 3EUFA 4KHZA 5FWAA 1MFZA 2NPOA 2V03A 2VYCA 4G5RA 1ONSA 1AUPA 1WPXA 4J7AA 5CTJA 1KJIA 4C43A 1Q0SA 1DJMA 4B4DA 3R5TA 4OGKA 1P6XA 1FDIA 2AJTA 3DLCA 4JS0A 4RIGA 4F4FA 1Y1QA 1ZN2A 3WGUA 4DE5A 3IKJA 4GLOA 3X43A 3QPDA 4YUWA 4JBLA 4TL6A 2AEMA 2OD7A 3TLBA 2CBZA 4YUXA 1JIIA 3RVSA 3PWZA 3WGZA 3SY8A 3WMXA 4W7IA 3RVKA 4K9LA 3GDGA 3FNQA 4F85A 2QM0A 3QKRA 4RACA 2Z5LA 2Q5LA 3RWOA 2Y2VA 4RHXA 3ZYCA 3BE8A 1VBFA 1VPDA 1PQ4A 3B38A 1PWXA 4WCFB 5F4BA 5TGTA 2BKEA 3A7EA 3ZCSA 2PH3A 1LBQA 1NI3A 2G9UA 3BIXA 3OE7D 4TV9B 1TA9A 5COBA 3SHTA 4RPGA 5DNDA 3X1WA 3AUKA 1Y3CE 3KNZA 3O1HB 2CNBA 4DJ5X 5HE8A 4YN3A 4OKIA 1A04A 4AURA 3KB2A 1FJHA 2ID7A 2QVXX 3ZKWB 1WXDA 1XU9A 1YNSA 2WSYB 2LP4Y 3ACDA 4G1MB 3L8ZA 1G20B 1FYDA 3PUKA 1NVBA 1QO9A 1Y48E 2XCIA 3VXKA 3QVMA 3KEGA 5U4QA 5JS1A 1I4LD 3AR5A 3CJQA 4INZA 1QKKA 4KGVA 1T25A 1T6BY 1T9BA 2ZJZA 3I39X 4Q7KA 4YYZA 4CDNA 3C48A 1G2OA 5ALNA 3G3EA 2XNHA 5I3CA 4O4IB 3MTDA 2AZ4A 5BXQC 2ORYA 2GCNA 2DWPA 3ZGOA 2O4UX 1FJXA 4OXYA 2ZE6A 5KSOA 2A5DA 3O2NA 4Z3KA 3W5AA 5DSXA 1UZUA 2GZ2A 1MW9X 4GM4A 1BMDA 4I4NA 4WECA 2QD2A 4MAMA 3UW1A 4C30A 4CIBA 1RAEA 2ZJ5A 4JU8A 4CJXA 1LVHA 4FDAA 4LRXA 5T3YA 1ZOLA 2OESA 4EHIA 5EQTA 4UUBA 3VGJA 2RFLA 4OUDB 4PR3A 4WLNA 5FCDA 3E27A 3EC2A 2PUBA 4Q48A 4GL2A 1L1QA 3I6YA 2C7PA 2YY6A 5IUNC 3R3XA 2OZLA 4L95C 5IZ4A 2X7HA 2QPLA 2NT3A 3GJ3A 3OZSA 1HK7A 1BHSA 4EDHA 1NULA 2NU6A 2PEYA 3PXAA 4LY0A 2WSSA 3Q7SA 2Q5QA 4ZVUA 2P4SA 5SV2A 5TVGA 2GEDA 2F1JA 2V3VA 3IGFA 2O5EA 3EVGA 1Q0HA 4RESA 2XUZA 4MGEA 4QYIB 4WGFA 4P3OA 2O8BB 1NMQA 3PNVA 2IZ6A 1S3IA 4JP2A 1OI2A 2O2DA 5SYNA 4MP6A 4GGMX 2ZE5A 3TDMA 1E2MA 5D3MA 1W88B 1VI6A 5A9TA 1QTQA 2JI9A 4ZO4A 4L0MA 2JIRA 2DPMA 3M1YA 5LDDC 1ODFA 1TJ5A 3GD5A 5JDCA 3IMFA 1TB4A 2BL4A 4C06A 1HT2E 5ITZB 2DH6A 1XJQA 3GEBA 4M98A 4PZUA 4QUAA 4PTLA 4L5BA 3F7MA 4J49A 4MWTA 2DLNA 3OICA 4Z5XA 2Z56A 3ZWWA 2ODEA 3WLFA 3MA0A 1G38A 3IV9A 3N75A 4CLOA 3IUQA 2IQIA 4TZTA 3R24A 4QASA 1SO8A 4W1RA 5CRIA 3S8EA 4GPIB 3H87A 2QX6A 5ALKA 4PAGA 2QRJA 4WXRA 2O6LA 1PL0A 2WVHA 2CK3A 1U0LA 3OJOA 1GUZA 1LLCA 3NAGA 1Q6YA 4XUGB 2AOTB 2WU4A 3G49A 4ZOLF 1TMYA 4WK6A 4BX8A 3Q15C 4KK3A 2PQ2A 1RAAA 4UW9A 3FB4A 4RF3A 3L8FA 3T1NA 3WDMA 3CWZA 4F8YA 1LDGA 2Q3BA 3DNMA 2RHDA 3EQ6A 3NGXA 4GBED 2OVBA 3M1LA 3HE3A 2QRLA 3HDQA 3JQ9C 3LV8A 4MKXA 4B3GA 1V9CA 3H18A 2P9YA 4IJWA 1PTJA 4QFCA 3DKVA 4FLMA 3JYLA 4IXWA 8OHMA 3QFCA 1TFRA 4LIPD 1E6CA 2OAP1 2QM3A 3IJPA 4FYIA 3V2HA 4OLBA 1P6QA 1KNXA 1L4KA 5EJ5A 3QVLA 2IU4A 2WF9A 2CNDA 1G7CA 4ZOAA 3T99A 5IAGA 1HE1C 1J0DA 1SD5A 4XW2A 2GHIA 5BMOA 1EHIA 2OVFA 3EXEB 1GVNB 1A4UA 1ZIXA 2R1TA 2RIRA 2WTAA 4MAFA 4NKRA 4DDUA 1GRRA 2E0IA 1CV2A 2VJMB 2PRSA 3TJRA 3RYIB 2O2ZA 1GZ4A 1W44A 2ZSHA 3SBEA 3EX7C 1AF4A 1XD2A 2CHFA 2C04A 2FRXA 3E9MA 4Q34A 5AIBA 4D25A 4EBFA 4FSXA 2G7ZA 1JIUA 2YOGA 3U4IA 2REXB 4ZPJA 5T3UA 4JLKA 5EE9A 1AMOA 2AXEA 3U6KA 3GLGB 4HR7A 3GGOA 3QI7A 1OI7A 4Z1MA 5KX5A 4YK7A 1A4RA 1Y9EA 2AR7A 3DDZX 1K7XB 3EW7A 1QGYA 3PF9A 3Q5GA 4G89A 4M8SA 4QUIA 3ZUGA 3S28A 3G13A 1JWLA 1V1MA 1CS0B 1DNPA 3RT1A 4ANFA 3I61A 3EQZA 2JI7A 5LB2A 4B46A 1BCSB 2AIRA 2KPOA 1PNRA 1C14A 1C7QA 1K86A 4NCIA 1SU7A 5E7QA 2A9KA 3VVLA 5KC9A 5DZSA 2XUDA 1N5IA 4M7RA 4X94A 5KSPA 3P20A 1HDRA 2NXWA 4GKJB 4AUNA 4EKIA 4FE3A 5DU2A 5BN5A 2ZTSA 2CZQA 4GPBA 1ISRA 4D9KA 3G2LA 1EM6A 3NC0C 4GNRA 1X1SA 1W5FA 2QF7A 1UZLA 4RLHA 1GGMA 2P30A 4POAA 4TV8B 3UK6A 3GUUA 4NBRA 1Z6PA 3ZZTA 5ES4B 2Y4OA 3D6AA 3VAAA 1IXKA 1N2JA 2EJWA 3D2AA 4BAUA 1QNLA 2GCGA 1LSUA 5AI0A 1AGRA 4RHYA 1M6EX 1C9MA 1EB9A 5HOQA 4CV1A 4OBWA 4KI7A 3GPIA 3DOHA 3C5CA 4UEOA 4CFYA 1FMLA 2HH9A 3SE0A 4EOGA 1YB7A 4ZVOA 3QW4B 3VH2A 4ZZ1A 4GXRA 1FFXB 4JXXA 2Z6UA 1VHQA 2OXRA 1HYEA 3M9WA 1N8KA 1PKEA 4L78A 1Z68A 2WRZA 5F2KA 2WDZA 1VIYA 3L05A 1ZEMA 1OFVA 1VSTA 4LDPA 3QHQA 4LGVA 5DTMA 1K5PA 6YASA 5KU7A 2GN0A 2H1RA 3KZ1E 4MWSA 3N0VA 4HAOA 4DILA 5K1ZA 5F7XA 1I2AA 1U7ZA 2VYQA 4CMJA 5AQ1A 3MD9A 2BFMA 3FOEC 3E8XA 4ZGWA 4P7BA 3KAKA 4W1PA 2LIPA 1JQDA 4I2VA 1XZMA 1IHOA 5A9SB 1NBMD 2CJXA 1W5BA 3N59A 1EGAA 1NY6A 4QGBA 4F7WA 3GMIA 1S3FA 5HE9A 3R6WA 5K0LA 3RCBA 1UBFA 3VR6A 2N0SA 2XLCA 4XWYA 2AW3A 3THYA 1RPZA 2DB3A 3WRVA 4QJ3A 3GW8A 1I9GA 5E6UA 3ZPXA 4KQCA 1EB8A 1PWZA 3UEOA 5DBIA 3EXFB 5TB5A 3EISA 1A9OA 1EA7A 4JH0A 1U2RA 5KTPA 4W1SA 2VZ9A 1OJLA 1PP4A 1T1SA 4WW0A 1QDUA 4JUFA 1WLSA 4CMBA 3TW0A 3E05A 3I5YA 3HJFA 4FOTA 4HLUA 1OFUX 4PF1A 2BOVA 3I1JA 4U6SA 1JKXA 1PHRA 3K0CA 1AV6A 1MO2A 2WR8A 2AMVA 4UTXA 3RYHA 2BKUA 4BXOB 1FYVA 4A9AA 1U8FO 3DBIA 2E55A 3NIGB 1SWWA 5TX7A 3ZHVA 3VR4D 2EGHA 3QOFA 4QXOA 3GMDA 4N01A 4TLAA 3NUGA 2WU3A 5FBLB 1A98A 2O59A 1MVOA 5J2UF 4TZ6A 3U3DA 2PK3A 3T9BA 1C50A 1Y6JA 1HTWA 2YFQA 2BFFA 3H6KA 4G26A 5TXGA 4B6FA 4CL8A 1U3CA 2VBIA 4DQDA 3VI4B 5C37A 3WKEA 2ZRMA 4PZLA 2IS6A 4RVCA 1RYBA 2C3MA 1X42A 1BWRA 1KPHA 3BC1A 2ZI3A 1GD1O 2HA5A 4WSOA 5EP2A 1FUIA 3OQJA 1WDLA 2GPYA 2VT6A 2IEAA 3C6KA 3TUIC 1Z5VA 1YR6A 1M8JA 3QJGA 4MCJA 3RS3A 1JWAB 1TK3A 2P27A 5CX1A 3HVHA 2GM5A 2OHIA 1ISHA 1TUGA 3EZFA 3VKHA 4KVAA 5IFLA 1M1XB 2LDXA 2O4CA 1TYEB 3H2JA 3MNFA 4FFBA 3AL0C 1DQNA 4C07A 3VO8A 2WE7A 3AI7A 3JZFA 1IOZA 3UXEA 1WCIB 2WJJA 4OHRA 5AHWA 1B0PA 2N1BA 4J7UA 3X1YA 4PRKA 4DNPA 5IKXA 3TZQA 4JXKA 3SZUA 5LZ9A 2ODAA 5T4FA 1W0JD 3X2EA 1PLLA 1OTXA 4ENRA 3FOFC 4YAOA 3DLHA 1W47A 1JDUA 2VJQA 4WUVA 5DYWA 1OC4A 1TTPB 5B1IA 4LX0A 4C7BA 3OQPA 3PV0A 1NM5C 1Y5RA 1RAIA 2VJBA 1LY1A 3TLXA 1VL5A 3DE4X 1GZVA 2YIMA 4KIUA 1QP7A 1B41A 1JG7A 1REQB 2IIPA 4H1VA 1EWRA 4GLFA 3LX8A 5KMGA 4NCKA 5AVJA 1Z5NA 5UKDA 1Y1KE 3BIFA 4P0TA 4X7RA 3FTFA 1S9DA 1LSSA 2K6GA 4O59O 4ZK6A 2ONZA 2GN1A 3H5RA 1B0ZA 5LQUA 2EWWA 2IP1A 2RARA 1R4MB 1FU8A 5AW6A 4M89A 1A96A 1U9IC 3SGLA 3U7IA 3ETLA 4EG7A 3DBLB 3ZLUA 2R1ZA 2MMGA 3HYLA 4O2AF 1VMDA 2ATCA 3C6ZA 4DEVA 3X1XA 1YDMA 1S8AA 3E1SA 4MJ7A 5JR3A 2FQQA 1K6JA 2VSFA 1U8EA 1S2LA 2VQ6A 4EHBA 3IVGA 1CP3A 3RJ5A 3PFFA 4LX8A 2J33A 2PGXA 5ECDA 2XGMA 5AR1A 3OZIA 5D1NA 3RF6A 5ESDA 4I1VA 4PHTA 3EIHA 3IQIX 3QSGA 1A77A 3HBNA 5DGCA 5HA5A 4DLKA 3VHRA 1A9XA 2OORC 3TPZA 3O94A 3C4VA 1Z4PX 4IDCA 2QE7A 4JODA 4O25A 2QRGA 1L4NA 5AK4A 2ONYA 4C78A 4XLTA 2FN7A 2BC9A 1G1MA 2F7SA 2IUSA 1JEDA 3OCCA 4U2FA 4UZEA 3T61A 3U3XA 4YV7A 4EF4A 1KQFA 4ZVQA 121PA 2YS7A 1HPLA 5PNTA 1FTWA 3ADCA 4ZYLA 2MYPA 5FLEX 1ZH4A 1OAOC 2VOJA 4R8VA 2H0QA 4CI9A 1GJRA 3B2EA 4R7GA 1Y9DA 5A3RA 3HXMA 3E03A 2D0PB 3MCAA 2DF8A 1EK1A 5TGDA 4W5RA 2A14A 2BUBA 3PA8A 2WVAA 1E0KA 2Y99A 3QPAA 1SCQA 3SQNA 4JP8A 2ECOA 4F84A 3VVBA 2XXJA 4US1R 2AHRA 2FEOA 4GVXA 4R3WA 1I2BA 5ICGA 4EH1A 4ENSA 4LSWA 1PRYA 1Q1ZA 5KYNA 1N5MA 3KKPA 1KI9A 3G2IA 4Q3DA 3EG9A 4I8XA 3IQGX 3UIEA 1B8VA 2VXCA 3QF7A 3VDNB 3DE2X 2FHPA 4MWDA 1E3WA 1S2IA 1Y4AE 4U9UA 4MVJE 4QQNA 2JEOA 3SVTA 2CMHA 3PR1A 5KTTA 2D8MA 3PTLA 1LH0A 2XECA 2BEKA 1L5HB 5KYTA 3VPXA 2P6PA 5HW0A 3N0TA 2R7LA 1QRAA 2WHYA 3A0UA 5AHOA 4DIEA 4CKWB 2IXTA 1NDQA 2VWPA 3T94A 4DKXA 3L49A 1GKLA 2B4TO 4YQEA 2WY2D 5DF1A 4MVJI 4D4HA 4I66A 3TSCA 2Y0PA 4RNDB 5I4BA 3TNJA 3GLRA 2CV1A 4RD3A 1RM5A 3M49A 4C0WA 2OECA 3G5UA 2ZYUX 2ZUDA 3SX0A 5A4FS 1L1FA 2J0UB 3CR3C 3TZLA 1UM9B 4M36A 4AI6A 1YS2X 2IVZA 3HL4A 4YA6A 3DFIA 3N5CA 3NNNA 5H81A 2IE0A 3DAOA 3NWBA 1Z13A 4JQSA 2V98A 4YDSA 4J0DA 1PK7A 4Q4HB 1VDMA 4E5NA 2HRCA 4PG8A 1E0DA 1XLUA 1WF6A 3MINB 2PIDA 3BCSA 4G9EA 3HLYA 2H1LA 3NHYA 2VJAA 2AC2A 2OUIA 1ANKA 4OREX 3TPCA 4ER3A 3QU9A 2H65A 4OIFA 1JPUA 5KKNB 1C1YA 1TF7A 3KJFA 3JYHA 3GP5A 4EG6A 1JFLA 2BKXA 3FR7A 3IEXA 1E20A 4EITA 4JXZA 2JIPA 2FRVA 1Y8RB 3PIRA 3OA2A 4MYRA 1N2BA 1CIJA 4ND6A 5IM5A 1BVRA 3K8ZA 3EZ2A 4H3HB 1DBPA 3MTGA 3UG7A 1FRQA 2H0AA 5FOXA 5LM3A 3UHFA 1JFFA 1QZZA 2ZYSA 1CF9A 4XIJA 3KYCB 2BLNA 3CKKA 3AM3A 4OK6A 5G0SA 3DMTA 4E4RA 4EGAA 4DDWA 5IPFA 3P9XA 4QECA 2OKGA 3PCTA 2IYVA 2JKZA 2ZJ3A 3QNMA 3ZQJA 4NJOA 4GWLA 4MW0A 1DO2A 4N0PA 4LHXA 4HDSA 2R60A 1MB0A 1SQSA 4EJSB 3F67A 2ODBA 4WLVA 4AYTA 2IHZA 4QYWA 8GPBA 1NSYA 1U28C 1CK4A 5IXJA 1N1DA 3H1BA 1YQUA 4CKEB 4DUZB 4DR1B 3IIIA 4AP9A 3BEOA 1JEAA 2POCA 4EUFA 1U2TA 1F5SA 2B35A 3GJQA 5D8DA 1QIGA 1V95A 4EJFA 3ENVA 5AKZA 5HRAA 1I1QB 3IAS6 2ZR8A 2J85A 2HD4A 4HVTA 1QORA 4GX2A 3BG5A 4EYSA 4L27A 1FJGB 1TLTA 3PT5A 3VHXA 4CPDA 5EP4A 2XF2A 1JJVA 3V2UA 1ZH2A 1PEKE 1YA4A 2HPZA 3CH7A 3DLAA 3GUHA 4W63A 4EEZA 1M1NA 1U2SA 4L22A 4TKZA 4LDRA 1NDUA 4MA4A 2FPPB 3NEYA 1K6XA 4NFYA 3SLKA 5TQ2B 2HK6A 4NOJA 3TXXA 5JY1A 1UPUA 1FX0A 5EJ9A 4GBGA 2ECQA 3SQLA 3TX6A 5BW5A 3FPCA 2F4NA 2JGNA 1U2DC 3AL3A 3DEHA 4EB8A 4X95A 2H9AA 1YGYA 2C4HA 3D4NA 3SE7A 1GRVA 2ODTX 4Q1CA 5TT0A 2IYAA 5KPDA 3DV9A 3ZKAA 4LNUA 3PQ8A 3RNOA 1XZJA 4ZEXA 3ZI0A 5JW6A 4BB6A 2K87A 2ZYRA 3R77A 1E1CB 4JB2A 4FUQA 4OI4A 1PFYA 2O2CA 1VYHA 1W0KD 4JLNA 4RCZA 2V96A 2HQRA 3PU6A 4D9JA 4MGHA 5DBHX 3VC3A 3MFYA 4EYKA 4QGSA 5JZBA 5CDSA 2XE4A 3PLRA 4MGYR 3O7MA 3CNLA 3F49S 3NFRA 5JPIA 3KE8A 4KB5A 4DQVA 2IUYA 4BQNA 4U39A 5ITWA 3N53A 1U2QA 2WNSA 2X40A 3FCSB 1TTHA 1PCXA 4OI1A 1XTSA 7YASA 4G9GA 1MB3A 1QH1B 5FEMA 3S8MA 5KX5F 4L9RA 2G40A 4LZAA 5L3QB 2HDHA 2XYRA 2IT1A 3IURA 4CEIB 2NSYA 3LUJA 3GLIA 2ODNA 4E7PA 1Z18A 3KG2A 2AFIE 3CSSA 1OAKA 4TXNA 3RRXA 4BP1A 2C5FA 2IEGA 1T36A 4G86A 1XF1A 3AVWA 4I1IA 4J1SA 2I87A 4ZAGA 3HUFA 2NUTA 3SKYA 2B69A 8ATCA 5KWEA 1ZRNA 5JYCA 3QVGA 1WZUA 1P9WA 5JLJA 2XOKA 3V33A 4B6JA 1G8MA 1Q14A 5EIEA 2DWOA 3VYSB 3DL0A 4Q1EA 3I8XA 4RVOA 2NLOA 1OPRA 2PKWA 1LSJA 3EMKA 3FVRA 3K32A 1W4AA 1KO8A 3IESA 2ZIFA 4LYDA 2EJUA 3D8SA 3DEZA 4HAWA 2I2AA 3SD7A 1Q3KA 1UXOA 1DTEA 1SC6A 3FFBA 4HMPA 1YZTA 4NYIQ 5JCPA 2AUMA 2IFTA 3U3RA 4ZKEA 1C8KA 3P45A 4II3A 5K0NA 1N5OX 4C1BA 4A8JB 3VYVA 4ENTA 2Q62A 3C6BA 4KGZA 4PYMA 3RVNA 1ZN9A 3UCEA 3WIVA 3L4JA 1XMOB 3W78A 2JFXA 4L73A 2BN4A 2VDLB 4L4ZA 2C42A 2UKDA 1BE8A 3DHNA 4ZV9A 4ZOQI 1ORWA 3KUCA 4U2BA 4S1VA 4Y0AA 2RGXA 1N2GA 3LY9A 1DRKA 1QBKC 3ZWQA 5F7OA 3FMPB 3LU1A 1VIDA 5B4VA 4RO0A 2OZEA 2IOQA 4TKVA 2IIBA 3ORFA 4ZEVA 3K73O 5LXTA 4YV1A 1KARA 1LGYA 2EFJA 1YR9A 3PLAE 2OO3A 2VF8A 2SKDA 1OT5A 2XDAA 4I3HA 3R1IA 1O94C 1G5TA 3C8MA 4X3CA 3Q0IA 4GDFA 1F2TB 4CZ2A 5HQ3A 2ENUA 2ZROA 4R1NA 4UNSA 1K8RA 1JQJC 4IGIA 1HG0A 5ULLA 3THOA 2PL3A 3AKZA 4C0BA 5CMLA 2G9NA 1S2MA 2OGTA 3ONEA 3WLJA 3F8WA 1YUNA 3ZC3A 1WCYA 1C30B 1VKHA 2IJGX 3AVVA 5IDQA 2BONA 3QV1A 5AICA 5F51A 2XKAA 4MS4B 3VV2A 2OCXA 5EIAA 5EKTA 1V7ZA 2J4DA 3WLNA 4DLSA 2P5TB 2EL9A 3COWA 3W0LB 4HK4A 5AUOB 1FS5A 3A26A 2ZJBA 1SU4A 2DR0A 1H8HD 1ZD9A 2G76A 2IEIA 2IYUA 4R05A 4XIIA 4EJMA 1YCGA 1KKMA 1E79A 1OKKA 2IIQA 5EZQA 4AF7A 1IBCA 1YUMA 1O96A 4JLJA 3EF0A 3L9WA 2RAFA 3QYJA 4RANA 2WQ6A 2X8JA 2Z6VA 1WEKA 4RQAA 3R7WA 3O2JA 1XMPA 2R87A 3E61A 4Y7CA 4HNSA 3BHJA 4JK3A 1OZHA 2C5SA 2GJKA 2I99A 2J45A 4GG1A 4KYTA 5FV4A 1EA5A 4QTUB 4TZKA 4IKEA 1YT5A 1JN0A 1KHTA 2GPJA 2NUAB 1IHPA 1JLKA 4HGRA 2PYZA 1TIPA 3V97A 4JVOA 4A10A 2V6IA 3PX2A 4WK4B 3OE5A 1RI2A 5FTNA 2AL7A 1XPOA 5EPOA 3SZOA 4AKTA 4B9AA 2F3TA 3MUOA 4LV6A 4J0IA 4PG7A 2G0NA 2IP2A 4UKDA 1X1QA 3AEYA 1ZNWA 3LL4A 3H83A 4YVFA 5JXIA 4NXNB 5T41A 1LJ8A 3V1NA 1XN1A 3S5UA 2P67A 3SNKA 4DR5B 3FVWA 3GOHA 1N2ZA 3CMCO 1NAIA 4ZC1A 1KJ9A 5G2OA 4TX1A 2NVUB 5B3JC 3H5VA 1VCOA 4JLPA 1B2LA 2CF5A 4G37A 4AZVA 4RK5A 3PX7A 4E1VA 5BV0A 1FS6A 4KDRA 1CR6A 5ED0A 1YBHA 1ESCA 2IV2X 4BMZA 3KU4A 2WKWA 2P41A 4MNTA 2X5JO 3DQQA 3GZ4A 2FWNA 4BDTA 2LXNA 1ZS9A 3ASUA 2BBTA 3ZGZA 3K7EA 9GPBA 1VJCA 1JVBA 1H5NA 1J8QA 4V39A 2A2ZA 2JLYA 4H3VA 5E8RA 1N3BA 3LT2A 4E51A 4EJSC 3MRXA 2NMVA 4D98A 1GFSA 2XUIA 4RSMA 3FVVA 4ARCA 3O1JC 3R6GA 1QQTA 3GRAA 4HMOA 1OU0A 3VR5H 3PIIA 3BYZA 1M83A 3OPVA 4QBTA 1IAQA 1NPDA 1NXXA 1RXEA 1Y1LA 2PO5A 1DWOA 2FPIB 1JI0A 4GOXA 1Q3HA 2BEUA 4QOEA 1B6GA 2ZLBA 4H17A 1E32A 4TS3A 3PUWA 3VR3D 4A27A 1PG0A 3A1SA 5FBRB 3NAMA 4IYRA 3ADPA 3B48A 1BFUA 5DMHA 2A84A 4I8DA 2R6FA 5F3DA 4FEAA 2P0YA 2ZB4A 3VZSA 3EDOA 2BEWA 4LPSA 1GPBA 5WRFA 1ULHA 1QH0A 4B4OA 1RW4A 2GFHA 2V1UA 1XK6A 5SZIA 3T52A 2E3JA 3AR6A 3CCCA 4OSEA 1DRJA 1PT5A 1Z37A 4AO8A 1T4CA 4DJAA 4I50A 2W8ZA 4QFMA 3GFBA 5HKLA 1GL6A 1XXHA 2FU5C 2R6R1 3A6JA 3HFGA 2GF9A 3SR4A 4QE3A 3SJBA 1JRLA 3AHDA 1SXQA 3EGDA 4Z9BA 4HZGA 4ZOLB 4BZWA 4IRXA 1HFJA 4K9QA 3OQIA 5D5PA 4BQOA 4KFCA 2XD9A 1JTEA 2A5FA 1LPBB 3PDHA 2FFBA 1OZGA 4YJFA 4BCCA 1XTZA 3RS9A 4BASA 3L41A 3RAFC 2Q29A 4ZWNA 3V3TA 4RDHA 5CG2A 5IBQA 4ODIA 4BLSA 1KYXA 3UMYA 4J7XA 2RHGB 4G5HA 2E87A 4C76A 4NI5A 2A1IA 2H29A 3GJSA 2JF0A 1M2JA 2HX1A 4JR1A 3ZY2A 4BN0A 1AUVA 4GE0A 2HF9A 1C8BA 4W9NA 1JTVA 1XLVA 1JFRA 3PTZA 4ZALA 4EAQA 3L0CA 5HZGA 3OAAD 4NPAA 4P33A 2IYTA 5LBTA 3AKEA 3NHZA 4MRRA 3TKLA 4CIYA 4N3NA 2OG2A 3TKAA 4KN9S 2A3NA 1VRWA 1OLUA 2QMHA 4IDEA 3PCRB 3I1IA 5F1OA 5SY4A 1NLUA 3GVXA 5E9QA 2C82A 5LA6A 1DMSA 1ZSYA 2D8AA 4A15A 4L72A 1JIJA 5TNXA 2AOUA 1G4AE 1IHYA 3H42B 1HSZA 2ZBGA 4TQAA 1IFXA 4Y6SA 3U7RA 3ZVLA 4BEJA 1EWQA 3FGZA 1YMQA 3CBQA 1UFQA 3ZIDA 4O3MA 3WGQA 2I3GA 4OHPA 3H99A 1SBTA 4ZA2A 3SVLA 2XR1A 2VSOA 3C5EA 3C7AA 3HP4A 4MI3A 3GGGA 4Q0MA 5TE9A 4IVQA 1N3YA 1KEEB 4ZDWA 3BA6A 2V0NA 4HSEA 5KCMA 4B2IA 2GKGA 4UMVA 3V80A 1ZQ9A 3QEKA 4U7TB 5F64A 1J1UA 2Q46A 3JQ8A 3ZU6A 3C3AA 3H65A 1ZK0A 4B5KA 4D57A 2B34A 3CO5A 2GGSA 2AMYA 1E3TA 2R4QA 5K0JA 1Q7RA 3KVRA 2CSUA 4OHBA 4Y1RB 5F21A 3H19A 4EO7A 4YXFA 4MWBA 4DCTA 2B6NA 3Q9UA 2L0XA 4DFDA 3K31A 1A7KA 3AR7A 3MTEA 4AIIA 1CUJA 1Q7BA 2GCIA 2B0CA 2ISCA 3E3OA 5ALTA 1V3UA 2CCJA 2W6JA 2WIFA 3FPAA 4PX5A 3AETB 5GVRA 1E2HA 4ZQIA 2B4RO 4GMGA 4BOYA 5FAXA 5EFZA 3AXTA 3C7TA 2P9GA 4M9UA 1P7YA 3CIFA 1ABFA 2H3HA 3C45A 1NJFA 5CT5A 3K8OE 3IDQA 4HZUA 4WOKA 1BGVA 4E0BA 3GIWA 4MYCA 3ZLVA 2XUAA 2WABA 4KG7A 5DM4A 4E2WA 4BMPB 1M54A 3ELWA 1WBBA 3NHAA 3QUSA 3LX6A 1CR4A 3C3BA 1Y8CA 2CZGA 2J5RA 3LBHA 3N0WA 4GNKA 3SC4A 4YRQA 5PGMA 3TL6A 1RYYA 2ZUEA 1G7SA 3UHOA 4ID9A 2RJ3A 1NR7A 2QUKA 2BRUC 1YBMA 3LOUA 3OZFA 1SB9A 5CLJA 1B1CA 3L0PA 2JAPA 1C1DB 3M2TA 3PRYA 3FNRA 4JEUA 4OYLA 1EP3B 2ZKIA 1CZOA 5FI5A 2ID9A 1MQ8B 5GGYA 3S99A 1N4DA 1BKSB 4BMVA 2ZTHA 4BFTA 5ALXA 1NBWB 1KMHB 2J9GA 4I9GA 4JFAA 4PXYA 2OLEA 5B1SA 4AG6A 1A97A 5EKUA 4HGQA 1Z88A 4XAQA 3NG1A 4BLQA 1KI2A 1AUQA 3IVRA 1JG6A 2W0SA 3MT7A 4NBTA 4U5XA 4EZIA 1APBA 3WDLA 3DZIA 2B98A 1JIQA 3T7IA 3LXUX 5BMVB 3DFMA 4HT3B 2YN0A 1ZM7A 2RJOA 1T4MA 3NH6A 2IYYA 2IXBA 3B6KA 3CW2A 2FFAA 4GPEA 1CFZA 1XCGB 1NSTA 2ZQYA 1OLOA 4X1IB 1EG7A 4D92A 4IVNA 2PEZA 3IQZA 3HCBA 4X61A 3R8XA 2X9QA 1NX9A 2ZT8A 2VKTA 2F8LA 4LF8B 3U7GA 3WIEA 2GQ0A 2A5GA 2BGWA 3GFSA 2NSLA 3HB1A 4FT2A 4NSNA 2OCKA 2NUPA 3B89A 1L4BA 2E9SA 3RU9A 1N0IA 2UUOA 3CLTC 3MUEA 5T4EA 2Y1OA 5IS2A 3GMSA 4HDNB 4RFSB 1E58A 2QRUA 4YAIA 1TZKA 3ZQ6A 1ZMOA 2IHYA 3U7QA 4M54A 1UXHA 4V2UA 1M66A 1ODJA 1UAAA 1GSOA 1PUJA 3FA2A 1KK3A 3OEEA 3IT1A 1JLLB 1T8TA 2SHKA 3RTAA 4N65A 3TLMA 1B8NA 3KR2A 4AX4A 4EHLA 3Q2KA 3LHIA 1QYRA 1N5JA 1MJGM 4ABTA 5J2UB 5A4JA 4AMYA 4CM9D 3BGVA 3VC2A 2QZ9A 2QQ5A 4UREA 1GPUA 1ONBA 5JNSA 4FK8A 3EGXA 1KJWA 4JQCA 4U2DA 1E9AA 1RP1A 2CXRA 3FDZB 3BXGA 3LQ1A 3FX2A 4LRQA 4WIAA 4M7OA 5CIWA 2B5WA 3H8SA 2O8BA 2QJFA 3ZGVA 1Y6ZA 2P4HX 1GDDA 4QXMA 2ZVQX 1M8FA 5HIJA 3R0XA 2B5VA 2AH5A 1KDOA 4X6LA 4R1LA 1II8A 2D5AA 5J4VA 1L3IA 4GQIA 4LRWA 4CMIB 1J2RA 2XEDA 1ZN8A 1BOFA 2CBXA 1YJCA 4RM3A 1E0AA 1EINA 4B9EA 1OXTA 2VT7A 3ESAA 3K30A 1IONA 2OLJA 4M49A 1YWGO 1WE2A 4NJMB 2FUCA 1C2TA 1FJ2A 1YDEA 1KY3A 3GF4A 3K2EA 1HE8B 1MAVA 4IEEA 3S6JA 2VZLA 3T0FA 4A1FA 2BSAA 3DNPA 1VTKA 3VX4A 2JS7A 2PJDA 5JV5A 4R1QA 4DCSA 1W0CA 5FPTA 1U04A 2AX4A 2QRNA 1M0TA 4LXYA 4I4CA 4X6YA 3QLEA 1TRHA 4TWJA 1PGPA 3E82A 4UHFA 3K94A 4Y98A 1JMYA 2O8FB 1DJLA 2QV7A 2WKQA 3FLMA 1KS2A 4MQ6A 3JARA 4F91B 1CF2O 4LC0A 4JJ8A 3CH6A 1S1MA 2Q5HA 3STTA 1XLWA 5DHSA 2H5JA 2OHHA 4M22A 3UW3A 4YY3B 5EMLA 5H02A 4NU5A 4E5UA 5CXXA 4JB0A 4Y1FA 5FFNA 2OGZA 5FLYA 5KAPA 4EEKA 3O84A 3PHGA 4KQGA 5AQEA 3EEQA 1OOEA 1DCKA 1ENZA 1TYCA 1K68A 1QH8B 1XDZA 2GEBA 2X58A 3AZPA 4IHKA 4KMSA 4QXQA 3ZDFA 4AS3A 5JJBA 5L4LA 4RIEA 2F55A 4HATA 5LXTF 1PDOA 1SVSA 3H8JA 3N07A 2MSNA 1QQBA 1OXSC 2JRLA 1ULBA 1IIRA 5BY2A 4QYSA 5FOUA 2B8JA 4DADA 4E88A 4HNVA 1F8XA 3IMEA 4JJ4A 3MSCA 2ZJ8A 3EIFA 3II6X 4WK0B 4W5OA 4PXSA 4G56A 2WWHA 3JZAA 3P1JA 4UFPA 4LWPA 3V6LA 1KHHA 4RTKA 1ZM3A 4HQOA 2Q1TA 1KWGA 4ZZ0A 2ZRGA 3HKDB 5MDHA 1I10A 3HM9A 4MW9A 1SC3A 1G19A 2P5UA 2XUKA 2ZB8A 2ERYA 4ROTA 3WOVA 1X6VA 3A6HA 1C0KA 4BVGA 4LVOA 1KIMA 4QELA 4JYPA 5DXAA 4H7DA 2I6TA 2OGWA 4R6WA 3DA8A 3PF8A 1YONA 4ZMSA 3MUNA 4ZT4A 3HL0A 3MS4A 3PVCA 4LDQA 4DA0A 1A71A 3QVXA 4CG0A 3UV7A 1R9JA 5K0SA 1ISJA 4G2NA 4J0HA 2M6SA 3EIUA 3QKRB 4OU4A 2XLBA 4PFJA 1DP4A 1EHCA 3FBWA 3C6XA 3OIDA 4KWTA 4RVFA 4RLQA 5A2QA 4GKKB 2PA0A 1V4VA 4PLCA 1N33B 3W6ZA 3PKJA 1ZJWA 2BAGA 2ONJA 5JEDA 3PXXA 4M3NA 1MOQA 2PZFA 2MR5A 3WLLA 2MYTA 5JFTA 1GNLA 1AC5A 5GV7A 3DL2A 1DXQA 4X41A 2E89A 4YGYA 5A05A 5HTOA 2AB0A 3AUXA 1RZRA 3NWEA 4ENVA 1FLNA 1IWOA 1EFPA 2ZRQA 3KAQA 2HCJB 3DMNA 2EIXA 1UBEA 2PMCA 3ND9A 4IIUA 4EHAA 3E3AA 6ABPA 4FMPA 2J48A 1ITZA 1L7PA 1XTUA 3DLPX 3L5OA 5FWDA 5H80A 3TF5A 3SHFA 5A3QA 1QFYA 2PLAA 5KC8A 2R1VA 3T7JA 3UT5B 3D9QX 1OUMA 2YV5A 3V8EA 5IAAA 2I7DA 1TD9A 3EUEA 4GSYA 2XTMA 4NPHA 4UZFA 1W94A 2HJVA 4KBFA 1XDWA 2WMYA 2IS1A 1BQ3A 4NE7A 2QAIA 4JC8A 4BGDA 1TQ8A 4TWIA 1GA1A 4P81A 5TARA 2AJCA 5DK4A 4F5DA 1ZONA 3I2JA 3TW8B 2JA1A 1CZKA 1JVNA 2AHOA 4P35A 3U1BA 1G6OA 3HV2A 1D9ZA 2YWDA 2VEDA 1AHHA 3A4NA 3QUQA 1NL3A 4PWYA 2PYIA 1KZ1A 1I33A 3B1WA 3LOPA 2AUNA 3SBOA 3VSEA 3N2KB 4BKMA 1ZI8A 2IYZA 2JHGA 2X4DA 3EOAI 3EMVA 5I45A 1GR1A 1BWPA 1U8XX 4GOKA 4MV1A 1FS4A 2VRCD 3L9XA 3GVIA 2ZK7A 4KLAA 5FUVA 1P2GA 1NXSA 2UV8A 2WYOA 3VPBA 4PC7A 2EKPA 3HXOA 3F3MA 4PS1A 3E7FA 1O97D 1AB6A 2C00A 5ALGA 3UUWA 5SY6A 3ZE1B 1UBSB 1X70A 3A6GA 3QM1A 5TPZD 3U3ZA 3UMGA 2WOJA 4KITB 3LQ2A 4LUCA 2NU6B 4K8RB 3DCNA 3VR2D 5CGQB 4KR9A 3A1FA 5A1TA 5LMNB 3ZGNA 3MJRA 3WA6A 2OE2A 4YDHB 1XRLA 5HJ7A 3A4YA 2ZXEA 3NTRA 5ECWA 3FG9A 5BSWA 1UDXA 5JSFA 1NC1A 1RE0A 3RC8A 2QDKA 4RTQA 2P6RA 5D3MB 3LNCA 2YVAA 4YX9A 2M2IA 1EVIA 2HEGA 3H1FA 3NGLA 1IN5A 2J9XB 1TKCA 2R65A 3NBFA 4C2AA 5K8TA 5F3RA 1KERA 1TUIA 3I3OA 1LS6A 1U8YA 2VTBA 1XQXA 2NW6A 4K46A 5BNIA 2B8NA 2VF5X 4B3RB 3CGGA 3L8MA 4D9BA 1OFUA 2R2GA 3AEKB 2JI8A 3H4IA 3J80A 1KSJA 5C0OE 4B4KA 3FPHA 2JBWA 4BKPA 3TTTA 3EWAA 4BAGA 5D5HA 3FCYA 4JB3A 4TXJA 3OJCA 4BNXA 4CLOB 5G40A 3ZU2A 3HKBA 1SCIA 2A35A 2H57A 1AX9A 3O1LA 2PGIA 4RGYA 1L8AA 3KKQA 3QIVA 4ETMA 3L0OA 4I50F 2FLKA 4TTPA 1YRLA 1VA4A 4NG5A 4UNQA 4X84A 5TT1A 1FNNA 3FZQA 4OHYA 3L6BA 3LQQA 3LK6A 4R54A 4JN6B 1IDN1 1ONPA 1CIPA 2Y76A 3UHAA 3PQ4A 3SQDA 1UXIA 1OCEA 2BM0A 4RQTA 3NOVA 2GN4A 4MV4A 4PQEA 4PNEA 1LK5A 1XB2A 4DWWA 4NZMA 2C7VA 5ESXA 2P3SA 1KE2A 3BMOA 2DY1A 1IHDA 3V8PA 5CJPA 5COAA 1Y5NA 4LMAA 5EIHA 2AD1A 4YJGB 3N70A 2ZUVA 5EUBA 1Q1BA 2SNIE 4WZBB 1Y1PA 1ZNQO 3RC1A 1J42A 3W04A 1O6CA 3D3WA 3JVVA 3KJHA 4WDRA 1R0BA 5IWCA 5EXSA 4OXRA 4WJZA 4OQ4A 4BTLA