4BVJA

Structure of y105a mutant of phaz7 phb depolymerase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
343
structure length
343
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNAHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPYNAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHB DEPOLYMERASE PHAZ7
publication title Biochemical Analysis and Structure Determination of Paucimonas Lemoignei Poly(3-Hydroxybutyrate) (Phb) Depolymerase Phaz7 Muteins Reveal the Phb Binding Site and Details of Substrate-Enzyme Interactions.
pubmed doi rcsb
source organism Paucimonas lemoignei
molecule tags Hydrolase
total genus 128
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature ec 3.1.1.75: Poly(3-hydroxybutyrate) depolymerase.
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bvjA00
4CCWA 4Q3KA 3VVMA 3VJLA 1LZLA 3C70A 1THTA 4UFOA 2GYVA 3FLEA 4HRXA 1CIJA 4X6UA 1EXWA 3KSRA 1VA5A 4LKOA 1VZ2A 4X93A 1C4XA 4FLEA 1EVEA 1YB7A 4F21A 5JZBA 1FFEA 4U2GA 3FWHA 1TRHA 3UMJA 1Y7HA 5I9IA 3OPMA 4QE3A 4AZ0A 3A2MA 4J0IA 4Y2VA 5AKGA 3R3YA 3L1IA 4FLMA 4GI1A 3W06A 4IH1A 1QTRA 1AURA 2DQYA 1WOMA 3GBSA 3WYDA 4KEAA 1BROA 5LZ8A 1YSCA 3ZLTA 5AHXA 3OURA 3BIWA 4H7IA 3LS2A 1MO2A 1LPPA 4MWTA 1JU4A 2OCGA 3BWXA 2VQ6A 3O4JA 4ZRDA 5HFNA 1XQVA 4CG3A 5EIEA 2WFLA 2XB6A 2WFLB 4MYDA 5AKYA 1VXRA 3HLKA 5AM4A 4ETWA 1CLEA 2XLBA 5DTJA 3EQ9A 3IUQA 5HK8A 5AM2A 2DQZA 2XUPA 1A7UA 3CXUA 3STUA 4Y2JA 2QKYA 3I2KA 4ITVA 1I6WA 2VT6A 1R50A 1XZHA 4EBBA 5KREA 1EX9A 1ZGBA 3KDAA 4BZZA 2GYUA 2WUDA 2WIGA 1H22A 3WA6A 2BUBA 1BEEA 1L7RA 3D2AA 4FWBA 4CG2A 1YB6A 2E3JA 1JJIA 2WG0A 3E1GA 4K6HA 5C7YA 1G66A 4H77A 5FV4A 1ZIXA 3KXPA 2XMSA 1W75A 1G4HA 5ALQA 5ALLA 5ALDA 4C6HA 1ODSA 1QFSA 4WCVA 4HTAA 2QZPA 5A7HA 4EY5A 4BAUA 5K3DA 3CCBA 1VXOA 1IMJA 1ZJ4A 3F9CA 2OGSA 4FKBA 2QRUA 4INZA 2QJWA 2B4KA 2VAVA 5T4FA 1HBJA 1UK8A 3C8DA 3HC7A 2WHPA 2Y6UA 2ZJ7A 3AJAA 2WHPB 3LIIA 3SK0A 2WJ3A 3A6ZA 4NMWA 4Q3OA 3FVTA 1GKKA 3O0DA 1JMKC 3B3QA 5JYCA 2ZSIA 2JF0A 4QEKA 2WTNA 5HFAA 5AI0A 4QZVA 2QOEA 4BDTA 5HF5A 2JIDA 4B0OA 5FRDA 1BN7A 1CUAA 2XLCA 2I03A 1HDEA 5ALNA 5ALKA 3F8SA 1RP1A 2WU3A 1SC9A 2LIPA 3VKFA 1YAHA 5AK6A 4BVJA 1XZAA 3HABA 1LPBB 4P9NA 3RLIA 1BCSA 4OSEA 3G0IA 1LBTA 3PI6A 5AIAA 1GQRA 3SWWA 1J07A 1VA4A 1XFDA 1UFOA 1DINA 4ZREA 1K5PA 3WL8A 4G4JA 4C4XA 1W76A 4WDQA 4LYDA 3M81A 3C43A 5A2GA 1L7QA 1U65A 4TGLA 5EIAA 2EEPA 4H18A 4ZWNA 5LZ9A 4PQEA 3AFIA 2VAXA 3R0VA 3STVA 1U4NA 4BE4A 3WK7A 1QIEA 3BXPA 1VE6A 1FFDA 4QNNA 5JANA 4BVKA 3ICVA 4K5QA 5AP9A 4BB0A 3WKAA 5JARA 5EGNA 2OGZA 4XVCA 1AGYA 2AJCA 4LXIA 1ISPA 1EDDA 2HA0A 5LKAA 5A71A 3AZPA 5ALIA 2VJDA 4LYEA 3CN9A 1CUVA 3ESCA 1C7JA 1VLQA 2WJ6A 4F60A 1ACLA 3HRHA 1ORWA 5AI5A 3S8YA 1VKHA 2QXTA 4NS4A 3UUEA 4BRZA 2IITA 4UBMA 4BVLA 4G4GA 3FOBA 2C5FA 5DYYA 1F0PA 1UKAA 2C0QA 4BRSA 2YXPX 4QDZA 1GPKA 2XUGA 2X8BA 1AZWA 1ZI8A 4KYVA 5CT4A 4N5IX 5J3JA 2W22A 1BN6A 3ANSA 3WZMA 4Q3LA 2QJRA 5JZSA 5AI8A 3DJYA 4UBLA 4MEAA 3FYUC 5HKAA 5AKJA 1QO9A 1JT2A 2ORYA 2O2GA 4CG1A 3I2HA 1J1IA 2VT7A 1B41A 1JJFA 2CUTA 3H2HA 1W52X 1X2EA 5ALGA 3RARA 3D5EA 1CR6A 3D7RA 1H2WA 4WY5A 4AQDA 1WPRA 3DS8A 3K6KA 5A6VA 4C01A 2ROQA 3WZLA 5CT5A 4ZV9A 4FNGA 4K6GA 2PVSA 4B0PA 4KR0A 4GDMA 4LIPD 2OAGA 4KAJA 4UPDA 3S2ZA 4W1SA 4A16A 2VF2A 1CFJA 2AJBA 3G9UA 3MVEA 4Z49A 1SCIA 2WU4A 4BZWA 5HF6A 2PSHA 1CVLA 3MGAA 4X3CA 3WK4A 3ZPXA 1ZI6A 2OCIA 3DEAA 5ALPA 3GROA 3KD2A 4FMPA 3DYVA 5FKJA 2JGFA 2FJ0A 4ZI5A 1ODTC 2GZRA 1XLWA 4AXBA 5BV7A 2BUAA 3DOIA 1CUEA 3O95A 1R3DA 1N5MA 2WSLA 1IZ7A 4ZV7A 1CUUA 2WTMA 5HF9A 5AI4A 2OCLA 3WWDA 4B9EA 4G9EA 2PU7A 4IQ4A 1DU4A 3HXKA 5ALYA 3RKSA 2QVBA 3HJUA 2PM8A 4UBOA 1MAHA 4DGQA 1C7IA 2B61A 4HXGA 4CIAA 1QIDA 4AZ3A 2OXEA 4N8DA 4FFWA 1CUXA 2WLSA 1HQDA 5ALHA 4G8CA 4DMHA 1XRMA 3G7NA 1QIFA 3DKKA 1AQLA 2FUKA 2Z8XA 2QR5A 4Y2QA 4J0GA 1ZIYA 1MX1A 2RGUA 3R3XA 5LZ7A 4IO0A 5LIPA 4HS9A 3RK4A 3IULA 4D9JA 2RHTA 1O6FA 1UWCA 3NGMA 4OUKX 3FSGD 4BTVA 3C8HA 4A5SA 4S0XA 1EDBA 4NZZA 2QTBA 2WKWA 3C6YA 1XZBA 3PUIA 5D6OA 1MAAA 4WDRA 4UHEA 1UOQA 2VEOA 5JD5A 2H7CA 1R4ZA 2CJPA 5FDFA 3U1TA 3RM3A 4UHDA 1ZICA 2WUEA 4RE6A 1R1DA 4BYMA 2CZQA 3P2MA 4FBLA 3M3DA 2OGTA 2PL5A 2XUKA 4ZGBA 2HA3A 2HM7A 3T4UA 3NWOA 5IVDA 3IUJA 3MUNA 1J2EA 1ZD5A 4I3FA 2QMQA 3I2FA 1MJ5A 4C89A 2J3DA 3SC2A 5AIBA 2XUQA 5CH8A 2G4LA 4MXDA 4EHBA 4U2BA 1UK6A 1CPYA 4PSUA 1GT6A 1H2ZA 1X2BA 2WIDA 4BAGA 2OG1A 4LXGA 4FFVA 1TCAA 1GPNA 1XKLA 3QPAA 5AM3A 1D07A 5DTIA 2GBCA 3BL8A 3AIMA 4YX9A 3ZLVA 3H04A 2HA2A 2RI6A 3FBWA 4X7BA 5K3EA 1XLUA 3MUOA 5ALXA 2GBGA 2B9VA 1WHSA 4H7JA 2HIHA 3KWFA 4MEBA 5CXUA 2WUGA 3WK6A 1QFMA 1OILA 1CUYA 3OG9A 4FBMA 4H35A 4Y7DA 4QDTA 4X95A 4LHEA 1K8QA 4BE9A 3A70A 5JATA 3LIPA 4UHHA 3DQZA 5I8PA 5AKIA 5ALJA 1BEZA 3QBJA 3L1HA 1FJ2A 4CI9A 4AMZA 2XUIA 4M0FA 1XZDA 2GBIA 4Y2YA 1YR2A 3I1IA 5LZ5A 4C4ZA 2ZJFA 4I19A 4N5HX 3LLCA 3H1BA 4OB7A 4U2CA 3WLAA 4BCCA 3FAKA 3D59A 4UHCA 2BUCA 1IUOA 1WCYA 3C6ZA 3O4HA 1LPSA 1LPOA 2VTVA 1OXMA 1B6GA 1QLWA 4AN0A 1HKHA 2CMFA 3ZLUA 4Q82A 1E8NA 5T4BA 1E3QA 3IURA 4WJLA 4GW3A 5AK3A 4BP8A 3QMMA 2HRQA 2IIVA 3H18A 3PE6A 3STYA 3G0GA 4EY7A 1XQYA 2CKMA 4K2AA 1BRTA 3D2CA 2I3ZA 4GXNA 5JADA 4Y2SA 3H0CA 5EHNA 5AI9A 5HQ3A 2WIKA 2BGRA 4WFIA 5HQ3B 4FTWA 2HA7A 3G0DA 1KU6A 4FDMA 1AMNA 4DMFA 2O2IA 1K4YA 4W1PA 3QZUA 1DTEA 1R9MA 1ZD3A 5KWJA 1W1IA 5HK9A 3H2JA 1TCBA 1EH5A 5A7FA 4J0JA 1RWQA 1IVYA 2XT0A 3B5EA 2DHCA 1MPXA 1DX4A 2XQFA 3OTQA 1MX5A 1N1MA 1WPXA 3PICA 4BP9A 1CV2A 3WIBA 3O4IA 2B20A 4L3WA 2VJCA 4P08A 2H1IA 2PSFA 1JU3A 4I4CA 1XRLA 3BE8A 5EHQA 1HLGA 4B80A 1ZD4A 4XJVA 2G63A 3WIOA 4GBGA 3WI7A 3TEJA 4GWLA 1VZ3A 2VJBA 2YASA 3EIOA 5AO9A 1QJ4A 5ALTA 3STWA 4YK7A 3FYUA 3FYUB 2EDAA 4M0EA 4X92A 4UBJA 4KE8A 4OU5A 4J7AA 1MNAA 4QLAA 3D3NA 4DMCA 3HI4A 4X00A 1CUBA 2PX6A 4QDXA 1Z68A 2ES4A 3WYNA 1NU8A 3W9BA 2XUJA 4G4IA 1TKRA 1E89A 5F4ZA 1T4MA 4ROTA 3I6MA 2C4HA 4XIIA 3ICWA 4BTLA 1FFCA 1CQZA 1H23A 2V97A 3VVLA 4ZXFA 3FCYA 4G8BA 5E2IA 2OPHA 5HCUA 2I78A 4DNPA 5FPQA 4WFKA 1YCDA 3WK5A 1UT6A 5JD4A 4HXEB 5AKHA 2C0PA 2PU5A 2R11A 3ESDA 3STXA 1F6WA 2XUFA 1P0MA 1BCRA 1UOOA 5D3ZA 3SX4A 3I28A 2JGJA 5AKLA 2WM2A 3IUMA 3G9TA 4MJ3A 4PW0A 3WWCA 4B81A 3BJRA 4A23A 2FJPA 5IKXA 4RNCA 2C7BA 3O9MA 4HXFB 1EB9A 3M83A 1X70A 3Q8WA 1TQHA 5DWDA 1Y37A 2WG2A 4AO6A 4ARAA 1EHYA 1EK2A 1QIGA 2K2QB 2GBFA 3O4GA 2HDWA 2XDWA 4HAIA 1IZ8A 4OB6A 1XQXA 3D2BA 1CUZA 2HRRA 5CT8A 2NW6A 1RYYA 3BF7A 4H7KA 4CCYA 3CCCA 4IHAA 5BWCA 2QM0A 4CCYB 5HKBA 1ZD2P 2GYWA 1U8EA 2GZSA 2I3DA 4AX4A 5DJ5A 4E46A 5JAOA 1AC5A 3R3VA 5K3AA 1UXOA 2VATA 4U2FA 3NOXA 5FPPA 5AOAA 1NU6A 1A8QA 1F0NA 4QDUA 5CT6A 5BWBA 4HVTA 5AI6A 5ALEA 4UFPA 2PSDA 1XQWA 4H7FA 2WQZA 2Z3WA 1ZJ5A 1Q83A 1XROA 5JASA 5KBYA 4J3JA 5DNWA 5DLPA 4TPKA 2WFMA 2DCMA 5HF8A 2EDCA 1THGA 2V9ZA 2Z5GA 2W6CX 5CURA 4IH9A 1XZJA 4FOLA 3BDIA 4HRYA 1MT3A 1LPMA 3TGLA 1XRPA 1DT3A 2ACKA 4DNQA 5JAUA 1U2EA 3PUHA 1VJ5A 4UBIA 3BDVA 2JGMA 4EY8A 4PO3X 5A7GA 3PF8A 4BAZA 3FNBA 3AINA 4KRXA 4B82A 2YH2A 4E15A 4LXHA 3I2IA 3W05A 3GZJA 4MQLA 4W1QA 4H7EA 1GPLA 1PJAA 1A8SA 2J4FA 2QS9A 5K3FA 1QIMA 5K3FB 3C5WP 3WA7A 3G8YA 4P93A 5KWIA 1XRRA 3AUKA 4MQMA 5ALRA 2C5GA 1XZGA 1SOMA 4UHFA 1LNSA 3IDAA 3R3UA 3X3HA 1CUJA 1QIHA 4J03A 3LCRA 5FXMA 5JAHA 3DYIA 2IX9A 2OQIA 4B84A 1E8DA 2PUHA 5DYWA 3WKCA 4H7HA 4M0MA 4FHZA 1GXSA 4G1FA 3V48A 1CUIA 4BDSA 5ALWA 3H2IA 5ALOA 1DWPA 4EUSA 1N8SA 3WL7A 5FLKA 5CT9A 1DQZA 3I2JA 5LZ4A 4E14A 5AH0A 2XUAA 4QA9A 1LPNA 5CH5A 2QUAA 2XMCA 4BBZA 3B12A 4Y2PA 3QPCA 4JUIA 3W9UA 2OCKA 2JGIA 3QYJA 2XI4A 4Y2RA 5ALFA 4L72A 3V1KA 5AK4A 3C6XA 4IH4A 3VISA 1UZAA 3FSGA 2AJDA 5DNVA 5AK5A 3KOOA 1AKNA 4KE6A 1TAHA 5JIBA 5AM1A 1VE7A 3I1YA 4H0CA 2G5PA 4KACA 2XMGA 1BU8A 4O08A 3IB3A 4UFNA 3EF3A 5K3BA 4BCBA 3ESBA 1T2NA 2Y6VA 2HU8A 2Y2VA 4Q05A 2H7XA 2DFPA 3DL7A 1EINA 1CUSA 2CEKA 3HACA 2BAGA 2WJ4A 2XQGA 4JEIA 5C8XA 2OQVA 1JFRA 4BATA 2J3QA 5K5EA 1QIIA 5JZ9A 3U0VA 4W63A 4YASA 3QPDA 1A8UA 4MWSA 3R40A 5SYNA 3QH4A 5LYYA 3E3AA 3H1AA 1P0PA 4G9GA 3F96A 3FCXA 1XZIA 2HL6A 1SFRA 3ANTA 1LLFA 2J4CA 1E8MA 1EK1A 3H19A 3WWPA 2FX5A 3WMRA 3F98A 1CUFA 1XRNA 3ILSA 4ARBA 4W1RA 1ZOIA 1HL7A 1MU0A 1PV1A 2VJAA 2WHRA 1YS1X 2HA5A 6YASA 4Y2TA 4AN1A 3VJKA 5DNUA 2WUFA 2ACEA 1FFAA 2BJHA 2OLEA 3R41A 1MTZA 1VOTA 3PFCA 1GQSA 3WL6A 5JD6A 4HZGA 3I6ZA 3AZQA 1UK9A 3KWJA 2WIFA 1BS9A 4X6XA 4N8SA 1ORVA 5AKXA 4FNMA 5CMLA 5T4HA 3EQ7A 5FOQA 1MX9A 4TVKA 1H2YA 4GHWA 1S8OA 3UUFA 5E4JA 2C58A 5YASA 1CUHA 5EI5A 1M33A 2RAUA 3NUZA 2G5TA 2WIJA 4Y9SA 3GELA 4DYHA 4GECA 2YYSA 5IVIA 4J0CA 4JNCA 1SCKA 2X5XA 4EB0A 3GFFA 3DL4A 1YA8A 4BC1A 1XZFA 3JYHA 3T52A 1ZGCA 4UBNA 4EZIA 1HPLA 5BOVA 4B6GA 2V96A 4DNFA 2O7RA 3C6BA 2DR0A 4KJXA 1YASA 5ALSA 2HHAA 3JWEA 3AIOA 2XQIA 4UUQA 1DWQA 3IBTA 1LZKA 1DT5A 2CBGA 4OU4A 5DYTA 2ZYSA 3WKDA 4DM7A 1XZEA 1A88A 3DD5A 4Y2UA 1TCCA 4E11A 2ZJ6A 5T4EA 5EFZA 5CRIA 2WG1A 1EVQA 2PSJA 5C8VA 3F67A 1K6EA 2PKYX 2HU7A 4PNZA 1UKBA 3DKRA 1EB8A 1JJBA 4DLNA 1P0IA 1XLVA 3GUUA 2QT9A 2HADA 2HU5A 4DNOA 2XE4A 3BIXA 5CH3A 3BF8A 3N0TA 1J06A 4X91A 4GEGA 4B85A 1ACJA 2XMQA 1UOPA 2HA6A 3GA7A 2D0DA 4KAFA 5EHXA 3L1JA 3BJMA 5A62A 5AICA 3HSSA 2HA4A 1XZMA 3TJMA 4WFJA 1JMYA 1H2XA 3WK8A 3W2TA 1CQWA 4QLOA 3HYSA 2XUHA 2RONA 2X76A 5FP0A 2ECFA 1LPAB 3D4LA 4C87A 3K9BA 2PPLA 2DHDA 3QVMA 2R8BA 4WY8A 5IVKA 2PUJA 1R9NA 2CB9A 3O9VA 2XMZA 3WKBA 4F0JA 4J0KA 4UBKA 4KAAA 1XZLA 3V9AA 3D0KA 4BC0A 2ZSHA 3TRDA 2Z8ZA 4JYMA 3F97A 5AKEA 3V1NA 2XMRA 1QIJA 4UHBA 1DQYA 4X85A 1CEXA 4V2IA 1R88A 5AKZA 3PFBA 2WFZA 1QONA 3E4DA 5LZ2A 4FLFA 3OM8A 2AJLI 2OAEA 4U2DA 1BE0A 1CUGA 4OB8A 1N5RA 3ED1A 4MYSA 1MN6A 5CTAA 1QTIA 2QUBA 4B83A 3QM1A 5IH7A 5ALMA 5C81A 1L7AA 1Q84A 1UKCA 3DNMA 1G42A 3VDXA 3WK9A 1W4LA 4J0HA 2UZ0A 2PBLA 5D3KA 1OCEA 5AKKA 2ONCA 1GGVA 4XX1A 3QMVA 3M82A 5ISMA 1EDEA 2AXEA 4K6KA 2Y2UA 1P0QA 3WQHA 4Q1VA 4L0CA 3IVMA 5AJHA 4P92A 5AOBA 1QIKA 1ETHA 2VSQA 3IUNA 5FUMA 2QXUA 1WB4A 3FVRA 4C88A 1XZCA 3EBLA 1UK7A 3WWOA 2XQKA 1FFBA 1WM1A 2H7YA 4AMYA 3STTA 4GLBA 3K2IA 3V1MA 5CW2A 5CBKA 3PF9A 5EIHA 3C5VA 2V98A 3ZI7A 1AUOA 1WB5A 3G0BA 3YASA 5LKRA 1SCQA 2ZYIA 2WILA 4DSZA 3C87A 1TK3A 1CUDA 3N2ZB 4RPCA 2JEZA 5AM0A 1EA5A 4PSCA 5EHZA 3IIIA 1Y7IA 2DHEA 5H3HA 2HFJA 2XQJA 1QOZA 2PSEA 1QGED 1TIBA 2Y1KA 4X6YA 5IVHA 3H2KA 5ESRA 4JYPA 4OD0A 1FSSA 2RIPA 1Q0ZA 3JW8A 4C4YA 1QZ3A 4BCDA 1WB6A 3I2GA 4X90A 2JBWA 1DX6A 4L9AA 2ZYRA 5JAPA 1YS2X 3LP5A 4X71A 3WJ2A 4PV7A 5E4TA 5ALZA 3HZOA 1CRLA 2AJ8A 4XWGA 5HZGA 5I7UA 4RGYA 3A2NA 5C8ZA 1XZKA 4Q34A 3WJ1A 2XUOA 3AIKA 3FYTA 3G9XA 4DTCA 1W6RA 3Q0TA 4KE9A 1QO7A 3VXKA 2RHWA 3QMWA 5AOCA 2BFNA 1E5TA 3H2GA 4N8EA 2JGLA 4QWMA 1K63A 2VA9A 1ODCA 2BCEA 1Q0RA 5LP1A 2BKLA 5CXXA 3EQ8A 3DLTA 3DOHA 1USWA 4Y2XA 3DDUA 3FLAA 4EY4A 5E4YA 1EI9A 4AO7A 4JH0A 1NX9A 4OYYA 4OCZA 2BGNA 4NVRA 1G5FA 4AO8A 1CUWA 1WHTA 4W9RA 4RE5A 3QITA 4OYLA 1CUCA 1GKLA 2XMBA 3E0XA 1XRQA 3VJMA 3OC0A 2DSNA 3G0CA 4B7ZA 3R3ZA 1KU0A 2O2HA 2WHQA 2JGKA 2XMDA 5JALA 4G8DA 2ZVDA 4QWWA 4F5ZA 3I6YA 3R3WA 1E66A 4U2EA 4J0DA 3C45A 4EY6A 1IUNA 1LBSA 3G9ZA 4OPMA 2ZYHA 4PSDA 4PF1A 5LLSA 4DSAA 1MNQA 1QE3A 5ALUA 2Q0XA 3ZV7A 3HEAA 5ALVA 2D5LA 2H9YA 1KEZA 3A2LA 3IA2A 1GZ7A 4G5XA 3V1LA 5K3CA 1DWOA 1PFQA 5D7BA 2Z3ZA 2JEYA 4DMKA 4EA6A 3W04A 3AILA 3CN7A 3OOSA 1YA4A 7YASA 3FLBA 2P8SA 2O7VA 1ZI9A 3WKEA 3H17A 4AB1A 1XKTA 3G02A 1IUPA 1O6GA 4B9AA 1JI3A 2JGEA 2XUDA 1JKMA 4KE7A 3AZOA 1F8UA 3ESAA 3ZWQA 4CIBA 5AM5A 4KRYA 4X97A 4H7DA 4DIUA 3DCNA 4QDOA 3WWEA 1AX9A 3WL5A 1YAJA 4X94A 5SYMA 1LGYA 3PDCA 2HFKA 4YPVA 4CFSA
chains in the Genus database with same CATH superfamily
3UV3A 3HY3A 4CCWA 3CLVA 3VJLA 3I2YX 4PZCA 4YPOA 5KNDH 2RH4A 3B48A 3AETB 3OAAD 2YZGA 5KYNA 2Y1DA 3C70A 1THTA 3IOBA 2GYVA 5FBKA 3FLEA 2PGIA 1QWOA 4F71A 4KWCA 1QMGA 5K4GA 3GJQA 1CIJA 3KTAB 2W0SA 3CURA 3WX0A 5IXYA 3KQNA 1DUVG 1PNTA 4X1IB 4GWKA 3LXUX 4G2NA 3JQ7B 4LKOA 3OOYA 1NP3A 1VZ2A 1X1CA 2I67A 2W93A 3QU7A 4YCDA 1UJ5A 1TO1E 2F00A 3HDGA 4FLEA 1EVEA 1YUMA 4XB6B 1UBSB 2GGSA 1EUDA 2ZAGA 5F7ZA 4ZIRB 1RYEA 4P0PB 1I80A 2P79A 2D54A 3BD9A 3OQIA 4MI9A 3NOOA 3FWHA 2FQWA 5TB5A 1A9QA 2IUEA 3KX2A 2HZBA 4Z0TA 4B33A 2WVJA 4CM6A 2A5GA 3WLQA 4M0PA 3S7ZA 3VR6A 5FUVA 4IDPA 1D4FA 5I9IA 2YXDA 4AJ9A 3OPMA 2C4MA 2NXWA 3HBNA 1YTLA 4DV6B 2B94A 1IXZA 3A2MA 5JHGB 2W6ZA 3D0RA 4LJSA 4Y2VA 1K97A 5IANA 1VL5A 2BMWA 4R41A 2C2BA 4I66A 4J91A 3DE7X 2FZ4A 3TF5A 3TOCA 3K1JA 3L1IA 1TYZA 2Q6LA 3BL5A 3E9QA 3K0EA 4FLMA 3AJRA 4JFRA 3MILA 4IH1A 4BVEA 2FA9A 5BNZA 1AURA 3AKEA 3IHLA 2Q9CA 2IUUA 3T15A 3PUWA 4RIIA 1II8A 1OI7A 2J3KA 1DDIA 1UXKA 3IV9A 4I2VA 4MQEA 4Y9DA 3W78A 4TWIA 3WYDA 1J6UA 3HHEA 4JIGA 3F90A 1KEEB 3FPCA 4N5LA 4EDFA 1IK6A 1TAUA 4OK3A 4OREX 3PYLA 5LZ8A 2O06A 1T9HA 3ZLTA 3OJCA 1Q44A 4KGDA 2VH2A 4LOKA 1TCUA 3B85A 5LOVF 1XYGA 2ZZKA 1CSEE 5FOXA 1M2WA 1SHUX 1WMBA 4X8MA 4D80A 3GA5A 4JVMA 1INLA 1IPEA 1FK8A 1N7GA 3SM3A 4N4AA 1L5RA 3E81A 5KTNA 1V7PC 2VXOA 1W1WA 4PRYA 3GEPA 3PUYA 4H7IA 3LS2A 1MO2A 4MWTA 3RAGA 2OCGA 3M6AA 3WP0A 4WWHA 5F2EA 3TIXB 4W9MC 4NY1A 2PGXA 3BTVA 4DIBA 1XVUA 3U3OA 1W46A 3D1LA 1AUVA 2EJBA 3ETDA 3QVSA 1XQVA 1ZGGA 2C54A 3KOZA 4LZOA 2WFLA 3ZX4A 4V2UA 3EPLA 2X6QA 2C98A 1KAGA 2WNIA 3LBAA 5EMMA 4IJMA 2VDRB 4OQEA 5JI3E 3OIWA 3DOEA 3OZEA 3SJ7A 4D41A 3V4RA 3EDQA 3EQ9A 1W48A 3N6VA 3PL5A 1WMAA 5K0NA 3R5HA 4B35A 1TE2A 3OQVA 2XUPA 1UUFA 3AVYA 3OUZA 1A7UA 2LV8A 3OIYA 1W8IA 4QARA 5J2TF 4YJ3F 3STUA 4BXOB 1DADA 2FPOA 3I2KA 3Q1LA 1ZJJA 4KXYA 3WRXA 4YRJA 3GT3A 1I7SB 1PFUA 2QLMA 1OXSC 3HZZA 1AK9A 1G21A 2X0KA 4GBJA 4Q1CA 1YCHA 4EBBA 5JNLA 1FVOA 4BZZA 2H16A 1EK6A 3RC8A 5J59A 2C8JA 3GYBA 2GYUA 2WUDA 3AY7A 2WIGA 4O4JA 3S0JA 1B23P 3B9QA 4A2QA 1BEEA 3D2AA 3FFBA 2WWHA 5B4TA 4JASB 5ARCA 1BKSB 1KSFX 4FWBA 4D3DA 5HR5A 4P1ZA 4ZI7A 3FYHA 5IJ9A 1KI6A 1JJIA 1J8YF 1Y8CA 3ZCRA 1V16B 4BWFB 4M1KA 2ZBGA 2JKYA 3E1GA 3T5AA 2O2XA 3QE4A 1RQGA 1K7CA 1HM5A 5AW8A 5C7YA 1G4AE 4YO8A 1JG6A 1G66A 1OXXK 1KEPA 3ACDA 3FMFA 2Y99A 3GYGA 4H3VA 4O4HB 4DNXA 1N36B 4RTKA 2PUCA 1RWWA 3TECE 2CUNA 2HRZA 2IYWA 2ZBVA 5KNBA 1R0YA 4F12A 1HZZA 1XZNA 2E85A 3H5TA 3RV3A 4I1SA 4CM5A 3P97A 1G4HA 1KARA 4WZBE 2YRFA 4HR7A 1YDEA 3QNWA 2AOTB 4XARA 5ALLA 5DTEA 3HWSA 2QVXX 2XOKD 2B36A 1OIXA 2CFRA 4EFNA 1TJYA 1IY2A 2HSDA 1QFSA 1FYFA 4GQAA 4WCVA 3ZBPA 3D1JA 4CMIB 4EY5A 5AUNB 2GN0A 1VXOA 1IMJA 3NT4A 5K4AA 3RK1A 3GEIA 1MPTA 1VBKA 3UQYS 5BQXA 1Z6XA 1EFVB 4R2LA 4EPTA 4YAGA 3PDJA 1QVVA 4INZA 4PO1A 1U6IA 4UM9B 2V3WA 3L40A 3AEZA 2PGJA 2QJWA 1U2PA 2SKDA 3L92A 4KQEA 3DUWA 2PWYA 2OB1A 4YUVA 2PN1A 4YEDA 1TQDA 4C7XA 5K6AA 1HBJA 4FPXA 5FI5A 4MW4A 3HO6A 4Q0MA 3AM1A 4DC9A 2YWFA 2YWBA 1GL6A 3BX1A 4R2IA 3A1EA 1E7RA 2WHPA 4X1OA 1H5NA 4BWVA 3JQRA 1Q20A 2XITA 2Y6UA 2NPFA 4E1BA 4F5DA 1UBKS 2YHUA 5BYAA 5MN6A 4MR7A 4RTOA 1SHZA 2NV0A 2W11A 4PQRA 4WADA 5E6SA 5LMUB 1BDHA 1RS0A 3ENNA 3DONA 3IS3A 1Y9ZA 3JZAA 1YK0A 2D00A 3ILHA 1EQ2A 3BG5A 4Q3OA 3U3MA 3LOPA 1OU0A 1ST3A 2B7CA 4ZD6A 4R8KA 4CETA 2FZEA 2VHZA 3EIFA 1SAYA 3LPAA 5EPEA 3RV4A 2XEXA 3OF5A 4R8LA 4D8WA 5JYCA 1IIBA 5DMXA 3PU6A 4A0SA 2ZSIA 5H16A 1DLIA 2JF0A 1MZVA 3GUZA 5CM8B 2QT0A 4HH0A 4OY3A 2ZT8A 1U0SY 3GFQA 3JR7A 4JQOA 2VP6A 4LMAA 4LUCA 1TUBB 3QKWA 1XDBA 5DIZA 4BB6A 3F0TA 5ADWA 4B3MB 3QG1A 3R6TA 1U3FA 2ZITA 4PLCA 5EWMA 4QZVA 3JD0A 1NN0A 4BDTA 1XFAA 3AF4A 4F6LA 2IBTA 3LY5A 5IH3A 1IHUA 2JIDA 3KYDB 4FGKA 2NQ8A 1CDZA 5EJ4A 2MSEB 2C5AA 2XLCA 3GZNA 2RHLA 2I03A 1URPA 4ZU3A 3I04A 1CJVC 2D1SA 4ZAGA 4REQB 4OJYA 2WZDA 3WBJA 4C7BA 4DCOA 1EP2B 1K0FA 1RE1A 1WVMA 3R0QA 3K1YA 3BRWD 2AXQA 3JYLA 5CBPA 5FADA 4LTNA 3QWFA 2W4QA 4U5QA 2VP2A 3VKFA 4YMVA 5AK6A 4K86A 5ECWA 3SXJA 1QGOA 1NASA 1WXEA 4I6JA 5EHIA 4D8YA 2C59A 3L7BA 2MSKA 2QD5A 3QY0A 2VP5A 2HSGA 2KQUA 3ZGVA 1XEFA 2GJKA 3BEDA 3IVCA 4LJYA 3VUFA 1B42A 2FVYA 4HQKA 3MWFA 3HJFA 3WBBA 4HPXB 3KAQA 3N7TA 3OKCA 3T5CA 4NNOA 4R8VA 1N2HA 3D4BA 4HRVA 2W70A 2I9KA 4N82A 4YJ2F 2XKAA 1ZC3A 3L0IB 3G0IA 1QQ5A 1LBTA 4XDZA 1ZH4A 4O1HA 1GHTA 4U1RA 4TN1A 4RFSB 1Z07A 4CGZA 2Z1MA 3GUCA 2DHRA 4WINA 4DMGA 3WC4A 1KC1A 1UFKA 1FRFS 4GMGA 1AF7A 1DG3A 4ASUD 1S3SA 3BVPA 2W6ID 2PWPA 1AH2A 1RYZA 2C4VA 4ZREA 3W77A 1K5PA 2ID9A 2V7GA 3IGFA 3OQ6A 3WL8A 2XBLA 1PRYA 4R1QA 2GO1A 3UAWA 2FY8A 3KYBA 2VPTA 4NAVA 4UE6A 4KWTA 3WLLA 4CFYA 2X2EA 2FEMA 3ABOB 2QSZA 3C43A 3N8NA 4ND7A 5KYYA 2A0KA 2CD9A 5A2GA 2RI0A 2ZE5A 5T6BA 2PT6A 3EWNA 4TTQA 3V46A 5CFPA 1PUJA 5F3DA 5EIAA 4PC3A 4HWSA 2I62A 3EXIA 3VM6A 4KDCA 1GAEO 1N75A 2C99A 3B1JA 3CMMA 1PJBA 1VB3A 3ZDCA 2DWQA 2VAXA 1NLFA 4WOJA 1GADO 4Q4JB 3STVA 1XDSA 5KVAA 1TLTA 1DRJA 2W6IA 1NDQA 4QXRA 3VYWA 4BE4A 4ZOBA 3I9MA 1LV8A 1NG1A 1P9NA 2O1XA 3RIXA 3HK2A 2OHGA 2C8VA 2R751 4QNNA 2B1GA 3I52A 3K0BA 1RLTA 3HZHA 1G8JA 4OIFA 1H6AA 2G88A 2R00C 2WF5A 1OYVA 3AY3A 3ICVA 1LA2A 3MWDB 1Z4PX 3S4YA 2IA5A 4H7PA 4ZGGA 4RKFA 4I2NA 3EULA 3K9NA 1CDDA 2GCNA 1M1ZA 1Y6ZA 2LDXA 4IHJA 1PJ2A 4LRWA 1FU8A 1W7AA 2OGZA 4MO9A 2R8XA 1B76A 1H1LA 1MH1A 1KJ8A 2VWHA 4GX2A 4JHLA 4ERNA 1P7WA 2AXPA 4TYMA 3UGJA 3FTDA 4NJEA 3S99A 1TAQA 5AQ1A 4FD3A 4GMDA 1DE0A 1NW5A 3OQBA 3DEFA 3VO8A 4BHTA 1PT9A 5ALIA 1GNPA 1G5IA 2OXCA 1DBQA 1CUVA 3GRZA 3DZGA 2BE7A 1KAQA 2PBRA 1NLUA 2FK7A 2B2NA 3I9KA 3P2YA 1JIJA 4ARVA 4F60A 3IT3A 5BSGA 3HRHA 2WDPA 2EG5A 4N65A 3P27A 2P2YA 3MPUA 1OZAA 3RC2A 5IRCD 5E7IA 3F5DA 3RWOA 1E63A 2UZ3A 3UUEA 5C2JB 5D7NA 2X2FA 2IITA 2YHBA 2VSFA 2CWDA 4LZWA 2ISSD 1GQOA 2GZDA 2DTDA 2JI7A 3L6BA 1S7GA 5IASA 2Z2JA 3FOBA 5DYYA 2GHIA 3BQMB 3L0ZA 1F0PA 5C1OA 4BRSA 4B32A 2YXPX 1FTGA 3NVAA 1T5BA 3JAKB 3NAMA 5HFJA 2JH3A 5HGXA 1GKYA 1Y63A 1TEVA 3C39A 4HF7A 4Q3DA 3KAJA 4CDMA 2IY7A 3GD7A 2Y1WA 1RWBA 3ANSA 4J1SA 4UVHA 5A5VA 2I6GA 3OMLA 3GCZA 2JATA 2QJRA 4MP3A 4OFBA 5JZSA 3RADC 1JT9A 2BYTA 2R7KA 3W5AA 4G0VA 4MUXA 1SZCA 3GNSA 1O6ZA 4UBLA 4B3BA 1GKIA 3JQAB 3ZKWB 1MB4A 3FYUC 3MWGA 1NW7A 2VHVA 1A7KA 5CYFA 5M5BA 5KYGA 1OGIA 1XCGB 2D1TA 4PQFA 5EMHA 3SEZA 4DA4A 1QO9A 3EPJA 2F48A 1JT2A 2O8CA 5J4VA 3ZWBA 1K86A 2C3PA 3U7QB 1IRIA 4N3NA 2PT9A 4QPJC 3CW8X 4Q1AA 2YJ3A 3FA2A 3TX2A 4LHVA 1J1IA 4WNAB 1N92A 1TO6A 1KRXA 5IARA 1EGAA 1UXHA 1W52X 3TSCA 4Z4EA 4RNDB 5LQSA 4E30A 4IEEA 2Y9MB 2WAXA 3H2ZA 3EMVA 3M6UA 4KUHA 1RM5A 1A9ZA 3RARA 1F8XA 1EVZA 2QL9A 1BDJA 2VK4A 3RFTA 1A97A 1EUZA 4JT2A 3L8EA 2IU6A 3FNHA 2RDMA 5B37A 4EGJA 4WY5A 3JWJA 2J0VA 2GHRA 3DS8A 4L02A 1KBOA 3CX7A 1XTRA 4PRZA 3UCFA 3WMEA 2FPIB 3OY2A 3DVLA 3L82B 4QC2A 5CT5A 1PUXA 5FFMA 2B6HA 1DKMA 2P2SA 4IFBA 1KR5A 3FNRA 4P5EA 4E6EA 2DJIA 3RSOA 3W6PA 4M1TA 4NE7A 4KR0A 3FPBA 1O4VA 1Y4SA 3SXPA 4ND6A 3VAYA 4W1SA 2RCNA 5JXHA 2DY0A 1AHHA 4G0OA 4E5KA 2ILVA 5AK0A 8LDHA 2O8VA 1N5LA 1ODJA 2Q3EA 4C0XA 1LSJA 1FZTA 3DMNA 3M1LA 4PNPA 1SCIA 2ZRDA 2VK1A 4BZWA 1P72A 3HN7A 4P32A 1GM5A 2BOVA 2WY2D 3PX7A 1K5GA 1JBEA 1SUAA 4F3YA 4EKDA 3E23A 4Z9FA 5KTPA 1ZN2A 3MGAA 2IELA 2ZP1A 3W4IA 3MAJA 3E5HA 3GK3A 5G0WA 2A9QA 2OCIA 1DUIA 2GPAA 3HRKA 1ZAYA 3KD2A 2OR3A 4NJOA 4DZTA 5I7RA 3K6SA 3V4SA 1NF9A 1LVUA 4ER0A 3UK2A 4ZOQI 3PUKA 2AE1A 1AY0A 2O2SA 2VRNA 1P44A 4I3HA 4MPPA 1JEOA 4QO8A 2HHCA 1BU5A 2OYCA 1VMIA 3I42A 4DLXA 4KN5A 4FZJA 3JTMA 2JGFA 3LGXA 2WOJA 4TX1A 1NN1A 2W71A 4IIFA 4ZI5A 1ISGA 1HFJA 2Y92A 4YIHA 4ZKDA 1YQQA 2CZCA 3ABIA 1HEYA 4UTZA 4EL0A 1IZ7A 2QROA 3C7AA 3RIMA 4C3OB 5EZYA 5K20A 4LQ4A 4B8WA 3GOQA 1MFPA 1SBQA 1SEPA 4BFZA 5KYUB 3QUBA 2B0JA 3PXEA 2RK3A 4J4BA 3O1JC 3WWDA 3ZWNA 5CK5A 1VMAA 2OCDA 1J8MF 4DZZA 3A3NA 3DZCA 5ALYA 3RKSA 2WM9B 1VDZA 2Y0BA 1J39A 2ZVJA 3RPEA 4EGFA 3GFOA 1RHRA 1XCPA 1I3OA 3IMGA 3PNMA 5DCYA 2EZ9A 3WXBA 2XRMA 3L7AA 4NJMA 4ENSA 4D9KA 2B61A 4FGZA 3MGKA 1WEHA 1W5SA 4UDNA 4M1OA 4POOA 1I4LD 4LJAA 2VPQA 3O8DA 4LZPA 1E2QA 3V1TC 1RI4A 2AX4A 3BTSA 1JDZA 3EK2A 3FDJA 3FZGA 4UNPA 2IGBA 5FOSA 4FB5A 2EZUA 3CPHA 1OC4A 2FP4A 5CDUA 1FF9A 4WOPA 3QI7A 3KLBA 4AULA 1XMPA 5ALHA 4G8CA 4JJ4A 4DMHA 1PDWA 4BB5A 5I7OA 2W6PA 4MI1A 3H7AA 3DKKA 3KB6A 4DLLA 2FUKA 1IHYA 1NURA 5CDGA 4TRRA 2D6FA 2JCVA 3NFRA 4AMGA 2KS6A 2X6TA 4OI2A 1G5HA 3G7UA 4XGNA 1MDFA 4Y2QA 2H2GA 4J0GA 1ONOA 1PFKA 1ZIYA 2AG6A 4JU9A 4HZUA 2GRUA 2I1QA 4Z9AA 3CLKA 1MX1A 1P81A 1N7HA 5F1YA 1NAHA 5JCOA 2FQQA 3DPIA 3FSEA 4IO0A 4LXTA 2ZT5A 3RK4A 3IULA 3OPVA 3VO1A 3QEOA 2QSJA 1Z82A 2JL1A 2FFBA 3JZFA 2IYFA 2UYQA 4LDZA 4YHBA 1UDRA 1ONBA 4MIYA 3L8YA 3RLFA 2EFYA 3V97A 3P4UA 4OQFA 3THWB 3CY6A 3I34X 3W1VA 2QGFA 3DBRB 3OTIA 4EGAA 3L8CA 4G84A 2QRVA 5KOYA 5KTRA 1N2ZA 4RHYA 4A5SA 1AN9A 2R4UA 1BHQ1 3PRJA 3ZTTA 4IMPA 3T3NA 3BFKA 1NVEA 1Z8DA 4NTZA 1X87A 5G3YA 3CUVA 2QTBA 3HJNA 4U9UA 4ZAXA 4JLWA 2FZGA 1DBRA 3C6YA 1XZBA 5D6OA 3BZWA 3GGOA 3Q4GA 4LTDA 1L9XA 1XDGA 3MCZA 2BFEB 2R47A 3BULA 3N0WA 1GL3A 1JF8A 3ZUPA 2QTHA 1J1UA 3Q2IA 4NULA 2F8MA 4BKQA 3ASVA 3TJRA 3DE4X 4JP5A 1A4XA 1O97D 4UHDA 2DPMA 1L4LA 1ZICA 2XDQB 3OI7A 2W2XA 1L1QA 1ZM9A 1XAGA 2YXLA 4KDRA 2XUKA 1NQAO 2KX7A 1DS6A 3JWPA 5LQDA 4WESA 4O02B 2PFGA 3KJGA 4L2IB 3NHZA 4IGAA 2QRZA 4WJKB 3KPWA 3CZ4A 2XZOA 3EODA 5TIIA 3SE7A 2OZLB 2XZDA 4RD4A 3HLYA 3BXZA 3KYCB 4MO2A 3LL7A 1P3Y1 1WVIA 1GEGA 4U5XA 1RBYA 2LR0A 4UM8B 2X19A 4QXOA 1C7EA 4JI0B 2YMQA 1QJCA 3OZTA 3UW3A 4GEKA 3I2FA 1MJ5A 3OX3A 1DEHA 2G0AA 4C89A 2NUAA 2XUQA 5JNSA 1P5RA 5CH8A 2XNKA 4YIKA 3SC2B 2DFTA 2IYAA 3EXHB 3SIWA 4RTRA 1P39A 4U2BA 2HPAA 4M3NA 4PSUA 4PZYA 2EW8A 4OHZA 2EL9A 2NQTA 1QS0B 5EE5B 4F9TA 4ENWA 3IILA 4IYRA 1E6CA 4H4CA 1JVBA 1O4WA 2I4OA 1YMVA 3HL0A 4DE5A 4GLJA 1BKDR 1RXUA 1U9IC 4O2BB 4AQ7A 2PHZA 13PKA 4JODA 3R1IA 1RTTA 2C1ZA 1O89A 1YONA 2Y27A 3F9RA 3QPAA 4GYWA 5DT9A 1E4EA 3S6JA 1C41A 5IBRA 1HRDA 2IYOA 4KIWA 1H94A 1NVMB 4HEA6 2BBSA 2FSUA 3AKYA 4EG8A 3BL8A 2VBCA 3R2JA 2VYVD 4CIDA 2LTAA 3NHBA 5TXGA 4YX9A 4CMKA 3ZLVA 4M0DA 1JA9A 5K3EA 4L8GA 3EH2A 4NZ9A 4UUPA 3H6HA 5BSUA 3Q3HA 3GLIA 4BMZA 3MUOA 4TUYA 2IK8A 2BM1A 1TF5A 1NOIA 3V4ZA 4L9RA 4Q01A 3OT5A 1Z4LA 2XF2A 2GBGA 3NHUA 4YDSA 3GLFE 3C24A 2OUKA 4HPWA 3PI7A 4B71A 3MJCA 3DFMA 2O19A 2VXCA 3VOTA 1HNWB 9LDTA 4H7JA 1B8OA 1GWNA 4U02A 3N39C 3E7PA 2WUGA 3DMPA 3SEFA 4WA8A 5CXUA 2NXEA 3IE2A 4AJJA 2ORVA 4OMUA 2EW1A 2VCHA 3L4JA 4BNIA 3G5UA 3QFFA 4Y7DA 2JK0A 3UT6A 2VYVA 5F2KA 4JC0A 1CK4A 4V02A 2CCKA 3SQMA 3ANYB 3AF6A 3CGGA 2QLFA 4JL5A 3A70A 5JATA 5KNDA 2WYWA 3W3AD 2AOXA 3WYGA 2G4CA 3LIPA 5ECGC 3TQIA 5IKPA 1HSOA 3DQZA 1FJHA 3PWSA 3MIZA 4UPVA 1BEZA 4AZ0B 2ZWVA 3KOUA 3RBVA 4L8FA 3L1HA 1FJ2A 3ZE2B 4F72A 1F4LA 1XNRB 2A9VA 4IIUA 3REOA 1U9YA 5I7HA 4J7CA 2Q7DA 3I76A 4RF5A 2XUIA 1C81A 1H8ED 1E6EA 2DP4E 4M0FA 3ZI0A 3D6TB 3KXDA 3ZWMA 4J0EA 2FXVA 5FR2A 1F2VA 3G2QA 3I1IA 4EHAA 2ZJ4A 4FYVA 1JIXA 1RHMA 4DIFA 3UMVA 2FR8A 4FFSA 3U9SA 3ZWWA 2H1LA 1XTSA 3DBVO 2PO5A 4CMJA 1X7WB 1GPMA 1YRWA 2ZSAA 3LLCA 4N5HX 4NC9A 4OGKA 4CF3A 2O4UX 1X1RA 4B8YA 1NJ2A 1IUOA 1F48A 5DLEA 5LXTF 2CY0A 3ZZUA 1A96A 4LZZA 4Y0NA 5CFLA 3W3AA 4YDHB 1W44A 1PW5A 2F9LA 3U0BA 2GNPA 3ZNPA 2A78A 5DSXA 1Q6ZA 3K09C 1L9KA 2CFTA 3ZLUA 1A1VA 1SCBA 3HYTA 2HBQA 1YKFA 5BV0A 5CA1B 1E3QA 3IURA 3L7YA 1IM8A 3WLEA 1DO2A 5C3MA 4RV9A 3SMQA 3U4AA 2UVPA 2QQ0A 2LKDA 3GJRA 4R2WA 3AFOA 4BFTA 3QWAA 4C03A 1RIFA 3BFPA 2QAGB 5FOUA 2G9QA 3T7IA 2HRQA 1TEZA 3TQOA 4REMA 4CIVA 1I4DD 3NYWA 2WD8A 3SBXA 3H18A 3TZCA 5I45A 1NL3A 3W2HA 3PE6A 4QVIA 3D6MA 4GX1A 4BN0A 1CX9B 1J8VA 2JLAA 4DWOA 4UAUA 3DYBA 1YFLA 4R31A 2YV5A 3WJAA 3TCXB 4EY7A 2EZ4A 2VQ3A 4HDOB 1T6NA 1E1QD 4Y2SA 4ZVSA 1ML3A 2RGNC 3F1LA 3G5MA 2H0RA 3D5TA 3GHHA 1P75A 2I7DA 2RKBA 3A31A 1RAGA 1VHJA 3DE1X 3IIJA 1R5BA 2REQA 2JHGA 4ZYTA 1PVOA 1JQAA 3SQLA 1XEWY 4M1WA 1F1JA 5AI9A 1Y80A 3REFA 4DA6A 5ABPA 1GTSA 2NO9A 2J46A 2WIKA 3IQFA 4JUFA 1JL3A 4I1UA 4WFIA 5HQ3B 5T8KC 1D5CA 5TQ0B 4GPIB 5D51S 1M54A 4MV5A 3UA4A 4ABTA 4NQRA 1VBMA 4FDMA 3JASB 5CCDA 1TKCA 3T7AA 4BO8A 3BEOA 2GKSA 3EXAA 1RLOA 4DMFA 3AVWA 3BJIC 3ELYA 3LP8A 4RD6A 4W1PA 5K0TA 3QZUA 1CCWA 1DTEA 5K8IA 1VQ1A 1YHYA 3OSUA 5KWJA 1XNQB 3LL4A 2FWPA 3TLGB 2VK8A 3COVA 3NUGA 3FTCA 5CD9A 2JGDB 4X24A 4Z4HA 1SEVA 2DTXA 5KYTA 1RWQA 3LFTA 4EVIA 4PC7A 1I2ZA 1VL8A 4YP9A 2CJFA 4Z7JA 5B12A 4MJLA 3B7PA 1FYDA 1HFEL 2PT7A 4HAWA 1DX4A 4PLYA 5CB4A 3QGMA 1JEJA 1YR8A 2O5VA 1MX5A 1N1MA 2VWGA 1NNUA 3CU5A 3PICA 1E96A 4IG4A 4WD3A 4Z3KA 5A4JA 2NUTB 3L6UA 3TTUA 3GRCA 3Q87B 1Z4JA 4OMFG 1G3RA 3RUCA 4UU7A 5REQA 4BUJA 5IKEA 1RM4A 3ESQA 5F21A 1U5BB 2FWRA 1N34B 2XZTA 2PSFA 1SIOA 3L06A 2HQSA 3NIGB 4G09A 4FKMA 2YVUA 3PFGA 3QHQA 3AI2A 4DY4A 2BI4A 3TNYA 4CKXA 1HOTA 4HS4A 4C0WA 5L53A 4JC5A 2E37A 2AKYA 4FINA 3WBKA 4CMAA 4I5GA 1OTHA 3LWDA 3S8MA 4P31A 4D0GA 3COJA 1TKBA 3O1IC 5IAJA 4AT1A 5DBHX 1HLGA 2ZUDA 4ARSA 2D3TA 1MW8X 2GWHA 2FU5C 3MS2A 1MT0A 3ZY2A 2PXHA 5DK6A 1GNQA 2C9DA 4NHOA 4RABA 2QZ4A 5TS3A 1WXXA 2LCIA 3E9NA 1C8BA 2O50A 3PC6A 4FFDA 4GBGA 4V0ME 1XE3A 4IVNA 3V8PA 2WAAA 2BFDA 2P5TB 2QTMA 4B6QA 4O33A 1NXVA 1RJEA 1RVDA 4Q7MB 5GAJA 2AGVA 3ABSB 4KTVE 4ZOEA 2JB9A 3T1YB 4Q9JA 2VJBA 5JI2E 1FX1A 5AW6A 4DSTA 1XVTA 4GAEA 3NRJA 4ID3A 1E2BA 3RO7A 1FRZA 1FUKA 5JWOA 1JB1A 1IHXA 2VF7A 1QRSA 3SY8A 2EDAA 1FB5A 3KV3O 2Z9CA 1VMKA 3QMPA 4CT4B 2C8LA 4KH0A 5HRCA 4A36A 3QQ5A 4BN4A 2H65A 1FQKA 2CLOB 3AWIA 4OU5A 2E1RA 4CKYA 1IY9A 1EFRA 3PDIA 1VDMA 2FUNB 3AM3A 3IQXA 4ZVNA 3VX3A 3V4LA 1MNAA 4ZVQA 4E03A 1G6KA 4NICA 1IHPA 3A7DA 1THZA 4NSNA 3GIWA 1UAYA 2CNDA 4PLZA 1IY8A 3O8QA 1Y7PA 5KAMA 1MOZA 1Z26A 2YWRA 1OI3A 3H5RA 5BSWA 1MEEA 1O77A 2V7EA 1B8UA 2VPZA 4QTZA 5ULLA 3W9BA 2UZ1B 2GEUA 1ECPA 1U9CA 2FCAA 3V8BA 1UIRA 4MCJA 4LDNA 2YHAA 4C5BA 3ICOA 3PQ8A 2ZBFA 4CI0B 2J7PD 4CKWB 4YRAA 3FOEC 1NMSA 3ZD7A 3H65A 2L17A 5F4ZA 4DG8A 1Q16A 3UYKA 1CIVA 4M36A 1NVXQ 1C7ZA 4TZ0A 2VHJA 2Z9BA 1DVRA 1HUQA 1C9YA 4JLDA 4XIIA 5CA0B 3ORRA 4HO1X 1BMQA 1IIRA 1XVIA 4R1OA 3VU8A 2GLTA 2A0XA 2ZCVA 2DUNA 4FQ5A 1SQ5A 3H13A 2OBNA 4WCFB 5DK4A 4QG7A 4BTLA 4LOLA 5LYJF 1LLCA 2MSNA 1GQQA 5D00A 4CL3A 1O9HA 2JJ8A 3LZDA 4H1TA 4F8YA 1F1BA 4MUIA 2DB3A 1TVKA 3AVVA 3NIWA 3FCYA 3BMOB 4P4GA 4M54A 4KQXA 1RCFA 4HATA 5F7OA 3HQ4O 2J5XA 2GD1O 3KOMA 1QO0D 1IRXA 2YWDA 1C7RA 2XRZA 1MC5A 4QRHA 5KQGA 3WHPA 2OV8A 2GTPA 5BYKA 8OHMA 1SVNA 5DHQA 5B58C 1UT6A 1P5FA 3K8YA 2TECE 2YOFA 4FHFA 2XE7A 1GZUA 1XA4A 2M32A 3GLGB 4DCGA 2GT1A 4ML3A 1GG8A 1KZ9A 3LTEA 4XW2A 2AFVA 2D1YA 1P31A 3MHPA 2HBZA 1IB0A 2JNWA 1OFGA 1PR1A 3ZDZB 2WDZA 2AX3A 3H4MA 4B3CA 1NUQA 4WUVA 4K6CA 4E1AA 2GCEA 4I6GA 5AKLA 3WGQA 2SBTA 3G9TA 3H8WA 1DJOA 4DIKA 4YAIA 2O5RA 2O4CA 3HPRA 1HO3A 4BLUA 4D82A 2YMMA 4A23A 3UJ3X 4IIBA 4FCCA 3M5PA 5KNCH 2VZ0A 4E12A 4I1PA 3P9QA 1RMTA 5F1KA 3T9FA 1YVEI 2R8PA 3O9MA 4PLWA 3RU3A 1VJCA 1GDTA 2CNWA 1PEKE 1Z4KA 1G9SA 4PYJA 3WDKA 3VKHA 3M83A 2ECQA 1SIWA 2JAUA 2RKOA 4H0FA 1TQHA 1H2RS 4NF2A 3DJFA 4US0R 5AJTA 5FNVB 1F4PA 3BTUA 3FDXA 2JIQA 2QA5A 2VK2A 3WRYA 4BEJA 2Q6KA 4P2GA 1RYBA 4N54A 1KMMA 1R10A 2H4ZA 2YIDA 4RIEA 1ECCA 1T36B 3ZC3A 4MVJM 4DA7A 2QX8A 2XDWA 4HAIA 5JSKA 1UZUA 4LDRA 1WG8A 1UBCA 1XQXA 2A9RA 2I5PO 3DV0A 4OB6A 4Y1GA 2Q4EA 3D2BA 3AEQA 4M9QA 4JS0A 1QAOA 3ZCUA 4EL5A 3HFJA 1ZR2A 2HRRA 3RASA 4BX8A 3QJGA 1DB3A 1F2TB 4A82A 2HJRA 2PUVA 1XP5A 5JDCC 1EQAA 3EFOA 2GUGA 4H7KA 4QUIA 4RS4A 1GCOA 4BBJA 5BWCA 1V48A 5HKBA 1XUOA 1QRDA 2PD3A 1LDNA 5C1DA 3FROA 2HCBA 4FC6A 4CUZA 3CSUA 1I14A 2R7MA 2QN3A 3BD6A 3RB8A 3DL0A 3D8SA 5FLEX 1KEVA 5EP2A 1PYDA 3A6JA 3NEYA 2QMHA 5P8WA 1DAIA 2I1LA 5K3AA 5KHLB 1N3IA 2EW2A 4ZQFA 5JXJA 2W6NA 4BMDA 2COEA 3PFIA 4EKNB 2O05A 2ZATA 1NSTA 1EP9A 1W59A 4JQSA 4RD3A 2W0MA 2AFIB 4JI6B 2O8BB 4EW2A 3KKOA 4RLSA 3EQ6A 3T94A 3MT8A 2BBOA 3NJRA 4K6FA 3CUTA 4XX0A 5HJ2A 3M4NA 4HVTA 4ZEWA 4KR6A 5JAQA 1JEQB 4QRIA 2XT6A 5DN6A 5AVWA 3OD1A 4IZ6A 1DTWA 3HXTA 5I5EA 4UVDA 1T1RA 4OIMA 1LLUA 5IJWA 1SXHA 3AEKB 2PSDA 3L18A 3GLSA 3CEPB 4PHGA 1RAEA 4FYXA 4RKEA 2ZSDA 1A2BA 5IG2A 1KFJB 1R5OA 3O2JA 1VHLA 1XROA 3I9NA 2H1OA 4IBOA 4WACA 4RTNA 2O7NA 1O96B 1W1UA 4LDAA 1MR3F 1TJPB 3KPJA 1DAOA 4C6TB 5KBYA 1ENZA 3KQMA 2G5CA 2BSQA 4CV3A 4F3RA 4GM0A 2WFMA 5JBIA 2MINB 2EDCA 2AYYA 2FF7A 5JMWA 2IDJA 1WS6A 2H8GA 2ZSFA 1QK5A 3MOSA 5GWXA 2IX3A 2Z5GA 2COUA 4NH0A 2JRLA 1CT9A 4KJZA 2RSLA 4IH9A 5CURA 2WTAA 1FFYA 3LPNA 1JQ3A 2LXNA 3N2KB 1E4YA 6ADHA 1N0IA 4PCVA 1TQ2A 4HRYA 3TS1A 3R7WA 4F7WA 2GCIA 2P9YA 2ZETA 4W99A 1LPMA 4IIJB 3TGLA 1XRPA 4FDVA 1DT3A 3O9ZA 2C29D 4E13A 1ISRA 4Q15A 1VI2A 4PX2A 5ANRB 3PX2A 1U2EA 1NVGA 4Q18A 1OYYA 5B30A 2HN9A 3LXXA 4V1CI 4NYMR 4ZCSA 3NPAA 3IQHX 5FT9A 3E8SA 2M98A 4Q93A 3BDVA 4B09A 3CQ9A 1RZ3A 1VKNA 4EI7A 4EY8A 4F11A 3TGWA 4OHYA 1OV6A 2XWQA 3CUSA 1O5OA 2NSDA 1FP2A 1KL7A 1QGAA 1U02A 2RHRA 2YNMC 4IF4A 2Q27A 3FNBA 4QBHA 3UJNA 1YRQA 1ZHFA 3E5MA 1PKEA 1H2FA 1JHXA 1KKLA 2ETXA 3AINA 1ZBQA 4KUGA 3LAWA 1NXTA 2K4MA 3ENKA 2C9YA 1B0ZA 4ALMA 3O4FA 3M33A 4EQ6A 2QN7A 4UAVA 3EBOA 4FM9A 1W36C 3PC4A 1JYEA 1GSOA 2EJTA 4FYJA 4NZMA 2GF2A 3PQ2A 4MQLA 5EXSA 3VBCA 4ZZ1A 2GFIA 4H7EA 1KY5A 1R4AA 1TPZA 1GPLA 2CDBA 4L3VA 3W8NA 3RIGA 1U3TA 1PJAA 1EYZA 1T0HB 3EXFA 3V00A 1HE1C 3L0BA 3UN1A 4BO0A 4P54A 3PPWA 4L9WA 5HMLA 5K3FB 4ZHQB 8GPBA 2W5UA 1N8TA 3OOHA 1KYQA 3C7TA 4AZSA 3WA7A 2AMFA 3LDFA 2HWYA 1NQWA 2BP7B 3HKBA 4R2HA 3SVZA 3U16A 3C3MA 4V24A 4NCJA 4DVGA 5B2ZA 1XF1A 1P29A 3CH4B 3JYNA 3LLSA 3GEGA 4L15A 1NV9A 4GOLD 4JBHA 4WQMA 3BXXA 2GQ0A 4DIDA 3I9V1 4YMGA 5JY1A 5JQGB 2VKTA 3KVVA 4EHNA 1GTMA 3HVIA 3IDAA 3OPYA 4KO1S 5LA6B 3UT5A 3TNFA 4BP1A 3MW8A 2YYZA 4L74A 1VPWA 2PAFA 3V2GA 1QF9A 1KYTA 1VKOA 1GTVA 4QAQA 3OF2A 5JAHA 4AS1A 3GU3A 1TK2A 3JQBA 3KKEA 4JC8A 4DG9A 3UPUA 2ST1A 2GXSA 1REQA 2ZUUA 3N76A 4GMFA 1L2TA 2FX2A 5BUZA 7MHTA 1W0KD 1PN3A 4P53A 1GL9B 3UK0A 3VTAA 4BLTA 3GFTA 4D9NA 1SUDA 3GNLA 5HNKA 1BYUA 3MRXA 2BRUC 2PUHA 4X61A 1E1NA 1GN8A 3WP1B 1OKKD 2DVMA 3COYA 4XD2A 3WKCA 4H7HA 2VWPA 4FHZA 1GXSA 4E31A 1O94D 4BIIA 4CMGA 4G1FA 3V48A 1OWPA 1Q0LA 1I3KA 3QTLA 4LHSA 3BS4A 4XGKA 1CUIA 1UMDA 2QRGA 3VA7A 1AU9A 4TKLA 5FAKA 2FSVC 2H9IA 3F7OA 2AK3A 4UULA 2J5QA 4JJ7A 5HQJA 5J4LA 2XYRA 3JPWA 5MHTA 1IXRC 4IIDA 4QT0A 2Z2KA 1KDRA 1AGXA 1SHLA 2NUBA 1WP9A 2QGZA 1C80A 1N8SA 4MA5A 1MB9A 4FKZA 4UM7A 1LY1A 5CHYA 3T54A 2A9OA 3PGJA 2XYPA 3PTLA 4OXXA 4ALJA 5FL3A 4JEUA 3RGGA 1OXTA 4J3NA 2JC3A 3G8BA 5TMPA 4M60A 4S1PA 5CT9A 1LB1B 4J8PA 3EVDA 5L4SA 2V6GA 1U99A 1V11A 1V71A 3BSSA 4NOJA 3X1MA 1TF2A 2IXFA 1TM7E 3O83A 5AH0A 1B6TA 3ROQA 3S2EA 1V3QE 1OZGA 4CQMB 1CD5A 2BKXA 3L07A 1QGUA 1BE6A 5CH5A 2D7CA 4UU0A 2XMCA 4JLNA 4NEGA 4BBZA 4FOPA 4Y2PA 2PLNA 5HJEA 1UBFA 3I4FA 5J23A 4TQUS 1E62A 1E5XA 2P30A 1C4OA 2HJWA 2HHHB 2OCKA 2H29A 3OTGA 2WC1A 1LK0A 2BFMA 3VKUA 4E5NA 3HXQA 4NBNA 2I2BA 1G2OA 3KSMA 3INYA 3DZFA 3LCUA 4CRWB 1QZTA 2NT3A 3WLTA 4IEFB 2KBFA 2VCEA 2J9FA 3V1KA 3O92A 1Z22A 5IYZB 4IH4A 4DRYA 2ZDQA 3FWYA 4FDUA 2ZIAA 4CR6A 4ENTA 1UMBA 4MROA 3ZBUA 2AMLA 2OO3A 1DOAA 2AJDA 1SGWA 4ZT5A 2BN4A 4W5WA 1Z2NX 4A10A 3EXEB 4C0QC 4ZAYA 1LQUA 3AH8A 3ROEA 1E9EA 2PUBA 3DKPA 5JIBA 1EBUA 4HDAA 5C0OE 1G3MA 5AM1A 1VE7A 4NCAA 3IP5A 1Z88A 2NU7B 4HH4A 2YL2A 1AXRA 2O48X 3I32A 4JKOA 1JQ5A 5D3MB 5E7MA 2DULA 3IA7A 4KACA 4TMXA 2P9HA 4ZO7A 1QP4A 4RPKA 1HDZA 1MJNA 2J5KA 2BEWA 1ZY2A 2W6JD 4UVGA 4CU5A 4F3CA 3DDSA 2QW1A 2AZMA 3IB3A 1SMKA 4DW8A 3TZKA 3OJWA 5K3BA 1QRUA 5IW8A 2ODPA 3UZUA 3TLXA 5HYVA 4LV6A 4BX2A 2LIVA 2Y6VA 4EFKA 4JSYA 4P84A 3ZZNA 4DF3A 1KJYA 3SS7X 4AKIA 1OI4A 1HG1A 2OBMA 4XIFA 1KP9A 2H7XA 1W94A 5B55A 2DFPA 4IDGA 2WVHA 3PPIA 5KVQA 4WVFA 1YD7A 2CEKA 1CUSA 1VB5A 5A3QA 2BAGA 5HZKA 5KU1A 1MRNA 3IDQA 2XQGA 4GP6A 1KY2A 1NRWA 2QLBA 3RI3A 2XCSB 4O4IB 3OEYA 2MSWA 2NSJA 3Q3CA 4LV5B 3TO5A 1RPZA 4AX8A 3H4VA 4IS3A 1XKQA 4MUGA 4GXQA 3A6EA 1JDVA 2W6JA 2MR5A 4EF6A 5K5EA 1FNCA 1QIIA 1SKYB 2X5OA 4BVAA 4Z7NB 3E1SA 2QVYX 2OMEA 4J75A 4E2WA 1JAZA 2YKGA 4D4IA 3OE4A 4AVYA 3TW8B 4ZVUA 2W2LD 2FWNA 1FXSA 1L4UA 2O0KA 3GI1A 4PYQA 4URHA 1YQTA 4NG4A 3ZY4A 4BVFA 4R51A 5CVDA 5CCXA 1D4ZA 4PN7A 2WTXA 3G59A 1YB1A 4DCCA 1AZSC 1FPQA 4X1KA 3ADDA 1G21E 1JPVA 1LJUA 2OFWA 5DTJA 3KHTA 4J1TA 5FBHA 1GUDA 3HGMA 1T0UA 1WHSB 4NOMA 3D0QA 5P21A 3JD3A 4EB3A 3LUBA 5DI3B 3RFXA 4OI0A 4ZAFA 5HJ7A 1PNRA 4XSHA 2L82A 1E6KA 1FCJA 1ZWKA 4D42A 4AJKA 1CUFA 1Y6RA 2DCUA 2PR2A 3B36A 1NZDA 3D5QA 3IPAA 2XY4A 5HBGA 4RLQA 3TL2A 1MV5A 3EGDB 5DN9A 5MN5A 4W5RA 2QE7A 3LA8A 1SM4A 2A67A 2Q9AA 3KIPA 5JD3A 2W2LA 3AR5A 1KQPA 1OVGA 2XDAA 1Z35A 1BJTA 4U00A 3SZMA 4YVFA 4OJTA 2VDMB 1TEHA 5ELMA 2X7XA 2C5HA 4LFBB 1BVYF 2ZCUA 1PIWA 4GXRA 3DG9A 4PSVA 1V2HE 2YJZA 5GMOA 2HKIA 6YASA 2ZGVA 3NWBA 3KV1A 1TB4A 2J59A 1XU7A 5KJEA 4AN1A 3R77A 3LZCA 4YMIA 3U3KA 5L40A 3ESYA 1VYVA 3X1YA 3DNFA 4LMRA 3HDJA 4CPDA 2YC4C 4XEUA 4I4TB 3GJ6A 3QU5A 4KNVA 1V3UA 2OLEA 4MUBA 1HDGO 1JU9A 2B4AA 2WABA 1XL0A 5DTRA 1IQ0A 1BDBA 2AUTA 4D6PA 4RXTA 2ADMA 3PFCA 3L02A 5J5AA 3WL6A 4KPUA 3FB4A 1I5RA 3EDOA 4WV3A 4YI5A 4EI8A 1TTTA 2FW0A 2JAOA 1DPFA 3K8ZA 1M83A 5JD6A 1I6LA 1L7MA 2WYIA 1R4MB 1UWVA 3FYSA 5B3JC 3KWJA 3SD7A 1FXWA 2WIFA 5FO0A 4RJTA 3L41A 4UTNA 3EOAI 1BS9A 2UYHA 1A77A 1M5UA 2ZM6B 1MIOB 2PTHA 3ZVLA 3QXGA 1A0OA 1T5TA 4BQPA 1MQ8B 1VE9A 5CW1A 2DLDA 4FDTA 5AKXA 3K7EA 2PXCA 4OEHA 2WV7A 2QLTA 5CMLA 4H16A 5E6UB 2G8LA 1X92A 3DNPA 4MVJH 1K6JA 2VWQA 2R85A 2RGGA 3A37A 3NANA 4XFKA 2W8BA 3HA7A 4JWKA 3TSOA 4H1VA 4ER3A 2V3CC 1RPTA 3WGOA 1COWD 1NATA 1NJSA 2V8OA 2H63A 5DVZA 3VYVA 4D92A 5FFNA 3K9LA 4BE7B 3QNMA 1LKZA 5L4LA 1T4CB 1ONSA 1ECFA 3BZBA 4DDTA 5AVQA 2AZ4A 1Q74A 1AMUA 4R81A 2OESA 2O2DA 3MAAC 3WY9A 2R84A 1GUAA 5IJAA 2PEYA 3CXRA 3NHAA 1XA0A 1BXRA 1JWBB 2IZOA 5A4IS 1RU3A 3L8MA 2QW0X 3GA0A 3RVNA 1IG3A 1H9BA 4KO8A 4TLLB 4DCPA 1JR3A 3GELA 1O87A 3DBHB 5IT4A 4A6PA 3EYAA 6CHYA 3THXA 1R16A 2I8AA 4B3FX 4WK6A 3JPYA 3CIOA 3MXTA 3PQCA 4B45A 4WZZA 3ZWOA 4EB0A 5I5GA 4MRMA 2OVFA 3GFFA 4RZ2A 1U63A 1ZCAA 3DL4A 4Q3BA 3HB9A 3L7DA 3BZUA 3UC9A 4QGAA 3T52A 3UFXA 1LFAA 5JH7A 4B3TB 4EZIA 3FRHA 1SPXA 3DZIA 1NNSA 1QYVA 3CG4A 4FGWA 1HPLA 4I9HA 1L7VC 4LHWA 5BOVA 4I55F 1KO8A 1WXHA 1DXQA 2L2QA 4WA7A 3WQBA 5GIPE 3EG5A 4F3NA 3M2TA 1SWWA 2RI1A 1BE8A 1VL1A 1QF7A 2JIMA 3BK2A 4KJXA 4ND8B 4I1IA 4RDCA 1YASA 3OJLA 5ALSA 2C7VA 2JFQA 1PL0A 4BNMA 5KX5B 3O8CA 3C6KA 3HNOA 1BGWA 1ZUNB 4GU5A 2H4YA 3Q8MA 4B2IA 1TM5E 1RW4A 3QXXA 5ERGB 4XRRA 3L7NA 1E9FA 3VPBA 5I3CA 3NQ41 2Q4BA 3IESA 1NN5A 3ZWDA 4E4TA 5DYTA 3UMCA 2QP9X 1K75A 3ND8A 5JS8A 4QXPA 1F8YA 1W9HA 4LHZA 2ZYSA 1NVKA 5A4KA 3MPOA 4DM7A 4X64B 3S55A 3RFFA 1A88A 1O6CA 2PMCA 4Y2UA 1XVAA 1UBTS 2YWCA 3JQ9C 4MV7A 4ENQA 4KVZA 5JMTA 4O4JF 4OA8A 4S1WA 2ZJ1A 4R54A 1RFGE 4WEQA 1KYWA 2A58A 1IOVA 2G7ZA 3DM5A 2BTEA 4YAKA 4TXJA 3PFFA 5LIRA 5CRIA 2INGX 4ZI7F 3NTQA 2WMDA 3C16C 1N5OX 1GG2A 3GV0A 1JAYA 5AW2A 2NZYA 2TS1A 2PIDA 1UKBA 3DKRA 1OI2A 4PZLA 4UEJA 2WVAA 2NADA 3ZGZA 3ZJ4A 3GUUA 4AKHA 1MKYA 4BIMA 3G2LA 3K2BA 4KOAA 1HEUA 1M1YA 2HADA 5EQJB 4Z99A 4DNOA 3CUKA 1BE1A 1M34A 2YVAA 3TR0A 1UEJA 3AR8A 5CH3A 1AD2A 1PFVA 5L6MB 3BF8A 5IJZA 1M5TA 4MDFA 1JXAA 4EUHA 2O23A 1A4UA 1L5GB 4B74A 1HK7A 4TQ9A 5CDTA 2BHRA 3PPVA 2XADA 1KJIA 3QFTA 4L0QA 4MYHA 3U4MA 4DEVA 4DEYA 1ACJA 3B6ZA 2FDCA 3PTAA 1DAMA 1I6KA 1YVRA 3S2GA 3RJMA 1ZNXA 4K8OA 3T3GA 4QDJA 1JRLA 1X7GA 4GPAA 3RAPR 2X9LA 4UHJA 4Q39A 2OECA 1Z4IA 1PT5A 5TEVA 2D0DA 4KAFA 1FIUA 5E3HA 4BX0A 1IWOA 3LC7O 5EHXA 2R1TA 2GEVA 1N33B 2PZ8A 1JIQA 2I4MA 3BRQA 4ACAA 1SG9A 3GAZA 1VHDA 1SBIA 3HKCB 3QU4A 4G24A 1NFQA 2AEEA 5B1DA 3Q1KA 2FEAA 1D1SA 1E5DA 3LC2O 2DG2A 1XPUA 4EP1A 1I3MA 2O3RA 3FPEA 1R9JA 4L6AA 2OAP1 3IUEA 3U3JA 2XGMA 4O5AA 5J63A 3AGQA 2XNSA 5I7EA 4J94A 1CQWA 3I92A 4QLOA 1DJPA 3NNDA 3CSDA 1T8YA 2XUHA 3DMRA 3M34A 3QWHA 4N7RA 3V34A 1JILA 2V7PA 4OK5A 4HGNA 4W7IA 4EECA 1EWQA 1I5OA 4TZ6A 1IG0A 1ZGAA 3HJHA 4ZMBA 1ABBA 3BA6A 1LRLA 1LPAB 2OZKA 4KIUA 5DHUA 5KC9A 2X13A 3MD0A 2PPLA 1SVKA 2Y1GA 1Q1QA 2XGOA 5EJ6A 3TUZC 3MTBA 4X5OA 1G17A 2EP8A 1WMFA 2NPOA 2PUJA 2IEGA 2X42A 3DCYA 3MFYA 3O8NA 4X1YA 4D43A 4JI2B 3NDPA 2XMZA 3WDMA 2HHLA 3MWYW 3HJBA 5I9LA 4M1QA 1BGXT 3WB0A 4E3WA 2WU0A 3C3AA 4GKBA 4C1BA 1XZLA 2OK8A 4K9MA 4Q1BA 1P60A 3A3OA 3N8HA 2BFCA 2J6BA 3CPJB 1FUUA 4L5CA 2V45A 3U26A 2ZSHA 2AIRA 1CZKA 1ZNQO 1Z0UA 3F97A 1TXGA 1WF3A 4PX9A 3W1EA 1BX0A 5IZCA 4MNTA 2UVQA 3R7SA 2WKPA 4XJTA 1JIUA 5HCNA 4FFBA 4NU6A 3EZXA 3GF4A 4RELA 1VL2A 2FOIA 5FV7A 4ETMA 1DQYA 1HLFA 3PR3A 2P2NA 5AXBA 4I9FA 2PRSA 1JAXA 3CTPA 1EEHA 2XHEA 2PX2A 4UMDA 4DDWA 4KODA 2Y1LA 3CTMA 1KBZA 1Z06A 4KDEA 3RVMA 4B7CA 4BQSA 1KPHA 2EAUA 4ZCTA 1I7QB 3WMXA 1G16A 2VDLB 4DDVA 4MV1A 4YUYA 4HWOA 1TNDA 3L6DA 4TZTA 5G02A 1M67A 2OAEA 5JPIA 3RABA 3ZDXB 4XM2A 2XNDD 1W0JD 1XMIA 4LJ6A 1IL0A 3BKXA 1L5HA 3IP7A 4XQ0A 3SYTA 4D0NA 2F4NA 3ED1A 3EARA 4DB2A 1UDBA 1BD4A 3MCUA 2ZSEA 3CHYA 3DEKA 1Q1NA 1QTIA 2QUBA 3E53A 4ARZA 4EO9A 5ALMA 5IF9A 2UUCB 1SBCA 4EI9A 2ZPAA 4N40A 1MVOA 5K0SA 1L7AA 1PDOA 3IMCA 2HV9A 5FWDA 3AF3A 5FORA 3PLAE 1JLSA 1YE5A 2VUIB 1Z28A 1GARA 4J0HA 2ZXEA 2Q5HA 5D3KA 4AAYA 3E70C 1X3LA 5L45A 1VJ1A 1G8SA 2QBYA 2VNIA 3FWKA 1Z3CA 3R4CA 5BW8A 1R0LA 3QMVA 4ZN6A 1UFVA 1M2EA 2J0EA 1YB5A 3CM0A 5DHPA 2J6IA 1ABFA 1L4BA 1OASA 1UDCA 2DBQA 2R65A 2XNDA 4DLUA 1EDEA 4EB6B 1CZRA 4IGFA 2D5IA 3Q7RA 4ALNA 5JCPA 1GZ4A 1P0QA 2XRFA 4RHEA 2XRYA 3IVMA 5AJHA 5KNCA 2Z09A 2C2KA 2X4DA 4NONA 4GYYA 2JCGA 1ETHA 4L27A 2IXAA 4R1SA 5HILA 4PYNA 1Y3FE 3B9RA 3SFZA 1QQBA 4GQBA 3OFKA 3FVRA 5DOZA 1N8NA 5K8JB 4ZU1X 4DABA 1E2UA 1UC8A 2HGSA 1NTOA 1NVFA 3K70D 2IS2A 5FOVA 1PQWA 4KBFA 5DP1A 4CEHA 4FJ1A 1AKQA 1V25A 1L5OA 1Z13A 2I9PA 4OFZA 3C3JA 3S68A 2QRLA 2O2CA 3LBIA 2AE2A 1HZZC 2H7YA 1LS6A 3QEJA 4KI7A 4A7PA 2JKZA 2RGBA 1S3GA 4RIFA 5B1SA 4IHJF 4CE6A 4UCWA 4D98A 2QQEA 2YWEA 1IMOA 1AKWA 2NNWB 3GGGA 1BWRA 4CT0A 1H4TA 2H2IA 1PZEA 4WSOA 5L3QB 3OKAA 1KEUA 4TKUA 4LXYA 2YN2A 2VDVE 3SC3A 2RAPA 3HUTA 3C5VA 4Z6KA 3UMYA 1TQ8A 2C3UA 5ES4B 1AUOA 1JYSA 1SXJA 4LS3A 4DL9A 3BXFA 2F8LA 4DPKA 4YYZA 5FPKA 4YJFB 5U4XA 2Z5LA 1L0BA 4HDNB 3YASA 1XJCA 4M0CA 3FNEA 2QN6A 4GPEA 4K2HA 2GN9A 1L3CA 1SCQA 2KMLA 2VDJA 3BHNA 2VJOA 3A9WA 5K6AC 1TLLA 3AIIA 5KVCA 4AUEA 4CL0A 1SBTA 1G4UR 1VIAA 1YBFA 2RHCA 2G80A 2Z98A 3UHFA 4Z51A 2CL6X 1YKGA 4RPCA 2WD7B 3DULA 3EPRA 2R1VB 3SC6A 1J0AA 2JCYA 1UZLA 3OCZA 4HUTA 3X2SA 2OKGA 1Q19A 2H9AA 2G9VA 2H5LA 3HMQA 4RK5A 2BDUA 3OQJA 1GU7A 3SSAA 2DHEA 5H3HA 2ZJ5A 3U48A 4L4SA 2AA3A 1KVQA 3CPSA 3JZIA 4FONA 3W4JA 4D2IA 2SHKA 2GAOA 5D6NA 3G85A 1UDWA 1XTJA 4PANA 4X6YA 2VS1A 2DHQA 4TYQA 1C3OA 3CA8A 3RAJA 3R9WA 4H60A 4HTFA 4ARCA 3ZZ1A 5JAMA 3ZE0B 4K26A 1JG2A 2DOKA 1EJ0A 1S4MA 2HC9A 4XDHA 2HDNB 4IM7A 4J16A 4Q6BA 4EEKA 4FGUA 3EDRA 2GETA 1FSSA 3WWYA 1TZ2A 1VCNA 1WV1A 2RIPA 3H42B 3KKLA 3QUTA 1C1DA 5CDFA 4I1RA 4EAQA 5TPWA 3KKMA 2C7PA 1QZ3A 1Y8RA 3KHUA 4RSGA 5L4NA 3WIVA 2UU9B 3C6QA 4U7JA 3D3WB 4ZVMA 1QRTA 4RVHA 1GY8A 3M6VA 5TC4A 1NFRA 1RQPA 1UBLS 3IKLA 5TE9A 4G5HA 1CIPA 3ZK9A 3CLUC 2JBWA 2RJOA 1Y34E 2E89A 2ZTMA 2AG1A 3MXOA 4TSFD 4DT1B 5TV2A 3SC4A 1XD2B 2CGEA 4DKJA 4BFLA 3NHJA 4ID9A 1ZLXA 3LP5A 1LSSA 3KZOA 2HIAA 4AUNA 2JJMA 4QATA 1CR0A 1FTYA 2ONYA 3K2QA 4LZNA 4DA0A 4EF4A 1KAEA 2J0QA 2F55A 4U8GA 1UP4A 3M6MD 3JWHA 5ALZA 5E4TA 4LJ5A 3UEOA 5BRAA 4GPZA 3HBFA 3VR4H 1P3JA 5HZGA 2QTCA 1LDMA 2PRJA 1H2BA 3L0OA 4RGYA 5EP3A 3TW4A 1X7YA 3N3AC 4DLVA 1TOAA 3GLRA 3PCRB 4LNUA 3W9SA 4P7JA 1YXMA 1XZKA 3ZH2A 1KHHA 2I7CA 5ESXA 1PWYE 2G82A 3WJ1A 2C78A 3ENVA 3SOZA 4D81A 2M6RA 4TTTS 3ML1A 3OT1B 5I4KA 1SVIA 2O8DA 3CNHA 2DEUA 2V6JA 1DAGA 5KQRA 3K9FC 4DUYB 1E1KA 1P6QA 2CXNA 1H1TA 3VXKA 4Q9KA 4KI0A 1II9A 4H08A 4KHPB 5ESDA 4BL5A 3LCMA 4BZPA 5CD1A 1E5TA 3H2GA 1X14A 3JALA 4EF5A 1OX4A 2PMWB 3NNNA 5H82A 2CMKA 2H0AA 1YKSA 3MGBA 1ADFA 4P4TA 1QHHB 2GTIA 4JELA 2WJYA 3ONNA 5A9SA 5EQTA 1SKQA 1UBOS 4KO2S 4X54A 4YAJA 4CKCB 1EE2A 3MLEA 1GOTA 3RUEA 5EZYF 2BCEA 3I1FA 3TG2A 3AHHA 3QW4B 2IODA 3AVUA 1SG0A 2PQ6A 5LUBA 2G40A 2MSDB 1M76A 1PEAA 5KZMB 3OOJA 4F6CA 1T4GA 4KO3S 3OLCX 4Y2XA 5BMVB 4HLUC 1JN0A 5BW6B 2OM2A 4ZYUA 4FW8A 4JB2A 4HKTA 5GZ3A 2XSZD 2CC2A 1EI9A 2E4XA 3BDAA 3NO4A 2OVBA 1COZA 2W2PA 1YQ9A 5C8YF 4G1MB 2F8TA 1UWKA 2D8MA 2XVZA 3GT0A 3DMYA 2OBXA 3CVYA 4OYYA 1RXIA 1XGKA 1VLZA 4UM5A 1WTAA 2Z30A 2CZGA 4NRDA 1BZYA 1G5FA 1EDOA 4XXHA 3AB7A 1CUWA 5JMPA 3U44B 1UM8A 2BGJA 5GP1A 1TK9A 3N5KA 3C3DA 4IQ0A 2I7XA 3GLIE 3RS0A 2LZ0A 1CUCA 3IAUA 1Y3HA 1D0SA 4WBNA 4EFDA 4YT4A 1EXDA 3PIRA 1XC7A 2YWJA 4YUAA 1HURA 3IO3A 4B5KA 1YZTA 1P7CA 2II6A 1E1CB 4D8VA 2IZ7A 4BJ3A 3KETA 3OX1A 1X80A 2ZJ0A 2O2HA 3N75A 4HDSA 1OZHA 3LBYA 4BMVA 1SBZA 2EKQA 3JQ8A 4UDXX 4Z1OA 3EVAA 1IEVA 3TAHA 4J2HA 3AUFA 3FAZA 3ZR4B 4RHTA 5JALA 4KAXA 2XECA 4LECA 2AQ8A 2H1SA 4OJKA 4KHZA 4R2MA 4COOA 3ZS9A 2QIOA 2ILTA 4WKGA 2WJAA 1T9KA 1X1DA 1FU7A 3QKSA 4U2EA 3P9NA 3U4HA 5IBCA 1I9CA 2TMKA 4NFLA 2TRSB 4PFKA 4F92B 3RTGA 4DJEC 1WQ1R 3PWZA 4PSDA 4EY3A 4LISA 3CNOA 4UJ3A 5JSHA 3EA4A 3IAEA 2J6CA 1L4YA 3GMDA 3Q40A 2NOAA 3LWNA 5A0FA 3O82A 5GTDA 4JOSA 2RHDA 4GI5A 3PP8A 3WRVA 2FPGB 3BXEA 6REQB 3P9XA 1OBFO 3D43A 2J3MA 4XKJA 1TEXA 1ZNYA 3FNGA 1LF5A 1JQLB 1V45E 3EASA 3JVEA 5G0UA 2AXNA 2ZRFA 1LCIA 4UXIA 4E0BA 3DDNA 1Q22A 1Q3TA 3UWOA 4DA8A 4HH1A 1QFYA 3AUTA 2QPOA 3LPCA 1PU2A 1M73E 5L3RA 2OFFA 1WCIA 3JQFA 4FK8A 2H9YA 5AUPB 3PFHA 1KYZA 3OOEA 1YTUA 4AZVA 5TARA 1DAEA 4KQGA 2PL1A 4BO1A 5B2EA 2ETVA 2OK7A 3U7JA 2G09A 2VF4X 4ARUA 3ONDA 3OMXA 4YAWA 1ZESA 4DHEA 2H4JA 1OBOA 3L6EA 2R87A 5F51A 2VDOB 4MCIA 4UPEA 4EKEA 2VRWA 3BE5A 4MWOA 1PG0A 2OC9A 1C9KA 2DLCX 5IT0A 4BQIA 2I1WA 4QGFA 3G2MA 4R9UC 4RWZA 1ECJA 3CW9A 3BMCA 4YCMA 4YJGB 4TLBA 1XKTA 3E3OA 1OOEA 3G02A 1O6GA 4B9AA 2WPDA 2ZXUA 5GPBA 4J2TA 2ZUTA 4N1AA 3KYIB 1JKMA 5TJHA 4KE7A 3AHFA 3T3HA 3MCTA 4MKXA 3NBZC 3M6WA 4YMTA 1E9DA 4PQGA 1J20A 5AM5A 2FW1A 3FZYA 5EJMA 4OGLA 1TVMA 2I2CA 4X97A 1EXVA 1JSZA 3SX0A 4ACBA 3OO0A 2FN9A 3NYIA 4WKBA 1CR2A 1E18A 1NW3A 1OSNA 4MA0A 1J8QA 4O29A 4D7AA 5LNK1 3FTFA 4W5JA 3HNRA 4EW1A 4P8RA 4BZQA 3ND7A 4E08A 2C2OA 1JFTA 3WL5A 3AYZB 2F17A 1RRMA 4S1NA 5TMDA 4UEKA 1D6SA 1RZUA 2PZFA 2XYQA 1T6BY