1KMCA

Crystal structure of the caspase-7 / xiap-bir2 complex
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
247
structure length
234
Chain Sequence
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQAARGTELDDGIQRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis/hydrolase
molecule keywords Caspase-7
publication title Crystal Structure of the Caspase-7 / XIAP-BIR2 Complex
rcsb
source organism Homo sapiens
total genus 79
structure length 234
sequence length 247
chains with identical sequence B
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2001-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1kmcA00
1BMQA 2H5JA 3V6LA 4NBNA 4ZVTA 3V6MA 3H11B 3S8EA 4I1RA 1K88A 5IARA 5I9TA 5LU8A 5IAJA 1NMQA 4D3ZA 2XZDA 3P4UA 4QULA 2HBYA 4QTYA 4EHKA 5IAGA 5IASA 2HBZA 2QL7A 3NKFA 4QUDA 3UO8B 1RHUA 4N6GA 3EDRA 5LUAA 2QL9A 1KMCA 3R5JA 1I4EB 2C2MA 4EJFA 4JB8A 4IYRA 2DKOA 3RJMA 4D3XA 3GJRA 3GJTA 4M9RA 2XZTA 5LU9A 2XYGA 3V4LA 1NMSA 4HVAA 3UOAB 3R7NA 4QUHA 2C2ZA 1ICEA 1RWPA 3P45A 2C1EA 3PCXA 4JJ8A 4EHNA 2CNLA 4NOJA 4N6OA 2Y0BA 1QTNA 3K7EA 4QUAA 4PRZA 3EDQA 2H4YA 3SIPA 2QLJA 1RWMA 2CJYA 2HBQA 2FP3A 2QLFA 3KJQA 4NOMA 4ZVQA 4JJ7A 5LUBA 4D3YA 4ZVSA 1RHKA 3IBCA 3NS7A 3QNWA 5IABA 2H4WA 5IC4A 3H13A 3V4OA 2XYPA 2C2KA 1RE1A 4HQRA 4QUEA 1RWWA 4JQYA 3S70A 2P2CA 1RWXA 4QU0A 1F1JA 4QUIA 1RWNA 4JR0A 1CP3A 4FGUA 4FXOA 4ZVPA 5IAEA 2Y1LA 4N6NA 4NBKA 2CNKA 5IC6A 1F9EA 3PD0A 3D6MA 2K7ZA 1I51A 4EHAA 4I1PA 3E4CA 3H0EA 2XYHA 5H0IA 2QLBA 1SHLA 4JR2A 2CNNA 3IBFA 4PRYA 4NBLA 4FEAA 3ITNA 4ZVRA 4N5DA 3D6HA 4FDLA 4QTXA 1CVRA 4PS1A 1QX3A 2J30A 2FUNB 4N7MA 4JR1A 4DCJA 1I4OA 2J31A 3R5KA 4LSZA 3V55A 2QL5A 4EHDA 3R6GA 2NN3C 1PAUA 4DCPA 3NR2A 1NW9B 2J32A 3SIRA 4HQ0A 3H11A 3DEJA 4EHLA 3BIJA 4QUBA 2J33A 5IAKA 5K20A 3R7BA 5JFTA 3DEHA 4NOLA 4EHFA 1I3OA 1SC1A 1RHMA 1PYOA 1M72A 3GJSA 4QU8A 1QDUA 4EHHA 5IBCA 4N7JA 2H54A 2H5IA 3PD1A 2CDRA 3DEKA 2HBRA 4QU5A 1NMEA 4DCOA 4JJEA 1RHQA 1RWOA 1GQFA 3GJQA 1K86A 4AWAA 4ZVUA 1SC3A 4QUGA 3V3KA 5IBRA 4NOKA 2H48A 4QUJA 4AWBA 5I9BA 1SC4A 4JQZA 5IANA 1RWVA 2H65A 3DEIA 4ZVOA 1SHJA 4IEFB 3R7SA 4PS0A 2CNOA 3H1PA 3KJNA 3R6LA 1IBCA 3D6FA 1JXQA 4QU9A 1RHRA 2CJXA 5IBPA 1RHJA 2AR9A 2FQQA 3OD5A 3KJFA 4AW9A 1RWKA 2C2OA 1GFWA 2H51A 2WDPA
chains in the Genus database with same CATH superfamily
2II6A 2H5JA 2R1ZA 1GGHA 3AEXA 5FX2A 4LDAA 4Q4HB 2AL7A 2ODEA 3WZ2A 2IK8A 1F48A 1ZWKA 3SP1A 3MAAC 1YUBA 3WLPA 3VZQA 3LL4A 2WT8A 4IVQA 5HBRA 3EIXA 5JASA 2D4AA 2AGVA 4GRIA 3SS9X 1W5SA 2JA1A 3NBQA 3PVCA 1UC9A 1P1RA 4L6AA 2DPHA 1J1IA 4YJGB 3CSSA 5CT9A 5FOWA 1CCWA 1EU1A 1W76A 1XFAA 5AI8A 4KR9A 3TIXB 2ZUEA 4W8GA 3PJRA 1QFYA 1N3LA 1KK3A 4DSOA 1OLOA 2LW7A 2WABA 4UREA 3N0RA 5LOVF 1FE8A 1SUSA 3N2EA 1XMIA 4ZALA 3TOCA 4MNTA 5H83A 2HDNB 4BLTA 3CSDA 1V1MB 2EQAA 5EQJB 3TQFA 2OFFA 4CM7A 3CUTA 2WM3A 4QODA 4I5FA 1PX0A 2ORWA 4YRTA 2BDTA 1P44A 5LM3A 1KVRA 4PSDA 1HZZA 3AP1A 3AR2A 3O4RA 5E1DA 3WL6A 3R4CA 4DMMA 4P8RA 2K87A 4GT1A 3LUPA 4EFMA 1BC5A 4OMCA 1ZW1A 1WB6A 4MRMB 2ZRFA 5HBGA 2W7TA 3I0NA 1YI8A 1IB0A 4KXMA 2D1RA 4UHDA 2IFTA 1L5QA 2HXGA 1W88A 3ZHOA 3KDAA 4B6JA 4FB5A 4HFNA 3NT5A 2GYYA 1KO7A 2B37A 1FP2A 3RSZA 3OX3A 5DM2A 3I05A 1ISGA 3HYLA 2YVKA 1U9JA 2FPUA 3I9NA 4UM8B 5HMMA 3RREA 1LU9A 2QY9A 3EBOA 3ND8A 4B4WA 1Y8RB 3EPKA 2XA9A 2B8JA 2AQ8A 1BZYA 2HC9A 4MW1A 4B6RA 3WRWA 3GP5A 4WNAB 1TI7A 1FX0A 2ISQA 2Z83A 3ETJA 4HWGA 3TLEA 4UEKA 4YMIA 4YRRA 4G36A 4J4BA 4IVRA 3DO8A 4WA8A 3NBUA 5C8YA 4X3OA 3BMNB 1FTGA 3JWGA 5GJWC 3VM6A 2CXOA 2ZRDA 1YZYA 3NXKA 3SEAA 4JA2A 1ORRA 2X9VA 1RQLA 3IAM6 1C7FA 4HPXB 4KMRA 3U1TA 4ZJYA 5C5IA 2QMUA 1WR8A 5EN4A 1RKQA 4ML3A 2DEUA 2JAPA 2ZRIA 2G80A 2JW5A 3O31A 4BFLA 2H92A 3DEJA 5FNZA 4BP1A 3KETA 2ZZNA 2JD1A 1JAYA 1PE0A 2BN4A 1WAMA 2J4CA 4D9IA 4F2GA 1DBVO 4TSKA 4H3SA 2QYHA 4OSEA 2H4JA 4M88A 1PN3A 5HE8A 4HDAA 1N2IA 1UT6A 3PJFA 1FSPA 3U80A 3KT8A 2NUPB 3DR5A 1RMYA 1AS0A 1ZL2A 3HZZA 1N2EA 4TMXA 4EW6A 5IMSA 2YASA 4F7WA 4YP9A 5GJVC 1HDXA 1FP1D 1ZISA 1I4TD 3NFYA 4I66A 5T5QA 1VTKA 3Q6NA 2F2TA 1OHHD 1QVAA 3M4NA 1P7ZA 1ST2A 1USKA 5CK4A 5FOSA 1OHHA 4IZ6A 1S1MA 2A1UB 3D8RA 4LRQA 2VL7A 421PA 2AS0A 5ALRA 4D9FA 4TT3A 3WGZA 2PMDA 5JH7F 5HDBB 3MAGA 1FRNA 3HYTA 1C7IA 3OECA 4MKHA 4ZAVA 2XQVA 4ODIA 1V9SA 3CLTC 5KTOA 3ZI7A 2O7SA 4YPVA 1NRJB 2OV6A 2OZLA 4NBTA 1AQ6A 1VSBA 1JTFA 2XHZA 3RAEC 1KO8A 4J0GA 1VXRA 3GHHA 1KMIY 3DZGA 4XWKA 2FG7C 1JJAA 3GN2A 5ECYA 2NNWB 3PDIB 4IR7A 2QZ9A 2F1IA 3F71A 4MVCA 4LHSA 2HU2A 3X43A 3O8CA 4HNRA 3LX5A 3DT8A 2PH1A 3G1WA 3PNQA 1W1IA 3OPYA 4Q19A 1VLLA 3ZV5A 1FVFA 4E7OA 1YK0A 3L40A 3JZFA 4RF3A 1DCMA 4TZTA 1L5NA 1CWUA 3E9CA 1BVYF 5B6JA 2C4KA 2W37A 5I4CA 4EKIA 1TIBA 4D4HA 1CB7A 3FVTA 3THOA 1SKAA 2VJCA 1JQKA 1QIHA 2F1RA 3QKRA 4BFVA 2IY9A 2PQ2A 5I3CA 5J5VA 1PJSA 3K92A 4IIJA 4JASB 1VPDA 3KZNA 4PLFA 4JI4B 3CNHA 2P9ZA 3ZLJA 2GK4A 2YZMA 4MRAA 1V35A 3EBLA 1M1YE 2OPBA 4Q03A 1Z8FA 4NFYA 5TVKA 2PK3A 3JPWA 3SJZA 2HTEA 4AXBA 4BVJA 1LBQA 3JWEA 3WL3A 2UZ0A 1M1YA 3GLQA 3LDUA 2HJSA 2OAGA 3KPWA 3TXAA 4H2DA 2XA2A 4IDBA 1T5BA 1COWD 2WJVA 1L4NA 4RESA 2D2EA 1COWA 1V1RA 4GX2A 4M37A 5LQMA 1ESNA 3UXHA 1FSFA 1JMYA 5CCXA 1EX1A 1I7PA 2FZ4A 4F9TA 6REQB 1CP3A 2WHXA 4HZUA 3TQSA 4G0MA 3GUCA 1N8NA 2IQIA 4WBXC 2FN7A 4XDZA 3MM4A 1P1JA 4OQLA 4EO4A 4MWGA 4HD8A 1NBHA 1AA6A 4MUAA 1KMHB 2EL7A 1NF8A 4FYIA 1Z6ZA 4J16A 3CRRA 4MEAA 3SSNA 4D8WA 1M8JA 1PU2A 5JMTA 5HS6A 5K0ZA 3NHMA 1CU1A 2ZBUA 5AHKA 2WZDA 2PWZA 2WK1A 2IUEA 2FUNB 2RG7A 4IVNA 2UUBB 4MUNA 2WJZB 2RHOA 4NNOA 1SUEA 3PNPA 3QELB 1Q0UA 2DPYA 3VGJA 4C3UA 4BU0A 2VP9A 2D0PB 2IY7A 1ZCJA 2ANBA 1DC8A 1DG1G 2ETVA 3LUCA 4M9XA 1CEYA 4GVLA 5ADVA 4PCUA 1SUIA 2DQ4A 3JVIA 4JLJA 1OU0A 1Y3BE 1G55A 4F3NA 4MV7A 3ROEA 5IVHA 3BTSA 3C3YA 2QTVB 4UU0A 3A1SA 1NPTO 4M7PA 4MYHA 5F9FA 3GLFB 2FEAA 1Z0JA 5A03A 3LVFO 3L79A 4KK3A 1GU1A 4MV8A 2DG2A 1K7YA 2OM6A 4HATA 3O2QB 1QLWA 4BV9A 2QW8A 2JCYA 2FEXA 3N0TA 3ZUPA 2XT6A 4XSVA 5DHTA 4U5XA 4B2IA 3WJ2A 4DV4B 1SEVA 1PW5A 2ECOA 2EFYA 4RJKA 4YJ2B 1K6XA 3VDMA 4JI3B 1TYCA 4B6PA 1CY8A 3R6LA 2GBFA 3BRQA 1FVXA 4Z2AA 4XCQA 5EJ2A 1ZZGA 3HHPA 2QE6A 2YX1A 3B3QA 3FVRA 1OH8A 4RF4A 5F2EA 3R40A 1L5HA 2VKTA 4AP6A 1XTJA 3KK0A 3VNAA 2VDJA 4E70A 4G0PA 1SUWA 2CXRA 1W5AA 1XVTA 4V0NA 4UQPA 3B1WA 2FOXA 4X91A 2GZ1A 1TC1A 2WD8A 4E03A 5DV9A 1HLPA 2EDAA 2Y66A 1W1UA 4FE3A 4IXMA 5BSUA 1RVV1 2ZRGA 1XKQA 4IDGA 4ZEMA 3O74A 4FE4A 2CFIA 1P0CA 2VK8A 4MYTA 2WVAA 3VKVA 1DAOA 1CDOA 3VDQA 1NYRA 2HV9A 4C0JA 4EH1A 1ZM4A 2G63A 2I33A 2OD7A 2PKQP 3F1LA 1C0IA 2FP4A 3M4JA 1XZCA 2E21A 3N75A 3P9RA 5K45A 3HJFA 1IG0A 2X0IA 1E3EA 1Z28A 1EXWA 4M98A 4J0IA 1BOFA 1IZ9A 2Y1DA 5JSYA 3IBSA 3VU9B 3IERA 1HETA 1NVWQ 4PLGA 2R4TA 3I76A 1CY4A 3BFVA 3RJ5A 1Y42X 1I4DD 1U9IC 4QEDA 4ND5A 3T9DA 4OMUA 1QE3A 1MD9A 4O2AF 1G41A 3ROXA 2FMFA 4HTFA 2W6CX 3PQ2A 1GFZA 5IEJA 3K0CC 5THXA 3AINA 4O4LB 4XIIA 4V0QA 2PMCA 4MIOA 3OVMA 2RGDA 3NYRA 4D9NA 3EF1A 3WWDA 4FYJA 1IN7A 1JG7A 1LPMA 2OB2A 2XQIA 2W4MA 1XCLA 5G40A 4JR0A 5DNDA 3HZOA 1CT9A 3IOCA 4HWTA 5GVRA 5AW9A 5TS3A 1KEUA 1DFGA 1F9EA 2P35A 2QJRA 3M81A 4FYXA 3DH0A 1F4LA 2CNWA 1FDSA 2R7MA 1XG5A 4XYMA 1NG1A 3S68A 2XQJA 5TQ0B 4WCFB 1QVZA 2ROQA 1FYFA 2VEOA 3EXFA 2CZQA 4S1TA 1VKJA 2VDVE 3IVMA 1BQEA 2JI8A 4XIJA 5TRTA 1FP6A 4B7AA 5M5BA 1MO3A 3KYDA 4CIXA 3W9BA 1G8YA 1QOPB 1WABA 4LK3A 5HUQA 2HM7A 4C6TA 1NW7A 5EWMB 5MFZA 1D2EA 1WD5A 3MYYA 1XLWA 3CO5A 4RVSA 2HA0A 3EVGA 4CLOB 3S8YA 5J5CA 2NYRA 2O0JA 2P27A 1KXJA 4Y2SA 5JD3A 1J9GA 1YASA 1L5VA 5EI5A 4M6WA 2XCSB 3L5KA 1WV0A 3TSWA 3GI1A 3AJRA 4X8HA 4L16A 2QTRA 3LYAA 2V0GA 3KEGA 5D7BA 3Q5EA 4NAVA 4GZLA 2BR5A 3KOYA 4JL6A 4ZI3A 2AZXA 1JS1X 3O2JA 1TPZA 3AB7A 1AKYA 2M6KA 2XVZA 1AXRA 1L4GA 4G0UA 2R85A 3F9IA 3HP7A 3O1JC 4HB4A 4LY0A 2OILA 4W7SA 5K51A 4BKQA 5B30A 3HKBA 3HBFA 2VWPA 3KOMA 4HEQA 3UHFA 5CAEB 1E9CA 1N92A 2OEPA 1QB8A 4LMRA 3UANA 3GJ4A 1UODA 3M9LA 4MYRA 4UEQA 3SZUA 5ALMA 1E1DA 4JGGA 2QPOA 3HA3A 2VA8A 2GZ3A 3AUKA 3LAWA 4K86A 1JQEA 4K9PA 1IBRA 1U3TA 3K2IA 4O8ZA 4ND8B 4PR0A 5EYPB 4DOMA 1VPEA 2Y1CA 4RFSA 4TTTS 1BD3A 4QGSA 3AG5A 3PHJA 5I9TA 5BW5A 3T5AA 4C0BA 8AT1A 1MJ5A 4JX9A 1Y7TA 2QW0X 1JV2B 1NQAO 1IHUA 3GBSA 5HTKA 8ADHA 3OUZA 3D2BA 2HF9A 1S2NA 1UBEA 4AJ9A 3F4BA 1DBPA 2ZS9A 4LWZA 2ZB4A 3CPEA 3DXYA 1IBKB 1T2NA 1RZ3A 5FDFA 3W5SA 1ZHOA 3G8BA 4M1ZA 2B8WA 2D74A 4CMAA 1SIBE 3N59A 4MUJA 2WINI 3FBWA 2NVOA 3CPSA 4ISBA 3R7NA 5LIPA 4UPVA 3HE3A 1GDHA 2AFVA 3TZQA 5J59A 2BGJA 5HGJA 1SUPA 5E4JA 3ZHUA 4RL6A 3MGKA 4PXYA 4O5OA 1WD7A 4D02A 3DXXA 5FPSA 3L8CA 4EL5A 4Z54A 4F72A 2MU1A 4GOKA 5CYFA 2VTDA 2XAAA 4XQCA 2VFAA 4YONB 5IXYA 1LPPA 3MUEA 4IGKA 3S55A 3LO8A 3DP9A 2BFEA 3HPRA 3Q3VA 4I1VA 1NGSA 1N25A 2EYQA 4H3HB 1DAFA 4LPSA 2XEXA 5EIFA 3G0OA 1JG6A 1PVVA 1H85A 1XHLA 3IAS1 5MN4A 1F2UA 1QGYA 1XXLA 3ECCA 4ZPXA 4C9BA 4I50A 5JZ9A 4JJFA 4LE2A 4EJSB 5CEJA 3WIOA 3NHYA 4DZRA 3D5QA 2OBLA 4BAUA 1ABBA 1VSVA 2XYHA 3WB0A 1UQRA 5I6DA 2FPPA 5JDCA 1YU6A 4MV5A 5IK2A 2WLSA 1V8OA 1G9SA 4N5DA 4QYSA 5IVIA 3OUUA 4G4SP 3TM5A 5GJBA 1MUUA 2XNSA 3RU2A 1BCSA 1EWVA 5TC4A 5IDQA 3WB1A 1UM8A 5JUWA 5CFQA 4RA6A 1E7SA 2H07A 1DAGA 1JFVA 3CY6A 1RJWA 4EHBA 1TFUA 1GZ3A 1QGUB 2WJ4A 3OOJA 1JL3A 4NHOA 1Y3AA 4Q3KA 3TW6A 3W7VA 2VYVD 4B87A 3OFSA 1Z6QA 3VHLB 2DOKA 5G0SA 4ZQBA 3IP1A 1PJAA 4XVUA 5JADA 4P98A 5BN4A 1KOLA 2HF8A 2M2IA 4IEEA 2XB2A 2R7AA 4UM9B 2D5CA 2NZUG 3OQVA 3KQTA 4JROA 1COZA 2IDMA 3PPVA 3CUEF 5A2GA 1PFVA 3WWYA 1FP4B 1ONNA 2MDTA 1NRIA 1QFSA 2KB0A 1E79D 3S99A 4F6LA 4YMHA 1AGRA 3CLRC 1O95D 1D2CA 2PXAA 3WQBA 5F7XA 1O95A 5ECGC 1POXA 4GLJA 3K1JA 1NU8A 4W1SA 4UZFA 2ZB3A 1KFKB 1L7BA 3QI2A 4ZDJA 1KIFA 1ZJZA 2Y2VA 5IBPA 5AI5A 1ESCA 3PENA 1XAIA 3PE6A 4EVSA 3HXLA 1GGNA 3LT5A 4HXEB 4KXXA 1A9ZA 2PT9A 2COKA 5F4BA 5L45A 3GNTA 1E98A 1B8NA 3AUJB 3DV0B 1EA7A 4MP3A 4B3JA 1KJZA 4UBOA 3G5UA 1LNQA 4KZKA 3I9V1 3CTPA 1H6CA 3FHCB 3GP3A 5EAIA 4BFYA 4U6NA 3VDNB 2B0JA 1OXTA 4C7OA 3MCAA 3OPNA 4U9HS 1ZM3A 2DLDA 3OBBA 3C5VA 1WHSB 4GI5A 4YJ3A 5SY6A 5BPHA 2UXBB 3GAAA 3IRVA 3OFJA 3B1ZA 4BVGA 3HHEA 3DVQX 3I2IA 3FGNA 4X63A 1WU8A 3I2YX 4H1VA 4LRYA 2L69A 4DS3A 4QXAA 3T9CA 3L3BA 1GPH1 1RWPA 3V8EA 4ARIA 5CA1B 4EF4A 1LI7A 1Z63A 2GHTA 4QC2A 4Q4JB 2P69A 4D3DA 3I34X 1E9EA 2EHDA 2UUOA 3PE4A 5GGYA 3CVWA 4LVOA 1M2JA 2CT8A 3RSQA 1RYYA 4Y9DA 1G3QA 1GTJ1 2O8EB 2L0XA 2ODPA 2VN8A 4MJLA 4ZOBA 2BHNA 3OX4A 4RA9A 2O2CA 4LOKA 4XLTA 4CV2A 4MP8A 1BDJA 1QG2A 1RR6A 4E3ZA 5JMPA 1E3IA 4NXNB 3IX7A 3JQ6A 1GRCA 1LV7A 4MPJA 4RIEA 3V4OA 1HL3A 4FFMA 3JATA 4ZYYA 3OM8A 4MS4A 2GM4A 4TWJA 5B1IA 4W5OA 4E2FA 2WIJA 1C0EA 1V2GA 3ZXSA 1NQOA 1VJCA 1V7ZA 3D2CA 3H4VA 5HRCA 1H1TA 4KVZA 4BLWA 4E6PA 5KUTA 4Q6WA 3IV9A 4M89A 2B7BA 5F64A 3D7RA 4A73A 1WF6A 4ZWNA 3TOSA 4D4JA 1DQPA 1O57A 4OEHA 3R5XA 5BNWA 1OGJA 1IY2A 3D3QA 5TEWA 4MWZA 4DANA 1U2GA 1BQ4A 1L5SA 1NPDA 1I9CA 3OIFA 4I5EA 1OD6A 1KL7A 1XHEA 1G9XA 2VHQA 3GVIA 3LTEA 3ZDEA 1BCRA 4BWGA 1W9MA 4DGQA 4B3GA 5DLYA 3QGMA 1U81A 1UQUA 1XVLA 4FC7A 1N6NA 2FUG1 5DLPA 4FR0A 3AHIA 1NZDA 4PC2A 3PG5A 5E4TA 4CKWA 4ZTZB 3DFKA 4Q02A 1SFRA 1P3JA 3KJEA 1ZOLA 3ETGA 3FZEA 1JUDA 1P17A 2BEKA 2XRMA 3GVCA 2IYVA 3QMWA 4G84A 3GUHA 4O2BB 2PRSA 4BX8A 4IDNA 1F4PA 4BCCA 3WMEA 1NW3A 5KYYB 3E3MA 2OHHA 4N5MA 4EHJA 5KPJA 1AZTA 1J7JA 1OV6A 1U1EA 2Z2IA 3MTBA 4S2UA 3UYLA 1J2TA 3C1TA 5BSVA 5K3OA 3IKTA 4EEKA 1F6WA 2Y1KA 4TKLA 1AKQA 2ENWA 3BXXA 3RTAA 1EZ4A 4GEGA 1KI1A 3DEKA 3TIVA 4KR3A 1JA0A 1IJKA 1GSOA 2XE8A 1CZNA 4EGSA 2GXUA 1GT6A 3QXHA 3T3IA 1K86A 1X1EA 2O8NA 3CH5A 4JYZA 4AF7A 1L4FA 2AFRA 4B3HA 2Y93A 1Y4ZA 3T0FA 5DHQA 3FZGA 1Z74A 3R9XA 3UOGA 4K46A 3VDXA 2O8FB 5K4GA 4UU7A 4R2XA 4FJ1A 1JKMA 3KQYA 2ZW9A 5G0VA 3RBXA 1SVMA 1QPZA 2OP0A 1FXUA 1T0HB 1PSWA 4P5DA 4PO8A 3NGXA 4BZXA 4PSAA 5CEEA 2XDQA 3PDUA 4BKMA 5LMCA 2V3CC 2F55A 2I6GA 2EKBA 5IYZF 4A36A 2YYSA 1AIPA 2HFJA 4XJXA 2GZMA 4XEUA 4YYEA 2V0CA 2GJKA 2HQOA 1EI9A 3HVIA 1G66A 3ORYA 1O0CA 4HYTA 2NU9A 4LOJA 4N48A 1IB6A 1M0TA 1NTRA 4MMYB 3TRKA 4RL4A 3RUFA 2VDQB 5IT5A 4X8MA 3WQSB 2GD1O 3ZJTA 1GAEO 3SIWA 5K99A 3MQ4A 4BGUA 1TYBE 5A7FA 3GEHA 2WNSA 3CNQS 3O73A 5AHOA 5T3UA 1CUJA 1A9QA 1D8AA 1UBNA 3RT9A 2MR6A 2Q3HA 4B82A 1ODLA 3HB1A 5DI9A 3TZLA 5CLJA 3J81A 3VPSA 2A59A 2LCIA 4IGFA 1ABFA 3ZHVA 5I8ZA 4DUPA 3L2OB 2C00A 3LBAA 2YZNA 3M9WA 3MWLA 3SSAA 3QEJA 4JP1A 4R0NA 3AY6A 4DQDA 1E58A 1R0YA 4W7HA 3RAJA 3VYTB 3UMVA 1G21A 4B6SA 1B2RA 2DWQA 3PC8C 4QPPA 1N34B 5JYCA 3A4TA 3OQOA 3AUAA 3QYAA 2YZ2A 3V1UA 2BUAA 4D4LA 1NJ1A 2E89A 2NXJA 3WRYC 4C4AA 4I6EA 1JVNA 4A0FA 4D79A 1JEAA 1L1QA 4GBGA 4RMJA 3C5HA 4FJ2A 5EP4A 2VRNA 3GFQA 2I71A 4I0WB 5DWDA 4F5WA 2CXNA 5LCXA 1GTZA 1MVOA 1HG0A 3ND6A 1MGPA 4NV0A 4D46A 2G6BA 3KZOA 1TECE 2MJLA 1ZRSA 4GMKA 3JQQA 3M6IA 4M55A 4R2KA 1TRKA 2Z2YA 3WB9A 4QUIA 4TM7A 5KHAA 4FB4A 3BQMB 4PZPA 1VLJA 1Z0FA 4IXWA 2IZZA 3E18A 3BGDA 4U7PB 2PS9A 1JKFA 1CY1A 1RQRA 3MFYA 4CLEA 4EPTA 4F8EA 5IT9A 3VR3D 5HIJA 1NUQA 4WBSA 5IM4A 5JPDA 1D6JA 1WCWA 4LE1A 2ATVA 2ZI6A 3CURA 2GHRA 4KV7A 1TTTA 1T0BA 3A36A 3OWHA 1L5WA 3QSGA 1E1NA 2OO5A 1I4OA 4M1YA 3KQUA 3KFLA 5JI3E 1WY7A 2HWXA 4LSZA 1F2VA 2ECFA 4R98A 3VUEA 5KX5A 4LZNA 5CRIA 3O6VA 4JKYA 1XRJA 3L4BA 5JBIA 1L1RA 4DA7A 5EA2A 3AEYA 3ZN2A 1YV9A 1PAUA 3KYCB 4YGYA 4R1NA 4FKMA 2I4MA 3U7QA 3MINA 3HEMA 1DARA 4DBLE 1EEHA 2WB2A 2FN9A 3MSXA 3QOWA 1VLZA 2HA2A 1VFPA 2R6R1 1RLMA 3NHSA 3ZHRA 4XD2A 3STXA 5E6UB 4CM4A 4ZJUA 1M73E 3MBIA 4OA8A 4QPCA 4XM0A 5F35A 3TX6A 4LX0A 1MXFA 1RJ9B 2Y67A 2YVUA 3IP6A 1NY6A 5J2UF 4K9OA 4NOKA 1P75A 1C3EA 1QO9A 1Z2AA 2HMAA 4BE9A 3WLNA 2VWGA 5JS7A 3G8DA 1WW2A 4HUQB 3SF8B 3LHIA 2UYYA 4RHCA 1W85A 2NU8B 1PG0A 4FMCF 1PT6A 3GCDA 1KI6A 3QY0A 1H5NA 1N5KA 1P61B 1Y8QB 1FTWA 4DCVA 5L3SB 3TFWA 4JWKA 3T4UA 4L78A 1YDHA 1O5OA 1K8XB 3IA2A 4GICA 4ZV9A 1W4AA 3B52X 5AQ1A 2HLNA 2AZ4A 3L1KA 3O3MB 4WJZA 3R3SA 2NO7A 4RANA 3S2YA 4HVTA 2WM8A 4DG5A 4J49A 1IY8A 1KE2A 1CNFA 2A9QA 1D0SA 2VUIB 3ZHZA 4B6GA 4L8YA 3RGWS 3P0RA 5TV2A 5KZMB 3BSSA 1CIJA 2XB9A 3GD5A 1K7SN 2QI9C 3KHUA 3QLEA 4FHDA 3FMPB 3JALB 2VDLB 2IU0A 3D0OA 4I4TF 3WA6A 1JH8A 3FPJA 3TYXA 2YMMA 3MWEB 1IHDA 1Q83A 1RRMA 1OXUA 2QJWA 5L8VA 1XEAA 3H5NA 2FPXA 2JS7A 3ISJA 1CJTC 1RRGA 1VE6A 1NV9A 1XZAA 2PFKA 2Q7XA 2CMHA 3IEUA 2OBBA 1GA6A 1Z6TA 2TYSB 2WSIA 4FHZA 4QPDA 5FPQA 3AF6A 1WV1A 3ZPXA 1KZGB 2J45A 3MA0A 4MIEA 1VA4A 1AC5A 1P8JA 1Z6XA 1Y6JA 2HF2A 1ZD8A 2F8LA 2HL6A 1EINA 4OU5A 2FW1A 4QJBA 4DUZB 2PT7A 3GNLA 4KO3S 4DCCA 3N39C 1Y9AA 1GPAA 4PZ9A 3E5RA 4TXHA 5DRYA 1O96B 1PDVA 2NO4A 3OQHA 3ZWMA 1V1JA 4OSOA 3WGLA 3D5TA 3I2GA 5KOHA 5EEHA 3TLGB 5LR6A 4NAUA 3V00A 4U4AA 1E9BA 3JYLA 1C8KA 1BMDA 3N05A 4YCJA 1H5QA 3WGNA 3OC0A 1M6VA 1ZN9A 1E8DA 4IHQA 2I0FA 5C35A 3FZQA 3A37A 4Z4FA 4ZOCA 3HO6A 3MWDB 2QQFA 2V7QD 3X1ZA 2DPGA 3AR9A 2D6FA 2KHZA 2XB6A 3PGMA 4KIWA 2H9YA 4X3PA 3E2IA 3LWDA 4BFSA 1KNXA 3TH5A 1KI7A 1L8XA 1LK0A 4CM8B 3Q7QA 1ZINA 1BS9A 4P4LA 4P32A 5EIXA 2XWSA 4KB5A 1AQJA 4PVCA 4DLXA 4NL4H 4EB6B 2GDZA 2XQKA 3NAMA 4MAFA 4EG3A 2BONA 1N0UA 2RH4A 4IQ8A 3LC2O 3R5KA 1QRTA 2BGGA 4RS3A 4JT2A 1W5FA 2BM9A 1C0LA 3DQPA 1JU9A 4HEA6 2QMYA 3LY7A 1ZUD1 1M75A 3AONB 2IIVA 1ZCFA 3LXUX 2VSNA 3O47A 5K3BA 3UXEA 2ATXA 4C3ZA 1RWQA 3ZVNA 2JI7A 1H2EA 5BSGA 5A4DA 2NXNA 2ZE8A 2ZANA 2V55B 3WQHA 4GLLA 1GT91 4OOEA 3VU0A 4KITB 3IEMA 1E69A 1QIGA 3PQEA 4CF7A 4GSKA 3R2JA 3QKWA 3IE0A 3RH0A 2QPAA 2DECA 3G0CA 4HAIA 4ZK2A 3W3AD 4BHTA 3EOZA 1RWBA 4Q01A 3BAZA 4DMHA 4HXYA 4QYXA 4REQB 1WKBA 2GN9A 4H18A 5F1OA 5JXJA 4V0SA 1K97A 5KNLA 4Z0TA 2DLNA 4Y2QA 4IBOA 1ISSA 3C6KA 3G2IA 4PLCA 1SHJA 3DW3X 3M6MD 3Q88A 5ADHA 2Q07A 3I4CA 1BKDR 1X9IA 1JDBB 1B73A 4NAHA 1ZC4A 3GFFA 2RJ3A 4QDKA 4YXWD 4L75A 1GA1A 2AN1A 4B0PA 4AX4A 2PANA 1MDFA 3KZKA 1Z25A 4JNCA 3TEFA 3RQSA 2F00A 1SB8A 3JQPA 2P9TA 1KOJA 4IW3B 3VH4A 4CL0A 4QYWA 3WL8A 1W4CA 3G7NA 4EZBA 1A9TA 5C7OO 4PO9A 4DLLA 1JKIA 4KXQA 2I2FA 3EQ8A 2Q8PA 1PTJC 3BA6A 1N8TA 3DE1X 2BWJA 3FD8A 2RK4A 3JQEA 2ERYA 3WV4A 1L7XA 5D00A 1DKQA 1VG0B 1GVHA 1SQ6A 4A2PA 1NULA 2PKQO 5BR4A 5U1PA 3LC0A 1TIKA 4DRXA 2HK6A 4LF4B 3LCUA 2P8JA 2ZSUA 1RLUA 4OHWA 4BAGA 2WJAA 1E3WA 3F8TA 1WBBA 2WT9A 3CR3C 2QT0A 2H4YA 4WE3A 3IP9A 3CE6A 1Q7CA 3MILA 3QPWA 3QYPA 4G4GA 2XCRB 2BMAA 4HS4A 4DR4B 2O4CA 2Q2QA 1L4YA 1HLGA 3FTDA 2Y92A 4A26A 1QO0A 4IDAA 4HUJA 1X39A 2W4QA 2YV3A 1J7KA 2FX2A 1X7ZA 2QROA 3K9BA 4CN9A 4GPAA 4F3YA 5K0JA 4HNSA 4YUXA 1YQQA 4JEIA 2PN1A 4OFXA 4E5PA 2JK1A 4L4RA 1JIIA 4QYIA 1LRJA 1QOQB 1WMSA 3SDZA 3FN4A 3UT5A 5EIBD 3OCYA 4V3BA 3GT3A 5B4VA 5ALZA 3DOOA 3T15A 1O58A 1HT2E 1Y89A 1YR8A 2J5XA 4O08A 3MRXA 2RAPA 3M0EA 4H3KB 4EBFA 2VLBA 3EVFA 4ZAWA 4OL9A 3FMIA 1KIAA 1BDBA 1YC2A 5EP3A 2QMZA 4OM7A 1E92A 3OCVA 2I6UA 3K9HA 1CQZA 4N9QA 2C07A 4OJMX 3OLYA 4RKEA 2CD7A 5DO9A 4YRNA 4JI8B 4ZJPA 2GPSA 1QIEA 3W7AA 4OQNA 2KW5A 3MPUA 3LZCA 2EDCA 2N0SA 2IHKA 2FWJA 5FR1A 3SM9A 2NSYA 3LQRA 1EFKA 4GECA 1XPOA 3NV7A 4YP0A 3ZGVA 2O3UA 2RG1A 3FHJA 3GQVA 1QH8A 1N36B 1PT5A 1V8ZA 2XCUA 1XK7A 5BW4A 1GAWA 1YVEI 2OORA 3Q0IA 3H5RA 4KXWA 2EFHB 1P5HA 3HV2A 4JELA 3ZIAD 2ZCVA 5E8RA 4B84A 4IXTA 1ZOOA 2RB5A 4CM9D 1ZJ5A 4Y98A 1ODFA 5A02A 1A9YA 5H9VA 5A2QA 1FIUA 1IM8A 2VZLA 4OA5A 1A2BA 4ZVUA 3W6PA 4AJKA 5F7OA 1KU0A 3G5AA 1C0PA 3F78A 3PDWA 4FYYA 1EXVA 5B55A 3CVUA 2PR7A 1BFKA 3TD9A 3EEBA 4AN0A 3KBBA 2YBDA 5JZVA 3R44A 5J5AA 4HRXA 4LA4A 3UUFA 2ZBDA 4P38A 3JVEA 5KYWA 4Q7EA 3AILA 1TFRA 5KO2A 3AKDA 5C53B 1TJNA 3BMOB 4EBBA 3DUWA 1WL8A 4Q7MB 1I4LD 2QJOA 1II9A 1DT5A 2G40A 1V8FA 2C3OA 1PJ4A 5DTQA 3WGIA 4J9VA 4GKAA 5ESDA 1GKYA 1YT5A 1YDWA 4IXDA 4KLZA 4GOMD 5JJBA 1A98A 4R9NA 2IOFA 3DQZA 1N3IA 3QU2A 3VPFA 3QW4B 1AMOA 1I2ZA 4W63A 4D41A 4NLLA 3LDFA 4BX9A 2CJWA 3QV1A 3BGOS 2HLDD 4MZDA 4ETMA 2I78A 2HLDA 4COKA 3WIBA 1FS4A 2AOUA 3U4IA 4WESA 2VK4A 3EUEA 1UKBA 3UQZA 1OE0A 5D2CA 1VG8A 2IY8A 1S96A 2ISSD 5CX4A 5I4BA 3O03A 1XVVA 5ALTA 1VC2A 2QQ0A 4ZYVA 4UASA 4YV1A 3S7ZA 1VI6A 4HY3A 1EFHA 5DXJA 1F8FA 4MCIA 2Z58A 4RQUA 2A7QA 4MW7A 1GA4A 1Z56C 1NW5A 2NADA 4FGZA 1HPLA 4Y6LA 3RJ9A 4PHCA 3SM3A 4U6QA 4XOIA 5EE3A 4TV8B 1PCXA 5KIAA 2EP8A 3FMGA 2VHCA 4EPVA 1NXSA 4Q39A 5F9MA 5HRUA 1W94A 2GCNA 1LW7A 4QHYA 1A9PA 4CIAA 3VPXA 3T41A 1YQDA 1PNQA 5AJHA 1VE5A 4MHOA 4OP3A 3QUAA 5EC8A 3L1VA 1Y6RA 3L8EA 4CDNA 4Z3KA 1MAWA 4NG4A 4YIHA 2YFKA 1WW3A 3CH4B 3DT6A 4XCVA 1LPAB 4OXNA 1ZAYA 2WVGA 2WT4A 4J91A 1V47A 1SUBA 3VR6D 3WRVA 1XX6A 1AHHA 2WSYB 3Q98A 5I8WA 1I6KA 3K9QO 3TAHA 2QNIA 5FNVF 4I3GA 1CVRA 4F2DA 1R8YA 2FVYA 1MX5A 5IJAA 5JO9A 3JQCA 3PGA1 4I5GA 5KJEA 1WSDA 1NVEA 2OCLA 4QE3A 4BCDA 4GBJA 5KC9A 3ZCQA 2C7BA 1VJDA 4RWEA 5DJ5A 4QXRA 2CSXA 5E38A 1U6IA 5CDGA 1Z3IX 2ZWOA 5CLFA 1IPEA 2EZ9A 1KIMA 3V46A 3GGDA 2OO7A 2EWVA 2C7RA 4HQOA 4OJTA 6LDHA 3K0SA 2BKAA 3RIMA 3B1XA 1EG7A 3SHTA 3GJSA 2QUIA 1QG0A 3LT4A 3PNVA 1GKKA 1KPIA 1EGMB 4RTJA 2CDNA 2CLHB 3HWX1 1XCMA 5C7LO 2VAMA 2VVTA 1RHQA 3EE6A 3LY8A 4NYJR 3IMCA 4PGAA 4NARA 4AWAA 1ORIA 2HH9A 4FBMA 1ESEA 1HDCA 3ZD9A 1E63A 4D98A 4EFDA 2AFIB 1O54A 2EX4A 2H48A 2HADA 2ONYA 3LCRA 3OZGA 5HK8A 1GCGA 4NEQA 3DHVA 5GP1A 4HPWA 1QK3A 3VOSA 3NHAA 4AJPA 4EUEA 1M8GA 1YRWA 3MJDA 5TPZD 7YASA 1FXWF 1CC1S 1NVVQ 4LI0A 5KJFA 1EFPB 1F7VA 4M0KA 5JQWA 3T7KA 4MGIR 4YIKA 2J8ZA 4CDGA 3KJFA 3L7YA 4H7PA 4LDQA 5CX1A 5D5HA 3ZV4A 4DSAA 3UHAA 2GLTA 1XMVA 3W5IA 4TL8A 8OHMA 1KY5A 2AN3A 2M6LA 3PSHA 4F45A 1HT0A 3LLUA 5SYMA 3SGLA 3EXEA 4NK5A 3V2UA 3NH6A 4E22A 5LDDC 4Z4GA 1DQRA 4XYBA 3M89A 2NW6A 5JH7A 4ATNA 1SIOA 1SOUA 4JYBA 1QXSA 5LJLA 3EVZA 4BTVA 3KU4A 3NHLA 1NXPA 4KMSA 3BMQB 3GDWA 1OQAA 4OFWA 4A6DA 1GSHA 2X0EA 3VO1A 4D80A 3N2KB 4XD7D 3PF8A 3HWWA 1XPRA 4DQKA 1O6FA 4OXKA 1VE7A 4KO1S 1C81A 3MLBA 4RIIA 1OBVA 3AVWA 4EK9A 4E15A 1X8XA 2UYOA 3QM1A 4XPIB 1WSWA 1T9ZA 4LTDA 1V9LA 2GAAA 2X9GA 3IAS6 4L7VA 1YVRA 2MYTA 3BK1A 2G04A 1U9YA 4KW7A 1SKYE 1T8TA 1BHQ1 3ZHYA 2OBFA 4KSCA 1VHJA 1LRLA 1XLVA 1YE8A 4DT1B 3ZE9A 4DPKA 2AI3A 4NOMA 2J09A 1X77A 1G4AE 4GAEA 2VAVA 3HI4A 5ECWA 1L4EA 1U4NA 4F86A 5AW0A 1UM9A 4HWSA 2O2DA 4TTJA 4YHHB 1PKEA 3L9WA 3FSGA 3NBYC 2VAWA 1OGYA 2V4MA 2O0KA 4IHJB 1QORA 1L7DA 3I8OA 3MTAA 1INLA 2PGAA 4EARA 5KKCA 1KJIA 1L6IA 1V5GA 1XRQA 2R1TB 3DHWC 3Q3IA 3QF4A 4IKPA 5AVVA 3HI6A 2XXBA 4AS1A 1RQXA 3GYBA 5JAPA 1T8SA 2VNHA 3UCEA 4UHHA 4WACA 5C18A 3LLCA 4YAGA 4NDZA 4PS1A 3KUUA 3DTYA 4G41A 1QHGA 3KUCA 4J0KA 3REQB 3ZDQA 2AG1A 1WQ1R 2Q3EA 3B2NA 3L6OO 1TEHA 2HMUA 2CKMA 4PPYA 4WBNA 1S0UA 2Y6UA 3L0OA 1HI9A 2VNSA 4K05A 2HR1A 2FWBA 1EUCA 3DVRX 2AN9A 4KRYA 5DMXA 1GGEA 1MJHA 2JLSA 5DNAA 1UBFA 3AZOA 5KTYA 5K0SA 1ISFA 2PGOA 1EJ0A 5IAKA 4Y9SA 5FLKA 4EDFA 4CMIB 5IJWA 4N7JA 3C6YA 4L5IA 3G2QA 1TM3E 3JQ8B 1RJFA 4HI0E 1I32A 2GS9A 4YFVA 3ZI4A 5JSHA 3W5BA 2BEUB 3BL5A 4GZ6A 2B98A 5C32A 3TE6A 4Z4QA 3I9V6 4H77A 2O48X 1XA0A 3RVKA 1U7XA 2BBWA 1BDMA 3E1SA 4UD6A 5B1EA 1WPXA 4YEDA 2FDRA 2G5TA 1N2CB 1MW8X 4M86A 2WWFA 4WECA 5CT6A 4AJ2A 4AWBA 3KSAC 3VTZA 3UA3A 2V5AA 5EMNA 1GAXA 1HY3A 4ZCRA 1N2SA 4GX0A 3NEJA 5JAHA 5T7BA 5G0TA 4LYGA 1RQ7A 4B4KA 3HJTA 3HM2A 5DNEA 3W7BA 1NUAA 1UZLA 2QVXX 2I7TA 4EQZA 3RV4A 3HXTA 1NBOA 1JXOA 5JWHA 4EFNA 3DTNA 3CNNA 5LKRA 2BI8A 4UTOA 3GRKA 2RMKA 1PEKE 4MUXA 4XPZA 4Z9AA 3OLXA 4IHAA 1XYYA 3ZE8A 1M1NB 4FSXA 4MW6A 2O8CB 1I14A 4CEHA 1Z34A 2XWQA 3U61B 1T9DA 2OSBA 1EFVB 1Q1QA 3LYLA 3I0MA 3RTBA 2P2DA 5M04A 4B3DA 1BOOA 2CEAA 3EZ6A 2FZCA 3TKLA 3WQRA 4WW0A 1TW3A 4Y9UA 3VOAA 3IUQA 1MX9A 3C3WA 3EAQA 4IJ5A 4DWVA 4JV5B 2GNOA 3QPVA 4EY7A 2O3TA 4WNYA 2HYIC 4ZVKA 2D5BA 4B5KA 5E95A 4OLHA 1DJPA 3H9JA 3QH4A 5FBVB 4YAUA 1D6NA 3L8YA 3LC7O 5KJCA 1PLLA 1U3FA 4PWYA 1UZMA 1RPJA 1Z75A 1XMPA 4KQ9A 1OYVA 3A6JA 4ZICA 1IL0A 2GBCA 3O8OB 7MDHA 4R31A 3LVQE 1W25A 3I8XA 5FXMA 5LYJB 1W9HA 1VXOA 4YDHB 4CJXA 2RONA 3V1NA 3D3NA 2B0CA 2CMFA 4TRMA 3PSAA 3ETNA 3PHGA 4B7UA 3FAZA 4ZN6A 2IP1A 2VHYA 4PHHA 3O75A 1G2IA 1G20A 2FW0A 1BEZA 2W2VA 3F6SA 1QIMA 3I01A 3NTOA 4J0CA 2UU9B 4RQAA 3NANA 4TTPA 4V0KA 1FYEA 1G3UA 1ZW6A 3COSA 5I7RA 1CQPA 3G2KA 2XKBA 4MSUA 3U81A 3LPCA 4LGMA 3WBBA 3AVPA 1IM2A 1CY2A 2JFXA 4DLKA 3B7WA 2EHJA 2P62A 5EE5B 2VH1A 4O2AA 1G0NA 4TMYA 1X15A 4ZCQA 2B92A 3HUEA 1OWNA 4N3BA 5AH0A 2GBLC 2WTMA 4KSBA 2CXSA 3NETA 4QEZA 2IYTA 3TSCA 3IODA 121PA 5ANRB 1Z6GA 3N07A 4YJFA 3H1AA 4OJKA 1FZTA 1OBOA 2Z5GA 5HFNA 1MZVA 4JQCA 2PUTA 3QNUA 4LGCA 4RLHA 1M0EA 1EDOA 3NO4A 5IVKA 2B4RO 2AYXA 2W90A 5BRNA 2PVCA 1JMKC 3BERA 4WZBE 5E1MA 4AT1A 3U4CA 5IJ0B 5DLDA 2ETXA 2JIRA 3BFJA 3OPQA 3WYEA 4C7MA 2BFDB 3NRJA 4WZBA 1YB4A 1GTVA 1JW9B 1D3AA 1XNHA 2EFCB 2ZSIA 4GQAA 4I9UA 3U7GA 1IG3A 2RGGA 2V3VA 1JRLA 4MYSA 1KS2A 1BN7A 1D7AA 1QV9A 4GOLD 1RRCA 1NVFA 4I7EA 2Y0EA 5ES3A 1JLHA 4NFSA 4OP2A 4F0JA 1JI0A 2B21A 2VCHA 3FNFA 3KHKA 2Z3VA 5ALDA 3W04A 4F21A 3PFWO 2QVBA 1E3MA 2ZWMA 2I66A 2R5NA 2XOXA 3GRUA 4YQEA 1IZ0A 1ZITA 4KOAA 5A06A 3TRDA 4NCNA 3VR4H 4NKRA 4RU1A 4P0PB 2ZSDA 3OJ0A 1TJ5A 2BFBA 2QK4A 1L5LA 4RCYA 3TTUA 5BVHB 1KY3A 1K5GA 3FOFC 3PI6A 5F2NA 4QAQA 2NU7B 3A6KA 1XNGA 4PNHA 2ZE5A 4QEKA 1RWKA 3RLFA 1XEXA 3II6X 4DTIA 2NUAB 4RFLA 1DI0A 4XLLA 3TLXA 4QOFA 3BULA 2Z8YA 4YJKA 9GPBA 4KQFA 3W5HA 1N5LA 3IC5A 4DN6A 4X5OA 4IIXA 4JT9A 5HOEA 3VTKA 2WF7A 1L7EA 4P84A 2QQEA 4EI8A 4HNAA 4UTZA 1JDBC 1GNRA 3AB3A 5LA6A 3OIYA 4CYMA 3ORRA 3U19A 5GIPE 3LY5A 1IULA 1WF3A 4JXKA 4EMSA 4LXQA 2AG0A 3EXHA 4PC6A 1FLVA 1GCAA 1Z16A 3O4HA 4F4DA 1O6BA 1P81A 3SC6A 2NAFA 2VT3A 2NMVA 1SOMA 4OGLA 4N3GA 4DNXA 1A8QA 2QP9X 3RYTC 5EJIA 1FJXA 4L3OA 2E5FA 2MT9A 1H22A 1M83A 4H15A 4NOJA 3D1VA 2EBFX 5EXXA 3WTBA 2C4UA 2YICA 5LXTA 1OIVA 3AIOA 3JARB 3L41A 1T5HX 3LNCA 2G83A 2GVNA 3JTEA 3L8MA 3IDZA 1HDIA 2XTZA 3DTVD 4NP6A 4F9EA 1WCV1 4KJZA 5A5EA 2PG3A 1Y3FE 4O4JF 1H2ZA 1P9WA 4NJEA 2WTXA 5EKTA 4YUYA 5K6AC 2LDBA 4E5NA 1DQSA 3H13A 4K9NA 4O25A 5AHXA 4YRGA 6GPBA 1IWBB 2DLCX 4BASA 3PC3A 4LBYA 1BD4A 2ZU0C 3WIEA 1LPSA 3M6FA 2IGBA 5G4KB 1TEXA 4KCGA 3NASA 3TIFA 4FGUA 4G0YA 1EMDA 1WZIA 2QPLA 4CODB 2A14A 2OV4A 5J40A 4ND7A 5FH9A 3WOHA 1OX5A 1O5TA 5KMGA 4W99A 2KI5A 3MMNA 4PQGA 4NBLA 3NHBA 3TQTA 2HMWA 1V0JA 1JYEA 1OXBB 1SXHA 3DZCA 1MAHA 2A84A 3T1OA 1DAEA 3ZGNA 1Z7BA 2X2OA 3G8CA 2YMPA 3OZEA 4LSWA 2P6PA 1NBEA 1M7GA 1A95A 1MOPA 3DCYA 3KE9A 4MR8A 4BQQA 3TE7A 3W4IA 2DBVO 3EEIA 1IVNA 1NF2A 5C5EA 2CCGA 1C1DB 2VBGA 4D26A 1G8GA 4U8HA 3ONVA 5LQNA 3PRHA 3FCOA 4BIIA 5DTIA 3Q6MA 3ZZMA 3MTQA 2W22A 3E5HA 3F74A 5C80A 2ZK7A 2VHXA 1W59A 4ZARA 1KMNA 4JI0B 1Q7GA 2K5UA 3PDHA 1Z2NX 4FFWA 1RPZA 4LXUA 3HN2A 1N6HA 3PPXA 3SX4A 2GM9A 1MOQA 3L7KA 1UXOA 3KX2A 4LJAA 2XYRA 2GPBA 3RS5A 1XTBA 4S24A 3SYNA 2VJOA 4Y1RB 1WUIS 1YDMA 3LBNA 5EPOA 4EJ6A 4ER0A 2R6DA 3GH1A 3RJTA 5DYGA 1RZRA 1U2TA 4ZOQI 1TC2A 1Q7TA 2NU6B 3WYAA 1HE8B 1NNUA 3RRNA 3RKUA 2VP5A 3KZMA 5K0TA 4OI4A 4M1WA 1N5OX 4ESEA 2CJXA 4LC9A 3SKXA 4LF8B 3AR3A 3QTLA 4DTCA 2F62A 4K2AA 5TPWB 4F5ZA 2Z8XA 1JR2A 3H4MA 3OF2A 2J0EA 1KQNA 4UUAA 1FDWA 2VBCA 4QIHA 4LKRA 2YNMA 3NAGA 5C8DA 1ENPA 1U98A 1ELOA 1KQOA 3BRWA 3I04M 3HKCB 4LKOA 1JHAA 4EMUA 3GC6A 1S2IA 1P1FA 1SMKA 3JD3A 3QBVA 4R05A 5JOQA 3AM1A 3UZUA 3AEUB 4R3NA 4GO1A 3R3WA 3NVKI 1THTA 4DYVA 3AYXB 3KTDA 1W34A 1T1RA 1PQYA 4FZ5A 1T36A 4C0HA 2OZVA 2JJ2D 3DWGA 1QH1B 3KOXA 3N8DA 1CV2A 1ECPA 1PVOA 2ZULA 3D7NA 1ND6A 2XYGA 3GCWA 3WXMA 1XNRB 5KDDA 4BV2A 3T95A 4K26A 2A5DA 2Y99A 1B6RA 3AW8A 1UXKA 3DL2A 2CDAA 2ZB7A 3L7JA 4GZ3A 2OG2A 1Y7LA 1Z07A 1PR0A 3HCFA 2AR7A 1MFPA 2IRWA 3NHFA 3VR0A 5JT1A 1NYQA 1LSSA 1S8FA 2VOJA 1LH0A 1USIA 3SY8A 4B2YA 2GF0A 5H81A 2AC2A 1XT6A 3ESXA 1GQQA 3ONWA 4L08A 3WLRA 5JARA 4BNLA 5ARDA 4P2BA 3RT1A 1UMCB 1GRRA 1ODTC 3F3MA 3HXPA 3T8YA 1MDBA 4PCVA 1JKJB 4BYMA 1EUQA 1H1LB 1QVVA 3B36A 2CBGA 5C4IA 3OZVA 1P77A 1R0ZA 1C3LA 2V1XA 5IFLA 5KYXB 1SZCA 4ANFA 1JSCA 2WWRA 4I9GA 1RRFA 4F84A 2O8BB 4X9XA 1M2HA 3OX1A 3FOBA 4ENVA 3U4QA 4FOTA 1NLZA 4MWSA 1R4NA 1W48A 2C4TA 5T4FA 3VV3A 2CUTA 3C14C 4YAWA 4R1MA 1BXKA 2C8LA 1H6DA 1P5JA 4JUDX 1YZKA 1Z5VA 2IXEA 2JRLA 3C8HA 4CQMB 1B14A 1WXEA 3HNOA 3QSYA 1U28C 3LK6A 2O2JA 5BQXA 6CHYA 1MRNA 1Z4JA 2MSWA 3RDPA 2VJBA 2HHLA 1AGPA 3C6XA 1SZJG 4NCIA 4UVHA 5AVZA 2MWMA 2BLNA 3MGCA 4KN8A 4LFCB 3GR6A 4N7RA 5CG1A 3CUYA 2SKEA 4L6CA 3B9PA 1D07A 2H1FA 4WKCA 1IWPB 1FNBA 3I9KA 3AKZA 1G5TA 4D3FA 3UJ7A 1XZGA 4KE7A 1IEWA 4BMYA 3NIWA 1X6VA 3HBAA 5A1TA 2XLBA 1G18A 4G23A 4X93A 2VQFB 3BD6A 4X45A 2DGDA 1HM5A 2GTIA 5E1BA 2C8VA 4CR6A 4MGYR 5KWEA 4B3RB 3B5EA 4Q9IA 3MEQA 3PR3A 5KYKA 1VCOA 3DNMA 2EERA 1YI0A 3W1VA 1K4YA 3D4PA 1N3YA 2YRFA 1QVRA 3WK7A 1RYFA 5D1NA 1D2NA 2I6QA 5KS2A 3AX6A 2PE5A 3D6AA 1CUXA 3EJWA 3HCBA 4GU5A 1TF2A 3A9RA 3DV2A 4J94A 4Z8XA 1TYEB 4F3RA 3BMCB 1WDMA 1ZM7A 3LUKA 3MUOA 1Y8ZA 4BDTA 4DUGA 1OYYA 1THZA 2UVPA 2X40A 4JI1B 2EJBA 5CNMA 3OPVA 4J1SA 2XADA 2O2ZA 3HRKA 2V98A 3H5TA 2Q3DA 4LTMA 1H8HA 1V16B 2GR9A 5D8DA 5IHPA 2L82A 2GN4A 2R9VA 3ZNOA 1EVEA 5CYOA 4WFQA 2ZE7A 3U3KA 3O8LA 2R0QC 1N9GA 4FUTA 5JAUA 3PITA 3K0FB 4W5RA 4DV3B 4XGIA 1Z12A 3QUQA 4WKNA 3RADC 1SRRA 4ND2A 2RH5A 1CJUC 2PFSA 1JNYA 3UJHA 1ATZA 3E7DA 5IYZA 1CJCA 1LPBB 1T9GS 4BQIA 4QSHA 1HNNA 2QDXA 4IH1A 4URWR 4WK4B 2C3MA 2R87A 2IBSA 4HDMB 3AVQA 1E3DA 2QE7A 1KZ9A 2WHPB 3C5WP 4LEIA 5P8WA 2W0MA 2IOQA 3H2ZA 2PGDA 5LZ7A 1ADJA 5NULA 1QAQA 2PX8A 4QUAA 3UPUA 3EAFA 2PWYA 3NW9A 5HW0A 4QXMA 1K3UB 4JQSA 4E51A 1DC6A 3FJOA 5HKKD 3DAYA 2GXQA 4C7VA 4OTZA 3B6ZA 5HF9A 2YQZA 1JPJA 1Q1EA 3KOWA 3RSCA 1B3BA 3HXMA 1H94A 2CXQA 2RK3A 2RHHA 1N3BA 1K89A 4JYMA 4JUIA 3N6XA 2UUCB 1TD9A 3IJRA 5F3DA 2ZQ5A 4XRGA 1XAHA 4J7AA 2ZWVA 2YWXA 3FKQA 1EVKA 1N2JA 3AESA 4NABA 4RY2A 4UCQA 2GCGA 4YJ2F 4HB0A 2IGTA 5DM4A 1H4TA 1DEAA 3C3JA 1Z39A 3PEEA 2CJFA 4Y9RA 4D8UA 5J4HA 5IKXA 4EKDA 2BFFB 1N2HA 4DA9A 3FUXA 1HR0B 2R6JA 4F5DA 1QIJA 1V41E 2VYCA 1D9XA 3I32A 4RD6A 4IFBA 5CH8A 1Z18A 3U48A 1UDXA 3FDZA 4LYYA 5IAEA 3ADCA 4AG3A 2QI9F 2WTUA 2KLBA 4XB2A 1PT9A 4Q4CA 3Q41A 1Z68A 5T64A 5BOVA 1ZD9A 5SY9A 4JQOA 2W58A 3OBIA 2W9XA 3I3SR 4PZDA 1ADCA 3RYHA 4BNYA 4HYQA 2G9NA 3CGWA 4D8XA 2O2IA 3KUKA 4PNEA 4EY4A 1YZLA 4BQOA 3K6RA 2FMTA 5GONA 4Y67A 2B3TA 4QNRA 4ITRC 3LKVA 1RAAA 4DR3B 4C0KA 3T54A 4W6QA 5ABPA 2FPSA 1N9ZA 5L6LB 3LPNA 4GOND 1PQPA 2JI4A 2NO1A 1R1DA 3LXRA 4BO3A 1M6HA 4R2IA 2FN8A 4ERXA 1FVOA 2V5UA 3TBKA 3CLKA 1S01A 3H3FA 2RIPA 1QMPA 3OTHA 2BF7A 4Q3EA 4DR5B 3AWDA 1U0LA 3DEHA 3KJHA 3DMRA 3VYRB 1ZOIA 4XDHA 3WLOA 5CMLA 1G5HA 2ZJ1A 4MI9A 3DZDA 5IDYA 4FWIB 4H7KA 1FFXB 4Q7KA 5EHGA 1U0NA 5CDUA 3NB0A 3OOSA 1P39A 1NURA 1XKLA 1Y3IA 1V6AA 3ELWA 4JC0A 4RC9A 4W9NA 4X7MA 4Q21A 4RDIA 1UAGA 1N8SA 3M6WA 1GTG1 1SHTX 2VRCD 5BYJA 1U6KA 2XW6A 1IJEA 1EYZA 3ZHCA 1AGNA 3W4KA 4AICA 4WOPA 4RDCA 3EVTA 2DH6A 5TEVA 1A04A 1A7KA 5AKHA 1BSVA 5AW4A 5EJ4A 1W5TA 3DAOA 4NC9A 4P83A 5B37A 3T9EA 4KE9A 3PXGA 3MZ0A 1DJNA 2X0FA 1G7RA 5TMPA 3JSAA 1W36C 2X77A 3QLJA 4TLDA 1FFCA 4NZNA 3OHPA 5J2UA 2UDPA 1T4CB 2AMLA 3I09A 4G5YA 3P71T 1WB5A 3T34A 2A9KA 2B78A 1WKCA 5L6MB 1WPRA 2B3DA 3RS7A 3KEMA 4TLAA 3WAJA 1GZ6A 3AQIA 1HE2A 3HXQA 1A2KC 1N5IA 2HWKA 2IU3A 2D2VA 2X7XA 2YV2A 2WFZA 3V9AA 1Z5NA 3PQ4A 2WZCA 1W29A 4C0XA 3VC1A 5DNYB 1A82A 3IIJA 4NMMA 2XUZA 4KFUA 1FMLA 3LOQA 2O0MA 1OLXB 1OYOA 4MS3A 2FTKE 4C3VA 3ZY5A 3WGYA 3GJTA 3TQHA 4CKCB 3T5GA 4YRPA 2NUTA 1FPQA 2Y0CA 1M8PA 3PA8A 4R9RA 3FMFA 4YCAA 5DCWA 4EW1A 3EGCA 5TMDA 2X5OA 1IQ0A 4RSGA 3S5JA 2CGEA 3EDOA 3GL9A 1HC7A 1RM4A 2NQTA 2WAMA 4CLDA 1X80A 1TADA 1J0AA 2FP3A 4I4TA 4DSNA 2I34A 4FFSA 4R8LA 5KAMA 1AF4A 3A10A 1QP7A 4GI3A 1I3KA 4IUBS 1X7XA 5ITWA 3G0BA 1A97A 2QAGB 2W8BB 3NCTA 3T7TA 4B4UA 1Z33A 2DT5A 4C06A 1LY1A 3I28A 4IH9A 3CU5A 3MS2A 4HDSA 2Q29A 3TR5A 4C7XA 4FVTA 2WDZA 3GLVA 4HNQA 1QB7A 5DBOA 2FZKA 1I2DA 2Q1WA 2QZPA 2Q5EA 1T8RA 3KR0A 1Z5GA 3NTUA 3AKEA 4J7CA 3U3OA 3ZKWA 4CEIA 5KVVA 5A4KA 3K09A 3U3JA 4J07A 4ZZ0A 2UYHA 1KYZA 4RAQA 3DZBA 3IO5A 4KN6A 4TVKA 1IYZA 4Y1FA 3SK0A 4BKOA 1J00A 2IEGA 1X1QA 3BSFA 2AF3C 3FBGA 1YB7A 3ZWWA 1FJGB 1DE0A 1TQDA 5F3RA 3QMVA 1GGMA 1N0VC 2V6BA 4M9SA 2FVXA 4RCVA 3RYIA 1GVNB 2JLZA 3UJ9A 1LDGA 4PC1A 2WSBA 1BYUA 2YDYA 1P19A 2OCXA 3DFIA 1MG5A 4JP2A 4PTLA 4Y9TA 5CVJA 4BZQA 5C37A 3LCMA 3TZBA 4TROA 4Y2YA 2GN6A 4ZGBA 5JXIA 1NF9A 4P86A 3ZU3A 5BV1A 3B9RA 4MS1A 3MTJA 2XOKD 1ZJ4A 3CCBA 1VGRA 3W1WA 1EK5A 2UZ1A 2XOKA 3BIJA 3IVGA 5GZ1A 3X1JA 5JDCC 5LPNA 3PLAE 3FY4A 3KWMA 5HHTA 1VMKA 2ZVDA 1W2WB 4AG6A 4AZ0B 1XUOA 5B7QA 3ILYA 1TK3A 1KGSA 2ZYRA 4BZWA 1QKJA 1WBJB 4UDYX 5EIOA 2HCJB 5U4QA 4ZRDA 3M4ZA 1HDGO 1NDQA 2EW2A 4NVRA 3UXYA 3OTIA 1BE0A 1BVRA 2Q5IA 3NHWA 1Y9DA 4W5WA 3T3DA 3N0VA 2YWJA 5HILA 2Z2KA 3FW1A 3R3ZA 5H1YA 3F0TA 3HNPA 4TZKA 2C7GA 1UFQA 1Y7PA 1T9CA 1BX3A 5DTRA 3L0DA 4KQXA 1P1HA 2WYOA 2CDCA 1KYYA 1CJMA 1JXQA 1H4SA 1GGVA 1FBTA 4RTNA 3I5UA 1YVDA 2OCIA 2PSEA 3FTNA 1GFWA 2C03A 2VAPA 4CIDA 4EA8A 1RLTA 5FWAA 2P68A 4LSMA 1UUFA 1G59A 2BEWB 4MVJE 2JIDA 3RRMA 1YOVB 3RSHA 3GUYA 4MVJD 5ELMA 3LUJA 1UBLS 5C0OE 4D0GA 5FUMA 1TUIA 4MVJA 5B3LA 2YXPX 3D4NA 3QBEA 3QX3A 1MO5A 2JLQA 5ENDA 1CKEA 1AM4D 2W93A 2CVFA 1SWVA 2PL1A 1YTLA 3K4PA 2ERCA 4K8OA 4L51A 2PCJA 1HTTA 4PPQA 5FIUA 2FG5A 4BN4A 5ELLA 3PQCA 3TGLA 1PFKA 1YQGA 5DM1A 2C3UA 4OBXA 2FFJA 3UVEA 3CX6A 1T4BA 2WV9A 1EEXB 3GMDA 4IIBA 2JF0A 4OUKX 4XIYA 4KXLA 3OKCA 4OOFA 5D3KA 1NMSA 2W6ZA 4L2IB 5ALQA 2ZSBA 4P4NA 1OY1A 4BXOB 2A9PA 4F3KA 2O7RA 4MVJG 1S8NA 4R1LA 2QWXA 1UFKA 2BRUA 1EK0A 1G2PA 4JH0A 2R4QA 4DJ5X 1KOGA 1Q0ZA 3KEOA 3JYOA 2EC5A 2ZI7A 3NIDB 5AP9A 4EHIA 5KQGA 5I3ZA 4U00A 5FWYA 2XCQA 3BOSA 4U9IS 4EYSA 1O94A 5J2TA 3P0EA 3LA8A 1NJFA 2IDJA 2Z6VA 1ESMA 3QXJA 1UKZA 2NSHA 1OCEA 3UH0A 3I3OA 5K9ZA 2V7VA 2OGSA 4CF4A 2XT9A 3LCJA 4AY3A 4CQLA 4E11A 3L1HA 1X86B 3K0BA 2FPRA 4U2EA 5LOVB 3TZCA 4REMA 3P2JA 4RH3A 5EUBA 4RGYA 2J3KA 3RYFA 2FOLA 2OHIA 1J2JA 2HSGA 4E88A 4QDTA 1G5FA 4G0QA 5FTWA 5KWJA 4X20B 3FWYA 2XTNA 4HAWA 3ENKA 2A4KA 3ZW7A 2D54A 2WJWA 4FLEA 3KZ1E 4JKIA 2PJRA 3TGPA 4KYIB 1HOTA 3FPLA 2I2CA 3DE7X 2JIPA 2H11A 1W35A 3UPDA 2FRXA 2KWIA 1L8QA 2YXDA 3OQJA 1IJBA 4FDLA 2ZS7A 1DS6A 3MGAA 2QS9A 4O4IA 4ZODA 5HIMA 3RSSA 4F11A 5AFSA 5G02A 2CYBA 3TUIC 3SAJA 1V96A 1Z37A 2OKCA 3R7AA 4IVPA 3RSLA 3W8RA 4ZCIA 2NN3C 1D09A 1MNAA 1NJ2A 2W6JA 3GRAA 4DCPA 3MWKA 2VPPA 4B0OA 3WLAA 5FJJA 2W2OA 5TARA 1D03A 2WYVA 4RHEA 1T3ZA 3GJ0A 5IDWA 2FFAA 2V8BA 1GL3A 1U2GC 4CG1A 4R8MA 5C3MA 2XVAA 2I2WA 3B8HA 4KAXA 2DUWA 4TT8A 2WNHA 2Z4RA 5EL0A 3FHOA 3DPIA 4UATA 2ANCA 2J9RA 5KNCA 1UPXA 4JVOA 3LWZA 2ZUTA 2OCDA 2P6OA 2WUFA 4WAUA 4WVFA 2J0UB 4CRWB 5KYTA 1VIAA 3EQ7A 3JRWA 4Q9LA 3KQSA 5F4ZA 3ROFA 3KNZA 1CXZA 2QG9A 3C74A 5B6PA 2W42A 4LECA 4QNMA 5JNVA 4BX2A 1C50A 4I4CA 1L7PA 1WDKA 4NH0A 5K0NA 3WGTA 1FTYA 3DO5A 1QE0A 4KMMA 4ZVOA 3G6WA 2YHUA 3N1UA 1W0JD 1AK2A 2R11A 2PO7A 4TM8A 3NT4A 5P21A 2Q7DA 5JQGB 4BNNA 1AKTA 2EU8A 2YV5A 3N2GB 3CJTA 3IFSA 3UFBA 16PKA 4DLSA 5HEKA 1TJ4A 5FOQA 2CCJA 3EGEA 3SCZA 1IZ7A 1D6MA 1NFQA 3VHXA 4XVCA 5CFLA 4BNJA 3IQXA 5BP7A 1G16A 4H6VA 1MABB 2LUOA 2MINA 4BNZA 4OMDA 2XR1A 2JFGA 1TMOA 3W5CA 2PZKA 3URKA 3K53A 5LDHA 3TSZA 2X15A 4X8OA 3HYNA 1JIQA 5A6SB 1QAOA 1S4MA 3DL7A 4DXDA 2V96A 3RUIA 2YWCA 1ZSYA 1SPBS 3ZVLA 4PN3A 4YCLA 2QX6A 3PP8A 1MV8A 3I5AA 2MOKA 3I8SA 2HDOA 1U2SA 3IUSA 5EQDA 4IDPA 3OT1B 4OQPA 5JANA 4MQLA 4ENQA 2CB9A 5TX7A 4XM1A 2QTNA 1JEYA 1PWZA 5LB4A 3F3YA 4EO7A 1GCIA 1T6XA 3BSWA 5B1SA 1GZ7A 5JNUA 5BN5A 4F3TA 3UJ8A 2C5GA 5M7EA 4CNQA 5CW2A 1P5RA 2ZRAA 4HF7A 4P36A 3W4JA 4BVAA 4EAQA 621PA 4D9KA 2ZTMA 2QMHA 5KWIA 4N65A 1XD2A 1CR4A 1OWMA 2M98A 4JC5A 3IPRA 4PLYA 2BTEA 4IEIA 5GIOE 1KJ9A 1JYFA 1YR6A 4M8LA 2RC5A 3KQVA 1BO6A 1UDCA 3CB4A 5EGSA 5C8ZA 3LUHA 4WXRA 1Y48E 2A86A 2QTWB 4HAZA 1S2GA 4ZMBA 2WIGA 4YFYA 1A8HA 1VKNA 3AETA 4HAVA 3CLTD 4IICA 4MINA 1KTVA 3AR5A 5ENZA 4M7WA 3BJIC 1LFDB 4O59O 4CIYA 2ZUBA 4WL0A 3H2SA 2DM6A 2IU4A 4DE5A 1NKVA 5AKXA 4F1KA 2Z30A 1WCXA 5DNCA 3SR3A 5JWOA 1DG9A 5L7TA 2VJYA 1BEUB 1LTQA 3R4VA 1VSQA 1W75A 1JZSA 2DUJA 1TKCA 2G3YA 1G8AA 2J0VA 3HO8A 3O8QA 2VPIA 4RE5A 3VVLA 5KQLA 2XE4A 3E9QA 1N1DA 4YS6A 2RGNC 2EP7A 2V7BA 4IIVA 4JP8A 3SIRA 1GYRA 3KTAA 3OCZA 4I99A 4K88A 1GITA 1KEEA 4C6SA 5K20A 3AJAA 5FNVA 1UBUS 1M5UA 3P2MA 1YSCA 5FAXA 4D42A 5LP1A 1KKUA 3ILHA 4JCOA 2DFDA 1NXTA 4HDRA 2OO5C 2D1QA 2VYFA 4G25A 3EDCA 2ZJ7A 1DEOA 3MHPA 1EE9A 4PNPA 1W1WA 4DCMA 5BT9A 4M0EA 5JW6A 3FG9A 1FF9A 1KKLA 3QK7A 1JF8A 1CUBA 3GFSA 3DB1A 5DHFA 3LHFA 1TT5A 4BNVA 2G71A 4OKIA 1PF7E 2R8BA 5F23A 3EUWA 4G9EA 3H7AA 5CPBA 2IHBA 2QSUA 3QU4A 5LWQA 1DAPA 1GGFA 3AF0A 4LAFA 2ZYWX 3SHFA 4U7WA 4KQ6A 3P8ZA 4B73A 4DBLC 4DLWA 5KSOA 3LKDA 3OHMA 3QPBA 3AVVA 2FGKA 3T7IA 5JALA 4QM6A 4XWGA 3FTEA 4Z9YA 2IYFA 1VKOA 4HX5A 1OX4A 2HQ1A 2I29A 2W2KB 2WTEA 3LPDA 5BOSA 1R00A 1GADO 4M7RA 3GEEA 1F60A 3PFNA 4WHMA 3TTYA 1GNTA 5JYDA 1LBSA 2PZBA 5K3DA 4BJ1A 4DMRA 1LS6A 2NZYA 3HZHA 1JHRA 1X2BA 4JXXA 2VDOB 1JIUA 1VB5A 5JAQA 1BXZA 4WT7A 1TM1E 4KO4S 3DKPA 4AUEA 1PSDA 3E22A 4EOGA 3NWPA 5ALEA 3WYBA 1M5TA 4FSHA 4L4XA 4P9NA 3RSFA 1CUDA 3OTWA 3OIDA 1ECLA 1F3OA 1H66A 4K28A 5ALWA 3UJDA 4EWLA 1KO5A 4KUHA 4EHNA 2DVMA 4YQYA 4LW8A 4HFJA 4RPGA 3EN0A 3MK31 4OSPA 1O7JA 4LXGA 1DELA 2ASVA 2ZYSA 3V32A 4WFJA 4YAIA 1I1HA 1MGOA 3TS1A 3MJCA 5A9TA 4J7XA 1KKMA 1YK1A 4HGZA 1H6AA 1Y7IA 2LR0A 2NZ8A 2WG2A 3EDYA 2AG5A 3GLHE 3IQFA 4FDVA 3LC1O 5JCPA 1M2FA 2VTBB 3UW1A 1MV5A 1E18A 2VDWB 2WP0A 2X2PA 3GLHA 3I4FA 1F8UA 2ZI9A 1XV5A 1Z0AA 2JGEA 5FOTA 2FETA 2HJRA 2MYNA 4IZOA 4Q3CA 4IQGA 4POAA 4IUDS 4AKGA 1TE2A 2POQX 3VZBA 3V97A 1DCFA 5A5GA 3DVAA 3KFXA 1T2EA 2FG6C 4O1HA 3RJZA 3ICOA 4TS3A 2IEAA 2QUKA 3H2BA 4HR7A 4LCEA 4DIEA 1YIOA 4C07A 1G38A 1JWAB 1P9LA 1UFVA 3K6KA 4OXXA 3KXLA 2CNDA 4LBZA 1E3JA 4YWHA 1JHPA 1SXJD 3CF6R 3R5SA 4EVRA 4XYLA 4OI0A 3DE2X 1EFAA 3T7RA 2I67A 4OB7A 4LOHA 4Y1GA 1EBFA 1NNI1 2WMDA 4E13A 3GPLA 4TMKA 5HZGA 4L8VA 2QRQA 1X7WB 2XDAA 3MOGA 3FLEA 4OREX 4JJGA 1ZD2P 5FOUA 3QWAA 1Y1PA 1PV2A 2ZIXA 3E9RA 3NR2A 1BXRA 1VKRA 3O95A 4JIGA 1T43A 1ZGHA 1Q22A 3K6SA 1JJFA 3M2PA 3DCNA 4CTNA 2QD1A 3TX2A 1QV6A 5TMEA 1A1SA 1NVMB 5DKFA 1I4WA 2C3PA 4FEYA 3B1FA 2QVYX 3ENNA 4ZYWA 1RHMA 2C2XA 4UHCA 4S04A 3OQPA 3SQDA 1US8B 3DXFA 3MCTA 2P9JA 2D7JA 1J1UA 1A8IA 3AERB 3ZG6A 4UU8A 3JQGA 1U7PA 1NE2A 3ONNA 4BNKA 3ZQKA 1PG5A 3GJQA 1Y9ZA 3BWBA 2VDNB 2WB4A 1RQNA 3GRPA 4KO2S 4H60A 4OIMA 4ESVA 1G7TA 2WJIA 3KVVA 3BWYA 1MU0A 3DBHA 4JSRA 3P9PA 1PK7A 1TTHA 4YWJA 2V3WA 2FEWB 2FUCA 1DTWA 1DPGA 4BNIA 2FCAA 4BVBA 1NQ5A 2C88A 2D62A 2G1KA 3Q7SA 1OI2A 4DIOA 4RZ2A 1E2UA 4KGXA 3K0CA 2GCOB 5BUZA 1U4OA 4MW2A 1FNNA 1II8A 1WVGA 1K8YB 3CV3A 4FGSA 3UWMA 3WISA 4IJQA 4R9VA 1EM8B 5H3HA 5FWNA 4WLVA 1V48A 2JHPA 4FYPA 4GVXA 5KCMA 5LU8A 4IWXA 2BMDA 3LZ6A 2HHAA 1PZNA 2IHJA 2BHRA 2XZOA 1T1EA 3EG9A 5CVCA 2H8GA 2GM3A 5BSTA 1HRDA 2CLLB 4OB6A 4ZO8A 5JPCA 1JWBB 1ZJ6A 2XKKA 1C30A 2CLKB 4XVRA 5FEUA 1DBWA 4CTMA 3MJRA 1EVYA 4YN3A 3Q3GE 3C6ZA 3DFMA 4FMBB 4ZQEA 5BSMA 4WH0A 4DDHA 2CUKA 3A3NA 2JK0A 4M2LA 1SULA 1M2OB 5ILQA 3U31A 4K81B 4XDGA 1RCFA 1Q14A 3BFPA 3F8WA 1NJ8A 3AC0A 3F7MA 3PU6A 3UYKA 2PUEA 4WLOA 4Z0PA 1E2EA 4KVGA 2RD2A 3A1DA 3SD7A 1CUSA 2BFCA 2DY1A 1RXSA 3K32A 5DNWA 2YY5A 5H16A 5A5FA 1SHZA 2D59A 3IGFA 4E12A 1FLNA 1RBQA 1ODJA 4ZU3A 3QEMB 5ADUS 4DDUA 3I9FA 5HRAA 1GNSA 1YBVA 5B36A 2EFJA 1USVA 4WOBA 1WBDA 4LUCA 1UC5B 3SI7A 1P4GA 3L6UA 4OBBA 4R41A 1C9YA 5EUCA 1VHTA 4M9QA 4LQ4A 2AQIA 4MR9B 3UMJA 4TYNA 4M0MA 2R65A 2QTMA 1RDFA 3ZDAA 3GIWA 1TF7A 2GEJA 4CFSA 4MWDA 2DHDA 4DFDA 1X1DA 5K0BA 1U8YA 4AZ3B 3FPCA 3PF9A 2QD5A 2WJJA 3C97A 4IFTA 4LXTA 1C41A 1JLSA 2NSLA 4NBSA 3V4PB 3AHEA 1FJ2A 5K0GA 4RF2A 5KHLB 1S5PA 3OCUA 4LDPA 3B60A 3BJEA 4LXIA 5TQVA 2HZ7A 4RIHA 3RUHA 1M74A 4UUBA 4R5HA 1E3LA 2PPVA 3ZCUA 2OQIA 1JSLA 4OHZA 1YZUA 1EIZA 5FPHA 4HXFB 1AK9A 3UMSA 2A57A 1OU4A 2BISA 2O3RA 4GYJA 5K3FA 4FSDA 3WGVA 4FEEA 3WWZA 3PFFA 3FF1A 3KHTA 2I4RA 2W48A 4DIDA 1WMBA 3GJYA 4LDZA 5E8JA 1RU3A 2VZEA 3LL7A 3OC6A 4O3MA 1N1EA 2VOEA 3IELA 1KVTA 1ADYA 2J41A 4DQ0A 2CUZA 3L0PA 4HNGA 4B81A 1JAHA 2BBSA 2HX1A 3BCUA 1XLTC 2JNWA 1UBCA 3I42A 2EGUA 5IT4A 3CKLA 3W5DA 1PZGA 3NORA 1DKOA 3UK7A 4YMLA 3WLSA 5DSZA 3SYKA 3GZTB 4DAOA 5KOIA 3ZXYA 1WUJS 2QA5A 1IBSA 3DLHA 1XZKA 2IHZA 2XSZD 2F3RA 3P26A 1H6BA 2VYQA 3HCWA 4A8JA 1W46A 3F2IA 2VCEA 1ZBQA 2XVXA 2OQ2A 4BLOA 1ZMBA 4DMGA 1W7AA 2GD0A 2Q9AA 3NVAA 4JGIA 2Q50A 4MVYA 3WGHA 1GG2A 1KDRA 2DR0A 2DRIA 2B6HA 2OR3A 3NV9A 3E23A 4KPUB 3W8EA 4DB2A 2EKQA 4FKBA 5COAA 1XK6A 1GARA 2D5AA 3AVUA 1ZLYA 4MUMA 4DYDA 3T5DA 4MEBA 1MORA 4EELA 1ZR2A 1PV4A 2IW3A 4GUDA 1RZUA 2H52A 3IBYA 5I8PA 1RI5A 5DI3A 1LQTA 4Q4AA 1E6MA 4LYEA 3KKZA 4IIFA 1EFLA 2LGJA 4ZDKA 4DG8A 2GHIA 3QOFA 1WXGA 4BC0A 4CCYB 2IIPA 3M1YA 1NY5A 2XUFA 2HN9A 3BWXA 3HY6A 3IDAA 1GG5A 1OC4A 4N49A 2W00A 1UPAA 3VZCA 3A7EA 2WAYA 2ZT5A 4KXFB 3F90A 2Q4EA 3LBFA 4L8WB 1JDJA 5DFAA 4DLTA 3DUFA 1C3VA 2HCTA 3AFMA 3LFHA 3KOOA 4NFHA 1ZMTA 5BWCA 3LNTA 1YIAA 1K9SA 1RAFA 3NVDA 3P94A 4PYIA 1GKLA 4UJ5A 1QG6A 3JR3A 3W9UA 2ZM5A 4BLSA 2W11A 4F92B 2JIBA 3E61A 1D1SA 5JRJA 2BZGA 1VMEA 5EHXA 2IW1A 1XZIA 4MMXB 4US2R 1UOQA 4BQPA 3IEIA 5AVQA 3DLIA 4DIFA 3FYUA 3LWBA 4JCCA 1NP3A 2ADFA 3LHKA 1VHWA 1U3GA 1P9NA 4URFA 1T13A 2DPMA 4L5JA 5SV2A 4WCDA 1DG3A 1SCDA 5LQRA 4KGDA 1EX7A 4MIYA 3O26A 3ZIUA 1SUFA 2C5SA 1REQB 1Q92A 2W4IA 5I7EA 4RHTA 3TXXA 1JQJC 2VTEA 1H2AS 1ICIA 2PUWA 3CRQA 4GKKB 1JR6A 2FMXA 3EW7A 4ZT3A 1U2DC 3PEVA 4W5NA 3FIUA 4L72A 3BORA 2J4DA 4L73A 3ZJ4A 1IZYA 3RR2A 2HOQA 2OCGA 2VHTA 3CLRD 1OIXA 2KX7A 3JVVA 4QLAA 2VJKA 2R47A 2ZJ3A 3ESRA 5CLGA 1A9XB 4YRKA 3U16A 1I94B 1FTQA 1U65A 1V7PC 2RGCA 4IDOA 3JXEA 4BNUA 4D9MA 2QQ5A 4PX2A 3AEQB 5JZBA 3H2KA 4NBKA 1U0OC 4CI0B 4O4JA 1JG1A 4PGGA 1AE1A 4RPJA 1HBJA 2V0NA 2Y2UA 2VDRB 4AX8A 1CS0B 1PRYA 1JAXA 1TCUA 3TQIA 1BX0A 1L7MA 1JX6A 2I7CA 3FSRA 2DWCA 2WAOA 3AHCA 1GLVA 4GRDA 5LSAA 1D5WA 2EEZA 3ZDXB 5KYGA 1GQ2A 2W6IA 2FX3A 3QXGA 4RMGA 5DX1A 1MCZA 5AOVA 1J25A 1WPQA 2F1HA 2WR8A 2AXNA 4FHCA 3EA4A 4ARZA 3R75A 1WHTA 4YAOA 1AVTA 3OG9A 4HBGA 4C22A 4F97A 5BQOA 3KKKA 1B8UA 4ID3A 1XZFA 2C9MA 4M4SA 4Q5IA 4Q4HA 3ZJYA 3TF5A 2NP6A 3AF5A 3OO1A 4PGHA 3ROQA 4HNTA 1IXYA 1XL0A 1YA4A 3CISA 1WXDA 4Z7NB 1PVDA 2IHTA 2N1BA 1G8PA 1YWGO 4KUGA 4ZK6A 4G81A 4J1QA 1U11A 2AJBA 1E2MA 4V03A 3GFGA 4YJGA 1L0BA 2YCBA 1KA9H 4U5QA 2OY0A 2VNIA 4S0ZA 4A0QA 3CWQA 1NAIA 3QVOA 2JKYA 5EIAA 1LXCA 2NO0A 3D6TB 4GE0A 3HJBA 5CJPA 1ZXLA 2ZIGA 3LX4A 1ZK3A 3UC9A 2H7VA 4HTAA 4PO1A 5KJ6A 3ER8A 1V8DA 3HPQA 3HDVA 2H3EA 1NQTA 1Z0DA 4PW0A 1V7QA 4UCWA 1UXIA 4Q4LA 2H2FA 1V1MA 3UATA 4BEJA 4UU1A 1XPJA 4TKZA 1DAMA 2FQ1A 2AR9A 4H59A 2QD3A 4FGJA 3PHIA 1LKZA 4TOIA 4PBSA 4OHOA 5REQB 2JFVA 1QE5A 2QTCA 4K6OA 3V7WA 4F04A 3DMFA 4TQUS 3D9QX 4LYAA 3ZBQA 2ZKLA 2AZMA 3SSMA 5KTSA 4GXNA 4MRMA 5GY7A 4CHTA 4N5IX 5EJ5A 3M49A 2OYSA 2Q2OA 1OZAA 3VNQA 3BKWA 2EZUA 2GYUA 1XCJA 3DFUA 4JUFA 3K70C 4N3CA 2IUYA 2CXTA 3F1KA 4JC8A 4I81A 1LDYA 5F51A 1ML4A 1PV1A 2OFWA 2ZGVA 1LC0A 3HYSA 3EPJA 4KPYA 2X22A 3C3MA 2CWDA 2AX3A 4RABA 1Y8RA 3ABOB 5AJTA 5TMBA 4IDHA 2XMDA 4IF4A 4A5OA 4F56A 1KPGA 4O5AA 4WNAA 4Z49A 4OXRA 3L0SA 4UFNA 3GJ3A 5FFFA 2C2ZA 3USZA 4JJ8A 4N6OA 1I24A 2OT3B 1SQSA 4QELA 4ZHQB 4TV9B 3I5YA 1MH9A 3N70A 4HN4B 4IS2A 4HBZA 3RU9A 2HQRA 3BMNA 4LXHA 1UBGA 2RIRA 1SBHA 2DH5A 1TVCA 1OZFA 1BROA 1IN4A 4G26A 1OA1A 5CNJA 1FRZA 3W1EA 1AD2A 1FFWA 3C2QA 5DM0A 1K98A 2C31A 5AXBA 6ABPA 5EMHA 4AY2A 1ZK4A 3L0CA 2DKFA 1VCNA 4UULA 4UW9A 4KR7A 4A8HA 3DA8A 4MW4A 4HYEA 5JNRA 3ULKA 3A2KA 3IQIX 5K6RA 3BXHA 5A3JA 3MBOA 4G37A 4Y2VA 3FWPA 3KBOA 1FTNA 1H42A 1QC5B 3V2GA 3VPCA 1MA3A 2D1TA 4FUQA 5K1ZA 2NUPA 5JXWA 4LC0A 1UZNA 2VI5A 1VZ3A 2YZGA 1R64A 1G17A 3ENQA 5AWFC 1I8TA 1YS2X 3KKPA 3FXAA 3NC1C 5SYNA 3R8XA 2A1UA 4Q48A 4DSUA 3IKLA 3JRXA 3M4YA 1CQXA 1GZUA 4M0UA 3UK6A 2COUA 1QGZA 4QQFA 5JI2E