4BVJA

Structure of y105a mutant of phaz7 phb depolymerase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
343
structure length
343
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNAHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPYNAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical Analysis and Structure Determination of Paucimonas Lemoignei Poly(3-Hydroxybutyrate) (Phb) Depolymerase Phaz7 Muteins Reveal the Phb Binding Site and Details of Substrate-Enzyme Interactions.
pubmed doi rcsb
source organism Paucimonas lemoignei
molecule tags Hydrolase
molecule keywords PHB DEPOLYMERASE PHAZ7
total genus 128
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature ec 3.1.1.75: Poly(3-hydroxybutyrate) depolymerase.
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bvjA00
5EHQA 4BYMA 3FCYA 4LXIA 2HA3A 5HQ3A 2BJHA 1BS9A 1QONA 2FJPA 4FKBA 4BTVA 4Y2UA 4G8CA 3WZLA 1ZJ5A 4QEKA 3IDAA 1U8EA 4LYEA 1CUVA 5AI6A 3M82A 4MEAA 3OOSA 3FNBA 5DWDA 2B9VA 2DSNA 3SK0A 3C8DA 1EDDA 1FFAA 4UBMA 1CR6A 4PW0A 2PSEA 5F4ZA 1IZ7A 1ACLA 2JGFA 1YR2A 1XFDA 5AH0A 2G4LA 1GPLA 3DNMA 2JGJA 4KAJA 3I1IA 4WFIA 4WDRA 4L72A 3D7RA 1UWCA 2HRQA 3EBLA 5JATA 3H17A 3G9UA 3SWWA 4BP9A 5AK3A 4WCVA 1DWPA 2OCIA 4GW3A 2C5FA 4Y2TA 2VF2A 3K2IA 4BCDA 1CUHA 5D7BA 3W04A 1M33A 5LKRA 1ZGCA 1IUNA 3VXKA 5LLSA 3G0CA 1GQSA 1TAHA 3F67A 4BRSA 1SCQA 1EK1A 3ZLUA 1YA8A 5CURA 4BATA 4MYDA 4X94A 4GXNA 3FLEA 3VJLA 1ORWA 1OILA 4JNCA 1CFJA 5ALXA 4JEIA 2AJ8A 3I2GA 1CQWA 5AHXA 2ORYA 3B3QA 5HK8A 4DNQA 4UHBA 4AO7A 4X7BA 5KREA 1RWQA 3JW8A 1XZJA 4B82A 4E14A 1QZ3A 5K3EA 2WIJA 3U1TA 1BE0A 4HZGA 4WFJA 1CUUA 2GBIA 4EA6A 2G5TA 4BVJA 3I2FA 5LIPA 5ALIA 1BCSA 3G0GA 1GPNA 1T2NA 2IX9A 3C6BA 3H2KA 4MYSA 2K2QB 1GKKA 2QVBA 1IUPA 2BUBA 1DQYA 3KOOA 4UFOA 2XUDA 3WIBA 2XMDA 1AKNA 4X6XA 3L1JA 4J0DA 4CI9A 1A8SA 1EB8A 2Z8ZA 3G7NA 2WHQA 4FTWA 4HAIA 2WFLB 4YK7A 4AN0A 2WG1A 1G4HA 3C70A 4MXDA 3B12A 1XLUA 1F6WA 4HXEB 4UBOA 3WKBA 1DQZA 5AJHA 4FLFA 1KU6A 5C8ZA 5LZ7A 2WILA 1QOZA 5AIBA 5FRDA 3MUOA 2BFNA 3WWDA 2VT6A 5HF5A 3L1HA 1IMJA 2XMZA 4Y2XA 2C0PA 1DWOA 2J3DA 4KAAA 1W6RA 4QDOA 1XZIA 3PFCA 2ES4A 4PSDA 2QTBA 3KWFA 5CH8A 1O6GA 4BE9A 3BJMA 1E89A 1BN7A 5AM2A 3FAKA 5DTJA 3M3DA 4I19A 1CUDA 1R9MA 2HHAA 4N5IX 4AN1A 4AZ0A 4K5QA 1N5MA 4N8SA 4V2IA 1X2BA 1IZ8A 1E8NA 1XZCA 3AIKA 5SYMA 4UBIA 2HU5A 2PU7A 1E66A 3G9XA 2VT7A 1YA4A 4GHWA 1JI3A 3O4HA 2DHDA 4OPMA 3A70A 4IO0A 5JD5A 4Q1VA 4X97A 1YCDA 2H7XA 5CXUA 3C5WP 4K6KA 1USWA 3W06A 1J07A 1ZI9A 2Q0XA 4GLBA 1HQDA 3ESDA 3DL4A 3O4GA 4MEBA 5AKLA 2AJBA 2QJWA 1FSSA 1J1IA 5FDFA 2XQJA 2RONA 1UZAA 4RE5A 3EQ9A 4QE3A 1XRPA 4FMPA 5LP1A 3WI7A 1VA5A 1YSCA 2CZQA 4P9NA 3EQ8A 3CCBA 3I6MA 3STVA 4AQDA 1NU8A 1XRMA 3A2MA 2GBCA 1EA5A 3DCNA 3DJYA 3OTQA 1J06A 2PL5A 4AMZA 2BGNA 5CT5A 2PUHA 2XMSA 5HF9A 1QLWA 4IH1A 3C8HA 4X6UA 4INZA 4AB1A 1CEXA 3R3WA 3QMMA 5DYYA 3DL7A 5HF8A 2RHTA 4TGLA 2HM7A 1EX9A 5A71A 2WFLA 3DOIA 3MVEA 2OPHA 5A2GA 3D5EA 1WHTA 1FFBA 3LIIA 4BRZA 4C4XA 3V1LA 2I3ZA 4PQEA 4FFVA 5E2IA 3UUEA 5FLKA 1E5TA 3WWEA 4EY8A 3IIIA 3AILA 2XI4A 5AKYA 1ZD2P 5CXXA 5ALVA 2ZVDA 3R3ZA 2VA9A 5DNUA 2OCLA 2JIDA 4AZ3A 3R3YA 4CCWA 4C89A 1BCRA 4QWWA 1UT6A 3STXA 5AK5A 5DJ5A 4ZWNA 3JYHA 5CT9A 5ALYA 1SCIA 4N8EA 1QO7A 2WHPB 3Q8WA 3A2NA 4W1RA 1B41A 1ODTC 2XQFA 4X71A 4BDSA 5I9IA 1H2XA 3YASA 3NUZA 5YASA 1EDEA 1CUXA 2X5XA 3FOBA 1QIEA 4H7HA 1EVQA 1AZWA 3IUJA 5BOVA 2QKYA 4Y2JA 3H19A 4JYMA 4UUQA 4G5XA 3QH4A 3H1AA 1SCKA 4U2FA 1CUEA 1NX9A 3IVMA 5DTIA 2RHWA 4U2DA 3IURA 4JUIA 5JZSA 2XUGA 4B6GA 4ZREA 5LZ2A 2HU8A 5ALZA 2ZJ6A 4W1SA 5AOCA 4EY4A 5DLPA 3CCCA 1P0QA 1A7UA 3F98A 3M81A 4A16A 2C0QA 2JGLA 3WL6A 4UBKA 1J2EA 1ZIXA 2O2IA 1FJ2A 4UPDA 1YS2X 1JKMA 5IKXA 2DCMA 3G0IA 2O2GA 4KJXA 1LPAB 4H7FA 1VJ5A 3O9VA 1T4MA 2WM2A 4CG3A 2VJAA 1EB9A 3ICWA 3T4UA 4NS4A 2DQYA 3WWPA 5T4HA 3WA6A 1EVEA 1CPYA 2HA7A 2XUQA 1BN6A 3D2AA 3LLCA 1JT2A 4KRYA 4B0PA 5ESRA 1CUYA 5ALOA 2H7YA 4G9GA 4NMWA 2CMFA 2VJCA 1X2EA 2JF0A 4G4JA 4CIAA 5T4EA 4RNCA 3ZI7A 1DX4A 1DT5A 2OQIA 2WIKA 3WL8A 3D2BA 4FBLA 3IUMA 4ROTA 5DNVA 1CUJA 4Y2VA 1TQHA 2WFZA 3GROA 1A8UA 1LLFA 2JEYA 4KE6A 3WWCA 2HRRA 2AXEA 2XQGA 3SC2A 3IULA 4ZXFA 3VISA 4DSZA 4Q34A 4KEAA 4BZWA 5LZ9A 1MX9A 3V9AA 3VDXA 2Y2UA 3E4DA 4FNMA 5CT4A 4BP8A 1WCYA 3TJMA 4QDXA 2HDWA 5LZ4A 2OG1A 1QFMA 3OC0A 3GUUA 2OGSA 4KAFA 3BXPA 2AJLI 2DHCA 5DNWA 5A7GA 1N1MA 1F0PA 1S8OA 3I2JA 4FOLA 4FHZA 2IIVA 2VJBA 5E4TA 1GT6A 7YASA 5JIBA 1L7QA 2RI6A 3E3AA 1VXOA 1UOOA 3DKKA 5C7YA 1G42A 1EHYA 3BWXA 3WKEA 4YPVA 5AI8A 3H04A 2CBGA 3FVTA 5IH7A 1LBTA 1AX9A 4EY5A 2YXPX 1QIJA 1JJBA 1E8DA 4DMCA 4B0OA 2JGIA 3FYTA 5I7UA 5HK9A 3ILSA 4PNZA 1VE6A 2XE4A 4NVRA 3HXKA 1GXSA 4HVTA 2XUJA 3S2ZA 2ROQA 4DNOA 1C4XA 1G5FA 5ALLA 4DSAA 1DU4A 1CUSA 2VTVA 1K63A 4EHBA 1I6WA 1LPNA 2DHEA 2OGZA 1JFRA 3HSSA 5FUMA 2I3DA 4QZVA 1ETHA 3KDAA 3I28A 4DM7A 5FP0A 1QTRA 4WY8A 1Q83A 2WUEA 5AI9A 2VATA 5ALPA 5IVDA 4DTCA 1MNAA 2RGUA 2OXEA 1QIDA 4U2GA 3G0DA 4C01A 4X85A 1TCAA 1WPRA 3FSGD 2JGEA 5EI5A 1LZKA 3PFBA 1XLWA 4UHHA 4EZIA 2VJDA 4U2CA 4E11A 1GPKA 2C7BA 5CW2A 5AKXA 2QT9A 4EY6A 4CIBA 1B6GA 3NGMA 2OCKA 2WHRA 1WOMA 1R9NA 5T4BA 4M0MA 1CIJA 4J03A 2WTNA 2Z8XA 1XRLA 1QE3A 2XMCA 4U2BA 4F5ZA 4H35A 2GBFA 1YS1X 3BL8A 3R41A 2VAXA 2ZYIA 2FJ0A 1UKCA 5ALNA 4W63A 3I2IA 2C5GA 2WG0A 5C81A 2PSHA 3QPAA 2BKLA 3FCXA 1TKRA 2OAGA 1LNSA 5JALA 3BDVA 3QPDA 5JAOA 1TRHA 3FYUC 5AI0A 1W1IA 1LPBB 1CRLA 1QIFA 1WM1A 2YH2A 4X92A 5FPPA 4H7JA 1W76A 3ANTA 5LYYA 4X6YA 2Y6VA 1DINA 2VAVA 4ARAA 3V1MA 3VKFA 2XB6A 2XUAA 2HL6A 3MUNA 2QRUA 4ZV7A 4QNNA 2ZYSA 1XZAA 3TEJA 4C4ZA 4Q3OA 1LZLA 2W22A 4NZZA 4AMYA 5AKGA 3IA2A 2JGKA 2AJDA 2Z3ZA 4BB0A 5A7HA 3RM3A 4H0CA 2O7VA 5ALSA 3I6YA 1HLGA 4L0CA 2QXUA 3T52A 2I03A 2WUDA 1ACJA 2PUJA 2I78A 3SX4A 2WFMA 1H23A 5AK4A 3D4LA 5IVKA 1UK9A 5CRIA 4X00A 4XJVA 3HYSA 4PSUA 4QLOA 5AM3A 3BIXA 1CUZA 3I2HA 1Y37A 5ALUA 3PF9A 1LPSA 5AICA 3G9ZA 3Q0TA 3QVMA 5K3DA 5FXMA 3AZPA 1ZICA 1ZIYA 1RP1A 1CQZA 3RK4A 5ALJA 4ETWA 3D0KA 5JARA 1P0MA 2QOEA 1KEZA 2QR5A 4G8BA 5ALHA 3C87A 4KE8A 2D5LA 3OG9A 2EDCA 5FOQA 2XQKA 4LHEA 3W9UA 3A6ZA 4BTLA 1JMYA 2XT0A 4H77A 2JEZA 4LKOA 3WQHA 4XWGA 4ZV9A 1BRTA 2Z3WA 3AZQA 3H2GA 4N8DA 4MWSA 4UHCA 1SOMA 1LPMA 3C6YA 3TRDA 1MO2A 4M0FA 4GEGA 3WL7A 5AK6A 2BAGA 4BAGA 3WJ1A 5BWCA 3WKCA 2V98A 3PICA 2EEPA 2WTMA 3K6KA 3A2LA 4ZGBA 3GA7A 4DMHA 5DYTA 3DQZA 3C5VA 1E8MA 3STTA 4CG1A 3V1KA 2HADA 4OU5A 4BZZA 3FYUA 1MN6A 4BAUA 1TCCA 3WK7A 1DT3A 3F9CA 3H2HA 1XZGA 4B84A 4F0JA 3H2IA 1IUOA 3JWEA 2XQIA 4FLMA 2OAEA 5AIAA 3R3XA 1QJ4A 4E15A 2HA4A 5ALKA 3DD5A 4UFNA 1VOTA 4B81A 1CUAA 1P0PA 5CH3A 4HRYA 2CEKA 3RARA 4GWLA 5K3FA 2XUOA 4MWTA 3STWA 5AKHA 1ZOIA 3WK6A 3WIOA 1DX6A 4WJLA 3ICVA 3I1YA 1UK7A 2DFPA 3W05A 1WHSA 4MJ3A 1MJ5A 1H2YA 3WK5A 3H1BA 3V48A 3LIPA 5HKBA 1XLVA 5ALFA 3F97A 4C87A 4H7EA 4LIPD 5AO9A 1H2WA 5E4JA 4LYDA 3R40A 4HS9A 1HL7A 1YB7A 2RIPA 5EHZA 4BBZA 3DEAA 4GECA 3D3NA 3PF8A 2QMQA 5JANA 1EDBA 1LPPA 5ISMA 3CN7A 1ZGBA 3ZPXA 2B20A 3HI4A 2J4FA 3DYIA 3G9TA 5HCUA 1EK2A 5IVHA 1WB6A 2P8SA 2XUHA 1AQLA 4FLEA 1GQRA 5JADA 3DS8A 3O4JA 4UHFA 3FYUB 4BCBA 2W6CX 1BEEA 1QIIA 1R1DA 2GYUA 5AOBA 5AP9A 3ESCA 3H18A 4IH4A 3GFFA 4P93A 1UOPA 2PM8A 2UZ0A 5BWBA 2XUKA 2PVSA 4P08A 1D07A 1CV2A 2ZSHA 5EGNA 3WYNA 1H2ZA 1X70A 3HJUA 5HFAA 2HFJA 2R8BA 5JYCA 4HTAA 5AM4A 1XRNA 1XZHA 5FV4A 3HEAA 2OQVA 6YASA 3WYDA 5I8PA 3R0VA 1MT3A 1R3DA 4UHDA 4M0EA 5ALQA 3R3VA 5AOAA 1MTZA 1UOQA 5CBKA 4EBBA 4EY7A 2V96A 3OPMA 1U4NA 2LIPA 1Y7HA 2HFKA 1FFDA 3KSRA 1WB5A 4WFKA 3UMJA 3ZLVA 4FNGA 3WJ2A 3K9BA 1CUBA 3ZV7A 3ANSA 1QIGA 1TCBA 4L3WA 3CN9A 1BU8A 4UBJA 2GZSA 3OURA 1YASA 4G9EA 1E3QA 4B9EA 4Y2PA 1EH5A 1AGYA 1ZI8A 5FPQA 5ALGA 2D0DA 3OM8A 2WG2A 3WK8A 4UHEA 5K3AA 2XLBA 3PDCA 2BGRA 2PBLA 3VVLA 1W52X 4Z49A 1GZ7A 1W4LA 2XMQA 3WL5A 5D6OA 3DKRA 5DYWA 4W1PA 1LPOA 3IUNA 2GYWA 4QDUA 4AX4A 1FFCA 1NU6A 4YX9A 1QIMA 4QA9A 5AKEA 1ODSA 4B85A 3C6ZA 4BCCA 3NWOA 4XX1A 4L9AA 3GZJA 1THGA 1N8SA 4AO6A 1PFQA 1HBJA 2Y1KA 4G4IA 1Z68A 1XRRA 3HACA 2WUGA 1EXWA 4B7ZA 3U0VA 4FFWA 4LXGA 4OD0A 4K2AA 4PSCA 5AKJA 1WPXA 2WIGA 3FLAA 3STUA 3DDUA 3EQ7A 4W9RA 4BC0A 4C6HA 2XUIA 4CG2A 2DR0A 1XROA 2BCEA 3QPCA 5ALDA 3C43A 4PO3X 3W9BA 2WQZA 4X90A 4KRXA 5AM1A 1AMNA 4ZI5A 3B5EA 1OXMA 1TK3A 3WK9A 1F8UA 2ACEA 2WU3A 1CUCA 2EDAA 4DMKA 4H18A 2DQZA 2WU4A 4DNPA 1K4YA 1RYYA 3QM1A 4IQ4A 4X91A 1A8QA 5KWJA 5A7FA 5J3JA 4IHAA 2VSQA 5EFZA 1ZD4A 4G8DA 2V9ZA 2QZPA 3LP5A 1UXOA 3RLIA 4Q3KA 1ZI6A 5JAUA 2WJ4A 1XZMA 1YB6A 3HABA 1WB4A 1YAJA 2PX6A 1VLQA 3EIOA 1MU0A 4KACA 4J7AA 5AKIA 2JBWA 4GI1A 4OYYA 5LZ8A 3AINA 3PUHA 4DLNA 3DOHA 5AKZA 4QLAA 1VA4A 1CUGA 1L7RA 4OB6A 1UFOA 2WSLA 4TPKA 4Y7DA 3C6XA 2QJRA 5AM5A 3GBSA 4Y2QA 3ZLTA 3BDIA 3HZOA 2XMBA 1W75A 2XLCA 3EF3A 3D59A 2ACKA 1XQYA 3QMWA 1CVLA 4J0CA 4Q05A 4FWBA 1MX1A 2WIDA 5JD4A 1CUWA 3FBWA 2OLEA 2NW6A 1MPXA 4X93A 3FVRA 2PPLA 5HFNA 3BE8A 2OGTA 1XKTA 5ALTA 4B9AA 1ZJ4A 2C58A 3LCRA 1SFRA 5CH5A 4OSEA 2GBGA 2XMGA 5ALRA 4G4GA 4XVCA 4C4YA 2HA0A 4A23A 4PV7A 4F21A 3ZWQA 5BV7A 2VQ6A 2WHPA 4J0HA 1JU4A 4KE7A 5CTAA 4J3JA 5EIEA 3BIWA 5JZBA 1DTEA 3O4IA 1LGYA 2IITA 1UKAA 3I2KA 4QWMA 5AI5A 4K6HA 4Y9SA 1EI9A 4P92A 1JJIA 2ONCA 4PF1A 1U2EA 4OYLA 3CXUA 3VJMA 1BROA 2WLSA 2YASA 4FBMA 3E1GA 4GBGA 3I6ZA 3NOXA 5K3BA 2JGMA 2Y6UA 1AUOA 5K3FB 3VJKA 3STYA 4FDMA 3QYJA 3WLAA 5FKJA 4ITVA 1XQVA 2WKWA 2J4CA 1CUFA 2HU7A 4K6GA 1VXRA 2FUKA 3KXPA 3AJAA 2O7RA 2OCGA 5HZGA 2B4KA 3R3UA 3IUQA 3ESAA 4DYHA 3N2ZB 4QDTA 1MX5A 1XRQA 4J0IA 1K6EA 1YAHA 2WUFA 3WZMA 1UK6A 1CUIA 3QMVA 4Y2SA 5AKKA 4X3CA 3FWHA 2PU5A 1BEZA 3PI6A 3IB3A 4TVKA 3LS2A 2QUBA 3RKSA 4BDTA 2CJPA 3F8SA 5HF6A 4JH0A 1GKLA 4U2EA 4IH9A 4HRXA 4CCYB 5AM0A 4BC1A 4BVKA 3VVMA 1XZKA 5ALMA 3F96A 3FSGA 4RGYA 2H7CA 4Q3LA 3N0TA 1XKLA 4S0XA 4CCYA 2ZSIA 1VE7A 1VZ3A 1K8QA 2XUFA 1ZD3A 3ESBA 4ARBA 4EUSA 1TIBA 2G5PA 2VEOA 3AUKA 4E46A 1JMKC 2R11A 2B61A 5SYNA 1XZFA 2O2HA 2BUAA 1PV1A 5E4YA 1G66A 4KR0A 1XQXA 3M83A 2ECFA 2PKYX 4H7IA 2ZYHA 5LKAA 3HRHA 1FFEA 2V97A 3O95A 3G8YA 5D3KA 4BE4A 2G63A 4HXFB 3ED1A 3O0DA 3WKDA 1O6FA 3AZOA 4MQLA 1LBSA 2WIFA 3WKAA 4BVLA 5T4FA 3C45A 2J3QA 3UUFA 1UK8A 1R50A 3W2TA 1VKHA 1F0NA 1N5RA 3QZUA 4AO8A 4DIUA 1XQWA 4H7DA 4A5SA 4KE9A 4X95A 4EB0A 4J0KA 3BJRA 3WMRA 1HKHA 4OUKX 5CMLA 3HC7A 2QM0A 1R88A 1ODCA 2X8BA 1QFSA 4H7KA 3KWJA 1QIHA 1ZD5A 3IBTA 3PE6A 4D9JA 2C4HA 3AIMA 3S8YA 4O08A 2ZYRA 4RPCA 3BF8A 2ZJ7A 3DYVA 2QUAA 1XZEA 1HDEA 1QO9A 5A6VA 3G02A 5JD6A 1GGVA 2AJCA 1SC9A 2CKMA 4DNFA 4UFPA 4HXGA 1MNQA 3WK4A 3AFIA 3PUIA 4UBLA 5CT8A 5EIAA 2X76A 5KWIA 1QTIA 3KD2A 2YYSA 5HQ3B 2Y2VA 5JAPA 1XZBA 3WWOA 1XZLA 1L7AA 4OCZA 3HLKA 4QDZA 5IVIA 4XIIA 4WDQA 5A62A 4J0JA 1OCEA 2PSJA 5JZ9A 4Y2YA 1Y7IA 3L1IA 1AURA 3X3HA 2CB9A 4N5HX 3H0CA 2E3JA 4Y2RA 2WJ3A 1KU0A 4J0GA 4RE6A 2RAUA 2HIHA 1AC5A 4BAZA 4OB7A 1CLEA 3GELA 1U65A 4KYVA 4MQMA 4W1QA 3WA7A 4LXHA 4C88A 1PJAA 1K5PA 2GZRA 1JU3A 1Q0RA 5ALEA 5C8VA 2H9YA 3E0XA 1P0IA 2WJ6A 5JASA 4JYPA 3V1NA 1IVYA 1C7IA 4Q82A 2HA6A 5D3ZA 3QBJA 5EIHA 1DWQA 1UKBA 2HA5A 4G1FA 1MAHA 4B80A 4I3FA 2QS9A 5K3CA 1HPLA 1THTA 3TGLA 4ZRDA 3QITA 2HA2A 2GYVA 4OB8A 5K5EA 1JJFA 1Q84A 4AXBA 1C7JA 2QXTA 3DLTA 3FLBA 4I4CA 2H1IA 3AIOA 4DMFA 1EINA 3D2CA 2Z5GA 5EHXA 3O9MA 2BUCA 1R4ZA 3BF7A 5H3HA 1ORVA 5JAHA 4B83A 2XDWA 2XUPA 5CT6A 2ZJFA 4UBNA 5EHNA 5LZ5A 2PSDA 1H22A 1ISPA 5AI4A 3P2MA 1MAAA 2XMRA 1QGED 4YASA 4DGQA 3G0BA 2CUTA 1A88A 1QIKA 5ALWA 4F60A 4WY5A 1XZDA 2FX5A 2PSFA 4OU4A 3H2JA 4GDMA 5KBYA 5C8XA 5HKAA 3MGAA 1Q0ZA 1VZ2A 4CFSA
chains in the Genus database with same CATH superfamily
3ONNA 2QN3A 3KDPA 1TW2A 4FWIB 2AK2A 3PK0A 2C7VA 5DSTA 3ZD6A 4HLCA 1C4WA 1C30A 1UKVY 1YI0A 4PLFA 5HQ3A 1A4XA 5JH7A 2VQFB 3GRCA 4DB2A 4L5AA 2D13A 1H9AA 4NBWA 4A0QA 3L0OA 4WNAB 1XYYA 3L0IB 5FL3A 1RWPA 1Y3FE 2PR2A 2GQ0A 4G8CA 5CIWA 5TPWA 3UK6A 3L7DA 2IV7A 2FOXA 1IONA 2VPZA 4EI7A 3T1HB 4CJXA 5FHQA 3UWKA 5TNXA 4QEKA 4K7JA 4YMLA 1KR2A 3DUWA 1P2TA 3RYHA 3ZHQA 3WIVA 1GTSA 5KTRA 4P0PB 1T10A 2JGDA 3BMNB 3U3XA 4MW2A 4BVBA 1PR4A 2FSGA 1BA3A 5KOJB 3RHZA 3OOSA 2DSNA 3SK0A 1XELA 4RVHA 3WGTA 5FI3A 4UBMA 3PNQA 1NG9A 3GPLA 3I0MA 3TK1A 1NQUA 2KI5A 2PSEA 2C92A 4QHTA 4DJ5X 2DUMA 2ZXEA 5EE5B 5F4ZA 3OJLA 4Z3OA 2NADA 2V7TA 2GS9A 1ULSA 1XVLA 2AEEA 2EP8A 5LLDA 2Y71A 3G5TA 1B0UA 1D4FA 3ER8A 1JBQA 2B8EA 1KBZA 3FIJA 4LN1A 1AZSC 5EKXA 1OBFO 3RYHB 4NCIA 3I1IA 3WRVA 3FWZA 5FUBA 4S35A 3M1IA 4AT1A 3G7UA 3JALA 2PVCA 1UWCA 3D4NA 4QM7A 4TYWA 5JATA 1OIWA 4JUFA 1FP4B 2OESA 3KR0A 2FMFA 3IHTA 3SWWA 3ICEA 2QTCA 4UU7A 2NLOA 2PBRA 3A6KA 3EIXA 2Q3HA 2V6BA 1F8GA 2IYAA 2QP4A 3P2YA 3UJDA 4L9SA 4WZBE 4PCVA 1FZQA 2QMOA 2XWSA 4I08A 1PD0A 1OGJA 1E2EA 4DUGA 1RRCA 3WLEA 5DGCA 3F7MA 3IIKA 4ZVSA 4I9UA 5F7XA 4Y2TA 2FP3A 2C3UA 1SEVA 5FAKA 4OQZA 3A6PC 4BCDA 4DLWA 1GFZA 4Q37A 2P7HA 1II0A 3TOSA 1IN4A 2B7BA 1IUNA 3D6TB 3GWGA 5DDIP 4I50F 4A36A 1SVSA 2QY6A 2QENA 4B43A 2QTFA 3UCEA 5K45A 1GV0A 3DV2A 1GLVA 3G0CA 1UJBA 5FBZA 1U8YA 5U1PA 2X1LA 4MGIR 4N54A 1FYDA 1A1SA 4WBNA 1UEIA 1TAHA 4WK6A 5G4KB 1JKJB 4BRSA 1RQRA 3QVGB 3Q8KA 5JG7A 3HI6A 1JAZA 1FXWA 1FYWA 4PCLA 1K3TA 3EG5A 3AY3A 5CTJA 3DZDA 4MYDA 4LK3A 3IAUA 3ASUA 3D4PA 1UQTA 3RREA 4AJNA 4ZI7F 3CVUA 4GXNA 4CKEA 3KVRA 4KMOA 4PLWA 1NIPA 4DIMA 2BFPA 5KC8A 4YAWA 4ZYVA 1VPWA 3X1ZA 4TQGA 2GZ3A 3JD3A 1ORWA 1OILA 4JA0A 1YK1A 1CFJA 3GCDA 4HDOB 4JNCA 1N7IA 1FJXA 3MYYA 5ALXA 4HTFB 1PT6A 2XVYA 4R6WA 2IL1A 3COSA 4I9HA 2CL7X 4WXPA 2JI4A 2JH8A 4HAXA 4C7OB 1XUOA 2Z6AA 4FM9A 1LA2A 1B0AA 1IEQA 1U5AA 2OORA 1FNSA 1HDYA 1NPDA 1RKUA 2CMHA 2ORYA 1FYEA 1SQ5A 5I8ZA 4AO7A 5ADUS 5CFOA 1JWLA 4DDUA 4RZQA 1SU7A 2VPWA 2ET6A 2RGCA 1AKTA 3RFUA 1KH3A 3ZGNA 4JELA 4X84A 5KREA 1RWQA 4MCAA 4B82A 2C84A 3RBVA 3WL8A 1KAMA 1SA0A 3ZXSA 4KQGA 5CNIA 1VP3A 3OZBA 3IQZA 2ZBUA 2WJJA 3VAZA 3WXMA 4UZFA 3BD9A 4KW7A 5EQJB 1IK4A 3RASA 2ATXA 2QGNA 2EVWX 2FFJA 2FZLA 4RCZA 2GBIA 2F59A 2XADA 1KZHA 4CF6A 3Q7RA 3P2KA 4BVJA 2Q49A 5KOYA 2JFUA 3DXXA 4MW7A 4NDNE 3NHJA 1Z5VA 1MX3A 1IY0A 3T6KA 3BMNA 2E49A 1ZM2A 3C6BA 2PX2A 1K08A 1U81A 5K20A 2OCDA 1ZN7A 1GKKA 2K2QB 1IUPA 4JP8A 5TR9A 4RCYA 2BUBA 4TYMA 4F71A 3BWDD 4D80A 1Z36A 1EFHA 3OE4A 2BONA 3B1ZA 3CBQA 1I2BA 3DYBA 4HUJA 3JQAD 4NRDA 5EWLB 3WIBA 2CFSA 4TKZA 3THRA 1Q7EA 5JD3A 3F3MA 2XSZA 1E4OA 1NT4A 1RQ2A 1T3SA 1Y6RA 3CEPB 4J0DA 4CF4A 5IC4A 5LR6A 1POXA 1AV7A 1Q0HA 2O0HA 3G7NA 2YIMA 4MLPA 3SOZA 1A5SB 4OX9B 2OP1A 3QKRB 3SYMA 1CNFA 2EFHB 1K06A 4TTTS 1U6IA 2QA5A 3NRCA 3ADDA 5E6SB 3OPNA 2G40A 1Q14A 4CV2A 3OE7D 2WFLB 1T4BA 2FPSA 2P5YA 3CNBA 1CY4A 3JYPA 1ZBDA 1DJQA 2OHGA 5HZKA 3I5XA 1CJCA 1GM5A 5JU6A 3CUVA 4RK7A 4WCFA 4JLKA 4AN4A 5EYPA 4ARSA 4DDVA 3QX8A 4NATA 3R1IA 3ZU5A 1ZMRA 3EIUA 3ZE1B 1WO8A 2H9AA 3W8NA 3FGOA 2QE7A 2J09A 3BX1A 1UAYA 3KJFA 3LY7A 4FLFA 1FQJA 3EE6A 4FQ7A 1NBMD 4XEHA 2W0SA 2FPRA 4CV1A 1ZK1A 2P30A 3AJRA 4I1VA 3KOXA 2FV8A 2YHSA 4KVZA 5KYVA 4FMCB 3UJ9A 5AIBA 2BFNA 3BL6A 3L49A 4JBNA 4BY9E 4G2TA 3AHFA 1BX0A 2ZRCA 5AJUA 1MB9A 3EVAA 5HF5A 1Z4JA 1KMNA 2G9UA 2P9FA 1DWOA 2J3DA 4MUAA 2ZUCA 1YZHA 3OE1A 3OZEA 4CDMA 4JKIA 3PFCA 1QHNA 3D8RA 4MVJG 2QN7A 3A9CA 1U7WA 4NK4A 1IB6A 2VHJA 5K4AA 2QTBA 3PVSA 3SXJA 1YMUA 4MB0A 2WDPA 4FWTA 2FUCA 3TNYA 3HV0A 2NQTA 3BJMA 4HVLA 1W9HA 4MGZR 3T5CA 4PBRA 4UOQA 4AM8A 2AZDA 4PE5B 1MGPA 4R05A 4OAQA 1BN7A 5HE8A 3IQHX 4DXAA 3LK6A 1WBJB 1KAGA 2X1MA 1I5OA 3FAKA 3GRPA 1UBCA 2CLSA 3LHKA 2PK3A 1NWCA 3ID6C 4HAYA 5KTNA 3RNOA 3ZI0A 2Q4BA 3OM9A 3WP0A 2EQBA 3WLTA 4DIBA 5JR3A 4HDMB 3EPPA 1N5MA 4I36A 4CODB 2JCXA 4JZYA 3HSKA 4LXUA 4E7OA 4XUEA 4V2UA 3ELDA 4LDPA 2IP4A 3BXFA 3OLWA 3DCIA 1ZJJA 3C1TA 4WASA 4D9MA 3SLGA 2CFCA 5EIWA 5D85A 1TFRA 3REQA 3TLXA 2PU7A 2P2CA 1UPTA 1ZM4A 3GZ4A 4N5LA 5FBVB 3U26A 1TYBE 2VT7A 1YA4A 1PI3A 4GHWA 1JI3A 3RFCA 1VG8A 5EJ5A 1KPIA 1R64A 2WZDA 3LUHA 3F5SA 3OQIA 4MKFA 3U3DA 5JSKA 5IBCA 3EUFA 1RR6A 3A70A 2C2YA 1W46A 4N4AA 3QY0A 4CTJA 3HR7A 2BMEA 5J4HA 5L3VA 1Q1NA 3IKVA 3NUQA 1EZZA 1TLFA 5FPKA 5E7QA 1KDVA 4II7A 4JR1A 4QOFA 3MF4A 4S2EA 1NAIA 3C5WP 4K6KA 3VR3D 1A98A 2ADMA 4OUDB 3W06A 4B8YA 4KWHA 1LWOA 3SZ3A 3TZ6A 5TQJA 2G04A 2EYUA 4GBED 1U63A 5B2ZA 4FMCF 1Z75A 2ZDQA 4YRIA 5IPFA 4M0LA 3ESDA 2O5RA 4OHVA 5SY4A 4ZYUA 2F55A 3O4GA 5C1OA 3BXEA 4EO7A 3NOVA 1IH8A 2VYND 2X5NA 4LDRA 4MEBA 5AKLA 3UXYA 2WTEA 4Z4EA 3VZBA 1J1IA 2AEJA 3E5MA 3IVAA 2XQJA 3WB1A 2RONA 1E1RA 2ACWA 2ZTLA 1FXSA 2XDAA 1YZYA 4IQ0A 4LHVA 1G4AE 3NX4A 1RMTA 3TCKA 1FNCA 3N3BC 4L15A 2QW0X 3WI7A 1VA5A 1OU0A 4REMA 3A9WA 4QUIA 2M6KA 1F8XA 5CJPA 3TZBA 3AETA 3EQ8A 3BXGA 3TBHA 5C53B 3D6AA 1M2VB 2VA8A 3CCBA 3FZYA 3NBYC 1RXVA 3KQVA 4KSCA 1M6HA 1ULHA 4EJSA 4IFTA 1GGJA 1LH0A 3A2MA 1E9VA 3SHVA 1AK1A 1BS1A 5ILGA 1SU6A 2XWBF 3G2KA 1FFXB 4ERXA 4HNQA 2VBGA 1J06A 3NHSA 3MS2A 4P34A 2NU8B 5I6DA 3TBFA 1R8JA 4RDCA 3ZGVA 4RKWA 4BWVA 2BGNA 3GYBA 2B8JA 4ZCPA 2XMSA 3P27A 3S70A 5E3IA 1PQWA 3M8KA 2QN8A 3B7PA 3IQGX 1N9GA 3EZ2A 3NRBA 4ZFNA 1WKCA 3C8HA 1J5PA 3GGDA 1S7CA 3L46A 1T5OA 3NRJA 5BVGA 5FT9A 1M1UA 1SD1A 3LV8A 1E99A 2JKYA 4KOEC 4IZOA 3HY6A 2LR0A 5L6LB 1JIKA 2J67A 2A58A 4HGYA 2X0DA 4NEHB 1GDHA 2BFDA 3BIOA 3BM5A 2ZUBA 4RJ2A 1AS2A 1N32B 1RTKA 5JAMA 1IBCA 2V7QD 2B82A 3GBVA 3ZBUA 5MN4A 5A2GA 1VLLA 2Z08A 1OHHD 5HKLA 2C03A 2JIMA 3PT5A 4MQFA 1WHTA 1CJMA 2YN2A 1D5CA 1PZMA 1RQGA 2FW8A 3CZ9A 2J85A 3EG9B 3GZNB 3AM1A 3KPWA 1QO0D 4W82A 1IPHA 1Y4AE 3SJCA 3LIIA 3V1LA 3C16C 2NZVG 1HTBA 4PQEA 1ECFA 1HGXA 3QF7A 2X9LA 2Y0PA 3FHTA 3OEHD 2WZBA 3IPXA 4XW2A 1NXWA 1FUEA 2OB2A 3EPRA 3WBKA 5CD1A 1NQXA 2Y1OA 4Q3AA 4AZ0B 2HMAA 1YOVA 3AFGA 3LUJA 1YRAA 4N0DA 3KE8A 4W99A 3VKVA 2OO7A 1IBMB 5ESDA 1WHTB 1MB0A 1YH3A 3AILA 2XI4A 5AKYA 3GVPA 2F3TA 4BB5A 3GP3A 3MD9A 1AXGA 1HE5A 4HWGA 1TOAA 4EJMA 3C7AA 2NXNA 2ONYA 1RPZA 2A5FA 3TDMA 4D8WA 2E4YA 3U3RA 2W8ZA 3WLLA 4OI0A 3TRJA 4ZDWA 4KKVA 1COWD 1JE0A 2P9GA 1VL1A 2W2KB 2Z8YM 3QLJA 4TMTA 1MDFA 3R3YA 2V54A 1R0BA 4ZVLA 3KQMA 3UH0A 2W90A 3DNPA 1KOJA 4MGKR 1L5SA 1NLMA 4OKIA 1HRKA 1OI4A 1SPBS 2XE7A 3GRAA 4RTSA 2I4LA 4R9UC 5JRJA 1JQKA 3RWMB 4UDXX 1X80A 3OZDA 1VPTA 2PZFA 2YJ3A 4N8EA 4UDOA 3U7IA 2BYTA 4HOYA 2P5SA 1TJPB 3AV0B 3IFSA 4LC1A 5DLYA 1XMJA 2WHPB 2CXOA 3Q8WA 3S27A 3EAFA 2P0EA 3BT7A 1F8YA 1FDVA 3E15A 4PLYA 1OWPA 2GEKA 4LYGA 5EP3A 2CHEA 4I1IA 3MTGA 4EGCB 1B7GO 4GL2A 1RW4A 2QI9F 3F5FA 3G8AA 6GPBA 4TLAA 3GDWA 5I9IA 3VHQA 5LWHA 3P7MA 1H2XA 1Y82A 1Z7WA 4H16A 1BMDA 3F6RA 3YASA 1T43A 4N3NA 4UARA 1T5TA 3OAAD 1KSGA 3OQMA 5KB3A 1BE6A 4C0LA 4LK2A 2X7JA 3RUCA 2HIMA 3KYBA 4MKXA 4NCXA 5LFAA 1QRSA 1U0HC 4IO1A 2HD4A 1P2SA 2B98A 4GRDA 4WECA 3REFA 4YRPA 3K16A 5CPFA 3FOBA 1PNOA 2FZ4A 2LZ0A 5F2NA 3MG9A 1YFJA 3AL2A 2HJHA 3JATB 1CQPA 3SYTA 4CGYA 1EVQA 2H3HA 3T34A 3T9CA 3IUJA 3EIHA 4GMFA 4LOJA 4D6YA 2BR3A 4G24A 4W9MC 4JFRA 4MK4A 3RYIA 5D00A 4XUDA 1C1HA 2Q8PA 1MO6A 1T6BY 4LJSA 3LD9A 2HRCA 1O94D 2A5DA 3SX2A 4RIHA 1HH4A 3SVLA 3QH4A 1N6RA 4A73A 1N2CB 1Z5GA 4MINA 3NT2A 2V0CA 4INOA 2YJTD 2ZG6A 3ZH2A 1CUEA 5DTIA 1MORA 4V3CA 4Z9XA 4AWAA 2JA2A 5KVSA 2VYCA 3IURA 4JYCA 1YJCA 2W6MA 1WDWB 4JUIA 2VRCA 3GW8A 1X15A 3O94A 4FE4A 3FSRA 4XWYA 4PYNA 4YJFA 5A9TA 5LZ2A 1JIUA 5FOXA 2XXAA 1JDSA 2CLIB 4LGYA 3KUXA 4XQEA 3LQFA 1SCJA 5EZYF 4BFSA 2F9FA 4O2LA 3VGJA 1XSEA 4HL6A 2AXQA 4GOLD 1H3EA 1A7UA 2ILTA 3CSUA 4RCVA 2JGLA 2DP4E 3I4LA 1Y9DA 1JMVA 3IBFA 4GSKA 4X7MA 4WIAA 3DXYA 4B17A 3FWKA 2RH4A 1J2EA 2XD4A 1JSCA 4JITA 4K3VA 4JT4A 2GUWA 3RC7A 4JL6A 4MP8A 3SFVA 3W2IA 2O2IA 4P80A 1NFFA 5KNBD 1GYRA 1ZA1A 1OT5A 1SU8A 1NHGA 4R8RA 2ZAGA 1QLJA 4Z4GA 2LNDA 4ZCRA 2AOUA 1Z6XA 2NVWA 4EHFA 1BKSB 4H3SA 4EG6A 3AVYA 2QRLA 1M1NA 2L0XA 3E1KA 2O2GA 2OY0A 4L3OA 1CY2A 4RBNA 5BQ5A 3TI7A 4I6JA 1DFIA 3DDWA 3QXHA 1OYVA 4HB3A 3CVVA 1S2OA 2YOGA 4OLJA 1GD1O 1NW6A 4LV5B 4MJXA 2PBFA 4TMZA 2WM2A 2ZB3A 5FUVA 4BN0A 1TJ5A 5SZIA 4GPZA 1X8LA 1YUNA 4G67A 4DJFC 3TZQA 4YCCA 5I7VA 4LJ9A 1JEDA 1PSWA 1S2GA 2EEZA 2ZIAA 3NHLA 1DKOA 2FWBA 1KMCA 3P2OA 2C8KA 1Z6GA 2HA7A 2IK8A 3SYKA 2ZRJA 2C5LA 3LLCA 2V3CC 1ST3A 4U9HS 2W8BB 4KRYA 4F4JA 1Z08A 4E2YA 2GFQA 2BDTA 2H7YA 1QQBA 3NJ4A 4A9AA 1Q2UA 2BGKA 4JEUA 4NMWA 4WZAE 1PYOA 1X2EA 3MM4A 5HIIA 3H5IA 4PS0A 2DLCX 1VPDA 1W6UA 3I5AA 4RL4A 2O8EA 4OQ4A 3A9SA 1IY9A 1Y81A 1ZN8A 2WKSA 4OA8A 4YRCA 5DOVA 5KNDH 2XCQA 4P3XA 3VPCA 3IDZA 3OJXA 5CCDA 3NALA 3DPSA 2V6JA 1BCRB 2QTTA 3C3JA 1I30A 2CLCX 3H6KA 3P0RA 3ZI7A 5JNWA 4WSOA 1ZCZA 2OQIA 1SAYA 1XL1A 1AKRA 1RZUA 1JG7A 1SM4A 2HMVA 3H9UA 3D2BA 3NJ8A 4FJ0A 4WXRA 5CX1A 5DNVA 4HWRA 4IEIA 2E85A 3U7QB 3ZWKA 1KH2A 1R74A 2CLHB 2O8DB 5DRTA 3PRHA 1Z3IX 5FBWB 4Y2VA 4FYPA 5FFFA 3ROMA 3HVJA 2Q3MA 1ZNQO 4M76B 3RV4A 3OQVA 3TQQA 4B8WA 2YYYA 3AM4A 4M38A 3GLQA 2WFZA 1T8RA 1A8UA 1LLFA 3GROA 1AOXA 4RTQA 3PVCA 4IG4A 3EQ6A 2OYCA 4NXMB 2AXEA 1KK2A 3T7CA 2XQGA 4A10A 3WLFA 4M46A 2N9UA 2P78A 3CXRA 1T5IA 2ORIA 2FSVC 4GM1A 4U7TB 5EHIA 4Q15A 4Z6KA 4N0PA 1Z2DA 3BQ9A 3TVDA 2HSWA 4CIDA 3QEBZ 5HIAA 1YWGO 2ODBA 4DSOA 3U1BA 4PLTA 5LZ9A 1LBHA 3IOEA 3EXHA 1BZYA 3WNVA 4CMHA 5JBQA 3W5UA 1MX9A 4YXWD 4LNUA 3V9AA 3WNCA 1EESA 3AYXB 4E88A 1AE1A 2J1LA 1MC4A 4FNMA 4EQ6B 2IPMA 1LDGA 1I0ZA 3SR4A 5L95A 2I9PA 2O6LA 3T4EA 2HB6A 1Q92A 5J40A 3A10A 1RRFA 2VDRB 1EE9A 1SUBA 3P26A 3WV4A 3KC2A 1DDIA 1FDWA 2GGSA 4RL6A 2BF4A 1EWYA 3SC6A 1WZ2A 4FT4A 3GUUA 2UYYA 1NBEA 3R7DA 4D43A 1LFAA 5FBQB 1MJGA 5JSZB 3K3PA 4COOA 2ZW9A 1P19A 5DCYA 1HDCA 1KYYA 4LOIA 5EE3A 5CA1A 1OAOA 2XTAA 3BGVA 4KFSA 4MLZA 3O84A 3OZTA 3CX4A 4G01B 2OCXA 2FZWA 3S28A 4I4TA 1MEOA 3M9WA 1DDGA 3OP4A 4ND5A 1N6IA 4R7TA 1XQ9A 3UW1A 1AXRA 1T13A 4TV9B 5ER6A 2EL7A 3PPVA 5BUCA 2XBUA 1S8OA 4L0MA 2FSVA 5JVDB 4FHZA 1N6KA 1GL7A 4BNNA 1A7JA 2O8BB 2RAFA 4OXQA 1DC3A 5IAEA 1IPEA 4L0QA 3LXRA 1MO3A 2GMWA 1UC5B 3A1CA 2ODEA 4IZIA 5EZ5A 4U9IS 5G41A 3DZGA 4YGXB 2WF8A 4B3HA 2O1XA 3QX3A 2YZKA 3MJSA 4PC7A 1JSLA 3I39X 4YJHB 1RLTA 1WZUA 3E3AA 1QE0A 2FYTA 3FNGA 3NCTA 1G8GA 4YJ2F 5E6SA 4RKYA 5IKEA 2G0TA 5JRZA 1IBSA 1VI5A 2Z09A 10MHA 2EFDB 1D4AA 5DTQA 2EHDA 5CNKA 4J7CA 4RPHA 4TV9A 1FK8A 1IN1A 4MP6A 4E31A 2CE7A 5DWQA 5IAGA 4DRXB 5AI8A 4YPVA 2AC2A 3DAOA 3AKZA 1L5OA 1REQA 1TJNA 2CBGA 2GO7A 5C34B 2HMSA 4ZV4A 2Q5CA 3PPXA 3TIFA 1Z16A 2EQAA 5LP6F 1YJAA 3MPUA 3TX2A 3BWVA 3KIPA 4NCNA 4Y9DA 4JWKA 4UXIA 5CB8A 3LW7A 3W1WA 4WFQA 4DR2B 4JJZA 1P17A 2YXPX 2ZPTX 3OTOB 4CLDA 1AG9A 2ZJBA 1P29A 3EWSA 3DOCA 3I92A 4JJ4A 1R18A 4DNXA 1HSOA 2CD7A 3VYUB 4ESHA 2NUPB 4EW1A 1BKDR 2X1HA 2VPYA 4B3FX 4CUZA 1FLVA 2WV9A 3KTAB 1NF9A 1A71A 5EFOA 2A30A 2XEXA 1NQ5A 3CRNA 4R41A 4CG0A 4PNZA 5JTTA 1XL0A 1KNXA 3DV9A 1P1FA 1O5TA 1OH6A 4NVRA 4NL4H 5E2BA 2E37A 5HHTA 2ROQA 4FUQA 3Q9LA 1C4XA 4A1OA 5DE3A 1P7WA 1XAGA 4JQSA 5AVRA 1DU4A 2G6BA 4X8MA 4YC7A 1QXSA 2PRSA 3B6JA 3CO0S 3NHMA 4N3AA 4MQ4A 5FD8A 4BQOA 3FUCA 4EP1A 3U7RA 3CS3A 4PLPA 4B73A 1JQDA 1RRPA 4P0TA 2IIBA 3OMWA 4UZEA 2CF6A 1Z74A 4WLNA 3TLGB 3VYSB 3CW8X 5CVEA 4EPVA 1UAAA 4PLGA 4RFSB 2JDIA 3R4VA 4Y3UA 2BBTA 2I3BA 3UJBA 1ZVQA 9ATCA 4RS4A 5EA2A 1SXPA 2VTDA 3CTMA 1CQJA 3IQEA 2I3DA 4JMLA 4UHJA 1Z0JA 3OI7A 4KVFA 3PL1A 3V6MA 2OYRA 3IXLA 4E70A 1ETHA 5KTYA 3KX2A 2EBHX 4CM9D 1DEKA 2FVYA 1KHTA 5FP0A 3P52A 1QTRA 1VSTA 2HDNB 5BWNA 4RYDA 2WD7A 5I3ZA 1PZEA 3JAKB 2RI0A 3LNCA 4LRXA 3MRXA 2Y8EA 5AI9A 4DUPA 2G1AA 2V0NA 3HCAA 2BHNA 5ALPA 3PEYA 3QEKA 3BTUA 5KI6A 4FNOA 5EE9A 3GJZA 4DTCA 1F2VA 2Z5FA 4MR8A 2J4DA 4I6GA 4K6MA 3UK7A 4XD7A 1ILWA 3EEBA 4AZTA 4KODA 1QIDA 3M0EA 2YIJA 4BKUA 3O31A 5IWCA 1W36D 3I6QA 4X85A 1Y1QA 1M76A 1ZXBA 3GA5A 1WPRA 3U49A 3EAQA 5CEJA 4R1QA 4YPOA 3UMYA 3RVBA 4RW0A 1MC1A 4ENQA 2QP3A 3PUKA 4YV7A 2VK2A 2OV2A 4ZZ1A 3NETA 2DTEA 3T99A 5C2JB 2RDMA 3K32A 1XLWA 4PX9A 1KDOA 4V0RA 4ZICA 3B6KA 5I9BA 4EZIA 3KLNA 2DF8A 3DEZA 3RJMA 4U2CA 3VO8A 5BN5A 5I7RA 4N3GA 4MI6A 4EABA 2I0FA 2FDCA 2F62A 4RVUA 1ABFA 1E9CA 1JZQA 1U2DA 1QB7A 2XIQA 3HUDA 5DGTA 1GG2A 1JB9A 3VSCA 4EY6A 2A4KA 1B8UA 2BHLA 2OCKA 5E1BA 4ZK2A 4DDWA 3GEGA 2A9FA 1XJQA 2A1UA 1O95C 2WHRA 3F47A 5EZ6B 4E2FA 4A15A 3OX3A 2I2WA 3TIIA 2Q28A 5KOJA 1J9EA 2EJUA 2YUTA 2C20A 4J03A 1Z62A 1WJGA 1TM3E 1ISHA 2FWMX 3OT5A 3WS7A 1QE3A 1WG8A 2XMCA 3LAWA 5EJIA 3DE0X 3TX6A 1PCXA 1EGAA 4P0QB 3Q1KA 3WB2A 4I4LA 2IHUA 1RSZA 4O4LA 3SZUA 3W8DA 4TTVA 1X1EA 2QSYA 1XMQB 4CIYA 1GLNA 4GRAA 4Y6LA 4JV5B 4GEKA 4NK5A 4AUMA 5JWHA 1UKCA 1VJRA 5ALNA 4B2YA 3EWIA 3I2IA 5EXPA 5I4BA 1MIOA 4OJTA 3SY8A 5ANRB 2PSHA 5DHQA 4A92A 1T5BA 3DVLA 3PCXA 4NH0A 2FY8A 3QPAA 5DTEA 2BKLA 1H9CA 4YHHB 5B3AA 3CEHA 1ZU4A 4Q4HB 1XEAA 4RQUA 3P97A 2AMFA 4R5MA 2BI8A 4PFQA 3K1YA 4TT8A 1B0PA 1IRXA 3ULKA 2F1OA 1CSEE 1EQAA 3EIQA 1GQYA 3RLFA 4AJPA 5JCOA 2YINC 3WMEA 3UIEA 3V3KA 4MW5A 2B2CA 4UEJA 3EA5A 4R0MA 3H97A 4ZT5A 4Q1DA 2VF7A 5HJ5A 2VHQA 5F2EA 1M74A 1W1IA 4Q66C 2D8AA 3CGWA 1M2HA 4RMHA 4ML3A 2GKOA 1UMCA 1NNUA 4U7GA 1YO6A 4K9PA 1JHQA 4LMPA 1BH2A 2GF0A 2ODNA 1Z39A 1GPUA 3NNNA 5KTTA 4KWCA 5FPPA 3LUAA 1R8XA 1MOPA 5H9VA 3RHTA 1KC1A 4DYDA 4BXOA 4AJ9A 4IGAA 1F3OA 4U02A 1KYXA 4ZMRA 4D4HA 1YI8A 4X6YA 2VHVA 4J07A 3TLBA 2DECA 4ED9A 1G0OA 4ENUA 4M6WB 2FPGA 4ARAA 1OHHA 3V1MA 1SD5A 4HQLA 4HYQA 4ES6A 2PLFA 2VWGA 3OE7A 4FD3A 2XB6A 1N2HA 3SM3A 4BVFA 4AQYB 2AC4A 3RVMA 2HL6A 2QI9C 1L5QA 4G0OA 4RSHA 5DV9A 2MINA 1S9HA 3TAHA 3OQIB 4RNDB 4A1FA 5A9RA 4MWOA 3H5TA 3GA0A 1Y4SA 4AROA 4ZEXA 2VRBA 1TF5A 3K9CA 2A5LA 1F6BA 3TVYA 1AHPA 5CYOA 3WGHA 3WQSB 3LVFO 4M88A 1FEZA 2QN1A 4MKRA 1YB4A 3ZNOA 1ZIOA 3IOMA 4IHJA 1H2HA 4DMLA 2K2WA 3WGVA 2IYVA 2JVKA 4QNNA 1AO0A 2GETA 3OX1A 3KPYA 1AK2A 1FU4A 2ZYWX 3LT1A 3ZU2A 4LBVA 1XZAA 3TEJA 1GCIA 3PQ8A 3UT0A 2OXFA 3LF2A 1GAJA 1OXBB 3DTVB 3MT7A 2SCUB 5GJCA 1PWXA 2QZ4A 4OYHA 3U56A 3B1KA 1P45A 4X65B 4I2NA 4RHXA 4BRUA 4NZZA 5JNUA 4WHMA 1WZIA 2Q4TA 4OHCA 5HTKA 4AJEA 5B3JC 1SUDA 2IUFA 1E6CA 2JGKA 4M53A 2OG2A 4OJQA 3C41J 2Q6IA 1TUBB 2YNMC 3A4MA 3RM3A 2RG7A 2O7VA 2Z8YA 3GFQA 1Q1BA 1W49A 1DC7A 3HWX1 4TXNA 4DE5A 1G41A 3F90A 4Q1AA 5I4CA 1HLGA 4DABA 4E12A 2X4DA 3GUYA 1S1CA 3MMPA 2OVFA 4MUGA 4WADA 2D4HA 5MF6A 4TKLA 2DT8A 3TDNA 2WUDA 3QVVA 4K9SA 4AULA 4G4SO 1PR9A 1UF9A 1ACJA 1XYGA 3FHOA 3KYCB 1QFXA 2D00A 1KDTA 2VJMA 3OCYA 1FFWA 1N6LA 3GNQA 3GO4A 3ZV5A 5L4SA 2P68A 3U3MA 1OOEA 5KJ1A 5F7ZA 5TQ2A 1EKXA 4CLOB 1HTTA 1A4IA 2PZKA 3ZK9A 3CLRC 4LRTB 1C8KA 3ETGA 4IIVA 4V24A 2J9YB 1D2GA 2H1CA 3IDFA 1U80A 2ZJ8A 4QBTA 5CRIA 3QKRA 3O4RA 3PDWA 4UOEA 5A4FS 1TZKA 4EB8A 4R1TA 4YJKA 3CLTD 4NCAA 4CU5A 2FR1A 2OV8A 1KO1A 3D6UA 3P0FA 4LNHA 1ZGHA 2H6EA 1K86A 5E4FA 2Q9BA 3HKDA 4B3TB 5B1EA 2HSEA 4B33A 3TSOA 4F2GA 4OGGA 1E5QA 2DUNA 3W78A 3TZHA 3WAKA 2ZAIA 3WLHA 4LYFA 2MSCB 3RR2A 1ICIA 1GITA 1LTKA 4BS9A 3RBAA 1ZINA 2YMLA 4P7FA 5JSZA 2VNKA 4XQ9A 3N2KA 1NTRA 4FC7A 5FXMA 3AZPA 3A9VA 3PPWA 3RVLA 3ETEA 1G7TA 3OPYB 1G1AA 3N8DA 3QJGA 3BYZA 2W9XA 3RK4A 2DKNA 3TW8A 2WSYB 3THYB 1D1PA 3LVBA 1RYBA 2GAIA 1FXUA 1HDOA 3FUVA 3MAGA 4RAQA 2AXPA 1JNXX 4GOJA 1M34A 2XXAB 3NVKI 2VDVE 1EWVA 1M8KA 4EW2A 4BQFA 1ADJA 2GK3A 1G3UA 3GOQA 2IZZA 1L8QA 5A3SA 4LYYA 1CKEA 3NIWA 5B55A 1EPUA 1JIIA 5ICMA 1R15A 2OOSA 1N5JA 3I73A 5IM4A 1XEFA 2D5LA 5C3UA 1T3TA 1YI1A 5CB4F 1BMFD 4MS4A 1KSHA 3SEAA 1V9LA 3URMA 4D4KA 3K0CA 4F4FA 1A7KA 1OT3A 1W29A 2X77A 2MINB 2AG8A 4WLOA 3RRBA 1H3FA 3HP4A 3EQ2A 3QHAA 1IB0A 3IJPA 4PNPA 5IEBA 5FOQA 3EPJA 4Z0TA 3VPGA 3ABSB 3S55A 3GK3A 2NSDA 1U3VA 1ZG3A 2AEFA 5K8VA 5K9ZA 4BV8A 4MUIA 4QFBA 4IOMA 1PU2A 3OUZA 2R6JA 1I2AA 2QAIA 3L06A 4MRVA 1WVMA 4B3SB 3IP8A 1W48A 3WQHA 1ZS9A 1T1JA 4DJTA 5BT8A 2V59A 3MJRA 5C4MA 2CE2X 1U6JA 2UUPA 3G9QA 2MTBA 3SFTA 2XCIA 4BL5A 4DQKA 5CG2A 1BRTA 2QWXA 2QRHA 2Z3WA 1UMKA 4AY2A 3BB1A 3B8EA 4ZQBA 3FFBA 1XJ5A 4I5DA 4NMHA 1SOMA 4Y1GA 1LPMA 1O58A 4M0FA 4Y0VA 3ORHA 1U3DA 5BOSA 4M7WA 4E2WA 4MV1A 1O87A 2SKEA 3FRJA 4IILA 4OHXA 3T0FA 3EVBA 3Q7EA 2CJWB 2F1KA 3WKCA 2H0AA 3NP9A 2C4VA 2G9QA 4YRJA 2GT1A 1X80B 3QVWA 4PHCA 3QG5A 1N2IA 5DYGA 4ZCSA 1WE2A 2PDAA 2CLLB 3K6KA 3DPUA 4ZGBA 4KNWA 2Y77A 1VL6A 3DULA 2DUUA 1LI7A 3D8BA 3FOWA 4FJ2A 3X1KA 4DG5A 1NKSA 5IF9A 5HM6A 2EYQA 4TMVA 4NBNA 5DN9A 5TGTA 3TNFA 4KLRA 1NGSA 3C5VA 4KQ1A 2WJGA 2ID7A 4DAOA 4HZUA 2ETXA 4RD0A 3NEAA 1HWYA 5EP1A 4GLOA 1JXQA 3W1EA 4EAQA 4G1VA 1WCXA 3BXOA 1WB9A 4TMXA 4WLEA 1JFTA 1OZHA 3HFJA 1JR3E 3FYUA 4HQRA 3WMWA 3WTBA 1L8XA 3ZDEA 4ZOAA 4W5RA 1DXYA 2E5FA 3CA8A 1NJ5A 3ZY5A 1ZVMA 4LMAA 4NQRA 2OHIA 3X1WA 5GONA 3IP7A 2J9FA 1RI4A 3IVGA 1XJWA 3WP1B 5LA6B 2B9EA 3FLMA 2XOXA 2JFGA 4RIEA 5AIAA 3WHKA 2PV0A 2H06A 3R5KA 3MS4A 2AFVA 3I8XA 5F51A 4ZVNA 2QLLA 4YT4A 3FCAA 1QJ4A 1ZHOA 3CX3A 2O4UX 1CZHA 1E58A 1U11A 3OFKA 2V8BA 3HXPA 2HMWA 2JGDB 2Z04A 1A97A 5EXEA 3T95A 4UFNA 1ID1A 8LDHA 1PQUA 5FWYA 3TW8B 4OREX 3INTA 2AQHA 3LBHA 3TTTA 3GG9A 2I91A 3U09A 3HDHA 4GO1A 5CH3A 2I71A 4YHBA 4ID9A 2BBWA 3JZAA 2ZI5A 1SUAA 1ZUNB 5K3FA 2YWHA 4WKPA 4FDUA 1QQ5A 1ESCA 3B20A 3KR2A 1CRQA 3IR7A 3DE6X 1J9GA 3STWA 3EPLA 2RC5A 2A9PA 4CEIA 2A7XA 4GNRA 3AHHA 4Z0NA 1GU0A 4GMXA 4IDBA 1G8FA 3WK6A 1NQWA 1YRLA 3CM0A 1A7AA 5GWXA 3UHPA 2W43A 3EIWA 3IE2A 4JBGA 4MVJA 1F1JA 3BH6A 1CQIB 3I1YA 4O63O 3UC9A 1UK7A 1MOQA 1E62A 1WHSA 3OU7A 3QLEA 4BVAA 3IUPA 1B15A 2O5EA 4C1BA 5LYJF 3B3FA 1SBCA 3KVNA 4JUDX 4DANA 3GLIA 2O2EA 1JR3D 3LIPA 2PL1A 5ALFA 3VV2A 1FDUA 4TKUA 3GGPA 2C2ZA 2PUEA 4H7EA 1KARA 1S8FA 1KAOA 4NONA 2JFNA 3OKCA 1G60A 4ZDIA 5BSUA 1LDYA 3HB7A 1EJBA 2ZRNA 5F1KA 4Q03A 2JRCA 3HL4A 5AO9A 4FI3F 3UMRA 3VR5D 3TL6A 3HXTA 2COEA 3BMOB 3QVSA 4N82A 2OFPA 3DKIA 3EZ6A 3IMFA 2ZRMA 4UEOA 4V0QA 3F5QA 4I3GA 1FFSA 4JODA 2IVZA 3I12A 5EHZA 1F12A 1E77A 2OOKA 3HUTA 4ND6A 1P91A 4RETA 2DTDA 1O0SA 3DEAA 5AQ1A 4HZIA 5FUYA 2QMQA 1JTFA 2WZQA 3GP5A 3K0FA 1S9DA 1TGVA 2RH5A 1IWPB 5DEOA 1TKAA 3ZDQA 4RDIA 2XF8A 1H6CA 2O3TA 4K0KB 3G3EA 3ZPXA 5D5HA 2JJMA 2DUJA 2COUA 3MXOA 2HK7A 4R3UC 3OF3A 1O94C 2B20A 5C5IA 3DZ8A 4NESA 3RVQA 1X7XB 1U31A 3G9TA 3VU1A 3F6PA 3HHEA 3P1JA 5IVHA 2HF7A 5EQTA 1EQ2A 1BHSA 4O8CA 1AQLA 4FLEA 4P32A 1GQRA 5C35A 4IFBA 5MGBA 3TXAA 5JADA 3E61A 3DS8A 3UV6A 2FX2A 1VCMA 2JLUA 1HQCA 4HDSB 5GINE 2A35A 5PNTA 4EFKA 2ZSUA 5GOTA 3MCTA 1SXJA 3N75A 2FN9A 2LE0A 1W2WB 1W8DA 3R76A 3SHFA 3LF1A 1BEEA 1DBVO 4XARA 1QIIA 1R1DA 4DLKA 2O0LA 4QPDA 3IE1A 3JQ9A 3ZU3A 3HBJA 3S99A 2HQRA 1NM5A 1P1KA 1RRKA 3IEUA 3ESCA 1Y5MA 3PXEA 4L73A 1G17A 1VKJA 1ZISA 4L85A 4U8HA 4IH4A 3LGAA 1EVYA 4CDNA 1GAQA 2SKDA 4RANA 2J9XB 2IX3A 1Z5PA 3H83A 5G1NA 1POWA 3C7TA 3AM5A 3T9DA 1QE5A 3QJYA 4B7UA 3AOEC 5LQUA 1YD7A 1QAMA 4MS3B 2PEZA 1IAQA 4K9DA 1PRYA 4CKWA 4HX5A 5FWAA 1TTQB 4MEJA 3L0BA 3FBTA 1V3VA 2XE8A 1CV2A 2BMAA 1U8TA 4PXYA 1BCSB 3LCJA 5THXA 3UAOA 4QXRA 2VK8A 3BK2A 3E03A 5IDWA 3WY9A 3O83A 1H8ED 1AQUA 4MLCA 5DT2A 4NPCA 2XCRB 2HFJA 1IHYA 2BELA 4OP1A 3RRNA 2F1IA 3S6JA 2R8BA 3DBOB 3E58A 3RWBA 5JYCA 2Z0MA 2VUSA 1XN4A 3QVOA 1O2DA 1OR8A 1XTZA 5I7SA 1N9ZA 1T5DX 2CDRA 2IYQA 4EECA 1I7DA 3VNAA 3R5SA 2QBYB 1RXSA 1XZHA 3N2IA 4MWEA 3BRWD 4OQNA 1J0CA 4W6QA 1QP8A 3EXHC 4ZANA 5MN6A 4XOIA 2PNFA 3WYDA 5M34A 1RHRA 3R0VA 3R0XA 1MT3A 3UAZA 3LA8A 4F38A 1DRKA 5BPHA 1GNTA 3L0SA 3SJ7A 4LRWA 4WN9A 2FPXA 5KSOA 1P0FA 2W11A 3L93A 1NQAO 1MIHA 4UHDA 3ZGZA 1NMXA 4M0EA 5ALQA 2E55A 5AJXA 2BCGY 5AOAA 2OV1A 4HATA 5CBKA 2W2NA 4PXAA 4EY7A 1CZOA 4B3XA 1JLSA 2IBMA 3WQBA 3L1UA 1U4NA 1OE0A 3ITEA 1WNTA 2L42A 1NXVA 4ZP1A 4JR2A 3F71A 5G3ZA 1XU7A 4PYKA 2EFEB 1HUQA 2FEMA 1WB5A 3H5RA 3HCNA 1TZMA 1UZNA 2XW6A 3B36A 4GOOD 4KYTA 3UMJA 3ZLVA 4AG6A 4FNGA 1Q91A 4DOMA 2WA1A 3BJEA 4GAEA 1ONPA 2C7GA 2D1FA 4RY8A 3N07A 4D8VA 1CUBA 2ENWA 2V8OA 1Y6JA 4ZOQI 1EFKA 4B7XA 3CN9A 3X0DA 4Q9LA 2PEYA 1A5AB 5DBOA 4L6IA 4ZK6A 2GZSA 3OURA 3BTVA 4G9EA 1UBNA 3AM3A 1QV6A 1QM5A 3H8VA 2ATCA 4IJ5A 3EMVA 1EH5A 1CR2A 1I3MA 1OV4A 4TL9A 4WNYA 1SCAA 3ME5A 5KSWB 4ZO6A 2QX8A 2IPOA 3I4CA 1U3GA 1ZI8A 3WC4A 1FUIA 3BERA 4EG8A 3RC2A 2Q5LA 5ALGA 5FPQA 3VPAA 5KNCD 2LDXA 3DO8A 3OM8A 2QTWB 1SRRA 3A28A 3WK8A 1HYQA 3IDQA 4N0QA 3HY4A 3KT8A 3IKMB 4BLWA 3DEHA 2BGRA 1JR6A 1H42A 2QJFA 3VVLA 1W52X 4W9NA 1SKQA 1ML4A 4G89A 2C9BA 1WHSB 5I5GA 4Z49A 1GZ7A 1EWKA 3OEEA 1V7QA 1QR2A 2DBRA 4XDYA 1UDAA 3UFXB 3ZHYA 3AHIA 3OOEA 4DARA 1GTMA 1DOAA 2WJVA 4YJ2B 2NQ8A 5TEVA 1AQ6A 4URWR 3ZY2A 1PBNA 1LPOA 4GXRA 1U8ZA 3K9GA 1FQKA 2HHJA 2GYWA 4HXYA 4FYWA 1Q5PA 2Q45A 5FF9A 4H1HA 1IY2A 5SICE 1JP7A 2OHFA 2QUKA 2P2ZA 3KD3A 4QUKA 1QIMA 4HBGA 1C9NA 3I32A 2YXDA 1QWSA 1Y5IA 2OORC 3EC1A 4PS1A 2FW9A 1A0OA 4JC8A 4JJGA 2WHXA 5HBRA 1S02A 4UTVA 3C6ZA 2IV2X 5PGMA 1JYFA 1TZ2A 5FORA 4G1CA 1N7HA 2UVPB 2J7PD 4X1IA 1D3AA 2Q4OA 1IQPA 5KYWA 4L9AA 3CRZA 3CZRA 1OVGA 1I1HA 3UF0A 4WJKB 3C5HA 1ZMXA 3GJ5A 4ZO8A 1QCZA 3ELBA 4O33A 5T3YA 1QS0B 2WKRA 4G6ZA 4YAUA 1JHMA 1PFQA 1FLDA 2C8LA 2C2XA 5BR8B 1OSNA 3RFVA 2YHAA 4G4IA 2R47A 3TXYA 2HMUA 4WXYB 1JE1A 1E20A 1Z4NA 4K9LA 4LYHA 5JCJD 1XRRA 3ZUGA 2BFWA 1PGJA 3KHKA 4NG5A 1JIXA 4DYVA 3M5CA 2WUGA 4GOKA 4XAQA 3X43A 1ZSVA 5K8IA 2BIFA 4B7ZA 4WV3A 3K5PA 2WWHA 5J23A 4XCXA 3SQNA 3BBLA 4JDUA 1WMFA 4MGYR 2QUHA 4MYCA 1E7QA 1GV1A 2BISA 5AKJA 2G1KA 3V33A 5KKCA 3FLAA 1Y8AA 1T1IA 1D04A 1ZGGA 3STUA 3EQ7A 4C6HA 3VOTA 1PZXA 4PYIA 3VU8A 1XROA 4R9RA 1WD5A 2HT1A 1X87A 4KLAA 4PO1A 3QPCA 4W8GA 3UATA 1GSIA 3KUCA 4DIFA 1CHDA 2BGIA 1Y4DE 4GR9A 4HZUB 4BEJA 4C6TA 3OIDA 3LFHA 4BV2A 2WQZA 1Y3DE 3OFVA 2R4TA 3I1JA 2WM9B 1CDZA 1JA1A 4E5KA 5C80A 3A1WA 4C21A 3NTUA 1LSSA 2O1WA 3LCMA 5JXGA 2NUBA 3WK9A 4UXJA 4KPEC 3WQQA 5FOVA 2J45A 2PY6A 4DZRA 3LX8A 4DTIA 3N76A 3VZRA 2GJSA 3CLSC 1JSRA 3FI0A 4H18A 4S1VA 2DQZA 2A0YA 1NZDA 2HV9A 2P2LA 2WU4A 1SCBA 1ZRNA 4I1OA 3SF8B 3WLIA 5C5EA 1K4YA 1Y89A 4EX6A 5A02A 2EIXA 2NYRA 2XNKA 3ICCA 4NS1A 2HEIA 4KGXA 5A7FA 5J3JA 4IHAA 3O3NB 3PZRA 4WKGA 4ILKA 4CLOA 4MUFA 5EFZA 2OA0A 2V9ZA 3DOOA 3AONB 2AI1A 4EL0A 4FSDA 3RLIA 4LF4B 3ZEAA 1XZMA 4ZU6X 4OBWA 1PNVA 2W6QA 3D1LA 1YB6A 1CJKC 3OPYI 1UJMA 3HABA 4NE7A 4PX3A 4ZALA 4YP9A 1JAHA 4GPEA 1WB4A 3L77A 1FDIA 3G5AA 2HI0A 3CNLA 4HGOA 4BO9A 4EF5A 3B9RA 4CL2A 2QRNA 3QSYA 4LY9A 3LBFA 3VDQA 721PA 4IJVA 1DPFA 5IT9A 1BA2A 3DTYA 3IPYA 4OQLA 2QZSA 3DDOA 3KZVA 5LA6F 4HDRA 3IAFA 4GI1A 4OYYA 3OOWA 1OB2A 3O21A 2QRZA 2P2DA 2GTPA 4JLDA 4MQ5A 3SS8A 4DLNA 1DQSA 4PNHA 3VFDA 1NG1A 1O8BA 1M75A 4L8WB 4WZAA 2JLXA 1GRRA 3KAQA 5DM1A 4MS4B 1K0UA 4C4TA 1QANA 3UKDA 1GFSA 1L7RA 5D1HA 5H16A 4WX2B 3NAGA 1UXGA 3OCXA 4RHEA 4I14A 5IFKA 1TLLA 1HMPA 1V37A 5K3OA 3DT8A 1UCFA 1AHNA 2Y93A 2IZ6A 4G56A 4KPUB 3O1IC 1TQ6A 4TPKA 3K71B 1L8AA 2X2FA 4OLFA 3WTCA 4E21A 1VLVA 2HX1A 1FX0A 3RCBA 4ATNA 1G59A 1KIMA 2BGGA 4MDYA 4DQXA 4FFRA 5LDHA 3TZKA 4U5XA 1A76A 5CLHA 3BDIA 2PFGA 1KFJB 1LLUA 4O4HF 4GWGA 3UJNA 2ZYVX 3IBGA 1L7DA 2RHBA 2YFQA 1VMAA 3EF0A 4AP9A 2X40A 3I3OA 5FOSA 3DLBA 1NP6A 1QLHA 4CV3A 2P35A 4X60A 1ULAA 4RJTA 2QVYX 2SNIE 4JSTA 3NT5A 4LUCA 5K0JA 1UXJA 3M6VA 3PFIA 2HF9A 3DLHA 4BB6A 3FI9A 2B2XA 4UKDA 4J0CA 2VTEA 1WULS 3I83A 1KQOA 1R0WA 3AY7A 4GZMA 4YT8A 4FYMA 5THQA 1I4DD 2Q41A 3GJSA 4GKAA 2R8EA 1C1XA 2GZMA 3KPJA 1YS4A 1NYQA 1ZESA 2Q8NA 3U81A 1QPGA 3H1FA 4QTXA 4R81A 5HIJA 4LE0A 2NW6A 4JGGA 1NJ8A 4KU4A 3KALA 1LX7A 1HE1C 2YC4C 2VC2B 3ELWA 2P2YA 2AA3A 2P62A 3ESYA 3FVRA 3WLPA 3RSHA 5HFNA 2OWEA 4YLYA 2KPOA 4E1AA 1QVVA 4E4RA 4ZI7A 1ZCAA 4KHZA 4ZAZA 2V1XA 4JYAB 2QW1A 2HJGA 1YDHA 2FN8A 3LCRA 1GPAA 2C58A 2Q3DA 1Q77A 2FR0A 2AB0A 2C9YA 2ZXFA 3A36A 1IE3A 4O5AA 5CH5A 2GM9A 4Q7QA 1XEXA 1RP7A 3AB8A 4FHEA 5ALRA 1RC8A 4MUXA 1I1QB 2IZ5A 1JAIA 2YRXA 1I0LA 1N33B 1UM9A 1NJFA 4M54A 5LPNA 3OZCA 4HDKA 1MJNA 2HA0A 4JK3A 3IHKA 2BFCB 3C85A 4F21A 4OOFA 3NWEA 3MEQA 5BV7A 4XYMA 2QD5A 3BJIC 4B32A 4DM3A 3V8VA 1GRVA 16PKA 1N8KA 2WZCA 4KE7A 2WMDA 1P4GA 3HXOA 1KMHA 1US8A 4JLJA 5IG2A 3INRA 1ENYA 1U8FO 2BDEA 3EEIA 3OZWA 3U40A 1P2DA 7ADHA 2C1XA 2VP5A 1GFWA 4IOLA 1ES9A 1XXHB 2W4QA 4BX0A 4HUTA 5DEIA 2C57A 2HF8A 2J5BA 3QFFA 3TBKA 4J0EA 1OFGA 3A6LA 1G20E 2GN8A 1SUWA 4D3DA 2HREA 5IW8A 2P91A 3EX7C 4Q1EA 3I2KA 1BEUB 4BV9A 3GMTA 1D4ZA 5AI5A 3CLSD 3JVDA 1NC3A 2C9OA 4HEA6 5E2AA 3T7IA 4P92A 2PZBA 5DGXA 2P1DA 4LXTA 1WEKA 4RY9A 4F97A 1P6QA 4KO8A 1V96A 3JVUA 2GUGA 1G19A 4P1ZA 5BN1A 4TLDA 4BFZA 1HG0A 4LCJA 4MRNA 1G2OA 3H42B 4XD2A 1U2SA 2QZZA 5BXYA 5KVAA 2HBRA 4E6PA 2WLSA 1NJGA 621PA 1CY8A 1E9DA 1HR0B 3EUEA 2I66A 3B7WA 3E1GA 3I6ZA 1MH9A 1N8NA 1V9CA 3EXFB 1XWIA 3LDHA 3Q87B 5EWJB 5K3BA 2VHWA 5E6RB 3UCFA 4C78A 1WBDA 1MENA 1VL8A 3QV2A 2X3YA 3MSCA 5DW3A 1I51A 3GRZA 1A5ZA 2PX8A 2GAOA 4FDMA 4NENA 1WP9A 3STYA 2AQIA 4FE3A 4KQ9A 5JEEA 2V7VA 4TKUB 1F4LA 3AK4A 2ZUVA 4QVIA 1GYQA 2B4RO 3CG4A 2JJ1D 4ITVA 1C0EA 3DEYX 5T57A 5DF1A 5TGDA 1QQAA 3CT6A 1E1MA 2IUYA 3D5QA 1DMSA 2HO4A 5I4KA 2XD9A 2VO1A 3NDPA 3I72A 4CL0A 4K6GA 4L8YA 1CZLA 3X1JA 1MC8A 5FLYA 2O7RA 2C5EA 1QZUA 3ZJTA 3WL4A 3RDPA 3QVTA 4Y9RA 5BYAA 5MDHA 4EI9A 4WOKA 4YI3A 1YU6A 2OLJA 2FH5B 2IY8A 3OQJA 2G9RA 4WOBA 2WM8A 4GKVA 1E96A 2MYPA 3TO5A 4K1LA 4ZODA 4RMIA 4I8IA 2LPMA 4U6SA 2H5LA 3DM9B 4FYVA 3RVJA 1XRQA 3FKSA 4J0IA 5CNMA 1CEYA 3ANLA 3CPSA 5BSTA 1TA0A 3QPBA 1AKYA 1QVAA 2P27A 3U3ZA 3HKEB 3W8EA 5D5PA 1JLLA 2N3ZA 3HJRA 3WZMA 1VCNA 4PLCA 3DHNA 3VR0A 3X1MA 1UPXA 1C5KA 4DA9A 5CA0F 3M6AA 4Y2SA 4QGFA 5AKKA 2VHTA 5BXQC 4CEHB 4IXNA 4ZD6A 3GF4A 4BKPA 3ZD8A 2GNOA 2O57A 1UXKA 3GN1A 1GGKA 2QXYA 4BTEA 2Y67A 1E4YA 5KUTA 2C2HA 2FU5C 3JQEA 4X1KA 3BRQA 3I0ZA 1F20A 3SJZA 2B8NA 1BFUA 1TM4E 4ZCLA 4TVKA 5BVHB 3U6BA 3MRSA 2H9IA 3EGIA 3LS2A 4EO9A 1NFRA 1LI5A 4YRSA 1B23P 3W7AA 3KYJB 2C5HA 2ECPA 4BDTA 2HPAA 4F2DA 3AVTA 1RWNA 2CJPA 3R5FA 1D8TA 1X7WA 2JH9A 1GKYA 1OXSC 3B53X 2JBHA 1Z56C 2D3TA 3F8SA 3L8CA 4KI7A 3DQQA 4UUMA 3DUFB 1EFPA 1GKLA 5LUBA 5BNTA 4W5OA 2WEKA 3ZBQA 3CNNA 5D86A 5AM0A 3OEHA 3H75A 2GEBA 3KXKA 4BC1A 4IIEA 5J2UB 4RF4A 2IYEA 3I64A 1FF9A 4BVKA 5D2CA 4C2UA 5JC8A 1N1EA 1PR2A 1RYHA 2FX3A 1Y1KE 3UJAA 4UXHA 3UJ6A 4B5LA 1YV9A 3IAM6 3QVJA 1F9AA 5DCLA 2GRAA 3RFFA 1KQFA 3ONEA 1UBFA 1IPFA 3QVKA 1PTKA 1KY4A 3DV0B 2GZAA 2V6IA 1B14A 4HQFA 4C0BA 2AXNA 3IR5A 1VHTA 2J3MA 1UDWA 3FPLA 5G0SA 4EDHA 1NY5A 3TSWA 3EFBA 3AEYA 4EKEA 1VE7A 3WDMA 3UWOA 4CM5A 3W9YA 4CT5A 1L1EA 4ARBA 4EZBA 3QELA 1M72A 2JS7A 2VZ8A 1KAQA 4E46A 4PNEA 1QVZA 3DLPX 1JMKC 2R11A 4FGZA 2B61A 3AB7A 3EZGA 2JFYA 1XALA 2D1SA 1UT8A 3CIOA 4MMZB 1XZFA 4OL0A 5SYNA 3V4PB 2BTQB 3U7HB 4NC9A 1WCV1 3LUGA 2BUAA 2XDQB 3S7ZA 3IAAA 2P3OA 3OPVA 2ORED 4I50B 4N6NA 1U1IA 1EEXB 2JFXA 3T3HA 3ZHUA 5G1PA 4BO2A 4D57A 3UNXA 2IDZA 1UMDA 2O0MA 5C52B 4DV6B 1NXOA 5LCXA 4YACA 1NXTA 1P5FA 5LKAA 1UBRS 1NW5A 2Q1XA 1FFEA 2ZIFA 2GKGA 1PGQA 2LVBA 3JTMA 4P3PA 3T1OA 1UC9A 2D59A 5D3KA 1IXZA 1Y8ZA 2G63A 5JXJA 7ABPA 4XJSA 4HDAA 5H83A 3G2PA 1X9IA 3WKDA 1XMOB 3AZOA 2Z1NA 3L4BA 4UZSA 1E9EA 4A8HA 1O77A 1S8AA 2PXXA 2C1ZA 3DWEX 4P4TA 1LJLA 4AY3A 2WIFA 2XODA 2XWQA 1YA6A 2ZUWA 5AD1A 3WKAA 1XVAA 1OLUB 1WQ1R 2DWOA 2FZEA 3E8SA 3C45A 5DT9A 4M8SA 3RSCA 2ISCA 3FDZA 3FZNA 4MS1B 1PT7A 3CCFA 3LY8A 2PL9A 4WT7A 2JIOA 3W2TA 4P7BA 2JIPA 3JQ7B 4L08A 2NZYA 2L18A 2W2LD 4ASUA 3GJQA 1V48A 1R6DA 2AL7A 1PG5A 1MJGM 4C7MA 3L6OO 4J29A 1ADCA 1XQWA 2CLFB 1UDCA 5E9QA 1FFGA 3OESA 4ER5A 4KE9A 4X95A 1ATZA 1OFTA 3DMFA 3OSZA 3ZIUA 4U2KA 1IZYA 3O8OA 1JLRA 1HKHA 3MJTA 3QKUA 4OUKX 5UKDA 5DXJA 2C3OA 3HC7A 5K6AA 3DC2A 2VP6A 4PLVA 5KQPA 1P3Y1 4O2AF 3KL4A 2W98A 4L95C 2O8VA 2OBFA 4LYJA 4D3XA 5H82A 4WL0A 2X2OA 1VRVA 1PP4A 3Q15C 2J08A 2KM1A 1SN7A 2DR3A 1H8HA 3DUFA 3ZY3A 4BMPB 5A9SB 1KF0A 1XXLA 2QF7A 2X9VA 4ALMA 1RJDA 3GXOA 4H7KA 5I9SA 1QIHA 1P2UA 1PDOA 2G7MC 3LYAA 5AXDA 3WWZA 4D9JA 1CQJB 2C4HA 5A3VA 5L9AA 3AUJB 4DB4A 1JN0A 1Q0PA 1WF6A 1YE8A 2I9KA 3AIMA 3Q5DA 4QFCA 3HNRA 2XMPA 4ZO7A 3ICOA 3JQBC 4O08A 3IQIX 5HDQA 3GDGA 4Z7JA 1K9SA 1NLUA 2ZJ7A 3DYVA 3GIDA 5C31A 1XZEA 5BUQA 2CLKB 2QG9A 1DV2A 2REQB 2WVAA 2XX3A 1HDEA 3E2MA 3LPCA 3M1LA 4Y6OA 3ROXA 3UTDA 3TMKA 3T1VA 1YNOA 2CKMA 4WN3A 2XVAA 4AWBA 1IG3A 1EUCB 4UFPA 3DHVA 3MJVA 3UGQA 1LW7A 2I7DA 4H1WA 1RJFA 2NTEA 2VLBA 1W4CA 1SQFA 2ZRAA 3ODGA 4TWJA 1QDEA 5LM3A 3JWJA 2XITA 2EZ8A 3L5KA 1G4UR 5J1TB 1SKBA 5KAPA 2WAAA 5KWIA 4PLZA 4P7JA 3AU9A 3CUKA 3IO3A 4D98A 4MPJA 3QUCA 3UAYA 3NTLA 4ZKEA 3KD2A 2YYSA 3KLMX 4ZRNA 4P81A 4ZYLA 2IU4A 4NG4A 4Y0NA 4O4HB 3ZEIA 5H8WA 2JFWA 2Y2VA 3R23A 5JAPA 1WS6A 3W6UA 3KNZA 4MI1A 4Q3BA 4IQGA 2VHCA 1HT1E 4NJMA 1G2IA 5DN6A 1RC0A 5E8JA 1Q1QA 3EHDA 1UL1X 4WTOA 5COBA 4BFLA 1A1VA 1N6NA 2DEUA 3LO5A 4OBBA 1A9ZA 4R31A 1U0BB 4ER6A 3CVOA 1QGYA 3HLKA 5IAOA 3L92A 1E2GA 3T9FA 5GGYA 4MPPA 4QYIB 2W83A 3GB9A 4POAA 4XIIA 4KXWA 1NATA 2PSJA 1AKQA 2XCUA 3B2QA 4YUYA 5IDXA 4KMMA 1A8IA 3JWPA 2GO1A 2IY7A 3PX7A 3WAJA 5L3SA 3DMTA 3CH7A 1OAOC 3PX2A 4Q7KA 4R0NA 3VR6D 5JI2E 1M9NA 1WIWA 3C98A 4NOMA 2REOA 4UTPA 5CFMA 1C30B 3OLXA 3S2IA 2E3JA 3MMNA 1A27A 1N8TA 2F67A 1EU1A 2WWWA 3L0YA 1HSZA 4ZC8A 1SHZA 1Y4UA 4TV9F 2HIHA 3E81A 1FTNA 4AXXA 5H7XA 4BAZA 5IASA 3PD0A 3FRIA 2YC2C 3A6FA 3UYLA 1TE2A 3AY0A 3F74A 2HSJA 3V2UA 3GELA 1P5ZB 4JP2A 4A8TA 2HO5A 1D03A 4R3WA 4BLPA 4ZEMA 5C32A 3MCVA 3ZYCA 1LXCA 4PSAA 4DEVA 4MQMA 4Z7NB 1G21E 3FPGA 4W1QA 3J81k 1CQXA 4LXHA 5CW1A 5A6SA 4C88A 3BZBA 1K5PA 4JL5A 1S7GA 1RI3A 1U99A 4TQUS 4NCBA 1CERA 2GRJA 3B60A 4FVTA 2BTQA 3AXTA 3PNPA 1QRUA 1UMBA 5JCJA 1X1BA 3W4KA 4A7PA 1I13A 4IBOA 5IUKC 1EM8B 3LWNA 1ZN9A 1SG6A 1V47A 2R7KA 4URYR 3ZGOA 4JYPA 5B53A 3ZDBA 3V1NA 1TVKB 1IVYA 3UAWA 2FG6C 3KR9A 4HNUA 2XECA 1C7IA 2XCLA 2BEUB 4W7IA 4JVNA 3LSYA 4H1TA 5J43A 2DB3A 2R7MA 3MT9A 4NV0A 4UHKA 3RUIA 1RLJA 3ZWXA 1RPJA 4BMNA 2H08A 3E9NA 3T3PB 1N0VC 1GL9B 1DWQA 3PJFA 1C7FA 2DZDA 3EN0A 3FMFA 4G8JA 2IUUA 2QS9A 1A2OA 2AH5A 1YCHA 3KEOA 5ICEA 2P75A 5K0EA 1NJSA 5DHPA 1J22A 2PKXA 1G9TA 2WV7A 3ZCXA 4UTNA 2JCSA 2HSGA 4WESA 4TX1A 4OP3A 3TGLA 1PJTA 3QU4A 1LLCA 1U8UA 1SCNE 2HZBA 1SKAA 4D9NA 2HA2A 1L7EA 3R3JA 4D82A 2FG7C 1GLGA 1D8AA 2YS6A 4MV4A 1JJFA 1Q84A 4BFXA 3HKBB 1AO3A 4LQLA 3TEMA 5IJ0B 2IEYA 5AW7A 2CXSA 1JX6A 4UVHA 3SSNA 2C83A 3R9XA 5EXXA 4L5JA 2RJOA 1JPUA