3I8SA

Structure of the cytosolic domain of e. coli feob, nucleotide-free form
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
264
structure length
260
Chain Sequence
MKKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTTTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSNTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Ferrous iron transport protein B
publication title Structural basis for the intrinsic GTPase and GDI activities of FeoB, a prokaryotic transmembrane GTP/GDP-binding protein
rcsb
source organism Escherichia coli
total genus 85
structure length 260
sequence length 264
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i8sA01
2OESA 3D8BA 3THWA 1PVOA 2ANBA 4D6PA 4IHQA 5JSZB 5TMPA 2A3RA 3W8RA 2OXRA 3T15A 1Q1ZA 5F9FA 1Z47A 4YDSA 1G17A 2ZR0A 4CEJA 3A36A 1YRBA 4V0LA 2IS6A 3QKSA 2ODBA 2ZSFA 3SDZA 4GOJA 3RS3A 4MDEA 2BM1A 1EWQA 3BOSA 1K6MA 2IHYA 5CM8B 3K9NA 2ATXA 4ERNA 1KK2A 2FSFA 3LWNA 3T1OA 2WWYA 4KFTA 2V7QA 4Q1EA 2F1JA 1BMFA 3CZPA 3W34A 3DO6A 3U5ZB 2G1JA 2ZSEA 3ECCA 3PEUA 4JVNA 4TQAA 2RKOA 5GJCA 4C2UA 1TL7C 3RWOA 1Z8FA 4G1UC 3Q5EA 4TTPA 4QHTA 1W2GA 1HT1E 4HAWA 2ZRAA 3CNLA 1OXVA 1ZBDA 3SC3A 4NU0A 2JJ2A 3GFOA 5DE3A 2P6UA 5L3RA 1VDZA 2ODNA 2J3EA 2W2VA 2YC2C 4IOMA 3SFZA 5FUXA 3ADCA 2GJ8A 3GCGA 4X8MA 3CF6R 1KAOA 1NJGA 4H1UA 2Q9CA 4MGKR 5JRZA 4I1UA 4IXMA 5AK0A 4V0KA 2J46A 2YINC 3RANA 2REBA 2ODWA 5FR2A 2BEJA 3W5IA 5DSZA 4BLTA 3ND9A 1W36C 1W1WA 3CF0A 4B3FX 4DKXA 5J47A 4DDUA 1Z6GA 4RD3A 1IN4A 2GXSA 3VU9B 1OB5A 3L0PA 3A37A 2GCOB 2J0UB 1W46A 3RS5A 721PA 1JECA 1IOZA 1ZNZA 2BBWA 3CX6A 4C7OA 5JJKA 2GHIA 5EXPA 2GRJA 5TDHA 2XAUA 3KQHA 2NO9A 3TW4A 3SYNA 1W0KA 4Q01A 3O8DA 1FPMA 1C9KA 3RAPR 1HE1C 1LW7A 1XTSA 2VP6A 2FSIA 2GEVA 4Q1AA 3AGPA 2QMOA 4R9UC 1VG0B 3B7GA 1E9DA 1E2IA 4UJ3A 3VR5A 1P2UA 1NVUQ 1DOAA 4TSFA 2ZI7A 1KI6A 3SQWA 3I32A 2JLUA 3TGPA 4TMKA 3QVVA 1B0UA 1EGAA 4E07A 1XD2A 2FA9A 3AF2A 3KKPA 1KOFA 4UNNA 2AXPA 3SJCA 5B2ZA 2F3TA 5C2JB 4Q19A 2DWOA 4EUNA 1NF3A 4DVGA 3SNHA 4IDQA 1FTSA 2DFTA 1E69A 4RVCA 5EE9A 4CGZA 3K0SA 2V3CC 3S1AA 3KDSE 3HR8A 3MG9A 1A2KC 3MWJA 5SZIA 4MUAA 2IK8A 2MMGA 1LY1A 2UZIR 2RB4A 4IKEA 3GP8A 1Z06A 1G291 4R2HA 2FSHA 2QGZA 2QMHA 4P31A 3OHMA 1ZIOA 5BQ5A 3OFNA 2R9VA 3ZVLA 2A7QA 5JHHB 1FW6A 2GBLC 3AM1A 1SXJA 1NIPA 2JATA 3AP3A 4II7A 1ZYUA 4AKIA 2CNWA 4NCHA 4W5WA 1UKEA 3UK6A 5HPYB 3CX8A 4L15A 2HYDA 1OXUA 1SVMA 2AWNA 2ZRPA 1AGRA 3TH5A 1OFIA 2ZE8A 1BS1A 2J7KA 2FJUA 2ZPTX 3RWMB 1AS0A 2WPDD 2HF8A 2CL7X 5LBIA 3THXB 4RZUA 3OIWA 1I4TD 4PX9A 3FE2A 3OIYA 1RRCA 5DI3A 3B5JA 3F8TA 1HH4A 2OG2A 4TT3D 3TVDA 2YKGA 1E2JA 1GUAA 1CR1A 1F48A 3BH0A 4M1OA 1XJQA 3WYAA 1QBKC 3K1JA 4TMWA 3TAHA 3U7HB 2ZSAA 5BN4A 1CRQA 4UXJA 2RGDA 3ADKA 2QN6A 2Z43A 3EAQA 4LX0A 3GPLA 1N6PA 1TU3A 1AS2A 4R2IA 4ZDWA 5JECA 4Q18A 4PC2A 1XD8A 4Q5IA 2Z83A 2J0SA 4BRUA 1QF9A 3EXAA 4NE2A 2JJ8A 2ZRIA 2Z6VA 3LW7A 3CONA 4PO8A 2IUSA 4S35A 2GJ9A 1Y63A 5K8TA 3BERA 3UPUA 3FHTA 5FOSA 1R0YA 1DAHA 1QG4A 2ZRCA 1VYVA 3OAAA 2ZE5A 2PEZA 3AP1A 4GI7A 5FBLB 2W58A 3DZ8A 2J59A 2JLXA 5GJBA 4FIDA 1NMYA 3NH9A 1PLLA 3KFXA 1EFHA 1QG2A 1CTQA 2ZUDA 4I4LA 1PZNA 1T0JB 4B74A 1T3LA 3VKGA 3NBYC 3WMGA 4EFMA 1SULA 5FOTA 4NPHA 3K8YA 2V6IA 1XD9A 4AIIA 3X2SA 4NZYA 5EXTA 2QAGC 5DYIA 3NC0C 4HAZA 4GMDA 4HEJA 4CEIA 4B75A 1QVAA 1NSFA 4QNRA 2KBEA 4FMBB 2C98A 2A2ZA 2CCKA 3CR8A 4DLXA 4A6PA 2P0EA 5KPJA 1P3JA 4HDQB 1ODFA 2ZRMA 4ARZA 2ZJAA 3RLFA 3MRSA 2QY9A 4NCKA 3B2EA 4FMDF 2WKRA 2RAPA 3CH5A 3ZZUA 1JXMA 2Q9BA 3W9YA 1NY5A 2WJGA 4B34A 2ZJBA 1W48A 1P62B 5JZVA 2JASA 1LS6A 1GKIA 1GRRA 4P0TA 4QJ4A 3CPEA 3RRNA 3GJXC 4JBYA 4MYUA 4MITA 2EFDB 1QDEA 4LRWA 3G5UA 1XP8A 3GJ7A 4Z54A 2D74A 1T4GA 1DAFA 1N6RA 3TBKA 1GITA 2PX3A 3A1TA 3W3AA 4JJZA 4TMXA 5P21A 3PG5A 4LJ4A 4WIAA 1N25A 2QMUA 1W2HA 3DL0A 4G0NA 2OILA 4GSYA 3QXJA 5CYOA 2C2HA 1XMIA 2Q3FA 4QJ5A 4DDVA 2C96A 1GKUB 1EG7A 1F60A 3D31A 2D06A 2XX3A 1KK0A 1XJCA 1PLKA 1TAGA 5FI0B 3NDPA 4URWR 2D7CA 5FPSA 4ESHA 3I5YA 4PPNA 5CJ2A 2R62A 2WJVA 3PUZA 1N5LA 4JIMA 4EPVA 2LKDA 2VHTA 3TKLA 1TX4B 1ANKA 2QGNA 5FOXA 5ELXA 2GF9A 2NZJA 5G41A 4IRUB 5DH9A 1KJYA 2XTMA 1E1QD 2OM2A 3ZZTA 3Q7QA 4TZ6A 2QM8A 1SVWA 3W90A 1KI9A 3IGFA 4WXRA 1OE0A 4G01B 2FSGA 3PEYA 1TQ4A 4BFWA 3W3ZB 2V1UA 1OB2A 5FUWA 2CDNA 3BB3A 1YKSA 3WBJA 2Q3HA 3ZIAD 4O3MA 3T1VA 1BKDR 4LJ6A 5EXXA 3A1VA 221PA 2ZRFA 4D4JA 5DLQC 3ZS8A 4BUJA 2QROA 3DOEA 5CB8A 3UWKA 2H7VA 4MH0R 4DEXA 2X8AA 4I1OA 5KO2A 2F1IA 1ELOA 4EFLA 1GRQA 3NKVA 5JI2E 2BHRA 4Q4JB 2FH5B 5J40A 5FUYA 4Q03A 2G77B 3NEJA 1Z2CA 4UXHA 2IYYA 4HAUA 1E0AA 4JSYA 3K9LA 1E79D 3QE0A 1FMJA 3X1ZA 2GXUA 4Q1FA 1CRPA 4TT3A 5E3HA 2WTUA 5EP3A 2F1RA 3TW8B 1RVDA 4CT4B 5F9HA 3AKCA 4CIDA 4O2LA 4A92A 4C3ZA 1GL7A 4PHGA 1LV7A 1U90A 3IIKA 2OV2A 3PIRA 1ZD8A 1KK1A 1MH1A 2VSXA 4HDCA 2ZSBA 2PJRA 2FPMA 3ICQB 2JEOA 1QHHB 2DFLA 3W8NA 1VECA 3TK1A 1X8LA 2AK3A 2BBSA 3QXHA 1M2OB 2BDTA 4FCTA 3NH6A 4NL4H 4XSHA 3CPHA 1D2EA 1KO5A 5EE3A 3U2QA 1LTQA 3WNCA 1Q20A 1L4UA 2QPAA 1NLFA 1XXHE 2ZI4A 4LSGA 4RFVA 2ATVA 2HLDA 3FVQA 2H17A 4TL7A 4AYWA 2CEAA 5HTKA 1JPNA 3VFDA 3MAAC 3WBKA 4UJ5A 2ZRNA 3Q8XB 4I99A 2QL6A 4CDGA 1ZAKA 2ZSDA 5B58C 4GOXA 4L9WA 1U8ZA 4OKSA 3I8XA 1RYFA 2DHRA 4GRAA 1EXMA 1IXSB 3GLGE 2EFCB 3M0EA 1G8FA 1NIJA 1ETUA 5G53C 4YQFA 1XX6A 3C5CA 1IM2A 3QPUA 1N6KA 2DFNA 2X2FA 1CJUC 4L16A 1AN0A 3KKNA 4JS0A 3O8BA 1OHHD 2C78A 3LV8A 4HSEA 1VCIA 1OH6A 2D7DA 1P61B 5JWRA 1EFRA 2OCPA 2QQ0A 2BM0A 2VP0A 3UMSA 2IYWA 1FNNA 1FX0A 2WIAA 2PLRA 2C5LA 1XTIA 5GJVC 1ZRHA 4A2QA 5F3WB 1G3QA 4TL9A 1JXOA 1KI3A 4ON9A 2VQSA 4Z1MD 1J99A 1ZP6A 4KVAA 5JCZA 2GDJA 1AJEA 2BMJA 4DWJA 1RW4A 3FKSD 2YWHA 1Q21A 2K5UA 1E96A 3PUWA 4RD4A 2BMDA 1IBRA 1NVWQ 1U8AA 4JLPA 1E9AA 1Q12A 1S2MA 1MKYA 1FFHA 1QHNA 2N42A 1VYUA 4WVFA 2ORIA 5C1BA 1UBGA 3QBTA 1DS6A 3W6PA 3T1TA 3U3MA 4YXWD 1NMXA 4B6EA 1Z5ZA 1D9ZA 4KU4A 1WDTA 1ZM3A 2H57A 4KODA 2A5GA 2CHVA 3MWLA 4DUGD 2ZYTX 4S2EA 1ZM4A 4BFVA 4PC3A 4NBSA 2VRWA 2Q9AA 4ILEA 4AD8A 5AJXA 2IS4A 3RS4A 4ACAA 4F4JA 4M22A 1UKZA 4DCSA 3U6BA 5H68A 5JHGB 4RD1A 4ACBA 1YJ5A 2DR3A 4ZV4A 3HDTA 1G9XA 1M7BA 2MSDB 5HR5A 2CCGA 3CIOA 1SQ5A 4FCVA 4PAOA 4AK9A 2FWRA 2VIIA 1V5WA 3K0FB 1KI4A 2V7QD 4F7WA 3H2YA 1BMFD 1E1QA 1EX6A 2YWEA 1X86B 1ZD1A 2GILA 4XWKA 1UEJA 4CYMA 2FG5A 3QEOA 5BXQC 2D2FA 4FD2A 4GPTA 3JZAA 3FYHA 1L2TA 3U3RA 3B1VA 4I81A 3LQQA 3AQ4A 4OI2A 4LY6A 3SBDA 3ZZ0A 3ZIAA 1J7KA 4JL8A 1N5IA 3EZ9A 4CEHA 1XEXB 3NTUA 4BZXA 1BYIA 2FE4A 1KDOA 3UANA 2VHCA 2I1VB 2ZVQX 3AKEA 2CLDX 4C9BA 4ITRC 2N46A 1DAGA 5LPNA 2Y8EA 3ZDQA 2R2AA 4F91B 5FTMA 1T3SA 3AF0A 5JBQA 1E4YA 5JEDA 1NSTA 2P6NA 1G19A 1D8TA 4LHVA 4CRWB 2WIBA 1SGWA 3GEIA 3ICEA 4ZIRB 1UAAA 1ZC3A 3VHLB 1OXXK 2NZ8A 1XXHA 1E79A 3HPQA 1Q1EA 1XU4A 4P3YA 2F9LA 1W5TA 1DAEA 2OBMA 1NJFA 1R10A 2D62A 2A5JA 4FWIB 5JMTA 4DDTA 1TADA 4EFNA 4L8GA 2GZAA 2B21A 2C9OA 1QHXA 2WWWA 5DGXA 4BLRA 1AK2A 4LYHA 3K0FA 3GLGA 1HE8B 4Q02A 4D4KA 2W6ID 1OFTA 3E5HA 2F9MA 4A8JB 2B7BA 1CJKC 3SU8A 2GF0A 4MYHA 3IKJA 1ZUNB 1TMKA 4M9SA 3P4YA 4LBYA 1T8UA 5KTYA 2ZRLA 2QRNA 3IBGA 1NLYA 1P9RA 3ND8A 1E0KA 2Q0HA 2R6AA 2PLFA 4JYBA 2PBRA 1OT3A 3K09A 2H8KA 1G21E 2F6RA 4MA4A 1G16A 2WHXA 2IXGA 2QAJA 1Z07A 2VHQA 2CL6X 1NRJB 2KI5A 4LI0A 1M7HA 1GP2A 2ZJ8A 3BB4A 4OK6A 1HY3A 3HU2A 4AYTA 3THWB 621PA 4B48A 2GA8A 3QG5A 3NHAA 4ZIRA 1DAKA 2C99A 2WAYA 3K0EA 2ZM5A 2BIFA 3L0SA 4OHYA 3IILA 5AJYA 2XEXA 4Q9HA 1FUUA 2V55B 3AKDA 4US2R 4CEJB 2RGGA 4US0R 4U02A 2AD5A 2P2LA 2ZJ2A 1LS1A 1Q3TA 1EK0A 3QKSB 3WNDA 3R9IA 5F98A 3I61A 1G3UA 4M8NE 4YMTA 4XD7D 1GL6A 2GAOA 2FMXA 3UG6A 2H16A 3MUFA 1S1CA 1ZW6A 2BWJA 4A8JA 5KPDA 5HCIA 5J4LA 1G6HA 1W0JD 5CIQA 1GVNB 1SVLA 3CRMA 4NYMR 4Z1MA 3QNUA 2XZLA 1AKEA 3ASYA 4HZUA 3SJZA 3AVPA 3FKSA 3QVUA 1F5NA 4PAQA 1KNXA 4KFUA 3Q7PA 1IY0A 4JL6A 5CK5A 2PZFA 1NN3A 2KBFA 2YVUA 4P4TA 2NO1A 2YOFA 1XMJA 3FKQA 1MABA 2WSMA 2RGCA 2FDCA 2F7SA 1J2JA 4DUGA 4HAXA 5AWFC 3I92A 5TV2A 3BD9A 4IEIA 4ZCMA 4EJSA 1RJ9A 3N2EA 1IN5A 2HDNB 4B2IA 2WMNB 1KSJA 2WOOA 2IWRA 5KOYA 3IBYA 1MRNA 2XJ4A 2J9RA 3FDIA 3REFA 2R6CA 5D3MA 4C0KA 1DBSA 3OAAD 4D4LA 4C7OB 2C8VA 4I1SA 3JZMA 4JLJA 1E99A 2ZETA 1XPOA 4JLVA 1EESA 1SVSA 4DIDA 4QBHA 4DLSA 2DYKA 4ESVA 3DKVA 1RRFA 3Q5DA 4AG5A 2FOLA 2HEIA 1E4VA 2LKCA 3FB4A 3AVYA 3BWDD 3KXLA 3PJRA 1A1VA 4IOLA 1WE2A 4Q4HA 4QC2A 2WKPA 4RSGA 4XOIA 1KI6B 1QHYA 2VO1A 1GRNA 3QQ5A 1XB2A 4KSCA 2JIZA 1E2GA 1XD2B 3MMPA 4IEEA 2W00A 5BW8A 1KYIA 2VEDA 2D3WA 3I8SA 3IEUA 3FTQA 1Z0KA 1UBFA 2OXCA 4HAYA 3QKRA 1JAIA 4LV6A 3G0HA 3PR1A 2QBYA 4D82A 3UKDA 2QENA 4WW0A 3NG1A 1KIMA 3UATA 4V0ME 2WVJA 3S1AB 2YWGA 1YZKA 3HPRA 4PO1A 1EFTA 2OEPA 1DO2A 3B85A 3GEHA 3SI7A 3ZQ6A 1KKMA 2AK2A 4KHZA 4QXAA 3VR3A 4OHZA 2IYUA 4ABYA 2JLVA 2FPLA 4Q47A 5E7MA 5LB4A 3MWYW 2H18A 1IXRC 5AJWA 1AQUA 5AUNB 4Q7LA 4POAA 5IDVA 2G88A 1E32A 1Q1BA 1A4RA 2REXB 2IS1A 2TMKA 4BWYA 3LBHA 2IBMA 2XNSA 1KNQA 5EP4A 2V9PA 1BYUA 4A0FA 5DI9A 1KZ7B 1KY2A 2VP9A 1SXJB 3NBXX 3AEZA 5JWOA 2G83A 5EE1A 1G8YA 2QM7A 2CE2X 1KK3A 2Q21A 3AGQA 1N2CE 3WXMA 4B32A 3KQKA 1Z0IA 4M9ZA 3IDQA 4OI0A 1E2HA 4LHXA 3WMFA 1K8RA 4ZDJA 1E2EA 3SYLA 2W6IA 3DDCA 4GFDA 5CLLA 1XCMA 1ZNXA 4TYNA 2V1XA 2G0NA 2XTZA 3TUIC 1C1YA 5DI3B 2FEOA 2YZ2A 3MJHA 1VCMA 4M21A 4HB3A 1T9HA 3ZQJA 1WQ1R 3QUSA 3EC2A 4BEBA 1JB1A 1NLZA 1WF3A 2C95A 2O8BA 4IDOA 1CBUA 1N6OA 4LGMA 3H86A 3KKOA 1CR0A 4LDJA 3RDPA 1MRSA 4BASA 4MKIA 1J8YF 2A5YB 4N0DA 5CM9C 1NMZA 4DLZA 1G6OA 2BKUA 2UVQA 2QTFA 5EUMA 5CLQA 1W49A 4Q1DA 1FTNA 3RRZA 3T12A 2QPOA 1FZQA 2ZU6A 1R2QA 2QT1A 4LCBA 4QOSA 3PUVA 4YONB 4BEJA 3DEFA 2W6JD 3CB4A 3IPXA 3AP2A 4UNRA 4TMVA 1R0ZA 1S8FA 4BZQA 2NTYC 3VNVA 3EZ7A 3KX2A 4HLDA 4IFBA 1I2MA 2WJHA 4LJ9A 2X77A 3K0CA 2QRZA 1GILA 2PX0A 3W6OA 3KQLA 4XD7A 4NP6A 5KDOA 4U5XA 5FTJA 1GFIA 3L0IB 3T06B 3T35A 5EP1A 1F2TB 1ZU4A 2JJ1D 1N6HA 3UMRA 4Q4AB 4DSNA 3RRYA 5J4HA 1W0JA 5JI3E 2QE7D 2ZROA 4CEIB 1XCPA 3H1TA 2RMKA 4RJLA 2AXNA 5KNCA 1NP6A 5DISB 5J4VA 5L3VA 4IXNA 1W4AA 2E87A 2ZVPX 3KZ1E 1AQYA 3DVLA 4NYIQ 3UWOA 2V6JA 3VQTA 1GAJA 3IEVA 1NVVR 4DJTA 4V02A 3I3SR 2YC4C 4ARZB 1YR7A 4U7DA 3K70D 2YV5A 3QEJA 5FFMA 1I4LD 3BGWA 1PJRA 2PL3A 1OF1A 1VYTA 3M4YA 1Z29A 4LBWA 2ERYA 5CITA 2YWFA 1R4AA 2G3YA 1R5OA 3GFTA 4B44A 4B2LA 4TLCA 3NEYA 1M8PA 3DOFA 4LYJA 4V0MA 4B3BA 4DB2A 4M4SA 2RGBA 2A5FA 5KHOC 1D6JA 1JI0A 4NHOA 4URXR 3F5FA 1LF5A 3GJ0A 4A2PA 3B78A 4WZAE 3FFAA 3GLFE 4QRHA 1G8PA 2ZS7A 2ZJZA 1KSFX 4OQFA 2HLDD 4DZZA 2PEYA 1G3RA 2OCBA 1KSGA 5IF9A 1AS3A 4P4SA 3MFYA 4H9GA 3GJ3A 5GJWC 5L8VA 2WBLC 5FTNA 3ONWA 4D81A 2QP4A 2NIPA 1ZINA 4OI1A 2JLWA 4D0LB 2IEYA 1F2TA 1PV4A 2DCUA 2LCFA 3C5HA 4Q4AA 4A36A 4MRPA 2O8FA 2VSOA 1GKYA 4DLVA 1M34E 2ECKA 3GMTA 1KO8A 2Z5FA 1PUJA 4HDOB 3IHLA 5DO9A 3IPYA 2PH1A 4QGAA 1P2SA 1JPJA 4HLQB 5FBWB 4NYMQ 2O8CA 4MDFA 4JVSB 2IYRA 1EFRD 1X3SA 1FL9A 2IA5A 4OHXA 4IVRA 1XTQA 3TUJC 1VCOA 4BPBA 4P4UA 5GVRA 2XZOA 1S9DA 2RCNA 2WWHA 4KCGA 3BH6A 1COWD 1AKYA 3K53A 1N5KA 2J0VA 1CKEA 3HP1A 2EWVA 3VX3A 1G7TA 3RNLA 5JS8A 1E0SA 1Z22A 4QG7A 2B7CA 3PENA 1TNDA 2BBOA 3P26A 2BMFA 4W7SA 5H8WA 2VHJA 1F3OA 1SKYE 2FV8A 3JVUA 5BWMA 2OLKA 2ZR9A 4PC7A 1ZCAA 2C9CA 2EW1A 3OIUA 2GXAA 2ZXUA 1WB9A 4LBVA 1HV8A 1OH7A 2A30A 3RSOA 3UMFA 4BLOA 1WMSA 4TYPA 4GT1A 1KO1A 2YHSA 3E70C 3QIAA 3OF5A 4XTRA 3KXKA 2QI9C 2FFBA 3QI2A 3CKLA 4HUQA 3AF3A 5D3QA 4UNPA 3EIHA 4FCWA 1II8A 3WHKA 4URVR 1KMQA 2D2EA 1TQ6A 4LJAA 4PHFA 4TLEA 4LZZA 5BYKA 3FMFA 2FFHA 1E9FA 3BE4A 1JQLB 3C15C 1U9IA 4LUCA 4OYHA 1JNYA 1E2QA 1XTKA 4Q21A 2V4ZA 4LBZA 4A0RA 1YZUA 2WSSA 1UDWA 2WWXA 2WWFA 2YOGA 3C7KA 5JCPA 3P27A 2B6HA 4MRVA 1TUEA 2XOKD 2GKSA 4QM6A 4KLNA 2WJJA 4O2RA 4B3XA 2CHGA 5BN5A 2ZRHA 5DN6D 1SHZA 2KWIA 4DB4A 5IRCD 4E09A 2W6JA 3L8ZA 1XPUA 3LNCA 3TRFA 3ZS9A 3HYRA 5FOVA 3SQXA 1KDTA 5IT5A 2B92A 1XNJA 1CLUA 1D5CA 1S4QA 3K9GA 4RZ2A 4PSVA 2ZYWX 4RKEA 3EIEA 4KYIB 2JGNA 1KO4A 2R8RA 4AWXA 3K9HA 2IS2A 4HZIA 3GLHE 4M1KA 3AV0B 2AX4A 4DCNA 1O3YA 1XTRA 2VA8A 1G5PA 3I72A 3KJHA 2NQ2C 1P6XA 3U6KA 1E6CA 3IHWA 4RCYA 1QVRA 2Z4RA 3CF2A 1YR6A 2JJ1A 1OYYA 2BEKA 2CE7A 1LFDB 5DHAA 2XGJA 3V00A 1GWNA 3GLFA 1SKYB 2QE7A 3E1SA 4EAQA 2VPPA 2FGKA 3M1IA 5EZ5A 4FMCF 1CS4C 3FHOA 1WA5A 4R7ZA 3B1ZA 3SS8A 4DCTA 3CUEF 3J81k 5FTKA 3MLEA 2GVZC 4XSGA 4LV8B 1E9SA 2ERXA 3AF1A 4KSBA 4G3XA 1II0A 2ZQ5A 1NKTA 1NKSA 3P20A 1I4DD 4P33A 1FX0B 4MKHA 4URZR 1XMSA 3BC1A 4ZKEA 2L0XA 4FMDB 3LW8A 1FOEB 2PJZA 4URUR 4A0GA 3FHCB 4M2LA 4DXAA 4W5HA 1TTTA 1HTWA 4AKEA 3EWAA 4JVMA 5E95A 3U4QA 4XWOA 3DZDA 2RGNA 3AF4A 1KDRA 2IYZA 2ZYVX 3SEAA 3KJIA 4WZ6A 3RS7A 1ZU5A 2FZLA 2V8OA 1CXZA 1YE8A 1KJZA 4GZLA 4OK3A 3UG7A 4NONA 4RKFA 4PHTA 4F4IA 3GJ8A 4B73A 1IN7A 1II9A 4JVLA 1YRAA 3EWSA 4F93B 2GNOA 2PCJA 3A58B 2XXAA 2X19A 4UXIA 1G5TA 2IC5A 5B64A 2EYQA 5FPKA 1UPTA 1W36D 1G41A 3U3OA 2FFAA 4WAUA 1MT0A 1EFUA 3LO5A 3U7FB 4HLUC 5E4FA 2IX3A 1T91A 2FFQA 4Q4LA 5FI1B 5KU1A 2VF7A 2F43A 5FL7D 1CEEA 4LYAA 4NMMA 1BOFA 2HJVA 2Z0MA 1ZUHA 4KBGA 3LAWA 1XBTA 2FF7A 4FW9A 4LJ8A 4NH0A 1HYQA 1OPXA 1VKJA 4WOPA 1W4CA 3PUYA 1VIAA 2X2EA 1F2UA 1NVVQ 1GDDA 4OK5A 1TPZA 4PTLA 2ZAMA 4KAXA 1FMLA 1COWA 2KE5A 3HR7A 3RS2A 5C46F 4LOAA 4F4CA 1WRBA 4MQBA 2QTVB 2ZI9A 4CEHB 1RKBA 2AN9A 2OE2A 4G5OA 4RZ3A 5E7IA 2ZAOA 1NG9A 3OEHD 3A1SA 2ZE6A 3R7WA 1MO5A 1YZQA 5J4YA 1CIPA 5CYPA 4B2PA 2XSZD 3R8CA 4OQXA 2IHBA 4RD0A 1JEEA 1IQPA 2FGJA 3CNNA 2ZJOA 3U44B 4RD2A 4OQLA 1XXHB 5K8IA 1U0JA 5J4KA 4BFYA 5SZHB 1A82A 3GLHA 1CJVC 421PA 4DCUA 3H0KA 4YDHB 2VF8A 2A9KA 4FI3C 5AJVB 4E5UA 2WAXA 4FMCB 1VMAA 4LJYA 1YR8A 3V9PA 4XWAA 3P32A 3GLGB 1ZIPA 3SN6A 3KJEA 2ONKA 3PEWA 5L3SB 1IJEA 4JT4A 4MRNA 1G3MA 2P67A 1G8GA 2EFGA 1CJMA 4K81B 2BVNA 2XOKA 5B57C 2CJWA 3KTAA 1S3SA 3I4LA 5DNYB 5DN6A 2JIZD 1JALA 4PQRA 4ASUD 2SHKA 2UKDA 4BLSA 3ZH9B 1A2BA 1Z08A 1JEDA 1TEVA 1B23P 3AVUA 3LBNA 4PXAA 4XVQA 4W9MC 3L8YA 4BFXA 2AD1A 4Q48A 2OO7A 4ZDIA 1YHNA 3CRVA 4DLUA 2CHQA 3LXXA 3TVTA 4B35A 1W36B 1IN8A 5FL3A 3U44A 1YZLA 1CULC 3QPWA 1HA3A 4TQUS 4F38A 2BJWA 3SE0A 5C18A 2CK3D 3WRYC 2ZR7A 5K8LA 1K5DA 1DEKA 1HURA 3DHWC 4JBXA 3PQCA 5AUPB 1XF9A 2IXEA 3KL4A 5JRJA 4LC0A 1JQJC 4M53A 3N70A 1ZUIA 2DWPA 4PSKA 5H1YA 4B6FA 2ZEJA 3ZD6A 3IO3A 4O25A 1HT2E 3IO5A 2VP2A 2RHDA 4IDHA 1P2TA 1NVXQ 4BECA 1M6NA 1TEXA 1A7JA 1ZCBA 3U3JA 3T1QA 4D25A 1Z0DA 5JFGA 5L3SA 2FX3A 2KJQA 5GVSA 1YZTA 4LHYA 3O8CA 4C0QC 2OUKA 3ZGXA 2DPXA 3NC1C 1E2NA 1IONA 5SZJA 3EG5A 1E9BA 2WWGA 2FU5C 5FPTA 4LPKA 1KKLA 2QA5A 3P1JA 4HLCA 4HZUB 5AR1A 4NYIR 4M1WA 2CMKA 1GTVA 2EFEB 2IYXA 3MD0A 2QP9X 1XCGB 3IQXA 1U98A 3KQNA 4AG6A 5CB6A 1SZPA 4FWTA 3KB2A 4TQ9A 1IY1A 1X1RA 1W44A 1E3MA 2N1BA 1XFAA 3E2IA 2JLYA 3QF4A 4DLRA 1E2LA 1M1YE 2ZITA 1MABB 1RC8A 3A4NA 3MSXA 3ADDA 3HWSA 4JJKA 1Q22A 1WP9A 5FH9A 3BFKA 1JAHA 4EJSB 1RJ9B 4TTQA 3EA0A 3NIBA 1KGDA 3FMOB 1LNZA 2GJKA 3LFUA 4A4DA 3LY5A 2ORWA 1OLOA 3K0AA 5D3MB 4B43A 1YZGA 3CW2A 4C2TA 3X1DA 1RFLA 2JA1A 4C0JA 3D7MA 3I62A 4GZMA 5TB5A 4G5SA 1WBDA 5FL7A 2V54A 2IUUA 3L43A 4ZCIA 2FN4A 2ZI5A 5GADl 2QTHA 3CPJB 1UKYA 1T5IA 2WZQA 3WY9A 4TTRA 1L8QA 3GJ4A 4Q1BA 4BGDA 3VR2A 5LD2B 3FMIA 4GNKA 4MKGA 4EPYA 1KJWA 3DMNA 5EZ6B 5FPYA 3ZD7A 2HF9A 4PQFA 5EQTA 4Q4HB 2BJVA 1RYHA 2GCPA 5FBVB 3LA6A 1MO6A 3TSZA 4PC6A 4PSAA 2PCLA 1LVGA 5SZKB 3DMDA 2IYVA 2WWIA 3FFBA 4IDNA 3THYB 4FN5A 3OIVA 2VLIA 3AKYA 3BK7A 2R65A 3RC8A 4PQYA 4ZO4A 3QKRB 2W0SA 1P60A 2HV8A 5BYJA 2PZGA 4CVNA 2QBYB 4Q7MB 3RC3A 2F55A 3AB3A 3OEHA 4G5QA 1FP6A 5CJPA 3CNOA 2XSZA 3TR5A 2ZUBA 4WZBE 4JZKA 2XJ9A 1KY3A 2IT1A 2E9SA 3UXMA 1OJLA 4TYYA 1D2MA 3A4MA 2RGEA 4LHWA 1G18A 2OFOA 1G3IA 1ZJ6A 3MWKA 4M0LA 3AH8A 1XZPA 3VTKA 2GCNA 1XWIA 4DCVA 4RZXA 2ZREA 5L3QA 2VP5A 2ZRJA 3EZ2A 3LQRA 4M1SA 4ZI2A 1OSNA 4EPXA 2BC9A 3O47A 5JS7A 1N6LA 4TZ0A 3BB1A 2GBLA 2RH5A 5LB2A 1SVOA 1ZM7A 5TARA 4TLAA 3LX8A 2A78A 4LK2A 1Z6TA 2OBLA 4N1AA 3FOZA 1E2DA 2NO6A 3AVWA 1ZD9A 4UKDA 4EDHA 3IUYA 5FOWA 1X1SA 2QAGB 4TL8A 3Q9LA 2JDID 3EASA 5UKDA 1G5RA 1S3GA 3WYFA 3THYA 5TVKA 4ASUA 1E2KA 4OBEA 3SBEA 5G3YA 2P6RA 5DYGA 4YMSA 5JLJA 2O8BB 3C16C 1O87A 1N0VC 1NNEA 3P4XA 2HXSA 3F0TA 5A5GA 3ZLJA 4AI6A 1AIPA 4A15A 4GDFA 4PC1A 1G64A 4B3GA 1H8ED 3H84A 1OKKD 3LVQE 4GP6A 3AVTA 4NCNA 4OQNA 2W0MA 2MSEB 2GEUA 4J0QA 2OZEA 4KI0A 3WHLA 1UF9A 3U60B 2ZANA 3AVQA 3PITA 5H70A 4KV9A 2C77A 1NY6A 2R44A 2O8DA 1S96A 4X8LA 2CK3A 2GWHA 5KSOA 2XB4A 4KFRA 5K8UA 3K09C 4Z8XA 4Q66C 4AKGA 4M1YA 1OIVA 4C0LA 4BRWA 2KSQA 1YU9A 4PPQA 3A4LA 3WNBA 1TF7A 1RRPA 5FPHA 3PVSA 5A0FA 1GNQA 4CZ2A 2CVHA 3T34A 1YQTA 4QFMA 2GK6A 1BH2A 2OT3B 4WA7A 4WBSA 1R6BX 2XITA 4JLDA 1RE0A 2BBTA 2OCYC 1OFHA 1N0WA 5KSPA 5JEEA 4QJ3A 2CXXA 3LBIA 2WKQA 2O8EB 4ZDKA 4YMWA 4PFSA 1OH8A 4W5JA 4PPGA 5JSZA 2QAGA 1Z6XA 3ETLA 5EE0A 4BLQA 4D2IA 4DC9A 3QXXA 2ZJ5A 4HUTA 1UADA 2IL1A 4C0BA 2OCAA 4XJXA 4JKYA 3GFPA 4MUBA 1NBMD 3BAFA 2GZDA 1N6IA 1AZTA 2R6GA 3RABA 2IYQA 4QHSA 3NVAA 1E9CA 2KB0A 4MGZR 4PPFA 4QGFA 1X8JA 4U00A 4TN1A 4V03A 4Q9KA 5EXSA 1Z63A 2Q6TA 4A8JC 2C9YA 4DLWA 4B33A 2BCGY 1GSIA 2WSSD 2XTNA 4B76A 2HT1A 1PLJA 4BFZA 3U7GA 3A1WA 2G0TA 3BFXA 4OI4A 2P3SA 3VKWA 3ADBA 4EPTA 4LWZA 2EU8A 1IAQA 1W47A 3CBQA 1NG1A 3GLIE 2QU8A 3X1YA 4QBIA 1UM8A 1R0XA 3QXCA 4F92B 1ONBA 2IXFA 4JYCA 4QHYA 121PA 2ZE7A 3CR7A 3KUCA 2NPFA 1XZQA 2QSZA 1UKVY 1KI2A 1VCNA 4JLBA 3TNFA 2EYUA 2WM9B 1Y3AA 2VSFA 1DG3A 1NBME 4P4SB 4DSUA 4EJSC 2DB3A 2C03A 2ODEA 3VU9A 2AFHE 1KZGB 2F1HA 3VR1A 2O8EA 1BIFA 4Q9IA 1W4RA 2GCOA 2BOVA 3LH5A 2J0UA 4C4PA 4KITB 4EKDA 3V4RA 2ZS9A 2O8FB 2YJTD 1IY2A 1FQKA 2ZRKA 3I73A 4K8OA 3R9XA 4D0NA 2FNAA 1U81A 2MSCB 3QY0A 1E98A 1JR3D 2DBYA 3VX4A 1N0UA 2QQEA 2XZPA 3NBZC 1KI1A 1OV4A 2O8CB 1BO6A 5LD2C 2HJGA 3KKQA 3B6EA 4NYJR 2YNMA 1R5NA 1JJVA 2HXYA 2AL7A 2OSBA 3Q3JB 2NO7A 1DE0A 4NDZA 4US1R 2ZI6A 4EPRA 5EJEA 1KI8A 2R6FA 1NN5A 3TQFA 3KJGA 4N0EA 2GJAA 4Q9LA 3Q72A 1SKQA 1P72A 1UEIA 3OE7D 1M7GA 4DLTA 2Z4SA 2IYTA 3SZRA 1UBCA 4LYFA 3GJ6A 2O5VA 2VYFA 3BBPA 4A6XA 3RVBA 2GK7A 3VKHA 4XVUA 2WV9A 4G5GA 5AUOB 3R8FA 3ASZA 3QJYA 2VHUA 1P75A 2CVFA 1X6VA 2GTPA 2QP3A 3WMEA 3ZYCA 2ZYUX 1KI7A 5HZHA 2VBCA 3GEEA 3EIQA 3LLUA 3FMPB 3T61A 4A2WA 3GLIB 4TYQA 4YC7A 3A1UA 1JR3E 4B3DA 3T5GA 3D6TB 3AVVA 2IF2A 4GBMA 4HB0A 4C0HA 4CF7A 3VHXA 1J70A 2H92A 4BFUA 1KSHA 1S9HA 2JDIA 1XPRA 4KBFA 1Q1QA 1MO3A 3B1WA 4HB2A 4HUQB 4A9AA 1HEIA 3CZQA 2B8WA 4D0GA 1II8B 4TMTA 2D4HA 1DPFA 4GMXA 5TXGA 5KNBA 3AVXA 1RZ3A 1ZVQA 3B1XA 4CT5A 3VNUA 1UJ2A 1HQCA 1XMVA 3CWQA 4OJKA 3EPHA 1P73A 4LJ5A 3B1YA 1H8EA 5FR1A 1OH5A 1G8HA 1OKKA 4MRSA 1US8B 3THXA 1KDPA 4C0SA 4HATA 2HT6A 2I4IA 3FWYA 2EFHB 4XH9B 1Q3HA 3NDBB 4CW7A 2I1QA 1Z0AA 5EUQB 1KO7A 1ZMXA 2DWQA 2GZHA 1AA9A 2I3BA 5HE9A 5M04A 1R0WA 2ZI3A 4HB4A 1LB1B 2X1VA 1DADA 3VMFA 1GNRA 1T8TA 1VTKA 2AFIE 3EC1A 2ZRGA 4MRRA 1Z0FA 4MYCA 3GLIA 4BZPA 2JLRA 1D2NA 4AKHA 2AWOA 3LLMA 4KJZA 2JCSA 2OAQ1 3KXIA 3RS0A 2UZ3A 4IVQA 3AUYA 3KUDA 4AURA 2J87A 3GLFB 1UDXA 1SXJC 2QT0A 4IJMA 5F2EA 1W4BA 3TSWA 2OHFA 1WBBA 2P5TB 1KAGA 1NBMA 4Q7KA 3K0CC 4HLUA 2EVWX 1YVDA 1I2DA 2QSYA 3TAUA 1MOZA 1KHTA 1VIYA 3RSLA 3SJAA 5BN3A 1QHIA 2DY1A 1Z6AA 3EW9A 1H8HD 4R71A 2O0KA 4QBFA 4JMPA 3WYGA 4AYXA 5EE5B 4AY2A 2BCJQ 3K70B 2GVDC 1US8A 2CCJA 4X8HA 1ZM9A 2WJIA 4OQMA 4MYTA 4PO9A 4A0HA 3T5DA 5FTLA 2GEDA 3B60A 4A1FA 1DO0A 5KUTA 2WOJA 4QL3A 1HQYE 1U99A 5AJZA 3U4QB 3AVOA 4X8OA 3VR4A 1CP2A 3NBFA 3L82B 1WCV1 1L4YA 2H5EA 1T0HB 1GOTA 3SHWA 4IDPA 2FEMA 1FUKA 4LPSA 4BLPA 2J45A 5DHFA 1G20E 1TQ2A 1SHKA 3LXRA 4TL6A 3VR6A 2IYSA 3CO5A 1U8YA 1Q44A 4PAMA 2IW3A 4JLNA 4DBLC 1K5GA 3W6NA 4EPWA 4V0NA 2ZRBA 3LVRE 2NPIA 2XXAB 3TR0A 2ZIAA 3A8TA 1OFUX 4D4MA 2OFXA 5J5CA 1RIFA 1W5SA 1G1MA 4OHWA 3SYKA 4OL0A 3X1XA 1CF4A 4YMVA 3PUXA 1IN6A 4V0OA 2IF0A 5CK4A 3PXGA 3PCRB 2B8TA 5KNDA 2J41A 3LX5A 2C04A 3ZVNA 1JR3A 2GJSA 3QKTA 3C41J 4GP7A 2F43B 3RRMA 4DT1B 5EP2A 1R8SA 3MJRA 1OXSC 3GQBA 3R20A 1ZM2A 1OW3B 4G5RA 1E1RD 3KQUA 3MCAA 4MGIR 4NTZA 1VHTA 3FPAA 2WPDA 1CR2A 3TQCA 2G1KA 2HCJB 2BMEA 1JR6A 1F2UB 1MV5A 1U0HC 3B9QA 3IIJA 3OE7A 4UQOA 2R6DA 5ANRB 5G3ZA 3THOA 4L4UA 1DELA 1CJTC 1QRAA 1IXZA 2XNDD 4YLGA 3GJ5A 1C4OA 3BXZA 3PEVA 4WXPA 1S1MA 5HE8A 4MKFA 1P7CA 2IYLD 3TLXA 1ZC4A 2AKAB 2REOA 4Q9JA 4B47A 2JLZA 4PANA 3BRWD 1P9NA 2AR7A 3CLVA 3QBVA 4GL2A 3H4MA 3BFVA 3DPUA 1XTJA 3UIEA 1JBKA 5A4JA 4HAVA 3R7WB 1D9XA 4KVGA 1HUQA 4DDWA 1SVIA 3RYTC 3CRRA 1NN1A 4BE7B 4IFEA 4IOJA 4XVRA 5FBQB 1N5JA 1Z83A 5KYKA 2F3RA 2G6BA 3QPVA 4OJQA 3L2OB 3TSOA 2QMEA 4IVPA 4JBWA 3LRPA 4C0AC 2W83A 1LF0A 4Z51A 3GLHB 2ZUCA 5IK2D 5KSZA 4NCIA 4L9SA 1E9RA 3ZVMA 4LV5B 3MGCA 3DM9B 4ZPXA 2CLSA 3TE6A 4DEYA 4DT1A 1L7VC 4PZZA 5FUVA 5E7JA 1T5LA 1QHGA 2P5SA 1G7SA 1YR9A 1Z28A 2OAP1 3NWJA 1EFCA 2ZU0C 3B9PA 1R8QA 2JLQA 4M1MA 4BQSA 1E9EA 3OZXA 4Q4JA 4JSTA 4P32A 4UNSA 1SVKA 5CDFE 1ZNYA 3LDAA 2J5XA 2QUZA 2CL0X 2FPKA 1GIAA 4NYJQ 4PR0A 4B71A 4LHZA 3SJBA 3QF7A 1Z6YA 2CJWB 3KTAB 3V4FA 3REGA 1GM5A 1FQJA 4AC9A 1OIXA 1E94E 2ASEA 4M9QA 4RCZA 1U9IC 4DLYA 3BJIC 5IHPA 4ZKDA 3U7EB 1UBEA 2BV3A 1DAIA 4PZYA 3WP1B 5FOUA 4DHEA 1VHLA 1Q57A 1U2RA 3QKUA 5KDLA 4DSOA 5HKKD 2ZRDA 2ANCA 1Z3IX 3G82C 5FBRB 1XRJA 4D80A 3BORA 3JVVA 4XIGS 1V43A 2PT7A 2VTKA 1QHHA 1ESMA 3EZ6A 4Q1CA 4EQ6B 2QORA 1P5ZB 5KDDA 1W7AA 5B30A 1J90A 1AGPA 5G40A 1G7CA 4JLMA 4I1VA 4PZLA 5AUQA 3I5XA 1TF2A 3BS4A 4K46A 4JLAA 4YMUA 1M74A 2HYIC 2J7PD 3IQWA 2JAQA 3SHFA 3SR0A 1Z2AA 1E0JA 1GL9B 2WJYA 1Q0UA 1VG9B 1N6NA 3NHBA 3OEED 3SOPA 1H8HA 2RGXA 3HU1A 1KTVA 1ESNA 4TLBA 1VPLA 1TU4A 4IW3B 4KLZA 4XTCS 3C14C 3EPJA 3DM5A 1E2FA 2O0JA 1J8MF 3OESA 3RHFA 3CRW1 4JKIA 1R7RA 1VG1A 3QENA 3LD9A 3B82A 4RFSB 2ZJYA 4M9XA 1WXQA 1S0UA 3U3KA 4MGYR 1AM4D 2ZS8A 4FINA 2PT5A 3U61B 3K70C 1XDBA 4TLDA 3X1WA 2J0QA 2NG1A 4QBGB 3HU3A 1E2MA 1MO4A 1IJFA 2PMDA 1Z0JA 1CR4A 3QF4B 2ZTSA 4H1VA 1VG8A 5LDDC 3W5JA 2H1LA 5CIWA 1AZSC 1OIWA 3EPKA 2A5DA 1MR3F 4Q7JB 4EQ6A 2RGNC 4IOKA 1TF5A 2RGAA 1XEFA 2QPTA 2JJ2D 1P4SA 8OHMA 4NCJA 3BH7A 5JWHA 1NL3A 2HUPA 2O0HA 1TUIA 2Q3MA 3K0AB 3CWZA 1CU1A 1A5TA 4PHHA 1XJ0A 2EWWA 5C4MA 3KB1A 2IWHA 2YOHA 4ZCLA 2XB2A 1R5BA 2W2XA 3EARA 2AHOA 3B8HA 3QOFA 2CBZA 4JLOA 821PA 1E1RA 2VL7A 2IEZA 3KFVA 3ZJYA 4DSTA 5HZKA 3CRQA 2GAAA 4UNQA 3HJNA 4N3NA 2CLCX 4C30A 1G7RA 2NMVA 3IIMA 4RFSA 2XNDA 2ORVA 2NOAA 2WMOB 1ZNWA 2AKYA 4QKQA 1DTSA 4ZI3A 2PMKA 4A82A 1GNPA 1W0KD 2OLJA 5CDFA 2BKEA 3GD7A 2RHMA 3N2IA 3TUZC 3N5CA 1YZNA 2IUTA 1X8KA 3PFIA 3CH4B 2W2TA 1QZXA 4NKRA 4Z8YA 2QEQA 5C4GB 1XEWY 4KFSA 1IHUA 4TSFD 1XEWX 2OFWA 3AUXA 1FP7A 3KKMA 1G4UR 4EIWA 6Q21A 2OBNA 3WP0A 2NO0A 4JL5A 4HYYA 3TJZA 1QHSA 3EZFA 4BFSA 5JJLA 1T3HA 1EWRA 3R9WA 1RPZA 1OYWA 1XEXA 1KMHB 3DKPA 5IK2A 2QG6A 3VAAA 4QM7A 3C8UA 5L3QB 1DARA 3QSYA 3L0OA 4TYWA 3EX7C 4Q00A 3NXSA 3B13B 3F3YA 3PV0A 4FXPA 1GZSA 1GG2A 1N3BA 2NGRA 1TQDA 3D3QA 4RY2A 3WRXC 4R98A 3ZVRA 3A6PC 4E22A 4TWZA 2DFKB 1FNMA 4KXFB 4B3CA 4RD6A 4BFTA 1DVRA 1EX7A 4LJ7A 4O0MA 3QXSA 1H65A 1T6NA 1U94A 2P65A 4LC1A 5DIFA 521PA 3OFND 3BIFA 1P2VA 2QZ4A 3M6AA 4QGGA 1NI3A 1SXJD 3I1FA 4DRZA 2VH5R 1RRGA 3QG1A 1G4AE 1JJ7A 2PZEA 2J1LA 4TMZA 4L5BA 1DG1G 2CNWD 1E2PA 2GXQA 3SFVA 1OHHA 2WICA 2HCBA 4E03A 2JLSA 3FGNA 5HKKA 4QNMA 4M1TA 2YYZA 2LWIA 1NN0A 3TMKA 1F6BA 1PUIA 2EQBA 3HYTA 4GOKA 1OXTA 2O52A 4JT2A 5HCNA 4D26A 2GETA 3CX7A 5JJIA 4URYR 4Y0AA 2O8DB 4QGHA 4Y0VA 1U0LA 2GESA 5TY0A 1KMHA 4KO8A 2ONJA 1DAMA 2J7PA 3TIFA 3EA5A 2QNRA 4DIEA 2VP4A 4KYUA 4HI0E 3CM0A 3EPLA 4YXWA 5KSYA 2E1RA 1P9WA 3Q85A 3OEEA 4JLKA 1UFQA 4OHVA 3C4JA 1SXJE 2G9NA 3O8RA 2MMCA 2FZ4A
chains in the Genus database with same CATH superfamily
1QYDA 2OESA 3GXOA 1XZBA 3IJEB 3N7TA 3O82A 1EQ2A 1HLFA 1W5AA 3TXXA 1U1GA 1QYVA 4B7UA 1U7UA 4D6PA 2Q0QA 1EK2A 2IVFA 5TMPA 3W8RA 3DDZX 4MDHA 3UAXA 2HBZA 1Z47A 3S5UA 4ZI7B 4P7KA 5TQ0A 3RC1A 1QAOA 4EB6A 4QZVA 1ICIA 2MT9A 2QD2A 2WJ4A 4RMHA 2AOWA 4MQ6A 4WK6A 5IJ9B 2XNCA 3DO8A 4RF2A 2B4QA 2VXBA 4M49A 1K2VN 2BM1A 4R9SA 5B6PA 2IHYA 5JFTA 3K9NA 4HRAA 2ATXA 4ERNA 4U0KA 1H9BA 2JFQA 3HO8A 3K4HA 3OBIA 2WWYA 1FFXA 1KYYA 1DHRA 3AO0B 3G2QA 4Q1EA 3CZPA 1L4GA 3W34A 5JH7B 3HXTA 2ZSEA 3NTQA 4TQAA 4JVNA 1W5BA 5K1ZA 5EWLA 3U1BA 3N8DA 1F0YA 4OJYA 3RWOA 4AS1A 4G1UC 1AMOA 3Q5EA 1ZEJA 4QHTA 3WSVA 4F4DA 5BSKA 4R0MA 1RQ7A 1FNBA 3JARB 1EVQA 2XF2A 3VC3A 1VDZA 4JLWA 3SYMA 1XWFA 2W2VA 1TZ2A 5FUXA 4WI1A 2GJ8A 2JKYA 3DBVO 4C2AA 1KAOA 1NJGA 3CN9A 3CUSA 4KR6A 1ZIXA 5HUHA 2Q9CA 3NBQA 4Q3KA 1VJRA 1W87A 2FFRA 3E03A 1K8XB 3GFVA 4I1UA 1QPGA 4Y2GA 1GAEO 3IKVA 4N8EA 4IHJF 4XW2A 4MO2A 1P2GA 4F3YA 3GUUA 3QWIA 2Q7XA 3F67A 4DZRA 2OZKA 1W36C 5C1DA 3O90A 5E6SB 2FG7C 2XWJI 4KPUB 2H1CA 2PTHA 2Q28A 2GXSA 3TQIA 5L53A 3L0PA 4DJ5X 3EJWA 2CNOA 3B6KA 3OFKA 3UH0A 4H7JA 2J0UB 1E5QA 4CM4B 1N2IA 4L8WB 4ZMSA 1N0HA 1BDJA 4C7OA 3TI9A 5JJKA 1MB2A 4I4TA 4LKOA 4XEUA 3OPQA 2YL2A 2GRJA 3F6CA 3F6BX 3OLVA 4JR1A 2V7XA 3ICPA 4RPIA 3TW4A 3OFJA 2A9OA 4KC0A 4A6EA 1ONSA 4CM7A 3W3AD 5BWLA 1E66A 1VRCA 3GWZA 1CIVA 2CKDA 4K6CA 1TC2A 3OCCA 3RVQA 2VP6A 2XYGA 2GEVA 5KS2A 1VCHA 3G3EA 1MOQA 3CTPA 3F9IA 3B7GA 1ECFA 1IZZA 4A8TA 3JQ7A 3DBLB 5CW2A 5D7BA 1NVUQ 1XRNA 4OQEA 4JB2A 3OTIA 5CDUA 1RAHA 1WLSA 2X6TA 2JH3A 3FPFA 3KQVA 4H1TA 3T4UA 2JLUA 1FZTA 4E07A 4CF6A 1XD2A 1QIGA 3GCWA 3RUHA 1T4BA 4POOA 1AG9A 3JALA 2AXPA 3R0JA 1PQUA 5CB4B 5C2JB 1DJLA 1LZKA 2I9PA 1ST3A 3DMRA 4FYXA 1FTSA 4OXKA 3C5VA 2Q5EA 4QVKA 4KZPA 2BUBA 4LNUA 3T1NA 1T5SA 3GAMA 2C2OA 3K5WA 4O5AA 2LZ0A 3NAZA 5SZIA 1TLFA 4JT9A 2IU0A 5BMOA 1LY1A 2WK1A 4B31A 1T36A 4QRIA 2AN1A 3RJZA 1G291 1V16B 1JEYB 2QG9A 5FD8A 5E0OA 4HAIA 2PX8A 4IDCA 2NYAA 1GPKA 2QGZA 3IJPA 4MJ7A 2YY6A 3RSFA 2QMHA 4FNGA 5BQ5A 3HN7A 3AM1A 3LQFA 5JHHB 3I30X 1FW6A 4LDRA 1SXJA 2E5WA 4PRYA 5ALUA 4YPFA 1PR9A 3LLVA 1L1FA 3RR2A 3DE6X 4W5WA 4A16A 3WNZA 2R84A 3RJ9A 1L5LA 4C07A 2Z2XA 2I33A 3S40A 2HRCA 4C43A 3QYPA 4UDNA 3ZWPA 4K88A 5FAKA 3TH5A 1XLWA 3VDMA 4EBFA 2IZZA 1BS1A 2JFUA 3SM3A 1UMCA 3W4KA 2WPDD 1ORTA 5LBIA 1TYCA 4H31A 2DCMA 3PHBE 2WIDA 3A9VA 3DNPA 3H9GA 4HDKA 3ZBPA 1RRCA 2FETA 4RQTA 5F33A 3CF4A 1KVSA 4A8PA 3LUGA 5AMXA 3HYNA 5EIFA 1XJ5A 4X95A 2I34A 3L7AA 5AW3A 1Q0HA 2UYOA 4G0UA 3FETA 4EW3A 4IQ0A 2ZSAA 1EUDB 3ZOKA 1PAUA 4HX2A 4UXJA 4O6VA 3G1TA 2NW6A 2VPWA 2A92A 3BTOA 1N6PA 4S1WA 1AS2A 4R2IA 3RJ5A 4ZDWA 3DF9A 4PC2A 3MT8A 4Q5IA 3VI4B 5JQGB 1DDIA 4HWPA 2OPHA 1V3VA 3DOHA 3EXAA 2YFYA 3IFSA 4NE2A 2JJ8A 2ZRIA 1WVGA 2IHUA 2Z6VA 4PO8A 1B1CA 2VJAA 2PHZA 1T2UA 1RHQA 2W48A 3D2AA 2XADA 5K3EA 5K8TA 1C9MA 3FHTA 3X3HA 1YK0A 1R0YA 3ZU6A 1DT3A 5DX0A 4FZ5A 5CBKA 2ZB2A 1VYVA 4IO0A 4QEKA 3AP1A 2JFVA 1SCBA 5FBLB 1U1FA 2W58A 3H3JA 2JLXA 4FIDA 4TN5A 4XE5A 4RSMA 1NMYA 3AHCA 3U4MA 2UXDB 1JWBB 1EFHA 3KFXA 2ZUDA 1NYTA 1PX2A 1VIDA 2P4HX 2PL1A 4F5EA 1T0JB 2D7JA 4NZZA 5AIAA 1RWQA 1PE0A 1M6HA 4ZZ2A 3WLPA 1UMDA 1EM8B 3OWXA 4XZ3A 4CMKA 5BOVA 4BQIA 4K0KB 2PH7A 2V6IA 4CFSA 4AIIA 4G84A 5DM0A 2DKOA 1LJ8A 3EDRA 3HWRA 2P2CA 5DYIA 2R5FA 2DG2A 2WTXA 2WSBA 2MU1A 3HKCA 4DTIA 5AVWA 2F62A 2P6MA 4GGMX 4MUFA 2JEZA 2AJLI 2I1WA 3PIDA 1RPNA 4QJBA 3H7IA 4P58A 4MTCA 1HOXA 1QGAA 4GBGA 1J20A 4GOLD 3WK4A 4OATA 4QNRA 1TUBB 1PT6A 3ZIUA 3V4RA 2C98A 4YUVA 1U0BB 4H7EA 1W73A 4YUZA 1SU8A 5JXWA 4JP2A 2BHLA 2YWDA 4A6PA 4XASA 2B20A 4UCXA 5DTIA 1P45A 4R2XA 1JF8A 4HDQB 4ARZA 3RLFA 3AIIA 4OQPA 4NCKA 3L1KA 1ZGJA 1GXSA 3WLNA 1DV1A 4LW8A 3GRYA 3RCBA 3UGTA 1IJKA 1L7OA 4TYMA 4GLLA 2GPTA 4EQZA 1GUBA 2YZNA 1JXMA 1WS6A 3EOBI 1LC3A 1PG5A 2WJGA 3Q6NA 4MMZB 5IT9A 3EBOA 2ZJBA 2XECA 2IDJA 2BFCB 1JSZA 2CL5A 2YIVX 1GTZA 1JTVA 2CZQA 2Y77A 5FJIA 3BHIA 5C35A 4KR3A 1FP1D 4QJ4A 2F1OA 3NVMB 4P0QB 2DECA 3MLAA 2Q0XA 4BNDB 3MINA 3A9WA 2ZG6A 3OD5A 4MITA 5JCXA 3O3CA 5LMNB 4LRWA 1IPHA 2RIPA 3BQ9A 3GI1A 3GVPA 4Z54A 4EMSA 1DAFA 1N6RA 2PKEA 3C3PA 1YHYA 5JCOC 3TBKA 1DX4A 3A1TA 2O7VA 3R0VA 3CLUD 4TXNA 4GI2A 1J5EB 2IKQA 3AZOA 1EP3B 2GPYA 1ID8A 3ROXA 1BU5A 4Y8VA 3LHFA 2QMUA 4TKVA 3EQ7A 2OILA 2FDRA 4KXQA 4PPYA 4WWHA 5CYOA 1Z2OX 4G8DA 3TDMA 5F5XA 3LMKA 1OLXB 3GVIA 4QJ5A 1BXKA 1GKUB 1XNQB 2GK4A 3ENWA 3D31A 2D06A 2FN7A 1KK0A 1F17A 4P4LA 1DC8A 3JQ8B 5A5DA 4YUXA 4IDFA 4RTRA 1C9NA 2P69A 5FI0B 2PUDA 4M7PA 2D7CA 2PGDA 4ESHA 1CYDA 2IIBA 2R62A 4Q3DA 5EUBA 1N5LA 2XMCA 1ZSYA 1L4BA 5HILA 2VHTA 1G5HA 2GUGA 1O97D 3W6ZA 4L73A 4AP5A 2QGNA 5FOXA 1NV8A 4C04A 4FD3A 1VLJA 2NZJA 1NUHA 4NX2A 3LL7A 3A2LA 4KXLA 1OX5A 1N32B 2XTMA 2OM2A 3LOQA 3ZZTA 1BFUA 1E61A 3IOBA 4J29A 3W90A 1Y5LA 4WXRA 1SBHA 3FA2A 3G2KA 4C88A 4NVRA 4HJXA 1MT3A 4BLUA 2FE1A 3R24A 2WTAA 3RIMA 3W3ZB 1O8CA 4DBVO 1TM5E 4M9RA 3ZY5A 3WBJA 3ZIAD 3T1VA 4JU9A 1BKDR 3HCWA 2AFIB 1XQWA 3A6DA 3HDQA 2YY5A 3HUFA 2GDZA 1A8UA 3IUQA 2VDNB 1Q16A 5JO9A 1CZKA 5DLQC 5C7LO 3DOEA 5GINE 3ZJTA 1Q2XA 5CB8A 5AKJA 4OMDA 1FTYA 1AF4A 4PAWA 4XDZA 4LSWA 2H7VA 3UWKA 3PJDA 2AZDA 2PMFA 1VFNA 4I3HA 4I1OA 5I5EA 2H1OA 4WGFA 2F1IA 1VSUA 4DMHA 2I87A 4M0PA 4EFLA 1H9AA 2ZBEA 1QH9A 3LQYA 4N6OA 4QPPA 3H1FA 2FW9A 4C5AA 1NSYA 1T0BA 1GG5A 1Z0ZA 2JCBA 3DULA 4LWOA 2G77B 3NEJA 3OSUA 1Z2CA 2O3RA 1XG5A 3M9WA 5KC8A 2H3HA 3BUSA 2I80A 1UBUS 1WKVA 5G2OA 4BP9A 1VKOA 3GLSA 1AQ6A 2QTBA 2WSYB 1CUVA 2MR6A 5DYNA 2GXUA 3IP6A 2QTZA 5K3AA 3UH1A 4DLKA 1WP4A 1AUPA 2F1RA 3NYQA 4DC0A 3D7LA 5C32A 1V5IA 2IV3A 3GLUA 4PAGA 3CZCA 1KPIA 1PUXA 3ME5A 2GPWA 3P2EA 5AI8A 4CIDA 4AJ4A 1GL7A 4G4JA 4HN4B 4PHGA 4G0QA 2B6NA 2M6LA 2FLVA 4CT0A 4RDCA 3W9BA 4KQGA 3T3NA 1EQUA 4OEHA 2PJRA 4ZQFA 2EZUA 4KR9A 1ZK4A 2BDUA 2HZBA 3ICQB 1PBNA 2I4LA 2BBSA 2J9FB 2EGGA 2BDTA 1RPTA 3AM5A 1K7CA 3IMKA 3ORRA 3QYAA 4FGKA 1MOSA 4NL4H 5B1YA 3W5AA 3T0FA 3GJRA 4M8IA 5AVSA 3F7OA 5EE3A 4DEVA 1CWUA 1H05A 1E1LA 2IE0A 2RC5A 1LVUA 8LDHA 2BELA 2ZAGA 1L4UA 3D81A 5ALQA 1JQ5A 3EIWA 1YQDA 4RDHA 2FXVA 2PUCA 2ATVA 4DR5B 2HLDA 1G6Q1 3IMCA 4TL7A 3EFOA 4E4TA 3EVFA 1Q95A 4RZHA 1O6FA 4PW0A 2QL6A 4AZTA 2Q5HA 4ZYLA 3EFEA 3L8FA 2WU8A 3IR6A 4OFXA 4EYSA 4L9WA 1AY0A 3ZHSA 2M2IA 2R7NA 4BBJA 4R7TA 1ZKDA 3IBFA 2DHRA 3GLGE 3C98A 3A31A 1EB8A 2EFCB 3AOEA 4YAIA 5AI6A 1ZA1A 5G53C 3VC1A 1LU9A 5AXBA 5JSFA 1A04A 2AR0A 5IAAA 3BPSA 3C5CA 3QPUA 2DFNA 1E1DA 5EYPA 4E6PA 5EIOA 5AM1A 2GMWA 3IBCA 1XQ1A 4OKIA 3O8BA 4WKCA 4FR5A 1VCIA 1OH6A 2XWQA 2WHPB 5JWRA 1EFRA 2QQ0A 1X74A 2BM0A 2HLPA 2E4UA 2X40A 3QLEA 3UMSA 1FNNA 1IG0A 2V97A 2VT7A 3KEQA 4DA9A 4RTJA 2PLRA 2Q5QA 5GJVC 5DHUA 3BCUA 3JAKA 4QD3A 1G3QA 2J8ZA 1GG9A 2JHCA 3D2LA 1KP3A 1SZJG 3HCRA 4MRMB 4TL9A 5KVQA 1QHEA 1OI3A 1SCJA 2ASVA 2VQSA 2BM9A 1ZP6A 4KVAA 4BC1A 4Z1MD 5JCZA 1Y1PA 3EF3A 1M2OA 2Y05A 2BMJA 1JEOA 3EC7A 3GLVA 1J09A 3P0EA 5CFNA 1P77A 2A59A 2AIRA 3P9YA 1E3JA 1UMKA 2I62A 4UTZA 4XB1A 1H1TA 2C88A 2QN7A 2VUHB 1MHTA 4JLPA 1U8AA 1NTOA 1E9AA 1Q12A 2B30A 2UVPA 1VYUA 5DNCA 1LQ2A 1CC1S 4C7KA 1N36B 1P1RA 5ENDA 3QBTA 3HADA 3N2NA 3D6MA 4RM2A 2VEOA 5CDGA 1N7JA 5A4MS 3DE2X 1WDTA 2D1QA 1NE7A 4K28A 5A1JA 1FVOA 1SKAA 2H57A 5U4QA 5I7RA 2A5GA 5KWEA 4DUGD 2YHIB 1RTKA 4PC3A 4HN2A 4RANA 3S27A 4GRIA 4M8SA 4ZVKA 3FROA 3JVIA 4GR4A 4MSUA 5AJXA 4F4JA 1FSSA 3PYXA 4OP3A 2REQA 3KE8A 1ZK2A 1UKZA 4UOZA 3HJUA 3DGFC 4DOMA 4OGWA 1RJWA 1NJ5A 1IULA 4IUCS 1VMKA 3HVJA 2V6MA 4EHLA 2R8OA 5ERGB 3DKIA 2G80A 4DAEA 1SUIA 1XNGA 4PAOA 4AK9A 4ARVA 1GUFA 2ORYA 2VIIA 3K0FB 4F7WA 3H2YA 1EX6A 1BMFD 2YWEA 3A3OA 3QU4A 2BZSA 3NOOA 4Y67A 3T52A 1P4HA 1FFSA 1M2NA 1NW4A 2OBYA 1CRWG 1HT3A 5JMPA 3U3RA 4I81A 2JRCA 4JA0A 1V1MB 3MD9A 4KQ9A 3ZHUA 3ZZ0A 3E9DA 3D8UA 3GFBA 1SCUB 3SBDA 1VHJA 3NATA 1JKMA 4KAJA 3KC2A 3EDCA 1DDOA 4IXDA 3S3TA 4PYIA 1WNTA 2G1AA 2ZVQX 3GY0A 2I7VA 4UEJA 4C9BA 2OMEA 2PSDA 5DEOA 3ASVA 3B7PA 2N46A 1DAGA 1BJKA 4ITRC 4F6RA 4HQRA 2Q46A 4YGXB 3ZGOA 2WHEA 4TVSA 3ZDQA 1IY8A 1FMTA 1NBEA 2BMVA 2MINB 2Q2OA 3KZCA 3MTBA 4JD5A 4NJEA 2JIQA 5FTMA 1YQUA 4I5EA 1E4YA 1SCAA 1J0AA 1PX0A 3NCHA 3N0RA 5E1BA 4LHVA 4NQZA 5JEDA 1LLDA 1MFZA 3KJXA 3GEIA 2MTBA 1SK8A 5JXIA 2CXPA 1X19A 3H6GA 3NKFA 2NZ8A 2ZBPA 4OL9A 5B3KA 5JAPA 3EISA 4MIEA 3VZCA 2AEJA 3C5WP 2ZZMA 1XU4A 4LXUA 2P0AA 4JB8A 3GGCA 2JGEA 3S68A 1PG0A 3SYRA 1ZBQA 1NJFA 1FFGA 3DVAA 3ZE6A 2BGKA 4C3OB 1MD9A 3H8JA 5D00A 1XROA 1L7DA 3J81A 1C50A 2FK8A 2IV7A 3GT3A 4LYHA 4KGXA 1HE8B 1O6GA 4LISA 1U7HA 1YAHA 3JASA 4WLVA 1RWXA 3RC7A 1AQNA 4P35A 3RV3A 3UYKA 1G8MA 4O4IA 5DHSA 4DL9A 1J22A 4YV2A 3IKJA 1ZUNB 1IHPA 1TMKA 3LGSA 1IIRA 4HPJB 1U4OA 1N8KA 3P4YA 1T8UA 3U7IA 2EJBA 3IRVA 3WA6A 3H9QA 2AJCA 2QYOA 2PG3A 2PMCA 3BTUA 2Q0HA 4OJMX 1EZZA 3T8YA 3FGZA 1G9SA 4C6HA 3EGVA 4U2BA 4QLBA 2PLFA 3MMXA 3OFSA 3L6EA 4CGYA 3V1UA 2PBRA 3HK2A 1O94C 1RXVA 3HKEB 1G98A 4MA4A 3JX9A 5BUZA 5HHTA 1ACJA 4IM7A 5ALFA 1KYTA 3NGLA 1GGHA 1FNCA 1ULTA 1Z07A 4HTFB 2CL6X 2KI5A 2Y1FA 5T67A 1GP2A 1Q7EA 1UK6A 3IPLA 3I3OA 1WKBA 2AUTA 621PA 3SDBA 4ZIRA 1FRNA 1ZMRA 3ADOA 2RHWA 1OD6A 1BX3A 2WAYA 3K0EA 3NHAA 4RQAA 4LVUA 2BIFA 3E53A 4Z2AA 4QREA 4KWHA 4Q9HA 2Q2QA 3X44A 4YP7A 4NNPA 3ZG6A 2V55B 1T5OA 3AKDA 3B20A 2QVGA 5E8RA 3KJNA 1JR4A 1N5DA 4MNTA 3TLZA 1E1CB 3K1AB 4CM8A 2JD1A 4LY0A 4NG5A 1G3UA 3QIVA 2GAOA 3RYCB 4IGAA 5EIAA 5J59A 3FZNA 4WLNA 5LYJA 2RC6A 3HYLA 1XL1A 4B9EA 4D43A 5BRAA 1ZW6A 2BWJA 3AUUA 2D5CA 2PQ6A 3DYIA 3DMHA 3IURA 3IPAA 4L7QA 4ROTA 4COKA 5LNK6 5E6UA 2HPAA 4MUYA 5CIQA 1JKJB 2X0FA 2ZJFA 4NYMR 5F7ZA 4C3VA 3QNUA 3PGLA 3ON5A 4HZUA 1Y3FE 4YT5A 2QRGA 3SEFA 1Q7GA 4PAQA 1B6TA 4UE6A 1KNXA 3GUVA 2CVPA 2VDOB 1XVIA 3TSYA 3HLTA 1QOPB 2EWMA 1PGQA 3KQMA 3KU1A 2BW0A 5CK5A 3LHIA 4CL8A 1U2TA 2KBFA 4J4HA 4N39A 2V6BA 1QJ4A 1Z35A 1SHLA 3GRZA 4TX1A 2CV0A 3FWKA 3BJMA 1RAGA 2LNDA 1D2HA 3BILA 3PJFA 3LOUA 3EEOA 2AXEA 2AOVA 2HI0A 1TFRA 2XUDA 3ILYA 3O6VA 4QUAA 5JD3A 1A7KA 1GCGA 3EJ6A 2Y3IA 4OO3A 3WYEA 1KQNA 4ZCMA 1TGVA 3N2EA 1DKPA 2WMNB 3FCCA 1KSJA 3KPWA 3BWBA 3LC1O 3FDIA 2WTEA 2V8BA 3W7BA 1R12A 1I3KA 3G8CA 5AQEA 1KJQA 2VDVE 4QUHA 5IDWA 3KLNA 1OGIA 4J43A 3OCYA 3GVHA 5DBOA 2Y2VA 1QH8B 2M6SA 4HNAA 2HPVA 3PXAA 3W5VA 4AN1A 4FDMA 1HNZB 4JLVA 1EESA 5IS2A 2HIMA 2XB9A 4GH5A 3IDOA 2DYKA 1LSJA 2CLOB 1RRFA 4LQ4A 3GIWA 4H7FA 4Y1RA 1R0CA 3DG9A 2LKCA 2HEIA 3T7TA 3FB4A 1ZGHA 5F1YA 1IWOA 3BMCA 3BWDD 3KR9A 1OA1A 3W4IA 3PHLA 2BI7A 5E38A 1XMPA 2V7BA 3LCUA 5CFQA 2O59A 2C84A 4RSGA 2X8JA 3NZEA 5IVPA 5EESA 4D46A 1KI6B 1RHRA 2YV2A 2IIPA 5B7NA 2BP7A 1GRNA 5B1IA 1YS1X 4AFNA 4KSCA 3KKKA 5CHEA 2BKLA 2JIZA 4IWXA 1A8IA 3MMPA 4YJFA 3O95A 4K9OA 5BW8A 1Y8RA 1KC1A 2VEDA 1V8ZA 3GZNA 3TXAA 3IEUA 2H4HA 3IP5A 3O0TA 2G1UA 1UBFA 1KZ4A 4HAYA 4HCJA 4MW1A 4R5MA 3KJQA 3G0HA 2QBYA 1NHWA 2VYVA 4AXBA 3SNKA 1ZOPA 3NG1A 1QFYA 3UATA 1T29A 2WVJA 1SQSA 3FTNA 2Q1YA 2O8EA 3Q2OA 1YZKA 2XUOA 1LPBB 1XN1A 2OEPA 4FR2A 2D5IA 3K35A 3M82A 2AK2A 3VR3A 4OHZA 4OFZA 5KEIA 2AI2A 2XKAA 4U7TB 3OT1A 5B4VA 5AJWA 3RIXA 1ZCZA 3MJ4A 4I8DA 2NU7B 1APBA 4JHXA 4AKTA 1LBQA 2PBZA 1P7WA 4OOEA 2G88A 1ORRA 4NJMA 1A4RA 4TGLA 4TUYB 3W2TA 3L92A 2IS1A 1ISSA 4UD6A 2IBMA 3L01A 3FPGA 3H2JA 3HP7A 1KZ7B 4N5DA 3NBXX 1AHNA 1PS9A 2Z95A 4PCAA 1OWMA 2X8WA 1TKCA 1T0IA 1L8XA 1YAJA 5K7SA 3U09A 4ZTZB 2CE2X 1T3ZA 1RLTA 2G5GX 3GAFA 1WZUA 1YB6A 2Q21A 2ZYAA 3AGQA 1N2CE 3GWGA 3WXMA 3NIDB 1Z0IA 3MTAA 3O8LA 2OZLA 4I14A 3ESZA 4M9ZA 5HF9A 1E2HA 1E2EA 3SYLA 2VKQA 2B35A 2W6IA 2UUPA 1XCMA 4FCCA 4GYJA 3HV0A 2ARKA 2J85A 2Q99A 1IOVA 1SOWA 2FEOA 5DI3B 1U9ZA 1V35A 4YJ3A 1B8OA 2ZM5A 4F2HA 1P4GA 3R7AA 2GBGA 1WQ1R 3FGPA 2BJHA 3EC2A 3RUEA 1XPJA 1NLZA 2ZKLA 3NASA 3U3DA 1NT4A 4P1ZA 4M1ZA 1QRDA 2JAUA 1R00A 2RBEA 2O8BA 2W2LA 2IUEA 1O0CA 1CBUA 1BWRA 1N6OA 2J09A 4LGMA 3D0KA 4TOIA 4U3JA 4G4GA 4BMNA 3RDPA 2EZ9A 1RCFA 4LXIA 4WPGA 3A1NA 1J8YF 5CX4A 2E55A 1KKUA 2ZYDA 4GZ3A 4LZLA 2ZJ0A 1D1TA 2ISCA 4N0DA 1NMZA 4F3RA 3GP3A 4WESA 1L6RA 1G6OA 2OTCA 4DLZA 2I6UA 2Q50A 1LV8A 1QGUB 3AR4A 3HV2A 5EUMA 4EO4A 1FTNA 3VTZA 2QPOA 1FZQA 4BUCA 3J7AC 2W90A 4LCBA 4YONB 3PUVA 4KR2A 2B5OA 1Y5NA 2QDKA 2YMLA 1VMDA 2W6JD 2OCDA 2SBTA 2HJ9A 1Z7GA 3TLEA 3I04M 3EEIA 4TMVA 3L8DA 3WWPA 2P40A 3O94A 3ROPA 2ZDGA 1GA6A 1R0ZA 1YA8A 4I1IA 4MVJD 4WCFA 1V7CA 2NTYC 3U40A 3QYFA 1B16A 1FA9A 2NXWA 5D5PA 2QD5A 5BMVA 1I2MA 3Q3EA 2EATA 2X77A 2Q6VA 3K0CA 4ZU3A 3UNXA 5KJFA 3UCEA 3KQLA 5TMBA 1XZKA 2V59A 3CJQA 4P5DA 4U5XA 3JQ9C 3FSGA 5FTJA 5TJ9A 1U9YA 2GZ1A 2YJZA 4WSOA 1F2TB 3LKDA 5T4EA 2JJ1D 1A9PA 3L7BA 1VJ0A 5CDTA 1KVTA 2P9TA 1CLEA 4C0WA 5JI3E 4KR7A 3NPAA 3DE1X 3FYCA 3H1TA 1FDIA 1W19A 4EA7A 2P5UA 4RJLA 4EA9A 1QYXA 2OGSA 1Y98A 1XLVA 1AKNA 1HSOA 1P1IA 1THTA 2VHXA 5ESRA 5J4VA 5L3VA 1ZITA 3IXLA 1W4AA 2CUZA 2XVXA 2YXBA 1AQYA 2ZVPX 4FYWA 1H6AA 2V6JA 3IEVA 4DJTA 1YI0A 1O1YA 3I3SR 2YC4C 5CB4A 2OCKA 1TMGE 3BGWA 5H5JA 1MC5A 5I7FA 1VA4A 3ZBTA 1OF1A 1VYTA 3M4YA 1Z29A 4LBWA 4ZO8A 4C08A 3EVDA 2YWFA 5CITA 1R4AA 4P86A 1R5OA 3OBBA 4B2LA 1G2IA 4FJ0A 3A9CA 3HCOA 1M8PA 4JBHA 3VM6A 4J6FA 5AVYA 1C2YA 1J24A 1EGVB 3D02A 4CIAA 3G9ZA 3U48A 2FSPA 3FNRA 2ADMA 1Z5UA 5KX5B 1LLUA 2A5FA 4G1VA 1J49A 1VSQA 5KHOC 1D6JA 1JI0A 2GVNA 1P0QA 2Q3BA 4OUDA 5KWJA 2P11A 1XAHA 2C8KA 3B1KA 1ZEMA 3P9ZA 4JH0A 3KPYA 2YRXA 4QRHA 2ZS7A 1Z16A 1KSFX 1ECGA 4RQUA 4CUKA 1QRSA 2ZAIA 2RI0A 1G3RA 1Z68A 4U4AA 5IF9A 1AS3A 2G7MC 1IJBA 1IQ0A 1Q77A 5C5CA 4D81A 2NIPA 3JSXA 1ZINA 4BY9E 1E6LA 2D0IA 5CFLA 1ZUWA 3PFNA 3JQFC 4YV7A 2O2YA 5JV5A 3ODGA 1X7ZB 4EJSA 5D3ZA 1PV4A 4URFA 5TT0A 2G4VA 2H1VA 1FJXA 1YB5A 4MRPA 1DMSA 5B1EA 4F3NA 5L4NA 2BGIA 4NCAA 1GKYA 2R1TA 3A3PA 2QTLA 3C3EA 3PC8A 4MCHA 2P62A 3D9QX 1Z4OA 2IPXA 4QGAA 1KH3A 1P2SA 3PR2B 1H93A 4HLQB 4KDFA 4RF4A 5FBWB 3ZI7A 3QLVC 1DCTA 2BRUA 2NT4A 2FKAA 3NHZA 1Z82A 2YZKA 2XYVA 1O5TA 5ESWA 1KJNA 2YVLA 2FLKA 3I01M 4GGPA 5FQNA 5AXAA 5U4XA 4R8RA 4X64B 1B6GA 1X3SA 4QARA 1XTQA 2CDAA 4FONA 1VCOA 2YYYA 4IMPA 3ROTA 2IITA 2O20A 4KCGA 5JJBA 2CXSA 3QVSA 2PXXA 4G5FA 5IF3A 1AKYA 3WKEA 3K53A 2JLCA 4V0SA 3SSAA 1CQIB 1P0CA 1N5MA 2GFQA 3HQ4O 1C41A 1T0UA 4Y2RA 4EFKA 3HP1A 2P90A 4RKYA 1R0KA 3PDWA 3ORYA 5GOZA 4B4VA 1G7TA 3RNLA 2HW8A 5HP4A 2B3TA 1Z22A 1O95C 4QG7A 4B3IA 3H5IA 5EG5A 4W7SA 4S1TA 4U5QA 4PGMA 5MFZA 4AJIA 2FV8A 3CVOA 1WY5A 2PRSA 3DZHA 3JVUA 3C4VA 5BWMA 4JK3A 1BXGA 2EW1A 5DBEX 4B3HA 1JIIA 2GXAA 5GGYA 3PEFA 2ZXUA 4I46A 4AS3A 4KO1S 3QFCA 2WD9A 4NS1A 1Z74A 1M1ZA 3K72B 5JVDB 3ZWOA 5JISA 1KFBB 3UMFA 2GN1A 1M0SA 1TJ5A 5HTOA 5EZSA 5HQJA 1KO1A 4WVLA 3E70C 3EMVA 3LP5A 1I24A 3QIAA 4D56A 3R3VA 4WZAB 5LBUA 3K0HA 1RQNA 1U2ZA 1BJTA 2Y1KA 3NM6B 1NULA 2FFBA 3TLAA 2BGGA 1T10A 4EYEA 2G09A 4FZVA 1XE3A 5I7VA 4XPZA 3DPIA 3MXTA 1TQ6A 4I7EA 4R69A 4LZZA 1RLOA 3RI3A 2FFHA 3CCBA 4X7RA 4RHEA 1JQLB 3SQLA 3NC4A 1W30A 4PBSA 3B6JA 1YH3A 4WDQA 4LBZA 1RXEA 2YOGA 4UCWA 3C7KA 2WWFA 1M34B 2O3UA 4E3WA 5EJ6A 5JCPA 1QJCA 3DDWA 2B6HA 4MRVA 5DCWA 2WFLB 3H11A 3ZNNA 1Z9BA 1XZHA 4MB6A 4KLNA 2WJJA 1U7WA 2HQBA 1DWOA 3R77A 4LYGA 5DN6D 5F51A 4AQ7A 3AUTA 2R8ZA 3BE5A 2ZTHA 1SHZA 3LWDA 1U0RA 1MMFB 1Z4QA 2KWIA 3WWEA 5IKPA 2XIJA 5LJIA 5M34A 2VXYA 3K9WA 1SXGA 4ZARA 1XPUA 2X3YA 2VRNA 3BREA 3ZS9A 1TQHA 1HETA 1F6WA 3V1MA 1RQGA 3K9GA 3ZIDA 3OE5A 2I4TA 2P4SA 2XB8A 4PSVA 2ZYWX 3WIUA 4TZTA 4KL8S 2V7VA 5K3SA 1XTBA 1BDIA 3OIFA 2JCXA 3AY7A 2AX4A 5EJ8A 4Y18A 1SRRA 1VE9A 4G9BA 1B0PA 1PCXA 1PN3A 3IHWA 1K9SA 3R0QA 5FPPA 4UBKA 3I04A 2VZ9A 2FPSA 4Y9UA 2Z4RA 3SPXA 5IH7A 4CIVA 1IWBB 1EWTA 2CE7A 3A1EA 4KAAA 1LFDB 1DWQA 4CMJA 5LQRA 1IBLB 2XGJA 4ZV7A 1CHDA 1GWNA 2FEKA 3UOAB 4BMDA 1SKYB 2QE7A 3I2IA 1EE2A 1XZDA 3W8DA 2VPPA 2FGKA 3ZWBA 4KQHA 5DTQA 1QQBA 3FCYA 3GDHA 2WA2A 1JDJA 4R7ZA 3FUTA 3ZJ5A 3B1ZA 4DCTA 3CUEF 2EKDA 2Z1DA 3BZUA 1QNFA 3DT9A 5FTKA 3GGOA 4BATA 2D5BA 4F5DA 1SU7A 4KSBA 5HFNA 3TRJA 4G3XA 2H06A 4N01A 1XRPA 3HR4A 4H7HA 4MCIA 4P33A 1FX0B 2X1LA 2C7VA 5JTUA 4ZKEA 4FMDB 4P7BA 4L4ZA 4ARUA 2WTNA 4M2LA 5G1NA 2XUQA 3EWAA 5E95A 1SCIA 5HIAA 3U9SA 1LSOA 1ZRMA 4JV5B 3KJIA 1TQ8A 1USUA 1E18A 2XGSA 3BL8A 3NHWA 4WZ6A 2PKRA 4XR9A 1ZU5A 2J3QA 1KJZA 4EDFA 5AW1A 1LSSA 1WW2A 4ZC1A 4WECA 3F1KA 4DPLA 5EMLA 3LE8A 2F48A 3RRFA 4DARA 1QLJA 1UP6A 3RT1A 1R88A 4F93B 3GT4A 2RK4A 3A58B 3R3JA 4J16A 2XXAA 1IRIA 4MW0A 3T3IA 3ZWMA 3MZ0A 2EP8A 3G6KA 3GPDG 1X1EA 4CG3A 3U3OA 1ODCA 3NANA 1RDFA 1MN6A 1MT0A 3NDJA 3LO5A 4ID9A 2RH4A 3U7FB 4HLUC 4CKCA 3VUFA 3LS2A 3WJ7A 4Q4LA 1ESCA 1UK9A 2VF7A 1MEOA 1OC4A 2PXCA 2E49A 1CEEA 3FSRA 3O0DA 4CQMA 2MDTA 4FNAA 1N3YA 4NMMA 1U7XA 3QUBA 3NALA 3GAZA 2FPRA 4XA8A 5LYJF 1JH8A 1ZUHA 3ORHA 3LAWA 2X6QA 3BMOB 1T9AA 4NH0A 4TTJA 2O2XA 1MHPA 2EF0A 5I8ZA 3AJ8A 3PUYA 4ZJZA 1SCNE 2NWQA 2X2EA 5AP9A 2FTKE 1CF2O 3WYCA 3WAGA 3FG9A 2Q27A 5CNMA 4BJ1A 1FEZA 4K2HA 2KE5A 2OHVA 3PNKA 3O4HA 5DXJA 3TCNA 4KN8A 3AL2A 3F78A 3VSBA 2I22A 4UVEA 3T7JA 4JROA 1YWGO 4CN8A 1C0KA 1ZKMA 2CNNA 2DF8A 2QU7A 3I01A 4K9SA 4RZ3A 5CVJA 4AULA 4ENTA 1QPZA 4CEHB 2O23A 2PYDA 3EDMA 2CYAA 3B9BA 3DJYA 3I6MA 5E7IA 1NG9A 1VIMA 3OEHD 3H8VA 3P0JA 4GP9A 5CPFA 4UFNA 1RXCA 5LU9A 2R7KA 5DCYA 4WINA 3EUAA 5B12A 3V2HA 1HNXB 1XLTC 1YT5A 2AF4C 2AOTB 4YGYA 4RD0A 3LT5A 3L79A 4AL4A 3CNNA 1QP7A 4MPRA 3WZMA 1T26A 4O8CA 1GN9A 4UATA 2GUWA 1U0JA 5B7PA 2MWMA 3TRIA 4EHDA 3GLHA 1CJVC 421PA 2WJ6A 5K45A 1TUGA 3JQAD 3FCXA 1DJPA 4YDHB 1ECJA 2FR1A 3U13A 3CVVA 2BSAA 3NB0A 1YI8A 3AESB 4BNVA 4NXNB 3V42A 4Z9AA 2JZNA 1W581 2YASA 1QK5A 1YS6A 3WB2A 1R4NB 3JYHA 4PYQA 5IAGA 4BWFB 4TTVA 2ILVA 3V9PA 4EG8A 1PVDA 4DJFC 2XLBA 4XWAA 1A5BB 2JFGA 2UYHA 4FGWA 3GLGB 1ZIPA 4KEAA 5B1DA 3H18A 3ROMA 3PEWA 4L5CA 4YI5A 2FX2A 4IIDA 4K2AA 2IZOA 4X9XA 2EFGA 1CJMA 3RIGA 3TOCA 5K8UA 3HTXA 1UKCA 2IQ5A 5CA0F 4RENA 1S3SA 4IDGA 5ECWA 2PGJA 5HZMA 5FYDA 2H9AA 2IBSA 1JALA 4PQRA 2SHKA 1PT9A 4GPD1 1OU4A 2FJ0A 3CC8A 1N9GA 3JPWA 4J90A 3V7WA 4BLSA 1W94A 5LZ5A 3HB0A 1AO0A 2FR0A 2WAAA 3QEKA 5AW5A 1TEVA 3O31A 4RIHA 4RJIA 3UGQA 1DKLA 1ZGCA 3PS9A 3ZDXB 1H5UA 2G82A 3KXDA 4IG9A 4UEWA 4BFXA 1RRVA 4JEHA 3RK0A 3EBLA 1DBRA 3E9CA 3W8FA 2VJQA 2FP4A 3B9RA 1YHNA 5ALZA 1LK7A 3CRVA 3AZQA 3RG2A 1C7IA 4QXRA 3TTTA 4GQAA 4JWKA 1JG3A 1Z33A 2A14A 4RV9A 4B35A 3SSOA</