1PFGA

Strategy to design inhibitors: structure of a complex of proteinase k with a designed octapeptide inhibitor n-ac-pro-ala-pro-phe-dala-ala-ala-ala-nh2 at 2.5a resolution
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVVKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Proteinase K
publication title Strategy to design peptide inhibitors: structure of a complex of proteinase K with a designed octapeptide inhibitor N-Ac-Pro-Ala-Pro-Phe-DAla-Ala-Ala-Ala-NH2 at 2.5 A resolution
pubmed rcsb
total genus 99
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2003-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1pfgA00
3VYVA 2WUVA 1TM3E 2HPZA 1HT3A 1ZVJA 2SNIE 1P7WA 5SICE 3D43A 3DE3X 3A3PA 1TM1E 1TM4E 1KDVA 2PYZA 3LPAA 1NDUA 3H42B 3Q5GA 5AMXA 3F49S 2W2PA 2ID8A 3BPSA 3CNQS 4HVLA 1KDZA 4NE7A 1CNMA 3DE4X 5JXGA 1T1EA 3GT4A 3AJ8A 1BJRE 1C3LA 1BE8A 3QMPA 1WMFA 4RYDA 1GNSA 1OT5A 4DWWA 1YJCA 1WMEA 2ST1A 5ARCA 1SBHA 4OMCA 1ZVKA 2PQ2A 1R0RE 2XTJA 1YJBA 3EE6A 1SUPA 3PTLA 1Y1KE 1P8JA 4JP8A 1SIBE 1R64A 1T1GA 2Z57A 3GCXA 5AVKA 3F7OA 3VV3A 1Y4DE 3VTAA 1WVMA 1EA7A 1YU6A 1SBTA 1C9MA 2DUJA 1SELA 1WMDA 2B6NA 3DE6X 2Z2YA 5JXJA 1Y48E 2SICE 3DE5X 3QTLA 1THMA 3TECE 3OSZA 2SECE 2HD4A 3LPCA 3EIFA 2ZWPA 4ZARA 2WUWE 1PEKE 3A3NA 4KB5A 3HJRA 4KPGA 1LW6E 2P4EA 1SIOA 2PWBA 4NMXB 1AVTA 2DQKA 5B1EA 2XRMA 2Z56A 1TM5E 1GA1A 5CW1A 3VSBA 5AQEA 1NLUA 4C3UA 4CFYA 5K7SA 2PKCA 3L1KA 5JXHA 1SBNE 1SBIA 5JMOA 2V8BA 3UNXA 1SCAA 1WSDA 2SBTA 3I37X 1KDYA 4LVNA 3SQOA 1Y3CE 3ZXYA 4DZTA 2W2QA 1NDQA 1P7VA 2TECE 1SUDA 3DYBA 1SCBA 1AQNA 1Y9ZA 3EDYA 1SPBS 1DUIA 1SVNA 2QTWB 3VV2A 2ZWOA 1XF1A 1DBIA 1PJ8A 5JXIA 1ST2A 5ARBA 3SICE 1CSEE 1EGQA 3DDZX 3D9QX 2ZRQA 1GTJ1 2WWTA 4CFZA 3Q40A 4FONA 3T41A 1TO1E 2PRKA 3DVSX 3GT3A 1C9NA 3LPDA 1SCNE 2Z2XA 1Y3DE 3I34X 4HX2A 1OYVA 2W2MA 2G4VA 5AVJA 1UBNA 1TMGE 3BX1A 4M1ZA 1GTG1 3DW3X 1GNVA 4H6WA 3QFHA 4CG0A 2X8JB 3WIUA 3DE0X 1KE1A 3WQBA 1SUBA 3ZXXA 3DE1X 4LVOA 3PRKE 3DWEX 1AF4A 4MZDA 1TM7E 3LXUX 1S2NA 2WV7A 3DE2X 4ZOQI 1SUAA 1GCIA 1V5IA 4AKSA 1GA6A 1S02A 1Y4AE 1SH7A 3DE7X 1VSBA 1GT91 1Y3FE 5B1DA 1BH6A 1TK2A 1SUCA 5FAXA 4WOCA 1R6VA 1Y34E 2E1PA 1C9JA 5FFNA 3WIVA 1A2QA 1AU9A 2W2NA 2PMWB 3A3OA 3WHIA 1SCDA 3TI9A 1SCJA 3F7MA 5ARDA 4Z2AA 1AK9A 1SUEA 1KE2A 4NE9A 4K8RB 4I0WB 3BGOS 1V6CA 1S01A 1TECE 5FBZA 4OV6B 1PFGA 4GI3A 4H6XA 3DW1X 1GA4A 2Z2ZA 1IAVA 2ID4A 2IXTA 3I30X 1Y3BE 1BFUA 1SBCA 3GCWA 4AKTA 1Q5PA 2X8JA 1MEEA 3CO0S 1GTL1 4J94A 1OYOA 3AJ9A 1TO2E 1T1IA 1PTKA 2IY9A 1ST3A 4H6VA 3P5BA 3TI7A 2DP4E 4YN3A 1SN7A 1SIUA 3DVQX 3VHQA 4C3VA 1JEAA 3I2YX 2W2OA 2Z30A 1IC6A 3AFGA 4DJ5X 1YJAA 4KG7A 4BWGA 4WOBA 2PWAA 1BFKA 1AV7A 1Y33E 4B5LA 1BE6A 1AH2A 3DVRX 4OMDA 1MPTA 5I9SA 2GKOA 2Z58A
chains in the Genus database with same CATH superfamily
1VE1A 3PCTA 5B1SA 4KX3A 3O0TA 3V7NA 4Y9UA 4JA2A 3NNDA 5FFMA 4HDMA 2HZ7A 5B57C 3EWIA 4YIHA 2GEDA 2OL4A 1E7MA 3KZNA 4QPJC 4UPDA 2JBWA 3U0VA 1IHXA 2X5XA 3F8WA 2EP5A 3TZKA 3UOAB 3GRAA 2J33A 3HGMA 2I33A 5F51A 4UAVA 3TBFA 3TSYA 4AX8A 3AL2A 5BP7A 5JBIA 3ZCVA 2A35A 1STOA 3T0FA 3H5TA 1NQTA 1RTKA 1Q7CA 2XIJA 1JHAA 2GSWA 2JCBA 3HKDB 5EHGA 5JAQA 4YAEA 2LIVA 2WF9A 1QVRA 1WEKA 1ZD3A 1WVIA 2CFSA 4G5XA 4F60A 5BR4A 3QVGB 3PTAA 1PQYA 2VDQB 2A78A 4Q7LA 5IPFA 3VU9A 4KUEA 4TRJA 5IJXA 4HVLA 2EFEB 4I19A 1ULTA 3W5BA 1T1EA 4ZOLF 4QDTA 3T3PB 1T35A 1P62B 1Q83A 2G9UA 3WNDA 2P3LA 3MWFA 3BRWD 1TZKA 2WQ7A 1KMQA 2UZAA 3OBIA 4Z3KA 2KM1A 4KP7A 1YCFA 1M1ZA 1P0IA 6NULA 1NUTA 3T6KA 3TB6A 4O0LA 1RWOA 2WUFA 2ECKA 3IP3A 3SC4A 4UM5A 3E3MA 3C5VA 3RI3A 4YV1A 3PF8A 3DS8A 2HBZA 3TLMA 3AONB 4L51A 1JTVA 2EF0A 3DJYA 4N5MA 3SC6A 5L3SB 1GAJA 4DXHA 5I48A 4FJ0A 4RIIA 5F2EA 5C52B 3DLHA 4QECA 2ZRCA 3UFXB 1RHUA 2JH9A 2ACEA 3KS9A 4CMBA 3RTAA 3PJEA 3FLMA 4YJKA 5JARA 1SBZA 3H65A 1BQ3A 1F8FA 1TLLA 1S0UA 2PSHA 3PA8A 3C5WP 3EF1A 2P69A 4QD3A 3WB0A 2CB0A 2GCEA 3CPSA 3JVVA 3ROPA 3KXPA 1ZD4A 1QFZA 1KRHA 4ZC8A 3SDZA 5KJ1A 2Q5LA 1C8LA 1QP0A 2WWVD 3ZGVA 4XOUA 1BNCA 1E99A 3UB4A 3VHLB 1GRCA 2JC3A 3ROGA 5K09A 2R2GA 1FLNA 1YJBA 2AJTA 2QOEA 4RKEA 3VH1A 4F9TA 2ZJAA 4F1JA 3IDOA 4RK6A 1ZMOA 2H1VA 3R9KA 1ONOA 4PG8A 2AKEA 1KS9A 2I8AA 3BXZA 4FQ5A 3NZEA 2G08A 3BK2A 3W0LB 4NNJA 1LF0A 2CF5A 2PMDA 2EQBA 1NJ1A 3U7EB 1J9EA 2VSNA 2AJCA 1T1GA 1SRRA 2DX7A 4ECAA 3PUVA 3QVOA 2EZ9A 4HWOA 4XWTA 4OI4A 1AO3A 2B34A 1XQVA 4XVRA 3QPDA 5FEUA 1YJ5A 1YL5A 1JIQA 2GYWA 2P67A 3ND6A 1FBNA 3Q6IA 3R5KA 4FDVA 2C82A 4M2LA 4U5QA 5BOVA 3V00A 5B4TA 4XWOA 4UHEA 4BKOA 2QRGA 4YP6A 4UMFA 1TAUA 5ELXA 1UPAA 2V5VA 4NCKA 3LP6A 4ZRMA 1ZMRA 2JW5A 1U2QA 3FKSA 4KR9A 2GBFA 3HSYA 4FGWA 1EA5A 1QPGA 1FUKA 4QQNA 4O4LA 1U7ZA 1S1CA 5EMJA 3R5TA 1MJ5A 4C5BA 5I4CA 2OBYA 2CJFA 1A9XA 3T5PA 2R48A 5JT1A 2ZITA 2E4UA 3HB0A 1N6LA 1X2BA 1LNZA 2A5DA 3DCYA 5GM1A 221PA 1CT9A 2PEYA 2JIQA 2IV3A 4UOZA 1ONSA 2JIRA 2NU8A 3DV0B 2EQAA 3ADKA 3IUPA 4KB5A 4TS3A 4WDQA 1QE0A 3A9SA 2ZAOA 4WW0A 1R8QA 5A3QA 2WD7B 4RLQA 4Z7OB 2PSJA 4Q1EA 1EIWA 1EFPB 4H6PA 4LGMA 4OUKX 3TOVA 3OI7A 4CQMB 1Z17A 1APBA 2GA9A 5DEOA 3IXLA 1LRKA 5K3SA 4ANFA 4C7VA 1KOGA 1N3BA 2H2WA 5JAZA 2Q9CA 1C4WA 4IVPA 2XQJA 1OLXB 1ABEA 1VFNA 5JSQA 3CLUD 1QRAA 4YEDA 5ED4A 7YASA 2Q3FA 4P82A 3NGMA 4XGNA 2DY0A 5G53C 5JCOA 4GYJA 2WYHA 2VDJA 4N5DA 1XHEA 2QN3A 3F6CA 1CRPA 3RU2A 1AB6A 2YQZA 4HLNA 5CFPA 3HU3A 7MDHA 4Q21A 2FDRA 3T34A 2LZ0A 2QWXA 2VBIA 3GLVA 4A1OA 5K05A 1G8KA 3B3AA 4I4LA 4GXTA 4JUCA 4ZT7A 3VR6A 4RPCA 5FYQA 5H80A 4BVFA 4N3BA 4CR6A 2JG3A 2BFMA 2ZVJA 4EIWA 4GXNA 3H2YA 2I03A 4B7CA 4D8TA 5CA0B 5AVUA 2WJ6A 3JAWA 3QUTA 1HBJA 1AMNA 1RQXA 4J16A 4XWKA 2BSAA 3MSXA 4PG5A 3NH6A 3TTUA 3ZTWA 4BTEA 4F5DA 3EDMA 3FMVA 2FQ1A 2WG0A 4GD3Q 4GQAA 3O8CA 1XRPA 4F3NA 1U8XX 1JW9B 1M5TA 3FPSA 1SCAA 5DOZA 5KYNA 3FYCA 1EIZA 3V7FA 2G7ZA 4YREA 5BSUA 1Y6QA 2ATEA 4OI1A 4HTFA 3EVZA 3F8SA 4L76A 1TYEB 2WZBA 1P0PA 3EGIA 1W5TA 3UPDA 1H2AS 1L4YA 2J9RA 2OA0A 3CZ4A 3P0JA 2DLCX 4LMAA 2DFNA 3BL6A 2ZZMA 2XWBF 4TS1A 2I4IA 1G55A 2TS1A 2ZUCA 4OJNA 1PZMA 3BMOB 2IHJA 4N0QA 2YRWA 4NPHA 3AHGA 1K3UB 2H16A 1P1KA 4L78A 2PX6A 3S0JA 1U8TA 1A9TA 2CFIA 3O3NB 4G67A 3EIOA 4JVLA 4L57A 4PGGA 3PNYA 5DNVA 5LUAA 4YAKA 5CLGA 3MXTA 1HLDA 1Y9ZA 3PP8A 4H18A 2YV3A 2PVPA 4JA0A 2PV7A 2Z9BA 4FE3A 4B74A 2PQ0A 1GRVA 2YQ5A 2QSJA 2CNWD 1NXXA 1Q17A 3CRRA 2ILTA 2NM0A 1UBMS 2EHJA 2WJIA 5LYJB 1XCOA 2RGRA 3JQAA 1H0RA 3W3ZB 4AJOA 2ZQYA 4X3PA 9GPBA 1OWPA 5CM8B 2HTFA 4UTZA 1WV0A 4YUWA 5A5EA 4KPYA 3L8FA 1ZOSA 4KAFA 3VYUB 5JNTA 2OFOA 3IV9A 1N2OA 3FW1A 5EZYF 3NXKA 4D9CA 3G0OA 2J4CA 3ESRA 1Z3IX 3LC7O 1F60A 1W46A 2B4AA 4WFIA 4C0XA 4CL0A 4MUBA 5J2UB 1WP4A 1Q92A 4NYIR 4OHCA 1E0KA 3CF4G 3O8QA 4G5GA 1ZN7A 2IXAA 1KAGA 1VSVA 2ZAYA 4JHXA 1DEXA 2C3OA 3OT4A 1Y9EA 2J30A 4LPSA 4M9QA 1O9GA 4DTIA 1DIOB 1IFXA 2XY4A 2YINC 3H2IA 3R1IA 4IFIA 5DTIA 1MZVA 2XMZA 1Q12A 3U3XA 4L5CA 1LVGA 3G9UA 1Z5VA 2PRSA 4RVFA 2BEWA 5EN4A 1T2UA 1HQYE 4DLRA 3VA7A 1O4WA 4HNAA 2ZWVA 4D99A 1E61A 5GV8A 2GZSA 3DEHA 2ZR9A 1BMQA 4ME6A 4K2AA 3T5MA 2AC7A 5FA5A 4URYR 1TJ4A 4ENPA 2EJBA 1NVGA 2VDNB 2GKGA 1B8VA 4KITB 4EO7A 5AVYA 1ZOLA 2O48X 1BW9B 1P2DA 5LIPA 2G82A 3OY7A 4RA9B 3T5GA 3KU1A 3HJAA 4LQLA 3AM1A 1NVAA 1XAIA 5FADA 3G88A 3K05A 4S1NA 4BNVA 2YC2C 3DMDA 4DIMA 3FOWA 3AP3A 1RHJA 4QOGA 3UYKA 3PC8A 3R3XA 1ZRMA 1HDOA 2FR1A 1MFPA 3E3NA 3MUNA 4AURA 4RTKA 4RJKA 4DQDA 1K2VN 2JD1A 2PYDA 5JJIA 4JI6B 3ASYA 5EXTA 1LI4A 2HQBA 2EKBA 1AUPA 2GM3A 1SVOA 1AXRA 2I80A 3T5CA 1AUVA 5BPHA 1HFWA 1IDOA 4AIIA 4J7AA 4WCFA 5JD3A 4PXYA 1GU0A 3UJ7A 5IAKA 4ZJYA 5HYVA 5H1YA 4ZU3A 4ND2A 2ZAMA 4IUDS 1JHOA 3FLEA 3K1AA 2ZI4A 2Z9CA 1RKUA 4LRWA 2HRCA 2QZ9A 4DBLC 3KFVA 1K06A 3OTIA 1U9IA 2JVJA 3E03A 4IDDA 2AZDA 5IYZF 1J56A 3BHIA 4Q4AB 3OKPA 2NW6A 4W8HA 4XKJA 3RFXA 4EQZA 2E5WA 4F38A 3GDGA 2OAGA 3OEHD 1HQDA 1T1SA 1K7YA 4DUPA 2OCLA 4KODA 4CXMA 1UP4A 2Z8YM 4GLOA 2SCUA 3B38A 3BD8A 4ZP1A 1KJ8A 4WINA 3C1TA 4Z0PA 1BH6A 4LVCA 1P77A 4H1HA 1SUCA 5IU6A 2IHTA 3OPYA 1TI7A 4WADA 3S70A 2FEXA 4Y67A 1UC5B 2AYXA 2Y1WA 1O58A 1E3WA 2AXPA 3GRZA 2J9FA 3BD6A 3NQ41 4GPTA 2Q1UA 3U7JA 4CMIA 3G9ZA 1JH9A 4B3TB 2JFFA 4HRXA 2N1BA 5E3HA 3G8BA 3DL2A 2P7IA 5K0GA 4K9OA 2X0RA 3WIVA 5CHEA 2FPMA 1FF9A 4BQEA 2WA1A 5BORA 2VH5R 1VJ1A 3NW9A 4M0PA 5KUTA 5ADUS 4P0PB 2QN6A 1FP4A 3KFLA 1QG0A 3FGZA 3NHYA 3L7BA 3HWWA 2QUIA 1KEWA 4IKEA 3DL7A 1T4MA 1KARA 4JGIA 4E70A 5IXSA 2P9FA 4HX5A 2NVUB 2ZE7A 1JB1A 1RWWA 1Z06A 1KK2A 1W9MA 5AKYA 5G0SA 5FBRB 3TI9A 1WDMA 3G2OA 4FFMA 3T1QA 3AQ4A 4QJ4A 4W6QA 4WJKB 3MTGA 1YO6A 1G17A 4J0IA 4A16A 3OE5A 5CAEB 3CQ9A 1XQXA 4C0LA 4DXDA 4Q7JB 4QSHA 5KTMA 4KRFA 3NTXA 1SXJE 2H48A 4OHVA 1XZQA 5C8XA 2LDBA 2JFHA 4H3KB 4P0TA 1JHVA 1JLKA 1L4MA 2L17A 4I0WB 4CV1A 3R9XA 5BWLA 3G0DA 2P3SA 4F72A 1SPXA 1ZK3A 3GRPA 1CUUA 2Y0PA 4TWJA 3CLSD 4MLZA 1RXVA 1V7QA 1YHNA 1ZZEA 4GOJA 5KTRA 1TECE 4P7BA 2A1TS 2OGUA 2JD0A 1Q1GA 1UKCA 2PD3A 3AP1A 1PFGA 1RYZA 3LOPA 3O4HA 3DULA 4V3BA 2GJKA 4F21A 2RB4A 1DAEA 2XMDA 2YIVX 2X4LA 4Z9FA 5EEGA 1Z28A 1U0GA 2HA7A 3C70A 4N8DA 3IAS1 5GGYA 1XKXA 2WINI 3E53A 4YWJA 1MRNA 1XJCA 1KO5A 1Z83A 2REQA 2VRWA 3NHPA 1LPPA 1TQHA 2OBNA 1PR3A 3AU9A 3NM5A 1REQA 2YZKA 5EE0A 3B6IA 4L8FA 2PT9A 2DUWA 4BN5A 4CHTA 2VRNA 3B53X 2HRDA 1N7HA 1ZIXA 3LT5A 4FFLA 3LZDA 4QG3A 1GT6A 1NI4A 1K08A 3WG9A 3Q1LA 2BJVA 4O59O 1S2GA 2WG1A 5CGZA 4BZQA 1OPXA 5KNLA 4JEMA 1VOTA 1WD7A 5FYDA 3L79A 4AY3A 5BW5A 1E6EA 1S7GA 2Q2WA 1RQPA 1HYGA 4D9EA 3TIIA 2P9ZA 2DECA 2QD2A 5ERXA 5CW2A 3FI9A 4H6VA 3O31A 4C0WA 5KC9A 5B2ZA 4RZXA 4YN3A 4YI3A 3JD4A 3U3ZA 1YIDA 3I5XA 3G2KA 1ONNA 4DM7A 2JDIA 2EARA 4JLNA 1FQJA 2D0OB 3QYAA 5ANRB 4F6LA 1Y8QB 1XVLA 3KPWA 2BHTA 4Q24A 4WCDA 1OC2A 3U48A 1QS0B 2VYVD 4IXNA 4PAOA 3RARA 4ZO4A 4MHOA 1JEAA 5G0TA 3WQRA 4GECA 3G2MA 2VJMA 2XX3A 2WYUA 4KVZA 1CF4A 3AFGA 1K6XA 5FRDA 4CQLB 1HH4A 5FR1A 4CGYA 2SKCA 4INAA 4IR7A 1SHTX 4DRZA 2JI4A 5K0SA 2JFBA 5IUKC 4DLPA 1E9FA 4YMWA 1CS0B 1CX9B 1CDDA 2EEPA 3NKVA 5JLAA 4DWJA 4ZGBA 5EJFA 2FPPB 4BZZA 3UMBA 1GQFA 1RYYA 1U3DA 4ZAGA 1W6RA 2OUIA 5CB8A 1NMQA 1E0AA 2R3SA 4LTDA 1G21A 3RGGA 3THOA 3L7KA 3TNLA 3ENNA 4EQ6A 2FMIA 3EH1A 2PFKA 2Y0DA 4R8MA 4MW6A 5TS2A 2P2LA 2AN9A 5DHQA 5JSZA 1HT3A 2QAGA 3LY7A 3MCWA 2DHEA 4OKNA 3D7SA 3T1YB 4BB9A 5JNSA 4V0ME 1RS0A 1FDIA 1AUQA 2GRJA 4OVKA 4WLOA 5CT6A 4B3XA 4CTJA 3K2QA 1KYQA 2AOWA 2XOKD 1DDIA 3L05A 1YA6A 3BZBA 5C31A 2JLVA 1E2BA 3F5MA 1PR2A 5LB4A 3T7IA 2OFFA 3VBCA 2B3DA 2H1CA 3MBIA 3AFOA 2QA5A 3SQLA 5BUCA 1KF0A 2ORWA 2ZBDA 4OBXA 2YW2A 4IDNA 1XXHB 2WF5A 3ND9A 5G4KA 4CQMD 4LV8B 4TL6A 4CUZA 2HK6A 4DJJA 4DMFA 2AFHE 3X2EA 3DD1A 4BPRA 1N92A 3K7EA 4HDQB 3ZLBA 3NYWA 2GZRA 4JEUA 5DYNA 1U7XA 5BVGA 5KJFA 3HLTA 3SEQA 2IW3A 3CNQS 1QYDA 2ONZA 1NBIA 1W2WB 2O2XA 4FDUA 3GBPA 4I5DA 4F7DA 2Q5HA 2K7FA 3L43A 1MAAA 2DFPA 2FOLA 5GONF 1P5ZB 2D2EA 5DZSA 4KDCA 1ACJA 2FW1A 4EYEA 1D1PA 2XWSA 4JQOA 4WJLA 3BE8A 3EZ9A 2UVDA 4K87A 4MYSA 2P6NA 1CR2A 2A84A 3SQXA 2XCQA 5C9ZA 4XWWA 3O94A 1GGMA 4YPVA 5KEIA 2EKPA 3T7JA 3KYCB 3SNKA 2BMJA 2QUHA 3I9JA 3MGAA 1L9KA 4B82A 1QZZA 4QUHA 1CKEA 4I9UA 2AXNA 1KNQA 1NWHA 1QV9A 2FFRA 4M7RA 5D87A 2MR6A 2FG6C 3ZU3A 4UOEA 2JHFA 3JXEA 4YAFA 2XOXA 3TE6A 4D79A 4LHVA 3ZK9A 1WBJB 4FMCB 4X60A 4UQLA 1JHQA 1BDIA 2QYSA 1I10A 4UNIA 2PMEA 5FWNA 1IMOA 5JEEA 2JFWA 2GGSA 2P3QA 1GZUA 2C1ZA 4JYAB 4HLCA 4EY3A 5DE3A 4ZWNA 1EM8B 1P9RA 1U1IA 1EVIA 2PQ2A 3HCWA 5DK6A 4BFUA 2YY6A 3PQ6A 3HWSA 1Y5RA 4BNKA 1NUQA 4FB4A 5AKKA 2O1SA 4NCAA 5EUMA 4XJXA 1XD2B 2JJYA 3VR2A 2PZLA 2D06A 3ORHA 3HI6A 3NPAA 1T8WA 1UAGA 4MB0A 2ISCA 1YRAA 1NU6A 3DAOA 1Q7BA 5D3ZA 4E21A 4ND6A 5B6JA 1FNDA 2J3LA 1M0WA 2V59A 3HN2A 3P26A 1D2CA 1ZP6A 3AGPA 4WXEA 1LC3A 4X62B 2UDPA 4X1YB 1N1EA 2YOHA 4R9NA 1Z4NA 3CZAA 3CUWA 3W2GA 4F5WA 2F59A 2TYSB 1USWA 3AF1A 2I6QA 1K8XB 3W9UA 1T6NA 1EVQA 1UXHA 1Z25A 3FPAA 4NFYA 1U8EA 4Q3AA 4YHBA 3E5RA 3SJCA 3FOZA 3STWA 1ULAA 1L5SA 3ZTYA 3BBPA 1U04A 2QDKA 1Z6AA 3PT9A 1N75A 4EF5A 2IEGA 2REOA 4DA4A 2X19A 3WBBA 4BFWA 1U8UA 3ZV5A 1EVLA 3E9RA 2Q6TA 1V37A 1PAUA 1VLHA 4ZN6A 1M2VA 3H2KA 2DR3A 3WISA 1NVMB 1D2HA 1E9DA 4GYKA 1JR3A 5IJ9B 4QYIB 4X54A 2M6RA 5GPBA 4YCNA 2OLEA 1OH7A 3FPLA 4EKNB 3MIIA 4TM7A 1BMFD 2J3IA 1QWSA 4MA5A 5FD8A 2H7VA 1U2RA 1M8GA 1W5SA 4DCTA 1XF9A 5K4GA 4JX9A 2XT0A 4F45A 4KR2A 3D31A 3HJRA 4KPGA 4ROTA 3R7LA 4IMJB 1SCUA 1IK6A 4N7BA 3SY8A 5YASA 1DINA 1RBZA 4Y6LA 1J0XO 4ACAA 5IKMA 3QHPA 2D4HA 3ZIUA 2CV0A 4MQMA 5JMPA 1P18A 1U9CA 3QBJA 2RHGB 4G41A 4MIYA 3DUWA 3KC2A 5J5CA 1X1RA 2OHIA 3MJSA 4IZHA 2VRCD 5COQA 3C6XA 3K70C 2GXAA 5FTKA 1ZK1A 2TMYA 3C7AA 1EFHA 2O0LA 3GN1A 4ZYTA 5IEBA 1QTRA 2CXSA 3QK7A 4HEJA 2R7MA 3IBCA 1ECPA 5K8IA 3EBLA 4Y2GA 1NKTA 1VKOA 2XGMA 1ODSA 1WKVA 3NB0A 4TUYF 4AMZA 1X42A 3LXXA 5CFOA 3JTMA 1D3AA 3GDHA 2IRWA 1YR6A 2Q4BA 2SKDA 4IF6A 4AMUA 4HDRA 3K0AB 4OMUA 1U4SA 2Q3BA 4F4JA 1RHKA 1KYVA 3IP1A 3LK7A 2YWFA 4MRRA 4EF6A 3T7CA 2XRZA 3GCDA 4A6EA 2RHDA 3M6AA 4UPEA 5BNFA 3AEUB 2COEA 3AFMA 4FR5A 4DZRA 3GH1A 1TE2A 3ANYB 5AKEA 5AT1A 5DHAA 3OBBA 4CF7A 2ZJ4A 4LBZA 3K20A 4LHZA 1XAJA 3ZWAA 2GFHA 4C03A 2QGZA 1DFGA 4TXHA 2CYCA 4MCHA 4FM9A 2QTAA 4AJPA 2PBRA 2ZSKA 3I05A 2EAUA 2WTMA 2X6TA 2XVMA 1E5TA 1FL9A 4X8OA 3BJIC 5FP0A 3THRA 2XBLA 3HMQA 3DEYX 4E88A 4EATA 3OQMA 1AKTA 3IGFA 3Q0TA 3ZBPA 3HKCA 3JQRA 3WAKA 4I6JA 4I3GA 1VB3A 3KVNA 2HRRA 1R5NA 4IGIA 2XCLA 3ZXYA 4UEWA 3C45A 1DWUA 1AIPA 3R0XA 1WL8A 1N34B 1T2DA 2W6CX 2AI1A 1LCIA 2OCXA 4OOFA 4LZWA 1GNPA 1M2GA 3HNOA 2JIDA 2I6XA 3I32A 1FFGA 2I4TA 3L0ZA 3HZOA 3PFFA 3Q15C 3L07A 4MGEA 4RMIA 4ZCSA 1E6WA 2EL9A 3O4GA 4GHWA 3IXMA 5EJEA 3TLBA 1TYZA 5HJ7A 1J99A 3EEQA 2ZIGA 5TMBA 1N6IA 1Z12A 3GRYA 5CG2A 5LP6F 3D2BA 4MYHA 1W9HA 4EFLA 2MYPA 1RPTA 2AFHB 2CJWA 2CUNA 4KPEC 1OLSA 5CFNA 3R20A 4UNRA 2QT1A 4R54A 3M5DA 4DV2B 1EK1A 5G3YA 1FDWA 1PSDA 4JB3A 3FWKA 4Y1FA 3QE2A 3LUFA 5JXIA 1XCMA 4MP6A 1IZ0A 3GEMA 2AEEA 3K0FB 2GPJA 4CCYB 3JPWA 1X92A 2ENUA 3TEFA 4KXNA 5DBFA 2GNAA 1GNTA 1Z22A 4XRGA 2FRDA 4IO0A 4UC0A 3PXXA 1PW7A 3M7IA 1EK5A 4IQ4A 5FXMA 4AU1A 2QLTA 1WXHA 5EI5A 3UVEA 3UFBA 4HTAA 1HNWB 3URMA 3VTKA 3J80A 4TX1A 3H1TA 4Y9SA 5G3ZA 3ICCA 3JW8A 2PT6A 4PF1A 1EBBA 2DBYA 2H4HA 1PT9A 3BFKA 3NYQA 5KOJB 3B1KA 5KCMA 4UNNA 2Q21A 3M49A 2Z0MA 3LY5A 3ZLTA 4BMCA 2XB2A 3LOUA 3FZNA 4YMIA 1P2VA 2J3JA 3JS5A 4YJFB 1R88A 1MIOA 1KEVA 3EGVA 2GBPA 2F3RA 4FUTA 2NUPB 1BGVA 3A6EA 4QARA 3WK5A 1R4ZA 4E22A 4E5NA 1V5GA 3IKMB 3SHOA 3C39A 1C30B 3DFZA 3LT0A 3HACA 4DMCA 1NJ2A 1ICEA 1XHLA 3LZCA 1N57A 3MQFA 2BMAA 4MRNA 1H9CA 2C1XA 1XE3A 2ODQA 2VPPA 3N7AA 5AW2A 3CZRA 4MDFA 3CLVA 5EJ5A 3C16C 1XOIA 4HDNB 3HBNA 5P21A 5I4KA 2QM3A 2VTEA 5E6SA 3V9AA 3GUYA 4UHHA 4Z54A 2IBSA 1QQ5A 2CK3D 1DAPA 3EXEB 1QYCA 2BGIA 3MGKA 2X0DA 1FMJA 1QHGA 1J70A 2ECQA 3A2MA 2JI8A 4QM6A 4AP9A 4HQFA 4UUPA 4B35A 1SQSA 3PJDA 1UOEA 2Y93A 3AESB 3RGWS 3HHPA 1MJFA 2MTBA 4E08A 3GRVA 2MSEB 1G7SA 4ZO9A 3PTZA 2ZUWA 1DUVG 1F6DA 4KFSA 4OG2A 4ZVKA 2IODA 2DWQA 3B12A 1ZM7A 1C1XA 2W6PA 3ITNA 2WHYA 1MJGA 2XDQB 4JLSA 4E3WA 1OHHD 3TAHA 4S1OA 5IJAA 3VC2A 4EAAA 4EHFA 3OIDA 1CZRA 1RHQA 1TEHA 3KL2A 4ONEA 5IVPA 3IR5A 2A6PA 2HCRA 2YXPX 1XTTA 4TWIA 5I51A 1CHDA 1XNQB 3O75A 5F1YA 2PUJA 4FS3A 2WV9A 2GBCA 1LTHR 1ETHA 5I9LA 2ZJ2A 4Q4DA 3ZYZA 1MIHA 1V5IA 4MTCA 1QE5A 4DGSA 5BN5B 1HG1A 1OX6A 2AA3A 2FDXA 2PD4A 4GLLA 4WLEA 3TFWA 2VHEA 1GQYA 2H2DA 1QDLB 1PJZA 4DLVA 3DE7X 2H0QA 3HYSA 4PFQA 1AGNA 4NBSA 4IHKA 1WPRA 5JCXA 5J3JA 4C5CA 3IEPA 1ZN9A 4OGLA 4PIPA 1SU4A 3HUTA 3TSOA 3UK2A 1JT9A 2QX7A 1A69A 3PQFA 2HV9A 1RM3A 4URZR 1IBCA 3LM8A 1IM5A 3N2KB 4RHUA 5DV9A 3RSGA 3TDKA 4AMBA 1FMLA 1S2IA 1XFDA 2XE4A 3Q8WA 5FHQA 4AZSA 4D5GA 1WCWA 2G1PA 5FAXA 5C34B 4TT3A 3RVBA 4QREA 3ZXSA 4Y2UA 4PE5B 2FN8A 2PU5A 2I4MA 1ZJJA 2HC9A 3AKDA 3DT9A 4MZXA 3T3IA 2YIDA 4EY8A 2LIPA 3VPCA 4XDZA 1L7AA 1GRNA 3L5OA 1UPCA 3HU1A 1C4XA 4EMSA 1X86B 4I14A 3COYA 1Z4QA 3O8OA 3F6PA 1BXGA 2KQUA 5FUMA 3F98A 3U1VA 4TWBA 1DKQA 1LLCA 4OXIA 2FF5A 4N8SA 1MA0A 2FHSA 3DM5A 2FEPA 2RD2A 4BNDA 3D81A 4HDMB 4S1PA 2GCNA 5EZYA 3FVRA 4E1VA 4E15A 2Q6KA 3VNRA 2WWWA 3OCJA 4LZLA 3WHIA 1JWBB 1KPHA 3EZYA 2E1RA 3KXDA 4Y6PA 4RPGA 4TMTA 2PZFA 3MD9A 2VL7A 1JU9A 4D4IA 4O2BF 2XTNA 2AI3A 5K8JB 1JQ3A 3E22A 2O2HA 5J2TF 1AK9A 1MN6A 2XUDA 4F1KA 5C37A 4B2IA 4POAA 1F0KA 5DP2A 2E89A 2H4WA 1XVVA 3H8SA 2G1AA 4RD2A 4Y1GA 5DW3A 1HURA 1FVXA 1ZD1A 3L93A 5C18A 3GDOA 2Q3HA 2V7XA 1BDHA 1FFBA 2FMXA 3VU9B 3KWJA 1QDUA 3HB1A 1I1OA 4JJFA 3D4LA 1JR2A 1WCIA 1ENZA 4KXUA 3T3EA 3QMMA 4DARA 5CCDA 3HFSA 4BV2A 1N33B 4GOND 5G41A 1KJWA 5K6AA 3KYBA 1UMCA 1YDHA 4RGYA 3ZUPA 5MF6A 4LPKA 4EX6A 5EJAA 2A58A 1CC1S 1M8KA 5FOSA 2PG3A 2D8AA 2DQSA 3H0KA 4XH9B 2P27A 5FLKA 3WWEA 4YRGA 5B58T 3GJZA 3EC1A 3JVEA 4IJQA 4EJ0A 4FFNA 3TUZC 1PQWA 1B74A 1XD8A 3S1LA 5JC8A 4XOIA 4WNCA 4JJIA 4GPBA 5HMMA 1KY2A 2HT1A 3VOAA 1RXYA 5G1NA 1Y3BE 1VPDA 4TM8A 5EYPA 5AOBA 4X6LA 5E9AA 4ZVNA 3ZHQA 3AFHA 3UAXA 4DF3A 3DLCA 3H7AA 3MJEA 4H0FA 1W5EA 1WSBA 3AF4A 3H19A 3AUTA 3QW4B 4ML3A 4MVJM 4PZLA 3N5KA 3TQQA 4JIMA 3E2MA 1U7UA 1B42A 2O5EA 1DRKA 4NU8X 2NNWB 2PSDA 3R3WA 1GAWA 1OYOA 3OAAA 5K4HA 2QUKA 2YHIA 5KHAA 2FN3A 1OROA 1QGDA 4XDYA 3GFRA 3IUJA 3W04A 4Z9XA 1HPLA 1TLFA 3GNQA 1YB6A 1IY8A 1RCFA 5LWHA 1OXBB 1PR0A 2GEJA 4IJ6A 3ZX4A 2WYWA 1KDTA 4Z1MA 1K3FA 4IKPA 3PQ4A 5IASA 4WZZA 4R2XA 2JBHA 3ZQKA 4KFRA 3TKYA 3TM4A 3KSBC 2XKBA 4I50F 3QYFA 1J1ZA 1Z6QA 3O7WA 1JF8A 4GQBA 5HCIA 4NBWA 3VSCA 4QTUB 1EQUA 5AVXA 3TLJA 4RTNA 1CZHA 2YOGA 4A0GA 2A33A 3FH0A 5BQ3A 4C0SA 4CR7A 3WIDA 3PXEA 1TFUA 1SXJD 4KQFA 1DHRA 4PGFA 3ONWA 4TL8A 4CWAA 1N9ZA 3QXGA 3VKVA 5IJ0A 4KK4A 1K6EA 4FYPA 3BB1A 2ZTMA 4JH0A 5TRTA 3UKJA 1M6VA 5CYGA 3DEFA 2G77B 1IQ0A 3AF5A 5HRAA 3ADPA 4O4LB 2ECPA 4ZOBA 2R8BA 3PHGA 4NBNA 4CKZA 3DCJA 2HIMA 2YJTD 1XTRA 2B92A 5AJWA 4C01A 5T41A 5KVVA 4DNPA 2IH5A 3H2HA 4M8NE 5BQPA 2Z58A 1A9XB 1UXOA 1Q3HA 1V7PC 2BTOA 2IYPA 3WKCA 3RSFA 3GARA 2FOXA 5IULC 1XPUA 2QY6A 4H16A 3Q0IA 4PBSA 3NKLA 3VC3A 4EG4A 1VJCA 1KETA 2NU8B 3PSHA 2F1JA 7AT1A 1Y4UA 1TW3A 1F20A 1Q0HA 1V8ZA 3LUJA 3BMXA 2Z2IA 3LF1A 3VYRB 2PX5A 1I14A 3M1AA 4U1RA 4CM3A 2Y3IA 4YC7A 2J0UA 1KOLA 2A9RA 3IVAA 1M2NA 2H3EA 4K1LA 1PT8A 2NPOA 3U4AA 3RYIA 1Y7PA 2RK4A 2CEKA 2R4TA 5AMXA 2FPOA 3F49S 1E1YA 4O02B 1KVQA 4A6XA 1MT0A 3CKLA 1KI8A 2FQWA 1E9AA 1AQUA 3CS3A 4J2HA 3IEMA 2EZUA 3CCFA 2EYQA 4QPDA 2CXRA 3DE4X 3ICPA 3O38A 2YV2A 1W5FA 2Z8ZA 1VSQA 2PWPA 2RH4A 3ZJYA 3OCUA 1L4GA 5FPKA 1BE8A 2WVJA 3V4ZA 1OKKD 4AWXA 2MDTA 1UWKA 1WMFA 4CLRA 1GNSA 3AG5A 2GLTA 2WT4A 2WU0A 1QE3A 2B9EA 4HWPA 3JAWB 1R6TA 1SQ5A 1LWNA 1YH3A 2R8EA 2VHWA 4Y2HA 2GBLC 2XR1A 3KOMA 1OXKB 1NMEA 2HPHA 2I4OA 3IS3A 5ILQA 3KWLA 3PICA 2FKAA 2VT7A 1V41E 3V8PA 1CJCA 3NHLA 1XTUA 4YCAA 1GZ7A 3RQIA 4AJEA 2XUAA 3P71T 3JZDA 1JEQA 3CW2A 3B6ZA 2QORA 4G84A 4H7IA 3IURA 2C58A 3LUCA 3MA0A 1E3EA 1LDYA 1GADO 1PR6A 1QHHA 1VCHA 2I2WA 4HTFB 4R1UA 5BSGA 3O83A 1EKXA 1KSGA 1IIBA 1PKEA 3URKA 1EFAA 4HYYA 4MPRA 4B17A 1D1SA 1RPZA 1LU9A 1I2CA 1KI2A 1NTOA 3KYDA 5DGIA 3RRMA 3SQWA 2PX3A 1KZ4A 1LQ2A 2EJUA 4RXUA 4W82A 1N2BA 1EGHA 3NHRA 2PZBA 4AWBA 1PJQA 3ILYA 2E0IA 2Q3LA 3Q7RA 3DDUA 1ZCAA 4IDFA 3ED1A 2R62A 3ITDA 1KO7A 1SIBE 4ZU1X 1E1KA 4JT9A 2VHUA 4HFNA 3VI3B 1CDZA 5ER6A 2IPMA 4TLLB 1QSGA 4BO7A 3JZFA 2OO3A 3ZHUA 4ZCTA 4B3HA 5B7QA 4EYOA 3B85A 2D0PB 3NBZC 2VK4A 4BYGA 5JD4A 4AN1A 5BV1A 2VDMB 3VZCA 3AC0A 3C98A 2CXPA 3X1WA 7REQA 3ZGZA 2CXTA 1O6GA 3JQAB 1G9XA 4HJXA 1I4OA 1RJWA 3F9RA 3RC7A 4CTOA 3BIFA 5CH5A 1NI3A 3KSZO 4GX1A 5EFOA 3WJAA 2Q4DA 3N0WA 3IJ5A 4B6FA 5I7OA 4RO0A 2F43A 3ZHVA 1NURA 1UDWA 3LIPA 3PGXA 4L5IA 3QQ5A 2C5FA 3VR3A 1ZJ6A 3FPGA 1EVJA 1JIKA 1SXPA 5F9FA 4KN8A 4X24A 1QLHA 2F1HA 5CLFA 3NV9A 1V1RA 1A97A 1NIPA 1TAHA 2FRXA 2HIGA 3L7CA 3SOZA 2O3UA 1OFVA 2E87A 2JIPA 3O8QB 1TL7C 3MAGA 3IEVA 5H81A 2DY1A 2BFBA 3EIFA 4B6JA 3ZWDA 1I3MA 1FP7A 4JYPA 2WUWE 5BN4A 2VT2A 1U02A 4ZVVA 4ACBA 4DV3B 2BEWB 1OIXA 2V6GA 3BIOA 3K16A 3OEEA 1RTTA 1ZD2P 3P7MA 1XN4A 4HNAB 4L72A 2OBLA 4ZVUA 2B8EA 2YMQA 3GY0A 3DBLA 3QKIA 1JU4A 1PNTA 4FOSA 1Y4ZA 2XVAA 1Q0UA 5I9BA 3ZDYB 5DBHX 4MVJI 1X70A 4PO8A 2DBVO 5JS2A 2VP2A 2GCIA 3RADC 4K6GA 5KKAA 4K9SA 1LLUA 3QVTA 5JEDA 5HNKA 2KSQA 1BD4A 1S2LA 2JATA 3OLVA 2QE7A 4MP8A 2GFIA 1BHQ1 1PBNA 4JJAA 1WU7A 3GCGA 3NHBA 1BTOA 3VJKA 1CR1A 4TRNA 4RTSA 3CZMA 3L4BA 5K1ZA 2GAIA 1DAGA 1TJYA 3A1SA 4JVSB 4D8WA 4F93B 1GVNB 1LBEA 4LWZA 4XJSA 1RAAA 2DWOA 1ONPA 3GGGA 3GI1A 2X86A 2YFYA 1QKIA 3WYCA 5HFJA 1K7SN 1XRRA 2BM8A 2G67A 2WTNA 3LY9A 3R6WA 3UB2A 3HKBA 2Z5LA 1I1HA 1B14A 2FH5B 5KYUA 1WA5A 3EB9A 1T6XA 3FX2A 4WZ6A 3M5PA 3VO8A 1LUAA 1T36B 2V7QD 4UVDA 5AW5A 3ZGXA 3AVXA 3DP7A 1FTYA 3W5VA 2C9BA 3LQ1A 3O82A 3QFRA 4FC7A 3WLSA 4ABYA 4C04A 4RTOA 1GPNA 2H54A 1M8FA 1GYRA 1SBIA 2QR2A 2ZKIA 3U26A 3C87A 1C7FA 1ECFA 3ZJVA 5I3CA 3D4BA 4F5ZA 5TXGA 1U6KA 1JPNA 3BFXA 4EA9A 4Z4GA 4LX0A 1GFIA 3CEMA 1F2VA 3L3BA 1LXCA 3K1AB 2DWUA 4D8YA 4BFVA 1R18A 2QL6A 3UWKA 3ZHSA 3E2PA 1BCSA 1Z0FA 4A36A 2P2DA 1PJ4A 1UBFA 4DPKA 2D7DA 1NXTA 1LWOA 1RRPA 4BKMA 5H3LA 1NOKA 3SJ7A 3DLTA 4PNEA 4FBLA 5TJHA 3RHSA 3MWLA 2XD4A 4X6YA 2SCUB 4BTLA 1J0DA 1VG9B 2ERXA 2HA3A 3MC1A 1SHZA 3A27A 2WUGA 3QITA 3EEBA 1J9ZA 1LK7A 3EPRA 3IDZA 4IQ8A 4K8OA 3TQRA 3VR5D 1U0JA 2VUHB 3GU3A 1V39A 3LWDA 4PAWA 3SF0A 5L53A 3OPYB 1H05A 3L0BA 1OMOA 4MV8A 3CVOA 5CA1F 5A4KA 1PFVA 4W1PA 3G49A 3IDAA 1QPBA 2HQSA 2WAAA 1E3WB 5F12A 1Y3IA 2J9FB 2C4TA 2J9YB 2ZRBA 3N0XA 2D2FA 3OFSA 2RBKA 4FSDA 3DVLA 5AM5A 5LZ2A 3KQYA 5BNTA 4AN0A 2I2DA 1A8SA 1UBTS 4QOSA 5EKDA 5EKSA 3FMIA 2M6LA 1EHYA 4FE7A 3WLHA 4TXLA 1R37A 4TV8F 4YBRA 2J7PD 3VMMA 1WUHS 1RJEA 1FP4B 3ND5A 3E5HA 1IJEA 2C29D 2LCFA 2YJZA 1Z68A 5ILGA 3SFZA 3TKLA 4A1FA 1NZJA 2JLCA 3AFIA 3HA7A 3L92A 3JQ6A 4M46A 5HJ2A 4BGEA 5DM4A 1Y6GA 2OORA 4I46A 3G0BA 3EGWA 3BZWA 4NBVA 3GEGA 1JI0A 2UUCB 4YK7A 3IPRA 3L8YA 3KJXA 2WA2A 2QX8A 4Z4HA 4I5EA 2BKAA 2ZTUA 3O5AA 3B1ZA 3DQPA 5B36A 3I9V6 1ULBA 1F0YA 1CIJA 1E59A 2IYOA 3JQFA 3PDWA 4GH5A 1MW9X 1PD1A 4R68A 2ZRHA 3SQDA 3R9XB 4FOTA 4KQIA 5TVGA 2RC5A 3B1JA 1FDOA 1F4LA 4UNQA 4IDCA 1NONA 3HDTA 1Q1BA 1WXQA 3IV6A 3D0OA 1JHZA 5CIQA 4HC4A 3CR7A 3X3HA 4F2GA 3OM9A 4OQXA 4DCUA 3UMMA 3EG9A 2G9RA 3NT2A 2OYRA 1UK7A 2VHQA 4Q6BA 1RRGA 3MOIA 3TJZA 4BC0A 3QE0A 1JFFA 3OQ1A 4GKVA 2O1WA 3SYTA 5J4VA 1ZH2A 3F3YA 1S96A 3ZU4A 5F3DA 1VBFA 3FWHA 3O73A 4TVBA 2P9QA 3NBXX 4BV8A 4DG9A 1JR3E 4A3SA 1HDZA 3BZUA 4TUYA 1U9ZA 2REQB 3GFSA 4C2TA 4M0UA 1OD6A 1A5TA 3Q2IA 4KRXA 1UC9A 5E9WA 5B55A 1EUQA 3EWAA 2XZLA 5FBVB 3K9QO 3UB3A 1REQB 4TYQA 2VSYA 2AD1A 2H9IA 4RD0A 2JBAA 1E3QA 2WT8A 1D09A 2XZPA 4AP5A 3Q2OA 4H6WA 2RH5A 4CVNA 3P2KA 4HDOB 4YRSA 1NI4B 4QYWA 4DA7A 3UT0A 3PBKA 2FTKE 1CQXA 3DO5A 3KZCA 5HILA 3MOSA 3ECCA 8ATCA 5B1IA 3BFPA 1U3WA 4NFLA 2I29A 2QX9A 2AC4A 3L6RA 2ZATA 3OLZA 4ZI5A 3KQUA 3ZDDA 4D0GA 1YBHA 1KEEA 3CB2A 3UOWA 1YQDA 2VIIA 2F8MA 4HATA 4LTMA 1B1CA 3KXLA 5AK6A 3RUDA 2IHBA 3I52A 1G5HA 4TL9A 4D26A 1TM7E 2N47A 1A71A 3QOFA 4GNKA 1YWGO 3SYLA 2OCKA 4GRAA 4V39A 3JWJA 3IB6A 4U9HS 5FOVA 2ZRFA 2ZJZA 5JS8A 2E4WA 1Z6YA 2L82A 4IEFB 4CMJA 3L0YA 3NTUA 3AUSA 3OF5A 4RM2A 4DR6B 4S2EA 2LUOA 1INLA 1JYFA 1NFQA 3ICWA 3V4FA 1M2FA 2MYNA 4MA4A 5D6OA 1VLZA 1KK3A 1PQUA 1AE1A 5AXAA 1NNSA 1SWWA 2VJMB 3DZBA 2OD7A 2IP1A 3OIWA 2X14A 1IB0A 2J67A 4A91A 1DELA 2G76A 3CRW1 4KE9A 1F2TA 3NVAA 1KYWA 2GPBA 1TK2A 2PJUA 4B8YA 3KJZA 1DG9A 4OM7A 3L7DA 3P2JA 1T9CA 2CVOA 3P9XA 4ZMBA 5BNIA 2VYFA 3C48A 4K81B 5ECWA 3KR0A 2FY8A 2H7YA 1Y34E 5ENVA 2CKDA 4R8SA 3SHQA 3FKSD 4FJ1A 8GPBA 3BE5A 5JNRA 4J0DA 4C88A 5L4SA 1JXMA 5A5DA 2QTFA 1A8QA 1G21B 2BHNA 2O3QA 5KDLA 1EUYA 3ZWPA 2ZW9A 3FUUA 3H9EO 3MG9A 2GCOA 4HAVA 4EQ6B 3GZNA 4UD6A 2AN4A 1NXSA 3QE4A 4CKXA 4W5TA 1NHWA 1GCAA 3NBUA 1A2QA 2QVCA 5D7NA 1ZJWA 4Q7KA 5JSZB 3RTGA 2QAGB 3AY0A 4B3SB 1F8GA 1KBQA 3GHHA 5LB2A 4C22A 2X8AA 1KJIA 3IHTA 4CLXA 1CQWA 5I01A 4D44A 4KMRA 4W1QA 3MTDA 1DL5A 1GY8A 4GS5A 3F4BA 1Z5OA 1AHNA 3IMEA 3PRHA 4UVIA 5FOTA 3TCNA 4DCJA 1UKEA 1V6SA 2ZSBA 1SC6A 3TO5A 5LNK6 4J7CA 2AC2A 1CCWA 2XQKA 5G4KB 4JDPA 2KLHA 1SHKA 1T2NA 1JSXA 2Q2VA 4KQKA 2X8BA 3LDUA 4RHXA 5THQA 1OXVA 5AESA 1V0JA 3A1CA 4ETNA 5BVGB 3QKSA 1OC4A 4TKZA 1RI3A 2ZK7A 3OFVA 5T4FA 5FBZA 4DE5A 1EVEA 2ZYAA 3IQGX 1XRSB 3K8ZA 4UAJA 2EJCA 4OKIA 4E5PA 1ADCA 2D5LA 1U2ZA 4IEIA 3FDIA 4EBBA 3NNNA 3ODPA 1FSZA 1BOOA 2A94A 4YXWA 3RC2A 4Q01A 1PRYA 3RIEA 3WKBA 1GSAA 3QVUA 4C4AA 3OZDA 1R5JA 3I83A 3VR6D 4GX0A 5CR9A 4DDWA 2ZM5A 2P8SA 3HDHA 3NXSA 1CJBA 3CUTA 2PUFA 1CUCA 1MU0A 4J0FA 4ENWA 4N47A 4Y8VA 4YMGA 4TKMA 4FFPA 2IEDA 5ALGA 3U09A 4NARA 4AI6A 3GH3A 3EVDA 4PXAA 4FLMA 3OPXA 1KEPA 2I5PO 2YHUA 3GNTA 5K0BA 4X84A 1UC8A 3PLRA 3DZKA 3R0VA 4BKRA 1OZGA 4GNRA 3L5KA 4YLEA 3GCWA 3KBBA 4MQFA 4GFDA 2P4SA 3LUAA 3V1YA 2W6IA 4NK5A 1MW8X 4A10A 3AVTA 1XRJA 3U4CA 3MLAA 2AV6A 3D6TB 1BOFA 3H0CA 1BG6A 1LK0A 5HRUA 4LYHA 4L0MA 2P62A 4CF6A 4YROA 4JMPA 2CBXA 3I6MA 4ZZ1A 1V95A 5CVCA 3ELUA 3F78A 1C3XA 4AJIA 2SHKA 3G8DA 4FN5A 1ZSYA 2C20A 4XCVA 1WSAA 1XALA 1BHSA 3FWYA 1J21A 1JBKA 2C7PA 4QRDA 3CNEA 4GOMD 3JATA 4NDNE 4MW9A 1ZCFA 5AR1A 4Y1RA 2OGSA 1C1YA 1CUIA 3CF4A 1R6BX 3JYOA 3QU4A 2YH2A 2HA4A 3T4PA 1S89A 4C08A 2IYUA 4CW7A 3AEYA 2RHRA 5T57A 5D84A 1KYTA 2H59A 2RBGA 2WWXA 1XVAA 3B1YA 4QG7A 4QJ3A 1J0BA 3D1JA 5F77A 4EMUA 3ZJ5A 1NQAO 1NBEA 5E1DA 2Q6LA 1YBAA 1Z16A 2XAUA 4DADA 3UW1A 3A8TA 4QAQA 1HF3A 4ND7A 4BP3A 1NP6A 3AVYA 4L5YA 3RJZA 2PCJA 3S2EA 1R8JA 1M2VB 2IS4A 4J3JA 3W5AA 1FTGA 2DJ5A 1FSGA 4AT1A 1IVNA 4LOIA 1GUYA 4XYEA 4YJ2F 2WJYA 3KPUA 5FNVA 1KRWA 3V1KA 1DPGA 1ZG3A 1NVTA 2GYUA 5DMXA 1JSLA 1W25A 1GCUA 5C7LO 1H6BA 2JFOA 1W1WA 2CDAA 3LD9A 3GFFA 5NLLA 1DEHA 2VAMA 2FZEA 4PN3A 1F9EA 3H13A 2GZAA 4RHYA 5DGXA 5AOAA 5SICE 4TLEA 1SCUB 2GXUA 1QQ6A 2JGJA 5C35A 1ABBA 1PZNA 1UQTA 3WXBA 4B32A 1KFCB 2RH8A 3FCXA 4KFTA 3HWRA 4FBMA 2MMGA 1DV2A 4X91A 1Q3KA 2JK1A 2ORIA 3SSAA 5I7SA 4KAJA 3AXSA 4BE4A 3LKZA 5HP4A 1UPTA 4BXOA 4AMYA 2DTEA 2OHGA 1VDMA 2ZI5A 2O05A 2QN1A 3OQHA 3W9SA 4PPQA 2YWJA 4R1TA 1OGIA 1FVHA 3FR7A 4WXPA 2WKRA 2PAAA 3SE7A 4OGFA 1OAOC 2ZREA 4I9FA 2HMTA 1M7GA 5ALPA 1OH6A 1KZ9A 3E9NA 1LLDA 1U5CA 1JJ7A 4MMZB 4ZI3A 4HDRB 4QU8A 1PIWA 2H0AA 2HWUA 3CVJA 2GF0A 2ZBEA 2O0HA 2P1RA 2V6IA 3GG9A 3WVNA 4BOYA 1AXGA 5KCZA 1XIVA 4R2WA 5IAGA 1W1IA 3I1IA 2OG2A 2Q50A 5IMSA 2AGVA 1KL7A 4K3UA 1Q50A 2O3RA 2UVPA 3ZHXA 3ZJ4A 1KXJA 3E0QA 2A3NA 3T3GA 3V6LA 2Z2KA 4G97A 3JWEA 2Z9DA 4HUJA 1PL8A 4NCHA 4ZAFA 5FUXA 3SX2A 4B2YA 2B35A 3CMMA 2K2QB 1FE8A 3WLEA 1POXA 1THTA 5HM8A 3HJGA 2DBZA 1C1DA 2X0JA 5BOSA 3TTSA 2Q2OA 2GN6A 1FZTA 3D6NB 4G85A 3MAAC 1W4ZA 2TMDA 1ZICA 2L69A 4QGHA 1SG9A 3E1KA 1G41A 1ISRA 1RI5A 4M6WA 1DBPA 1EAMA 5AKIA 4A15A 3HKCB 3GT0A 2CSXA 4FFRA 4ZQFA 3LDHA 1G291 1PJSA 3P0HA 3FNEA 1KI1A 3LLUA 4X6UA 1VB5A 2VDKB 1N2SA 3Q3EA 5DLPA 5TEWA 1RC8A 4RX1A 4N3CA 3KETA 1H2FA 2P2GA 3L0PA 4DIBA 4F9EA 3CVXA 4I50A 2C7RA 3OY2A 3EEIA 4JKOA 4RK4A 1YI1A 1QIGA 1H66A 2UZ0A 2YICA 3EYAA 4LY9A 4FZVA 3IKTA 2C7OA 2I8LA 1CP2A 2GZ3A 3KWMA 5BN3A 3CYFA 5C46F 3R24A 2CY0A 3K0KA 3W6ZA 1D7OA 4YCCA 2IQ5A 3ZYCA 3NHMA 3JSAA 1KZGB 1RLIA 2G4LA 2CDBA 1LBSA 3T3OA 1CBUA 2CJWB 3KV1A 2QIOA 2H0RA 2DUJA 3CZQA 1OLSB 1SELA 2RG7A 1GFSA 5EIBC 1J7JA 2NOAA 2VCHA 3NHWA 4J0EA 1G1MA 1I13A 3REQA 3GNSA 4MV0A 4RQAA 5ALZA 3WL3A 3KQNA 5B3AA 3G0IA 1Y48E 1ADFA 5JVDA 3LTNC 2ORED 3KKKA 1PD0A 2AF3C 4PW0A 3I6YA 5KAMA 1L8LA 5AUPB 4AUKA 1E2HA 4CQJA 1Z7EA 3NTRA 2BI7A 2C2GA 2XE6A 3KZVA 4BO4A 2F4VB 5GMOA 4B3BA 2HD4A 5C1OA 2AS0A 1JQEA 3QU9A 3GELA 2O2IA 4JUIA 1PEDA 2HLPA 4H4CA 3ZWXA 1GQSA 2G8NA 1QFSA 2V03A 3CLTD 3PKJA 4MI1A 2W70A 3MN1A 4BRSA 4HVCA 3RUAA 1QBGA 1EXWA 1BHJA 3DL0A 4BO6A 4IIEA 5IVHA 5K0NA 1V9LA 3IDSA 3D2CA 2QTVA 4W9RA 4BCDA 3RS8A 1ISIA 1MIOB 3OOWA 2W6OA 5L45A 1XWFA 3GEPA 1CVRA 5EAIA 3WFJA 2IYXA 4GKKB 2HK8A 3H1GA 2NYUA 2VDPB 4P3PA 3QPAA 2A0FA 4NV1A 4ATNA 4BMYA 3BGIA 1L7QA 4BMNA 2YHBA 3WIEA 1WCXA 4K0KB 2YJ6A 4JBGA 1H9BA 3HSKA 3ROZA 1J8FA 2R65A 2IA5A 4HLUC 4OIMA 4UBMA 5AJTA 3Q3IA 5CW1A 5E6SB 2OFXA 3E9YA 2ZLBA 3IAM6 3IKLA 1E60A 5DWVA 4PM4A 1YR9A 1LK5A 2VDOB 3CEPB 2AWOA 3GEEA 1ZO8A 3QBEA 3KXIA 4GE0A 2Y1EA 4NBLA 6ADHA 1GYPA 4I36A 4JGGA 1XMQB 1WBBA 5REQA 1IUNA 1UXIA 4YGXB 3AM3A 1EDOA 1XZEA 1F17A 3CEJA 3C3PA 2QYHA 2WUEA 3PKZA 1AZTA 2GJ9A 1T3ZA 2PY6A 3MCZA 1PG2A 3FZGA 4RF2A 4WJZA 1C1XB 3SLRA 3WGVA 3TQTA 1SQ6A 2C5BA 3EW7A 3PHIA 2WABA 1D03A 1GNLA 1SBNE 2GN9A 1EB8A 1Q0RA 2YWEA 4HSEA 3CNNA 2H51A 5D00A 3T9DA 3N05A 1OZFA 2O7QA 3Q7IA 4FGKA 4DCNA 2O8FA 4QXAA 1V8OA 5LD2C 1UDRA 2JGRA 3RKRA 4QOHA 1OWLA 4QU0A 4H27A 3MEQA 1KFJB 4EVIA 2E49A 3NHJA 1Z35A 3RRXA 3ABSB 1Q0TA 3SZMA 4ER0A 5TEVA 2IXDA 3RVRA 4LE0A 4JGBA 3ANLA 4N5NA 5H02A 1P75A 2ZSIA 3VUFA 4F7WA 1FSPA 2JDID 3OJWA 3S8YA 3QVWA 1EFLA 2ASVA 4ER5A 4CLEA 1CJMA 4GC9A 5EPEA 3MW8A 1KAMA 2VATA 3HDQA 1FS5A 4BO5A 4YAUA 4L0QA 1CRLA 3B1FA 3HP1A 3RWMB 4ISBA 1SCBA 3X1KA 1IJKA 2BVNA 1Y7IA 1JAHA 4FT2A 2J32A 4Q3DA 4AMGA 8AT1A 3IQXA 1V43A 4DA8A 1FDVA 4DJFC 1EBUA 1Z62A 2QY9A 3I01A 3OZEA 4E0BA 1W59A 2ZB2A 3MWYW 4KFUA 4TROA 2G80A 3ZWWA 2A2ZA 3U49A 3OF3A 1GZSA 1N6HA 2XRFA 3ZHCA 4CTMA 1X7ZA 4Q05A 1ISFA 1NR7A 2VPYA 1G4AE 1NC3A 2VKQA 3O8OB 1BXGB 3ZCSA 3G8YA 3MS7A 1N4DA 2W8BA 2E4YA 4PRLA 2D6FA 4GYYA 2VJYA 1Z37A 1A2KC 1D4AA 1PJ8A 1XF1A 2I78A 4O4JA 2BGRA 2C31A 5AVRA 2V9ZA 2WT9A 4MICA 4BNDB 3C43A 4RCVA 2D74A 4WLVA 1VCNA 5EZYB 3M6WA 5LBTA 1Z4KA 1CSEE 3PWTA 4YFVA 2P90A 1P4JA 1AGPA 3E9ZA 5F23A 1EFUA 4RVDA 4X1KA 1IY9A 3D9QX 1NUHA 3D6FA 4LMRA 1A9SA 5AI0A 1ZYUA 1U0FA 2QQFA 4LGCA 3UUEA 2PGDA 3GXBA 4U6NA 3RRZA 3NUZA 2B20A 4PLWA 2C9DA 3UN1A 2V9PA 3E22B 1UJ4A 4RIFA 1QRDA 5CX1A 3K0CA 1I3KA 1FS6A 3UKOA 1G60A 2OCBA 1Z7BA 1WCYA 2MSWA 1XKQA 2IE0A 2N9UA 5LZ5A 3B13B 2PGOA 3O92A 4Z4EA 4D4LA 2EP8A 1FU4A 4NYJQ 2Z4TA 2TMKA 1XB2A 1G42A 5CDFA 1U0TA 2OV2A 3MTBA 3O4RA 2GPYA 1I4TD 4ETIA 3VU0A 1T2EA 1WCIB 1F1BA 2XQFA 4PS0A 5AJYA 2OVFA 3BUSA 1F3OA 3UBTA 1IBRA 3RBZA 1AGYA 1UMCB 4REMA 4Y9TA 1JSZA 2QL7A 5GZ6A 1UPXA 2GTHA 4G23A 1W85A 2WMDA 4UU0A 5JNUA 3TW8A 3AM4A 3RM3A 1BXRB 3VR4A 3VM6A 2EFCB 5EWLA 1CK4A 3BEOA 2IZ5A 2XQGA 3D7NA 4H1TA 4B81A 1GV0A 5DCWA 4LGYA 4Y2VA 2JLQA 4AMVA 2PS3A 2VF5X 3JAKA 4X71A 5F3WB 1OGJA 5EYPB 3DW3X 4GL4A 2HLNA 1SVWA 4AF7A 1Z7WA 5ALNA 5T67A 1NVDA 3BCSA 3R3VA 3AX6A 4KN5A 4E2ZA 1A04A 2FX2A 2WPDA 3C3EA 3QFHA 4AKHA 4FEGA 3OZCA 2Q7DA 3BJZA 4QBGB 2AQHA 2XNCA 4H0CA 3VUEA 4B6QA 4XD2A 3EZNA 2EXXA 1ZKMA 5C4IA 3ID6C 5B1YA 1MG0A 4OSEA 1AF4A 1I7QB 3OJCA 3DAYA 5KTOA 1G5IA 2JCXA 3LV8A 5CJJA 2XUQA 1ELOA 3GJ0A 4X5OA 3DONA 3M2PA 3VVMA 2DH6A 2BV3A 2V1XA 4DSAA 4O6VA 3EXIA 5ES3A 2EGUA 3UOGA 1AS3A 1U7OA 4AKSA 3GPLA 6PFKA 3TRDA 2WTBA 3NVKI 2P6MA 1SH7A 4HEA6 3TRHA 1GTRA 5H3HA 3EYWA 3HMKA 3NG1A 3QSYA 3CRMA 1Z45A 1HDYA 4XUGB 2AG6A 5D7BA 1O4VA 3OHSX 1JALA 1HTTA 4Y18A 4HVTA 1K68A 1W76A 1IQUA 2PS9A 2PGNA 4IKOA 3U4MA 2XT6A 1P5HA 5AJUA 2F3TA 4LJ8A 621PA 4M8SA 1Z5PA 1CP3A 1E4EA 4LNUA 4BQFA 3A6ZA 3G2HA 3QXSA 3EA5A 3EZGA 3S28A 5BQ5A 1JMYA 1T2AA 1N2HA 3KALA 5CA1A 1MH9A 3E84A 1WB5A 3EGXA 3V4RA 1E9CA 1M6VB 2ZULA 2QJRA 2ZYWX 1JEJA 1FX1A 2HT6A 2J3KA 1RWMA 4HZGA 1VL8A 3OO1A 1ZC4A 4AQYB 2H85A 2Y0CA 3O21A 5ICFA 3ZWKA 2LTAA 5EHZA 2PJRA 5C8YF 3B48A 3LGAA 2C9MA 2P75A 2NYAA 3F4LA 2Y0BA 1NC1A 1R3DA 2C92A 3KKOA 1JN0A 1JR3D 2A3RA 1R1DA 2VZ9A 3MTJA 1C41A 3Q0EA 4TZKA 3MTEA 4UQOA 2B4YA 4RQBA 2OECA 3T3DA 4CM6A 3FOFC 4L73A 3AERA 3A3OA 3C8ZA 3CHYA 3GRFA 4XI9A 2FWRA 2OV3A 4ZT5A 1RLTA 3SC3A 2X9GA 4IQFA 5LZ4A 2JKYA 2HL6A 3T5TA 1L1QA 1VG8A 2L19A 3S5JA 3OIUA 2WI8A 1YV9A 3COZA 3AV3A 4BNFA 1ZRSA 1UBJS 2J0UB 2OVBA 1ZH8A 3GFVA 2UXDB 4HQ0A 5EXSA 4HZIA 4KW7A 3C7CB 3K31A 3RYIB 4PCUA 4JBWA 2NSDA 3TX2A 3E3OA 3LQKA 4NR0A 3AEQB 2EKLA 3MCUA 3Q2KA 1ZGJA 4WOKA 1W87A 1P7PA 1XK6A 4MI6A 4WNAA 3WL6A 4OQLA 4TLBA 5ALDA 3U4IA 3SBXA 2BGJA 3G79A 5BV8A 4G1CA 3VGPA 2IDMA 4LFCB 2WE8A 2OHHA 5ALMA 1G7TA 1P0MA 2AWNA 3AKYA 3HUDA 1RE1A 9ABPA 3L4KA 5F98A 4L9RA 3QFTA 5CLLA 4CLRB 4WA8A 4OOEA 4P93A 4BVLA 3JR3A 1P5JA 1QHIA 1VTKA 1TJ3A 2CF6A 4KZKA 4B43A 4MVJF 3HM9A 2VP5A 3D6VA 2CN1A 4YI5A 3QEKA 2QRMA 2ESRA 4G4JA 1JQ5A 2VYCA 3K9FC 3LX4A 4ARBA 4JENA 4DIKA 1AGXA 1ZN8A 2ZRPA 2G36A 3AI3A 3E35A 3FGPA 4RQTA 1N3YA 1JWLA 1XCPA 1KNXA 2YJ4A 1JTEA 4ZOCA 1S6YA 2QMOA 1SG0A 3DTYA 3ABZA 3WHLA 3ZDEA 4EITA 1PHPA 1BFDA 1JEQB 2NTYC 3B8EA 1DOAA 1H3FA 4CN9A 2BF4A 2C3YA 3LCRA 4Q3KA 1NNI1 1L3BA 2CL6X 3A4LA 3ANSA 1QHHB 4OXXA 1GTL1 2X0EA 2CHGA 1GIAA 5JS6A 3RG2A 2QIPA 2Z5FA 2HYIC 1HK7A 1DCMA 2LBPA 3KYDB 1IUOA 3A10A 4V03A 3OU2A 4UASA 1ACMA 1Z2DA 2IXEA 2YXLA 4EGJA 5CEFA 2QAJA 1F0PA 1CUYA 3C2QA 2ZYRA 1SKUA 3FYUA 3FTEA 4N7RA 2WYIA 1HT2E 3TGWA 3A36A 3OESA 4K9KA 4EDFA 1YAJA 2BFNA 4KNYA 1WS6A 4DKXA 3ASZA 4MX8A 3KJIA 1SOMA 3M82A 4MUMA 3VHQA 1GTMA 5F7XA 3AO0B 1VIAA 3A37A 4JB2A 2AKYA 3ML1A 3RYFA 1I4WA 5CVDA 2VJCA 2IZ1A 4ARSA 1YU9A 1PK7A 4QODA 3N0RA 5KYYA 2ID9A 2CHUA 3TX6A 1GLVA 3QJGA 2NSHA 1Y9JA 4NBRA 3WDMA 3HXOA 2P65A 2JCVA 3IUYA 3N8NA 4XFDA 4I1OA 1PUJA 7REQB 2IOYA 3BJEA 4AYXA 1PI3A 3ZNNA 3WX0A 1VSUA 1EVYA 5JYBA 2F43B 1DC4A 3C15C 4JLAA 2O8NA 4R1NA 1FP2A 1FFWA 1HTBA 3AR2A 2QXTA 4KL8S 4E30A 3U7FB 2BGNA 3UK1A 1T5LA 1V1RB 2XKJE 3M4ZA 1EX9A 2Z6UA 1VMDA 2R5NA 1LBHA 3UXHA 1EK2A 3MRSA 2F9LA 4X45A 1DO8A 2PD6A 4HJRA 1OBCA 4ENUA 2QTNA 1II8A 4FGLA 5KSWB 3ANXA 1DWPA 2BFBB 1V25A 1V9CA 1WW8A 5K2MA 4H17A 3DFMA 1Y4SA 3ZCTA 2BR4A 4RGQA 1N9KA 3FIUA 4K6CA 5BN4B 3EXG2 4MRSA 4EL0A 1NOIA 3MIZA 4PG7A 2YZGA 5JFOA 4KO2S 4RSHA 4U2BA 4UZFA 4M0MA 4Q1DA 3ELWA 2BLNA 3LGSA 3DBLB 3SM9A 3ABQB 3ZC3A 4G0OA 4DLBA 3BT7A 2JGAA 2ZM6B 3J7AC 1AKQA 1HDRA 1FNNA 3Q5GA 3F90A 4Q12A 5H9WA 3HY3A 3FJOA 3I5UA 4D97A 4EY5A 4NMMA 4D6PA 4RV4A 1SXGA 1X1DA 3OM8A 1YB4A 1S2DA 3ELYA 2F17A 2I87A 2HRBA 2V7EA 4W9MC 1ORWA 4M49A 4OU5A 4ZEXA 4LSGA 5JO9A 1RZ3A 4IH9A 1AC5A 2TSYB 2HXSA 3U6BA 1G18A 4OQZA 4F4HA 3ZQ6A 3U44A 2GQ0A 3VR1A 3HKBB 3BK7A 1Z47A 4M0LA 4ON9A 5KOIA 3FOCA 1W36B 2V4UA 1XZAA 5KYUB 1L5GB 3NT4A 3TSAA 4H7JA 2YUIA 4KQ2A 4OH1A 4CIAA 4XUEA 1YJCA 3WK9A 1WMEA 2ZCUA 1I80A 2MSNA 3WV5A 3GFGA 1ZL0A 3WBFA 2BKEA 1MG5A 4H7FA 4PHTA 3E4DA 4A8HA 1O87A 3BXGA 2XUIA 3W3AA 5I7VA 2YZMA 3IUNA 2I2AA 2NGRA 4EUNA 5DASA 1ZY2A 3NIDB 3NRJA 4BIMA 4ZTZB 3QX9A 4C2UA 3ZVLA 2WOJA 1JHPA 1MV5A 4RAQA 1R9GA 1U81A 2H5LA 4ZKEA 4IUYA 4LRUA 2XUPA 3SSNA 3UJ9A 1L1FA 1NYRA 4R8RA 3VXKA 4B4KA 1BCSB 2D5CA 2ON6A 2P40A 2Y0EA 4XLTA 3QHAA 3OOJA 2Z4SA 2J0EA 2OFPA 3NHKA 1AS2A 3TLCA 2Q0HA 4CIVA 3CISA 1V5FA 2RGGA 1K89A 2JI6A 3RAGA 5KNCD 4BVKA 1XZLA 5JH7A 1V2GA 4HN2A 3DZDA 2JAXA 3I76A 1AB5A 1DJNA 1YB5A 2XEXA 3KSMA 4MAMA 1XTQA 3DGFC 4YVFA 2CC2A 3VYWA 3VVCA 1ENPA 5IH7A 1KXZA 5B3JA 1JX6A 4MMYB 3T95A 3LO8A 2XMQA 4QM7A 1SOUA 2OHXA 3PS9A 5CJ2A 2XXJA 3TD9A 1R64A 1FOEB 1SRQA 2ZBGA 5AVKA 3IT0A 8ADHA 4QEKA 5BSHA 5FPPA 1MENA 3MNFA 1P1JA 3GT7A 3I9LA 1E2FA 2HJGA 3OIFA 4I55F 4UREA 5IM5A 2WIKA 1GZDA 4UXJA 1D2NA 2VXCA 4WX2B 4M1YA 2RK3A 3I45A 2WTUA 2DM6A 1KPIA 3PFKA 3F2IA 3KJGA 3F5FA 4LYGA 4A5OA 4P4SA 1DKMA 3SF8A 4ARZA 2AEFA 2HNKA 1H1TA 2YASA 3G59A 3LFHA 4W7IA 5K0JA 1F5NA 1SKYE 1M7HA 3LUHA 2IKSA 2QTMA 4YRDA 1Z7YA 4BO8A 4W5JA 2E21A 4LDPA 3M3PA 4TTJA 3ZQUA 4RH3A 4R7GA 1T9BA 3R5XA 5TVKA 4RH0A 3EHEA 5CFRA 3I9MA 4YJ2A 3RH0A 2PH3A 5ITVA 1J07A 2Q5EA 4GZLA 3BWCA 4UCXA 3J81A 3VKWA 2FMUA 3GOHA 1UZLA 1YR1A 3PVZA 1E6CA 3OZIA 2Y76A 1U8AA 3CKYA 3WLIA 1BHO1 1A9ZA 2JEYA 1V1MA 3WGTA 2PKXA 1L8OA 3BRWA 5EL0A 1RWBA 4NHOA 3L82B 2O4CA 3U17A 2VHJA 5IABA 3SZUA 1P19A 1W0JD 2DU8A 1XVTA 1KMIY 2FZWA 3ILXA 1Y1QA 1O96A 1SIOA 1D2MA 3EG9B 4D25A 4XTRA 3SZGA 1OB5A 4AX4A 2JFNA 5EIOA 4AL4A 1X7YA 3Q7EA 1JEYA 4B9AA 1DNPA 1Q2UA 2YV4A 1E2GA 4I8XA 3FMOB 3IX7A 4MVYA 4AKGA 1J8YF 1IHYA 1PQPA 1ZA2A 4QA9A 3GYBA 2V3VA 4NCJA 1P80A 3I9V1 3PHBE 5G2OA 1QGZA 1XAHA 3GNLA 5DEIA 5FA6A 3VSBA 1DDGA 4GX2A 3WC4A 4F3RA 4BJ5A 4W5NA 4H60A 1SXIA 2Q3DA 5D3QA 3ZLJA 1MGPA 2GHRA 3KUUA 5EMKA 1Y1LA 1N5RA 2Y68A 3A6LA 2ZUBA 3PGJA 4DBVO 3FCYA 3HBMA 4EG7A 1I6WA 2H5EA 1YI0A 2HR1A 1PNOA 5B3KA 3ABRB 2JBAB 3QLEA 1KJJA 2PQ6A 4ZOAA 1QONA 3B82A 1TUIA 2FLVA 3FRJA 4D4GA 1XGKA 5ESRA 4Q48A 2WE7A 2EV9A 2C5EA 2Y9MB 3R7DA 4A8JC 4COKA 4AP6A 3H11A 5DWDA 3WHKA 1UWVA 3AY6A 4EA7A 3ZN2A 5FX2A 1KEEB 3TTXA 1A5ZA 3Q7TA 4GMFA 2ETVA 3OAAD 5E4FA 4JLMA 3BCRA 3T4XA 1U28A 1ZEJA 4J1SA 1XQWA 1XRLA 5F5NA 1N8SA 3D3JA 3F8TA 3IHWA 4KIWA 1YXMA 4R83A 3UXMA 1X1EA 1WUYA 2WU4A 1W5AA 1W4BA 4GZMA 1LH0A 4Z1MD 1WXGA 3NO4A 5AVTA 3GJSA 1VI2A 3LX5A 2FFJA 4L3VA 1PWZA 5DN6A 2AMJA 2UUOA 4N01A 4O5OA 1QVVA 1W75A 2QB5A 3CT6A 4Q9NA 3UGJA 5HOQA 1B23P 3AI1A 3C3KA 1KOFA 2C7VA 3KE8A 4E94A 4C76A 5AKXA 4ITVA 3ESXA 3DLIA 5L3RA 3LI2A 5FUYA 1FZQA 1MO6A 2C4WA 3F4KA 1F2TB 2QMUA 3F9CA 3M1LA 3NTQA 5CTAA 3T7AA 2MU1A 3W8EA 2GARA 1E5QA 2BMEA 2J7KA 4EKYA 4L16A 5A4DA 3B1XA 4DUYB 2H08A 4BNXA 1HXHA 1VMKA 2BFDA 4BLQA 5KQLA 5MN5A 1KYXA 5ESXA 4JLUA 2XLCA 4HVAA 1NZFA 4F46A 4BU0A 1NSTA 2E82A 3WKDA 1W93A 1TU4A 2V98A 3NBQA 4GBMA 2Q46A 1QHNA 4IL5A 3ZE8A 1SPBS 2WSBA 3A25A 4ZPXA 1SVNA 2CNBA 2H17A 1XLUA 2QYTA 1VYTA 3DXYA 1HDGO 1WUJS 4XVQA 3WI7A 1WUIS 2GCOB 1VGQA 2ZWOA 1IOZA 1M76A 3BREA 1HMYA 3GZNB 4JMLA 4KGXA 3WO0A 4O29A 3QGMA 4ZYWA 3HB4X 5KNCH 1RQLA 4HGQA 3WLRA 4ZYYA 4NDAA 3HBJA 4PCAA 3CPHA 3EIXA 4U8HA 3RYTC 2QK4A 5BT8A 3HFJA 3SAJA 5IZCA 1ZGCA 3TLXA 5CCBA 4MVCA 1OY1A 4QL3A 1SVMA 3HQ4O 2XYVA 3PE4A 4TTIA 4YQZA 1PGNA 3UMCA 4DDVA 3ZVNA 2F55A 2XYRA 3HSSA 4FPXA 3ULKA 2R6GA 3D4OA 3GW8A 4S2UA 3R5HA 1Y42X 3Q40A 1DAOA 1DC5A 4KXWA 1BJKA 4DRYA 2GDJA 2ZTHA 5AI9A 5A4MS 5ITWA 5JLJA 1SZPA 1LFAA 5CLJA 4I4TF 1H1LA 1B0ZA 1Z15A 1OX5A 3GO4A 3MS2A 1YQWA 1MKYA 3PXUA 4HPJB 3OX4A 1IZ7A 2H1HA 1XI2A 3CE9A 4PANA 3CBGA 3IT3A 4TLCA 3QKSB 4Y2QA 3WGLA 1J5EB 2FN9A 4K6MA 4EYSA 1AXEA 4KVAA 1U1CA 2Q4TA 2PWZA 2WVAA 3BYZA 1H22A 1MUUA 3TNJA 2OXRA 1GG5A 3WOVA 4CIYA 2AR7A 3N2GA 4PPFA 3OECA 1KY5A 3ZQ4A 2PPVA 3N76A 4IIDA 5HXAA 4M4SA 5FUQA 3MS4A 1ZM4A 1DQZA 2QPOA 3FRIA 5LNK1 4OBBA 4QXQA 1HX7A 3BVPA 2AG0A 5LZ7A 4LSWA 5DCLA 4EB8A 1KI4A 3CJQA 5D8DA 3LP5A 4LDAA 1GARA 3E8XA 3O3CA 3BG5A 2OYSA 4M1ZA 1LPOA 4CI0B 3BGDA 4LFAB 2NVOA 1X7XA 4QUBA 3ZDZB 4D5EA 4D9GA 4HX9A 1YULA 4FFBA 2CMKA 4LRXA 4LK3A 4HL6A 5BWBA 5J4YA 1SQGA 1GU7A 1QH0A 2H52A 4NBTA 4TQGA 3BS4A 3E7FA 5TS3A 1KDOA 3VVBA 3O3OB 3LNTA 1JJVA 1UXKA 3A1EA 3WQBA 2IDZA 1MOQA 4HG2A 2HSGA 5LLSA 1TF5A 1P1CA 3VU1A 1JIXA 5LFAA 2CXQA 5JNLA 3TLKA 3BTVA 4IO1A 1QRSA 5DX0A 4YRRA 3NHUA 3WGGA 3ZLUA 1SKYB 1TB4A 1P9NA 1TW2A 2BH9A 1PWXA 4GP9A 4EEZA 2PV0A 3LRXA 1U0NA 1ZC3A 2REBA 4MUXA 4OP3A 1UP7A 3CU5A 3F0TA 5KKCA 2KBFA 2PX2A 2CLEB 3D54D 4U7HA 4UEOA 5HIMA 4KOEC 1QG4A 2EKDA 2DPYA 2AMVA 3JATB 4PLPA 2WNIA 3V48A 3BAFA 2K87A 3LIIA 3IODA 4Y1RB 3S5UA 4C7OA 2WSSD 1KKLA 2XXAA 4JLOA 4NEGA 1G8GA 1L7OA 1NMSA 5TT1A 1Z2OX 3LLSA 3EVCA 5L7WA 5AHKA 2GDZA 3GPCA 1UR5A 2IWHA 3KT8A 3PEWA 1J20A 4YCJA 4EVSA 3J81k 4UBIA 1N2IA 2VP9A 3VNBA 3AVUA 2D54A 2C9OA 1HYEA 1K9SA 2WWIA 5FBHA 2H18A 4G0PA 1RZUA 1ZGHA 5K9ZA 5EZSA 4S1VA 2CL7X 3GG2A 4I8DA 3HDVA 4NZPA 2XB6A 3USZA 2E1PA 4DBLE 3EPJA 1P2SA 4AG5A 1E6KA 4GI1A 3ONEA 1QO9A 2JLXA 3SZRA 1QDEA 1K7EB 2IQIA 4BZWA 3RT1A 2XSZD 3QOYA 3E3AA 5FNVB 4ZPJA 4Q6WA 2XA2A 3NJ8A 2C8LA 5E4JA 3THWA 1XTBA 1RC0A 1YGYA 2VH1A 1K7XB 3HCRA 4KLAA 3KIPA 4L02A 3TQSA 3UUWA 4JX8A 3FSRA 1T2VA 4AJ9A 2IXFA 2P9GA 3ROQA 4BNWA 5JYEA 3OJXA 4P8RA 4HT3B 3HCFA 3QOWA 5C1PA 1BWRA 1OU4A 4IS3A 1FUEA 5ARDA 3L1HA 5SZKB 2EU8A 3LCMA 1YDMA 1BYIA 1SKAA 3DAHA 5TQ2A 5BYJA 1YL7A 1U8CB 4OHUA 3MFQA 4PYKA 4E1BA 5EE1A 3TEMA 3UJ8A 1R4MA 1Z8FA 4Y2TA 1ECLA 1NVFA 2ZJ7A 5DBOA 4Z1OA 3ZXUB 2O8FB 3EX7C 4BXOB 4TPKA 2ZUVA 2H7CA 3I0MA 4IXDA 1JXOA 4BP8A 1PV4A 2FHPA 3KT0A 4EKIA 1B00A 1AKYA 1S01A 2OFWA 9ATCA 1VPWA 3F6YA 3DXZA 3IQWA 1I4DD 1H94A 1K5GA 1O95D 2BD0A 3GP5A 3RFUA 3A4NA 4R1SA 1N0WA 5A9SA 2ONCA 4MLPA 4PRZA 5I6DA 2HFJA 1T0PA 2ZJ8A 2FGKA 1F6BA 1MLDA 4RHCA 4M22A 1V48A 2GVDC 3DDSA 2B4QA 3SX0A 2E3JA 3UAWA 2L2QA 3I61A 3KOXA 3DMFA 4KXMA 2GBLA 1RM4A 1PJLA 2B61A 2UVPB 3I2JA 5DTQA 1DRWA 1MRZA 1PVVA 3AHJA 3ME5A 1C2YA 1CEYA 1GXSA 2Q0SA 4KIUA 4FFWA 1YRHA 3QZUA 2D1TA 2HJHA 4NHEA 5DNEA 1XMXA 4JOBA 3IPAA 1C1DB 5BOSB 3I9FA 1FQKA 1I0IA 5ISMA 3DHYA 3KXKA 4PYLA 1Q5PA 1VKNA 1CQJA 3GMTA 3I58A 3NKFA 1TCCA 2X0NA 4CV2A 1KEKA 2CFOA 3EDCA 4IDBA 4LY3A 1X2EA 4LZZA 4M6WB 1UK8A 4NECA 2AFIA 4YIKA 4AQDA 1C3JA 2YRXA 2HBYA 3WWDA 2XHZA 1FNCA 2CE2X 4HZUA 1K7FB 5IT4A 3MRXA 7MHTA 2IOQA 3B2QA 4K46A 5I9NA 2AX4A 1YZLA 4BX9A 5THKA 1CRQA 1O2DA 1ID1A 1R4NA 2DP4E 1NA5A 2I3DA 3DD5A 3KE9A 1LDGA 3NVMB 1NBME 2XYHA 4I50B 4P4GA 5ALJA 3EVNA 2IWRA 1PNVA 3K1YA 4LDJA 1KMCA 3H6HA 4OQNA 3UJNA 1JHRA 1T9KA 3WV4A 1P4SA 2AR0A 5D86A 3EQ6A 4A23A 1U7PA 1KDPA 2FR0A 2FU5C 2PQMA 5SV2A 4AXBA 5IBQA 4W8OA 4ZCQA 1DEOA 3SFVA 5A62A 2ZSJA 3HEMA 4AXXA 5E2BA 5DW0A 3I2YX 4LXUA 4C6HA 3GIWA 4WAUA 2Y1DA 2FF7A 2FSIA 4L1KA 4NYIQ 1OTHA 4GVPA 3EXAA 4PHFA 2VSXA 1NW5A 3KHSA 1JG1A 3SLGA 4N03A 4FMDF 4FDAA 4F86A 3O26A 5JWRA 4L5AA 3EMKA 3REQB 1F4PA 4Q82A 4R0NA 3UAZA 1LNQA 2JAOA 2OSBA 4E4RA 3RC1A 1M75A 1KGDA 1D6SA 4OJYA 5GY7A 5JVDB 1AH2A 2XB9A 1U9YA 3DXFA 3A11A 3TN7A 3FOEC 2Q49A 1N77A 3FDXA 5FORA 3FB1A 4P5PA 5I9SA 1XBTA 5C8YA 3RLFA 4C21A 4LQCA 5KQMA 1CZNA 2C5GA 3HVIA 1QZ3A 2QQGA 3C3AA 5JROA 1TADA 2XZTA 2ZROA 4QIHA 4D4KA 3NOVA 5F33A 5B4UA 1JPJA 3P96A 3I39X 4M0DA 4DV1B 3CTPA 2AG8A 3Q8KA 5JZOA 4D3FA 2OEPA 4WBNF 3U1BA 1DGQA 2QTVB 3EHDA 3OCVA 1PT6A 3ZK7A 1X1QA 4FR0A 4E7PA 4FGSA 4LY6A 4IXWA 1D7AA 4FNGA 3CF0A 5E2IA 5TQJA 4V0OA 3MHPA 1IXRC 4JQCA 2A5JA 3TVDA 2EW1A 1BC5A 4IGKA 4GKJB 1Y5IA 3VYSB 3FLAA 2R0QC 4YLGA 4HSGA 4UMDA 5CGQB 5DXAA 1AOXA 2W6JD 3L7IA 4PC2A 1GGJA 2GF9A 5C7IO 5K3FA 2YUTA 3W5HA