2HIMA

Crystal structure and allosteric regulation of the cytoplasmic escherichia coli l-asparaginase i
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
334
structure length
324
Chain Sequence
KKSIYVAYTGGTIGMQRIPVSGHLQRQLALMPEFHRPEMPDFTIHEYTPLMDSSDMTPEDWQHIAEDIKAHYDDYDGFVILHGTDTMAYTASALSFMLENLGKPVIVTGSQIPLAELRSDGQINLLNALYVAANYPINEVTLFFNNRLYRGNRTAKAHADGFDAFASPNLPPLLEAGIHIRRLNTPPAPHGEGELIVHPITPQPIGVVTIYPGISADVVRNFLRQPVKALILRSYGVGNAPQNKAFLQELQEASDRGIVVVNLTQCMSGKVNMGNALAHAGVIGGADMTVEATLTKLHYLLSQELDTETIRKAMSQNLRGELTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-asparaginase 1
publication title Crystal Structure and Allosteric Regulation of the Cytoplasmic Escherichia coli L-Asparaginase I.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 102
structure length 324
sequence length 334
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2006-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2himA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 2himA01
1NNSA 5K45A 1JSLA 5CBPB 1JSRA 2GVNA 1HFKA 1HO3A 1HG1A 4RA6B 3PGA1 2D6FA 1JJAA 3ECAA 5K4GA 4RA9B 1AGXA 5DNEA 5K3OA 1ZQ1A 4NJEA 1HFJA 5I4BA 5HW0A 1O7JA 5DNCA 4R8KA 4ECAA 5I3ZA 5CBPA 4Q0MA 2OCDA 5K4HA 1HFWA 4RA6A 3NXKA 2JK0A 2HLNA 2WLTA 1DJPA 4R8LA 5DNDA 1WLSA 2P2DA 4PGAA 1JAZA 5F52A 5I48A 4RA9A 1DJOA 2P2NA 1WSAA 1ZCFA 1HG0A 1IHDA 3NTXA 1WNFA 2HIMA 4NJEB 2WT4A
chains in the Genus database with same CATH superfamily
5C31A 3TGLA 3DFIA 1E2IA 3Q5GA 2REQB 2NZJA 4M0LA 5KOIA 2C7GA 3F7OA 3NOOA 2FPRA 1X7WA 2FPIA 3ANYB 3AHEA 3WBFA 5DEIA 1IPFA 4HLDA 4JJ6A 4D2IA 5BSVA 3MPUA 1FQOA 3PJFA 1QB8A 2CLCX 3DBRB 4ND8A 3TB6A 3BWYA 3EGVA 3VUEA 3WK8A 2OTCA 2JAQA 4EG1A 2P6UA 4HX9A 1WAMA 3P2OA 3IH5A 5JIBA 1DCMA 1E98A 3UB2A 1X7GA 1FFAA 1X8LA 5U4QA 3ZE6A 2ZJFA 1M1YA 2ZP1A 5GV8A 3WLPA 1D6SA 1JIKA 3GXBA 5IM4A 2I3BA 1H6DA 1C4WA 2YOFA 3E3NA 2TMKA 2QTLA 4A8HA 1R0XA 4Q82A 3UXHA 2A8YA 4WERA 3BF8A 1SXIA 3GJRA 3WZLA 1E7QA 3RSQA 1U81A 2ZCUA 1RBMA 1T5DX 5KMGA 1MAHA 1V2HE 3CCCA 1RJGA 4NF2A 2AXPA 5D3MA 3ZNOA 1T6NA 3U7JA 2R47A 4X1KA 3PWZA 2I3GA 4TLBA 1L7OA 2PX3A 3FFXA 1A4UA 4GMFA 4JGIA 3HHPA 4D4HA 4N7RA 1YB7A 4H1HA 1OX4B 2KLHA 5BQ5A 3SI7A 4LSWA 3W2FA 3TDNA 3SWWA 1TMKA 4ITRC 1WMDA 1SQGA 3JZMA 3MRTA 1GNQA 3OJCA 4MPPA 1F2TA 3RH0A 2DFDA 2H2AA 1YJAA 2HOQA 3P9IA 2XDWA 4M9CA 2NNLD 4TWBA 2J46A 3T9FA 4JJFA 5B12A 2SKDA 3KKKA 4UM7A 1QHYA 4Q1AA 3DOCA 1GGMA 1RPNA 3VYWA 2FWRA 1QZTA 1NL3A 1FPQA 2FRDC 3C3KA 3TUZC 1UAAA 3ICPA 3INTA 4FYMA 5E1BA 1N77A 3VI3B 1DFIA 1F38A 1UOEA 1BHJA 3Q6NA 1VKOA 1LEHA 4RJ2A 4WXMA 1JG2A 3RIYA 1KZ6A 2AR0A 1NC1A 4MW1A 1Z4NA 4OLHA 2GVZC 3DLPX 2OMKA 1TECE 4YTEA 1UKCA 3BE8A 3Q1LA 4HP8A 4WY8A 2V98A 2NMVA 1JIUA 1ULSA 1WP9A 3TS1A 2Y0DA 4BE4A 3PGVA 3HXQA 2HU8A 1HFWA 2IZOA 2FR8A 3PLRA 4QJBA 4K6MA 4PZUA 4BO1A 4D97A 1RAAA 5GTDA 4KDFA 4YYZA 5LQKA 1CUBA 2PSDA 1KQNA 5CVTA 1JKIA 4K1XA 4EI9A 4GLBA 4IKEA 1YV9A 3W9YA 1DEOA 2Q5CA 4BECA 3KAKA 1ZPDA 5JO9A 2BFCB 2GTPA 4RZXA 2MWMA 4D79A 3B1KA 5GM2A 1DKPA 1U9CA 2PL5A 3PQ3A 4LCBA 4MQ5A 3E9CA 3NBQA 4ZOAA 4R1QA 4RTJA 1THTA 3O84A 4RTMA 3N7TA 1KDOA 1C30B 3JQAD 2WHPB 4LRQA 2VDQB 3OQ1A 1NRXA 1ABFA 3ZLBA 2AX4A 3M1AA 5JADA 3AF5A 3QEOA 4CQLB 3JR3A 4UM9B 3F9IA 1CUEA 1V5IA 2WF5A 3ZWPA 5CG1A 5KOHB 2N0SA 4N6GA 1UH5A 1XVVA 4OBEA 3VR6D 1EMDA 1LDNA 4EW1A 4G9GA 4I5GA 2H4FA 4LOLA 4DLAA 5AM3A 1KO8A 1DQPA 4LJKA 3NVKI 4D3FA 1XRPA 4JDUA 4C7KA 1L4LA 1JE0A 3IUYA 4M1QA 1RZ3A 3KLBA 4WGGA 1PZEA 4XDZA 4B9AA 2YOHA 5IZCA 2P41A 2SECE 2X22A 5JD6A 4Z4IA 3FFAA 4CXMA 3TEFA 4CF6A 4KQCA 4UTVA 3DE3X 1JG6A 4XVCA 1P4JA 5EMLA 3VPAA 1T2UA 4KPFC 3MWEA 4CNBA 2OQ2A 4GYJA 1VYUA 5AHWA 5BRAA 1DMSA 1KFBB 3HV0A 4LA4A 1DJLA 1PJ3A 4MA5A 1W35A 2AYXA 2DPYA 4P2GA 4EPWA 4G5YA 2YKGA 3ET5A 3H1EA 3IUSA 1W36B 4V3BA 1XZNA 3IAHA 3MB8A 4IIJF 3HRHA 1RM0A 3CNNA 1U7TA 3QLVC 2PCJA 2Q29A 1QDEA 3SEZA 4PTZA 3S1SA 4QELA 3VAZA 2CFRA 4EECA 2C3PA 2W71A 3DXXA 1KS9A 4I7EA 3LOPA 3VR2D 5AI0A 3M5DA 3FWNA 4I5EA 1EJBA 2FW1A 2IHTA 3VBEA 3UJ9A 2GVDC 1T4CA 1V35A 3DBIA 2J07A 3T3NA 1J0XO 1Y8QB 2XAAA 3ETGA 3RGWS 1L5OA 2OHVA 1RWWA 1SFRA 4PVDA 3SC2A 2H0QA 2BFDA 4KXMA 1XCMA 4MV1A 5IWAB 2JGDB 3OP4A 2GPBA 2Y1EA 4Z0HO 3VXKA 3JQBA 4UCWA 1ZP6A 2IHYA 3QOWA 3CPJB 4Q0MA 3UJHA 5KTTA 1TF2A 5CX4A 5DH9A 4WKOA 3RT7A 5AVUA 3H4TA 1XN1A 1WEKA 2JANA 1XDWA 2B3DA 2ZIAA 3D2BA 1A72A 3LG2A 2OV6A 1PAUA 6GPBA 3E8XA 2WTMA 1CJSA 3AUKA 4HG2A 1PS8A 2RI1A 4QWMA 4RAOA 4WDQA 3UJ6A 3ZQJA 5C52B 2Z08A 3LO5A 3NLLA 4O4JA 4G1BA 5KSPA 2H1OA 3CRQA 4P31A 4X91A 4DC1A 3NIGB 1XTZA 5T64A 4F4UA 3TBKA 4B3GA 1E94E 2Z5LA 1ML3A 1YXMA 2BR5A 4H31A 4EUKA 1VSVA 4HV4A 3OF5A 1KK2A 3MERA 2J1LA 4A8JA 1KJIA 4FGSA 3L7JA 3D5EA 2OAGA 4FKZA 1A2OA 2GZ1A 2VHEA 1UWKA 3JARB 3OTIA 1JDTA 4JCCA 3UT5B 3WLAA 1OUMA 3FROA 4MVCA 3RW9A 4B3HA 4JBLA 3ZW7A 1VJ5A 2NTEA 3AV0B 3ULKA 3L0OA 5ERGB 3ZW9A 1OB2A 5TJ9A 1BCSB 2CXPA 2XHZA 1BA3A 3PG5A 4J1TC 4K8RB 4QUAA 2WEKA 4Q9HA 5GONF 1UANA 1YGPA 2QORA 3K9LA 2MU1A 2X7JA 3HJTA 1CD5A 1K6IA 1GTMA 4TKVA 5FFFA 2O8BB 1NV8A 2VKQA 3KUUA 1EQ2A 3MTBA 1ECPA 2VTKA 4KAFA 4RK7A 2QTWB 3ZOZA 4DHEA 2XCTB 1U7UA 3FIUA 1MEEA 1U1GA 4EAQA 2HGSA 2JGIA 3PI6A 4IOLA 5EWMA 4C7VA 1ITZA 2ZULA 2H9AA 4GPIB 4C7MA 1UBOS 3QWIA 2IGBA 4RGQA 2QUJA 4WZZA 4BLRA 4C0WA 1CY6A 4K28A 1H05A 4PYOA 4X71A 4Z2AA 4CFZA 3JPYA 2IH4A 2IPAB 4C05A 2XR1A 3R0XA 1SCBA 4N8EA 3W77A 2BJVA 4ECEA 5B1YA 4X60A 5SYAA 2QQEA 4X95A 2GBLA 4Q3EA 2H63A 4M7OA 4WCFA 1LRJA 5FOQA 1QH8A 2L42A 2AJTA 5HIAA 1K8XB 4I8DA 5JFOA 3RD5A 1Z8DA 5IUNC 2NO4A 2B69A 4BVJA 4PYQA 1B8OA 1C9MA 5DW3A 4IIUA 1EZ4A 4MUYA 4RCYA 4DV6B 4GECA 5E0KB 3R41A 5EI5A 4YRSA 1GGHA 2IHZA 1WKCA 2JARA 3OPNA 2UUPA 4JVNA 3SFVA 3TF5A 1X87A 4I1PA 3RTGA 3V3KA 1WZNA 1WF3A 3KUDA 5EEGA 3SJCA 3Q8MA 3RU3A 2UYYA 4B7XA 2VP3A 3DBLA 4J6FA 3DJFA 1JEOA 1QHEA 4QQ8A 4MUXA 3QTTA 1ZNXA 5G53C 2ECQA 2IYQA 2VA9A 1GJRA 3HNRA 1S89A 4MI6A 4PRZA 3BKXA 2UYCA 4L7QA 3VR0A 3CGWA 2OEPA 3SE0A 1GM5A 3K20A 1OREA 2QYHA 2ZVPX 1RQRA 4MWBA 3QPBA 5ENVA 3U4CA 5LQAA 2H29A 4P81A 4A82A 1U63A 2RHJA 3G3EA 1TEZA 2DFLA 4QM7A 4MQLA 1NUQA 1KVQA 5L3VA 4DDKA 4ERXA 2WKWA 4Y98A 5BORA 2EBWA 2QJOA 2Q8NA 1CHNA 2FE4A 4EENA 2ADOA 1EB9A 2Z2YA 1V7ZA 4BX3A 4RWZA 2FMUA 2ZCVA 3O82A 3ZE2B 3NIFB 4FKMA 5J59A 4AJ1A 1UKEA 1WZUA 4KVGA 3IYLW 4I50A 4HL6A 5AM1A 4YJ3A 1XAJA 3N5KA 5FBKA 4AF6A 3SK0A 1XUOA 3GY0A 3EDRA 3B36A 3L1UA 3LYUA 3OEED 4UHCA 4LHZA 1PYOA 2XVYA 2UVPB 3T3GA 4P4SB 4OIMA 5TGDA 2WTAA 1OHHD 2GAOA 3ZX4A 3WWEA 2PZFA 2PUHA 4K3UA 1B8VA 3UXYA 2YWBA 2X9NA 4DQ0A 2PUTA 4RU1A 2QQ5A 2XCOA 3D6TB 4H15A 3A9RA 4JT8A 4LQDA 2B7BA 2ZFUA 3V8MA 3S7TA 3DBVO 3VKFA 4Q9DA 4R9NA 1GQRA 4B47A 1T0PA 2HH9A 1NW3A 1JNYA 3DYVA 3LC7O 1G8SA 2LIPA 3FDZB 3KOYA 3GHYA 3GLQA 3HN6A 2O1SA 5CX1A 4LIPD 4BO0A 5JNUA 1GSAA 5IK2A 2R86A 3KAQA 4D41A 2C2KA 3F90A 4BAZA 2QVZX 3AW9A 3RUPA 5SZIA 3H7AA 3OA0A 5A4DA 5HF5A 3GZJA 4FNMA 1MOZA 4WXPA 1XVIA 3S29A 3JCZA 3TIGA 4ZXFA 2HA0A 2GJ8A 2PKQO 1K4YA 4E5MA 1M6VB 1QFYA 1RC0A 4E51A 1NZFA 3NUZA 1KSJA 5AW1A 3JD4A 1T1IA 2O14A 1X7ZB 3T7KA 1TCUA 3W3AH 4B3IA 3OQMA 4G6ZA 3CE9A 3DMNA 3OZBA 1DGQA 1JSZA 4IMRA 5EFOA 1UUFA 5ALDA 4HZGA 1IB6A 3OESA 3SR4A 1IQRA 1EJ0A 1YR7A 1JAZA 3PWSA 1XN4A 1Y5MA 4Q3NA 2IV3A 3QEAZ 2NSYA 3BBPA 3OZDA 4Q24A 4DG9A 5AESA 4DR4B 2X4LA 3ABIA 1D2NA 3FAKA 4BNTA 1JE1A 3IXLA 1OX6A 5FUYA 1LZKA 1CS4C 2ATEA 2JAUA 4GX2A 3R8CA 5BVHB 4YROA 2V0GA 4YV7A 1NFQA 3NC0C 3TW4A 5IN4A 2XUPA 1KIAA 4H27A 2Y1OA 4QA9A 2W70A 3JD1A 3QX9A 3PB3A 3WJ2A 3FGPA 2VA8A 4G0YA 5I51A 3LHKA 3UW1A 4AZ3B 3V8QA 1R5BA 3E5NA 4XSVA 2D3WA 3IA2A 4RMJA 2BSQA 1ZXBA 1E1YA 1QZZA 3HBFA 4IHJB 1UC4B 3ORSA 4IXNA 1R4MB 4CN8A 4D0RA 4MOWA 4OGLA 3HLYA 3R7SA 2HDWA 2C77A 3RYFA 5KU7A 4KLAA 1QVRA 3H9JA 4OHYA 4I2VA 2WE7A 4WBNA 1J2TA 1A9OA 1UKYA 2H1CA 3TGWA 2BMAA 3HR8A 1K6EA 1GR0A 1W6UA 1E92A 2FQQA 3ER6A 4XRRA 2R4QA 1DUVG 1X8XA 1TTHA 2UDPA 2UZ0A 2WG0A 5G4KA 4BMCA 4IHAA 3BMOB 3JYOA 3RVJA 3O94A 1DDIA 1Z83A 3AR6A 4YRZA 2CLKB 4EGQA 3L4BC 1L3BA 4L4SA 4IXMA 2XHEA 1X7YA 3R0VA 4I4CA 2QNRA 4N5HX 4OL9A 2Q7XA 1GPMA 3BIOA 3PPVA 1N2ZA 4G8DA 4M49A 2MYTA 5BOSB 5CGZA 4WNAA 3WWYA 2FPGB 3P96A 3A4MA 2QD4A 4WDRA 1I5RA 2Z3VA 1TLLA 3MTDA 3V6LA 4WLFA 4YUWA 1ZXXA 1W88B 2OV8A 4LPKA 2FPPA 5JPCA 1PDVA 1XLTC 2JJ1D 3EW9A 4EIWA 5CYPA 1QXSA 2C2GA 4OLFA 5I9BA 1ISFA 4LBWA 1X9GA 2R96A 3PKIA 3DL7A 2H08A 3QWBA 1XKTA 1EGAA 2FEXA 3DEYX 1L7MA 4K6FA 2MCFA 5B2EA 3MA0A 5DNYB 2NLOA 4RY9A 1R12A 3VNSA 3ZN2A 4BLVA 4L3WA 4BLQA 5H80A 3LSTA 3TZBA 4PQFA 4JI4B 1J9EA 1TJPB 1R4NB 3GA5A 4LBYA 3AP2A 2I0FA 4A2PA 3C7KA 1R16A 4NJOA 2XB6A 3VPXA 2ZRMA 4PFSA 3OE1A 4U7FA 5A71A 3O8NA 2NZ8A 1KQ3A 3B9BA 2XWSA 4ZEXA 1BZYA 4CM4A 1KQGA 1TPYA 1BE8A 1HQDA 3DONA 2ZYGA 2FSFA 2H52A 3GAZA 3LTEA 3WGJA 4NENB 3TSZA 1TJNA 2VT2A 4JP2A 7GPBA 5CCXA 3H1BA 3R77A 5G0TA 3B3FA 1G20E 4EKIA 2CXXA 5IUJC 5A3RA 2J5XA 4QYIA 4TM7A 2IBMA 2H2FA 3AOEA 5D3ZA 2AFHE 2NXWA 2QMOA 3DQPA 1H6AA 3IQZA 3Q3JB 4LMAA 5MGBA 1JQ5A 3H5VA 3QV1A 1QFJA 4UEWA 1T5BA 2J6BA 2QL9A 3L7IA 5HPYB 2QBYB 3GIWA 3SZ3A 3FSGA 2E1PA 3H5LA 4B2PA 3VKHA 2PVPA 4HGOA 5DX8A 4MQUA 3KNZA 4NK4A 2N46A 4PICA 2FFRA 2XECA 3YASA 2VDNB 4LYHA 6REQA 3SBDA 5KNBD 5BT9A 6AT1A 1ZD5A 1KRHA 5DM1A 4NYIQ 1QTIA 2ZJOA 2GK3A 1WP4A 3JQAA 2BMJA 3STXA 1K5PA 3UMYA 3ONWA 3TBFA 4I9HA 2C42A 3RRMA 1S3GA 1H2ZA 2WG1A 2XWQA 2JEOA 5HFNA 3ANMA 2V8BA 4GPZA 1H8HA 3VR6A 4W5TA 2WJYA 4CIBA 4ZQCB 3OT4A 5EE1A 2CL5A 2E4ZA 3OZFA 4EATA 2UYHA 3LV8A 3FWKA 3KE9A 4P7JA 4IX9A 3CRMA 3MB5A 4Y6PA 1R0BA 1UKBA 2NO0A 1DCFA 1JP7A 1LS1A 3IULA 4IZHA 4NG5A 2V9ZA 3K9BA 3UJCA 5B1DA 4AMUA 5BURA 2O59A 1M1NA 3HBJA 5AOBA 3WHKA 4UBOA 1E69A 4S24A 4EHAA 2BZGA 1DB3A 4C7XA 3QXJA 1ECFA 1CY8A 1HTTA 4MLPA 2JFVA 3ABRB 1V41E 5CT6A 2JFBA 5GAJA 3URMA 1NQOA 3VVLA 3GRRA 5LM3A 4KXYA 4HF7A 3VYSB 2YS7A 1UBNA 2W4IA 2L82A 4YMLA 2RJNA 3K7EA 2ZRKA 4N48A 1RI5A 1R6XA 4JOQA 3UK7A 1A9RA 1K0FA 1PWXA 3WDMA 1ZI6A 4DABA 5AW6A 1W1WA 4TMXA 5DNEA 5DRTA 2FN4A 4A6DA 1Q77A 2R6R1 2WT9A 3H3FA 5K3EA 4MDFA 1KYQA 2GCEA 4N6NA 1XTIA 5IJXA 3Q7EA 1JZTA 1SZDA 2QENA 1N2SA 3GARA 4YRNA 2H5LA 4AJ2A 2H8KA 2J9FA 2ZRFA 3R1IA 4RIFA 4UMVA 1A04A 1N5MA 2OAEA 3QFFA 4MV9A 3O2QB 2ZBGA 3LT0A 3KJQA 4YN3A 5C5IA 5ADVA 5JS8A 1XTBA 2C3OA 3AF0A 5A1TA 2X7HA 2QS9A 3NWEA 4MAMA 3OQBA 5JALA 1L7EA 1CVIA 2WF9A 3T7TA 2WU1A 3FRJA 4Q3CA 2X4DA 4EYKA 5BMVF 3OCVA 4H7PA 1F4LA 2B8WA 2R62A 1JJFA 3DAHA 3FZNA 3ZGNA 2BGIA 1BNCA 5L40A 1FDUA 3ZYCA 2H7VA 3COVA 4KO4S 3U0VA 4EY5A 1KYIA 2RK6A 4LAFA 3FE2A 3MUEA 1K98A 3NYIA 3OLZA 2IS4A 1PJAA 1RYEA 2HAEA 4GZ6A 5IABA 2FKAA 2O7QA 2VJYA 4NBVA 2QX8A 3PITA 1II8B 5F76A 4DN6A 5B6JA 1CY2A 4K9RA 5EXXA 2IPMA 4P9NA 1L4MA 4JI8B 2HFJA 4IOMA 1SRRA 2IYEA 10MHA 1Q1ZA 3D0RA 4I8IA 4D0SA 4GVPA 5JRDS 3HJAA 3R0ZA 3HVUA 3T3MB 5IH3A 4P4LA 4EFLA 3BMQA 4AJKA 4FMPA 4LGCA 5EOVA 5KSYA 2BAGA 5DP2A 2JCXA 1PT7A 2BEJA 3S2ZA 4EG7A 4TV8F 5HIKA 3WJAA 1PV1A 1GZSA 2LDBA 3E3OA 4C88A 1JGTA 5KVCA 1TFUA 3FNIA 5JCPA 2B7CA 4JEMA 3AJ8A 3ZHBA 3AHJA 1NN3A 4M8NE 1RFGE 4LISA 3DA8A 5BNTA 2ZIGA 1D1SA 5EHQA 1V8DA 4OU4A 3H5RA 3PDHA 3B1YA 3COZA 1S3IA 4CMIB 3P1JA 1J8QA 2BRUA 4LDRA 4DARA 4HLCA 5JWOA 4OPMA 4DRYA 5IZ4A 3QITA 5LXTB 4COOA 1VLHA 4JB8A 4GD3Q 1LPMA 2ZE6A 3A9TA 4YB8A 5K20A 3KKQA 5DW0A 2UKDA 3AEUA 1UJ6A 3CBGA 2C99A 2I6GA 3ON5A 2IZZA 2FKNA 1TGVA 2REBA 1PEAA 3R3SA 4M1WA 3DUFA 1ZK4A 1CS0A 3QK7A 1YVRA 3G49A 3NH9A 3TR0A 3PF9A 2XBLA 5BR8B 3RR2A 4P3XA 4PYIA 3QUCA 1R6UA 3FZQA 4M0EA 3C43A 3PGMA 4MYRA 2ZUSA 1Y4DE 3U1VA 3KUXA 1I32A 4DV1B 4EA7A 1D2CA 4DADA 3CLRD 2YV5A 3GUCA 1XVAA 3L18A 3HXOA 4CMEC 2DZDA 2OB2A 4N5IX 4OXQA 1N0WA 2Q27A 1JILA 5A9TA 3UT0A 1HRDA 1TCCA 4MV6A 4RULA 1JH8A 3KTOA 2E85A 5CU7A 3OX2A 1KZ1A 4FQ8A 1R3DA 3GT4A 2Z3ZA 5F7OA 1WEHA 2BGGA 3FOBA 4YC7A 2QVCA 1RAFA 2WIAA 4G26A 3IQXA 4RQAA 1IM2A 4R3NA 5A9RA 3H9EO 2OV4A 4CKZA 3IDFA 2ZQYA 4JBYA 3D2LA 1O96B 1ZIXA 3ROQA 1NE2A 1JDSA 3KETA 1C7IA 1ADBA 1PW5A 3OHMA 2OP0A 1M33A 4ILKA 4JR0A 3B6IA 1J9GA 1I9GA 2BLLA 1T0IA 1DJPA 3DVLA 1F6BA 2BY4A 3AX6A 1BQ4A 2F3UA 3LUDA 4EJFA 3NDPA 3FOEC 2K4MA 3PPIA 2QL7A 3RTCA 3W4KA 2P3OA 2YV3A 4GVLA 5AHKA 1ZIYA 3RIGA 5DNVA 4CKBB 3NJ4A 2QTRA 4S35A 1TD1A 2XT0A 4RTSA 3OJFA 3T5GA 4S04A 3L0SA 1H23A 2HIAA 2IUTA 3GBVA 4D4MA 4AS2A 5B30A 3U7GA 3TLCA 3WDKA 1KH2A 3JVEA 1A76A 3K9FC 1L7AA 3L6OO 1OFUA 4QQNA 5E4JA 2HYIC 4Z5XA 1F0YA 3BMNA 3EY4A 1FJGB 3WBKA 3OEEA 2QPTA 4K9OA 4QDOA 2FSGA 5FP0A 4C7JA 4QXOA 1LI4A 3PNVA 4CTJA 2X9GA 4AZWA 4IMIB 4YREA 5FTNA 3KCQA 3OPYI 2WSYB 2BBSA 1ZRMA 2P9ZA 5A5VA 4R1UA 2G76A 3DKRA 4KQGA 2ZSHA 5F5NA 2E82A 2Q1TA 4JKIA 5I3CA 2WWYA 4G5GA 4QQRA 2EV9A 2VJAA 4JVMA 3V4OA 2O8EB 2F43A 5C3UA 2JBWA 3JS5A 2QM0A 2X76A 2ZIWB 5ALFA 2XBMA 4E30A 3T7DA 2HCTA 3VDRA 3R23A 2C4MA 2VBFA 3U4AA 4J1SA 2O8DA 3AGPA 2WC1A 2XUOA 3IOEA 3W1VA 3PDWA 1P81A 4H1VA 1KAHA 4TV9B 5CXSA 2QZ9A 3PD1A 1XMXA 1G1MA 1P2SA 1IJFA 1I10A 1JHAA 2AKAB 3BCSA 4BQSA 1J2RA 2D06A 6YASA 1ABEA 5HCUA 5HKBA 2AQHA 1DEXA 1YBMA 2NYRA 2OBMA 1AKEA 4RFSA 1EBUA 2O0KA 2XUZA 3EIEA 3IA7A 1DV1A 3BE6A 4PSKA 3WL4A 1QK4A 1CWUA 3AQ4A 1U0OC 2B4AA 2DBRA 4NECA 1T5LA 1O6BA 1RKXA 2CFTA 2I1WA 2IYFA 2JH3A 1PJTA 2P6PA 4POAA 5EPOA 3QVJA 3AR4A 2CSXA 1ZG3A 1JL3A 4QPPA 2IIPA 3MRVA 4Y8VA 2AVNA 1YMQA 2XKAA 3BTOA 3NHSA 3CVYA 1R9JA 5IANA 3RVDA 4KO8A 1KERA 3FUTA 2W2KB 4MWSA 3RRZA 3EF1A 3GLIE 4GOMD 1EFHA 3RV3A 1ESMA 1GSHA 1GZ7A 1ZM4A 1H1TA 4M6WA 3T7SA 4ZC1A 1KU0A 3CTPA 3FMOB 5C7OO 1WM1A 2PLNA 4P5DA 1HI9A 1M5TA 3WAGA 4Y2HA 4Y1GA 1MHPA 1LRLA 2FLVA 4KBFA 5CCEA 2GJ4A 3INYA 4ZT5A 1GN8A 2BFBB 2PGXA 3U17A 4ZQFA 3QJYA 4QECA 1I2CA 3HO8A 2Z09A 3QLUA 3N59A 3TXXA 4H2DA 4YMIA 4JI7B 1M2NA 4TVKA 3BS4A 3W6OA 4FWIB 3IHLA 4DB2A 5EGSA 1MORA 4FZ5A 3U16A 3NTUA 1MAWA 3ISVA 3FAZA 4AX8A 2YVLA 3T5AA 4QIHA 4FW9A 4IXWA 4IQ4A 3RCBA 1KAGA 3W9UA 4P3YA 2WJAA 5EYPA 2Y1DA 3V46A 4ZO8A 2HA4A 2AE1A 3E0QA 3SFZA 2J31A 5IFKA 5F33A 3GEEA 4H7KA 4UBMA 4DBLC 4EWLA 3IUNA 5DMHA 4LNHA 3NU1A 3ETJA 5LB4A 1N9KA 1QR6A 3HXKA 2YV2A 4I46A 2ZIXB 2FUG6 3RVNA 3KVOA 5KQMA 3BJEA 5J2UF 3I5UA 4GE3A 3L40A 3VSAA 4K46A 3PYXA 1B41A 1R0CA 2F1JA 2P75A 3EC2A 3R0IA 4G81A 4M76B 5AI5A 3WO1A 5K0ZA 5KYTA 3OZXA 3TQHA 3GVPA 4TRNA 3AI3A 2IXAA 3VU9B 2IJGX 1NAIA 1XK6A 5KUTA 3EIHA 3HM2A 3MEQA 3H5IA 3P5BA 2JJ1A 1ZWKA 3HKCA 5ICEA 4ESVA 3CX4A 3MGCA 3QHPA 4BWYA 1CE8A 1N36B 4KR2A 2GI4A 2F48A 4LOAA 3CWZA 1KC3A 1P74A 1B2RA 4BB6A 3OQNA 3HCDA 4LTNA 2CUNA 4YRJA 4AYXA 1SQ0A 3BIFA 4LKOA 5J3JA 4L5BA 1I3KA 1J06A 3GN2A 3UMCA 5BQFA 4G67A 1L1RA 4PGHA 2AG8A 3Q2KA 2OXIA 1XNRB 5M34A 1JIJA 2QEQA 4HCJA 4HKTA 1GNPA 1U8CB 5AXCA 3VNRA 2BBTA 3EEOA 4Y18A 3LPMA 3BZBA 2PBZA 4G0MA 3C5CA 3P4UA 2VQEB 1ZX1A 2FW9A 5LZ5A 3AEKB 4MAAA 5CVVA 3PZRA 4EPVA 2AOTA 1N2CE 1NF8A 3JW8A 5CW2A 2HW8A 3ICWA 3VHXB 5CT9A 2XXAA 4AZ0A 3I5MA 4WLUA 1OU4A 3JQRA 3ZCSA 1IN7A 1VFPA 3PPYA 4IJVA 5DLYA 1TYDE 5A7HA 3RQIA 3WIOA 4EAAA 4NICA 5KTMA 2P2ZA 5ESWA 3TPFA 3INGA 5DO9A 4BVBA 2IYAA 3AMVA 4Z9YA 5IU6A 2ZR8A 4K9NA 5FTKA 1BA2A 3USES 4E14A 2IYWA 5KOYA 2V1UA 5ED0A 2XADA 3I83A 4ZI7A 2O1EA 1QQBA 4N47A 5JPDA 3NG1A 1W0JD 4XPIA 2K87A 2NOAA 2PSJA 3WYFA 3CX3A 4Y2YA 2PS3A 1KHTA 1C14A 1XYGA 1J49A 4ZO9A 4BTVA 5C37A 4HO1X 4OKSA 4RDIA 1SUFA 2EERA 1WCWA 5JCXA 2R1TB 4C4XA 3VR5H 4AFNA 4GPEA 2Z3WA 1U0FA 3H5TA 4I1UA 1UIRA 2CXHA 4JUDX 4OJMX 3AJ9A 2Q6VA 3M6FA 1F51E 4F1JA 4R41A 5SICE 4ID9A 2P1ZA 4XAQA 5BUCA 5JYBA 1BU8A 1QE0A 3WLJA 4IJUA 4G5OA 2PBLA 4W5JA 1AU9A 1FFEA 2AR9A 5GM1A 5KTOA 3QU9A 3PC4A 2IRWA 4LF7B 4MUIA 2JNWA 3H2GA 3SD7A 2QN6A 3OE4A 1TFRA 2JIDA 4MO9A 1XKLA 5FXMA 1UXIA 4L5JA 4E22A 5IVHA 1VSTA 3H18A 3EEFA 4QX6A 5M29A 4ZT3A 5I9LA 3NCTA 2AE2A 1JFRA 1SIBE 3B2NA 4QGAA 2PG3A 4RESA 4EG0A 3FUVA 2NUPA 3HUFA 2P2SA 5DBGA 3JQ9A 1U1FA 2HZBA 8AT1A 1V1JA 2OGWA 2Z58A 3LDGA 3UC5A 4DCJA 4CMBA 5KJCA 1NF9A 2ASVA 3PKZA 4FGLA 4PE5B 3TIVA 4Q3LA 2VEOA 5I5GA 3N3AC 2C03A 4K86A 2GPAA 3N75A 4OSEA 4TTJA 1CUZA 1B16A 3GEGA 2FWJA 2ZSIA 5BYJA 4O4IB 4GMGA 4BMZA 4R2MA 3AB3A 3P0EA 2YJGA 5DV9A 2P8JA 1G6Q1 2A0UA 5E9AA 1IZ0A 4GP6A 3NDJA 5HTKA 4CLEA 1GRNA 2XTMA 4MQ6A 3AJEA 1OBFO 2F00A 1O0SA 1IJKA 1YE5A 1GNSA 1SVLA 4L2IB 3JAWA 3EUEA 5KVQA 4ZEVA 1NQ5A 3O1JC 3PWTA 3KVRA 4BX0A 4UTNA 3RVQA 3VC3A 1WKBA 4DSUA 3GLFB 2HJRA 1QYDA 2JA1A 3EPPA 4JDPA 4OQPA 4RD3A 3AUSA 3JZIA 4HB3A 3VVCA 1JLLA 4G1FA 5JTUA 1JJ7A 3UOWA 3SSOA 1I3MA 4C0BA 2BDEA 2WFLA 2BZ0A 3PUIA 1P9NA 3BHMA 4W6QA 1R2QA 4FHZA 2G9UA 4N54A 4F5WA 1VIAA 2FG5A 1KI3A 2O5EA 5GVSA 1JXOA 2QVLA 3PC6A 4DSZA 1RR6A 3IUMA 3OC0A 5JMPA 1CQZA 1MZVA 5L95A 4HN4B 4CV3A 3HCRA 2BEUA 4EHHA 3D6UA 3LQ1A 1XKXA 2QTVA 3CNHA 3R3VA 5TGTA 1JV2B 1GYRA 5BV1A 4GWLA 4KN6A 3U60B 1DPGA 1D0IA 2Y99A 2HQBA 2LKCA 3ZD9A 3DSRA 2RAUA 1C7FA 5B6PA 1PJSA 2ZANA 2GHQA 2VPXA 3A6ZA 4RHEA 2QN2A 4EDHA 2CXUA 1EG7A 1OI2A 2IOHA 2NVOA 4JB3A 3K0AB 1TADA 1YRHA 2GO7A 1AHIA 1KAEA 4IJQA 2HV9A 4BBJA 1JVSA 1IWOA 3I9JA 1Y1RA 2XZDA 3NO4A 1LW7A 3PKJA 1JXQA 1XTUA 2QAGC 1UPCA 3D31A 3EPRA 4E70A 2WJ4A 1SVNA 2HRRA 3DEFA 3FDXA 2Y27A 1YRYE 3IP1A 1N6LA 4BB5A 1SKAA 4LNUA 4MK4A 3PDJA 2F1IA 3NRCA 4J0DA 2Y4OA 2F8LA 4W9MC 3CKKA 4W5HA 4BN5A 5DHUA 4N5NA 3IBSA 4TMVA 2QKYA 4A9AA 1WO8A 2O2IA 3EAQA 1E2EA 4OHKA 3M3DA 5GADl 2HCBA 2P8SA 2QR3A 4LV6A 4Y9UA 1IY0A 5EIWA 5LU9A 3H13A 4IKOA 4NV0A 5FPTA 4U6NA 4BMNA 5IXYA 3DZKA 3IQIX 1J25A 1OXMA 1WOYA 4ND6A 1H42A 4A6PA 5CDTA 3MAAC 2CJPA 2F3PA 1GL7A 1E32A 1N8NA 5CB4A 2QZJA 4RSRA 1M34B 1OTHA 2VHTA 3KJFA 4AUEA 3A6DA 4PO3X 5KHLB 3AG6A 2W0SA 1C1HA 3SJAA 5K03A 5EMNA 2XOKD 3DMYA 3IR5A 4MEJA 3EEBA 5B1EA 1VI5A 3W90A 1TM5E 1BOFA 4F97A 2QX7A 1QX3A 4U7DA 1Y9AA 2W83A 5LWHA 2FX3A 3IERA 4INPA 1T0BA 2CXOA 3W9BA 2WU8A 1A5SB 2RHWA 3DFFA 4ZRMA 5IDVA 4YUXA 2QY6A 3H7IA 1X7XA 3O4GA 4OLBA 3MJEA 5HJ5A 4OUDA 1WDMA 2VSOA 3IVGA 3DTVD 4KYTA 2ZE7A 1TVEA 5IDQA 4HH0A 1BDIA 3GRAA 1TKCA 3GRYA 3DD5A 3DE2X 2X1MA 3I28A 4DW8A 4XX0B 4F0JA 3IDSA 1N2XA 1ENYA 5GQSA 3I2IA 4FFOA 1FS4A 4Q01A 2PXXA 2VK1A 3U1TA 3GJ3A 3FBTA 1GUZA 2ACEA 1P8JA 2WW8A 3A4VA 1C8KA 2DCUA 4YMHA 3WGIA 3GF4A 4ZVSA 1P6XA 1E79D 2B36A 2ZQZA 4PX3A 5AOVA 4BX8A 4TYNA 3ZVRA 4LJLA 3I1JA 2G7ZA 1YS7A 1MG5A 3KAPA 4Q1FA 4OX9Y 2HTFA 2CFIA 4JQCA 2J3LA 1PL8A 5KB3A 2OESA 4CTNA 3NKFA 3UMJA 4TWRA 4DMCA 5BV8A 1A9XA 4B44A 1MP0A 4BIMA 1T15A 2GPWA 1X70A 3L0CA 4KAJA 1ZISA 1U8ZA 4G36A 1HDCA 1BEZA 1IHXA 2OHIA 4KJXA 2VDLB 3PHCA 2LD4A 4W5RA 4PYMA 2P67A 1Z2CA 3LPAA 2GBIA 4YUVA 2O2GA 2OHFA 1XWFA 3ENNA 3ZKWA 3AKYA 1Y7IA 4D3SA 4I3GA 2GNAA 4FWTA 2P5TB 3GVHA 4EHIA 1M73E 4HTFB 3TLYA 3IUQA 1KFKB 1NBOA 3RS8A 2V7EA 4M4SA 4DMMA 2ID9A 2AFIB 2A35A 3A0UA 2Q3MA 2X86A 1X9IA 3OKCA 1B00A 4YCJA 4AM8A 1SXQA 2BF7A 1OIWA 1E2LA 1NVAA 4LJYA 4M3NA 5A5GA 4KTVE 2ZUFA 1TYEB 4EUFA 1GTRA 3NTOA 2ZIZA 3HVIA 3E53A 4UFNA 3VKGA 1QG6A 1YSCA 1DFHA 4Q9LA 1RXIA 2GXAA 5E9JA 3KG2A 2XCRB 3C1UA 1E77A 2C7BA 3IEKA 2H2IA 3PHHA 4MWOA 3WKAA 3VHLB 5I9IA 1R1DA 4LY6A 4D3ZA 1JA0A 1HEUA 2ORWA 1BXRA 3DEZA 1JPUA 3JYHA 2WB2A 5F7ZA 1CCWA 3WRWA 4L74A 4URVR 2VHXA 3ANSA 2W2NA 3CSDA 5HUQA 5JQGB 3T0FA 3C2QA 2ZJ4A 1V5FA 5DLPA 4UVHA 1SVKA 2EFCB 3H83A 1P0QA 4FEAA 2WA1A 5CNJA 1X94A 3EXHB 3FSRA 4RPJA 5L53A 3NRBA 4PS0A 2UU9B 2BM8A 2O8VA 3PGLA 5AQEA 4LWQA 4TLCA 4J76A 1CZLA 2QUHA 3GUVA 1ML4A 4QLBA 3QXSA 2C4UA 1N8SA 2WMOB 4RMNA 4ZJZA 5JDCC 4ZEOA 3PRYA 2UZAA 1ODTC 2HA2A 2DT5A 5EJ9A 3M89A 3OLCX 1MO3A 4OI0A 1HETA 2GCOB 2WOJA 4HQ6A 2GS9A 5IJ0B 1IY9A 2A5FA 1RI1A 2VNJA 2W4QA 2X4IA 5DB4A 4WJZA 3UH0A 3GLTA 2VSXA 4F1KA 1EFLA 5HIMA 2QTFA 4XWAA 4MKIA 4CQMA 4NMHA 4M0CA 2WKQA 3F98A 2BM9A 4XX1A 1KGDA 2XLCA 2BFNA 2GNPA 5LYYA 4DLYA 2YTZA 3AIMA 3WKBA 1NSTA 1PR2A 1LDMA 1NQUA 3Q6MA 5CNMA 5F9MA 5C5EA 3IBGA 3K09C 1E0AA 1XRMA 2YYYA 3PLNA 1G59A 1U4NA 2AOWA 4E2ZA 1A5AB 1VZ3A 1AT1A 4ETWA 1YUNA 4Y0VA 3RSSA 1Z0IA 5HQ3B 1JALA 3EH1A 4ZYLA 3LJKA 1IHPA 4R1OA 2F55A 2Z8YA 1SU8A 4JFAA 2VDWB 1GV0A 2QX6A 4E33A 4FGKA 4DVGA 1UQUA 4HDRA 2XMGA 4GKJB 4V02A 4EY3A 1NBAA 4TRRA 1A9PA 3UKDA 4AD8A 3STWA 2OBYA 3MWFA 1VI6A 1QV7A 3UGQA 5DHSA 1ZA2A 4B46A 2DR2A 4CUKA 1ZOSA 3IIIA 3BHNA 4BV8A 3UAYA 3PEYA 1DC5A 4Z3OA 1HF3A 2AHRA 3S8EA 3CH4B 2A86A 1KYXA 3DDNA 3FYSA 4IOJA 1O95C 3BXPA 3ZCVA 1N9ZA 5EJ6A 3PICA 3TB4A 3SS8A 2GZAA 2O2ZA 1XRLA 1MT3A 2W2VA 4MUKA 4NEHB 2GASA 4F9TA 2CNNA 3JZDA 4AY3A 4XOIA 3ZGZA 3HL4A 1LJUA 4ZA2A 3EZGA 4ZAZA 1XCJA 4RJKA 4OI1A 1Q1GA 1GUAA 1KFJB 3FTQA 1L6IA 4GRDA 3S1LA 3GA0A 1D5WA 1SVUA 5DE3A 3QF4A 1C8VB 4D3XA 1M1YB 2H4YA 1FFDA 1HEYA 3HJUA 3ZWOA 5BN1A 4TSRA 3PUJA 4K26A 3DNMA 3F74A 3FVRA 4LOKA 5K7SA 4FOLA 2IP2A 3KB8A 1MO4A 1P7PA 1CEYA 4RSGA 4G4GA 2YFYA 3N2ZB 4H9GA 1YFLA 2W2PA 4QHSA 1RFLA 4DC9A 2BI8A 2F1HA 4URXR 2JG3A 1JHZA 4AROA 1EBFA 1FDWA 3NP7A 4MRAA 3D8BA 1G20A 1OGYA 2AI1A 3OF3A 4Y0NA 4BEWA 5KIAA 3A7EA 1GR1A 2ZPTX 1BGXT 3LH5A 1UC9A 2OV1A 4NCNA 2AFHA 4YT4A 5DTEA 1AHHA 3PQ2A 4M1YA 4UHHA 3LGAA 2I9KA 4ZYYA 1CUGA 1W0JA 3I6YA 2VF2A 3GGOA 2PUJA 2EIHA 4UEQA 1F2TB 3ODPA 5I9SA 3STYA 1NONA 3UHOA 5IYZB 2QSJA 4HLUC 1EBBA 4ZVTA 3FCAA 3FPJA 3LY8A 4QDUA 1KI6A 2QQFA 2C8JA 4LGVA 3JQDA 3V42A 1G55A 1Q3HA 3B7GA 1EP9A 1ESNA 2CJXA 2PA0A 3D3NA 3R3YA 1XMSA 4CR6A 1ANKA 4WK2B 5DNDA 5FYDA 1PQ4A 1XHEA 3KQYA 3OBIA 1ZMBA 5JJIA 2QM3A 2A30A 1JFVA 1I2BA 4FFLA 4F3KA 2HT1A 1U28C 4X64B 4CM8B 5K0CA 1NN1A 4L5AA 4OQXA 7REQA 2FZCA 2POCA 5AOCA 1MA0A 4UD2A 5BQPA 3SYMA 1Q1QA 1U31A 2J6HA 1FRQA 2RI6A 4W5QA 3FCOA 2XLBA 1P1IA 4DCMA 4OP3A 2F4NA 5FA6A 1PJ2A 1JAYA 2CLIB 2QMHA 5JE8A 1LNSA 3P2JA 4PX5A 4GWGA 4Q7MB 3PNKA 4XQGA 1RE0A 4B85A 4RTRA 1PQUA 2C5BA 2BGNA 3AYZB 1E0KA 2W6JA 4TTAA 2V7BA 1QIFA 3GCGA 1FQJA 2O2CA 2F8MA 3PC7A 3LUJA 2DUMA 2BGRA 2ZU6A 1BWSA 2AJBA 1KDZA 2QUAA 4QARA 1U7XA 1R0RE 2HREA 2I4MA 4R5HA 1Q0PA 3V4ZA 3Q15C 4IKPA 3IQFA 4QREA 3JQFC 2BW0A 3A05A 3UW3A 5BO5A 1J8MF 2R00C 3GGPA 2RGUA 4MB6A 1BS9A 1W47A 3IT1A 1WSBA 2D0IA 4M1KA 4R3UC 4AG5A 3U80A 3ZBTA 4DMUB 5ICSA 3ZNQA 1CR4A 3C41J 4NAVA 2CXQA 3IKLA 2X8JA 4RL4A 2EP8A 4TL8A 5KCZA 3RIHA 1TNDA 3HCOA 3L7NA 2OOKA 4IJKA 3D6NB 1E1LA 1WULS 4EFMA 1E7SA 1K3UB 1RWNA 1UZLA 1Z5PA 4NIMA 2PMCA 5A62A 2JLXA 2ZSUA 2VZ8A 1IIRA 2HXGA 2JGKA 1MXHA 5AMXA 3QE2A 3PYLA 2NXCA 3UMFA 2J0QA 1GG9A 1GCGA 2C94A 2VJKA 2XEXA 3FI9A 4EB6A 2QDKA 1YS6A 4RJJA 4WD3A 3SVZA 3G2LA 4FT2A 3SHWA 4E1AA 2QGFA 4X65B 3A27A 3LUBA 1O9GA 4E88A 1UOOA 4R2IA 4J91A 1G19A 3IMCA 3S2FA 3L49A 4G4JA 2ERCA 3CX6A 4E4TA 4ZMRA 3ZZ0A 4DR1B 1RKBA 1OAOC 2HSGA 4MR9A 5E2IA 2JK0A 2ZJ5A 3H8SA 5GGXA 4B3DA 2V0CA 3LXUX 3QI7A 1QGOA 4CQJA 1M8KA 3PUHA 3WB2A 2BH2A 2AN4A 1P5JA 2YXLA 3DF9A 1V16A 3TLJA 4E1BA 3IAM1 4UNNA 2UUCB 5FX2A 1PJRA 2ZEJA 2HMTA 4PLYA 3AQIA 4CLRB 3DLIA 2FUCA 3DT6A 3L1HA 4EPTA 1EWKA 5K3OA 8ABPA 2CMDA 2YIJA 3VAYA 1DJQA 1RM4A 4D9CA 5KX5A 5JS1A 1IN8A 3MINB 2AC7A 4MPTA 4X7RA 3QPWA 5IXJA 3A6FA 3DHVA 5LQUA 2P3QA 1O9HA 2PCLA 1XMQB 2O2DA 4LJ8A 4DTIA 1J2UA 2Z9CA 3OURA 4P2BA 5DGHA 4Z9XA 1KI4A 1T3HA 5K0SA 4TT3D 2NX2A 1DBRA 4HZIA 4P3NA 1R5JA 1XEXA 3L3BA 4ITVA 1J1UA 1O2DA 3C8MA 4OFWA 1E6CA 2B6HA 2JI7A 4A8JB 2CLHB 4WA7A 2H51A 4LPSA 1B73A 5EN4A 3P7MA 4G1MB 3G5TA 3IIEA 4WV3A 1A5TA 3RYHA 5KDDA 5CFNA 3F8WA 4LYAA 3SKXA 5DYYA 3RTEA 3GH1A 3M83A 4QQKA 5ECYA 2VHCA 2NO9A 2WF7A 3GCWA 3EQZA 3UHPA 4D26A 3UG6A 1Z5WA 4GC5A 1XTPA 4EVSA 3LT2A 5AFSA 4Z0PA 3M6MD 1MXFA 1UMDA 3KLPX 1GVNB 3G5UA 2O20A 3L8FA 1J24A 2JLQA 3CHYA 4HN2A 2XOKA 1Y48E 1V7CA 4TKVB 5CBKA 4K9QA 4EGFA 1W85B 2QI9F 3WISA 3HLTA 4HN9A 1CUVA 5E0OA 2A5JA 4YQEA 2VXOA 1ZEJA 1JVNA 1XTVA 1P8AA 5P21A 4UNRA 4PZLA 3K70B 2PZLA 1QONA 3L8ZA 5EWMB 2E6KA 5LQSA 1Z4PX 3DTVA 2VDUE 1QPBA 3FM9A 1E9RA 1M0WA 1OU0A 1C3OB 1ULZA 3QXCA 4ZJYA 1P91A 2B82A 5J5VA 4IWYA 4ZANA 3SLRA 5DYGA 3TZCA 4PV7A 3H04A 4D98A 5EKDA 4UXHA 4L95C 1DIBA 1I7DA 1PZFA 4QFBA 3W2IA 3IP3A 1ZM3A 5K3DA 2KMLA 3QMWA 1E79A 3G0BA 4RM3A 3VZCA 4D6YA 5GWXA 2QYOA 4WCFB 1QH8B 3WTBA 1IK6A 2XMPA 5DWQA 4XJTA 4M1TA 4P36A 3K9CA 3R7BA 9GPBA 3MLEA 2CB0A 3MN1A 3EISA 2GK4A 2QV0A 4UM5A 4IFEA 4QSMA 1V5EA 1NG1A 3UXEA 1RQNA 4AJLA 2D0PB 3I5AA 4OAPA 5HQTA 5I01A 2WWGA 2A33A 4K9MA 3VNBA 3L7DA 2MSEB 1P0CA 1ODFA 3B12A 3HCEA 3C15C 3HU1A 4K0RA 4WY2A 3JVVA 5K01A 2IXDA 1JR4A 4ZAYA 5A2QA 1M0TA 2RHMA 3KLOA 2DY0A 1G5FA 2RHLA 1XHLA 3AHDA 4GM0A 4E5PA 3DBLB 5HKAA 4MJXA 5HNKA 3DMGA 1J20A 5EG5A 3AFMA 2YZ2A 2YCLA 2SKCA 4EEZA 3FCXA 2D54A 2PD4A 2QR2A 1CT9A 1EJ2A 2WILA 3HKDA 1E9CA 1OWOA 3VH2A 5DSZA 2HPHA 2I9PA 5FTMA 5CR9A 4BKPA 5IJZA 3ND8A 1JSLA 1JIXA 1TMYA 1JBEA 1RXYA 1VCHA 1YACA 1ST3A 2RDMA 2XV1A 3OCCA 1E2DA 1TKAA 1Y7TA 4NNOA 1MF7A 1GKLA 4OH1A 4Q37A 5CJJA 1TA0A 1KI8A 1V3UA 3OA2A 2WNSA 1Z39A 3HBMA 3MCZA 1B0PA 4OFZA 4PIPA 3SDSA 3C6YA 4L8GA 2XF2A 5HBRA 1ZUIA 2PUCA 2EWVA 4TLDA 3B5IA 4NU0A 2R8XA 4ZIRB 1SHJA 2XA9A 3WGGA 4EZEA 3R5HA 3KELA 1EZ1A 1X80A 3IC5A 4DQDA 4BMDA 1FYDA 1EG2A 4FP9A 3K0CC 4FCCA 4E2YA 2BFEA 3KT3A 4RV5A 3IV7A 4RA9A 1MEJA 2JF0A 1PS9A 1Y6ZA 4O4HF 2CJFA 3V2UA 2O0MA 2PMKA 3G0CA 4B43A 1WPRA 3WLFA 4DJJA 3VDQA 1W94A 2BIFA 1L3IA 2RCNA 4C30A 5DTIA 2QUBA 2P1DA 4QVGA 4MS3B 3E4CA 1SBNE 1MRSA 4AVYA 4N8SA 5CFPA 5MN5A 2XSZD 4L16A 3LBYA 1RP1A 4OO3A 4RF2A 3CLKA 4G37A 1N8TA 4PO8A 1JKJA 2EW2A 4ZHSA 3QVLA 1TC1A 2NZXA 3IBCA 3KZ1E 1FSFA 1YI1A 5DGXA 4Q12A 5THQA 3VJKA 3L7OA 3QPCA 1TO1E 4LCEA 3GLIA 3HJRA 2D2XA 1T5OA 2V4MA 3EXG1 4FW8A 1KSFX 4ZVOA 5AW3A 2CCKA 3FOFC 4AJIA 1LSSA 3DKIA 3Q88A 4PZ0A 3RJ9A 1ZGBA 2CZQA 1LI7A 2KM1A 2OCAA 4FIZA 3PYMA 5AI9A 4UUNA 2DT8A 5TARA 4TPKA 5BR4A 2OGTA 1J8YF 3ILYA 2HSEA 4FS3A 5H7XA 3R6GA 1QRUA 1ES9A 3EJWA 3WNZA 2JLUA 2IIBA 1NGSA 4WPGA 3BRCA 3E8SA 4R4JA 4X8HA 3ADBA 4D4LA 3TNDA 4OYYA 1CDOA 3EDYA 1CJVC 1E1QD 1YIAA 3D6MA 3QLVA 3RVLA 3SLKA 2XOEA 1Z74A 4GBGA 4GZMA 1MFPA 1FZQA 3KXIA 4N40A 4Y2QA 5FI0B 5FL7D 1L5NA 3UUWA 2AF3C 5DNCA 3M9LA 4YS6A 4XWYA 3RSGA 5A5EA 1X1RA 1P72A 1DPFA 4OQYA 3RBVA 3SPXA 4CG1A 1TUBA 4G8CA 5J2TA 2C54A 3BL5A 4HDCA 3GLGE 3A4NA 3HB9A 4CEHB 2E7ZA 2KI5A 2VC2B 4EA8A 1NAHA 2J59A 5KNLA 3D8TA 3M3PA 3AV3A 1GV1A 3EBPA 2GM3A 3HVHA 1KH1A 3CUKA 3LAWA 4RZSA 4B6RA 1VMIA 3P0HA 2FWAA 1DFGA 1FEZA 3PXDA 4JY7A 3IVAA 1SUCA 3G17A 3GOQA 4KE9A 3USZA 4ERNA 1R8QA 2AEEA 3SHVA 2P40A 2XE8A 2A14A 1V4BA 3NQ41 3RYFB 1JJAA 1LGYA 2C0PA 1YR9A 1JLKA 2J3HA 1PO7A 1MENA 3GQBA 3H11A 3M1IA 1QG4A 1ZU5A 2JCGA 4UNQA 4WBNB 4W9NA 4LJ6A 2QG6A 2F67A 4Y1RB 5TPWA 5CA0A 1XZFA 3I23A 2FH5B 4GGPA 4E1VA 3R5FA 3SM9A 5G4KB 4BO3A 4LRWA 1OBHA 1TMGE 3NXKA 4MJ7A 4YGYA 1VKZA 2A1UB 2X19A 4B8WA 3A6JA 4JLBA 2VYND 2FPUA 3LYAA 2NSHA 4DRZA 5BUSA 1UDRA 1QP4A 1YVPA 1P39A 1X7YB 2JD0A 3DE4X 3HUDA 4FYPA 5F12A 1WPXA 4C4TA 4DLTA 1JIVA 2YDYA 1T6BY 2C98A 4M9ZA 4QRDA 4G5RA 4ZCLA 4Q03A 4C87A 5A03A 1OW3B 1YR8A 1DLIA 1WDTA 3BAFA 3RS9A 1KY5A 4B32A 3QSYA 2C00A 3KL2A 2GK7A 3M6IA 4N65A 2P6OA 4NEQA 4ACBA 1OAKA 1R4ZA 2I2WA 1CIJA 1N2IA 1ADJA 2D5AA 3A2NA 5CM8B 3N9IA 5CFQA 2PZAA 1EM6A 3F5MA 3D4IA 1TE2A 3GN1A 1SEPA 3G2IA 4DCNA 1Y6JA 1QRRA 2FPPB 4J75A 7ADHA 1L7BA 4G0XA 4OHUA 2XTAA 1N1GA 3TRDA 2BGMA 3W3AD 2G08A 3MTQA 1BCRB 1JPVA 2HWYA 4KQ2A 5AK3A 3W6PA 4CI0B 1O5IA 5F2EA 5JUWA 4KSCA 2DSTA 2PKXA 2JI4A 1KVTA 2OZKA 3Q12A 3QF7A 3F5DA 4NU8X 1DOZA 2WSSD 3EC7A 2H4HA 2HL6A 1YB6A 1F8YA 4XB2A 3KYDB 1KKMA 4J0IA 3AKDA 4BATA 1ULBA 5KQSA 4INZA 4NS1A 5F1OA 2QYTA 3G0OA 4YHBA 3JVIA 3UB3A 1BFKA 2NVBA 3HDTA 3JWEA 4U7TB 1LC0A 3D7KA 1KZ4A 1I3NA 1H3NA 1SC9A 2VP4A 1E96A 1DCKA 2C82A 2YS6A 3BK1A 3LRPA 4I9GA 2IIQA 4XM1A 4N0PA 3A2LA 2OO5C 4BV9A 4P7FA 5AVJA 3X44A 1DQZA 4O5AA 2PWAA 3KJHA 4HNUA 2QMZA 2UVDA 4R40A 4BNJA 4DRXA 3A26A 1JAXA 4NI5A 5KO2A 3OEWA 1ZJWA 4RGVA 2VS1A 4D9EA 1XD8A 2M6RA 2XTNA 2RJOA 5ALEA 3RC2A 2K7FA 3HPQA 4DJEC 5EJAA 1WQ4A 3ZH2A 4GKBA 3QVGA 4D7AA 3K0SA 2OHHA 3Q9LA 2J0SA 3TG8A 3IAS1 4JUAA 1DBIA 6REQB 4GT1A 4AF8A 2C8KA 1RAEA 3MJCA 5CTJA 2BP7A 3MGAA 5KYKA 4LHVA 1EWQA 1MJHA 3K4PA 3JQAB 5TVGA 1QGED 3U9SA 3OLYA 2FSIA 1M2FA 2ORIA 3GK3A 3RSLA 1JH9A 2MYNA 1SUSA 3LNCA 4MRPA 2YV4A 3TZEA 4B79A 1IB0A 4PAWA 4A2WA 2YR0A 1KFEB 5T8KC 3VPSA 1FUYB 1WLSA 5ANRB 4AJNA 4CBVA 2DEUA 3LHDA 3SIWA 4QUKA 5EWJA 3QQ5A 2ZKLA 4JT2A 3OCWA 2XE6A 4EO4A 5KDLA 2Y93A 3MWLA 4FSXA 3TSOA 5DWDA 2I5PO 4RZ3A 1FOEB 1KMIY 1UT8A 1ZINA 1EGMB 1T4BA 2R7MA 3C3PA 3N2KA 4HUJA 2HF8A 4NPCA 4ADSG 4BAGA 2DTXA 3LYLA 3ECSA 3TUIC 2XVZA 3ZZ1A 1QYWA 1P0IA 1TZCA 1VRCA 3A3PA 3R3HA 3GRVA 3G79A 4IHQA 4IDOA 4OFXA 5HF6A 3TD2A 1FMJA 4F06A 3ZWBA 2PJRA 1W7AA 1JHRA 2C7PA 4J7CA 1X1QA 1EHIA 1H5NA 3NNSA 3DCJA 4J4BA 5JAQA 2JFHA 2ZW9A 4BBZA 4DBVO 3KX2A 3WLLA 3MC1A 4ZPXA 3TW8A 1JQBA 1OY1A 3ZXXA 5F9FA 1XRRA 3FTFA 3DEAA 3MTJA 1WXDA 1Q7GA 4FYVA 5J63A 3VZPA 1BMFD 4J16A 1PNOA 4ASUD 2B5VA 1UAYA 4GSYA 1Z5NA 4OATA 5K5EA 1L5WA 5SY9A 2P90A 3UYKA 4YCMA 1C50A 2VZLA 2ZAGA 3VNQA 2AWOA 2EKPA 1W5TA 2EL7A 4MP3A 1Q3KA 3Q9SA 3AB7A 3NALA 4OSOA 4B8YA 3T4PA 2CDNA 4DQXA 5JECA 3W8DA 5KHAA 1Y8RA 3HY4A 4W7SA 2IYSA 4FU0A 2H17A 2JVIA 2R6JA 3EVAA 3NGLA 3CZQA 4GKVA 4A26A 4E5NA 5CIYA 2JBAB 2VWHA 3RB8A 1FA9A 1H0SA 2AK2A 2P0AA 5CH3A 2WNHA 1Z33A 5TXGA 1CUUA 5LWQA 3QMPA 5KYYB 2HQRA 4TN1A 5B36A 3HN2A 4WOBA 4M88A 1S96A 1EVLA 4ZVUA 2AN1A 2J9ZB 4IZOA 1DEHA 4O6VA 1W5EA 4J07A 1YDEA 4HWRA 3WK7A 3ZK9A 2KLBA 2UZ1A 2DY1A 3OEHD 3JU3A 4MV7A 5IAOA 1HSZA 1KMHA 4H60A 2YN2A 1BD3A 1OI7A 2FP4A 1NT2A 2OUKA 1Y1SA 3EDCA 4IHJF 1RWBA 4YNBA 4TT3A 4AXBA 2HJHA 1BAPA 2PY6A 3FPLA 1I8TA 3WKEA 3GAMA 2ZPAA 2DECA 2N9UA 4KHZA 4L51A 4NZ9A 4WVFA 4W5NA 3KXPA 4XASA 2VAPA 5KTYA 3U7EB 3LFHA 3ESCA 2R6DA 2RAPA 3LLUA 1SCUB 3ZWNA 5FNVB 5HE8A 4FJ2A 4HYYA 2C8LA 2OFFA 3BTVA 2OCGA 3HUUA 1SZCA 3IEMA 3U4DA 3WYGA 3MT7A 2DUJA 1FXSA 2NZWA 2GEUA 1F2DA 4GMDA 4DIOA 4QDZA 4BLUA 2JCYA 2R79A 3MCAA 4I6GA 1HQKA 1RLOA 2PMBA 1JQDA 2QRVB 4G89A 4F6CA 5DI3A 3LP8A 4P4TA 3QVSA 1Y3IA 2VH5R 1G4AE 5ALOA 5D3QA 2WHXA 1Y7LA 2JFOA 4ZQGA 4EYSA 5T5QA 2NYAA 5E7JA 2AG5A 1Z4MA 3D3WA 2IYTA 3MCVA 3AW8A 2JH8A 2OYRA 2X0EA 1MX3A 4IFTA 3AVPA 3DG9A 4QFMA 4W63A 2M98A 4XFJA 2ZR9A 2B2NA 4OIFA 3AKZA 2HMUA 1Z56C 4ZU3A 4G97A 5DIZA 5HILA 3HA2A 3WGYA 1YKSA 2GZ2A 3ELBA 4UOEA 1MO2A 2OZPA 5CVEA 4BGVA 1VM6A 3DUFB 3TEJA 5JH7B 4TXJA 4LDQA 4JNKA 2JFZA 4L85A 4RTNA 3OIGA 1SU7A 2W2LD 2QJFA 3LVBA 4XI9A 3ECCA 1GVHA 1Q7EA 1LTHR 3FXAA 4B40A 1W49A 4B2LA 4R8RA 3T94A 4COKA 4NDZA 1GAQA 2B30A 2Q6KA 3K53A 5AVQA 5KVSA 3DWGA 2DBQA 2OK7A 5JBQA 2VBGA 3H1PA 4X92A 5LZ4A 4GXTA 5JRJA 2H1IA 4P5PA 4GF5A 4P4GA 1WXWA 2OCYC 2BMFA 2I2AA 1Q44A 3TIIA 1X1EA 2R751 2W93A 2DF8A 2GN0A 4K1LA 3V1TC 1H1LB 1NJGA 4JVLA 2XKJE 4QDJA 3FDFA 5CNIA 1LCIA 1YCGA 2G88A 2G9NA 2EF1A 2OCLA 4OOFA 4N7MA 4RLQA 3CE6A 4C6SA 3QU2A 8GPBA 1F17A 3H2ZA 1SUEA 1U5AA 4O2AA 4CVNA 5JAPA 3ITDA 3TD6A 4QUGA 1XRQA 2H5IA 3WQSB 1N2EA 1EUCA 1CJUC 4IYRA 2GM4A 4Q34A 4RPGA 1BWPA 4G4SO 5EIHA 3OWHA 3M82A 1KY3A 2DQKA 2IE0A 2EF0A 2ZUBA 3OY7A 4FFVA 3W5VA 1MRZA 1SQSA 1Z75A 2OZLA 3EVGA 4K8OA 4RVHA 3QUBA 2O8FB 3I8OA 4M8KA 3BH0A 3M1LA 3BUSA 1EWRA 2GEFA 4G0QA 1TA9A 2B20A 3ZDFA 2C4WA 1UBCA 1RRFA 4G01B 4JA0A 1V26A 2OD7A 1FJ2A 1TXGA 2H3HA 3B5JA 2J0UA 2V7WA 3DOFA 1JG3A 1KP2A 1LDYA 3PNSA 1TU4A 3L8YA 4Z99A 3SHQA 1CRPA 2QT9A 4HFMA 4FUQA 3RRNA 4L4RA 4Z4QA 3TTTA 1U90A 2XTJA 3RSCA 5FJIA 2WWHA 3R8FA 2Q1WA 1IOVA 1CJCA 2R8PA 2WHYA 3HWSA 4MS1A 5DHPA 4UU0A 5IHPA 1KZ7B 1M2JA 1M1XB 5JCOA 2GPSA 1P60A 2VK4A 5BN5A 1JFSA 2Q5OA 2Z1DA 4DLZA 5CLQA 2BT4A 1N6KA 1U0RA 2OR3A 4MHTA 1G4HA 3USCS 2F43B 3SMQA 4B4DA 5PGMA 4BFZA 4BB9A 4D6XA 1R5OA 3AEQA 3JV7A 4D96A 1IEQA 4YRBA 2IDKA 1U4OA 2YUIA 5DNUA 4D74A 1Q5PA 2Y1LA 2YHIA 3V2HA 1TTQB 3NAGA 5K4HA 3CO0S 4DV4B 3IESA 1QJCA 3EFHA 2OMEA 4HWOA 1JKMA 5AJYA 1XEFA 5CH8A 1QLJA 3A3KA 3UJ3X 1P4RA 3RREA 2A1IA 4EJMA 1K8ZB 3R40A 3AO0B 3WGTA 4JGBA 2C2YA 3CPHA 2ODNA 3I58A 4OMFG 2C9CA 3FBGA 3B8EA 4YLGA 1J2JA 1CQXA 1TAGA 4OL0A 3L7BA 3WFZA 2NU6A 3AERA 4R51A 3NB0A 4ZQIA 2X7XA 4RFSB 3V4LA 2Y8EA 2VG8A 2XGOA 4CL3A 1N1DA 3RU7A 4UKDA 3LUCA 3RK1A 1SG9A 2VDPB 2NPFA 1E1QA 1YDWA 2B7LA 4QXPA 1XD2A 2W6QA 3IJEB 4LYGA 1FQWA 1L5GB 2ZB3A 3THRA 4V0ME 4BBAA 2RBKA 1ADCA 4BP8A 1GRQA 1NBMD 1FNSA 4H1UA 5G0VA 1C0KA 1QG2A 5FTJA 3Q41A 4ZHQF 3NDRA 1PGOA 4DT1A 2SNIE 1O5TA 1HE3A 4YV1A 2JW5A 1P0PA 1QP8A 2BHRA 4EJSC 1HURA 1P3Y1 1FS5A 2IKSA 4QVKA 1E99A 2XT9A 4DIKA 1YCHA 1FDSA 2GD6A 3VX3A 4CODB 4Y2GA 3ADDA 1UJMA 1IXSB 5JY6A 1QF9A 2HXYA 2R9VA 4XYGA 2AD1A 1I80A 5D51S 3ZEAA 5KVVA 4DZRA 3I0MA 1WU7A 2JVJA 5I9MA 1TW2A 2GBPA 4PLGA 1TJYA 1PCXA 3AB8A 5CHYA 5E3IA 5FBLB 5FPQA 2IEIA 5B4TA 1UQRA 4P80A 2PRJA 4G5QA 3KQSA 2FCRA 5F52A 1BDBA 4FCTA 2GRAA 2OQVA 1M0SA 2GF0A 2PANA 1LBSA 3OTGA 1T1RA 4KUGA 5FHRA 1OILA 4WECA 3O74A 1FYWA 4NPAA 2FOIA 4XWGA 1GPUA 4Z6KA 1WBDA 2VP0A 4HLNA 2B4YA 2Z6VA 5BXYA 2QRQA 5F1KA 2VYNA 4GUDA 2W42A 3BFKA 4K6HA 3ZBUA 1U9IA 4RH1A 3IAFA 4KGDA 2ZJZA 1DJMA 1D0VA 3SICE 1KO5A 2CNBA 1EFVB 2GYWA 1NW9B 2Q7DA 1NT4A 1RYNA 3ZBPA 2IQIA 3FYUB 2B94A 2P7IA 1WCV1 4GGMX 1D4ZA 3DWIA 3LY9A 4IDHA 2ZOSA 1DTWA 3M33A 4JT4A 3HM9A 3RFUA 4JHLA 5FDFA 3G9ZA 1J90A 3KQWA 2ODQA 2VP2A 3DC7A 4AKIA 1D2HA 3EGWA 3GZ4A 5HRAA 3KDSE 2GEVA 3N6RA 3HKCB 2Q1XA 2W8BB 3W3AA 3GA7A 2E5WA 4P84A 3TINA 5K4AA 2CY0A 3UOAB 4IV5A 2IOQA 1RM5A 3ASVA 4CU5A 2JFXA 2AK3A 2GBFA 3DWEX 4XSGA 3RRJA 3RUCA 4BXOA 2GLUA 2PKRA 3UT6A 4QU5A 2GJSA 5AKHA 4J0HA 1OLSA 2WSSA 1CZOA 1WU8A 1YR2A 3HY6A 4QATA 5LPNA 1Z7BA 4LNAA 5EP1A 3MVEA 3Q0EA 2DUNA 1SK9A 2PT7A 4P4NA 4REOA 4YH1A 3T5BA 4BASA 4DIDA 3TK1A 4OKNA 4QGBA 4XA8A 5NLLA 2HBZA 1BO6A 1S2OA 4LJ7A 1FFWA 2OCDA 4LTMA 1WTAA 1VPVA 3KU4A 3JRNA 2AOTB 3AFNA 2BMDA 2INGX 4C4PA 3W2EA 4PR0A 1YE3A 2DVMA 3KJZA 4MVWA 5G4LA 1THMA 4LQLA 1KY2A 1U7DA 2ODPA 4KRFA 2FE1A 4OKIA 4REQB 4AB1A 2G80A 3O9MA 1VG1A 1BWRA 4RBNA 3WLNA 4CT5A 2EJWA 4LXYA 4WY5A 2IUSA 1JFLA 1CULC 4J9UE 1QBKC 4MLDA 3SE7A 4CMEA 1DIAA 4M8IA 1DT3A 1K27A 2XMQA 4ZI7B 4YY3B 2Q5EA 4UPDA 4G1VA 3QY0A 3OOEA 3DDZX 3NS7A 4RZ2A 4GU5A 1XTSA 2KBEA 4XLLA 4XPIB 5EUBA 5HKOA 3V3TA 1KZYC 1P6UA 1KQFA 2EBFX 2FDCA 3NFYA 1B76A 2RGWA 5F2KA 5F35A 4JZKA 4RA6A 3W6ZA 1E4VA 5LP6B 1TQ6A 4CTKA 4ZOQI 1E4EB 1W96A 1OTYA 1NYLA 3OU2A 3G8YA 4TWZA 4TUYB 4YXFA 4YWHA 3TMYA 1IHYA 3TSYA 1FYEA 2O2YA 2QW0X 2XUDA 3WGZA 5AJTA 1LD3A 5BUQA 2AMJA 4Q18A 5H68A 3CS3A 1RXVA 1QKKA 1ZEMA 2M32A 5LZ8A 1EX1A 4JENA 4ZCQA 4IIJB 5JANA 3TEMA 3O8RA 3JQBC 5DU2A 4BFSA 1OB5A 4RQTA 2VF7A 1NI3A 2W6IA 3C24A 2FWNA 3E9QA 3OQVA 4DLNA 3R5JA 4YXWD 2X77A 3F7NA 4HPXB 1G63A 2ZTMA 1XDDA 4KOEC 3GGCA 5ALLA 2GRUA 3W3ZB 2W2OA 2WTXA 4K9SA 1DG9A 2YJZA 4B74A 1UFKA 3AZPA 4MSUA 2BKXA 2QYSA 2DCMA 1LH0A 3VFDA 4MP8A 2GX6A 5B4UA 2Z2KA 4DLPA 2VJNA 2J0EA 4I99A 4PAGA 9ATCA 1M6WA 2BGTA 4EABA 5AH0A 4DQLA 4O1HA 4AYTA 3MWYW 4Q9KA 4B3RB 5MDHA 4OLAA 3QH4A 1RI2A 1YOVA 2OT3B 4HNVA 4TV9F 1O57A 4YMSA 3AIKA 2BKUA 1L8OA 1A82A 2VH1A 1KOJA 3IQWA 1BMFA 3OJ0A 2ZTSA 4GM4A 2WWWA 4LRTB 5F77A 4B7CA 5BV0A 2PH3A 4BE9A 1N5IA 3VUFA 1X1AA 5LYJA 2SCUB 4YHHB 2LBPA 3B13B 4GNRA 4PHHA 3V9AA 3KPUA 3F4KA 2N1BA 1P1JA 1IN6A 1EP2B 1TI7A 1L5HA 1W0KA 4R01A 1O6GA 4M7WA 1WHSA 4N0DA 3A9SA 1N7JA 1SBZA 2FX5A 2FPWA 3OZUA 1DO0A 2O9JA 1E7WA 3ZZUA 1N9GB 1NMZA 4IUDS 3QEMA 1F7UA 5CDUA 5LSAA 5KWJA 1SGWA 5C1IA 1D4OA 4JQZA 4BU0A 3CNOA 3L7LA 2XYHA 4EZBA 4JYCA 4DSTA 3L4EA 1MH9A 3RRBA 4HNAA 4WESB 2FY8A 5FOVA 4IDFA 3C16C 3VDMA 5HFJA 4AZSA 3NBMA 3OEHA 2IY7A 2LPMA 5SV2A 4BIIA 2YY7A 3A4YA 4LBZA 4QT0A 2HK6A 4TLEA 5E6SB 3GXOA 2BEUB 2GBLC 1IOZA 5BPFA 3REQB 2ENWA 3AHHA 3UK1A 3C5EA 4FD2A 3ROPA 1ZW1A 3KQLA 2L2QA 4JYAB 2EFJA 2OHOA 3SZRA 4Q16A 4F7DA 2PE5A 5KJFA 5BMVA 6Q21A 4UHJA 4N49A 1PU2A 1MLDA 4OM7A 3ZJTA 2IWRA 3PVSA 1AMOA 4RTLA 1VTKA 2ZSJA 1HE5A 1NUUA 1N5OX 2AJ8A 3F5FA 4KPUA 1V47A 4TS9A 3F5SA 5HMLA 1VI2A 1BYUA 2O3QA 3TCKA 4GFDA 4Q7JB 3W5HA 4QBFA 5LD2B 2DWUA 1TRHA 4QWWA 3OM0A 5DKFA 5K0GA 2Y0EA 4TX1A 2O6LA 4IV0A 4MYHA 4XQ9A 1MB9A 2XBUA 1B93A 1SH7A 1BMQA 1GITA 3TQFA 3K73O 4LHYA 1DIHA 1Y3FE 5EUMA 3V1KA 3L1JA 3OIUA 4EF4A 5LB2A 4U0KA 4KAAA 3IV6A 5EMMA 4NBWA 1V25A 2MDTA 3FB4A 2XQKA 4H3KB 2P2NA 4P1ZA 2JA2A 5FADA 4PSUA 1T29A 4X90A 5T6BA 5SZHB 1Z0UA 1SUWA 4RMHA 2ZG6A 5IMBA 1CERA 4M9UA 2MHCA 2WU3A 3PR1A 5HMMA 3OFND 4PYLA 4ENUA 4ZZ1A 1XCOA 3LUGA 5K2OA 4MS4B 5EQTA 4BGIA 2I99A 4UXIA 1B0AA 1R8SA 4OGGA 5LOVA 4AS3A 1ZQ1A 4QFDA 3CCBA 3JAKA 4DNPA 2WM2A 4R8SA 1IL0A 1YA4A 3FFTA 1NM5C 3U9LA 5CB4B 1Z8HA 1TJ5A 2ZYIA 4HUTA 3MUNA 5H3CA 1FLAA 1ST2A 5EKUA 1RVV1 4JC8A 3CWQA 2XGGA 2J3DA 1P19A 2E37A 1O95D 2VJMA 2VT3A 4ISCA 1LXCA 2NAFA 2HWWA 3B6EA 3K1TA 4NH4A 4TMKA 3CVXA 2BSXA 4B4KA 2JATA 4CETA 1E5XA 2PZ8A 1IBLB 1IATA 5DCUA 3FR7A 3K15A 2NO7A 3ERCA 3N1UA 1C9NA 4LG1A 4MHOA 1XMJA 2JLRA 4HVLA 2WQ6A 1R6VA 1A95A 3DPSA 4EKDA 2ODTX 2XXBA 5CPFA 2AH5A 1ISGA 2QTGA 4QT4A 3WFJA 2W2QA 4NBNA 1LNQA 1ORRA 2ATVA 3OQPA 5HEKA 5I7SA 5DM70 5ALKA 4ROTA 4OJYA 2J3EA 1WCYA 5EFZA 3VYUB 4GS5A 5JYDA 2ZETA 3EGOA 2DETA 3KKZA 4KHPB 2PAAA 5F78A 3ZWQA 2C7OA 2AOXA 3AIOA 3IXQA 4G84A 1QUFA 1RWPA 3ORHA 1YKGA 4GEKA 2HJGA 3N2GA 4YASA 5GONA 3IHWA 4F5DA 5LKRA 1CQJA 1V45E 1JDBC 5JI2E 3F47A 1VLJA 2R65A 2J5QA 3A14A 2Q3LA 4BRUA 4FBGA 5B7NA 3JVUA 4OHFA 3G13A 4B84A 4DM3A 4CEIA 4HQRA 1E9EA 5K8UA 1L7XA 2ATXA 1A9XB 1WR8A 2PWZA 3HKBA 2QU8A 2GEDA 1N5DA 2WDZA 2G28A 2L17A 4KIJA 3U7QA 3HR7A 4U6SA 1RC1A 2YFKA 2IZ7A 1HQCA 3C5HA 4GVXA 2F3RA 4KXNA 4NWIA 5H81A 3GRCA 1I1NA 2D13A 1V11B 4J2OA 1XELA 3SS9X 3DO6A 2WD9A 5CNKA 1VCNA 3W1EA 2XIJA 2DR3A 2MYPA 1JU4A 1V39A 2IXBA 4NOJA 1BEEA 4TQAA 4XUEA 4MAFA 8LDHA 4BGDA 1KJWA 3M7IA 3EAFA 3D3EA 1H4QA 1P5ZB 3LM8A 3FJYA 4PY2A 2X8BA 2FWIA 3R7WA 1VCIA 2O6HA 5BV2P 1EFCA 4ZDWA 1NY6A 2I6FA 3B85A 3FOZA 1J5PA 4B6FA 3V8EA 1J0CA 1Y5LA 2PR2A 1DAPA 3SZUA 4AF7A 2HHHB 4RCZA 1CQWA 2JJ8A 3G1UA 3PQ8A 3ZI7A 3MLBA 4O4IF 3CJRA 3NJ8A 1T0UA 4AS1A 2MT9A 4R5MA 5LKAA 3HCWA 3KE8A 1QTNA 2HMAA 2VHJA 3AJAA 3JXEA 4J4TA 1Z34A 2RHHA 3F2IA 5FORA 3WVNA 2BFFA 3MQFA 4QBHA 1SOMA 3IMKA 2PGOA 2YICA 3DFKA 1UMBA 3UA3A 4D0GA 1NFRA 3DVRX 4GNKA 4OA8A 3DKPA 4EF5A 3ENVA 3E0XA 1RAGA 5K8CA 3CPEA 5B5SA 4YR7A 2JLZA 4MGYR 1ZHOA 3QJ5A 1E3MA 3ZJ5A 5JVDA 1Z26A 4EFKA 3FSEA 1UZAA 5BSRA 5CA1F 3M4ZA 5EIBC 3GJ4A 5FKJA 5HJ2A 4U9HS 4L0QA 4WJLA 2I67A 1GHTA 1PQPA 3QRWA 2O7SA 2FB9A 3JWIA 3ICQB 4HQLA 4UE3S 1UKVY 1CFJA 2QRKA 3BGIA 3QW4B 4UVIA 3UAGA 1R6TA 1NATA 4UUMA 2FZGA 3CEPB 3MK31 4LZZA 4B7UA 4JL8A 3AF1A 1H4TA 2Z4TA 2PQ2A 1Y4AE 3GLGA 4I8XA 4PQGA 4CIDA 1YA8A 4HX5A 3M49A 1YD7A 5KHOC 5G1OA 3C7DB 1GTVA 4P86A 4Q3KA 5ES3A 5KOJA 3E2IA 1K8QA 1F0PA 4HRYA 3CX7A 4AYWA 4P32A 3HYSA 1UL1X 4H7FA 1SG6A 4JI2B 3D4LA 4UBIA 3N7AA 1Z12A 2IZ6A 3T0GA 5KJ6A 3EGDA 4UJ3A 3TIFA 4E94A 2YHAA 3GP8A 2WSMA 5P8WA 4CV0A 2VT6A 4PPQA 2CBGA 4E6EA 1YCDA 4OXXA 1XWWA 2ZI3A 2JJYA 4ON9A 4F3YA 5JBIA 3FHTA 2IIVA 1NHWA 2P9TA 1RXWA 3CNEA 2PXCA 2WSIA 3AOEC 3K0KA 4EG4A 3PC8A 4HDQB 5DNAA 1GIAA 4BFXA 4HOYA 2WJPA 2CZGA 4FX2A 3K8QA 4N5DA 1EK0A 1K8RA 5JSYA 3RO7A 4KACA 3M6XA 4UASA 4ZGGA 5C7YA 4EHBA 1N2OA 3IFSA 4LE1A 4JI5B 5BN4A 1YL7A 5DXFA 3QBJA 3C7CB 3W78A 5LZ9A 3JYLA 2R6GA 3D8HA 3TZLA 2ZJ1A 2C1XA 2Q2WA 2QAGA 5GIOE 2H1WA 4PC2A 4RK5A 1XAHA 3H9GA 3TQRA 4BAUA 5BSKA 1JWAB 3H9QA 1G8PA 1B26A 2PBFA 3VKWA 3OTOB 2W37A 4P34A 3GEHA 1WXGA 5J58A 1SZPA 2BELA 5ADUS 1QAOA 5EXPA 1UADA 3L01A 4Q4JA 2CMGA 3U4MA 3BXZA 4DB4A 2X8LA 3MJDA 1IJEA 3HU5A 4CM5A 5FV4A 1DADA 1W581 1SD2A 2E5LB 2VZEA 3QF4B 1UINA 3BGWA 4HHEA 2VPZA 3OZCA 4X8LA 2Q0QA 3E9YA 3RUDA 2D1SA 4LJ5A 3DZDA 4NDAA 4CZ2A 3LZDA 2P11A 5IULC 4US2R 5EZ5A 4FWBA 2ODBA 2PRZA 4CCYA 1C0IA 1KNQA 1ZD1A 1QS0A 3FB1A 4A5SA 2O3SA 3LK7A 3I9NA 1B3RA 5K2MA 2IV7A 1X8KA 2G83A 4P33A 1PUJA 1J0DA 4TYYA 1U8UA 4EUHA 4TKUB 1G20B 4AXXA 1Q12A 5AM0A 4MZXA 3RUAA 4MI3A 1NBEA 2I2FA 1SJ9A 4JYMA 2ZUTA 4CU2A 5HP4A 3GUHA 5EHNA 5BW6B 2FOLA 3P0JA 4JEHA 1HLFA 1GKUB 2HSZA 4PHTA 4BO8A 1U99A 3PGA1 4N1AA 1ONPA 1B8UA 3VTZA 4N3AA 3NASA 4M1MA 1Y0BA 3HVKA 1J0EA 4IGAA 4XM2A 3ZHTA 5CBPB 1Y4SA 1VLQA 3T9DA 2FXIA 1A9SA 5JZMA 1HO3A 5BSWA 8ATCA 5JC1A 1W29A 3RWBA 1U0BB 3E48A 3ETCA 1QK3A 4O3FA 1H66A 4R83A 4XTCS 5GOZA 5JDIA 4RTQA 2DWOA 3K2EA 3BKWA 1OA0A 1QBGA 5FF9A 3AP1A 3ZIDA 5M7EA 3RYIB 2WIBA 3IJRA 3NEAA 4QOIA 1XU4A 1GGVA 7REQB 1EWYA 1RWXA 4YXWA 3PGXA 1ZITA 2Q50A 3ZTWA 5FWYA 5I47A 1GZUA 2H6EA 3R7FA 3VPCA 1Z2OX 5GMOA 1WVMA 1YFKA 1YL6A 2IZ1A 2NVUA 3BJZA 1KI7A 1QOPB 3MOGA 2H1VA 5ALSA 3SJ7A 3I2GA 1XB2A 2B34A 2G70A 3R0JA 2PJUA 4X1OA 1DE0A 3OHPA 4DLBA 4EELA 1B15A 2HM7A 4HDMA 1WCXA 4IJWA 3RG8A 3ZWCA 5GZ3A 3L04A 2Z4SA 1USKA 3PVCA 4LX8A 1EM8A 1QZXA 5H4HA 2BGLA 1XVUA 4IINA 1TU3A 3AFGA 3Q11A 3HA7A 4J90A 4PRKA 5JLAA 1A8SA 2GLTA 3UHFA 3UZUA 4TS4A 1YR6A 4D0LB 3E9ZA 1A1SA 4L8LA 1L8LA 4ARBA 1MW9X 1LSJA 3B7PA 5IKPA 3IIKA 3F0TA 4IX1A 1CZNA 2HNAA 1RJ9B 4KQXA 3H17A 1SMKA 4AY5A 5ITSA 1VPLA 3HU3A 4FDTA 3V7YA 5L3SA 3LOQA 3PSHA 2QROA 3GL9A 3ZGXA 5TGZA 2JIMA 5JQGF 3AM1A 2XVMA 4YP6A 1XLUA 2G4LA 4L02A 2V65A 4G0ZA 1WMAA 3K1JA 1TCAA 3IKVA 3P2YA 4UTXA 1Z6TA 2FA9A 3O2JA 3OIFA 2AQKA 4MV5A 3ZU2A 3ZCXA 4YJFA 2DYKA 3H2HA 3O92A 4KMSA 2FPOA 4RCVA 4LZWA 5KNDD 1YNSA 3H1GA 4CMJA 1DVRA 4GI3A 5DCYA 5ECWA 5K3FA 5KWSA 4QGSA 2B21A 1JIIA 4EG6A 1ABBA 4CT0A 3AF4A 4RYDA 2PIDA 1K4KA 4QJ4A 3J7TA 2IELA 5AI4A 1B3BA 1G5TA 1ZUD1 2BRUC 2HRDA 2LR0A 2C96A 2HWKA 1HDRA 3BE5A 1VGVA 2HSDA 1NW8A 1OXUA 3DAOA 4XD7A 3VC1A 1IBSA 3DH0A 2QG4A 4UAJA 3E70C 4B1FA 1CXZA 1PL7A 2ZRAA 1HDXA 3WKCA 5TLSA 4GYYA 4EB6B 2N3ZA 5ESRA 2V7GA 4YAUA 2OBLA 2GN8A 1C8LA 1Y9JA 4TZKA 1U5CA 1XO1A 4CEJA 3QSGA 2YQ5A 4EYEA 2IBTA 2NTYC 1L6RA 4R6WA 4BLTA 2ZUUA 1G21E 4BRWA 2JD2A 4B9EA 3AHCA 1JR3E 4BKOA 5K0FA 2GFHA 2ISCA 2I34A 3DMFA 2W6NA 3CVUA 5DGCA 2VHQA 2UYOA 5E9WA 3CPSA 5FI5A 1PLJA 4HNQA 5ILQA 5BWMA 3AK4A 2A57A 2G09A 4KWEA 2AJDA 2PRYA 4N39A 2ZT7A 4M0KA 1P2VA 3R3XA 3BCUA 2GHTA 3TXAA 1FMCA 5HQJA 3BMXA 3FPAA 1JDPA 3C97A 3AHFA 3AHIA 3E7WA 3KKEA 2B8TA 5ECGC 1QHFA 3I73A 4FJ1A 4PG8A 4R3WA 1QGUA 3RC7A 2B1JA 1MDFA 1WA5A 3CZ4A 1FLDA 1MG0A 1CG6A 4ZPJA 2G5TA 2XUJA 1S8OA 4QHYA 2BEVA 3ZIAD 5KQGA 1UZMA 1LQTA 4FHFA 4C7BA 4N3CA 3QP9A 2RGEA 3D8NA 4DDHA 1X7HA 2CKDA 3DW3X 1VE9A 3Q0IA 4WK6A 3LHFA 4TYPA 1UWLA 2GZMA 5EE0A 3RE1A 4AWX<