3I8SA

Structure of the cytosolic domain of e. coli feob, nucleotide-free form
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
264
structure length
260
Chain Sequence
b'MKKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQFSTTDHQVTLVDLPGTYSLTTTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQPLLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDPALHIADARYQCIAAICDVVSNTLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the intrinsic GTPase and GDI activities of FeoB, a prokaryotic transmembrane GTP/GDP-binding protein
rcsb
molecule keywords Ferrous iron transport protein B
source organism Escherichia coli
molecule tags Transport protein
total genus 85
structure length 260
sequence length 264
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
A PF17910 FeoB_Cyto FeoB cytosolic helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i8sA01
4TTQA 1VMAA 3DKVA 4D6PA 1KI6A 4W5JA 3RRMA 4F92B 4I99A 2FF7A 3L8YA 1NVXQ 2ZS8A 4MYTA 3TUJC 3WBKA 4B33A 1NSFA 3K9LA 4DSUA 1SXJA 2C9CA 2Q9CA 1QRAA 1LTQA 2WWXA 2BV3A 2BHRA 2GJSA 1U94A 4KYIB 1IXRC 1S0UA 3RRNA 2FMXA 4PPNA 1W5TA 1E0SA 5J40A 3U3RA 3REFA 3X1YA 4BFYA 4ZDIA 1CULC 5JMTA 5DN6A 1SVKA 1XBTA 2XSZA 3K1JA 4B48A 4BLRA 4DLZA 1UDWA 3THWB 5DH9A 3ZD6A 3TR5A 2I1VB 4JLDA 1FMJA 2BMFA 4M8NE 4Q7MB 4RKFA 2ZREA 2YVUA 2VYFA 2L0XA 4LJ5A 4MA4A 4UNRA 3AKDA 3U7EB 2HYIC 4C0KA 1MO4A 1DAMA 1E96A 1XRJA 2XITA 5EUQB 3VR5A 3SDZA 4B34A 1FL9A 1N0WA 2PZFA 1QG2A 3AF1A 2DHRA 2F1IA 3QBTA 2ZRJA 3PR1A 4UJ3A 3QBVA 3T1QA 2R62A 2G1KA 1AK2A 3GLIE 2OM2A 1NLZA 4MKGA 2F9LA 4ON9A 1AN0A 2YWHA 4TQUS 1E79D 1J2JA 1C1YA 1OXSC 1E9AA 3ND9A 2C96A 3I8SA 5AUNB 1CP2A 2WKPA 3EC2A 1NKSA 4QRHA 3CF6R 4DCSA 4BLSA 2DCUA 2ZU6A 1ANKA 2AK2A 4IVRA 2NO6A 4HB3A 5J4YA 1E2NA 1R7RA 2HF8A 3SBDA 1A7JA 5JEEA 4GNKA 5HZKA 2AXNA 2O8CB 4DLYA 2D2EA 2IS1A 2VH5R 1CKEA 4HB0A 2O0JA 5CM8B 4P31A 3SEAA 4NH0A 4HLQB 2IS2A 2PX3A 1VHTA 1D9ZA 3I3SR 2IYRA 3KB2A 3TQCA 2EFHB 1IM2A 3FMIA 5B58C 2BWJA 1XEXA 2BOVA 3H0KA 2CLDX 4JYCA 3QKUA 3GJ6A 4Q01A 4AKGA 3IO3A 4F7WA 1Z63A 2VQSA 3CNLA 3M1IA 4HAWA 4DVGA 1WCV1 1KDRA 4CGZA 2GKSA 3EASA 2O8DB 2OE2A 4Q5IA 1Z0KA 4Q7JB 3NBYC 1OH5A 4H9GA 3AP1A 3C14C 2PZEA 2JJ1A 1NSTA 4TSFA 1Z8FA 4OKSA 3W5JA 4BEBA 3AGPA 2IYSA 2ZI6A 3A4NA 4E5UA 2CXXA 3L8ZA 4RD2A 5J47A 2ZJAA 1OW3B 3ADDA 4KU4A 5IDVA 3U7GA 2GNOA 2QEQA 2IYZA 3VQTA 1HT1E 3CZPA 3C15C 4URZR 3OF5A 1LF0A 2O0KA 1GNQA 1NN0A 4A4DA 4G5GA 3CW2A 1KI9A 4DXAA 1IJEA 2PL3A 3LH5A 1L4UA 1QHNA 1XMSA 1ZIOA 4XSHA 2ZE5A 4IOKA 4Z8YA 1ETUA 3NXSA 5E95A 1KO4A 4GI7A 2YZ2A 1RYFA 4PFSA 4MGZR 5CYPA 4Q03A 3G0HA 4XSGA 2X8AA 4TLAA 2ZVPX 5AUOB 3QI2A 1L7VC 1CRPA 1W4CA 1Q0UA 2IYXA 3IO5A 1I4DD 1MRNA 4MUAA 3THXA 2QAGB 5K8IA 2WJGA 1MKYA 5CYOA 2OHFA 4LHZA 3SHFA 2AL7A 2QM7A 1ZNYA 3L0SA 3S1AA 3RABA 3TBKA 2ZVQX 2PJZA 2QT1A 2C03A 5EXTA 4F4IA 1W36D 2RGNC 2J46A 3BE4A 3IPYA 4Q1DA 4LHWA 1ZD1A 1D2NA 2RMKA 1NBMA 2DWOA 4AG5A 2QROA 3OEHA 4G5RA 1YRBA 3AH8A 1WP9A 4KFTA 4FI3C 3FHCB 4LV8B 2RGGA 2OBLA 3DMNA 1MABB 5L3QA 2ZYWX 1DAHA 3MSXA 3EZ9A 3FMPB 4JSTA 1OJLA 1RYHA 2PEZA 2W00A 2ZI7A 3QUSA 4FXPA 3ZH9B 3CH4B 3CR8A 2Q9AA 2KI5A 1IN6A 4F38A 1Q21A 3VR6A 4FD2A 2EU8A 2ZRCA 1DO0A 1KI4A 4R9UC 1K5DA 4G5SA 1G7CA 4YXWD 3KTAA 2X1VA 2ZRHA 4RKEA 5FH9A 2RGEA 5CK4A 3GCGA 4NCIA 1T3LA 5DE3A 2QRNA 4F93B 2V4ZA 4LDJA 1QHGA 1KSJA 3O8CA 1GL6A 3FB4A 4LJ4A 2CL0X 5BYKA 1UFQA 3CB4A 2ORIA 4BASA 3RANA 1VG0B 2IA5A 3GD7A 2GF0A 5SZKB 1XNJA 2FU5C 5KO2A 4XOIA 1U0LA 4G1UC 421PA 1KK3A 1XCPA 2NZJA 1P2VA 1TPZA 1M1YE 4IDQA 1UBGA 2C9OA 1JR6A 5AJZA 2IC5A 4YC7A 3BBPA 2VF8A 1XMVA 2WPDD 4WZ6A 4G5OA 2QPOA 4LJ6A 4EFNA 4A2WA 2VP0A 1PV4A 1YR9A 1SVOA 2FEMA 2E1RA 4YMTA 4FMCF 1IAQA 3VR1A 5J4HA 1G9XA 4PZYA 1DAKA 1G6HA 2A5GA 3LD9A 2G3YA 3X1WA 5B57C 2IXFA 4P4TA 4B47A 3TQFA 4RCYA 4HAUA 3BWDD 3QIAA 1J8YF 2P5TB 2IYTA 4DSNA 3U7HB 3ZIAA 1X86B 2SHKA 4KJZA 2OEPA 3NHBA 4TYPA 1VG9B 4TMWA 3UMFA 1VG8A 2ZJ8A 4AKHA 1Z0JA 4NYMQ 2XXAA 1D2EA 3QPWA 1KYIA 3LBIA 4MGYR 2QGNA 4WZAE 4AK9A 5CIWA 4DCVA 1DPFA 2V55B 3QQ5A 3KZ1E 4B75A 1XEXB 3A8TA 4IFBA 2X19A 1TQ2A 2ZJBA 3QKTA 1DG1G 3GFOA 5JI3E 2IYQA 2V54A 4UNNA 3UIEA 2QQEA 3TKLA 3I72A 4XVRA 4RZUA 5FTNA 2QG6A 4JJZA 4LCBA 2H57A 3THYA 4C2TA 1KNQA 4G3XA 4A6PA 1IXSB 4Q7KA 1G4UR 2ZRNA 4C0BA 1E2DA 2XNSA 4S35A 4H1VA 4ASUA 1G8PA 3MWJA 5DISB 2GRJA 5KNDA 1M74A 1C9KA 1D8TA 3T34A 4CEIB 2REXB 4TMZA 4OJKA 3RWMB 4JVLA 3CRMA 3D6TB 4Q18A 4RZ3A 4DLSA 1KDOA 1CJKC 1RPZA 2N42A 1Z07A 4K46A 4CW7A 3VAAA 1YHNA 4MQBA 5CB8A 2CHVA 3GFPA 4I1UA 3WP1B 3I4LA 2R9VA 3KJIA 1AQYA 3KKNA 3ZVRA 1DAFA 1VIAA 2GBLA 2YC2C 4UKDA 4PPFA 5J4KA 4FWTA 1DVRA 2JJ8A 1WBDA 1KTVA 1NKTA 3FMFA 1W7AA 2VF7A 2GDJA 4I1SA 4NP6A 5L3VA 3QXXA 2X77A 1UM8A 2ODWA 3ADCA 2B6HA 4P4SB 1S4QA 3VKHA 1FP7A 1Z83A 2VIIA 3EZ6A 5FPKA 3LQQA 3AP3A 5AJWA 4QOSA 2ZI5A 5IRCD 2EFCB 1NL3A 1KK0A 3S1AB 3K0CC 2ODBA 2ZROA 4KCGA 3DDCA 1Z6YA 3CR7A 2YOHA 3PUYA 4N3NA 2QAJA 1OXUA 1F2UB 4KI0A 4MITA 4LX0A 5GADl 3BFXA 1W47A 5DNYB 3DPUA 4U7DA 3NIBA 1NG1A 3LLMA 1U99A 3MLEA 4Y0VA 3SFVA 1JAIA 4IFEA 2HXSA 4C7OB 4AYTA 5FR1A 1TF5A 5DHFA 3GEIA 1BS1A 3H1TA 3N2EA 5KU1A 3LXXA 3SS8A 3NHAA 4L9SA 2Q3MA 3EX7C 3RRZA 3B7GA 4IRUB 3HR7A 5AWFC 1E94E 4HLUA 4BFWA 1OB5A 1AKYA 1G5PA 4TLBA 5K8TA 2ZR7A 4IDNA 3D3QA 1EESA 3IILA 1T9HA 121PA 4QBHA 4KVGA 3TR0A 3JVVA 4XVUA 1R5NA 4POAA 2RCNA 1Z6XA 4Q9KA 2A2ZA 1LY1A 2YWEA 4OK6A 5EP4A 4XD7D 1X3SA 4Q9LA 5B64A 5GVSA 4P4UA 2BKUA 2HLDA 2Z4SA 1TQDA 5JWRA 1NF3A 5FUWA 1QF9A 4C0LA 3N70A 1T6NA 4EDHA 2GAOA 5FL7A 3ETLA 2ECKA 4EKDA 1XMIA 3EIQA 1M7HA 2IUTA 2O52A 4MGKR 1Q20A 1DELA 1GRQA 3C5CA 3IKJA 2ZUBA 3GPLA 2ZRPA 2UVQA 1G7SA 3K0FB 3MCAA 3CRQA 5TXGA 4X8OA 1RFLA 1I2MA 2IEYA 3B8HA 3CRVA 1XWIA 4AWXA 1EXMA 2IS4A 1N6PA 1JALA 2J3EA 4UNSA 5E4FA 3U3KA 2PJRA 4PHTA 4PZZA 2ZUCA 2PCJA 1E0JA 4Q19A 2XNDA 3TAHA 1AS2A 1VCMA 1KZGB 4B3DA 2PZGA 1CJVC 1AJEA 4TMTA 5KPJA 3NC1C 4LHYA 2CNWA 3A36A 3OEEA 1BOFA 4YDSA 2XXAB 1X8KA 5LPNA 5AJYA 3MGCA 4I1VA 4RD1A 2ZS9A 5L3RA 2V1XA 4B3GA 2W6IA 1G16A 2B7BA 3D7MA 3LDAA 2JASA 1IJFA 1BMFD 1GG2A 1YZQA 3QXHA 4OQLA 4PANA 4LSGA 4GMXA 1CJMA 1XU4A 5FL7D 2VRWA 4RD0A 5H1YA 1CBUA 3QF4A 2HJVA 4TMXA 4L5BA 5LBIA 1T8TA 3MUFA 1CF4A 3ZVLA 1GTVA 3THYB 4Q9HA 2FOLA 3VX3A 3IDQA 3AF3A 1JR3E 2CEAA 4DCNA 5JHHB 3BFVA 2A7QA 1Z5ZA 4BFVA 2CDNA 2VBCA 2WV9A 1Z6TA 2ZSBA 5DI9A 3UK6A 2NPIA 3LO5A 2FEOA 2IHBA 4Z1MD 1G19A 3CNOA 4FWIB 4DLTA 1QDEA 3Q5DA 1GNPA 3C7KA 5FPSA 3I8XA 1UDXA 1GFIA 3E1SA 4KSCA 2XZLA 2Q6TA 4AKEA 3THWA 1R0YA 2K5UA 3A1UA 3LBHA 2ZI4A 3SC3A 2YV5A 2HEIA 1JJ7A 2V8OA 3SOPA 5L3SB 4DLVA 4C0QC 3NDBB 3CX6A 2GVZC 2R6FA 3HWSA 4XTRA 2IK8A 4TL9A 2FN4A 2A5JA 3I73A 1OB2A 4Q1BA 4RFVA 3FE2A 2ZANA 1TU4A 3UATA 2ZM5A 4C2UA 1PJRA 2GAAA 3JZAA 3O47A 4MDFA 2YHSA 1F2TB 1EWRA 2QT0A 3GFTA 2ZI3A 2J41A 4D82A 1DAGA 5TVKA 4NMMA 1G17A 3K9GA 2HDNB 3SR0A 3WHKA 2WKQA 3AQ4A 1OXTA 2FZ4A 3PCRB 1FNMA 1T8UA 3J81k 2ZR9A 5KPDA 2WM9B 4MRPA 2GJAA 3X1ZA 2ZITA 2QTVB 4U02A 2AFHE 1H8EA 2PBRA 2GJKA 4K8OA 2BMDA 1KZ7B 2P2LA 1I4TD 2FPMA 3LFUA 4D4LA 2AR7A 2DY1A 5TDHA 1SULA 3CF2A 3U6KA 3AKYA 1VDZA 1T3HA 1DEKA 1QG4A 3FVQA 2MSDB 3QF7A 4O0MA 4EJSC 2AX4A 3GLHE 1TU3A 1VG1A 3REGA 3AF2A 3VU9B 3NBXX 2ZRBA 3W8NA 4LI0A 1TEXA 2J45A 1KSHA 1ESMA 6Q21A 3AUYA 1TL7C 2WZQA 2ZAMA 2QQ0A 2Z0MA 2QPAA 4JLVA 1NVUQ 2Q21A 4BLOA 4AI6A 4JKIA 4BZXA 2Z4RA 2WHXA 1DADA 3FHTA 3VNUA 2O8DA 1S9HA 4JVMA 1AQUA 4KLNA 3FOZA 5C4GB 4QBFA 3R9XA 1KJZA 1P60A 1NJGA 1OT3A 3C41J 5EXPA 1RRFA 2QI9C 3QXCA 2BBTA 3QJYA 4NCJA 1M7BA 5FL3A 2OCAA 3DVLA 1JR3D 1VHLA 4Y0AA 2R6DA 4EPYA 2Q0HA 1ZNZA 2VHQA 2VSXA 1JPNA 4DWJA 4GFDA 1TUEA 2EWWA 1W48A 4HEJA 4QNRA 1E0AA 2BC9A 1KKLA 4A92A 2ZJOA 1I4LD 3ADBA 1NY6A 5F9HA 4IOMA 3B1VA 2F43A 2TMKA 4B3BA 4TMVA 5SZJA 3GLFA 1L4YA 4HB4A 3OIYA 2BMEA 1GNRA 1E2QA 2B8TA 1E2MA 3KDSE 3K0EA 1GITA 4QXAA 3X2SA 2ZE7A 2PMKA 1CR0A 1UEIA 2ZJ2A 3OIUA 2VEDA 1SXJE 3QKSA 1WMSA 1BKDR 2OT3B 4BFTA 1JB1A 3EA5A 3K09A 1E1QA 4QKQA 2C8VA 2JIZA 3SU8A 2ZIAA 5GJCA 1SVSA 2OUKA 2D7CA 1E1RA 5HZHA 2NIPA 1KI8A 5HTKA 4OYHA 2JJ2D 3K9HA 3B1YA 2FPKA 3PXGA 4NHOA 2QAGA 1UPTA 3GEHA 4GRAA 3PEYA 1JXOA 3TK1A 1P75A 1TNDA 1ZNWA 1X1SA 4MUBA 4DB2A 1Q1EA 5CM9C 5FOVA 4V0KA 3UKDA 4RCZA 3AB3A 2HUPA 3EPJA 2CVFA 5TY0A 1YZGA 3ASZA 3RSLA 5KTYA 1W0KD 2QMOA 3KJGA 3T61A 2DPXA 3UPUA 4V0MA 3CKLA 1MABA 1T5LA 5EXXA 4B3FX 2N46A 3IHLA 1Z2CA 1A4RA 4KO8A 1FTNA 5JLJA 4KBGA 2WWFA 3I62A 1V43A 3B85A 4TZ6A 3DL0A 3C16C 4B2PA 3NEYA 5JCZA 2ZYVX 4IOJA 1XTRA 5IK2D 3PJRA 3KXKA 4JZKA 4NCHA 3MAAC 5FBVB 1SQ5A 3QE0A 2AWNA 2RKOA 4I1OA 2BJVA 2ORVA 4YQFA 3TMKA 4R2HA 2OESA 2WIAA 2CK3D 1R10A 2VHTA 1P3JA 1SVWA 4ZCLA 2FH5B 2UZ3A 1MO3A 2VSFA 1JI0A 4D4MA 5J4VA 4IXNA 1JPJA 4P3YA 3T1VA 4HUTA 4BUJA 4PO8A 1BIFA 1UKZA 3C8UA 2ZYUX 1SKYE 2AD5A 3L0IB 5HE8A 1PVOA 5JJKA 1OHHA 1ZCBA 3Q5EA 1FUUA 3QPVA 4JKYA 2D06A 3M0EA 4M53A 4JLBA 2G0NA 4NDZA 2VHUA 2CE7A 4OJQA 3HU2A 4TTPA 4ZI2A 3CF0A 1E9FA 5AUPB 3K70C 1MH1A 1XTSA 1OV4A 3BH7A 1W1WA 2IYUA 2ZRFA 4QGFA 3OE7D 4TWZA 5SZHB 3GJ5A 5DYGA 2V7QD 1JNYA 1MOZA 1FMLA 3U44B 1TADA 5D3QA 1W4AA 3MG9A 3PUZA 4DEXA 3GLGA 5P21A 1NMYA 3EC1A 4PC3A 4UXHA 3RC8A 4HDQB 1AA9A 4BRUA 3E5HA 3EWAA 2OLJA 1SXJD 3AVXA 2GXAA 2X2EA 4PSKA 1FX0B 4IJMA 4DZZA 4D4KA 1RC8A 4PC2A 4ZKEA 4TZ0A 1A82A 1VYUA 2QMEA 2QMHA 4LHVA 1G7RA 4Q48A 1GP2A 3TJZA 3NG1A 4M2LA 1EFCA 4DT1B 2W6JA 1N6KA 5FTKA 3IBGA 1XTIA 3AEZA 3B60A 3D8BA 1E0KA 2E87A 4NYJQ 3SJAA 5DN6D 2XSZD 2DYKA 4US1R 4URWR 5TMPA 2UKDA 4LPSA 2JATA 1PLKA 4D26A 2IYLD 2J7PA 4TLCA 621PA 1KMHB 4A0RA 3FFAA 4LUCA 1GOTA 1N3BA 2QRZA 1NRJB 4OK3A 5LB4A 1XPRA 4M9XA 4ZKDA 2QP3A 3B1XA 2GWHA 1KK1A 3RVBA 2NO1A 4LWZA 1JXMA 2IW3A 4KFRA 2R8RA 1JQJC 1VTKA 3H2YA 1XEWY 1QHSA 4W5HA 4GBMA 1JEEA 4RY2A 5FPHA 5AJVB 2RH5A 4FCWA 1NVVR 1J70A 5EUMA 5HE9A 2H18A 3OIVA 2OG2A 3A1SA 2IUSA 1ZC4A 2XTMA 2LKCA 4GOJA 2QSYA 4Q47A 5M04A 4Z51A 4JL8A 1ZJ6A 1US8B 3SNHA 2GCPA 4CEIA 2VP2A 1GAJA 1M34E 2D62A 2J59A 3U60B 2JDIA 1NBME 2JLRA 1YU9A 3CIOA 3LA6A 4L9WA 2OCBA 1XCGB 3TE6A 1G18A 1LW7A 3AUXA 2F43B 3GLFB 4Q21A 5F3WB 4F4CA 2XX3A 3I5XA 4OI2A 4QJ3A 4M9QA 4KITB 1DARA 2ODEA 3QKSB 1IY1A 3W6OA 5CLLA 1XJCA 2WWIA 4RFSB 5C46F 5EJEA 1Z47A 1VCNA 4LJ8A 2R65A 2OO7A 4MDEA 3LW7A 1ZCAA 2IXEA 2PLFA 4A9AA 4WXRA 4NU0A 1KOFA 3DOFA 2Z83A 4P4SA 1OF1A 3BB3A 1EFRA 1HYQA 2OXCA 3IIMA 1C4OA 3PEVA 1Q1QA 2IL1A 1FFHA 2HJGA 4P0TA 3W34A 2ZSDA 2V3CC 1AKEA 5FBWB 2JJ1D 1A2KC 1F5NA 2QTFA 4O2LA 3ICQB 4TSFD 4CZ2A 2QM8A 1F2UA 1RZ3A 2OILA 5BN5A 2CVHA 3IGFA 1P5ZB 2RGBA 3RSOA 4OHYA 3AVOA 2IYYA 2W2TA 4EIWA 4NPHA 2C98A 3GQBA 2D2FA 3DO6A 2GESA 3A1VA 1YRAA 4C7OA 1OIVA 4G01B 3JVUA 4YONB 2FV8A 5EP3A 2CJWB 1G8HA 4EJSB 2BCGY 1W0JA 3L82B 3CWZA 2Q9BA 3AVTA 1QHHA 3WHLA 2PH1A 5F2EA 2HV8A 5BWMA 2NQ2C 2F7SA 1LFDB 1IHUA 2WAXA 4A82A 1OSNA 2PLRA 4X8HA 3Q85A 3BFKA 1NI3A 1G3UA 2GEVA 4JLNA 1RRGA 2WAYA 3FHOA 4UXIA 2IF0A 4PC6A 2G9NA 1MR3F 2H92A 4QFMA 5FOSA 4EFLA 2A78A 2XOKA 3BOSA 4GSYA 1Z2AA 4KFUA 3WY9A 1XPOA 2OAQ1 2QU8A 1X8JA 4WIAA 1KAGA 1U0HC 1R5BA 1T91A 2QE7A 3PV0A 1YE8A 1ZMXA 4PC7A 3SYLA 1P61B 1Z22A 2O0HA 4PHGA 1EWQA 2NPFA 4QJ5A 1FQKA 1X8LA 3OAAA 4S2EA 4QBGB 3KKPA 4B35A 2OFWA 4NE2A 4HZUA 5DGXA 4FCVA 5FOWA 5HKKA 2BMJA 3BJIC 1CRQA 1NBMD 3AVWA 2OXRA 1G6OA 5FBLB 3I1FA 3OEHD 1LNZA 2V6IA 4UXJA 3MMPA 3ND8A 3EWSA 2BM1A 3NKVA 1AS0A 4B74A 1HH4A 3K53A 3K0FA 1DS6A 2MSCB 3ONWA 4LV6A 3BGWA 3OFNA 2JLZA 3GLGB 3UWOA 1BH2A 1W0JD 3UMRA 3GEEA 4ZIRB 3E70C 4GMDA 4JLMA 1G3IA 4ZPXA 2ATVA 3QVVA 3PVSA 5DO9A 1G5TA 4Q4AA 3RYTC 4DC9A 4ERNA 3I32A 3ZZUA 4PPQA 3H84A 4LV5B 4NYIR 1S1CA 5ANRB 3GJ3A 1QBKC 1SVMA 2H1LA 5K8UA 3ZZTA 4EQ6B 1GKYA 4C3ZA 2OV2A 1TMKA 1ZBDA 4DCUA 5GJVC 4QL3A 2AFIE 4OQFA 1JBKA 3LLUA 2AWOA 3JZMA 3R7WA 2I1QA 1R0XA 3QVUA 2WWWA 1KKMA 2EYQA 1ZU4A 3TIFA 2RGNA 1P72A 4FCTA 2C77A 3CBQA 3NC0C 2QBYB 1HY3A 4IDOA 2IHYA 4RZXA 5BXQC 1CU1A 2GILA 5LDDC 2GJ8A 4JLPA 4LJYA 3VMFA 1N6NA 1UEJA 4RD3A 4CDGA 5IF9A 2GXSA 3VFDA 4OHVA 3QPUA 2DFTA 4M22A 1D2MA 1G8YA 3TLXA 3EPKA 1VECA 2C95A 2OLKA 3EPHA 2P0EA 1ZYUA 3H4MA 1UKVY 1QHIA 3OFND 3SJZA 2BKEA 4QGGA 4D0LB 3DOEA 2EW1A 1OKKA 3AVPA 1I2DA 3ASYA 1E2LA 2CCJA 2ATXA 4YDHB 3TVDA 4XIGS 2HYDA 4Q4JA 3GLIB 1OH6A 3AGQA 1DAIA 1J8MF 2BBSA 3ZIAD 1GVNB 5CDFE 3U4QA 1M6NA 3ZS8A 3EW9A 1XTJA 4QC2A 3ZZ0A 4WAUA 5L3SA 4N0DA 4FMCB 4YMSA 4RZ2A 1SHKA 2AKYA 4IOLA 4BFSA 2XGJA 2UZIR 1II0A 2EWVA 4BRWA 5JCPA 2W2VA 4IHQA 3CPJB 1XZPA 2IBMA 2FJUA 3WNCA 5JWOA 1BYIA 3BH0A 1F2TA 3SBEA 3FDIA 1OYYA 1VKJA 3M6AA 1VCOA 1HURA 4MYCA 3W8RA 1RKBA 3QNUA 4WA7A 2JLUA 3K70B 5AJXA 2W2XA 4K81B 2JLYA 4ESHA 2H17A 2GEUA 2HF9A 4IVPA 2XB2A 2XAUA 4BLTA 2QY9A 2WVJA 4C9BA 1T0JB 2B92A 3PUVA 4R71A 1T4GA 4C0SA 3LQRA 4ITRC 1KSGA 4HZIA 4LYHA 5KDOA 1CR2A 1RVDA 2BCJQ 1JJVA 2ZU0C 1E2KA 1VYVA 4JL5A 2C99A 4LBWA 4V03A 4AC9A 4B2LA 3WP0A 1N6LA 4CEJA 4D80A 3T1TA 4ASUD 3RDPA 2CHGA 3TW4A 1GZSA 3I5YA 4WXPA 2W83A 1OKKD 3U3JA 4B3XA 2ZRIA 2B7CA 4F91B 2DFKB 3EIEA 1NIPA 1UKEA 1Z6GA 5JSZA 1T5IA 1KDTA 4B71A 2EFGA 5EE1A 5H70A 1IN7A 1UBEA 1IY2A 1U8AA 4W9MC 3NBZC 4Z8XA 1Z3IX 1F60A 1FP6A 3VU9A 3G5UA 1N5JA 2P6UA 721PA 2FGKA 1E2PA 1F48A 1QHHB 2A9KA 3NVAA 1G291 4A8JC 1E9SA 2VO1A 2FFBA 1YVDA 1GKIA 1LF5A 2W0SA 1GUAA 1VCIA 5BN3A 4TYWA 1AZTA 1KI3A 1FQJA 2QORA 4JMPA 2NO0A 3B6EA 3KQKA 1Z0IA 2F3TA 3CPHA 2P6RA 2RGXA 4HYYA 1RE0A 3R8FA 2WJIA 4W7SA 3U2QA 2P6NA 5K8LA 1A5TA 1WDTA 4DKXA 1WRBA 3QKRB 1XP8A 2B8WA 3SN6A 1S9DA 2IEZA 1KO8A 3B5JA 4LRWA 5AR1A 2XZPA 1IY0A 4DDVA 4Z54A 4RVCA 3AKEA 4HZUB 4MRVA 4HAXA 3DMDA 1N6HA 3TSWA 3GJ8A 4HAYA 4OQXA 2AN9A 1OH8A 1DOAA 5DI3A 1AZSC 2ZRKA 1XD8A 3PIRA 2XB4A 5LB2A 4TMKA 5JJLA 5JZVA 2WOJA 2J0UB 4BQSA 1SHZA 1LV7A 1OYWA 3FGNA 4JYBA 2FPLA 4B3CA 3TH5A 1GKUB 1SVIA 2ZE6A 3HU3A 4BFUA 3IQWA 3IEVA 4Q1FA 1E32A 1P4SA 1E2GA 4Q4AB 5FPTA 2BJWA 3IPXA 1TEVA 4QHSA 2NGRA 3TSZA 4LJ9A 3PG5A 1TTTA 1VIYA 4KFSA 4QM7A 1Y3AA 4XWAA 1W5SA 4A0HA 1XJQA 4B2IA 1OFIA 3RS4A 4KODA 3AP2A 4LBYA 4PX9A 3R7WB 3K0CA 2OCPA 2MSEB 3Q8XB 1DBSA 1OXVA 2ZJZA 2HT1A 5TARA 1OXXK 2HLDD 1A1VA 1NNEA 1W4BA 2NO9A 1KI7A 2ZEJA 2DR3A 2WOOA 5TB5A 1P6XA 3AF4A 1ZC3A 5CIQA 2P5SA 5C2JB 1ZD9A 5FTJA 4OHZA 1ZAKA 5BN4A 4B44A 2R6AA 3ZDQA 3THOA 3VKWA 1KGDA 3WYFA 1HTWA 2JLWA 2HCBA 1U90A 3GJ7A 4BPBA 3B1ZA 5CJ2A 2QP4A 3VHLB 4C0JA 3ZD7A 5CLQA 1RRPA 2VHCA 4BFZA 1TQ4A 1YZUA 4P32A 3KXLA 4MH0R 3IBYA 5UKDA 1N2CE 4HLCA 5BYJA 4EFMA 1EG7A 4IW3B 2WWHA 2O8EB 3MWKA 2YWGA 3BAFA 3EZ2A 3BK7A 2FX3A 2DWPA 3QG5A 2AK3A 8OHMA 1LVGA 3ZS9A 5KDLA 2BEKA 4Q4JB 2XNDD 1HQYE 4LK2A 3PUWA 4DDWA 4TQ9A 1KSFX 4V0NA 3FKSA 5GJBA 3U4QB 1NY5A 4PAOA 3VX4A 5C18A 3EAQA 2CNWD 3OEED 2GEDA 2ZUDA 3A4MA 2LKDA 2EFEB 3W90A 3BIFA 3TW8B 3DHWC 1XD9A 2FWRA 4KYUA 5FOXA 3U61B 2JLSA 4JJKA 4AD8A 2VHJA 2W6ID 1FPMA 4URXR 3I61A 3EIHA 1G5RA 3Q7QA 1DO2A 3VHXA 1E2IA 1NVVQ 4O25A 5FI1B 2PMDA 3QENA 1OFHA 3C5HA 1XEWX 3FTQA 4ACAA 3U44A 2F55A 4JT2A 4M9SA 3C4JA 5C4MA 1HT2E 1YZKA 2CE2X 4DUGA 4US2R 2QL6A 1WQ1R 4BE7B 1G8GA 2Z6VA 2OBNA 1LS1A 1CS4C 1FX0A 2ZRAA 4WZBE 4CEJB 2EQBA 1WBBA 4EPVA 4XTCS 4PQRA 1NN3A 4DT1A 1E9RA 5B2ZA 1WA5A 4B6FA 3TGPA 5LD2C 1XCMA 1E9DA 1KO7A 3CRW1 4V02A 5JSZB 1SVLA 4TLDA 1SGWA 2KB0A 4OQNA 4ABYA 5IT5A 3TSOA 4LYJA 2WWYA 5JJIA 2FFAA 2XTNA 3B1WA 1Q44A 1HQCA 2WSSA 2ZRLA 1KMHA 3EA0A 1HV8A 4A36A 1H8HA 2GETA 4LGMA 1AS3A 4G0NA 1U81A 4V0OA 3RAPR 3BD9A 3NEJA 2ZPTX 3WMGA 5KSYA 4Q02A 5EXSA 4JBYA 1Q1ZA 2OCYC 4PZLA 1CIPA 3BH6A 4I81A 2HT6A 2QPTA 1SXJC 3F8TA 1ESNA 4O2RA 3HR8A 4TT3A 1US8A 2AD1A 1E98A 2H7VA 2XJ9A 4JLJA 5BW8A 3W9YA 1GL7A 2JGNA 2VP5A 4DDUA 2PX0A 4ZO4A 1GWNA 2BEJA 4NZYA 4RSGA 3A1TA 4R7ZA 2IWRA 1H8ED 3CX7A 5DSZA 1W44A 4A6XA 3W6NA 4V0ME 2N1BA 4JLOA 3T12A 1X6VA 5DI3B 3VNVA 5D3MB 3RS3A 2ERYA 3NWJA 2CL7X 1OH7A 4FINA 4CYMA 5CB6A 1COWA 2ZRMA 2WKRA 3T1OA 3U7FB 2ORWA 4KXFB 4RFSA 1P7CA 2LWIA 4TTRA 5FFMA 2J5XA 3MJHA 1SKQA 5J4LA 1XXHA 2WIBA 4JIMA 1KMQA 3ZGXA 2ZQ5A 5KNBA 2CBZA 3CRRA 2EYUA 1RIFA 3IIKA 1WXQA 3KKOA 1HE8B 1IBRA 2GCNA 3F0TA 1QVAA 4ESVA 1G3RA 2BVNA 2G88A 3GLHA 3EXAA 3SHWA 2A5YB 1L2TA 2HXYA 1PUJA 4ZCIA 1KNXA 1M8PA 2GK7A 1ZUNB 4NCKA 2J0SA 3F3YA 1ZU5A 2NZ8A 1CJTC 3K0SA 1P2TA 2WJJA 3RRYA 3CX8A 3U3OA 3MJRA 4X8MA 1P73A 1R6BX 1AIPA 2CJWA 1TF2A 3M4YA 4NL4H 3B9QA 2G1JA 2WJYA 2BBWA 4EJSA 2ZJYA 4CIDA 2D4HA 5FUVA 4D0GA 3QEOA 1BYUA 1Q22A 2GCOB 4M4SA 3T35A 1Z06A 3SI7A 4TL8A 5FBRB 4A8JB 2FSIA 1EFUA 1ZUHA 3SQWA 4QGHA 4C4PA 1CLUA 3WRXC 4A2PA 1E1QD 4Q1CA 3CPEA 4RJLA 2JIZD 4EPRA 4Q4HA 1D6JA 3UXMA 3CUEF 3LX8A 3ZYCA 1E1RD 1GRRA 1T0HB 5JRJA 1B0UA 3LW8A 5E7JA 4CT4B 3G82C 3RS2A 2CLSA 1E79A 2QA5A 1Z29A 1FZQA 3PEUA 4BLPA 1W36C 3VTKA 4IKEA 1F6BA 1XEFA 1FUKA 3DZDA 4HUQB 1D9XA 1KY2A 3NH9A 1AGPA 3GJ4A 3U5ZB 2VP6A 1CTQA 4LZZA 1CXZA 1YQTA 5H8WA 4EAQA 3HPQA 2KBFA 3SYNA 4GOXA 4R2IA 1ZINA 2D3WA 4PAMA 4U5XA 5A0FA 3ZJYA 2WMOB 2NOAA 2JA1A 4MRSA 3AKCA 4DB4A 4QNMA 1XZQA 2FNAA 4TLEA 5JI2E 1E3MA 5J5CA 2ZR0A 1Q1BA 3ZVMA 1G3MA 2I4IA 4JVSB 4ZIRA 4II7A 2PT7A 1ZP6A 4Q1AA 4EUNA 4URUR 1Q57A 3KUDA 3KX2A 1MO5A 1AGRA 3Q72A 5A4JA 2RHMA 1MV5A 4A0GA 4MYUA 1E4YA 4EQ6A 1YJ5A 2QZ4A 2YC4C 4GP6A 4BLQA 1KDPA 2GZAA 2QNRA 3VR3A 1U0JA 1XMJA 4PHFA 2FDCA 1KJWA 1N0VC 1HA3A 4OI1A 3K8YA 5SZIA 4M1KA 2ONJA 1U9IC 1S8FA 2G6BA 1IN5A 2QBYA 3LNCA 1EK0A 1EGAA 3UANA 3T15A 1OHHD 2GHIA 4LBVA 5JS8A 3P26A 4ZV4A 1J7KA 1S96A 4JSYA 2IYVA 1DE0A 4LBZA 1TX4B 3WYAA 2A30A 4TYQA 2Z43A 3HJNA 5E7MA 4KV9A 3BS4A 3VKGA 5BQ5A 3OIWA 1Z28A 4HAZA 4M9ZA 4HDCA 2O5VA 2P67A 1W2HA 5F9FA 5KOYA 2CCGA 1G64A 1KHTA 1TUIA 3NTUA 1NLYA 3IHWA 4GOKA 4IEIA 2ANCA 4C30A 4D25A 1E2HA 1HEIA 1P9WA 3UG7A 2RGDA 2H8KA 1YR8A 2FFHA 3QEJA 3Q7PA 3GLIA 1OLOA 4LHXA 2YJTD 1P2UA 1FNNA 1G8FA 2RGAA 3GJXC 4MRNA 2W6JD 1S3SA 3CWQA 3BERA 3IIJA 5FOTA 2YWFA 4JS0A 2OAP1 3KQUA 3W5IA 2P3SA 3VR2A 3AF0A 2ZAOA 3OHMA 3QG1A 4ZDJA 2ZSFA 1NVWQ 3CNNA 2J7PD 2BM0A 1NJFA 4N1AA 3SE0A 1NIJA 3T5DA 1G20E 5FOUA 1XXHB 821PA 2RB4A 2JLVA 4QGAA 3HPRA 1GRNA 4FW9A 1NP6A 2O8FB 2ZE8A 1CR4A 1R8SA 1ZM7A 2CL6X 1WB9A 4ARZA 1VYTA 3AVUA 1P9RA 3B13B 3A58B 3B78A 4IEEA 3V4FA 5IHPA 4CF7A 3GLHB 3BB4A 1IXZA 4XVQA 4B43A 2DFNA 1N6OA 3B2EA 3O8DA 4QBIA 5KYKA 4B76A 1MO6A 4D81A 2XJ4A 3CH5A 1WF3A 3IEUA 1HE1C 1KK2A 2GZDA 4YXWA 1GILA 5G53C 2O8BA 3OESA 2NO7A 3BXZA 5JBQA 3EZFA 3RC3A 3KQNA 3TUZC 1ZVQA 2JLQA 2JDID 1NN1A 1W46A 4H1UA 4CRWB 2WTUA 3LY5A 4LOAA 1GIAA 5LD2B 2H5EA 1U98A 1YZTA 4L4UA 5F98A 2DB3A 4Q66C 3RWOA 5JHGB 2KSQA 2IS6A 1G21E 3N5CA 2WICA 4MKIA 4A1FA 1QVRA 2XTZA 4CEHA 1U9IA 3MD0A 1ZW6A 3CZQA 3W3ZB 1UF9A 1CEEA 3PQCA 4RD6A 1XD2B 4KVAA 5FR2A 2WPDA 5JFGA 1TQ6A 4Q4HB 3ZQ6A 4FMDF 1PLLA 1DTSA 1G1MA 3A1WA 1JECA 3QY0A 4OHXA 4C0AC 4TYNA 1OFUX 3K70D 1R4AA 5FPYA 3QKRA 1KI6B 2KJQA 2ZYTX 3IUYA 1EFRD 5B30A 3LAWA 4PR0A 4L16A 3U6BA 1ZRHA 1G41A 1N5IA 2ZJ5A 4US0R 4MYHA 1SXJB 4HATA 3V9PA 1O3YA 4WVFA 3B82A 5HR5A 3IQXA 1II9A 1XF9A 4ZI3A 3KJHA 1KJYA 4WOPA 1P9NA 2QP9X 1IOZA 3Q9LA 1ZM3A 1A2BA 2V6JA 1E9CA 2J1LA 4ILEA 4DCTA 3FMOB 5KSZA 1E6CA 2R6CA 4PC1A 5AK0A 1Y63A 3AVQA 1RJ9A 2PCLA 2GZHA 2KBEA 2B21A 3QXSA 4N0EA 3W6PA 2FSHA 3CONA 1K5GA 4XWKA 2J0UA 4OHWA 3RLFA 4M1TA 2GBLC 3TVTA 3X1XA 4YLGA 1KAOA 1YZLA 2CHQA 4NONA 2GVDC 3GMTA 4FN5A 3ZQJA 3CLVA 3B9PA 1DG3A 4OI0A 4LYAA 1GSIA 1UADA 3K0AA 4JL6A 2W0MA 4AKIA 2XOKD 1KO1A 1XJ0A 2G83A 2QUZA 5DIFA 4QHTA 2EVWX 4BZQA 3KJEA 3LVRE 4EPTA 1ZD8A 5G40A 2QE7D 2C2HA 4HAVA 4BGDA 1Q3HA 2H16A 3OAAD 3EG5A 1EX6A 4KAXA 5E3HA 2DWQA 4Q1EA 2ZS7A 2YOGA 4FMDB 3TRFA 5HKKD 5EP2A 3T5GA 3KKMA 1X1RA 4P33A 4TQAA 2VA8A 1UKYA 2VPPA 2ZXUA 4MKFA 2Q3HA 2ZETA 3W3AA 1W4RA 1Q3TA 521PA 3I92A 1ZM4A 1SKYB 4IXMA 2O8EA 5HCNA 1W2GA 4UQOA 1R5OA 3DM5A 1R0ZA 2WSMA 2WBLC 4ZDWA 1YR6A 2FG5A 1II8A 3ZLJA 4HLUC 4QM6A 4A2QA 4PO9A 2ONKA 3AVYA 1BO6A 5KDDA 2OFOA 3P4YA 4B32A 4NKRA 4DBLC 4LJAA 4PHHA 5FTMA 3NH6A 5ELXA 4GDFA 1B23P 2FSFA 3LXRA 4GPTA 3QSYA 2WJVA 1M2OB 3SZRA 4DIDA 2Y8EA 1W36B 1XTKA 2OFXA 5A5GA 2ZI9A 2YYZA 1NMZA 2C5LA 1E9EA 3KB1A 2ZSEA 1UJ2A 2ERXA 4C0HA 1Z0AA 4L8GA 3K9NA 4XH9B 1E4VA 2PT5A 5JWHA 4PTLA 1IN4A 2JAQA 2REBA 3RS7A 4A15A 1NLFA 1MT0A 3HYTA 3R9IA 1S2MA 1Z0DA 4KSBA 4YMUA 1EFHA 1MRSA 4NTZA 3ADKA 1PZNA 4ARZB 3VR4A 2DBYA 2JEOA 1OE0A 4NYJR 2CLCX 4IDHA 1ZM9A 1N5KA 2VP9A 2X2FA 5JRZA 4M1YA 2W58A 1ODFA 1KY3A 2O8BB 2ZRGA 2IWHA 3V4RA 1E2EA 4TL7A 4BWYA 2GXQA 1Z6AA 2RAPA 4PQFA 1LB1B 4RD4A 5EZ6B 3THXB 4XD7A 1ZNXA 5KHOC 2WJHA 5JEDA 3PFIA 4GZMA 4HB2A 3UWKA 4OK5A 3GP8A 1QZXA 4M1WA 5G3YA 1YZNA 1F3OA 3HDTA 4CEHB 4E22A 3PEWA 2WMNB 1K8RA 1G3QA 4Q9IA 4TYYA 5FBQB 1Z0FA 4XJXA 2VTKA 4BEJA 4UJ5A 1E99A 4UNQA 1JAHA 3ZVNA 3HP1A 5CDFA 5L3QB 1KO5A 3BC1A 2FE4A 2AKAB 4DLXA 5FTLA 4FMBB 5CITA 4O3MA 3CM0A 1N6RA 1OIWA 3GJ0A 4AG6A 2ASEA 3TUIC 4E03A 1H65A 1GDDA 2REOA 2CMKA 3P20A 4DDTA 5KSOA 1J90A 3KTAB 1Q12A 4PSAA 5EQTA 1GL9B 2GXUA 4KHZA 3FKQA 3KQLA 2F6RA 2J0QA 1D5CA 5G41A 4OBEA 5FUXA 2A3RA 3BB1A 5D3MA 2HCJB 1R2QA 5H68A 4YMWA 1RJ9B 1U8YA 3KXIA 5DYIA 5EZ5A 2JCSA 2IYWA 1UAAA 1OFTA 2F9MA 3RS0A 4IVQA 4OQMA 1YR7A 1BMFA 3HU1A 5JECA 1XTQA 4EPXA 4JVNA 1QHXA 3P32A 4L15A 4PXAA 1ONBA 2FZLA 2QSZA 3NDPA 4GL2A 2I3BA 1N0UA 4DLUA 4BFXA 3P4XA 4TL6A 3LRPA 4NBSA 3AM1A 3LX5A 3DM9B 3ICEA 3EZ7A 3KUCA 3L0OA 4J0QA 2ZRDA 3K0AB 3SQXA 2IUUA 3PENA 3DEFA 1EX7A 4U00A 4Z1MA 4E07A 4HI0E 1CJUC 4Q00A 4QG7A 2E9SA 2QENA 3AV0B 1AM4D 1CR1A 4Q9JA 2VL7A 5GJWC 3T06B 1L8QA 1XDBA 2IT1A 5KUTA 3WYGA 1U8ZA 4AYWA 1KI2A 2V1UA 3BRWD 1K6MA 4OL0A 4HLDA 2A5FA 4DSTA 2Z5FA 3R8CA 2J7KA 3OZXA 4LY6A 4UNPA 2GCOA 3SJBA 1NG9A 3EARA 221PA 2ANBA 1P2SA 2XZOA 4A8JA 4M0LA 4AY2A 2OZEA 4YMVA 2KWIA 3P1JA 4GP7A 2A5DA 1II8B 2KE5A 3QXJA 1N25A 2JLXA 2RHDA 3BORA 4IDPA 4DJTA 2D74A 2MMCA 4HDOB 4AIIA 3KFXA 3PITA 5KSPA 1WE2A 5E7IA 3WNBA 4NCNA 1M7GA 2ODNA 2C9YA 2V9PA 3WNDA 4D4JA 1RRCA 1QHYA 2ZSAA 3FPAA 2MMGA 4M1SA 3MRSA 4HUQA 4DLRA 2OBMA 5HPYB 2ZTSA 2J87A 1OPXA 3R20A 4KLZA 2FSGA 4LJ7A 1XFAA 4LC0A 2F1JA 3FFBA 1PUIA 2QGZA 5EE5B 2EFDB 1JEDA 1FW6A 4I4LA 4PQYA 2GTPA 4URYR 1IQPA 3O8RA 1XB2A 5CJPA 4DIEA 5EP1A 1IONA 3P27A 2C78A 3A4LA 3LVQE 1XX6A 2VSOA 4DEYA 2FGJA 4MRRA 1TF7A 1N6IA 2IX3A 1RW4A 1O87A 3QOFA 4NYMR 3KQHA 3K09C 2QTHA 3PUXA 2J0VA 5TV2A 1DAEA 4URVR 2Q3FA 1V5WA 2GK6A 3L0PA 5GVRA 5C1BA 4JBXA 1ZM2A 4LYFA 1U2RA 5DLQC 3WBJA 3RNLA 3SYKA 5G3ZA 2QAGC 4HSEA 2YNMA 2GF9A 4GZLA 3LV8A 3GLFE 1LS6A 2VP4A 4QJ4A 3RS5A 1P62B 3L2OB 3TNFA 1FTSA 2R6GA 1JR3A 3FKSD 3N2IA 5DHAA 4CT5A 1FOEB 4W5WA 2BDTA 2C04A 1E9BA 3D31A 4FIDA 2DFLA 5AUQA 3MWLA 4ZCMA 2D7DA 1HUQA 1XXHE 2NG1A 4V0LA 4LC1A 3UMSA 2XEXA 2R44A 4MKHA 1GM5A 2O8CA 3KL4A 2GJ9A 4LPKA 2QN6A 4M1OA 5HCIA 4B73A 3U3MA 2AXPA 1R8QA 2P65A 2RGCA 4ACBA 4DLWA 2IXGA 2QMUA 5FUYA 3A37A 2BIFA 4DUGD 4TN1A 1XPUA 1N5LA 1NN5A 3FWYA 3LBNA 2JJ2A 3HYRA 1ELOA 4QHYA 3E2IA 5FI0B 3ECCA 4KBFA 2IF2A 4WW0A 2AHOA 2YINC 4WBSA 3Q3JB 5JS7A 3EPLA 2NMVA 4DRZA 1VPLA 3CO5A 3X1DA 3R9WA 5CK5A 1J99A 4OI4A 5EE9A 1UBFA 4Q4LA 3WMEA 2WSSD 3WXMA 1UBCA 2F1HA 4GT1A 1G7TA 4E09A 1YKSA 4BECA 2BBOA 1W0KA 1H8HD 2VLIA 1ZIPA 4PAQA 4Q7LA 2PEYA 2FFQA 2NTYC 3LWNA 5EE0A 4D2IA 2F3RA 4G5QA 4M1MA 5KNCA 4CVNA 2O8FA 1E2JA 4F4JA 4JLKA 1IN8A 4PO1A 4EPWA 3SJCA 4JT4A 1EFTA 1TAGA 2LCFA 3F5FA 3FYHA 4A0FA 1PLJA 4BZPA 5IK2A 2CCKA 3SFZA 1KI1A 1SZPA 4AURA 4DHEA 4XWOA 2F1RA 4PSVA 2CK3A 4TT3D 2R2AA 1W49A 1ZUIA 3DKPA 3WMFA 1T3SA 3KFVA 4R98A 4AYXA 3MFYA 1R0WA 1E2FA 3WRYC 5EE3A 5L8VA 1JQLB 1S1MA 2OSBA 2WWGA 4B6EA 1S3GA 1Z08A 3V00A 4M21A 2FA9A 1NMXA 3O8BA 4D0NA 3L43A 4ZDKA 1OIXA 2GA8A 3RHFA 3UG6A 1KIMA 2YKGA 1E69A 2J9RA 3GLGE 3DZ8A 4X8LA 3A6PC 2YOFA 1COWD 3MWYW 4NYIQ 3NBFA 1G4AE 3TAUA 3H86A 2G0TA 2G77B 4PPGA 1XD2A 3OE7A 4DSOA 4JBWA 2V7QA 3AVVA 3KKQA 4MGIR 4JLAA 3QF4B
chains in the Genus database with same CATH superfamily
4TTQA 3DKVA 3I58A 2ZWAA 5DCLA 3RRMA 3CKKA 4S1TA 4RJJA 1P2BA 2ZS8A 4MYTA 3PZBA 4DSUA 3K9LA 3EUWA 2C9CA 2XCRB 2WWXA 4XUEA 2X0FA 2GJSA 3IUNA 1K8QA 5FUQA 4KYIB 3ZVRA 5TF4A 1ECBA 4ZHQB 4UPEA 2R7MA 1IXRC 3T9DA 2Y6VA 3VKVA 1N8SA 1ADFA 2FMXA 5J40A 1W5TA 1NRXA 2H0QA 4A2CA 1ISJA 1RM3A 2NUPA 2G82A 4QVKA 3SQNA 2GNPA 3V9AA 1XBTA 1TI7A 3K1JA 2Q5OA 3ORYA 3U4IA 4LNAA 4DLZA 1UDWA 3THWB 4W1QA 4G37A 3M8KA 3TR5A 4FLEA 3AX6A 1AVTA 4HQNA 2GSWA 1K6XA 2YVUA 2VYFA 2WMDA 4MA4A 3QX9A 2YUIA 4P58A 1RXCA 4QELA 1MO4A 2PS9A 2NXJA 1U4OA 2VDWB 2VH2A 5H3LA 1WZIA 1Z5GA 3GAMA 4P81A 2H1RA 1H2WA 4RSRA 5EKSA 5H3CA 1FL9A 3ZEIA 4B34A 1E7RA 1ORWA 1OWOA 5BWCA 2IY7A 3AERB 5CTJA 4X61A 4G4SP 3FA2A 1QG2A 1DIHA 1NFQA 4QOHA 5REQA 3NHZA 3ZDRA 3ZKWA 4HG2A 4UJ3A 1YUBA 3PR1A 2OPHA 3QBVA 2ZDQA 1JG7A 3DTTA 4G0WA 2Z98A 3IPRA 2BEWA 2E82A 3G6KA 3Q11A 1YFLA 4PVDA 5CUQA 4DV0B 2BUBA 4K9QA 3W8DA 3GUZA 3HKEA 4TQUS 5EI5A 1SG0A 1E79D 2GBCA 2JCBA 4KWHA 4X24A 4CLOA 3I8SA 3CKYA 1Z2OX 1N2BA 1ORVA 1CP2A 5G0WA 3UWDA 4JI8B 3AFIA 3RRBA 2A67A 4OATA 2P40A 2R00A 4EHBA 3SJ7A 2EKQA 4KE9A 4BLSA 1V47A 2NYVA 1T9GS 2QN3A 1MJHA 4IVRA 2VXOA 4HNHA 2SICE 4O08A 4XGQA 5J4YA 4MULA 4F2PA 3EOAI 1A7JA 3BMOA 1JILA 2CWWA 5ALQA 1M9NA 2O8CB 1BGWA 3CTPA 4HJXA 4IYRA 2D2EA 2JFYA 3BMQA 2WD9A 3ZE7A 4CR8A 3ZOKA 3LWBA 2O0JA 3SX2A 1GRCA 1WLSA 1SK8A 4P31A 4YHHB 2AMFA 1TFUA 2IS2A 2AJLI 3AF6A 1E4EB 1AKUA 1MVOA 1R18A 3RSSA 1EBUA 1RU3A 1HDEA 1EVZA 3KB2A 4MI1A 4N0QA 2QW0X 4QNNA 4ES6A 3F3SA 4CODB 4HMPA 2BWJA 5JQGA 3K15A 3L6UA 2R8EA 2CYCA 1ADJA 3GJ6A 4G1VA 3ZWQA 4D9MA 2VQSA 4FR5A 4MR7B 5TQ0B 4HAWA 3OIFA 3SKVA 4DVGA 1MLDA 2ZIWB 1MDBA 4HX5A 3PNBA 1P39A 1FSFA 2GKSA 3CH7A 3FPHA 4O29A 5CLIA 4B9EA 2ZB7A 4UUMA 4YNBA 9LDTA 2OE2A 2O8DB 1W93A 1B6GA 2H1WA 2V7EA 3C14C 2WF8A 1AGXA 1J1UA 2JJ1A 1KYXA 1TM7E 3D6JA 3JXEA 4TSFA 5C3UA 1JDSA 4OKSA 4P35A 3W5JA 5IJ9A 3S7ZA 4YAUA 3A4NA 2PK3A 5AVWA 2CXXA 1PHPA 1X0VA 3UKOA 3WB0A 3OTGA 4WZBB 4K3VA 1OW3B 2CLFB 4KU4A 5B6JA 3U7GA 1K7EB 1FXWA 1PWYE 4CM9D 1WW8A 2UUPA 4BU0A 1GSHA 3FYTA 5AHKA 3TJRA 1YS2X 1GNQA 1NN0A 4A4DA 3ETGA 1GGMA 4QODA 3G9UA 4YAEA 1IJEA 3E61A 1GFSA 7ADHA 5ETJA 1TCAA 1AKNA 1QHNA 2FW7A 1O94A 2BMWA 1QV6A 3FUWA 3EPRA 4HDNA 2OYCA 3PRHA 2FN8A 3TINA 3RJTA 2IQ5A 1PZEA 1GPLA 2VDPB 4QLBA 2FMKA 3HZRA 4JI2B 2BZ1A 1L5GB 3QY9A 4TLAA 2WYIA 4LVUA 3P9XA 5JZ9A 5KX5A 1L7VC 1G2QA 1X80B 1N5OX 1W4CA 3HHPA 3RFTA 1CRPA 1Q0UA 1Q1AA 1Z12A 4J16A 4RPHA 2CNOA 4JJ7A 1E3JA 1GPNA 3ADOA 2FEWB 1V8BA 5BR8B 2B83A 2XCTB 1U1CA 3K5PA 3L0SA 1Y42X 3D5EA 2PJZA 1DXOA 3OJEA 3E5MA 4ZARA 2J46A 1R8XA 4N01A 5D3KA 1N1EA 1DSSG 1M34A 2RMKA 4PLTA 3NYRA 1QRSA 3CLSD 3ZHSA 4MS4B 3QKWA 4FNGA 3ZPXA 3PK0A 2JG3A 3EAFA 2TRSB 3D7SA 4YA6A 2WTMA 3AH8A 3VTAA 3BF8A 4B6JA 4ND8A 3JQFA 4LV8B 2RGGA 2OBLA 3DMNA 1HK7A 5JD3A 5L3QA 2PVSA 3MSXA 3V33A 3DAFA 4U39A 1KORA 2DUNA 4B35A 1YB6A 1RYHA 4FXPA 1AH2A 1M6VA 1XZJA 3AB8A 4OCZA 4OMDA 3S8EA 4IHAA 1WHSB 2QLMA 2KI5A 1Q21A 1SRQA 3PC2A 2GERA 3QFHA 2EU8A 1E3SA 2B34A 2YV3A 5BP7A 3FROA 4LZAA 3CHYA 4KVFA 3RUHA 2CXOA 4ZZ2A 1MV8A 2JCVA 3JQGB 3ZI4A 3I2FA 4NCIA 3GELA 1L5HA 2OORA 1ORIA 2QRNA 3X0DA 5BR4A 5HIKA 2Z1DA 3A2NA 4LDJA 4JYAB 4OB7A 5A9RA 1LZKA 4MPDA 3O8CA 1Y4ZA 3UJ3X 4D9FA 2RJOA 3FB4A 3LKDA 1CPYA 1PFUA 5FO0A 3F4KA 2Q27A 1HT3A 5DP2A 3CB4A 2BM8A 5I7RA 1VG0B 4ND4A 3M5PA 3B1FA 4IBOA 1U3TA 1J49A 3AL3A 2VWPA 4QT4A 1TFRA 2FPUA 2J5QA 3PNSA 4JBGA 2HRQA 1P4AA 2X7JA 4ZI7B 4I1YA 1UINA 2ZTLA 2Z6AA 4EHJA 1Z74A 2IC5A 4XYBA 2ZVDA 1M8FA 4M37A 2X15A 4QTZA 3AUSA 3KSMA 4G5OA 4WZ6A 4LJ6A 1F9EA 2OKGA 2JK0A 2ICAA 2VP0A 5H16A 4D56A 1YR9A 5F7XA 1SVOA 1PV4A 2BSXA 2CEKA 1HMPA 1VKHA 4DXDA 2O23A 1ISGA 2HMTA 5IAJA 1YL5A 3VU1A 1YJAA 4YMTA 1HE4A 2C42A 1EB9A 1Y0BA 1DAKA 3O4FA 4RM3A 3X1JA 2A5GA 2J4DA 3CR3C 2VPZA 1L4EA 1Y9DA 3IX7A 4CT0A 3A4IA 3QA9A 4RCYA 3BWDD 4I19A 3R6GA 3VDQA 2X0KA 2PA3A 3PQ3A 2VYNA 1LBHA 3P9QA 2RHTA 3A10A 4JX8A 4RH1A 3UENA 3VOSA 2OEPA 1VE3A 2AG8A 2IIVA 2VEOA 3UMFA 3EVZA 2PL9A 3ZXYA 2I80A 1J23A 4WEOA 1KS9A 3EMVA 5DBIA 2EIHA 5HQJA 4A27A 4AS2A 4AKHA 6PFKA 3K6RA 3HUDA 1KYIA 4TRNA 1PFVA 2I6SA 4HO1X 2YICA 4WZAE 3SKYA 3LZDA 2V55B 2X4IA 3H9QA 3C98A 4M8KA 4QLAA 3FJYA 1IXYA 3BMXA 2VSNA 2ZJBA 4BVEA 3F6BX 3RBVA 1E3DA 1UKCA 4HWSA 4WH0A 1Z15A 4UNNA 4Q3EA 3UIEA 3C7DB 2FR8C 1BGXT 4GPBA 2X22A 2QRPA 2BGMA 4ZRDA 2AE1A 1C41A 4TWIA 2QG6A 4JJZA 4HAOA 2C84A 3WLLA 4RJIA 1IXSB 5K05A 2ZRNA 3A32A 1YQEA 2XNSA 1SURA 1G60A 3ANSA 4H1VA 1IZZA 1FDTA 4IH9A 2C7PA 3C8ZA 3MWJA 5I9NA 5G1OA 3PFGA 5DISB 2WUDA 4HWGA 4CM8A 1C9KA 2FFJA 3RE1A 4D8VA 2REXB 4C7BA 1T0BA 1X87A 2FI1A 2MYPA 5AKIA 1L3CA 4KUGA 4W9NC 3M83A 2VHZA 3RF7A 3RWMB 3S8MA 4Q18A 4B3RB 4KE7A 3LTEA 4Y18A 2QNBA 5ALXA 2P5YA 5GY7A 5U9CA 3NT5A 4EUHA 1TGVA 4D1YA 3VAAA 2QE6A 2A58A 4R51A 4MQBA 4YLEA 3LOUA 4HGQA 5DGTA 2VZ8A 3KKNA 1ZK2A 5CVTA 1XHFA 4DRYA 4H7JA 2H8GA 2GBLA 4ZAXA 1MIHA 1ZOSA 4CN9A 1GCAA 3OJOA 5J4KA 3HO1A 4ZVMA 1DVRA 4C6TB 5IKOA 3RUCA 4EI7A 4IJ6A 4DCPA 3U4DA 1Z5PA 1WKVA 3CNEA 2GDJA 3M33A 1W7AA 2X77A 3G2PA 3L18A 4QTXA 1GQYA 4KWIA 3ADCA 2RC6A 3WGLA 4P4SB 1A2OA 1FP7A 1KYYA 3FSEA 1VL6A 2IVFA 3LQQA 2I91A 4LJKA 2OHGA 1V6SA 4NPAA 1GDHA 1F9AA 4RTKA 3P0FA 1JVBA 4HH3C 4PCUA 4J1NA 1SOVA 4ISCA 1SHTX 1VSVA 3QELA 2IEDA 1KMIY 1WD7A 3DT6A 3K0CC 4HFNA 2QTVA 4JXXA 2O2JA 5K3DA 5GONB 1EKXA 2QAJA 5K09A 4KI0A 4ZRNA 5BN5B 1O7JA 2HGSA 2GWRA 1CS0B 3C6YA 1VI5A 4BMSA 5F35A 4ARAA 1FQOA 3NIBA 4WN9A 1LDYA 4U7DA 1BDIA 1ECPA 1U99A 3UJPA 4EM6A 5F51A 1KQPA 1OXMA 2B78A 5I7UA 2OKCA 4RDHA 4PIPA 5FR1A 5HZMA 4N48A 3FYDA 5KYVA 1TGYA 5DHFA 1ORRA 5LA6A 3GT7A 3F3KA 3HXKA 3H1TA 3N2EA 4G9BA 5EWJB 3NHAA 5E8RA 7REQA 1YUNA 3QU7A 3P9RA 4OQYA 3V8RA 4GOMD 3EXIB 4X90A 5JVDF 3EX7C 4FGJA 3FFXA 3B7GA 4IRUB 3WGVA 4D5EA 3HR7A 4KXQA 1D7AA 4I6JA 4P98A 5AWFC 1E94E 1KA9H 3DL7A 2FOIA 3IUMA 1UFOA 2JARA 4HLUA 1DG9A 4JR1A 4N6OA 4NJMB 4TKVB 4V38A 5THKA 5K8TA 4R1SA 2IIBA 4QFDA 3CTMA 1P18A 4Y6PA 3CLUD 121PA 4JX9A 3AYZB 1RAFA 4OHKA 4BAUA 4RF5A 3TLJA 3EW7A 4F9FA 1LY1A 2X40A 1KE2A 5EP4A 1KQGA 4Q9LA 3VRHA 1T1IA 4P4UA 3GCXA 4DMKA 3J7AC 1FP4A 2Z4SA 1HG1A 1TQDA 4XYLA 5JWRA 1TC1A 4KN8A 5FUWA 1QF9A 4RM2A 3Q2IA 3N70A 1U8FO 4TGLA 4D3FA 2YTZA 1W96A 3CEAA 4RKRA 3OLQA 4C21A 2X0DA 2GAOA 4NAHA 2PMFA 3W5DA 4EGAA 3FY4A 4EKDA 1XMIA 3EIQA 3I6YA 4ZQIA 3OCVA 1K7YA 2IUTA 3NPMA 1FYXA 3KM0A 1BSVA 1GRQA 2LIVA 3IKJA 3ST7A 1JG4A 4B09A 5JATA 3GPLA 2YV1A 3K0FB 2WLSA 4M60A 1PD0A 4KN9S 3H2BA 1G21B 1P1CA 1RFLA 3HO8A 3KQYA 3B8HA 3CRVA 1XWIA 2A35A 1PUXA 1ODIA 3E18A 3K96A 4YT5A 5IFLA 4UNSA 1JALA 3U3KA 1DCFA 3UWPA 4MJLA 1CF2O 2FUNB 1KFEB 1YV9A 1MAWA 1WDLA 3EVEA 2POQX 2PCJA 2ZUCA 4W9RA 9MHTA 1N2XA 1CY4A 3OT5A 1IYZA 5L6LB 3K1YA 1ZH2A 4LSWA 1AMUA 2YS6A 3LTNC 1T24A 1AS2A 3JARB 3OZRA 5DKFA 3KQQA 2BPOA 2YZNA 4JCCA 1OZFA 3JTEA 4X60A 2IHKA 2M98A 3NC1C 4MB6A 1I6MA 1SNYA 2A9JA 1QYVA 2BF4A 4Y6RA 3DNPA 4YDSA 4CMBA 4YYEA 1NLUA 2XXAB 4O4JA 4QQ8A 3JQCA 4ER7A 5LPNA 5KKNB 4LDQA 2YQ5A 3RYCB 4J1SA 5L3RA 4IIXA 2V1XA 4B3GA 3BCUA 2BR5A 3BQ9A 3VMMA 1GPKA 1G16A 2W6IA 3D7MA 3LDAA 4GRDA 3N8GA 5EJ4A 1GG2A 2PZLA 3JRWA 3C45A 2PJDA 2JCGA 4GMXA 3W5SA 3HVRA 1CJMA 2I7TA 2BHLA 3IAUA 4RD0A 5H1YA 1G2OA 1MNQA 1YONA 1KJNA 1K8YB 4TMXA 1EE1A 5LBIA 2RI6A 2ZRQA 3F5DA 3LKVA 5FBKA 2ZG6A 1GTVA 3THYB 3F6EX 1XKXA 3ESYA 1RMTA 2FOLA 4WNAB 2OHVA 3L4JA 3AF3A 4GQAA 4DCNA 2BH2A 3IAEA 3IPLA 3WOHA 2AC2A 4B3TB 2WV9A 1J1IA 4ZHQA 1AHPA 3RJZA 3LO5A 3DVRX 2FSVA 1G19A 4XQEA 4G5YA 4EG8A 3RKUA 1LRLA 4MTCA 3GLKA 1GL3A 4P7BA 5CEEA 4Q3CA 5FPSA 4AMBA 4QASA 1CVRA 3I9MA 3L92A 3AIMA 3ORQA 1NW4A 2CD7A 4LN1A 4R9VA 3T3MB 2I9PA 3ZV3A 4AKEA 3THWA 3A1UA 3G13A 4TV8F 1ZGZA 3QPDA 5JANA 2CFRA 2YWDA 4I08A 3SC3A 4DJDC 2HEIA 3L7IA 3SOPA 4DLVA 2VDWA 4OHOA 3O8OB 2IK8A 2M1XA 4YRFA 2CLKB 3AERA 2A6PA 1AG9A 1OB2A 2FUKA 3FR7A 4Q1BA 1ZDMA 3UATA 3RK1A 2ZM5A 1PJRA 5EKTA 1ZIXA 3DEIA 4OMCA 3BXOA 1F2TB 1EWRA 2QT0A 2RAVA 1T8WA 2WUVA 2ZI3A 3F7MA 3OZ7A 5FULA 2EJTA 2X3YA 3T9FA 4JWTA 3K9GA 1JHYA 3WQHA 1UDAA 3WHKA 3D4LA 2P9QA 2ACWA 4N8EA 4E5YA 1R4MB 4BBAA 1FNMA 4UU1A 3V7UA 2WM9B 3OLYA 3EXG1 3TRDA 2ZITA 3ILHA 4E7OA 1C9EA 1F0NA 4U02A 4J43A 3C1OA 3CPSA 5ILGA 3N74A 1JQ3A 2O2DA 5DX0A 1K5HA 3C87A 1Y1QA 4K8OA 4DR5B 2DERA 3DF9A 4F5ZA 1TIPA 2FPMA 1XSEA 5TDHA 1SULA 3D5TA 1C1HA 2QIPA 3CF2A 3U6KA 5E8JA 1VDZA 3KNZA 1DEKA 3VZDA 4DV1B 2W11A 3I04A 1K3UB 1MIOA 5AKJA 4R01A 3I2KA 2QS9A 4S0XA 2DHDA 1CB0A 2ZRBA 1CY7A 3JQ9C 2XQFA 4IICA 2A1IA 2G4CA 1LV8A 1TEXA 4H77A 4JWKA 1L5RA 4K05A 4LI0A 3VKUA 2PBZA 3LOQA 4YJHA 2WZQA 1CSEE 2ZAMA 8GPBA 2EL9A 2G5CA 2QQ0A 4A5OA 2NN3C 3KLPX 3HXLA 4Q15A 2GH1A 3FWHA 1VPDA 3MGAA 3WHIA 4FKMA 3FHTA 3VNUA 3OEYA 4B3MB 2O8DA 5JZBA 4HNUA 4EA6A 3SBXA 1LDNA 1L5OA 1P7YA 4NE9A 4C6RA 1NJGA 4WY8A 5JNUA 3U09A 4NCJA 1OVGA 5FL3A 2H7XA 2OCAA 3H17A 3SSNA 3BXHA 1JR3D 1LBSA 3IBFA 3KK0A 5T6BA 3W4KA 4EPYA 4WZBA 2VHQA 1EVYA 3M89A 4HNQA 4TWAA 5JDIC 4AN4A 3ZWBA 4U8HA 3H1FA 4KGVA 3HJFA 3VHRA 3IOMA 1TQ8A 4GX5A 1KKLA 5E6RB 4K1XA 5GV8A 3ADBA 4UATA 2ZUWA 4LRTB 3TS1A 2HJSA 4HCJA 1WXFA 3EBLA 1C8VB 2PH7A 2YHUA 1Y7PA 1X1AA 1O6CA 2PN1A 2VOJA 4WOJA 1E92A 4R69A 4B0OA 1XA4A 2PMKA 1UEIA 3OIUA 3ZJ5A 1D5WA 2WIFA 3L7DA 2EOAA 2OT3B 2N1MA 1L7QA 4DA7A 5J43A 3RAFC 1E1QA 2GCIA 1EHYA 2C8VA 2JIZA 1KH1A 4NICA 4PGMA 3REOA 2D7CA 4P7GA 3AWDA 2NIPA 1L4HA 1X80A 4D98A 1BRMA 2H3EA 3GOHA 1GZHB 1J8VA 1U9JA 1AF4A 2GD2A 4L3VA 4LMPA 4PSUA 3PXGA 2C31A 3KS9A 3GEHA 3K9WA 2YBEA 5EGNA 2JZCA 4DNPA 2IP1A 3OPVA 1TNDA 2NTNA 1MVNA 3KQSA 1WCXA 3LGSA 2EHDA 4BJ5A 4HNAB 3TLCA 1EWTA 4NIMA 2ZSHA 4GW3A 1AKMA 3HNRA 2JFHA 4MUBA 1VCHA 4KWCA 4W6ZA 5EJ2A 1Q1EA 3BZWA 3USZA 3GB9A 1PT9A 2WI8A 4X1KB 5FOVA 5K6AC 4V0KA 2OZPA 2WT4A 1M72A 4JI4B 1E3TA 2OBXA 3DTVA 2Y2VA 4UDNA 5D5HA 3EPJA 1USUA 2CVFA 1YZGA 2FUEA 3C6ZA 4MS4A 3OPMA 5KTYA 1O5IA 2A0YA 3KJGA 4TN5A 3T4UA 3BTSA 1YZHA 3UPUA 1UBJS 5FA8A 5D84A 1T5LA 2XHZA 4B3FX 4D9KA 3B5EA 3LLVA 1JQBA 1Z2CA 3IHLA 4KO8A 1FTNA 4DZRA 5JLJA 5LFAA 3OU7A 1EVQA 5T8KC 1RQNA 2I6QA 1W5BA 4BNDB 2ZYVX 4IOJA 1WHSA 3N2KA 1VL8A 5I01A 2Y0EA 3AK4A 1JPUA 3PJRA 3DKRA 3MAAC 1DBPA 3BD6A 1C3VA 3UJCA 3UMCA 4CIAA 4D3SA 1ABBA 1RPAA 2W8ZA 4D41A 1WWKA 1MOSA 2XZDA 1P0MA 5LXTA 4FUQA 1CY2A 2CK3D 3WBFA 3ND5A 1F3LA 3ELYA 1ULSA 2GASA 2ORED 1U0BB 3W8FA 4JJAA 1KVSA 3VXKA 5J2TB 2BTEA 2WG2A 1IATA 1YVRA 2Z5LA 2VSFA 3BREA 4KIUA 3L4BA 3W1EA 1HEYA 4Q6BA 4TV9F 4JENA 4OJNA 3OC0A 2QR3A 3C3JA 4E33A 5JMOA 4PO8A 1QYDA 1BIFA 3NI2A 5EHIA 1XZ8A 2AOUB 2HIHA 3M4NA 1JKFA 2AD5A 2ZYUX 4JHLA 1DDIA 4WFKA 4G0OA 1KC3A 3TD2A 4YCMA 1E8DA 1QYIA 4WXHA 4JLBA 4NDZA 1BEEA 2CE7A 2VHUA 3HVJA 3L1HA 1UPBA 1ONPA 1M2HA 3GZNB 2GPNA 5AKXA 2BISA 3FNRA 3OZCA 1T2DA 4RHXA 4NMLA 2GDZA 2V7QD 2IODA 1B8OA 1MOZA 1N4AA 3LO8A 3VV2A 3GLUA 3GVPA 5LP6C 3PUZA 5CHEA 2CF5A 3C4QA 1U5BB 5D5QA 3TOVA 3RC8A 4S05A 3E2PA 5BPFA 2B1JA 2QYTA 1RTKA 3E5HA 4Z0PA 3EWAA 4PGGA 1SXJD 2D6FA 4QPDA 4IJMA 2IUFA 4QOFA 1SWVA 3NW9A 2QDKA 4TZ0A 3R6LA 4UEKA 1EQUA 5BYAA 1FYDA 4NBWA 3V1UA 3N0WA 5CGQB 5HRCA 3QX3A 2AN1A 3ME5A 2WLTA 3IBGA 5FTKA 3B60A 1H1TA 3D8BA 4FQ8A 4WACA 1UT5A 1FFSA 1D04A 1N8KA 1PK8A 1EFVB 3EGCA 3EVDA 2XSZD 3FDXA 4NYJQ 4RFLA 4ZVPA 4P1ZA 4CMIA 2UKDA 2COEA 2JATA 2ZP1A 1NLMA 4X7RA 2A1UB 2IYLD 2J7PA 3FFAA 2VDLB 2SKDA 1GOTA 1ZD3A 3A27A 4L5JA 1RYDA 1L7PA 4NR0A 3UXEA 3UQZA 2QRVB 3VR5D 2JH8A 4M9XA 4AXXA 1ESZA 2QP3A 2HZ7A 1KK1A 2XRMA 4H7IA 4CR7A 1JXMA 2AFVA 4ZICA 4JUFA 1T34A 2IZZA 1JQJC 1L7AA 1P44A 1ISIA 3EZXA 2E5WA 1Y1PA 4NBRA 5D7NA 4B40A 1EUDB 2G9UA 4W5HA 3IKTA 2CZCA 3OQ1A 4QICA 3TRHA 1ZD2P 1X42A 4CWAA 2H9IA 3ABZA 2OG2A 3A1SA 2P4UA 2XTMA 2ISSD 2WIDA 1MHTA 3Q7EA 2DJ5A 4MPJA 5DTJA 3ML1A 4KQMA 4Q34A 1I5EA 1KYZA 1CNEA 2EEPA 1US8B 1GHTA 2R60A 4G0QA 4Z51A 3UMMA 2IU3A 4NOKA 2D62A 6REQB 4BQRA 4EEZA 2HF7A 1U3UA 2ZB8A 2CN1A 1NBME 4XJSA 1NQVA 3IUQA 3GGSA 4BLUA 2P3QA 2C0QA 2B6NA 4LYEA 4NMHA 3ZY4A 2ETVA 1UOOA 3DC7A 1XCGB 1GA6A 1ZJWA 1G18A 2HHLA 1LW7A 1OY1A 4EHDA 2F43B 2OVBA 5ISMA 1MZPA 1VE9A 2PX5A 1VRCA 2XIQA 2OO5A 3CEJA 3FUVA 4U7PB 3SLRA 3S40A 3ZGZA 4ARCA 4XPIB 5JG7A 5IT0A 1B3BA 1GT6A 4O2BB 3VVBA 3SC6A 4M9QA 1XVUA 2DHCA 1O6FA 4MVXA 3H13A 1X1EA 2FG7C 4JFAA 1XJCA 4KJXA 4BVLA 4LOIA 3ZLVA 3R5HA 2ZKIA 1U4SA 3SF8B 4EI2A 5IDXA 1WP4A 3LW7A 1ULZA 2IIPA 2J3MA 4II2A 5EJ7A 1N5MA 1VSQA 2NZVG 3ETDA 3ZHXA 2FVXA 4C4AA 2V03A 3KD2A 4P4SA 4A0QA 3BB3A 2GYVA 5B3JA 2VZLA 5EKXA 2C83A 3IIMA 2RI1A 3PT5A 4UCXA 4PZ0A 1BQ4A 4BKQA 1FFHA 4P0TA 4PZEA 5D51S 2V7WA 3OLCX 4BXOA 3P9PA 3WADA 2FSSA 2V3CC 4JOCA 5DWVA 4F5EA 1EVLA 4RF2A 3R75A 1HQDA 5GONA 4CZ2A 1R5JA 5JMPA 4BBPA 1Q74A 1RZ3A 5BN5A 1DXQA 3AHFA 1DQYA 3PF8A 3NR2A 1H4SA 2RGBA 1CS0A 3PDUA 3AVOA 1P2GA 2I8AA 5HOQA 4BP3A 3SP1A 3ISTA 4NPHA 2C98A 3SYTA 3JYHA 3IH5A 1JIUA 3UBTA 3AI3A 3DO6A 1TD9A 4BIIA 2XHEA 3A1VA 1YRAA 4G01B 3JVUA 2AQIA 2FV8A 4UUQA 5JCJD 1W88B 3R8XA 2PKCA 2WJAA 4GPIB 3A25A 2BCGY 1W0JA 5JYEA 3L82B 3L9WA 5DEIA 4YPOA 2UV8A 3G1TA 3WO0A 4GLJA 1PDWA 2PUBA 4YBZA 5THQA 3UJAA 3G0GA 3JU3A 3ULKA 3WHLA 2XMZA 2F4VB 4JB3A 3GP3A 1VI6A 1OBFO 3N7TA 3M1LA 2FSPA 1P6QA 1LFDB 3EXIA 1FP2A 4LJSA 2Q1YA 1OSNA 1UC8A 2EV9A 4X8HA 5BRJA 3B3GA 5A4FS 3OHSX 1A0OA 4YCCA 1NI3A 2GEVA 5K0NA 4F21A 4TKVA 4RE6A 3QWAA 2WAYA 2XA2A 4UXIA 2F90A 4EFLA 2EF0A 2X6TA 1HDIA 4NV3A 3GGJA 5EPUA 3BOSA 3CUVA 4QU0A 4EH1A 2ZTUA 3CFYA 3DHNA 3LLSA 3I28A 4DA4A 3PGKA 3OFVA 1X8JA 3DOUA 3IPAA 1LPPA 5LLTA 5I9TA 1T91A 5KREA 4L9AA 1YE8A 1YOBA 1ZMXA 1DB3A 3KZMA 5CB4B 2LCQA 4S2EA 4QBGB 1L8XA 2KM1A 1QVVA 2XY4A 3KKPA 3O31A 4PV7A 5FO1A 4YWJA 5KHAA 3MTEA 4K87A 2O07A 2AN3A 2A57A 3U31A 1RKUA 5KTTA 3GWGA 2BMJA 3GUVA 1CRQA 3FYSA 1UJ4A 2XQJA 4E11A 3E9CA 3AVWA 4Y1FA 2Y68A 4I5EA 4MYSA 4UXJA 3HUUA 1WAMA 3HUFA 3KIPA 3UJDA 5FX2A 2Z5GA 3K0FA 4YR7A 1OLXA 3ZNPA 2AMYA 4Q93A 3O74A 2YVAA 1L4GA 3CCFA 3H65A 4ZHSA 2XT6A 3P71T 5D7BA 3AI1A 2ATEA 2YIVX 5G4KB 1XAHA 1PSZA 1AN9A 1W0JD 4OU4A 4QUIA 4REQA 3GEEA 4ZIRB 1SY7A 3IBSA 1BOOA 3VGPA 4YCLA 4ZPXA 5LUAA 1EIWA 1Z4QA 3PVSA 5DO9A 1G5TA 4MSUA 2J5KA 1NVBA 2C5EA 3O4VA 1CJSA 3H84A 3CJRA 4HUJA 1PFKA 4NYIR 2W2MA 4Y2RA 3JVDA 3UT0A 2CDBA 1GKYA 5FNZA 4UAJA 2JAOA 2OV2A 3KAJA 2PL5A 4JLWA 4DCUA 5KYGA 3NU1A 3VGJA 2XVZA 1VYHA 1QJ4A 2GUGA 3KLOA 1OLSB 3KR1A 3L6BA 1JBKA 3AY6A 2AWOA 3KVNA 1WUYA 3F49S 3RYCA 1HRKA 2R79A 1R0XA 4MIKA 5LP6F 2JLAA 1LJUA 2WWWA 3VNRA 1VLMA 1H6AA 1L5NA 1C7JA 3PYXA 3I45A 4FW8A 4FNAA 2QBYB 1HY3A 3EUEA 4FTWA 4NZPA 4CR6A 5BXQC 1GD1O 3K0KA 2Y0DA 2GJ8A 4KMSA 4LJYA 3PDIA 1FXSA 3VMFA 5A02A 1UEJA 1PJZA 1SU4A 1XQ1A 3P0JA 1P5JA 3C85A 4EGCB 3VFDA 1SKAA 3T9AA 2QX9A 1FZTA 1D2MA 1G8YA 3BJEA 1U2GA 4WNAA 2C58A 3I30X 3NO4A 1ZKMA 2YRWA 5E4JA 3LWDA 3KETA 2C95A 3DE3X 4I9UA 3TZHA 3EPHA 3KRTA 3H9GA 3ROQA 3RC9A 1USWA 2BKEA 4D0LB 3L5OA 3A14A 1MGPA 3USES 1DOHA 1I2DA 1Q84A 4Q3DA 4NWIA 3ASYA 2PWZA 4RTPA 1EU1A 2CCJA 3COYA 2ATXA 2VCYA 4EATA 5CLFA 1XE3A 3FPFA 2P75A 1ORTA 1WXGA 4XM2A 5LQJA 3AGQA 1WEHA 4BQPA 2BBSA 3ZIAD 1DPGA 2XUGA 2D0OB 1OCEA 2IHTA 3H0EA 3P5BA 4JNKA 3WSVA 3ZS8A 2DPGA 5CDFE 3EGIA 3U4QA 3EW9A 1NASA 3H19A 2JGJA 2XMSA 3ESAA 4FMCB 4GM1A 4N5IX 4PYLA 2R8XA 4RZ2A 4PNZA 2IOFK 4YMSA 3U7JA 2UZIR 4PQEA 4E5VA 3FYUC 4MQLA 1XDGA 2D0DA 4U5QA 4BRWA 3ZJTA 3A2MA 4Y2HA 1A8IA 4KQXA 3UVEA 4CTKA 4KFCA 3NVMB 4TTAA 3RVNA 3BH0A 1F2TA 1PS0A 4Q9NA 3OCJA 3HXQA 1V4NA 1X92A 1R27A 5EPOA 4MV4A 1C8BA 3M6AA 1HURA 3S44A 4N76A 1XTPA 4RKQA 2CJFA 1XWFA 2H17A 4FX5A 3VTFA 3JASB 4IVPA 3L1KA 1R4MA 3KHKA 4K86A 4MOWA 4B7XA 2B92A 3OY7A 4K40A 3I64A 2F62A 2O2CA 2C99A 4AC9A 4LZPA 3DVQX 3NPAA 1P1JA 2N3ZA 5F21A 3T1TA 1DFHA 1T2AA 1L4FA 3L0YA 2X4DA 3TW4A 2R8PA 1GZSA 1CHDA 2JVIA 1OX6A 4G89A 1JWAB 3Q10A 4B3XA 1H3EA 3FTCA 2PSHA 5K4GA 2B7CA 4AJ1A 2HA4A 3EFEA 3GQBB 1NIPA 4UFNA 5BORA 5CCBA 5E2IA 4BZWA 2I2XB 5JSZA 4DMGA 3G8AA 1BDJA 2GMWA 5CH8A 5EE1A 5H70A 2H1HA 1KVUA 3HA7A 3NBZC 5CRIA 4Z8XA 5F33A 1YFZA 2FCAA 3C24A 3LGAA 3M7IA 4DN6A 2VQ3A 3WFJA 3OBBA 1YB7A 2FFBA 2VO1A 4QDXA 3AR2A 3R0QA 1A9XB 1J42A 3NP9A 1KI3A 1FQJA 4G4GA 4LDAA 2R6HA 1P8JA 4G1BA 1R1DA 1Q11A 1FUEA 1Z0IA 2F3TA 1ZR2A 3NFRA 1OTXA 4TLMB 4HYYA 1P7PA 3LK6A 3R8FA 2CW5A 2YDXA 2WJIA 1U0SY 3U2QA 3P45A 5CA1F 1A9SA 2WT9A 4P3NA 3MXTA 2YJ4A 2HNKA 2OO3A 3MJSA 4DKXA 4ZJZA 5AM0A 5CDYA 2C7QA 2LXNA 3WKCA 2Y4NA 2UAGA 2XNHA 3OQVA 5EVJA 1P17A 1MORA 5I45A 1P45A 3IUSA 4LRWA 5A3QA 1U9ZA 1EJ6A 3PXXA 5AR1A 2VQEB 4QDOA 4DDVA 4N7JA 4ZQGA 1JN0A 3RSZA 3RV4A 1OFVA 5DM70 2IX9A 3D6VA 2BGWA 4K6FA 3FAKA 3FZEA 3KZOA 4IV0A 1XVVA 1Z4JA 2SBTA 1N6HA 1NFFA 4XDZA 5E6RA 3ESBA 3GJ8A 1DWUA 1B26A 2AN9A 5HDBB 4FFVA 1DOAA 3OM8A 4BO2A 1AZSC 2FFRA 4L8VA 1M0EA 1XD8A 2ZLBA 4IMJB 4TMKA 2XDWA 1WV0A 3G2HA 5JBIA 1V41E 2J0UB 1CE8B 2AOTB 1OYWA 2WZDA 3FGNA 3JZFA 1CF9A 1TKAA 1GKUB 4ESEA 4IH4A 3IQWA 5L53A 3QYPA 1YZYA 2WFMA 3HV2A 4HXYA 1E32A 1P4SA 1E2GA 2EZ9A 4Q4AB 2LD4A 4QHSA 4AS3A 3MQ2A 3W9SA 3HNOA 5ED0A 1KXZA 1ZN8A 3HDVA 1HNXB 4QOEA 4RV9A 4G0VA 4FZVA 4MVJD 5T6MA 5JYCA 1Z2PX 3HFRA 2EKDA 1PJ8A 1UP7A 4WMLA 2R5FA 2GI4A 4QM7A 2Y99A 1W5SA 3D7RA 1M83A 3EB9A 2CV1A 1OFIA 1IQRA 1LPSA 2AUMA 1R0CA 2TYSB 2YBDA 4HNAA 4QUBA 3QVWA 5EJGA 5FFNA 1I5OA 3AONB 4IJ5A 4LBYA 1ADGA 3KT0A 2H3HA 4WK4B 5DBFA 3WNQA 1L5FA 4X1KA 1PEDA 3LYLA 3Q8XB 4GR4A 5KWIA 1H9CA 4BB9A 4IIJB 2PS1A 1A1VA 3A9CA 3PNKA 3VYRB 1H2RS 2E3JA 3N28A 4C06A 4ENSA 4UQLA 4LI3X 2WOOA 5TB5A 1REQA 2NUTB 2OVFA 3AF4A 3Q3VA 3K35A 4M7PA 3QLTA 4NCXA 2G5TA 3ZCXA 5C2JB 1XTTA 1VPWA 4OHZA 1RHRA 4MP6A 5EIAA 3WLNA 3WYFA 1CRLA 1KGDA 1W9HA 2J9FB 5B1YA 2A92A 1CZRA 1EA7A 3GJ7A 3JAWA 1MCZA 2YJGA 4HS4A 4R6XA 2PFKA 2ZT8A 4C0JA 2XYRA 2VTVA 4GQBA 4XYEA 4BFZA 4DLKA 4BNDA 4YYZA 3TG2A 2UXCB 3KXLA 1A98A 4MH0R 1LQ2A 5BYJA 3SWWA 4IW3B 4HDMA 2QUIA 2CVZA 2VR1A 2WU3A 3IP3A 4EHHA 1QO0D 1RM4A 4AIRA 1EVKA 1FTWA 1LPOA 2PSDA 5F76A 5B53A 4D74A 1W75A 4IFTA 5KDLA 3G2KA 3OPYB 3PWKA 4Q4JB 5J2TA 2ID4A 4J3JA 5T4BA 1NQTA 4BV3A 3EQ8A 4DDWA 4RS3A 1KSFX 4TQ9A 5K01A 5GJBA 4D8UA 3CVWA 2IOFA 5DLPA 2B61A 3ENNA 3N8HA 4L73A 2P62A 4PAOA 5TMEA 3VAYA 5AW0A 2PZJA 3OEED 5EMKA 2LKDA 5T3YA 3STHA 2MR6A 4DARA 3BIFA 4AVYA 4S0ZA 1XD9A 1XROA 2QMZA 2FWRA 3UAXA 5JXJA 4GZ5A 3U61B 2JLS