4BVJA

Structure of y105a mutant of phaz7 phb depolymerase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
343
structure length
343
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNAHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPYNAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PHB DEPOLYMERASE PHAZ7
publication title Biochemical Analysis and Structure Determination of Paucimonas Lemoignei Poly(3-Hydroxybutyrate) (Phb) Depolymerase Phaz7 Muteins Reveal the Phb Binding Site and Details of Substrate-Enzyme Interactions.
pubmed doi rcsb
source organism Paucimonas lemoignei
total genus 128
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature ec 3.1.1.75: Poly(3-hydroxybutyrate) depolymerase.
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bvjA00
1NU8A 3SK0A 5AIBA 4HRYA 1JFRA 5K3CA 5AI5A 2VJDA 1QO9A 4QEKA 4QWMA 1AZWA 3H19A 3CXUA 2XUJA 4UUQA 4BCDA 3W05A 2WTNA 4GEGA 1IUOA 1QGED 2J3DA 4Y2UA 2HA2A 2YASA 1LPPA 1XZMA 5CH5A 2GBIA 4OUKX 3TJMA 1CUHA 2V96A 3PICA 3ZPXA 2H7XA 1OCEA 4B83A 3FYTA 3UUFA 2VJCA 3FVRA 5IH7A 2OCGA 3H17A 5DWDA 1VA5A 3QMWA 1T4MA 2HA4A 2XLCA 4P08A 4NZZA 2GZRA 5A62A 3MUOA 4GWLA 2WFLB 4MQMA 4PW0A 4BE9A 5JYCA 2WJ4A 2O2GA 1EXWA 1XRRA 4MWSA 4X6UA 2PSEA 5K3BA 3E0XA 2XUIA 1CVLA 1LLFA 1LPMA 3KD2A 2YXPX 3IDAA 1ACJA 1S8OA 5LKRA 3IUNA 4Q3OA 1A8SA 4UHBA 3WA6A 4E15A 2I3DA 4IQ4A 4BDTA 1XZGA 3O95A 2HU5A 7YASA 3GROA 5C7YA 3GZJA 4Z49A 4L72A 1ZGBA 1WCYA 3HJUA 5E4JA 3WL7A 3SX4A 3I2HA 4HXEB 4UBLA 5DTJA 2OCLA 3HEAA 1THGA 3U0VA 1UZAA 1XZBA 5KBYA 2ZSIA 1GQRA 1DQZA 1Q84A 5JANA 4AO6A 4MEBA 3FYUC 2HM7A 4Y2YA 1W75A 3EQ9A 1A8QA 1DU4A 3WK9A 4WY8A 4UHDA 3DL4A 1P0PA 2WIDA 5CT9A 3L1IA 3CN7A 4K2AA 4EHBA 4WJLA 1CQZA 4JUIA 3D5EA 1CUYA 4KE8A 1ZI8A 4QE3A 2ZYRA 2ES4A 2VJBA 5DNVA 4IH9A 2DHEA 3WJ2A 3GELA 5CTAA 2PU7A 5ALIA 2WFLA 5CH8A 4QLOA 5AKJA 1ZI9A 1VLQA 2R8BA 1GPLA 4M0MA 3DKKA 1F0PA 1MAHA 4KRYA 4H7EA 1MX1A 1H2WA 5ALDA 1J2EA 3JW8A 1ZGCA 3IA2A 3I1IA 2OGZA 1VXOA 3V1KA 1M33A 4ZI5A 3C8HA 3HXKA 5CURA 1N5RA 1VJ5A 5CMLA 2WUEA 1EDDA 1GGVA 4B9EA 3EBLA 5AH0A 3O9VA 4BC0A 3Q0TA 1QE3A 3ZLUA 4CCWA 4BAUA 1JU4A 3LIIA 4YK7A 5ALFA 5AKYA 2XQFA 4DGQA 2V98A 1UKCA 4IHAA 5JZ9A 1QIJA 4D9JA 3KDAA 2EDAA 5ALNA 2OGTA 3T52A 5DYWA 1L7QA 2WTMA 3S2ZA 2XI4A 1UT6A 1MO2A 5EIEA 2WHPA 3WWPA 4FMPA 5ESRA 4AZ0A 3H1AA 4B0OA 5EHZA 1CFJA 2QMQA 1IMJA 1ORVA 3HACA 1LZLA 3AIOA 4AN0A 3WYDA 2DSNA 1VKHA 3DNMA 4MEAA 1WB6A 2ROQA 2VSQA 3FLAA 2G4LA 4C4YA 5C8VA 3W06A 3FSGA 4ZGBA 2QZPA 1XZHA 3DYVA 1P0IA 3AZOA 5E4YA 2AJ8A 3IULA 2HHAA 3C6XA 4Y7DA 5HZGA 1EA5A 2AJCA 4K6HA 1CUIA 1LPNA 1FSSA 1GXSA 3D4LA 1TQHA 1BEZA 2XQJA 2QVBA 3STYA 4IH1A 4BC1A 2K2QB 5AIAA 4XIIA 2AJDA 4E14A 2PUJA 1USWA 2RONA 1XZCA 2PSJA 3O4JA 4QDXA 2HA6A 5LZ2A 4PF1A 2VT7A 4ZWNA 4KAFA 5ALRA 3LCRA 5CRIA 3B5EA 4X7BA 4QDOA 3BIWA 1CUCA 3BDIA 5ALLA 4Y2TA 3B3QA 5D3ZA 2DQZA 5JD6A 2XE4A 3JYHA 3OG9A 4Q1VA 2PKYX 3L1JA 5LYYA 1EDBA 5CH3A 1HDEA 3I6ZA 5C8XA 1CUEA 3F97A 1XRPA 5FKJA 2BGRA 3G9TA 2D0DA 1CUVA 3D2CA 3PF9A 3NOXA 3WQHA 1K6EA 3WWCA 1EK1A 2GYUA 5SYNA 4V2IA 4WFKA 3G0BA 1VE7A 5HF8A 3I2FA 4BZWA 4AO8A 4FTWA 5A7HA 1UOQA 2JEZA 2H9YA 4C88A 2DHDA 4PQEA 4EY8A 4B84A 2IITA 1ORWA 3G9UA 1MN6A 4PV7A 1L7AA 2JGLA 1JI3A 3BJRA 1XQWA 1WM1A 3IUQA 4X71A 1AUOA 1WHSA 3EQ7A 5CT8A 4CCYB 3OURA 5SYMA 2VA9A 4CFSA 3D7RA 1ZIXA 5CT4A 3KWFA 4AXBA 5IVKA 2ECFA 2JEYA 3I2JA 1QIKA 1UK6A 4BP9A 4PO3X 1T2NA 4G8BA 3I2KA 1XZAA 4IH4A 3PI6A 5AK4A 3OM8A 4BB0A 5CXUA 2XMZA 1N5MA 3KOOA 4XJVA 2WHQA 3QYJA 4X90A 4MWTA 1Q0RA 1MTZA 3BE8A 3LLCA 4U2DA 4A5SA 5J3JA 4W63A 1JMYA 3F9CA 3FNBA 4FFWA 3VKFA 4TVKA 5AP9A 4FBMA 2PVSA 2VAVA 4X85A 2G5PA 3WIBA 1HKHA 2DQYA 3BF8A 2I78A 1H2YA 4X94A 2WIKA 1ZICA 2OCKA 4HVTA 5T4EA 4FBLA 3TRDA 1LBSA 3R0VA 3ILSA 2NW6A 1EI9A 2XMGA 2B20A 4LYEA 3WK8A 1XZFA 1VA4A 1BN6A 4GI1A 4BE4A 4QLAA 2QOEA 4TPKA 3H2GA 4G4GA 4H7HA 1EHYA 1R1DA 2HA7A 2XUPA 5FLKA 5A71A 3ZWQA 3AILA 2LIPA 3C5WP 1CEXA 4OCZA 1P0MA 2ONCA 3TEJA 4WY5A 5JD5A 3D2AA 3WWEA 4Q3KA 3H18A 3JWEA 5AK6A 2HIHA 1RWQA 3R40A 3ZLVA 3R3UA 2PU5A 4BYMA 3VJLA 1EVEA 1U65A 4CCYA 4WCVA 3FLEA 3QMVA 5K3EA 1KEZA 5AO9A 5AM0A 4FNGA 1XFDA 4WDRA 5FPQA 3VDXA 3M81A 3A6ZA 5AICA 1ZJ5A 4NMWA 3BL8A 1LPOA 2EEPA 1CQWA 4J0DA 5FXMA 2BFNA 1HL7A 5HF6A 1GPKA 5AM4A 3D3NA 4WFIA 1SCKA 3D2BA 2C5GA 5FOQA 1QLWA 3EIOA 1DT3A 4N8SA 3QVMA 1FFCA 4KEAA 1W4LA 4U2GA 2XQIA 1QJ4A 5AOCA 3O4GA 1ZOIA 3A70A 3AINA 1WB5A 4MQLA 1K63A 3C5VA 4KJXA 3DYIA 3QMMA 4JNCA 1X2EA 4CG3A 2XUHA 4Q82A 1XROA 3H2KA 1XZLA 3DOIA 2FX5A 5JAHA 6YASA 3WZLA 2QT9A 5AKHA 1X2BA 4H7KA 4X92A 1AMNA 1BEEA 4Y2JA 4YX9A 1J07A 4BZZA 3DL7A 1WPRA 2ZJFA 5C81A 1MU0A 4F21A 4UHFA 4Y2QA 3KXPA 1QIMA 1KU6A 4N5IX 4J0GA 4J0IA 1X70A 2ACEA 3G0CA 5IVHA 4K6KA 4EBBA 4J0KA 1LZKA 2AJBA 3WJ1A 1ACLA 2WSLA 3FCYA 4DNPA 4FLFA 4IO0A 1MAAA 3G0IA 1DINA 4LXIA 5YASA 4LKOA 4H77A 2XUAA 4DMFA 2OG1A 3VJMA 1R3DA 4UBMA 1E66A 4DNFA 1JJBA 4BCCA 4J0HA 4PSDA 4P93A 2JBWA 1EINA 2J3QA 4KR0A 5ALEA 2WQZA 1BCRA 2HA3A 3RARA 5HKAA 1O6GA 4A23A 2PSFA 4DNOA 4FWBA 4HS9A 2C0QA 2CZQA 5JALA 3TGLA 3PE6A 1QIDA 1HBJA 1DTEA 2JGKA 1J1IA 4YPVA 3G8YA 4J0CA 1A7UA 4GBGA 4ZRDA 3BJMA 5ALTA 3WL5A 4Y2PA 4X93A 3BF7A 2WHPB 3I2IA 4BVKA 3DQZA 1XZKA 1KU0A 4EY4A 2QRUA 4ZV9A 3V1MA 4YASA 4UBNA 3I2GA 1CUUA 2WG0A 1EX9A 5LIPA 5DJ5A 1AURA 5K3AA 5LZ4A 2WUGA 2HRRA 3DCNA 4B9AA 5D7BA 2CKMA 3H2HA 1IZ7A 3WKBA 1THTA 3W2TA 3RK4A 3GUUA 5CW2A 2HA0A 3F67A 4F60A 4OD0A 3ZI7A 2WKWA 3WA7A 1R4ZA 2JGEA 4W1PA 2GYVA 4W1RA 2W22A 5FDFA 3EF3A 5KREA 4FLMA 3I28A 2WIGA 1YASA 1BU8A 4ZREA 4DM7A 2XUQA 2XMRA 1SFRA 5AKEA 3ESCA 5CT5A 4HRXA 1J06A 2X8BA 2CBGA 3HI4A 4FHZA 4Y2VA 1Y7HA 5A6VA 5JZSA 2JF0A 2ZYHA 4JEIA 3FYUB 4X97A 3FLBA 1VE6A 3I1YA 2XB6A 1QONA 4OU5A 1DWQA 1EH5A 3AIKA 1FFBA 1N1MA 1UWCA 2Y2UA 2OAGA 2XQKA 5HK8A 5BV7A 2CEKA 3ICVA 1GKLA 1W6RA 5I8PA 5ALOA 1NU6A 5AM2A 4UHCA 4QNNA 4O08A 2HFJA 4QWWA 3WKDA 1B41A 3K9BA 4X6XA 3W9UA 1W76A 3DLTA 1MX9A 4LXGA 4B85A 3QPDA 3CCBA 2WJ3A 1ISPA 1Y7IA 5HFAA 2OQVA 5JASA 5EFZA 3LS2A 3EQ8A 3WL6A 1QTIA 2V9ZA 1YS1X 1GKKA 2XLBA 2HRQA 3LP5A 4I19A 3C8DA 2DR0A 2VATA 2DFPA 4EY6A 1G5FA 1A8UA 1XZIA 4LHEA 2QJWA 2FUKA 5ISMA 1XQVA 3BWXA 3H1BA 2PX6A 5KWIA 1H2XA 4M0FA 2WFZA 4BATA 1PFQA 4UFNA 2FJ0A 4FFVA 1FFEA 3IURA 4H7DA 2OGSA 2RIPA 3UUEA 1C4XA 2RAUA 4KE6A 4M0EA 1BRTA 4CI9A 1E3QA 4UHHA 2O7RA 2QR5A 2Z8XA 4LXHA 3QM1A 1ZJ4A 4OYYA 2PM8A 1E5TA 4FKBA 5EHQA 1XZEA 1RP1A 3FYUA 4C87A 4BCBA 3VVMA 2XUFA 2X76A 1H2ZA 2OLEA 3ED1A 3OPMA 2WUFA 3DD5A 1R9NA 1VZ3A 2XT0A 2I03A 4UHEA 2JGIA 3GA7A 1DWOA 4GECA 3QPAA 3C70A 1CUFA 3IUJA 5EHXA 4J7AA 1QFMA 2HU8A 2VAXA 2VQ6A 3PUIA 3DJYA 4NVRA 1Q83A 3WYNA 4B81A 4UPDA 2HA5A 4FDMA 1G42A 1F0NA 2C7BA 1LPSA 2HDWA 2ZVDA 3FSGD 2BCEA 2GZSA 1TCCA 4GDMA 2I3ZA 4AX4A 2XUDA 2RHWA 3DS8A 4AN1A 4CIBA 1QIFA 4Y2SA 3ESBA 3MGAA 2C5FA 3FCXA 1UKBA 5FUMA 1YAJA 5HCUA 3H0CA 4H7JA 5HKBA 3I6YA 4UBIA 2P8SA 4K5QA 4KE9A 1ETHA 2JGFA 3STUA 3N0TA 4FOLA 1W1IA 3FOBA 3O0DA 5ALQA 3V1LA 5I7UA 1QIGA 4DNQA 4OPMA 4RGYA 1GZ7A 4QDTA 5HQ3A 1YA4A 5ALGA 3VJKA 4BP8A 5HF5A 2XMSA 2H7YA 2OPHA 2QXTA 4JYMA 5H3HA 4HXGA 1R88A 2IX9A 5E4TA 4KRXA 4QA9A 5ALXA 3STXA 5JAPA 4DTCA 3WLAA 1JJFA 4G8DA 1XRQA 2H7CA 4RE5A 4GW3A 3K2IA 5AKKA 4UBKA 1XLVA 3FAKA 4L3WA 1XZDA 3FVTA 2H1IA 3NGMA 1MPXA 4F5ZA 3E3AA 3G9ZA 5T4FA 1GT6A 1R50A 4AB1A 3A2NA 3IVMA 2O2IA 4X3CA 1CUGA 5DNUA 4QDZA 4XWGA 2E3JA 1H22A 1LGYA 3W04A 4ITVA 1YCDA 5AOAA 1XRMA 2HU7A 2BUBA 1SOMA 1XKTA 3K6KA 3IUMA 5IVDA 5DTIA 2OQIA 3R3YA 5ALWA 2Z3WA 4ARBA 4S0XA 4BRSA 2PSDA 1JU3A 4Y2RA 1ZD5A 3BIXA 5EGNA 4BRZA 2ZYIA 1Q0ZA 1D07A 1DX4A 2WIJA 1YSCA 2WG2A 4QZVA 1N8SA 4H7IA 1FFAA 1DWPA 3NWOA 4AO7A 4BTVA 3FBWA 5ALHA 1HLGA 3C6YA 1CLEA 1K8QA 2WU3A 2YH2A 4A16A 2GBFA 1ZD4A 1AKNA 4RNCA 1QZ3A 2BAGA 1OILA 4C4XA 3P2MA 5K3FB 3R41A 4BVLA 4DYHA 1CR6A 1MT3A 2VT6A 3C6ZA 3WKAA 1IVYA 3PUHA 5LP1A 4XVCA 3QZUA 5A7GA 5FPPA 3M3DA 2Z8ZA 2V97A 3A2MA 5CBKA 3WK6A 4UBOA 2XDWA 5EHNA 3QBJA 4Q05A 2OAEA 5DNWA 2BKLA 1RYYA 1ZD2P 1E8MA 2Z3ZA 3M83A 4ARAA 1SC9A 3QH4A 5EI5A 2WM2A 3X3HA 3IIIA 4BDSA 5EIAA 3HC7A 1TKRA 3AIMA 2C0PA 4MYSA 1CPYA 2ZYSA 2PUHA 1E8NA 2FJPA 1BS9A 5EIHA 3GFFA 2XMBA 1LPAB 2AXEA 5JATA 4G9GA 1YS2X 1TAHA 4RPCA 4N8EA 3ANTA 3E4DA 4Q34A 4B80A 1PJAA 2XUOA 1XKLA 1TCAA 1VXRA 4CG1A 4U2CA 1CUDA 5AKZA 2CUTA 2QJRA 2GYWA 2WFMA 3RLIA 4I4CA 5AKXA 1FJ2A 5DYYA 1O6FA 2Y2VA 1WHTA 1G4HA 5LZ7A 1R9MA 4K6GA 1QIHA 4G5XA 3PF8A 1CRLA 2WJ6A 2HL6A 3O9MA 4CIAA 4F0JA 5AKGA 5K3FA 2XMDA 2VF2A 3DDUA 3H2IA 1K4YA 4DSZA 5AOBA 2XUKA 5T4BA 3OOSA 1GQSA 1YB7A 3BXPA 3RM3A 4H0CA 1W52X 4C89A 5C8ZA 2J4FA 1U4NA 3ZLTA 1U8EA 4GXNA 4ROTA 3WK5A 1XZJA 3KWJA 3N2ZB 5ALKA 2GBGA 4LYDA 4G8CA 5E2IA 4W1QA 1C7IA 3O4IA 2QUAA 4ZV7A 1Z68A 1F8UA 4BTLA 3AZQA 1WB4A 3WZMA 2O2HA 3STWA 4BBZA 3S8YA 4RE6A 3C45A 5IVIA 5LZ5A 5LLSA 3DKRA 3HZOA 4AMYA 1QO7A 5JD4A 2CJPA 3WK7A 3H04A 4AMZA 4BVJA 3PDCA 3A2LA 5AM1A 1QOZA 4MYDA 1VOTA 4I3FA 2CMFA 4KE7A 2GBCA 4INZA 5DYTA 1U2EA 1EB9A 2B4KA 3STTA 2CB9A 5HF9A 2Y1KA 1CUBA 3KSRA 2D5LA 2OXEA 4NS4A 3AZPA 4G4JA 2Z5GA 1DT5A 3ESDA 2VJAA 3VVLA 1UKAA 3QITA 1EVQA 2EDCA 2DHCA 2YYSA 2J4CA 5AI4A 2WILA 3Q8WA 5AI6A 4E11A 1B6GA 3DOHA 1JMKC 1ZI6A 4X00A 3ZV7A 5F4ZA 1YAHA 2Y6VA 1G66A 1QTRA 5AI9A 1HPLA 2WHRA 3F98A 2QS9A 5AM3A 5JAOA 2JIDA 1CUAA 2VTVA 1C7JA 4BAZA 4LIPD 1SCIA 1BCSA 3B12A 4B0PA 1AGYA 4H18A 3YASA 2ZSHA 3STVA 5A2GA 4OSEA 2PPLA 1I6WA 2QTBA 2BJHA 4W9RA 5I9IA 5AI8A 4PSCA 1CIJA 1XRLA 3T4UA 5K3DA 4L0CA 1MNQA 5BWBA 2X5XA 4Y9SA 1CV2A 5BOVA 1ODTC 2WIFA 3SWWA 4DLNA 4KAAA 3WKEA 4GLBA 3C6BA 1FFDA 3MUNA 3NUZA 2RGUA 4H7FA 1IUNA 4FLEA 3QPCA 4J3JA 4EY7A 5T4HA 2XQGA 1CUXA 1XQXA 5DLPA 2XMCA 1AC5A 4TGLA 2HADA 4EUSA 4DIUA 1OXMA 1PV1A 2PL5A 2BGNA 2G5TA 5HQ3B 5FP0A 1DX6A 3WK4A 4OB6A 1TK3A 4MJ3A 4HZGA 4JH0A 4C6HA 3V48A 3FWHA 3R3VA 1IZ8A 4QDUA 3M82A 1QFSA 1UK9A 5IKXA 4X95A 3WWDA 3HYSA 3F8SA 1UXOA 3WKCA 4UFPA 3LIPA 4ZXFA 5CXXA 4OYLA 1TCBA 2QUBA 3D59A 2PSHA 4EZIA 5D6OA 3WL8A 1JT2A 3R3WA 3R3ZA 4X91A 2O7VA 2QKYA 2JGMA 2ORYA 3G02A 3ICWA 3ANSA 1E8DA 4XX1A 1UOOA 4U2BA 2OCIA 1UK7A 2G63A 4EY5A 4KACA 3IB3A 1E89A 2PBLA 4L9AA 1K5PA 4HAIA 4UBJA 4PNZA 4C4ZA 1YB6A 1IUPA 2BUCA 4H35A 3HABA 2B61A 1F6WA 2W6CX 2ZJ6A 1AQLA 5CT6A 5FV4A 3CN9A 3WMRA 3IBTA 3L1HA 5LKAA 3HSSA 1H23A 3D0KA 2WU4A 4HTAA 4WDQA 1L7RA 1MJ5A 1XLUA 1ZIYA 4C01A 1UK8A 4HXFB 1CUWA 2AJLI 1LPBB 2WLSA 3I6MA 1Y37A 2QXUA 1QIIA 4W1SA 5AJHA 4J0JA 4DMKA 1YA8A 4B6GA 3MVEA 4EA6A 4CG2A 4Q3LA 5ALMA 1MNAA 4JYPA 2ZJ7A 5HFNA 2VEOA 5JADA 4KYVA 4N5HX 4U2FA 1XLWA 4OB8A 3AUKA 3HLKA 3V9AA 3HRHA 5LZ9A 5AHXA 2C58A 4J03A 3W9BA 5AI0A 1GPNA 1UOPA 3R3XA 1SCQA 5A7FA 1QIEA 3DEAA 2XMQA 5ALUA 1CUSA 3UMJA 4G1FA 5AK5A 1YR2A 1NX9A 3E1GA 2RI6A 2Y6UA 5BWCA 4G9EA 5FRDA 2BUAA 3C87A 4U2EA 3G0DA 3AFIA 1XQYA 3WIOA 4DMCA 1WOMA 1BN7A 1BROA 4OB7A 4EB0A 4GHWA 3G7NA 3PFBA 5HK9A 2DCMA 3ESAA 2QM0A 3BDVA 1EDEA 3OTQA 5ALZA 2JGJA 1VZ2A 2Q0XA 2WG1A 1EB8A 4AQDA 5AKIA 1P0QA 4Y2XA 3F96A 2R11A 4G4IA 3AJAA 5AM5A 1EK2A 5JARA 1ODCA 5ALYA 2IIVA 5AKLA 1WPXA 1AX9A 2ACKA 3G0GA 4FNMA 5AK3A 4B82A 3RKSA 1UFOA 5ALVA 3GBSA 2WUDA 4BAGA 3PFCA 3VXKA 5JIBA 4DSAA 1BE0A 3V1NA 2HFKA 4N8DA 4X6YA 1A88A 1JKMA 3O4HA 4AZ3A 3CCCA 5KWJA 1ODSA 4PSUA 1DQYA 4ETWA 1JJIA 4DMHA 5D3KA 3U1TA 4P92A 4OU4A 3WWOA 2XUGA 4KAJA 2C4HA 1CUZA 1LNSA 4WFJA 2RHTA 4MXDA 5ALPA 1XRNA 4B7ZA 1TRHA 3SC2A 2B9VA 3C43A 1MX5A 5ALSA 4E46A 5LZ8A 3VISA 1ZD3A 5ALJA 3G9XA 5JZBA 1HQDA 3OC0A 1CUJA 1LBTA 4P9NA 3WI7A 4UFOA 1TIBA 3H2JA 2UZ0A 5JAUA 5K5EA
chains in the Genus database with same CATH superfamily
1Y7TA 2OXRA 2XCQA 3FMOB 2VDQB 5FL7D 5IKEA 4QYTA 1QBKC 1YDEA 4HH4A 1RTTA 2QX4A 2Y8EA 5AI5A 2VJDA 5AOVA 1U0OC 2PLWA 2EGUA 1YMQA 4YCLA 2V59A 2H06A 4QWMA 4BFCA 1N2XA 1U2GA 1AZWA 3RRJA 4EDHA 2HSGA 4Y6OA 4ZTUB 1LI7A 4HLCA 4FT4A 5DPMA 2KW5A 2WTNA 4GGPA 3MGBA 2FSGA 2W6ZA 2XWJI 1E2LA 4U9IS 3W2EA 3W5IA 2J3DA 5TB5A 3FPAA 4MS1A 1LRLA 3IIEA 5H70A 1H4SA 1AD2A 1E2GA 2QP3A 4IW3B 3NNDA 1LU9A 4IFBA 4ZAXA 4B5LA 2A5GA 2VTEA 3I6BA 2LRHA 3LV8A 4RF3A 1XZMA 3R6LA 5CH5A 3I76A 1M1YE 1O58A 1UBNA 1U3VA 3Q87B 5B12A 3PICA 3HSKA 5SZKB 2HJ9A 5ERGB 1SCNE 4P4SB 3V4VB 4P53A 1X1TA 2Z08A 1V7CA 4LJ6A 2OO5C 5F7XA 4FM9A 5EJGA 4B83A 3TQRA 5DTQA 3SDSA 2YZMA 3V4PB 1MENA 4I14A 3AV3A 3B7GA 4PRYA 7MDHA 2DHRA 3A3PA 5JVDB 4E0BA 5BVHB 3DLHA 1UM8A 2IY9A 2OCGA 5KOHA 1TEVA 2JFVA 2IHNA 1YT5A 1ML4A 2JNWA 3C3JA 4M98A 3H17A 5EA2A 5KC9A 3RVJA 1L6IA 3PRJA 1UEXC 1XXHA 1Y81A 1EZ4A 3QMWA 2HA4A 3UB2A 3ZIAA 2XLCA 3K9QO 1PDWA 4R2KA 1SK9A 3IRUA 4B6FA 1JPNA 3K8OE 4UE2A 5I7VA 1Q16A 4MZXA 4PW0A 4XGIA 2QR3A 3W8EA 1GO2A 2FSFA 5KB3A 4BE9A 1UXKA 4Q4AB 1IEVA 1DG9A 1ZN7A 5EXTA 3V46A 1ZL0A 4EARA 5J2TB 1RXWA 2ZJYA 4FFMA 4ODIA 3GW8A 4ZIRB 2ENUA 2CXOA 4F3CA 4AJIA 4X6UA 3A4TA 4Y0AA 2PSEA 2Y3IA 3AFHA 1J0BA 2YCBA 3DE3X 3HLTA 1Z5WA 4UREA 4C21A 5K3BA 2L42A 1FSFA 2H1OA 2XUIA 2CJXA 2PCJA 4D7AA 4IRMA 2NPOA 3U0BA 3EMDA 3REFA 4EHJA 4HT3B 3M4JA 5DT9A 1KYTA 2G8LA 4R9SA 1L8OA 4L2IB 1I9CA 1KBZA 2EGGA 4J2TA 5LKRA 3Q4GA 2DFVA 1Q57A 2BLNA 3UJ8A 3T15A 2GN8A 2OLJA 1VL8A 4Q3OA 2GSWA 4ECEA 5CBPA 3ZDCA 2FQYA 2JAOA 3E3LA 2V1XA 1T8PA 4E2XA 1XIVA 2JB9A 5FT9A 1TVCA 3HI6A 2WYWA 1DDIA 4CHTA 2FOIA 1NVBA 4X41A 1JHOA 1FQJA 1M6WA 2QTHA 2QZZA 1N2ZA 3GROA 3HGTA 1M2WA 4HQNA 3TXYA 4EUEA 7YASA 1T9DA 2JFBA 3ZW8A 1M1UA 3ZU5A 3D7KA 4HADA 2JK1A 2XPCA 3GDFA 4QXOA 5F2NA 4IRUB 3HL4A 3Q3GE 4U3JB 1LKZA 3W5JA 4EM6A 3OZTA 3OPNA 1HTWA 4IWYA 5DK6A 3VHXB 3AP2A 2OB1A 3LYUA 1SU7A 1JS1X 2QLJA 4MLPA 5EC8A 1RPTA 5E4JA 4RVUA 3RK0A 3THSA 1PK9A 3WL7A 4N3AA 3R9XB 4D9HA 2NU6A 4RTOA 3I2HA 2BHNA 3M3HA 4HXEB 2BJWA 2A33A 4FKMA 4UBLA 3PC4A 1VYVA 3EASA 3NI2A 4R9RA 4E07A 4NG5A 2OCLA 1MVLA 2PT6A 2XKBA 3TZBA 4U5QA 1KYXA 4HY3A 4UTRA 3PC7A 3MCZA 3NV9A 3GT3A 5KBYA 1IRXA 2AQKA 1GQRA 4MW9A 2J9FA 4AMBA 2KI5A 4E5SA 3QWFA 4KN5A 1PT7A 2W4MA 4O4HF 4H6PA 2Q2NA 3EGXB 4NYIR 4YJ3B 3T7KA 3I5YA 2W0SA 1Q84A 4BNZA 5JANA 4I2NA 2C5AA 2EKLA 3AM1A 5JAZA 2FW8A 3BL5A 4ZQIA 4Y2YA 3QRWA 1UAAA 3BD6A 4INPA 5U9CA 4M36A 5I4KA 2V8BA 5IK2D 3I5AA 1YKSA 1A8QA 2C2MA 1DU4A 7AT1A 1NVVQ 5EPOA 2A58A 1VMIA 1XD2A 1DXQA 4JLNA 4UHDA 4WY8A 4ND4A 4RACA 4NBSA 1PK8A 4BZQA 3R8XA 2I9KA 1Z4JA 1SGWA 3ETJA 3S2YA 1JYEA 3WY9A 4QJ3A 3V32A 3CKMA 1IEQA 1JAIA 1YBMA 1VLVA 3W3AH 5ETJA 3SR3A 2G83A 3PDUA 5E6UB 1QGOA 4R81A 1GGFA 4WJLA 1J7KA 5AJUA 3DDSA 2MSNA 2ZAIA 4F2DA 1SCDA 2P9CA 2ZSKA 4A2CA 2CHEA 2QW0X 2YJ3A 2LCQA 2DETA 1CUYA 1YB4A 1OBOA 1ZI8A 4I46A 2Z4SA 2C2YA 2XZTA 3PUJA 4AZVA 5BVHA 1N5LA 4NYJR 5A5DA 1N2EA 2MSDB 5JVDA 3HK2A 3PZBA 4HD8A 4EABA 1Z4PX 1ULTA 4RD0A 5TQ2B 1DRWA 3MRTA 4Q4HB 2H1VA 5KMGA 5CTAA 1IHPA 1KE2A 2FFRA 2MTBA 4BMNA 3PJEA 4KSCA 5BV0A 5K0CA 3GLUA 2O8EB 4EP1A 1T1IA 3HVRA 1A9XA 5AXBA 1N2CE 4D0NA 5JT1A 3F46A 3IO5A 2F8LA 2IF0A 3J7AC 1IUKA 4QSMA 4ACAA 4IM7A 3UMVA 1B73A 1ZJ6A 1KMQA 13PKA 1VC2A 4RJKA 5I7FA 1K5GA 4BV8A 5J2TA 1F6DA 2GPJA 4Z0TA 4QOHA 4ZIRA 2R8BA 5FPHA 4YUVA 1JKJA 3FUWA 3M70A 2O5CA 1NRWA 3U7EB 3D7NA 4M0MA 2OYSA 1Y63A 2BFBB 4W9NA 2C3MA 4ZARA 3TTWA 5GINE 3B1FA 1CX9B 1F51E 3BB3A 5ICEA 1G1AA 1MAHA 1A3CA 3TSOA 1K27A 3H0EA 3RUFA 4IOKA 4IVQA 4L2IA 4LECA 3L8GA 1IU9A 1H2WA 3VFDA 2EZ4A 1GSHA 3QE9Y 3JW8A 2AK3A 1KIAA 1ZGCA 2SKCA 4QBTA 1UPTA 3A3NA 1GCIA 1OH8A 4YGYA 3IA2A 3WGLA 2P0AA 4NR0A 2BMJA 4I4TF 2IXGA 1UMDB 2VYND 4ZYXA 4DMLA 1EJBA 2NUTB 3A1TA 1S3GA 4P84A 3REGA 4HP8A 3W0LB 4TYMA 1Y5MA 2B6HA 4EH1A 1M33A 5BWOA 1O97D 1AXRA 1U2DC 4ZVKA 4J3NA 3ADCA 2HRBA 3M6AA 4ZRNA 4G1BA 3IBCA 2HHJA 3CNBA 5JH7F 2PRIA 1KMNA 4I1RA 2GZMA 1N5RA 5CURA 5CMLA 2R9VA 2WUEA 3X1WA 4XW2A 1GGVA 1GG8A 1X1BA 2FEWB 2RHGB 3NTQA 3AHCA 4B9EA 2F3SA 4BB9A 4DR2B 3R9XA 1RAIA 4D9KA 4F72A 3NWPA 3X1KA 1NATA 1QG6A 2HMYB 4B43A 4O63O 4OQLA 3F5QA 4CCWA 5AJVB 3H84A 1L7DA 2C4NA 4YRCA 4QVKA 4YK7A 4B17A 2A30A 5CA1F 5CFNA 4S1NA 4G9BA 4Z99A 1S1CA 2V98A 2JAXA 1UKCA 4MQBA 4UASA 4D3YA 2W2NA 2QNBA 5BWMA 1MH9A 1NJGA 3FDIA 5JZ9A 2EWMA 2JH9A 4D9JA 1VKOA 1NBIA 2R8PA 1UMCB 3CKLA 2IIPA 4FBGA 3UWSA 2ASVA 3CVYA 3EGXA 4F71A 1D3AA 2MDTA 3KDAA 4EGJA 2EDAA 1UINA 4WASA 4M9RA 3UHAA 5JR3A 1CJMA 3S2IA 4AXXA 2F67A 2C59A 2F1KA 2OLKA 3PJRA 3DOUA 1SCJA 2C7VA 3NIGB 5C5DA 1RLJA 4DJDC 1ZISA 3FE2A 1B8NA 3DBLA 3BXHA 5HYVA 4JJIA 1SZCA 1N3BA 3Q9SA 4CEIB 4GOND 2J4DA 1MA0A 4L15A 5EHZA 1NG9A 2JAWA 1YOBA 2XD9A 4Q0MA 5DNDA 2DFLA 2A59A 5KEIA 4EKNB 2QD1A 2ZJZA 4UQOA 4DCNA 2OCDA 3WTCA 1OH7A 2W37A 3PPYA 1WMEA 4B79A 2NIPA 2PMDA 1VKHA 2KWIA 1LX6A 4DDTA 3PR2B 3F73A 2ZIZA 1UF9A 2CFRA 1E1DA 2G5GX 2W6OA 3DNPA 1D6MA 1ZMTA 1USVA 2QU7A 4RD3A 3MS2A 4C4YA 3V8MA 3ZKAA 4ENSA 1X14A 1A0OA 2AKYA 1JT9A 4QBHA 4JI6B 1V6CA 2GNOA 3HSYA 3R0QA 5EZSA 3TOXA 1L8XA 2BR3A 3QYAA 5P21A 2O1WA 3DYVA 1JZSA 5FULA 5EERA 3T9DA 1MG0A 1H0RA 2TSYB 5KVQA 4C0AC 4B7CA 4TYYA 1RQRA 1WHSB 3ODPA 2P0EA 4Y7DA 1QE0A 3SHWA 4E51A 1GFWA 1GZDA 1FFGA 4QC2A 3ICOA 5HZGA 3G9QA 3UGKA 2B25A 3Q41A 5JQGB 4DLNA 4WK6A 4ND6A 3CNLA 5C52B 2XB2A 1LPNA 1OLUB 2LZ0A 1GXSA 3OFKA 3V42A 3UW3A 1CF4A 3EX7C 1TQHA 3SX0A 1SIBE 2BFBA 4TTTS 5LIRA 4MAFA 2XQJA 4LC0A 3BEDA 2RHOA 4O4LA 2I6QA 1COWD 4BC1A 2K2QB 3L7IA 4XX0B 2NTEA 3L07A 5AIAA 1KMCA 4XIIA 3UV6A 1I4TD 3ZKWA 4A8JC 1AKEA 4E14A 1IZYA 1P5JA 2PSJA 5H83A 4MVJG 4QDXA 4L76A 1SUIA 1YRHA 4HYYA 1T4CA 1CLUA 2BKEA 1QGUA 3GARA 3FTNA 4BX8A 1I6KA 2CNWA 5ALRA 1EFRA 5D00A 2NUTA 3VR6H 3K9CA 4E1BA 4F3YA 3LCRA 3PL5A 5GJVC 3VR4D 4QDOA 5SZIA 4B3GA 2IYTA 2BKAA 3AEKA 3RKUA 4IBOA 4QD3A 4TL6A 4Z4QA 5ALLA 1MB4A 1V2GA 1EXMA 1FXSA 5EZ5A 1NP7A 3TNFA 3OIVA 4ESOA 1XJQA 3FTQA 3WR5A 1HLFA 3UKJA 5D3ZA 2DQZA 4PZZA 2XYHA 3E15A 4D0RA 3HKCA 2Y0CA 2DVMA 1GZUA 3TL2A 4QVGA 1TO2E 1JIIA 2XE4A 3CISA 5DULA 2Z2XA 2FTKE 2D62A 5UKDA 4KIFA 5IPFA 3BWEA 1O6BA 3OG9A 4KXVA 2YOFA 1N25A 3N2LA 2VJKA 4HNRA 3GRZA 5LYYA 1G64A 3ZD7A 4RK6A 5FOWA 5TLSA 1UMCA 5IDVA 1SMKA 2QBYA 2OYRA 3DCIA 1EBBA 2IHTA 1CUEA 3F97A 3BVPA 2V4MA 4HRAA 4F56A 3DVQX 2B2NA 1QORA 2FVXA 3G9TA 4FT2A 1PUJA 4ETIA 1SCUA 4L9WA 1OQAA 3AWDA 2V8OA 1GDHA 3D3KA 1ML3A 3PF9A 4HFMA 3G8BA 3VA7A 5AHOA 3AY6A 2JJYA 4EEXA 3ND8A 3HBNA 1GA4A 2JLRA 4CKXA 2A94A 4GPAA 1HDRA 3C3CA 3VOSA 4BWYA 1ZR2A 1KOFA 5AESA 1QH1B 4Z9BA 4N76A 3I5MA 4L74A 4CEIA 2I6XA 4MYHA 2DZDA 2YICA 3GGCA 1YUNA 3G0BA 4ZDKA 1RI2A 5HF8A 2NYVA 4B4KA 2NV2B 3DZKA 2VDOB 4JOCA 1E60A 1KHTA 1TL7C 1M34E 5J2UA 2G8NA 2D1SA 3ZW9A 3QLEA 2FCAA 1PKXA 4LMRA 3NHAA 4FE7A 4C20A 2MR5A 3FTFA 3MWDB 1OX4A 3KE8A 4I9GA 4QRHA 4MVXA 4RSRA 3ZBTA 3ZGYA 2ASEA 5K6TA 4MI1A 2WI8A 2I2CA 4ZEVA 4AZ3B 4HUQB 1MN6A 3FGPA 1JI0A 1F2UB 3ZYZA 1E3SA 3GRUA 1L7AA 1CP3A 221PA 3RVRA 4EPWA 4GRDA 3LLUA 4UBJA 3IA7A 5F9MA 4C4ZA 5JQWA 4I3GA 3AT1A 4F4UA 5CG2A 3LTNC 3T1QA 1U28C 2QWXA 1AUOA 2G7MC 4FFBB 3RAPR 1O5TA 4EVIA 1WHSA 4YUXA 1M1YA 2CBZA 4HQ0A 3PSAA 1X74A 2F62A 3EXHB 2IBTA 3BYZA 1QYCA 5CT8A 3GFBA 2XKAA 5JE8A 3VH4A 4H31A 3MINB 4RBNA 3MOGA 3W7VA 3MTIA 5JQGA 5FNVF 4PZ0A 1RJGA 1FMTA 3P9RA 1VM6A 3FHOA 2YW9A 1XEXB 1BEUB 5JOQA 3KZCA 2QV7A 1EUCB 3RAJA 2Z56A 1WP4A 3NRCA 4OREX 3ZIUA 2IHKA 2ZYTX 1WOYA 1SZPA 4OVKA 2O1XA 1L5WA 3SC2B 3B3GA 2AFRA 4RK4A 1XP8A 1GYRA 4C7BA 2JEYA 3PIIA 3T9AA 3WGMA 3LZCA 4MVWA 4X5OA 1BQ3A 4BO9A 1I36A 4GX0A 4AJPA 2NZVG 4J1NA 5GP1A 2R0QC 4MQ5A 3AKCA 1KP2A 3WO0A 4G8BA 4WVLA 4JI8B 4L73A 5CDSA 3PI6A 1B8OA 2ZVJA 3O8DA 1LSJA 3HBJA 1TJYA 3V34A 1SC4A 4B4WA 3BCRA 3ELYA 2PZBA 3VBCA 2HKIA 3CSSA 3VYTB 1PHPA 3T38A 1GNLA 2ET6A 1G0OA 2WHQA 4BMPB 4BN4A 3F5DA 2FW0A 1Q0RA 4IOMA 4MWTA 1Z4QA 3F1LA 2AXNA 2NUPA 4OM7A 4BGVA 2Q4TA 3CBGA 1DCFA 1JPUA 3EVZA 5J3JA 3QLUA 4TT8A 2BP7B 2QD3A 4DDMA 1YJ8A 2YC2C 2VKTA 3AKYA 4P86A 4W5JA 3A1EA 1NVEA 3FNBA 3HFJA 2BTEA 3JAKB 1T26A 4J0EA 2YUIA 3HN2A 1DQNA 2CXHA 2GR9A 2HLDA 1YS9A 2IEAA 2PRZA 5E4FA 2OA0A 4CV3A 5IJZA 1CY8A 1AUVA 2J9RA 1SXJB 3I8OA 4DV0B 1U0JA 3O2QB 1EFCA 2PYZA 4M1WA 4UUOA 5TGDA 4TX1A 3BF8A 4AP6A 1OFVA 3EFEA 3N74A 3JYLA 2EZTA 1ZICA 3D4NA 3SBDA 1QM5A 1RPJA 3HWRA 2B8TA 3KR1A 3LC2O 4PPQA 1I9GA 2QLFA 4G0WA 3MZ0A 3OMLA 4WNIA 3T35A 2Q5HA 4QPPA 4PR0A 4E5NA 1JQAA 4F4HA 4F04A 3ENVA 3GLGE 2P9FA 3SSNA 1TGVA 1Q92A 1WG8A 2NW6A 3F6EX 2PMCA 1IYZA 1XA0A 4DA0A 3WK8A 1XZFA 2L18A 1VA4A 3EF1A 3ETHA 3LQ1A 3QPBA 4GI1A 1ZQ9A 1QH1A 4QATA 1KI6B 1NBME 2CK3A 3O8NA 1QHSA 4V38A 5HILA 3U62A 1L5OA 3W78A 4BIMA 3H2GA 5BQ5A 1XD8A 2V7GA 1LDBA 1TM4E 2QTWB 3GR6A 3TO5A 4F6RB 3RYHB 4LDJA 2PUBA 3KOWA 1U1CA 2C4MA 1CNEA 3Q72A 2HBYA 4GL4A 1Z4MA 4BN5A 5L40A 3LBNA 2P69A 1R1DA 1RLTA 3EW9A 3ESRA 1K8YB 4RZUA 2XUPA 2FMFA 3EN0A 3PKZA 4BJHB 5DNYB 3UK7A 2IT1A 1UJCA 3PNVA 4FOPA 5K45A 4DNXA 4E22A 1N0IA 4HUQA 4DC0A 4GOLD 3C5WP 3TEJA 3IP3A 4QOEA 4AY4A 3H5IA 4DVGA 4V0ME 1ID1A 1XAHA 2HX1A 4LSWA 2PBRA 5KNDH 1AV6A 1EDOA 2FG6C 1QR2A 1UOEA 2FU5C 3F90A 2F4NA 5K0TA 1FZTA 2O2JA 4URYR 1VQ1A 3AI2A 3R40A 2FGJA 4FFBA 4KQ1A 1H5QA 2I7TA 4KGXA 1WDTA 3EZXA 4N54A 2ZBUA 3CUWA 3EXHA 3M3PA 3ZDXB 2CLCX 1UBUS 4PN7A 4GMXA 1YDGA 3UJAA 1OLXA 3D5QA 2LXNA 2JIOA 3MINA 5KQSA 4WCVA 3K1ZA 3FLEA 1OY1A 1P7VA 3QMVA 4H60A 1WX1A 1XEXA 2PQ0A 1UC8A 2YWGA 4MYCA 3IT1A 1KEZA 1EUCA 2AI1A 3TDNA 1IVSA 5AM0A 5F1PA 1JXMA 2CE2X 3HHPA 4PANA 1DJLA 1AQJA 4FNGA 2XTJA 5JJIA 3DZDA 1KAQA 4JLPA 2XB4A 1NJ1A 2VPWA 2ZTSA 1K6IA 3GOQA 4L75A 4BU1A 1XFDA 2HSDA 2QLTA 2XA9A 4FI3F 4YONB 3U56A 2QTLA 4LF9B 5FPQA 1FBTA 1P4SA 3CH7A 3VDXA 5KTTA 3B7PA 3A6ZA 2Z6AA 4ETMA 1N1GA 3NDBB 3GJQA 1XX6A 1UBRS 3G2PA 3R5JA 4J0DA 1N2CA 3RYCB 1ZVKA 2FW9A 3L1UA 2YRWA 3ROGA 3EZNA 2ZZMA 1SRRA 2GOYA 4RETA 4RTMA 3B2NA 3F6YA 3ASUA 5A1TA 1COZA 2I34A 5HOEA 2IYYA 3PI7A 5HIKA 1SJ9A 3CF4A 4BB5A 2PZMA 2ZUDA 3IKVA 1EPUA 4XWTA 5CJ2A 4UMDA 4EG0A 2BC9A 1E62A 3K71B 3G5UA 2JDID 1RADA 1MAUA 1G5IA 2QA5A 2C5GA 3DKVA 1KDVA 5G1NA 4LC9A 1QLWA 1OTHA 2REQA 3GQBB 3I6QA 3G79A 2BP7A 1LVUA 1DT3A 4FE3A 3F8TA 4BZPA 5KDLA 3IAEA 3U4AA 1W4LA 3CNQS 2GWHA 4MVJD 4U2GA 1AB6A 2DT8A 2XQIA 4BB6A 2C4VA 3MAAC 4F2HA 1GGNA 4JJKA 2CHUA 4R9UC 2PJDA 3KZXA 3A70A 5EIBC 3SLGA 4PC7A 5TQJA 2C8KA 2MSEB 1WB5A 4S04A 3U16A 1RWOA 4JITA 1OPXA 4U7WA 5BV2P 1KJJA 2J6CA 3KB6A 3GJ6A 5HNKA 1PNQA 4II2A 3HJCA 4YMUA 1DO2A 2ZWPA 3C5VA 1E1LA 2C1ZA 4WA7A 5SY6A 4HWRA 2O8DA 1LJ8A 2B1QA 2VN8A 3A1CA 3N05A 1E7QA 4KZKA 3L7JA 3KBOA 4OXYA 3SLRA 3UH0A 1SUFA 1NVUQ 1UQTA 3H2KA 3NCTA 3S8EA 1XZLA 2O23A 4HX5A 2JH8A 3UH1A 2BONA 4TTSA 2QW1A 1ABBA 4LF8B 1D1TA 1HZJA 4PSAA 1ZVVA 3TJZA 1N6OA 5E9JA 4YCAA 4IQFA 2QYSA 3ESYA 1X2BA 2V7BA 3FPEA 3N7TA 4H7KA 4C5AA 2I9PA 2GTPA 2WF6A 3UAGA 1RRGA 4P98A 4TV9B 3RJMA 1AMNA 4Y2JA 5H4GA 1RPAA 4F6RA 4HAVA 5JSUA 2ZZKA 4NYMQ 5B7GA 4D80A 1TM2A 3CRVA 4HZIA 1DOZA 1NUTA 1X80B 3GN1A 4Y2QA 4I7EA 4LZPA 2G82A 4C29A 1IXKA 1KU6A 3ABZA 5DEIA 2XAUA 1C8LA 1OW3B 2R6HA 4AI6A 3DE4X 4J0IA 5L6LB 3GO4A 1UWKA 1W2GA 3BQ9A 1T10A 3AV0B 3LQKA 5K6RA 3INTA 3P2YA 2C57A 4RS3A 5IVHA 5TC4A 4CR6A 2GUWA 4D4GA 2CDCA 2AJBA 2H5EA 1K0FA 1I14A 2WSLA 2DULA 3BZBA 5FUXA 4DNPA 3ONFA 1EGVB 2CFOA 1JEDA 2I6GA 2DSTA 3VAZA 1R0ZA 3K0HA 3TRFA 5KU1A 1DINA 2ONYA 4LXIA 4FKZA 3ZZ0A 3BGDA 1CY1A 1D2AA 2HMWA 4ZYVA 4LDNA 3SSOA 1R3DA 1M34B 3ORYA 3VC2A 3HJHA 4YCNA 3GCWA 1Z6PA 1ATZA 2EP5A 1V16B 4L1KA 4NZNA 4XUEA 4O2BB 4KZPA 4RF5A 3HVKA 1Z4IA 2NSDA 2FPSA 3P9QA 3ZNNA 4TWAA 5E3HA 2VDKB 4D74A 4PYJA 2J0QA 4B75A 5I7EA 1MO3A 1KY2A 3NXSA 4M60A 4P93A 4ZJPA 2FZLA 4ZT7A 3OEED 1Z7WA 4TLEA 2G7ZA 4YREA 4JGBA 1BG6A 2AF4C 4ISBA 4KR0A 1M0TA 1L3IA 4PPFA 2HA3A 2OC9A 4UVDA 2OHOA 1PVVA 4E7OA 1N9KA 2Q4BA 1IH8A 2J0EA 1BH2A 5EAIA 2QMUA 4CTJA 4FQ8A 3EMBA 5DBFA 2O3JA 1BA2A 5JRDS 3FUVA 3LKZA 4J90A 4I4NA 1JGTA 4QGSA 3CVUA 3EG9B 3N8HA 5TIIA 5G0VA 4Q1CA 3K1YA 4TLDA 2XAAA 4JBLA 3CXRA 3L8YA 2E49A 4ANFA 3CZ4A 4IMJB 5E3IA 3TAXA 1SC3A 4HS9A 1HXHA 3DV0A 2HHCA 2P9TA 1QC5A 2QBYB 1J5EB 3N0VA 2HF2A 2K87A 1Z0ZA 1ZXXA 1SXPA 2CZQA 4DG8A 4CEJA 3GNTA 3EJ6A 2JCXA 5JALA 1GITA 4XKJA 4PRLA 1D6SA 2QVZX 1JAZA 3GQBA 1M73E 2ZB7A 4K26A 4G2NA 1QIDA 1HBJA 1P74A 1Y34E 2JGKA 3DR5A 3O4FA 1V7QA 3ZCPA 4DEVA 4X20B 1Z62A 4Q7QA 4YPVA 1J00A 1Z45A 4G63A 4H1UA 4I50A 4XOIA 1CTQA 4J0CA 1L5RA 4CIWA 1IK6A 4FINA 2ZE7A 3QIAA 3KL2A 2DBVO 4PGGA 5ALTA 3G6WA 3EEQA 4Y9TA 2M6LA 3MWGA 1G21E 1FVHA 1OZAA 3DOJA 5JHHB 2WHPB 4N6NA 5TJ9A 3LCJA 2C20A 3UT5A 1P0CA 5J1SB 1OZHA 2B34A 3DQZA 3E9CA 3PA8A 1XZKA 3SYMA 3VSEA 5F1KA 3GRAA 4D92A 2JFXA 3CF6R 5EKTA 1X3LA 2PXXA 1TLLA 1UBJS 1WCWA 2X9VA 4DE5A 4EY4A 3D4OA 1OBCA 3DEHA 2NMVA 3FTCA 1BGWA 2ZVPX 1S1MA 4MULA 2G9ZA 3I2GA 4H6WA 4Q48A 4UBNA 3H4TA 2WG0A 3RGGA 4BGUA 2PX2A 4TV8F 1ACMA 1T35A 4RHTA 3VU3A 3K6RA 5LIPA 3TVTA 10MHA 4CGZA 1OWOA 3NZEA 3BE6A 5D8DA 2JJ1A 4JFAA 1E5QA 3UAZA 5BMVF 4JJAA 3ZQUA 5LZ4A 3VPCA 3KQMA 2WUGA 1XKQA 3OJXA 2PXHA 521PA 4UTNA 2GCOB 1T9BA 4I1IA 3M1LA 2QVGA 2VNJA 4TYWA 1N32B 5T67A 2A1UB 3MXTA 4JL5A 1V2HE 1VI2A 4WFQA 1XTIA 5FBVB 5FPTA 4TV9A 5BUQA 1ULAA 4NHEA 2GVNA 2WE7A 4JODA 3RSFA 3T7JA 3W2TA 3RK4A 3ZHZA 3ZCQA 3X1ZA 2Y92A 3GUUA 3HUEA 1Z3IX 4UNQA 1QNLA 3EXEB 1Z0AA 5BNTA 4GT1A 2QRGA 3M6UA 4RMNA 2Q6KA 3RS5A 3ZE0B 3K2QA 3PXUA 4DJEC 1R5OA 4QG7A 4UQLA 5DLDA 4V1CI 2EYQA 2HSJA 3WA7A 2JGEA 5EP1A 2YL2A 4ZGWA 2GYVA 3Q2OA 2YZGA 3UTCA 1I4LD 2W22A 2ZIGA 1POWA 2WSMA 3UATA 1GZ4A 4K9SA 4N5NA 2GN9A 2P0YA 3TLJA 3T3IA 4YRBA 3GLGB 4FLMA 4IIYA 5FEMA 1XA3A 1IDN1 2NVOA 2WVAA 1PR3A 2YC4C 2VP2A 3P26A 3D0OA 4QDJA 4ZO4A 3RASA 2G67A 3CUEF 2H59A 2GHIA 1XTTA 2WIGA 2E6UX 2YZKA 3ONWA 3KYIB 3KLBA 4Q3NA 2FUCA 2H51A 2GZ3A 4EGQA 5BN4A 2JKVA 5EL0A 3OPVA 5JAMA 1CT9A 2B0JA 2XUQA 1UKEA 4TZKA 1EG7A 3SQOA 1SFRA 6REQB 4BGIA 4RXUA 4LJKA 3IQZA 1M34A 2AC7A 4HRXA 3WGVA 1J06A 5DN6A 3OFNA 4FEGA 2CBGA 4O2BA 2XXAA 1I1HA 3HR8A 2A5JA 2GKSA 3SQXA 2KS6A 5A6VA 1RAGA 4LMAA 5FWXB 2XQVA 3CX8A 3I42A 2YXBA 2QQ0A 1O7JA 4KQXA 2BGLA 2XRYA 1HSZA 5A4AA 2QI9F 2QN6A 3FLBA 3VNVA 3EIUA 5T8KA 1YZFA 4JD5A 3RYIB 2VP4A 3I1YA 4KP7A 5J4KA 1BVRA 2BFEB 2FWRA 5JY6A 3BB4A 1E79A 2X6TA 1W6UA 2B82A 3AB8A 2MSCB 3CF2A 1QTQA 3OEWA 5FA5A 3F9IA 4DIEA 4R8RA 4X3PA 4AMGA 1BQ4A 2F3PA 3CRQA 1N1MA 1I24A 3II6X 3EG9A 4GLJA 1K66A 1N4AA 3RJZA 2R4TA 4LVCA 2PMWB 2O6HA 4RQAA 3DHEA 3V4OA 1ZONA 1NVGA 3UOWA 2HWXA 1GKLA 2FPPA 1KI3A 3T3GA 1ATIA 2WTAA 5ALOA 4Z4IA 2B4RO 1M10A 4OBEA 4OK6A 3JWPA 4UHCA 3IS3A 2HFJA 1D8AA 3OAAA 1EMDA 1GNVA 5JTTA 3AG5A 1KHHA 1A5TA 3PU6A 1EU1A 2NVWA 4RSGA 4HAOA 5AXCA 4X20A 4YV2A 1SO8A 1LQUA 3TMAA 3QEBZ 2MSKA 4Q03A 1PFKA 4A5OA 2OD9A 3HDYA 4IKPA 2WWVD 1RDFA 3K05A 4FJ0A 4N0EA 4B33A 4PZAA 3KSDO 4R5HA 5JCJA 2WJ3A 4DJJA 2UU9B 3BIFA 3L0PA 1P1FA 4D97A 3VPSA 3JSXA 4QELA 1C4KA 1JNXX 1JAHA 2P65A 3NBFA 2VH1A 1RI3A 1CE8A 3KOZA 3WL6A 4KOAA 3K30A 4LDQA 3SS7X 5KKCA 3NEYA 1V71A 2AQIA 1DJQA 2W70A 4ZYTA 5KPJA 1I01A 2YFHA 3HJAA 2EJUA 1ZOSA 2HRQA 3PNBA 4FXOA 1RKQA 1T4GA 3LP5A 2Y68A 4FD2A 4KFSA 4C7JA 3O47A 1K3FA 4PYNA 4I19A 3ZY5A 2DR0A 2VATA 4G56A 1EVKA 4NZPA 3W5HA 1RQGA 1QK3A 4W8GA 2GCOA 3O3CA 2J5XA 5DP2A 5LP6A 4F4IA 2ZYWX 4FZ5A 4ALNA 2CMKA 2A1UA 1RWNA 2BN4A 2COKA 2KJQA 3QLUC 1E6EA 1ZINA 3OMWA 4LHEA 2QM8A 1WCV1 4CM3A 3ZHBA 1KYVA 4JELA 4F2WA 1P4GA 3COVA 2J3HA 4AF8A 1G9TA 2PWAA 4U7TB 4WW0A 1VG0B 2FWPA 2EHJA 2BPOA 2ZU0C 3CLSD 3AR2A 2H4YA 1U9ZA 5T7BA 2WF7A 4HGOA 5TV2A 2J3KA 2WINI 1TZ2A 3MUEA 4Q3EA 3SQDA 4D9FA 2A9FA 1EZ1A 1GPWB 1NBHA 1T3LA 3FB4A 5TR9A 3C6QA 4JB3A 4TMYA 1QK4A 2COUA 4DLPA 5B36A 1IULA 4GPEA 4TSKA 3GLGA 1EX6A 3MF4A 4TYQA 3W5UA 5I8WA 2IS4A 2P9YA 4UUAA 4MDFA 2CD9A 2B2XA 2RAUA 2IEDA 2W83A 3EDCA 3OVMA 1PV2A 3EULA 4MZDA 5FOSA 1I4EB 1U3UA 3NYIA 1A50B 1R10A 2JGDB 4LHZA 5EUCA 2IHVA 3DMTA 4B34A 2CYCA 3HP4A 3ENQA 1Q17A 4YHBA 1T13A 3TNDA 3D64A 2OHXA 5IJWA 5HIAA 5D5PA 2O7RA 6REQA 1D09A 1ZJ4A 3LCVB 3O38A 4OI1A 1QUFA 3MTAA 4ZU6X 1YZHA 4RY9A 1CRPA 4OYYA 1CYEA 4ARZB 2O57A 4IJQA 4EFNA 1TTPB 1BS1A 2VPZA 2W6NA 1A9TA 5FWXA 4FQ7A 1CR4A 4N65A 1P44A 3W5VA 1T8RA 2FUG6 3VPFA 5ADVA 2ECQA 2X19A 1B3BA 2ZRLA 4HFRA 4LRQA 4NBUA 2ZBPA 2ZPTX 4LHSA 4V0MA 4ZO8A 4EELA 2X76A 3SQLA 4LBYA 1H2ZA 5KTMA 2DTXA 3FZQA 2BFEA 2CW5A 3C8MA 3HDVA 4PLWA 4QOSA 2XSZA 3KKMA 3ED1A 4PINA 2J7KA 3OPMA 4LGCA 2WUFA 1EA7A 3DD5A 4IZOA 1KDRA 4NQZA 2ORED 4D45A 2NOAA 3N75A 2R25B 2J32A 4UHEA 4C14A 3ZU2A 2VPIA 2ZWMA 3GA7A 1NMEA 1I4DD 2CCKA 4G01B 1TF2A 3RBZA 5C1IA 2FR8A 4S12A 2VP0A 2VP5A 2X3FA 1CUFA 3BH7A 3NONA 3UMSA 4EHHA 3UGJA 1U04A 1OI3A 2DKFA 2FWJA 2GLXA 2R44A 3NAZA 5JS2A 4UUBA 2XIQA 4I1OA 2QVLA 2VQ6A 1WUJS 3VH2A 5E1DA 3AC0A 4DCUA 2BHTA 5G2OA 2B2CA 2FHPA 2ODWA 1BSVA 2RSLA 3Q7SA 2I2WA 3RFTA 1JE1A 1Q83A 1K5HA 1D9ZA 1YZQA 5BUZA 3S2EA 1XYGA 5DSXA 1FUKA 2X0NA 5EXEA 2JGAA 1NXWA 2Q46A 4XM0A 4FDMA 3QVGA 3TQSA 3T5AA 3LT4A 4LK3A 2JHCA 3JTMA 1F0NA 1KC1A 1RXUA 2JEOA 2W5UA 2XZLA 3LGSA 3KQQA 3BRCA 2UVPB 3I0ZA 4INJA 3DE2X 2QPOA 2G06A 3UHJA 4AWXA 1V11B 2VRCA 4XWYA 3EUAA 3QVOA 1ZRNA 2WWIA 2Q9CA 3QJYA 3V00A 3H5WA 3H8JA 4PYOA 3HFRA 4M2LA 4P58A 4XAQA 5A3VA 3UXEA 3THYB 3B6ZA 3L0BA 2WOJA 1OIVA 2PKQO 5BP7A 2PD4A 3BQNB 3O6VA 4GQIA 4K86A 4CR8A 1PT6A 2XBUA 4CIBA 3GEEA 4Y2SA 3L92A 3FNRA 5CK4A 1WE2A 3LF2A 3PDJA 1MC5A 2C5FA 4BLOA 2NTYC 3N8NA 2CYAA 2CUZA 2C9ZA 3CZ9A 4K9MA 1DAPA 3FMPB 3CF4G 3H0CA 3IAM1 3OX4A 2G9UA 3NQ41 1GAJA 2O9JA 3SYRA 3TRHA 2ILTA 2FF7A 5HKBA 4W5TA 1UWVA 2GEDA 4YIHA 5HXAA 1VPDA 4K88A 1WSBA 1SXJC 1Z15A 1H4TA 1SIUA 2JGFA 1V7ZA 1ZIOA 2JLSA 1E6MA 3TD2A 3D3QA 2O0LA 2C3UA 3H9QA 3NC4A 4IF6A 5ALQA 1JF8A 1H6CA 2Q9UA 4JLKA 5C32A 1XMQB 1OLSA 1OXTA 4N9WA 4ALJA 4OPMA 2XITA 4O4JF 4RGYA 5CFMA 1GZ7A 5CVTA 2G04A 3T5CA 3WLKX 5ALGA 4R9VA 4GX5A 3UMGA 4MV8A 3KOXA 1E2EA 5CFPA 2JJMA 2OPHA 2OR3A 1M76A 4HEJA 3Q1KA 3S6JA 3UB4A 2YVKA 1PZXA 4UXJA 1G38A 1GUDA 2IX9A 2X2FA 3NJ8A 1W93A 4GI2A 3E05A 5E4TA 5EEGA 4LFBB 3DEJA 1CR0A 1G55A 5F5XA 2G28A 2OBXA 5BR4A 4UU1A 4NTZA 2ZOSA 3ENWA 4XTCS 4KO8A 4W99A 4D0GA 1ISHA 2FSVA 1FW8A 4KRFA 3HCBA 2GESA 5EIXA 1PLJA 4DTCA 3N70A 1I80A 1OC4A 1X6VA 3GGSA 3FXAA 3K0CA 4G8DA 1BXZA 2C3OA 4M1KA 5I7RA 1UQUA 4PSVA 1MQAA 1L5SA 1LDEA 1A9ZA 1RXEA 1ZJZA 4EATA 2XYRA 4GW3A 1E6UA 1TOAA 2RHBA 3WLPA 3ZCRA 3NEAA 4Z7JA 3K2IA 3P0JA 1HT3A 1QUEA 4B3IA 5JROA 4I1PA 3OX1A 2V74B 2AFIE 1MQSA 3CE9A 2ECPA 4QL3A 4C76A 2W0MA 5A0FA 2FEXA 1Q1BA 3MWFA 1QP0A 1C8BA 1M2FA 3Q2KA 4K7JA 4YT5A 3HCEA 2UZ4A 2IZ1A 5FV7A 3JD0A 4ZCIA 5HQTA 3FUUA 1AGNA 1TNDA 4UAUA 5T4FA 2X5JO 1IONA 1G8YA 1D2GA 3GY0A 4UM9D 3U26A 4WXEA 3D9QX 4MGZR 1CUGA 3K53A 5KTOA 3QUBA 3ORQA 3DBOB 3KSAC 4QDZA 3P45A 2E3JA 4N5MA 3IPCA 1KJIA 2DLNA 4YAOA 1H1DA 3W04A 1PG0A 4OHRA 2EARA 3VPXA 3ZTYA 5JJLA 3TNJA 4NJOA 4DLZA 1AS3A 3ZV4A 3K70D 5D6NA 1BW9B 3BM5A 3L18A 3ROMA 4EPRA 2Z98A 1N34B 3CCFA 3VR5H 1BA3A 2W2LD 2EX0A 3LVBA 4CDMA 2BUBA 5HJEA 2ISQA 4OHZA 4E5VA 5JNVA 1S9HA 3ROZA 2XNDA 1QHGA 3LUDA 4LZWA 4MJ7A 4TUYA 4WHMA 1X94A 4CM9A 3ZDFA 4A0FA 3MWLA 1U0HC 4HI0E 4I66A 3P9SA 4CQMB 1H5UA 1NR7A 1V11A 4I2VA 4M8IA 1DUIA 1E32A 2RBGA 2C77A 4XJTA 3OC6A 1DOHA 4BRSA 3PP8A 3L0OA 2PSDA 2DECA 5I3ZA 5LQAA 3THYA 1UEJA 2P5TB 1JU3A 3PNMA 4Y2RA 3LX6A 4UU8A 4DLBA 3AF1A 2Q6TA 5EVCA 1JTFA 3EFOB 5JPDA 4HOYA 3N0WA 3TOZA 4YMWA 5K0FA 3NNSA 1SXGA 1T8WA 1O8CA 1AU9A 1FFHA 1Q0ZA 1HY3A 3GP8A 2WIJA 1OFUX 2WG2A 3O7MA 1G21A 4YI3A 3OLYA 4PLTA 1PRYA 3DCYA 5FORA 2YWHA 1FRVA 3GLIE 1LX7A 1SG0A 4YQEA 1B0PA 4EYOA 3VTZA 3H05A 1UDXA 1LTHR 1KA9H 2R79A 4G2TA 1C9DB 1JW9B 1HLGA 3EGOA 4TMZA 2PUEA 1P3Y1 3RS0A 1DPGA 1DE0A 3PWSA 1SD5A 1CLEA 1SD1A 2JCYA 2AMLA 4MPPA 5FPKA 4PX3A 3ZLJA 1GZ3A 2AE1A 3L46A 1K8QA 5ICCA 2WU3A 2YH2A 5DTRA 3U4IA 2Z95A 4BXOB 1GKYA 1QZ3A 1XJ0A 4KTVE 1GZHB 1WXEA 3DV9A 3EA0A 4L07A 4TTVA 3VC3A 5HKKD 3R41A 3OU2A 3JZIA 4BVLA 5LWHA 1YRLA 1CR6A 2IYOA 1YDMA 2VT6A 5K3OA 3HA5A 3C6ZA 3OE5A 4HN4B 4RGVA 3OZGA 4BLUA 5KJCA 3PUHA 4D4MA 2GTIA 5LP1A 5J4VA 1ELOA 2ZPAA 3UWDA 3GU3A 2W6JA 1ZRMA 4KXXA 1U8AA 3TSAA 3KYDB 4GP9A 1DIOB 1K9SA 4KGZA 4M0LA 2BCJQ 5FH9A 1W9HA 3W5DA 1Z6QA 3SZGA 1VPVA 2ZREA 1V37A 1DJPA 3NGXA 3TCKA 5EHNA 3QBJA 3GP3A 1K08A 5DNWA 2BRUC 2BKLA 4LC1A 5BQ3A 4LZAA 1YUMA 3HWX1 2VYVD 3W6NA 1TA4A 3D7SA 1E8MA 1YL6A 2X2EA 2JRLA 3TL3A 3DTVB 4IUYA 1UAGA 2IPNA 3M83A 3ONEA 1SC9A 4D79A 1AM4D 2EGHA 3EGDB 3JATB 4M53A 4NBRA 2W4QA 2XYGA 3PRHA 2J8ZA 4US1R 3LDGA 2CJYA 3TMYA 4PONA 4GZMA 4LZLA 5FYDA 1NVVR 5EJ5A 1AK9A 2CXTA 3PFFA 2C83A 2JJ2D 4GD3Q 2ZEJA 3TOCA 4PZLA 2C4TA 4QUKA 4DEXA 2ZT6A 4E2WA 5LA6B 5LNK1 1C8VB 1T6YA 1CPYA 2K5UA 3K8YA 2ZYSA 1NE2A 1WSWA 4GFDA 2PUHA 4HK4A 4PLFA 4NPCA 2IYFA 4RJTA 2HDOA 3IFSA 4XIFA 5IM4A 4JHXA 1BXRB 4CNBA 5B5SA 4DB4A 1PFUA 1WABA 3RU7A 5J40A 4M4SA 1Y4SA 5CJJA 5LUAA 3MM4A 5B57C 3NH6A 5KYKA 4WTOA 3GFFA 4AY3A 2Y4OA 1ADCA 4WI1A 5CM8B 5EWLB 3H5VA 4MW7A 3TUJC 3A28A 1T91A 2O3UA 3HDGA 1R6TA 2GNAA 3TX2A 4KX3A 1DC8A 1R0SA 2N47A 2ZRIA 3OZXA 5AW8A 1XFAA 5T8KC 1V4VA 3B3FA 1JIQA 4R1PA 1TAHA 4OV6B 3VOAA 1HM5A 4DS3A 1HNXB 1AV7A 3FPCA 3T3MB 2Q1UA 2WKSA 1W5SA 3GVCA 4YCDA 3A4LA 5GM2A 2WKQA 4GLLA 1YQEA 4AS2A 3ACDA 4CQMA 2CV1A 2WAXA 2MIIA 5HOQA 3UJ6A 2ZRDA 3QVJA 5H81A 1QVZA 1U7XA 4JBYA 1WSDA 3K15A 4OLJA 2PT5A 4J7XA 2FR1A 3G0HA 4FWIB 2Z1DA 3I9OA 4A8PA 3AETA 4O8CA 1GRQA 1O03A 2CUTA 3HY6A 3MB8A 5GM1A 1T4BA 3NBXX 1QG0A 1E2IA 3EFOA 4EL5A 2Y67A 2O0MA 2WTXA 1I0IA 3IQHX 3H4IA 3AR4A 5AKXA 1A2BA 1FJ2A 3WB1A 1GUFA 3Q11A 3RBAA 3CNEA 3PQEA 4FSDA 4TKZA 3DYBA 2HB6A 2PJRA 3LC1O 2D1TA 3FWNA 3H11A 4R41A 2C00A 3JD2A 5DYYA 1RYNA 3V9PA 1WTCA 3QP9A 1RWVA 3PGMA 2QTFA 2C2GA 1ECPA 2EFJA 1IY0A 2IVZA 2Y2VA 5JCOA 4EYQA 5L9AA 3HXQA 5F9FA 5EWJB 1D4FA 1QB7A 1OFHA 1PK7A 3A14A 4IEEA 4JYCA 5EMLA 3SC4A 4YCJA 4DDKA 4EUKA 3MYYA 2Z04A 3NWEA 4DIKA 4EITA 3DAFA 2BKUA 4XGKA 4C04A 1NVKA 2ZSJA 4A6PA 4KIWA 5EXSA 4G5XA 4NENB 4TTPA 4ZU3A 4F4DA 2P2YA 1ZJYA 1CRLA 2WJ6A 2O14A 2PH3A 1FQKA 3D43A 3L0CA 4F0JA 2Z2JA 4AYTA 5AKGA 2ADFA 1WUKS 2C4WA 1XC7A 4C9BA 4ZT2A 3HRIA 3I9NA 5IFKA 3ILYA 2DM6A 5DE3A 4JLMA 2PBZA 1RXSA 2XMDA 2K7FA 3BTUA 3KVOA 3FX2A 3CVWA 1A71A 3E7PA 2VNIA 3P0FA 5CLJA 1ESDA 3ZDBA 3FM9A 4MINA 2XUKA 5T4BA 2ZSFA 1X7ZB 3JQFA 4YUAA 1YB7A 3KYDA 1INLA 1CIVA 1VHTA 1W1WA 3WMWA 4F6CA 3UMMA 3U5ZB 2L69A 3T3OA 2IH2A 3L7LA 4L85A 3VZRA 5C8ZA 1PU2A 3IE0A 4UEKA 3D02A 5FA6A 4ESVA 4IDNA 3H2ZA 4UM7A 1HEUA 3Q2IA 4GXNA 3FVWA 3JPYA 3WK5A 1R0WA 2NTJA 4MITA 3ETEA 4J49A 4L6IA 3IAXA 1EVYA 3ZIDA 1SD2A 2D54A 4BQSA 1V1JA 3ABQB 3LQYA 4XFDA 5F35A 1NR5A 3DTVA 1DQRA 1YHNA 1PFWA 5I7HA 1G6KA 2ATVA 1JIVA 1LV7A 3MPUA 4H15A 4A8TA 2RCNA 3W5BA 5ALKA 3LA8A 3Q0EA 2HH9A 1MCZA 5KJ1A 2QUIA 3MK31 1OYVA 4ENTA 3FMFA 3HVUA 3LL4A 1K7XB 3TD6A 4DA7A 5KYGA 3VHQA 1SHUX 3MJTA 1ORIA 5T3YA 3EVBA 2R2AA 2QUAA 2ZUFA 3IP7A 2P6NA 1ZEJA 1NZDA 2ZWAA 3RVQA 1FA9A 4M0DA 3QG5A 3DMTC 5LA6A 3H13A 1G2PA 1TMYA 3VR2A 4JI0B 1EFHA 1S8NA 1Z68A 4JI4B 2CE7A 4QT4A 1UKVY 2X6RA 3INRA 1Q7EA 5HZKA 1BXRA 2M6SA 2X5KO 3D3WA 2I8AA 3BL6A 1N3YA 1OV4A 1OPRA 2LW7A 3AZQA 1JA9A 3FLMA 3WZMA 2BTQB 3UY4A 2NX2A 2ZPUA 3JQAB 1GGHA 1ZP6A 5T64A 5CEFA 4GM1A 2WZDA 5EWLA 3LGXA 5K1ZA 1JTEA 1M6YA 4K9RA 1YTUA 4D9EA 1DCMA 2AG8A 2Z2ZA 3KB2A 3NHZA 1HC7A 4Q6BA 3K6JA 3ZBQA 1L2TA 2GD1O 4HR7A 4I5IA 3UF0A 3AHDA 3IDSA 4KXUA 5JD4A 2CJPA 1E9AA 2E37A 3H04A 2XNCA 3B60A 3OFJA 2A78A 3OY2A 4QXAA 2ZB2A 1GDDA 1Z17A 4EY3A 5SZJA 5EZYF 4LS3A 3TX6A 2HO4A 1NTRA 4L95C 4R7GA 3SEZA 1QYWA 3UT6A 3TECE 1QOZA 2ZIWB 2X0DA 2W2KA 2WA1A 1NKSA 1W2WB 1TYAE 3LMKA 4K87A 4MYDA 4XYMA 1VOTA 5IN5A 4I3FA 1L4KA 3A4VA 5J47A 4YGXB 2NADA 1V47A 1FXWA 3L7BA 2A5DA 2GBCA 5I4CA 1FTWA 2HRCA 2JFOA 4INZA 2OFPA 4I81A 4OFZA 5EQFA 1U2EA 2VLBA 3OQBA 1FRFS 3ZCVA 4CM8B 3AHJA 2GN6A 1SKMA 4RX1A 4F8YA 1PUIA 2NTNA 3A9UA 1HORA 4NBKA 2D2FA 1F20A 2XMPA 1KI7A 2QJFA 1RC8A 1Y9ZA 3HPRA 4YAEA 3BE5A 1I6MA 1QZTA 2OXEA 3GDWA 2DB3A 1GSOA 3NO4A 4CGYA 3AZPA 4R1LA 4G4JA 4HPJB 1YRWA 5B4UA 4OA8A 4EIWA 1Q14A 2ZSDA 1U2SA 3EFHA 2VJAA 3ESDA 5KPDA 4UM5A 2C31A 4MLDA 4YNBA 1Q21A 1IFXA 3ITDA 2PFKA 4NENA 3UAWA 1UKAA 3QITA 3VKUA 5ARDA 1E2FA 2DHCA 2YYSA 3ADPA 4NCXA 1SOVA 4DA4A 1NW4A 2YMLA 1RCUA 1SU8A 3DBIA 5JYDA 3BORA 1JHZA 4XCXA 3JPWA 1TUIA 4E11A 3VTFA 1SC1A 1T3ZA 1Y1KE 2AN9A 2RGGA 1BVUA 4HDOB 3M4YA 4JDPA 2CXSA 4DY6A 3GLIB 4IIHA 5JDIA 2IUFA 4X00A 3DOEA 5DX0A 1I2MA 4DCJA 4IQGA 3K4HA 1X7ZA 3QUCA 1U1FA 2I1QA 3KXLA 1HE3A 1YRQA 2HWUA 2WAYA 4Z9FA 4L6AA 5B1YA 2OK7A 3N59A 3E82A 3LFHA 4GZ6A 1TECE 2O5RA 2PCLA 1HPLA 2QL5A 4HUTA 1PWEA 5HVNA 1RXYA 3NDJA 4LRYA 5JAOA 1EVLA 1Q3KA 4QYXA 3P0IA 4YRTA 1CUAA 3B70A 1LUAA 1M2JA 1R12A 1ZITA 3I2YX 4OQ4A 1TTQB 1B7GO 2GDZA 4J1TC 1S3SA 1IEWA 2I4LA 3G7UA 4B0PA 4L8WB 4WECA 2Y76A 1Y4ZA 3BSYA 2VHYA 3NHWA 3R6DA 1UEIA 3KR2A 2AE2A 5KHAA 2PGAA 2Q49A 4IG4A 4TQAA 3UJHA 5A2GA 3THWB 4OSEA 1L5VA 5FYQA 2JJ1D 3DZBA 4Z51A 2DE0X 3SZRA 1ZH8A 2O3SA 2KB0A 3TLXA 2XNSA 1WLYA 2HIAA 3H2BA 5I9IA 1D1SA 1JEYB 3B8EA 2ETVA 3RTBA 5EP3A 4CLOA 2AOUA 5IUJC 5KINB 1EJ6A 3A9WA 1XTKA 1QCYA 1U7DA 1N0WA 3PFGA 4LPSA 1L5KA 4L0CA 4MUKA 2ZU6A 4NZ9A 4C2AA 4URHA 4E2YA 1MNQA 1Z0FA 1BMDA 2IZ6A 2WJWA 3SHTA 1US8B 3LNTA 5BWBA 2WIFA 3G8AA 4UTPA 2FEPA 1WEKA 1O1YA 1J8QA 1B43A 1CY7A 5KKAA 3OOWA 4WT7A 2AFIA 2XRFA 3FOEC 2AW3A 2ZRBA 4N6OA 1LSUA 4ACBA 3DT6A 1AGPA 1P0FA 1VRWA 2IBMA 3C6BA 5GMOA 2IEIA 3V8EA 4BOYA 3G68A 4BS9A 4JYAB 1A9SA 1FFDA 4NONA 3OQIB 4KKVA 3RWBA 3ZH9B 5DT2A 2AMYA 5DNCA 3IHTA 2RGUA 4G89A 3TZKA 4H7FA 3CH6A 2D1FA 2FSPA 2OFXA 1UDBA 5KWVA 1G7SA 4QEZA 4XASA 2OBLA 3H3JA 3QPCA 3VNQA 3G2HA 4Z8XA 3QHPA 1S3IA 4OKNA 4QGFA 5K8TA 1GGKA 5HBRA 4L5BA 2UAGA 1DC5A 3IYLW 3P9YA 1KFJB 2FLKA 2VL7A 2XJ4A 2XMCA 3MLAA 3R5XA 5LUBA 1XU9A 3CBQA 2E4ZA 2X40A 3NUQA 3OFND 5GWXA 2FV8A 3DOFA 3KB8A 5DN6D 3E7FA 2BKVA 4LFCB 3WBJA 1VG9B 4CUJA 4CJXA 1BXKA 2WU0A 4H16A 4IX9A 3VR1A 2BGNA 2AMVA 1PL8A 2UUOA 4WK0B 3CWZA 5FP0A 5C8YF 2IELA 1KIFA 3FHLA 1C0LA 3RTEA 1OAOA 4FMCB 2C2OA 4HZGA 4NX2A 4C6HA 3LECA 3WFZA 1HT1E 5K99A 4MUEA 4DIBA 5KDDA 2W9XA 1IL0A 3R3VA 3SEFA 1W4BA 1KC3A 4MB6A 4QDUA 4GLFA 2YVAA 3M82A 1QFSA 1Q1AA 1UK9A 3FJYA 1CDEA 4S1TA 4XH9B 2JLCA 1GN9A 3BFXA 2HJRA 2LWIA 4OLHA 3WKCA 1MPTA 3LIPA 3BAZA 4ZXFA 5HFJA 4L5AA 2PO5A 3A6JA 1PQYA 3TK1A 5B2EA 3JQBA 1JWLA 4D2IA 4LNAA 3TR0A 1I94B 4EZIA 4TYPA 1W36D 2ODEA 3GLIA 2IWHA 1Z25A 4C0XA 3IE1A 3R3WA 3R3ZA 2PLAA 4X91A 2O7VA 4U6QA 2W42A 3IEIA 4FNOA 1IZ9A 5T57A 2Q5JA 2JGMA 3KK0A 3OZRA 4IDDA 1YKGA 2QD5A 3ZUPA 3TTVA 2B8WA 2R2GA 5IT4A 3HDQA 4JBWA 1ECBA 1M9NA 3ANSA 4U7HA 2P6UA 4RPJA 1P5HA 3ASZA 4ZODA 5F3DA 5BO5A 2XHZA 2PG3A 3GVXA 5JCJD 3HV0A 3OM1A 5EIOA 3F3MA 1SNYA 2G63A 1Z8DA 4EAQA 1E0SA 2AI2A 3A1NA 4XEHA 3JQ8A 3UJ7A 2PKWA 4EY5A 4KACA 5A4MS 1KWKA 1I13A 2F3TA 1YE3A 4BMCA 2IIQA 1NN3A 3E0QA 4LGYA 1L4FA 2EF0A 3BC1A 1YB6A 1U5CA 3CLUD 4RNDB 1IHDA 1N6NA 1QHYA 2A0UA 2PZLA 2Y93A 3HGMA 4O25A 2GO7A 2XYQA 4LNUB 2O8BB 2FWAA 3KYJB 2VHQA 1CF2O 3ZQJA 4G5RA 4RVHA 4FGKA 4MMYB 1WXXA 2YHSA 5KYNA 1SUEA 1XWIA 1HUQA 1E7SA 3BMXA 3HGQA 4NESA 3FPBA 3UA3A 1FBNA 3AONB 3SZOA 3UOGA 2ID4A 3LUGA 4B32A 4F1WA 4V1CB 1SBZA 1DPFA 3PUWA 3CN9A 4M76B 4Q3AA 1ADGA 5JHGB 1TYBE 3K9GA 4RXTA 5DOVA 5CB4F 3TE6A 3WO1A 1XHEA 4D5GA 3QEMB 4C7XA 1ZK4A 3PENA 3GJ4A 1G291 1ESMA 1Z36A 2FKAA 2FN7A 3B6IA 4UD6A 4B2LA 3V55A 4L4RA 1BRMA 4BASA 2EFYA 5JSZB 1IPFA 3IMGA 1CUWA 3NOOA 5F12A 5KQMA 3SAJA 5HSGA 4Z4HA 2V5VA 2WLSA 2O7SA 4KGVA 4P33A 2DFDA 3CEJA 2ERCA 3OPYI 4I36A 4NOMA 1XNRB 4W1SA 2HJSA 1NQVA 2RHLA 1NBMD 3DVRX 1M6VB 3JASB 3PXGA 1XNQB 4KQCA 3SJ7A 3IL2A 4DCCA 3N0RA 5HX7A 1IBSA 1Y8QB 5WRFA 2BY4A 2AV6A 3SJBA 4Q3LA 3B1WA 2DPHA 2RARA 2DEUA 4R6XA 4G41A 2CFIA 5KX5B 4JV5B 3E53A 3RABA 2IYEA 2D3TA 4H0FA 1A7AA 3PJFA 4LUCA 3V1UA 2ZJ7A 2RB5A 5ESWA 4HNGA 3UZUA 5HFNA 2VEOA 5JADA 1N75A 2OHHA 3BGWA 1SK8A 1VP9A 3BG5A 1XJWA 3PXEA 3G13A 1D5CA 3PHLA 2NSJA 4UAGA 3IOMA 2XSZD 3K5HA 3ULKA 5DVZA 3E9DA 3HCOA 2BFWA 3FCEA 4DLAA 5G4KA 4EJSB 4KFTA 3V9AA 4OYHA 1EJ0A 1VSVA 2DPLA 1SHKA 5FD8A 2Z3VA 1UIRA 4XR9A 1EQ2A 4QU9A 2OSVA 3C3XA 3LPNA 4A73A 2C58A 2FYTA 4D96A 4QYIA 2IS1A 4EGAA 3MNFA 3DEFA 5I8ZA 1MIOB 5IP5A 4BPRA 5AI0A 1GPNA 1R0XA 5TT0A 2JATA 2UZ1B 1WNFA 3GDGA 3QXSA 3L2OB 2H7VA 2IYLD 3ESQA 2WDPA 1KRWA 2C8JA 3O8CA 4BFWA 3B6EA 4HEQA 3RSQA 3AUUA 4EX7A 4GUDA 4NY1A 4R51A 2V7WA 5C1PA 2EW8A 4N03A 4FDVA 1NE7A 2E4XA 4OKSA 4XUCA 1UMKA 3TZHA 3N6RA 1TXGA 2Z9DA 3F49S 5GONA 1RSZA 3ZQ6A 2RI6A 5G0SA 1U98A 1M3SA 3WHLA 2Y6UA 4FMDB 4JVMA 4H17A 4AL4A 2QUHA 4XWAA 3KKNA 4L5YA 4ETNA 3VU0A 2IHYA 3ZV5A 1HDYA 2D6FA 3O8QA 1XXLA 4QASA 4ENUA 4CU5A 4D8WA 1KI4A 3AERA 3L7AA 4OQNA 4PICA 1T5BA 3NT4A 3VX3A 5LDDC 3RG2A 2VRCD 4LJ9A 3P97A 1FMCA 1NQOA 9GPBA 3VOTA 3WIOA 1O54A 4Q7KA 1WOMA 4DWVA 3IBGA 2J3EA 1W35A 1KS9A 1BKYA 4JKYA 2ZIAA 3RC8A 1GG2A 2C5SA 3OM9A 4LNUA 5P8WA 3PEUA 5BUCA 1X1RA 3C7DB 3FKSA 1GRVA 3ESAA 1G1MA 4URUR 1WQ3A 1C3EA 1PQWA 4PYLA 3KDSE 4V1CA 4Y1GA 3LOPA 1EDEA 5ALZA 4B2IA 4ZQEA 2NXNA 4NYMR 1AIPA 3N6XA 2ID7A 1R5JA 3NYRA 5CDGA 1ZFNA 5A0VA 1W25A 1EB8A 4FR0A 1Q1ZA 1U1DA 3QEMA 4G4IA 1I1OA 1T36B 1Y9JA 3AFNA 3EOBI 5AM5A 5EJ2A 3I34X 4YJ2F 2CDBA 2WZBA 1R2QA 2RC5A 1SM4A 1ODCA 5JSZA 5ALYA 2IIVA 2PRJA 5AKLA 3DOCA 2XZPA 5HRAA 2C7PA 4MA4A 2PT9A 1LD3A 1OVGA 1FFSA 3FNQA 3GIWA 3G0GA 4QDKA 1X87A 2R5NA 4H2DA 4C7MA 1ZW6A 4R8SA 4JKOA 2JCGA 4LG1A 5AWFC 2H18A 1X3SA 4NEGA 3CLTC 3P9IA 1ZA1A 4MGIR 1IC6A 1M6VA 3UV3A 4D3XA 5ALVA 2AVDA 3OT1B 4BAGA 3EIHA 3ZQKA 1Y8QA 2RG1A 2VWPA 5JIBA 3U1BA 2G07A 4LDPA 4NS1A 4RADA 1NOKA 1Z4KA 4MICA 4MRAA 1JKMA 5B58C 1T9KA 1XDWA 1WKBA 3LHIA 3ZGVA 5CFZA 2PEZA 4ZCQA 1FL9A 3O4HA 1PNTA 4CIYA 1HV8A 1TD1A 1L7PA 1U4SA 1JIKA 2BDEA 4QYSA 1YRYE 3B9PA 3CCCA 1Z7GA 4ZAYA 3HA3A 4KDFA 3TWOA 4AQYB 2QZSA 3K0FA 3PWZA 1H2FA 1V8FA 4NWIA 4PSUA 1XCGB 1EE1A 1PR9A 3NT5A 1QKKA 1KBQA 1M0WA 1ZGAA 3U1TA 5BW6B 4W5QA 4P92A 1VDZA 3PYMA 2ZGVA 5IN4A 2OK8A 4I1VA 2R97A 4WFJA 1K4KA 1K7YA 3LDUA 1DKLA 5DCYA 2RHTA 3E84A 4LXTA 3Q85A 4ES6A 5CDHA 1CIPA 1B14A 2CHFA 4RKRA 1W1UA 3OZBA 1ODLA 2IJGX 3UQYS 3DUWA 1IDOA 3OQNA 3ZWAA 4BNKA 3BX1A 5ALPA 3GJTA 3ISVA 4R1SA 1X86B 2BT4A 1NPYA 3PUYA 4D8UA 1IG0A 3DXYA