4E1VA

X-ray structure of the uridine phosphorylase from salmonella typhimurium in complex with 5-fluorouracil at 2.15 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
251
structure length
248
Chain Sequence
KSDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Uridine phosphorylase
publication title X-ray structure of Salmonella typhimurium uridine phosphorylase complexed with 5-fluorouracil and molecular modelling of the complex of 5-fluorouracil with uridine phosphorylase from Vibrio cholerae.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 85
structure length 248
sequence length 251
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2012-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4e1vA00
4GLJA 1A9QA 5CCEA 1T8SA 1ZOSA 3KVRA 4F3KA 1VFNA 3EEIA 5FAKA 4R2WA 4BN0A 5EPUA 3OZDA 1SD2A 1WTAA 3D1VA 4TTAA 2OC4A 3DPSA 3BJEA 1T0UA 1Z5NA 1CG6A 1TGYA 1V2HE 1Y6RA 4TXMA 3LBAA 3PNSA 3GGSA 4RJ2A 1VHWA 1RFGE 1A9PA 2AC7A 4G8JA 5JPCA 4GKAA 4MARA 1TD1A 3EUFA 1Z39A 2I8AA 1Z35A 5B7NA 1PR2A 4QATA 3DDOA 4YMLA 2Q7OE 1JP7A 2A0XA 4TXNA 1RXYA 2AI2A 1PR1A 4PNPA 4WKBA 5EFOA 4DA7A 4GLFA 1B8OA 2QDKA 1U1GA 4L5AA 1JE0A 1LV8A 4I2VA 1N3IA 4NSNA 1ODJA 4TYMA 4U2KA 3FAZA 2HSWA 4D98A 1A9RA 4JP5A 4DAOA 1A9OA 2I4TA 3INYA 1JDUA 1SQ6A 1JPVA 1T8RA 3OCCA 1V4NA 2AI1A 1Y6QA 1TGVA 3KUKA 1VHJA 1A9TA 2HWUA 4QARA 5CYGA 1TCVA 3MB8A 1LVUA 3UAYA 4DANA 1NC3A 3O4VA 1Z38A 4TS3A 4R2XA 5IU6A 3OF3A 3BL6A 3DJFA 1Y1QA 4D8XA 3OZBA 1JDVA 2HN9A 3PHBE 1NW4A 3OZEA 1RT9A 5F76A 5F77A 3K8OE 1JDTA 5ETJA 4R31A 1RXUA 4G89A 2GUWA 4OJTA 5EUBA 3SCZA 3UAXA 3P0EA 5B7PA 5F7XA 1PKEA 3NM6B 4YO8A 3LA8A 4H1TA 5F7OA 4OF4A 1A9SA 4DA6A 4G41A 4MCHA 1V48A 4LZWA 1SD1A 1V3QE 4E1VA 1Z5OA 4DABA 4L0MA 5F73A 1U1CA 3UT6A 1ULAA 3KVYA 1JDSA 4IP0A 1NC1A 5CXQA 1OTYA 4KN5A 4P54A 1XE3A 4TXHA 3TL6A 2ON6A 3NM4A 2QSUA 1TCUA 3KVVA 4M3NA 3QPBA 3PHCA 2RJ3A 4F1WA 4WKNA 1CB0A 5CXSA 3C74A 1Y1TA 4L6IA 1YR3A 1U1FA 3BSFA 4EARA 1PK7A 1JE1A 3U40A 3UAWA 1ODLA 1OTXA 4BMYA 1Z37A 2AI3A 4QFBA 1YQUA 4DA0A 4L5CA 3OPVA 1RR6A 1Z33A 5IFKA 3FWPA 1K27A 1Y1RA 3DF9A 1K3FA 5F7ZA 1ODIA 3EMVA 1V41E 1OVGA 3K8QA 1ECPA 1Z5PA 4OGLA 2B94A 1FXUA 1YQQA 3BGSA 2QPLA 3E9ZA 4BMXA 5KB3A 4LNAA 1PWYE 4F2PA 1V45E 2QTGA 4TXJA 5I3CA 1B8NA 1U1EA 4NY1A 1RXSA 1JDZA 4DARA 3NM5A 4WKOA 1T8YA 4LDNA 3OOEA 3F8WA 5F78A 4OEHA 1VMKA 5CCDA 1T8WA 5DK6A 3KU4A 1RSZA 4DA8A 4QEZA 5F7JA 5C80A 4OGKA 4UC0A 2OECA 3ODGA 4YNBA 4F3CA 4NS1A 3O6VA 4TXLA 4OY3A 3IOMA 1PR4A 2H8GA 2A8YA 2HRDA 1OV6A 3P0FA 4FFSA 4MCIA 4TS9A 4WKCA 2A0YA 2OC9A 1QE5A 4QASA 1ULBA 1M73E 4QAQA 2A0WA 4DAEA 3KHSA 4L5YA 3ENZA 1Y1SA 1A69A 1LX7A 4K6OA 1RCTE 1PK9A 1Z34A 5K1ZA 3FUCA 3GB9A 3E9RA 4JOSA 3FB1A 1G2OA 2IQ5A 4X24A 4PR3A 2OXFA 1YBFA 4YJKA 4ECEA 5B7QA 3ONVA 2ISCA 1ZL2A 1PR5A 4LKRA 4F2WA 1I80A 4BMZA 4D9HA 4M7WA 1ODKA 3MMSA 4D8YA 3E0QA 3IEXA 4WKPA 4D8VA 1YRYE 3UAVA 1K9SA 1RXCA 1JYSA 1PR0A 4JWTA 3UAZA 3PNPA 5CYFA 2PGAA 3DP9A 1OU4A 4M1EA 3T94A 1Q1GA 1RYZA 2XRFA 1PW7A 1OUMA 5B7GA 4LNHA 1Z36A 1SJ9A 3OOHA 4GMHA 1C3XA 2QTTA 3EUEA 3LGSA 3NBQA 2P4SA 1PF7E 3FNQA 2BSXA 3OZCA 3FOWA 4EB8A 1PBNA 1U1DA 4TTIA 1PR6A 4TTJA
chains in the Genus database with same CATH superfamily
2O3TA 3F5SA 3HDVA 3KDAA 3P52A 3MRXA 3UK2A 4B6RA 5L3SA 3FNRA 2I91A 3P9NA 1L8LA 3TVYA 4YT8A 1VKOA 2L17A 2WWHA 4G5GA 4MUFA 1XB2A 1C1DA 4WBSA 5KS2A 5A4AA 2CFCA 4GR4A 1H85A 4A03A 3L1VA 2EVWX 4KQ2A 1Z7EA 3F6YA 3HYCA 3T1YB 3E5HA 3L02A 4P93A 4E2WA 3HGMA 4DQVA 5DNDA 4HGNA 2C04A 4XB2A 4B2PA 1XRRA 4JGIA 2C3YA 3MEQA 2QVYX 1WRBA 4V38A 2O8VA 2IBSA 2CD9A 1VPDA 2MMCA 2DUUA 4W9RA 1Z4OA 1FQWA 2A1UB 3ND8A 1FTWA 3PXAA 4ERXA 3HJRA 3X1DA 3I32A 4Z0TA 1E5DA 3J7AC 2Z4TA 4JAVC 4B3GA 1NUPA 3G5UA 2VNHA 3KJIA 4J3JA 1N6LA 5EMNA 5F21A 1U0NA 3PR3A 3FAKA 3KTOA 4RPJA 4BV8A 4JB2A 1UM8A 2ZRLA 5AM4A 1KC1A 3CXUA 1YWGO 3EXFB 3LBAA 2XGMA 3PGXA 4EB0A 4M0EA 4XDHA 8ADHA 1KGDA 4JIGA 1QQAA 1M66A 1G20B 1HFJA 5IZCA 5JXHA 1YVPA 3ZWNA 2RIRA 4YRRA 3PHHA 3U4QA 2R8XA 4PZPA 3IAUA 3HUTA 4CUKA 2E49A 4PLHA 1HKUA 2FPSA 4UM5A 4YXFA 1SOUA 2FUEA 3G79A 2ICAA 4QPNA 2QTVB 1DG9A 5DNUA 1K7YA 3B7PA 1MDFA 1CUAA 2I76A 3EUFA 3O21A 4LF5B 4Z53A 1F6DA 2C98A 5B7NA 1DEKA 1DQZA 5JDCC 1UQUA 1G64A 1BHSA 1VTKA 3KKPA 1Z5UA 3H2ZA 2OCPA 2Q7OE 1QHEA 4O4HB 2V7WA 4QDOA 1IM8A 2PLAA 2WG1A 4AO7A 3L4JA 4KXFB 2DJ5A 1CVLA 1PT7A 3R9XB 5CH5A 4OI1A 4D4JA 5KYYB 1OZHA 3PE4A 3RRNA 1QPGA 1PGOA 2W2LA 2WKSA 5LZ5A 3QVSA 1LSSA 2IYTA 1YBHA 4ZYWA 3DDNA 3QWFA 1DEXA 1HE5A 3EZGA 4FW8A 2Y6VA 5BNWA 1NVEA 2N1BA 3OCXA 1LNQA 2B61A 1XR3A 3CX7A 2VYFA 2NSYA 3DFIA 1O9BA 3GVHA 2ZJ4A 4FDAA 1J99A 4ER7A 1G8SA 3BICA 2AW3A 4GRAA 1N6HA 2MINB 3SEQA 3ZBUA 1HE4A 1Z4JA 1Z74A 1JHUA 2FMFA 3PITA 1Y80A 2WJAA 3O1IC 3KTDA 1IL0A 1PSDA 4JVOA 3RUPA 1GNSA 1QCCA 4JUAA 3HI4A 2J6IA 1A96A 1VSUA 5C1BA 1R0SA 1RQPA 1KWKA 1XUOA 3ELWA 2B21A 3QJ5A 2Z9DA 4JUBA 2C42A 4BNXA 3QVGB 4PAMA 3BGWA 5LCXA 2RGNC 2B5WA 3WRXC 4KWHA 4C05A 1IN7A 4YYEA 2XMBA 3LGAA 3M6AA 1KVRA 4TZKA 1DEHA 1TCVA 3NDIA 3VXKA 3KQSA 3KQKA 3G2HA 3CU5A 1VE5A 1W48A 3QQPA 2ETXA 1UBCA 4EEKA 2GYWA 1SCKA 4LW8A 1G63A 3A9VA 1XQWA 3OEWA 1DXOA 2RHGB 2RGAA 3R23A 4DANA 2FW9A 2XX3A 1MD9A 1YZGA 4HYQA 5H82A 4G2NA 4OHYA 5EZSA 2X14A 4FI3F 2NW6A 4BFCA 3EZLA 4JA2A 3CRRA 4JI7B 2W00A 3IUPA 5CT8A 2ZUVA 4MI3A 3UJ8A 5CA0B 3GLGA 3UHOA 3SQWA 1YNOA 5CH3A 2JARA 1AK2A 3DJFA 4YI5A 5P8WA 3EF1A 3ETHA 1M76A 3HRHA 4OK3A 5A05A 3K0CA 1CE8A 1RMQA 2X42A 3Q3HA 4R8VA 3TECE 3B5EA 4GD3Q 1KQGA 1JBEA 1R4MA 5FV4A 1DOZA 3T5PA 3NATA 2WICA 5FTKA 5JYBA 3HI6A 1RS0A 4BKRA 2P75A 2XCSB 4PX9A 3KPWA 3H97A 1Q7BA 3LP8A 2G63A 2QGNA 2PMCA 2XBLA 1JDTA 5KMGB 3C39A 7ADHA 1OA1A 4IF6A 2QP9X 2W43A 3L1IA 4N5IX 3C87A 3T12A 1MB3A 4R3UC 1O57A 2GM5A 5EXTA 2PSHA 3RTGA 2OZLA 3HJTA 3TN7A 4C1NA 4MPDA 4RJKA 5C4MA 4B32A 1Q0SA 4P33A 2A9RA 1Z88A 5FTWA 2X3YA 4KXWA 1N5OX 5AKEA 2QG9A 4RKYA 5A6SA 1EX9A 2DUWA 1DBRA 3P0IA 4HRAA 1H93A 1Y42X 1CZKA 3TTWA 1E9RA 1QONA 2BEWA 3GJRA 4B4DA 4ZVUA 4EKDA 5FJIA 3OH8A 1CS4C 2HIMA 4HS9A 3ZWQA 2Y9PB 4G5YA 4ZOLB 1JDBB 1R4ZA 1ZG3A 3ESCA 3TLKA 1XZFA 1IMOA 4HVAA 5L7YA 4CCAA 2R8BA 3MAAC 2GM4A 1J0AA 1Q7EA 4EHBA 3T5MA 2RGBA 4L0MA 4Q9HA 4FGKA 5IBPA 3T7TA 3VPDA 1C0PA 1YS7A 3F73A 1QAMA 1NU6A 5ALNA 4FINA 3TZCA 3VZRA 1E3WA 1TVEA 5CVDA 2GDJA 3SEAA 3ESBA 1GKKA 4IQFA 1ZC3A 3H65A 5BV8A 5T8KA 1QYIA 3JY6A 3PKJA 3WL3A 4L4YA 2PV7A 1IN8A 3EGEA 3V9PA 2DU8A 3TSWA 4DLKA 3W3ZB 5HQJA 1XZNA 1PJ3A 3L05A 3ZWXA 4LF4B 3HCFA 4O2RA 1QU2A 1O2DA 3H2GA 2Q07A 1KBOA 2MIIA 1DDOA 1WMDA 1ZVQA 2O4UX 1W0KA 2BEJA 4UHJA 4PEVA 1ENOA 5JO0A 2Y8EA 2Z30A 1GQSA 3GF4A 3I9OA 1KAEA 1XD2B 3F47A 4RFVA 4HR7A 4V0QA 3DFFA 4TL8A 3H04A 2R00C 2Z4SA 5CVCA 1ZINA 1UDBA 4EK9A 4JMLA 3DE5X 3Q7EA 2QIPA 2W6CX 5EE3A 2BEUB 4AX4A 1LK7A 1E1KA 1XXHE 2HZBA 3KUUA 4F5WA 2HYIC 4BIIA 2HQ1A 2HU2A 4KXYA 1XA0A 4TLBA 4Y9RA 4RTQA 3QPAA 4B71A 1YOBA 3BHNA 4XD7D 3BPSA 3DC2A 3PHCA 2NXNA 1DAFA 1FDIA 1MF7A 4F1WA 5EHZA 1FX1A 3V8QA 1S4QA 5JBNA 1ISFA 1NJ2A 3DR5A 4LTNA 1HRKA 2P1ZA 3OZGA 4OXXA 5JDIA 3DV9A 1IK6A 3DTVA 4EBFA 1EGQA 1QFYA 1TA9A 3OMXA 1PEDA 2VH2A 3L5KA 4GVXA 3V7NA 4RMJA 4ZK2A 1E2NA 1Q77A 1UOQA 1LDEA 2XZDA 1N3BA 2D1SA 1TAHA 4P8RA 3RAGA 2HLDA 3RI3A 4DXDA 3OQOA 4Y2SA 1WSAA 2GN2A 2G67A 2ODTX 2TMGA 3T3EA 2V98A 1X8KA 5LBTA 4PWZA 3VNRA 4Y2RA 1PHPA 2G5CA 5JQGF 2C2GA 3N2GB 4MMZB 2EBFX 3LYLA 3N0WA 1WP9A 2ZRDA 2EKDA 3DOHA 1CDEA 4EATA 3DZ8A 2PVCA 2J5BA 2WW8A 1FQJA 4E3WA 3AF2A 1I5OA 1T25A 4HLUA 1Q1EA 2HEGA 3BQ9A 4DDVA 2OYSA 3G0CA 4DSNA 5JCJD 1IN5A 4EABA 3COSA 4HS4A 1RAHA 4B84A 1T3LA 3U4IA 3L7LA 1R66A 1AF4A 2BI7A 3OOWA 1KA9H 3V6MA 4DCVA 1H2HA 4DWOA 4K9SA 2CJFA 2P9HA 3FMPB 4ID9A 4UPVA 3OT4A 3BXFA 4BNKA 1QHGA 1BEUB 3NZEA 3ODPA 1OXKB 1T5SA 4PZUA 3QU7A 5CVJA 4BWYA 1R6VA 3I6BA 5AK6A 2R84A 3CBGA 4ZT2A 1NQOA 1OOEA 1TKCA 2GBGA 3X1YA 4EHHA 4ZYTA 1GO2A 1XXHB 2GVDC 1ECPA 1EP2B 3LYHA 4FLEA 4IHJA 2H9IA 3T3HA 1WZ2A 5LYJF 4WY2A 1NW8A 2E1RA 3H05A 3RSQA 4C0SA 2E6KA 4HWPA 4XYEA 2NPFA 2O14A 3QEJA 2O8FB 2F8MA 3BGSA 4LBVA 2NUTA 1OFIA 5IKEA 1HYEA 1JU4A 4G0WA 3MTJA 4C2TA 4LNAA 1OBVA 3LLCA 4RHXA 2OO3A 2X23A 4ND8B 4RK6A 3JWHA 4F2PA 3PLAE 3C1UA 2BFCB 1ETHA 1QGED 2UXBB 5EE9A 3IT2A 1RXSA 3ZHVA 4Q7QA 2FPKA 3PCRB 4LQCA 1N2JA 4UHCA 4LWQA 1QIFA 4BMOB 2EHJA 2C82A 3CKYA 2DBVO 2P27A 1S7GA 3RLIA 1ZM9A 1U2PA 1YB7A 2PZEA 4CFYA 3OOEA 2FOXA 5K05A 2ZJZA 1L7QA 2Q1YA 5LQDA 3TNLA 1Y7IA 3DC7A 3SBEA 1E20A 1MX1A 4YHHB 2XXBA 4PIPA 4R05A 3V4VB 1JX6A 2PBRA 1POWA 3BTVA 3D43A 2EQBA 3AHFA 4D4IA 1J8YF 4W7IA 4A73A 5AO9A 2Z6UA 3D4PA 5EJ9A 1E7QA 1ZR2A 3M82A 3FGNA 4YQEA 4A0FA 4NVRA 3UJHA 2XB6A 3WQBA 3QVVA 1J8FA 3HFJA 1NKVA 5KPJA 3SM9A 2WF8A 1WSWA 2OHGA 3CH6A 3VUEA 2DHDA 2NIPA 3F6RA 4CPDA 3THYB 1SBNE 3IAM6 3HFSA 4CNQA 1IATA 3LUHA 1F0YA 1YI0A 3U49A 3WIDA 3JU3A 1GNTA 2O2IA 2FPUA 3FFWA 2LKCA 4MKXA 4NJMB 5KWEA 1VLMA 3AVVA 1RYFA 3UKOA 2OLKA 1NBEA 3ASUA 2AQHA 4G0UA 4TN5A 1Y9JA 2G8LA 2KS6A 4M83A 1D6MA 1LKZA 4ZPXA 1WOMA 2CNLA 3ZDQA 1BHQ1 2AJ8A 5CXXA 3OPNA 4DDHA 4JYAB 1JQBA 3C3DA 2A9QA 3Q15C 2XBMA 3FYUA 4WZBE 3DMFA 1R5NA 5A7HA 2D5LA 5EQJB 5A5DA 3BBLA 1ORRA 4D7AA 1JPUA 3N7AA 1EZ4A 3ZGNA 2OAEA 2JIOA 3RS7A 1R6TA 2P9QA 3H9UA 1JEDA 4K5QA 2ID9A 3GNLA 1LJUA 5LQRA 1O94C 3WOVA 4K03A 1TMOA 5AW2A 1UJ6A 1OBHA 2ACEA 2ZI3A 1L5VA 3CRQA 2GBPA 3B48A 4Z9YA 2EP8A 3T1QA 2NU9B 4B83A 5LDDC 2JIDA 5DMXA 1HV8A 5DI3A 3IEPA 3NHKA 3EJ6A 1KH2A 1DHTA 1PZEA 4GI1A 4BLQA 1Y6GA 4FYJA 2BM9A 4C0WA 3KR9A 3FNIA 1TL7C 1R0YA 1HQKA 4KGDA 2B3TA 5ISMA 4JXZA 1ADYA 4RCYA 5KYXA 2JFVA 2X0JA 1U8YA 2R8OA 3ELDA 3QX7A 4IKOA 2JD0A 3BZUA 3E1GA 3RWBA 5KCZA 1BRTA 2WP8J 2O5RA 1BMFA 2H2WA 1G5FA 2IQIA 2OZEA 3GJ3A 4PPNA 2PAAA 3K31A 4GE3A 3U31A 5ALGA 4EW2A 3TRKA 2C4MA 4KBFA 4N7RA 4CM9A 2EL7A 5D84A 5TLSA 3WDKA 5C8DA 1ISIA 3HCCA 1RD4A 1S4MA 4YAKA 3ULKA 4TV8B 2Y4OA 1NATA 1GA6A 1P8JA 3MTGA 3OCYA 1SHTX 3GXBA 3KC2A 1THTA 4MQFB 4MW6A 1TVKB 1PHRA 4UE2A 4HMPA 1CUSA 1E5XA 4WVLA 3GBVA 4PNZA 3TTTA 1U3FA 2O2EA 5E4YA 2RHOA 4EA8A 1TYCA 2QGFA 3EZFA 1N7GA 2VF7A 4L9RA 4TV8F 3DEHA 5LP6F 2GN1A 3WLFA 1FXSA 4IJKA 5J1TB 1RZRA 2ZI7A 2WMDA 2ZI6A 3EFOB 2PZAA 3EY9A 1R50A 1NTOA 4WZBB 5D3QA 2FX5A 3WDMA 3FYHA 3LSYA 5FBLB 1O54A 3FYDA 1O0BA 3CM0A 3IODA 2WJPA 4J0IA 1T29A 1W6RA 4KR9A 4C7OB 3QUSA 3I5YA 5KCMA 3THOA 3HDGA 2O0HA 3G9XA 1YQTA 2QUHA 3NEYA 3TL2A 1PT8A 1IUOA 4PCLA 1QRSA 2A35A 2G1PA 3ETJA 3NUGA 3MCZA 1QWOA 5F64A 1P3DA 3CW9A 1PL8A 1U9IC 2PMWB 1GDDA 1NUSA 1G6OA 2EC5A 3IP1A 3TIXB 4RETA 3ZJ5A 4JXXA 3ZH9B 4RQAA 2Z3WA 3QH4A 1RJWA 3FMVA 1TJ4A 1EM8B 1BS9A 1ICEA 2QVXX 1YDMA 1UWKA 2Z98A 1V0JA 4JP2A 1XP5A 4NZNA 5FEMA 2XRZA 1W9MA 3HCOA 3G68A 4NCIA 4E03A 5C8XA 2HA4A 4OOFA 3HN6A 3K94A 1LQ2A 2VF2A 2KSQA 3C6KA 4LECA 2W6OA 1E1MA 1WXXA 5DM60 1M9NA 4LJYA 3P4XA 4LQDA 1MAAA 1ZH6A 2C99A 3IAS1 3ZHBA 5F35A 4WE3A 2XZLA 2RE8A 2NOAA 4QXPA 4DLPA 3ZYCA 4EBBA 3JASA 3IUEA 2ZYWX 4IOJA 4UASA 3ROEA 2HIHA 3W5BA 4XGQA 4QXRA 3EEQA 2VPTA 4FGLA 3ETGA 5KHOC 4M49A 1ZPDA 4LY9A 3EGDB 4PG6A 5H3LA 4A5OA 5DT9A 1I3LA 1U6IA 1FBNA 4TL7A 1U6KA 4F3RA 2BWJA 3VI4B 2MYNA 5TPZD 3JATB 1XZDA 3LBNA 2BY4A 2GYVA 4KGZA 4RMHA 3C5CA 1L1QA 5BVHB 2Y99A 3AL0C 1CUYA 1MRZA 4D9JA 5FI1B 1G21E 3H1PA 5D7NA 4CIYA 5C46F 4N8EA 3JVUA 5B30A 4XD2A 3ET5A 3A2NA 1L4GA 1TDJA 2DT5A 1H8HA 1A98A 2KQUA 3CEJA 5KO2A 5BUZA 2R44A 2IDMA 1ZA2A 3DT6A 10MHA 1FIUA 1XTSA 1TO6A 3KJGA 5E3HA 3ZI7A 1A9XA 4CETA 2JGEA 4TTAA 1RHQA 3IUJA 3ZD8A 3ZGVA 5DHSA 1W5FA 2HT6A 4GECA 3WV4A 1HZJA 5G1NA 2F1HA 3A32A 5AJTA 4JT2A 4F2HA 2ONCA 1L7VC 1XPUA 2B78A 2PD3A 1TM7E 2QTBA 3EOBI 4HDRA 1ULZA 4WZ6A 4ZCPA 3HU5A 1IWOA 1SA0A 2BBSA 3PNSA 4WXRA 3T1OA 3IURA 3EEYA 2BFAA 1AJEA 1TUBB 2FR8C 4LVUA 3D54D 4KZKA 4M7PA 5BQ3A 1LDBA 2QROA 3IO5A 4K6HA 1U7DA 1FUUA 3OIGA 1W59A 2WABA 5AM1A 1A9PA 4M21A 3NPAA 2GPNA 1W0JD 5JPCA 4LWPA 3IEKA 5GP1A 3U37A 5TGDA 4EKIA 2BPOA 4JJKA 3F6PA 3SJ7A 2NUBA 2R6FA 2VXOA 3MINA 4HB2A 2MYTA 5EKUA 4GBGA 1WZNA 2ZRAA 4MWBA 4LXQA 1TYBE 2PSDA 1QQ7A 1JAHA 13PKA 3QFHA 5BSTA 2F43B 4YMSA 3ZZ1A 4KYVA 3NTRA 4JSTA 5J58A 4WCFA 2K5UA 2RGWA 6REQB 3H13A 3T34A 2B1QA 1CJKC 3PP8A 4GOLD 4N0DA 1RXYA 4UM7A 4UUNA 2WTEA 2WVHA 2RAUA 3UHAA 3CB2A 2G5GX 4QTUB 2QIOA 1YK0A 3MS4A 2HSGA 4ALNA 3DLAA 2W58A 3PPVA 2ZZNA 2WB4A 3QKRB 4M0FA 3DMNA 3RSZA 4D6PA 1JFVA 1SU6A 4N1AA 5HXAA 5AHWA 4UAGA 5EVJA 1GAXA 2XYRA 1YDGA 4H18A 2Y1EA 3WWYA 3KG2A 1QB8A 2BKVA 2YZGA 3KV1A 3TZQA 5AW8A 1E6EA 1U2GA 2CY0A 4I2VA 1QDUA 2RONA 3U62A 1H0HA 1AQJA 1EXVA 1QBGA 3ZHTA 3HEAA 2ZBFA 1EK1A 3RT9A 1R5OA 2CFTA 3BG5A 4AG5A 3INYA 2AMFA 3TG8A 1S6YA 1SQ6A 3MT7A 1E18A 2VHXA 3AG5A 4U7GA 4M1MA 1RLTA 3Q87B 4QNRA 3VAAA 2AI1A 3F7TA 1VBKA 4GH5A 4PLYA 4BC1A 1WY5A 5IKXA 4X66B 3H1FA 4CG3A 1QE0A 1QOQB 2YBDA 4BDTA 1SM4A 4Z8XA 2X4IA 4RUKA 4BWGA 1I32A 5BOSA 4RDXA 4QIHA 2GN4A 3PQ4A 4G24A 1R2QA 2GJ8A 4Z86A 4DM4A 4K05A 1VSTA 4G9EA 3ZHZA 3U7GA 1X15A 3FSGD 1CEXA 1E9BA 1DIOB 4XCXA 2VSFA 4HCJA 4L57A 3NORA 2VSOA 1L4LA 2C7PA 4UVIA 5K0BA 2ISQA 4LWZA 2PO7A 5DTIA 1GUAA 3OF3A 3CF2A 1WULS 4O25A 3VZBA 2NVOA 4FNAA 3VTAA 2ODEA 1ATZA 1VJDA 3RGWS 1BH6A 4YCSA 1X7WA 2VJBA 1GADO 2JKVA 3NETA 4X3OA 3ICWA 3FWNA 5IDVA 1T4BA 2OGZA 3Q41A 3KHUA 1MNAA 2A33A 1XI2A 3L04A 1MTOA 1FP1D 1PNVA 2XYGA 5I7RA 1Z0IA 1CLUA 3QF7A 5IZCC 1H5NA 3THWB 3QIVA 3A6KA 1OTHA 3V34A 1HE3A 2OAP1 1XAIA 2FSFA 5ICMA 1H2EA 1J9GA 1JHMA 2Q3FA 5LXTA 4FGSA 2FQ1A 2PZKA 3R9KA 2WWTA 1P9OA 4Q3NA 3HDJA 1GGJA 4IPTA 4W82A 1AH2A 3S1AA 2G72A 3R74A 4DMRA 4JHXA 3OZIA 1Z0ZA 2QLBA 4I4LA 5T6MA 1NQWA 5TDHA 5CU7A 2A92A 1FU7A 4BNVA 4Q21A 2ZAOA 1NLMA 2JLYA 1NMEA 5BQOA 2PUEA 1QQ6A 2FWAA 4Q9NA 2WJGA 1L9XA 3RF6A 1YR9A 1AM4D 2JAHA 4DDKA 2QRJA 1RJFA 4G41A 3LGXA 1DPGA 1I9GA 4RSGA 1QGUB 3AVXA 2A58A 3F5QA 4ZYUA 1DHRA 1Q50A 2B69A 1XYVA 2GJKA 5FL3A 5FUYA 4QU9A 2QTZA 1L5KA 2P9EA 3FZEA 3P0HA 5EY5B 4BQRA 3SHTA 4NCXA 1UEIA 1GCAA 1P33A 3FUXA 4X92A 4PY2A 4KR0A 1O5IA 5CURA 4AKEA 3BJMA 4ZYVA 1V95A 3E27A 1L6RA 1NAHA 1O6GA 3CLRD 3H83A 4PC2A 3MOIA 2I33A 3VR6D 2HADA 3A06A 1LFDB 3PX2A 4CKWB 3GT0A 1HYGA 1TMYA 4GC9A 2NQ2C 4O4JB 4RMGA 3TSOA 3EG5A 3UT6A 4BGIA 2AK3A 4EHIA 2X5XA 5IULC 3Q85A 3LY7A 1ABEA 4GP9A 5CTJA 4YIKA 2PA0A 4ZT5A 2FY8A 3SS7X 1ARZA 4EPYA 2X19A 3ZHUA 5TMPA 1G7TA 4I19A 1JW9B 4RHEA 5I51A 2ZIWB 2O2XA 4IMJB 1O6ZA 5H83A 1AQNA 1J4AA 1VG0B 5AJUA 5DTRA 3TW0A 4FVTA 3VVMA 5HKKA 2X0DA 5LQKA 4YC7A 1L7OA 4IICA 1GCIA 4WWHA 3DHNA 1X87A 3P9ZA 4C3VA 1ZMOA 3K0SA 2C3PA 2BFBA 2LZ0A 1D4OA 1Z45A 1KYTA 2BSAA 1CQJA 5U1PA 3G1WA 3UWMA 2IHUA 3WLAA 3G3EA 1D6JA 1T24A 2J0SA 4OM8A 1SC3A 1KOLA 3HCWA 3ZCPA 1QNFA 2EERA 2IXAA 3MWEB 2VWHA 3OQIB 5HG0A 5IH3A 1JA1A 4RJLA 1I7LA 1UBOS 3UGQA 4CKCB 1OXXK 1Z17A 3O3OB 3QEOA 1JZSA 2XTNA 4YP0A 6Q21A 1VKJA 1FFEA 1GZ3A 4I46A 5H5JA 1QVZA 4NFHA 2Z1NA 4L6IA 3OTOB 1QGOA 1RW4A 1DTEA 1F06A 4IFTA 1P81A 2V7UA 3LFTA 4A91A 1IHOA 4FBGA 1PNTA 2HOQA 4OXRA 4ZEOA 3WRYC 1B4DA 2OQ2A 2Y1LA 4FU0A 4HSGA 5ENVA 3FRIA 2YVAA 3BMCA 4NAUA 1MIOA 4GLOA 1E2UA 3CNOA 3Q8WA 5IKOA 2BHTA 2WSSA 5IEBA 3UAWA 4PC6A 1XPJA 1YVEI 3G2NA 3RWMB 3VM6A 4ER0A 3I6QA 1ZEMA 3EZYA 4YP5A 3KSAC 3UUEA 1JMVA 3PEWA 3PKZA 3VO2A 2HCBA 2GO7A 4P98A 3CVJA 2CJWA 1P7ZA 3BB3A 1NONA 1BU8A 5JLJA 3WL8A 3FHTA 1AUVA 4XFDA 1VJTA 2CEKA 3DUFA 2WSLA 3R3WA 2XCIA 3AYZB 3EIHA 5IFKA 5E4FA 1NT4A 1IM2A 1NNSA 4YAGA 3UIEA 2VNAA 1SZJG 2FWPA 2R11A 3MS7A 3B7GA 3OX2A 2IY7A 2NZ8A 2XHEA 1U0LA 2PVSA 3G8YA 4JMPA 1K3FA 2FPIB 4N5LA 1YZLA 4DW8A 1HDOA 1P9WA 4U00A 1JQ3A 5C5DA 1Y8CA 2VRBA 1VCNA 3PS9A 3GUHA 4I99A 4JL8A 1LLFA 3HQ4O 3HWRA 1H94A 1KL7A 4Q4AB 3M3HA 3V1NA 4URVR 1VKHA 1Z7GA 3FFAA 2J9GA 2RCNA 3NHLA 4NZOA 5D5HA 4CM8A 4EG5A 3CUYA 4Z5XA 1YR8A 2VP9A 1Y4UA 2JW5A 2ZTMA 4Y2VA 3BXXA 1FXUA 3FOAA 4YAWA 3VR5D 3AR7A 2VCEA 3LDHA 4L4XA 1M8GA 4S12A 3D6HA 3USES 4ARSA 5L3QA 4CQMB 3I72A 2R7KA 2RGEA 4XVRA 3I2YX 3PEUA 3NBUA 4ZHQA 2QTGA 4Q4HA 2EFDB 3MGKA 2W0MA 4GFDA 5LM3A 1PGQA 2PUWA 3BZWA 3MRVA 1XVVA 2VPQA 3C6XA 3KTAA 4KEAA 3DZKA 1K5GA 3DOIA 4KODA 4TS4A 3AESA 4WA8A 3O94A 5E38A 3GLHE 3WJAA 4WKOA 1PZNA 4ZVOA 4LTMA 1QP0A 1FNBA 2JRLA 3AFMA 4ZDKA 3JAKB 4HUQB 1BFUA 1LPMA 1T6BY 2OBNA 4FYHA 2JGRA 1PGPA 2BM1A 4JLWA 3R0ZA 2O7VA 4ZT6A 3SZLA 5JARA 3NB0A 5DYNA 1FP6A 3RH0A 2I67A 3KWMA 3R3SA 5E7JA 4TMXA 3NGLA 2H08A 4AWXA 1DX4A 2V9CA 3C70A 3D1LA 3OUZA 3UGTA 4J75A 2MTBA 2XCOA 3AUXA 5CVTA 1BRMA 4O4IF 1T91A 4UAJA 4WX2B 4TTRA 3ZNOA 1ZBQA 4BNDA 3WVNA 4DTCA 3ODGA 1LK5A 2QZSA 1MKYA 1XQ9A 2V7BA 1P0QA 3DFMA 5ALEA 5ICCA 3OZRA 5CAEB 1CUIA 3TNJA 3JARB 4EYSA 3EQ7A 4L08A 2ODNA 3SU8A 1OV6A 1PG0A 1RTTA 1ABBA 1YV9A 5FYQA 4MPRA 5JDIC 3ZDEA 4Q4DA 3VPAA 5A62A 4PLPA 1OLSB 4LZNA 1GXSB 1X7YB 2HV9A 1UBHS 4IDFA 1CT9A 1DMRA 4WLOA 5IYZA 4QASA 2A9OA 4ZI5A 1ULBA 4QECA 3TI9A 5GADl 3GA7A 2EGHA 1M2OA 3CG0A 1POXA 4D9IA 4PXSA 3VHLB 2QE7D 4WEQA 1WCYA 1JZTA 1Q84A 3OMWA 4YJGA 5JH7A 3HXTA 5JVDF 3OFND 2AZTA 1EFKA 2ZRGA 3EXHA 4FDVA 3LTNC 3UMVA 1NN1A 4YRMA 1NP3A 2BGRA 5L7WA 4IOLA 1VBMA 2PUHA 1LX7A 4F11A 5KX5A 4KQGA 1SCNE 2YW9A 4WFIA 3PC7A 3SJAA 3A7EA 1NVMB 1RCTE 3GH3A 4B8YA 3UVEA 1KI6B 3PJGA 1TCBA 4KLCA 4MW5A 1SWWA 3HSSA 1J24A 2PR2A 4HLUC 4M9CA 2DUNA 3U9LA 4Q3DA 2X4GA 2CLFB 4X91A 3CBQA 3ZCXA 5KYUA 4H2DA 4QTXA 4RW0A 4CL8A 1I3MA 1Z3IX 4Q7MB 1X74A 5CT6A 4JOSA 1VXRA 2XVZA 5F23A 4IX9A 1NBOA 3HN7A 5ENZA 2PH1A 3X43A 3D5TA 1EFVA 3EJWA 4WH0A 2YC4C 2ATVA 2F90A 1H4TA 4YJKA 3A6GA 1WCXA 3S2UA 3TW4A 3C7AA 1EX1A 5HKOA 1FW8A 1JGTA 2I7VA 2ISCA 5DO9A 4IDDA 1NUHA 2GEKA 1ND6A 3VPBA 2YYAA 3FHCB 3P96A 4K6KA 5DTQA 2YXDA 1WY7A 1B41A 2EF1A 5C8VA 4F84A 5JALA 1FK8A 1H69A 3GUUA 3SKVA 4HX2A 4M7OA 1YQEA 3ZGYA 3ZVRA 4BECA 3AFIA 3T9CA 4G0NA 1DQPA 3TE6A 2LGJA 1NU8A 1H6AA 1IFXA 1MB0A 3RW9A 3KUDA 3YASA 1NY6A 1GCUA 5BNZA 1FYEA 3GXOA 1NVBA 3V32A 4CT4B 5CDTA 1WDMA 2NN3C 4K1XA 4YMWA 4FHFA 1O5OA 3IBFA 2PTHA 3VZPA 3D6FA 3R8FA 2V7QD 4K8RB 3WBKA 1PTKA 1JTVA 1V5EA 1K2WA 4G4SP 4B3TB 4C76A 4PCVA 4DCJA 4LIPD 5B1SA 1WBDA 3TR0A 1CETA 2NU7B 4B6PA 4BMNA 1FA9A 2O48X 4YVFA 3S68A 4XDGA 3WXMA 4D4LA 1NY5A 5KNDD 3RSSA 2ZETA 2EDCA 3DZCA 3I92A 1AXRA 1KSFX 2HQRA 2R6AA 3VR6H 3EDYA 3D3NA 3P0RA 4MUKA 4UEKA 2YCBA 3LCVB 3QEKA 4FSHA 3UZUA 3ESYA 3AX6A 3K72B 3QTLA 1UH5A 3RAEC 1S8FA 3GLTA 2XOEA 3MN1A 3PF8A 4RWEA 1T1RA 1IY2A 1NX9A 2WTNA 3V46A 2JGMA 3CHYA 1PW7A 1Y5MA 2P41A 2J3MA 2OPBA 2NYVA 4N5NA 1OUMA 1GZ5A 4NFLA 4HV4A 1OX4B 3ZU6A 3E81A 4FSXA 1F8GA 2AFIB 3BUSA 2FPRA 3JWEA 1KEKA 1ADFA 1S1MA 4YUZA 2O8DA 3FM9A 1HMYA 4GE0A 1A4IA 2QR2A 3EWIA 4CLOB 1U8TA 3GFFA 5KKAA 2WD8A 3BRCA 2VCHA 3RDPA 3QFFA 4TMZA 2VJNA 1P75A 4WGGA 5GJCA 2XF8A 3R5XA 4KPEC 4ARIA 4WCVA 1E0DA 3ORSA 3M2PA 5AIBA 2BSXA 3KX2A 4IHKA 3HGTA 3WY9A 4AQYB 1GT6A 5GIOE 4IVRA 1MAUA 3FYUC 3O8CA 3BGDA 1PE0A 2OAQ1 3IR7A 5FPSA 1CJUC 1HLFA 2BMVA 3DA8A 4TT3A 1NL3A 4KWTA 1Q0PA 5ALUA 3ROFA 1SQSA 1U8CB 3FR8A 1JIXA 1NMXA 5CCEA 5I4BA 3ZIAA 4RO0A 4F3KA 4TL9A 1T1SA 4Z4GA 2GUGA 3SR4A 2BTQB 1YQXA 3F3KA 3D4LA 3GZNA 4KFRA 3T5GA 3T7AA 4ZI3A 3RRYA 1EWQA 4JLNA 3PTAA 1XQYA 1E4EB 2INGX 4MUGA 2NYAA 4HWOA 4OA8A 3COJA 3SZRA 2ZWAA 1JEEA 4ZKEA 4EG0A 1U0HC 2QENA 2J87A 3EGIA 2NUAB 1L0BA 2AHRA 3U0VA 2VN8A 4FFWA 3I04A 5CUQA 4C87A 2DTEA 5C81A 4G5XA 1KK3A 3SLKA 4RVSA 3MWKA 1XF9A 3L46A 1W36D 3IAXA 1GRVA 1IDN1 4M7RA 4MNTA 3WQQA 3EC2A 4U7HA 4DG5A 4BO5A 5CDFA 4RTRA 3EG9A 1NQAO 4PHCA 4AS1A 1CG6A 1CPYA 2VYQA 1FP7A 3PRKE 1NMZA 3QU5A 3I2GA 3S28A 1RDFA 2WM8A 4DHEA 4PX3A 3LVRE 2VQFB 2ZRIA 1KI3A 4P83A 1FZTA 1T4GA 3LHIA 4PVDA 5AVYA 1UPCA 1CY0A 3SEZA 3LWBA 3RS4A 5AHRA 1X3LA 3JALB 2C7VA 4HSEA 5DEOA 3WLMA 1JBKA 2Z9CA 3S1SA 3E5NA 1M8FA 1PP4A 1P7CA 2C5GA 4MJ7A 4WZAB 2AC7A 4IMRA 5BT9A 5DT2A 4RVCA 1ZGCA 3RVKA 3ESDA 5ESWA 1RBQA 1YJXA 3KB6A 1IBMB 1JIQA 2DWOA 4EUSA 1GGFA 1UPFA 1P7YA 1CW2B 3LYUA 1CJTC 1CRZA 2HA7A 3PKIA 4G4SO 4RSRA 3T4EA 3EPHA 5HM8A 5FDFA 3JQ9A 2IWRA 1X38A 2P78A 4ERNA 3PCTA 3AEQB 1QFMA 4IV5A 4OHWA 1NOJA 3KXPA 1MMFB 2H1HA 2HEIA 2O2SA 1ZJWA 3EUAA 3MTBA 2A67A 4IAOA 4PQYA 4UTZA 4ZAYA 2AEEA 4XRRA 3NEJA 4GRDA 2FEXA 3VSDA 2B6HA 3QHAA 3A4LA 3N2KB 3EVAA 1L5SA 1ZS9A 2I6QA 2ZKLA 1LS1A 2NXCA 3QYAA 4WD3A 5CVUA 1EKXA 1NUUA 4MVCA 5H81A 1RXWA 3VX4A 4WLUA 1MEOA 2ETVA 1B8OA 2FRXA 3B6KA 3ZXSA 3KPUA 5AJVB 3CFYA 5T4EA 4YO7A 1KZ6A 1T3ZA 4RESA 4CDGA 4MYUA 2O5EA 4DV3B 3WL6A 1TPYA 1A9OA 1NQTA 1NW9B 1XLUA 2CZCA 1QKJA 3AKEA 1HWYA 2PFKA 3AGPA 3CNEA 3JQ6A 4IJQA 4YJ3B 3ZZTA 4D9NA 1LBEA 2PUDA 5IYZF 2EJTA 4N0QA 2YOHA 4PAOA 1MW8X 4UEWA 2VQ6A 3B6MA 1YB4A 3E03A 2HF8A 4JYMA 4XQ9A 5DIZA 9ABPA 1UBJS 2OV2A 4HAXA 5IT4A 3ZD7A 4M60A 3GEMA 1E1QA 3ZBQA 1OT3A 2FZ4A 2QJWA 2AK2A 2J6HA 3DGEC 3LXRA 3DDCA 5I01A 3NHZA 3SZMA 1GQ2A 2O1SA 2BBTA 4D9BA 2ZR9A 5F5LA 4DMMA 4UMVA 1VHDA 1RNLA 3B78A 3FZQA 3G5AA 1QO0D 4Z9XA 1CF9A 2IF0A 1NE2A 1NHWA 2FSIA 1U2QA 2HMUA 3Q1LA 2IBTA 1S9HA 3FUTA 3SQLA 3JQAD 3MB8A 4R6XA 3TO5A 1CRWG 3K2BA 2BRUA 4II2A 1JIVA 5HDQA 3M70A 1VB5A 2QE7A 1UADA 3IVGA 7YASA 3OP1A 1SELA 3BCHA 3IDQA 3R3ZA 3TBHA 2Q5EA 2EG9A 4BGVA 2CYAA 1MR3F 3NOOA 4OMUA 2B25A 4WDRA 2P2CA 3N0VA 5KYVA 5LA6F 4AF7A 4K6FA 4LMRA 2QD3A 1T35A 1Z5ZA 2AJLI 4PO1A 1JLLB 3E3MA 2HA6A 3JQRA 1N1GA 4CJXA 3DE2X 3PQCA 3Q8LA 3QVLA 2XBUA 1RJ9B 4A23A 3GFOA 3CPHA 4KOAA 2X2FA 1GAEO 3AXTA 1FNCA 4D8XA 1TUIA 2PSFA 2ZM5A 3U4GA 1SCIA 1HTWA 2CGEA 2QMOA 1JKJB 4TYNA 2B4AA 2XJ4A 4JY7A 2HN9A 4X97A 1G7SA 4YWHA 4BNYA 3P32A 5FWNA 2AJCA 4JNCA 4ZHSA 2X8JA 3N0XA 4Q34A 5EIFA 2W6IA 2WD7B 2WG2A 3K9CA 2AQ8A 3VVLA 1V96A 1NLZA 1RXUA 4OU5A 2O2GA 1JFTA 4KLZA 4LSWA 3RVJA 3W8FA 3B1WA 4PX5A 4XOUA 4Z4HA 4CKYA 2IHTA 3LNTA 3P5SA 4IWNA 4DIKA 1ONPA 4Z9FA 5BMVB 7REQA 2H5JA 3P94A 1HDZA 3PDHA 3SOPA 2MSDB 3LA8A 3LH5A 4WW0A 5BN3B 4H1TA 2AOTB 4I8IA 4TM7A 2VAMA 4HGQA 3O31A 4J6EA 1CV2A 3F71A 3C2QA 2VJDA 4WCFC 3FBWA 2Y1OA 3WIOA 4DXAA 3OZTA 1FPMA 5FLXA 2CXPA 1YC2A 3KEOA 4LZWA 3C97A 4D02A 3ROZA 2JCGA 2JI6A 4FHZA 5E7QA 1F0KA 3CTPA 3QVMA 4E13A 2C3OA 1V9LA 2XSZA 5T3YA 1V3QE 2X7JA 2OO5C 3K1TA 4AZTA 4JGBA 3QSGA 5KTKA 2CLEB 3EMBA 2HR1A 2ZW9A 3HLKA 3JAMA 4ZTZB 3FI0A 2JDIA 3V7YA 4C0HA 1RFLA 1IHPA 1U2GC 5TT1A 3EC7A 2VDWB 3T9BA 5KNDH 1BE1A 4R1LA 1OV4A 2CXTA 1UPBA 3OX1A 2Z58A 4HB3A 2D3WA 2DMRA 4ITRC 4MKFA 2YWJA 1O96A 4MIEA 1E1NA 1PEYA 4X71A 3A05A 2GX6A 3FD8A 1DCMA 1JDSA 2AZ4A 2JIZD 2NXJA 3OHSX 4KE8A 4NCJA 1SUEA 3IAEA 1RPAA 4GEKA 3IVRA 1H2YA 4YN3A 4EL0A 1MHPA 2BF7A 2R1TB 1OY1A 2PEYA 4DB2A 3LPCA 3H86A 2XVYA 4GYKA 5GV8A 3R9IA 5ALHA 5KDLA 4C0BA 1LD3A 2RGYA 3SF8A 1OYOA 4GI7A 1YBMA 1Y4DE 2PEZA 4MKIA 3IHLA 3ZWAA 1ZU5A 5LC1A 4EO7A 5JNRA 3VQTA 2NP6A 1VPVA 4ZIRB 2P2NA 4F8YA 3ICQB 2VKQA 1UIMA 3HKBA 3AKYA 5K8JB 4PHHA 4YJFB 3VO1A 4NEGA 4LV8B 4B4VA 2H5LA 2ZT8A 3ITNA 1S2OA 2ZB2A 2OGTA 3P2IA 2NU6B 4XSVA 3H42B 2CLSA 4HQOA 3UWPA 1BWQA 3RC8A 2IHJA 1UXHA 3BA1A 2G4CA 1D8AA 1CP2A 4LZLA 4C4RA 4JYZA 4R9NA 5J4VA 5KTPA 1FFSA 1J2RA 3QVTA 4KPUB 2YNMD 4DDWA 4OGFA 4J0JA 2R6JA 4GS5A 3ZJVA 5B37A 1IY8A 3LDGA 1N6PA 4D9GA 3U4MA 2VUIB 1QFZA 2QRPA 2WZCA 1GTRA 2C2BA 5JCPA 2H3HA 2O52A 2I66A 3PHGA 2Q46A 1BW9B 1X7XB 1V5GA 3I9FA 2XEXA 3L18A 3LLSA 5KNBA 3DB2A 2J9ZB 4YLYA 1PT5A 2FH5B 2PMEA 3EZ7A 2WAYA 1J0CA 3M4JA 4NH0A 3U9SA 4EG7A 3LCCA 4V0RA 5MFZA 3C6BA 3ZJYA 2UXDB 3M49A 3OCWA 4MUMA 4DKXA 5BNTA 1WVGA 3OETA 3VDRA 2Y1KA 1BIFA 4BYGA 1IHXA 1MT3A 1RXVA 1VXOA 1RPJA 4ZGWA 4BCDA 3C3YA 2ZJYA 2AW5A 4OJNA 4HZUA 3RV3A 1Z33A 5M7EA 1T3GA 3BJRA 2F2TA 2HNKA 2PL3A 3NCTA 4S35A 4Q4JA 4UEOA 3MCTA 2Q0SA 1CIPA 3SZUA 3M6WA 3DF9A 1SZCA 4HGPA 5BT8A 5GZ3A 1X86B 1E66A 2NTNA 1GQOA 2ZIAA 3JR3A 4FFNA 4C6TB 2H51A 1WAMA 2RBKA 4WQMA 1T1JA 4W7HA 1DV2A 1ODFA 3EGVA 2DPYA 3NHMA 2C92A 3CCCA 4ZOBA 3BEDA 3TCKA 1K8QA 3UJBA 5IFLA 5HW0A 4RKRA 2OOKA 4NE7A 1ATIA 1Z7WA 3OO1A 3PNYA 4UXJA 2IU4A 1P4HA 2ET6A 1OBCA 3FSRA 4AW9A 4XQCA 1XU4A 4GYWA 5H16A 1OZ0A 1Z4LA 2J5QA 4BEBA 1PD0A 1K7EB 5CFQA 1P2BA 4OGLA 4HAUA 4PIVA 4BVBA 1J1ZA 1RQXA 3OA0A 4CL3A 1SOWA 3L4EA 3L8MA 2IE8A 4L7QA 5JXIA 5KB3A 3NLLA 2WV9A 4YXWA 1U7PA 4PYLA 1LWNA 1SVSA 1T0IA 1WMSA 2O4CA 4CEIB 1M7HA 4NY1A 3OZVA 4H35A 2I4NA 1JDZA 3LQ2A 3MQFA 1C0EA 1VIAA 1RC1A 2VJMA 3DXFA 3FGOA 2CVZA 3OPYB 3O8QB 4IYRA 4JOBA 1XMXA 1SKMA 3ZE9A 5NLLA 5B12A 3JVDA 3NIWA 3E82A 3M5PA 3TDKA 4LYGA 4XW2A 2HIAA 4HY3A 4I3GA 4IM7A 4MUYA 4P4SA 5AVRA 4EUKA 2GK7A 5CB4A 1M2NA 4FFOA 4EB3A 3CVWA 1GGKA 1YIAA 2AQKA 1HY3A 4QEZA 3NJRA 4P4GA 3DHEA 5DRYA 1GRQA 1LY1A 2QA5A 1RMYA 1NR1A 2PLNA 2PL9A 2YICA 5CGZA 3O3NB 3CE9A 5HGJA 3RSGA 3KSRA 2CUZA 1XZGA 3R77A 2Z8XA 4AJEA 3QNMA 4ZV4A 3DT8A 4LXGA 2A59A 2C95A 4DL9A 2F67A 4D0NA 1AKNA 3SOZA 1RAFA 4RJJA 2E5FA 5AW3A 1ZHFA 1PR9A 4LHYA 2ZJBA 5KAPA 4OP1A 1VQ1A 1MCZA 1RP1A 1RJEA 2ZKIA 1LDMA 2A0YA 5DXAA 2NZYA 2W2PA 4QULA 5FOTA 3UT5A 5CD9A 3X2FA 1QO0A 1QRTA 3ZE6A 1GP2A 3A4MA 1Z8FA 2NQ8A 4PYMA 4M55A 2BHLA 1TOAA 1SBIA 1I33A 1NJFA 1D2CA 1CR2A 2E4XA 2P1DA 2QRNA 1GIAA 3DAHA 4FCVA 3ZHXA 3F0TA 4BBJA 1CLEA 4KVGA 3SIXA 5JZOA 2ZSJA 4UULA 5C52B 1R0BA 1ZD9A 3R0QA 4IOMA 4H7DA 4C9BA 5KTMA 1QV6A 2B1JA 2JVIA 3U6BA 2VDUE 3ZWCA 2CT8A 1IMJA 4JBHA 3PCXA 1P45A 1UWCA 1P0MA 4ZAZA 4L8VA 4RD0A 3K8ZA 4CT5A 5CYOA 3QBVA 1K4YA 1H2BA 1QGZA 4GZ3A 3ILYA 5BSHA 4PW0A 5L53A 1Y9EA 2WMYA 1WEHA 1P5RA 2CFSA 4TKUA 5FF9A 3B1JA 1OHHD 1NUAA 3PSAA 3I0MA 4ZVLA 1U8XX 4A16A 3P5BA 1SCQA 2PL1A 3GZJA 1QH9A 5F1KA 2Z6QA 1HXHA 1W8IA 5D3KA 4BQPA 1GPYA 6PFKA 1EP9A 1ORTA 2IYQA 2V8OA 3ZJTA 2I3ZA 2CXOA 3ZWDA 3L7DA 1GV0A 3CEMA 3TRDA 1U8AA 1P6QA 2BKUA 1JKIA 3MMZA 4P3OA 2W70A 2ZVQX 3TI7A 4AY5A 2FZEA 2QI9F 3O1LA 4JNKA 5BSEA 4OI0A 2PQMA 4MA0A 4D9HA 3DOFA 3PQDA 1TZJA 4WN9B 2K2QB 1G2PA 2W6JA 3T7IA 2O8EB 4FM9A 1L4NA 3AZOA 3QMPA 4FFVA 4Y1EA 2WIBA 3IEXA 1OYYA 4WLFA 3DHVA 1Y5LA 3WL7A 1YRYE 1AZTA 5ALRA 4LJRA 2YY5A 5JY1A 2JFOA 4LFBB 2SICE 2JC3A 2GXUA 2Z8YA 3JQEA 3C3BA 3FA2A 3V7FA 1HDXA 4GU5A 3DWFA 2F55A 2I03A 3G0IA 4J4BA 3KD3A 2QBYA 4YAFA 3IOYA 4HWRA 1FYWA 1E3LA 3KEQA 3RF7A 5FL7D 3MIIA 1TTHA 3QVKA 3WYCA 3QA9A 2QLMA 5CYFA 3W8NA 3ELUA 1B1AA 1IZYA 3U7QB 4C0AC 4YV0A 3C1AA 2WF7A 3FVRA 2NLOA 1WCIB 2HQOA 2JLBA 3FUUA 4NENA 3KQOA 4UVEA 5B4VA 3AV0B 4P4LA 3IVAA 1XTUA 3MFQA 4KQCA 3ZNQA 5IX8A 3O93A 1MV8A 1KJYA 4R1QA 5TV2A 2H2AA 4UOQA 1W1WA 5FUVA 2XQIA 3T94A 2Z2YA 2IU0A 1ZGBA 1GPBA 3ZLBA 1HNNA 2JHGA 2CL7X 2P69A 4DUPA 3VHQA 1T0BA 4EUEA 2ZRFA 4HDMA 4KL8S 2XMCA 1C9MA 1AHIA 1O95A 5LOVA 1AKEA 3TQOA 5AICA 1QDLB 5EMMA 5B58T 4CL0A 121PA 4PLTA 1A97A 4D43A 2FFQA 2ACWA 3T1HB 2UZ1B 3OOHA 1AG9A 2A3NA 4DJAA 4QVGA 2CXSA 4U9UA 4QQ8A 3W79A 1KMMA 4OX9Y 1PJTA 3DCNA 2RHBA 3O8OB 1P5ZB 1T6ZA 3D4OA 1RYMA 1XNGA 3RE1A 2ECOA 1SZPA 3T7JA 3ZD6A 3S3TA 3AC0A 2E2WA 1IB0A 4RVFA 4I4TB 4D44A 1TIBA 2I78A 3HA2A 3SN6A 2QVGA 3B70A 3EAQA 4RHTA 3EXHC 1CQIB 2NTJA 3H6HA 2E0IA 4FMCF 4IXNA 3MZ0A 1E3DA 1PBNA 3OEED 1GA4A 4TTIA 1PR6A 3QXCA 1GUFA 1L5WA 4N7MA 3UC5A 1JFSA 1G98A 1TFRA 1SQ5A 2C3MA 2XTJA 1A9QA 1SAYA 4RK1A 4HTFB 4A26A 4C4SA 5MGBA 3PDJA 4B3HA 3TOZA 1XNRB 5KVSA 1VJ1A 3EEIA 2DQKA 4R2WA 5EE1A 3A1SA 1R18A 2QXUA 3EODA 1J2YA 2VHYA 1XZPA 4NOJA 2VNSA 1ZCZA 3I37X 4F56A 1BMTA 4YLGA 2CVOA 3V2IA 4BRUA 5JOQA 1C8LA 1U0RA 2RI1A 3DR3A 3K9BA 3Q1KA 5D01A 5ED0A 3R7AA 3DM9B 4QL3A 2R48A 5AW9A 2ZFUA 2OYRA 2C54A 1BXRB 1SB9A 3C41J 4FONA 2CV1A 2FR1A 3E9MA 1LGYA 4IIGA 4OKIA 3JV7A 3BDAA 4BO8A 1ENYA 1JNXX 2C1EA 3HKDA 4ZEWA 1T5BA 1T0UA 3PQ7A 4I66A 4MP6A 4OHCA 1TPZA 2RMKA 4LSGA 5JAZA 5L51A 3T3GA 3L5OA 3DLTA 3VU1A 4DYDA 2R7MA 2Z2JA 4KPGA 3T7KA 3TQRA 4GF5A 2AH5A 3I34X 1IDOA 5C35A 1A88A 5E1OA 3SXJA 5L3SB 4E46A 1EVEA 2IZOA 3GGSA 3MVEA 1C3OA 4M9RA 2V45A 3BS4A 2NO7A 1BXGB 4GO1A 1C1DB 3LDFA 1SPBS 4FQ8A 1VHWA 1PI3A 5I7UA 1C4WA 4J1TA 2R2GA 1FX0B 1T13A 1T1IA 3GT7A 3OCZA 4WVFA 1KR5A 3WLTA 1GZ7A 3MYRA 4JBNA 4ZXPA 5T67A 3EVEA 1AKUA 3WYFA 1EINA 2I6UA 1JH8A 3BH0A 1M7BA 1GVNB 3L6OO 4YBZA 2Q28A 1MRNA 2BV3A 1XLTA 2FXIA 2I7CA 3FYSA 2I65A 1CZNA 1N5MA 4IDAA 3ZE2B 2BLLA 1MB4A 2VPPA 1YGYA 1B14A 2ZIZA 5HCIA 1YR6A 1NF3A 1PW5A 3K0HA 4DB4A 3RTCA 1Y6FA 1EDEA 1EHCA 1GLVA 2EZ4A 2GRUA 1RI4A 3FF4A 1VLJA 1I4WA 1TKAA 3PNOA 1IK4A 2WV7A 1MIHA 4Q1AA 3LNCA 4XLTA 4AMGA 3GP8A 2SKCA 5ECWA 3RK4A 1ZVJA 4AS2A 2ZZKA 2ZRPA 1ACLA 5AK3A 1X80A 2O6LA 2PWAA 2ZCVA 4YAIA 3FPHA 4E5MA 1TKRA 4J16C 4NBLA 1R8XA 1H3EA 4JU9A 1X7DA 1R88A 4EG1A 3NH9A 2JS7A 3H2KA 2FWJA 4JJ7A 1ESEA 2QDKA 3RVPA 5AW1A 3LLMA 4L5AA 5K9ZA 1AHNA 1YCHA 3DKIA 2HI0A 3OWOA 3PJRA 2EX1A 3MM4A 5IASA 1CVRA 1QHFA 2RHMA 3FAZA 3WLIA 1OAKA 4PZDA 1SB8A 1A9RA 1SU7A 1D09A 5E8JA 4GYJA 5KIAA 2W6ZA 1R64A 2IUTA 2VJQA 2WIKA 4KMRA 4OHKA 3CZAA 1CUWA 1YUMA 2AMVA 2WLTA 2WIDA 2QRQA 3MTDA 3TLMA 2EQ5A 3DVRX 4JYBA 4QBHA 3IBTA 3NIDB 2GYYA 3HY4A 4MLZA 3CSDA 1MOZA 3FCAA 1M8KA 1VHJA 2POCA 1FUYB 2OVBA 2V54A 2ZQ5A 3WKBA 1CUEA 4G9BA 2HDNB 3NX4A 1XA3A 2O2CA 3UKJA 2AV6A 3R7NA 3ZDFA 1U11A 2NZVG 3RKRA 1CY2A 1E3QA 1WR8A 3FKJA 1ZK1A 2IYNA 3FTDA 3PJDA 2VT6A 4GX0A 1GZ4A 3LD9A 5CNJA 1LPOA 2FR0A 3HXLA 1WZCA 5AVSA 1JEQA 3WGUA 4WT7A 1ZD1A 1PBTA 1Z82A 2QVZX 3QJGA 3UN1A 1P0PA 4DMFA 2CLOB 3NBMA 4ZREA 3IS3A 1E7MA 3TOVA 1GG9A 3THXB 4AIIA 5IU6A 5LP1A 5JG7A 2DH6A 2V6MA 3F9CA 3GGGA 5T3UA 2DULA 2YY6A 4E7OA 1BU5A 3ZGZA 1WBJB 3K09A 3AR4A 3QBEA 5ALZA 1UMDA 4FR5A 1SCJA 3FSEA 5FORA 4AFNA 2VAVA 3IO3A 4UQLA 5K4GA 1GPNA 2ZTVA 1QF6A 3AR2A 3JQFC 4M0MA 4LQLA 1JJBA 1JQJC 1KJNA 1OLOA 2PS9A 1SUSA 4R0NA 1N2EA 1EP3B 1B8PA 5EFZA 4CLRA 4BEVA 5IJ9A 5I7HA 3QVOA 2R8RA 2HD4A 5G2OA 2YOFA 4PBSA 4R2HA 2ODPA 1EXDA 5HF6A 1R0KA 3GDWA 4FUQA 3H1BA 4UU8A 2P7IA 5CRIA 5KYWB 1U0SY 3STUA 5EP4A 4A0RA 2UUCB 4QUJA 1IG3A 3PDIB 1SKQA 2IS4A 9ATCA 1UQRA 4P2GA 4ID3A 1XROA 4EGCB 4KXUA 4N6OA 3U56A 1BZYA 3DV0A 2XUFA 3D4BA 5SZHB 3U7IA 3WADA 5HIJA 4ZOQI 1ITZA 1NXSA 1PKEA 3NM6B 4XFJA 3EXIB 3N3AC 2I3AA 1AKWA 3DAGA 4MYCA 3AR9A 4ZT3A 3JQ9C 4TWIA 1UAGA 2J4DA 4DSZA 4OQXA 1PVOA 3LCUA 2LCFA 1SBCA 4D96A 4YQFA 2OZPA 2CNKA 3DOCA 3E48A 4AMUA 4BU1A 3SC2A 1R4MB 3AEUA 4I6JA 4HNSA 2BTEA 3PWZA 1H2AS 5JAUA 2UZIR 4I0WB 3JQGB 3GFGA 5H8WA 3ITKA 3NHUA 1XTPA 1EZZA 2BMFA 5INTA 1Z2EA 4RHUA 2VI5A 5KJCA 1JLMA 3AXSA 2NO9A 3QOWA 3BAZA 4UHEA 4C3UA 3PFFA 5C2JB 3C0KA 4IUDS 4WV3A 4XWAA 2GBLA 4BGEA 4DIOA 4F86A 5LOVF 4Y67A 1GRNA 4X7PA 2OZLB 1J5EB 3ISVA 4YALA 3OSUA 4DUGD 1UZMA 4ZCTA 3U4DA 3AIKA 2B1GA 3T3MB 3A1NA 5CM8B 4IG4A 2G7ZA 4FOLA 3BDVA 3D2BA 4QOJA 1RKUA 1XWWA 2QAGA 3BD8A 3W2EA 4ONEA 2AIRA 1HDEA 4GR9A 4BUZA 2BEWB 2AZMA 2A57A 1MX9A 1DC8A 2CVHA 1RHMA 3R1IA 3PUYA 2IV7A 4GHWA 3EVBA 5HFJA 3PHLA 2AYYA 5CEFA 4HADA 1L3CA 3PZRA 2GZHA 4MTLA 3NWBA 4IDGA 3KFLA 1DNPA 1Y8QA 1K2VN 2HJWA 1NZDA 4IDEA 4RY8A 3B12A 4BKUA 3CEHA 4I4NA 4V0SA 1DL5A 4YH1A 5HF9A 1ZH2A 2GA8A 4H60A 5GAJA 4BB5A 1UF9A 4JYCA 2QTAA 1J49A 2CB9A 5FBKA 1RJGA 2EF0A 2E7ZA 2PKWA 3KQVA 3PPYA 4FTWA 3FJOA 2D2FA 5F51A 2GAAA 1TLFA 2EBHX 2JLAA 3GRVA 4BTLA 1E3WB 4Q7EA 3IAS6 2DFVA 4D3SA 4XYMA 4WKNA 5IXSA 4I6GA 1SU4A 1JXMA 3DZFA 5EGNA 4N3NA 1QHNA 5AVUA 1RI5A 3PYLA 3A1EA 2X8AA 4ZVQA 2BDTA 3CRW1 4FKMA 4TOIA 2PBFA 1QIMA 1JE1A 4JA0A 2AXQA 4EPRA 2IH4A 4UNIA 2DTXA 3DVSX 4I1UA 4MIOA 3JQBA 4P3NA 4CXMA 1QFXA 4UMEA 1I4LD 1XALA 1OQAA 4M0LA 2V3CC 1OWPA 2HDHA 5EC8A 1D6NA 3AY7A 2FI1A 3MELA 2BAGA 3CR3C 3SEFA 1NULA 2GLTA 2WKPA 4PC1A 5T4HA 2FSSA 3TD9A 3ZXXA 3UPTA 2JAOA 4FWBA 2RB5A 1SHJA 2IYZA 4RTOA 3Q10A 4JQYA 1IBRA 3BXOA 3RIXA 4CDNA 2OTCA 2XNCA 2ZYRA 2HIGA 3GEEA 4M76B 4LC0A 4YMUA 2NUPA 1OI7A 3E4DA 3FWPA 4KIJA 3AINA 1K27A 3A11A 2IZ1A 1AS0A 3VSBA 3Q72A 5J40A 1KI1A 4QWWA 1CFJA 3GRUA 2O8BB 4YUYA 4GL4A 4JJ8A 1TC1A 3ZY3A 1ZK2A 2GPYA 1FB5A 3E15A 3GN2A 4W4TA 1IAVA 1OXMA 2XDWA 5AHOA 3TZKA 2XTZA 2QN3A 4EL5A 3AOGA 1UDWA 4TS1A 1YJ8A 2AA3A 2WJZB 1PJ8A 1EVQA 4FMDF 4UMFA 4A0QA 3HHPA 5A3JA 1YXMA 1K7SN 1XXLA 4KLRA 4RY9A 5GZ1A 3UC9A 4LDPA 1XP8A 1II0A 1NVWQ 3TSZA 3E7PA 5HJ7A 1GUYA 2GSDA 2XQVA 3AR5A 3CCBA 3MWLA 4H0FA 1NP7A 3OX3A 1FRNA 3MD9A 4LY3A 1VSQA 1ZN7A 2X3UA 3RVBA 1L4UA 1ZNWA 3FIJA 4RX1A 1UZLA 1JAYA 1N1MA 5K8IA 4XJSA 1KXZA 4U02A 2C4HA 3DM5A 4UUPA 3UUGA 4RTSA 2IZZA 4NESA 1LK0A 3ML1A 4IO1A 4UUBA 4C21A 3GUVA 4I55F 2F1RA 3QLUC 4FILA 3SHVA 3GCGA 1JDPA 3Q3JB 2IUUA 1PV2A 3ROTA 4C01A 4LDNA 4KX3A 1Z28A 4KRGA 3ZDDA 3E1SA 5ALWA 1XEWX 1EJ0A 1QTNA 1BKDR 2GGSA 2HBZA 1EGAA 3HKCA 4P3XA 5F78A 1R8YA 2RGGA 2NAPA 4PPFA 3VPFA 3ZIUA 3F98A 4IHJB 1WWKA 4LBWA 4I5FA 3PTLA 4X1KA 1C9EA 3W5SA 4WHMA 5CIWA 2WLSA 3AHCA 3AHIA 1AB6A 2BFOA 3V4SA 2PAFA 5EGSA 5HKAA 1LXCA 1U65A 2NUTB 1JJIA 1OFUA 5F1OA 1KZ9A 1ODCA 1F0NA 4ENQA 2F00A 1QR6A 4MCAA 3AF0A 5K4AA 3V1YA 3VV3A 4DHWA 1XK7A 1X94A 1BVRA 1YB2A 1YZYA 3TE7A 2D8MA 4ZQIA 3WIBA 3UGJA 4TXLA 5LBUA 4BO7A 4CMKA 5MN4A 2VXYA 3AG6A 3FDFA 2JCBA 3SHWA 4IILA 1QHXA 3STYA 3P0FA 4BZPA 5GQSA 8LDHA 2G40A 4WKCA 1ZNXA 1YU6A 1V35A 2UYOA 5E8RA 4RAOA 3K32A 3N75A 3INGA 1IXZA 1TECE 5B3KA 2D7DA 3RWOA 1KJJA 4OTZA 3IR5A 4BCBA 2GO1A 4UUOA 3NV9A 1FDRA 3WK8A 4XWYA 4D8TA 1SIOA 4JEMA 1E3MA 5DNWA 3RLFA 1BGVA 2YZ2A 3NJ8A 2KLHA 4KQ1A 1A1VA 3KKZA 1M0SA 1Y1SA 4JJIA 5DLEA 2E4ZA 2XCUA 1UJ5A 2Q5OA 3HUEA 1XJ5A 3JQ8B 3N05A 4X5OA 4OYYA 3IVCA 4ZQCB 3QOFA 5EJIA 1CFZA 3SDBA 2ZIUB 4QUIA 3HFRA 2JLQA 4CIWA 3JZFA 4QDUA 2GM9A 3R5TA 3E84A 3ROMA 3AP2A 3D6TB 3SYNA 4UM9D 3L4SO 1GTVA 2E37A 2Q3CA 2Z57A 4Y2QA 8GPBA 5LWHA 5K1ZA 3SSNA 4ER6A 1W94A 2P40A 3Q3CA 5CR9A 1J0XO 2VTKA 3RS0A 4BNZA 4KAXA 2I8CA 4O0MA 4NOLA 1TW3A 2FPLA 3TMKA 4DMHA 2XQKA 4EY5A 3DMRA 2BL4A 4NU5A 2JATA 4O4LB 1TZKA 1XWFA 4N5MA 4RE6A 2PIAA 1UEJA 2E85A 3OQ1A 3PFBA 3GBPA 4I50F 3UPDA 2ZM6B 5HEKA 2O7NA 1GNPA 3F6BX 1G3UA 3NAMA 3BVPA 4YACA 2I1QA 3EGXA 3IV6A 1JKFA 1ORHA 3IAAA 3TX6A 4IBOA 3GFBA 4O4LF 4RL4A 3K1AA 4Q3OA 5A9RA 1ODKA 2YMQA 1Q14A 2Z8YM 2GN6A 1EWYA 2A1TR 4PFQA 4FNMA 2VWQA 1FLDA 1M1ZA 4R1PA 3UHJA 1W2WB 1UJ2A 2OUIA 4J1SA 3WISA 1JHXA 3FPAA 1CEEA 1SXJD 3WGQA 3IT0A 2IOHA 3CV3A 1G17A 4O2BA 5DI3B 3DMTA 4PAWA 1FFBA 3NPMA 3SIPA 2FCRA 4DBLC 5LU8A 2YH2A 3QVJA 5GPBA 2JASA 3RTAA 5FIUA 5D8DA 2A5DA 3EY4A 3L82B 1RHRA 2AJBA 5KYXB 3G59A 1E9EA 2FMIA 1SC9A 5FLYA 1EFUA 1FYXA 5A03A 2GAOA 2P7HA 4BJ3A 4JJ4A 1T4CA 4N3AA 4YRLA 1SCDA 2ADFA 2QAIA 4E32A 3ETDA 4DBZA 3OFJA 3R4VA 5KJ6A 1H22A 4FYWA 2V3VA 4OLJA 1QTIA 3EVNA 1QIJA 3G9UA 4K9PA 4WAUA 4YCJA 1YFZA 1P9LA 3RC7A 3TQCA 5F3WB 1P1CA 2ORED 5PNTA 4G4JA 3NYWA 3TCXB 4JI0B 2ODWA 4EKYA 4EI7A 3WG9A 5L4NA 2ADOA 3L92A 4TZTA 1R0WA 2CWWA 3LRXA 1X8XA 3MGBA 2FZWA 4QBFA 4X9XA 5DK4A 2H29A 3HACA 3PUZA 3AB7A 4ETNA 2DJIA 1U5BA 4LGCA 1C80A 5TS3A 4WN3A 2YWBA 3FCCA 3KL4A 3IH5A 4GMHA 1DBVO 1DTSA 1C3XA 1J8VA 3B6EA 5AQ1A 1NTRA 4K9QA 1LC0A 1R16A 4XVQA 4EDHA 5IF9A 1NGSA 4BYMA 4C7MA 3BSYA 2H16A 1NYTA 1CZRA 3VJRA 4ZRDA 3CVOA 4MGKR 1KTIA 1JI3A 3RIHA 4HDOB 3O8LA 4AZ0A 4RQTA 4MWTA 1YFKA 1QX4A 1S2MA 1YHNA 3CNNA 3K7EA 3FOWA 3N8IA 3DW3X 1XV5A 1SHLA 2O50A 4YCDA 4J8PA 1UWVA 2MHCA 2MSLA 2BJHA 4UNNA 2H07A 2TRSB 2I34A 2MWMA 2VPXA 1KO1A 3NT5A 1OFVA 4WADA 1E64A 1I4OA 1T8SA 2FGJA 4HVTA 3DVLA 1OZGA 3CN9A 4CDRA 5FAKA 3T9AA 2WA2A 3SJCA 4U7JA 3NKVA 3RHFA 1V1JA 1M6VB 2JCXA 2H2GA 1NQXA 1FSGA 5JZSA 5ADUS 2DHRA 1CERA 1TEVA 3KELA 3AW8A 3OZDA 2X0FA 1Y63A 2H0RA 3FCXA 2FFAA 2JGDA 3KYIB 4CM5A 4MYDA 3RABA 4IUBS 2QN7A 4ZMBA 2EG5A 1S7CA 5CMLA 2J0UA 4A0SA 1LPBB 1UZUA 2LV8A 4EO9A 3D6JA 4KNVA 1SD2A 3IBSA 2I1WA 4JYPA 5SZIA 4MV7A 3HXQA 5LR6A 5JT1A 3JRWA 2BEVB 4L5JA 2G9QA 2ZIEA 4BQFA 3H2JA 2XADA 5ARCA 1TK2A 2WOJA 3A1VA 1FP2A 3UG7A 1OI2A 4PR0A 1XTBA 2FQYA 5NULA 4J9VA 1OLXA 3WX0A 2SHKA 2F8TA 1Q5PA 4KCGA 4WOPA 2EQAA 1YH3A 3W5JA 1H8ED 2GR9A 4QD3A 1HNXB 4GPTA 4YAJA 4INJA 5GV7A 3ZHOA 3CKMA 5GVRA 3UA4A 4AURA 1R3UA 3IMEA 1U81A 5HRCA 1DIHA 2XE7A 4XH9B 5TT0A 3RANA 5JXWA 3MGCA 5TQ0A 1AY0A 2P67A 4PG7A 5EJFA 5DF1A 2W8BA 2CLMB 2C5LA 4GSLA 3F96A 1E7YA 4O2AA 3AFGA 4CTMA 4I9GA 3ZQKA 4BMCA 2JAQA 5CLLA 2HK7A 2GPBA 5IVKA 2QU7A 3LUBA 3UHPA 1JG6A 4XIIA 3MBKA 2ZDHA 5JI3E 3ANSA 4EI2A 4JVNA 3FG9A 3I12A 1TIPA 3GMDA 1H3NA 4C7JA 4F92B 1AQUA 2GHQA 4NV3A 1W75A 1S2DA 1SA0B 2HSZA 3M6VA 2ZJ8A 4FDLA 4WNIA 5LZ2A 1EE1A 5H7XA 4YRBA 2YDYA 3ICCA 5DM0A 1FFCA 4GMKA 4P0PB 1O95C 1ZD3A 2P5SA 1FDOA 4F5ZA 4MV3A 3BEOA 4IIUA 5REQB 3H1EA 4ENWA 5HSGA 3B9BA 3MWDA 3N6XA 3Q88A 1G8YA 1FTQA 5EYPA 1YDEA 5G3YA 3TW8B 4C29A 4V0LA 1M6NA 2DBYA 1SOAA 4TWBA 4TVKA 2FPPA 4NSNA 4UCQA 5CDHA 2R6HA 3HRKA 4HATA 2G71A 1Z47A 2XNHA 1U0TA 4R81A 3VR2D 4X1YB 4LE2A 1DFHA 1KS2A 4EM6A 3WP0A 4MUBA 3CLKA 4Y3UA 5C8YF 1ADJA 5BQXA 4P86A 4WCFB 1E98A 3C4JA 2FN3A 2WQ7A 1I3OA 1T9ZA 721PA 1A2KC 4K88A 2XNKA 4CM6A 1CUFA 1Y6QA 1TGVA 1HEYA 2XWPA 1IQPA 4HDAA 1M10A 3GX1A 621PA 2HWUA 3JWIA 1BX3A 3Q5EA 5KYNA 3I1FA 5DW0A 1UMKA 2P91A 3WLJA 1XL0A 3ESRA 4NMXB 4RVHA 4YASA 3SK0A 2FSGA 4ZCIA 4RE5A 2X6QA 2QRHA 4M36A 4XI9A 3A2LA 1U2TA 3KJXA 4KSYA 4WUTA 1Y1KE 1SMKA 4ARZA 4RIEA 2E87A 1EAYA 1C1XA 3I09A 3AB8A 3KQWA 3W9SA 4IV8A 1QWSA 2J59A 5JSUA 1VLHA 2ZDQA 1MO6A 1L8XA 2CYBA 3MHPA 3PL5A 4MEJA 1RWBA 4UBJA 4EA7A 3ABIA 4K6MA 3TEJA 2GXSA 1H6BA 3VGJA 3I62A 3HEBA 4JK3A 1CUJA 2QT1A 5HJ5A 1TQDA 5AUNB 4J3FA 1M6YA 2PIDA 1MQ9A 2NACA 2V7PA 2WQZA 2GASA 1T2AA 2DC1A 2IYVA 4MVJA 3G2PA 4D8YA 1RT9A 1ZD4A 5F76A 3OO0A 1CR0A 4RFLA 3STXA 1EG7A 1GARA 2X40A 4YP7A 1KYIA 3RFUA 1IVSA 2ZDGA 5HIAA 4JLJA 1GPH1 4XYGA 4LI0A 8AT1A 1Q17A 2VLIA 4J1TC 4LPKA 1Y81A 2OWDA 3KSZO 5ETJA 3TR5A 3UMBA 3EIOA 4UTPA 3KKOA 3V7WA 1QS0A 1Z7YA 1LI7A 3BF8A 4JASB 5K2OA 1ZD8A 2XUPA 1G6HA 1NNEA 4Y8VA 4M88A 3WMWA 3I52A 2LP4Y 5FBQB 2GUWA 4EELA 4H1WA 1Y3DE 3VV2A 5EIBD 2QV0A 2HSDA 1HORA 1XLTC 3NXKA 4M1QA 5EWLB 4LOAA 2QJOA 5AJWA 1E60A 1E2HA 2OCDA 1N3YA 3W3AA 4KK3A 4U9HS 3T15A 3ZWYA 1JEYA 1X7WB 5A71A 3W3AH 3TGWA 3ZW7A 1ZR4A 3O0TA 1ESDA 5IJXA 3BZBA 1LQUA 2C4UA 3OIUA 3SZOA 2CV2A 1B23P 4TMFA 3OCUA 3LVBA 4YMIA 5IP5A 3TUZC 4IUCS 5BV0A 2PTGA 4E12A 3DB1A 1V6SA 1YZTA 3ONWA 3SQNA 4O33A 2H85A 3GJ5A 1YZUA 2WYOA 4TYQA 1X1QA 2J0EA 3DO5A 4FBLA 4TV9A 3C15C 4FOOA 5I8WA 4URUR 1YE5A 1NOIA 1M2WA 1Q2UA 3T6KA 2VAPA 4GP6A 1WMBA 1MU0A 2HAEA 3T1NA 3ZXYA 3PLNA 5IUJC 3I6IA 3D6UA 2QMHA 3GRRA 3QWBA 1WPRA 4HN4B 4AX8A 3KOXA 3SE0A 3VR3A 2R4TA 5DHUA 3ZV5A 3VVBA 1N5RA 2M6RA 1SEPA 3DBHA 4IP0A 5TSDA 3DHYA 2FV8A 2ZULA 3OEHA 4MKRA 1U0GA 4N41A 5CPBA 2GERA 3L7CA 4EGAA 1GA1A 4BV2A 5CXQA 3RYCA 2JFNA 4IIBA 4EJMA 1OTYA 3VKWA 4EMSA 5HKLA 3ZTWA 2PZLA 4HFNA 1KIMA 1WF6A 4NNPA 3MJ4A 3TOXA 3VMMA 1SY7A 2PSSA 3H75A 5FCDA 1YJ5A 1FDUA 4RANA 4TXHA 1VMEA 3ZNPA 4UFPA 5TY0A 3E61A 3T61A 3EFEA 3COZA 3EEBA 4XQ0A 3VUFA 4MDEA 4KKVA 4I08A 1OFUX 2VSQA 2XODA 2V7TA 3RJMA 1E3SA 1XRLA 1NA5A 1RI1A 5CBPA 3LX8A 2HYDA 4P53A 2PX0A 4WK4B 3HXMA 3D8NA 2M1ZA 5EXDA 4R7GA 2DPGA 4B4UA 4LV5B 4C0KA 5F98A 3LL7A 4JP1A 3GJQA 1UM9B 2GPJA 4ZANA 3IOCA 3VU0A 1BQ3A 1NV9A 1DT5A 1LPNA 2Q21A 3C16C 3DCYA 2UYGA 2PG3A 3IHKA 3L07A 1OXVA 1Z13A 2W8ZA 5IVIA 3GLIB 2DLCX 1HT3A 3C98A 3K09C 3OHMA 1FDTA 4U7PB 1CC1S 3L6UA 1M8JA 3HJBA 2C1ZA 4KIGA 2BFBB 2FU5C 4Z4CA 1I94B 5J63A 3P27A 4O1MA 1H4SA 3VR0A 3WK7A 5C1IA 3GLQA 1JMKC 4BX2A 5BSGA 1NMSA 2ZUWA 4P82A 4GI2A 3W2GA 4AXXA 2V7XA 4MUJA 2GCPA 3EWNA 3NYRA 2XIJA 1ZP6A 4IZ6A 4L50A 5FOSA 1D4ZA 4GXQA 2NSLA 3TTVA 1BS1A 3DEFA 3L7KA 1I6KA 3MTIA 4QFBA 1RM3A 3M6UA 5DHRA 3O4JA 3RSCA 5EXSA 3LT5A 3IPYA 4V0KA 2EATA 3WZLA 4B3RB 2EZUA 1YRLA 1M34A 3E70C 3MXOA 3OU6A 3IMFA 3O75A 4CMGA 3QYPA 2UDPA 3I9V1 4F1KA 4YPVA 3KCQA 4JUCA 4K9KA 5FBVB 3COWA 5JAMA 3VO8A 2WJ6A 3KKMA 3WB0A 4N7BA 2JRCA 3CW8X 2O2JA 2PGLA 3T9DA 3N59A 1ZQ9A 1B00A 4K9RA 3TYXA 3BMCB 3TF5A 3AUKA 1MIOB 1MVLA 3EVCA 3R7DA 2CMDA 1XAJA 3FJ1A 1YDHA 4YR7A 4V1CB 2QZZA 1U80A 3U48A 3C6YA 1RAEA 5FWXA 2UYCA 1SIWA 1RVDA 1XQ1A 1IHDA 1RWWA 3D6MA 2OFPA 2PMKA 3U4HA 2BFMA 1X42A 5JR3A 3D7MA 5HUHA 1U2ZA 2JBAB 2I29A 2P68A 1SBYA 4C6SA 2V6IA 3BSSA 3EGCA 1DOAA 4EO4A 2CJWB 4X90A 3AHJA 3WXBA 4EGFA 3UXEA 2Q5LA 5IK2A 3T41A 4FIZA 1ZWLA 2GBLC 2IL1A 2M6LA 2FHSA 2GCNA 1FE8A 1U7UA 3D2AA 3PLRA 4GQIA 4ZGGA 3DUFB 2AS0A 2JI9A 2ZSFA 2XW6A 3QLTA 3AF4A 1OKKA 4X41A 3LVQE 4B3CA 5JLAA 3OF5A 5FPTA 3UJ7A 3ED1A 3ZKAA 4PSKA 1N8SA 3NUQA 2XUQA 5K7SA 5M04A 1BDBA 4YQZA 1Y7PA 4KXNA 1TB4A 1A8SA 1VMKA 4MROA 3HYSA 1BKSB 4HAVA 5JECA 4ZU1X 3TXYA 1T8WA 4CM8B 2OD7A 1T36A 4B75A 1N0IA 5FLKA 4RPGA 3TMAA 4HYTA 2RG1A 3Q7QA 3KL2A 2BMEA 4F6RA 4BNFA 5B3JC 2R5WA 1PZXA 3NCHA 3UK7A 3RS9A 5I7AA 4F2GA 3VR2A 5K0FA 3NVAA 4ZA2A 5DN9A 3AVWA 3UJ3X 4G0QA 4Q4HB 5G53C 1QJCA 4EMUA 1TI7A 5F3RA 5CFPA 3KTAB 1M2KA 3GEIA 1DJQA 3WHLA 3WA6A 4BQQA 4B3IA 2RHCA 3NOQA 1K6JA 3L1HA 1HDIA 5DP1A 2J3LA 1MJGA 1XBTA 4QQFA 4WINA 2P3LA 5M5BA 1F8YA 4MW2A 1G8HA 3HEMA 4HYYA 5B3AA 3NT4A 2WIAA 3A1DA 4E4YA 4QAQA 4DAEA 3BERA 4ED9A 1DJLA 1GPUA 4LZJA 2HK8A 2M1XA 1OT5A 3GQBA 3WSWA 3K3PA 5B2FA 3JQBC 3CURA 3L6EA 3AY0A 4LHWA 2IS2A 1IY0A 3JD0A 2WI8A 1SHUX 3R5HA 2VPZA 2J3HA 1E77A 1C30A 1FVOA 4CF3A 5B4TA 1MO4A 2HHCA 3ND9A 4BNDB 3M6LA 1EA5A 2WIJA 4BASA 1M1YA 1ZONA 1SXIA 3IAHA 3WYDA 3T1VA 5SY6A 1JJVA 1Y7HA 2ZYDA 2YXNA 3GLGE 2P9YA 5GGYA 3EVDA 3M5WA 1Z34A 1E1CA 4TVBA 4M99A 4DLNA 3P1JA 1C3VA 4WI1A 5GONA 5BSMA 5B6IA 3AP1A 4TMVA 4LYHA 1BJRE 3DDUA 2HCFA 4MPJA 1G19A 9LDBA 2XPCA 1RBYA 2WC1A 5B1DA 2BFEA 4C1BA 4P7BA 4GR5A 1LDYA 1W4AA 2V0NA 3KD2A 4UU0A 4YJGB 1N5IA 1Q0UA 4B6GA 1JFFA 2X1LA 1F4LA 3EXHB 1KE2A 4BFZA 1SKAA 2QV7A 1PJLA 1TZBA 3V48A 3M7IA 3G0OA 2ZYAA 2V7VA 4R68A 1TK3A 3S2IA 3HTXA 5LSAA 5FUMA 4J0HA 3MTQA 1T8UA 1HUQA 2A5YB 2QD5A 1U8FO 2GA9A 2V5AA 5K0JA 1DXHA 1VLZA 5HDBB 3RRFA 5FFMA 3LU1A 3FH0A 3G9TA 3EIQA 4HGRA 1PJRA 3O38A 2DFNA 4FXOA 3WGGA 2V7EA 4IL5A 5C7YA 2VRCD 4G36A 3CLVA 3E22A 3JW8A 3ND6A 4QLOA 1PR0A 1WLYA 2D3TA 4FCWA 1Z4IA 1KQ3A 1Q92A 3V00A 3CGGA 5F52A 4JKOA 4AO6A 1EFVB 2V0CA 3GPBA 5TC4A 4F5EA 1SOVA 1NW6A 2FJUA 2BGIA 4UUAA 2R4QA 3TM5A 3UAZA 1EFRA 3PNPA 4RTNA 3PV0A 4P38A 2Q7XA 5JNTA 5HMLA 1FQOA 5GZ6A 4HO1X 1N2IA 1L7BA 3LCRA 5C1PA 1QC5A 1GZ6A 4R8LA 4UMDA 5AOCA 1E2KA 1KR2A 2IU3A 2XDYA 4EJ2A 1DAEA 1JU9A 1Q74A 1AGXA 1TJNA 2CZGA 4R2JA 3DEIA 4KVAA 1DWQA 3QITA 4HUJA 3GLGB 1GLNA 1E2FA 1YRQA 2R66A 3NTXA 3UATA 1J09A