2HIMA

Crystal structure and allosteric regulation of the cytoplasmic escherichia coli l-asparaginase i
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
334
structure length
324
Chain Sequence
b'KKSIYVAYTGGTIGMQRIPVSGHLQRQLALMPEFHRPEMPDFTIHEYTPLMDSSDMTPEDWQHIAEDIKAHYDDYDGFVILHGTDTMAYTASALSFMLENLGKPVIVTGSQIPLAELRSDGQINLLNALYVAANYPINEVTLFFNNRLYRGNRTAKAHADGFDAFASPNLPPLLEAGIHIRRLNTPPAPHGEGELIVHPITPQPIGVVTIYPGISADVVRNFLRQPVKALILRSYGVGNAPQNKAFLQELQEASDRGIVVVNLTQCMSGKVNMGNALAHAGVIGGADMTVEATLTKLHYLLSQELDTETIRKAMSQNLRGELTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-asparaginase 1
publication title Crystal Structure and Allosteric Regulation of the Cytoplasmic Escherichia coli L-Asparaginase I.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 102
structure length 324
sequence length 334
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2006-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2himA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 2himA01
1WNFA 4RA9B 4RA6A 1HFKA 5K45A 2P2NA 2HIMA 4NJEB 3ECAA 2JK0A 5I4BA 1JAZA 3PGA1 5K4HA 5DNCA 3NTXA 5DNEA 2WLTA 1DJOA 5HW0A 5I3ZA 5I48A 5DNDA 5CBPB 1JSLA 4R8KA 2P2DA 1IHDA 1HG1A 2OCDA 1AGXA 2WT4A 4RA6B 1ZCFA 5F52A 1HFWA 5K4GA 2HLNA 1HG0A 5K3OA 1JSRA 2D6FA 1DJPA 4PGAA 1WLSA 1ZQ1A 1JJAA 4NJEA 4RA9A 4Q0MA 1WSAA 3NXKA 4ECAA 2GVNA 1NNSA 1HFJA 4R8LA 1O7JA 5CBPA 1HO3A
chains in the Genus database with same CATH superfamily
1E6UA 4HEJA 3R7AA 4AMZA 3FPCA 1PE0A 4YV2A 3PHLA 4LPKA 4G0OA 2VTBB 4XOUA 3PT9A 3TKYA 5K2OA 4LFCB 4HMOA 3ZDYB 5FWDA 4DSAA 1PWEA 4KK4A 3PC2A 5CEJA 1E5XA 2CL6X 5THXA 1Y6RA 2GN9A 1E7YA 2WJAA 2Y1GA 3O2SB 2QXUA 4QDZA 4ZOLA 3T61A 1T9DA 4PZCA 4FYWA 5FAXA 3D6UA 1ECPA 4FQ5A 4XDGA 4M9ZA 2BKLA 1PZNA 3ONNA 4NMWA 1J22A 4Q7QA 4Q6BA 3KZ1E 2EGUA 1N0VC 3X1YA 3KYBA 3G8AA 3ADBA 1SXJC 4GMHA 5F9FA 1IG0A 4CLDA 5D01A 1QYWA 3L41A 4A91A 1XD8A 3CT4A 1E8DA 1N7GA 1PJ4A 2IYWA 5G0WA 3LHKA 4Q9HA 1UT5A 1LLUA 2ZRBA 4DIEA 2G0TA 1GM5A 4G0PA 3OT5A 5L7YA 3ROEA 3VTKA 1QZXA 4XB2A 5A05A 3M3DA 3EFOB 4PGMA 4TQGA 4ZT5A 2PIDA 3PDIB 1NVMB 4KGZA 3VMMA 1LSJA 5EWJB 1S89A 1RFGE 3CG4A 2JCSA 2QTHA 3PC8A 1GSHA 1EEXB 1QAQA 4PANA 1YFJA 1EVYA 2UUCB 2IS2A 2Q2VA 2R87A 2HT1A 2H4YA 1FLAA 5L51A 5D7BA 3QVKA 1KTVA 2GPAA 4KIFA 3TINA 1TA4A 1UXIA 2IYOA 3C8HA 5JG7A 3UGQA 3URKA 5M2QA 2VYNA 3RLIA 4F8YA 5F12A 2V7XA 1L7QA 1P45A 3NPAA 3ZDXB 5B36A 3FTDA 2JJ2D 5KVSA 1SUSA 2PTHA 1R5BA 2C4HA 4EW1A 3M3HA 5BOSB 4M0LA 4KFCA 4FR5A 3VBCA 1G18A 3IB3A 2CD7A 1XF9A 2VTVA 4Z4EA 4MRMB 5EE5B 5L4SA 4FE7A 2OAGA 4PZDA 1ZITA 3JW8A 3RODA 1YJ8A 4CM8B 2F3TA 1ZOSA 3R4CA 1Y3BE 2ILVA 1VMIA 3RGGA 4MRAA 4C7VA 2WF9A 2C2WA 1V5FA 4FXOA 4K8RB 4QICA 2GZRA 1ISHA 1ZGBA 1OBCA 621PA 3RVSA 4DPKA 2DF8A 2FWJA 5AJVB 3PXGA 2P4EA 5K3SA 2FQQA 2D7JA 1O0BA 2HRZA 1XZLA 1ZA1A 3Q7IA 1XCMA 4HG2A 3FDIA 4YT4A 1I94B 4CM3A 3QUSA 3EVFA 5D85A 4B3TB 4CTNA 2PU5A 3BEDA 3KLBA 1YTUA 1ZX1A 4RVCA 4GC5A 1JEEA 1EUCA 2XTAA 1SJ9A 3KR2A 3BWVA 4FFBB 1Y9ZA 3N07A 4EB8A 1OILA 1M2FA 3P0JA 1X8KA 3HYNA 3DBVO 4AUNA 4R9NA 2C8VA 1C4OA 2CXXA 2H31A 2JGFA 4MW5A 3RVLA 1BE6A 4F3KA 3CGWA 2VBCA 2E7ZA 5F2KA 4CLOA 1GTL1 4RQUA 4ITVA 4YQEA 4CM9A 4LZLA 2J3QA 1Z8HA 4ZZ1A 4D98A 3R75A 5DX1A 2WHEA 2CNKA 1FNCA 1QCCA 1R8YA 3K0FB 3WGHA 1FEZA 3FNRA 4E51A 5KWSA 4X1OA 5D3QA 2RFLA 4P4SB 2C7RA 4FGSA 3HWRA 2AE1A 5L3SB 2IHNA 4WVLA 4EHLA 2B4TO 4YPVA 4N5HX 5AXBA 3HUTA 1EZ4A 4HLUC 3W2FA 1PNQA 3E23A 2OK8A 1BEZA 2VPXA 4K6HA 4MVCA 4QUBA 5DWVA 3S1AB 2EJWA 1U80A 4RM2A 3VU8A 3SS7X 3WP0A 2A3RA 1I51A 2GTPA 1XDUA 2I87A 3QKSB 4NNOA 4MUJA 1SZDA 4NTZA 3WXBA 1NW9B 1GPH1 1KEZA 1XWFA 4L8FA 4X3OA 1Y1SA 2XHZA 3D6FA 2H5IA 4GPEA 4RELA 4GZMA 4C07A 4G0VA 2ZT8A 2O2GA 3BVPA 3H65A 3QBTA 5EWMA 1DADA 3IV9A 3QWHA 4RKRA 4S24A 4EFLA 2I76A 1B3RA 2G40A 4ZVTA 1L5MA 4O4LA 4KXWA 1ZUNA 4YJGB 3ZQUA 1WMSA 2XOKD 3D64A 1R5JA 2VJAA 3C39A 1W5AA 5AW4A 5K8IA 3BT7A 2Q3HA 1D2EA 4KWCA 1IBCA 2FK8A 1P4AA 4AF7A 4WSOA 1UBNA 2P6OA 4NICA 1ZU5A 4Y7CA 3KOZA 1V16B 4I2NA 1B93A 3EGEA 5FTKA 2I4NA 2IHZA 2JFNA 4ZT4A 3QYFA 5KAPA 2WWTA 2Y71A 4Z99A 5A71A 1NC1A 1SBCA 1OFVA 2BGIA 3R3ZA 5EVCA 3UAVA 3DWGA 4OV6B 3VBEA 5JAPA 3HCDA 1AIPA 2YVLA 2AZDA 5CJ2A 4PYKA 2H1LA 1WNFA 4RXMA 4X1IA 4KO3S 4CV0A 2ID7A 4XIYA 5AJUA 4YCSA 3SSOA 2YTZA 2VDMB 4U02A 5TIIA 1E9VA 3PLNA 2XZOA 4N6GA 2Y1DA 5ECWA 1JPUA 2WA1A 2Z1NA 3O4JA 2ODEA 4F86A 1KS2A 1B8NA 1P1KA 1QRDA 4KSCA 2GJSA 3KJHA 1KSJA 2J0EA 4IKEA 1SKYE 1YZGA 4AULA 4I4TB 2NPFA 1KP3A 3QK7A 1J9EA 4OQNA 1GYRA 5I8ZA 2ZPAA 3NBMA 3QFTA 3FTCA 1XQ9A 3O5AA 2I22A 4WCFA 4FFWA 1GNVA 3HUFA 3DM5A 1ZRHA 3FX2A 1C9MA 2Z30A 4OGKA 3L6DA 2H07A 4AECA 1L8OA 3DE7X 5HZKA 5JJBA 1QLWA 2YY7A 3CSDA 1V9LA 4KBFA 1DIAA 2BFBB 5EXEA 1U2QA 4IIBA 2HA6A 4YAKA 3U16A 3DKKA 5J47A 4O1HA 9MHTA 1KETA 1NZJA 3DT9A 4D6XA 4FJ0A 3TTTA 4D74A 3E03A 1ESCA 3P19A 5CRIA 5EXPA 1G16A 3IHLA 4R8VA 2YS7A 4BNWA 4BCDA 3UIEA 2RONA 2Y6UA 3C41J 3DP7A 1YONA 1KDRA 2CVFA 1ULTA 3K2QA 3A28A 4TV8F 5IWCA 3FYSA 1ESDA 2P9JA 2QTGA 2X2PA 1GUFA 3KAKA 4NU5A 4POAA 1IVNA 2LV8A 4MUIA 2EATA 5EE3A 4WK4B 4DR6B 4XVQA 5GONF 5IKPA 1OKKD 3ETCA 4JDPA 4P93A 3G0DA 4FSXA 5ESDA 4X20A 3SICE 1AT1A 1Q3TA 4IIGA 2JIZA 1DBQA 3I23A 4P4LA 4UBJA 2H48A 5AWFC 4D7AA 3V1MA 1E1DA 1E7WA 5K03A 4CCYA 2A5YB 1O4WA 1R6XA 2WJWA 3TVDA 5DMXA 2VUHB 3CUUA 4CM4B 3U7QA 5KNCA 4Y18A 3I05A 1GSAA 1Z38A 4PQRA 4XQ9A 5IVHA 2W8ZA 3LSTA 4X3PA 2XNHA 2DKNA 2IA5A 2PBFA 3W78A 2WIBA 3EIEA 1E2EA 3KPWA 5KWEA 2V9PA 1T1IA 3K73O 3LWNA 2FRDA 2O3UA 1V1MA 4HDSB 1LDBA 4F6RB 4BEBA 5BN3A 2I3DA 3M6FA 2C31A 3E1SA 4XKJA 3GVCA 3BJEA 3K8QA 4E3ZA 1EK0A 1II0A 3WQSB 3DGFC 4IDDA 1TK3A 1SG9A 1WQ3A 1EG2A 4HUTA 4FDTA 1W1UA 4UNPA 4AN0A 4N12A 4KVFA 2Q2NA 1Z88A 1RLUA 1DSSG 1AQNA 4KQKA 3S2ZA 3IEIA 4KWTA 1O95D 4D9GA 4EGSA 3MT7A 2CHEA 2ERCA 2Q62A 5D5HA 4A03A 3Q3HA 2PD3A 1RHJA 1ZXXA 3I6QA 1B0AA 1OBFO 1GQYA 3QVLA 4ZI7A 2TECE 4EB3A 2JZNA 2D54A 3RRZA 3RTCA 5JFOA 5T5QA 4RMGA 3BG5A 3M6IA 2Q7XA 3E9RA 2WABA 2YJTD 5H9VA 3RV3A 3DTVD 4TWBA 3FJYA 3PPVA 4X95A 1QDLB 2JAOA 2BFAA 4XWTA 2ZS7A 2RI6A 2X4DA 2VRNA 4EEKA 1PK9A 3H16A 5EIBD 3L18A 3P52A 4ZAYA 1D9XA 2B8TA 3N2EA 4Y9UA 3H6HA 3ROXA 5LQNA 4B3MB 4ZOLB 2FMUA 4LF4B 4HH1A 2BP7B 2LBPA 4KNWA 4RVGA 2YWBA 4RZ2A 3EXIA 1XELA 4PS1A 5BNFA 3M83A 3HDJA 2W83A 2WKPA 4CEJB 1PD0A 1YFKA 3LKZA 3JD3A 5BXYA 3RFTA 3K0BA 5JD4A 2FKAA 3HB9A 3RFUA 3K53A 3S7TA 4A5OA 1I2ZA 2UVQA 3KQWA 3G59A 1OREA 1KI9A 1G3IA 3A1CA 2CZGA 4FYXA 4OD0A 3MCZA 4WACA 2GM4A 1YQQA 4FNAA 4EJ2A 3HU5A 1Z33A 4Y8VA 5LNK1 4FX5A 4X6XA 1DJPA 2RB4A 2PQ6A 3EGXA 5JSUA 1JSCA 5T64A 4PG8A 1NVAA 3SCZA 4BP8A 1M75A 1NC3A 2EVWX 1A7KA 1A77A 2K2WA 3O3CA 4QSHA 1G20A 4NOJA 3RK0A 3PX7A 4HDRB 5D3ZA 2P62A 4IIEA 3WO1A 1KFEB 3NDPA 2B36A 1RKQA 2WLSA 2X6QA 3GWZA 3EEFA 4H7PA 1WOMA 1EK2A 1MG0A 5B3JC 2GEFA 3F6SA 1FDVA 1ZBDA 4CM7A 4YMUA 4TMZA 4E15A 3DR3A 4Y2HA 3TBFA 2ZR8A 2AOTA 4BVLA 2NXCA 4HWKA 3EW9A 5TC4A 4ZPJA 5H0IA 3V1NA 4KL8S 1M7HA 3PDJA 3NX4A 2OILA 2VP6A 1HDCA 2C0CA 2Q9AA 3ND8A 3D3EA 1YZLA 4AURA 4ESOA 4A73A 2ODBA 3OZTA 5AW7A 2MHCA 3PCRB 4Q05A 1DJNA 1BN7A 2P4SA 4TQUS 3ZQ6A 3SX2A 2WQ7A 1U7XA 3EGDB 5F76A 3H5IA 4AO6A 2UYCA 4RHCA 1COZA 4YRCA 3OWOA 1Z45A 1HXHA 2VDOB 3JQ6A 5FIUA 2PT9A 5HIJA 2EXXA 1TNDA 2YJ3A 4ZU6X 4JWTA 4RZUA 3E3LA 1DAKA 1TAHA 2E87A 3OOSA 1X0XA 5ABPA 3QP9A 1UPUA 1V3TA 4X7PA 1X6VA 4ECEA 1RQ7A 4M7RA 9ATCA 4RY8A 5B3AA 3BE5A 1NVBA 1ZK2A 4B43A 2PAAA 4BZXA 5F9HA 2AUMA 2ZB3A 2A78A 3OVMA 4C0WA 5D51S 1EUCB 5AM1A 3N53A 2QW1A 1N6NA 4Y9TA 3AF0A 4TN5A 3KSRA 3CLVA 4REMA 4U5XA 3ZDRA 1C7EA 1M34E 1UJMA 2QMYA 4CEIA 1NX6A 2FPWA 2H2FA 2HIGA 2WQ6A 1D5CA 1TAQA 3UCXA 1GKKA 4HDNA 4CLOB 4IFIA 2P1ZA 3HDQA 3FTFA 1JKXA 4IJ5A 2CLOB 3QEBZ 2JK1A 3FFXA 1JQKA 4H15A 2WWGA 1QWOA 3QWBA 5TGZA 3F9RA 3ND6A 4L75A 1YZFA 3A6JA 1N2HA 3TWOA 1NF2A 3QA9A 1Y8ZA 2WJYA 4LNHA 4JJGA 1B16A 3FDZA 4WXRA 3MM4A 4Q34A 2Y6VA 1N33B 2IIVA 4TTQA 1P3Y1 2JGAA 3U26A 2LKCA 1O03A 1SC3A 1WCV1 3GJQA 2PEZA 2Q1UA 4C06A 3W9BA 2VQSA 2L69A 4PNHA 2Q0XA 1UPFA 4YO7A 4G5RA 4MUBA 3E84A 2D1FA 2UZAA 3L92A 4KE9A 5C5CA 1L4GA 5CVDA 2XMPA 1WMBA 2ZI5A 3CO0S 3OMWA 1GP2A 2QQGA 2ZBDA 1NM5C 2FJUA 2ZQ5A 4RH0A 2C8JA 3H5LA 2PS3A 1QZZA 3G9UA 3GV0A 1ZUNB 1YAJA 4EPYA 1M6YA 1NUSA 1J2JA 4FFNA 3T7KA 2GESA 2PRKA 2P67A 4HNRA 4G8DA 4IJQA 1NSFA 4KQJA 4PX2A 3TGLA 4A0QA 4DJ5X 1RQRA 2B4AA 1CG6A 2XNSA 3N28A 5FUQA 2D7CA 4UE3S 2PUWA 2NU9B 5C1BA 4Q9IA 3B51X 2YJ5A 3FCUB 5EMKA 3D7NA 3WSTA 4IOJA 1E2DA 3R0JA 1VG0B 2YYAA 1UMCA 4Q4AA 4RABA 5E38A 1K3FA 3G13A 3JWJA 5AOVA 4MO9A 4NJOA 4MV8A 1L5FA 3CTMA 4R9UC 1RHMA 1LQUA 3RTDA 4AY3A 2WF5A 4MINA 1XVIA 4PPYA 1C7QA 3VH1A 3WQQA 3PJDA 1NJGA 1EBFA 2ZYRA 221PA 1XFDA 4K9MA 4CGYA 4S1WA 2CEAA 3EVGA 1R5OA 4X1IB 2CDNA 1XEXA 2Y1FA 2JLQA 4TKLA 1NSYA 2F64A 5I7RA 1MKYA 4BNUA 1QNFA 3WFZA 1VSUA 1BRMA 2C0QA 3UO8B 1SBHA 4X7MA 1KBZA 4R7ZA 3GG9A 3RK1A 3V1LA 5HKAA 1QQBA 1DGQA 1JDBB 3BD8A 2AIRA 5D00A 1L7PA 3NM4A 2AN5A 3UJNA 4L57A 1OFGA 4A2WA 2E4VA 4K9NA 4CKCA 4M8LA 3NNNA 1U2TA 4O4IF 3I12A 3T1OA 1NJSA 3IDFA 4PEVA 2QPOA 2Y0CA 3SD7A 1UR5A 1WDTA 3AEQA 3EXHC 3EVAA 5LD2B 2F8LA 2EFGA 4A0RA 1PSDA 4XXHA 1XVVA 2JJYA 1EQAA 1H1LA 1OA0A 2GEBA 4R81A 3AP1A 2YW9A 1YIOA 3L93A 2NUPA 2R8XA 4KP7A 2OLEA 3PHBE 4M8KA 4XD7A 5JNSA 3G0HA 5JTUA 1NVKA 1EFDN 3E0XA 2GXAA 2C8KA 4FBMA 3I5UA 3G0CA 2N75A 3IUMA 2PZKA 3C6KA 1PDVA 1ZCZA 3JWEA 3M4XA 5JMWA 1Z34A 2X0NA 2Z9DA 4GMDA 1FL9A 1ANKA 4L0MA 3MILA 1MJGM 1VI5A 4EJ6A 4AP6A 2IU6A 1YOBA 2GN6A 5A1TA 1ESZA 1JU4A 4OKNA 1WTAA 4E5DA 2ZJ7A 5F98A 1JDJA 3NVAA 5K3EA 1QPZA 2DMRA 1ML3A 3G6WA 1JLLA 3IP3A 1IHXA 4HNSA 4OYRA 4CCYB 3FTQA 3ZI0A 1UBSB 4EG1A 3O95A 5CDHA 3U7QB 1R12A 3NYIA 4ZA2A 3JQPA 2X8LA 4FK8A 3OY2A 4TMXA 1CD5A 4DV0B 1PFGA 3SWWA 2C9YA 3CXUA 3N0WA 1ZJZA 1GNLA 2G0NA 1H8ED 2WG2A 4IVRA 4IRUB 4JBHA 1V1MB 1P62B 3I8SA 1EWTA 1GG2A 5KJEA 4D5GA 3ZW8A 2IFTA 5BN3B 2WYOA 1ZG3A 4J8PA 2BDTA 3IKMB 5EJGA 2IYAA 2GPNA 3G8BA 2Q5CA 4YP0A 3HHPA 5DMHA 4HEHA 3A4MA 3G23A 1SQSA 3A9RA 3JQQA 3TSYA 1FW6A 2E4UA 1QHSA 3BAZA 3KBOA 4JHXA 1BRTA 4ZJUA 4FTWA 4X9XA 4QOIA 1Y5MA 2VK2A 1DU4A 1TT5A 2NTYC 3KVYA 3PGVA 4R1LA 4RK6A 3UJPA 3V9PA 4ZI7B 3DVQX 3MD9A 1PEKE 1DEAA 1N6RA 2WTAA 4HD8A 3F7OA 4LOJA 4OMCA 5CGQB 4ZQFA 3TLZA 2Y9MB 1GAJA 4RSMA 1AMOA 5IHXA 1KI4A 3GB9A 2FEOA 3FPKA 1FW8A 3UMRA 4I08A 4IPTA 5B58T 3QLUC 2ZSAA 2G5CA 2YHBA 1KQPA 2G77B 1TJPB 4DT1A 4NCJA 5G4LA 4B2PA 1HL3A 5IH3A 1D1TA 1JAXA 3IV6A 4KRGA 1JG3A 2P3OA 4RSHA 3RWBA 5EMLA 4QGAA 2BE9A 2YFQA 5ALDA 1P5RA 2OD7A 1ABFA 3KEGA 5I4CA 2G1PA 1S8NA 3CX8A 3BHJA 2DQZA 3I1FA 4YUWA 1RZRD 5CFPA 1VYHA 3EXIB 3RARA 4FJ2A 1PV1A 1WVIA 3DZ8A 4WZAA 1JG2A 1FVOA 1RRVA 1T9GS 5CNMA 4Z3DA 4F45A 3ZCTA 4MQEB 4DZRA 1VECA 1SURA 1TEVA 2QRPA 3DMHA 3ISTA 3DZKA 4QNNA 3W2IA 2C20A 1N5JA 3CXRA 5E9QA 2IL1A 3OQMA 3U9LA 4LISA 2QYSA 3Q11A 3AO0B 5KDOA 1QVZA 4MQLA 4UMDA 3T5MA 1Z4QA 3LDAA 1YC2A 3ZHXA 1NR5A 4AP9A 1NW8A 2H0AA 1X8XA 5BQPA 2C58A 4GF5A 1TU3A 2ZIUB 2GUWA 4N01A 1CUAA 3QY9A 2IOHA 1RJGA 1T5OA 2CW5A 2ZIZA 3VYRB 4DVJA 3NRBA 4R2WA 3NTXA 2P65A 4EEZA 5HIKA 5JNTA 2OCLA 2XDYA 1UBCA 2H0QA 3AYXB 5JPIA 2FN4A 4HNQA 2YWDA 3P7MA 4KNVA 4WK6A 4O08A 4HS9A 1PZXA 4KR9A 4L28A 1RR6A 3DAYA 3W2HA 4YPOA 2B7LA 4FDAA 5ARCA 2O0JA 1P7YA 2OGUA 3LS2A 4KGDA 4QGHA 4Y1EA 3H9EO 3HJHA 4ER0A 2AOTB 3X1KA 3LQ1A 5ADVA 2ZXFA 4PVDA 4X92A 4GNKA 5EE0A 3QW2A 2VP4A 2JFQA 3I9V1 3IOMA 3LWBA 2P9QA 2VRWA 4B6FA 5I9LA 4URXR 4A82A 4MAMA 2X0EA 4A1FA 3ILVA 1X7WA 4M2LA 1S8OA 3JQBA 1XJCA 1XTJA 4RJIA 1IN6A 1T4DA 5LNK6 4R54A 4G67A 3TOVA 4ZHSA 4BVHA 3CVWA 2A3NA 4EFNA 2V6GA 4KACA 2ZJ0A 4OHOA 1Z4OA 3IQGX 3ORHA 5H3LA 2CEKA 4GQIA 4NCIA 4X97A 1N3LA 2P6PA 1DINA 4N3GA 1Q16A 4AP5A 4BN0A 1UJBA 3I30X 1JJ7A 3LY8A 2HJRA 5JD6A 3B8HA 5JJLA 3KT8A 4R71A 1U7HA 2P4UA 5G53C 4XVHA 3RUDA 5J43A 4CT5A 3ZDZB 5KSZA 1XPOA 1A9XB 5EUQB 4MS1A 4NULA 3J81A 4MV6A 1AHIA 3HA2A 2ANBA 1G63A 4WY8A 2ID8A 1O54A 1H3EA 1ZM3A 3TH5A 3CV3A 3KXPA 4Q4HA 4CEIB 2BVNA 3B9BA 1MOQA 4QU8A 3U2QA 3GLFE 3WIEA 1R4MA 2C3OA 1P7PA 4N7JA 3L6EA 5EWLA 4V0QA 1HG1A 1V7QA 1YBFA 2K87A 2GNAA 5BV7A 4GOLD 4J0KA 4K9KA 4ARVA 3S2FA 2PMFA 3RANA 1WTCA 1KJJA 2HNAA 2YMQA 2H51A 4J03A 1NJ2A 1NY5A 5EHQA 3W77A 1N0UA 1JTVA 3OJXA 2IH4A 5KTNA 2HDHA 1XR3A 1T5HX 2A9QA 3WRWA 2OXCA 4B47A 1RXYA 1MRZA 3FDZB 4F4JA 2GCIA 4JLJA 4LC1A 4TTJA 2OVBA 3I37X 4C9BA 1E3SA 3FJ1A 2CLSA 2RE8A 1V3QE 1B15A 1Z3CA 4G8CA 1BFUA 4MGZR 4YV7A 1E2HA 2Y8EA 1PT8A 2NO4A 1PEDA 1AK1A 3FWYA 3IQXA 1RYNA 2HMWA 3L7LA 4GX0A 2C5LA 4A7PA 5SZIA 4L3WA 1JL3A 1GEEA 2QAGA 3FLBA 3K4PA 2QVGA 3ELDA 4FE4A 4LSGA 3DZDA 3LDFA 1DV1A 3U1TA 1G5RA 1NX9A 1Z7BA 5L53A 5I7AA 3MWKA 1LQTA 3VDRA 3GMIA 2OCAA 3F7NA 1JR3D 4FC6A 4RK5A 3L46A 4M7PA 3R41A 5A4FS 2CYBA 4HI0E 1B74A 5EYPA 4PQEA 1USWA 4M49A 3TB6A 3BDAA 5DCLA 2W6MA 5KKNB 2NZ8A 2W2MA 3R23A 4H1TA 4JR2A 4UUOA 4D0LB 3A1EA 5CDFE 1DJMA 2GD6A 2RHGB 4NZPA 4DA9A 4YNBA 3NNSA 2BBSA 4MV1A 2HWWA 1ICIA 4UREA 3D5EA 3X1WA 3LPLA 5E4FA 3SM3A 3UJ7A 4IR7A 4KO2S 5K45A 2B9VA 4U6SA 3T3HA 1AM4D 1Q7TA 4Q4AB 5HDBB 2DERA 5I3ZA 2RI0A 2QMZA 2KWIA 1KZ9A 1ZEJA 1ZZGA 3CH4B 4JN6B 2P2DA 3JVEA 4DTIA 2O1XA 4GUDA 4AQDA 3CNEA 4PNPA 4XYLA 5T8KA 5GIOE 2FB9A 1O6CA 3ND7A 3UW3A 2IPMA 4Q1CA 3HN2A 3STTA 3VU9A 4RTSA 3GAFA 3AFOA 4AJIA 5B37A 1ZIOA 2UYOA 4L8WB 4EKIA 4L78A 3WA6A 1XEXB 1HDZA 1P9NA 4X5OA 3UANA 1Z39A 5JQGA 5I9MA 3TG8A 5AHOA 1EZ1A 1EJ6A 1NF3A 1YL5A 3SNKA 1NW6A 1PJRA 2FX2A 1E3WA 4UFPA 2O05A 3EARA 2Q2OA 3ZBPA 2W6ZA 1XN4A 1FQWA 3DDWA 1NUHA 4H31A 5DNEA 2G70A 4KMOA 1QGZA 2D4HA 1JXMA 4H7FA 1KO4A 2RGCA 2ZWPA 1B23P 1SHZA 2NVWA 3GARA 3TTXA 2VFAA 4CKCB 3EUWA 4OXQA 4R8MA 2BGTA 4NF2A 3A9CA 1SG6A 3LHDA 2GZSA 1ZSVA 3D5TA 4IJ6A 5G3ZA 3WK7A 3BIFA 1VCMA 1QMPA 4XIIA 2WKQA 2QRMA 3AEQB 3JU3A 4QU0A 1U1IA 3DLPX 4TKUB 4BCCA 2ZTSA 4ZCRA 2PANA 1Q1QA 2CFTA 1H1LB 1JA1A 1N2OA 5JEEA 1Y7PA 1N2CA 2NUPB 1NVEA 4MWTA 1HQDA 2C83A 1EBUA 1KBOA 2FWRA 2OD9A 1QORA 3FWZA 3OCJA 4IDFA 3BB3A 3IALA 1BVHA 1OX4B 3SJZA 1Z4IA 2V55B 3MA0A 1KAEA 2W6JD 1KHTA 1VHDA 4IJWA 2W2OA 5U9CA 1ZUHA 3IEPA 4W6QA 1N4DA 2D5CA 3W90A 4BDTA 4FZ3A 4YI5A 3USZA 3FZQA 2DM6A 2RGYA 4L9RA 1K8RA 4ND6A 3QU9A 1VQ1A 1JLLB 5BO5A 4ZI2A 2AC4A 2CXTA 2OV4A 1JF8A 2CNBA 3B70A 4I36A 1PT6A 4RIHA 2UUPA 4BV3A 4XTRA 4WBNF 3GIDA 3B89A 3ZTWA 4YUZA 1XCBA 1XZMA 2B2XA 4YDSA 1EXDA 2RG7A 2A0YA 3D8BA 4BE4A 3H9JA 1PR6A 2A0WA 4QTZA 1R50A 2G1AA 5I7OA 3EMKA 1X9HA 1DFHA 2GMWA 3FPHA 4GZ6A 4HQOA 4LZWA 4PLGA 4QYMA 5M3BA 1CXZA 1THGA 4YONB 1QKJA 1QM5A 5BSWA 5JS1A 1DIGA 3NHZA 1A04A 2HBQA 3FROA 1QBGA 4NKRA 4NQZA 2JFFA 4QATA 3PE3A 3IUSA 3AFNA 4QQ8A 5KVAA 1RWWA 1BEUB 1IZ7A 2ECQA 2B0JA 3F6PA 1RFLA 3IILA 2BHRA 4LTDA 4GL4A 1XCPA 2H57A 2G76A 2J6HA 1W48A 4ZOQI 1ILWA 1CVRA 2R7AA 3AF4A 2ZQZA 1N7IA 4BO7A 5JH7B 2WM2A 4KO1S 1EVJA 1TT5B 1IQRA 4HYYA 3KEMA 4AX4A 4PZYA 4P4GA 4BFLA 4US2R 2VUTA 1R6VA 1UBRS 1GL7A 3IT2A 4X61A 5K0EA 4ZZ2A 4Q9KA 3QKUA 4YAFA 4DJDC 4BBAA 2PSEA 2RHDA 4N65A 4TYNA 1AA9A 3R6TA 5BUSA 3OLXA 3SIPA 3WV5A 3ZHRA 4HNGA 3RBXA 4R2IA 1RBZA 1XCOA 4HSGA 3V00A 5TARA 4DT1B 3JQFC 4EJFA 2G67A 1GQOA 4Y1FA 1RJWA 3DD1A 3OZWA 5JQWA 4OAQA 4O3MA 3DMTC 2BM8A 2XQFA 3MOSA 3UGKA 3D5QA 4EI9A 2QN9A 3HBFA 4O8CA 2IUUA 2IPOA 4WZAB 1R0WA 2JHAA 2TSYB 3PHCA 5F7JA 4AJ2A 4CLXA 4DXAA 3QWFA 2Z2YA 1I1HA 1W36C 2E4WA 2PH5A 3LC2O 2Q28A 1CPYA 4M9UA 5F51A 3NC1C 1QQAA 4HNTA 5FDFA 2X4IA 3LG2A 1K0UA 1SRRA 1ZD3A 4ZHQF 1CR0A 4B6GA 1FU7A 2OG2A 2YVKA 3DOIA 3LDGA 4MEBA 2D0DA 3H5OA 3PJEA 4IEEA 4EY5A 4RY9A 3ET4A 4JP1A 2A1TS 2CL0X 5C3UA 2GDZA 4Y30A 3MHTA 1TADA 1FTWA 4XE5A 3GFPA 1VE1A 1GUDA 3CZMA 3ENWA 3FETA 1E1CA 5THKA 4DA8A 4ZMRA 2JFYA 4EA9A 1B2LA 2WYHA 4WQMA 4L8GA 3UMCA 4W5NA 5LP1A 1OPXA 1VHLA 2ST1A 3I28A 4RVFA 3A6FA 2VXCA 2I6QA 3QEMA 3FWNA 3TRKA 2J67A 3GLSA 3WLIA 4JZYA 3C98A 4AJ9A 4N3AA 3N8KA 2H1RA 1UEIA 1NRXA 2W4MA 1AGRA 4RH3A 4ZI3A 2IDZA 1P1IA 3U09A 5ALYA 1LW6E 3HR8A 1UXJA 2XYPA 3GGSA 3GT3A 3EDCA 3G0OA 3F49S 3GJ4A 2ODPA 4N5MA 4N47A 1ZK1A 4B0PA 1H6DA 4TVSA 5K6AC 1WM1A 2H1IA 5I7HA 4GGOA 2EL7A 4OEHA 1M1YA 5MDHA 4Q21A 4UNNA 5KDLA 3DLIA 2HU5A 4Z8YA 4FWBA 3EXFB 5L95A 5EMMA 2R4TA 5EKUA 1DQYA 1YQEA 2E1RA 1I2MA 1M2WA 1XRMA 3AF1A 3K6KA 3UUGA 1H2WA 1E66A 4CIAA 1G5IA 5COAA 4JJEA 5IM4F 1MLDA 4FMDB 1NVFA 3C7DB 3FMOB 4TTRA 1PLJA 1R6AA 1VPEA 1MEJA 2OFXA 3G3EA 3R76A 3VC2A 5CT9A 2ACKA 2YBDA 1P2TA 3LT5A 3TUIC 5FOVA 3A6ZA 5IU6A 4J0JA 2ZIVB 5CURA 5MN5A 1UAYA 5IF3A 1GRVA 1GRNA 3CRZA 4KQ9A 5K0FA 2X2FA 4Z0TA 1YE5A 5TVGA 1LLFA 3LXXA 3O2QB 4XUGB 1JMKC 5L3VA 1UF9A 4Q4HB 4UM5A 5CIYA 4KH1A 2VP5A 4IILA 5KQGA 5G0VA 2OO5C 4EP1A 1R4MB 2JI9A 5EWLB 2ZBRA 1EDBA 3D3KA 5J4HA 2Q5HA 2I2CA 1CUUA 1GCIA 1ARZA 2RHLA 3G9XA 4HDCA 2QJOA 4MR8A 1W2HA 3OJLA 4HY3A 4ZTBA 4DS3A 1H3NA 3DL0A 2ZLBA 3H4VA 4EG0A 3IE1A 4Z5XA 2N42A 2ATCA 4C0JA 5I8WA 4AWAA 3JV7A 3T35A 3DNPA 1XZBA 2PKXA 2ZK7A 3OX3A 1YKFA 3FWKA 5AKLA 1UWCA 4NYJR 4JJ4A 2E5WA 2QR2A 2A57A 1ZXBA 3I3OA 1HT2E 4NIMA 1RC0A 5DM2A 4A2PA 1YZTA 2Y68A 3TR6A 4MJLA 1Z5GA 2BTQA 3BH7A 1N3IA 2QAGB 3N1UA 3EPKA 3TQHA 1I36A 3FYHA 1KU0A 4YJ3F 1BX1A 3DULA 1W73A 2CVHA 4RLHA 4ZAGA 3HK2A 4BVAA 4MQUA 2VH1A 2XCIA 2XJ9A 3H2ZA 4F2WA 3PTLA 5EYPB 4FOLA 4NSNA 5AXCA 1QH8A 2Z6AA 4YUAA 2QRJA 5I5EA 1P0MA 2CMHA 4DCMA 1TA9A 4MW4A 5EG5A 1QH9A 1SXIA 2KX7A 3L04A 5KTSA 4EUSA 3BWBA 3VPBA 3G1WA 1PJTA 3H3JA 3OTGA 2R84A 3TVTA 2PUDA 4LHXA 4C0BA 4GOND 2D13A 4QJBA 3TXYA 5CTAA 4RCYA 2WU0A 3LL7A 2MSWA 4NJEA 3B52X 3R9XA 1GGMA 1DQNA 1HKHA 4AWXA 3HLYA 1ZVJA 5CVCA 4GI7A 4MYDA 4OQEA 1VDMA 1U04A 1X1SA 3A31A 3OFND 3KYIB 4Y2TA 3VU9B 3WIDA 4E0BA 5EMJA 1ND6A 2JIZD 4WINA 4I7EA 3IAS1 3CONA 3FVRA 7ABPA 1O4VA 1SPBS 1QVWA 3QZUA 4IMIB 1E3WB 5DGDA 4EENA 4C89A 2CDRA 4EY3A 5KNCD 4M88A 3OU7A 3RUFA 1XPUA 4DMMA 3SQXA 3QMWA 1GDDA 2IY7A 3HACA 2N0SA 5FR1A 3KZOA 3PQ6A 3UHJA 1GVHA 4BTLA 2E1PA 2QK4A 5DISB 3WGGA 3OTOB 2CXNA 1NW5A 2BIFA 1WXDA 1QAMA 2AL7A 3OX4A 4MZXA 5E2AA 4PIPA 4QAQA 4CMAA 1P1RA 2J08A 3DONA 3NWBA 2ZZKA 3KL4A 2I66A 4Y1GA 5KU7A 3LECA 1VRWA 4AKEA 1GTSA 1RD4A 2EYQA 2XWBF 3RF6A 5DHRA 3NHUA 2IUTA 3DQPA 5J5AA 3GLHE 3CEAA 3AHHA 4AX8A 1D2GA 3EZLA 5AI9A 4HNVA 4X91A 2ZAOA 3EBLA 1B8PA 2H2AA 3KR9A 1P7CA 1I30A 1N2CB 1R27A 3NASA 5ARBA 4U2CA 2HYDA 2NT4A 4RHUA 4RTMA 1V25A 1QONA 2KJQA 3IBFA 3L7IA 3PBKA 4NARA 2B4YA 3UKDA 2RBEA 2WSSD 4EABA 4PC6A 3CKMA 5EZSA 2W6OA 1TKAA 2W6QA 1FVXA 5DNWA 2O8EA 5BVHA 4K9LA 3HYSA 3W0LB 3TNFA 5BPFA 5LZ9A 1Y1KE 4EY6A 1VOTA 4MYSA 5DXFA 2XQJA 3OZAA 5DLDA 4RHEA 1U0FA 4DAOA 1G8KA 2AS0A 3CVOA 1AQJA 5B53A 3DO5A 2Z6UA 3CX4A 1ZOLA 4Q16A 1QHYA 2ZUDA 3GO4A 4WH0A 3VJKA 1O9BA 2F8TA 1A5TA 2DHRA 1W85A 2J5XA 1Z5WA 3N39C 4YIHA 5HNKA 4I5FA 3VR5D 4XYMA 1G55A 2NX2A 4PCAA 4BJHB 4HNUA 2Q1XA 1JGTA 5I6DA 4JC4A 2HWXA 3NUZA 1RYYA 4OQDA 4LWQA 5F1KA 2V9CA 4Z7NB 2G17A 3DKVA 5I01A 4MMXB 1JI3A 2WG0A 3GPBA 1DPGA 4HWGA 1UT6A 2IHBA 3G5MA 4Y2SA 3ZG6A 4A2CA 5CVVA 3TD9A 5TLSA 1XAJA 2O9JA 1JIJA 1K86A 2CLKB 2XUGA 3MAAC 1NQ5A 5FUBA 5FADA 1XI2A 3V4LA 2ZRKA 4A6DA 1DXOA 2GM5A 2JKYA 1M6EX 3ANXA 1IZZA 1HFJA 1F7UA 3U31A 2H9IA 1ORTA 1KEWA 4I4IA 3TMKA 1W1WA 2C82A 5BQOA 1Z15A 2D0PB 4FMCB 2EX4A 3CX7A 3PUKA 1LLDA 4DARA 2WY2D 1EX9A 2WJIA 1KP2A 1H2EA 2WFLA 5KPJA 4DPMA 2PKQP 4HLNA 2PK3A 3C3WA 4GKAA 3NV9A 4PSAA 2V7GA 3OQPA 1P2BA 4M8SA 4R83A 5T67A 4KZKA 3OP4A 1ONOA 4F6LA 3BB4A 1IIRA 3WLKX 5F7ZA 3U6KA 3R6GA 5ALJA 3TGWA 4GBGA 1CRQA 4R2MA 1JJFA 4IIDA 1QCDA 4TV8A 5DBGA 1SA0A 3A06A 4GP6A 1E0JA 2O7SA 2LCIA 3OQ6A 4NFLA 5FLYA 5H8WA 4L51A 4AM8A 1H4QA 1PT5A 5GONA 4MRPA 3TAUA 1AF4A 1U8FO 2RGWA 1PR2A 2IY8A 1PFVA 2A9VA 1E9EA 1XCJA 5DYGA 2HADA 1S4QA 1WVMA 5JAMA 1Z7YA 1RHKA 3IVCA 3AVVA 2ISQA 3PRJA 3ZGNA 4M1ZA 2C94A 2GYWA 3U56A 3RRXA 2IU4A 1RBMA 1HYEA 3A4VA 3Q87B 1W52X 2JEZA 3I2JA 5F2EA 3OKFA 2QKYA 3HCCA 3HYRA 4JL5A 4KU4A 4OFXA 1P81A 2FF5A 3OCZA 4W9NA 3EQ9A 5ALMA 3ZXIA 3F1LA 3KVRA 4D96A 4Q7EA 3ZQ4A 3ZJTA 1N2XA 1MNAA 4JGGA 3D6AA 2B98A 4ZV9A 4E1AA 2Q4EA 1E1CB 3KQHA 1CC1S 1VXOA 4OK6A 1IXYA 2XIJA 4CF5A 1U81A 2QX9A 1BD4A 1PS0A 4HH3C 2IZ0A 3FI0A 3W6NA 4OMDA 2PGLA 3ZKWB 4A0HA 1T6NA 2ERXA 1N5KA 2HSEA 3QEMB 2OKCA 3V2HA 2AFVA 1X19A 3LQ2A 1U28A 1IAQA 4YQFA 1M6VA 4D92A 2B94A 4J3JA 5AM0A 3WWEA 4NXNB 1PU2A 1GZDA 2KYRA 4ON9A 4PCUA 3UY4A 3ZZNA 3RVDA 1NFQA 4EF6A 4BZWA 1J2TA 2XCSB 2X5OA 4EELA 1YQUA 4XQCA 4UVEA 2H4XA 5KJFA 1S8FA 1QUEA 5FI5A 3AM5A 3I01A 1FY2A 2K7FA 1KMQA 3L8GA 1V4VA 1ZVKA 1M1YB 4EKYA 1EFCA 2FMFA 2FZWA 4R1TA 4YIKA 1JEQA 4FOPA 5DB4A 3LY7A 4AYWA 4D4IA 1V26A 1Q0ZA 2XY4A 4CTOA 3QUBA 2PM8A 3T99A 1U4SA 2CHGA 3GX1A 5KWVA 4N9WA 3M2PA 2FPMA 1UKZA 2ZDGA 5AMXA 1J2RA 2CHVA 1JXOA 2CGEA 5AJXA 5HKBA 2JI7A 1DAIA 1FJ2A 1F2TA 1X3SA 4MGIR 5KOYA 3JCZA 4UATA 4CNQA 5EIEA 1MO3A 4U8GA 1T8SA 3KFXA 4PC1A 5GGYA 2XTNA 1B26A 3LYLA 1TLFA 3MPUA 3QYPA 4KQIA 4PSKA 1NP7A 1VL0A 2ZULA 3JR7A 1SC4A 2P68A 2VBIA 1Y8CA 3F90A 3CE9A 1V1JA 4D82A 5AFSA 1EU1A 4HDKA 1PQ4A 4LZOA 4ALIA 2HMUA 3ANLA 4TMWA 4DMLA 4LF6B 4JK3A 4TUYF 5EXTA 3A4IA 3ZLTA 1E64A 1E2IA 4C4AA 5J23A 1NXQA 4ZYWA 4OBWA 4MKXA 1XQXA 2AD5A 4Q7MB 2CMGA 1CY2A 4WHMA 4DREA 1A9TA 2EFHB 3WTCA 3DP9A 3FLMA 4UNIA 2CCGA 1G6KA 2NYUA 3QPDA 4MR8B 4RC9A 5ALIA 1SCNE 1YGYA 3TL6A 5K6TA 1FU4A 4EHBA 2PX3A 2LE0A 1JU9A 1SOWA 2Y0BA 3C7TA 2J32A 3C7CB 4B34A 1NOKA 2IEYA 5J2TA 2PH7A 3NHMA 2WAOA 4GI1A 1O08A 3HNOA 3PICA 2WJGA 2VZLA 4C29A 3PGKA 2VSOA 2LR0A 2OZPA 2ZWOA 3BAFA 3L7JA 4Q3CA 4Q93A 3R7SA 1E32A 3UV7A 2JD1A 4LZAA 2POQX 2R11A 4P0TA 1ZR2A 2C5BA 4M1OA 4RJJA 3NT4A 4WOCA 3KIPA 3LT1A 1XYVA 1ORDA 3LLVA 4AN4A 1IHUA 5GJBA 3HVKA 3UMVA 1SVUA 5FPYA 4GM4A 2QQFA 3Q9LA 5D84A 4Z49A 2EJVA 3R24A 4L5IA 1KHHA 1G4AE 4LMRA 1QH8B 2R7NA 1MD9A 3IIKA 4GG1A 1KVTA 6ADHA 2DR2A 2QLMA 3DLCA 1PN3A 4GGPA 2IEDA 2IYUA 4GH5A 3QVXA 3JQ9A 4A4DA 1KO8A 3IIJA 3SX0A 2LXNA 2YXDA 3W7BA 2VN8A 1CEYA 3IBSA 4PWYA 2F3QA 1YB1A 1I3OA 1TF2A 1XQYA 2QRHA 3ENNA 2I6GA 4X85A 4XD7D 1XZJA 3MBKA 5KSWB 2XCTB 2BJVA 1XNGA 3FF1A 2R79A 5E3HA 3MUEA 3P26A 3AERA 4MQBA 3DHYA 1KTIA 4NJEB 1W87A 1Y7IA 3LIIA 5EQJB 2IWHA 3OFKA 3R9XB 4YMHA 2E4XA 2F67A 3PSHA 4WPGA 1Z08A 4BWFB 2EGHA 3WE7A 5K6RA 1DZ3A 2GF9A 1E1KA 1XLTA 1NV9A 5ENDA 1MRNA 3AOGA 3UENA 3W06A 2GBCA 2GGSA 4ZD6A 4EI2A 2VNHA 2NVUA 4QOFA 1W49A 1KEUA 1THZA 2Y92A 3BSYA 4I1RA 2D1YA 1T91A 4HBGA 3EVCA 2EBWA 4RIEA 4UBMA 1RBQA 4FGUA 1CZLA 1OXSC 4F0JA 3K0AB 4RYLA 1LRKA 3HDYA 1TVKA 1LTQA 3BIJA 3ZKAA 3K72B 4W1RA 1FUEA 2BZGA 4I1IA 3R9WA 2PCLA 3C16C 3KETA 1MO6A 4C2BA 2WKRA 3B1WA 4LKOA 1NQTA 1RMTA 1TYAE 2YVAA 1RWOA 1KRWA 2G25A 3R44A 2IS6A 1FP2A 5TEVA 1M2EA 5EJ6A 2HPZA 1O57A 3RS9A 4O6VA 5HZGA 1GUYA 2SKEA 2QMQA 5F1PA 5GMOA 1FSZA 3CLUD 3GU3A 5CLFA 5KOHA 5EKDA 3MTBA 4P1ZA 4BRUA 4LRTB 2AHRA 5ALHA 4QOEA 3LMKA 1MJGA 1AV7A 3A6LA 4MW2A 4MWEA 2OSBA 4KWIA 4MW6A 3QKIA 1SXJA 4IFEA 1XKXA 2R6HA 4R2KA 1QGYA 2I34A 3T95A 4EKDA 3IMFA 5IM5A 1F2UB 4ZVKA 5LXTF 3TXXA 5FTJA 5FR2A 1FTSA 3WMFA 3VJRA 5AIAA 4N49A 1R8QA 1QANA 3CKKA 2CL5A 1W44A 2I8LA 3PD1A 2FRVA 3CSUA 4EHNA 4IJKA 3W1VA 4BO3A 3ZJYA 1GPLA 1T8YA 1UEJA 3AVPA 3BTOA 4TPKA 3IJEB 1O95C 3ORFA 2RKBA 1DOZA 2YCBA 3MTIA 1U7WA 1YQXA 2DAPA 4CV2A 4DBZA 3AF6A 2HR1A 4HS4A 2CJFA 4ZVPA 3O03A 5HKLA 3WC4A 3WYGA 1AD2A 1UZMA 1V2HE 4QYXA 5FYQA 1LPNA 5J40A 5JLJA 3AJDA 5JZMA 2O5EA 1WF3A 2G7MC 4MH0R 4OHKA 3I72A 2GR9A 3NM5A 3L8HA 5GZ3A 4FD3A 5AJYA 1ZD4A 6Q21A 1CU1A 2CXSA 1WEKA 2QVLA 2WWRA 3BGSA 3C6YA 3KUUA 3RTBA 3ZDEA 3AHJA 5KTMA 1RYHA 5LR6A 1GLVA 1LDGA 3TNLA 3VHLB 3K9WA 2AG8A 4R1UA 1NXTA 2V5UA 2EIHA 1BJRE 4E2XA 3CR7A 2GZ2A 2JLUA 1P7WA 2TMGA 1H2HA 2PO7A 5EIBC 1T29A 1L7RA 1P18A 1JNYA 3AV0B 3HXPA 1VMAA 3LWDA 3PQ8A 2QM0A 4O4IA 1JHPA 2CSXA 5E8RA 5CFNA 4X8LA 4XW2A 4B3FX 4I2VA 1WKCA 4EMUA 4KI0A 3A9WA 3WI7A 2N3ZA 2C88A 1YKGA 2C2KA 2FPXA 5JNVA 1TI7A 2ZTHA 3OAAA 2XKKA 4DYVA 2XI4A 1JHVA 2B1GA 3UJ8A 3NUQA 1DCFA 1P9RA 5LZ5A 3UWDA 4B76A 4CW7A 4X90A 1VZ3A 4PRKA 5HCNA 1MU0A 4EQZA 4EJ0A 3P9PA 5DEIA 5TS3A 4XQ0A 1AX9A 4J7XA 3RTGA 2Q1YA 3JQAD 2H7YA 2ZE5A 4TV8B 1MXFA 1L5WA 1SA0B 2P0EA 1GFIA 1VBFA 3JALA 3AZPA 3U49A 1UL1X 3W8FA 3TJZA 1P6UA 2H1CA 4NE7A 3N0VA 5GONB 4ENWA 4QNMA 5BSTA 4I19A 2DBRA 4G56A 5TMEA 1I01A 1BWQA 1J39A 4XWGA 3AKDA 3HB4X 3IT1A 1NLFA 2PN1A 4RJ2A 1MH1A 1VL5A 2NQTA 1EP2B 3EUFA 4XGQA 3OOEA 5FLKA 1Q74A 3JRXA 5BN5A 1EHIA 2AR7A 2VYVA 2O3JA 3SQLA 3LZ6A 5IT9A 2HSJA 3KAPA 2ZGVA 1L3BA 1BOOA 3IDQA 4G8BA 4RA9B 5IBPA 5KNBD 2X0JA 1KS9A 1R66A 4DDHA 3B7WA 3LUGA 3IP8A 3P0FA 4GSLA 4HLUA 4HOYA 2IDJA 1OXBB 3GCGA 1VLZA 1LI7A 2VHQA 3QV2A 2QTLA 4L6CA 4F2GA 4N7MA 4YAGA 2I55A 5KS2A 1GAXA 3INGA 4JVNA 4PYOA 1DKNA 3N9IA 4ADSG 4D9MA 4E94A 1WXQA 1U8YA 1MDBA 3A10A 4PLFA 2AN9A 1J7JA 4BC1A 3ESXA 4CDRA 3H83A 3WB1A 2IHJA 1OOEA 1M6VB 4BLVA 4XWKA 2WTUA 2EOAA 1OZFA 2EFEB 4L7VA 2OZKA 3HA3A 1N6LA 2QY6A 4RMIA 1F8GA 1ZKDA 4OKSA 2IYYA 4EKGA 1NV8A 2PSHA 3KDPA 4X8HA 4ZKEA 4YI3A 5FPTA 3RJTA 5C35A 5C80A 1XRJA 2VNSA 3F3KA 1HE4A 4G0QA 3FFTA 4ZOEA 3TR0A 3SKVA 1J8VA 4YREA 2A4KA 1JEQB 1M2GA 3BMCA 3GZJA 4EVRA 1ZH2A 1SUEA 3ELYA 4HB2A 5BRNA 2EC5A 1QK4A 5FB3A 1J8MF 4LHWA 1JQLB 3QE4A 3T9FA 3L7AA 5TMPA 3FTPA 4GYWA 2CFSA 5CMLA 4YMTA 3Q9UA 4L8VA 1PGOA 3WLEA 1QP7A 1F2TB 2D5BA 3KZKA 4YECA 3BWDD 5HDQA 3V48A 2H8GA 2HSWA 3MRSA 2D74A 2DQYA 2KPOA 4EARA 3J81k 1CHNA 2VQ3A 1CZKA 2J3IA 2WUWE 3PE4A 1VBMA 2QX8A 1PW5A 2J7KA 2C3UA 3L6CA 3MJDA 2PA0A 5KYTA 2HT6A 1QDUA 2CMDA 1V5EA 2IKSA 3PGXA 4RV4A 4HB4A 4DWVA 1VJCA 4F06A 1NT2A 1T25A 2DZDA 3WYCA 1IN1A 3CZ5A 2AEJA 1OPRA 4AMGA 4IAOA 4F9FA 3WLPA 2X40A 3D8SA 4HDKB 2ZIXB 4YCNA 1A76A 1SH7A 3T3IA 2JGDA 3MLEA 4DQUA 1QR2A 3LUFA 3TAHA 2QTMA 4QVGA 2WUEA 1ULSA 1DMSA 1W19A 1FSFA 1QGUA 2PDAA 1IULA 4QVIA 4WKGA 2Q3MA 1ODLA 1D6SA 4NC9A 4RQTA 3ROQA 3DE2X 4XWWA 1EFKA 5DSZA 3EIUA 3RV4A 2Z2XA 4E31A 1INLA 3B3GA 1QIJA 1P3DA 1JU3A 3ANNA 4QBFA 2YWRA 4Q02A 4JX8A 4RQAA 2VQFB 4H0CA 4F3NA 3T94A 2DT8A 4GPD1 1H8HD 4JQZA 1CY7A 1B8OA 3GFQA 5K8JB 4QPZA 1DC7A 1Z0ZA 4XRRA 2EKQA 3AY6A 4MCIA 2NV2B 1GCOA 3A14A 4Q4LA 2H85A 1KDYA 4F71A 4O59O 2P9EA 2YXEA 3SQNA 1UXGA 4DV3B 3F4KA 2W2XA 4J0DA 4PAGA 2A5FA 3TLBA 3W34A 4B4OA 1XRNA 1CUFA 1N75A 1Q1BA 1TE2A 3K0KA 5A4KA 3TZKA 2YMMA 3NNDA 1RWBA 4NK4A 3R40A 2IZOA 1A9QA 3OOJA 1EXVA 3DBLA 4UZEA 4C88A 2O2CA 2PGJA 3RAEC 3PNMA 5FXMA 3H97A 4RJTA 5CA1F 4GLLA 3DEZA 4N82A 1LSSA 1E1QA 1VSQA 4BJ6A 4Z9AA 3KYCA 2RCYA 5FFNA 1CUSA 5ALLA 2YZGA 3S55A 1K06A 5AW8A 1J20A 2I4MA 4JITA 2RBKA 4RE5A 2XUHA 3FBTA 3AERB 2HA4A 2QGNA 3AHFA 1V11A 3GA0A 4RM3A 4AS1A 1Y42X 4K46A 5M34A 2B82A 2WZCA 4FUTA 2QTWB 2YMLA 5U4XA 3FE2A 2ZJ3A 1TUIA 1FFDA 3BL6A 1OGYA 1B4DA 2NIPA 2ZU0C 1A1SA 3WKDA 1MO5A 3O93A 1HKUA 2NTEA 1ZGZA 3U0BA 2VRCA 5HUHA 1V35A 1J2YA 1TM2A 3NBYC 3I6MA 3Q41A 2NVUB 2Q1WA 3ZXXA 2ZRHA 4E6PA 3K5WA 4JQYA 1HDGO 3KPJA 2ZAGA 5AK5A 5FBQB 2B21A 1VHTA 4CUZA 1RXIA 4DSZA 2I80A 2NVOA 2V98A 4DC0A 1FDSA 1TVKB 1XNRB 2R2AA 4H6VA 5CB0A 1Z13A 5H82A 2ACVA 1XTSA 2JFPA 3L40A 4HXYA 3QH4A 3A6EA 1NMZA 4YC7A 1N9GA 4EYKA 4CMIA 4QTXA 2D8MA 4ZRDA 4X62B 1NBMD 2QTCA 4YO8A 3WGQA 3LAWA 1HBJA 3L0IB 5G4KA 1USGA 2FFHA 2IX3A 4FCVA 1ZA2A 4ZO6A 3GXBA 4A0SA 2C57A 2FPPB 3K2EA 4K6GA 4MYUA 5BNZA 5KOHB 2GZAA 5IDQA 1U0GA 5ESXA 1N78A 1IK4A 2G7ZA 1YZUA 3ZDCA 4JH0A 1KXZA 1VIDA 4ARZA 1M2OA 1SXJB 1GUZA 2GO1A 1QP0A 3MJHA 1L5KA 4I9UA 4DJAA 1IOVA 1E1RA 1YI8A 2BM0A 2R97A 1S7CA 2WKWA 4GOJA 1PT7A 2YXPX 3I6ZA 4NOLA 2NUTA 2XEDA 3KVOA 1YVEI 3NONA 2BTEA 2OECA 3AZOA 3GDGA 4BAUA 5MGBA 4IGIA 4WI1A 4YRFA 1WLSA 5BP7A 4P8RA 2RIPA 1Q0SA 3GFTA 4D41A 3S29A 4DL9A 3STYA 1KQ3A 4D9FA 3LD9A 3WFJA 3P2YA 2QVYX 4XCQA 1L3IA 2P5UA 1E2PA 5BSVA 2ZPUA 4R8LA 1R74A 5JTTA 1ZN2A 3B5JA 1PZGA 3BJMA 2C2OA 1Y9EA 4NBSA 4D9JA 5HZHA 3QBJA 1YZ3A 3OOYA 4JJ6A 4K86A 5HUQA 4EH1A 4YT8A 4C4XA 3OU2A 3OE7A 3C3CA 4GLBA 5B3JA 4RTQA 5CXQA 5I48A 1Z3IX 2FEKA 4UHJA 2BMEA 3CR3C 2PNFA 1TCAA 4G41A 5FLEX 1G5HA 2MIIA 3FFWA 5CNJA 1Y8AA 4J9UE 5A0TA 3P9XA 3FPLA 2HLDD 2NV6A 1XE3A 2RK6A 3ZIAA 1LBQA 1I24A 5B30A 1E77A 1S9HA 3TYXA 5AJTA 4K88A 1E96A 4DRXA 4O4IB 1P17A 4KMSA 4X8MA 3TG2A 5F3RA 2O3QA 4IFTA 5HA5A 2C07A 3AOEC 4IV5A 3HRKA 5DT9A 5H16A 3ES9A 5H3HA 4UUAA 2ASEA 4UTOA 4B79A 2GPWA 3W5JA 3DEHA 3P94A 1ONPA 2VBFA 3KQPA 2UZ4A 3F7TA 1KO5A 2HY7A 1E69A 3KM0A 2AMVA 4LC9A 2PL3A 1T2AA 1GPUA 3V8QA 4FEYA 4U5QA 3JALB 821PA 3GFBA 4QOJA 3TN7A 3V1KA 2J9GA 3O4VA 4QO7A 2NACA 2ZTUA 4ZVRA 2CV1A 4DDVA 4Y9DA 3VDMA 4BCBA 4AUMA 4R9VA 1WSAA 2OQIA 2P4QA 3DQQA 4TOIA 3X1MA 4CLEA 3R8CA 1SD5A 2J1LA 4NBNA 3RFFA 2WT8A 3TOCA 3TVYA 2FLWA 1DKOA 4RPGA 4WBNA 4LJ7A 1F8XA 1AF7A 5WRFA 3TW0A 3G8YA 4QXMA 2DYKA 1WD7A 3O26A 1I3KA 1DWOA 1IM5A 3F4BA 1U8AA 2CE2X 5HYVA 3TCXB 2IPAB 4TM7A 5ED0A 5K0TA 2JPDA 1V8FA 4MLZA 4Q1AA 4WA7A 4DIBA 4DNXA 2A1UB 2JIDA 1ZNXA 1X38A 3Q3JB 1Y1LA 2BWJA 3VUFA 4GO1A 3CUYA 3FFBA 5FBRB 1SVIA 16PKA 2Z6QA 1OAAA 1VIAA 3SEAA 3U4CA 1HC7A 5K1ZA 3RC7A 3ZWDA 4GOMD 1DRKA 2C9MA 1Y5LA 3H2IA 4LJLA 3TR5A 5BYAA 5KB3A 1BHO1 1PJLA 1SB9A 2GBLC 2RKOA 5JDCC 2PUBA 1IXSB 4AKHA 5E0OA 1BVYF 3OLCX 5EPUA 1RS0A 2WRZA 3BL5A 2XMBA 3MIZA 4N7BA 1NM5A 2Q0HA 1FYVA 4UUQA 3L6BA 5A02A 5CT8A 1H22A 5JXGA 4PYJA 3B20A 5DNYB 1EFVB 2MR6A 3QYAA 4ZAZA 4HT3B 1CF4A 3HY3A 4Y67A 2JJQA 5TJHA 4OATA 3SJUA 3BGWA 2FWAA 1D2NA 1AB6A 3IVXA 1ONBA 3BMCB 4C4PA 4BKQA 4UTPA 3ZWNA 1DTWA 2D8AA 2AX4A 3QE9Y 4O25A 3JAKA 3R7BA 2QORA 4QUDA 3B2EA 3VGPA 2NZ2A 1Z8NA 1XRRA 5B1DA 5PNTA 5DKFA 5CJPA 1IXRC 3IA2A 3UXMA 3EQZA 1WPRA 5LBUA 4JX9A 3I92A 2A9JA 4I8XA 3BK2A 4ONEA 3FBWA 5BR1A 1AZWA 1RI2A 1KMMA 2HU8A 4CKYA 4IM7A 4UU0A 1AGNA 3A9UA 1MIOA 1D0VA 2NWQA 1N8KA 3DYIA 3TE6A 3OBIA 3HO8A 3K1JA 2VJLA 1D09A 3R5XA 4MA4A 1J06A 5GINE 5ALEA 5FWNA 4Y0AA 3A4NA 3CKYA 4ZHQA 1XP5A 2JBHA 3E9QA 1F0YA 2JGNA 4ZREA 2NSDA 2KQUA 2BGKA 1OFUA 4JP3A 3GMDA 1E3IA 5DGCA 3RS5A 2JGDB 2BN4A 3ANYB 3RWMB 4AJJA 3W4IA 2XVYA 1T2VA 2J0VA 4QFDA 2YDXA 1NBWB 1QGUB 4WNAA 5C51B 1QG2A 1YRYE 3HZHA 2BV3A 2F3UA 3UV3A 4Q9NA 2L18A 5EJ2A 4Z6KA 4JELA 5C1OA 3WYNA 3ZCSA 2LCQA 2H7CA 3D6TB 2GYYA 4MW7A 1H0RA 1X13A 2VZEA 3AWIA 4GM0A 5HS6A 4MYTA 3TMAA 1C4WA 1UBFA 2OBNA 2HFJA 1FC0A 3PPIA 1Z2PX 3GH1A 1TK9A 5E4TA 4OA8A 1KMHA 1Q1NA 3P27A 1S3FA 1Z8DA 5D5QA 3V4SA 2XKAA 2QJFA 2QP4A 1ZHOA 2DTEA 4KYTA 2HQOA 3GGJA 4L74A 2EG9A 2GCGA 1PCXA 3BH6A 4KOEC 4ZCTA 3LUCA 1E4EA 1MOSA 4O4JF 2VOJA 1NQVA 1GGKA 5SYAA 3RC2A 1Y6JA 4AZSA 1IOZA 1U0RA 1KK3A 3BKXA 3GGDA 4EF4A 1RWKA 5ECYA 2GARA 4KBYA 4U63A 2Y93A 2EL9A 3SNHA 1ENYA 1GARA 5H4GA 1C3XA 3L8DA 1TIPA 1X1BA 1TQ2A 3DBLB 3OF2A 4QBKA 4TSFA 3I9LA 3T4PA 1OVMA 3OMLA 5B2ZA 1GA4A 1SM4A 1PX2A 2P5TB 2VT2A 2XEXA 3CJQA 4K9PA 1E5DA 3RC9A 5ITWA 5IM4A 3KCNA 2AFHA 3GBSA 3I5XA 2YH2A 1P9WA 3PD0A 4D6YA 1VGQA 2B3TA 3KYCB 4J2HA 2QT1A 1AKNA 4U7WA 4YDQA 2GF2A 2GK6A 1O0SA 2CNNA 4J0HA 4WZBE 1U6IA 2XVXA 1JIIA 1CB7A 1C8BA 4Y7DA 3DSRA 4ME6A 2H7VA 2P69A 1V11B 1Q1EA 2JCXA 2BFDA 1ZHFA 1CUHA 2FSGA 3PI6A 3PP8A 3IEVA 4QASA 3L84A 2ES4A 4YASA 2YASA 2DBZA 3BRSA 4GICA 1FB5A 1RQLA 1X8JA 1H6BA 3K9HA 1EWKA 1NRIA 1RTKA 2JLRA 4S2EA 1J90A 2MJLA 2Q1SA 2BGRA 5C32A 1QRTA 1YJ5A 2WYUA 3SEFA 1Q0HA 3MRTA 1B2RA 1RYZA 2UVPA 1WX1A 4NE9A 4BRSA 3H0CA 2ILTA 1T6XA 3QVTA 4MV5A 4ZCLA 4BO6A 3ABZA 4FVTA 4HX2A 2DUJA 3C3EA 4Z0NA 4NHOA 3ACBA 3AKZA 2DP4E 1FYFA 2HBRA 3N0RA 2CCJA 4RY2A 1R0XA 2QSYA 3T9BA 1EYZA 4EPXA 4IP0A 4YRZA 3FUWA 3CLTD 2FP3A 3GEHA 2O8CA 2QZJA 2YN2A 5AVUA 2IVFA 2ORED 1BWPA 1FXWF 3LUAA 1N9GB 3UGTA 2L2QA 1Z07A 4PIVA 4CMIB 3EPHA 2GEDA 3OE4A 2BGWA 3J7AC 3EZYA 2B61A 1A8HA 2Q8NA 2QJRA 2YS6A 4R16A 2ZYIA 5G4KB 4TYMA 3ZZ0A 3PJGA 3TJMA 4Z1OA 1YU9A 3PXUA 4CV3A 1HT3A 1NXOA 3K0SA 3A2KA 7YASA 5B1EA 1Y3AA 4ZAFA 4L4RA 4GDFA 4DV5B 4FFVA 2EKBA 4IIYA 4ARZB 1M2OB 4MA5A 4AG5A 1L2TA 3OF5A 3GH3A 1IUNA 1TC2A 4GGMX 2VAXA 2VPZA 2NPOA 4FW9A 4XR9A 4V1CA 3ETNA 4X3CA 1FK8A 4GX2A 2DWUA 2JEYA 1ZI9A 2NUTB 3BXXA 3I04M 4QFCA 4TVKA 3WK5A 4F2PA 3TZLA 2VAPA 1O58A 1QYXA 1TPZA 4DHWA 1M2VA 2I9PA 3PGMA 2XDWA 2O2HA 2VK4A 3QPCA 1YR9A 1V4BA 3WKEA 5HF6A 1W6UA 4M0KA 1SCBA 4JFRA 1Z6YA 4R5HA 5HBRA 5KTPA 2I1LA 1X86B 3OQVA 4HGNA 3RVQA 4Y2XA 1CUYA 1E89A 2QL6A 3L0DA 3TNJA 4HUQA 1PQPA 1D6NA 2QROA 3JD2A 3DHVA 3KZXA 4E2ZA 1M8JA 2XUAA 3VI4B 4DYDA 5AI8A 1EWVA 2JHPA 3P20A 4G4SO 1N6IA 5G3YA 2E21A 2LVBA 4DWOA 1WZCA 3L0BA 4KRXA 3WG9A 5I47A 3PC8C 1NVTA 1V95A 1W59A 1X2EA 1YDWA 1DAEA 1JP7A 2AUNA 3SJBA 4QG3A 4H3VA 1Z37A 1NURA 1WXGA 4MS3A 2CLLB 5ESRA 5FYDA 3UK7A 4JB8A 1QV9A 2Q4TA 1O6ZA 4LXHA 1PFKA 4D3SA 3SVTA 2QZ4A 8LDHA 2P2LA 4LK2A 1WMEA 2YHSA 4D8YA 4L5YA 5HRUA 2WWXA 5IC4A 1EMDA 2CHQA 3FSRA 4J7UA 2YWXA 1DRWA 3LTEA 3M4NA 3NCHA 3RU7A 5K20A 5DM70 1P4GA 2I9KA 4WVFA 1FYWA 4K3UA 3HM2A 3U4DA 1N2JA 1RPNA 1BA3A 2VHWA 1NWHA 2VTDA 2PZ8A 2VDLB 1CIPA 1IY1A 4H7DA 1HOXA 4DE5A 2DQSA 4DG9A 1T2DA 5DN6D 3RJZA 1M9NA 1VLQA 5LUBA 3KOYA 1UXHA 2VEOA 3BXOA 4ZV4A 2ALJA 3ESBA 4JEHA 4W7IA 3QVGA 3ITEA 4WN3A 1S5PA 3TCKA 3JWGA 4GEKA 3X1ZA 2GA9A 3QEJA 3UMGA 1LVGA 1QIHA 2OZLA 4U00A 1SVSA 2ZUFA 2HMSA 1H0SA 2JK0A 1T0JB 3HUEA 4LVOA 4J7AA 4LOLA 1IJBA 1P60A 1L5LA 2BGGA 3R0VA 2EWWA 3A1DA 3OQ1A 2Z4SA 1IHDA 1EFUA 3AR5A 1X9IA 2VRBA 1ULHA 2YY5A 1GGEA 4FUQA 4PLYA 4WBNB 4ZJZA 1U9CA 2CXPA 4KMRA 3O73A 4A8PA 3BD9A 2QENA 4H4EA 4DLYA 1JB1A 2FSFA 3KJFA 3IHKA 2SCUA 1P9LA 2J9XB 1RQXA 1JHOA 4UU1A 2OXIA 3TLCA 4YAOA 2EJCA 3CZ4A 5EUBA 4FEGA 4O2LA 4QXPA 1W4AA 5LIRA 1G4UR 1LPPA 4TTPA 1ZHHA 5C2JB 2QQEA 1IB6A 3B6JA 2A59A 1HY3A 2WWWA 3C5WP 1AB5A 1FMTA 5DU2A 1NG9A 3MCTA 1DHTA 3G5LA 3UJCA 1DDGA 1NW4A 3G2QA 5A3VA 4L5JA 4BATA 4CBVA 3C6BA 3ICPA 3COWA 2OFFA 2FYTA 2PXXA 3C3AA 1JSLA 1EA5A 4MROA 3DC2A 4MW9A 2HQRA 4PYLA 1GNSA 3PUJA 4MUHA 4UVDA 4TXMA 4TS1A 1G8HA 4H7KA 1D4ZA 1YO6A 1PKXA 3E7PA 4NBRA 1USKA 2FLVA 3E1KA 3GDHA 5DXJA 2HRQA 5F1YA 1TD1A 1C3JA 3PKZA 3GJYA 3Q9NA 3LTNC 2BKEA 3GJ0A 4G5OA 1TU4A 3EISA 1GG5A 1ZMTA 2GZ3A 2KBFA 2VLIA 2V54A 2O07A 1KFKB 3V97A 3GRRA 4J0CA 1N9ZA 3PZBA 1DTWB 3O75A 5IXJA 4BEWA 3G2HA 4W63A 13PKA 4OI1A 3JAKB 2G80A 5D1NA 5FWXB 4NXMB 1K5DA 2JDIA 2OGWA 3FMFA 2HRBA 4EB0A 5IC6A 3VNAA 3BE8A 4MQ6A 4B7CA 3ASUA 3GNTA 1LBTA 2NO9A 2VJBA 3EXEA 3IQEA 2HA5A 1V43A 1HTBA 4LXYA 4O5AA 1QIKA 4OFBA 4BEJA 4MP8A 4R0VA 2KS6A 2O3RA 4ZEVA 5G0UA 4ENPA 2F7SA 1MIOB 3AU8A 4DCGA 3JVIA 1UJ6A 2FSPA 1F6BA 4MGKR 1GO2A 5E9AA 3U0VA 3VR6D 3MJ4A 4JCOA 2I3ZA 4Q24A 2XGMA 1GPYA 3K1TA 3DWEX 4GT1A 2OCIA 5JMOA 1GTMA 3HKCA 3PHIA 1JI0A 5BWCA 1J07A 1O5TA 2YXLA 5BUQA 4ALKA 4ZHQB 4Y6QA 3I4CA 4PHCA 4QIHA 4ZV7A 1KE2A 3MEQA 3O9MA 4PINA 3HXMA 1OJ7A 3COVA 4EX7A 2Q46A 5KKCA 2O06A 3BWEA 4Y6LA 4Z1MA 1MENA 5IMSA 3T7CA 1ZIXA 3R5KA 1Y6QA 1JBKA 1Q83A 3CZQA 4BLRA 5B4UA 1YHYA 1P2SA 3FPAA 3NOVA 4LC0A 1DUVG 1FFBA 1LPAB 1T13A 2ICAA 4FIZA 5TPZD 4E12A 5AKHA 1RPTA 4CN8A 1Z6ZA 3AHGA 1OH6A 3EXHB 4KLNA 3QW4B 3ROTA 2W2VA 3O38A 3UK0A 2WKSA 1KMHB 1DDIA 3D9QX 4ZYVA 1KVUA 1Z2CA 2BBWA 3UNXA 3BREA 2NZXA 4J29A 5B57C 3MIIA 4X6UA 3UB2A 1KC3A 1E4EB 6AT1A 1VXRA 3A6PC 1LV7A 3U4MA 2O2IA 1Q7BA 4NAHA 3SPXA 5JU6A 3LNCA 1LV8A 2C7PA 5DM4A 2FUKA 1X7GA 4LJSA 2EIXA 5U1PA 1Y82A 2PRIA 2VA8A 5EHGA 3V2UA 1FP1D 3M34A 4U7HA 5G2OA 2QN1A 3QHAA 3I0MA 4B6SA 3TKAA 4MLPA 3HI6A 1YZKA 4DA7A 3EZGA 2GJKA 4JSRA 3W5CA 1W9MA 4QLBA 2KE5A 1NMYA 4OGFA 4ZO4A 4MVJA 3GBPA 3MWDA 4YXWD 3R7DA 3UM9A 1ZVQA 3U4HA 1GL9B 2X1HA 2VDUE 2HC9A 4GVPA 4HQNA 3WHPA 1JDNA 4R6XA 3EEYA 2X15A 3D3JA 1VPWA 3EVEA 4MCHA 4MPPA 3T5GA 1LK5A 2XMRA 2V7QA 3LT4A 3NIFB 4LRUA 5JLAA 3LP5A 2BFDB 2IP1A 3QKRB 4NDNE 1ZW6A 1J0XO 1QO0A 2PLWA 2XUOA 1LVUA 3G1UA 4ZPXA 3RVMA 3DW3X 3COJA 4TUYA 2HF8A 1ECLA 1U2ZA 2AFIA 2V7EA 1X8LA 2ZS8A 3NW9A 4QYWA 5IVIA 3R5HA 3RVNA 5EXXA 4O29A 4AD8A 1NXWA 2XZTA 4LRXA 2DSNA 1VLLA 2Q9CA 4ML3A 3OT1A 5IUJC 5JI2E 1D3AA 3OEWA 2UVPB 4QAJA 4N76A 1DCKA 1RWMA 1A4UA 2H4JA 2HPHA 4DLAA 1DHRA 2GF0A 3FGNA 5I3CA 3AEYA 1DL5A 1DBPA 1XRPA 5TT0A 2JGEA 3BFPA 4ESVA 1W4CA 2P1DA 1UC4B 3EQ6A 3U4AA 3UCFA 4H2DA 4FFMA 2JGKA 4AYTA 4NESA 1SVWA 4NECA 2J3LA 4O8ZA 1L5YA 3CCFA 4DJEC 4E32A 3OC6A 3GNQA 4R1PA 1DKUA 3ZE9A 3K0CC 3OU6A 5E1MA 2O8CB 2V0GA 2C97A 2VNJA 1XJQA 3L43A 2QPLA 1QIDA 2Z57A 3GCDA 3GRVA 3MW8A 4HCJA 4HL6A 1GNRA 1H6CA 1YRQA 3ETHA 1SHJA 1VFNA 3CRRA 2YINC 4N39A 3JQFA 4TS3A 3PNBA 3U19A 1JALA 4PLHA 5D5PA 1QQTA 3HLTA 2D4AA 2A84A 4RD0A 3TTSA 1JG6A 1ZK3A 1E2UA 4BNZA 3VYSB 2IYXA 3DMTA 2GEJA 2YFKA 3KYDB 1WMFA 2C2XA 2I4LA 2JFWA 3EZ2A 3K35A 4BO0A 3QJYA 4CF6A 5TMDA 3WWDA 3F5QA 5AOCA 4AMBA 1BHSA 4NYIR 2Z5LA 1ZGCA 4NZYA 4J1QA 4OXIA 4RPIA 2DR3A 5H3CA 2JH8A 2VSFA 2Y0PA 1I1QB 1QSGA 3C3XA 3F9IA 1LI5A 3EBOA 3NJRA 3I9MA 2PMCA 4MKGA 4V1CB 3ECAA 1DIHA 3OAAD 4HLCA 4B3XA 3WGYA 2IUFA 3EZ6A 2R5WA 4K0KB 5CVJA 1X74A 3LUHA 1LLQA 3C45A 4EUFA 3SK0A 3EY4A 3LT2A 5L45A 2VYQA 1M2VB 1U1EA 4HQLA 2CV2A 4K5QA 4LVCA 1SUFA 1ZNZA 2FUCA 2HCTA 3DFZA 3THOA 1F38A 4IZHA 4P5PA 3CUSA 3DJFA 4BMOB 2CSUA 5AVZA 1SFRA 2VCHA 3C85A 1HDOA 1HX7A 4DB4A 2BW0A 3F1KA 5A4IS 5DHPA 2B78A 3LK7A 4HUQB 1YXMA 3BMXA 1VCIA 2ACEA 5F7XA 1D9ZA 2IPXA 1J25A 1MA0A 3IDOA 5IAJA 2VKTA 4JASB 2IZ1A 4AMVA 2PEYA 3NIGB 4ZTUB 1SPXA 2CZQA 4MS3B 4NQRA 3MMXA 4M1MA 3U3JA 4FI3C 4C08A 3FOZA 2YOHA 3B7GA 3QFHA 1ONNA 5K6AA 1PG0A 2VHCA 1GZ6A 3E5NA 3ZWKA 3BCUA 4QWWA 2Q21A 3E7WA 4BL5A 5LL6P 3VYUB 4CCAA 3DBRA 1R37A 2D2VA 4Y2VA 3BORA 4F5WA 1DDOA 1XYYA 3NIBA 1HEUA 2ONJA 3RRYA 1SOMA 3G7NA 1O94D 4HGOA 4NJMA 1RBYA 2ZRGA 1ZL2A 3QGMA 4CL0A 4PO1A 4EZIA 3DLBA 2BFMA 1A2OA 2PV7A 3NWEA 4J6FA 1EFAA 1PR3A 3DEAA 3EAGA 2PKWA 4N54A 1RKUA 1DQRA 2W2NA 4GPIB 3FSGA 2YYYA 1MO2A 4TQAA 1WMDA 4TT3A 1L4BA 1GZVA 1R16A 3QVGB 1V3VA 5IANA 3WBFA 2CBXA 4X1KB 4ZWNA 1L7OA 1QOZA 3HMQA 3QVMA 4QQKA 3SE7A 1PG5A 2OZLB 1J1IA 1A5AB 4Y2GA 1BW9A 1G60A 2JGRA 4KYVA 2JF0A 4MVJP 4JT4A 4WZAE 3UMBA 4DFDA 2OO5A 3AUUA 1SVMA 3BRWA 3RT9A 1ULBA 1FS4A 2EHJA 1GFZA 2CY0A 2O7RA 2PVCA 3LBIA 4H7HA 3PUXA 4RD4A 3GD5A 3WISA 5HHTA 4OKIA 4PRZA 4QUEA 5IAKA 3EOZA 4Y2YA 4CCWA 2AXPA 5LZ8A 1S02A 2SCUB 3PWKA 4DB2A 4WY5A 4C7MA 2ZE6A 4C5CA 4DLWA 3DFMA 3FNHA 5CXUA 5KYYA 1NU6A 3LCCA 3ICEA 2HO4A 5AICA 3GT4A 1S2OA 4C2AA 3C87A 1PJ3A 3EULA 4JT2A 4UM9D 3G2PA 4NABA 5LDHA 1GILA 3H7AA 2OV1A 5EJ9A 1XXHA 5A3JA 3TD6A 2X8AA 2QLTA 1JHYA 3IT0A 3B3QA 3T1QA 4F4FA 3FWHA 3Q3IA 5ALOA 2XZLA 4M0UA 2CF6A 4ZQBA 4NMHA 1KAOA 5ELLA 4IO0A 2HBYA 1E1LA 4C4YA 4ZYUA 3HBMA 3LIPA 4H27A 2IBSA 1BU8A 4ZOLF 4YAIA 1E8NA 4ALNA 4DUGA 4XIFA 2WNHA 3MGGA 5BQ3A 1SUBA 1DAPA 3M1LA 4C7KA 2PHZA 3LF1A 1CF9A 5E7MA 4ACAA 1QIEA 2VL7A 3GUUA 1IVYA 2WT4A 3D6JA 4I6JA 3OIGA 4W7HA 1KZ6A 1IVSA 4H6PA 4NG4A 3CF4G 2Z4TA 1L6RA 4Z4HA 1GPJA 2I0FA 2GHQA 2ZB2A 3UAGA 8ADHA 2YOGA 3NRJA 3EXEB 5KOIA 1OTXA 2IXFA 4AN1A 4RD6A 1SQGA 4P08A 5BSEA 2X6RA 2VWGA 4KPUA 4Y6PA 2D3WA 1RNLA 5F7OA 2EKZA 4UUPA 1V6AA 1ZWLA 2FOIA 3LBFA 3FLEA 1WL8A 3MYYA 5JXWA 4ANFA 1OAOC 1WCXA 1VE5A 3ZCXA 4CLRA 1N32B 2JFXA 3HKCB 4K03A 4B3CA 1ZAYA 4DMUB 4ETIA 3IX7A 1PK7A 5JC1A 1IYZA 2WTNA 3LDHA 3KR0A 4LJYA 4MNTA 4US0R 5LQDA 1H2AS 3EEBA 3IELA 3N8HA 3NXSA 1Q0TA 4HNHA 3IVRA 2H4HA 4BFWA 4E7OA 1UK8A 4LXTA 1I10A 4Y2UA 1G7RA 1DV2A 3GJ3A 5HKOA 5JS6A 4J1TC 3DEYX 4XFDA 4UXHA 1T0HB 1L7VC 1NW3A 4CKWA 1Y98A 2I2BA 3HE3A 1IUKA 4COKA 3I1IA 4J76A 3KJXA 1WHSA 3QUTA 4HAWA 5BV0A 1XQWA 1XRQA 2J09A 1U3DA 2OHVA 4RGYA 1F3OA 3DOUA 5DX0A 3ZTTA 3GYBA 4IIUA 5AVTA 4DSOA 4P35A 2P41A 2Q3BA 4QX6A 2NGRA 1A4RA 2VG8A 1YBMA 3AR6A 1F3LA 3WNCA 2VPPA 1FNNA 2X1MA 3GUCA 3I73A 4X66B 4PTZA 1G1AA 1RJFA 1WAMA 2PX4A 4J07A 2OAEA 2QI9C 2OB1A 3ZI4A 4URVR 5AM4A 1ZNYA 3DMRA 4IKPA 4WOPA 1CS0B 3P2EA 3BOSA 3R6DA 3NOQA 3ASZA 1ZLXA 4IHQA 2QUAA 3PQEA 1GUBA 2YN4A 4QUIA 3RG2A 2J4FA 4PRYA 1VI6A 4MUAA 5FNVF 1RWQA 2YXBA 3UFXA 1QXSA 1F0NA 2CE7A 3JYHA 3QF4A 3VRHA 2GWRA 1X1EA 1JFVA 1ZGHA 1W581 4YMVA 2CLCX 3R3XA 1Z6QA 3CIOA 3ZYCA 3MWDB 2YQ5A 4KQ1A 3RS8A 1V0JA 1E20A 5LMCA 4BKMA 3EIHA 4QLAA 2HMAA 3ABQB 1Z2OX 2RHCA 4GRDA 5ERXA 3KB1A 2AN4A 4P58A 2P9BA 3ZWPA 2Z43A 4FWTA 1KFJB 4MRRA 2R68A 5EC8A 3E27A 3BCSA 3I9FA 2BE7A 1R6DA 2OZVA 4DIFA 4OLJA 4BVGA 1FDUA 1KAHA 1NFFA 4FOTA 3T7RA 3NBZC 2R00C 1OE0A 1X2BA 4TUYB 1E2NA 4O02B 1QHGA 2EKLA 3U3XA 4INAA 4Z86A 4CI9A 1Z82A 4Q03A 3ZW9A 1ICEA 4IS2A 2WJJA 4RTLA 3PL1A 4CYMA 3B5EA 1Z62A 2Q3DA 2WF7A 3PRKE 5CJJA 3UN1A 4DPLA 1NUPA 1PI3A 1TO1E 1C3LA 3O31A 4G97A 3CLUC 2VPYA 1RRKA 3OHMA 4PZPA 1DLJA 3UUEA 2A2ZA 2OG1A 1TX4B 3D1LA 4GHWA 4M37A 2X0FA 1DARA 4ENUA 2Y2VA 2IYFA 2CYCA 1Z36A 1IOLA 3BA1A 1ZZEA 2D06A 3N7AA 3O4FA 2UZIR 3RS3A 3VTAA 5C8XA 4UDOA 1RYEA 1BDHA 2AKEA 1NUAA 2BHNA 4OU5A 1Z73A 2WF6A 3DTTA 3DXYA 3EFEA 3LUBA 3OE7D 1F9EA 1FVFA 4O4LF 1F4PA 3RYFB 2AOXA 3CNHA 4F1WA 4JI3B 1S4MA 4U2GA 3JRNA 4UCXA 4JEIA 1LCIA 1XDZA 4CHGA 1YNOA 2FPSA 2FZCA 2UVDA 3GAAA 4JUDX 1YVDA 4P33A 3RROA 3TDKA 2RJ3A 3OZCA 5HX7A 2VQEB 4WA8A 3EVZA 4FDLA 2IYVA 3ZIAD 1F7VA 1TVMA 5I7SA 2PJZA 2R25B 1N2CE 2HH9A 3LKVA 1OUMA 4OB7A 2Y67A 3SIXA 5CA1A 4L1KA 2ZREA 4ZCSA 2G71A 3R3UA 2HHAA 4AT1A 2W0SA 1W36B 1LRLA 4LX0A 4ALMA 2AE2A 3OP1A 4RFSB 1VCNA 3FH0A 3N8IA 2WSIA 4IDEA 4FLFA 1Q1GA 5CT5A 4JNCA 3I2HA 3F5FA 4JLMA 5FORA 1G38A 2UZ1A 4ZRMA 1ZH6A 4LSZA 3VSAA 1R6UA 2WE8A 4KN8A 2MSCB 1WCWA 3WLQA 4QL3A 3VR4H 4EMTA 5KYKA 1M72A 4HQ6A 1KJ9A 2D1SA 4D25A 3UJAA 4F60A 4FQ7A 3NETA 3OCVA 4EHDA 1KK2A 5HBGA 3V46A 3BA6A 3ZY5A 3MFQA 1PJ2A 4DIUA 5MN4A 1E3MA 3U3DA 3KWMA 4FHGA 1NR1A 2ZAIA 4I3FA 4OO3A 5A0VA 1EGAA 4LJ5A 1IM8A 2W93A 3U9TA 2FZVA 1R9NA 2B83A 3KKLA 3C4VA 3Q12A 3Q9SA 2V4ZA 4NAUA 1MZPA 1FMFA 2QJWA 3OFSA 1PWYE 2DC1A 5JSQA 2R8YA 1A95A 2SICE 5AT1A 2QLBA 2JLYA 2FFBA 3T1VA 1RI1A 4MKFA 2L42A 1JFSA 4XX0A 3T3MB 3H75A 3W6UA 3Q72A 3J80A 3FCEA 4CR7A 2Q5IA 2VAMA 4QPCA 1I0LA 1MORA 4MR7A 4RCZA 5B6JA 1KYWA 2ZOSA 4GLJA 4NJMB 4YMLA 1GQSA 3RTEA 3TOSA 2HF9A 2UKDA 4U7TB 3MC1A 4V0RA 3VHXA 3E61A 1UZLA 2FMTA 3TIIA 2Z9BA 1DX4A 1T0IA 3ACCA 3GPDG 4BMZA 1KK0A 5JANA 2DLNA 2O19A 1U31A 1WD5A 5CK4A 2JFZA 3PYXA 1HLFA 1J5EB 3IXQA 1B0PA 5LXTB 4ER6A 4O5OA 2XE4A 1SOAA 3EFHA 1W7AA 1PGQA 1BW9B 1GU7A 1GTG1 3GYGA 1IN7A 2JA1A 3EVNA 4FOOA 4TRRA 2Y1LA 4TT8A 3T5DA 4IUCS 4G1FA 3E81A 1W46A 5ESWA 2D5IA 5FL7A 8ABPA 2EARA 2WSLA