4BVJA

Structure of y105a mutant of phaz7 phb depolymerase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
343
structure length
343
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNAHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPYNAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical Analysis and Structure Determination of Paucimonas Lemoignei Poly(3-Hydroxybutyrate) (Phb) Depolymerase Phaz7 Muteins Reveal the Phb Binding Site and Details of Substrate-Enzyme Interactions.
pubmed doi rcsb
source organism Paucimonas lemoignei
molecule tags Hydrolase
molecule keywords PHB DEPOLYMERASE PHAZ7
total genus 128
structure length 343
sequence length 343
chains with identical sequence B
ec nomenclature ec 3.1.1.75: Poly(3-hydroxybutyrate) depolymerase.
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bvjA00
3O4JA 2VT7A 3FCXA 3I2IA 4X93A 1XQYA 2ZSIA 5BWBA 3C8HA 3WK8A 2B4KA 3D0KA 3W9BA 4DYHA 1YB6A 1YB7A 4A5SA 3CCCA 4C01A 2JEZA 5AKGA 4CCYA 1MN6A 3PICA 1CUDA 5DYYA 3T4UA 4O08A 3QMVA 1QLWA 2X5XA 2WIKA 2NW6A 3WLAA 1I6WA 3WWPA 1XLVA 5LLSA 2XUKA 3ZV7A 5AM1A 4J0HA 5C8ZA 2Z8ZA 2Y2VA 3IB3A 2CZQA 4EHBA 4UBJA 1DU4A 2PL5A 3OTQA 3QMWA 2J4FA 4YX9A 1ZJ4A 4BB0A 5FP0A 2R11A 2J3QA 4OYLA 1GXSA 3I6ZA 1LPOA 4M0FA 4DMKA 5AOCA 1SCIA 3O4HA 5A2GA 2BGRA 3I6YA 2B20A 1R3DA 4BZZA 1XZEA 4GBGA 1NU8A 2JF0A 4J0JA 1JJIA 4AB1A 3W06A 1JU3A 4W63A 3R3UA 4QLAA 4NS4A 1K4YA 3BDIA 4BVKA 2WQZA 4D9JA 3N0TA 3DKRA 1BCSA 5AP9A 1KU6A 3NWOA 2XI4A 3C43A 3WL6A 1MJ5A 2AJBA 1ORVA 2XUAA 3AZPA 2WTNA 1YR2A 4X91A 4W1PA 3PUIA 4AO7A 5E4YA 1QTIA 5FLKA 4Q34A 5HKBA 4FMPA 1CUYA 3EBLA 2WUDA 4JEIA 1F6WA 3O9MA 1QO7A 4DIUA 2ZVDA 1R9NA 4G4IA 1QIMA 4ARBA 4Y2PA 4UFOA 3I1IA 1EINA 4M0EA 4JUIA 4UBOA 2HA3A 2HA0A 2PPLA 3KSRA 1WB6A 4X7BA 2C4HA 2PSEA 1K63A 5AH0A 1LBSA 5CT6A 2HA6A 1MPXA 5C7YA 1QIDA 1IUNA 1SCQA 3WQHA 4Q82A 1QFMA 2PU5A 2FJPA 2FX5A 5K3AA 4I4CA 3PF8A 3I1YA 1QIKA 5JIBA 1ZOIA 2V9ZA 3MUNA 3WA7A 2RAUA 1DX4A 1DWQA 2ZSHA 4J0KA 2JEYA 4UFNA 5YASA 1RP1A 2D0DA 2CJPA 5AM2A 4K6HA 4KR0A 2VJAA 2RI6A 1CUBA 5FKJA 4BCCA 5E4TA 2OQVA 3DKKA 5K5EA 4DSAA 4B81A 4OCZA 3C6YA 4KRYA 3G9XA 3WK9A 3WZLA 4DNQA 2Y6VA 4FLMA 4GEGA 4X85A 1K6EA 2AXEA 4P9NA 1EH5A 3MVEA 3R3ZA 3WL7A 5A7HA 2LIPA 1BU8A 3CXUA 4QDZA 3A2MA 1GPKA 3ED1A 5JARA 3IA2A 5JASA 3ANSA 1EB8A 2RIPA 4H35A 4BTVA 3QPCA 3SX4A 3O95A 3S8YA 3CN7A 4BE9A 3L1IA 3IVMA 5ALXA 1CUWA 1E8DA 3DL4A 3E1GA 3WMRA 2OQIA 5CBKA 3L1HA 1P0MA 1GZ7A 3B5EA 4ITVA 4AZ3A 3IURA 1H2ZA 2HU8A 4QA9A 3HYSA 4XJVA 3R3VA 2G4LA 2OG1A 3DCNA 3NGMA 4NZZA 5KWJA 5BOVA 2XQJA 3VISA 3X3HA 4U2EA 2JGFA 1YA8A 2QRUA 4QE3A 3GUUA 3I6MA 5LZ7A 1TQHA 2OCLA 5AKJA 5LYYA 3H2JA 1H2YA 3WYDA 5ALSA 2E3JA 2BAGA 3ZLUA 5HZGA 1W76A 1GKKA 2ROQA 3ESAA 2C5FA 1G4HA 1HPLA 3E0XA 3LIIA 4N8EA 4EY4A 2AJDA 3H2HA 3C6XA 5AK3A 1LZKA 2VAXA 1L7QA 5EIHA 3TGLA 2I3DA 3V48A 1AUOA 5ALZA 1Q84A 1VE7A 2C58A 4KJXA 3ZLVA 3D5EA 4EZIA 4J0CA 2ES4A 3WYNA 1R50A 3DEAA 4KE6A 5ALGA 2JGLA 1DWOA 2VQ6A 2BUCA 3FLEA 3GFFA 3H2KA 3H2IA 2DQZA 3DQZA 3H1AA 5JD4A 1XQWA 3F67A 2BGNA 2JGKA 3FVTA 1UT6A 3O4IA 5AIBA 2ZJFA 4G8BA 2PUJA 4C89A 2QM0A 5CT4A 4H0CA 1DWPA 2AJLI 2Y6UA 3RK4A 4FLEA 4K6GA 2WUFA 4F5ZA 4HZGA 1QIGA 1CRLA 1PFQA 4G4JA 4PSDA 1SOMA 4WFKA 4AZ0A 5JADA 1BRTA 2XQIA 4OU5A 4LIPD 1LNSA 3PDCA 1TAHA 4EY7A 1W6RA 1YAHA 2Q0XA 4FKBA 3AIMA 4KAFA 1EHYA 5ALLA 1TCBA 3PE6A 1C7IA 5BV7A 2V96A 3HACA 3WA6A 1ZIYA 1YA4A 1XFDA 2GZRA 1ODSA 1IUPA 4PV7A 4H7JA 4BVJA 1QTRA 1CUZA 5ALTA 1H23A 1XZHA 3KXPA 2OGZA 5EHXA 1WHSA 1CEXA 2XT0A 3BJRA 4CIBA 4H18A 2QUAA 3B12A 4WY8A 5T4HA 4C4XA 1ODCA 1NU6A 4WFIA 1AZWA 3PFCA 2WIGA 5AOAA 1EDDA 3C87A 1CUJA 4MEAA 4QDUA 3H04A 4UHEA 1IZ7A 3FYTA 4HVTA 2XUGA 3WKCA 2QT9A 3DL7A 5AKEA 4C4YA 5JZ9A 1XZIA 2YYSA 4X92A 1R4ZA 4TPKA 2ZYRA 1KU0A 2XUPA 4AMYA 2YH2A 4UUQA 1B41A 4BAGA 3AUKA 1BEEA 3FVRA 4BC0A 4ARAA 5EHZA 5AK6A 2PSHA 1W52X 4XWGA 1QIEA 4BC1A 4JH0A 2WIJA 1N8SA 5AK4A 4BE4A 4Q1VA 1QIJA 4W9RA 1XKTA 5D6OA 1A8UA 4EY8A 1ZI6A 3H19A 1ZD3A 3G7NA 3BXPA 1HKHA 4LXGA 3IDAA 3WK7A 5AM3A 2Z3WA 2H1IA 1Q0RA 1VE6A 2WUGA 1WCYA 3KWFA 2J4CA 5E4JA 1A88A 1LPMA 4UHDA 3FLBA 3CN9A 3F8SA 4K5QA 1FFDA 4UHBA 1VKHA 2BCEA 1L7RA 4MYDA 4FHZA 4WY5A 1MX5A 5IVDA 2EDCA 3RARA 2WLSA 4C88A 1U65A 3NOXA 4CCWA 4TVKA 3DYIA 2XQGA 1ACJA 1EVQA 4QEKA 1BE0A 2XUJA 3WIBA 2WKWA 2QXTA 4Q3LA 1CQWA 3AJAA 1TK3A 3G0IA 3DJYA 5ALIA 4J0GA 1DT5A 2RHTA 3WL5A 1F0PA 4KAAA 1ZD4A 3G0BA 1QFSA 1XLWA 2VATA 4FDMA 1BN7A 1WPXA 5DJ5A 5LKRA 1CUEA 3AFIA 1ZI9A 5JATA 5HCUA 4HRYA 2W22A 4DTCA 1UFOA 2OLEA 4H7IA 2G5TA 1O6GA 5DNVA 1WB5A 2WFLB 1EDBA 1ZGBA 1UK8A 2RHWA 3IULA 4UHFA 5DTJA 1JFRA 2ONCA 5LZ9A 3OC0A 4DNOA 2PBLA 4L3WA 2OCGA 4MXDA 4FNGA 2GYVA 1PJAA 5DNUA 5LIPA 4KE8A 3ICVA 4HXEB 2XDWA 2QKYA 4H7HA 1CUXA 3K6KA 2PX6A 3C5VA 1G5FA 1GQSA 3IUMA 3KDAA 5LZ4A 4AO6A 3M3DA 4B9AA 5CW2A 5E2IA 4BAUA 5SYMA 4XIIA 5FRDA 1MAAA 1ORWA 2HL6A 3ESDA 3W04A 5K3DA 1LGYA 1THTA 5ALMA 1FFEA 2VT6A 4UHCA 4Y2UA 1JJBA 5CMLA 1SC9A 2OAGA 4BAZA 4HRXA 1QOZA 1CUIA 1CUCA 4L72A 5IKXA 2PVSA 1CUGA 5IVIA 2JGMA 4Q05A 3LS2A 3W2TA 1AURA 1GPNA 3QYJA 1TKRA 2GBFA 4HXFB 3FAKA 3HRHA 3LIPA 3OG9A 1CPYA 3WK5A 3ZI7A 2Y1KA 2J3DA 3AILA 2WSLA 5KBYA 1LPAB 4ZGBA 2YASA 1YS2X 1JJFA 3A2NA 2VA9A 4AQDA 4NVRA 1WB4A 1G66A 1CUVA 3WJ1A 1N5RA 4H7FA 2O2GA 4H77A 5DYWA 1YS1X 1BCRA 4KRXA 5H3HA 3A6ZA 4P92A 5JAOA 1S8OA 4ZI5A 2XQFA 2EEPA 4B84A 4IH4A 1DX6A 1XRNA 2XMGA 2XUHA 5C8VA 1W75A 3R0VA 2HU7A 5ALOA 4PQEA 4W1SA 5IVHA 2ZJ7A 3RLIA 1VLQA 4H7DA 4V2IA 3BL8A 2H7YA 3JYHA 4FBLA 3D4LA 1AC5A 2I03A 3HZOA 1TCCA 3E3AA 4PW0A 1Q83A 1NX9A 1WPRA 4X90A 3D2BA 1BROA 3I2GA 5LZ8A 1E66A 5FPQA 4GLBA 2WIDA 4DNPA 4LKOA 5I9IA 1UOQA 2PSFA 1U8EA 5FUMA 4UBIA 2WTMA 5ALWA 4P08A 1M33A 1XZLA 3BF8A 4U2BA 1CV2A 5CXXA 2XMRA 4MQMA 4IH1A 4G5XA 1X2EA 4B0OA 5CT9A 5BWCA 3F9CA 3G9TA 5AOBA 3U0VA 4WDRA 2HHAA 4GXNA 2HFKA 4BCDA 3R3XA 4E46A 4UBLA 2PU7A 4PSUA 3ILSA 4F21A 5ALPA 4QWMA 5EIEA 3FBWA 1VZ2A 1UXOA 1CQZA 2WG1A 3FNBA 1LPPA 1DQYA 5ESRA 1VXRA 4Q3KA 2VJBA 1CUUA 3I2KA 1EK2A 2WM2A 4E15A 3N2ZB 3B3QA 1E3QA 1UOPA 5AI5A 2WHRA 3DDUA 3C6BA 1FSSA 2DR0A 2XUIA 2OGSA 2V97A 3P2MA 2QS9A 3WWEA 3STTA 3HEAA 1BEZA 4J0IA 2CMFA 1JI3A 4MQLA 1XZMA 2OXEA 4N5IX 4INZA 5CH8A 1DT3A 2G63A 1XQXA 4OB8A 4C6HA 4I19A 5HF8A 3R40A 2WILA 4BP8A 3DYVA 3H0CA 4DMCA 1WM1A 1UKAA 3EQ9A 4EUSA 3ICWA 4DNFA 3Q0TA 2QJWA 4FFWA 1VA5A 1CFJA 1HDEA 4X6YA 1E5TA 3Q8WA 4RGYA 1J2EA 1MAHA 4JNCA 3TJMA 2QZPA 4XVCA 1HQDA 2ACEA 5D7BA 3HJUA 1CUSA 2XMSA 4BDSA 5J3JA 4FTWA 2V98A 1A7UA 2WJ3A 3G0GA 2HA7A 3DNMA 1F8UA 1LPSA 3AINA 4GHWA 4Y9SA 2XQKA 1Y7IA 1VA4A 4W1RA 3I2HA 3ANTA 3WL8A 5CH3A 4Y2QA 3D59A 1FFCA 4IQ4A 4X94A 1XZDA 5A7FA 3KOOA 3V1NA 3R3YA 4AO8A 5JZSA 1QZ3A 4B9EA 4BRSA 1QJ4A 1C7JA 3PI6A 1UKBA 2WUEA 2GZSA 1ETHA 1H2WA 1MNAA 1TRHA 4G9EA 4Z49A 2DCMA 4RE6A 4Y2SA 5CT5A 1T2NA 5CURA 1VOTA 5JALA 2JIDA 2XMCA 4MEBA 2RONA 2JBWA 4Y2RA 3VXKA 5DLPA 3T52A 5CH5A 4KYVA 4RPCA 4FFVA 5ALRA 3V1KA 5A7GA 5EHQA 5I8PA 3FOBA 4WDQA 4A23A 5IH7A 1XRMA 2CUTA 4Y7DA 2OAEA 1XLUA 3MUOA 4FBMA 1G42A 4G8DA 4BDTA 1QIFA 4J3JA 1FFAA 4CG2A 4G9GA 2OCIA 3EF3A 3WWCA 2GYWA 4OU4A 4OUKX 3WIOA 1W4LA 4MWTA 1GQRA 2XE4A 4YASA 5AIAA 3JW8A 4WJLA 1Z68A 2DFPA 1PV1A 1X2BA 2ORYA 4E11A 1UWCA 1UK7A 4K6KA 3EQ8A 2WHQA 3BIWA 3R41A 3WWOA 2O7VA 4DMHA 1LPNA 3K9BA 4GECA 5ALQA 4EA6A 4CIAA 4KE9A 3HSSA 1FFBA 2ZYSA 3WKEA 3ESBA 5T4FA 1AGYA 2O2HA 2OCKA 5HKAA 4X00A 2ECFA 3WKBA 2BFNA 4DMFA 5AKHA 2IIVA 3A2LA 1P0QA 2I3ZA 1YAJA 5D3KA 1XZJA 1DQZA 4PSCA 1XZAA 1IVYA 2GBGA 3FYUA 5JD5A 1ZICA 3ESCA 3FSGA 5A6VA 4HXGA 3STYA 4B85A 2CEKA 2HIHA 4CCYB 2VJDA 4OYYA 7YASA 2WJ4A 4CFSA 4GDMA 1Y37A 2Z3ZA 4DGQA 4UHHA 3STVA 2AJCA 1HBJA 3UUFA 4LYDA 5HF6A 5T4BA 4L0CA 3DOIA 3C6ZA 5JZBA 1YCDA 4X3CA 2DSNA 5JD6A 5AKKA 3K2IA 4Y2YA 4U2FA 3W9UA 1HL7A 5EGNA 2XLBA 3PF9A 3I2FA 5ALUA 3STWA 2WHPB 1XZBA 3EIOA 3OURA 4N8DA 5ALNA 3LCRA 1EK1A 5ALFA 5K3EA 1ODTC 4BP9A 1T4MA 2Y2UA 1J07A 1LLFA 3VJLA 3QMMA 2PM8A 1ZD2P 1GT6A 3FSGD 5ALVA 1ZD5A 2JGIA 3G9UA 3UUEA 5K3CA 1QIIA 4BYMA 4F60A 1TCAA 4QZVA 5HQ3B 3HABA 3FLAA 2QVBA 3SWWA 1XZKA 3BDVA 1VXOA 5HFAA 5C81A 4EB0A 5AI9A 1CUHA 1O6FA 2WG2A 5AKXA 2VF2A 4BVLA 1U2EA 4C87A 4OSEA 2HRQA 3C8DA 2DHCA 3DOHA 1OCEA 4OB6A 3MGAA 1RYYA 5ISMA 3VVLA 3ZLTA 3WKDA 2B61A 2QMQA 3O9VA 3WI7A 3WZMA 2HA5A 1XRQA 1E8NA 1MO2A 4U2GA 4X95A 4ZV7A 2W6CX 2AJ8A 3WK4A 4QDOA 2H7CA 5HK8A 2OGTA 1GKLA 2VEOA 2QR5A 4G1FA 2ZYIA 1A8QA 3UMJA 2HA2A 3SK0A 1UZAA 4OD0A 4L9AA 1XZGA 5AKYA 4QDXA 5KWIA 2XUFA 3VKFA 1XKLA 2GYUA 3H18A 3LP5A 2ZYHA 2P8SA 1MU0A 3H17A 5K3FA 5FPPA 1UK6A 1OXMA 3F98A 4X97A 4EY5A 3E4DA 1Q0ZA 4TGLA 3BWXA 4H7KA 4FLFA 3D7RA 1N1MA 5FXMA 4JYPA 3IUJA 3DLTA 3HLKA 5AI8A 1CR6A 4BTLA 1CLEA 5EHNA 2GBCA 4C4ZA 2XUQA 3QM1A 4AN0A 2O7RA 3R3WA 4Y2TA 1JMYA 1QGED 3PFBA 4ROTA 1LBTA 1F0NA 2G5PA 4AN1A 5AI4A 3FWHA 3KWJA 3ZPXA 5AI6A 3KD2A 4Y2VA 4G4GA 1XQVA 3QPAA 2K2QB 4S0XA 2X76A 3C5WP 3GELA 1BS9A 5ALYA 1E8MA 4ZRDA 4HAIA 3O4GA 3WK6A 2XLCA 4BCBA 5HK9A 3HC7A 4HTAA 5DNWA 3STXA 2Z8XA 1QO9A 3WKAA 5EFZA 3HI4A 4CG3A 3YASA 5LZ2A 1VJ5A 3TRDA 1EI9A 1P0IA 1XRPA 2DQYA 2C7BA 5AKLA 4FOLA 4DSZA 4A16A 2HU5A 3I2JA 6YASA 2XMQA 3BF7A 4NMWA 1KEZA 5JYCA 3EQ7A 1H22A 3I28A 1GGVA 2HADA 5JAPA 2FJ0A 5JANA 4MYSA 1DINA 2PSJA 2GBIA 2WFZA 4X6XA 5FOQA 2XB6A 2D5LA 5CTAA 1IUOA 2VTVA 5K3BA 5KREA 3NUZA 1QIHA 1Y7HA 3HXKA 1JMKC 5AM0A 4W1QA 2I78A 3BJMA 4U2CA 1HLGA 1FJ2A 3H2GA 1SFRA 2JGJA 4HS9A 5AO9A 4J7AA 4Y2JA 4N5HX 3VVMA 3M82A 1YASA 4BRZA 4J0DA 4AMZA 1L7AA 3CCBA 5DWDA 4EBBA 2BJHA 4X6UA 4RE5A 5ALHA 2OPHA 3M81A 4CG1A 4QWWA 4N8SA 1EB9A 1WOMA 4P93A 2C5GA 2H7XA 2BKLA 1JKMA 1CUAA 4X71A 4G8CA 2X8BA 4GI1A 4PF1A 2RGUA 2PUHA 2XMZA 1QONA 5T4EA 1N5MA 1K5PA 2XMBA 5LZ5A 1DTEA 3FYUB 3QVMA 1AMNA 3U1TA 1CVLA 4RNCA 4I3FA 3L1JA 3FCYA 2WJ6A 3G8YA 3VDXA 3AZQA 1MTZA 1EX9A 4B82A 3FYUC 5IVKA 4CI9A 3RM3A 2QUBA 2ACKA 3G0DA 4IHAA 3VJMA 2BUAA 3BIXA 3WWDA 1YSCA 4BZWA 3QZUA 1OILA 1EVEA 1IMJA 4UBNA 5LP1A 3AZOA 5AM4A 2DHEA 5AICA 3C45A 2XMDA 1UK9A 2WFMA 4MWSA 2WIFA 4IO0A 2QXUA 5DTIA 2WHPA 5EIAA 3M83A 4XX1A 3QPDA 1K8QA 1USWA 2PSDA 4BATA 1ZI8A 1XRRA 2XUDA 4KE7A 4DLNA 4AXBA 2VJCA 3G9ZA 3WJ2A 5F4ZA 4UBMA 4Y2XA 5I7UA 3QH4A 1QE3A 4PNZA 4JYMA 5ALEA 3AIKA 4LXIA 4QNNA 4YPVA 4K2AA 1SCKA 3LLCA 2PKYX 3OM8A 1R9MA 5HQ3A 5HFNA 2HRRA 3IIIA 1C4XA 3ZWQA 3F97A 2HFJA 3H1BA 4UFPA 3IUNA 1IZ8A 1CIJA 3RKSA 4UPDA 5JAUA 1UOOA 1P0PA 5SYNA 4M0MA 1MX9A 3V9AA 1ACLA 1GPLA 4KAJA 5A71A 2H9YA 5A62A 3OOSA 5AI0A 5AJHA 1H2XA 3GROA 1UKCA 1MX1A 3F96A 2CB9A 1EA5A 4BBZA 4MJ3A 2QJRA 4UBKA 4GW3A 5EI5A 4U2DA 4WFJA 1ISPA 1WHTA 3O0DA 1ZJ5A 1J06A 3DS8A 2Z5GA 2JGEA 2HA4A 3DD5A 1XROA 4Q3OA 1E89A 3A70A 3W05A 4GWLA 1XRLA 5D3ZA 4LYEA 4YK7A 1AX9A 1R88A 1B6GA 5CT8A 3QBJA 3SC2A 2B9VA 2UZ0A 3TEJA 3GA7A 5ALKA 2QTBA 5K3FB 2IITA 1THGA 2HM7A 4KEAA 4F0JA 4B7ZA 3JWEA 4ZREA 1EXWA 1W1IA 1EDEA 1D07A 4E14A 3GBSA 4KACA 4QLOA 3C70A 1XZCA 2WFLA 4PO3X 5C8XA 2XUOA 5AHXA 2CBGA 5AKIA 1XZFA 1U4NA 1AQLA 2C0PA 5ALJA 1RWQA 3V1LA 3D2CA 5HF5A 2FUKA 5JAHA 2HDWA 4FNMA 4J03A 2VAVA 1R1DA 3IUQA 4FWBA 1CUFA 3OPMA 5CRIA 3G0CA 5HF9A 1ZIXA 4EY6A 3V1MA 3QITA 2IX9A 4B0PA 4ZXFA 4QDTA 2BUBA 4DM7A 3D3NA 3D2AA 2WG0A 4B80A 2WU3A 1ZGCA 1MNQA 4ZV9A 2EDAA 5ALDA 1MT3A 1JU4A 1AKNA 2QOEA 1TIBA 5LKAA 5FDFA 1A8SA 1BN6A 1X70A 5DYTA 2CKMA 4H7EA 2R8BA 4IH9A 2C0QA 4ETWA 1JT2A 4ZWNA 1LZLA 1VZ3A 2DHDA 1LPBB 4LHEA 4WCVA 4B6GA 3BE8A 5AK5A 2YXPX 5AKZA 2WU4A 1J1IA 2VSQA 3STUA 5CXUA 3G02A 3GZJA 3AIOA 3VJKA 3PUHA 2O2IA 4OB7A 4B83A 4OPMA 5FV4A 2ZJ6A 4LXHA 5AM5A 3IBTA 4AX4A 3S2ZA
chains in the Genus database with same CATH superfamily
5CAEB 3PC6A 2QW1A 4LVUA 4DRYA 4DBVO 1WXFA 3LYLA 3QFHA 5LA6F 3I2IA 4WLNA 2WM9B 4QGBA 3GLGB 1Y9EA 4O5AA 4A3SA 1XQYA 2HKIA 1GR1A 2ZJ2A 1PFYA 1DWUA 2LCFA 4POOA 3WDLA 3C8HA 2B4KA 3D0KA 3MRSA 1KY2A 4HH3C 5IC4A 3NOOA 4EL5A 4DYHA 4WZBE 1UC5B 3O0TA 4CTJA 3KELA 4YCJA 2JLXA 1YB6A 4P58A 1X19A 2FHSA 1HEYA 1XAHA 2P0AA 1EP1B 2QJOA 4C01A 4MR7B 5AKGA 1LFDB 2CWDA 3BXZA 5P21A 1K3TA 1KZ9A 4IGKA 2GKOA 2PT6A 1M7HA 2H48A 4BV3A 4KZKA 2Z5FA 2DAPA 2JLRA 3QMVA 1U4OA 2OP0A 3QX7A 1OC2A 3RUPA 1L4GA 5HIMA 2ORWA 2X5XA 5A02A 1DJMA 2WIKA 3MBKA 3AKYA 4E07A 1I6WA 3ODPA 1EGAA 2CDBA 1T6ZA 3DZ8A 3WDSA 4RDCA 3WWPA 4DQXA 3OOHA 5D2CA 1XLVA 4NEHB 4IIYA 4B3JA 3MWYW 1D4AA 2WPDA 5D1NA 1LB1B 2P2NA 4C20A 1X3LA 2LUOA 2WLTA 4WKOA 2Z8ZA 4RF3A 4HLUA 1DZ3A 1Z25A 2Y2VA 4L50A 1YQ9A 4QO8A 4F4CA 4URVR 4RSRA 4D8WA 3GLSA 2QSJA 4N18A 4UBJA 5ERXA 1B74A 2V8BA 5JI3E 3NMUF 2P4UA 1FFXA 3KEMA 5JO0A 1RC8A 2PGXA 1V0JA 1N4AA 1WD7A 3B9PA 4OXRA 4XRRA 4YX9A 1ZJ4A 4JEUA 4Y8VA 4OV6B 2I6FA 1HNXB 1DCFA 4HDMB 2HJGA 1KDYA 5D86A 4DVGA 3GFBA 3GRCA 4JK3A 4UEQA 4P7BA 1ZK2A 1EGHA 4PFKA 1Y8QB 4UM5A 4B87A 1MR3F 4BLOA 3MWFA 3TLGB 2P5TB 2WYHA 3E22A 4PVCA 2FZGA 3O4HA 3JQCA 2H4WA 1NQAO 4RYLA 9ABPA 4CIYA 2P9ZA 1JDSA 4CM9A 5IULC 1ZJZA 3H1GA 3RAEC 5BUZA 3PTZA 4GBGA 2OFFA 1NU8A 3SDBA 3SQWA 3ADDA 1PJBA 5BNFA 1TXGA 2JF0A 1GCAA 1JR3E 3IEMA 1EFRD 3TCKA 2A1IA 4I1IA 3AP1A 2ZYDA 2VFAA 4AJLA 1JU3A 3IV7A 4JVSB 3R3UA 5I5GA 4LCJA 4WINA 5E6UB 3W34A 3ZXYA 2B83A 1BHSA 4YRCA 1K4YA 4ME6A 3INTA 4LI3X 4F4DA 1LK5A 1T6YA 3F7TA 3PT5A 3HK2A 4FMDB 1RWKA 1VJCA 2Y8EA 2J9ZB 2JKVA 2Z2ZA 3ZOKA 1SZCA 1E7MA 3OPVA 2A84A 4I55A 1J8QA 1AA9A 5AP9A 5ECYA 2IF0A 5JDIA 1NRWA 1TNDA 3NBZC 3KJIA 1JAHA 2YOFA 5DW0A 1WXDA 3AR8A 1GTRA 4PAWA 3BB3A 2QSYA 5FF9A 5GY7A 2G7ZA 1GKYA 1ATZA 2AJBA 2AH5A 3BIFA 4FYVA 5JS2A 5JMWA 2RI0A 1GRQA 4Q0MA 1JL3A 3CUSA 3FMPB 3E3MA 1Y1QA 4NU0A 5F76A 5H3CA 1OX4A 3SZGA 4FKMA 2W8BB 4G97A 3VPCA 5F2NA 4U0KA 4GOJA 3AM4A 2BM0A 4FZRA 3BMOA 4Q34A 3K09C 4RGVA 5HKBA 2FSHA 4FMPA 1CUYA 4KVZA 4X8MA 2ACVA 1X1SA 2O8BA 1F6WA 3O9MA 5IDYA 2QV7A 3R4CA 2QP3A 1PR2A 1U0RA 3HKBB 2ZVDA 3ZCPA 4II2A 4UUBA 5A0VA 3PCRB 2PRIA 1QIMA 1RAEA 4BE7B 5BY2A 2EV9A 3E7WA 3U61B 3I9JA 1V4BA 3IOCA 3C5HA 4IWNA 3R7DA 4WPGA 1DUSA 3NTUA 1RQPA 2HI0A 2ZRDA 3D4BA 2OXTA 1VCMA 2GXQA 2I6QA 2QL7A 2TRSB 3R3JA 2ZBVA 2HA3A 3EXHA 1M1ZA 4C4AA 1JW9B 4HYQA 4B34A 2B0JA 2XW6A 4HATA 5DEOA 1E2FA 4QASA 5DTMA 4X7BA 2QJTA 3UMSA 2C4HA 1JR3D 1GPBA 2E1PA 2PSEA 2TMYA 4HH0A 4HVCA 4H31A 1FYDA 3ADCA 1VTKA 5H3LA 2WYIA 3V80A 3GV0A 4E70A 4RA6B 3F5SA 4LRTB 5CT6A 2HA6A 3CQ9A 1XDWA 1NXPA 2FSVA 1KK2A 2Q6KA 2FLKA 1BXRA 1QIDA 3F5DA 2QAGA 4Q18A 2EKZA 2PUFA 1QFMA 2VWHA 2FB9A 3OJWA 2PU5A 3VPGA 2WSYB 5JZMA 4GQBA 4UVGA 4I1OA 4BGDA 1JR4A 4B6RA 4JKIA 2F4NA 4ZIRA 4FSHA 3VPXA 3LVQE 1VBKA 1NVBA 2VP0A 4RVSA 4IDPA 2C77A 2X5KO 2A0XA 4WXYB 3QFTA 3OJFA 1U2TA 1UMBA 5J2UF 1YDEA 1XWIA 4KLCA 1WG8A 1I14A 2CHVA 4LMRA 2V9ZA 1D0VA 2FSSA 1XF9A 1QZZA 5IW8A 3T5GA 1DX4A 4G85A 2CT8A 4ZEXA 1E4OA 1QGZA 3A8TA 4JXZA 4J0KA 4BIIA 1A2OA 1QLHA 4K9KA 5GV8A 4KPFC 4Y9TA 1KPIA 2V5VA 2VUHB 3DWGA 1XNQB 1LEHA 4PS0A 3L04A 5JRDS 1J00A 3HRIA 3N05A 1IJBA 2LNDA 3HMQA 4Q3DA 4UFNA 4BL5A 3H11A 4GXQA 2BHSA 4HMPA 4B6OA 3GAAA 3OZEA 5YASA 4IL5A 3V1UA 1RPZA 5HTKA 3DXZA 2D0DA 3W8NA 2EHDA 2JAQA 1RABA 3LXXA 4H15A 2CJPA 4Y7CA 1N0HA 5JXJA 5LNK6 3K0CC 2OO5C 3IQXA 5I4BA 2JFHA 4K6HA 4MVJE 2OCAA 3M5DA 4F3YA 5FKJA 4BCCA 1SVIA 1IIBA 1M2OA 5KTTA 5KI6A 2OAP1 5IBPA 1NYRA 3MHPA 2OQVA 1J99A 1FFHA 4LRXA 2BKUA 4TTJA 1KZGB 2IYWA 3C6YA 1QX3A 2BM1A 3CBQA 3Q6MA 4DA8A 1MPTA 2PNFA 1SOVA 5K4GA 3WZLA 3NHPA 2FVXA 1CJMA 3OFSA 3CW2A 1CTQA 1YVDA 2P2SA 3QVVA 5AVRA 1M8JA 4BXOB 2X6RA 2NUAB 1T2DA 1QYDA 3D3KA 4RNDB 2AXEA 2CVFA 3BTOA 4WNCA 2ZWIA 1EH5A 2WT9A 3MVEA 3Q6NA 3R3ZA 4KN6A 4YAIA 2BEKA 4O4HB 2VYVD 4EO4A 1ODFA 2VHJA 3KZKA 1ZXXA 5A7HA 3KKNA 5E3IA 3CNOA 1BU8A 2QQEA 3CXUA 1XR3A 4UASA 1USGA 4WOPA 1PDOA 1M8FA 2QLLA 2HMWA 4RDIA 1ZUD1 3W9SA 4AC9A 3N8DA 3ED1A 4DLPA 4ENPA 1MVNA 2LZ0A 3GFPA 5TB5A 1JQKA 2CUNA 3MINB 2CMHA 3K2EA 2PMFA 4ZEMA 5JASA 2WMNB 3QG5A 3TD2A 4IUYA 4MKZA 5CVCA 1CY8A 1OJ7A 2VXOA 1AXRA 3MG9A 1OASA 1A9PA 4WOKA 1EB8A 2RIPA 1VJGA 4A6DA 4M21A 3ZI4A 4ZKDA 4WBSA 1VL5A 3SHOA 2F8TA 1ORRA 4BTVA 4B4KA 3N7TA 3SX4A 4P4UA 1I7LA 3O95A 1S2OA 5DYGA 2Q9AA 3REOA 2CDRA 1V8PA 4FYPA 5BN1A 2DBVO 2AMYA 3RSLA 3ZZNA 1KP2A 3KT3A 5TQJA 4BVFA 2P4SA 3L1IA 1Z3IX 3JR3A 5A4IS 1HE2A 1US8B 1NW9B 3IVMA 4EPYA 2YVAA 4N6NA 4EFLA 3CLHA 1HE4A 1KC1A 1ORDA 2YDYA 1HE5A 3ZTWA 1ONBA 1GSOA 1DC4A 3Q2OA 3DDNA 4R16A 4N6OA 1Z2PX 1Z15A 8ABPA 3HVJA 1GZ7A 1T6NA 2K87A 3B5EA 3OT5A 4J43A 4ZZ1A 3GBPA 3H2ZA 4ZAVA 2HU8A 2RK4A 3MMNA 3HYSA 3B2EA 4UQOA 4XJVA 1U0TA 4NYIR 2V6GA 3FBTA 3R3VA 2AVNA 2H08A 1U2PA 4TL9A 1FP4B 1XQ6A 1O2DA 1NBMA 5HOEA 3EGIA 2W4QA 1PEKE 1K8YB 1N5LA 2JFQA 3LC7O 3MJHA 4MW6A 3EXAA 5AHOA 3PDHA 2V65A 2PUCA 2BTQA 4G41A 4I9NA 4INPA 5KWJA 4ZVLA 1NBOA 1T1SA 5CIYA 1AKEA 3LC0A 5DGHA 5BVHB 2IYFA 4U2EA 2O6HA 2DJ5A 2JJ2D 1WPGA 8MHTA 3VR2D 3NEAA 3KAJA 4QE3A 3JR7A 1NVFA 3B53X 5IABA 1JFLA 2C54A 1O6CA 4KIWA 4ZU3A 4DA4A 1D8AA 1EE1A 1Q7EA 3MAGA 5AVTA 3UFXB 3TLBA 1DCTA 5LZ7A 1GPUA 4ZPXA 5B36A 1HTTA 4LZLA 2Y27A 3OTIA 4XWKA 1KOLA 4JYBA 3KQQA 1JJVA 5AKJA 3GRYA 1BU5A 1QYXA 2PWAA 3H2JA 3DAOA 4Q6WA 5AT1A 1E1QD 5FJIA 4NCHA 2FPWA 3WYDA 3QENA 2E3JA 3U44B 3H2SA 2O7SA 5HZGA 3CUKA 4C0WA 3JWPA 2AT1A 2YV3A 2Q21A 3N8GA 4TS4A 3HDVA 1Q3TA 2R6ZA 3IAM1 3RO7A 4E32A 3KQLA 3ESAA 1CG6A 1G4HA 1IXRC 1JHRA 1HPLA 3E0XA 4KRFA 2VDMB 1KY3A 4GOOD 4YNBA 2AJDA 3L6CA 2UZ4A 4F45A 4F2HA 3TQTA 2XWJI 1C0IA 1LZKA 4W5HA 4U1RA 3UGJA 2OA0A 5AESA 2OGWA 1YZVA 2BEWB 2WWHA 5G0UA 3SSAA 1KNXA 1PKXA 2OTCA 2DKOA 3O4FA 5JDIC 3BHMA 3SSNA 2VZLA 1U1IA 5HZHA 4HGOA 2ZPTX 3OPYI 2XDQA 3QA9A 2Q5HA 4DCCA 1RYFA 5CB4B 3N3BC 4KJXA 2F3TA 1AB6A 2G07A 2P5SA 3A1EA 1Y6GA 1BA3A 1F5NA 4O63O 3OMXA 3U9LA 1OYWA 3LUKA 1GA6A 3QJGA 3W8FA 4EZIA 4DRZA 2ZCUA 2QL9A 4PLGA 3R7WA 1S3IA 2ZU0C 4YMLA 4YCNA 1ZSVA 1MJNA 5ALGA 2JGLA 2VQ6A 5EPOA 1YFLA 1RI5A 1EX7A 4PRZA 4TZ0A 4AKSA 3U60B 3FCSB 1IQUA 1L5NA 3WWZA 3FLEA 5TDHA 3VTZA 1ESMA 4WUTA 3BWDD 1QF9A 3MCVA 2Z58A 4KKVA 3NKVA 1Q0HA 1XQWA 1MABB 2QAGC 2BGNA 3BL5A 4JSTA 3LQRA 3FVTA 1W96A 3KFLA 1FNNA 4I6EA 1TMGE 2QYSA 1GJRA 2ZJFA 4GZMA 1R16A 1XPRA 4F6RA 121PA 2GZ3A 2JI6A 2SKEA 2A92A 4H0CA 1B00A 4OBXA 4LXXA 1DWPA 4QNRA 5BNTA 2JCBA 1D5CA 1CIVA 3BQNB 4DEVA 3TZ6A 1T1IA 1U8CB 1IUKA 1F2DA 1QIGA 4OQEA 2J46A 3MQ4A 5BW6B 4HZIA 1PFQA 4F5ZA 5T67A 3OIFA 4IDAA 5EJ5A 2O2JA 3PUYA 5AW5A 1JPVA 1EAMA 1MRZA 4HQKA 4IBOA 4JQSA 4PSDA 1SOMA 3FTDA 3H1PA 1QWOA 2NO9A 5DWVA 4M7RA 4H08A 4NENA 4V24A 4BZXA 2V1UA 2RSLA 1WDMA 5C4GB 4E33A 2P75A 1Y3HA 3DZIA 4OVKA 3GEGA 5AW0A 3IPRA 1Q1ZA 1JVBA 4EG5A 3TMAA 2J1LA 2I2XB 4NCKA 5F12A 3UQZA 4A4DA 3OCYA 2QTNA 5IXSA 2J3HA 1D4ZA 4G09A 4EMTA 4GLLA 1FYVA 1PO7A 4KAFA 2AE1A 4DXHA 4F97A 3IBCA 1WLSA 2D4AA 5ALLA 1PYOA 3LQ4A 4OL9A 3WAKA 1TCBA 4AQ7A 2Q4DA 1LX6A 4D81A 2HW8A 2QD4A 1AUPA 2IYSA 1P5JA 2P2YA 2OXIA 1RVV1 4AG6A 1M6NA 1IHOA 2ZT6A 3VR4A 5B6IA 2CFIA 1E6LA 3P2OA 3T1YB 3E6AA 4IUCS 3DVQX 5B6JA 1IUPA 1EWVA 3B5IA 3BMXA 1UPCA 4BX9A 4H7JA 4EENA 4BVJA 3KE8A 2AYYA 4OY3A 1WW2A 1UT5A 2ZWAA 3SM3A 1H23A 4LJ6A 4UJ5A 5JNWA 1SKBA 1XTKA 2FA9A 221PA 3X2EA 1J24A 3DW1X 4EMSA 3VU3A 2XT0A 4HN9A 3HM9A 3T5BA 2E0IA 3KT0A 1W5BA 4H16A 4PZZA 5CYPA 3GU3A 1ULAA 1U1CA 2IDJA 1CJTC 1EFVA 1O96A 2QUAA 1COWA 1JZSA 4I7EA 3CE9A 3TRKA 4A2CA 2PZJA 1P6UA 4FZ3A 4S3MA 4RULA 4X65B 1GTL1 5JSZB 3OUUA 2JZNA 2NTEA 2G1KA 4PLTA 5B3JA 1VKOA 3KQWA 5KC9A 2FPSA 1QB8A 3RSGA 4L9RA 3D1LA 1C3JA 3LPCA 4HDCA 2DLNA 4L0DA 4MRVA 1G8GA 1FFGA 1I3OA 1USVA 5T4HA 2QX8A 3BM5A 1XEAA 1KMMA 4W99A 3AKDA 2D2EA 2JIOA 4AZWA 4J2OA 2JFPA 1NU6A 5C46F 2V7GA 4OK5A 5D8DA 2Z2KA 3P9XA 3TEFA 1AZWA 3MTEA 3PFCA 4GUDA 3IL2A 2R1TB 5AOAA 4PN7A 1U1FA 3V34A 1KAQA 4CBVA 2I29A 4MWEA 3WC4A 4CLOB 1HTWA 3ETLA 1D2GA 4UHEA 4HDQB 3R7FA 5FTKA 3IDZA 3OZCA 1XTQA 5DO9A 2QRKA 2QTWB 3E7DA 1H1DA 3F9RA 4ZVNA 2W90A 3TZLA 3WKCA 2WD8A 3DP7A 1AOXA 3EGDB 2ZWMA 1BH6A 1JAIA 3NIWA 3T4EA 4FB4A 2VNHA 3HCNA 2ENWA 2GCOA 1C1HA 3L7LA 4YMSA 4L8GA 5KDOA 1O87A 2YYSA 1UAGA 3UHPA 4E1VA 1YUNA 5D3MA 3T9AA 1XD8A 2H31A 4FHFA 4LYFA 4OQXA 4AMYA 1PBTA 2YH2A 4YUWA 1BWSA 4UUQA 2I33A 4FDUA 3ZS9A 4RK4A 1W19A 5E7MA 1T0BA 4Q4HA 1OX4B 1AQJA 3THXB 1A4XA 2IS2A 3OQPA 4KN9S 1AZTA 5D84A 4QBGB 5EUBA 2NP7A 1UBOS 2ZT8A 4DLWA 5K20A 3UC5A 4Q1CA 3T7DA 3ZE9A 1YS6A 2B2NA 3FVRA 2O8BB 3KEQA 2COEA 5DW3A 2ZI4A 1P9OA 2R84A 1W88A 5EHZA 2GTIA 1BOFA 3L8MA 1PZXA 1U2GA 1H94A 1PX2A 2FI1A 3KC2A 4XWGA 1ADCA 2BI4A 4HL6A 621PA 1C0KA 4YAUA 5TT1A 5EJ6A 2Y0PA 1AHNA 1CJSA 1PHPA 2DRIA 5AK4A 1TM5E 5C3UA 1QIJA 4Z1MA 1CFZA 1N3YA 1RYEA 4K9OA 4W5TA 3GGSA 4W9RA 5CYOA 1JG2A 1XKTA 1MHTA 3IT0A 1A8UA 5J5VA 4ZGGA 2I9KA 4W4TA 5KJ1A 1ZI6A 3H19A 3Q1KA 5CPFA 4B35A 4CF3A 2GYYA 5LYJF 3QY0A 1QHHB 4WI1A 1QHNA 3QUBA 5FBWB 2I6GA 1GGMA 2X6QA 2KB0A 4HNAB 2GHQA 2L19A 1WVMA 2XOEA 3B9RA 3VPSA 3MHTA 1ZD9A 2FWAA 1D0SA 4M1EA 3VH3A 1V8OA 1AKVA 3GDGA 1KY4A 5TVKA 4P82A 5L4SA 1ZX1A 1KS2A 4YMVA 1Y6ZA 3JSXA 4E6EA 1Y9AA 2HCFA 3QWHA 2J4CA 4JL6A 5K09A 2F1OA 2ZAOA 3UAZA 2QMZA 4YUVA 2YL2A 4B4VA 4BO3A 1Q7TA 4YXWD 2J33A 2PA0A 3SS8A 1FFDA 3VYVA 4NBWA 3Q3VA 4ZOBA 1TUEA 4CHTA 1NP7A 2C0CA 1NUTA 4HTFA 3BBLA 2Y99A 3BGOS 2Y0CA 3L6OO 4I46A 4WY5A 5HG0A 3RF6A 4KO4S 1X0VA 2RGXA 1UMBB 1C4KA 4GR4A 1I1QB 1ZONA 4D3SA 4C88A 5JS7A 1UDXA 4YLEA 1KSHA 2O19A 1QV6A 1RWXA 2C2WA 4MZXA 4XYGA 3QI2A 5EXPA 1ACJA 4BNUA 2J3MA 4ZP1A 4GS5A 4ZHSA 2X3UA 1SQFA 2X4GA 4P4SB 1U2RA 3GGDA 2JFVA 3M5PA 4MHOA 1GPWB 1N6KA 1WULS 3UHAA 4YQFA 3CSDA 3DYBA 5DHPA 4E08A 4K6OA 2YWRA 5CEEA 4LUCA 2CDAA 4J0GA 3JVEA 2NO4A 1ZN8A 3KXKA 3T5MA 1T6XA 2OCXA 3TJRA 1SC6A 4B3GA 3PXEA 3TE6A 3I37X 1DEOA 4MKHA 5C32A 1PWHA 3P4UA 1L3CA 4G0QA 4TYNA 1YDFA 4EA9A 3G0BA 2HTFA 3IXQA 2DU8A 3IYLW 3ZHBA 1E98A 1H4QA 5BSRA 2ZYWX 2BH9A 3EY9A 2G70A 3TLJA 1G5IA 1A5AB 4PYRA 2VQSA 1UJ5A 3IP3A 1M2VA 3PD0A 1V9SA 2GPBA 1PZMA 2PWPA 5DJ5A 3RVBA 1Z8HA 1ZW1A 2TMDA 4AL4A 2G0TA 1PEYA 3L79A 3FMIA 5JATA 3HS3A 1I30A 1OX5A 3A1VA 1UXHA 3PQ6A 3CLRD 1HFJA 2AEMA 4M1OA 1XAIA 2DSTA 2HLNA 2JK0A 1UFOA 2W22A 4A2WA 5KSZA 4EDHA 3RYFA 4IZ6A 4NWIA 4U02A 5AJXA 1F0YA 3MC1A 2QW8A 2GN4A 3TW6A 5E2AA 3PGVA 4H6WA 2FOLA 3OEED 5CJPA 2NZVG 3CRQA 3H0KA 1NY6A 5JWHA 4DN6A 2VAWA 3T3EA 4LDRA 4JDPA 3VOSA 4MW1A 5F51A 3AUYA 4QFBA 1I33A 3K8OE 2ONCA 1UBTS 2XY4A 3L0BA 3CNQS 4IIVA 4NAVA 1EHIA 1SU8A 5AUPB 2WTAA 3ZKWA 2BISA 1VYHA 4CKWA 1VG8A 5K6AC 2FZKA 2IUFA 4N40A 3MJEA 3JWHA 2P6OA 3G8DA 1FVXA 1PFKA 3NFRA 4X44A 3RIMA 4YT4A 5LIPA 4KR3A 3KR9A 4RL6A 2A59A 4FGJA 3DGFC 3MXOA 1QYRA 4BWVA 2Z56A 1TMKA 1UBUS 2FPGA 4JYAB 4H7HA 2GESA 1HDOA 2UYHA 4URWR 2QXYA 5JCJD 4QFDA 2V7PA 4CTMA 1DAOA 2PX6A 3E8SA 5EQFA 5EMJA 2HMSA 3DZFA 3RJMA 1EP9A 3S44A 3KDAA 5GOZA 2CJFA 3CTPA 2CFRA 1I4TD 4FR5A 3KSMA 4MQ6A 4PGAA 3R7AA 3IRUA 1Q12A 1JNXX 3ZHZA 4A92A 2FCRA 1WBJB 2QGFA 4H4DA 1RZRA 2HO5A 5EJFA 2G9NA 1A71A 2XZLA 3NC1C 4YJ3A 3ZU4A 1S02A 2BFEB 1MAAA 2QNBA 4XIIA 5B3JC 3W04A 4NDAA 1U9IC 5KYNA 1FE8A 1FFEA 1LDMA 1U94A 1HLDA 1XJ0A 2RJOA 3FN4A 3NAZA 3ND9A 4HDNA 3K9CA 2BGLA 1SC9A 4WKBA 2OAGA 1J21A 3RJ5A 3K70C 4BAZA 2OM2A 1NP6A 5GADl 3QBEA 3CXRA 3O94A 1CUCA 4EI7A 4OHZA 4G84A 4PTZA 5IKXA 1K75A 1CUGA 4Y6LA 1Y3FE 4RK0A 5T8KC 3RVOA 4BMCA 2Q5CA 3LS2A 3LY5A 3EVNA 4EL0A 4R9VA 2A94A 2V54A 1ZSYA 3WYAA 1B16A 3PR2B 2W43A 1C4OA 4CV2A 1NVKA 2DUJA 4ZRMA 1XAGA 4S24A 1QH9A 5KAMA 3SS7X 1X38A 5KVVA 2O0KA 4YXFA 3ILHA 3HYTA 4IMRA 2BBWA 3GEDA 3TPFA 1V6CA 1CPYA 1JIVA 4XWOA 1JHVA 1KI7A 5AUQA 5TNXA 5ED4A 1IOWA 1GG5A 4GYYA 4YJ2F 2Y1KA 3BIOA 3CRVA 3AILA 2WSLA 4EECA 5DE3A 2WWTA 3TLEA 1MF7A 2ODEA 2QV0A 3PDIB 3C16C 4LWZA 1EQ2A 3WLIA 1P73A 1D6NA 3SI7A 4WV3A 4DHEA 2H9IA 5INTA 2JAXA 2ZK7A 2NTNA 3G1WA 4X0EA 3QWIA 2VA9A 2ZJZA 4XH9B 3UJ7A 3IX7A 2CMDA 5KMGB 3RE1A 1Y81A 2P9GA 1W93A 1VI6A 4ZHQF 1H5UA 4C6TA 2PTHA 2VSOA 4GBED 3UXMA 3ETDA 2ZYTX 2X4IA 3AUUA 2H1CA 2OWDA 3QTBA 1U8TA 3MSXA 3K5HA 4Q12A 1WB9A 3AVUA 2WJHA 2O2GA 1S4QA 4H77A 3ULKA 1HY3A 1MLDA 3AF5A 4FHDA 5EJMA 3D8SA 2DFTA 4Z54A 2PRKA 3KU4A 4GPD1 2FR8A 3CLTD 4K2HA 5CFQA 1Q16A 5JAOA 2R6DA 1PUJA 1WR8A 1ID8A 2NV2B 4ALMA 1DKRA 4LFCB 4EB3A 3SQOA 2ECQA 2VDKB 1S7CA 1SA0B 4MS4B 4CLEA 1FDIA 1L1RA 2BHTA 3B3GA 4G65A 3THSA 2WTUA 2EEPA 1QG2A 3Q0IA 3RCBA 2C92A 4IH4A 1DX6A 4GICA 4D4KA 3IO3A 2XMGA 3L8CA 5C8VA 1II0A 1OJLA 6LDHA 1OBOA 2ZTUA 3PFIA 2BGJA 1Q3KA 4I1UA 4ZVKA 5A6SB 1FJXA 1IU9A 4BNWA 4PYQA 1YB2A 1T8YA 5IDQA 3E7XA 4B3DA 2FSPA 2ADMA 1VIMA 3LXRA 3RLIA 5FLXA 1ZFNA 2PV7A 2XYQA 5K99A 4DL9A 2DTXA 3A6FA 1OOEA 4NC9A 4BO2A 3D6UA 2H7YA 4KXMA 4LX8A 3WJAA 2ZCJA 4GPTA 3K2BA 3ZZMA 2V6JA 4JS0A 2W6JA 1XMQB 1RRMA 1LRJA 3GIWA 4U3JA 1GRVA 2E48A 1H3FA 2JVIA 3N76A 3K53A 3RFTA 3HZOA 2PO5A 1PJRA 2R7MA 3JSAA 3UCEA 3WV4A 5JC1A 4N7BA 4Q03A 3B78A 1RADA 3AKCA 2LCQA 1R12A 1Z9BA 1LSSA 1DAEA 2EOAA 1E66A 2X8LA 2YUIA 3C3XA 3EFEA 4GO1A 5FPQA 4JUBA 4EHDA 4OQYA 4RMJA 3UBTA 1B42A 1B8UA 2GMWA 2WIBA 1SBYA 4OH1A 1NJSA 1K98A 4MUKA 1UOQA 2Q4TA 3ANXA 1O54A 2FWPA 2VSYA 1OPRA 3G2QA 5K0LA 1Y4DE 5LMCA 1JE1A 1IBKB 2W2XA 1IIRA 4EGQA 1HC7A 5B7NA 1KBOA 1M33A 4F8YA 1CEYA 2FYTA 1XYYA 4TMKA 4FMDF 2L18A 3T95A 3WO0A 1TUGA 2ZSFA 1F6DA 2P2LA 2ZR7A 2IDMA 3B1VA 4JB8A 1ECLA 4MQMA 1R37A 4IH1A 3AW9A 4KR2A 1RJDA 1YHZA 3QLUA 4MCAA 1I2DA 4FSXA 2IF2A 4J7UA 5IMBA 4CKYA 4ERXA 1BMQA 3Q7RA 1ZL2A 3QLTA 4OP2A 4QXMA 4KMOA 4TN1A 5KYUB 1XHFA 3ZDFA 2L42A 3G88A 4KTTE 3SZRA 1Q0TA 1L4HA 4G4SP 2CMKA 3U0VA 4UU1A 3VYSB 3R9XB 1NJFA 3IOBA 4PLCA 3MQFA 4LHZA 4KDFA 3UGQA 1SR8A 3RV3A 5HMLA 1T8WA 4E46A 3BK1A 1RMTA 5F33A 1NUSA 1DAGA 5CEFA 2H4ZA 1KR5A 1ZSNA 1IJFA 4PSUA 2RCNA 4KU4A 3HJCA 2OENG 1OZHA 5DGTA 5LP6C 3ILSA 1G8SA 3A9SA 4LQCA 4YMIA 4Y6GB 2IH4A 3OD5A 5FEMA 3TECE 3SZUA 1N3LA 2Y71A 4DEXA 1R6VA 4OXKA 3RBAA 1USKA 2C00A 4KX5A 3RWBA 2H2GA 4HVAA 4CMKA 2B1JA 4DMRA 3KXDA 4Q7JB 3FCOA 1GV1A 3FSRA 3VRHA 2ASEA 2AD1A 1FYFA 3CEPB 4AZSA 1DQYA 3DBLB 4OM7A 5AYVA 4N3CA 1U11A 3ADKA 3BX1A 2F7SA 2C94A 2RJNA 3G0HA 4C4TA 1VXRA 3DKVA 4UULA 1QYCA 4ZYLA 1KC3A 1OI2A 3HKBA 3A58B 4B43A 3HJFA 4QL3A 1UJ2A 1E2EA 2X14A 4U5XA 4XFKA 5HKKD 4GP7A 1OFHA 4S04A 4URZR 3B3QA 3CKMA 3RS8A 4B6FA 1XX6A 2HK9A 3AYZB 4HDKB 4YUXA 1E3QA 1UOPA 3LQYA 4UUOA 1YOVA 2IVZA 5B6PA 4FFSA 2EX1A 3UMFA 1SKYB 3ROXA 1G63A 1JEQB 3ZQKA 5BW8A 2P77A 2V97A 4QUAA 1O4WA 3GZ4A 3O91A 2ZRQA 5HIKA 5A1JA 2B37A 3FJYA 2XCOA 3HN2A 3RIGA 3VI4B 5A5GA 1KQGA 3C3CA 4ZALA 3IKVA 3QIVA 2YIMA 4KXYA 2VTDA 3ZWOA 4J0IA 2CMFA 5TXGA 1YZKA 4MQLA 4CLDA 3HADA 4N82A 2GX6A 3JD0A 4DSUA 2HJVA 4GKJB 3KL4A 3AESA 1SCAA 2G5CA 1DT3A 1RI3A 2OKCA 1XQXA 1B1CA 5KIAA 3KOXA 1CY1A 1ADBA 4U7WA 3R40A 2EKLA 4RBNA 3PNQA 1RQXA 3C6QA 4M4SA 1CETA 4XD7D 2WILA 1V11A 5FOUA 1ZA1A 1AO3A 4PC3A 3DL0A 4GPAA 4W9NA 1PU2A 4TT3A 4DDWA 2Z5LA 3DYVA 2OLJA 3SQNA 2WZQA 3FPEA 5JC8A 1HFKA 3TR0A 1T0JB 2GOYA 1KMIY 3IJ5A 2FUCA 4JUDX 5EKSA 4ADSG 2J0SA 2ADOA 2V58A 3J81A 3I01M 3P5BA 5EKDA 4FCCA 4LHWA 1FRNA 1R0YA 2Q3EA 4ID9A 4YP7A 3AFNA 4B7CA 4DNFA 5DX8A 4BJ5A 2D8MA 2ILTA 4Y1RB 3PG5A 1IVNA 3Q3IA 5HJ5A 3OEHD 4KOAA 2AJTA 1M2WA 1MJGA 3LSTA 4OAQA 1RI2A 1MD9A 5AXBA 4ZZ2A 5TSDA 4V1CB 2XE6A 3H8WA 5IT9A 4IQGA 1DJPA 5K0ZA 4WJZA 5BYAA 3LBYA 5FORA 5A2QA 4J07A 4OUDA 4R9SA 5ICGA 2ZE8A 1CP2A 5IN4A 2QQGA 4ZN6A 5T3YA 3HA3A 5EUMA 1E2DA 1GG9A 1K2VN 1QV7A 1OHHA 3IPYA 4BX0A 1XVIA 1CC1S 2QN2A 3WY9A 2DLCX 1E2NA 1G0NA 2YVKA 1CUSA 3FDJA 4KPUA 4URHA 4YMGA 3KDPA 2ACWA 4G1MB 4A6XA 2JAPA 2V98A 1B1AA 2GAAA 1A7UA 1XL1A 1M2OB 2EP5A 1ODLA 2N9UA 2WJ3A 3GHHA 1E2PA 2Z04A 4PYOA 4Y9UA 3TIIA 5C80A 2CXXA 2FJUA 2RHRA 1KEVA 1QX4A 2WB2A 3EX7C 1XBTA 3PJEA 4BFSA 3EEOA 4BJ3A 2ZW9A 3TUJC 3LX4A 1AT1A 3EZ6A 4HTFB 2DETA 3DEKA 3SE7A 4U6NA 5D5QA 1TF2A 2ZVPX 4NFHA 5ICCA 1YS9A 4OLHA 2IOQA 4PBRA 4EABA 4TROA 3D59A 2NGRA 3NI2A 1Y8RB 2CXTA 3M4XA 3SC3A 3KLBA 3V1NA 3E53A 1CD5A 1Q74A 5T6MA 1BWRA 1NA5A 1L6IA 1Y98A 3ASVA 3COPA 3NTLA 4IEEA 4JU9A 1GTVA 2I71A 4AO8A 1JAYA 2GM5A 1KEUA 3LDFA 4LJ7A 3REQA 2QY9A 4BFCA 4NBTA 1L7VC 4JWTA 2YNMD 3NNNA 4FW8A 1E2BA 4M1SA 3OM9A 4BRSA 1TIPA 1QJ4A 1O9GA 2W00A 2AW3A 3TPCA 3FF4A 3IHKA 1FPQA 5CA0A 3FWYA 3DH0A 3RTAA 1PR3A 5CDFA 5AVVA 4D43A 2I87A 1SIBE 2YHBA 3SZOA 1A5ZA 3GX1A 3OJLA 4P6VF 1MNAA 1J0CA 2CHQA 2QLMA 3EXG2 4XUGB 1M34E 1TRHA 4G9EA 3MOSA 2AZDA 2UUAB 1FTGA 4RE6A 1WDWB 4PO8A 3DVAB 3ZHTA 2OPBA 5L6LB 3CVXA 1G8AA 1T2NA 3CJTA 4ES6A 5K8CA 4G0VA 4EYGA 5JFOA 1BMTA 1VOTA 3A6DA 5TV2A 5JALA 2BGWA 4RF4A 4QT4A 1A1VA 4WK2B 2RONA 1SB8A 2FMFA 1FS5A 2IGBA 1L0BA 1VHWA 3AH8A 1OC4A 3DEYX 4PLWA 1LTKA 2IEYA 1TD1A 4UTRA 1NFRA 1EBBA 2DMRA 1O94C 2C9MA 5I8ZA 1QDUA 3UAGA 4X1YA 2FPMA 4KYVA 4MA4A 4FFVA 3AB8A 1KE1A 4AKTA 1IDOA 1JHYA 1MOPA 2BGKA 1Q2XA 2PR2A 4NDNE 4YUAA 2VP5A 2B4RO 1DG1G 3JD2A 4NBLA 4UU8A 2CV0A 4LZWA 1T3LA 4B2YA 2CUTA 2OAEA 3LFTA 1CHNA 3OPQA 1EG2A 5C34B 4RWZA 3GH3A 3PPWA 4DA9A 4KGXA 4YJDA 5JYBA 3WLOA 1G42A 4L8YA 5DX0A 3PVZA 2G28A 3PXCX 4J3JA 1FFAA 5JEEA 4UREA 1EBFA 1C4WA 2AFHA 2IYXA 2XNJA 2XTNA 3G5UA 3WGGA 3L05A 5I9LA 4AF8A 1WZIA 2QPLA 1WZCA 3CKKA 3DMYA 4RVDA 5FYDA 1ZR4A 4QUGA 1DEKA 3VVCA 1QUEA 1XAJA 3DVSX 1O8BA 1NKTA 2EX0A 2QQ5A 1FRFS 3DLHA 3IOEA 1VHQA 4J16C 1NF2A 4JVNA 2XRZA 4I1SA 1X1QA 3VHXB 1U2DC 3ZWAA 3DJFA 1NONA 2XEXA 3JW8A 1Q0SA 1M75A 2XSZA 3SYTA 3G6WA 3CUYA 5FL3A 1DUIA 1K92A 3T5AA 1PV1A 1UQUA 3RVKA 3BSSA 3QUQA 4P53A 5EMKA 2BYTA 3TTSA 2DFKB 4FW9A 1ZH0A 2GKGA 2PYDA 3H9CA 3LL4A 3SYMA 3DA8A 3NVAA 5F3DA 5BORA 2O1EA 4BKRA 1FJGB 4NY1A 4UHJA 5DLYA 1WW8A 3UT5A 3TFOA 1Z6PA 4QQRA 4EIWA 4RK7A 9GPBA 4YV1A 4QRHA 1GEEA 4HDNB 4IDGA 4AMGA 2W2MA 3TSCA 2O1SA 1LPNA 2ARKA 3O8LA 3SYNA 1J0BA 3O8RA 3LTNC 2YIJA 2ZR9A 4AJPA 4FC7A 5I4IA 4QYIA 2ZYSA 5ANRB 1JDTA 3H5TA 4GMFA 3VR3A 5KQLA 2AFRA 5D87A 4HEA1 1P1FA 2R4UA 5HKAA 1EDOA 2X0RA 4R1LA 1R9GA 4FFOA 3W7AA 5B2EA 5AVXA 3KPWA 2WJZB 1QUFA 3MWEA 3VU0A 1RCTE 1KZ1A 1NOIA 3KXIA 3R7WB 1NR7A 1XMPA 3U5ZB 2HK7A 3Q5DA 1NG1A 5MGBA 5A04A 4YXWA 4YYEA 4BQPA 2WOJA 5HE8A 2WWVD 3PXUA 1YRHA 3T7CA 2GR9A 4GPBA 2C2XA 2ZTHA 1V9LA 2EP8A 4MP3A 4CMJA 4TYYA 2WF5A 4ZMRA 4B3IA 3B1ZA 1IVYA 2GBGA 5E95A 3QE3A 3TX2A 2WPDD 4R9RA 5EJ8A 1GDTA 2FZ4A 3DTVA 1XPOA 1XZQA 3S70A 1E7YA 1U0LA 1RYMA 3MRVA 5H7XA 3H16A 1IZ0A 3ESCA 5FULA 2IE0A 1QQAA 2GRAA 3SZ3A 3F3YA 1S89A 1RE0A 4F6RB 1SUPA 3I23A 3CJRA 4MLCA 2WU0A 4B85A 1CR0A 4LHSA 4C6TB 1TEZA 2HIHA 3LT2A 4BU0A 4CCYB 3HLTA 3LHKA 4FYMA 2C8LA 2WJ4A 5E8RA 1E9RA 5LIRA 2FPXA 4L2IB 3ZNNA 3RQSA 1Y37A 1ULSA 4H3KB 2Z3ZA 3EH2A 4OXYA 4PZ9A 2KBEA 4PINA 3ZWPA 2W6NA 5IAGA 1KKLA 1UMKA 3LY8A 1QOPB 5IF9A 4TMTA 4HFMA 1RPNA 4I5DA 5BVGB 3UUFA 3GUHA 2QL6A 4MULA 4JMPA 3MD9A 5F4BA 3CEAA 4QO7A 5A3JA 2X15A 2OESA 2ZUVA 4MS4A 1R5OA 3CRMA 1RYZA 3MBIA 4NU8X 4WK6A 2Q07A 3VKWA 1RU3A 5JPCA 3MLEA 4GRIA 2BTOA 4C0LA 3MT9A 3U09A 1P2SA 4AJ4A 2QF7A 1DCKA 3S5UA 5IZ4A 3WHKA 1FRQA 3KEOA 3PTLA 5G2OA 4X3CA 3LOPA 1VB3A 4J9VA 2VTBB 4RORA 1KEKA 3C3JA 3QFSA 3X1DA 4ANFA 1WKVA 1T36B 3KR1A 2DT8A 4F1WA 2EWMA 1NXVA 3D8UA 3V4LA 3UHOA 3KKLA 4PSKA 3W9UA 1HL7A 2ZI5A 1P2GA 2HT6A 3KZXA 5EGNA 4DRXB 2YZKA 5CDSA 1OWLA 4AW9A 4BMNA 4IXMA 4OK3A 3I2FA 4COKA 1LLQA 2BE9A 1PZHA 2FPIB 4GF5A 2VJYA 4JASB 5T5QA 3DBOB 2GPYA 3ICQB 1I4WA 3MRTA 3DO5A 4LNHA 4EI9A 2XZPA 5ALNA 1KFCB 1W1WA 3LCRA 3FHLA 4MWOA 3SYKA 2FR8C 4EHAA 2OEPA 2XNSA 3W77A 3GJ7A 2NSDA 2UUPA 1ULZA 2JCYA 1HDRA 1ODTC 3OCCA 2NN3C 2Y2UA 3ZV5A 2F9LA 2O3QA 1J07A 4HFNA 1MW9X 4Q02A 2GD2A 3M4YA 3CZ5A 4OX9B 2ZRMA 3VJLA 3ABIA 1DXHA 1C7EA 4IS3A 5CVEA 3KM0A 2H2DA 3LBNA 5I3ZA 4M37A 1NF3A 3LO5A 1BH2A 2O2ZA 4G36A 1OIXA 4AP6A 4Z4QA 1ZESA 3QMMA 5IANA 1ZGZA 3EC2A 1ZD2P 1L3IA 3KD3A 1GT6A 2ASVA 4Y6RA 1ONPA 1R8XA 4RYDA 2VS1A 1TI7A 3K0KA 3G9UA 1XALA 5JJLA 2QVZX 4BYMA 4D6YA 1D5WA 5M7EA 3FCUB 3PC4A 2YW9A 4IDBA 4QZVA 4MUMA 5HQ3B 5JH7F 4F5EA 3WOHA 3KUDA 1C2TA 1S0UA 4KIUA 1TYDE 4R1QA 3SIPA 1N3BA 3RUCA 5M04A 4HDSA 4ZQHA 2NZ8A 1A7KA 1TJNA 3ZUPA 2J5KA 2OR3A 2PUTA 4YCLA 5C81A 2VDUE 3GVCA 3AF4A 5U1PA 3H84A 1M72A 4R2JA 1RJGA 3L7YA 5J1TB 3PKIA 2O3JA 4UCQA 3ZJ4A 4D6PA 5AI9A 2V7EA 4EB0A 4YAGA 4G25A 4YR9A 2GUWA 1BE6A 3IODA 1DBQA 3I0MA 2NXJA 4X6LA 4HLNA 2AFHE 2QZSA 5F7OA 1T1JA 2EG9A 2JL1A 2ZRNA 3NYWA 3TCXB 4BQSA 3HL4A 3C7DB 4D96A 5L7YA 1P1KA 2P1DA 5G40A 3BAFA 1SQSA 3P0JA 4EVIA 3D3WB 5H59A 1DAHA 3RUFA 4U6QA 5DT2A 3CLVA 3ROKA 3ZCXA 2X1HA 1SOWA 1TQ4A 1UJ4A 4FZJA 1UR5A 1E5XA 4XGNA 4W8GA 5AVSA 1CNMA 4QJ4A 2YMMA 1FUUA 3L49A 3ONNA 4WZAA 4EELA 4KMRA 4EPRA 5B4UA 3L0ZA 3L8ZA 1ILEA 2O3RA 2GQ0A 2TMGA 1IBRA 2JLBA 3SJAA 3LL7A 4IYJA 1NZJA 1NQXA 1ZN2A 2C95A 1URPA 2EGUA 2WKRA 3CPJB 3R5SA 2P3SA 4YCBA 4JBYA 3MCZA 1XRQA 1E8NA 2GXSA 3CYFA 1BFDA 1NSTA 5FBKA 1GRNA 3HJRA 4U2GA 4RTPA 4LG1A 3S29A 4HQ0A 5EWMA 3M6IA 5JMTA 3ABRB 4B73A 2JARA 3C6MA 1JEQA 3WK4A 1J42A 1G16A 2HMTA 1RHQA 2ZIVB 1M34B 2A67A 5JCPA 2J32A 1ZWKA 2H7CA 1A5SB 3E5NA 4NHOA 4J49A 1GKLA 1RIFA 4G5OA 4KYTA 1Z33A 4AY4A 2XNKA 2CZCA 2IIBA 2ZYIA 3PUJA 5IXYA 5MF6A 1KDTA 1TD9A 3NWBA 1JE0A 2DT5A 3LUAA 2HA2A 4GDFA 1BE8A 3SK0A 5K0EA 4XPZA 2C4KA 3AESB 1XJQA 1TO6A 3GFTA 3M4ZA 4RZUA 5JROA 2ZULA 5K0TA 3L4KA 3TQCA 2ONKA 5KWIA 3DB1A 3KOMA 4FE4A 5I4CA 3DOFA 1G21A 3A26A 4CLHA 3O8CA 1M0EA 1RXUA 1WF3A 3WNCA 1TJ5A 1LSOA 3UPUA 2GYUA 2D1YA 2NVBA 4QBKA 1OA0A 5DMXA 3H18A 1M0WA 1V11B 3DKIA 4Q1FA 1FL9A 1TM7E 2B3TA 2A0UA 3LP5A 3P2YA 4YP0A 4RELA 1B3BA 4OIFA 2WHXA 5GIOE 3THRA 2ZYHA 3B82A 3GEMA 4MCIA 3GLHB 3WMEA 1NSFA 3RS3A 5ITWA 3HGMA 5K3FA 1V45E 5FPPA 1G20B 1PT8A 4A9AA 3KJFA 1LXCA 1QPZA 1RJWA 2YHUA 4UQLA 1MCZA 4X97A 1Y1KE 4EH1A 1NW6A 2J6BA 2GDZA 3GNQA 5HP4A 3TNLA 4CPDA 3RRNA 2WQ6A 4RGQA 2PUEA 1PD0A 3QOFA 3GVHA 4MP8A 1IJEA 3B6EA 4HRVA 2XB2A 2ID4A 2CBZA 4P4SA 4PY2A 4FN5A 2MJLA 2W6JD 3OX2A 4F3TA 4HEQA 3NFYA 4TYPA 1CR6A 4BTLA 1NN1A 3IAXA 4EGFA 1H05A 4N6GA 3RFXA 3JARB 2HSDA 2JJ1A 3QM1A 4AN0A 4M9SA 1NRXA 3M6LA 5I8WA 4P0PB 1FLNA 3I09A 2VPXA 2H4HA 4KPUB 1P2DA 4EOGA 4YJGA 4KR9A 1VSBA 1QGED 4I9UA 3VNBA 4Q4JB 1P61B 4X8LA 1FMCA 3E1SA 2GJSA 4P3NA 2HJHA 4ZZIA 2RHOA 1F0NA 1TT7A 3C3AA 3F7MA 1UWKA 4LV5B 3A25A 4F93B 2EP7A 1G8KA 2K4MA 3FWHA 1BSVA 3HZZA 2JHPA 4X84A 1IPEA 5DM60 2FPPB 1SIOA 5I7EA 7AT1A 4Z5XA 1Z37A 4NE7A 3MBOA 3ZV4A 2B5OA 1YT5A 2AG5A 1TC2A 2BDTA 4RSGA 2PA3A 1IC6A 5F1KA 4BIMA 3BOSA 5C5EA 3H3FA 2ZUCA 4QOSA 5CLFA 2YJTD 2WAYA 1BX3A 3UUGA 4C29A 1QLJA 5BO5A 4O33A 4TSKA 1PT6A 2H06A 3DAHA 5FBQB 2VVTA 2C84A 1V5IA 2CL6X 1XEWY 4ZRDA 4J3FA 3V8BA 1MC5A 1Z3CA 3ZGNA 4B7XA 3FCEA 1SXQA 3VC3A 1OD6A 3JQ7A 4YO8A 1T4CA 1IE3A 1F4LA 2M9MA 3C7AA 3CVJA 3RYCA 3JWIA 2KWIA 4NKRA 4QDJA 4YWHA 4HTAA 2HNBA 3W5SA 1H1TA 1AHPA 2Z8XA 1ELOA 1B8VA 1ZHFA 2R00A 2ZP1A 5JJIA 4QGSA 3VJRA 4CG3A 1EWYA 1TZ2A 4N0DA 4WEOA 2XODA 3ZK7A 1IXSB 4HMOA 1J0AA 1JLRA 1VJ5A 4FIDA 3T61A 3NUGA 4Z99A 3VNSA 4FDVA 2R66A 3MTIA 5AVWA 4EK9A 1P0IA 2ERCA 5DHSA 4A8PA 3OU6A 3VR5A 2YJ4A 4K05A 4UPEA 4C4OA 1Y7PA 4KUGA 1AKYA 4TRNA 1AKRA 4FOLA 1WKCA 4GQAA 4A16A 1C5KA 2WKPA 3G0OA 3ILVA 1O97C 1LCIA 2JFUA 2C8VA 5TJHA 2HU5A 3I2JA 2YFQA 4YRPA 3QHQA 2IHVA 1RW4A 3BF7A 1PJ2A 3PQEA 4OMCA 1RHKA 2D0PB 3INGA 3PIDA 4PC2A 1RWNA 1XTVA 2JCSA 2OK8A 4FI3C 4H0NA 4ZKEA 5TPWA 4ENTA 2NSJA 4X1YB 3DHYA 5JANA 5EZ5A 1G5TA 2CKDA 4B4OA 4KVAA 2HYDA 5DBIA 1IN4A 2GPTA 1UCFA 3HI6A 5AW6A 2O0LA 3JXEA 2YWHA 2C96A 4D97A 5K3BA 2J45A 5KREA 1LBHA 3NUZA 4YJ2B 3WO1A 1H8HD 4A2PA 1FTNA 4QTYA 3Q7IA 1Y7HA 3HXKA 3GNLA 5IARA 2J3EA 4GSKA 1UWLA 2JGDA 3FMFA 1ZU4A 1FP7A 4JJAA 1TYAE 2NTVA 3I5XA 3ZLJA 1AQYA 1PQYA 3LY7A 5F2OA 5LC1A 3WMXA 4KXWA 3I34X 1SFRA 3DWIA 1GP2A 2D2FA 2HCRA 3HH8A 3MOIA 3NHZA 3HCAA 2IEZA 4HS9A 4PRKA 3L7CA 5AW1A 5IPFA 1UJBA 3LOUA 2BEUA 2EYUA 1VL1A 2V9PA 2XDYA 2Y93A 3L6BA 4N5HX 5K45A 4F56A 4EZBA 4TT3D 4GKBA 3L84A 1HZJA 1T6BY 1YASA 4IHJF 1X94A 4OGWA 3JQBC 4CT0A 5IJWA 3KLMX 1CF9A 1U5CA 1N5JA 3JPWA 4HGYA 4IDCA 1AV6A 2A9VA 1ZQ9A 3ES9A 4OI4A 3UGKA 3VUFA 1AV7A 2W4MA 4I8IA 3UT5B 5CVVA 3UOAB 2IEBA 1EFCA 5FHQA 1Y6JA 1NXXA 2B1RA 4GOKA 4CG1A 2HCBA 2H4JA 3AM1A 3N2LA 4JLPA 1PJLA 2B8JA 1QO0D 4F9EA 2BGGA 5C31A 1W36D 4L07A 2HBZA 4J6EA 1GA1A 2O8FB 2FUG1 3HDHA 1C3XA 3HQ4O 2A6PA 1R0RE 3HXQA 1E9AA 3T8YA 2H1OA 1E1MA 1GGHA 2FFRA 4RZHA 4TX1A 4YRGA 1UPBA 3N2NA 5JH7A 2H4XA 4E88A 1AUVA 4OQNA 1UPAA 3AUAA 4PG5A 3EA4A 5JJKA 3OZFA 3RROA 3N2KB 4PF1A 2RGUA 4V0RA 3VAAA 4ARVA 3OMLA 5EE5B 2OK7A 3R24A 2D3WA 2QM7A 2JIMA 4O2RA 4MWCA 1YR1A 5EJ7A 1E0JA 1RQ2A 1K5PA 1YB5A 5ES3A 1U90A 4LPKA 3WHIA 1H4VB 3NTXA 4C1BA 5IRCD 4PG8A 2VJNA 2PWYA 4AXXA 4CMCA 2R86A 3DTYA 2JLZA 1YDHA 4QD3A 1DTEA 2PYZA 1TF5A 1DJOA 3SEFA 2ETVA 4MIKA 4EHHA 1JLHA 1HYHA 3ZZTA 3FYUB 2HSEA 4GM1A 4C2BA 5GP1A 1QZUA 3DC2A 3EZ2A 5E3JA 4ND7A 5CXSA 3W7BA 5JEDA 1DRWA 2C99A 3JYOA 3R5XA 3U1TA 1EDZA 1N7HA 3GO4A 1CVLA 2OZEA 2WMYA 3ZQ6A 1Z5PA 3ED5A 4F04A 2JI9A 3S3TA 3FR8A 4YTEA 1M10A 4Y2GA 2WJ6A 3G8YA 3SPXA 4FINA 1YDGA 2R87A 3DD1A 4YRSA 1X8KA 3FYUC 4CI9A 2C20A 4P84A 3S2YA 3CG4A 1SNYA 2RH4A 2GM9A 3PR1A 1KIFA 2I66A 1JZQA 3R20A 1U5BA 4FK8A 3W4JA 2ZBQA 3A1SA 2AF3C 3ORHA 3D4NA 1G55A 4JJKA 3SQMA 3W6UA 1NNUA 4EGSA 4EITA 5AW2A 2ACKA 2XVXA 1T3GA 4IHAA 5J4LA 1JA9A 2QROA 3E15A 4JLDA 2AMFA 4LE2A 3VJMA 4LFAB 1DIOB 3EDMA 1WP9A 1PQWA 3KB8A 1GWNA 2IYVA 3KR0A 4UCXA 3AI3A 4KPYA 4TQUS 4J4TA 2V03A 1ADYA 1EVEA 4E0BA 2WSIA 3PGJA 1KOJA 2EVWX 2KMLA 5MGNA 1XCLA 2P4HX 3A06A 4CDNA 4UBNA 1OU0A 4I8DA 1WMAA 3RC7A 5FNVA 3PVSA 4YRRA 2AEFA 3SDZA 2WFMA 5LU9A 1WXIA 3A4TA 3F5MA 5DISB 2YKGA 1S2IA 4MVJP 2A88A 4E94A 1KGDA 1DEXA 4M89A 4D7AA 2GNOA 3A3NA 4YFYA 4KQKA 3P71T 3WNQA 1U98A 2NQTA 3LBHA 2FPIA 3NHMA 2PT9A 4LC0A 3OFNA 1ABEA 1RHRA 3P9YA 3N2YA 3VSEA 4ZQCB 5KEIA 4MARA 3CHYA 2ZSUA 1PKEA 4O1HA 1PLLA 1F8XA 3MB8A 5BYJA 3ZNPA 4HGZA 2B8WA 1I8TA 2XITA 4KV9A 4CU5A 5CVUA 1E3IA 4C0AC 2ZJYA 4YYZA 3FUWA 4Q37A 1KFBB 3V5NA 3ROPA 1G9SA 4GSLA 1SGWA 3OA0A 2YOGA 4DLNA 4H7PA 2MHCA 3PX7A 3E2IA 1RMYA 2VKTA 3E35A 3G9ZA 4CKEB 3HYNA 2WHYA 4LZPA 5F4ZA 2BFOA 2DWCA 1GILA 1ZUNA 3BJZA 3DO8A 4J29A 4LHXA 2UV8A 4RS4A 5KSOA 2VC2B 1YI8A 3OBIA 3UBMA 3VC2A 2BGIA 1JG6A 4EO7A 4Y2XA 5I7UA 3G6KA 4Q9LA 4B3BA 1K9VF 3RBZA 3EIFA 4RQTA 2VRBA 3BBPA 4BQOA 2CNLA 1PQUA 3A6GA 4J8PA 5BN4A 2O8EA 2Z43A 3VGPA 1M1XB 3AIKA 5DGCA 1AK2A 3MS2A 3P0HA 3LUCA 2AMLA 3QYPA 4J2TA 5GZ6A 3DEZA 3AP2A 3AY6A 3E18A 3G2IA 5HQ3A 4OQDA 2NPIA 3CZ4A 2BBSA 4JYZA 5KJCA 4UUNA 2JK1A 1NAIA 3LAWA 4YUYA 3NORA 4KYIB 4HDSB 2HFJA 4P81A 4QG3A 3WP0A 3H1BA 4UFPA 1GCIA 1T13A 3IUNA 4IOKA 2IEGA 3Q87B 1OBVA 1CIJA 3PJFA 3RKSA 2DQSA 4WW0A 1IZYA 1NDQA 1P0PA 1YBVA 3VH4A 4M0MA 1H9BA 4GX0A 4OFWA 1R4MB 3C41J 1BQEA 4RZSA 4WRRA 1ACLA 2AFVA 3K94A 1S5PA 3A1DA 2P5UA 3ACDA 1OA1A 3C1UA 5KO2A 5C9ZA 4RZ2A 3RGWS 3VO1A 5A62A 5JUWA 5AI0A 4ZDKA 2LGJA 5C4MA 1H2XA 3DVRX 4Q3AA 1K5HA 1ADGA 3L1UA 4YRQA 5ARBA 3GROA 1Q5PA 1EGQA 1Z4LA 1DTWB 1WAMA 4RZQA 3RSHA 1S2GA 3TNFA 4TQAA 6GPBA 2GM4A 5DHTA 5THXA 3F4LA 1L7PA 5H4HA 1PNOA 4JAVC 4NMHA 4AROA 1IEVA 1REQA 4WE3A 3AX6A 3E9CA 4PLHA 3S5JA 3SHQA 3OO1A 5EJIA 3L0DA 4BBZA 4MJ3A 3NDRA 1PR1A 2OBFA 2I62A 2QJRA 1Y33E 3R09A 4RC9A 4CTOA 5IJ0A 3FFAA 2QA5A 3AOEA 3LPLA 2O2XA 1CRQA 1NI4B 1NQ5A 3TDKA 2PV0A 3VR6A 2FX2A 3VR6H 4U2DA 4MR8B 5H68A 3QLVA 1CB0A 1S8AA 2HXSA 3VSAA 1C9MA 2JIZD 4NFLA 3ZBTA 2ZB4A 3GRAA 1UXGA 1LDYA 3HN6A 3OFKA 4MRSA 5DOZA 4RV5A 4MYCA 3RSFA 3JATB 3UWPA 1JKFA 2ZCVA 1UIMA 2PZBA 3OE7A 4O8CA 5HZKA 4WWHA 1U8ZA 2LTAA 3NWEA 1V26A 4ZQBA 3SKVA 1E79A 2ZWPA 4PXYA 1ZJ5A 3D5TA 4IIXA 1KO1A 4OUDB 4LBVA 3L7OA 4KI0A 5BN3B 2BRUC 3JVIA 2QZ4A 3QLVC 3DXXA 2B34A 2F1HA 3SHWA 3PRHA 3AJ8A 4JCCA 3DD5A 3KV1A 2ZE5A 2YVLA 5BWMA 1HG1A 1RJEA 3TL2A 4OA8A 1KQOA 4HQOA 3T9CA 1XRLA 1SXGA 2IHUA 3QOYA 1YIAA 3KV3O 4LVNA 2WJVA 5LOVB 4ZMBA 4DDHA 1QCYA 3WLJA 4KODA 4COOA 3PSAA 2X9QA 1T8SA 4RKRA 1KO5A 1TYCA 1VECA 2HNAA 3QU5A 3WIUA 4LZZA 1C9DB 3TXXA 2HGZA 1N2CB 1IFXA 2GK7A 2QZ9A 1MENA 3OEEA 4Y1GA 1MJGM 1W9MA 5FUQA 5K3FB 1ZITA 2DQKA 2RGGA 4L7VA 2YS7A 5TMDA 4BQRA 1THGA 4YMTA 2GN8A 4F0JA 3ETNA 3VSCA 3WOVA 3TIVA 2WP8J 4DIDA 3PU6A 3CEMA 3PXGA 2WOOA 4RD3A 4ZJPA 5COAA 1I3CA 5DU2A 3T1HB 3WV5A 3JWEA 3IR7A 4ZREA 1SG9A 1DPGA 5TC4A 2PNJA 1EXWA 3REQB 4DG8A 2G9RA 4KQMA 1T5TA 3BKXA 1DRJA 3GPCA 3V2HA 2HIMA 4QUKA 4P1ZA 1KJ9A 4ND8B 5BWOA 3FOZA 3O4VA 5FUWA 1L5RA 4MGZR 3GBSA 4DSTA 1U81A 2J9XB 3IJPA 4DJAA 2YS6A 1E6EA 3I8OA 4QQKA 1Z4QA 1RBZA 1D2AA 1GSIA 1MOQA 1M6VA 1RC1A 1XWWA 3EFBA 4X7PA 1GYPA 3MJCA 4OP3A 3WYBA 3GLGE 1LI7A 4FHCA 1V3QE 1MB2A 3GQBA 4JT2A 4TT8A 3CX7A 2G06A 3T0GA 1Z06A 3B52X 4YACA 1II8A 1ZVMA 4I4NA 1XZFA 1XT6A 3E48A 3BERA 2B1QA 2PL1A 1U4NA 4AI6A 1SUIA 2C0PA 5K6AA 3DVAA 4C4PA 4CIDA 1RWQA 3A14A 3D2CA 3TZEA 3OLYA 2FUKA 2YVUA 3EVTA 3KJEA 5ADWA 1WDKA 1M0SA 3T4PA 1DRVA 3GGPA 1LC0A 3PVCA 4K0KB 2JFOA 2YIVX 3DDHA 2CE2X 4RESA 1C3VA 3ONVA 3MGCA 1WZNA 1GTG1 2NYVA 2VAVA 1R1DA 3E03A 4IJ5A 2H18A 3SJ7A 4EZEA 5HYVA 4U6SA 3KR2A 3R4VA 4BMPB 4BWFB 3GH1A 3I3SR 1F8YA 1ZIXA 3GPLA 2XCIA 4HYYA 1T4CB 1E2UA 4CI0B 1EUYA 1OXBB 2P4QA 1BGXT 2DGDA 3F3KA 1L5VA 2QAJA 3G13A 2WRZA 2ZYVX 1J6UA 3H8VA 1VE5A 2IX9A 3QITA 5D5PA 4KNYA 1C30A 1RP7A 2D06A 4JDUA 1X6VA 3CU5A 3MGKA 4TYWA 1QCCA 2ZGVA 2AFHB 4QDTA 4DB2A 3K8YA 1J2TA 2SCUA 2W0MA 4XKJA 1ZP6A 2WG0A 2O5VA 2YYAA 1WQ4A 4DIEA 2FRDA 4BNHA 5FOTA 4BMZA 5JCZA 1MNQA 4MPPA 5MHTA 1RM3A 4ZV9A 1Z35A 2UZAA 2EDAA 4KB5A 2RC6A 2O2EA 2VP2A 3M6FA 1JU4A 3ASZA 4GKVA 4LK2A 5CD9A 1AKNA 2I6TA 1TF7A 2PXXA 3U81A 3M5CA 2FW8A 3WB2A 2VBGA 2QOEA 3PE3A 4BKOA 3CMMA 1G59A 5FDFA 2WZBA 1PI3A 2B21A 3FPCA 2OV2A 4P54A 3OP1A 3UV6A 3ENKA 3RD5A 1N36B 2CKMA 1VB5A 1A76A 3BD6A 5ECDA 3HE3A 2PLWA 5TPWB 4EJSB 2UVDA 3K2QA 4K6FA 4Q1AA 4BVAA 3AP3A 2C5EA 4OHRA 4JI0B 1KRXA 2G9VA 4IV5A 5JSUA 4FJ1A 4FXOA 3VMFA 1ECCA 3SQDA 5FAXA 3WVNA 5LOVF 4ZO6A 1W25A 3ZCVA 3RT9A 2UDPA 5KYYA 2GUGA 2ZKIA 1CZLA 1RD4A 4BV8A 3S28A 1FX0A 1NYLA 3EVEA 2WA2A 3IP5A 5EWJB 5FWXA 4ZWNA 5IJXA 5TEWA 2J31A 2ZIEA 3KTFA 1ORIA 1KIMA 2IYEA 3K9GA 1HYQA 4MRMA 2YWGA 3IPAA 4B6GA 5AK5A 3E7FA 4TMXA 1SG6A 1JIKA 2WU4A 2I5PO 1EBUA 1U0NA 2YHIB 1KMHB 2E4YA 4LJ8A 3KLPX 1U3TA 1F2UB 2HMVA 4KSCA 5EQDA 1YS7A