1PFGA

Strategy to design inhibitors: structure of a complex of proteinase k with a designed octapeptide inhibitor n-ac-pro-ala-pro-phe-dala-ala-ala-ala-nh2 at 2.5a resolution
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVVKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Strategy to design peptide inhibitors: structure of a complex of proteinase K with a designed octapeptide inhibitor N-Ac-Pro-Ala-Pro-Phe-DAla-Ala-Ala-Ala-NH2 at 2.5 A resolution
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Proteinase K
total genus 99
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2003-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1pfgA00
3VV2A 3GT3A 1VSBA 1ZVKA 3DE0X 1GA6A 1Y4DE 5SICE 1TM3E 3HJRA 1OYVA 2V8BA 2WWTA 1Y9ZA 3I37X 1DUIA 1SBNE 4KB5A 1AK9A 4NMXB 1KE2A 1CNMA 3PRKE 1WVMA 3QMPA 3I34X 1OT5A 2GKOA 1SH7A 4J94A 2Z2ZA 3T41A 1R64A 4K8RB 1YJBA 3F7MA 5FBZA 4CFYA 1TM4E 1GA4A 2ID8A 3H42B 3EE6A 5FAXA 1SCJA 4OMDA 4AKSA 4H6XA 3DE5X 3CO0S 4KPGA 1YJAA 1Y48E 3DDZX 1SIUA 1Y3FE 1ZVJA 1KDVA 1SBHA 2W2PA 2ZRQA 1BJRE 1TM5E 1GTJ1 1SIBE 2SNIE 2WUVA 1WMDA 2X8JA 1A2QA 1C3LA 1V5IA 2ZWOA 3BX1A 4C3VA 2X8JB 3ZXXA 1ST2A 1GTG1 1P8JA 2ST1A 3QFHA 3DYBA 4NE9A 4B5LA 1BFUA 1AF4A 1R0RE 3A3PA 3DE4X 3OSZA 3GCXA 3DVSX 1TO1E 2PWBA 2ZWPA 1C9MA 3D9QX 1EGQA 3GT4A 1BE6A 1ST3A 3LPDA 4H6WA 4WOCA 4MZDA 4C3UA 2DQKA 5ARCA 5B1EA 3A3OA 1AV7A 1S2NA 1TM1E 1Y33E 1SUPA 1SPBS 4GI3A 4BWGA 2PMWB 1GT91 2Z2XA 5ARBA 3TI9A 3VTAA 1SCDA 2Z57A 4OV6B 3EIFA 4ZARA 3VHQA 4HX2A 1UBNA 3LXUX 4DZTA 5JXJA 2HD4A 1C9NA 1NDUA 4ZOQI 2Z2YA 3VSBA 1SELA 1EA7A 1IC6A 2Z56A 1IAVA 4NE7A 2W2OA 5ARDA 1SBCA 1SUEA 1KDZA 3D43A 3SQOA 2DP4E 3DE3X 1R6VA 3DVRX 2PYZA 2PRKA 1TECE 1DBIA 2IXTA 4H6VA 4JP8A 1S01A 2W2MA 4LVOA 2WUWE 1BFKA 3WQBA 1AQNA 1GA1A 1WMEA 1SIOA 1JEAA 2W2QA 5JXHA 1SUDA 1GNSA 3DW1X 1OYOA 1NDQA 1SUAA 3DW3X 1SBIA 1LW6E 1YJCA 2ID4A 3QTLA 2P4EA 1PEKE 4LVNA 3LPAA 5JXGA 1T1GA 1PTKA 2XRMA 1T1EA 2XTJA 1GCIA 1Y1KE 1MEEA 4M1ZA 1S02A 2WV7A 3AJ8A 3PTLA 2DUJA 3F7OA 4DJ5X 5FFNA 3VYVA 3DE6X 3DE1X 4HVLA 4YN3A 3EDYA 4RYDA 1TO2E 3GCWA 3DWEX 3Q5GA 5I9SA 2PWAA 1WMFA 1WSDA 1CSEE 1SN7A 1SCNE 1Y34E 2PQ2A 1KDYA 2HPZA 3Q40A 3BPSA 1HT3A 1Q5PA 1TK2A 3DE2X 4OMCA 3WIUA 5JXIA 1THMA 3CNQS 3I2YX 1AH2A 1AVTA 2PKCA 3DE7X 3I30X 1SVNA 4CFZA 1SUCA 1SCBA 1XF1A 5AVJA 3UNXA 3WHIA 1MPTA 1P7WA 2E1PA 1Y3DE 2B6NA 2W2NA 3L1KA 2QTWB 3DVQX 3P5BA 1KE1A 2SICE 5AVKA 2SECE 1V6CA 1P7VA 1C9JA 5B1DA 3TI7A 4DWWA 2Z30A 1SUBA 3VV3A 2SBTA 1AU9A 2TECE 3AJ9A 4WOBA 4CG0A 3TECE 1Y3BE 3WIVA 4AKTA 1PFGA 4I0WB 1PJ8A 3F49S 1SBTA 2Z58A 2IY9A 3LPCA 5AMXA 2G4VA 3ZXYA 4FONA 1NLUA 1TMGE 1T1IA 5K7SA 4Z2AA 1Y3CE 1YU6A 1GTL1 5JMOA 1GNVA 1Y4AE 3A3NA 5AQEA 3SICE 3BGOS 3AFGA 1BH6A 1SCAA 1TM7E 5CW1A 1BE8A 4KG7A
chains in the Genus database with same CATH superfamily
1VHJA 4PYIA 1ABEA 1QDLB 5C51B 1RQNA 1E1CB 5NULA 4ISBA 3TQOA 3PYLA 4I2NA 2CZGA 3E18A 1EGHA 1CNMA 1D07A 2AB0A 2D62A 3DA8A 4QQFA 3ZI4A 3FRIA 2MSCB 4YVFA 3RYFA 1FMJA 2PR7A 5JANA 2V3VA 1SCJA 2VPIA 4OSPA 3AZPA 4W63A 1J1UA 1XTZA 1NVTA 5F35A 2UKDA 3FWPA 2R65A 1B43A 1Y1QA 3GRZA 1K4KA 2BHTA 3A4IA 3KHTA 4LE2A 3T7IA 3TIXB 1T4CB 2WUVA 5KWIA 2CCJA 2QHXA 3KLMX 2EX1A 2LP4Y 3E9DA 4ND5A 2B99A 3ZLVA 3A1EA 2HIGA 3K70C 3E35A 4R1UA 1TU3A 1EE9A 3IAUA 4J4HA 1V25A 1MO6A 3I6MA 1TJYA 4RKRA 1DC7A 4YJ2F 1QFSA 3JZFA 1KJZA 3OEYA 5T4BA 4ARZA 3BMOA 1NF2A 3A3OA 2XUQA 5CVTA 4C6HA 1WUKS 1R0CA 2WF8A 3W7BA 4G5XA 2PMWB 4N54A 4U7JA 2AR0A 3UATA 3U1BA 1TGYA 4MLDA 1QZ3A 4DREA 1J20A 3NC0C 4QUJA 3F0TA 3SPXA 3X0DA 4OCZA 4F5ZA 3BDAA 5EHIA 1I24A 2H54A 2QP3A 4QSHA 3TQIA 1YXMA 1I01A 1PNVA 4KIFA 4FQ5A 1EGAA 3R3HA 5JJKA 4YFVA 1KEWA 1RHRA 3LCUA 3L93A 2OC4A 4EX6A 5KOJB 1PK9A 1AQNA 3JQGB 1NP3A 1TQDA 1P6XA 4COKA 1KQFA 2CFCA 3BMCA 2IYFA 1I3OA 1IOZA 3RT1A 1OXTA 4ENVA 3DVAA 1M9NA 1CC1S 3QTLA 5D5HA 1JDPA 4BZWA 4XWGA 1ZN8A 4WLOA 5EP4A 3S8MA 3SHVA 2IYVA 2QMHA 3OZ7A 5A9SA 5L4LA 2F3PA 4TZ6A 5AJVB 1L7DA 3JD3A 4NS1A 2QOEA 3GJTA 4LQ4A 2QW0X 4ZV7A 2QUIA 4BJ3A 1K7XB 2Q2OA 5B4UA 1IMOA 4FHDA 4E1AA 3SF8B 1NJ5A 4KDCA 2R86A 2O06A 4DKXA 1WETA 2P4QA 3AU9A 4Y2HA 5EUBA 3BSFA 3A04A 4KCGA 4AZTA 2RK3A 4H1UA 1J24A 2VT2A 4WERA 1FSPA 3KFXA 3RBZA 2M98A 2YV1A 3GFPA 5AVJA 1F0YA 1U31A 2JI9A 2W22A 3I2JA 4IF4A 4ITRC 4IP0A 1FMTA 3WHKA 3L0DA 3PQCA 5AVKA 1P1BA 2CUKA 1Z5UA 3TPCA 2YWBA 3WIBA 1UAAA 2ZT8A 4BU1A 4RH1A 3RGWS 2Q1SA 4PLPA 1GTZA 3L5KA 1PV2A 5JASA 5JJ5A 2O8FA 4PFKA 4ZEOA 2GDZA 4PO3X 1VI6A 4S1WA 4F84A 3ACBA 3U4CA 1Q0SA 1E1RA 1RD4A 1EH5A 4B4VA 1E2IA 5BVHA 1UBUS 4XM1A 1ESMA 2KX7A 3TLZA 3K0FA 2N75A 4OQ4A 3VKFA 4D41A 3HU3A 3KXPA 4JVSB 1ZVKA 3RTCA 1TKCA 3ABRB 3L7BA 4CKZA 4XWAA 2OAEA 4RIHA 1IN8A 3V46A 3M6FA 3IP8A 4X3CA 4C2BA 4FEAA 4CFSA 5KUTA 5TQ0B 3BJEA 4PPFA 1LI4A 4IIEA 3ZKAA 3ZU2A 4TS9A 1YR2A 2D3WA 1RRMA 3L46A 3PD7A 3QVTA 2OHOA 3RUAA 1TZKA 3M34A 3UK7A 5F9FA 4JGGA 4CN9A 5JSYA 2O2SA 5E1DA 4CDNA 3KQNA 3UJCA 1M1YE 4HTFB 2FPKA 3DR3A 4URYR 5B30A 4DB2A 5J5AA 1FVHA 2P11A 3TD6A 3WLTA 1A2QA 2D2VA 3IBSA 4BVBA 4D81A 1VFPA 2PBFA 2Z0MA 2QN8A 3G9QA 1F2UB 5ALHA 1L5ZA 4N18A 2R1VB 2GOYA 4A0SA 2OFXA 1OXKB 4B5LA 3O4GA 5ADHA 4B32A 2IT1A 1T34A 2X4IA 2NO0A 2YFHA 1HE5A 2OE2A 3CH6A 1MH1A 4O4LB 1NQVA 4RQTA 3ZWWA 2D1SA 5GM2A 5HCIA 4F1WA 1QYCA 3INNA 3NOOA 4PFJA 2G8LA 2UXBB 4ZARA 1SVLA 4OHZA 1VDMA 4UEOA 2BGUA 5AW4A 2AFIE 4BRSA 4AY4A 4KO4S 4W1SA 1SG6A 4B8ZA 1N5DA 1IIRA 3UK1A 4C4PA 2GYYA 3W77A 4RA6B 4LIPD 4N5DA 5F77A 1RWWA 2H3HA 1MFPA 2OZPA 4DIDA 3AWDA 4NCHA 4H6VA 4LVOA 1V37A 1QG0A 2QTTA 5EWMA 2SHKA 3A1TA 1N36B 3HS3A 3QRWA 1DXYA 3L92A 1EK5A 1KI2A 1OH6A 4QU8A 5IANA 2R8BA 1Z83A 1Q1NA 5EFZA 1ENYA 2I4MA 1Z5WA 2VDWA 2VQ6A 5D3MA 3LXMA 5JECA 1GVNB 4QUHA 5E4FA 5LU8A 1TGVA 2QMUA 2GBFA 3E0XA 1NNSA 1ZFNA 1BE1A 4KXXA 1L4BA 1S1CA 5JALA 4S1TA 4EJSA 2WPDD 4HWGA 1JDVA 3M2TA 1X94A 1A69A 2WDPA 4FYHA 3VU1A 4FW8A 4I5FA 1SQFA 1HQKA 1YFKA 4LRWA 3IIKA 5TF0A 4YECA 1UEJA 2CL5A 4WVLA 3B13B 4BB6A 3ZV6A 4QULA 1U6KA 4BBJA 4B3JA 2PSHA 2VJPA 3OAAD 2XF8A 4KH0A 4C07A 4XFDA 5GZ1A 5K99A 1O89A 2O1XA 1BVHA 2FEOA 4HDSA 1CRQA 1YBMA 1W4BA 2XNSA 3F4LA 4PXSA 4WOPA 2P4UA 3TMYA 3SFVA 2GGSA 4WVFA 3ROXA 3SLKA 4BLUA 4WXHA 3QBDA 2VNSA 2ZIXA 2XUZA 4NJOA 5DGXA 4JT8A 5KWEA 3HR8A 2OXCA 1TLTA 2X8LA 3K4PA 3KKZA 3C0KA 3GWGA 5E7IA 1SQSA 4CL3A 1AA9A 1A7AA 3JR3A 4CHTA 1V95A 2NT4A 4J4TA 1J9ZA 2ODBA 1Z36A 2XRYA 3KZCA 4G0QA 3PPVA 2NXNA 4LG1A 1RM3A 1SCUA 1VP9A 1KGDA 3RHSA 5EJGA 2C29D 2VP0A 1FQWA 3CLVA 3JASA 3JW8A 4Q3DA 3DD1A 3OTOB 3RIHA 3W2HA 4X95A 3M1LA 4LJSA 3HCBA 4NJMB 2SCUA 4M53A 3WGVA 5FOXA 5C8DA 1VSBA 1QHNA 3PUXA 2BH2A 2JJ8A 1YB5A 2H9IA 3JSXA 4ZTZB 3IS3A 2A9QA 3MJDA 5C5EA 2V03A 5KZMB 2OEPA 1CK4A 1L7BA 2GK3A 1NLFA 2I4IA 1PUIA 2Y76A 1XL0A 2YZNA 3EXIA 1MZVA 2H0QA 3Q7SA 4WFJA 1RI2A 1M2VA 2A9VA 2GARA 2PT5A 3N75A 3RRYA 3JVEA 3T3PB 4CQLA 4YWHA 2C2ZA 4BN4A 5CX4A 3N2EA 1A97A 2HF7A 4FHCA 4CR6A 2WJ6A 4KIUA 2D6FA 4UHJA 2WM3A 5JAQA 4L2IA 5LLDA 1N25A 2FEKA 2QRNA 3D59A 4C0KA 4ZHQA 3D1LA 3K0AB 4GVXA 4OYYA 4BP8A 2CXOA 3W5SA 2YWRA 1E3IA 1IBSA 3NETA 4S0XA 1IDOA 3E1KA 1ADBA 3RRJA 4A8TA 2XEXA 5DXAA 4X62B 5DX8A 3VMFA 2QVCA 3VNSA 3TNDA 1NV9A 2JI6A 2P1RA 4WBSA 2BC9A 3OTQA 5CVCA 3SHWA 3DFMA 2ADFA 2PH1A 2FHPA 3DZCA 4TV9F 4QEZA 1QP0A 1VLHA 2XKKA 2EFJA 4HNSA 2IZ6A 4IDOA 3KD2A 4M0FA 4CU5A 4KDRA 5EI5A 2ZB4A 3A6PC 3ZVMA 3KT3A 2GWHA 3BL5A 4BQPA 4JL5A 4GX2A 4L5BA 1K5DA 3PRYA 4JGBA 2VZ0A 4W8OA 2IK8A 2QM8A 2Z2IA 4UTZA 4DCJA 3NANA 4YIHA 1XQVA 3ANSA 4ZQHA 5FBLB 4DZZA 1Q57A 8GPBA 1W5SA 2IELA 3B1ZA 1E63A 4PSKA 4YAOA 1IVSA 4IQFA 4XCQA 3FSJX 1D9ZA 1N9ZA 1SUAA 3SF0A 2POCA 4IJVA 2YZKA 1PR1A 2VT7A 1R7RA 5K8IA 4FSDA 4TPKA 5EPEA 5EE5B 3HN2A 1KJYA 1WDTA 3B89A 4MVYA 4KR3A 4D9CA 3PF8A 7REQB 1PT8A 1ZLYA 1F6WA 1SMKA 4Q3OA 1A5TA 5K20A 5LU9A 5FFFA 3CVXA 2JLYA 3O8QB 4ZEMA 1VLVA 2P35A 3BB1A 1PQ4A 1YS9A 5DLEA 2WJ3A 3NIDB 2YOFA 3BCHA 221PA 1QQ5A 3VZBA 4ZCRA 1E20A 2IF0A 1SWWA 4ILKA 4DJTA 4U3JB 2XYQA 3MF4A 4NULA 2A6PA 3DE2X 2DWCA 2QS9A 3QNUA 3BB3A 3V6LA 4RVOA 5CT4A 3CEHA 1NVBA 5CFPA 3S2YA 5BSGA 2JI4A 2HYDA 4HQ6A 4MW1A 3AQIA 2PCJA 4U6NA 5T57A 5LZ9A 4H15A 1OIWA 1V5FA 2R0QC 1JKXA 5KYVA 1U3CA 2GHQA 3DLAA 5HJ7A 1CHNA 3LY5A 3PV0A 5MF6A 2Q46A 2QZJA 2WHXA 4BGDA 1PJ8A 1NY5A 2I4LA 4JMPA 1I4TD 1E69A 2W6NA 3QVVA 4UZEA 3DTVA 1N75A 1Y81A 2ZRJA 5KSZA 1R4ZA 2A1UA 5HW0A 1WOMA 1YZFA 2ECPA 3E03A 4RMJA 4XSHA 3T1VA 2FZLA 3O38A 1H2EA 4RLSA 5CNJA 2FMXA 4JT4A 1UXJA 5I4BA 2C3UA 1R0XA 2JGEA 1FRFS 2UV8A 1WXDA 2FV8A 4P5EA 3KQYA 1KYYA 2E2WA 2VPPA 1I4WA 3DXYA 1PU2A 2OB2A 1AURA 5J4YA 1GN8A 2Q1XA 3O0DA 3E23A 1SPXA 3RVNA 2H29A 5KREA 3FB1A 1F2TB 1R4MA 1YZGA 1Y7TA 5D1NA 2EW1A 3OF2A 5KYXA 2ARKA 4HNQA 2FXIA 1SKAA 2E4AA 2ODQA 3GP8A 2GJKA 3UHJA 2XCOA 1OAOA 1SB9A 2RJOA 4NMMA 2J5KA 4DC1A 16PKA 3IAM1 3KALA 4PPNA 4L57A 1KZHA 2BGIA 1IOWA 4UKDA 4KITB 5JQWA 3UMMA 1HE8B 1JMYA 4GLFA 1U7XA 4GFDA 4N4AA 4BVEA 3TBKA 4PC6A 3BEOA 5KNBD 2V4UA 3FUCA 3C14C 3OM9A 3JVUA 4E07A 4JJFA 1ZZEA 2P8JA 2BCGY 1M0SA 4CM1A 3ZHOA 3BH0A 3G5UA 2WFLB 3DFUA 1QHHA 2VP2A 1UWKA 4JSTA 4O4JF 4OQEA 1JV2B 2VDJA 3OT4A 5F98A 3UJ8A 1U9YA 5ED4A 2AR7A 2JVJA 4QWMA 3FYTA 4GH5A 3JXEA 2CLDX 1N1MA 1ZUWA 4IKOA 1E79D 2G9ZA 3KSUA 5DU2A 2TMKA 3A06A 4N01A 1EZZA 1KO4A 4G09A 3QPBA 4Q37A 2VAVA 5EIOA 4WZAB 3U7QA 1EA7A 4TVKA 1VZ2A 1CE8B 4B3SB 2WIJA 1QQ7A 3D43A 2R8YA 4Q6WA 1ZKMA 4RK1A 2PRKA 1AXEA 2NZ2A 2QRKA 2B8JA 2WAMA 2O23A 3CLRC 3FPCA 4BUZA 4ETIA 2BZGA 2KYRA 5AVSA 3SS9X 1E1KA 2WLSA 1DAGA 1LC0A 2I9PA 1SIOA 2W6JA 1CB7A 2PTGA 3N5CA 2UU9B 4IF6A 4TRJA 1YVRA 2XCUA 1NE7A 2OCIA 4MA4A 3H17A 4G63A 2PM8A 5KTYA 1GFZA 4GMGA 1W35A 2BEWB 4TS1A 1ZITA 1ONOA 2JFNA 3I6QA 3RUFA 1ETUA 3GOQA 1N2OA 2P4SA 1NXQA 4YQEA 3OJ0A 4JI6B 2ZZNA 4LYEA 1JT2A 2IKQA 3B1JA 3C48A 1P60A 3PC4A 2R1VA 3QU9A 4EGSA 4HDAA 1Z5OA 2GD6A 3Q5GA 3VDMA 3WK7A 3ANLA 3GN2A 1B00A 1M1NB 1UJCA 4WAUA 3WIUA 2GEUA 4GSYA 1FTSA 2J48A 3TNYA 1XP5A 3DDHA 3IT2A 5ITSA 4KEAA 1X42A 4ER0A 1Y7PA 2AI3A 3DPUA 1R0LA 1ULZA 2CVZA 1VLLA 2EZUA 3KCNA 3O8QA 4PSDA 4XQGA 1ACJA 4QECA 1R6DA 4YRFA 1H42A 1V8BA 3SDZA 2VJKA 1DBPA 1Q1AA 3Q7PA 4IVRA 1P9NA 1NZDA 1HPLA 3QLUC 2I8AA 3F6YA 5I9MA 4D8TA 3THXA 3BXEA 3OZBA 4US2R 3ZQKA 4OHPA 4AN4A 4F46A 2MT9A 4O29A 1MZPA 1JAZA 2QVYX 4YUVA 3PPYA 2QPLA 2CF6A 1WF6A 3QSYA 4PX2A 1RHQA 2VLIA 4CWAA 1YRHA 4Z0HO 1S2LA 2OCXA 3HADA 2LPMA 5DW3A 5AHKA 2QNBA 5JMPA 2WB2A 5G4KB 1V1RB 1CEEA 1OVGA 1A88A 2FLVA 2IEGA 2GPAA 4TKMA 1NRJB 2HQOA 2ZSKA 4R1LA 2D5LA 3A4MA 5CA0A 5L9AA 3TTVA 4GKAA 3VHXB 2PZEA 4TKLA 1E6WA 3SZ3A 4DCTA 5B7QA 3ZE6A 4UDXX 2QD4A 1T2AA 2QE7A 4O3FA 4X44A 2O5EA 4QEDA 1NOKA 2QTVB 2JZOA 3WLLA 2C07A 2GTIA 1WO8A 1Z15A 3MELA 4UXIA 5K51A 1JVNA 2RGDA 1V41E 3AETA 1A9SA 2FX5A 1DDIA 5K0GA 2D4HA 2FK8A 2HEIA 4PQEA 1E3TA 1E96A 4HOYA 2WG2A 3KR2A 1MOSA 3D8SA 4Y1RA 4U02A 5C31A 4KXYA 4M0MA 1OW3B 3AFIA 4X5OA 3T3IA 3BGDA 2XKBA 4FR0A 2EZTA 1OROA 4PX9A 3A3PA 5ESXA 4W8GA 5FHRA 3IJ5A 3UW3A 5IC4A 4O6VA 1N3BA 4C4AA 4D57A 3IDSA 3BB4A 2C0CA 4Z0TA 1ZD2P 3S2UA 5JAIA 4B6FA 3ZDRA 1U9ZA 1PK8A 3QOFA 3ZCUA 3LY7A 4RK7A 3K0HA 4JENA 4YLYA 1SQGA 5FIUA 1KJIA 4TS3A 4KAXA 3UAZA 3D8NA 1MXFA 4TYQA 3VNQA 1YF3A 3WICA 1JDJA 2HI0A 1QRUA 2JLBA 2VXBA 4OUDB 2J9XB 2F1HA 2PEZA 3FIUA 1E4EB 1P7CA 2XCLA 3VR6H 2C2MA 4RD3A 2R3SA 1E4EA 2CZCA 1Q6YA 2CSUA 1NVXQ 2PL9A 4RENA 4ZOCA 2OAP1 3B1VA 1AUOA 1ONPA 3ETNA 4PX3A 4PW0A 3B9RA 1PJ3A 2AQ8A 1EK0A 3GJ6A 3HSSA 1V8FA 4OQZA 4RFLA 1O9BA 1IB6A 1H0RA 3QK7A 3RJ5A 3KXDA 5IDWA 1DADA 1PWXA 3VMMA 1CF4A 5L7TA 3EOBI 2XMSA 3UT6A 2GPJA 4ZAVA 4U6SA 1I33A 1K0FA 2W8ZA 2CV2A 1GPLA 1UT8A 1II8A 4Q5IA 1CZHA 3OPXA 2CXSA 1EPUA 3WADA 1W46A 3WZLA 3E3OA 4PZLA 2QI9C 3OA0A 4G67A 1Z9BA 4EL5A 3TLYA 2F3SA 4EJ6A 1GCGA 5L51A 1O0CA 2ZUCA 1L4YA 3ZY6A 1ZYUA 3HM9A 1W34A 2B78A 2WIAA 4E3WA 1P80A 1NMYA 9ATCA 4YQFA 1XK7A 1YFZA 4GP9A 3DHNA 1YKGA 5I7EA 4OFWA 4A6XA 2YFYA 3NJ8A 5IW8A 3RIGA 4LZWA 3ZIAA 2WAXA 5C8YF 1XHEA 2F17A 3GZJA 4E5SA 3RANA 1RJDA 5FR2A 3NV9A 3Q11A 1CEXA 1XZAA 1W2GA 2ZRFA 5IUKC 4MS4A 1UM9B 2IH2A 1M8PA 1NAIA 3WAGA 1NTRA 3OFVA 3HB9A 5EUQB 5KDLA 2RD2A 3IR5A 2F9LA 2MYTA 2BGLA 4NHOA 4NV3A 3CR7A 1YJ8A 1KY3A 3NHPA 5DW0A 1L5RA 3DAFA 3GQBB 3N3BC 2AOUA 5J4KA 1VJDA 4M87A 4DAEA 3ECCA 5U9CA 4GM4A 2LVBA 1T26A 4HN2A 4PYNA 1W73A 5TS3A 1UJBA 2AGVA 3D2CA 1FFXB 1OF1A 2QDKA 1WHTB 2WHRA 1W59A 1QIMA 2VO1A 3D0OA 5CM9C 3EEOA 1SXQA 2PZLA 4K1XA 1ORVA 5BR4A 4HH1A 3B1WA 3PJEA 2Q1YA 3NQ41 4OHUA 1OYVA 4OI2A 2X40A 3MWLA 1W49A 2I0FA 2OESA 3A10A 5TS2A 1OGYA 3AQ4A 1ZI8A 3KQUA 3UGQA 3RAPR 3RJTA 1JU9A 4UPDA 4R0MA 1CULC 2QX8A 4LVCA 3WNCA 5B6IA 4I1RA 1U3UA 2CXHA 2CLOB 3DE5X 4JXZA 2ABWA 3EXHA 3GFGA 1CJSA 1X92A 1ECGA 3Q12A 4V38A 1ISSA 1AKVA 3BGSA 4U9IS 1V8DA 3GCGA 3QHQA 4IZOA 1OX4A 4UXHA 5AQ1A 3GJRA 4G5HA 4BNFA 2W4IA 3CFYA 3NBFA 5DYWA 2XWQA 4EW3A 1KVSA 3I9OA 2BCJQ 2XUDA 6REQA 3UYLA 2GN1A 3EMDA 4OJMX 3T7JA 3GFSA 2OWEA 4FDVA 1K06A 4QQ8A 1R00A 3QKSA 1KZYC 3PP8A 4ML3A 3LW8A 4NOLA 3EXAA 1AF7A 4P3PA 1V3VA 4I4TA 3SKYA 3NRBA 1T5IA 4DLTA 1Z4QA 3P19A 3VOTA 5JATA 2M1ZA 4J07A 3ZCXA 5D1HA 4LI3X 4JXXA 2AVNA 4N48A 3SBDA 1WX1A 3KAQA 4HUQB 1CF9A 4Q24A 4KFCA 9LDTA 3COJA 2JGMA 1X0XA 1XTIA 1QWSA 1WLSA 1WF3A 2EOAA 2WKRA 4IIDA 4PLGA 3QFFA 1M1UA 3OEHA 1OFUX 1PAUA 1W6UA 1PJ4A 3A2LA 2FUG6 4CMEA 4QKQA 3KHUA 1VKNA 2X0IA 4P7KA 3HKEA 4WSOA 4DLAA 2DUUA 2CL0X 4CIYA 4E32A 3KSDO 4L02A 2O2CA 5AHWA 1VHQA 5ALIA 1ND6A 3FUVA 4N3GA 2DJIA 1BCSA 2R11A 3JQGA 3KKPA 1NQOA 4ZEXA 3PI7A 3F3YA 4YRRA 2WIBA 1QP7A 1B23P 3BORA 4RYLA 1R9MA 3OQVA 3ANTA 3CZAA 3URKA 4UNNA 3SWWA 1IXSB 2OXEA 3IAS6 3NYWA 4MAFA 3GLGA 1E3MA 1PZEA 1K68A 2NUPB 4PZEA 3MJCA 2QYHA 3CX8A 1ABFA 4Q34A 4XYEA 5D01A 2GHRA 2NYAA 4DLPA 1UKBA 3K0FB 3KE9A 1QMGA 3M6WA 1QVWA 2O05A 3MCVA 3R5KA 4YRIA 2Y8EA 3UNXA 1LBQA 4BHTA 3U4QB 4MB0A 2PPLA 2RHJA 3B6ZA 3SE0A 4I19A 1DFGA 2H57A 1X1RA 2BTEA 4JCCA 1G5IA 2Y0EA 3K2QA 2VNKA 3V1UA 4NABA 5KNCA 1XRPA 3LK7A 4IZ6A 4JHLA 3WGLA 3AUUA 2FF7A 1JHPA 1CQZA 1RLUA 4ALMA 2NW6A 4QJ5A 1O6ZA 5AJXA 1DG9A 1Y6QA 3OPVA 4J0JA 5G4KA 2MU1A 4YIKA 4P34A 4ZZ1A 1OLOA 1NMQA 2VUSA 1KL7A 3FPKA 1F06A 3A28A 3NM5A 5KAMA 4YR7A 5KU1A 5GIOE 1M2KA 2X19A 3EE6A 2G0TA 1E1YA 1KYIA 1PR9A 3FNRA 3HN6A 2QUZA 1DC3A 4BZPA 4TV9B 4W82A 3JTEA 1J5EB 2BGMA 1F3LA 1TM3E 1Q7RA 3E3LA 3LKBA 5L3ZA 3AR3A 2XNDA 4HPXB 3C16C 4IH9A 4M49A 2QV0A 4PHTA 2EBWA 3P9SA 4Z9BA 1QH1B 5GOZA 4B75A 3FMPB 1W9MA 1WW8A 2J5XA 3SNHA 4XXHA 2BMWA 1CS0B 1AUXA 2RKOA 1ZM9A 3T4PA 1GO2A 4RETA 4TT3D 4BEVA 4YCBA 2QMQA 4QARA 1SVWA 1DS6A 5IM4F 1US8A 4JVMA 4BP3A 1UWLA 1BGVA 3OIDA 1BJRE 3CW8X 1WUHS 4X1IB 3ZVLA 1ZN2A 5KVVA 2XA2A 2JCSA 3EWAA 4X45A 5BXYA 3TYXA 4YPOA 3TG8A 4AZ3A 3AGPA 1SCQA 3EYAA 3OSZA 3GCXA 1G1MA 4FSHA 4YDQA 3PC3A 3IB3A 3QA9A 4WDRA 3U16A 4FI3F 1XZMA 3DPSA 1GYPA 4EY6A 5GONF 1XD2A 2FKNA 2LDBA 1N5JA 2ORVA 1TM1E 3EGDA 4NMLA 4KWHA 4Y18A 5DTIA 4LXIA 3ONEA 3V3TA 3VBEA 3T3MB 4EEXA 5BSEA 1RXUA 4IJKA 1VXOA 1A7JA 4JNCA 4QOEA 1MABB 4M83A 4XGNA 5DNDA 4YUYA 2Z57A 4D9NA 1Z75A 1Z0AA 1ZCZA 4RVDA 1RIFA 5CA0B 1G9SA 2XNHA 3UAVA 1CVLA 1H5QA 4X7MA 1G6OA 3HRKA 4G86A 1MIOA 1JHOA 4MIYA 1QV6A 5IPFA 2OHJA 4IV5A 1SBCA 2PQ0A 3ZY5A 5AVYA 2DP4E 1WCIA 4UHKA 3K3PA 1PLJA 1HL3A 5BN5B 4Q9NA 3TEMA 3SJBA 2YXEA 1I7NA 3LUCA 2JANA 3PCTA 3DYVA 2X0EA 2CDRA 1SZDA 3CKKA 2DKFA 2ZRIA 4H3VA 4IIBA 1WB9A 1N2CE 4M76B 3RIYA 1YBVA 2INGX 3H9QA 2Q5CA 4IUYA 4JUDX 5LIRA 3THXB 4D8VA 3RC3A 1N2CA 2GFHA 3G0HA 2C4HA 2WWIA 2C84A 5EKDA 3JAWA 2IYAA 4ZIRB 3PTLA 1H1LB 2O1EA 3TM5A 2RBEA 3KAPA 3NBYC 4MW6A 5DN9A 1N7JA 3WB2A 5JAMA 3K5HA 2PRIA 1V8PA 4ND7A 5ESRA 5HP4A 4TTRA 2DLCX 3E8SA 4X93A 4RNCA 1XFAA 1ZONA 4RUKA 3JARA 4M1TA 3RROA 3Q6NA 4GBGA 4LBYA 1EFAA 4PO8A 1HFKA 2A94A 2P78A 4ZPJA 4H0CA 1L7QA 3C3JA 4S1PA 4X97A 3D3WB 4IICA 4GZLA 3KKKA 4DDWA 1CY0A 1TUBA 4U2GA 2C9YA 4QATA 1JIXA 3HEMA 2HSWA 4NFYA 1E9RA 2YHSA 3RD5A 3CR3C 4BO8A 4JI7B 4IINA 5FWYB 4R7ZA 5KYYA 4I1YA 1HF3A 3DP7A 4JYBA 5LZ4A 2HUPA 5DEOA 1TFRA 2JCVA 4JJ7A 5JEDA 1ILEA 1OWOA 1OX4B 3L6DA 5F52A 1HG0A 4P6VF 1MC5A 3OWOA 5BSHA 4MRRA 3FSGA 1GTL1 2UAGA 2X5JO 3DFZA 3LF1A 1NNUA 3A2MA 3GJQA 1FS4A 3P0FA 1M6VA 4NP6A 4V0SA 4MR9A 4WNCA 5DE3A 3H5IA 4WZBA 5KTNA 1EG7A 2Y66A 4CMHA 3N2LA 3WJ1A 1AZLA 4CM9A 1OIXA 3UG6A 4I3HA 1GGEA 5FTKA 3D8UA 2FWJA 2WAAA 4FT4A 3TQQA 2XLBA 4CR8A 3N0WA 2D06A 1MDFA 4W5JA 1J0DA 1ZD8A 2JFZA 5EIHA 5BW8A 2BI4A 2CE2X 3QXXA 3BHJA 4DM3A 1JZTA 4NG4A 2J5BA 3G9UA 5EJAA 2WSIA 3LUFA 1CR6A 2GJSA 2MSDB 4XJVA 1IHOA 3ZHQA 1RQGA 1J5PA 3L8CA 4YP6A 1O1YA 3C4QA 1F4LA 4KN8A 3ILHA 3MGKA 2Z5GA 3TW0A 4P4SA 2E6KA 4LJ5A 2NUAB 1RABA 1L9XA 1VSTA 2WWHA 3T8YA 4B3DA 1KEPA 2OHFA 3AY7A 4IOMA 5FPQA 1HFWA 4Z1MA 4RTQA 5EAIA 2JAQA 1MG0A 1ICIA 1UP6A 3LPDA 2FEMA 1Z6QA 3CVVA 1CFJA 3AF1A 2QTNA 1JPVA 2CYAA 3S5JA 3VNBA 4F2GA 1TUBB 1LRJA 1MPXA 5ALRA 3HHPA 3TZ6A 1WPGA 5HYVA 3I9V6 1UC4B 2LE0A 3Q0TA 3EIFA 4PPQA 2OHHA 1J1IA 1DI0A 2QLFA 3FKSD 2PS0A 3LL4A 4RK4A 2PUBA 3RTEA 2XIJA 2G82A 4FBLA 5EJEA 2ZJZA 1IYZA 4HDNB 1C2TA 3NDIA 2PG3A 5HKOA 1QIJA 4FBMA 1SQ5A 3KB2A 3O92A 3K9FC 4PQGA 1CUHA 4GRDA 1B1AA 3PNKA 1L5HA 1XCJA 3WQBA 1BKDR 4AY5A 1WMEA 4HBZA 4RL6A 1J0EA 2QRQA 4DARA 1SRRA 4R71A 4UTXA 4S1NA 3N2KB 1K5HA 2BW0A 1NFFA 3EWNA 2RGWA 4MV8A 4F7WA 2IGBA 1D6JA 1PUXA 2D3TA 1JDTA 5F33A 1JG6A 3PC7A 4XIJA 1FYDA 3N6VA 3U09A 5A3SA 3ZEAA 1Q92A 1UEXC 1P7PA 2B8TA 3NV7A 4YA6A 3HFJA 1GQOA 4EPYA 3DE6X 2B0JA 2FN8A 2Z09A 3QBVA 2ISQA 4QOJA 1PFQA 2ONJA 3VJLA 4PN7A 4QG3A 3TW6A 2ID7A 3NUGA 4NV1A 3TRDA 2W6ID 2G5TA 4S1OA 2GRUA 2IDMA 1KWKA 3W5BA 3MWJA 3Q15C 1ESCA 1GAWA 2XGMA 4GGOA 4L5YA 2IU6A 4LZAA 1K92A 2A92A 4YCSA 3W9BA 1PR4A 1SA0B 3CE9A 3NTVA 3RR2A 3ZCPA 4ENPA 3UHAA 5FPKA 4U7DA 5DM1A 4QYXA 1R0YA 1DT3A 3WK5A 1Y3IA 1E98A 3H1BA 4EHIA 3THWA 3PFFA 4COOA 4N0EA 3EXIB 4CW7A 1L5KA 3BRWD 3TECE 1Q0LA 3I09A 1Y3BE 1PBTA 4HRXA 4BVGA 3NWOA 5A02A 2N1MA 4BAZA 2J5RA 4J2TA 4PXYA 2H4WA 3WO1A 2XHEA 4QYIB 1GGKA 3C3DA 3I5XA 2SCUB 2VKTA 4AY6A 2HW8A 1JP7A 2ZREA 4IWXA 1RJFA 3AVWA 4YCLA 2FMTA 4FGZA 3PGJA 4ENSA 2OYCA 4LV5B 3RHZA 1YZVA 4XCVA 3U7QB 3C8MA 3GP5A 1EESA 2ZS8A 4MRNA 3V6MA 4UTOA 4DMRA 1QYIA 2UZAA 3W7AA 4ZYXA 4MRMB 3NVKI 1CRLA 2I34A 3F5FA 1BVUA 3R5TA 1ZG3A 2ZUBA 3OHMA 2WSYB 2MCFA 4OKIA 4BL5A 1ODSA 3TUJC 3S1SA 1QGDA 1E9SA 1VLZA 3MMSA 4ECEA 1Z6ZA 4HDOB 1Z4NA 3L1VA 2VUUA 4JLKA 4EUFA 9GPBA 4JBLA 3GLFB 5BN5A 2HCJB 3CUWA 3AESA 2IKSA 2O6LA 2ZYGA 4ZTUB 5C8XA 4BAUA 3UJAA 3QEMB 4BFWA 1KFCB 4XDHA 1CR2A 1KXJA 3D8BA 3NALA 4FYVA 2V59A 3GMTA 1QVZA 5DLQC 5G3YA 3UPUA 4F4HA 1A9PA 5JHHB 1KI3A 3PR2B 4KR0A 5CFQA 4NU6A 4H17A 1VBKA 1I94B 2WWFA 1YMQA 1R8SA 3GGCA 1TZ2A 5A3JA 5KTKA 1DXQA 3SXPA 2Z2XA 2B2CA 1GUBA 4R1PA 3N8DA 3C5HA 4I5IA 3PWZA 4EHHA 3RVQA 4C30A 2QD2A 4OH1A 1T8SA 1KEKA 4NJEB 1TA0A 1M0WA 3F6RA 3CLTC 2REOA 3R6WA 5L3SB 1KDZA 3BIWA 1XU7A 4HEHA 4QBKA 5JMTA 4RXTA 3SM9A 2GNAA 3HABA 4RMHA 2PUEA 4ZDKA 1S01A 1L4EA 5CDFE 1H5NA 2Q21A 3A1CA 5EIXA 4RVCA 4KMMA 5DTQA 1ZOPA 5WRFA 1DRVA 4ZT6A 2JVIA 3HSKA 4BEJA 4EKEA 4YR9A 1ZCFA 1XTSA 3DW3X 1JSCA 4QUBA 2PKXA 1PSZA 3OZTA 1L5LA 1A2OA 2AQHA 1P4HA 2GM5A 2B0CA 3MBIA 4KMRA 5HIIA 2YJ5A 3C5EA 3F97A 3PYMA 1ZJYA 1MH9A 2CLKB 3U7GA 2GETA 3HJCA 3GDWA 3JRWA 1DIOB 3IT0A 1XD9A 3VYTB 4AMVA 5MFPA 2DFPA 1JDBB 1R18A 1JHXA 3QU7A 1IWOA 2UUPA 1N57A 1U11A 3VR3A 5JSZB 4MARA 1HXHA 1QIEA 1PR6A 4UUAA 8OHMA 3P7MA 4OMCA 1QUFA 2YMLA 2XODA 4G0XA 1I7SB 3HEAA 4OD0A 1CS0A 4UNPA 2GN9A 1OBCA 1NA5A 1BO6A 1KKMA 2HWWA 2V45A 3CH4B 3G5TA 1PIWA 4ND6A 3L4KA 3BE6A 3P9RA 9ABPA 1UR5A 3LM8A 4U7PB 3R40A 5JLAA 3FDJA 3PUWA 2WOOA 3W4KA 1XXHB 4M37A 4CG0A 1JPNA 4FGSA 3EG9A 1IM2A 4KNYA 1XMVA 2V7EA 3EQ2A 1K8XB 3UQZA 3TQTA 4LOLA 4GG1A 4ESEA 5FORA 1L1RA 4G5SA 5J2TF 2DJ5A 3DFFA 1Z6TA 5SY4A 1SUIA 3HN7A 4YT5A 5AKHA 3BCSA 2IPXA 4NPAA 2G9VA 1O6CA 2OSBA 2YWFA 1S7CA 4YP0A 5DIFA 7ADHA 4FXPA 4CQMD 5TPZD 3I2FA 1O4WA 5T67A 3OX1A 3LZDA 4V0RA 1COWA 4QT0A 3MCUA 1Y9AA 1A2BA 1XJQA 4MKXA 2PV7A 3FNQA 2PY6A 1IWPB 1WJGA 1E1LA 2XUFA 5KX5B 2PUFA 4BRWA 3FI9A 2EERA 2R6FA 4NFHA 1E3DA 2B1JA 2G83A 6ABPA 4EQZA 3AVXA 2YV2A 2ZWMA 1GZVA 2D0OB 1FRVA 3U48A 5I9IA 1IEVA 3H42B 4H77A 4KQMA 1PVVA 3QITA 4YBRA 2MSKA 3H83A 4XPIB 1NKVA 1SIBE 5LCXA 4WJLA 3N86A 1T4GA 3KX2A 2KJQA 3X1KA 5HKAA 3HCWA 1AK1A 1OZHA 2VJCA 3UUGA 1X13A 1XLVA 1LFAA 3OPQA 5JAZA 1JEYA 2AZXA 2ST1A 1YHNA 5IBPA 1BE0A 5U1PA 1R0RE 2BFEB 2ZM5A 2AEFA 4HSEA 1VKZA 4D8WA 1BYIA 3KO8A 4HDKB 1II0A 5TT1A 4KPUB 2CVHA 1Z17A 1SCKA 3LBYA 4CLDA 3KJFA 2BTOA 1M6EX 4JBWA 5JT1A 1W85B 1RI3A 4Q7EA 1E0DA 2OXRA 1KO8A 3A4LA 5CDHA 1X0VA 2WSLA 1ZK4A 4O4JB 1NT2A 2IYLD 4H1WA 4JEUA 1YA8A 1XKLA 3PDJA 4KQCA 1CKEA 1NM5C 3VR4D 4BNKA 1WD7A 2A9RA 1FNSA 2PMCA 3K31A 3KWLA 4BKPA 4OLBA 4I1UA 4KBYA 1GPAA 1M72A 3FR7A 3DUFA 4NEQA 4D43A 1Z38A 4NONA 2XVXA 1KO5A 2P2CA 4BQFA 3U19A 4EB6B 2WTBA 4BLPA 2I1WA 5GINE 3UXEA 5BYBA 5EZYA 1C7QA 2EJTA 5GMOA 3FLEA 2DFTA 2VHQA 2BTQB 2DECA 2R00C 2ZS9A 3GCZA 3QWHA 4E5PA 5IF9A 5JD4A 4QOSA 4GC9A 4PWYA 2PMEA 2F64A 1X39A 3FVRA 3M5PA 4DRZA 1UJ4A 2YNMC 1RNLA 2KLBA 2NT3A 3ETEA 3L8GA 4I1SA 4ZOLA 3UN1A 3VC3A 5LSAA 1FJXA 5ALVA 3ERCA 1IVYA 5BV1A 1VGVA 3A27A 2BEUB 3JU3A 2WR8A 4N6NA 1N4DA 3TNFA 4L7VA 4MVJD 3UVEA 3TEFA 1BX1A 1WZUA 3HZZA 5A9TA 4TL9A 3D54D 3UJ3X 3RFXA 4EFNA 1PT5A 2OMKA 4R69A 4IJ6A 2HPZA 4JBYA 1EK6A 1VYTA 2FFBA 2GRAA 2X7HA 3Q5EA 4PTZA 3SSMA 4JHXA 4KX5A 2JBWA 4P33A 5FWAA 5KOIA 2OM6A 2QTCA 3WDMA 1A4UA 2GEDA 4WT7A 4LGMA 2CF5A 3RC8A 4KBFA 5JR3A 1YS6A 3H13A 1K6JA 1U7HA 1Y9JA 3WP1B 4ZQEA 4NICA 3VKGA 2GAJA 1JEJA 3LZ6A 2HJSA 1P7VA 3VAAA 1NT4A 3PXUA 1CY1A 5DBGA 3ROPA 4GYYA 1X1TA 3UMVA 5EUMA 3NYRA 2IS6A 5IDYA 4KXQA 2EVWX 3F6PA 2B8EA 5AK4A 2ZJ0A 3U9SA 4NFLA 2WYWA 3DWIA 2ZTLA 4MUFA 2R79A 1JAHA 2B4YA 3JD4A 3M1YA 3C7KA 3LGXA 4GZ6A 5K8VA 2QQGA 3CRZA 1ZJ5A 3QUTA 4BP9A 1AHPA 1X74A 4MUNA 2C59A 4TT8A 1OT3A 2ZYVX 3LLSA 2HXGA 3V1LA 1H66A 2WA1A 4EGCB 1JXAA 4LA4A 1XALA 3QPAA 3UT5B 3GBSA 5LOVB 5EXEA 3AUTA 1Z6YA 3UT5A 3T0IA 3OOEA 4UAGA 4XZ3A 1MAAA 2BR5A 1K4MA 1XYYA 2C42A 1XEWX 1ECPA 1G8HA 1VG1A 2NO9A 3ETJA 4Y1GA 3OPNA 4WBNB 1MCZA 1GKKA 4W5QA 1P0FA 1T2EA 4R40A 2BCEA 3AJRA 3Q7TA 2YH2A 2ZTMA 4BNUA 5JQGF 1N6NA 1B4DA 2G04A 3JAKA 3B85A 5FI5A 4A8JC 2XZDA 4KQJA 4RY0A 2C57A 2D5AA 2HA2A 3FNGA 4G9GA 4CMJA 4UAVA 4WN3A 2NUTB 4F9FA 2IHVA 4ZAXA 1WEHA 2B94A 4D0RA 1VYVA 4FOSA 4RMNA 2JEYA 4ZJZA 1UPBA 4AVYA 5LMNB 1QCYA 3AEZA 2JJ2D 3A6LA 1ZNQO 2NZWA 3H8WA 3QVMA 4Q21A 4RZHA 5DI9A 1AV7A 3S2ZA 2DF8A 2J5QA 5BR8B 3C8HA 3TNJA 4I9NA 3W9SA 1SGWA 4YXFA 5CLFA 5CFLA 1C9KA 1GSIA 5KTMA 1JLLB 4R01A 1HSOA 5IFKA 2HRQA 4YP7A 4I81A 3U44A 3HKBB 4WI1A 1OH5A 1H8HA 2GZHA 1JLKA 3BJZA 2NPOA 3L41A 1CU1A 1DV1A 2Q49A 7ABPA 3LT2A 3ES9A 4XJSA 4PQFA 1ISPA 4NE7A 1EVYA 4IOLA 4ZU6X 3FDZB 1MQ9A 1D1QA 3BHIA 3JQ6A 4L5JA 1DBIA 3GT7A 4MWBA 2H4YA 2WJIA 4CIAA 2PUAA 1JSLA 3R5SA 3TZEA 3WLKX 5FH9A 4YCNA 1PF7E 1ODCA 2WWYA 4Q1FA 1Y7HA 1Q14A 1RWQA 2JGAA 4PNZA 5DF1A 4EPRA 4NCXA 3IPRA 2Z6UA 2HREA 5TXGA 2XH8A 3O1IC 4WKGA 4X7PA 2QT1A 1RXSA 1X1QA 2ACWA 4OHCA 4QNRA 4ZCPA 2K5UA 3ZHRA 4WLVA 1XLTA 3DBLA 2D2XA 2UVQA 4FFVA 4ZVUA 1D6SA 1Q7GA 3Q0EA 1A82A 1TVCA 1FX0A 4C0BA 3LSYA 1T6YA 2W43A 2YJ3A 2ZB3A 1OUMA 3W5JA 5JAHA 4A3SA 1TO2E 1UMBA 1Z3IX 1BXRB 2B1RA 4EKDA 5LL6P 2JJ1D 1KSJA 3G82C 4AXBA 4EATA 2J09A 4FOOA 2PRSA 4LHYA 4UEJA 4XLZA 1L1QA 2E49A 4O4HB 4WA8A 3TR6A 3BFJA 3FF1A 3RG8A 3UW1A 3LHDA 3VR3D 2PZJA 3L6BA 3AU8A 1G3MA 1YCGA 1W4LA 3HJTA 1N0WA 2WRZA 3KJQA 4GVLA 1L8LA 5U4QA 4GZMA 5HKKD 1F20A 3NBUA 4LWPA 1JIKA 3VBCA 4UXJA 1DCFA 3ZIDA 3QMMA 4RTLA 5E6RA 1XRMA 4P2BA 2C4KA 2DYKA 3FBGA 1F17A 3CB2A 1L8AA 2GXAA 2NWQA 5CVDA 3TZQA 3TKLA 4LY3A 3CZPA 2D2FA 1ZXBA 1PL8A 2HJRA 4K2AA 4KYIB 4TXLA 4HVTA 1SXPA 1WZ2A 2QNIA 3H5AA 1T29A 1REQA 4D74A 1NF8A 1REQB 4INJA 5H3HA 1J8YF 1V8OA 3GD5A 3DEYX 1V3UA 1IZ8A 3I76A 3CBQA 4GWKA 4UU8A 3TLKA 4EA8A 1O5IA 3T1QA 2W6IA 1U0LA 3KUUA 2ATVA 4XRRA 1O08A 3O1LA 4M86A 4EUNA 2QRVA 1JEOA 4TVBA 4N8EA 4FJ0A 2X6TA 4HUJA 1RAIA 4PZCA 2V7VA 5GPBA 3ZE9A 4AC9A 1BDBA 4DMMA 1N9GB 3UZUA 3S8YA 2GYVA 1L5FA 2LCFA 4PRKA 3W1WA 3O82A 2R44A 3HNRA 1EWVA 3MJ4A 3I4CA 3CF4G 4KLNA 3B51X 3AHEA 1GZ7A 1T13A 1E5VA 4Q4CA 1GTJ1 3KPWA 2CMDA 5LOVF 1KTVA 1Y89A 3DKRA 2UYYA 1BW9A 3ETHA 4KFTA 4C2AA 1EG2A 1BDHA 3DOOA 5AKIA 1J56A 1DAEA 1KI9A 3E2IA 4NENA 1I5EA 3LX4A 3FVWA 5ALTA 5JZVA 1BVRA 1Z3CA 2C7RA 3TZKA 4EGJA 5AXBA 4F5YA 1JIUA 2H6EA 1QFYA 4PHHA 3I2GA 4GM0A 3V4FA 5FPPA 3MTEA 4F8EA 2EP7A 4HMQA 3WZMA 4KGZA 1QVVA 3AC0A 4CCWA 3I2KA 1I32A 3U6BA 3W5IA 3EMVA 4DVJA 3P94A 4FFMA 4JVNA 2C7BA 3TE6A 4E21A 3U5TA 2JAOA 4RF4A 3IEMA 1GQSA 1J33A 3C98A 2LCQA 1A5ZA 3FDIA 3G0BA 4B82A 4ENTA 1G21B 1MF7A 1T24A 2XTAA 3QYAA 3ED1A 4LGYA 2YJNA 2KBFA 3R9WA 1T8TA 1UT5A 2YJTD 3HGQA 1PSWA 1UFOA 3U3KA 3HGMA 4TN5A 4EY3A 1KEVA 1JG1A 3RSQA 4OPMA 4JIMA 1NW6A 3H6HA 1R9NA 1U1EA 3OQHA 2REXB 2VHTA 3PRJA 2CV0A 1CBUA 1FOEB 5CNIA 4E31A 1GCUA 1KHHA 3CWZA 4UQOA 5JCPA 1DU4A 4TKUB 2VPWA 5LDHA 2YUTA 3G6KA 3RS5A 5HF5A 3KQKA 2FFJA 5HOQA 3VC7A 5EY5B 3HBJA 1EDEA 1C3OB 5KPDA 3U49A 2DVMA 4LJYA 4EGAA 1WMFA 1M34E 1MRSA 1UZLA 2GEJA 5SY6A 3ZZUA 1HGXA 2VXYA 3BPSA 2A5DA 3PA6A 4QREA 3AKEA 4XEUA 1T9BA 5IKPA 3R0JA 4P4UA 4DIBA 4E7OA 3RLIA 4KDFA 3UXHA 5JCJD 3MJEA 1E6CA 1BEUB 3EBOA 3IVXA 1AQJA 1SFRA 2BKVA 4A0GA 2G67A 4RDIA 2Q9UA 5DTEA 4DJEC 2I4OA 2SICE 3K70D 1IJEA 2J9ZB 2AK3A 3O84A 4M1OA 4XWWA 2W48A 3L8EA 1LRLA 3B6IA 3EIQA 3GFQA 1IY2A 1AKRA 5FJIA 4NG5A 4PRLA 3SFZA 2LW7A 3W6NA 1FQOA 2I6TA 2O19A 2P2LA 1ZC3A 2FLWA 2IYSA 2XOKA 3WB9A 5BVGB 1MORA 2A86A 2PLAA 3HXOA 3PUYA 2RGUA 1VIMA 3BTVA 5ISMA 4Z2AA 1RKBA 2BFCB 4YV0A 4J0EA 4AJJA 2GHTA 3AY0A 3FPGA 3ISJA 5AOCA 4DOMA 3JD1A 4AXXA 1OLXA 2AOWA 3DTVB 4M7WA 2AFVA 5BSMA 3G8BA 4MS3B 3TO5A 2W11A 1ZK0A 1I36A 4DVGA 3NAGA 1IB0A 1W88B 3PVSA 3EVTA 3FCUB 3KJNA 4KVZA 4FE3A 1SHZA 1U1FA 5K0ZA 1XRLA 3I12A 1F1JA 3B3AA 4FYMA 4GICA 4YI3A 1UJNA 2VT3A 3FHJA 3IAFA 4HQRA 3DKKA 3DBVO 4D4IA 5DHTA 4E5MA 2I66A 2Q5EA 3MUEA 4XLLA 4E2XA 4TTPA 2ZBGA 1DC4A 1WDMA 4JZYA 1ODLA 1RYNA 1UOPA 2HO4A 2FN9A 4AZ0B 2JLAA 5DN6A 1L4NA 1QGUB 2JGRA 5KX5F 2SNIE 2JA1A 1B2LA 4X20A 3VVMA 2CLEB 1PX0A 1EMDA 2DLNA 2M2IA 3UV3A 5LD2C 2HLNA 1PGOA 2K7FA 2XJ4A 3UJBA 3K70B 3RVKA 3I04M 2GA8A 2JIRA 1FSZA 2CLFB 3C45A 5KNBA 4IMRA 1LZKA 1VIVA 4Z7NB 5IZ4A 3UHOA 4EG4A 5ARCA 2BFFB 4TRNA 1X2EA 3PX2A 4MX8A 2JEOA 4DN6A 2DHRA 1VI2A 2QTVA 3D81A 3L8YA 4ND8A 3QE9Y 1DWQA 1U2PA 5DM0A 4BVHA 2WYVA 2QN3A 5G53C 2P3OA 3ZJYA 5EE1A 5D7BA 4KLRA 3T7CA 3GUHA 1UAYA 2JL1A 5C8ZA 3WJ2A 1ZN7A 2HRDA 4JITA 3SHOA 4IG9A 3KEFA 1DARA 1BKSB 1V16B 4ZWNA 2OORC 5J59A 2Y1OA 4XIIA 4BVJA 4NNJA 2QF7A 5E2AA 3GFVA 4MR8B 5CR9A 3BRSA 2O7QA 4E5DA 4RJJA 5HPYB 4ZEWA 1CEYA 1N5LA 5H82A 4Q9LA 5JVDF 1DG1G 1V7QA 3NORA 4MDEA 5F7OA 2X41A 1RS0A 4FCVA 3KB1A 1DKMA 4MWCA 2PKQO 5B12A 3G8AA 3PWKA 3DDSA 2PSSA 1J4AA 3FSEA 3WHLA 4FHGA 2FCAA 5KBYA 1OYYA 2CLMB 3QEOA 5F1YA 1TAHA 4MRMA 5AI4A 2X58A 3BULA 4K1LA 2IQ5A 1THGA 3NG1A 1JVBA 2AJDA 1TIKA 4D5EA 3WLAA 1E1CA 1TUIA 3DZHA 1LEHA 2JFVA 5SZKB 4NYMR 5JSQA 5KDDA 1SU4A 3N70A 5FUQA 1I3MA 4UCWA 1TT7A 1GR0A 4I2VA 2D5IA 2ZYHA 5LMZA 5ALEA 4UEWA 5ARBA 3LHFA 1QIGA 3B48A 2VDVE 1TZMA 2P9QA 3SLRA 3B78A 3E9YA 4BBAA 3M2PA 1CS4C 4L4UA 3WBJA 2W58A 4CG1A 1ORWA 2SBTA 3I04A 3ROGA 3MYRA 2EKDA 1H6BA 5FUWA 1RCTE 1E9FA 4C1BA 1B26A 2ZXFA 5AMXA 1VSVA 2E9SA 1SK8A 5L6LB 1WUIS 4GP6A 4MK4A 4Q3AA 5BT8A 1X7XA 4C78A 3AR4A 4J3NA 3V1MA 1EB8A 5FI0B 1ODTC 1WXXA 4Q1VA 1UPFA 5HFNA 2B69A 2ZRCA 4K05A 1AGNA 3CCBA 1Z5PA 1A9TA 4BE7B 2OFPA 3WC4A 3WO0A 4JT9A 3AL3A 3TDNA 4C0JA 5KTOA 4L7QA 1YNSA 2P7IA 3AIMA 4K6HA 4X0EA 2CVQA 1NGSA 2HA5A 2BKAA 4PYRA 3RWMB 3T0FA 5DWVA 4JI0B 5KSWB 4C87A 5D2CA 3K0CC 1ZD4A 3S40A 2O20A 3PICA 3KYCA 3A37A 1MDBA 4U0KA 5CJPA 2GNOA 5CITA 1N33B 2H7VA 4KPGA 5HSGA 1UOQA 3N0VA 3VPXA 3ZHSA 3GH1A 4AZ3B 2PBLA 2ZS7A 4AURA 4BQSA 3SYNA 1A71A 4BTEA 4TUYB 4QFCA 2WZCA 2YHBA 4PYOA 3ZWPA 4QO7A 2NO1A 2FFHA 3G2PA 1S0UA 1U0OC 3LP5A 4IFTA 1N2SA 5ALXA 2IYZA 1S4MA 2I7VA 2D7CA 2P0AA 4QFMA 3I8OA 3ID6C 4MJLA 1BN7A 1JILA 3C7CB 4JJGA 3UKDA 4ER7A 1UF9A 1FU8A 1R1DA 2F7SA 1JTFA 3VXKA 5ALPA 3MGBA 1JLSA 1P2DA 2QK4A 3TGLA 5GP1A 4YJGA 3TI9A 1JG2A 1F14A 4YLGA 5AJWA 1G5TA 3AOGA 5DKFA 4Z7QB 4CLRA 4W9MC 3EQ6A 4IMJB 4WA7A 1KVUA 4LJKA 2HUNA 2VJDA 1IZYA 3QE0A 4V2UA 1BVYF 1NDUA 4KOEC 4AFNA 1FP6A 3W2FA 2IPLA 5CXXA 1W5EA 2PUHA 3H3FA 4RH0A 3TD9A 3W5AA 1OXXK 2NM0A 5SZJA 2VP3A 3SQOA 5K4AA 1NLYA 1IM5A 2EU8A 3PXXA 3FPLA 5I3ZA 4H6PA 4HEA1 3QPUA 4PAMA 1UKAA 4GXNA 1GPKA 1TZBA 3I3OA 3IVMA 4U8HA 4BNWA 4FE7A 2HDWA 2YS6A 3A6ZA 4MW7A 5EMKA 5LB4A 4XDZA 5CAEA 3ZWNA 3FWYA 2JH8A 2GBGA 2PX0A 2XSZD 1I1NA 2IHUA 3L79A 3N8KA 4D9HA 2C7QA 1FBNA 3UMRA 3W1EA 2A9KA 2JJYA 5KJ1A 2CFOA 4AJEA 4F92B 1A4RA 1NN0A 3RSFA 3FCXA 3GG2A 3IOBA 3U60B 1L7AA 3CGWA 1Z08A 2J3QA 1YAHA 4IO1A 2W4MA 3IUNA 2QVBA 2BEKA 3EW7A 1P2GA 3LHKA 4FMBB 4HJXA 2H2WA 2JFHA 3IEXA 3EZ7A 3H2YA 4MWEA 4RYDA 5BOSA 4W1RA 2QL7A 1TJNA 4CKCA 5IF3A 1IMJA 4JOBA 4HQOA 3RF7A 3MOSA 4NCKA 2PH7A 2DCUA 4HN4B 4JL6A 4MI9A 1WPRA 2PVSA 4QGFA 2JRLA 1AH2A 2CXPA 3ZE1B 1AVTA 3O7MA 3MS4A 4NYIR 2RGXA 2G70A 4R8LA 1WUJS 1SCBA 2NTJA 2BP7A 4OGLA 3SN6A 5IXSA 2C5GA 4F2HA 3CBGA 1DC8A 4RV4A 5JLJA 4UUQA 2QTZA 3LC0A 3NHBA 4L95C 3AJ9A 3BMQA 2IX9A 1YZUA 3PFHA 1MVNA 4YJGB 4B2YA 4C0SA 1PG2A 1YDEA 3EAQA 3HKDB 4HNHA 4YAJA 3RIXA 2H1FA 3SX0A 4G41A 3IE1A 4IXTA 4Z4FA 3IOMA 4B85A 4KGVA 3UAOA 4LKRA 2ZUEA 1IBRA 4OUKX 4F2WA 3QVSA 1QCDA 1NJGA 2AEMA 3AWIA 3I9LA 1HZJA 2MSWA 2WTNA 2WFAA 1EK1A 3PNQA 5M5BA 4P0PB 3A7EA 1L7EA 3LX5A 5AVOA 1JA0A 2AKYA 3N2NA 3MSXA 2B37A 3A3YA 2Z04A 4PCVA 3SF8A 2L0XA 5LJLA 1QTQA 2O8CA 4ALJA 3WB0A 5EEGA 4LY0A 5DM4A 4W7IA 1M5UA 4M7OA 4OHKA 3ZGLA 4NTZA 1T5LA 1GQFA 4N3AA 2JLQA 1E4OA 2G8NA 2A9OA 1LI7A 1SU7A 2Z9DA 2XGSA 4RS3A 3KVRA 1P44A 1RC1A 2VBCA 1Q17A 2OORA 3HP4A 5FBZA 5YASA 2CHFA 2WIKA 2O0HA 4J9VA 2YIMA 3B3FA 4BY9E 2VQFB 1A95A 3F6EX 2BEJA 3LT5A 3PNYA 3IPYA 4ZU3A 3TLGA 3PS9A 3R7LA 4C4SA 5JNVA 4TLDA 2ZOSA 3WE7A 3IYLW 3WLRA 4KR2A 1YR9A 2A1IA 2IY8A 1NVAA 3HCDA 3C3PA 4Q1BA 5EHGA 2CD7A 3ZXIA 4C4TA 4F5EA 2PDAA 1DKOA 1MO2A 1Q0RA 2CMHA 2OGTA 5AI9A 4AP9A 2GM3A 4DXAA 4F96A 1GJRA 1TK9A 3H8SA 3HZOA 2R5FA 2A78A 3FCCA 1EFTA 3HYNA 3FY4A 4JYCA 4Y30A 3EGVA 3H4VA 3RBAA 5IEJA 2IUYA 2P65A 1M6YA 4UJ3A 3C43A 4RHXA 5DP1A 2VP6A 3DOUA 4LF9B 2R00A 1A7KA 3NM6B 4ZYLA 4IDCA 2P6UA 5LNK6 4LDQA 2BDEA 3PSHA 4G26A 3C3CA 4WL0A 1AS2A 3SX4A 4Q15A 1Z0UA 1Y1RA 4QG7A 2QIOA 3R8XA 5JRJA 3AIKA 1JJ7A 3NVAA 3R2JA 4MVJA 2R4TA 4HXGA 3QQPA 3DF7A 4B5KA 5CEEA 4J43A 3SCZA 1T1JA 2QMOA 5H1YA 4RFVA 2VQSA 2Y1CA 5CFNA 4L6AA 2RH9B 2XA9A 3TPZA 2ZQ5A 4EO4A 4EJ2A 1RBZA 3IKLA 4EHJA 1VCIA 1KNXA 2C99A 4OJTA 1XTRA 1GZUA 2RHBA 2ZB7A 2Q7XA 2VDLB 4JSYA 4MLPA 1KC1A 1GUZA 2BHSA 3CNBA 5G02A 3C6ZA 1UBGA 4URFA 4J8PA 2GCEA 4TXHA 2Y1EA 4YP9A 4CUKA 3X2SA 1G8MA 4JB2A 3QLEA 1OLSA 3MFQA 3IVCA 3H4MA 3VR4A 3HYSA 3QVGB 1ESEA 2C9DA 2V55B 3MWEB 4ENUA 3LV8A 1E59A 2IZ5A 2K7ZA 1DAKA 1SCNE 4PCAA 1DKNA 3QG5A 4KE7A 3ZE7A 1UL1X 4IMIB 4Q3BA 1S6YA 4V0MA 3WIEA 3PCRB 1O2DA 4M0UA 1H2AS 3RU9A 1JU3A 1S9HA 3N8HA 4BQEA 3IIMA 3BOSA 1V16A 4LF8B 3N7AA 5CB6A 2XTMA 2AI1A 1W5BA 4ZKEA 3EAGA 3MIIA 1M2VB 3ST7A 1VMKA 3L1KA 1T8UA 2FX3A 2W42A 4N5HX 3FYCA 4NL4H 1NC1A 2NYUA 3BMXA 1MR3F 1Q0ZA 1W4CA 1BMFD 1LV8A 3CONA 3EGWA 4QYWA 4LYGA 2F1OA 2RB5A 2JFOA 4PRYA 1B6GA 3ILSA 2KQUA 1FP2A 1QR6A 1UEIA 2BFWA 2QTMA 2XUOA 1NLUA 4XOIA 4DQ0A 1JUDA 1TF5A 1E0AA 2PUJA 5DHAA 1Y98A 4F1KA 4I1PA 4KQFA 4MUXA 3ENNA 4EHFA 3X1MA 2PTHA 3MILA 3MQ2A 2OLEA 5BNTA 4G84A 2WIGA 2J08A 2HPVA 4UHHA 3W05A 3HJRA 4PQRA 4B9EA 2GZ3A 4EHDA 3G2MA 5D87A 3GVXA 2QD3A 4ZMSA 1CIVA 3QX9A 5T6MA 4B84A 4TYPA 2BIFA 4JQOA 2BMVA 2ZATA 3KWJA 4KAJA 1UBMS 3GJ8A 4DLKA 1G8JA 4PBSA 1ZIOA 1YL6A 3HYRA 5AHOA 3V4SA 2PSJA 3DGEC 3NTUA 1GEGA 1NMEA 3O4FA 2HQBA 2WTEA 4HX9A 1ZIDA 1ZQ1A 3WGYA 3AFHA 5CFMA 3D6FA 4C3VA 1Q1BA 2OBXA 3CUKA 3ZD6A 3FOAA 1PW7A 2GUGA 3FMGA 1Z4JA 1Z2EA 4PLVA 4AB1A 4YUXA 3KB6A 1G8SA 3WYEA 1TVKA 4OF4A 3HDJA 1RHKA 3AKZA 4C3UA 3P52A 2OCAA 4W6QA 3RKUA 1IN1A 3T0GA 2Q27A 4C9BA 1APBA 4HDCA 2PGLA 1D4AA 2P9GA 5JYCA 2ZJBA 2MMCA 1FMCA 4ZO4A 5M2QA 2BHLA 2HD4A 4UTPA 3U0VA 1IE3A 5KINB 1ZK1A 4ZOQI 1IXYA 4UBMA 2H1IA 4EB0A 2W71A 1M83A 1O8BA 1UZMA 3MNFA 3WV4A 1IRIA 3NHZA 5EPUA 3BDVA 4NU5A 4JUIA 4L85A 4PU0A 4ZFNA 4E94A 2YQ5A 2IZ7A 4GKBA 4RVSA 2BZSA 5JQGB 2O4UX 2OMEA 1G3RA 1FVFA 1ODJA 1P5RA 1U6IA 2ZJ1A 1P77A 4BFYA 4OGWA 4RHFA 1Z39A 2WTAA 2NUBA 4U9UA 3T7SA 1RQLA 4DE5A 2HFKA 2NXEA 3FRJA 4ETNA 4CEHB 3FI0A 1KAEA 4NV0A 4M7RA 1ZJJA 2GZAA 3KKLA 3VHRA 3AG5A 3D2BA 1FBTA 4Y7DA 1PT7A 2WQ6A 3K0KA 2WJGA 2A0YA 1QCZA 1NW5A 3VR1A 1YASA 1YZHA 4DSOA 5BQ3A 5B2EA 3LXRA 1L7XA 2YV3A 2XGOA 3VX3A 4YO7A 5KVSA 3LQ4A 1OTHA 3QFSA 4FW9A 4MVXA 4RH3A 5E95A 5IKOA 4B71A 5GWXA 4EJSC 1G0OA 1U0GA 3JQDA 2CL6X 5CCBA 4KKVA 4ZMBA 3NWBA 1JQBA 3EPKA 4GLBA 4AK9A 1J0AA 1WSDA 1H6CA 4I50A 1HE1C 4DDHA 2ZM6B 1RP1A 2FR8A 3X1XA 3HJFA 3KVYA 3MTQA 4D3DA 2H17A 2O7NA 2W7TA 3DLPX 1G20E 5HJEA 3BFPA 4YBZA 1VKRA 3WSVA 2CNWA 5BWOA 2E5LB 2BBWA 3COYA 4CU2A 1X8KA 1JFTA 2UYCA 5JUWA 3ICVA 4AZVA 5I01A 2QPTA 2NQTA 1T5HX 1T8RA 2RAFA 2ZSEA 5EIWA 3SX2A 3T4EA 1JWAB 5ECYA 4OQQA 4MULA 3RSLA 2IDZA 5C5CA 1DUSA 4FZRA 5CH8A 2H4JA 4U2FA 4P7GA 1BWSA 3RSZA 1EQAA 1VE1A 3DHEA 4IHKA 1UMCB 4B3RB 1T5DX 4PYQA 4UVGA 4IGKA 2QUHA 4ZYUA 1M2EA 1A9XB 1TQ4A 1UXIA 3IQZA 4NBSA 3OCZA 4FIZA 2F59A 3LFTA 1COWD 4JJ8A 4Y6GB 5GY7A 5IN5A 3RVLA 3TB6A 5LUAA 2OYRA 1E79A 5HGJA 5JOQA 1KR2A 2ZJ3A 4AKEA 3GRYA 3IQWA 2WU3A 1EDZA 2XY4A 3BL8A 5CLQA 5JNUA 2OD7A 3KPJA 4AN1A 3EZFA 2GCNA 3V8NA 1O97C 4AUKA 2AOVA 3ORRA 3WRVA 3L8FA 4FXOA 3WL4A 2BJVA 2CYCA 2WHEA 3URMA 2X9NA 3NCTA 3PUKA 4B4DA 5K3BA 1DQRA 2COUA 3C6XA 1CYEA 3RVRA 4ZI7B 1B8PA 5LLTA 1FB5A 4OXIA 1UDXA 2XEDA 3TEJA 3VAYA 4WKBA 1C0EA 4L5CA 3VTFA 4Z3OA 4PZAA 1XXLA 4F5DA 4PQYA 4ZVNA 2NXJA 5D7NA 3V1TC 1HT2E 1K63A 5AM1A 4DC9A 3PIIA 1J25A 1GZ6A 4EHNA 3C7DB 5LNK1 2QJOA 1NW4A 2IEYA 3OIFA 3VU9B 2D1RA 4BIIA 5C8YA 2IS2A 1UJ5A 1DFHA 1NI5A 4C4OA 1TAQA 4AJ4A 4TQUS 3T61A 3I8SA 4MUBA 3IQXA 4BNDA 1OC4A 1XAIA 3D5QA 1NULA 4FDLA 4UHBA 2GDJA 2AOUB 2WA2A 3C87A 1W48A 1O4VA 2R25B 2BOVA 3CLRD 1FFAA 5EESA 1Y6RA 3OLZA 4N12A 3VTAA 1JKFA 4JQYA 1M0EA 2GVDC 3HA2A 1RDFA 1Y1SA 4JROA 1MJFA 2OV4A 4Q4DA 2P9JA 3LPLA 1V1MB 1W19A 2R1ZA 4GI1A 3OUZA 4R3UC 4YYZA 3MN1A 1NIJA 4HFRA 5CB4F 5LWQA 3UWOA 1GYRA 1IC6A 1LTHR 3V4VB 4YHHB 1AN9A 4LSZA 5FEMA 3ISTA 2GUWA 2B4RO 2QLBA 3IO3A 4M98A 2VOJA 4LRXA 3H1AA 3ZK7A 5KOYA 4JLMA 5A4FS 4DTIA 2ZSJA 3OIUA 3WGNA 1H2RS 1SKUA 3OTWA 1YULA 2ZYDA 2VCHA 4MGZR 3P71T 1PCXA 3NHRA 3P9ZA 4H7HA 5FBVB 3V4ZA 3EUEA 4JKOA 1Y1KE 4L9RA 3NWEA 4RKYA 4UNQA 4AS2A 3QUQA 3L6EA 3I72A 4ER3A 1O5TA 4BWFB 4QUKA 1XNQB 1SCIA 2AC7A 2FW7A 3CW2A 3FG9A 3ZH9B 5C1IA 1I3NA 2Z6VA 4L8FA 2I6XA 4EZIA 2VEDA 5LZ7A 1JKJB 2C4NA 2ODTX 2K6GA 3RVSA 4K81B 1A4IA 1N9KA 2E5FA 3FTDA 3QXSA 4QE3A 4WZAA 4ZANA 2PKQP 2VTVA 4DCGA 2BR3A 5BT9A 1GDDA 1RZUA 2B4KA 3EZ2A 3GEMA 5IYZB 3BERA 4HUTA 5KNBH 1DWPA 1H9AA 2HCRA 2WINI 3JYOA 1E5QA 4MGKR 4DV4B 1IY9A 1LPSA 2B61A 1S9DA 4L6IA 4LCEA 4P7JA 4DBLE 1K3FA 4G4IA 2ISCA 3EUAA 4AJ9A 1PS0A 4DM7A 1ZH2A 3GIWA 4C0AC 1NSYA 3WGIA 1TNDA 2YY7A 4D4GA 2ETXA 1Z35A 3LCRA 5M04A 1U5AA 2PD4A 3PQ4A 4Z8YA 1O94C 1SXJA 3WYCA 3VR2D 1T1IA 1VL8A 2HHLA 2NSHA 2QYOA 5K6TA 4JUBA 1XA3A 4AKIA 2ZITA 3A1SA 4HTAA 3BGOS 4J49A 1MIOB 2RHMA 1CNFA 3SE7A 2FRXA 3K2IA 1Z07A 4OL0A 4NI5A 1M2OA 4XGQA 3GRAA 4LF6B 4GOOD 2M9MA 3KTAA 1F8XA 1VJ5A 1UK8A 1U2QA 3P2KA 5BW6B 2I7XA 1YJXA 1BC5A 5FTMA 4G5FA 4PY2A 2CNDA 1KBOA 3IUSA 1OQAA 3QF4A 4BWVA 2DWUA 3EQZA 4CMBA 3RTDA 5CEFA 4D79A 1KNQA 5JW6A 1BU5A 1PW5A 3EVBA 2KPOA 1SD5A 1RWOA 4OXNA 3I5YA 1XAHA 2E4UA 3KOMA 5JQGA 1T3ZA 4YJFB 1CUUA 2CCKA 4K5QA 1H0SA 3IBTA 1UFKA 3TQSA 4ENQA 1NMXA 3EVNA 2NP6A 1X14A 3IKTA 1M74A 3VNUA 2EKBA 1ZICA 3HVJA 1US8B 4MEJA 1WUTA 3QM1A 4RORA 1PBNA 1YD7A 3PUZA 2IUTA 3PRHA 1PJZA 5IT4A 3RC9A 4Z4QA 5L53A 4DS3A 1BGXT 3BA1A 3I39X 1WB4A 2HYIC 1LLFA 3VVLA 2RH4A 1FRQA 5CJ2A 1QIIA 1R4NB 2I54A 4Z0NA 1TEZA 4XE5A 1GXSA 4MV5A 4FN5A 3E5HA 5I7WA 1SBZA 1V1JA 1K0UA 4TYNA 2OILA 4QX6A 5AJZA 3CJQA 3CZQA 2CDBA 2CKDA 2HK9A 1D0IA 3G89A 1BS2A 1T0IA 2OHVA 2YW9A 4MWDA 4ED9A 2OG2A 5JS8A 2GD2A 3QX8A 1F9EA 2JIDA 3L1HA 3NI2A 3PUVA 3ZVRA 3HVRA 1GUYA 1B3BA 3A4VA 1GG8A 1MNQA 2PYZA 2RJ3A 1WXGA 4FZ3A 3QYFA 3USES 5IVHA 5EZQA 3FGPA 4JV5B 1A1SA 2WW8A 4BO9A 2MSNA 2KM1A 1MC4A 3GEBA 2IHZA 3C1AA 4RGQA 4BTVA 3AB7A 2OD9A 3OZSA 3H4TA 1U0NA 3SJUA 2H16A 3B7PA 4O0MA 1UPTA 2FOIA 2EGGA 4BWYA 3KETA 4TWAA 4TSKA 1RXYA 1EIZA 4XGKA 3CWCA 5EVCA 1XCLA 1JWBB 3VC2A 5GVSA 2X4DA 1TTHA 1ZW1A 3I2HA 1PTJC 3ENWA 4N3CA 3C6MA 4HVLA 3NVMB 4PYMA 4KWCA 1NVVQ 5E7QA 3I4LA 3B5EA 3KDPA 4J0GA 2QKYA 1SXJD 4HWTA 5K3OA 2XTZA 3E70C 1EDBA 4Y6QA 3VOAA 3BE8A 3VR5D 3HEBA 4L5AA 3NW9A 1EX9A 4PYLA 3ROZA 3DL0A 2A1UB 3OKFA 5E6RB 2W2NA 2A5JA 5B5SA 2G0NA 1Y37A 5KVQA 1F8GA 1R66A 4C21A 1J39A 3OZIA 5GADl 2JLVA 4MYDA 4IJWA 4L1KA 4XWOA 1B93A 1U4SA 4EYKA 3FWNA 3T5DA 4JJ4A 2D5BA 2QA5A 1LDEA 1MXHA 1PJCA 2ACKA 4KL8S 3IDQA 5FDFA 3P32A 1KEEB 2R2GA 5IU6A 1QIFA 1NSTA 3FSRA 3W9UA 5D3KA 5ESDA 4YMVA 2GZSA 3DWGA 4GOMD 4QC2A 4FZ5A 4DNQA 3G9TA 3OD1A 1XMSA 4HMOA 4KN5A 4ZVOA 1LXCA 4PAOA 3SICE 4CTKA 2WZQA 4FYYA 2EJCA 4J7CA 2FW1A 1NUUA 3VSEA 4OYHA 4FQ7A 2FSUA 4Z0PA 3VV2A 3CVUA 5TY0A 3K53A 3DFIA 5KU7A 1DUVG 1SEPA 2PXCA 2WT9A 3RYFB 2WJHA 1HE3A 3EBLA 3LBFA 2EX4A 1YA4A 2DTDA 4NMXB 1JJVA 5DTRA 3PXGA 1KE2A 3L6CA 5L3QB 5LP6A 2ZVDA 3S68A 2GZMA 2I4RA 3OUUA 4AO8A 5IBRA 5KNDD 1QB7A 3HFRA 1E2LA 1YRQA 4JYZA 2Z2ZA 4K8RB 2Q6VA 3ENZA 1KI6B 1YB2A 3F7MA 1JPUA 5E6UB 4PAWA 1PX2A 2OCYC 3WBFA 1XA0A 4RHUA 4YRLA 1I7DA 4GNRA 1Q7CA 4ZD6A 4MQ4A 3TLJA 2B35A 4LPSA 4Z9FA 2B83A 2H00A 1ID1A 1G41A 3MFYA 3P2OA 4ZPXA 4MTLA 4BNMA 4C7OB 1WXIA 2F67A 2QW1A 4MW4A 2FQQA 3R0XA 3ROMA 2XB9A 4GKKB 3T4XA 1OZFA 5DN6D 3BWBA 3IHKA 2UXCB 2XQJA 2QGFA 3VPCA 5EJ6A 3GYGA 5FLKA 1NBMA 3V8MA 4F72A 4DRYA 4QXMA 4PICA 4D3SA 4JUCA 2GCOA 3IHTA 1R37A 4IJQA 5ECGC 2ZULA 3V2UA 4D4MA 1IY8A 3LIIA 4JYPA 1LH0A 4KQGA 4RADA 1JQLB 1NVKA 5BMOA 4FGWA 3R5JA 2FOXA 3HJNA 2FJPA 2QD1A 1OAOC 1CDDA 1CUEA 2OG1A 1P3JA 2XBLA 2D59A 2DWOA 3AUFA 2BMEA 5CK4A 1Q1QA 3TBHA 2BUCA 2YC2C 5A1JA 4G07A 3QVJA 5T6BA 4DR3B 4IX1A 1R6VA 3P45A 3DH0A 1LC3A 1VXRA 2HBRA 3I2IA 3PE3A 5IYZA 1XMQB 3ITNA 4QASA 1ZRHA 2WHPB 2QXTA 2QIPA 3ZU3A 2QN7A 1JEAA 1YK0A 4BNIA 4EX7A 4MLZA 3DD5A 1J7JA 1NC3A 3EDQA 4IIYA 4KI7A 1HOXA 3TG2A 3PJGA 2NVBA 4W5NA 4DY6A 4PC3A 2NU9A 2ZJOA 3RSCA 1IAQA 2BLLA 3I73A 4B3MB 4LYHA 5TQVA 3QU2A 3CT4A 2YVQA 3HJUA 1ZY2A 2RAPA 2B36A 3QKSB 4LMRA 3QH4A 1ELOA 5AW1A 5TNXA 4N8SA 1RXWA 2QV7A 1NPYA 1MO3A 2B98A 4X3OA 2EQBA 2CFSA 1M34B 4YASA 2PMKA 3EYWA 1P7YA 4TV9A 1F6BA 5ERGB 1N32B 1PLKA 5I51A 4XSGA 5BV7A 1T5SA 1U8FO 1OZGA 3GEIA 3L0IB 4PNHA 4TVOA 1O9HA 2QJRA 3CLUC 2VF4X 4FCWA 5EGNA 1UWVA 1N78A 4WESB 5JWHA 1KSGA 3BH7A 3KDSE 4KREA 1MQAA 4YCAA 5I4KA 1Y3DE 2ACEA 4IUBS 1QGAA 1GG2A 5B1SA 3H0EA 4LRQA 5EWJB 1E9VA 1GRVA 3HR4A 3MS2A 2JJQA 5TGTA 1VDZA 1MP0A 1ONSA 4CT0A 2AFIB 4OQFA 1OD6A 4FIDA 3NBZC 2IHNA 4KPEC 1FUEA 1X8XA 3AXSA 3OWXA 2ZU0C 3IP5A 2YWEA 1A77A 5E7MA 5B7PA 2COKA 3WBBA 8ADHA 2PJRA 5KOJA 3BK2A 4XM2A 3Q3GE 2OGZA 5FUBA 2QDXA 2E1RA 2Z8YA 3GR6A 2VJMA 2GI4A 3EIEA 4JLWA 3LNTA 3I9MA 5F73A 1D04A 4OLJA 1SCAA 1QV9A 2G25A 2CMKA 3KP1A 3UICA 1OI3A 4KW7A 1YOBA 4ZVLA 1U2SA 5SICE 4MKIA 2EATA 3R6LA 3OMLA 4FHEA 1XDDA 3DBRA 4HNUA 2I2WA 3E9MA 4OMUA 2ZSAA 2BSQA 2FWPA 1HNXB 1TX4B 4HP8A 3IP9A 3MWDB 2XXAA 1L5MA 2YWJA 3K0CA 2WZDA 3UCEA 4R5HA 1Q74A 4E46A 3TKAA 2HZBA 2PE5A 2BRUA 4EYSA 1LNQA 2AJ8A 3RG2A 5HZKA 3PXDA 3B70A 5CIWA 2YHUA 3F9IA 1SIUA 3HI4A 3WVNA 1YRLA 3GLFE 4L8GA 3CNNA 2AKAB 2IXGA 4HR7A 4R7GA 3GPDG 2FW6A 2WV9A 3GF4A 4EYGA 4MQ6A 4S0ZA 3AKDA 2J85A 3O6VA 4A9AA 1ZI9A 3EIOA 2B5OA 2IHTA 2QU8A 4L3WA 2FHSA 3VU0A 1CLUA 1ZIYA 3FAKA 4ZCLA 9MHTA 5F1PA 1Z88A 1CG6A 4KMOA 1TEHA 1ECCA 4DUGD 4KKXB 2FE4A 3AERA 2OQVA 4ZQCB 3DQPA 5KYUB 3UBMA 4HAZA 1HDOA 4RIGA 5I45A 1TAUA 3WMFA 1V3TA 1GR1A 2QAGB 1QQ6A 3ZCQA 4L07A 3ZTYA 4BNVA 4BKQA 5L45A 1LVGA 1M73E 2V58A 4PSVA 4A15A 3KZOA 4JKIA 4CBVA 1VHLA 2JCGA 1LV7A 4X64B 1NQAO 1JFFB 4P4LA 3BGIA 1J06A 1DBQA 2AYYA 2ZRPA 4GLOA 1TXGA 1OBOA 4BMOB 2Q4OA 2WNHA 3SSNA 1KZ1A 3AHJA 4IRXA 4ZT3A 4DQLA 1PN3A 3QU4A 1DWUA 5HM8A 1LGYA 5AKJA 4DEYA 5L3SA 2QSYA 3OE4A 3AB8A 3TF5A 1QOQB 4NRDA 2GO7A 3N9IA 5I8PA 5KKCA 2FFQA 3A36A 1ORIA 2OV6A 2HADA 3N1UA 1E6LA 2HU7A 4Q9DA 1FQJA 3KZXA 1Z0ZA 4LHSA 4WZZA 2DUJA 1TUEA 1I14A 5LQNA 4IDEA 3M1AA 2WHPA 2Y4NA 5CK5A 1AMOA 1C81A 4Q03A 3OT5A 1MIHA 3I01A 3VISA 4DTCA 2MTBA 3ESQA 3E9RA 3W2TA 4QPPA 4Z3KA 2Q28A 2ZTHA 1O6FA 5LXTF 4CL2A 5IUJC 5KVAA 5AVXA 3G1TA 3TFWA 3NGXA 3OJWA 5T3YA 2AMFA 1E3WB 1FA9A 1UKZA 2YXPX 4IXWA 4X65B 2O8BB 4AKHA 1UUFA 4M0DA 2C94A 3MW8A 3WKAA 5JBNA 3NJ4A 2ZYSA 4HT3B 2FUG1 3RAEC 4H4EA 2B1QA 1NV8A 3CR8A 4P36A 1E2PA 1HT0A 1ECJA 4NPCA 4RW0A 5AKEA 1U8ZA 1F2DA 2C5HA 2XV1A 4RDXA 3AUKA 5E1BA 3FOZA 3T7TA 3WRYC 4EDFA 1CCWA 4RDCA 1GGJA 1RJGA 4MRAA 1HLGA 2IUFA 3PPWA 4MI3A 1K8RA 1OCEA 4Y1RB 4TKVB 4ZAZA 4QA9A 3UXMA 3MMXA 1DTEA 1LX6A 2C2XA 1TTQB 3T1NA 1ZOIA 5L7YA 5F12A 1FXWA 1GTRA 1JDSA 2TMGA 2OTCA 3CZ4A 4CTNA 4JH0A 2QL6A 2O6HA 1QFZA 3AM3A 4UC0A 4WK2B 1N7IA 1KI6A 2GQ0A 1O96A 1TQ2A 3FNEA 3JWPA 4ICIA 3ZXSA 1NDHA 1RC0A 8ABPA 2DUWA 2Z43A 2DM6A 4KR7A 2BGGA 4OSEA 1VG8A 1QRDA 1XZNA 1ZM2A 3RU3A 4BV3A 3EVAA 4R9NA 4YI5A 4KYUA 2XMCA 5AUOB 1OOEA 1HR0B 1ZVVA 4N0QA 1KKUA 4RCVA 5EA2A 1RM4A 1R6AA 1HFJA 1ZM7A 1HTTA 2G40A 4M0CA 5KX5A 2OKGA 4W4TA 5AK3A 5KMGA 3WGQA 1CR4A 2PRJA 1M2WA 4EF6A 2FEXA 1UBRS 3K6SB</