2HIMA

Crystal structure and allosteric regulation of the cytoplasmic escherichia coli l-asparaginase i
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
334
structure length
324
Chain Sequence
KKSIYVAYTGGTIGMQRIPVSGHLQRQLALMPEFHRPEMPDFTIHEYTPLMDSSDMTPEDWQHIAEDIKAHYDDYDGFVILHGTDTMAYTASALSFMLENLGKPVIVTGSQIPLAELRSDGQINLLNALYVAANYPINEVTLFFNNRLYRGNRTAKAHADGFDAFASPNLPPLLEAGIHIRRLNTPPAPHGEGELIVHPITPQPIGVVTIYPGISADVVRNFLRQPVKALILRSYGVGNAPQNKAFLQELQEASDRGIVVVNLTQCMSGKVNMGNALAHAGVIGGADMTVEATLTKLHYLLSQELDTETIRKAMSQNLRGELTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Allosteric Regulation of the Cytoplasmic Escherichia coli L-Asparaginase I.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords L-asparaginase 1
total genus 102
structure length 324
sequence length 334
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2006-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2himA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 2himA01
1JJAA 5I4BA 5K4GA 1ZCFA 1IHDA 5DNCA 5HW0A 3NXKA 1ZQ1A 4RA6B 4RA9A 1O7JA 2HIMA 2GVNA 2P2DA 4NJEA 4NJEB 1JSRA 1HG1A 1HO3A 1DJPA 1JSLA 2JK0A 5DNEA 5F52A 1WLSA 1HFJA 2OCDA 5DNDA 5I48A 5K45A 3NTXA 2WLTA 5K3OA 4RA9B 1DJOA 1AGXA 1HFWA 4RA6A 1HFKA 4R8LA 4ECAA 1WNFA 4Q0MA 5I3ZA 2WT4A 4R8KA 5K4HA 5CBPA 1WSAA 3PGA1 1JAZA 3ECAA 4PGAA 2P2NA 2HLNA 2D6FA 1NNSA 5CBPB 1HG0A
chains in the Genus database with same CATH superfamily
5CBKA 5CAEA 1LC3A 1V6CA 1GPKA 1CUGA 4YVFA 3L1VA 4URXR 4PAOA 4EHAA 1RYBA 5HSGA 1B0UA 4JLSA 4EYQA 2PG3A 5A4JA 4G37A 2G07A 4QYIA 4XYLA 1PV1A 3F97A 4BNJA 4GSLA 1D4FA 3BHJA 2ZJ7A 3DDWA 5ALWA 1G5FA 1G8MA 5KVQA 3DAGA 4O25A 3QKIA 1YVEI 5AJWA 1QHYA 1W5SA 4W1PA 4X0EA 4CGZA 2C8KA 3JWHA 1E9SA 2WUFA 5EVCA 4YAWA 4EHKA 1HDOA 4EGQA 4BJ1A 3V4ZA 4CR6A 1W2GA 2ERCA 3NJ8A 1IM5A 1JG6A 1RLOA 4MRNA 4OXKA 2IEZA 3QKSA 4HH4A 2ADMA 3T1OA 1ZH6A 4AWBA 3GEGA 2HPAA 4TWRA 4BTVA 5FBKA 4DLKA 3I37X 3HV0A 2ZSAA 2EZUA 3M9XA 4OGWA 2RIPA 4Q5IA 2O2GA 4BFSA 1Q3HA 3H1TA 2W90A 1I01A 2PWPA 4HC4A 3RHZA 1KZ6A 5J4KA 3X1JA 1QO9A 1ISSA 4R1PA 1PQWA 5JSYA 1SG6A 2E1RA 4BGVA 3B5IA 2VLIA 4B45A 5KU1A 1YD7A 4U8HA 3TUZC 4UDXX 1A7JA 2PA0A 4K6CA 2B4QA 2IS1A 1CUHA 2UZ4A 4G5SA 2FN8A 4LHXA 1YGYA 4Z51A 5JJBA 4RK6A 5TS3A 5A5EA 1M76A 1W0JA 1I0ZA 4HLUC 5A4DA 4LDZA 4JI5B 4J3JA 1RXCA 4NULA 2XUAA 2PS3A 4BNTA 5CDUA 2EP7A 1IBSA 5IEJA 5KIAA 4RF3A 1HE1C 3LBHA 5KQSA 4EB6A 2EBHX 4K05A 4W63A 5B1SA 2Z56A 4DV3B 1P1IA 4KUHA 3BB4A 1ACJA 1V39A 1N6RA 5BSUA 4FHFA 1WDLA 1OREA 1TKRA 3KFXA 2ES4A 2WM9B 4II2A 4O5AA 3F8SA 1YOVB 2QVBA 1KZGB 1BMFA 5FL7A 721PA 3CVYA 3DV0B 2WJHA 3EQ2A 1OGIA 3C45A 1P45A 3SJCA 1P9NA 5KQPA 1XDBA 3KU1A 1VLVA 3JQAA 1KXZA 2J48A 3W6NA 1G8YA 1UXIA 2B8TA 1ZNXA 2PH5A 3CF0A 1BXRA 4FEYA 1AQUA 3GUHA 3HSSA 2OEPA 1E69A 1DVRA 2FWNA 3LUKA 2V7QD 4YDHB 1Z2PX 3HWSA 4K6MA 1B7GO 1OFVA 1OQAA 1QZXA 2HNBA 3QBDA 3QXGA 1OV6A 4HDKA 4LOAA 3EVAA 3GROA 4LMPA 2YCBA 3AU8A 5ERGB 3ZZUA 3A26A 1PNOA 1MCZA 3KUXA 4L07A 4LHZA 2XB4A 1VA4A 3NKFA 4MPJA 2OA0A 3MJVA 2HQSA 3TB6A 3WJ2A 2WJZB 2QI9C 4UAGA 4LJSA 2DKFA 1EFPB 2A9QA 2XYPA 4M9RA 4II3A 3WLPA 3BWVA 1V25A 1N7JA 2BTOA 1TB4A 4BVFA 4D80A 4TLLB 2VI5A 4UOEA 2K5UA 2OCLA 4GWLA 3JD0A 2JVKA 3W9YA 5C18A 1YQTA 3FBGA 3OA0A 1B14A 4BUJA 2X1VA 2XVYA 2RKBA 4BEBA 2AZMA 1FTWA 3FWYA 1OC4A 1FA9A 4MR7A 4QQKA 2V8BA 3UG7A 5FOUA 1V8ZA 5JLJA 1N7IA 3NYIA 1ECBA 4MYTA 4XGKA 2ZI6A 1C30B 3GJ4A 5B3LA 4XR4A 3M0EA 4B8ZA 5KBYA 2P2LA 1U02A 1C4XA 4LTMA 4Y7CA 2ANCA 1LJUA 1BA2A 3COSA 3JQFC 1YONA 4B75A 1JB9A 1QIKA 2X5KO 5AWFC 7MDHA 4BO7A 5L3SA 4URHA 2C98A 3OBBA 4U2BA 4RY2A 1DXOA 3TUJC 3W2GA 4BBAA 1J90A 3OY2A 5BYBA 2L18A 2QY6A 2OWDA 1CEXA 2PWAA 1CDZA 1CUDA 3VDQA 4BFZA 4TVOA 2JLZA 1MAWA 4E3WA 1YHZA 2ZVQX 1N2OA 3PQFA 4ARAA 1DEXA 2JW5A 4Q4HA 4S1PA 1QMGA 2AFVA 4MB6A 1WPXA 4XZ3A 5FD8A 2IOFK 2JPDA 5TY0A 4I99A 1K6EA 2O0LA 2AFHB 1CJMA 2TRSB 3FE2A 2VYFA 3EFBA 3IP3A 1PFUA 2YQZA 4GGMX 1DKMA 3U62A 1JXOA 5BP7A 1AV7A 1Q3KA 4NH4A 2GZRA 5ER6A 1PZFA 5DRTA 3NONA 1FP2A 3SXUA 1HA3A 1NQTA 4NFHA 1HETA 3KM0A 4YJDA 1L3CA 2Q1SA 5DX1A 3RGGA 5LSAA 2F3RA 4Q9NA 1GUAA 1URPA 4HX5A 5FO1A 5EYPA 1IWBB 1MO2A 2LIPA 1T6XA 2A78A 2VJMB 1G2OA 4IX1A 2R79A 4ZT2A 2RGAA 4YCNA 4LZOA 3JYLA 2BP7A 3T9AA 1C7ZA 3IMGA 4IIGA 3PLRA 2GVNA 1FX1A 5HK8A 4IO0A 3TRIA 4KYTA 4YRNA 2BJVA 2AH5A 3ZE7A 5E9QA 4E51A 5BMOA 2VQDA 1U0LA 3A4YA 4J4HA 2JARA 4UNNA 4HDNA 3E27A 1UPCA 4KAFA 1RW4A 1P7ZA 4OQYA 4WE3A 4MW6A 4QQRA 2OMEA 3LX6A 4FSHA 2IX9A 4EKDA 3EK2A 1YO6A 2I7DA 3PSHA 2IYPA 4L74A 4PRKA 1KSFX 4G86A 5JDCC 3B6JA 2VHCA 3HYCA 2WIKA 3RUIA 4HRYA 1FFAA 3I61A 3IL2A 5JSQA 2H31A 5AW3A 4DY6A 1UMCB 3DTNA 4MAFA 4AL4A 1J39A 3C7TA 3L7MA 3MJTA 3CX8A 1VLJA 1YHNA 5CFRA 4Y2PA 1AUXA 1YE8A 2ZITA 3PKIA 1E7YA 4XWYA 4R68A 2XEDA 3HYNA 1UBCA 2VHUA 3TZBA 4RTOA 4X9XA 1X42A 3KVRA 1DQNA 1YR2A 1FDSA 2NLOA 2R47A 5P8WA 2BBTA 5JO0A 1KP9A 1OAAA 3C98A 3VKGA 1EI9A 2JIDA 5GGXA 2YMLA 2HLHA 4BU0A 5ADHA 4MVCA 3U3RA 5GONF 1CY6A 1NVXQ 1IUNA 2Z6AA 2DJ5A 3G9ZA 3H4VA 2XXAA 4X1KB 1OVMA 3OHSX 1KSJA 5HFJA 2ZPTX 5DNVA 1OI4A 1XD9A 2ID8A 4GYKA 3G8BA 1SA0B 5KC8A 1ODLA 1ZCBA 4P92A 1D0IA 1U1IA 4R9RA 3DYBA 4LQCA 5BSFA 3HKBA 1P6XA 2CJWB 1M54A 1YU9A 2JI7A 2AMVA 3PF9A 2I7TA 4M8LA 4MWOA 1G5QA 1GRRA 4WZAE 5TMPA 3H1AA 3DTVA 3KLMX 1XRQA 3HJNA 3N0WA 2IEAA 4GQIA 4KU4A 1KIMA 3GH1A 5JOQA 4TL6A 3UC9A 1D3AA 3R0XA 2C7RA 4TYNA 1MEEA 2QD4A 1SXJB 5AHKA 3MMSA 3PEEA 2C2MA 5DSZA 1OFHA 1WTAA 2K4MA 3LC2O 1NOIA 1OKKA 2EFJA 3HVKA 5AT1A 5HGXA 2PZMA 4M0FA 3W8EA 5I9NA 2W6MA 3U4GA 3FWNA 1ACMA 3IOCA 1Q74A 2CYBA 4IL5A 2NVOA 4ICIA 4P32A 3CW8X 4J7UA 4YAFA 5JD3A 4A8PA 1O97C 4HEQA 1JH8A 5EEGA 4BKMA 4IJMA 4C9BA 5THKA 2XZOA 4BO6A 3HCRA 5CJ2A 1JFFA 2NP7A 1II8A 4ZO6A 1T3HA 3KPWA 4QEZA 4D4MA 4P93A 4LY9A 3ZWYA 1SRQA 2RGXA 4HATA 3EDOA 4D26A 2FSGA 4NJEA 3VC1A 1PWZA 2J46A 1T1EA 3DLPX 1XO1A 1RJ9A 1EWKA 4FMCB 5EZ5A 4F93B 3AKEA 5CD1A 3IESA 2E49A 4YP5A 1Y3FE 1YV9A 3ZZ0A 1CQIB 8ATCA 4ND2A 1TLFA 4MW9A 1YCHA 4OO3A 1A0OA 2P7IA 5TS2A 2FMKA 4RMHA 2DFVA 1IZZA 3LV8A 1J0DA 3E4DA 3GFGA 1KJWA 4G26A 4GL2A 4KQEA 3TH5A 1JI0A 2G7ZA 2WHEA 3ANXA 5IM5A 2SCUB 3GPCA 4W8OA 2G9RA 2WM8A 1RXWA 5TIIA 1R27A 2ZXFA 1T5TA 3A31A 4M1MA 4IJQA 4BNYA 2VLBA 4A0QA 3C4JA 2YMQA 3PIRA 3Q5GA 3QW2A 1NKVA 4C78A 2ZIUB 5HMLA 4P31A 4BNXA 4BQEA 2OO5C 2P79A 2MSKA 1EPUA 5DVZA 1ZU5A 4I1SA 5EMLA 2R1TA 3KSZO 3DLIA 3ICPA 3UUWA 3U7GA 2K2WA 1GDTA 5LBUA 3ENWA 3ILSA 1N5MA 2B3DA 3CO5A 3CEHA 3RS8A 2GB4A 1TT5A 1K8XB 4IR7A 4LG1A 1EGQA 5CA0A 2X15A 3WK8A 4D1YA 3LQ1A 5IM4F 4YY3B 1N5RA 2NXWA 2YXPX 2AD5A 4NPAA 2JJ1D 3MF4A 1DKOA 3CW9A 5ARBA 5B1IA 4CKZA 2A88A 2ZM6B 3OOEA 1C1HA 3A1EA 3JARB 5EXSA 1RJFA 2XE8A 1T1GA 4FQ5A 4DPKA 2VHTA 1C4OA 1XCOA 3B2NA 1ANKA 1VG0B 5IBPA 1KZ1A 3BJEA 4U6SA 4NBWA 3RTBA 3TMAA 1JKMA 1O89A 3W3AD 4C7OA 1JFTA 3IHWA 3OVMA 3WNZA 3D8NA 2C2ZA 1NLYA 5A04A 3F74A 3BE8A 2VK2A 5HS6A 1MAUA 3R3WA 4DR5B 2GVDC 4HGRA 1T4CA 2ZUCA 1X13A 3BIXA 3GLHE 2IBSA 3IOEA 1KEEB 5IBRA 2E85A 4X1YA 1X19A 5CVVA 4KIFA 3BRWD 2WYWA 1B93A 1UBLS 3T99A 1VKOA 1XN1A 2OV2A 3OM8A 2XMZA 4REQA 5DISB 3GOHA 3NH9A 1L7XA 1D4AA 5T6MA 2JGJA 1YS9A 3X2FA 3KZKA 1V3UA 2MSCB 3EXG1 3TR6A 4IWNA 4FINA 3L06A 4G1VA 4MI9A 3DE4X 2RI0A 1OA1A 4U6QA 3T3MB 2O6LA 1E3MA 1AKWA 3CZPA 4RQUA 4YP7A 3U13A 1F51E 3C5VA 2QUHA 3HB1A 4V03A 5FOWA 2G7MC 2V7UA 4B84A 4D8WA 1ORWA 1O7JA 2W2NA 2WJAA 3DPSA 4LYHA 5HOEA 4NABA 2WJ6A 3ZLUA 2X6TA 3RFCA 1USKA 1U2DC 4IYJA 2VATA 4KR3A 3I9V6 4MB0A 1EKXA 3K4HA 5CAEB 3JQFA 2ONZA 2GF2A 3TRHA 1KMHA 1XZDA 3JQDA 2RGGA 3UK2A 2QA5A 2CDBA 2B6NA 2BKVA 2A84A 2WSSA 4UBNA 2OESA 2R48A 1DELA 1FFGA 4UEOA 3BSYA 1UJ5A 1XOIA 1NVUQ 5EPEA 4CM7A 2CE7A 4IIJF 1SVSA 1V9CA 1SA0A 1TAQA 3L6DA 4KQJA 4AP9A 1X7ZB 3INNA 4ERNA 5HQ3A 2J0QA 3A37A 4D3DA 2YZMA 2ORWA 2PK3A 3GDGA 3HE3A 3NAQA 4MGZR 2P6NA 5AICA 3EPKA 4EEZA 3KPJA 1XK7A 1HUQA 4OSEA 5FA8A 3USZA 2FW9A 2WKWA 1HK7A 3MTEA 1ODTC 4EF5A 1KJIA 1AKNA 4HJXA 3G2OA 3WBJA 1OZHA 3PDHA 3QUQA 4E88A 5IC4A 1IN5A 1WVIA 2HQRA 2ZSJA 2N47A 1F12A 3JZAA 1G9TA 3ECAA 4LXIA 1BCSA 3BAFA 4B40A 1S6YA 2LCFA 3GOQA 4U0JA 1VYUA 1W1UA 2O0KA 3GJ5A 5ALJA 3ER6A 5ARDA 4CUZA 4RCZA 2JBHA 1U8UA 5G0WA 5BNTA 4B7AA 3WXMA 4N5NA 2VT2A 4R9VA 2Q3JA 1HMPA 2XKAA 3B1VA 4JH0A 4WSOA 5DXAA 2WM3A 2C9CA 1W0CA 1U28A 2NTYC 2B8EA 3EG9A 1II9A 4OXIA 5A4FS 1UIRA 4RJ2A 3VUFA 4F1KA 1QVVA 2MTBA 3U37A 1BROA 1CYDA 2XW6A 6ADHA 3LY7A 2X9GA 4TLBA 5IF3A 2E3JA 2PLAA 4X6YA 4BB6A 1RHMA 1X2BA 3LDUA 4QHYA 2VTEA 3IRUA 3UW3A 3X0DA 1I36A 2V98A 3T9BA 1MU0A 3DT8A 5IZCC 3GBSA 3IO3A 1AU9A 2Y3IA 5CLQA 1ZONA 3RBAA 2QM7A 4OYYA 4LJ5A 1XVLA 1CRQA 3GU3A 3RS4A 5DIZA 2X8LA 3UBMA 1BOFA 4P82A 2ZUSA 1G5RA 1OLXA 2GKGA 3A06A 4RV9A 3QSYA 4F9GA 5TDHA 4P83A 3B6EA 2REBA 4LNAA 4LYAA 3MWJA 1XEAA 4MS3A 4I3HA 2QN9A 5ED0A 5IAKA 2J3MA 4J43A 3RIXA 4OLJA 3SDZA 3TOCA 2H06A 4PYNA 4IOKA 2C2XA 4B09A 4MLPA 4YYZA 1JGTA 1QUEA 1Z75A 2WR8A 5FPKA 1PSDA 3IVXA 3OAAD 3F5MA 4DLAA 3GEEA 1KZ9A 1EE9A 1QWSA 2M6LA 1YDFA 3LT2A 1XDGA 4DDKA 1WCIB 1FTYA 5EQTA 2F3PA 2GCGA 3NGLA 4FILA 4HJRA 4N5DA 5AXDA 5BYKA 2NPOA 2NO7A 4MUKA 3J81A 1ENPA 1IVSA 4B3HA 1U3TA 1VI5A 3IIJA 1PT7A 4Q3CA 4XSHA 3BD7A 1RD4A 3CU5A 4P7FA 1NULA 3DV0A 5F2NA 2A67A 2QVYX 4JI6B 1YRAA 3DFMA 16PKA 4ZI2A 1IK6A 1RLUA 2BVNA 3NYWA 2VHEA 3CINA 3DTYA 3JWIA 1DBSA 2VHZA 4UHKA 3RABA 1UCFA 1O9HA 4HH1A 2NXEA 3Q2KA 1ONSA 3BWXA 2D1QA 3K2IA 4QYMA 4TT3D 1Y4ZA 5C46F 3PDWA 1W29A 2C9DA 4TMTA 4WFKA 1Y37A 3MPOA 2A94A 2OOSA 1A95A 4JIGA 1FFXA 1JQJC 1R0RE 4UDOA 3BD9A 3KSAC 2IT1A 3I01M 2G5TA 3RKUA 5DHPA 2WJYA 4CN8A 4G0WA 2DT5A 3CLUC 1YZKA 2KJQA 4IDGA 2IZ5A 2BDEA 2W2MA 3OHMA 3HB9A 4JASB 1TU3A 5BQ3A 4AN4A 1NW3A 1LLCA 4LF4B 2JBWA 3IKVA 1NVEA 1LDBA 3IXQA 2BHTA 5B1HA 3LNTA 3K0SA 3P9SA 2B8JA 4N0EA 1NN5A 1VHJA 4KIUA 1QLJA 2EIHA 2OC4A 1ZN8A 4M0PA 2HMUA 5AJXA 5CXSA 3U4HA 3HWX1 3G23A 1QE3A 4Z1MA 5JVDA 3BQMB 3FDXA 4NS4A 3SQOA 3RW9A 3KYDA 4MVJI 5KCZA 2R00C 1IHXA 1JXQA 2ICAA 3GRKA 3UQYS 4H2DA 1L1EA 1DLIA 2BMAA 4KKVA 4A6XA 3TOSA 3L02A 4MQFA 3FOEC 5F7ZA 3F90A 3R3ZA 1H1TA 1KK3A 1EWTA 3Q98A 4YCMA 1TM5E 5HR5A 2N46A 4GI7A 2XDQA 4OBBA 1NVMB 3WK5A 4GPAA 4XTCS 3CVWA 1MENA 4AS1A 4L4UA 3I1YA 3UG6A 4ZT5A 1Y48E 2PEZA 2IX3A 2ZS8A 5JW6A 3IHLA 1CR4A 2UYQA 5G1NA 4BQQA 2Y2VA 1JBEA 3THSA 2ID7A 3HXTA 2IA5A 3QWIA 1QIMA 2WD9A 3IUSA 4RJKA 1B1AA 3Q87B 4CMGA 5BOSA 5MN4A 1M6VA 3ZWWA 5AW6A 4AS2A 3T1TA 4QZVA 2P8SA 4MQEA 5K0TA 2G9NA 2FDCA 3B1KA 5FUVA 1M7GA 1C0IA 4FUTA 2O8CA 1JFLA 1NONA 5AK3A 3G7NA 1X1EA 4LTNA 5HJ7A 1RC8A 1IXYA 1GNRA 2RGEA 1CRWG 3BULA 3TVYA 1NRJB 4QRIA 3EN0A 1QYVA 5GV8A 2QN8A 5TQ0B 1VIAA 1L5LA 4BN5A 2XT0A 3EDQA 2ZDGA 5BURA 2PZKA 4DHEA 4LDRA 3TLXA 4GBGA 4DKXA 4C2TA 1PJZA 1WCYA 4KN5A 4JC0A 1L5NA 5L53A 4FFRA 3UMVA 1PNQA 3L9WA 3LUDA 4IZ6A 4R6WA 2GM3A 3MVEA 3ZHXA 3ZYZA 5JCZA 5JYCA 3K96A 2IQ5A 3M3PA 1ICIA 2E89A 3OZBA 1GPLA 4RY9A 2QPLA 3OF5A 1UBUS 1MPTA 3MT0A 1N7HA 4V1CI 3R0JA 2BE7A 3EOZA 2OP0A 2H1SA 2VYVA 5EHXA 5L3RA 2J33A 3GDFA 1QS0B 4F8JA 1OB5A 5IAOA 4JT2A 3ZDRA 4DNQA 3QLVA 5C5IA 2WG0A 2GCOA 2X42A 2WKRA 4ZKEA 3GP8A 3LGAA 4P3NA 1NNUA 1SC4A 3ET4A 1KZHA 1UJNA 2JLSA 2J3LA 4NK5A 1OASA 5DSTA 3TM5A 5CDSA 2FXIA 1CZLA 4JP1A 1RZ3A 2DY1A 3RJMA 3R44A 4DNPA 5KTSA 1H2FA 1JI3A 4DQKA 3RADC 3AK4A 5AM1A 1JG4A 1LTKA 2ZR8A 5FYDA 3A6PC 3KQTA 1GGNA 2P2ZA 2TYSB 3R0QA 4DZTA 4ZOQI 3HP4A 3NHUA 1ZHHA 1Z5OA 4ZZ3A 3BM5A 1N1GA 2FPGA 1IRIA 1UDCA 3EPPA 3A2MA 3HCEA 3URKA 5JALA 1WSDA 1WCIA 2ZBRA 3GCGA 2DECA 3IQZA 3RAJA 1QF9A 5IFLA 1ZN2A 3PRKE 5JXGA 2HMAA 4F4JA 1M0WA 4YYEA 3GJ0A 5G4KA 1ZX1A 3UMFA 2Q28A 2HF7A 1ZGBA 3N9IA 4X6XA 5TNXA 3P9IA 1GFSA 2XCLA 1TVMA 2CKDA 3VR5A 3RSZA 3GP3A 2ZRIA 4NH0A 1RCUA 4Q4CA 3U81A 5BORA 4EUSA 5HKKD 5LA6B 4JJKA 3WDSA 4NS1A 4RVOA 1YH3A 5F23A 2RHBA 4JUFA 1VA5A 3NUZA 2X6QA 4GPIB 3FFAA 2GN6A 5J58A 4EA7A 4E14A 4J7XA 4KRXA 1T8WA 4US0R 1MF7A 4Q3LA 1QGZA 2AZXA 3QHQA 3IUNA 4FYMA 1NN0A 1T2AA 2EJTA 4YPVA 1VIYA 9LDTA 1QMPA 4KACA 5FORA 1DG9A 1CIPA 1JVBA 1VE7A 2Q3CA 4A15A 4BNKA 5E7JA 1P74A 3GK3A 3DXZA 4GL4A 1Z5GA 1ZGCA 3OKFA 2I8CA 4KVGA 3DDCA 2RH9B 1N3IA 2B7CA 2VJNA 3HZOA 4PGFA 4DANA 3CKMA 1RHRA 1GCAA 4CTMA 1GSAA 2ZVPX 4J9UE 1NNI1 1DCKA 3GFRA 4AF8A 3HL0A 2H5LA 2EQ5A 5EFOA 2IPLA 2QL5A 4LDNA 1M6EX 1NBME 1Y63A 1DV2A 2RI1A 2W4QA 2X7JA 4FQ8A 3ZWNA 1Z4MA 2WA1A 1IEVA 3QBJA 4EZBA 3LL7A 3TNJA 5T4HA 2P9JA 4NYJQ 4LECA 2ZKLA 3AVUA 3KEGA 2QM8A 3F4BA 4MV3A 1EVYA 4PLGA 4PGHA 4ZYUA 2VDPB 4ZOLB 3N0VA 3WMXA 1MH9A 3B20A 2PN1A 1N3YA 3DYIA 2VP0A 1K9SA 3O8CA 2X8AA 2ZAGA 5C80A 3TRKA 4R1NA 4XD7A 4BO5A 4LC1A 1ZR2A 4QFCA 4LGVA 3OIDA 1OXTA 2E82A 3ESQA 1JDTA 1UBOS 1VJDA 4ROTA 1V8BA 3LZ6A 3LHSA 3HBLA 1XTSA 2J32A 1TVKA 2IPNA 3E9RA 3JW8A 3NLLA 3GNLA 3DEYX 3U7RA 1QR2A 2UVDA 1CJKC 1WF6A 1D1QA 5K0BA 1I1NA 3UXYA 1F2DA 3IH5A 3T5PA 2XAAA 1RPAA 5ESDA 1GQRA 2QX6A 1LRLA 4HWTA 3Q6IA 4Q3AA 4DRXB 1IN1A 4YIHA 1CUBA 2ACVA 2LD4A 4CG3A 3V8BA 3HSKA 4DC0A 3M6VA 1SVUA 3PWTA 1C0KA 3FKSA 4F3RA 2ZUFA 2ZBVA 4M7WA 2O05A 4ZI5A 2EATA 1NW5A 1G7TA 1Y0BA 4Q4LA 3WJ1A 5CCXA 1DJNA 3HH8A 1VE6A 3T7RA 2O8VA 3UJ6A 2ZR9A 3VKUA 2OGSA 4X1IA 1JNYA 1INLA 1L9KA 1Y33E 4Q9DA 4CMCA 3OC0A 1XN4A 3HEMA 4PO3X 3G2LA 4F04A 2ASEA 4PIPA 5KB3A 4KPYA 1GN9A 1BX0A 2A9FA 1DFIA 2P6UA 2JIZA 5LP6B 4RFVA 4MMXB 1BSVA 5F21A 3RYFA 4D6YA 4TZTA 5JATA 3GAAA 1ORDA 4BMZA 1PR1A 1HLFA 1T5BA 3NHWA 5C1BA 1YR9A 2O4UX 1T9BA 3PCXA 4Y2TA 5HKBA 2ZULA 1ZH8A 4KDEA 3G0IA 4I4TF 2Z2JA 1CSEE 1JWLA 3IEUA 3ZV3A 4ETNA 2Y0PA 2BMDA 4YRRA 1CR2A 4Q1DA 5K4AA 2VBFA 5FEMA 4KOEC 4DR6B 3ZIAD 2IIVA 4ZHQF 2DFNA 1DWUA 1ZJWA 5JMWA 1G0OA 4L7VA 3ZXXA 2DBRA 1M8FA 1ZJ6A 3S27A 4CBVA 4YXWD 1OF1A 2IYLD 4ZI7F 1X7WA 4D4IA 5JECA 3V48A 5ECGC 1XQYA 4QOHA 4D3YA 2BONA 1VKRA 4V2UA 3WKEA 1M2OA 4GWKA 5GMOA 5H68A 1XMPA 2E4WA 4DDMA 2HK7A 3E03A 3I3OA 2C9MA 1XALA 1J97A 3EIUA 3IB3A 1IMJA 2I8AA 4LPKA 5EXXA 4C6TB 1U7WA 2QVLA 3ABOB 2GBGA 2HQBA 2WHYA 4JMPA 2YZGA 5EWJB 2QXUA 1R5OA 1NBAA 1QGOA 1YVRA 2PLFA 1P1JA 3D7KA 4LZAA 4QT0A 4B85A 4L8YA 4ZVTA 1E1RA 2ANBA 5JZ9A 3UKDA 5DTIA 1CQXA 2YOFA 2E21A 4D8YA 1Z29A 3WRWA 3EF1A 4PG6A 1XVAA 2ZRDA 3N8DA 4YAOA 2DPMA 4O2RA 1B6SA 1ZICA 3BICA 5A0FA 4ARUA 4WASA 4QFDA 3ZHRA 4DCUA 4J1TC 4A23A 3TZ6A 4ZO8A 5L4NA 2JKZA 5HG0A 2YY7A 3QLJA 5BQ5A 3F6BX 2ZBUA 2DHQA 3V2IA 5D6OA 3PXAA 3O95A 1Z4OA 1YB2A 3WYCA 3KOUA 3U3KA 3DPIA 3DVRX 4FGZA 4G0YA 4LK2A 1QHFA 2DTDA 3KWJA 4GSKA 5CLGA 1PFYA 2ZGVA 1Z0DA 1X7XA 5JZVA 3ELYA 4ACBA 5K8TA 1GRNA 4ZP1A 5D84A 1BJTA 1QGDA 1MV5A 1ZQ1A 3TAHA 4RU1A 5DK4A 2RGUA 3K94A 1ZL2A 4IIEA 3ZH2A 1G3UA 3AFGA 2FSHA 2QORA 1R0KA 2VZ9A 2OR3A 4E2YA 3RROA 4DV2B 2OWEA 3H5WA 2G9VA 2R8BA 3K5HA 1NHWA 2PKRA 3D3JA 3K0CA 2XWSA 5HBRA 1OXVA 3OZDA 4RFSB 1SKBA 5E7MA 1MC4A 4CEJB 1NF8A 2H65A 2VUHB 3AEYA 1W0KD 5CLFA 1T0BA 1FYWA 1ZIXA 2EG5A 3M34A 4GM0A 4CV0A 5I7UA 5K05A 3L8FA 2TECE 4TLDA 1DP4A 3DDSA 1B15A 2LPMA 4GZ3A 4DJTA 1BE8A 1JPNA 2IYNA 1ZG3A 5BYJA 5JBNA 3WIBA 4AO8A 1XZLA 4JEIA 5BQXA 5JZOA 1FVHA 5CR9A 1D2EA 1GILA 2DSTA 1DSSG 2IZ6A 2QT9A 2EBUA 2RBEA 5EMNA 4YMGA 4Z6KA 5L7TA 1OH8A 3OCCA 3I5AA 2ZR0A 1RBMA 5CX1B 2PBRA 5FFFA 5H83A 2WYVA 5C1IA 1RRCA 3SEZA 2VH1A 3KEOA 3KPYA 3OFVA 3EAQA 1SBYA 3I0ZA 4WX2B 621PA 2I6QA 4RIFA 4C06A 5EINA 1F6DA 2CFCA 2QN6A 4FZJA 4Y9RA 3STYA 3CPHA 3KEMA 3AVOA 1TYEB 5F76A 4AURA 4UHEA 3SMVA 3PI7A 1Z68A 3MELA 2HCFA 3QYAA 4KBYA 2I2WA 2JFUA 1L6IA 3JATB 2XMRA 3OOJA 4PTZA 4BGUA 3M1LA 3STVA 4WVLA 5HIAA 5CYFA 4QLAA 3PITA 4Z99A 4F9EA 5ESRA 4IIVA 4OK6A 2Y93A 3TF5A 3HK2A 3P0EA 2NZXA 1ZXXA 1N1DA 1QIIA 2OFOA 3B5EA 4BN0A 1E79A 1EP2B 3EW7A 5GOTA 2O9JA 5AW2A 1HYBA 1A76A 1NW9B 1P73A 3P2MA 3HKDB 4IHQA 4O2BA 4QVGA 4UXIA 5JQGB 3EXAA 3L8MA 1NN1A 3RVKA 1K3UB 5AOVA 4DCMA 2P40A 3AM1A 2PIDA 1SB8A 3GRUA 3NT4A 2Y1OA 3HFJA 3EB9A 1ELOA 3W7BA 1ZUD1 3L43A 3RSGA 4TZ0A 3IUBA 3P20A 1RXSA 3OLZA 3VKHA 2GZHA 1SD1A 4ZVRA 3RH0A 1SHTX 1UMCA 5EGSA 4DAEA 5HPYB 1UAGA 1SUDA 4XEHA 4ALKA 5REQA 2CCKA 5BSRA 5C7OO 1I7DA 2CV2A 3BWEA 1C9JA 1YTLA 3QP9A 2PUFA 2FW8A 1SCUB 5EJ2A 3SSAA 3P2OA 3MWYW 4WY5A 4YECA 2CNWD 3TLGB 5DZSA 1GQFA 4HDNB 1CUWA 1G4HA 5SV2A 5JS6A 4FVTA 2FZ5A 5IXJA 2AJDA 1ZNQO 5HKLA 1SKYE 2Z1DA 2OTCA 2XD9A 3EHDA 3RC1A 2XYHA 5TV2A 3TL6A 3OT5A 4AY6A 1GZUA 2V5VA 1WZEA 2ZOSA 3DKKA 1FLDA 4E5MA 4YAGA 5LOVB 4UTOA 2A9JA 3DBRB 3GEHA 1HY3A 2FFBA 2CXSA 4MI3A 4O4LF 4XGQA 1J2YA 2QRLA 4N3AA 3CG0A 3HVHA 1YRWA 4CKWB 2JVIA 5KYWB 1MT0A 1ODIA 2GZ2A 4ZT4A 1CW2B 1KY4A 3BDVA 3G88A 4I8XA 4RD1A 4RPKA 3ZEAA 3I6ZA 2WLSA 5AHXA 2YHSA 2IHJA 1E79D 1P2GA 1XZCA 4Y18A 4YLYA 4QUBA 3OFSA 3SU8A 3MJFA 3QWAA 3BD6A 3VU1A 4V0RA 2J85A 2R5WA 4RACA 3NCTA 3AUUA 4YROA 1MA3A 5KJCA 3EXIB 1ZPDA 4P1ZA 4PFKA 4UUNA 4WXHA 3JAKB 3NOXA 1GUZA 2QUJA 3L07A 3HFGA 1DXYA 2VYND 5FTKA 5LQNA 4DCPA 4XX0B 4RWZA 4YREA 1MFZA 1YRQA 3DO8A 3JR3A 2OV8A 1WHTB 1GUFA 2Y67A 3PNKA 5LQSA 2C8VA 5IVHA 4IIJB 2JFBA 4X84A 3QNWA 1PE0A 1AURA 2FGKA 1PS8A 2QN7A 3HJTA 5SZKB 4CN9A 5LMCA 1SKMA 1G7CA 2XTNA 3HNRA 4IX9A 4WLVA 3THYA 1Y7TA 1DAFA 3C87A 3LZDA 2R60A 2CXNA 2Q1UA 4AN1A 1KU0A 2ZT6A 4ZT3A 4INAA 4Z3OA 4TN1A 3WGGA 4GHWA 2HD4A 3HLKA 1Q0PA 4PLVA 1VDMA 2G09A 1UZNA 2O8DB 1Z13A 5JADA 3SC6A 4DQ0A 1NAHA 4ZVNA 3UJ9A 3ZS9A 1XZEA 3HJCA 4ZOEA 3TTWA 2XKJE 4D9FA 4IZHA 3V1UA 1UXGA 1QQBA 1NI3A 3HKEB 2ZJOA 3C2QA 1G17A 1C7FA 2AFHE 1U9CA 4ARZA 1AM4D 3X44A 1JVSA 2YHAA 4IIFA 2JA1A 2IHKA 2YUIA 1SVKA 3C1AA 1OLUB 4LQ4A 3AIIA 1UFKA 3P0HA 4JFRA 4K9SA 4XQCA 1F1BA 2VK8A 3KSRA 3SC2B 1JTFA 3NDJA 4KR6A 2H85A 3TJMA 2O14A 5KO2A 3FDZB 4IILA 2XTZA 1LXCA 1EH5A 2AMJA 5EIHA 4QULA 1GHTA 1MAHA 2II6A 4IV5A 2HEIA 5AKXA 2QV0A 2XLCA 1ZOPA 3AHJA 1VCMA 5F5NA 5JT1A 4S35A 3QE9Y 3OQOA 3H9CA 2XB2A 3OI7A 2XUKA 4MUEA 4CM9A 1ZH2A 4XYEA 2BL4A 5F1PA 2ENUA 3ETJA 1V1RA 5GM1A 5BPFA 2YXDA 1SBTA 2QG9A 2UDPA 1SULA 2W6ID 2XECA 4JC8A 1AB5A 5J2TF 3SR4A 1AO3A 3GMDA 3VSBA 4I4NA 5AUQA 1HE5A 4C6RA 3BX1A 1RYDA 5BMVF 3KZNA 3QJ5A 3EIQA 1EFVA 1JR3E 2OCBA 3KTAB 2CHQA 3EQZA 2WAMA 3UK6A 4O2LA 4MIYA 1TLLA 4Z1MD 4BO3A 1DAMA 2YZ7A 1LWOA 5B7QA 1L8OA 1IDOA 4D96A 5LMZA 2OHJA 1QIFA 3X1WA 2PYZA 4JI4B 1ECLA 3P26A 1S3FA 4MKGA 5NULA 5LLDA 1NSFA 1C1XB 1D1SA 2CGEA 4HBZA 1G3QA 4DLVA 1PZHA 4I4TB 1XVIA 4GVXA 3WBBA 2GAAA 4XB1A 1H0SA 3NG1A 5JAIA 1SQGA 4RANA 2OCXA 4FFWA 4M0UA 1YDEA 2A0KA 5I7SA 2JFXA 3ZZMA 5EUMA 4RHXA 3ZCVA 3V6MA 1PUXA 3E15A 3QKRB 3DB2A 2VDWB 2HNAA 1CJVC 1X1TA 3Q5EA 3DBVO 3HI4A 2JI9A 1BAPA 4R9NA 1BYUA 4UPVA 3MOIA 4QD3A 3QM1A 4YGXB 2DERA 2BHLA 1YR8A 1YE5A 3WLHA 4CFZA 2UYOA 4F06A 1GFZA 3CB2A 2G77B 4M3NA 3VTZA 5BWLA 5I4CA 1JBKA 2Q2OA 3BXGA 2OCKA 3CA8A 8GPBA 2NVBA 5LIPA 1ORVA 3EZ6A 4CMEA 1WQ4A 1KOJA 4O4JB 2QRVB 5FJJA 3UJBA 3GLQA 3M2TA 4G5QA 4LVOA 4ZT6A 3B6IA 4YMHA 3VOTA 3CN9A 4MWZA 1B76A 1K75A 4RVDA 4OU5A 4DKJA 1N5LA 1V71A 4EJMA 3L04A 3GBPA 1G16A 2OHOA 4OL9A 3SR3A 1GQ2A 2JLXA 1GPWB 2ZETA 3TINA 4YQEA 2W6IA 4QE3A 4BCBA 3E9NA 1NY6A 1FNNA 1G6Q1 4B2YA 4LQLA 2YICA 3L49A 1VLQA 3KL2A 1K63A 3PL5A 3FTCA 1SC9A 1YB7A 4NDZA 5DN9A 5C3MA 3DEZA 4CI9A 3EUFA 2BR5A 2OE2A 1F5NA 3IULA 3IR5A 5ERXA 4UTVA 3TGPA 1S2OA 1PG2A 1R9NA 1K2VN 3T3HA 2R86A 4REMA 4OHFA 3G2MA 1X15A 3V46A 1TVKB 2R6R1 3Q12A 4URUR 1Z5WA 2SICE 1JEEA 1I3NA 2VDUE 3HYTA 4BJ5A 1NMYA 4LXQA 1DBWA 1W4LA 3A9TA 1Q17A 1KVRA 2GPBA 13PKA 2BKXA 1XK6A 3TTTA 2QL6A 4Y2XA 4MUXA 1J56A 3L5KA 4D6XA 1H5UA 3BDAA 3FCSB 4MV4A 1GNLA 1QVRA 4BZXA 3HBJA 2XZTA 1RKUA 4MK4A 5KTTA 2VP4A 1YZHA 1E8NA 1E1QD 1YKSA 3CKYA 3G9UA 3O8NA 4L16A 3AZPA 1JZQA 1MGPA 2VHQA 3S2YA 3ADCA 3JRWA 3UK0A 2D2IA 4L78A 1FMTA 1I2CA 1UL1X 3CISA 3U2QA 1DBQA 1W5FA 2QN3A 3FPFA 3LBNA 2DEUA 5EA2A 1P8AA 3G8DA 3K09A 4RGYA 2ABWA 3HADA 3KSMA 4UD2A 3MTAA 3SYRA 2Q45A 3JQPA 4BQIA 1FVFA 1D2NA 1HE3A 3A1VA 3I45A 4LPSA 4WLUA 1RMTA 3T1NA 4AI6A 1CS4C 4ED9A 2P0AA 5TXGA 5IVKA 3OWOA 5EUCA 2ZYAA 2FW6A 4QNRA 4Q93A 5B3KA 4DR3B 4S0XA 2CLHB 2Q1WA 4G8BA 1OFUX 3ZD6A 2ORIA 1KI1A 1UBMS 3VR4A 1C4KA 3JTMA 3DVSX 3COJA 2FRDA 3K9BA 5JAPA 3QHPA 2Y99A 4B79A 1W4ZA 3WMWA 4F56A 2PGJA 5CLLA 2UZAA 2BW0A 2Q41A 3DZGA 1TJ4A 4L3WA 1OE0A 1YK1A 5HUJA 2GEDA 2HCTA 3BBPA 4FHZA 4D46A 2M98A 3OCZA 1GDHA 1HI9A 5K0FA 4NX2A 3P0IA 4PIVA 4TVBA 1ZD1A 2ORYA 5JMTA 3SM9A 1TD1A 1PN3A 1ZVMA 3B1XA 1K08A 4PC2A 3GDOA 1G20A 4G2TA 4MZDA 2RHCA 5AHOA 2C5BA 5D3ZA 6ABPA 3ZVKA 4Z9FA 1FZTA 2PPLA 3CH7A 1EGVB 1FDUA 3Q40A 2KMLA 3P32A 4XSGA 5DFAA 4EGAA 7REQA 5IH3A 3ZQ4A 2WF6A 3C3JA 3WP1B 2QGFA 4UU7A 2ZIEA 1OH7A 3DDOA 3KOWA 1M1YA 3D3EA 1DXHA 3EGDB 1PDWA 2VP3A 4LOLA 3HWRA 3RS5A 3GLIA 4B3BA 5ALVA 2IE8A 1Z2NX 4N49A 2DP4E 3KX2A 4WH0A 3T38A 4NOKA 1X9GA 4RNDB 3T52A 3WLTA 1RYEA 5FTNA 2CZQA 1AH2A 3WE7A 2QNIA 3DVLA 4TTSA 3U4IA 2DHRA 5JAOA 1FK8A 5JZMA 1RCTE 1T5LA 4HS9A 5HWSA 3IT1A 3Q3IA 3UWDA 1YIDA 4PQRA 1H8HD 1GVNB 2LDBA 4C30A 5DI3B 2O54A 2QZ4A 2YVUA 2VJCA 4C5AA 1WWKA 3C5WP 1YQEA 2IU4A 5AVRA 1XELA 3BG5A 2I65A 5ETJA 1G2IA 4ZRDA 1T25A 3USES 5LU9A 2QRVA 3FNGA 4DVJA 1LTQA 1G60A 1ZMTA 2X4IA 4IWYA 2P62A 4K1LA 4B73A 1JG2A 3NS7A 9ATCA 2AUNA 1P1FA 3CRMA 3QYPA 4QAQA 2CMGA 1X0XA 3A3NA 3OIYA 4RLSA 3V34A 2EJCA 3V97A 2WOJA 4HPJB 3SOPA 1NG9A 1KZ7B 2PJUA 4Q9IA 3DAFA 3PQ8A 4K5QA 3ICQB 3IVMA 2EXXA 2HA5A 4CMJA 1FS4A 1MO4A 1XBTA 2DGDA 2VYVD 3DMGA 4J16C 4YS6A 4ZCSA 3AR6A 1NHGA 2XNKA 1AHNA 4X95A 1OILA 2AW5A 2YBDA 4WOCA 2OHFA 2X9NA 3ZTWA 1T1RA 2DR3A 3RS0A 3DLAA 3TZHA 2P0EA 1TM1E 2WFLA 1D9XA 2QIOA 3BIOA 3CEPB 3E8MA 4YJGA 1M34A 3ET5A 3CH5A 2VAMA 3M4NA 1F2TA 4RV5A 3THOA 5MFZA 2ZRNA 4DWOA 1JHQA 2HK6A 4S2EA 1PV4A 4AKIA 4ROSA 4N5HX 2OO3A 3M9LA 4MCAA 4UCXA 2OBLA 1Y89A 4OCZA 4OMCA 5DLYA 4TTTS 3S2GA 3KQHA 3NGXA 2JVJA 2Z2YA 3G2NA 2LIVA 1PVDA 5AMXA 1N77A 4ZVPA 4IBOA 2MR5A 3I9OA 2ZBEA 1G5PA 3H17A 3WMFA 4UKDA 3HCWA 1K27A 2HDNB 4TMXA 1HE2A 4DR7B 1YJ8A 3TQRA 4AZWA 1UPTA 2HLDD 2P2GA 3SLKA 1CY1A 3P2IA 4X24A 3KCNA 3KCQA 2OXCA 4GMDA 1RRFA 2V0GA 1GLVA 4CF7A 5ERYA 3A4VA 2QZ9A 4ZDKA 3IQEA 2IHNA 4OFZA 2I4IA 2XCOA 2WTNA 2XYGA 1BDIA 3C3PA 4HO1X 2ORVA 4WZAA 4W8HA 2YUTA 2CHVA 3OTQA 3Q41A 3TAUA 3EIOA 4KVZA 4PSAA 1LSJA 1ISIA 2XA1A 1JHXA 3THRA 4FMCF 5IDXA 1CLUA 2PGLA 1UP4A 3G0HA 3I04M 1JQDA 5ALOA 1G4UR 1Z0KA 2H51A 1FMFA 1Z6AA 2BLLA 3H5AA 5GIOE 2C83A 5EMKA 2OBBA 2RKOA 1WRBA 2C4HA 3IV9A 4G23A 4TMWA 3R5SA 1R37A 1XTZA 3L7OA 3OIGA 2FSVA 3I4FA 2HCRA 4O3FA 1JQEA 4RKQA 3GRYA 4X44A 3AF6A 1JJFA 3CIFA 4RNCA 3CS3A 1RIIA 1ZVJA 3HR4A 3DE2X 2IDZA 4M21A 2FXVA 4OHBA 3TNDA 4BVJA 1WS6A 2QDKA 3GXBA 4INJA 4D92A 2V6BA 2AN9A 3CV3A 1COWA 4KVFA 1HLDA 5JD4A 1SO8A 2C0PA 1DX6A 4EAAA 1MG5A 3ZVNA 4MLZA 3L1KA 1XMOB 2AUMA 3VTFA 1H2WA 4A9AA 2D2EA 5KVCA 2CL5A 5DW0A 4BAUA 1T9GR 4EVIA 2ZXEA 3R6WA 3VTAA 1TT5B 3E05A 2AX4A 2EBFX 1VBNA 1ZK4A 1ZL0A 4X3OA 4JUAA 1E2JA 1W7AA 3AG5A 1GTRA 3QFRA 4KQXA 4XKJA 5BN4A 1QKIA 2ZYSA 5IJWA 1H2HA 1NZDA 1T24A 1TF5A 4LOIA 4CL0A 2C1EA 1GQSA 3R7NA 2G04A 3GL9A 3IBGA 5ELMA 4Z0HO 5FRDA 2OECA 5BXYA 5B12A 3OQ6A 5C8YB 5JBQA 3ZQJA 2BTQB 1YQWA 2LNDA 2HU5A 3GY0A 4UCFA 4R71A 1RLIA 5BYAA 3G0DA 1IIRA 2CCGA 1AG9A 4FTWA 4EW2A 1JXAA 3MWEB 5JFOA 4QQ8A 1BGWA 2JCXA 4BGEA 2FEKA 4OYHA 2I9KA 3FYTA 2HHAA 3S8EA 1AY0A 5AI4A 2XQJA 3BGOS 4C07A 5ENVA 1EESA 2PD6A 4H3HB 5T64A 1F6BA 2B94A 1CZOA 3I30X 3LBFA 4M6WB 4XJXA 5CFMA 5ITSA 4PO8A 3PD7A 5TGZA 4ND3A 1ZHFA 3DF7A 4KK3A 3V8RA 4RSHA 4WLOA 3C43A 2IYTA 5CH5A 1AJEA 1AKEA 4Q1VA 4E4RA 1OGJA 4R1OA 1OX6A 2R8PA 4UVDA 4NU8X 1P7CA 3QUSA 3WGQA 4YMUA 3MBOA 1II8B 1R7RA 1KI4A 3ND5A 4IDOA 1VQ1A 5LQMA 2KB0A 2PY6A 1H93A 1WPGA 4RZ2A 4Z9AA 1GL3A 3CMMA 1QFYA 2O7VA 2WG1A 3FR8A 3HCOA 5HF9A 1BA3A 4Z4QA 3CRRA 2CUNA 3CW2A 2FQQA 4FFBB 1K8RA 4AKEA 3Q6MA 1YQDA 1NP6A 1TADA 1IN6A 2PZAA 3R24A 3EVZA 1Y5NA 4UMDA 1D2GA 1PQYA 1Z83A 3HJGA 3DEHA 4R83A 4BC0A 4WA8A 4IRUB 3S2FA 2X0IA 4P0TA 1Y42X 3ETGA 4WXRA 4KRYA 3OUUA 4RTKA 2Q3BA 4WXEA 4WNAA 5JCJD 2JGIA 3KEQA 3K6JA 2ATVA 2H7VA 4WMLA 3MCTA 1FNMA 3V42A 4KWCA 5JEDA 3IE0A 1KPIA 3GZTB 1QHXA 5DTQA 1P0MA 4DCSA 5D1NA 2UUCB 1VL0A 1X39A 3EG5A 3AERA 1YL5A 4QA9A 2PKQO 2XD4A 3T12A 4YMIA 3V55A 2Q6OA 1CP3A 2YRWA 4IG9A 3S8YA 3FMVA 3SBDA 4NKRA 3LRPA 3MUFA 3LC1O 1F4PA 5AM5A 1PS0A 1N6OA 1J6UA 5B7PA 1DV1A 1AKYA 1ZVKA 1BMDA 2B20A 2ZT8A 1Q6ZA 1UEJA 2ZKIA 1UWKA 5EUBA 4YMTA 2V6IA 3IR7A 5DB4A 5ALZA 4MVJA 3WP0A 2H7CA 1P4AA 2I6UA 1VHLA 1C8KA 2ZB7A 3EMDA 3G0GA 3TRDA 2PZEA 1XZAA 3RWBA 2H1RA 1EE1A 3KHUA 1ZZGA 3PNBA 2JLRA 1GKIA 2NN3C 2XCRB 4ER6A 3WBKA 2YFKA 3CZ5A 1W52X 1GPBA 5EQDA 3RC2A 3E5HA 3EFEA 3K8OE 3KQMA 2PLRA 4I5EA 3ZWAA 1KHTA 5BNIA 1H1LB 3ICOA 1RNLA 3UJCA 3V4PB 4RD4A 5EHIA 1SBQA 1S5PA 2WVAA 3TL3A 4A2QA 4FXPA 1GNPA 2XMPA 3GT3A 3GMSA 3OCWA 4FONA 4QXMA 3OZTA 4AXXA 3ORFA 4PGMA 2FOXA 3IEXA 2HQOA 3ZBUA 2POCA 3NCHA 4EZIA 2VP9A 2CJFA 4P7GA 3E5MA 2BEVA 2XCIA 3AV3A 1EM8B 4R8MA 4RJLA 4WY2A 1G20E 5EQJB 1SG9A 4GBMA 4BNIA 3T3OA 4CQMB 3Q85A 1I8TA 2AE2A 4M83A 5EP3A 3HA3A 3UK1A 5ILOA 2J5RA 1I13A 1RWNA 2WKQA 2Q50A 4YRSA 4M7OA 1L3BA 2HIHA 1X1QA 4I14A 4L28A 4RCVA 3RIHA 1D5CA 1SM4A 3LRXA 3S2UA 1BE0A 1Y8QB 1R5NA 4IAOA 3EIHA 4GEKA 1CV2A 2ZTMA 3ROXA 2O50A 1YKFA 1JAYA 2GEBA 4JUCA 2BFNA 1XNHA 4XCQA 2VJMA 1H5NA 4IDDA 4YRPA 4QLBA 1VI2A 3IBYA 5E9WA 4R7TA 3PI6A 2P4SA 3Q9NA 3HJAA 5E6RA 3B8EA 3C7KA 4WW0A 1WB5A 4PC1A 1IXRC 2IHZA 3CKKA 3JYOA 3PE6A 4PSUA 4YP6A 3RBVA 1BG6A 3F3KA 2ACWA 2BKEA 3LVRE 4J1NA 4BRUA 5I7EA 4D9MA 3HL4A 1BMTA 4ABTA 3WADA 1SUFA 1QCCA 1Z0FA 4DIEA 4UUAA 1Z15A 1C1DA 4N7BA 4XEUA 3W6PA 2HU7A 1G8FA 1T1IA 4QUJA 4NJOA 4MOWA 2HRCA 5CURA 2BGGA 3W0LB 3FVRA 4EI9A 5IVPA 3KJIA 5LVAA 3R3YA 4ZQEA 1JIXA 2NYVA 1QB7A 1HEYA 1W4AA 2B34A 5CRIA 1AS3A 3GB9A 1YR3A 3FYUB 1DL5A 4JYPA 2R6ZA 2WYUA 2YC4C 4UZEA 1ADBA 3T5CA 3GJYA 4C6SA 3WI7A 5DLQC 1UAYA 4TV9F 3O91A 2ZYRA 3HUDA 1BGVA 4N6OA 4RAQA 1N5IA 5DM4A 2JDID 2NSYA 1JYFA 4DQDA 4B82A 4Z4EA 4U2KA 1E6LA 1JLHA 1PDVA 3A3KA 4KQ2A 1KARA 3OP1A 4BASA 4CM8A 3WL8A 1KO1A 2G1AA 2PKWA 3R77A 4WJKB 3RYTC 1MLDA 3T4UA 3TNFA 3K70B 1LLFA 4GXRA 1DE0A 2NYAA 4Z4HA 3O4IA 5ALHA 3UHFA 4CF4A 3B6ZA 4YX9A 5C5EA 2X0FA 2IIBA 1ETHA 4UREA 4X93A 1A4RA 1HZZC 2ZWMA 1L7DA 4O08A 4CWAA 4QATA 3T35A 1LSUA 2BGKA 1RXVA 3UENA 4TTQA 3VHLB 5K9ZA 3CH4B 4MVJE 5H82A 3RCBA 3AMVA 4OH1A 5K1ZA 2FVXA 4EDHA 3NVKI 1N4DA 3NNDA 4P3PA 2GESA 3S5UA 2G72A 1NXTA 4HRAA 4EB6B 2IHTA 2UKDA 4IJ6A 2CUKA 3TLMA 1TCVA 2V1XA 1I9CA 1WXWA 1MJNA 3R3VA 4UEWA 1V5WA 2I66A 2PSHA 4WRRA 1X7XB 3K53A 2YOGA 1OH5A 3VAZA 1DCFA 2HV9A 2FPRA 3NHZA 2FN7A 3EIFA 4TKVB 1PFVA 1JECA 3RBXA 2FSPA 3VVBA 5CTJA 1FPQA 1Z34A 4KIJA 5FUQA 1VXOA 1PX2A 2AJ8A 2I03A 1BFUA 4KE9A 3W5IA 5SYNA 2WQ6A 2O8FA 1L4YA 5EIFA 1CHDA 1PZXA 2OLKA 2VPPA 4AF6A 4CDMA 1UJ6A 4CQMA 3ZLJA 4AZTA 3TKYA 1N6PA 4CHGA 1CUYA 1FYDA 2ZAOA 5AI6A 4CIBA 4N7RA 3QIVA 5LUAA 1E2EA 1U04A 3B3QA 3EQ6A 5KQMA 5AP9A 3WO0A 1H8EA 3DT9A 4DXHA 5G3YA 3AC0A 3IXLA 3NNNA 3T3GA 3ZV4A 1UDRA 1IHOA 3COZA 1L8AA 2C9YA 3ACCA 4P9NA 1HSOA 4NHEA 1J9EA 1FLVA 3WQHA 4XIIA 3OEHA 4MV1A 2BBWA 1EIZA 1J9GA 5FOSA 3A4LA 2QZJA 3KXDA 1ZMOA 3T3PB 3U49A 5L45A 1K5PA 1FDIA 1P5ZB 3L6CA 3SSOA 5KWVA 5CIYA 3U5ZB 3WHIA 2FJPA 4JJ6A 1Z6YA 4D0GA 4LFAB 5A9TA 2YX1A 3I6YA 1L8QA 4PLHA 4IG4A 1JFVA 1MFPA 5JVDB 1MB9A 4YAUA 4JLNA 2DFDA 3PYLA 1NQ5A 1TC2A 3RSHA 1VMDA 1WV0A 3E1SA 3V8NA 5F2EA 1XTTA 1KEUA 3IAM1 3K0BA 3W5BA 5FQNA 5E0OA 2E6KA 2W2VA 2ACEA 4J2TA 5JE8A 4L8GA 2RGNA 3VU9B 4HTFB 5CDTA 4O4JF 4RZXA 3MRXA 4IY1A 5ITWA 3U44A 2PYDA 3TECE 2FRXA 1O6CA 2YV1A 3FKJA 1QCDA 5CW2A 3ZDBA 3GGSA 1YASA 3F5SA 4RK4A 4Y0NA 2J9GA 3HPRA 2XE4A 5TEWA 3WXBA 1CDOA 4E5KA 4EGJA 1X7DA 5BSKA 4LF9B 4LJ6A 3FPJA 3BUSA 3SFTA 4EUEA 5EGNA 2GS9A 3IEIA 3M1IA 1GUDA 2MHCA 1ATZA 1WPQA 2WTXA 3DEJA 4HQ6A 4TMFA 4ENVA 1H6BA 4NCKA 1G18A 1H6DA 2BFEB 3GLTA 3OF3A 2V7TA 2LE0A 1XRLA 4RJJA 1JDUA 3DZKA 2JIPA 5HQTA 1QRSA 2HA6A 4O4IB 3WL6A 2CXHA 2DQ4A 3A25A 5CH8A 1A97A 3OFJA 2VDLB 5C8DA 5SZHB 3TSCA 2EEPA 1C9NA 1EK1A 1SCUA 1X8XA 2FPIB 2NVWA 2QRNA 1PZNA 1RJGA 4GE0A 5CFZA 4GSYA 1U8AA 2KHZA 3QPWA 4Y6SA 4JHLA 3F3SA 4EYGA 5TLSA 2WPNA 3GLIB 1W2HA 2QLJA 5BV1A 5EIBD 1EJBA 3CVVA 2JFGA 3WK6A 2D7JA 2G9ZA 3EC2A 3M89A 4GS5A 3OAAA 4Y2RA 3CZQA 1WCXA 3DQQA 4Y1FA 3ZVLA 2NGRA 5JD5A 1MZPA 2DQKA 3ECCA 3FNHA 5LA6A 4BFTA 5HOQA 2X5NA 3BFXA 4MVWA 4UU0A 5ICGA 5KTMA 2VNJA 2VQ3A 1PWHA 3DEIA 1NVFA 4HSEA 5FBRB 4QUKA 5KQGA 2WFAA 1XDDA 4CUJA 4XCXA 4B6PA 4QGGA 1M2KA 1XI2A 3MM4A 5DYGA 5BVGB 5BSWA 1EWYA 3V7NA 1NJ6A 3Q1LA 3PQ6A 2TMYA 1IXSB 2PRKA 4B6QA 4BNFA 1L9XA 2AFHA 4CGYA 2CL0X 2YJ3A 1FLAA 3B8HA 3OOWA 4M76B 3ONWA 3L5OA 4FFNA 4PBSA 4O4HB 5FNVA 3WQRA 3H2JA 4DTIA 1LK0A 3DOUA 1V0JA 2CVHA 3NTOA 1UXHA 4KFRA 3V8EA 3MZ0A 3RIEA 1WF3A 3WDLA 2J59A 3BFVA 3ZW8A 2HJRA 2QW0X 2R8XA 2X0EA 2E18A 2V97A 1M1XB 4L27A 1SUAA 5IANA 4FW9A 3ZIDA 3ZLBA 3FOBA 2Q5LA 3OWXA 5FAXA 4YRKA 5EFZA 3T8YA 2BM0A 2B1GA 2EW8A 4DW8A 1JIQA 2XVXA 1M5RA 3EOBI 1S3SA 4NECA 4NBUA 3KB1A 3BDIA 2P9EA 4YMSA 3U7EB 1NLFA 1Q44A 1D0VA 1T8TA 2WHPA 4WGFA 4LFCB 1QOQB 3O38A 4KE6A 3CLRC 3O75A 4MW4A 2GCOB 1YIOA 1TA9A 5AVZA 1OWNA 3V8VA 1EUDA 3B3FA 4PLCA 3ROKA 3RUEA 2Q4RA 1IMOA 4KAXA 1QS0A 2VDRB 4UEKA 4K28A 5CPBA 3VMFA 1S8FA 1V16B 3CLSD 3DDHA 3O8LA 1I80A 4Q47A 2YXBA 4IMIB 4EJ6A 2IHBA 2NPFA 4HDRB 2Q3EA 4MHSA 1CVRA 1P0IA 3C7CB 3CZCA 3RFFA 4HMOA 4K0KB 4EG5A 1LI7A 1WUHS 3GJ8A 3SSNA 4DEVA 1S8NA 2VPIA 3TBFA 3ZU2A 4AO7A 3IE1A 2XNJA 4OLAA 5KWSA 4FD2A 4KXMA 2OQVA 2FG6C 1OBOA 1E92A 1OYOA 4AJHA 3FPAA 2GA9A 3JQBA 3WS7A 3T41A 3IELA 1BQ3A 1CVIA 2IEGA 5EAIA 3V4OA 3IB6A 4TSRA 4LX8A 4J6EA 4RULA 1MO6A 4CM9D 1AQNA 5AI8A 4XW2A 4CM4B 4I8DA 1CUSA 3G59A 1J0XO 2PXAA 3HDYA 2A4KA 3LK6A 4GP6A 3T54A 3WZ2A 3FDJA 2HLDA 3QJGA 1X6VA 1S4MA 1UBNA 5A0VA 2D6FA 4G84A 1CR6A 1OTXA 2J07A 3ML1A 3VU8A 1J2EA 1P7PA 4AJNA 5A4IS 1UKAA 1ODCA 2NTVA 3HCBA 4NE7A 3X3HA 2M6KA 4RD2A 2A0WA 1EG2A 1NN3A 2DG2A 3FROA 1E2DA 2BGTA 3IUMA 1J0CA 1PFWA 4HYQA 1FDTA 2BGLA 2MINA 4UFPA 3LUCA 3NM4A 1DJMA 4HN2A 4G1BA 1ZD3A 1RKQA 3D2CA 3DMTA 4YV0A 3GWZA 2W93A 4L4XA 4F9TA 2B36A 3NV7A 1UUFA 3BN3A 2QPOA 1N2IA 4A0SA 3WY9A 3GFFA 2FWPA 1N5KA 1G59A 1SK8A 2Z6QA 3K71B 1EYZA 3AFNA 3WAGA 4B5KA 2EGGA 3QLTA 1F2TB 2A1TR 2HLPA 1VKNA 3DKVA 4IDPA 5IT0A 4RGBA 4R69A 1Q95A 5J23A 4QU9A 3F8WA 1XQXA 4RA6B 1Y3BE 2ORED 4J3FA 3ASYA 3OWHA 1OC2A 5AVWA 4RMIA 4V0SA 1O77A 1W88A 2P75A 3KJNA 3OZIA 5JBIA 2E5LB 1CULC 2YN0A 5JHGB 2EWMA 4Q3OA 3FWHA 1CK4A 1XTRA 3ZUPA 5TPZA 4IVNA 3KR9A 3FUTA 3D5QA 4MKIA 3GEBA 3R5HA 3SC4A 4IKPA 4CV1A 3D4LA 4F5EA 2HYIC 3IDSA 1T0PA 3R1IA 3WYBA 4BMDA 4E5YA 1OT5A 2YJNA 2JFHA 1MRZA 3AP2A 4OXYA 1YDHA 4YMLA 2JH3A 3DJYA 4JELA 4AM8A 2CK3D 1QYXA 1Y1KE 2WYHA 5GJCA 1UOOA 3S1SA 4M9ZA 1UC8A 1AKMA 3ESBA 3MTJA 1IBRA 3PUYA 1RZRA 2JI6A 2QQ5A 7AT1A 1N8KA 2FCRA 3RTGA 1RWOA 3BSSA 3VMMA 4LHWA 1T2FA 2NZJA 4O1IA 2NQTA 1N9ZA 1W44A 5F5XA 1YR1A 5FNVB 2IIQA 1XKLA 2EC5A 3KQVA 4D2IA 3L40A 3R2JA 3ZQUA 3M4YA 1CP2A 4DB4A 4KWHA 2C04A 1J42A 3GAMA 2QLNA 2OUKA 2MSNA 4HN4B 4RBNA 5A7GA 1W85A 3VPHA 4QUGA 4AZVA 3I1IA 1R0CA 4FOSA 3UMSA 2BFDA 2ET6A 1E4OA 2O3SA 1VIVA 4RHYA 2GDJA 1Z88A 2CLMB 1IOVA 4NV0A 2LTAA 5ADWA 4PG5A 1KZYC 2CY0A 4QM7A 2P67A 2J87A 4GPZA 4B3GA 3FSJX 5K3EA 1KE1A 1CUFA 1TUIA 5IX8A 3HDGA 5HJ2A 3LM8A 4IGKA 3GLFE 1JIIA 3SX0A 4D7AA 3A4IA 1U3CA 3Q7TA 4M38A 3LUPA 2D13A 3EIWA 1HZJA 5FWNA 1GG5A 1VP9A 3OM0A 2WT4A 3IYLW 5CEFA 5AXAA 4N8EA 5F73A 2XUHA 1GKUB 5EIWA 3PLNA 2OZPA 5JHHB 1YFJA 3WLOA 3KJFA 5CEEA 1N2HA 2H00A 5LNK1 5E9AA 1X77A 3I0NA 5JDIC 3LW8A 3PWSA 2GCPA 4FDLA 5CHEA 2FFAA 1YC5A 3KYCB 1JEDA 2GDZA 3WISA 1VOTA 1ONBA 3OJEA 3MJHA 2G6BA 1Y6RA 1YRHA 1ZH0A 2VXCA 1E9DA 3ETHA 4OQ4A 4A1OA 5DNAA 3IBFA 3R7DA 1IHPA 1U5BB 3B9RA 3ED5A 2WMOB 4ZVQA 1L7AA 1XSEA 5FI5A 2COEA 1A3CA 3G9QA 1WUJS 4XX0A 5SZJA 4ZREA 1Z82A 3EZGA 4Y9SA 4M4SA 3I83A 4W1QA 1A5AB 1KS9A 2O1SA 2HBZA 2WFMA 3B9PA 2EKDA 4G1EB 4O8ZA 4R1UA 3TM4A 4V0LA 1IHUA 4E2WA 5JFTA 5C53B 3O82A 3P9RA 2PS0A 1EZ4A 4P3OA 1XB2A 2I1LA 3C8ZA 4INZA 4YJ2A 2GVZC 3X1XA 1M7BA 3WK4A 1WM1A 4CG2A 4EHDA 2W2OA 3T7IA 1I1OA 4ZPJA 4L1KA 3N6XA 4GLFA 3ROEA 1Z6PA 2Q7XA 3NDBB 5M3BA 5J5CA 3V8MA 1ESCA 2GGSA 3TUIC 5KKCA 4UM7A 4IEEA 5COAA 2DLCX 1LQ2A 3H7AA 3HHEA 1N2CB 1WMSA 4KDCA 2Q1YA 3ZY3A 1CX9B 1VMEA 1PHRA 1XZIA 1CR0A 2XQGA 4WGGA 2ID9A 3W7VA 4LJAA 2ZTSA 3KLBA 1MC1A 3IMFA 3LP5A 4MQMA 1OYYA 4NDNE 4OQXA 4V39A 1N6IA 2BFAA 1C7QA 4CLOA 4H3KB 4IHJB 3ERCA 4GI2A 4XGRA 2VJLA 3KTOA 2UVPA 4KX3A 4HXEB 2ZU6A 2SKCA 1A7KA 4N0QA 3Q3VA 3RT7A 4NCHA 3KVVA 1HOTA 1JQ3A 3PF8A 1CE8B 4JLDA 4TGLA 3D6TB 3BE5A 4LDJA 4XWAA 5G0TA 3TKLA 4EY6A 1E3EA 1G55A 3QXHA 2QE7D 1ZUIA 4QYSA 4MV6A 2IH4A 1Z7YA 4Q0MA 2A14A 5KYTA 4V0OA 3Q8KA 4XARA 3N7TA 1NNLA 5CYOA 5AHRA 1T8UA 4DZRA 1CY4A 2A30A 1BWSA 1BU8A 4WL0A 4Q7KA 1E7WA 1NBMA 2YVQA 3OQMA 2DR2A 4KB5A 4UTZA 4BNDB 4KGZA 4JKIA 2YZ2A 2AT1A 3OE1A 4KBFA 3TSWA 2WF7A 4P3XA 2X5JO 3CY6A 3DVAA 4ER5A 1SZCA 3VO1A 3EGVA 1CUJA 1ZI6A 4QWMA 1H5QA 1PSWA 4NEQA 4GOKA 5AKJA 3RVJA 4M37A 2J3KA 3TW6A 1O3YA 3WYFA 4C7VA 2FW7A 3D64A 1I14A 2D5LA 2B4TO 4OQQA 1ZVQA 4B7ZA 1US8B 1RP1A 3ECSA 5LBIA 1ZJZA 1NIJA 1U94A 2XGMA 3TQTA 5AIBA 3KQSA 3JATA 1DZ3A 2HBRA 4WCDA 3MHTA 5LB2A 2PMEA 3FXAA 2Y6VA 3OKPA 2QD1A 3RUFA 3Q8XB 3UA3A 4YCSA 1W76A 1IDN1 5K3SA 2HSWA 2DFPA 3QY0A 4NV3A 5COBA 1KGSA 3V1NA 5K6RA 1DUIA 1T3GA 4MUYA 2QJWA 2V7PA 2PRJA 4TV9A 3EEIA 5CA0F 3NAMA 1KTVA 1J06A 3N76A 5TT0A 4KKXB 4WQMA 2RE8A 1J8FA 1KH2A 3FM9A 4AZSA 2JAQA 1QOPB 1N36B 3F2VA 3FNEA 1IEXA 4HAUA 4JJFA 4XH9B 3U39A 4EPXA 4POOA 1DOHA 3BRQA 3SQWA 4AG6A 4DJEC 3SZUA 1U3FA 2UV8A 4L9WA 4RKFA 5HCUA 2PSJA 4B2LA 5JSUA 2Q4BA 3UOGA 2ZYIA 3T3IA 2ESRA 2O8FB 1PAUA 1QYDA 2YBEA 1ISGA 2C2YA 4H1UA 2XJ4A 2XVZA 1C3LA 3W8DA 1C0LA 1I3OA 3K6SB 2DR0A 2JC3A 5B53A 2PL1A 1FEZA 2ZWVA 4B35A 1FYFA 3R3JA 4PV7A 4ZI3A 4BO4A 3OURA 3OCUA 4C5BA 1RQLA 1DOZA 2IY8A 3L4JA 3DC7A 1AUOA 1XAJA 3IJRA 4PCVA 1TTQB 1V9LA 4G89A 4N3BA 2PHZA 4REQB 4BOYA 4C08A 4ZZ1A 3ZH9B 2QAGA 2NUAB 3E8XA 4A8JA 3KQYA 1SCIA 3NYQA 4OGKA 4OD0A 1JJIA 3QE2A 4N12A 2Z5LA 4PNEA 2P77A 4D9BA 3QX9A 2GN2A 1J5PA 3E9DA 4Q6BA 1JV2B 5L8VA 1W35A 5A9RA 4QJ3A 5K0JA 2V7EA 4TZ6A 2FLWA 4C0AC 2I55A 3H84A 1RZUA 2Y0CA 3DJFA 3H0KA 3L84A 3LOPA 1H4TA 1GCIA 3CR3C 4MUGA 3TN7A 3IEVA 1PEYA 2PX5A 3IOMA 3NHYA 4XTRA 1HDRA 4LRSB 4E2XA 4LV8B 1A2OA 3N2KB 4AG5A 1OFTA 2OC9A 4R98A 3E48A 2AQIA 4AKTA 4X64B 3EA0A 1MJGA 2RGDA 1LBIA 2X22A 1BHJA 3IDAA 1T9KA 1LLUA 1RACA 3MWDB 3HA7A 3DYVA 2C96A 5KNLA 2J1LA 5M04A 1GD1O 1WXXA 2ZIAA 3AXTA 1W25A 1BD3A 1FQJA 4E03A 2F9FA 1N5JA 3AUFA 3BMOA 3ZGYA 3TG2A 1SBHA 2A5YB 1ZIPA 2VBGA 4RA9B 2WNIA 1E3QA 1JHYA 3DFKA 2Q6KA 1EDZA 5AD1A 1ZMRA 3O94A 4I5DA 1V37A 4JJAA 3MD0A 5DGDA 1T9CA 4PHGA 1JJBA 2JAHA 2FSFA 3UGJA 4RJIA 4IUCS 4BS9A 4U7JA 4O5OA 2O8BA 1U7DA 4GC9A 1L2TA 4FFPA 3QZUA 4C7MA 1US8A 1P5JA 1J8DA 1C1YA 1KIFA 2XI4A 3FTDA 1RJEA 1EAYA 2PR7A 2RHOA 4B83A 1BS1A 1FUEA 1WOYA 2LUOA 3VZPA 2IGTA 1U1DA 4I6GA 3NGMA 3V1YA 4DGSA 4EPTA 2B9VA 1K4MA 2GKOA 2HJVA 2B4KA 4XLZA 1DDOA 4UHDA 1J8MF 3D8RA 1QORA 5EIAA 3CN7A 1HEIA 4FLMA 5JSZB 3OT4A 1KI2A 3DQPA 1K7EB 4HDQB 3HR7A 2VPXA 4EVQA 1SHUX 2ONCA 1MH1A 2FVYA 3FPCA 1K7FB 4PRYA 1IQ0A 2Q21A 3LI2A 2J6IA 2RGBA 3EDMA 3EPJA 2CE2X 2DUMA 2ODQA 2OM6A 2YWJA 4PAMA 3PYXA 1ZJ4A 4YNBA 3S44A 1QHEA 1QGAA 2WWIA 1UQTA 1Y9EA 4E2FA 2BZ1A 2QMZA 1JT2A 1OB2A 1P4SA 2ONYA 4Q00A 3S2IA 5EJ9A 3WWOA 1M0EA 4HY3A 1S8AA 2WAYA 4C3OB 3ZDCA 3QFCA 3HZZA 4FCVA 3NWJA 1BGXT 4UNIA 1AGYA 4HH0A 1YF3A 4HFNA 1N9GB 1XZPA 2J09A 1O5OA 1PVVA 4CLOB 4RDHA 1SIWA 3B13B 3QF7A 4EEXA 4YH1A 3NEAA 2JJYA 3Q5DA 4A91A 2VTBA 2GD1O 1I2BA 1NURA 2AJCA 1SUEA 3F5FA 3CLRD 1CWUA 1ZJ5A 1KI6A 1KNQA 2FA9A 2OBXA 4L5CA 5HX7A 1KVSA 2HR1A 4GXNA 1LPOA 1T3SA 1NI4A 5C35A 1WVMA 2XGGA 3LP6A 5LU8A 1U4SA 3FOAA 3ESZA 1WOMA 2YV3A 5L4LA 1FTGA 4ZMRA 2Z9DA 1B3BA 3OEWA 2YXNA 4Y1GA 1BKDR 3V1KA 3A2LA 2MMGA 1MOSA 2DOKA 2RONA 4IKOA 1RAFA 3S0JA 4BVAA 3UJHA 4F6LA 4OG2A 3UJDA 3VSDA 1U0NA 3JXEA 1NNEA 1R4NA 2NZVG 3ACDA 3LPAA 2RC6A 4BMSA 3TAXA 2GCEA 4IDHA 4PX5A 3UGQA 2DBYA 2QB5A 2XZDA 3HGMA 1HDZA 3LCMA 4ZCMA 1UKYA 2WINI 4FFOA 2UUPA 2BH9A 4B74A 1JPJA 4FYHA 3PUHA 3R7BA 3GPIA 3RSOA 3HBNA 4U63A 1LZLA 4XB2A 4DMKA 1TKAA 5ADUS 3PEYA 4NJMB 3ETDA 3ITKA 3MMXA 3LUGA 3GD5A 2GTIA 4URYR 1HYQA 3T7JA 5LD2B 5C0OE 1T4DA 4FMDF 2C4WA 3RK0A 4P0PB 5KOJA 1ZNWA 5CD9A 4IVPA 4W5RA 4JY7A 3O74A 2DPGA 2FSVC 1JFRA 2GBLC 3W6UA 1C3OB 4WCVA 3M7IA 2ZRKA 1T2NA 1TM3E 3OLXA 3QOWA 2QR5A 2WK1A 2LGJA 3JD2A 4PLFA 1FS5A 4WT7A 4FFBA 1F1JA 1PR0A 5IVIA 3VR3D 1N2CE 1P17A 2A9VA 1QQ6A 3JCZA 5T8KA 2B78A 3V4FA 1WXEA 3VH3A 1N5DA 3NEYA 1T2CA 1XP5A 4HGOA 1YS7A 4OVKA 5FPTA 4G5FA 5DU2A 8AT1A 1JHMA 1M2WA 1C8VB 1RYFA 1S7GA 2AVDA 2HJHA 3RVBA 5CK4A 2FUKA 4CUKA 3O21A 1NXPA 1S3IA 3DL4A 1ECPA 2B21A 1U0TA 1GZ4A 1NR7A 1G20B 1EQAA 2Z8ZA 3M5CA 2ZIWB 4TLAA 2BFOA 4OFWA 5BSGA 2V1UA 1P4JA 3D43A 3GCDA 1QCZA 2OO7A 3FUWA 2P9YA 4MWTA 3QU9A 1UFQA 2D0DA 2NO6A 4HHEA 1EBBA 2B98A 4JSYA 1KBQA 1BOOA 1XYVA 3I92A 5DGCA 1AB6A 1BXRB 3ES9A 3TE6A 4CR7A 1ZD4A 2QD2A 3Q0IA 4XPIA 3L92A 2C84A 2MT9A 3OESA 4KBGA 4BNHA 4HDMA 1X8LA 2QTAA 1TUBA 2PXHA 4AT1A 3PC7A 1AK2A 2QU7A 1OFUA 1LWNA 1NE7A 2FMUA 1OUMA 1IUOA 1DTSA 2IK8A 3OZEA 3E9QA 1DAIA 3ESAA 5TVGA 2BRUA 4ZRNA 4FI3C 3KAQA 1WW2A 3JY6A 5FH9A 3D8HA 4YPFA 3AP3A 1JSXA 2CBZA 2BM8A 3L6RA 4J6FA 2A1UA 3SEFA 1KQFA 4XGNA 5CVCA 3AU9A 2AZ4A 3PB3A 3EWSA 4YXWA 4BEVA 5HVNA 3P1JA 1Y9JA 2MWMA 3VKFA 4JLJA 4DBVO 4MJLA 4YV7A 1XMSA 3IVRA 3VV2A 2FNAA 1D7AA 1RJWA 1TF2A 1UKVY 2O2XA 4LN1A 4P3YA 1CTQA 4BUZA 4I2VA 2H3EA 1PGOA 4BQFA 2RH5A 2WWHA 5KSOA 1ORIA 3T7TA 4MHOA 3MAJA 3ZNOA 2O52A 2P9QA 3I6IA 4OU4A 4UVEA 4JC4A 3VTKA 3V1TC 1CUIA 1ULBA 3EXEB 4I0WB 2HXSA 5KI6A 2Q6TA 4JT4A 2HV8A 2WJWA 4HYYA 3SSMA 2P6PA 1E1QA 2ZYTX 2FZLA 4KO3S 2OCDA 5FXMA 1K8YB 3ANNA 1KOLA 4A8JB 5K7SA 2JCBA 3WLLA 1NDHA 4X20A 3LECA 3PC8A 2WJPA 4OAPA 3UJPA 3PX7A 3KIPA 2BH2A 1SOMA 2AKYA 4HDKB 4J75A 3UFBA 2IV7A 3UN1A 5FPYA 4B32A 5ARCA 4AJEA 2J0SA 2IDJA 4AECA 2YXLA 2I4TA 5LR6A 5B7NA 1NGSA 4JD5A 3NHBA 4D6PA 2JNWA 4F60A 3IEKA 4B5LA 2WM2A 1N2SA 1YQQA 3U3MA 1VKHA 3OOSA 4AZ0B 1SBIA 1TIBA 3OJCA 3QELA 4KQIA 1TFUA 4F91B 1QH8B 5DHRA 4E6PA 3CGWA 2XMSA 2WHQA 3GVPA 4EB8A 3SJBA 5FULA 1JDNA 1RYNA 1Z2OX 3SK0A 4X71A 3FMIA 2ONKA 2HF8A 4RSMA 3VSCA 4DRXA 4EJFA 3ELDA 3HUUA 2G9QA 4HZUB 3SJ7A 3QEAZ 1LVHA 1X2EA 1XD2B 4V3CA 1KF0A 3OZAA 4MVJM 4YDRA 3RREA 2L82A 3B1FA 5IHXA 1HKUA 1YBVA 5AKHA 4ENQA 1ZXLA 4KIGA 2PKYX 1M74A 2F8TA 1BZYA 1NTOA 4WKOA 5D2CA 3WWCA 4ZK6A 1KJZA 2FUCA 3LYAA 1Z4NA 3LBIA 4QRDA 3JTEA 4IHAA 1OWOA 5FI1B 1KDYA 2JAXA 3AJRA 4ZJUA 5KSZA 3EXHA 3O1HB 5EP1A 2WC1A 1G38A 2PJDA 1YJBA 3LWDA 4DEXA 3C0KA 2JCGA 2QD5A 1E2FA 2ZE5A 3GJ6A 4JKOA 4EHNA 1XZJA 5C5CA 3N8GA 3K8QA 4IJ5A 1UAAA 2VSNA 1ILEA 1K6IA 1VCIA 1YR6A 4DAOA 4X8LA 2JHGA 1Y3DE 1KY2A 1T26A 2BSXA 1JU3A 2WICA 2EZ4A 5GQSA 4I4TA 1SFRA 3BZUA 3DLTA 4N82A 3UCFA 3O4RA 3L6OO 4XOIA 3F6RA 5LDDC 3K0HA 1YAJA 3BRSA 3SD7A 1GGHA 5DKFA 1L0BA 2JKYA 1U2TA 2D1FA 1EDDA 1Q16A 1F14A 1KFKB 1E9BA 1ZO8A 2ZIVB 1RXYA 2QWXA 1EFVB 3FSRA 4OHPA 3ITDA 2VJYA 5AJUA 4W5JA 1RAEA 4G65A 3LLMA 2FGJA 3EGIA 1E3DA 3K31A 4KLNA 4QXRA 5EZYF 3TSAA 3CJRA 1L7RA 1V7QA 1USUA 4MV5A 1LK5A 2D59A 3NAZA 3E61A 4RXUA 4LC0A 3JAWB 4KGVA 4V02A 3SVTA 2AJBA 3P52A 1ZSYA 2N3ZA 1QGYA 3C3YA 3L6BA 1JQ5A 2P9BA 2HJWA 1QRTA 1P75A 4KOAA 2ECOA 4RVCA 3RNOA 2G5PA 4Z1OA 3N2LA 4AF7A 1H66A 1Y6FA 1T6BY 2P91A 5EYPB 4LHSA 3FTPA 3ZV6A 4F92B 3I76A 5JUWA 1JEYB 1SXGA 4ON9A 1WW3A 5DN6A 2VPZA 2CUTA 1KMIY 3E1GA 4PZDA 1WXIA 4ZALA 4DN6A 5JAHA 1Y8AA 5EL0A 3SC2A 3U16A 2JJ2A 4Q12A 1QCYA 2DX7A 1JX6A 1LC0A 5HCNA 4MWSA 3CM0A 4ZV4A 4LWQA 4D0NA 1OPRA 4CTOA 3RAEC 3TQHA 5K3FA 2OLEA 2HIAA 2CXTA 3OQHA 4QUAA 4RD6A 3S55A 4BP1A 3VR4D 3PPWA 1WTCA 1M75A 3L8YA 2GM4A 4HOYA 4Q4HB 5SY4A 4C2BA 3FCEA 5F3RA 1YOBA 1YI0A 5GIPE 2OXIA 4CM1A 4F2PA 2P65A 1BHSA 1LNQA 3JYNA 3RKRA 4D98A 3ZVMA 4LJ9A 1ECFA 1A8PA 1VGQA 4TMVA 4JKYA 5IUJC 4XFKA 2J30A 1UM9A 3JYQA 1KH3A 1T0JB 2YYAA 1NQUA 4GLOA 2YIDA 3E9CA 2HCJB 4C4PA 1IBMB 4Y9DA 4MUMA 3RYCA 3ISTA 1U6IA 3T06B 3F4LA 1RHKA 4UM8B 4F3TA 3OUTA 4M1YA 3BXOA 3SJZA 1PW5A 4G0MA 8LDHA 3GJSA 2F1HA 5DP2A 1VGVA 2W71A 3LF1A 3UAOA 3U3ZA 2Z5FA 2RSLA 2VRBA 1VJ1A 3OH8A 4LSMA 1RXEA 5E1BA 4MQLA 3UK7A 2VZ0A 3KZCA 4R6XA 5BXQC 3FCUB 1UMKA 5IKPA 1JKJA 5G1PA 5AOCA 2O5RA 2DKOA 4JBGA 3R09A 121PA 1IRXA 5EWLB 4F3YA 2F3SA 3GGCA 4OBWA 3L41A 4QDKA 4LZZA 1ESDA 1DG3A 1FYEA 2DAPA 3PTAA 3PC8C 5DLEA 3BOSA 1UBHS 5TGDA 2EU8A 2X4GA 1H42A 4OJKA 1E9EA 3ZKWA 4MIKA 4IF4A 1VPDA 3PDIB 1ONOA 4MRMB 2IFTA 2Q8NA 2V5UA 3STHA 1Z47A 3H9GA 4EJSB 5A4AA 4C7KA 2IH5A 2NUBA 4RK5A 1DTWA 5ALGA 2O5CA 2FMHA 3BXHA 1R8YA 3AQIA 1V35A 5FBVB 3LIIA 4DG9A 1TU0A 3DC2A 5GONB 4CQMD 3WLQA 4UTNA 1RWXA 2WMNB 5DCYA 4Z0TA 3AL0C 1ONPA 2FZCA 2ARKA 1EP3B 1R8JA 2OXFA 4UTPA 1F8GA 3NHJA 4C5CA 4KPUA 3LPCA 4OIMA 2NACA 4DBZA 4YT4A 2HI0A 3WB0A 2PUBA 2CLOB 4NLLA 4M1QA 1LEHA 3UH1A 3RT1A 3UAZA 2Q5QA 4AUNA 3DP7A 4B81A 1A5ZA 3OU6A 1D6NA 1GTMA 1XZFA 4C29A 5M7EA 1HT1E 2HUNA 1MEOA 3UXHA 5CYPA 4B48A 1K7SN 2VWHA 2FEMA 2QTHA 3D1VA 3Q88A 4A0HA 1LTHR 3BTUA 3FFWA 3O4JA 1ULHA 2BHRA 3B9QA 5E0KB 4D4LA 4GU5A 3UOAB 3SQLA 1U7UA 2C3YA 2OPHA 5JANA 2BKLA 1TGYA 2C92A 5GWXA 1QZZA 4OGGA 3NVAA 2IWRA 5IWCA 4EVRA 1T4CB 3K9QO 5C8VA 4O3MA 1T15A 4DLWA 5JIBA 3QF4A 2ADFA 3EJ6A 1E7SA 3ONVA 3LWZA 4H6XA 1RM0A 4HNVA 3GAFA 2YMPA 3SHFA 1UANA 4MP6A 4YAIA 3HKDA 2LVBA 4L85A 4LY6A 3N2ZB 1NP3A 1SXHA 4NU5A 4W7SA 3ZOKA 3ZK9A 2XT9A 4GBJA 4EHBA 4I1UA 3L7AA 3RFUA 2PGXA 1DT5A 4P86A 4UUQA 4ZKDA 5EJFA 1F8YA 4JXJA 2REQB 1TYBE 2AG1A 2FX2A 2J08A 1CNEA 3EJWA 4LNUA 1BQEA 4U7HA 4AUEA 4L22A 4K2HA 4ARBA 1O5TA 2FP4A 5CX4A 2FOIA 4A3SA 4LF6B 2G25A 3PUWA 1BDMA 4RKWA 4C0KA 4JBWA 1A71A 5DWQA 5AM4A 3FBTA 5LIRA 3LPDA 4WK2B 1AXGA 3K15A 4EP1A 3HN6A 1NUTA 5ENZA 5JU6A 4TYQA 2XCSB 1LSSA 4DV1B 3DZBA 4IXTA 1G0NA 5GZ1A 3CTMA 3LRTA 3ZX5A 1KOFA 1KVTA 1KKUA 2Q5FA 2ZS9A 3LXXA 4YONB 1JG7A 2I3ZA 5U4XA 3UXMA 1O4VA 5GTDA 1W34A 3DMYA 3C15C 2HT1A 2LR0A 2H5JA 4J76A 5L3VA 5K8UA 5SICE 1IY2A 1F8FA 4YRGA 2W00A 5I47A 2EDCA 2NZUG 3QRWA