3I8SA

Structure of the cytosolic domain of e. coli feob, nucleotide-free form
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
264
structure length
260
Chain Sequence
MKKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTTTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSNTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrous iron transport protein B
publication title Structural basis for the intrinsic GTPase and GDI activities of FeoB, a prokaryotic transmembrane GTP/GDP-binding protein
rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 85
structure length 260
sequence length 264
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i8sA01
3EAQA 3CNOA 3SC3A 3CNLA 4KLNA 3HPQA 1KNXA 1RW4A 4XWAA 1NN3A 2WIBA 1OXUA 1T3SA 2B8WA 3IUYA 3IEUA 5JJLA 1ANKA 4PC7A 4F4CA 2D74A 3ND8A 2ZRNA 4HUQA 4NYIR 3OZXA 3PV0A 4LJYA 1T3LA 1LTQA 2WPDA 2TMKA 4MH0R 1U0JA 2OCBA 521PA 1EWQA 2EFCB 4KXFB 1COWA 3O47A 2EYUA 1KZ7B 4R2IA 4TMWA 4B3XA 2WPDD 4MYHA 3WYFA 4HLUA 3GLGA 3R7WB 3U3RA 3Q9LA 1L8QA 1AQYA 3QF7A 1COWD 2FSFA 2VF7A 1E0AA 2ODWA 3P26A 2C9OA 2A5JA 4BRWA 2D7CA 2JLRA 5GJVC 3GLFB 1T8TA 2BBTA 4JYBA 4URVR 2PCLA 3IIKA 4HATA 1R0XA 1VECA 3T06B 2VHTA 4QGHA 2ZXUA 1R0YA 4RY2A 2I4IA 1Z5ZA 4ZIRA 3REGA 5HCIA 1X1RA 4ZCMA 1GZSA 4DDTA 4HYYA 1SXJE 1N5IA 4XTRA 4JVMA 3JZMA 4IVQA 3I32A 5CK4A 4Y0AA 3GJ0A 1GKIA 2R6DA 4RD6A 3FDIA 4QNRA 1X6VA 3Q5DA 4US0R 4Q21A 3BC1A 3CH5A 4W5WA 2GEUA 2FV8A 2WZQA 3KXKA 3RVBA 2VP6A 1E9BA 1VG1A 4PR0A 1T91A 2NO9A 4D6PA 5TB5A 1QHNA 3ND9A 5DE3A 4QXAA 3BFVA 4JKIA 5J4HA 2XNDD 2J0QA 4BZQA 2R6GA 4X8MA 3ZYCA 2QSZA 1EGAA 1P6XA 5FUVA 4C2TA 4UNPA 1ELOA 4JSYA 5FPYA 3SYNA 1XFAA 4LK2A 4C0QC 3U6BA 1DVRA 2YWEA 1KI4A 1TUEA 4PX9A 2VQSA 1K5DA 4G1UC 4A2PA 4M1TA 1UBGA 5EE0A 2IEYA 4PXAA 4U00A 3QY0A 4TYYA 1P61B 2G6BA 2BMFA 3TLXA 3WP1B 1YKSA 4C0SA 5F3WB 1OKKA 1ZM2A 3BERA 4H1UA 4GT1A 1MV5A 5HE8A 5JHGB 1VDZA 1MOZA 3PIRA 1QHXA 2VO1A 4Q7MB 1BMFA 2A5YB 4LJ5A 4LPSA 2IUTA 5AR1A 1AM4D 3W5IA 5H70A 5EXXA 3OEED 3OIVA 5DIFA 2VYFA 4DDWA 3HJNA 1Z47A 2XB2A 3M6AA 2JLUA 1TF2A 3UATA 2QMUA 4DB4A 4GOKA 1Q57A 4YXWD 2G0NA 2QNRA 1S9DA 1UBFA 2QSYA 2VL7A 3D8BA 4LBZA 4TMKA 2FJUA 2ZS8A 4PSKA 4XSHA 2ZUCA 1R8SA 2HUPA 3Q8XB 1N5LA 1FX0B 3FMFA 1LS6A 3HR8A 2MSEB 3DM9B 1T8UA 5DYGA 1TU3A 1DOAA 4LOAA 1Q12A 5JWOA 2WV9A 1TF5A 2EQBA 1M34E 4UQOA 2C8VA 4PO9A 4C0JA 4JIMA 2P6RA 4F4JA 5JMTA 1ZBDA 3B13B 1ZM4A 4PPFA 5J47A 2ORIA 3KKMA 4RD2A 4AKHA 4JLAA 3OAAD 3EASA 2G9NA 4KO8A 2V9PA 4OYHA 1W36D 1OXXK 3THXB 3C4JA 1W49A 3RSLA 1E9SA 3GJ6A 1X86B 1HEIA 3L8YA 2PEYA 3KUCA 3W8NA 1WCV1 2Q3MA 1Q3HA 2GZAA 4Q1EA 4URWR 4AD8A 2ERYA 4L8GA 4N3NA 3I92A 1KHTA 4KV9A 4BLTA 1E2GA 3UKDA 1ZU5A 3CR7A 4A8JA 2OZEA 2QA5A 4F91B 3U5ZB 2YC2C 3MJRA 3MGCA 4QFMA 3U3KA 2VSXA 2ZR0A 1U8YA 1G5RA 2OXCA 3L82B 2QG6A 4NCKA 3U44B 1E2HA 1IY2A 1VYVA 2OAP1 3CWQA 1DEKA 5CLQA 3FYHA 1E2IA 5FUWA 1Z3IX 2CJWA 2IYSA 4IW3B 3CPEA 1SHZA 4TQAA 1Q20A 5FOSA 3AF4A 5AJWA 1WBBA 2P67A 2C96A 4NYJR 4DDUA 1NY6A 2QTHA 1DAMA 3RRYA 1VYTA 1J8YF 2BCGY 2MMGA 2Q0HA 4F38A 4ZIRB 3KFVA 2QAGC 1E0SA 5KSYA 2CL6X 2BMEA 4C0HA 1TTTA 4Q9HA 4TLEA 3GJXC 3R9IA 3LVQE 3CRQA 4BPBA 2WWWA 5ELXA 2QTVB 5DHAA 2WWIA 4DHEA 2OSBA 2GA8A 4LHWA 3NH9A 3AEZA 2AK2A 3ICEA 3NBXX 3K0CA 5TVKA 1MABA 4IDOA 3AVYA 5UKDA 5KNBA 2CLSA 2QENA 3AF3A 3NBZC 4F7WA 5A4JA 1HE8B 5H1YA 2X2EA 2F1IA 3LXXA 2WSMA 2PLFA 3T1TA 2WWXA 4LHZA 4QG7A 4OKSA 1IY1A 3RABA 4R7ZA 2Z4SA 3ASYA 4PSVA 1VG8A 4HB4A 2BEKA 4C2UA 3HU2A 1KAOA 2J7PA 4GI7A 3SNHA 3H2YA 4L5BA 3GPLA 3THYB 3F3YA 5JEDA 1ESMA 4DLXA 1WF3A 3PITA 3PUVA 4B3BA 3VR4A 3AUXA 1Z29A 1NBMA 2ZEJA 2YWFA 1RYHA 4KU4A 2IK8A 4Q4AA 2W6JA 1N5JA 2ODEA 1N5KA 3OIUA 4LV6A 4BFXA 5AUOB 1GNQA 4G5QA 2GCOB 2Q9CA 3WNDA 1GUAA 3SQWA 1RKBA 1A82A 1MO4A 3HYTA 3CRMA 4NZYA 5CIWA 3AV0B 5FI0B 4M9SA 1T5LA 1R5NA 2GJAA 1F2TB 4BE7B 3SHWA 1GIAA 5FH9A 4FXPA 1FMLA 3TSOA 3TGPA 3PG5A 4D0NA 2QP3A 2E87A 2CXXA 1IJEA 2W00A 4B75A 2F9LA 2WICA 1XEWY 4RCZA 2NG1A 1WQ1R 4OI4A 5JWHA 3QXCA 2ZREA 5FL3A 3IKJA 3NXSA 4GBMA 1JBKA 3ONWA 4W5JA 4C30A 2XITA 3PENA 1D8TA 2FFAA 3K1JA 3TRFA 4QJ4A 5B64A 2XNSA 2W6IA 1G6HA 2FG5A 1QBKC 5CDFA 3I8SA 1R5BA 1M6NA 4FCWA 4EPTA 1G7SA 1ZM9A 4F92B 2ZRDA 1G16A 2KE5A 1KO7A 3R20A 1Z07A 2V1XA 1G19A 4HAXA 4DLTA 4KLZA 1KK1A 4QHSA 3W90A 3L2OB 4M4SA 3EPLA 1JJVA 1JJ7A 1QVRA 2PLRA 2BBSA 4EPWA 4DLWA 1W2GA 3ZVLA 1OHHA 2P0EA 2CDNA 1KSGA 3TMKA 1JAHA 2BIFA 1T0JB 2G77B 1OHHD 2ZE8A 3UXMA 1U8AA 3PUXA 3KJIA 3ZVNA 1HTWA 5KDDA 3G5UA 1OF1A 4OK5A 3SR0A 4QBIA 4EIWA 2PMKA 4BWYA 3WNBA 1GL9B 4F93B 3GFOA 2XX3A 1RPZA 3WMFA 2Y8EA 1DG3A 4IFBA 1KI3A 1XCMA 4LJ8A 3QEOA 3MJHA 2MSDB 2PEZA 4D81A 5FBLB 1ZYUA 3PVSA 4OBEA 1JXOA 4XTCS 4CW7A 2NGRA 2JLZA 3PEWA 1Z0KA 4TL9A 4WIAA 1XJQA 4HZIA 1XMSA 3VR2A 1L4YA 1GILA 1OSNA 3EX7C 1P73A 1S3SA 2BBWA 4GFDA 2QP4A 5FOUA 3RANA 3K09A 5GVSA 3GJ5A 3W6NA 5L3SA 4B71A 1SVWA 1W0KD 4ARZB 3KJGA 2E1RA 3KKNA 3ZLJA 3VKWA 3LX5A 4DCTA 1IBRA 2ZRHA 1TAGA 2ERXA 3VKGA 3TR5A 1XDBA 1MKYA 3EWAA 2IUUA 5AJYA 3BH7A 3T61A 3WXMA 1CJVC 1ZD9A 3AH8A 2R2AA 1Z0AA 4AC9A 4C7OA 1D2MA 4ZDJA 1W36C 1G3UA 1N6RA 1NVVQ 3EIQA 4A15A 1JQJC 3ECCA 4KCGA 3KQLA 2J7KA 1U9IA 1M74A 4Q1FA 4BFZA 1JR3D 2J41A 3H4MA 1Z6XA 1OT3A 4JLNA 1KK3A 4XVRA 4P4SA 1FNMA 3BH0A 2VP4A 3TUJC 2HXYA 4NH0A 3CRRA 4OL0A 1OJLA 4MUAA 4CF7A 1XCPA 4ON9A 5C2JB 3VHXA 1NG9A 3KTAA 3R8FA 3THWA 5L3VA 3TW8B 1YVDA 1R0ZA 3K9LA 2FZ4A 4FMBB 1SKYE 4PANA 1UBEA 5JCZA 2IWHA 1JPJA 3EA0A 3BB1A 2JA1A 4M21A 1KNQA 2N46A 4GP7A 4NP6A 2WAXA 4BUJA 3E1SA 1OFTA 5DGXA 3QXXA 2BEJA 4U5XA 5C4GB 5A0FA 1Z0DA 2ZYUX 4YMTA 4MGYR 1QHHB 2F3TA 8OHMA 1LY1A 2J0UA 2XAUA 3IPYA 2YOFA 1K5GA 4TZ0A 1N6IA 4Q48A 2D06A 1KSJA 1G7RA 4ZCIA 4V0MA 4OHYA 2VSOA 3KQKA 1HY3A 2WTUA 4A0HA 1P2VA 3SOPA 2AR7A 2B8TA 4AG6A 2YHSA 1XBTA 2YV5A 4LSGA 3IO5A 1XTQA 2OFOA 2OO7A 4NONA 3B82A 4JBYA 1U8ZA 2R6CA 1OH7A 4URUR 1E96A 2QQ0A 3QPVA 4BQSA 2QEQA 3FHOA 3AGQA 1FP7A 1B0UA 1ZINA 1JR3E 1BKDR 1DE0A 3TK1A 4HZUA 1GFIA 4K8OA 2HT6A 3W5JA 1B23P 2ZROA 1AS2A 3EZ2A 2V1UA 2HXSA 1KJYA 2CMKA 2F55A 4PQFA 2PZEA 2OFWA 3QXSA 5IRCD 2OCPA 1G41A 2ZUBA 2NPIA 3KB1A 1IQPA 1FL9A 4CYMA 4JL8A 4KFRA 4TTRA 3L43A 2A5DA 2KJQA 3QKRB 3U7GA 2AL7A 5EXPA 2QZ4A 2ZITA 4KFTA 5EZ6B 3DVLA 2CE2X 2GK7A 4JKYA 4TYNA 1ZU4A 1IOZA 1GOTA 1W0JA 3BWDD 3PR1A 1MRSA 3WHLA 5CLLA 5BN5A 3Q3JB 1E0JA 1SQ5A 2J59A 1FQKA 3KKQA 4FMCB 4I1OA 4NKRA 1UDWA 2GJ8A 2H16A 1W0JD 2HYIC 1IJFA 3P1JA 2O8CB 1Q3TA 4Q4JB 3T15A 2PJZA 4TL8A 1H8EA 2PZGA 1P72A 3WMEA 2UZIR 2XZOA 3GLFA 4L9WA 3TNFA 4ZI2A 2XOKA 1S2MA 2O0HA 4V0ME 5FTNA 3CUEF 4J0QA 5M04A 3AVUA 621PA 4JMPA 4C0AC 3TKLA 1ETUA 5LDDC 3ADBA 1PLLA 1GL7A 1E2DA 2FE4A 2ODNA 5DI9A 3O8DA 3O8RA 1AA9A 4XD7D 3LAWA 1W4RA 3B60A 4FCTA 2FFBA 1S96A 2CHVA 3AKDA 4W5HA 1KO8A 4HDCA 1RIFA 3FKSA 5FPTA 2GBLA 3RS5A 3MWJA 1F2UB 1EK0A 2ZTSA 4BLQA 3TSWA 2QL6A 3KQHA 2H18A 3KJEA 2GXQA 2H17A 3LDAA 4P4TA 1KZGB 4TQUS 2ASEA 4QGAA 4LC1A 2ZI6A 1UF9A 3BK7A 4TT3A 3R8CA 4CEIA 2VP0A 3FMOB 1E1RA 4G5SA 1HH4A 1XZPA 2P65A 4XJXA 3EPJA 1FQJA 2FA9A 1QHSA 1I4LD 3B85A 3EWSA 4LDJA 4Q02A 4RVCA 4PAMA 3FKQA 2A5FA 5LD2B 1ZUHA 3SE0A 1S3GA 4IEIA 5G53C 4QJ3A 3RRNA 1AIPA 1RZ3A 4B3FX 2IXGA 3OF5A 1WB9A 3IEVA 2AD5A 3AVVA 4TYQA 3SHFA 4MDFA 4OHXA 3MCAA 3LV8A 2O8BB 1II0A 5CYPA 1E98A 1KSHA 1VCOA 3GLFE 4LYHA 4UKDA 1DAKA 1IN8A 5FPKA 4WXRA 2IS4A 2Q21A 2RGNC 1W1WA 2IW3A 1NMXA 4JZKA 1KI9A 1UKZA 4WA7A 4Q01A 4B32A 4JLMA 4PFSA 2QI9C 5EUQB 1P2SA 2ORVA 4QBHA 1G8HA 4QGFA 4TLDA 2IS6A 5JCPA 2Q6TA 3RWMB 4PPQA 3LLUA 1N2CE 2GRJA 4JJZA 2G1JA 3REFA 3W6OA 2F43B 2FF7A 1XXHE 2GHIA 4I1SA 4LRWA 5KUTA 4YLGA 2CBZA 4Q66C 2FMXA 4YMWA 1Q44A 3UMFA 4BFSA 4CZ2A 2ZRFA 5GADl 2J87A 1FX0A 3VNUA 4QM6A 4DEYA 1KY3A 2A78A 2V6IA 4JLBA 5FL7A 2GXSA 4BLSA 1KI8A 4DIDA 3T12A 3ZH9B 4FMCF 4H1VA 5DISB 1QHYA 3LO5A 3ZQJA 3CONA 3PEVA 4IDQA 3IPXA 4OHZA 5E4FA 4WZAE 2FDCA 1G8YA 5L3QB 1R2QA 1SXJD 4PSAA 3P27A 1XD2B 1G4UR 2YOGA 1EX6A 1LFDB 4MDEA 4ZPXA 2REXB 5KDOA 1U2RA 3BBPA 1HQCA 1KAGA 2W58A 3QF4B 3THXA 4OQMA 3DZ8A 1TX4B 2RGAA 2VP2A 3EIEA 3AP2A 1UFQA 2IYUA 4R9UC 1XPRA 3CNNA 1D9ZA 1EFCA 4DCNA 1O87A 2VLIA 3ZD6A 1G5TA 2DFTA 1G3RA 5FTLA 3U61B 2CL7X 4IOMA 3LRPA 3WY9A 1OXSC 4EPXA 5P21A 3OE7A 1NRJB 4AY2A 2X77A 2ANBA 3CX8A 4AG5A 4M1SA 4P0TA 5FTKA 5FFMA 1BIFA 4M8NE 2A5GA 3TUIC 5TDHA 3OE7D 1LNZA 1N6HA 2D7DA 3EPHA 1II8B 5HTKA 3E5HA 2IWRA 3U44A 4JVSB 1ZNXA 3U3MA 4DVGA 3C5HA 1P7CA 4RKFA 1KKLA 4QJ5A 5F9FA 3I5XA 1KI6B 4LYFA 1G8GA 3DHWC 1N6NA 3EC2A 2DY1A 3H84A 5H8WA 1ZMXA 3N2IA 2VHJA 4HEJA 2GVDC 3ADCA 4NCJA 2IT1A 3AKYA 4EFLA 4DSTA 3KQUA 5FUYA 3FB4A 3N2EA 2R6FA 2AX4A 1FNNA 2VF8A 6Q21A 4FN5A 5EE5B 4B43A 5B30A 2JCSA 5AK0A 2B92A 4TL7A 4PO1A 1M2OB 2ZI7A 4IOJA 4XOIA 1TF7A 2D62A 1HT2E 1SZPA 3LBIA 4Q7JB 3RC3A 4M22A 2QRNA 3FMPB 3MMPA 1KSFX 1FP6A 2JIZA 3FPAA 5HCNA 3BORA 5EUMA 3K9HA 4NE2A 2QM8A 5E7JA 5GJWC 1DAHA 3VAAA 1H65A 5EE9A 1CR0A 2WAYA 2DPXA 1YRBA 2Q9BA 4LUCA 4CEIB 1XRJA 3CPHA 3UMSA 1Z06A 1NNEA 2VBCA 4HB3A 2OCYC 3LW7A 1E3MA 2I3BA 3ASZA 3THYA 2XSZA 1QRAA 4D82A 1DS6A 3U60B 1E9CA 4GMDA 3QUSA 1W4AA 4LV5B 3LFUA 4Q9KA 2C9CA 2GDJA 1D5CA 4FIDA 4PC6A 5FI1B 5J4LA 3QKUA 2A7QA 3NHBA 1A2KC 2XTMA 3GLGE 1UPTA 1E2MA 4IXMA 3KUDA 3MD0A 5FOTA 3Q7PA 2GCOA 3IHWA 3EZFA 1L2TA 4JBWA 4OQNA 3EZ7A 3CZPA 2RB4A 1BOFA 3AP3A 2FN4A 3KKOA 3RWOA 3X1YA 1XJCA 1F2TA 3LH5A 4O3MA 1TQ6A 2CNWA 1OKKD 1KMHB 2GETA 2Q3HA 2IBMA 4I81A 4LCBA 4Q9LA 2PX3A 4AURA 2AD1A 3RLFA 3QBVA 2ZAOA 2NQ2C 2CNWD 3RS3A 2QTFA 4KFUA 4WVFA 1BMFD 4A92A 4B73A 2VPPA 1AQUA 1YR6A 1YZKA 3L8ZA 3M4YA 3UANA 5E3HA 4JLPA 2HJGA 4E09A 2QGZA 3LD9A 2JJ2A 2OBNA 4BLPA 1UADA 4LZZA 4JLOA 4MUBA 3F0TA 4FCVA 4E22A 1E69A 1M7BA 1WA5A 2P5TB 1OPXA 2AFHE 2KI5A 1P3JA 2JASA 2ZI5A 3ZZTA 4ZDIA 2WJVA 4TQ9A 1R6BX 4N0EA 3BGWA 1VKJA 1IHUA 3DEFA 5DHFA 2GCNA 1XCGB 3S1AB 2BMDA 3FMIA 5J40A 2FFQA 1OXTA 1XX6A 4EJSC 3B9PA 1M8PA 2AN9A 2HLDA 2H8KA 5GJBA 2RCNA 2WBLC 2YYZA 5F9HA 2ZI4A 1YZTA 3HP1A 1P2UA 1WRBA 2ZVPX 4JJKA 4PC3A 3RS0A 3X1DA 4OHVA 3K0FB 2R6AA 2ZJAA 1GRRA 3L0OA 2ODBA 5BYJA 1MO6A 2GEVA 1UM8A 3IO3A 2G1KA 2QAGB 4PHGA 5KTYA 4TMZA 1QHIA 4Q7LA 3LQQA 5FUXA 4CIDA 3WRXC 2OHFA 5J4VA 4EDHA 1KY2A 4BFYA 5KNCA 2WJIA 1Z63A 1NP6A 1XZQA 4IXNA 1G20E 1RYFA 3P32A 2WOOA 4PAQA 1X1SA 1WBDA 3PEUA 3SU8A 3R9XA 1Q1QA 4OI2A 4OJKA 3EIHA 3UK6A 4NMMA 1FOEB 1W44A 2XTZA 4RFSB 2GCPA 2FPLA 2EFDB 1CKEA 4M9ZA 1GKYA 1UJ2A 2VHCA 4N1AA 4HAVA 3RAPR 4GP6A 1EXMA 2J46A 2WKQA 3U2QA 2WKPA 4ARZA 5FOWA 2GAAA 2QT1A 2DWQA 2GZDA 4GRAA 4UXJA 5JZVA 1J2JA 1NN1A 3K70B 1QHGA 2PBRA 1MH1A 2IYLD 2G3YA 1DAGA 3CW2A 1PUIA 4C9BA 5DO9A 1BS1A 1K8RA 1SXJC 1NVVR 2BDTA 2NO0A 3O8CA 2FU5C 1Q1ZA 3UWOA 3I72A 2O5VA 2AWNA 3IQWA 4GZLA 1KOFA 3H1TA 4F4IA 5EZ5A 1XMVA 2FNAA 2VRWA 2LCFA 3I73A 1IXZA 1FUKA 2ATVA 2ZI9A 4IFEA 4UNRA 2XEXA 4PTLA 2H92A 1XEFA 2HF8A 1TQDA 4OI0A 1Z2CA 4PHFA 2DHRA 5FPSA 1HA3A 2ZYVX 1XD9A 3OIWA 3EG5A 1EFUA 2ZR7A 2J7PD 5EP3A 5JSZB 5AJVB 3PJRA 2WJGA 4NYMQ 4AYWA 1S4QA 3VR3A 1Z0JA 3TSZA 3I1FA 1NBMD 5CK5A 4AYTA 4HLUC 1W4CA 2V55B 2W6JD 2WWFA 1OFIA 4OQFA 2W2TA 1Q0UA 4IEEA 5HKKA 4A36A 4Q4HB 1D2EA 2B7BA 3T35A 2O8FB 2IXEA 4TSFA 3A1WA 2ZRBA 4LJ7A 4NU0A 1QHHA 1XB2A 5CIQA 4TLAA 2ZRLA 3QJYA 1KI1A 4EQ6B 3TQFA 2FSIA 4CVNA 3K0AB 2RH5A 2HF9A 4Z54A 4DDVA 3ZD7A 3JVVA 3LNCA 4A82A 2F7SA 3VTKA 4BASA 1LF5A 2H5EA 1G4AE 1TEVA 5FOVA 3LBHA 3LA6A 3Q7QA 2GEDA 1LB1B 2WMOB 4DT1B 3NWJA 1VYUA 4AKEA 1QZXA 4HB2A 3DDCA 4ZV4A 3B1ZA 1CR4A 1OYWA 1ZJ6A 1RC8A 2DFNA 3A8TA 4ESVA 1G7CA 1XEXB 3AP1A 2LKDA 2WJYA 1YR7A 3A37A 3NDPA 4FD2A 4Z1MA 1PLKA 3V9PA 2NTYC 4JL6A 4WZBE 3TE6A 3DMDA 2Z0MA 3D6TB 4EAQA 5KPJA 3V4RA 2W6ID 4A6PA 5JS7A 1DO2A 1P4SA 4X8HA 5JWRA 2QORA 1NY5A 3U7FB 2PT5A 3QG5A 1AN0A 1NL3A 3NG1A 2IUSA 3ADKA 4B35A 4W9MC 4XH9B 1MR3F 2QPAA 1HE1C 2QBYB 1SULA 4TTPA 2JJ8A 4D4LA 1G21E 2O8DB 4Q5IA 1NBME 1A2BA 3QKRA 3QPWA 4BEJA 3I4LA 1KO4A 1MO3A 4G5RA 4JVLA 2QT0A 1YZUA 4KBGA 3HU1A 2IHYA 2KB0A 3BH6A 4HLCA 4P33A 2C77A 1UEJA 1ZIPA 4IDNA 2JLWA 5EQTA 3W6PA 4RJLA 4JLVA 1MO5A 2ZU6A 2YOHA 1VG9B 2IYTA 1W46A 1SVOA 2O8CA 1CJKC 1ZD8A 4Q4JA 1G3MA 1H8HA 2DFLA 4LY6A 2OLJA 4NHOA 1W36B 2O52A 1KDTA 1T0HB 1UDXA 2RGXA 1S0UA 1EESA 3SEAA 3NEYA 3F8TA 1Z6AA 3KFXA 3TIFA 4R2HA 4UXHA 3SI7A 3IIMA 3QQ5A 1N0WA 1SHKA 1TL7C 3PUZA 4HDOB 2IA5A 4DJTA 1FTSA 3AVXA 3B5JA 1N6KA 2ZSDA 2Q9AA 3CX6A 1II9A 3LBNA 3KX2A 1QG4A 1S1MA 3L0IB 2NO7A 3IHLA 2R44A 4B2LA 1BYIA 1ZM3A 5CDFE 2QMHA 2IYXA 2VEDA 3GEHA 4C4PA 1ZC4A 5JI3E 3LLMA 4WXPA 1NJGA 1NLZA 1OE0A 3N70A 4KYIB 3ETLA 1X8JA 3F5FA 1F2UA 1OH8A 5BN4A 4D2IA 5KU1A 5GVRA 1CLUA 3ZIAA 3O8BA 2A9KA 1DADA 1ZNZA 1CJMA 5D3MB 1JECA 5AWFC 2YINC 2D4HA 3ZIAD 1F6BA 3W9YA 3X1ZA 1E9AA 1LV7A 2EYQA 3GJ4A 3SJAA 421PA 4B2PA 1E9EA 2H7VA 4MITA 3U7EB 3BFXA 2ZRKA 4EFNA 3E2IA 2IX3A 2FSGA 2ZSAA 2NIPA 4L15A 5KO2A 2WWYA 5FR1A 1NI3A 4V0KA 4B3CA 4NBSA 2XJ4A 3GLHB 2BJWA 3FHTA 4US2R 4A2QA 1GVNB 2IEZA 5EP1A 2V3CC 4WBSA 4B47A 5JBQA 2VA8A 1E9FA 1P60A 3B78A 4LC0A 4FI3C 1UKVY 1PLJA 1RRGA 1Z6TA 2AKAB 1Y63A 2JEOA 4XWOA 1N6LA 4RKEA 1FZQA 2YKGA 2O8BA 1IN6A 1XTKA 3K9NA 4A8JC 4RSGA 1CF4A 1JQLB 1VTKA 3TUZC 2QAJA 5KSPA 4KJZA 3KB2A 3SDZA 1J90A 1ZUNB 3EZ9A 3B9QA 4O0MA 2DR3A 5E95A 5FBRB 4B44A 4BLRA 5FBQB 1R10A 4Z51A 2KBFA 1VIYA 2FSHA 2QMEA 3B1VA 1W4BA 1GTVA 2ZRMA 1R0WA 3BB4A 2OT3B 2OM2A 2NO6A 3AUYA 4CDGA 3CKLA 1Z28A 1E4YA 1YJ5A 1F48A 2F43A 3AKEA 4DUGA 3D31A 1A1VA 2QUZA 1UAAA 1U99A 3BRWD 4E5UA 2DWPA 3LW8A 1X3SA 2NZ8A 4HUTA 2FWRA 2PH1A 5KSZA 1WXQA 4M1WA 4MYCA 2BC9A 3QXHA 1L4UA 1ZUIA 4RD0A 2QGNA 2Z83A 2IS1A 4MQBA 3RHFA 1F3OA 1P9WA 1T6NA 1U81A 2ZQ5A 1ZRHA 2ZS7A 3DOEA 4POAA 4M9QA 3K0CC 2P5SA 2YNMA 1TPZA 4ZKDA 4O2RA 2IYZA 2JAQA 4LYAA 1E94E 1PZNA 1LF0A 1VIAA 5L3QA 3CF2A 3P20A 1XD2A 3NHAA 4HAUA 4OJQA 4IDPA 2J5XA 3OEHA 4RD1A 4A1FA 4V0OA 2IS2A 4LJ6A 4E07A 2Z4RA 3QF4A 2O8EB 4C0LA 1E79A 5HZHA 2WKRA 4KSCA 1W47A 1SKQA 3DPUA 5BWMA 1VG0B 3HPRA 3NVAA 3TAUA 1YHNA 5IT5A 2CE7A 5K8IA 4NTZA 1QF9A 1CRQA 4FW9A 3T1QA 4CEHB 2WJHA 1YZNA 1OIVA 2C99A 2QPTA 5CITA 2V54A 2OCAA 1CR1A 1ZC3A 2D2EA 3UWKA 2W0SA 3RS2A 4GZMA 2ZJOA 1K6MA 2QY9A 1II8A 3CF6R 3GEEA 3MSXA 4G0NA 2GXAA 1N0VC 3RYTC 3NH6A 3KQNA 1NKSA 5B2ZA 2ONJA 2J0VA 1JR6A 2GAOA 2MMCA 4DEXA 1KI6A 4MKIA 2BVNA 3GD7A 1DG1G 1OV4A 3ZZ0A 3OIYA 1QVAA 4L9SA 1CRPA 2F1HA 4L4UA 1H8ED 2MSCB 1NIPA 4JBXA 5GJCA 3EXAA 3CB4A 3T1OA 2FOLA 1FMJA 2QRZA 4MA4A 4TTQA 2XOKD 5EP2A 4PHTA 1TEXA 2IL1A 2CK3A 3SBEA 4LBWA 3TH5A 2Z5FA 2J3EA 1F5NA 2B21A 1Z83A 4DLRA 2ZI3A 3A58B 1WDTA 2WHXA 2B6HA 5TY0A 4E03A 2GF0A 4YMVA 4XSGA 3IQXA 4HI0E 3GCGA 4BZPA 3TVTA 4A6XA 2DYKA 2I1VB 3FKSD 3UPUA 1ONBA 3MWYW 4B3GA 1OB2A 4BFUA 2ZE7A 1HV8A 1SKYB 4S35A 4FMDF 1UKEA 1OFHA 4I99A 3GLIB 1UBCA 4TT3D 1ZNWA 4PC2A 3X1XA 3LXRA 1W48A 1A4RA 4CRWB 1E1RD 2QPOA 1WP9A 4MGIR 5TMPA 3A1VA 2VIIA 4KBFA 1J70A 3L0PA 3MWKA 1V5WA 2KBEA 2ZRCA 1EG7A 4ACBA 1HURA 2BOVA 1FW6A 4GDFA 4R71A 3VX3A 3AF0A 2ZRAA 5DI3B 2O0JA 3BE4A 3VFDA 1CS4C 4MRPA 3FWYA 2ATXA 4DC9A 1I4DD 1VCMA 3MAAC 1GKUB 3T34A 4NL4H 3AVTA 2C98A 2ZANA 4YMSA 4JS0A 821PA 1FUUA 4Q7KA 1WE2A 3K0SA 2PT7A 1GNRA 1KMHA 2V7QA 4D80A 2PZFA 1C4OA 1J8MF 5SZHB 3T1VA 3U6KA 2EWVA 2FH5B 2HCBA 1DPFA 5D3QA 4D4MA 1XMJA 3K09C 2VH5R 3LWNA 3OESA 2QE7A 2BM0A 2XZLA 4RZXA 1D2NA 2E9SA 2ZJBA 3MRSA 2XXAB 4BLOA 1TQ4A 4O25A 1QDEA 3JVUA 3B1YA 3VX4A 2GVZC 4IJMA 4EKDA 3UG7A 3VU9B 2NZJA 2F3RA 4LPKA 4PPGA 4M2LA 3B6EA 1S8FA 3KDSE 4Q47A 3H0KA 2WOJA 1C1YA 4ILEA 1UEIA 4EUNA 3FHCB 4IOLA 2OBLA 5L8VA 1KYIA 4GSYA 1LW7A 3S1AA 4DXAA 1XTRA 4QNMA 5FL7D 5BN3A 4CEJB 3MLEA 1Z8FA 4MKFA 3GJ3A 1A7JA 1ZCBA 4KSBA 1W5TA 1E1QA 4Q1CA 1PVOA 1R4AA 2ZRJA 3K9GA 2AFIE 2Z6VA 4Q03A 1YE8A 1CR2A 1CTQA 3P4XA 3AB3A 1U9IC 1IXSB 3TQCA 4AI6A 2SHKA 1EFHA 2CVFA 4G3XA 4PZLA 3ZS8A 3K0FA 3NBFA 2FPKA 2C2HA 2ZE5A 4TYPA 3Q85A 2QAGA 1W5SA 1L7VC 2VP9A 4D0GA 5SZIA 1Q1EA 5J4KA 1FTNA 1EWRA 2RKOA 3NIBA 1XMIA 2RHMA 221PA 3KKPA 2VHUA 2BM1A 3AQ4A 4EPRA 4GNKA 3KJHA 5TV2A 1AZSC 2FEMA 2ZYWX 1QG2A 3HYRA 3WNCA 3CIOA 4I1VA 3K8YA 2CVHA 1IAQA 2GNOA 4TMVA 1DARA 3A4NA 3EA5A 3KXLA 3WHKA 4QM7A 4UJ3A 1I2DA 2GKSA 3QKTA 4IOKA 1AS3A 2OFXA 2ZR9A 1CU1A 1T9HA 4RFSA 4M0LA 2IHBA 2XB4A 5DYIA 2ORWA 3NDBB 4MGKR 3RNLA 3GFPA 4H9GA 4DKXA 4DSUA 3BD9A 3SJCA 2PL3A 5KYKA 4MRSA 3W3AA 5HPYB 1TQ2A 1U98A 4V0LA 1MT0A 4QRHA 4DSOA 5LPNA 4AKIA 3WBJA 2OV2A 3K70D 4AIIA 5SZKB 5IHPA 1YU9A 2RGBA 3AVPA 4BZXA 5SZJA 3NC0C 2WM9B 2GF9A 4V0NA 2F1JA 1HYQA 5EXTA 4JLDA 2ZETA 4DLVA 1P5ZB 1AKYA 3B2EA 1Y3AA 1SVSA 3V00A 4NCIA 2HJVA 1V43A 2J45A 4LYJA 2P6NA 4LJ9A 1RE0A 5BXQC 5K8UA 4V02A 1LVGA 4Q9IA 1E2JA 2JIZD 3HU3A 3X1WA 2N1BA 4HAZA 2WJJA 4AWXA 4A0RA 1G17A 1JPNA 3LY5A 2ONKA 1NJFA 3KL4A 4TMTA 2J1LA 4NYMR 3GJ8A 2EVWX 2EU8A 1XXHB 2G88A 5CB8A 1SVIA 4DB2A 4URZR 4BFVA 2KSQA 4TLBA 5BW8A 1KIMA 2UVQA 2XSZD 4JL5A 2W83A 4RZUA 3CH4B 5JSZA 4Y0VA 3RC8A 1KDOA 4GMXA 2XNDA 4DCVA 2HDNB 2Q3FA 4BRUA 3PCRB 1OXVA 4GL2A 3SN6A 4Q4HA 1GRQA 2BMJA 2O8FA 1DO0A 3EC1A 4KHZA 4EJSB 2CLCX 5HZKA 2WMNB 3PUWA 4EQ6A 4JT4A 3K0AA 2VSFA 4HAYA 4DRZA 3U4QB 1ZNYA 1NMZA 1GAJA 3W3ZB 4PZZA 2D2FA 4HLQB 4AKGA 4U7DA 2ZPTX 4DT1A 2WIAA 3QKSB 1J99A 1JEEA 3A4MA 5E7MA 3CRVA 4GOJA 2PMDA 4YDHB 3FFBA 1Q22A 2RMKA 2W0MA 2GJSA 3RS7A 2ZSFA 3QI2A 1AJEA 1XEXA 2GBLC 3FFAA 5J4YA 2JJ2D 2OILA 3OEEA 5HE9A 1I4TD 1VHLA 4QGGA 5KOYA 3QNUA 1NSTA 4Q00A 3SYKA 3A1TA 5FBVB 4LBYA 3GMTA 2EFHB 2GK6A 4YXWA 2BBOA 1S9HA 1DAIA 4URXR 3CO5A 2QBYA 5K8LA 2QM7A 4A0GA 1ZW6A 2O8DA 4M53A 5KNDA 4RFVA 4P31A 2HLDD 2QMOA 3GP8A 3VHLB 4IKEA 1US8A 2BKUA 1N25A 4DCUA 2A30A 1KJWA 2JGNA 3WP0A 5J5CA 2YWHA 5IK2A 3EZ6A 1SXJB 1UKYA 3SJZA 1E2PA 5DNYB 3OAAA 3ZVRA 5IK2D 4MRNA 1NVUQ 2BWJA 4QOSA 3NEJA 4HDQB 2C78A 1G64A 5ANRB 3X2SA 4KITB 5JECA 1JNYA 3IILA 3C14C 2FGJA 1NVXQ 2REBA 4CT4B 1NN5A 1RJ9B 2C95A 4B3DA 2PJRA 1XU4A 2CHGA 4OQLA 2OAQ1 3BJIC 2C5LA 1NLYA 5LB4A 5IF9A 2QN6A 2HEIA 5JEEA 1E6CA 3RRZA 1E32A 2EW1A 4OK3A 1AGPA 3PXGA 5IDVA 2JJ1A 2UZ3A 1NIJA 2R9VA 4KAXA 2BV3A 2JATA 3QPUA 3VMFA 3TVDA 4DCSA 2JJ1D 2PCJA 3TJZA 2KWIA 2WWGA 4HUQB 5CB6A 2X2FA 2LWIA 3H86A 4B6FA 4X8OA 3MWLA 2V8OA 5F98A 3IGFA 2ZRIA 2AXPA 2REOA 5TARA 3VKHA 3WYGA 3QIAA 4K46A 4NYIQ 2IYYA 3FE2A 3GLGB 3OFNA 1AZTA 2X8AA 2ZE6A 3A36A 3C8UA 2RGEA 4RZ3A 4YDSA 5D3MA 5EE1A 4BECA 2ZM5A 4QL3A 2ZRGA 4D4JA 1ZD1A 3VR1A 3OFND 4L16A 3I62A 3CF0A 4Q1AA 1Q1BA 2W2VA 3VQTA 3I61A 3B7GA 2W2XA 2GWHA 1IM2A 2RAPA 4B76A 1TNDA 5CYOA 1SVMA 1JI0A 4D25A 4Q19A 3U3JA 4YONB 1J7KA 2P6UA 2XJ9A 2ZVQX 1NN0A 1OIWA 3CRW1 3QOFA 1KI2A 2F9MA 2C04A 4X8LA 3GLHA 4YC7A 1CXZA 3BB3A 2BJVA 4R98A 4M1MA 3ZJYA 3WYAA 3QSYA 1XTSA 2CL0X 5CM8B 2IC5A 4DLUA 1TMKA 2HT1A 1Z08A 3FOZA 1AK2A 2AHOA 5G40A 3SQXA 3PUYA 1OH5A 2CHQA 5FPHA 1TU4A 1YZQA 4D26A 4BFTA 3MFYA 3T5DA 1D6JA 3QBTA 4DIEA 4C0KA 4K81B 5E7IA 2JLVA 1CIPA 4KI0A 2ZRPA 1X8LA 1IY0A 3EW9A 5KPDA 4S2EA 2ZSBA 4ZCLA 2RHDA 4TWZA 3U3OA 2F6RA 3ICQB 4NCNA 5HKKD 3AVWA 4NPHA 1G18A 2FFHA 1KTVA 1GSIA 4DLSA 2DCUA 4TSFD 3K70C 2CCGA 4DLYA 1T4GA 3HDTA 5JFGA 4D0LB 2YWGA 1U0LA 2OUKA 4IHQA 1IN7A 1PUJA 3TAHA 5KDLA 3DL0A 3UIEA 4LBVA 4QHYA 3SZRA 1G291 2QU8A 2YZ2A 1YZLA 3AVOA 1G7TA 4HB0A 2N42A 1E4VA 1AKEA 2OEPA 3L0SA 4Q1BA 4B33A 5C1BA 4LHYA 4LJ4A 1FPMA 4JLJA 3ZGXA 3GEIA 3CM0A 3GLHE 4Z1MD 3OHMA 2NMVA 1IXRC 3QVVA 5EE3A 2BKEA 2ZIAA 4Q18A 2O8EA 3C15C 2JLYA 4TZ6A 5FTJA 4ABYA 5G41A 4XVUA 3BOSA 2OLKA 1HUQA 1U90A 2HV8A 4ASUA 2ZJ2A 3SS8A 2QQEA 3J81k 1G3IA 4CEHA 4QC2A 3DOFA 4ASUD 1U0HC 2GXUA 5BYKA 1G8PA 1RRFA 1LS1A 4TN1A 1M1YE 1US8B 3TW4A 1GM5A 1T5IA 2FZLA 5EXSA 4OI1A 3DMNA 4ERNA 3EARA 4EPYA 4NDZA 1IN4A 2IYWA 2OESA 1WMSA 4UNNA 1Z6YA 1E99A 2CCKA 4URYR 3SYLA 1KMQA 3UMRA 1EX7A 2X1VA 5KSOA 3AM1A 5B57C 2R62A 2JLXA 4PAOA 1ZP6A 4B48A 1H8HD 4ESHA 3A4LA 2AK3A 5DLQC 1GP2A 3BXZA 1BYUA 5FOXA 3PEYA 1F60A 1NMYA 2ZSEA 1M7HA 1IN5A 4Q9JA 3CX7A 4A2WA 2CEAA 5EJEA 1NLFA 1E9DA 2P3SA 1KKMA 2AXNA 2IYRA 2WVJA 1GG2A 1OLOA 1KO5A 1NKTA 4P4UA 4A8JB 4M1OA 3THOA 4EPVA 4U02A 3VR5A 3W8RA 4NCHA 3Q5EA 4IVRA 1OIXA 4HLDA 2ECKA 1Z0IA 4OQXA 2RGNA 1AS0A 3PQCA 3ZQ6A 1KDRA 4LHVA 2H1LA 3C41J 4MKGA 3A6PC 4A9AA 5G3YA 4JYCA 3A1SA 4RCYA 3KZ1E 1VHTA 5FTMA 1W0KA 2CJWB 3SJBA 1CJUC 3TBKA 3GLIA 4Z8YA 3N5CA 4ZI3A 2I1QA 4JSTA 4A4DA 2JLSA 3CZQA 3AKCA 2B7CA 4UNSA 4RD4A 2YC4C 3ZDQA 1NSFA 1XTIA 5F2EA 4MKHA 3K53A 4EFMA 3NBYC 4P3YA 1TUIA 1IONA 2GJKA 3I5YA 1HT1E 5K8TA 4NYJQ 2G83A 1XJ0A 3ADDA 1Z2AA 4ZDKA 4C0BA 2OE2A 2FGKA 2PX0A 3LX8A 2IXFA 1E2EA 4XIGS 2J0SA 5DI3A 4LWZA 1E2QA 4AK9A 4YQFA 3WBKA 1MRNA 1MABB 4UXIA 3QEJA 3FGNA 3IIJA 5FR2A 2O0KA 4DLZA 3B8HA 2GTPA 5C46F 1JR3A 5DN6A 3G0HA 3VR6A 1BH2A 3IDQA 2ZS9A 4V03A 2OG2A 3CLVA 5A5GA 5C18A 721PA 4FMDB 1U94A 1ZIOA 3V4FA 5DN6D 3AF1A 1S1CA 2X19A 4JLKA 2C9YA 3DO6A 1KI7A 2HYDA 1G1MA 2FX3A 4ZDWA 1ESNA 1ZM7A 3HWSA 2XXAA 3I8XA 2DB3A 2VHQA 4O2LA 1KK0A 5JHHB 3CWZA 2R8RA 3GFTA 5G3ZA 3D7MA 4TYWA 2AWOA 4Q4AB 3GJ7A 3VU9A 2K5UA 4DUGD 4FWTA 1CBUA 4PQRA 2ANCA 1GITA 5AUQA 4LHXA 3B1XA 3K0EA 5CJPA 4PPNA 4B34A 2C03A 3UG6A 4BFWA 5FBWB 5JRZA 4HAWA 3GLIE 5LB2A 2ZAMA 2GILA 4KODA 4CEJA 3QE0A 1G3QA 3LQRA 5EP4A 3SFVA 1KGDA 4DSNA 4AYXA 2NOAA 3BS4A 5KHOC 1ZCAA 1E2KA 4UNQA 4WW0A 3BFKA 5AJXA 2F1RA 1FFHA 3G82C 1OW3B 1R7RA 1JALA 4MRVA 4WOPA 3C16C 3A1UA 1XF9A 1ZAKA 3PFIA 4CGZA 4LJAA 1RFLA 1XTJA 1A5TA 2QROA 3OEHD 4OK6A 4WZ6A 5BQ5A 1VCIA 1N3BA 1RRCA 1SGWA 1XPOA 1E79D 4JT2A 2XZPA 3CPJB 1YR9A 3TR0A 2OXRA 1P9NA 5CJ2A 1Z22A 3VNVA 4G01B 5JLJA 1YRAA 2HCJB 4PZYA 4RD3A 3DKPA 3NKVA 1KDPA 4KYUA 3ZS9A 1OFUX 2J9RA 1AGRA 1T3HA 4QBFA 1G5PA 3I3SR 1E9RA 1NF3A 4I4LA 5H68A 1R8QA 1Z0FA 2BCJQ 2EWWA 1JXMA 3ZZUA 2DBYA 2UKDA 1OB5A 1P75A 2V6JA 2XGJA 1W2HA 1JEDA 2G0TA 5C4MA 2L0XA 5TXGA 2H57A 4IRUB 3WRYC 1DAFA 3MUFA 4P32A 3QENA 5CM9C 4XVQA 1P9RA 5DSZA 4B74A 4ZO4A 4US1R 5AUNB 5L3RA 2AKYA 5JJIA 5JJKA 1ODFA 3FTQA 1BO6A 4M1KA 3R7WA 2CCJA 1VCNA 2CK3D 2WWHA 1DTSA 4WAUA 2JLQA 1OYYA 4TL6A 3Q72A 4LV8B 2ZYTX 4Z8XA 2Z43A 1Z6GA 4Q4LA 1PJRA 3IBGA 1XD8A 5LBIA 2VTKA 4MYUA 4RZ2A 4ZKEA 3BAFA 4XWKA 2YJTD 1RRPA 2NPFA 4DZZA 3NTUA 3B1WA 3BIFA 4XD7A 5AJZA 1SVLA 2GZHA 1PV4A 2YVUA 3U7HB 5L3SB 5JI2E 1G9XA 4QBGB 1XEWX 2FPMA 2WSSA 2ZJ5A 4M1YA 4UJ5A 3RS4A 1YZGA 1EFRA 1XXHA 4QKQA 4QHTA 1DBSA 2WSSD 2ZJYA 3LVRE 3FVQA 4JVNA 1E0KA 1EFRD 2DWOA 2XTNA 5DH9A 4I1UA 3T5GA 4G5OA 3HR7A 4KFSA 4TMXA 4KVAA 1XNJA 1N6OA 4BEBA 3EPKA 1XPUA 3JZAA 3WMGA 3RDPA 1TADA 1NVWQ 4C7OB 1P62B 1YQTA 3CBQA 3AGPA 3R9WA 4CT5A 4LI0A 5AUPB 4MRRA 1GL6A 2EFEB 1D9XA 3GQBA 4EJSA 1C9KA 5JS8A 2RGCA 2ZJ8A 2LKCA 4ITRC 2IF0A 1P2TA 4B2IA 2ZU0C 3U4QA 1X8KA 3SBDA 4PQYA 4D4KA 1G6OA 2V7QD 1CJTC 4Q1DA 1CULC 3AVQA 4BGDA 3QXJA 3M1IA 4P4SB 4GPTA 4KVGA 3QKSA 4HSEA 1DAEA 4FINA 4PHHA 1GNPA 4C3ZA 1N0UA 2V4ZA 2QE7D 5JRJA 1W7AA 1CEEA 1HQYE 1I2MA 2BHRA 2RGDA 1E2LA 121PA 3DM5A 4IDHA 2CLDX 4IVPA 3E70C 1KK2A 4W7SA 4DBLC 3KTAB 1EFTA 1DELA 2ZJZA 2D3WA 1O3YA 4YMUA 3IBYA 3MG9A 1RVDA 2DFKB 2GJ9A 3QG1A 3THWB 2NO1A 4FWIB 2IYQA 2R65A 3P4YA 1VMAA 1JAIA 3KXIA 2FEOA 3AF2A 1N6PA 1SVKA 3RSOA 4A0FA 4MGZR 1R5OA 3CR8A 1JB1A 2QP9X 2VP5A 4M9XA 3SFZA 2J0UB 2ZUDA 3ZVMA 1KJZA 4LX0A 2GESA 2P2LA 3RRMA 1CP2A 5LD2C 4TLCA 1NG1A 1E1QD 4N0DA 4MYTA 4PC1A 3M0EA 2JDIA 3QVUA 2IYVA 1XWIA 2A2ZA 3D3QA 4II7A 5B58C 1Q21A 4B6EA 1OH6A 1ZVQA 2JDID 2EFGA 3C5CA 4LGMA 3DZDA 3W34A 1E2NA 4ACAA 1GRNA 1GWNA 1SXJA 2OBMA 1G8FA 1KO1A 1VPLA 2IF2A 4GOXA 1M7GA 3DKVA 4OHWA 1GDDA 4HZUB 1E2FA 1YR8A 4G5GA 4PO8A 4DWJA 5HR5A 3C7KA 3NC1C 1XP8A 2A3RA 2RGGA 1RJ9A
chains in the Genus database with same CATH superfamily
2HTEA 3EGWA 4N5HX 3CBGA 3EDYA 2G17A 4GI3A 3CS3A 3CNOA 3OLVA 3WZ2A 5BVGB 4QPDA 2V8BA 1RW4A 2GBCA 3T1HB 5I9SA 1QYVA 1YQ9A 3UV6A 5JJLA 4C1NA 3CLRC 1H1DA 4PC7A 1GN9A 3ND8A 2JIOA 3HADA 1XLTC 1FIUA 4MO9A 2EJBA 1PL6A 4ND3A 2VDMB 4DW8A 3R24A 5KTPA 1KAHA 2TMKA 3CUTA 2DKFA 1U0JA 2OCBA 4KYTA 5D84A 1LK7A 1NVBA 4BN4A 1COWA 3W3AD 3WYFA 4CWAA 4TQGA 4JT8A 3EISA 1ZLXA 1L8QA 3QF7A 2XAAA 1COWD 1KXJA 2YNMC 4H7IA 1E59A 1TM4E 5DXFA 2IPNA 2QVGA 2WDPA 1ODKA 4M6WB 3ZUPA 4ENTA 4FFNA 2HRRA 2A5JA 3R74A 2WMDA 2I91A 2Z8XA 3O7WA 1A97A 4TTSA 4EUKA 4IWXA 3I9MA 4HATA 4W6QA 3HR4A 1RXUA 2O3SA 3PHIA 1L7OA 4QGHA 1E6WA 1R0YA 2FF5A 3R5KA 4EGJA 2I4IA 4Q12A 1RJDA 4QU0A 1JEYB 2WZBA 3REGA 1REQB 4FT2A 4KXVA 4D6YA 4X6UA 1T9GS 4DDTA 4HYYA 1MB4A 4RHTA 1D03A 3C1UA 3P9XA 1KE2A 4ED9A 3LUDA 4C4OA 5L51A 1Q15A 3JZMA 3OLCX 4Y0AA 4NBTA 1JEAA 3FDIA 4LXIA 2WRZA 3Q5DA 4KXXA 3M82A 4US0R 5FWDA 4L5JA 3TLZA 5JR3A 1LPSA 1M8GA 1F8UA 2FV8A 3O26A 1RZRD 3L7YA 4X1KA 4O1HA 3A1NA 1Z45A 2AFHA 2OZVA 1JZTA 4Y98A 4AS2A 3DV2A 2XVAA 3ND9A 4QASA 3FIJA 1R8XA 1A3CA 3LUCA 4AMBA 3BFVA 4JJ7A 2XNDD 2QMQA 5JH7F 1TXGA 2FFJA 3IPAA 1IDN1 3AR5A 4CM6A 1L5ZA 3HNOA 3KUUA 5H02A 1IPHA 3WJ2A 3EVGA 3IPLA 4O8ZA 4H4CA 3ZYCA 4D8XA 1K4MA 2PGDA 3COJA 4C2TA 5LN1A 2GDZA 4U8HA 4YRBA 1Q7EA 2H2AA 3R6LA 4F2DA 3WFIA 1TFRA 2JGIA 3PKZA 2LNDA 2YWEA 4PX9A 3SQLA 3VZDA 1D8AA 2YWDA 4AY4A 3S44A 2OGZA 5ARDA 4COKA 3AFHA 4M1TA 2HMSA 1UBGA 4EG5A 2WNSA 5EE0A 5EEHA 1RWKA 5DMXA 4K6CA 2OQVA 4U00A 5I7SA 3QY0A 1Z12A 1K8ZB 5DP2A 4QTTB 4S1OA 3PE6A 3ITKA 3FFXA 1D2HA 2FZWA 4UC0A 1TCVA 1V4NA 4LCJA 5AI5A 3PYXA 4C0SA 1GZ7A 1OKKA 5A02A 3BERA 2R4UA 4H08A 4QXRA 1W76A 2IPAB 2FR1A 1ORWA 5E38A 3I9V1 4IJQA 1G20A 1MOZA 5KJFA 2VO1A 4JB3A 5AR1A 4E5DA 4MVJM 5E3IA 3H1EA 1BW9A 5CG1A 5GZ6A 1XQYA 4QPZA 2I2CA 4ZALA 2Q7XA 4G36A 1NVGA 3H5RA 5GJBA 1TF2A 3QI7A 3STUA 4GOKA 4C43A 1SQ6A 4YXWD 2G0NA 3FCCA 1T5BA 2QRMA 1JQ3A 2FXVA 1S9DA 3D6VA 3I4FA 2NYRA 2QZSA 4LBZA 3CB2A 5DNDA 3OTWA 4HXYA 4YHHB 1IJKA 1R8SA 4B87A 4CKEA 2HUPA 4CUJA 2Q4EA 4OEHA 2LVBA 5EJMA 3E9ZA 3MXTA 3EDMA 3DM9B 3JQ7B 3WL4A 2VF4X 5DYGA 1IQRA 3T0GA 4F5ZA 1RC0A 4NZOA 4B40A 1YULA 3NM4A 5BT8A 4LOAA 4FGUA 5ICFA 1Q12A 1YE3A 4AN0A 5K3FB 2I4LA 1SXIA 3EFEA 4UQOA 2J3QA 1ATIA 1NW3A 1QC5B 4JIMA 4MARA 1TKBA 2PKQP 1EEHA 2XQVA 2EJTA 1VM6A 4JLAA 3CZMA 3BMCB 4LXGA 3TM5A 3RSLA 1E9SA 2OBXA 3GJ6A 1A4XA 1JNXX 5A5VA 1IMJA 3FYCA 1JLMA 3MQ2A 1QIEA 2PEYA 1E5TA 4AXXA 5K09A 3KV3O 4DQ0A 1NTOA 1W52X 5SICE 4URWR 2FEAA 3WL3A 2GFHA 1QF6A 4AQYB 3KEQA 2Q50A 4N3NA 4O08A 3MRVA 4R1NA 3WGQA 3W5AA 5I8ZA 3R7DA 1XCLA 2MOKA 1MQSA 4W1RA 3UKDA 3UMCA 4JD5A 3CR7A 4L6CA 2QA5A 4F91B 5IKEA 3AUFA 2YC2C 3E6AA 2QV7A 1P1CA 2AH5A 1FFWA 1MJGM 2GLXA 3MJRA 4QFMA 2GZ1A 2ZR0A 4RV5A 2H4XA 2ZG6A 4ZTBA 4D1YA 3PEEA 3ELDA 2OXCA 3OF2A 3P97A 3HU5A 1SWVA 2W2LA 4NCKA 1E2HA 2AI2A 2V58A 3OZWA 4RLSA 1IY2A 2OAP1 2XNCA 1W88B 3PC2A 4WKNA 5CLQA 4Y2JA 1RM4A 3EUAA 2WU4A 1RYZA 3CPEA 4TQAA 1DQSA 2XMPA 3PPYA 5FOSA 2O1XA 2I4NA 3AF4A 5AJWA 3RGGA 5AFSA 4O5OA 4KWTA 4X20A 1QP7A 2B5OA 4JQOA 2ZUFA 2N47A 4DDUA 1EFAA 1DAMA 1UR5A 1J8YF 4MQ6A 1J2RA 3B6KA 3WA6A 2Q0HA 3BIWA 1OGJA 3WTCA 1GO2A 4F38A 1LSOA 3PQ4A 4I9FA 1CUYA 1FMCA 4W9NA 2Q2QA 4BVJA 2PGIA 4LW8A 3GJXC 3ZHZA 4WXMA 1TVCA 3R9IA 3ZHCA 3WB9A 3ANTA 1XPJA 3KHSA 2QTVB 4ZQFA 5ELXA 2WWIA 2W7TA 4DL9A 4DHEA 1ISFA 4LHWA 2GA8A 3WK8A 3R6DA 2X0EA 3HXMA 3ICEA 1NJ1A 4YASA 3K0CA 4CJXA 4R8SA 1MABA 1JQEA 1QIHA 3L6OO 3D3WB 1L1QA 4Y6OA 3T7SA 4E5PA 3V32A 2XEDA 4ZVRA 2GLTA 2QJWA 3BIJA 1E1DA 3LC2O 1HE8B 4E08A 2X2EA 4F7WA 3N0WA 2WB2A 1JIJA 1MB9A 3MAJA 2PPLA 3A28A 4M0KA 1R3DA 5FADA 2HMWA 3FDXA 1IY1A 1U3WA 1Y1SA 3H4IA 3RABA 4HEA6 4Q34A 3G3EA 4M7PA 2ECQA 2HWYA 3RPEA 5JNUA 2PL1A 5DM4A 1ZXLA 3TD9A 3TR6A 1OZ0A 4IQFA 2IEGA 3WG9A 5JEDA 2PQ2A 3GPLA 4B3BA 3THYB 3E18A 3VR4A 1G21A 3ICWA 4C7KA 2JHCA 2YWFA 2CNKA 3A04A 2IZZA 4KOAA 4MWGA 3GFQA 2W6JA 1N5JA 3G5MA 2ODEA 1N5KA 2Y71A 3ZUGA 4BFXA 5AUOB 3JYQA 2HJSA 2HPZA 1WCWA 5JCOA 4CF5A 2O7NA 2R96A 3PJFA 3WNDA 1YF3A 2Y92A 5C80A 3JQBC 3OPVA 1A82A 1VL6A 4M9SA 1T5LA 3COVA 1DOHA 1KH2A 3K2IA 1F2TB 2P2GA 4BE7B 5ADWA 3JWHA 3FG9A 1YMVA 2PFKA 1FQOA 3DYVA 1KY5A 4X97A 4PFQA 3GZNA 5FH9A 4D0NA 3BEDA 1A1SA 1MBZA 2FXIA 2BGGA 1VBMA 2I3ZA 2XCUA 1BW9B 4I8IA 4A26A 3V34A 4OKIA 2WICA 2NG1A 4UHDA 3HXOA 4DR6B 2DPYA 4OUDA 2X2OA 1ZA2A 4GX0A 3WGOA 1PZFA 1GHTA 1X15A 3NXSA 3ONWA 3E1GA 2FFAA 2BKVA 1QIFA 1PDOA 3NKFA 5ALIA 2V03A 5CW2A 1EI9A 4I66A 4YV1A 4X7RA 1R5BA 1N0IA 4IGAA 1YI8A 3Q3HA 1G7SA 5IARA 1JDTA 2ZRDA 4DJFC 4DV1B 2FEXA 3FCEA 1DT3A 3FX2A 4ALNA 1VZ2A 3RE1A 5KNCD 1KO7A 3QMWA 3R20A 1VA5A 1OILA 3PC6A 3WA7A 2V1XA 1A69A 3GRAA 1C8KA 4HAXA 5F1OA 4EI8A 1KK1A 1GPJA 3BK2A 4HDMA 2PM8A 3I9KA 2PLRA 2CLKB 4ETWA 1LBHA 1TOAA 1OHHA 4NIMA 3UGJA 3DDNA 1C3JA 2BIFA 2AMFA 1T0JB 3W05A 2AZXA 2G77B 1OHHD 2ZE8A 1FDWA 3GT7A 3KJIA 5ALDA 3ZVNA 1Y8ZA 1NXXA 1QK4A 1X87A 2OD2A 1J6UA 3ND6A 4CGYA 3IDOA 1OF1A 4M86A 1EGMB 4QBIA 4EIWA 4RJ2A 2FZGA 5GINE 3CNEA 4YP0A 1O6GA 1RPZA 4INAA 4B7ZA 5D7NA 1DG3A 1KFKB 1XF1A 3HLTA 4TLLB 5AVWA 4F6RA 5KOIA 1DEXA 3MJHA 1E1MA 4X65B 3ZJ5A 3DUFB 2PEZA 3AJDA 3W78A 4F7DA 1ECCA 3NIDB 3O90A 4IZ6A 1M0EA 2D5LA 4G9GA 4J0KA 3IODA 3JQAB 3PVSA 4LJRA 3V4LA 3ZK9A 2BFEB 4TL9A 1PFYA 4EG7A 4WLNA 4WIAA 1XJQA 2GARA 3VVLA 1SQGA 1L4YA 1T1RA 3B6MA 3VNAA 2Y1WA 4R9NA 5C3MA 2HQOA 3JSAA 3OPYB 4WPGA 5JS2A 5ALVA 2YHIA 4IZOA 1QOZA 4P81A 5GVSA 2NX2A 5LA6A 2XYRA 2B8JA 1BJRE 2PRZA 2D1SA 1E2BA 5L3SA 1IUOA 2FWMX 1PDWA 3LWBA 3OMLA 5JSKA 3RYFB 4B4WA 5BPFA 5J1TB 2O7VA 3M4ZA 1JTEA 4ARZB 1ULZA 2HJ9A 5A3VA 3CLUD 1L8AA 4L8VA 4YRPA 3VKWA 3DZIA 1YFKA 1ENOA 1ZEJA 4B3JA 5EXEA 2E21A 3MTEA 1TD1A 2ZRHA 4CKBA 5CNKA 1GPWB 3QELB 3EVBA 4C4YA 2N9UA 2MHCA 1QANA 3TR5A 1XDBA 3EWAA 5EPEA 1AKMA 1U63A 3DBHA 1M2HA 4D4IA 5FKJA 5AJYA 3BH7A 3RYCA 2CV1A 3HO1A 2POQX 4KWHA 3E03A 4QPCA 4R7GA 3UB4A 1CJVC 2OZLA 3OQIB 2R2AA 5I9LA 2A1UA 1P4JA 2AN3A 1KA9H 2HHHB 1D2MA 1UXIA 1W36C 1G3UA 3ZE7A 2Y66A 4CQNA 4BLUA 2DEUA 4A15A 3T7KA 2VNAA 3ZYZA 1LBQA 2A92A 2HSJA 3C3KA 2ATEA 3GAAA 4KH1A 3KQLA 3QX3A 4F6LA 5K20A 4B31A 4QLOA 5BVHA 3AHIA 5BSHA 4CCAA 1PNOA 3BSSA 3T7EA 4RIGA 1KMMA 2JA2A 4HFRA 2YYYA 5JCJA 3ERCA 3H4MA 1ATZA 2QXTA 3ZQKA 1IZ9A 5CLIA 1OT3A 4JLNA 4ZT5A 5I4CA 4XVRA 2YMQA 1CZLA 1FNMA 2HHAA 3BH0A 2DQKA 3O92A 4JJ8A 3TUJC 5I51A 1E3SA 2HXYA 3OUZA 3CRRA 2FMIA 2IFTA 3GARA 4J91A 1AOXA 2QN3A 4CF7A 1OA0A 3IAFA 3VHXA 5C2JB 1NG9A 1EP3B 4TWIA 3GUUA 3M34A 2Y4NA 1QTNA 2FSPA 2G7MC 4OMDA 3W4KA 2WEKA 4AJ4A 3M9WA 1D4ZA 1GNSA 1NXVA 1K0FA 1QP8A 4BEWA 3RFVA 1YVDA 2HRBA 2FZ4A 1UQRA 4TROA 2Y05A 2IWHA 4M21A 4EEKA 2PKWA 2N46A 5CIYA 2VWPA 5H16A 3WKBA 2WAXA 5I4KA 4S1NA 1UK7A 2NV6A 5D87A 3K96A 2O59A 1LY1A 1A9YA 1WP4A 2XAUA 5JAZA 1HETA 3RNOA 4AS3A 4L2IB 2PSDA 1OTHA 1RADA 2A88A 3MW8A 4FZJA 1MPTA 4OHMA 5T67A 3ZE9A 3U19A 2XD4A 4Q48A 1JG2A 2E6UX 4N54A 4TZ0A 2XTJA 4JYZA 4DV5B 1QDLB 2QN7A 1KSJA 3KYCA 5BR4A 4OHYA 1IZ8A 2QVZX 4JMLA 5AVQA 4ZV9A 4BNFA 2WTUA 2WKWA 4HFMA 1AF7A 2BI8A 2DUUA 1P2VA 3SF0A 3SOPA 4AG6A 1TK9A 2EP5A 4LSGA 1XTQA 5CFQA 3IULA 2UZAA 4M0MA 4RU1A 2R6CA 5HNKA 2QQ0A 2ZYAA 3EGDB 1O77A 3FHOA 5CCBA 4FFBA 3HC7A 4PYQA 4C87A 3GXBA 1Z7EA 4K8OA 4FW8A 2HT6A 3I01A 3PGMA 1ZITA 3U48A 2OENG 3DONA 2DCMA 3IDAA 3FY4A 3KDPA 2V1UA 2HXSA 2DTXA 5A1JA 1LH0A 3IJPA 1LX6A 2NT4A 3H19A 3N0RA 3QXSA 2XNKA 4XQ9A 2VYVD 1G41A 1UMKA 5J2UF 1FSGA 4CYMA 5DM70 4JL8A 3KUXA 4TTRA 3NAMA 4XFDA 1PWXA 2ZWPA 3U3ZA 2AL7A 4MMZB 2ZITA 4J75A 3ESQA 2AB0A 3WQHA 3DVLA 1LJ8A 1ZOLA 3AR4A 4WJZA 1G8MA 1EVKA 1KETA 4TYNA 3AB7A 3I09A 1JDBB 2V9ZA 4HWOA 2E4ZA 4FMCB 4KN9S 1FQKA 4X92A 4DNFA 4N18A 2GJ8A 1OBVA 2QR3A 4YJDA 4RVOA 1IJFA 1UIMA 5HGJA 4A91A 2EHJA 2O8CB 2ONYA 4MQLA 2WF8A 4MA0A 5AM4A 1DIBA 4H15A 3CF4A 1U02A 2PZGA 2VR1A 1I5OA 3BF8A 4ZI2A 1PTKA 1XQ9A 1S2MA 4V0ME 4ZEOA 1Q6YA 4NH4A 4BUZA 4YMHA 3CUEF 3ITEA 4PCAA 4FSXA 3PLAE 2XCQA 1Z5NA 4C0AC 1YJAA 4CL3A 5B7QA 3HKEB 2GM5A 4EYQA 1GL7A 5JNTA 2FE4A 1DC8A 1LQUA 3EJ6A 3VSAA 4KR6A 5EKXA 2PGLA 2X0NA 2F3QA 4P3XA 2CHVA 4UPVA 4X1IA 1EBFA 2GM3A 3WO0A 1FUIA 3FKSA 1GGHA 4L28A 2V0CA 5FPTA 4CV0A 2GBLA 2OHHA 1OI7A 3LKDA 5A4DA 1R0CA 3KQHA 1TLTA 1E60A 2H17A 3LDAA 4BNVA 4P4TA 1KZGB 4R68A 2V6GA 1A96A 3F6YA 2ASEA 3ZWPA 2GAJA 1SMKA 4IDDA 3A11A 4LC1A 3PCTA 1PN3A 1SB9A 1ZLYA 2VP0A 4TT3A 3R8CA 3SWWA 2A1UB 2NNLD 3R3HA 2PN1A 3C8ZA 4Y2SA 2GZ2A 4WLEA 3UXHA 1AX9A 3GCWA 3IAAA 5BQFA 5MDHA 4UTNA 3V1TC 5B1YA 1Y8QA 2FA9A 2IPLA 3ABRB 3I3OA 3B85A 3EWSA 2AYXA 4LDJA 5GV8A 4RVCA 4B79A 1F4PA 1SG6A 1ZUHA 4QAJA 1ZOSA 4MAAA 2FETA 1N2BA 4Q7QA 1AIPA 4OXYA 1RBYA 1JDSA 1TT5B 3GA7A 1YHYA 1UUFA 2IXGA 4PRZA 1ZIDA 4LXYA 2YUIA 1WB9A 1T5OA 1L5MA 2AD5A 4KN8A 4TYQA 2WTMA 4OHXA 3MCAA 4I9UA 4R2LA 1II0A 2O8BB 5CYPA 1E98A 4E1AA 4AJ1A 3AL2A 2EDCA 3NIWA 1QRUA 4D5EA 4WD3A 1JWLA 3ULKA 4WXRA 3Q8MA 2IS4A 1HRKA 1WHTB 1SBNE 1XKQA 2O2SA 4URFA 3QE2A 3VMMA 1VLLA 4QVGA 1KEWA 1V16B 1KARA 5JH7B 3DDWA 4Q01A 4B32A 2IEDA 3TLBA 1C14A 4RA9A 1UDBA 2IS6A 3QNWA 2G63A 3DH0A 4RKQA 1N2CE 3AB8A 1X1DA 1YJ8A 3H5IA 5EXDA 4MV8A 3LT0A 1BVYF 3REFA 2OB1A 2F43B 1PQ4A 5DM60 2GHIA 1L4KA 2JHGA 4UD2A 1Y3CE 3UK7A 5IZCC 3UT5A 5BW5A 1JHMA 2GAFA 1JLSA 2I2XB 1UCFA 2W11A 2Q4DA 2FMXA 4PXSA 4YJ3F 5ADUS 4CZ2A 1Q44A 3KYCB 4BFSA 5GADl 2FLKA 4EABA 3FF4A 3AXSA 5GPBA 2X9NA 3ET4A 2A78A 2JAHA 2V6IA 1HNWB 1UMCA 4G1EB 5DFAA 1KI8A 3Q12A 2ICAA 1Q2XA 3ZH9B 4BWFB 1OI2A 2JFHA 1QHYA 1YS2X 4YRQA 4H0FA 4CM1A 5H9WA 3IPXA 2BUCA 4EDFA 1H3FA 4QE3A 1G8YA 4BAUA 4WCFA 5L3QB 1R2QA 3LC1O 3QPAA 2HQRA 2RIPA 4DG9A 1YDFA 1G4UR 3GRYA 1EX6A 5ALRA 2QN2A 2C4WA 2REXB 2ZAYA 4NXNB 3HB0A 4PZCA 4OQMA 5C5EA 1KAMA 3EIEA 2JI8A 2W90A 2XHEA 1C1DA 3AP2A 3UHJA 3WWOA 4DTIA 3FOZA 4ZAWA 1EFCA 1ORIA 1O0CA 3WRVA 2DFTA 2I3DA 4UAVA 1G3RA 1POXA 3ZCSA 5FV7A 4EVSA 4MUMA 3CQ9A 5A9SA 4RTNA 1NQXA 3LRPA 4YT5A 2BEVA 2Q5FA 5BV2P 4EPXA 2P9ZA 5P21A 3EMVA 3IQHX 4I46A 5K99A 3IA7A 3OE7A 2PU5A 4MSUA 3GEDA 2ANBA 4RM3A 3SLKA 4M1SA 1SUAA 2FN8A 4D3YA 4UM8B 1FEZA 3B9RA 4W4TA 5FTKA 1BIFA 5HILA 1VLMA 4TTVA 3RS8A 4BMZA 3F7OA 4NCBA 2ZT5A 3GAZA 3OE7D 4FDLA 4HAOA 4MROA 5A4MS 2G4VA 5KOHB 3PWSA 3ZHXA 1UDAA 2RI6A 5A4AA 2TMYA 3FBWA 3K6SB 1UPCA 1RQGA 3NT4A 4DVGA 3UAWA 4QJ5A 4DM7A 3HCFA 3DZKA 1G8GA 3A9VA 3KRTA 2GT1A 5JSQA 4CG1A 3JS5A 3COZA 3N2IA 3ICOA 4QGBA 1UWKA 3AKYA 2W2KB 4JENA 5CVEA 3T3DA 3RG8A 4L22A 3FB4A 1TPYA 1WMFA 1SJ9A 2R6FA 4G8BA 2AX4A 3TTWA 3DMFA 2JAPA 2HIGA 2OKGA 2VF8A 2CZGA 4IXWA 4TRNA 4F46A 5K7SA 3TRIA 4I14A 4PN7A 5B30A 2XUAA 3AHGA 1ACJA 4HRXA 4TL7A 4FXOA 4RDXA 4TSKA 2XDAA 4RUKA 2ZI7A 3GOHA 2CNDA 1XKXA 4PHCA 3GGCA 3RRXA 1ODCA 3NYQA 3EGVA 1M73E 5ULLA 3CEMA 4M22A 4DYVA 4FZ5A 4G81A 2VNHA 2J9XB 2HTFA 2NTJA 1QE0A 4DR1B 4IL5A 4NBLA 1X19A 5HCNA 3VPCA 3BORA 5FQOA 3ZY3A 1J0XO 4CCYA 1E1KA 4XGNA 1I0IA 5E7JA 5MHTA 3AM5A 1IXYA 3L1VA 3H17A 1YE5A 5IAOA 2QW1A 2WAYA 4LUCA 3ZY2A 5LWHA 2UXDB 2VH2A 3HV2A 5IVHA 3UMSA 2OD9A 3MLBA 1FK8A 3OZVA 1IZ0A 4R69A 2VBCA 1JU9A 5IZ4A 4DPLA 1EUCB 5JDIA 1L7NA 3ASZA 4YT2A 2XSZA 3UPDA 1E5DA 1DS6A 1XK7A 1U0TA 5F77A 3CUUA 1Z8DA 1U6JA 3QUSA 5H81A 1C80A 3JU3A 3ROGA 2PZKA 2QVBA 4MNTA 4PC6A 2QYSA 3NHBA 8ABPA 3G9ZA 2WA2A 4XLTA 1BJTA 5FUQA 3GLGE 4ZU6X 4KXMA 4V3BA 2VOJA 3AJAA 3OPMA 4BNZA 1KYYA 1CQJA 4JBWA 2IPXA 4HQFA 1RS0A 4PSUA 4XYGA 1DRJA 3EZ7A 4FIZA 3FZQA 3RTDA 4IQGA 4BYMA 2ID4A 2FN4A 3AP3A 2R2GA 4O3MA 1OX4A 5KHLB 4GZ5A 1CZKA 1T9ZA 4PRLA 5IDYA 1HE4A 4RMGA 1SD5A 2GETA 2YY7A 5D1HA 2AD1A 3RLFA 2NQ2C 3WNVA 1H0RA 1KBOA 1YA4A 5CYFA 1VE1A 3PL5A 1RHRA 3LCUA 4NRDA 3UJ8A 5CD9A 1AQUA 1YZKA 3MXOA 4L4XA 4NK4A 4ZZ0A 3RSFA 3W7AA 1JTFA 4Y2TA 4YPFA 4E09A 4F06A 1XNQB 1TMYA 3A3YA 4B8WA 1PJTA 1RT9A 4LNHA 2ZBGA 2Q3LA 2P6MA 4RV4A 1NZDA 2Q4BA 5ES3A 4RETA 4C3OB 2I2BA 4UVGA 1E6MA 3A9RA 1SEVA 1P9LA 2YICA 3QFHA 4ZDIA 4B3SB 1Y4DE 3HN2A 1IM8A 4MHSA 2GYWA 1BA3A 2ISSD 1ZIXA 4M8IA 3BGWA 5EOVA 3ZLTA 4JLUA 1T9KA 1RWMA 1VKJA 1IHUA 4L0QA 4CNBA 3OQJA 5DHFA 2GUWA 4Y2XA 5DWVA 5KYUB 3RYHB 2PX8A 2JIRA 4GMFA 5BN3B 2HU5A 1T13A 2CKMA 2PH7A 1C4WA 1P80A 5JXJA 2CF6A 3O21A 4NJEA 1U8XX 1MHPA 1P1RA 4NARA 3LOQA 1TCBA 4EJSC 3SSNA 1FS6A 1E1CA 2AN9A 1NF9A 2QN1A 2FPUA 2H8KA 3QQPA 5ESXA 3UV7A 2WBLC 1DC4A 5G0SA 3D4LA 5IAGA 4G26A 1Z0SA 4MS1B 5IJAA 2VBGA 4JJKA 2G25A 4KZKA 2FPPA 4KG7A 2BEUB 2R6AA 2ZJAA 1GRRA 3COYA 3SG0A 2GEVA 5HKLA 5KYGA 4QPJC 3GRPA 4KNYA 3Q9UA 5FUXA 1GV0A 2X0FA 3AWDA 4KYVA 2OHFA 3GZTB 2G40A 1R4MA 2JGFA 4EDHA 1KY2A 1JHAA 3LNTA 3EZYA 2H2GA 2OYSA 2IQIA 1XZQA 3IRUA 4WKOA 1XQ1A 3CJTA 1DJLA 1N7HA 2H1CA 4BS9A 2WOOA 3PXDA 3DPSA 1WBDA 5YASA 1UZAA 2VBFA 5EG5A 3H1FA 1Q50A 4R9VA 5GWXA 4C08A 4OI2A 4JEHA 1NW5A 2I7TA 3HBNA 3F78A 4ZVTA 3QU9A 3FRIA 2OYCA 4LOIA 3V4VB 3OM1A 5LMNB 3UK6A 5JPIA 2XTZA 4JUCA 5DKFA 5KVVA 3G5LA 4W7HA 3ZEAA 1JFFA 1EFLA 1VPWA 1W6UA 3QYJA 4GP6A 4C78A 1NJ6A 2FFRA 4OQPA 1VMIA 4FWBA 2WKPA 2Z5LA 3V55A 3Q10A 1P4RA 5E2BA 1C8BA 2GAAA 4DQUA 2DWQA 2GZDA 3HKCA 1CYEA 2VKTA 3OZGA 4RTSA 2G3YA 3NNDA 1K4YA 1XZGA 5AI8A 2ZGVA 3F5DA 1BS1A 2BHSA 3V6MA 2YJ5A 5LZ4A 3RK0A 1KEEB 1SXJC 2R1ZA 4J2HA 4YP6A 4D96A 4DA8A 4EA6A 4RACA 2O4UX 3RUCA 4FKMA 4JP3A 3ONDA 5DTEA 4AX4A 1NWHA 3O8CA 3T7IA 1KQGA 1FU8A 2A9PA 4Q9NA 3ANXA 1I3CA 4OQXA 2O5VA 2B36A 4J90A 2WMYA 2O2XA 1QH1B 1P6UA 3C3JA 3P2KA 3WLHA 5CB4F 5CPBA 5JNSA 5TMDA 5KNBD 4EWLA 5IMBA 4E46A 2Y0PA 1BDJA 1SCDA 4UMEA 4K9NA 4P58A 3KYIB 2MU1A 1FUKA 4K3UA 2ATVA 2P9JA 5LBUA 4ZRMA 1Y8RA 4RK4A 2X0JA 4FHFA 1J0BA 5JV5A 2H92A 3MGAA 1HDEA 2AOUA 3LYUA 1AKWA 1CDEA 2PUCA 4OI0A 4HO1X 1A9OA 4TUYF 2DHRA 4QIHA 1HA3A 1T4MA 1TZKA 4KAAA 1XD9A 4LISA 1YTUA 1EFUA 2J7PD 3HJGA 2D54A 1PX0A 1L7BA 5CTJA 2FPGB 3AEQB 3CR3C 1JEQA 4NYMQ 1T5DX 3TOSA 4DA0A 5A9TA 2V5VA 1JILA 4BTEA 1J49A 2OORA 1NBMD 2ZTLA 1Z0UA 4HLUC 4PNZA 1SVNA 2WWFA 3M6XA 3EGIA 4Y6GB 1W19A 3LLVA 1Q3KA 5HKKA 4A36A 1D2EA 2VNKA 2B7BA 3HVRA 3BD8A 5BPHA 1OX4B 2IXEA 4TSFA 1JL3A 2ZRBA 4LJ7A 4NU0A 1QHHA 4TLAA 4YV7A 1GZDA 3TQFA 2FSIA 5I4BA 2G67A 4JP2A 4BPBA 1TZCA 4TKVA 3P5BA 4DR2B 3ZD7A 1C29B 3LNCA 3G49A 5AW2A 1NUPA 3BK1A 3Q3CA 2YDYA 3VTKA 2WIFA 1E0DA 4HPWA 3LA6A 1UXJA 5EJIA 2WWVD 4AJLA 2GHRA 2FPXA 1LB1B 3LPCA 4NNJA 3DG9A 2JFUA 3NWJA 4RF5A 5KJEA 4DMRA 3UZUA 4ZV4A 3DDCA 3ELWA 3CCBA 3FZYA 1IBSA 1RWVA 2DM6A 3QTLA 2VT7A 5CA1F 4IH9A 3AP1A 1XEXB 2G71A 2LKDA 3A37A 1BVHA 1FNBA 4Z1MA 3T5BA 4XX0A 3PTZA 3G7NA 5E6RA 5M2QA 1V41E 3RD5A 1T9CA 3DMDA 1DC5A 1O97D 1YQWA 2DJ5A 3RBZA 5JSHA 3VDMA 4EZIA 2VP3A 5JWRA 2O54A 2AIRA 3HYLA 3FDFA 1NY5A 4OXIA 4GC9A 1D2CA 2QDKA 4NY1A 2PT5A 3H3FA 4OM7A 4Z1OA 3HUFA 5JXHA 2Z5VA 3GDOA 4D44A 1YA8A 1MR3F 1MEJA 1JPVA 4W9MC 2X6RA 3L04A 1F12A 3F2VA 2QBYB 4TTPA 3LK6A 5KQSA 2J5KA 4Q5IA 4R54A 2Y1CA 3RAEC 1A2BA 3DV0B 3QKRA 4XM2A 1AN9A 2HRCA 2O3UA 3I4LA 3PC7A 3R6GA 1KO4A 5B53A 4BNNA 2OUIA 4U63A 2VJKA 2VAXA 4KBGA 1Z2EA 5DLPA 2IHYA 2KB0A 3DNFA 3M1LA 4HLCA 1NVFA 3LXMA 5F1YA 3QWBA 2GB4A 3QPCA 5DM0A 1UEJA 4XEHA 5A06A 3V8EA 4DIFA 4EGSA 5A4KA 4JWKA 4Z0HO 1MIHA 1K98A 1MOSA 1TM7E 2FPWA 3ROXA 4K1XA 4AWBA 2L82A 4JLVA 1P1FA 2DZDA 4HH4A 3ETJA 2HRZA 1RYDA 5E1BA 4EX6A 2LDBA 4HOYA 2IYTA 4NFSA 3I5MA 1DI0A 2YFQA 1H8HA 2DFLA 1W36B 4B45A 4J7AA 4UMDA 3LT5A 5KQMA 3T3OA 1T0HB 2BTEA 2PL5A 2RGXA 2PRSA 3PHCA 3UTCA 5FLEX 1VJCA 5K0CA 5KTKA 4MB2A 2K7FA 3KSRA 4PZUA 3ZU3A 1GU0A 3IIMA 4UHFA 5KU7A 1CE8B 4DJTA 3PUZA 1P31A 1DFIA 1XZFA 2YFKA 3UXYA 3QITA 1N6KA 3AI3A 3KZCA 4HGOA 4FFLA 5EMNA 5J2UB 4OA8A 2QUIA 4L6IA 3FCUB 4FGLA 1QG4A 1MJHA 1P1BA 1WB5A 1YTLA 2R44A 3IHLA 3L0IB 4YIKA 1ZM3A 1DC6A 2SKEA 4B2LA 5CDFE 1S2IA 3SMVA 1SCUA 4KGXA 2QRLA 3GEHA 1ZC4A 2VJDA 5E4YA 4FILA 4WXPA 2Z3ZA 4MJLA 1SUIA 3KHTA 4L95C 4BKUA 1APBA 1X8JA 4QOFA 2PH5A 1BX3A 3CUWA 5KU1A 2ZKLA 1E20A 2E4AA 2IYNA 3FFTA 4L9RA 3P9ZA 1DADA 4S24A 5D3MB 5ICEA 1JECA 1A9TA 2P4EA 5F76A 4YJFA 1F6BA 1YH3A 3ETHA 3FMVA 5CXXA 3GVHA 1NUQA 4E2XA 4ARSA 4QLBA 3RV4A 3QWAA 1HK7A 2H7YA 3NV7A 4RQTA 1FJXA 4LDAA 1O54A 2BH2A 3GPBA 5CHYA 1UBMS 2YFYA 3BFXA 3E2IA 4EFNA 2ZSAA 4L8YA 3SXPA 3SKXA 5KO2A 4QRDA 4NVRA 4RMJA 2QQFA 4OAPA 3UYLA 4LQ4A 4ZOLA 1FUYB 5G02A 3V48A 4YAKA 5LU9A 1NXWA 3G1WA 3JASA 4BWVA 3UMVA 5EP1A 4WBSA 2FP3A 3NOVA 3QGMA 1JBEA 4AZ0A 3B78A 3BHMA 3ORRA 4LC0A 4HEA1 5F51A 1Z6TA 1WY7A 1XQ6A 4XWOA 3EZNA 4KQGA 2W6CX 3CGWA 2YKGA 4EHAA 4DLKA 1UBUS 1QRRA 4EL5A 1IN6A 4R6WA 3GMIA 1Z6QA 3T5TA 4A8JC 1RI5A 3A26A 3OM8A 1JQLB 4ARBA 1WM1A 2QVXX 3KV1A 1ZUNB 3U3KA 3T4UA 3B9QA 1WPQA 5E95A 5CFLA 4BLRA 1MIOA 1PTJC 3UW3A 1H05A 3FLMA 4DBVO 1R10A 5K6AA 4Z51A 1BS9A 5T8KC 3D3EA 3KAPA 4A27A 4ZXFA 4F1JA 5DVZA 2EZ8A 1XVVA 4ZCQA 4QG3A 4PQGA 4MUYA 2HF7A 2DVMA 3AU9A 1R0SA 4OHFA 4B8YA 1NUSA 2NO6A 5IULC 1L7DA 3CKLA 3HBLA 4Y2RA 3L7DA 4CDGA 1E4YA 5GQSA 3IVXA 4W5QA 1Q1NA 3P9SA 4GEKA 4J1SA 3H6HA 1CUWA 1A04A 1WV1A 4TKVB 4WGGA 3BRWD 2JKYA 3W3AH 3OCYA 2FWRA 2B4KA 2I8CA 3IBTA 1OLXB 5KSZA 4NWIA 1XO1A 4CF6A 3LHFA 3PFKA 4ER3A 1RZUA 5BRAA 2E7ZA 3RVMA 3HVUA 5EHIA 2QGNA 2Z83A 4TYMA 3S2FA 1VJGA 1P9WA 3DDUA 1T6NA 4W82A 2CY0A 3DOEA 4J0IA 4YP5A 3TLJA 4M9QA 4KQ9A 4PAGA 3HJFA 3GRZA 1V7CA 1TPZA 2BP7A 2G04A 2VSYA 4I8XA 4D9EA 2H7XA 3S2ZA 4L5IA 3CF2A 3Q0EA 1X3LA 3HHPA 2Q29A 4HHEA 3QIVA 1HLGA 1F0PA 2WHRA 3FETA 4IDPA 4TV9B 1XDUA 1XZJA 4H4DA 1B15A 2V74B 3HZOA 3NFRA 4LJ6A 2ZZMA 1V48A 3LOPA 4E07A 3QF4A 2P90A 4I0WB 3RROA 2V3WA 2XZDA 3HS3A 1IOVA 2WKRA 2WYHA 1W47A 3EQ2A 4D74A 1ETHA 1SKQA 3DPUA 1CWUA 3OCCA 1VG0B 5FWXB 1ILEA 3EXHA 4MW0A 1YHNA 3EK2A 4GW3A 3RJTA 5HF8A 5AVZA 4YJ3B 3S7TA 1Y7PA 1WETA 5B37A 3DMHA 4QXMA 4ZQCB 1OIVA 4DYDA 4HUJA 1W1IA 5LU8A 3OU7A 3MWDB 3IEIA 1XZKA 4CU5A 1XMPA 2GN1A 3OE4A 1E9VA 3GZ4A 2XUQA 2P9EA 1II8A 3GEEA 4FNOA 2G5PA 3MSXA 3TSAA 3ZW9A 4TTTS 3KQNA 1GPMA 3DVQX 3V2GA 4TRMA 5B2ZA 1BWRA 1H6DA 1M1NB 1GGNA 3CZRA 3MEQA 1UT8A 2MMCA 1KI6A 2F8TA 3EXFA 3ST7A 4OXKA 4XM1A 3GD7A 1YQQA 2X5JO 3T1NA 1OV4A 1Z5VA 3ZZ0A 1Z2PX 4KXYA 5K8JB 3P9CA 2K87A 4LRYA 3ZWQA 4B0OA 3A6ZA 1MTOA 1EUZA 5CX4A 1QG0A 5B6IA 1PP4A 3OPYI 2XOKD 1BXGA 3URKA 1Y4SA 4M83A 1MNAA 4QGSA 2RHLA 2IL1A 4U8GA 3MJFA 1Z33A 4R1TA 5K4AA 1QFYA 5IBQA 1IBMB 2PU7A 4Y8VA 3IDSA 3A58B 4DLRA 1YAHA 1K3UB 2BEWA 3B7WA 1WMAA 2WHXA 3L02A