4BVJA

Structure of y105a mutant of phaz7 phb depolymerase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
343
structure length
343
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNAHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPYNAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHB DEPOLYMERASE PHAZ7
publication title Biochemical Analysis and Structure Determination of Paucimonas Lemoignei Poly(3-Hydroxybutyrate) (Phb) Depolymerase Phaz7 Muteins Reveal the Phb Binding Site and Details of Substrate-Enzyme Interactions.
pubmed doi rcsb
source organism Paucimonas lemoignei
molecule tags Hydrolase
total genus 128
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature ec 3.1.1.75: Poly(3-hydroxybutyrate) depolymerase.
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bvjA00
1YA8A 4Y2QA 5IKXA 4KYVA 5ALJA 1CUDA 2WTMA 3FLAA 3PUIA 5LYYA 1VKHA 4JH0A 3KWFA 2QOEA 3WWOA 4BC0A 3D3NA 2QKYA 4OD0A 3VJKA 2OCKA 4TGLA 4HXFB 4Y7DA 5EIAA 2PSEA 4K6HA 2HRQA 3SC2A 4QWWA 5K3AA 1UXOA 3JW8A 5DLPA 1TCAA 1CLEA 5A62A 1UOPA 3HLKA 2ACEA 4AO8A 4LIPD 3CCCA 1LPNA 1J2EA 1CUHA 2OCLA 3WKBA 1U4NA 2ZSHA 4B6GA 5HF8A 3EQ7A 2ZJ6A 2WKWA 3F9CA 1QJ4A 1GQSA 1G42A 6YASA 4BBZA 1ZD5A 2QVBA 4N5HX 3N2ZB 2BGRA 3H0CA 5JZSA 5AP9A 1DQZA 2JGKA 3VDXA 2VA9A 2ZJ7A 4QWMA 1CUAA 5HKAA 1ZI9A 3DDUA 3U1TA 4AN0A 4OU5A 1C7IA 3U0VA 4H18A 2JIDA 4WY5A 1YA4A 4FBLA 5E2IA 3BIWA 4M0FA 4BP9A 5LP1A 1OXMA 4DNQA 1H22A 4BTLA 2C5FA 4LXHA 2PKYX 4BDTA 2OCGA 2WIJA 3H2IA 4X7BA 3AJAA 3BF8A 5HF5A 3DEAA 2AJ8A 1WB6A 3F67A 4X94A 3ICWA 2WHPB 5FKJA 2VAVA 4BE9A 1ZJ5A 1IVYA 2XMBA 3HZOA 3BXPA 4YASA 2V9ZA 1YB7A 5A6VA 4UUQA 5AM0A 4J0GA 2HA6A 3HACA 4Q34A 4WJLA 1MU0A 2WHPA 2BUBA 2WLSA 1XZIA 2ZJFA 4KEAA 3C8DA 1XFDA 4O08A 3M82A 4G9GA 5CW2A 2WJ3A 1UFOA 1CUBA 3C6BA 1YCDA 4DTCA 4MWSA 2QRUA 1W75A 4G4IA 3WA6A 3V1KA 3B3QA 4BB0A 1QTRA 3M3DA 4DMHA 3RK4A 3AZQA 5D6OA 3D7RA 3ZWQA 4QDUA 4IO0A 3DCNA 4PSUA 1W4LA 3FYUB 3O4JA 5AI4A 1N5MA 4B82A 2XMZA 4DMCA 3FNBA 2OG1A 4FLMA 2XMQA 1ZGBA 5JASA 1XZFA 1XZEA 4JUIA 3S8YA 3WQHA 5AKYA 3RKSA 2PVSA 4BAUA 1GXSA 3EIOA 2I3DA 3W9UA 2WU3A 4E14A 3FCYA 3DKKA 2Y1KA 4ZXFA 4EUSA 3HEAA 4H0CA 2X8BA 4Q1VA 5ALNA 2QXTA 5AI9A 4F5ZA 2R11A 1YAJA 1HL7A 4L72A 1IZ7A 4YK7A 1CR6A 2XUFA 1P0QA 4B0PA 3T52A 4P08A 3TJMA 5ALQA 2VSQA 4BE4A 2QM0A 4UHDA 2FJ0A 2DHEA 3QM1A 4DMKA 2J4CA 4EY5A 2OLEA 3HRHA 4EY6A 4XX1A 2HU7A 2HFKA 1W76A 1AKNA 3W06A 2HRRA 4G8CA 4W9RA 4M0MA 1Q84A 3W9BA 3QYJA 5K3BA 1VJ5A 4MEBA 2WG0A 5IVIA 4DLNA 2PBLA 1TQHA 3D0KA 4UBMA 3WZMA 3W05A 1AQLA 4FFWA 2WG1A 3I28A 4X6YA 1A8UA 4CI9A 2Y2UA 4IHAA 2WIDA 1XZBA 5AOCA 4QDXA 1TRHA 4RNCA 3ANSA 4BCCA 4U2GA 1BN6A 1DX4A 4UFOA 4UBNA 1GPNA 2XB6A 4BDSA 2YXPX 5ALUA 2HIHA 2IX9A 2DQYA 4DSZA 1LPPA 1IUNA 3ILSA 1LPOA 1CVLA 2XUJA 4W1PA 1LZKA 4RGYA 4OYLA 3QMVA 2VF2A 1QZ3A 5JAPA 2CZQA 5AHXA 3FCXA 3FLBA 1YS2X 1NU6A 1QTIA 2BUCA 3RARA 2XMCA 5J3JA 1GZ7A 1ZD3A 1EDEA 4D9JA 2C0PA 3WYNA 1LPBB 1CUUA 1LZLA 5CT9A 5CT8A 2C7BA 2Z8ZA 3STVA 4LXIA 1AUOA 4OUKX 4TVKA 3OPMA 3GZJA 3WJ2A 4G1FA 1YB6A 3ESDA 4C01A 1WCYA 3ZLTA 1W1IA 5YASA 4HZGA 2DSNA 3IVMA 2QMQA 5KREA 2G5TA 5BWBA 1XZHA 2I03A 4GDMA 3STTA 2HHAA 3WWDA 2ACKA 1JU3A 2BCEA 3DYVA 4BP8A 3C5WP 2YYSA 1LGYA 1A8SA 4Y2UA 5D7BA 1H23A 4UHHA 3WZLA 4GW3A 3H18A 5A2GA 5ALYA 1MX5A 1P0PA 1QIGA 3HJUA 4Q82A 1ZICA 2CBGA 2PUHA 2DHDA 1QLWA 2G5PA 3TGLA 2XQKA 2ZYHA 1MAHA 1T2NA 2JF0A 3GA7A 4QDOA 5AKHA 1YSCA 2HADA 1UWCA 1C4XA 2JGEA 2JGIA 4ARBA 3K6KA 4QLAA 4BYMA 2BAGA 1X70A 2W22A 1UOOA 1A8QA 3H17A 4FNMA 3DOIA 3RLIA 4AMYA 5CH5A 2H7XA 2OPHA 2C5GA 3EQ8A 5ALOA 5E4JA 3QPAA 3IUJA 2FJPA 3NWOA 2XUKA 5K3EA 4U2FA 2OQVA 1XZAA 4HXGA 3M83A 4JEIA 3Q8WA 3O9MA 4FLFA 3WWEA 1B41A 2WHRA 2JGFA 5AKGA 3BL8A 4HAIA 2VJCA 4J3JA 5KBYA 4LYEA 1TKRA 2GZSA 3FSGA 5ALDA 4K2AA 3PF8A 4KE9A 3WK4A 3LIIA 5KWIA 2JEYA 3WWCA 1XZLA 5AM5A 2XMSA 1VA5A 4C4YA 3QVMA 5ALLA 3G8YA 2XUPA 1LPSA 3Q0TA 1Q0RA 4PNZA 5ALTA 4QNNA 4MQLA 5JZ9A 2WFLB 1ZIXA 1X2EA 3I6MA 5AKIA 1JJBA 1CQWA 4F60A 3QMMA 1HQDA 1CUCA 3DKRA 1QFSA 2FUKA 3ED1A 3GROA 2BGNA 2HU8A 2O7RA 3KWJA 1XRLA 4B7ZA 1VXOA 4PW0A 1CUZA 2VT6A 1Y37A 5AH0A 2AXEA 3M81A 5C7YA 5SYMA 3GBSA 1XLUA 4UBJA 2Y6UA 2DCMA 2WSLA 1AC5A 1KEZA 1JMYA 3CXUA 3D5EA 4INZA 1N8SA 1CPYA 4S0XA 3HABA 5LKRA 1J07A 2BFNA 2WFMA 5AKLA 5JATA 1GKKA 4HRYA 3I1IA 4E11A 1ACJA 3R40A 3QPDA 4LXGA 2JBWA 3V1LA 4H35A 3FYUC 4B85A 5A7HA 5HK9A 1E5TA 5ALXA 3ESCA 3H2KA 1N5RA 4CG2A 2QTBA 3WIOA 4Y2RA 2OAGA 4Y2VA 1QIFA 1GQRA 1WM1A 3VVMA 1F0NA 5AIBA 4KE7A 3R3UA 4ZGBA 5LIPA 2RI6A 5EHXA 3MGAA 4H7KA 3IULA 1WB5A 1E8DA 2QZPA 2BKLA 2PSFA 3G0IA 2C4HA 3ESBA 3FVTA 1DT3A 3SK0A 1XQYA 1XZJA 1N1MA 1EXWA 3I2FA 2DHCA 3PDCA 5CMLA 2ZSIA 2CEKA 2VJBA 1XZKA 3K2IA 1RP1A 4AZ3A 1LPAB 4X85A 3WK9A 1EDBA 3W04A 4HVTA 4BC1A 4UHBA 5CXUA 3PFBA 2CB9A 4OYYA 5EHNA 2FX5A 2WTNA 4FDMA 1K6EA 4BVLA 4QDTA 3GFFA 4LYDA 1F6WA 5JIBA 3DD5A 4UHEA 3I2JA 1UK7A 1VLQA 5FLKA 4AN1A 1CUVA 4UHCA 3AIOA 4B81A 4H7DA 4CCYB 5K5EA 1VOTA 5ALGA 4Y2PA 2WM2A 1JT2A 4ROTA 3PI6A 1G4HA 1BEZA 3W2TA 5AIAA 1R3DA 3WIBA 5AKEA 1SCQA 5T4HA 4XIIA 2H1IA 3CCBA 1JJFA 4U2BA 4IQ4A 3D4LA 4A23A 4XWGA 1RYYA 4QDZA 1ODCA 5AKJA 1ZI6A 3NUZA 3F96A 2DFPA 1FFAA 3QZUA 1PFQA 2VTVA 1UOQA 5DTIA 3O4GA 5FRDA 3BE8A 4QE3A 2Z8XA 4QLOA 2XMDA 2VT7A 5A7FA 2XQJA 2HM7A 3MUOA 4Q3OA 4Y2XA 3EBLA 5AKKA 4KE8A 5AK5A 2ZYRA 3DLTA 4MEAA 5AO9A 3OOSA 2I78A 4DM7A 5FOQA 4PSDA 2H9YA 1CUIA 3S2ZA 3DS8A 2DQZA 3STYA 5CBKA 4C4XA 2XE4A 1YASA 3DOHA 4YX9A 3E4DA 3P2MA 2I3ZA 3VJLA 2XMGA 3LP5A 4Y2YA 1ORVA 2RIPA 2Y6VA 5DNWA 5AKXA 3RM3A 1AMNA 1XKLA 3ZV7A 1XRQA 4J7AA 2WJ4A 1M33A 1FSSA 4AQDA 3FYUA 1Q83A 4W1RA 3G9ZA 3STXA 1EH5A 4OB7A 5ALVA 3KXPA 3B12A 1CUWA 3MVEA 5I9IA 2NW6A 4OB8A 3MUNA 1DWQA 4X92A 4NMWA 3A2NA 5HZGA 4X93A 2WG2A 2CUTA 4H7HA 3IUQA 4RE5A 5LZ7A 1G5FA 2PSHA 4H7JA 4FTWA 3WL7A 1EVEA 2XLCA 4BZWA 1FFBA 4V2IA 3LLCA 3EQ9A 3V1MA 1EB9A 1FFEA 2QS9A 5EHQA 5FPQA 5T4BA 4ITVA 1XRMA 4Q05A 1R88A 5H3HA 3DYIA 1A88A 2OGSA 4CG1A 1G66A 4EY4A 1JU4A 4W63A 4ZREA 4UFNA 1YS1X 1UZAA 3D2BA 3QPCA 1GPKA 4KAAA 3A70A 4X3CA 5ALMA 1HKHA 4JNCA 1CIJA 3QH4A 2Q0XA 5AK3A 5HF6A 4NZZA 2EDAA 3WI7A 2ROQA 2W6CX 2V98A 4J0CA 2HA0A 3C43A 4G5XA 1HBJA 2WIGA 3UMJA 4KJXA 4XJVA 1W52X 4UPDA 2PX6A 3I2KA 2HFJA 1QONA 2HL6A 4MYDA 3OG9A 1XQXA 2RGUA 3H2GA 3PICA 1GKLA 2X5XA 1JKMA 4BAZA 5EIEA 1I6WA 3A6ZA 4CG3A 4K5QA 1QGED 4B9AA 2XUGA 1GT6A 3KDAA 3DL4A 5ALIA 4EB0A 5DWDA 4A5SA 4DNPA 1VZ3A 4JYPA 1ZIYA 3BJMA 4J0IA 4J0DA 2Z3WA 3AIKA 5HFAA 2P8SA 1ISPA 2XMRA 4RE6A 5DYYA 2AJBA 4AB1A 1BS9A 5ALFA 5T4FA 2DR0A 2PM8A 1S8OA 4X6XA 5CT4A 1L7QA 2XUAA 1A7UA 5C81A 3H1BA 2YH2A 5AI6A 5AK6A 4BTVA 5DYWA 1ODTC 3IUNA 2QUAA 3HYSA 4UHFA 1Z68A 1T4MA 3AINA 2RHWA 2XQIA 3DJYA 1CUFA 1SCIA 3D2AA 3BDIA 1AX9A 1JJIA 2EEPA 2V96A 4G4JA 1BRTA 1H2ZA 4UBIA 4QA9A 2G4LA 2C58A 3G02A 4HTAA 4CCWA 3E0XA 1L7AA 4U2CA 4GWLA 1UKCA 2QR5A 3B5EA 1XRRA 5LZ5A 1WHTA 2QJWA 3WKCA 5JALA 1H2XA 3EF3A 4PF1A 4UFPA 4GEGA 5ALWA 2QUBA 4H7IA 2XUOA 1YR2A 4OU4A 2VQ6A 1GPLA 1QOZA 5A7GA 5IVKA 2ZYSA 3ESAA 5ALHA 3WJ1A 4K6KA 4AX4A 4L9AA 4J0KA 4K6GA 4KAFA 2HA5A 3FBWA 4X71A 4GBGA 4OPMA 4J03A 3C45A 2GBFA 3WKEA 1ZOIA 1O6GA 1EVQA 3T4UA 2HA3A 3D59A 1LLFA 1W6RA 3I6ZA 4N5IX 4PSCA 1J06A 1CUJA 1IUOA 2HDWA 4EZIA 3H2HA 3AFIA 2CMFA 1E66A 5HCUA 4EY7A 5CXXA 1SOMA 1L7RA 1CQZA 1QIEA 5EHZA 5LZ8A 3FOBA 5JD6A 3JWEA 5BOVA 4BAGA 2CKMA 1ODSA 1AZWA 4U2DA 5C8XA 3FSGD 3PFCA 1K63A 1XQWA 3V48A 1JMKC 1ZI8A 2O2HA 2B61A 3CN9A 3C6ZA 1QO7A 3VJMA 3WKDA 5LLSA 4Y2SA 4L0CA 2O2GA 2JGJA 1CUEA 2WFLA 2WUDA 3AUKA 2J3DA 3WA7A 4EY8A 4DMFA 1P0MA 4L3WA 1CUYA 1Q0ZA 2PUJA 2UZ0A 3G0DA 4KAJA 3C5VA 4B80A 3PE6A 5LKAA 3F8SA 4UBOA 1WPRA 3L1HA 2OAEA 4P92A 1R50A 1EHYA 1K8QA 5KWJA 2XQGA 1MN6A 4RPCA 5ALEA 5JADA 4MJ3A 3HSSA 3C70A 2H7YA 1AGYA 1O6FA 1CEXA 2GYWA 1TCCA 1XQVA 1EK2A 1VA4A 1PV1A 5DTJA 3H19A 3BWXA 4KRYA 2RONA 3UUEA 2WUGA 1QIKA 1FFCA 5LZ4A 1HPLA 1NU8A 5LZ2A 4I3FA 5IVDA 3UUFA 4ZI5A 3G9UA 4WDQA 1CUGA 3KD2A 1QIHA 4OSEA 3LIPA 5AKZA 1XLVA 5A71A 1YAHA 2GBIA 1WOMA 2ECFA 7YASA 4OCZA 1BROA 1E89A 1Y7IA 2QT9A 5F4ZA 4B0OA 1UT6A 4FKBA 1MTZA 4WCVA 2VATA 3STUA 1U2EA 3VVLA 1THGA 5I7UA 2ZYIA 5FUMA 3WK6A 1DWPA 5ALRA 3X3HA 3LCRA 2OCIA 2VJDA 3C87A 1BCSA 3ICVA 1QO9A 1U8EA 2VAXA 3DL7A 5D3ZA 4ZV7A 2GYUA 4X97A 1F0PA 4FLEA 2PSJA 1R1DA 4BVJA 1UK6A 5EFZA 4ARAA 3BF7A 5CT5A 1LPMA 1XLWA 3WL6A 2HU5A 2BJHA 1XRPA 1R4ZA 4QZVA 1USWA 5IVHA 2RHTA 3DQZA 4G4GA 2WHQA 1C7JA 4KACA 5AK4A 4GECA 3FYTA 2XUHA 4BRSA 5JAUA 1JFRA 5CH8A 1EDDA 1H2WA 2WUEA 3E1GA 3O4HA 4C87A 1SCKA 2XI4A 1K5PA 1BN7A 4CCYA 4C6HA 5JZBA 1X2BA 4WDRA 3G0BA 3DNMA 1FFDA 5AI8A 3HXKA 1UK8A 2K2QB 5JAOA 4DIUA 4KE6A 1DU4A 4N8SA 2AJLI 2J4FA 1E3QA 1E8MA 3ZLVA 3TRDA 3L1JA 3WL8A 1DX6A 4C89A 5FXMA 2GYVA 1MO2A 2B4KA 4LKOA 5CTAA 1E8NA 4X91A 4ETWA 2ES4A 5ALPA 4MWTA 5HQ3B 5AJHA 5ISMA 5JANA 1TIBA 5DNVA 1U65A 5LZ9A 3V9AA 5IH7A 1MX9A 1B6GA 2VJAA 4H7FA 5HQ3A 3AZPA 5K3CA 4QEKA 1QIDA 1AURA 4EHBA 1LBTA 4X95A 1EK1A 1H2YA 4ZRDA 2Z5GA 4W1SA 1IUPA 3I2HA 3SX4A 1D07A 1Y7HA 3I6YA 3OC0A 1VE6A 1QE3A 4DSAA 5E4TA 5SYNA 2GZRA 1EX9A 2WJ6A 1MX1A 4F0JA 1TAHA 2WILA 3ZLUA 5ALSA 3I2IA 4DNOA 4NVRA 5T4EA 3G9TA 2WIFA 3QBJA 4N8EA 5AICA 3E3AA 2JGMA 3IURA 4FBMA 2E3JA 5ESRA 3ZPXA 1OCEA 1WB4A 4A16A 3G9XA 1SC9A 4G9EA 1QIIA 3VKFA 4AMZA 3WK7A 5BWCA 1HLGA 2XUIA 4UBKA 5CH3A 1XROA 1DWOA 1CUXA 4IH4A 1XZGA 5JD4A 5JYCA 2JEZA 3K9BA 3A2MA 5I8PA 4HRXA 5AOBA 5HFNA 3QMWA 1CV2A 2RAUA 3BJRA 1SFRA 1WHSA 2IITA 4FMPA 4W1QA 3OTQA 1ZJ4A 5JD5A 5CRIA 3QITA 2WU4A 5FDFA 2D5LA 4X90A 4FNGA 4Q3LA 4KRXA 3C6YA 4DNFA 5AI5A 4FHZA 2PU7A 4G8DA 3I1YA 3R3WA 1QFMA 3ANTA 2HA4A 4G8BA 4WFIA 1MNQA 5K3FB 5BV7A 1UKBA 2AJDA 1MNAA 3IUMA 4B9EA 3BIXA 4Q3KA 2QJRA 3KOOA 4EBBA 4PV7A 5HF9A 5K3FA 3FWHA 4I4CA 3WK5A 3O95A 4WY8A 2XLBA 3F98A 3NGMA 4EA6A 3FLEA 1MJ5A 4Y9SA 1UKAA 1BE0A 1P0IA 2OQIA 4FOLA 3F97A 4IH1A 3R0VA 2ORYA 5FP0A 4OB6A 5JARA 2J3QA 4NS4A 4C4ZA 3AZOA 4H7EA 2PL5A 5ALKA 4AO7A 4MYSA 1DQYA 3BDVA 5AM3A 4PO3X 3NOXA 4KR0A 3VISA 5HK8A 2XUQA 4MQMA 1UK9A 5E4YA 4CIBA 2GBGA 1XZCA 1XKTA 3YASA 2QXUA 4AO6A 3O4IA 1GGVA 4BVKA 4X00A 4CFSA 4CIAA 1XRNA 1CFJA 4P93A 2WQZA 5AOAA 4P9NA 3R3YA 3IB3A 3WLAA 5DNUA 1KU0A 5AI0A 4AXBA 4BCDA 3PF9A 2PU5A 2X76A 4J0HA 1FJ2A 3H04A 1CRLA 3R3ZA 3JYHA 3WL5A 2O7VA 2EDCA 2XT0A 1EB8A 1ZD4A 2G63A 2ONCA 2WFZA 3V1NA 2Z3ZA 4LHEA 4GI1A 3WK8A 1JI3A 2B20A 3FVRA 3HC7A 1LBSA 4B84A 2OXEA 3ZI7A 3I2GA 3R41A 3HI4A 5D3KA 2JGLA 4B83A 4E46A 1K4YA 3R3VA 5JAHA 2BUAA 1IZ8A 3WMRA 1EA5A 3WWPA 4XVCA 4WFKA 1XZDA 1MPXA 3G0GA 5FPPA 1MAAA 4E15A 4X6UA 4FWBA 4GLBA 4C88A 2D0DA 2PPLA 4MXDA 3OM8A 5CT6A 1R9NA 3TEJA 3H1AA 5DYTA 4BCBA 5C8ZA 1TCBA 3IIIA 1IMJA 3H2JA 4FFVA 4BATA 4U2EA 4H77A 4N8DA 4ZV9A 3GUUA 1XZMA 3FAKA 2OGTA 5EGNA 3C8HA 1WPXA 1OILA 1LNSA 4M0EA 4DYHA 2XUDA 1THTA 1DTEA 4TPKA 4F21A 1J1IA 3IDAA 3AILA 2AJCA 1VZ2A 1BCRA 4BZZA 3SWWA 3D2CA 5CURA 5EI5A 4Y2JA 5K3DA 5AM4A 1ZGCA 3N0TA 1ACLA 1ORWA 3L1IA 3IBTA 4DGQA 4Z49A 2V97A 1ETHA 1KU6A 3PUHA 2WIKA 4WFJA 1VXRA 5DJ5A 5C8VA 2XQFA 1VE7A 1RWQA 3KSRA 3A2LA 5AM1A 2CJPA 1MT3A 1ZD2P 2H7CA 2GBCA 4IH9A 4PQEA 1EI9A 3VXKA 1PJAA 3CN7A 4HXEB 1TK3A 3LS2A 3WKAA 3STWA 3G7NA 3R3XA 1HDEA 4GHWA 4BRZA 4JYMA 1DT5A 2ZVDA 3OURA 2Y2VA 3O9VA 4GXNA 3AIMA 1NX9A 4YPVA 1QIMA 4UBLA 1BEEA 5EIHA 3C6XA 2O2IA 1R9MA 1DINA 1F8UA 2C0QA 4HS9A 1QIJA 4J0JA 2IIVA 3WYDA 5ALZA 1CUSA 5FV4A 3GELA 3O0DA 1EINA 4Y2TA 2HA2A 2VEOA 2R8BA 2WUFA 3IA2A 2PSDA 3G0CA 2XDWA 2LIPA 2B9VA 5HKBA 2OGZA 4AZ0A 2YASA 2HA7A 4ZWNA 5AM2A 1BU8A 4I19A
chains in the Genus database with same CATH superfamily
2QVYX 2R4UA 1OBVA 2Y99A 4QXQA 4M83A 3TLBA 1Z5OA 2BM9A 3QLJA 3RFXA 1PV2A 1GTZA 1QG4A 4PRKA 3UN1A 3WIUA 4CTOA 4EHIA 5ALJA 1G6HA 3ZV4A 1KR2A 5IABA 1M2OB 2IY9A 1C9NA 2YHUA 3DLPX 3NHZA 5EPUA 3PUIA 4NH4A 1G59A 4G0MA 1QAOA 1XOIA 3AM4A 3G1UA 5LYYA 1L5HA 1VKHA 5IT5A 3UYLA 3U49A 2P0AA 3QKRA 4TL6A 3WWOA 2BMVA 5FBRB 3F8TA 2XOKD 1SCJA 2J3EA 3BYZA 1SURA 3IOEA 4R5HA 3R6WA 2Z6AA 1XDBA 2BRUA 2VDJA 2QI9F 4BECA 4DLUA 2C4KA 3BJEA 3N0XA 3SM9A 4TGLA 2P2YA 2REBA 4AC9A 4DAEA 3ADCA 3JQEA 4Y7DA 2KBFA 2PSEA 3UWDA 3DV9A 3PITA 4WTOA 4K6HA 4DKXA 1TYZA 3OZ7A 1RWVA 3RS8A 2MSNA 1ECFA 2BEWA 2G82A 2OK8A 2YVQA 3UB3A 1BE8A 2H8GA 4K0KB 1D2EA 2EKZA 3EZFA 3R7FA 4CU5A 1ZW1A 5IF3A 1P8JA 3VSDA 3DO6A 5K3AA 1GSHA 1XQ1A 2VDNB 3GFOA 2QJTA 3JW8A 4PEVA 3WB1A 1DJQA 2AWOA 4CVNA 2CW5A 2CDAA 1VMAA 1UBCA 5K0CA 4M9CA 3HLKA 4HDRA 4B74A 2VBCA 2ACEA 2NO7A 4KBGA 1OFHA 3B13B 3EMVA 4TWRA 4EVQA 3VC7A 1QFXA 3HFGA 4XUGB 3WB2A 4BU0A 5BV1A 1Z45A 1WVMA 1SO8A 4XYBA 2AFHB 2VKTA 4QHTA 1U4NA 1GIAA 3A1EA 4QFDA 3AG5A 3UC5A 3H5AA 2ZSHA 3QPVA 3HDHA 4B6GA 5JYDA 2GHRA 5HF8A 2C2BA 2JFNA 4GX2A 3HM2A 4KZPA 3P4UA 4M4SA 1BQ3A 4LG1A 5HKKA 2JCGA 2EL7A 5C8YF 2P79A 4IIBA 5HJ5A 2HEGA 4W5TA 3F9CA 1QJ4A 4RA6B 5JXJA 2RGWA 4H4CA 2GD0A 1ZD5A 3O84A 2XV1A 2BFEA 3L40A 2ZIUB 1HFKA 4XR9A 3R9XA 3QA3E 4FJ0A 1XWWA 3R9IA 4XVHA 2AFIB 3N2ZB 5JMWA 2ZUFA 4FFOA 3DCYA 3EXG2 5JZSA 3NASA 5AP9A 4HAVA 1DQZA 2JGKA 2I87A 4CODB 1JHYA 1XELA 2IOFK 3GT7A 1MA0A 2WHXA 4MW9A 3VDXA 4BVGA 4P6VF 4R3UC 3X1WA 3SSMA 4ZMRA 3U9SA 2OHXA 2ZJ7A 3FJ1A 3G82C 1JEEA 1ZI9A 2IOFA 1ZJWA 5JNRA 1S3GA 4WIAA 7ADHA 4CWAA 4MO2A 1IN8A 4K46A 4ND8A 4UNQA 3OC6A 3ZLBA 1LDNA 4ZCQA 1WA5A 2YKGA 2OR3A 4ZK2A 2ZAYA 5I45A 3F4BA 2IXDA 4LNUB 4UM5A 3UY4A 3SJCA 5E2IA 3DO5A 3IKLA 4UQLA 1DHTA 4PZ9A 1TTHA 4AYXA 2W0MA 2EWVA 5K03A 3H9JA 4Y6QA 3NDIA 4DTIA 2JDID 3ITDA 5JZOA 2X1VA 3W9SA 3OD1A 2WFAA 2QTMA 2C5FA 3SZ3A 4FFRA 4TL7A 4Z6KA 3C3YA 4X7BA 2P3SA 1XHEA 3CR8A 3AJAA 3QJYA 1G6OA 5THQA 1WUJS 2H4FA 1S5PA 1L7MA 1N6PA 3ZE0B 4C06A 3ZHOA 2I4RA 2JFPA 4ZALA 2OY0A 1OPRA 4RF5A 1WB6A 4LY3A 2Q1SA 4YP7A 5BVHA 4F72A 3QVWA 4X94A 4GC9A 4GKKB 1ZX1A 4DYVA 4YAEA 1C8VB 1N9GB 3JQ8A 2PA3A 4BN4A 2WSBA 4A36A 3FHLA 2E89A 2WD8A 1IVYA 4MS4A 1H1DA 1X14A 3QFRA 1ECGA 2EFDB 3AOGA 3BXPA 3LPMA 5TXGA 3VPBA 2B4AA 4OI4A 3T12A 4UUQA 1MZPA 3KYBA 2DX7A 4QYIB 3VC3A 2HA6A 4ZO4A 4BEBA 2VPZA 4EPRA 4CM9A 1E4EB 2G17A 2HDHA 2OOSA 3L7LA 2I55A 4RDHA 1T3LA 3HACA 4Q34A 1S8FA 2E0IA 5IHPA 3WLHA 2FEPA 3WNVA 3DKPA 3HZHA 1TDJA 3IIEA 1QRRA 4YFYA 1GTRA 1GFWA 2ZDGA 4NABA 3RUPA 1LI7A 4F4UA 3LW7A 1EZ4A 2NTJA 3I39X 4W5WA 3FTQA 4JJZA 1UZLA 3BK1A 4H60A 1GG9A 5COAA 2H0QA 4CIDA 2FFQA 4YXFA 1Z0DA 3K72B 4GPTA 4YP1A 3M82A 1DOZA 1X1AA 5FHQA 4UUBA 4C0JA 2EFEB 3CWCA 1ECLA 2ZCUA 3C6BA 1WZ2A 4YIHA 1B0UA 2PKQP 3EJ6A 2DE0X 3KQLA 1JECA 5DGIA 1NOJA 3QX7A 1SA0B 3RGWS 4M0LA 4RA9B 3OWHA 2QTGA 4QFMA 3ZHQA 2PE5A 1XAHA 1W87A 3B3GA 5JCOA 4YMSA 2H4HA 1JG2A 1V0JA 1WP9A 2AYXA 3MGCA 1QR2A 3IOYA 3LBHA 3O75A 4OLJA 1YB1A 3TE7A 4TUYB 4BB0A 4DIDA 4MOWA 4DLYA 5M29A 5EKXA 5K6TA 2CNKA 4UVGA 3FZGA 5F51A 1I2CA 2P2GA 2WYUA 2CLFB 3AZQA 3LI2A 1DIOB 3TZCA 3ZWQA 4HGRA 5DW3A 1CRQA 2YRXA 5BVGA 2Q5EA 2Q3DA 4IO0A 3TW4A 1T2DA 3IE1A 3L79A 4IX9A 4YI5A 3V34A 3G8AA 2BJVA 2G0NA 2ZW9A 1N5MA 3EW7A 3OZXA 1P5FA 4JMLA 4DDTA 1GYRA 1RXCA 2I1QA 4O02B 3TSAA 3E03A 2ZXFA 3I2YX 4Z3DA 1EFLA 2XMZA 3TLGB 2WZCA 2EKLA 3FNBA 3NUGA 4INAA 4PHHA 2NX2A 4OQLA 3O6VA 4BNIA 4DB2A 5FI1B 3OY2A 2PFKA 2HBRA 1VSTA 5JASA 1UBNA 4RD2A 4DGSA 3G8BA 3WQRA 2EARA 3DPIA 5B37A 3H9QA 5JWRA 4I46A 3OZVA 5HK9A 4JUIA 1WZCA 4QFBA 3PNBA 5AKYA 3QX3A 5BQ3A 2PVSA 4FGLA 2IBSA 3AJ9A 1TAUA 3EIOA 3MJEA 4U00A 2I3DA 4KPFC 4QDJA 3W9UA 3DMNA 2X6TA 1GNTA 1VPEA 1WU8A 4MS1B 3SHTA 3W6ZA 3FCYA 3DKKA 2B83A 3B9QA 5CCBA 5GMOA 3WC4A 2BDTA 1BVRA 2HK8A 4H0CA 4MRNA 9GPBA 2PGOA 4B3JA 1JPJA 1MC5A 2FLVA 2G36A 2M2IA 2ZRAA 1OSNA 2CL7X 3K9LA 1AQYA 3MBIA 3U4DA 4PQGA 1SB9A 2R11A 1YRWA 1TXGA 4Q3CA 3LA8A 3W2IA 1O89A 2CXSA 3ND6A 4LZAA 4YACA 4YK7A 1Y1SA 3ZZUA 3SS8A 4D56A 1RW4A 4AP6A 3O82A 4DC1A 3OEYA 2BFBB 2WZQA 2TMKA 3PGXA 4MJXA 1Z6QA 2GO1A 5ITSA 4L76A 2J33A 3IP9A 2LW7A 1MMFB 1G1MA 3NBAA 3KTAA 4MHTA 2CHGA 3TJMA 3LGSA 1DJMA 3LUHA 1N25A 3O1JC 1NJ2A 2P62A 4PSVA 1C80A 2ZT5A 3VYSB 4BE4A 3AB7A 2EQBA 2ZWAA 4L78A 2Q9CA 4P81A 3KWLA 521PA 1M54A 2ZZNA 4O3MA 5KWVA 3GUZA 3SXUA 4C9BA 5KTPA 2F1IA 4OUDA 3ODGA 4EY5A 1YJ8A 1GFIA 1G41A 3I5UA 3E5NA 2CZGA 2GA9A 3HRHA 4NBNA 2OAQ1 4EY6A 4NARA 5C7IO 4AY4A 2NZ2A 3RGGA 2FFBA 4LHXA 3SC4A 4I50F 4PTZA 2O5CA 1NBIA 1V35A 2HFKA 2Q50A 3P2IA 4WZAA 1EYZA 4WJZA 2J08A 5E7QA 5TB5A 3RYFA 4MIOA 3HCRA 2VCEA 1C1HA 3M4JA 1G2QA 4QEZA 3H6KA 2GJ4A 3K20A 1FFHA 4IICA 1L7OA 1JTEA 3FPAA 3ZTTA 4P7BA 4YLGA 5F7OA 2JFWA 4HAOA 1FC0A 4HB0A 4LF6B 2W6PA 2OC9A 3JR7A 1OYWA 2FZLA 1VJ5A 3QE0A 4HEA6 5IVIA 3F3MA 3UJDA 4DHEA 2PFSA 3H4IA 1R8JA 4HWTA 4K28A 3LYAA 4LJ9A 5ES4B 2AGVA 1RTKA 3GT0A 1PI3A 3OOWA 3GL9A 1ADCA 4FB5A 4C2UA 1TQHA 2WJWA 4UBMA 3FDJA 1I5RA 3DT9A 4FT2A 4EG5A 5J23A 3WZMA 4HEHA 2AN3A 2PXHA 4ENUA 1QOPB 1ZUNB 5K8TA 3W05A 3PV0A 4OBWA 4E7PA 2G1PA 3IB6A 2ID9A 3AKEA 4HO1X 1SN7A 4KPEC 3I0ZA 2H85A 4FFWA 2BEVB 2WG1A 4CM4A 3OETA 4A0FA 3KQVA 4IHAA 1VYVA 2HWXA 3UPTA 7GPBA 4O6VA 3CRW1 5AOCA 5KINB 3PB3A 3MTAA 3NTUA 2P2LA 1TRHA 3TRFA 1JFFA 2W9XA 2PKEA 2JIBA 4UFOA 1I10A 3K73O 1XMVA 2VP9A 1HEUA 3LM8A 3UPUA 3IH5A 1GPNA 2XB6A 4RVFA 4BDSA 1P73A 4WEQA 5EIFA 2FLKA 2HIHA 2X9VA 2JKYA 4KSCA 3SC3A 4YMTA 2CVFA 1SZDA 2IX9A 3FZQA 3PXAA 2DQYA 4R7GA 5M04A 3EEOA 4F91B 2B35A 5H82A 4BJ6A 2JJ2D 1JU9A 4W1PA 4JDUA 4G5YA 3BZUA 1PKEA 4LJ4A 2BFPA 3ADDA 4FGWA 3FOZA 3T3NA 1PNRA 1QZ3A 5JAPA 3A7DA 4NYJQ 2CVPA 3HVIA 3PGJA 3TSWA 1EVLA 4M8IA 1CDEA 3PJGA 4FSHA 4S12A 5DX1A 3L46A 3FBTA 1BSVA 1QTIA 4LFAB 3RARA 1JR6A 4M76B 1EFRA 4FGKA 5HRCA 2BFOA 4Q9HA 3UJBA 3HVJA 1BWPA 5DKFA 5LMCA 2AQIA 2YNMC 3AU9A 4OMDA 1TK9A 1L6RA 3CUKA 3CRVA 3EC7A 5CT8A 3K3PA 4HEJA 1W6UA 1AUOA 3PT9A 1ZD9A 4TVKA 1P2GA 3ZNPA 4C22A 5C4GB 3JR3A 3R7NA 1VDMA 3AP2A 2QB5A 3C4QA 1J56A 3IRUA 3N8KA 1DC3A 3PRKE 1YB6A 3II6X 1E77A 3UHOA 2FMIA 5IH3A 3H5VA 1W1IA 4R31A 1UMDA 3IDOA 1PL7A 2JHCA 1VGQA 1Y1RA 2XNJA 3P9XA 4HZGA 3TQOA 4P5EA 2FQ1A 3TBFA 2O8EA 2G5TA 3DP7A 4BVFA 2PD3A 2I03A 1PL8A 3STTA 4WV3A 2MSCB 2Q4RA 2HHAA 3BREA 2O0KA 3WWDA 3TD2A 3FMFA 3BQNB 1PJRA 1W85B 3WGJA 1QCCA 2O6HA 1J09A 1ZM3A 4ZJUA 3DYVA 1YQWA 3KTDA 4RENA 2IEZA 4YRRA 3M0EA 1ZQ1A 2R6HA 3IEXA 1QCYA 1YS4A 5REQA 2QVZX 4BJ3A 5CD1A 3QWAA 3STHA 4BFCA 1TZCA 3T1TA 1N77A 1U8TA 1OI3A 1O9GA 1JJAA 2ZB8A 4JQZA 4GE3A 3T5DA 4Y6LA 2QVXX 5LN1A 2G9ZA 3TM5A 4X64B 1H23A 2PMDA 3WZLA 3TCKA 4RZ2A 4ID9A 1Z2EA 2WC1A 3CVJA 3DWIA 2YTZA 3EFBA 1O0BA 2A4MA 4GW3A 4CMCA 5AVQA 1BJTA 3THWB 3JQGA 5TMEA 3G89A 5ALYA 1MABB 3SY8A 2P1ZA 1XDUA 4MUJA 4DQXA 4YT4A 5KC9A 3SHFA 3SJ7A 4MW6A 4QQRA 3SXPA 2XWJI 1RBYA 3KT0A 1ZICA 2PUHA 3PUXA 2DHDA 5I4CA 1TVKB 4Q1CA 4TMTA 4EGFA 1QLWA 1ICEA 1MHTA 4Z4IA 4B33A 1ZCJA 2EV9A 5A2QA 2JEOA 3JQ9C 4G0OA 2O23A 4YMIA 5EJEA 3TGLA 4QNMA 1PJZA 1FUEA 3PUJA 1A8PA 1T2NA 4KWIA 4AUNA 3FTDA 4MKXA 2V7UA 3EOAI 3GD5A 2DH5A 4QTYA 2ETVA 2WSIA 5BXQC 3TD9A 3OMLA 1UJNA 3IBFA 1GL7A 1ZQ9A 4ZEOA 2ONJA 1FU4A 1UAYA 1U1FA 4MVWA 1O97C 3NHLA 4UE3S 3N86A 1UWCA 2JGEA 4IGFA 2JGIA 4QIHA 1XT6A 3VTFA 2RCNA 3T34A 4BYMA 1WF3A 2Q3FA 3V9PA 1I13A 1M6YA 2JGNA 1N9ZA 5BSUA 1DBSA 1OB5A 3TCNA 1LVHA 4LI3X 4MGEA 1G2IA 2PRIA 3D3WB 4CM8A 1IOWA 4E94A 1ODLA 1Y9JA 5LNK6 1NRJB 4D96A 2H4XA 1RAHA 4BQSA 4P3KA 5CXSA 2X86A 1IM8A 3INTA 3AEQA 3ND7A 4MWGA 3G2KA 3RV3A 1OH6A 1U7UA 3G23A 3SGLA 1Z5NA 3EQ8A 2KQUA 2FSIA 1U1DA 2HBYA 5TMDA 2YY5A 1DO0A 3MWFA 5JH7B 3OHSX 1SZCA 4A0GA 3NWOA 3KJEA 3GCGA 3NC0C 1VPTA 1ZCAA 2E87A 4TKVA 1FW6A 4PC1A 1AN0A 5FUXA 3C7TA 1M34E 2P6NA 4HXGA 1P3Y1 2NPOA 4WBXC 3CPEA 5FOTA 1CP2A 1MLDA 2A1TR 4JEIA 3ZDCA 1HTTA 1F2VA 1CYDA 2O57A 3ZE1B 3H1EA 2FU5C 1V3VA 2Q4BA 1SG9A 4LDJA 1ARZA 1FOEB 4L0MA 4GBJA 5IULC 7ABPA 4IMJB 2FZ4A 3D6UA 4BWYA 1IONA 4CJXA 4MROA 3KQUA 1A9OA 2NTYC 4GSLA 3FDIA 1DKNA 4EB8A 4DG8A 2GVDC 2Z3VA 1RZRA 1UMBA 1QGOA 4LJSA 2I3AA 4WJKB 1N5IA 3AUAA 5A1JA 5HE8A 1ZONA 4HXYA 3X2EA 3M4ZA 4WHMA 3WGYA 1EUDB 5LDGA 2C1ZA 2CXHA 2JAQA 2LIVA 2NYVA 2J3KA 3QK7A 4KXNA 2FMFA 4M8SA 1HZZC 2BF4A 1REQA 4G84A 4LC0A 4S1TA 4UJ5A 2DBVO 2SKEA 5KBYA 4LYEA 2Z0MA 1OHHD 3QRWA 4J1TC 3FSGA 4AECA 4BRUA 4ZKEA 2NUPB 2JFFA 2XZLA 4KE9A 1ZMOA 1MJNA 1R6DA 2JJQA 5DBEX 4E1AA 4CLRB 3WDKA 3H5NA 1ZEMA 4D41A 4QBHA 1MO5A 3HXPA 1U2SA 3AT1A 3JVIA 4OJYA 5AVOA 1NV9A 1NI4B 4WKBA 5JHGB 5KKNB 1M8GA 2XECA 2Q29A 4N82A 1QRAA 4K9KA 5ALLA 4J29A 3T1HB 3KHTA 1GT91 3TJZA 1A9QA 4KQEA 3ENKA 3Q0TA 4CLXA 2HAEA 3AUXA 5LLTA 4R1OA 3OEED 4RY0A 3E5HA 2Q5FA 1G8SA 2FPRA 1U3GA 2YYZA 2CB0A 3CG0A 2RGGA 4QBFA 4QUGA 2BCJQ 2F3TA 3BAFA 3CVOA 1C41A 1P39A 2IUYA 3I6MA 3N8DA 4G0UA 1JJBA 4MTCA 2R8YA 2XNHA 4U8GA 3T5AA 1BXGB 5JDIC 1X7WA 1DO2A 5CFNA 2B2CA 4MV7A 3DKRA 3TAXA 2SKDA 5J2UF 3CKLA 4A15A 2A9RA 4LOAA 6AT1A 3GROA 3WB9A 1SXGA 2BGNA 2C4UA 1XRLA 1PBNA 3MT8A 1U4SA 4NOJA 4UUMA 1XE3A 2IP4A 4PW0A 1PGPA 1NQVA 3D7NA 2VT6A 4KLZA 4C2AA 1W96A 2P4EA 2RCYA 3AFOA 3D02A 3HTXA 5ULLA 3ZS9A 3KJHA 1KPHA 1MGOA 3OTWA 4KFRA 4OXNA 2PMWB 2VK8A 4I81A 4D8XA 5JH7F 5L40A 1XLUA 5G2OA 2DCMA 3A0UA 5JPDA 1NZJA 2RGNC 1CY6A 1HDXA 1T9KA 2OVFA 1RLUA 2YNMA 2PGXA 2VS1A 1ULSA 3CRMA 1VL8A 2I2AA 3OF2A 2QUIA 4MO9A 1U8CB 1MV5A 1UIRA 3GNQA 3GUHA 1Y81A 4IIDA 1HDYA 5DNDA 1D03A 1ESMA 1Y6ZA 2JFOA 5HRAA 1N8SA 3JD2A 5B4VA 4B73A 4JLPA 3FYHA 3FUVA 4WN9B 1CF4A 5DEIA 4FW9A 3RYHB 3QNUA 3HABA 5K09A 2NXJA 4DR2B 4RZQA 1NVGA 1R18A 1R6BX 2HSZA 4P80A 4MRSA 4E32A 2WFMA 1SG0A 2BFNA 3HJTA 3SYNA 4FFMA 1NW4A 2Z9DA 2X1LA 3OKPA 1NLUA 4X7RA 3F6SA 5BQFA 5JATA 1H6DA 3O74A 1JR4A 1UUFA 2NAFA 3A6FA 4HRYA 2QRZA 1XPJA 3PQ3A 1GYQA 2P9YA 3JVDA 1PJ4A 5LLDA 1KGDA 2EFHB 1E92A 3GJ4A 1FP6A 1WTCA 1IJFA 4O2LA 3TTVA 2VN8A 4UU7A 4DCUA 2GGSA 2XZOA 3R1IA 3UF0A 1ZEJA 2FEMA 4JBGA 4V1CI 1BFKA 2CK3A 4PIVA 4RTPA 2F8TA 1UBHS 5A5GA 4ZOLA 5KX5B 2D5BA 1KC1A 2X19A 1ZUWA 2JBWA 3EDOA 4IDAA 4DPKA 4H6WA 1OJLA 2EWWA 1II8B 3V1LA 4H35A 3ZQJA 4PO8A 3WV5A 1NJFA 3EQZA 1A5TA 1IEXA 2D2EA 4E33A 1FNDA 4H2DA 5ALXA 1HO3A 2V3VA 1Z0ZA 2YXNA 2RJNA 1DAKA 1NURA 1OUMA 3PEFA 3R8XA 1KQ3A 3AF4A 3WIOA 1KJ9A 3H75A 1I24A 3ILHA 2WWRA 2WE7A 1SBNE 5FNVF 2GI4A 4GMDA 4IG4A 3O7WA 3JX9A 1X0XA 3RSQA 4B3XA 1BD3A 2BBOA 4Y2VA 3GT4A 2PMKA 2NAPA 3C4JA 1T6YA 4RV5A 4ZTBA 3JARB 1BFUA 2J0UA 4TYQA 5E1MA 1K1EA 3ZBQA 1NVKA 5AIBA 3QEBZ 1MJGA 3TW0A 3JQ9A 1I36A 4QQNA 4ZGBA 2QL5A 5JUWA 2WWVD 2Q5CA 2V8OA 3A4VA 1N2ZA 3EOZA 5CW1A 4YMWA 5B2FA 5LIPA 3VZDA 3B78A 1YJ5A 2I99A 4HMOA 4D0LB 1O54A 2JLWA 2AG0A 2ZDQA 3AY3A 1A1SA 3JZIA 4MHSA 1EWTA 5EHXA 5DTEA 4CV1A 2HX1A 4H7KA 4G2NA 2G9QA 5F9HA 2PLAA 3FKJA 4IUBS 1E8DA 2QZPA 2X1HA 2BKLA 4E22A 3UATA 1YRHA 2PSFA 3DHWC 4EARA 1UZUA 4B2IA 1C1DB 2C92A 1DT3A 5HXAA 4NE7A 2CE7A 1SUWA 1NXSA 1U2ZA 4TX1A 1RKBA 2IV3A 1O4WA 1GOTA 5JXIA 3I2FA 1M8JA 3AHIA 1C9DB 1PEAA 1U0HC 1Y3CE 3N1UA 4KO2S 5I7VA 3J7TA 3A1CA 4J7UA 5AW7A 5F7XA 1VG0B 2ZSIA 4ZDIA 1YI8A 3W0LB 6CHYA 3WGZA 3K2IA 1N5OX 1RP1A 3PFNA 3A4TA 3M49A 5B1YA 1IG3A 4JKYA 4QUIA 1D2MA 1A76A 1YHYA 1I6KA 2G1AA 3DVAB 2GKGA 5DP2A 3ZHZA 1RLJA 1MEEA 3HQ4O 5TT1A 1JG1A 2J3HA 5FOVA 4MK4A 4MUEA 2WK1A 3V80A 2X2FA 5EUQB 1QAMA 2OORC 1SD5A 1NBHA 1N2OA 3KJZA 5KEIA 3MIIA 3BFVA 1QV9A 1Y1KE 1G20E 1ESEA 2QTZA 2GJ9A 3X0DA 4OHPA 5HKKD 3CUSA 4RA6A 1DAHA 3KLPX 4ZA2A 2UZ4A 4OV6B 5D3MA 3V3KA 1O6ZA 4PHGA 3EK2A 3PU6A 3HCFA 4M1TA 4QDTA 2QQ0A 2O2JA 2V6IA 3BHMA 1TMYA 4LYDA 4R2MA 3RTCA 3I2JA 1EP3B 3PFFA 3VC2A 2P27A 1U5BA 3G13A 3N8HA 5EXDA 5FI3A 2VDOB 4YCMA 2HLDA 1PJ8A 1CUVA 3NBMA 2NNLD 4Q12A 1K98A 4E51A 1HZZA 3KXLA 3LVFO 4H7DA 3R24A 1J2RA 4JT2A 4RF4A 2PGDA 4ML3A 4BV9A 4CCYB 5JCZA 1VOTA 5IWCA 3V4FA 5L3SA 2JARA 3T38A 3ZUPA 1E4VA 3I8XA 1ZH6A 5J4VA 1IWPB 1CF2O 2JK0A 2ISCA 4NTZA 3GPBA 4P35A 1DADA 4U7JA 4UAJA 5AIAA 3B2EA 3U7QB 3KPJA 4K1XA 4B6JA 5D7NA 1HTWA 3VNRA 3WGUA 4ZT4A 3K0BA 3DBRA 1D6MA 1KP9A 3L0DA 3K1ZA 3PC2A 3REQA 3ANLA 1Z06A 2VUIB 3SVTA 4JCCA 1KK0A 5GAJA 3ETJA 1Z4NA 3EA5A 4BZQA 2HY7A 2HJGA 5T5QA 3N2EA 1O2DA 4OHZA 4KLAA 5AKJA 4WBNF 4ZCIA 1KETA 1QG6A 2OT3B 2IPOA 3DONA 4JC4A 3BCSA 4PYLA 4UQOA 3NUZA 3VNUA 3OP4A 1GRRA 2IUSA 3DFMA 2DFPA 3QZUA 2NXEA 4NCIA 5JDIA 2JLCA 4PQRA 2KBEA 2XBLA 3TLJA 3F9IA 3LY8A 1I3MA 5GONB 3TWOA 4BUCA 4CM7A 1DCMA 2FGKA 5DTIA 4A0QA 3ESZA 1NLYA 1N9GA 5B4UA 5HDBB 4EW3A 5ILQA 5HQJA 1DOHA 4DZTA 3BE8A 2C9YA 2WAYA 1M6HA 2JAPA 2E5WA 4QO7A 3CNHA 5EUBA 4QYIA 3RHZA 3OTHA 3WP0A 3CIFA 4FM9A 1B23P 7AT1A 5CXQA 4D9EA 3BFKA 2IZ1A 2QY9A 3CV3A 4CM9D 1R6TA 1XU4A 3CR7A 3NVAA 1GUBA 1NLMA 1DI0A 1GUAA 2ATVA 2VT7A 3BXOA 5A7FA 1NN0A 4ZYUA 5IZCC 1GLGA 2YN2A 1AMUA 3CJTA 3MUOA 4Q3NA 2FFHA 3EBLA 3KL2A 5FWXA 1FTNA 2HMYB 1WXEA 2RGNA 3KKOA 3B9PA 1VPWA 4MEAA 3OLZA 5IS2A 2VUTA 3OPYI 4K8RB 4JXXA 4Z4FA 4S1VA 3FHOA 1E96A 2O5VA 2DQSA 2I78A 2A1UB 3JU3A 2D5IA 3SE0A 2HLNA 4PSDA 2WJPA 5KTMA 2J0QA 1CUIA 4FSXA 1ZIOA 2R4TA 3AR8A 1FY2A 1VG8A 1FFXA 2GZ1A 1RWOA 2PJUA 4WADA 5KYVA 3STYA 4C0LA 5CBKA 2X9NA 1SUIA 3BCHA 3QVXA 3ANXA 1E1CB 4OAPA 4EG3A 4MQ5A 4EPYA 3NDJA 3DOHA 2GN8A 1SA0A 2YOGA 3P2YA 4PLHA 3QHQA 1Q0PA 4W5QA 1N2CB 5K4GA 5G02A 1JZQA 2VBGA 1XVTA 5MDHA 2D7CA 3Q85A 1U3FA 2WTBA 2UYYA 3FCSB 4Y2YA 5KTOA 4NV0A 3G0HA 4TUYA 4Y2HA 2OQRA 5DNWA 1IBSA 2OZVA 3EVNA 5AKXA 2BHSA 3PX3A 3QLEA 1XKLA 3D3QA 5IC6A 4DEYA 1AMNA 3VKHA 4J3NA 3NRBA 5K8CA 3GY0A 3QU9A 5TVKA 5M2QA 2NZVG 1XMPA 4J7AA 1QORA 4XJXA 3V32A 3LUPA 2W11A 1FSSA 2AOTA 4JASB 3VQTA 1OE0A 2HF9A 2O48X 3R9KA 3VYUB 5FPKA 4Q4DA 5EKDA 4MRPA 4W1RA 2NIPA 3RHFA 1AKRA 1WUHS 3V4OA 2QYHA 1T0PA 3TLGA 2FKAA 5LXTB 1EFKA 1UPTA 3JAWA 1QU3A 2BE9A 1O57A 2IXBA 1A8IA 4LRXA 2BBWA 5C31A 2AFVA 1E99A 5I9IA 3R2JA 4G1UC 4ZU6X 2Q4TA 4G9BA 1DWQA 2ATCA 3OQ6A 3TQFA 2GUGA 2XZPA 4RLFA 2JI9A 3OFNA 4UXIA 2E82A 1WS6A 2FUG6 4AG3A 2QV7A 1DB3A 5EWLA 4TT3A 4DV5B 5H80A 4DA0A 1OWOA 3A3OA 5HZGA 1STOA 3LLMA 2D1YA 4XLLA 4MS1A 2E5LB 3DMGA 3USCS 4KO1S 1M2EA 2E2WA 1A04A 3IBCA 4O2RA 1JHOA 2EC5A 3QVLA 1TMGE 4H7HA 2FG6C 1TEHA 1WULS 4LVCA 4RTRA 5AOVA 4RE5A 3FCUB 4KYTA 2JZCA 3FNRA 1GCIA 2C2OA 1ODFA 3LQ1A 4G09A 4RF2A 3WSVA 4DMMA 1GA4A 2ATEA 4Z51A 1OASA 3BUSA 3KFLA 1J90A 2PGIA 3LCCA 5IT0A 1XK6A 5J1TB 1S2LA 1VJDA 3W5VA 2C00A 2IYFA 1X1QA 4PPFA 3CEMA 3AUYA 2I8CA 5F64A 1PEDA 5HBRA 1LD3A 1DAGA 5CM2Z 3F71A 3FROA 3SQWA 4JL6A 4JUDX 3SJAA 1OLOA 2BFBA 4N0DA 3UBMA 5A9SB 1T8PA 4FJ1A 1URPA 2QS9A 4W7IA 1YZTA 1R8QA 4ZOEA 2FN8A 2H11A 3I4LA 1LSJA 2IEIA 2PLWA 3IPRA 2RH5A 3O2SB 2OE2A 4Q6BA 5DASA 4DCGA 5BP7A 2PR7A 1R88A 5H3HA 4DAOA 2F1HA 3OA0A 2QIPA 5EQTA 2FG5A 3ZHCA 2NT3A 2ZS9A 4LCJA 1HT3A 4N6GA 3L4EA 2MYUA 4UU0A 3IGFA 1W2GA 5EJGA 4RTLA 2Y1FA 3GVIA 2CJYA 2YBEA 3CZQA 3DTVB 5LQUA 1Z0KA 2OGSA 3S1LA 1NMYA 5IJ0B 4CG1A 1G66A 4EY4A 4K0RA 1H8HA 2I2XB 1YS1X 4E07A 3S68A 5FWYA 2OORA 2GFQA 4GMXA 4CEIA 2FV8A 1I4DD 4QM7A 3O94A 2I2DA 3HJNA 2RGBA 4YUVA 1RS0A 4F06A 4GOXA 1P0CA 4EB6A 5DHTA 2NXCA 1JL3A 2P67A 3KUXA 4Y1FA 2QM3A 4YEDA 1M3SA 4NOLA 3ZXYA 2Q0XA 3B1WA 3UHPA 5GIPE 1F12A 5FR2A 2VDLB 3QUBA 5HF6A 4NZZA 1CWUA 4ZQHA 4MUIA 3ES9A 1SUBA 3VSAA 1LFAA 4HGNA 3EGWA 5LBUA 5H1YA 4YIKA 3D54D 3F7TA 2HBQA 4G5XA 4PZUA 2R2AA 1GZ3A 4WZZA 2JJ1D 3AF6A 4KDEA 2O52A 4GUAA 2AR0A 3CGGA 1T1IA 3KEFA 3MAJA 4HDKA 4LDPA 4QXPA 4ECEA 3HBMA 5HZKA 2IEAA 1B26A 4KJXA 4L75A 2H7VA 4RXUA 4P84A 1O0CA 4LJAA 3AXSA 3MF4A 4Q7JB 4V0QA 2C61A 1EGAA 5E6UB 1CY8A 3BFPA 5K0NA 1HNXB 1JQEA 4CNQA 4ZCRA 1QOQB 2HRDA 3EXAA 4IIGA 2B7LA 2GA8A 2VF4X 5A9RA 4OOFA 1J8MF 4DLXA 4J4BA 4WZBB 3CXRA 2IYLD 1ZVKA 4F45A 1KMHA 4N18A 2ZR0A 2FQXA 4YP6A 2PWZA 2WWXA 4RTNA 1BXRB 1IRIA 1R6AA 2G72A 4F6CA 5KWEA 4CL2A 2OFOA 1E3DA 1DO8A 2ZSFA 4AZTA 2IYZA 3PICA 4DQKA 5CB8A 3F46A 5JS2A 2OBYA 3VUEA 5DCLA 1HNZB 2XCTB 2B5OA 1UZNA 2B21A 3GBVA 3D8UA 4UM8B 2GX6A 2WJIA 3W5UA 4CG3A 4K5QA 1Z0JA 1I6MA 1PO7A 1UEJA 4N3BA 5L3RA 4AS1A 4TRJA 3QMPA 4I14A 3HP1A 3TQTA 2W37A 1WZNA 3SF0A 3T41A 2R5NA 3D8HA 5BQOA 4QTXA 1ENPA 3Q0EA 3DL4A 4MVJF 4F6RA 4HX2A 4CFZA 5CDFE 1G8JA 4JYPA 5JDCC 2IWHA 3AHCA 5GZ6A 3VZPA 3IAEA 3KZVA 4J0IA 1NNLA 1KI1A 4JC5A 4J0DA 4AS3A 4EA7A 4BY9E 3GVHA 5CB4F 5IZCA 2EW8A 2D6FA 4GX1A 4UE6A 2I22A 1R4AA 1TKAA 3DZ8A 4DVGA 3QEAZ 1XTTA 1SOAA 5BWLA 3KOYA 1ZR4A 1B8NA 1TLFA 2ZETA 3EYAA 4UDOA 4EKYA 4RE6A 4TYYA 5DYYA 2A78A 3EVBA 4HNAB 1BS9A 1KEEB 2C99A 5HIJA 2GPWA 1H5NA 2CNLA 1QANA 3FTFA 2GCNA 1U3UA 1TM3E 1S8OA 3VO9A 2GJ8A 1E0JA 4KR2A 4Q18A 1XALA 1E7MA 1SHUX 4F96A 1XNJA 1A5ZA 1CW2B 3N58A 3UG6A 1W85A 1KK1A 3H5TA 1PP4A 5AI6A 1PYOA 1EX1A 4UOQA 3UW3A 2M32A 5EQJB 2QUAA 4G0XA 4HQFA 4J91A 1Z68A 2ET6A 2GS9A 1T4MA 2LPMA 3UAYA 1G3MA 1IC6A 4N0MA 1E6UA 4O4HB 1IAQA 4XH9B 5I8WA 1EGMB 1R37A 2PRSA 3FOFC 1JX6A 1FXWA 4X3PA 4MR8B 2YUTA 3DEYX 2OO3A 4R69A 2AOWA 4RDCA 3DJYA 5J40A 5I7FA 3CRNA 2P91A 3CM0A 2EOAA 3THWA 1XCOA 1XSEA 3BDIA 1FU8A 3ZGZA 1JJIA 2HZ7A 1NONA 1CZUA 1D5CA 2NV2B 3A3KA 3P27A 2JI4A 3OOEA 1GUDA 1N5KA 3Q7IA 3ZI4A 2Z58A 1JDBB 4UBIA 2GZMA 3BEOA 3HXMA 4IVNA 1R8SA 1ML3A 2C58A 2P40A 3RS0A 4ITUA 1TECE 2G1JA 2VL7A 4O25A 3EGDB 3G02A 3LWDA 3REGA 3E0XA 5JAZA 1YTLA 3DLAA 4D81A 3ZJTA 1WG8A 4LF9B 1Y1TA 2IXFA 3I3OA 3PL1A 1UKCA 4BX8A 1YD7A 1C3OA 4NG5A 3Q9SA 1XRRA 1KDTA 5GPBA 1WHTA 3OMXA 1SXJB 5EINA 1VHQA 4UDNA 1EFTA 3AFMA 2B94A 3E48A 3EF3A 4PF1A 1N6KA 4HDSA 3OT1A 2QUBA 1SU7A 4I1IA 3JD1A 4ND3A 1KBZA 1YR2A 5A7GA 1QOZA 2EJWA 2ESRA 1V8FA 2XNDA 3T5TA 2FR1A 3K0CA 3TCXB 4OKNA 3ESAA 1KDPA 2DBYA 3WGIA 2Y1OA 3DE1X 4KFTA 4J0KA 4G81A 4QUEA 1NMEA 5MGBA 2WJZB 1L3IA 3IUEA 4K6GA 2QRNA 1JIXA 5KJFA 1L5YA 5AESA 4DLPA 3DR5A 2O1EA 4ON9A 2QZ4A 3AEKB 1KYXA 2L2QA 4EO4A 2RG1A 3C45A 1RYBA 1Z73A 4J03A 3G5UA 5DRYA 5FBVB 1LLUA 2FCAA 1Q1GA 1F2TB 3GZNB 2VP3A 1ZOIA 3KOXA 1NW6A 2WKPA 3L7NA 4IQFA 3U3KA 4JI2B 4B1FA 5CVDA 4D9IA 2HA3A 3D59A 2JZOA 1GGJA 1UJ6A 2XA1A 3G2MA 4JS0A 5FYQA 5AXCA 8AT1A 1T4DA 3I6ZA 2EKPA 4N5IX 1VMKA 4ARCA 1JHMA 1ZUHA 1Z5WA 1WCIB 3PVZA 1EQAA 3DMTC 3FPJA 3B82A 4D4IA 1BEUB 1SAYA 3EXG1 1YNSA 1YCHA 1RNLA 1CUJA 1IUOA 2XDQB 2N3ZA 3GJQA 2HDWA 3CO0S 1DUSA 3NOQA 3WB0A 1BCRB 3H2HA 4JJIA 2VYFA 4RY9A 4RZ3A 2DLDA 1XCMA 2CCJA 2X0IA 1BG6A 2CMFA 3ETEA 4DIEA 1QHEA 2CEAA 3PQEA 4GOJA 5FTKA 5PGMA 4RLQA 1RZRD 4J43A 2QF7A 2V9PA 2WWFA 4EY7A 3QW2A 1EUDA 3COYA 4FZVA 4RTSA 2ODWA 1X7DA 2O3JA 3K94A 4RXMA 1SOMA 3T7EA 4DC9A 3IFSA 3OQNA 3H5IA 3B51X 4F12A 2Q2VA 2EBUA 4RPLA 4EHJA 4RJJA 1CULC 1J99A 4UTXA 3I5MA 2Q5HA 5ER9A 3F6PA 4TSFD 5CJ2A 721PA 2XGOA 4Z2YA 1Y5IA 3FSGD 1G7RA 1PFWA 1KAEA 1OGJA 2QPTA 3PFCA 1C0IA 4MSUA 4OKSA 5EN4A 4DPMA 3U5TA 2AE1A 3Q6MA 4BV2A 3ICPA 4COOA 3KCQA 4JWTA 4KU4A 2O2HA 5FAKA 3ON5A 5EJFA 1Q50A 2PYDA 1J39A 2K5UA 2ZUVA 2JPDA 3IDFA 1Z75A 3P9IA 5LLSA 2R00A 4C08A 5KTTA 1KHTA 1HWYA 5G1PA 3ZDBA 2P9QA 2ZI4A 4IS2A 2ID4A 1FU7A 2OP0A 1H8ED 1SPXA 4CFYA 1RBMA 2O2GA 1X19A 2JGJA 4MX8A 2EXXA 1NMXA 4R41A 3ZJ5A 4HQOA 1Z08A 2I3GA 3VUFA 4B5KA 3AUKA 2JLSA 2O06A 3SS9X 4YAFA 1XRSB 3H97A 5IW8A 4KWEA 4EY8A 5LM3A 4DMFA 4TZ6A 3UJNA 3THXB 4KIJA 5JNUA 4KITB 1Q0ZA 2EL9A 4YN3A 3OU7A 3I9OA 4XGRA 2UZ0A 1GAJA 4XIJA 4HNVA 4DR3B 5LUBA 1J8VA 3SNKA 3OQIA 2EATA 3RFVA 4M38A 2EFGA 4RHFA 4BNXA 3C5VA 3MMPA 4RH1A 1YR1A 2RH4A 3W2GA 4DV6B 1QHIA 2OGUA 3W5IA 3GLSA 1OXUA 5HNKA 2IBTA 1Z7BA 4TLMB 5NULA 5A0TA 4NNJA 1UBMS 1WPRA 4I5DA 5J9FA 2A5JA 2J5KA 2W2OA 3L1HA 3ZI0A 2WF6A 3RRNA 3ZK9A 1EHYA 3L84A 4FILA 4HWKA 1DC7A 2XQGA 2IHKA 4GP6A 1NWCA 2WTAA 4OSPA 5ALEA 4D4HA 5LDDC 2LE0A 4JKIA 5DCWA 2K6GA 2IEYA 4BNVA 4G67A 3O8CA 3D6NB 1XZ8A 2RJ3A 2YNMD 3C70A 3A4MA 4MLDA 5BW5A 2H6EA 1EZ1A 1AGPA 1ZH2A 1AGYA 3JAKA 4QGGA 1O6FA 1CEXA 2IRWA 2WJYA 3GLIB 2UXDB 2YWJA 2GYWA 1TCCA 1X1EA 3AY7A 3CEPB 4E6EA 1JFTA 4WZ6A 3PFHA 1USKA 4NBSA 4KJZA 1KYWA 4RJIA 4R1NA 2QD1A 2FPKA 4WRRA 1EK2A 1VA4A 4D8YA 5DTJA 1UODA 3COVA 1KQNA 2PIDA 1XU9A 1BMQA 1Z15A 3EG5A 3EMBA 4KRYA 4EOGA 4BXOB 2V4UA 2ENWA 2JHFA 1BIFA 2WPDA 1XCPA 3FXAA 3I30X 3FCAA 4ZANA 3UUEA 3UUWA 5JSFA 4HGZA 1WU7A 3SZMA 4EJSC 1HPLA 4LWZA 3EJWA 3CX4A 4U7GA 4OJQA 3N7TA 2CHUA 5IVDA 4RMHA 1L7NA 2EAUA 2KX7A 1PQUA 5TPZA 4GBED 5JJIA 1DZ3A 4NV3A 1N33B 3D7LA 4GBMA 4NBKA 3KD2A 2CK3D 1QS0A 3HJBA 4O5AA 1W59A 1GUFA 4YAJA 4NNPA 4OSEA 1ZGJA 5KX5A 3LUKA 4RHUA 2FWMX 3W8RA 4B34A 1WOMA 2OWDA 4DLZA 4MWDA 4O29A 4ZGWA 2UUOA 7YASA 4GYKA 2FSVC 4Z7NB 4ZYTA 5CHYA 1Y7IA 2YHBA 1PT6A 1VP9A 3IO3A 3QVKA 3C6KA 4B0OA 4C0KA 2QUJA 3VSCA 1LDMA 3MAGA 5I01A 1V2GA 2I4OA 2J67A 1MAWA 1YJCA 3ZQKA 5I6DA 3VX4A 3RT1A 1KK2A 3NTVA 2P4SA 4YQYA 2Y4NA 3FHJA 4BIIA 1JG6A 2FY8A 1SUSA 2Q99A 4ID3A 2FFJA 3NT2A 4DG9A 4WCVA 5B7GA 3SIRA 1HR0B 2ZJ4A 1YRLA 4YAOA 1GAWA 4HUQA 3DULA 3H3FA 3IQDB 2XA9A 2C1XA 3LPLA 1PJ2A 3JATB 4P7KA 1U2EA 4I6GA 4ZI7F 4DG5A 5G53C 3VVLA 3WLMA 2BEKA 2P75A 2ZYIA 4EJ0A 3GLTA 2TS1A 3WK6A 2FHSA 4MRVA 2A57A 4N65A 4YJFA 1IWBB 5L7YA 2EZTA 5CU7A 1IZ9A 2VUUA 2J6BA 3GLIE 2OCIA 1B73A 4RPGA 2DQKA 1O97D 1MBZA 1CQXA 1T0BA 1BCSA 3PWSA 5T64A 3AI1A 2VHCA 2ZYAA 1C1DA 2GZAA 1PFUA 1B6RA 4II3A 1WSWA 1P80A 2VAXA 3EC2A 4FHFA 4FWTA 4RL6A 1M0EA 3GCDA 3K1YA 4DIKA 3IHTA 1XTJA 1HFWA 1MOZA 4OLHA 4XEHA 3T1NA 3WBJA 4XQCA 1XX6A 1V95A 1XEXA 2MIIA 2PIAA 1LQ2A 4HTFA 2PY6A 2J09A 2RHBA 1EFAA 1ZMTA 1SBQA 2AQHA 1UK6A 4O63O 4FQ5A 1U8AA 1SR8A 4B2PA 3KDSE 1CY0A 1FEZA 2R6AA 4FEYA 3IYLW 1YB2A 3PDWA 4QNRA 5D5PA 1QVWA 2FP4B 2O5EA 1X13A 4XRGA 1HURA 1OJ7A 2ZIZA 2YQ5A 3I1JA 3WLNA 2G88A 4QZVA 2B99A 3CE6A 3CB4A 1BGVA 2H1RA 3OCCA 3P9NA 4YVFA 4G4GA 2HQSA 4A1OA 4ETIA 4X41A 5DXFA 2CHVA 3PQ7A 1C7JA 1Q12A 4MMYB 4PFQA 4ZT7A 3RVJA 3BD9A 1UC9A 4EYSA 1HRDA 3IVRA 2W2KB 3OUUA 4GKVA 1VL5A 1C0LA 4ZC1A 3HUFA 3MCZA 3SBEA 1M6VB 3QEKA 1VSQA 3CFYA 4TN1A 2B7CA 1TIKA 1V6CA 2FP3A 1FDOA 2CMDA 3A1NA 3H9BA 3OQVA 4HDOB 3V8QA 1G3UA 1K0UA 5I7WA 3KQNA 3FFAA 5TGTA 1KQFA 1OU0A 2DG2A 3CY6A 2WE8A 1GR1A 2WUEA 3E1GA 4L4UA 5G1OA 4GGOA 2BTOA 3KE9A 1U8XX 1YJXA 1CG6A 2HLDD 2BP7B 4JYCA 3RIXA 1YZUA 3ZDZB 3N6RA 4B3HA 4R51A 2PWYA 4P86A 4CCYA 1RYEA 5HX7A 3DB2A 2ZPUA 2O0LA 3TN7A 3NDRA 1KMMA 1THMA 1GV1A 4MKGA 4C6HA 5JZBA 4PCAA 1IAVA 1GCGA 2NVOA 3G0BA 4TS1A 4DPLA 3DNMA 4TROA 1Y4SA 2H31A 1U3WA 2BGGA 1XAGA 2MSKA 4BLVA 3PGVA 2AMLA 5GV8A 4DIUA 1P74A 2AZTA 5EMHA 3JWPA 5KCZA 2DUWA 2X2OA 3FKQA 4EDFA 5HUHA 2FN3A 3U09A 3HU5A 2BGKA 1GKYA 3BMCA 5IXSA 3EMKA 1LF0A 1W25A 2ZI6A 3ZWPA 2XXBA 1DX6A 4R0VA 4WT7A 2WSSA 2GYVA 3GLGE 1MO2A 1Y3AA 2J5BA 2B4KA 1PNVA 3BKXA 1E8NA 4PLWA 3L7DA 4N4AA 2IY7A 5TGZA 3FM9A 3DUWA 2HV9A 1SULA 3KDPA 2XNKA 3OZAA 2X4GA 3H8SA 5GVSA 3IHWA 3O1IC 3FJOA 5GONA 4JVMA 4RH0A 4S0ZA 1H2FA 3ETHA 1TM5E 2FZWA 1JQKA 3HKDA 2LWIA 3DZDA 5ISMA 1YRQA 2ZRLA 3L43A 4A0HA 1HDCA 3BEDA 1JEQB 5K20A 3KQPA 3NBQA 3V9AA 1LY1A 4DRXA 1V1RB 5IH7A 2C7QA 2A3RA 4F4IA 3K9QO 4YY3B 3N7UA 1R5JA 2H3HA 4IO1A 1D8AA 3BWCA 2XVZA 4NBUA 1EGQA 2YJ5A 4IEFB 4C7KA 1QIDA 1AURA 5DN6A 1FL9A 5BOSB 5ABPA 1FBNA 2Z83A 1C2TA 5JAIA 1U3CA 4JVSB 1U02A 1NIJA 1QO0A 3SP1A 1QYIA 3DHYA 2YHIB 2Z5GA 4UMEA 1IUPA 1Y6QA 3I2HA 1EM8B 2DPLA 1CIPA 1VL6A 3ABIA 1B74A 1N3YA 2VG8A 3AG6A 1M34A 2Q2OA 3L7CA 1DTWA 2BI4A 5EJ9A 3S6JA 5IMSA 4BASA 3ONWA 1YKSA 2N0SA 4GC5A 1SUPA 1EJBA 4HWSA 4YDSA 3VFDA 3CRRA 4J9UE 1RRMA 1J2UA 1W4CA 1Z2PX 2W6OA 3W77A 3WLKX 4OFWA 4ZTZB 2GSDA 4PQYA 4PYKA 2VP0A 5HS6A 4CV3A 4EGQA 2WJ6A 1M8FA 2PUGA 1NQUA 3PRJA 2W6JA 3V2GA 4ER7A 4EJSA 3H11A 5ALSA 3BMXA 4BKQA 2XITA 2ZIXA 1XD2B 3H1GA 4TL8A 4B3DA 5CLFA 1GSOA 3MOGA 4FR2A 2ZTHA 3FF1A 3TL6A 5L53A 1DVRA 4ZVNA 4BO9A 2QMZA 4CR6A 3CVUA 5BN3B 1J97A 4CT5A 4FUQA 4KN9S 2C94A 5LUAA 1UBFA 3K9NA 4HDNB 3M33A 3QBDA 2LGJA 3K92A 3SYTA 1EFPB 2VPPA 2I7TA 3PXGA 3D6MA 1UKVY 1FBTA 1FJHA 1S6YA 4KQCA 4URVR 4IIFA 4TZ0A 4JFAA 2FSVA 1JDBC 2IGBA 1R16A 3P9ZA 5H3LA 1AA9A 5D6NA 5JQGB 3SZGA 2YMQA 3KIPA 1JEDA 5LXTA 3GFTA 3UENA 1C50A 3KJGA 4O2BB 3DE7X 4A16A 1CSEE 1XEWX 3OF5A 1UBTS 1GGEA 3ICOA 2ERCA 2D1RA 3G9XA 1IWOA 2QRMA 3U26A 3GJ3A 2H8KA 4N0EA 1KZ7B 1RHRA 2GFIA 1F38A 1CQJA 2BZGA 3AETB 1KEUA 1DG1G 4UAUA 1Y42X 4A0RA 1SXJC 4D5EA 4H4EA 2XUIA 3OFND 1FMCA 2OSBA 1QB7A 4UBKA 8LDHA 4J94A 4TT3D 4ZJYA 2R8RA 1Z8DA 1CUXA 1ID1A 5DX0A 1NXWA 1WUKS 1OZHA 1XZGA 1W8IA 3OA2A 3H5LA 1PZHA 3HY4A 2HF7A 4Y18A 4IOMA 5ADVA 3S2FA 2WMDA 1JA1A 2X58A 5AOBA 5CLLA 5HFNA 3IAUA 5KHAA 4RSRA 1NUQA 1WMAA 2ZJYA 4IWNA 1PFVA 4BU1A 3I04M 1E64A 1V4VA 1M1ZA 4ZO6A 1SFRA 2WBLC 1Q57A 3CW9A 4OBEA 2IITA 2B82A 4NENB 1L5NA 1CZOA 4B3IA 1VPVA 4CMEC 2GM4A 2XGJA 3N3AC 5JD5A 5EMKA 3QV2A 3L6UA 3K0AB 1N75A 1YR6A 4PS0A 5A9SA 3L7IA 2IS1A 2DJ5A 4CTMA 4DWVA 1RZVA 3V97A 3B6IA 2DF8A 1SBTA 4QREA 1DKPA 4JX8A 2F1JA 3QTTA 1E9FA 5BSEA 3EZLA 4A7PA 4XEUA 2JFBA 4MP3A 3C6YA 4ZPJA 3MNFA 3ZE6A 4DNFA 2PANA 4YA6A 3RJMA 3UZUA 3RUAA 3RU2A 3I1YA 5DEOA 1ILEA 1OBCA 2B30A 2ZWOA 1A72A 1NMSA 3DTVA 2PL1A 4XJTA 1MHPA 1LLQA 1VQ1A 5AUQA 1OXTA 3OLXA 4OFXA 3L8GA 1EUCB 4ZVLA 3LQ2A 2Q5IA 5JSKA 2C78A 4LJRA 1N2XA 4JJ4A 5DBGA 1M74A 1BFDA 1MNQA 3WHIA 3HLTA 5IU6A 1NZDA 1DS6A 2XHZA 5C1BA 1W73A 4B7AA 1KRWA 4JGBA 4A0SA 4AS2A 1MNAA 3IUMA 4QRDA 3TNLA 2FOLA 1YBFA 3BIXA 2B0JA 2BFCB 3H9EO 2H92A 2HMVA 3INGA 2I0FA 5G0SA 1P1HA 3N5CA 2PV0A 1C7ZA 1QJCA 3NZEA 1W8DA 2JIOA 1UDRA 3E18A 5ECDA 4F93B 3OTOB 3RV4A 3T06B 4MUYA 4US2R 1BQ4A 1CJCA 2Q6VA 1SUEA 4AK9A 3LXMA 3CRQA 2WP0A 4A1FA 5LQMA 1E1DA 3RVQA 3BT7A 4P4TA 5DULA 3CJRA 1UXJA 3VPHA 1E32A 1X1RA 2GDJA 1RI3A 1YQGA 4TMYA 1S3IA 4KW7A 1P0FA 1QNLA 4LJKA 3HCCA 4CQNA 5EHGA 3ANMA 3ZW7A 3FLEA 2WVHA 1MIOB 1WXQA 2Q2NA 2VF5X 1G1AA 4KBFA 5FUVA 4RULA 4JI8B 3WIEA 3T3MB 4CCSA 1MJ5A 1PD1A 1UKAA 1BE0A 1MPTA 3CLSC 3F49S 2XYVA 4JEUA 3V42A 2IOYA 5KYYB 1QRUA 3IR6A 4JZKA 2IH2A 1AQ6A 2OQIA 1N6RA 1IN4A 2HJ9A 3TINA 2QQFA 2VLBA 3AYZB 3UOGA 5AVKA 4KVZA 4R1QA 3VH2A 1K89A 3GNSA 3NH6A 4B3FX 5CEEA 2Q6IA 5FP0A 3WX0A 4D42A 4EL0A 3ILYA 4TYNA 2WVJA 5JARA 4EI2A 4OLAA 4Q48A 5I7HA 3UKDA 4IVPA 3MMZA 2CFRA 4FFBA 1OWMA 2IV2X 5KSYA 3GJYA 5ALKA 5TJHA 3V8VA 3AFHA 4AO7A 1DQYA 1NOIA 4GR4A 1ZC3A 3SIPA 3V8NA 4QLBA 2GN6A 2B4YA 2INGX 2JD0A 5HE9A 1YR9A 4ZIRA 3FCCA 1P9LA 2Q9UA 2WKQA 3DKIA 3IEIA 2QZ9A 4PO3X 3VISA 1AXGA 4O4IB 3BOSA 4JZYA 5HK8A 1VIYA 3NM5A 4LK2A 1E2KA 2C2MA 1ZLYA 4CLEA 5I5EA 3VZBA 2Q1UA 4HB4A 1UK9A 3MHPA 1GDDA 4X1OA 2OHVA 2GBGA 3SQOA 4BP3A 3AV0B 2PGLA 4HVAA 3GVPA 4ROSA 4W6ZA 3YASA 4AO6A 2GCOA 2IH4A 2DEUA 5HWSA 4HEA1 3QGMA 5LU9A 4XWKA 5IVPA 5MN5A 4X00A 4B46A 3NALA 2CVQA 2NU9A 1JAYA 1FVHA 1XRNA 1Z6PA 3KFXA 4TRRA 2YJTD 3V3TA 2WAXA 4A8JC 1U1IA 2C5BA 1QHGA 5UKDA 4DUGA 5JNVA 1A77A 1XTZA 2QG9A 1WO8A 5IM5A 3PEUA 3UM9A 2WD7B 4RETA 4KHPB 1DV2A 2ZIEA 3PD7A 4Q9LA 5DNUA 1KU0A 3FPCA 3R0XA 4AXBA 1HSZA 4X63A 2PU5A 4J0HA 2AFRA 2R84A 4F9EA 3GO4A 4OF4A 3UMGA 2A9FA 3R7SA 1CVRA 2JCYA 2UVPA 3GRYA 4W7SA 3RROA 4R0MA 5ICMA 5LDHA 4C4OA 4X1KB 3E27A 4JJKA 2FVYA 4KTTE 1W94A 3KLNA 3T1QA 4FZRA 4HH0A 1ENYA 4UNSA 1G20A 3D7KA 3HJFA 4YGXB 4H08A 1EB8A 5BO5A 4DVJA 1OI7A 1ZK2A 2H2WA 3Q5EA 2N42A 3KO8A 1QCZA 1C8LA 4LKRA 2YZKA 5BRNA 4QUBA 1YUBA 2FPGB 3TNYA 1QV6A 1M0WA 1AY0A 1ZOPA 4I08A 2EJVA 2PMBA 3TR0A 3V1NA 4AJHA 1B8OA 4DLSA 5LJLA 5CM9C 3AR3A 1BHSA 1E79D 3WK8A 4RTQA 4X1IA 2GUWA 5KYWB 2B20A 1U31A 2FPIA 3DV0A 4LQLA 2R47A 1YC5A 3OCXA 4H3VA 3TK1A 3OJWA 1LBSA 5CM8B 4BGIA 2HCBA 3ZDDA 4B84A 2DKFA 2OXEA 2PTHA 1E6MA 2ODQA 3G8DA 4R4JA 5FPSA 1K75A 1FYEA 2FDXA 3QUQA 3LBNA 3R41A 4ILKA 3SF8B 2H2AA 5TE9A 1AGRA 3U60B 4AKGA 2JGAA 2HSGA 1ZK3A 2IYUA 2QQGA 2VZ9A 5HEKA 3P4YA 1G5HA 4V02A 4GR5A 5ER6A 5JAHA 3AHEA 5GV7A 2IYPA 1UM9B 4LHYA 5K4HA 2QG4A 3UWOA 3QVOA 3ZHYA 1MZVA 3ZHVA 2W42A 2G09A 2CXQA 4WFKA 1IN1A 2P5SA 3DAPA 4HMQA 1YDHA 2BTQA 4JLBA 4N6NA 4NHEA 4O2AB 4ZQCB 4TKMA 3DBHB 4D02A 1TZJA 1QHXA 3VPCA 3ZR4B 3F9RA 4MW7A 1XEWY 4HLQB 3LC7O 3T5MA 4PC6A 3H1TA 2WWIA 3KZNA 4G26A 2AUMA 1JFSA 2EBWA 4XCVA 4LTNA 2OD2A 4J16C 3BIFA 3N2KB 2Y0PA 3TE6A 4XDYA 3P9PA 3A9VA 4BFUA 2NP6A 4XB2A 1I7DA 4LMPA 1H2RS 2IYAA 1AQUA 2RB4A 3OM8A 4MXDA 1Y1PA 4F5YA 1N7IA 1JR3A 3PTAA 2HJHA 4H0FA 2XNDD 1T1EA 4EX6A 5C4MA 3H1AA 5DYTA 3VPAA 1RRPA 4BCBA 4GOKA 3PVCA 4CI0B 1RCFA 2ENUA 2NMVA 3HUEA 2FMHA 5F2OA 4CMEA 3E1KA 5HM6A 1Y4AE 1XMJA 3O26A 3U61B 4H77A 4N8DA 4RH3A 4L4XA 3M9LA 4XYMA 4ZV9A 3RJ9A 2OMEA 1GZ6A 1V9SA 2GO7A 3B20A 3ED5A 3KD3A 4LW8A 2TECE 1DAEA 1DEHA 4MWBA 3C8HA 3QNWA 5EGNA 5KVAA 3BGVA 3SE7A 1TW3A 5L45A 1IJEA 1LNSA 5DSTA 4ENQA 2I5PO 4B75A 2E4VA 2OCYC 4M0EA 3K8YA 5E0OA 5HZMA 3GZNA 1F2TA 3ME5A 4ATNA 5JW6A 4UE2A 1LS6A 1SZPA 4F2DA 1Z4PX 1RTTA 3C24A 3UAOA 4E03A 4Q9JA 4K05A 4TPKA 3DVRX 5BT9A 1YIDA 3PE4A 2F55A 4ALKA 3U13A 3A6DA 3Q41A 5JSHA 1J1IA 2CDBA 4ZOLF 2C4MA 3ET5A 2PX2A 2XDQA 3HP4A 4E21A 2WRZA 5K01A 1BCRA 1OKKA 1WCXA 2D06A 5JSYA 4C0QC 3SWWA 1XHLA 2O54A 3LQ4A 1N4AA 4XGNA 4N1AA 5EI5A 4XYEA 5AUOB 4P3PA 1E2LA 5K3DA 4HWPA 5AM4A 4H1TA 1ACLA 2BGIA 2R8PA 1ORWA 2VVTA 1BD4A 1QH8B 4JXKA 5L3QB 3ZWXA 2HU2A 1KHHA 1W36B 1ETHA 1KU6A 5M7EA 2TRSB 4GPZA 1F2DA 2DAPA 2IP2A 4V1CB 1R4MA 3PUHA 4BNWA 1MD9A 5DLDA 1TAGA 4AJOA 1J9GA 1GAXA 3N28A 1Z37A 1XG5A 2WUVA 5IF9A 3KXIA 5I47A 2O8FB 3OE7A 2PO5A 2VZ0A 3P32A 1LCIA 1V47A 3DTTA 3T3HA 4AT1A 3HR8A 1IY9A 3GGDA 3EPRA 1R10A 3A2LA 4YJHA 5EXSA 5AM1A 4HYEA 1NV8A 2CJPA 1HFEL 3K09C 1GTL1 5TEWA 4AG5A 4TKZA 3GIDA 4UCXA 1FFYA 2F3QA 2XADA 1EFCA 3MA0A 2IA5A 4GYWA 2WMYA 3ABOB 1H2AS 5L7WA 1SHLA 4ZCLA 3IE0A 5EIWA 3DEFA 3DYBA 4JA2A 4ARIA 4D3YA 4ER0A 4URHA 1QU2A 5KKAA 3CG4A 4C0BA 4EO7A 4J2HA 2HK7A 1XPRA 3LS2A 1M76A 2X5JO 1RRCA 1MEOA 4V0SA 4IYJA 1I0LA 4RVHA 3DWFA 3ML1A 2X3UA 3DA8A 1T5HX 2PEYA 2QX7A 3ANNA 3CUWA 1KAOA 4IEEA 4Q4HB 1U9CA 1I2DA 3A14A 1W0CA 3K5HA 2QL7A 4GLOA 4PRZA 4N3CA 3L0BA 4AJKA 4E4YA 3OBBA 1DNPA 2Y2VA 3HNPA 3LCJA 4QPZA 1K5GA 1QIMA 3LA6A 4WNCA 3VVBA 4C21A 2O2IA 4YBRA 3UWSA 2QGZA 2WF5A 4RF3A 2QLLA 3MOSA 4NAUA 4C1NA 4ME6A 3WNZA 1A9RA 3S5JA 4B3GA 4EP1A 2PWPA 1O8CA 1QIJA 4J0JA 2H1OA 3ACBA 1R0XA 4N03A 4YWHA 4A8JA 2E85A 3OX3A 1AF7A 1CUSA 4Y2GA 4MWEA 3GDGA 3GJ6A 3O0DA 4IILA 1P8AA 3KPWA 4Q1DA 1SHZA 2A58A 2W2LD 1KJJA 1HOXA 1XGKA 3B3JA 4HQRA 3TB6A 1P2VA 3T0IA 4MH0R 4NE2A 2HI0A 3TZEA 4AP5A 4MWCA 1PNQA 3MWYW 3OZEA 2PSDA 2I8AA 1USIA 3RC2A 2Z4TA 1YACA 2PRJA 3ZBPA