1SXIA

Structure of apo transcription regulator b. megaterium
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
273
structure length
273
Chain Sequence
TTTVGVIIPDISNIFYAELARGIEDIATMYKYNIILSNSDQNQDKELHLLNNMLGKQVDGIIFMSGNVTEEHVEELKKSPVPVVLAASIESTNQIPSVTIDYEQAAFDAVQSLIDSGHKNIAFVSGTLEEPINHAKKVKGYKRALTESGLPVRDSYIVEGDYTYDSGIEAVEKLLEEDEKPTAIFVGTDEMALGVIHGAQDRGLNVPNDLEIIGFDNTRLSTMVRPQLTSVVQPMYDIGAVAMRLLTKYMNKETVDSSIVQLPHRIEFRQSTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Glucose-resistance amylase regulator
publication title Structural studies on the apo transcription factor form B. megaterium
pubmed doi rcsb
source organism Bacillus megaterium
total genus 76
structure length 273
sequence length 273
chains with identical sequence B, D, G, I, K, L, M, N, R, T, W
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sxiA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sxiA02
4H3KB 1FQWA 4NCAA 4UHKA 4E7OA 4EYKA 4N41A 3H1GA 3HZHA 4WUTA 5HSGA 2A9PA 4RKRA 1EAYA 4MQEA 5BRJA 2FMIA 5GOTA 3R0JA 4ZMSA 1CHNA 4PICA 2JVJA 2NZVG 2R48A 3EQZA 3O2JA 3Q7TA 5IEJA 1K68A 4YLEA 4YWHA 4YGXB 1EWTA 3EGCA 3KLNA 4JA2A 5CHYA 4DADA 3H5IA 4F8JA 5JNTA 4WXEA 5KC9A 2E4YA 4Z4IA 1YVUA 3GWGA 3QLUA 4MR7A 5CNKA 8ABPA 4G0YA 3BILA 1YMVA 1APBA 3H5TA 4ZMRA 4Q6BA 4G0OA 5TPZD 3RVNA 4W5QA 3LMKA 2RGYA 1DZ3A 3H1FA 2FQXA 1MB0A 1M2FA 2H3HA 4MAAA 3HCWA 5E3JA 4XAQA 1QP0A 4RXTA 3JY6A 3KYIB 1D5WA 1JBEA 5IUJC 1C4WA 2FLKA 4EGSA 2PAFA 1ABEA 4OBBA 3QEMA 4TMYA 4F3TA 1AB5A 3N6VA 4ETIA 1BVHA 2W42A 4LZLA 3HJFA 4Q7EA 5EWMA 5TQ0A 4WWHA 3EJWA 3BREA 2WMYA 3GBPA 4G97A 4PZ0A 3SG0A 4Z4EA 3T6KA 3ILYA 1NXWA 1JH9A 1HEYA 2FW0A 2MSWA 5EWJB 2CHFA 4KQ9A 3MQ4A 2A9OA 2L2QA 5JNUA 2YHAA 1GCGA 3HEBA 5HM6A 4DQDA 3GBVA 4NCBA 3CNBA 3M6MD 4P1ZA 1BDJA 2DRIA 2JCGA 3NHZA 4EVQA 4P98A 5BR1A 4UHJA 1I3CA 4RV5A 4EUKA 1EWKA 5FBHA 2FEWB 1OXKB 3N0WA 1E6MA 4Q6WA 3HXMA 1DG9A 1KMIY 4JOQA 4YV7A 2YHBA 2OQRA 2QR3A 2RDMA 2FMHA 3Q7SA 3H1EA 4Z4GA 1NATA 1SXIA 4KMRA 4QYWA 1T34A 3C6QA 3K4HA 3OQNA 3DGFC 3HUTA 3UKJA 5IX8A 1GUDA 3O1HB 4RWEA 4G86A 3SQNA 1Y1LA 3LOPA 2WB4A 2R25B 3QLVA 1ZAYA 2IYNA 3I45A 4Z4CA 9ABPA 2N9UA 3S99A 1EFAA 2CHEA 3H5LA 4EYOA 1LBIA 2MSLA 3F6CA 3FFWA 3QEKA 2AYZA 1W9HA 4RK0A 3RVQA 4L85A 3MIZA 1DBQA 1DCFA 3OM0A 4MLDA 1SXHA 2PLNA 5FWYB 3SAJA 2KYRA 5JNSA 1MB3A 5BRAA 2RJNA 4HNQA 4OG2A 4GNRA 3SNKA 1SRRA 4MR9B 4XFKA 1TVMA 5B3JA 1QQBA 4MRMB 3EODA 4RZSA 1VLZA 4MLCA 4N76A 3I42A 3K9CA 3MM4A 3BBLA 1P2FA 4RXUA 1DC8A 5EWJA 2PUAA 3IP7A 1YS7A 1A0OA 1NY5A 1L5YA 5KWSA 1A2OA 4G0MA 1J56A 1MIHA 2VK2A 3JTEA 3O75A 4LX8A 1M2EA 2HJ9A 1TLFA 1JWLA 4RK4A 2QW1A 4WZZA 3W9SA 1U2PA 3DZDA 4JASB 4D74A 2A9QA 5JS1A 1KRWA 1NXSA 2HQRA 4LRQA 3H5OA 1DBWA 2FEPA 3SY8A 4E7PA 1DP4A 1DJMA 1JFSA 2LPMA 1ISRA 1RZRA 1ZY2A 4JB2A 1XHFA 4YO7A 2HQBA 2PMCA 2BGGA 3O1JC 1QQAA 1BA2A 1TJYA 5JS2A 1KGSA 2R47A 4MR8B 4ZPJA 3H6GA 4MS3B 3CG4A 4LDZA 4RS3A 3HDVA 3HS3A 2FQWA 4MS1B 7ABPA 5ABPA 3LUDA 1NXXA 3TO5A 1U04A 1P6UA 1D1PA 3M9XA 1VKRA 3QLTA 1D1QA 3D02A 4JP1A 1U0SY 5I4CA 2FN9A 3I5AA 1PEAA 1QO0D 4Z9AA 1ZGZA 3IDOA 1GUBA 1P8AA 1Z12A 3RVPA 1BAPA 2J48A 5FWYA 1DRKA 1YK1A 4Y9TA 5DTEA 1GCAA 1MAVA 3RVSA 2WJAA 1TMYA 1U8TA 3OMXA 3G85A 4QYMA 1JDPA 2GKGA 4RY8A 2FMFA 3F7NA 4MR9A 4Z4HA 2O20A 4CBVA 5JNWA 2VUHB 1D2AA 1JYFA 4MRMA 4OLBA 2FTKE 3ROTA 2LUOA 3Q9SA 2PUBA 1RZRD 1JFTA 2A9RA 3HV2A 1USGA 2PKXA 3DLHA 1E2BA 4Z4FA 2PUGA 2E4XA 1D4ZA 1B00A 3H6HA 5CNIA 2M1ZA 2WY2D 1FFWA 3KJXA 2MYNA 3ILHA 4W5RA 1E6KA 4N03A 4YP9A 2V0NA 3LUGA 3Q7RA 4WT7A 4OTZA 5KQGA 4PYRA 3D8UA 1SXGA 2E4ZA 3UK0A 3OLWA 4PE5B 3N8IA 1S8NA 3JVIA 3DGEC 4ETNA 4MYRA 5BQ3A 2FMKA 2FKAA 4HYEA 2HQOA 4KV7A 1WETA 1XHEA 2VUIB 4MR8A 4RK7A 1FSPA 4W5OA 4MS3A 1Z2EA 4IMJB 2PJUA 1EHCA 2QU7A 4YS6A 1PUXA 3CG0A 4FE4A 4MS1A 4KVFA 3RVOA 3NNNA 2HSGA 2LBPA 2JVKA 5D2CA 3BRQA 3H5VA 1TM2A 3URMA 3FGZA 3SM9A 3TMYA 2PUFA 1JYEA 3CZCA 4MQFB 2QV0A 3P9YA 1E6LA 3OLYA 4PEVA 2FSPA 4N0QA 4RU1A 3OO0A 3HK2A 4QPJC 5IUKC 2B1JA 1LJUA 2QVCA 3IPAA 3OLVA 2MSKA 4WXMA 3QLUC 4RK1A 3C3WA 2Q5CA 2RJOA 3LUHA 3H75A 4G0QA 4HNRA 4L4UA 5CNJA 5DKFA 3GRCA 3OQOA 1JFVA 1Z2DA 5FWXB 1RNLA 3RVMA 5IULC 1JLKA 5TQJA 4EVRA 2E4VA 1ZESA 3OO1A 3A0UA 2P9HA 3GA5A 4F11A 4S05A 2ZWMA 1W25A 1Z13A 5C5EA 1K66A 4RK5A 5IC5A 5KQLA 2PL1A 4JAVC 2GI4A 3LUKA 1QMPA 2QXYA 2FLWA 4RKQA 1F51E 3ROFA 1ZITA 3N75A 1QNLA 3GV0A 3LUCA 1YS6A 3L6UA 2H0AA 2E4UA 1CEYA 3JPWA 3LUJA 1QKKA 4O5AA 1DCKA 2IDMA 4IGAA 5DGCA 3CU5A 4G0XA 1A04A 4YCSA 3Q41A 1PNRA 1L5ZA 1VRVA 1YTUA 2IKSA 1PNTA 3KKEA 2ID9A 2B4AA 1QP4A 1ISSA 4FB4A 2P4UA 4W5TA 3FDFA 3H5WA 4NV3A 4O1IA 4KFCA 2PUEA 4NICA 4XASA 3IPCA 4EYGA 6ABPA 3N53A 2MYTA 1UDRA 4EVSA 4MQFA 4OATA 3O1IC 3GYBA 4F06A 1KRXA 1DRJA 2M98A 4ML3A 4JB0A 3N0RA 3O2QB 1PHRA 1LJLA 1DC7A 2VYCA 3KCNA 3RVKA 3DLBA 1MVOA 2PE5A 3QX9A 5IEBA 5TQ2B 3QELB 3M9WA 4MGEA 1DBPA 5FWXA 1NXTA 4W5NA 1RPJA 3OQMA 3IP6A 2IPMA 3T8YA 2MYUA 2IPLA 5JNRA 4LE0A 2IPAB 2CWDA 1PEYA 2QVGA 2L18A 2CD7A 5F64A 4EY3A 1QP7A 1JHZA 4TLLB 3EULA 3O2SB 4HNSA 4YR7A 3C3MA 5HKOA 1ABFA 2LIVA 2NT4A 3A3KA 3KTOA 2MYPA 3C97A 3EAFA 5B3JC 3KSMA 3O21A 2FN8A 2X7XA 1ZH4A 4IILA 5CNMA 3FFXA 2JRLA 4M88A 5HQJA 4Z99A 2JVIA 4RY0A 4OLAA 3CTPA 1BDHA 1NTRA 4MS4B 2JB9A 3T95A 4G0PA 2FQYA 2NT3A 1ZN2A 2I6FA 3JVDA 2GWRA 4RK6A 4B09A 1C0EA 3E3MA 3Q15C 2AYXA 4N0PA 2F8SA 3LFTA 1VPWA 4Z9BA 2NZUG 2ZAYA 3VNBA 3C3KA 1JF8A 2JK1A 3HO1A 1AB6A 3F6PA 1M5UA 3T38A 1NXVA 3CLKA 4KK3A 3NNDA 3LKBA 4MPTA 3LTEA 3FMVA 4FE7A 3HSYA 2QZJA 1Z25A 3E61A 3HUUA 1Z17A 2R4QA 5T3YA 1R8JA 1URPA 5TQ2A 3QELA 3QK7A 4KNYA 2LP4Y 1GLGA 3LUAA 3RVRA 1FFGA 3OM1A 4LE1A 3RVLA 5ED4A 3NHMA 5TPWB 3CRNA 2E4WA 4XXHA 3RVJA 2XDYA 3KHTA 3EQ2A 1ZH2A 4KK4A 4RSMA 4N47A 5IBQA 5T7BA 2WWVD 5EWLB 4LE2A 1EWVA 2PL9A 3HDGA 1SD5A 1ZDMA 1RXEA 3JS5A 4KPYA 1RXIA 4YRZA 3IP9A 3F73A 5DCLA 4H3HB 3MA0A 5KC8A 1ZHHA 4QICA 5KI6A 1NXOA 2JBAB 3LUFA 3MF4A 3G1WA 5JNVA 4NQRA 3RH0A 5KQPA 2GBPA 4XLTA 2HPHA 4F12A 4IMIB 4EYQA 3O74A 1U2QA 2L19A 3I09A 3KG2A 4GPAA 4MS4A 4TN5A 4MQEB 2QSJA 3LKVA 3B2NA 1OXBB 3GL9A 4ETMA 4S04A 1H9CA 1FFSA 3OLZA 3KYJB 2FEKA 3QX8A 3CKMA 3TD9A 1BDIA 1Z18A 1QPZA 1IIBA 4RDCA 3A0RB 2IPNA 4MR7B 4D6YA 3BRSA 1LK0A 5KQMA 3MMNA 3DBIA 4D6XA 3TX6A 2FVYA 3CZ5A 4H60A 2IOYA 3CFYA 3L49A 1XWWA 2NUBA 4RXMA 1CYEA 4IRXA 4KQCA 3UUGA 1LBHA 1YK0A 5GQSA 3OLXA 4TLMB 1JL3A 1JX6A 4RY9A 3TB6A 2TMYA 4ZYLA 4KRFA 5TPWA 1QO0A 1M5TA 2OENG 2PUCA 3KS9A 4Z0NA 3HM9A 1USKA 2ID7A 3A10A 3CHYA 3NNSA 4IF4A 4O1HA 3QEMB 5FBKA 2PUDA 2FXIA 2F8TA 3VNAA 1USIA 5EWLA 3HVRA 1ZGGA 5EWMB 4ZJPA 1NXPA 4G0ZA 3RQIA 5TQ0B 5TPZA 5IUNC 1Z26A 5TE9A 2GX6A 5C5CA 1Z15A 4DN6A 2WRZA 4KREA 1P6QA 2WJWA 1DCMA 1YIOA 3GT7A 3OMWA 4KZKA 1F4VA 3QLVC 3EDCA 4LDAA 2L17A 3N0XA 1ZVVA 3KLOA 2JBAA 1Z16A 3MYYA 6CHYA 3CS3A 3FFTA 5DLEA 5PNTA 4XARA 3IP5A 3NBMA 1JDNA 1YMUA 3JPYA
chains in the Genus database with same CATH superfamily
4I9NA 3OY2A 3BGIA 3HKEB 1BWRA 2OLJA 1G4UR 1T6NA 1YR1A 1F2VA 1SZPA 3C4QA 1ZL0A 5SZJA 1SOVA 1V11A 4LF5B 3PFBA 2G9RA 1J5PA 1W0JA 1O94A 1XMVA 2NZVG 1A8PA 2H8KA 2PY6A 2R5FA 2ZSFA 4EKYA 5FA6A 1UKAA 4ECEA 5J47A 1ZYUA 2XI4A 2ZM5A 2ZSBA 2B1QA 4CEHA 5J4VA 1KFEB 3MWEB 4BFLA 2E4YA 1RLJA 1MAAA 2VKTA 3I01A 4YH1A 2GMWA 4B73A 4Z49A 3T5GA 1XTZA 1F8UA 3MJSA 1GM5A 2VPIA 3CMMA 4YQFA 3OPXA 2C9BA 3BILA 1YMVA 1VJGA 2LKCA 3AHDA 4GLJA 5LL6P 4WERA 4YCCA 2UXDB 4E2YA 4QGSA 3GCWA 3LMKA 2RGYA 4CNQA 3VJRA 3TTWA 2C7OA 2NVBA 4M9SA 3HA2A 4YUVA 1EFKA 1H2EA 4AKSA 5ADWA 3KU1A 1VKHA 4P86A 4RSGA 4ZT3A 5BWBA 1E2DA 3FR7A 4B47A 1P1HA 1N7IA 4HH4A 6Q21A 1XUOA 2H9IA 2NUAA 1RD4A 1XQ9A 3EE6A 2FSVA 3P9ZA 4X24A 3E81A 3VTKA 3ZK7A 4DA9A 1IEXA 3ERCA 4G5YA 1N2EA 4DM4A 1LDGA 3P19A 3QEMA 1Q22A 4FKMA 4FB5A 5JBNA 1JR3E 5A7FA 2PH7A 5JYEA 3OH8A 2JFYA 5E4FA 1E60A 4DLWA 10MHA 1O96B 2XF8A 1N9GA 4G97A 1DEOA 5EKSA 3FTCA 3GUUA 4G01B 2DETA 1L7MA 5FA5A 3W79A 2EEPA 4D02A 3PK0A 4ROSA 1J8QA 3NATA 1DIAA 4RZ2A 2NPFA 1ILWA 5CFZA 2E55A 3CUSA 4TQGA 1SKAA 3DBHB 1I80A 2IZ5A 3T7EA 2VLBA 4CPDA 4NENA 3GVHA 5ES3A 1FFEA 2BI7A 4GU5A 3E9YA 1DQPA 4NCBA 5JTUA 3K94A 1JHQA 2IYOA 4KIJA 1BCSA 5IBRA 1BZYA 2P4SA 4OP1A 3SZMA 5TMEA 3UK2A 4MW9A 4PLZA 1EWKA 5GVSA 2IHKA 4NFYA 3TNLA 1BCRA 2YJ5A 2VAPA 5HQ3B 3EYWA 1P4JA 1J8YF 1OXKB 4QPNA 1CFZA 3HXMA 3DAPA 4MWBA 4B34A 1DG9A 4OGLA 4B3DA 4IP0A 5IJ9B 4P7FA 2A5YB 2ERXA 1Z5NA 3AUKA 4LFAB 1FYDA 1R0KA 2B4QA 3E9DA 4UXIA 2X4IA 1C1DB 2RHCA 3I92A 3QI2A 1HYQA 1JA0A 2YFQA 1WUJS 3L92A 2J45A 1EFUA 3KQNA 4K9KA 4ZDWA 3GLRA 3C3BA 4X1YA 2H52A 4QUEA 5HUQA 4ER6A 2XXAA 3CLSC 2PD4A 2YV1A 3QVGB 5ESXA 1QR6A 1VFNA 2J9FA 1DEHA 2CV1A 2FUCA 1UXGA 3PJGA 4I14A 4IXWA 3S99A 3LCMA 4QGFA 2OAGA 2QP9X 4MKRA 4BJ5A 3H86A 4QDZA 4DIOA 1OBHA 3CZAA 5AQEA 2AYZA 4L4RA 4H1HA 4NBKA 3WNZA 2WWHA 4L85A 2ZE5A 1LRLA 5BN1A 3BICA 2J87A 3RJ9A 4DVGA 4AXXA 2O7VA 1E3DA 1T6BY 1WBJB 3NGLA 2LV8A 4E07A 3KXIA 4B7XA 3V97A 4JBYA 3AJ8A 4CQLA 1WMEA 2K5UA 1XI2A 1AC5A 4JL8A 1H2RS 4RA9A 1I94B 4Q9IA 1SELA 1M8KA 1BDMA 4BRWA 3SP1A 4P5PA 3I42A 5TY0A 1NQUA 3LWZA 3SI7A 1P2FA 3OPMA 3ZD9A 1EZ1A 3HXPA 3ZHVA 3Q3IA 2JLZA 1HDZA 4K6FA 1L5OA 3EMDA 3LPAA 4LOHA 3UFXB 5IANA 4HH0A 2AK2A 4G5XA 1WKVA 5CM8B 1S01A 1WDLA 1X74A 1T3TA 5JT1A 2HJ9A 4PRZA 3K0CC 3PXEA 1GG2A 2GA8A 4YCNA 3ZE7A 1KBZA 1WAMA 2OBBA 1TAQA 4MTCA 4EB0A 1H6CA 2OCLA 2FA9A 4C0HA 1AV6A 1JQJC 3DO5A 4JUBA 4YJ3A 2AOUA 3FYCA 4J0QA 1ZH0A 2QE7D 5EIWA 5HIJA 4CTKA 1EVKA 1E7RA 5J5CA 4UTRA 3U16A 1GKLA 2HA2A 4YO7A 2YYSA 3F74A 5FOSA 1BA2A 2O2HA 1ZGJA 1KGSA 2R47A 3Q7EA 4GXRA 4Q3KA 4CM3A 5FI0B 1AGPA 4MS3B 4DCOA 1HR0B 3D2CA 1A8UA 2X7HA 4JUIA 4NCXA 3N2KA 4O1MA 1GIAA 4MKIA 3TLYA 4E11A 1N3LA 3ZVMA 3L7AA 1P6UA 2HYIC 3QLTA 2ODTX 1D1QA 3D02A 3L7MA 3N3BC 1V6CA 3DBOB 5I4CA 1MW8X 1J70A 2QRLA 3IAUA 4L9SA 2NP6A 2X6QA 4N65A 3RC1A 4S12A 1PV4A 3TLJA 2BZSA 1B74A 3DLPX 1K3FA 1CPYA 3MPOA 3CVOA 2VWGA 3ZTWA 1B8PA 5CFLA 1T9BA 5EVCA 3IQEA 4NRDA 5I5EA 1C7IA 2LGJA 1E6UA 4U6NA 1I32A 1Q0QA 4R54A 1WEHA 1U4OA 3N2GA 2R8BA 1Z5WA 1XEXB 5H3HA 3RKSA 3ROTA 4OLBA 3I9KA 1MAUA 1Q1AA 1R8YA 1M2OB 4JWKA 1CB7A 1PIWA 3Q6MA 4MUIA 5E6RB 3UAVA 4DM3A 1ZUD1 4MKXA 2CNOA 1E58A 3MJCA 4WV3A 3T54A 1Z39A 4KPUA 4L50A 5AKIA 4BZWA 3CN9A 4HN9A 2WY2D 3S2FA 1IUNA 4MPJA 2HOQA 4EO9A 5I47A 5JWOA 4TLDA 5ALGA 1IAQA 2IYRA 2K87A 1DZIA 4K28A 4D3ZA 3AMVA 5AKKA 1PFUA 1N5OX 3D3QA 4GX0A 4JZKA 4EJSC 1T8UA 4V03A 3BL6A 5AW6A 4PE5B 3OKFA 3JD2A 5C3UA 4IUCS 4DWOA 4RD4A 1V26A 2E48A 4F1JA 5JAUA 4JJ7A 2W6JA 1F6DA 4AICA 4EA6A 1JUDA 5KOIA 4M1OA 4PYMA 4AMBA 2GN2A 2PK3A 2FSFA 3BWDD 2ZJYA 4M4SA 4RZQA 2W2PA 4RK7A 2XR1A 4MKHA 5JS6A 3IOMA 2H4HA 1Y37A 1JNYA 3OTIA 1H85A 2WG1A 5ALOA 5BT9A 1G4HA 3KQHA 1L0BA 3L1HA 2QV7A 5EZ6B 3WJAA 2ETXA 1ZN9A 3DHVA 4CNBA 5CXQA 2ZWVA 4JYZA 1E0JA 1NRIA 1RJWA 1X9GA 2QY9A 1L5HB 1U31A 1W29A 4TV9B 1G17A 4JQCA 4TMTA 4X71A 5D7NA 2IWHA 2J5RA 4M9CA 3U39A 4CTMA 4LOLA 5IN4A 4UAUA 4BU1A 2QB5A 2QV0A 1XV5A 3C5EA 1JG2A 2WMOB 4AJNA 3NX4A 3OVMA 1DKQA 2PMWB 2AFRA 3EGOA 5KWIA 2UYHA 4I2VA 3VPSA 5IKEA 1YJXA 1ZN8A 4FQ5A 1BRTA 2WVJA 4WXMA 3IJEB 3RGWS 3PX7A 5DISB 3GZJA 4CR6A 5JHHB 1VFPA 5JJBA 3K72B 3UMFA 1DLJA 3AESA 5IABA 1GHTA 2H1CA 2AT1A 2JI9A 2XGGA 3E9RA 4HNRA 4X41A 5CGQB 3R7DA 1JFVA 5HNKA 3A37A 2RE8A 1MFPA 3PUHA 1V7PC 5ESRA 3TNDA 4JC4A 4QEZA 3AR3A 1JLKA 3TAHA 3S8YA 2BHNA 1JSLA 1RYZA 3AY3A 1ENPA 3F9CA 3ZJVA 3K1AA 3RJTA 1MX3A 5ERXA 3HDHA 1YOVB 1W36B 2NV2B 5C5EA 1DE0A 4RK5A 5BR7A 3QPCA 4E2FA 1RWNA 3DCJA 3T1HB 4MVYA 4O2RA 1Z75A 4K9RA 2JAOA 3DPUA 4FBLA 1X94A 1QMPA 1A82A 2BMVA 5EKDA 3D5QA 3VTFA 2ONJA 5TQ2A 3LQYA 4R9SA 2RH9B 2CUTA 2FFJA 1XKLA 1M83A 1EESA 4KE8A 5IN5A 1OFUA 4OKIA 2V7VA 1XE3A 2JLSA 3ICQB 2BPOA 3NI2A 1DC6A 5LZ9A 2PZMA 3L7NA 3QEOA 2X3FA 3L8ZA 3BHMA 3M6XA 3DEHA 4KIWA 3PL1A 2XX3A 3C8HA 3ET4A 4W7HA 1KDYA 3TSCA 2R7NA 3OCZA 4HF7A 3V4PB 1PSDA 2OV6A 2XDQB 2QROA 3LO5A 1XEWY 3IPCA 4QDJA 1YKFA 3KNZA 1U2DC 4NAUA 4J8PA 1G60A 3N8GA 1Y5MA 2EF1A 4I0WB 1U3UA 2RC5A 3RRFA 4BO1A 4CTNA 3UFBA 3TW0A 4EBFA 3ZIDA 1KK3A 3O2QB 3PFNA 5C1IA 4LXGA 4HGRA 3S0JA 1O0CA 2H08A 5LFAA 4J0FA 2B92A 5K7SA 2BFEA 5BN4B 1EUDA 3PNKA 2PE5A 5DLQC 1RI1A 3AVTA 1RHMA 4LJ4A 3ESXA 5KAMA 4AUMA 2OCIA 1E7SA 1RI2A 2WJGA 3AHFA 4KQ2A 4P7BA 2GF0A 4TKLA 5BW6B 3AEZA 1M6WA 2YN2A 4R2JA 3IFSA 5ED0A 3PDIB 3FCSB 4PHFA 4Y6PA 4LHYA 4ZK2A 5K45A 5A02A 3JQRA 5LVAA 1MW9X 3OCXA 1SUBA 3OQJA 2X42A 3T4XA 4TTIA 2QUBA 1M33A 5JCJA 3FWKA 4BNLA 5L51A 3JALB 4WZAA 1OJ7A 3ID6C 1OWPA 3K6JA 2O0JA 2QVGA 4HFRA 4Y1FA 4AF6A 4ZT6A 5SZHB 5ELXA 5THXA 1PFQA 2GD1O 2XYVA 1SHTX 3HC7A 5DTQA 1RM5A 2B98A 1PP4A 4IO0A 4JJKA 3ESBA 2NU6B 1QCDA 1NF3A 2XBLA 3C3MA 3SX0A 2VTBB 4ENSA 3REQA 3QE4A 1B2RA 2ZAOA 4DSUA 1WW8A 1OX6A 2F55A 1FFAA 1Y1KE 2NNWB 3IQGX 3L07A 1ESEA 3V4LA 3KSMA 4TTPA 3ZXUB 4AUEA 1HLFA 3EWSA 4QHSA 2CXHA 4R1OA 3U2QA 1CEEA 1PTJA 4TGLA 3KKNA 4Y6SA 3U62A 2JLXA 5HRUA 2ZUFA 3KVRA 3OP1A 2ZXFA 3NFRA 4KBGA 5FPHA 3WQRA 1ZK0A 3KJNA 4UFPA 2WTUA 1K6MA 5F3DA 5K1ZA 2DQYA 1VZ3A 1OIWA 2EX0A 2QTVA 1FSGA 3O8DA 1Z4IA 4QBIA 4WK6A 4V0LA 2F9FA 4XYBA 5DGXA 4EX6A 2PMEA 2AOTB 4ZODA 4CODB 1FDWA 5FL7D 5AFSA 3LAWA 1ZN2A 4G67A 4LXXA 3ZVRA 3B12A 4CTJA 4QYIB 2AX4A 3E3NA 2F3QA 3NH9A 3R44A 5L3QB 5G1PA 2P2DA 5ALKA 5T57A 1COWA 2VNKA 1RHKA 2ZUBA 4MPRA 3WYGA 4BFZA 2HWKA 1ZM2A 1J0DA 2RHWA 4I1VA 3CLKA 2JCXA 4JYAB 2IXEA 1WCXA 4OJNA 4YCAA 3VMFA 1WUKS 4XLZA 3DZJA 1IM8A 3JVUA 1J0CA 1TLLA 2Y0PA 3T1VA 3I73A 2Q8NA 4ALJA 1NN1A 1ZAKA 2HFJA 2WK1A 3OPVA 4WKBA 1G5RA 3DMFA 3QJ5A 3JATB 5A7HA 1BS1A 3FN4A 4JJFA 1PJ8A 1AZTA 1XIVA 1A95A 1C9DB 4B32A 2WHYA 4FUQA 4RUKA 2JFOA 1H2ZA 2JKZA 2XDYA 4UZSA 2VP6A 5H70A 5AH0A 4CG0A 1RXVA 5LOVF 2ZIZA 2IOFK 4K03A 3HVKA 5BV0A 1YQDA 1FXWA 3OQ6A 2XYPA 3ONNA 1K4KA 4ARBA 3MWDB 4D8WA 4R31A 4HC4A 4ZQIA 4C7BA 2RARA 4EY6A 4D9KA 1EE9A 1QV7A 4IXDA 3F8TA 3DD1A 3WAGA 1EDZA 4NOKA 5HCIA 4Z8YA 2IHZA 5C7OO 3MGGA 3T3OA 4QWWA 3PXUA 1EGMB 1M54A 2Q28A 1UBHS 2E1PA 3MWKA 3QY0A 3LUFA 2QENA 3OJXA 4KDFA 4MA0A 4QGBA 5CLFA 2XVXA 1J6UA 2R8OA 1SMKA 2WAAA 2V7UA 3R6DA 5GWXA 2F1KA 1EM8B 1QLWA 1MOPA 2IW3A 4P3NA 1QYXA 2AVDA 2A1TR 5DF1A 5J58A 2ZR7A 3PFHA 4AXBA 3A1TA 2PO5A 1ABBA 1P81A 4GPBA 5A05A 1GAXA 1OXBB 3C24A 3UVEA 2WM3A 5K03A 2AXQA 4D4LA 4GRIA 3UJ8A 1PUJA 3CKMA 4RE6A 1SM4A 2CLHB 4MDFA 5AVXA 1ECGA 5LBTA 1ZONA 1QPZA 1GGNA 1EWRA 2R6JA 1FQKA 2IZOA 4IDFA 1MJFA 2A86A 3ED5A 2PZKA 1B8VA 1UF9A 4GR9A 1E9AA 4D3DA 1RLIA 2O8FB 1L1RA 3NYRA 5K0FA 1A5SB 1YI0A 1SU6A 3L8CA 1T2AA 4KTTE 1FDVA 1FB5A 5CB4A 2QTRA 3V8RA 3M0EA 4ZQBA 3CGWA 1YL7A 3WLTA 1JQ5A 2OENG 2QZ4A 4MQBA 5FIUA 1TECE 3B6IA 3A10A 5FBKA 2WVHA 5BURA 6AT1A 1NJ5A 3LA8A 4NZOA 2DVMA 3DO6A 5FEUA 3LIPA 3W2IA 2ZB2A 4B7CA 5EWLA 2OILA 1IN1A 4YRMA 1ZGGA 1THTA 4K6CA 5JEEA 1YRYE 2HF8A 2QX7A 4G0ZA 2XOKD 1Z26A 1NZDA 2AHOA 4XX0A 4EG1A 5CP8A 1S3IA 5KTKA 4G63A 2GXSA 3PXCX 4PQFA 3SIXA 2QMEA 2NMVA 4PAWA 3D31A 1BOOA 1PEKE 3SF8A 1QZZA 4QFDA 2NAFA 2QM7A 3EXG2 5KKNB 3E9EA 1P4AA 1BMQA 1GZ5A 2NTNA 4CVNA 1VIVA 1EK2A 3WR5A 1R4MB 3HZHA 4UC0A 3U3ZA 4YA6A 2UUPA 4QD3A 2QMHA 4YJ2B 5JIBA 2OM6A 5IW8A 1JXOA 1KDPA 4L4SA 2ENWA 1N2ZA 2R48A 1NSTA 1PJQA 4LI3X 2A88A 1SU7A 2B8EA 1CRPA 1Z36A 2YJZA 2YVLA 4LZAA 4MX8A 5DHQA 2GHQA 4BP9A 1GD1O 2GM3A 1BRMA 4I5GA 2CL0X 2QT9A 2FN3A 3PFCA 5G4LA 5JNUA 2OHXA 1E69A 1HXHA 2BM0A 2WC1A 3KSUA 4G09A 1APBA 1XA3A 1W7AA 4KXVA 5K0LA 4YYEA 3OURA 4Q6BA 4TTSA 1GN8A 3EVBA 4JL6A 4Y6OA 1PSZA 1PD1A 2PA0A 2YYZA 2YIJA 4Y0AA 3BGVA 4S2UA 4DSZA 3ZLVA 1SUAA 4MVJE 1AJEA 2OYCA 4ZZ0A 2UAGA 1QX3A 3IKJA 3M6WA 3OPYI 5EY5B 1KRHA 3T3HA 3LSTA 2E37A 3PQ8A 4KKXB 4NMHA 3ZCUA 1E96A 1EXNA 1P7PA 4KXNA 4F71A 1BKDR 3F7OA 4OB6A 3U4GA 4A2WA 1EBBA 3N6VA 4Y1RB 5BUCA 4NYJR 4C08A 4YT4A 4R9NA 3R7WA 3F6EX 2ECFA 2NNLD 5HKLA 3HJFA 1Z45A 1SG0A 2B3TA 4KSYA 4QXPA 1PSWA 3MGBA 3N2IA 3GLIE 4GVPA 1DAMA 3ENZA 5FB3A 4FFOA 1JA1A 1DLIA 1SN7A 2KX7A 2VP5A 5D3ZA 2XUJA 1T36A 3IOYA 3LPLA 1B41A 1QG0A 2W8ZA 4A8PA 3KQSA 4IHJB 2MR6A 3TW8B 3BWYA 4P80A 3GBVA 1OC4A 2JH9A 2I65A 4B6PA 3RS3A 5FTLA 4EELA 4X64B 2VYFA 5C7IO 4JS0A 1N1MA 2C04A 5BR1A 1OYOA 2F1RA 3CM0A 3GRVA 3HO6A 1U99A 3KQMA 4P7JA 2CLCX 2X86A 3B6ZA 3K70D 4UNSA 5IDVA 3IE2A 5H16A 2F7SA 5CXUA 5CVTA 3EC2A 2XRFA 1PR6A 2RGNC 4ZQEA 3OHPA 2QR3A 4P22A 1T8WA 3TVYA 3Q3JB 2JA1A 1FBTA 4Z4GA 1T0JB 4OH1A 2HN9A 3PHHA 1N2BA 3PFKA 4H7IA 3C6QA 8AT1A 1RZ3A 1FLAA 3M4YA 1GUDA 1LUAA 2HWXA 1YZFA 3PPWA 1Y1LA 1NUTA 1QHFA 4YY3B 3IT2A 1MX1A 1VPLA 1VP3A 2P41A 3LLVA 5FAKA 1ADCA 3DOOA 4UJ5A 4KCGA 3S1AB 2WWFA 2XZTA 4N8DA 2ZDGA 1IUOA 5EUCA 4ARZA 1RQ7A 2DQZA 5CW1A 4PNHA 1NVAA 1SPBS 3VGPA 3IUJA 1W2HA 2OFPA 4NECA 5F5LA 2BMDA 1WD5A 3FDZA 5FWYB 3V46A 2ATIA 4IZ6A 1HZJA 3KOZA 3OTGA 4M0KA 2GAFA 1WZIA 2GKSA 4RPIA 4X20B 5FL3A 3I58A 1GZSA 3ZV3A 3IR6A 2QTTA 1N2OA 2VPQA 4MR9B 1UJCA 1VLJA 4OFBA 1Y3HA 1FYVA 2BFDB 4EBBA 3H83A 4G5HA 3UM9A 4ZCMA 4MRMB 1F1JA 1H1LA 3EIHA 4FEGA 4J1NA 2V7GA 2QX9A 3EOAI 4UD6A 3EZ9A 3IP7A 4LKOA 4H3VA 3RCBA 4WFQA 4EHIA 5KWSA 3JWGA 4C1BA 3Q12A 3ABIA 1WOMA 5K3AA 4O08A 1ADBA 1KARA 3LRTA 5CT5A 2WQ6A 2QUHA 1X1TA 2VF8A 2YHIA 4C7OA 1CUSA 3HCRA 3DDSA 4FGSA 3VR4H 1W4ZA 3KOMA 4P4LA 2DHQA 1BHJA 4ZV4A 1ZCJA 2JIBA 2BGWA 3NHKA 3D4LA 1DOZA 4AWAA 4GG1A 2WJ4A 4BGEA 1OWMA 3H3FA 3RE1A 3WDKA 1TD9A 3HA3A 4I8IA 2HX1A 1AQNA 1F2UB 3CT6A 3ORRA 4TTVA 2GYWA 1R00A 4WLNA 3P0HA 1F4PA 1T1RA 4V0SA 4Q00A 4XDHA 5AM0A 1ZJWA 1SUCA 1NJFA 1FS5A 1TT7A 2FPRA 1I8TA 1FLNA 3CG4A 4L51A 4YJ2F 1XDUA 2CFCA 3HS3A 2BI8A 3PVCA 3NWPA 3PNBA 4FMDB 2D5AA 4GEGA 3IEMA 3CLRD 1TZKA 3IMCA 1T1SA 2BGNA 1QGAA 2Y9PB 2CBGA 4BVBA 3LYAA 1F4LA 2ZULA 2REQA 4WN9B 2W8BB 3FSGD 1X1RA 3WWEA 5G4KA 2BKAA 5LU9A 5JJCA 3RROA 3N87A 4V1CA 2AX3A 2AJTA 1ZVQA 1ML3A 3HBMA 3VR6D 1GR1A 3IEPA 5K8VA 3HNOA 1DRKA 1YK1A 4B3CA 1MAVA 3GLGA 1FA9A 3MRSA 3TNFA 1E77A 1JHOA 3QUBA 2LIPA 3SX2A 4KQ1A 1Y63A 2GKGA 4NMMA 2P6MA 2B5VA 3SKYA 1SBNE 1PJTA 2NO6A 3I9FA 1H8ED 4UMEA 4BB0A 2V7QD 2V0CA 5EE1A 1GFZA 1E2EA 3GIDA 5L45A 4WKCA 3DFIA 1E2NA 3HFJA 1NUUA 1C0PA 2K7ZA 4TM8A 2PUBA 5SZKB 1F14A 1JFTA 5JALA 1O03A 1UZAA 1FVHA 2BAGA 5A4KA 5B7PA 2D0OB 1Z8DA 2PUGA 1YRHA 2YXNA 4HI0E 4R4JA 5AP9A 3LNCA 5GJCA 4WACA 1M6VB 2QG9A 3CWCA 3VRHA 1MGPA 4G5SA 3ODPA 2WYIA 1EBFA 5GTDA 1DRWA 3TS1A 4DLTA 2ZIEA 3EGWA 3RHFA 2VQSA 1DAHA 2P3LA 4CMKA 1T4CB 1TC1A 4BLPA 5CCXA 2J3MA 1XLWA 4IHJF 2JKYA 3FETA 1GU1A 1NMYA 1OI7A 1P5FA 4N01A 1AHHA 2FKAA 3SWWA 5FULA 1WKCA 5KJEA 4ZTZB 1XG5A 3ZGYA 4MJ7A 3H04A 5A4FS 2P68A 2C07A 2TYSB 3NH6A 4DDHA 1Z2EA 3KQUA 3WRVA 3MTBA 4BBJA 4Q4JA 4YS6A 1UBUS 1YQXA 2BR3A 4MPPA 1KH3A 1L7DA 2QRPA 3C70A 4OXQA 3O8OB 1W6UA 1UC4B 4QTTB 4R69A 3AIIA 3H42B 2Y71A 4O0MA 1MQAA 3RSOA 4AUKA 2XQGA 4LV5B 4BU0A 2FZ5A 1QK5A 3K1YA 2D54A 2Z4TA 4K6MA 3T3MB 5CG1A 2QQ0A 2F4NA 3OECA 1V8DA 1KMQA 1YTLA 1ZG3A 4NBTA 3NVKI 1QGOA 1J8VA 2BM8A 2ACVA 1VJTA 3LK7A 5IZCA 4DG8A 3N3AC 4EY7A 3OO0A 1E9RA 3AEQB 3HK2A 3AONB 3T5TA 4HUTA 3IPAA 4UXJA 5IAEA 2IV3A 4R1SA 2VJCA 5IHPA 2G06A 5DNUA 3P7MA 2HJHA 4Y2YA 5B3AA 5I8PA 4B8ZA 3QKUA 5D5PA 2A7XA 3DC7A 4B6EA 3CR8A 4OUKX 5HPYB 3D1VA 1OH8A 2WUFA 4JR1A 3ZU4A 4EFDA 2RBEA 2XCTB 3ETCA 2P2YA 1SNYA 4ID9A 3ZGVA 4UNNA 3ZYZA 4PZZA 5G0TA 1YDEA 3ENWA 2P77A 3IL2A 3L84A 5H4HA 3QSGA 3U48A 4MGHA 1F38A 1NYRA 4JJEA 2BM1A 5HF6A 4EW6A 1XEFA 1Z3IX 3A4NA 3R5HA 2PMBA 5GONA 4LVNA 2OFFA 3GUYA 3W6NA 1Y8RB 3L6UA 3QVXA 4YT5A 3U81A 3ZHXA 3T15A 3W2HA 5MN5A 4P4SB 4P3XA 4AIIA 3DMYA 2H1VA 3I6IA 3VC1A 4UTVA 1R6AA 3A1VA 3WGUA 4Y0VA 4Q9LA 1Y4SA 4BBAA 1VSBA 2OUIA 5B1HA 1M2NA 1BE0A 4Q4HB 1YTUA 1XNRB 3OZSA 3E48A 3K05A 4RENA 4ZI3A 5A5FA 3RRXA 1OYYA 1ISSA 2ECKA 3IV9A 3VSEA 1HLDA 1P7WA 3HE3A 4BQSA 5M7EA 3AV0B 4L15A 3QLEA 4KC0A 1J8MF 1RE1A 3VMMA 4CUKA 2H5JA 4QUIA 1JMYA 4JOSA 2GLTA 5FI5A 2EL7A 3GLFE 2CYBA 3K53A 2QLLA 1E2UA 1HDRA 1D5CA 1NW5A 2XMCA 3BXGA 3HKBA 4R8RA 2EKZA 4BMNA 4TV8A 2ZCJA 1SB8A 4DFDA 5I7FA 2GUWA 2C5FA 1G5HA 3PFFA 1MDBA 4YRDA 3QPDA 3T9FA 1R3UA 4FMDF 5DCWA 4D8TA 1SZCA 3W3ZB 1EXVA 2DWOA 3QMWA 2B8TA 2FRDA 1GGFA 3U4IA 2ZXUA 1WHSA 4JJZA 5DN9A 2FWAA 4BP8A 4FGJA 4W1PA 1YU6A 5FL7A 2WJZB 2PH3A 5FWXA 1F1BA 1F2TA 3JZAA 3RODA 3DMDA 1T2FA 4G3XA 3QOYA 5BUQA 1OLXB 2Q3HA 3BXXA 2FHPA 2VEOA 5BNFA 3R6TA 1Q2XA 3T8YA 1XD2A 1L4LA 4C6TA 3WYBA 1UBRS 5AM5A 4LGMA 1ADFA 3CEAA 2JZOA 3OFSA 5G41A 3DULA 2ZJ3A 3LT1A 1ADJA 2PT5A 1ZL2A 2NLOA 5FT9A 3ZKWB 5B36A 3VVCA 5LLDA 3ZNPA 2QNIA 1IDOA 1ODKA 1TO2E 3H11B 5H9VA 5KTPA 3M2PA 3WLKX 1Z29A 1VBNA 2C95A 1STOA 5T8KC 5G3YA 3EXAA 2J31A 4RF2A 4RF5A 4HTFB 2HCBA 5FAXA 1E3EA 1OI2A 1VPDA 1DJLA 2K6GA 3SBEA 1PS9A 1PYDA 4BNJA 3IKLA 4QNMA 4YJHB 2ZRNA 4CR8A 4EGJA 4AJHA 2V5VA 2VHTA 3MELA 3RS0A 1QB8A 4DA7A 1QANA 2CJWB 1NW9B 1XTQA 1ZK1A 3HN2A 2G40A 5LP6C 1ACMA 1Y5LA 3HXOA 3FMIA 3KHUA 4DRYA 4JROA 5DHSA 1OH7A 3DEIA 1F9AA 4AAYA 1J2UA 3P94A 2QL5A 4ZCPA 4J0JA 3LDGA 3CE6A 3H2SA 2VQFB 4XDGA 3E6AA 5EMJA 3VKWA 5I8WA 1N2CA 2VP2A 1IG0A 1GNVA 2CE2X 2J8ZA 1M34B 3NT4A 4FWIB 2H7VA 2O54A 4ED9A 1RJFA 4J07A 3VVMA 4YN3A 3X3HA 1XZJA 2EBHX 4WBNB 4EPYA 3CR3C 1ECBA 2BTOA 4Q4AA 2PV7A 3D4OA 2BFWA 1W8IA 2ZI3A 3RK1A 2WJ3A 4CU2A 3LTEA 3STVA 2CT8A 2DOKA 1QE5A 2FFBA 2WNSA 1U7UA 3PJEA 2Q6LA 5CFNA 3MWFA 2OCKA 1WUIS 1Z2CA 2O3JA 3EAQA 2GFHA 5BN5A 3GFOA 2IRWA 4JOCA 2VSFA 3ME5A 1SAYA 2QVBA 2R1VA 2V6BA 4G23A 1KZ6A 1WR8A 3ZDFA 4B40A 4BXOA 2ZU6A 4MVJG 2VJAA 4F91B 2YMLA 3EQ2A 4QT4A 3QM1A 4BAUA 4BJHB 3NV7A 2WYHA 4E32A 4JYPA 1KYWA 3L0PA 1WVIA 1EG2A 3WG9A 2CXQA 2B2XA 1R6XA 4Y9RA 1YVEI 1SIUA 4P3OA 3F5QA 4NG4A 4A2CA 1SHLA 1EX1A 4HVAA 4H3HB 4RQAA 2HSEA 5T6MA 4MZDA 1A4IA 3TK1A 2W9XA 4XB2A 3AUFA 3UPTA 4XWYA 1MTOA 2J0SA 2EP7A 3U6KA 2AJCA 3QXSA 1G6KA 1TK2A 1YHYA 1UAYA 4M53A 1PAUA 1MORA 2EYUA 2H1IA 2J07A 2RJ3A 1GZ7A 1L3CA 3RSLA 2AFVA 4F12A 4EVIA 3D5EA 3HXQA 2RHLA 4C0KA 2F4VB 4FOPA 1F0NA 4OX9Y 1QRSA 2VJBA 2XUQA 3I09A 1IUKA 5TARA 5TVGA 4C87A 4CN9A 4K40A 2JFNA 4ACAA 2XOKA 1F2DA 4B75A 2FF5A 4H7PA 4ZV7A 3D0QA 3TUJC 1JXQA 1JR3D 4RTNA 4MP6A 4LQCA 1PT7A 2I54A 3TD9A 3O95A 1P60A 4KLRA 4MIOA 2EFCB 3H17A 1OOEA 1DAIA 5HILA 1U0OC 2HK7A 3FCYA 4IS3A 4KHZA 1H93A 1HORA 2O7NA 3I2YX 4X91A 1UFOA 1XQYA 3PUWA 4HSGA 1DDOA 1QKIA 2IOYA 3CX7A 1DWUA 4JJ4A 1S7CA 4WA8A 4Z4QA 3CF2A 3G2HA 4KQCA 1DWQA 1PG0A 3G8BA 4F7WA 4HAYA 3R7LA 1Z6XA 2XQIA 3BWMA 2WJIA 3WL7A 2QL9A 2TMYA 3S44A 2AJ8A 2Z9BA 4C5CA 3BWEA 4KQXA 5D85A 2OE2A 3FUVA 2XT9A 4LXHA 5E1DA 5KO2A 3GT3A 2OGZA 3DBRA 3HV0A 4WLVA 5CDFA 5CTJA 1RPZA 3H0EA 2O52A 4CDRA 3IQIX 1TM1E 2R4UA 3LVQE 2OEPA 5BWMA 1DV1A 1P33A 3BCSA 2DZDA 4O4IA 1T5OA 1N6KA 2CNKA 3QI7A 4FQ7A 1K7XB 4L1KA 3WNCA 1D09A 1GGEA 2O1SA 5DM0A 3H87A 3OMWA 3NBXX 4JLPA 3M6LA 1YJ5A 1BG6A 4GEKA 1A9TA 1P0PA 3AIOA 4NBLA 3ZBQA 6CHYA 1TAUA 3GY0A 3TL3A 5GINE 2Q7XA 4ND8B 3FZQA 4L8GA 1THMA 1SUPA 2AN5A 3WGTA 3ZWAA 4CGZA 1MOSA 1V35A 3BT7A 2G07A 3KL2A 3LDHA 1SIWA 4E7OA 4MVCA 3SK0A 1KEWA 2R1TA 3D5TA 4A0HA 3I9NA 3B9PA 4F4DA 3BB4A 3K9QO 3NFYA 4YJGA 2XVYA 5AI8A 2R5WA 4IAOA 5AVOA 4YREA 1U5BB 1S8OA 1P17A 4FSXA 1UINA 3DJFA 1DEAA 3WZ2A 2OFOA 4JITA 4YWHA 4J94A 3WZMA 4RTJA 2Q2QA 3UXHA 3OQMA 3TE7A 1O97D 4MRSA 2R7LA 2VDKB 4EZBA 2VDWA 4KKVA 1DEXA 2GBIA 2I8LA 4NCNA 3PPIA 4ZRMA 4ZRNA 2VJPA 2OK7A 1IFXA 2H1WA 5IS2A 2BGIA 3LKZA 4J3NA 3ZOKA 1ZSYA 1SOUA 2AG1A 5A3VA 1YL5A 4HLNA 5EUMA 4BO2A 3JQDA 3KQKA 4ZMRA 2H16A 4P5EA 4OI2A 4R1UA 2V4UA 4J0HA 1NF9A 5I9NA 3NOQA 1WPQA 1FVXA 2PT6A 1ZVKA 2CVZA 4IJUA 3VU9A 2M6SA 4H7HA 5BSEA 1RPTA 2OOSA 4DLBA 3HRKA 3GPDG 3Q8WA 2HL6A 2CC2A 4E0BA 1C3EA 2PRZA 3CUEF 1FUUA 1WB6A 1X8XA 3ZEIA 3UC9A 1SXQA 1NY6A 4AN1A 4F1KA 3LVBA 2XBUA 5A4JA 3B1XA 3QV2A 3AM5A 3UUFA 4Q34A 2PKRA 3CX3A 4IPTA 1N6PA 2BEUA 5LZ8A 5TQ0A 3T4PA 4M76B 3T41A 5KOJB 2GCNA 1TKAA 1U2SA 4G8CA 2V6GA 4UBJA 5KYWB 3G9TA 3KVOA 3WP0A 1XK7A 2NXWA 1T5IA 1PTKA 3BUSA 1PO7A 4C04A 1EWQA 2I03A 3SF0A 3SIPA 2C5LA 4PINA 2OB1A 3UV7A 1RXYA 1QDUA 3TD2A 2BDUA 1WDWB 3COVA 3QPAA 4CMIA 1JKMA 1OXSC 1X7WA 1PDOA 3NHZA 4ARVA 1OF1A 4BLVA 1T0UA 4P98A 1XRJA 1NLZA 5CH3A 2FAXA 2HMSA 2YX1A 1QR2A 1IRIA 2IEBA 4Q4LA 3UMRA 2IHUA 2WOJA 3NHPA 4LWPA 4MW5A 1INLA 5FP0A 1NP3A 1KH1A 3PI7A 3L7IA 2ZJ7A 4KFSA 1TYCA 3ZTTA 3WA7A 5I3ZA 1P3JA 2YJTD 3U1VA 2QSZA 1EGAA 3AJDA 1NAHA 3T7SA 1KYVA 4FT4A 1IN7A 1N0HA 1ORRA 5K3OA 1P0IA 2JJYA 2HR1A 4L16A 5JZ9A 2ZGVA 2YJ4A 2VJDA 4BVEA 1ZFNA 1VIYA 3UUWA 4JI8B 4S1NA 3WA6A 3LHFA 3LP8A 4CLRB 2BGRA 2J6IA 4A5OA 1PDWA 5EXXA 4MW7A 1DJQA 4LGYA 5DLYA 1XPJA 4CM4B 1TDJA 5FPYA 4C6HA 3IRVA 2WUDA 4RACA 2ATVA 1BKYA 3KE9A 4HGYA 1DCFA 3DV9A 4F04A 1RAFA 4F46A 1ZOIA 4MB2A 1JT9A 2NN3C 3ZCQA 4PHTA 4QNRA 2YUIA 2GBLC 3SNKA 2G1UA 3ZW9A 3JVVA 3X2FA 3ELBA 1S9HA 4XFKA 3RRYA 4DKJA 4QUDA 3I1YA 4I81A 1H2FA 1KDZA 4GMFA 2WJYA 2XA2A 5EAIA 2AG5A 2HDHA 3FSGA 5BPFA 2XRMA 4O2LA 4BMXA 4IIGA 1QHNA 1A9PA 1OA0A 5LA6A 2DFLA 1L5YA 2ODWA 1P39A 1RS0A 4HFNA 5FBQB 2V5UA 3VR6A 3W5DA 3ECCA 4JKIA 1QU3A 1IN4A 1UPXA 3G7UA 3ZHBA 3ZE2B 1D04A 4G0VA 1O6FA 3I2KA 4BX2A 4J9VA 1JHPA 1KMHA 3BFJA 1H8EA 2I3ZA 4BEBA 4O2BA 2WJVA 4D42A 5HVNA 5BUZA 4MGYR 5EZ5A 3BX1A 3N1UA 5A06A 3E4DA 3NLLA 1V3QE 1XYGA 3J80A 5K0TA 3QKSB 1FNDA 4RQBA 4QM6A 2P9EA 2EKBA 4BLRA 1OXUA 3S5JA 5U1PA 1GTG1 1MABB 3NTVA 3O1JC 1P0CA 5ICCA 2NU8A 3I4LA 4V0NA 3ACBA 3TOXA 1XR3A 4ND7A 5DTJA 4IV8A 5FPTA 3FI9A 5K8CA 4X3PA 1SHUX 4DOMA 1NXXA 5J4KA 5KTOA 4KGVA 1VCNA 1O6BA 3WL6A 1R5OA 3S40A 3F4KA 4JLUA 4EUNA 1F7UA 2FN9A 3GXOA 3RPEA 3LHSA 2P67A 3FVQA 4R1LA 1SXJA 2BL4A 1KK0A 4DNFA 2XRZA 3FCAA 4ACBA 5BN3B 2GR9A 3R0XA 3RVPA 3WB1A 4NVRA 1NASA 1LDEA 2AJBA 3PD0A 4HADA 4E94A 3U5TA 5JDCA 1B2LA 4HDSA 5FLXA 4C2UA 4RY8A 2AUTA 1MB9A 2Q45A 1RYFA 4OHMA 5EMLA 3K6SB 2P7IA 5LQAA 3O9ZA 1MO6A 4U5QA 4XQGA 5EESA 3M6IA 3V3KA 1TU3A 1TFRA 3BL5A 4YMSA 1S2GA 4KI7A 2LUOA 2DPXA 1CEQA 1QRTA 4GBED 4AJ2A 2CCKA 1FYWA 2ZE7A 1AK9A 1DOAA 3RAJA 3IHKA 3OOWA 3SFZA 4KGZA 4PSCA 4XSVA 3H6HA 4RD6A 2X23A 3TZCA 5DHFA 1QQTA 3BAZA 1TEVA 2IUUA 4DV4B 3V42A 4POOA 2DWPA 4CETA 2A9VA 2PTHA 3LUGA 1DUIA 2GCPA 4AG6A 4B3MB 1KYXA 4HXYA 5EXEA 2HU8A 1U81A 4LC1A 4MIEA 4LCBA 2VF4X 3V48A 1FMLA 4MARA 3ONDA 4DV0B 3OLWA 1X70A 3C5WP 3HHEA 5AHXA 1ZWLA 4XCVA 4V39A 1XZNA 3PPXA 1SCUA 2H4FA 3S2ZA 5LMCA 4AQDA 1TKRA 2ODEA 3V33A 3Q5GA 4QELA 3CH6A 1IZ7A 1WZEA 1GADO 4KN5A 1GUFA 3Q2KA 2WSLA 4V02A 4LYDA 5AOVA 1LBQA 4E2ZA 4M99A 2VUIB 3OHMA 1TYZA 4FNMA 4GLOA 2UYGA 4W5OA 1EAMA 1TUBB 3ZWQA 4AI6A 4YRJA 1K75A 2RK4A 3O31A 5AOCA 3RVOA 4C4XA 1TCAA 4EQ6A 2FMTA 2LBPA 2OB2A 5CLJA 1OZFA 3HPRA 1C0KA 2HWYA 4I4CA 1EFPB 2ONCA 1UQUA 2PGDA 1FX1A 4DADA 4XYEA 1GKUB 2FW1A 4I08A 3EVEA 2ZRAA 3EYAA 1O57A 1IZ9A 3I9OA 3HL4A 1J90A 1CVIA 1B42A 1LBEA 5FHQA 3J7AC 1QH9A 1VSUA 2ZJZA 4Z0PA 2XB8A 3HJGA 3K96A 2AI1A 4JC0A 1D9ZA 3I6BA 2ODQA 3QE3A 2A6PA 4L4UA 2FOLA 4CKYA 1KVQA 2Q5FA 4KRGA 3K1ZA 3L0ZA 5J2TB 4BVLA 3THXB 2Y93A 2GLXA 3H9UA 4HBGA 4HNAA 1JDSA 5H81A 5CPFA 1KKLA 3VOTA 1NRWA 3KD3A 4UVGA 2MDTA 3PWTA 5COBA 5IM5A 3KWMA 5EQFA 4DIFA 2AE2A 2ZWMA 3IJPA 4QTUB 5ADHA 5JDIC 4P9NA 1CRZA 3OJEA 4JKYA 3QIVA 5CA1A 2YIMA 3KQYA 2EOAA 4GWLA 1SU8A 2VN8A 2JLWA 5K9ZA 1ORIA 2YC2C 3DZFA 1UPAA 6YASA 1DCTA 1BX0A 4DAEA 1DUSA 1BH6A 3MFQA 3BB1A 1N0VC 1M1NB 4AJLA 3N58A 1UQTA 5CW2A 4IGAA 3MT7A 5H3LA 4R7TA 2G9ZA 2B7CA 1A04A 4HV4A 3L7KA 3PHIA 1ZISA 9ATCA 1YCGA 3OD5A 1LLCA 1THZA 2I2XB 5SICE 3DE0X 4CL2A 4NZ9A 1WEKA 1QE3A 4BZZA 1QP4A 5FPPA 1X7YA 4YRPA 2V6FA 4R16A 4X93A 3A2NA 1H05A 1N9ZA 4NICA 2ZTSA 4PC6A 1KAEA 4KU4A 3RWOA 4YRSA 1MJ5A 4DUGD 3NUGA 5TS2A 4U3JA 2ZRPA 4F21A 4F97A 4HWTA 4J75A 3AWDA 4O33A 4ZYWA 4ML3A 3V1NA 5KCZA 5CYFA 2RGWA 2C92A 4OU4A 3LOUA 1DHRA 4UNRA 2Z4SA 4P36A 2QLBA 5JO9A 2HWWA 2VPTA 3C16C 3GZTB 1U8EA 3QX9A 1K6XA 1P80A 3GG2A 4V0KA 3NVMB 1QF6A 1EVYA 1KKUA 1ORVA 2VP9A 2ZUCA 4A0SA 2BONA 4LHWA 5DOVA 1EDOA 5AJXA 1D6MA 1WXIA 3TLBA 1GOTA 2G72A 3OWHA 3KT3A 2V8BA 1EJ2A 3V32A 1Y5NA 3K0AA 1T91A 4LXTA 1G21A 4YRKA 3WB9A 1R9MA 4X7BA 2PRIA 3EXFB 3PGVA 2PKQO 2YR0A 4K2AA 2FETA 3F3YA 4DT1A 2VRCD 3WWOA 4GPIB 2UUBB 1GU7A 4MUEA 5IVHA 4LXUA 2X8BA 3O2SB 5LB4A 4D26A 2I7XA 2O3QA 2LIVA 2R00A 4KP7A 1RRFA 1PZGA 2YJ3A 1Z6TA 5K3FA 3A1DA 2IKQA 1KZGB 4I4LA 4NYIR 4GHWA 5B3JC 5KNBH 4IDHA 2B35A 3VU0A 3IB6A 1KY5A 1QRDA 3HFGA 4IILA 1NC3A 4U9IS 4EDFA 1Q91A 4J1TA 2Y9MB 4RFSB 5F23A 1JDZA 4C3UA 2C5AA 2IXAA 4G81A 3ZQUA 2BLNA 2OKGA 2CW5A 4UU8A 1RYNA 2YN4A 5JSUA 2XCIA 4RFLA 5C7LO 2WF7A 1MB4A 1U94A 5SYAA 4ZOLA 4BE4A 1O58A 3I6YA 3S2YA 4BLSA 3BM5A 1KSJA 2GUGA 2HMWA 1M0WA 3E3MA 4YIKA 1NUAA 1TJ5A 2M9MA 3KQPA 3K9FC 4D3FA 3QJYA 1H2AS 3EVZA 1A7JA 3FD8A 5A03A 5LD2C 1FOEB 2XE8A 4HB3A 3HJUA 1G8MA 2GYYA 1J42A 2AC2A 4FYHA 3T38A 3OA0A 1ZUWA 4C1NA 3ZHCA 1BYIA 3G89A 1Z6ZA 2XQVA 3FMVA 4FC6A 5F35A 5KX5A 1J49A 3G82C 5E2IA 3JYLA 3Q3GE 1Z17A 3UT5B 1T9GS 3DDZX 3ANNA 1SKMA 4IEEA 5M34A 1JR3A 3DE5X 1LFAA 3D8BA 2QTFA 4JSTA 5D1NA 3I01M 2LVBA 1U3FA 1JHXA 1IEWA 1M6YA 2JIRA 3BJRA 4IGIA 3W1WA 2ZUEA 1C80A 2DFVA 5KU7A 3WS7A 5LQRA 4XXHA 4YCJA 2H5EA 2IEIA 4OHWA 4PAMA 3BCUA 1JJ7A 2AZ4A 2WWVD 1XMQB 2P3QA 4IJ6A 1BGWA 3KKMA 2Q5JA 4U7WA 2O0HA 2VK4A 4ZREA 3CY6A 3EPPA 5J2TF 3TZEA 3WDSA 1NBME 4MJLA 4QBTA 1E3MA 1V8BA 2CVFA 2QPLA 1M0SA 2Q6IA 2JBAB 3R5JA 3GJ4A 1LF5A 5DH9A 3G8YA 2JFGA 5ALYA 5KYUA 2BP7B 3JQBA 3TBFA 3C4VA 2JAXA 2Q9UA 2GM5A 4C0WA 4MVJD 2OO5A 2Y1XA 1J25A 2MT9A 3B53X 5MFZA 1ICEA 1JGTA 1F8YA 1DNPA 1U2QA 3EIOA 2WQZA 2LTAA 2JJ8A 5F12A 1JLLB 4MQEB 2OV8A 4U6SA 4AJ1A 2J67A 3T5CA 2J30A 2OZEA 1D6SA 1XD9A 1IOZA 3IOCA 1H9CA 2JFZA 1EVLA 4GDMA 2YASA 2R65A 4Q82A 1E3LA 4PPGA 4GT1A 1LY1A 1WPRA 1CUEA 2CNWA 1AY0A 2RHRA 4R1QA 2BI4A 4JJGA 3TPFA 4OBXA 3L8FA 2JASA 5A0FA 1FNNA 2ST1A 1EQ2A 4D4IA 3QW2A 1CZRA 1RQGA 4BQRA 3TB4A 4M0FA 1IVNA 1P8JA 4D6XA 2BHSA 4BC1A 4IGEA 3RT1A 3RYCB 3NIDB 1NBIA 3L49A 4FS8A 2PS1A 1PDVA 2X77A 4ZC8A 4B48A 2GAAA 4XUCA 4IYRA 5AJTA 1P5JA 2OHHA 4ITUA 3UMCA 1GG8A 4MA5A 2XRYA 1G38A 3V7UA 4IW3B 4F2HA 3GOHA 1ZUNB 4IEFB 3EDRA 5GJVC 3E7FA 3PEFA 2PNJA 5HK9A 1X19A 1E32A 1QG2A 1U8FO 2JCSA 3IEKA 1IBLB 4W9NA 5B30A 4GL2A 3HM9A 3AL0C 1TZBA 2E85A 1SCKA 4O1HA 4UHBA 2RBGA 4JL5A 2ZI5A 1H3NA 3ESRA 2HF7A 1NR1A 3JSAA 4L74A 3TQCA 4PBTA 3WLOA 2DEUA 4MDEA 3C8MA 3KZOA 1L4UA 3L5KA 5DNVA 5TDHA 1H22A 2OG2A 3CX4A 3QHPA 4W1SA 2QS9A 4QOSA 4CMJA 1QC5A 4CKWB 1AXEA 1Z7BA 2F1OA 2WD7B 1YIOA 2WIGA 3OX4A 3C4JA 4KMSA 4LDAA 4X63A 4DV2B 2UZ0A 2ZI4A 3KCQA 2O7QA 3LIIA 1GPLA 2CJXA 4RIFA 4JXZA 1G7TA 1XZCA 4ERNA 5JV5A 1Q7CA 3M1LA 3W6PA 2YNMD 1KF0A 2BY4A 4ZO8A 5E6SB 5GZ6A 3NBKA 5CPBA 4A8JA 1N1EA 4Z0HO 5IJ0A 5CTAA 1ZIXA 3FHTA 2BGJA 1ZRSA 3AO0B 5DCUA 1EAYA 4TL6A 2V5AA 3DDOA 1JG7A 5AW5A 1GDTA 1A69A 3DCIA 4LS3A 2EIXA 3R0JA 4EMBA 4JDPA 3GQBA 5HTKA 4KWTA 3ETEA 1CSEE 2GBFA 1U1EA 3IR5A 4UTOA 3U37A 2P2LA 3E70C 1KYYA 2XWPA 3IAM6 3LXUX 3P2IA 2PU7A 3MINA 3V8QA 1UKEA 3KTAA 1YVUA 3GWGA 3Q72A 4AJ4A 1U7XA 3K09A 2WAOA 5CIQA 4YUZA 3ZH2A 3VKFA 4IQ4A 4DQUA 4NFSA 2TSYB 1ZM7A 2Y1GA 4G0OA 5FNVB 2LKDA 2HUPA 2WFAA 5TPZD 3UMJA 4LYYA 4OSPA 1DWPA 3RADC 1R0ZA 2UV8A 3KBOA 4LMBA 1M2FA 5P21A 4MYHA 2BGLA 1DX4A 2J3QA 1JQDA 1XCPA 2FFHA 3GJSA 4EY8A 4NHOA 2AUNA 3HRHA 3KYIB 2O8BA 1IK6A 4QUAA 1RJDA 1ES9A 4NE7A 2CV0A 4YXFA 1ABEA 5IRCD 4QQFA 2BFNA 2JD1A 5CG2A 3I6ZA 1LDMA 3TIXB 5KTMA 4UQPA 1E8MA 2H57A 2C00A 3I53A 1H6BA 5CEJA 1JTFA 1N1DA 3TJZA 3ZVNA 1BYUA 1B3RA 2N1BA 5JFTA 1FZTA 2VHJA 4W6ZA 2FNAA 4ZI5A 4P4UA 3AB7A 4C43A 1XZDA 3GP3A 4K86A 1UXKA 1KE1A 2NOAA 1YUMA 5F9FA 1TX4B 2PKCA 2AEMA 4HDCA 4NJMB 3UCXA 4MEBA 4PR3A 3BYZA 2ZYHA 5AMXA 1CE8B 2QI9C 3H2IA 4LMRA 3SMVA 4IJKA 2QLTA 3GCXA 3KQQA 4II7A 3URKA 1FP4A 4DQLA 5JR3A 2FJPA 5EE9A 1PUIA 4UBKA 2YQ5A 3J81k 3BFPA 4N9WA 1KJQA 2D1QA 2V4ZA 1U7DA 2VDVE 4FDUA 4UTZA 4KUEA 2FWJA 1QORA 3RG2A 1E6MA 3SE7A 1EVQA 2XVZA 2UXCB 4L02A 2R11A 4DJEC 2PD3A 4XYGA 1XQXA 2PUTA 2J3DA 2FMHA 2MINA 3Q7SA 4D79A 3E35A 4IKPA 4UAVA 2Q2VA 4BDSA 1YF3A 1U1CA 1BHQ1 3PV0A 3ZGXA 4N5HX 1MUUA 1CF4A 4B35A 2FMXA 1EFLA 1N5KA 3GYGA 4IIYA 4JVOA 1UMDB 3UKJA 4E09A 1NI5A 1IZYA 1FSZA 2EJBA 3EUFA 3HN6A 2P11A 2ZRIA 3I05A 4G86A 5ANRB 1OLOA 2WB4A 4ZT2A 1AGYA 1FP7A 2P27A 2ZVQX 4KIFA 3ZWMA 4BMOB 1OHHA 3O92A 2BLLA 4UUMA 3I9JA 2B0CA 4R2HA 4NWIA 4WZBB 4X8HA 4KDEA 2ZM6B 4LBYA 2WVAA 1LF0A 1XCMA 1YQTA 3OM0A 5ENVA 3TQOA 1P4SA 2WV7A 4AC9A 4H4DA 3R3UA 3KLBA 4KVAA 2G77B 4DZRA 1VP9A 4LHXA 1DSSG 5CCDA 2OBYA 4OJQA 3ZBTA 2AOWA 4DIUA 2PMKA 5EJ7A 4C2AA 2M2IA 2ZQZA 1SVIA 3TOSA 3K9CA 3MM4A 3F1KA 2FN7A 1OU4A 3EF0A 3HWRA 2QZPA 1YS7A 2IHYA 1Q0UA 1HK7A 3BHIA 3LW7A 2PD6A 2HXSA 1YZLA 4G0MA 1TM7E 4CKZA 1ETUA 3AUAA 3U7GA 1AN0A 2YW9A 1U7HA 1SK8A 3BZBA 3FPLA 2H7CA 4LJ8A 1Z4KA 1A2BA 1YRLA 4IIVA 4MWZA 5KNCD 3LBNA 3VA7A 1KRWA 1OFIA 1ZINA 4LRQA 5AHOA 2OXCA 1V1MA 4DMKA 4ISBA 2GVZC 2EKDA 3GJRA 3HYSA 2QE6A 1SULA 4WFJA 1IXSB 3CVVA 1PNOA 4QDUA 3I5UA 2PZBA 1CQJB 2WD8A 3I4CA 3IR7A 2RGCA 3D3JA 4DF3A 4CM5A 1KK1A 1G0OA 2ZPTX 4LRTB 4Q7JB 2GD0A 3W7AA 3HDVA 1LBSA 1RPNA 1XZAA 2CNLA 2BTQA 1QV9A 3BJMA 1G7SA 4PS1A 2HRQA 3ASZA 1VKRA 2HH9A 4IDAA 3SYLA 4FLEA 4MQ4A 1MENA 4HQLA 4CM7A 2Q4BA 1LU9A 5HJ7A 3MMZA 2C1XA 2OCBA 5E9JA 2AMFA 1WQ1R 1HYHA 2J48A 2Y1OA 1UM9B 1H69A 2O57A 2YC4C 4OY3A 4Z86A 4XOUA 3NBQA 5DTEA 1CK4A 2GEKA 1UZUA 3L01A 1GP2A 5FNVF 2Z2XA 1M72A 1W75A 4E14A 4IF6A 2QRVB 3EPRA 3FYUC 3OUUA 3WRWA 4Z4HA 3W9YA 1T8YA 1NRXA 1UADA 1K2VN 3H84A 3IDAA 4Y98A 4MNTA 3RAGA 5B6IA 3ZR4B 3L4EA 5HR5A 3R7FA 4LJAA 1RC0A 4GOOD 2RD2A 1XXHB 1XZMA 1DQSA 1NT2A 4TN1A 1ZCZA 5E9WA 1P0QA 2ZT7A 1CY8A 1OLUB 1KPHA 3OQHA 1XCBA 1C3VA 2WWGA 3TX2A 1DC5A 1J2TA 1QF9A 2PEYA 1S5PA 4V1CI 5KDDA 1JLSA 3Q7QA 5D00A 1HKHA 4Z1MD 1GUAA 2QMUA 2J9ZB 4BNFA 3N7TA 2OD2A 1HE2A 3DVAA 4C20A 2DLNA 5IJWA 1OVGA 4LIPD 4W7SA 5CMLA 5E8JA 1CQWA 2H7YA 1Z63A 2YHUA 3EIFA 2O50A 4OIMA 4FYVA 3HWSA 3PQDA 2SBTA 2WE7A 3ZEAA 5AYVA 2VUSA 5EMKA 4KL8S 1ZD9A 4MUXA 2WLSA 3GCZA 4UCXA 3H2BA 4IQFA 3V8VA 1ACJA 2EL9A 1Y48E 2OWEA 1LLFA 3GLKA 3AUTA 4FLFA 1ZXXA 1TZJA 4WCFA 3SVZA 1GPYA 1TFUA 3V1UA 2OMEA 4CHGA 1MG0A 4Q01A 4Y2PA 1KVSA 4LOJA 5KHOC 2QAGC 4TMWA 2WLTA 5T3UA 3ZCVA 1DKPA 2QP3A 4KGXA 4ZIRA 4KPEC 2H92A 4TKUA 2JC3A 4RAQA 3PGA1 4BEWA 4L9RA 3WAKA 2EEZA 1A2KC 3KYCA 1X8KA 2I6XA 3WGGA 4EDHA 2I29A 2ZBGA 2FSPA 3P4UA 4N0QA 1U0JA 2WU1A 3L6DA 1KEEB 1NP6A 4C4ZA 5B4UA 4O4LB 1EM6A 3WAJA 5F98A 5JLJA 1YR3A 3CBGA 3QLUC 3T7TA 3TI9A 4D9GA 4W9MC 4FILA 2B21A 3LWDA 4DJ5X 2O4UX 5CNJA 5DKFA 3BMCA 2GAOA 5AUNB 2NV6A 5CD1A 3RLIA 1QCYA 1G63A 2F3PA 3BMQB 3LJKA 4JX9A 5AJWA 2ECOA 3U49A 3WK6A 4EVRA 5CVEA 3D3NA 4DUGA 2ANCA 3A0UA 2BISA 2X9VA 1OLSB 4WW0A 3TFWA 4AF7A 1WQ3A 3FWHA 5K5EA 5GGYA 1P9LA 2C4MA 3GN1A 5ECWA 3PVZA 1NBEA 2WKQA 1JEDA 4G07A 1GL3A 1CR2A 2BHRA 1Q1QA 3ETDA 3T12A 3GBSA 2GZ3A 3JD1A 1U8AA 2ORED 2ZSKA 1FEZA 1GGHA 4GZ3A 4DL9A 4XM0A 3PEEA 1V39A 3WGJA 5B1YA 1EK6A 1AKNA 1I13A 1USUA 3LUCA 5K09A 1E5QA 3KR2A 2E4UA 4GC5A 3PGLA 2NO4A 1U6KA 4D6PA 5JSKA 3HKCB 1O6ZA 1BX1A 2XUHA 4KQEA 4DCCA 2DR2A 2O8VA 3B1WA 3VJLA 3W5IA 3ZD6A 4CW7A 2AHRA 4BAZA 3STUA 1PNRA 1L5ZA 2JAHA 3DZHA 4Q7LA 3ANMA 1PNTA 3P4XA 2VRCA 5ENZA 3RBZA 2BEKA 3OX2A 1PGQA 2B4AA 2FPKA 3C15C 1DPGA 2IH4A 2FPPB 4QU0A 5A4MS 1N77A 3E9QA 1DJOA 1BMDA 4J4TA 4MQLA 3TOZA 1XNQB 1L1EA 2FCRA 2I5PO 1HT0A 1HZZC 1I9GA 1RWMA 1RZVA 2WSYB 4DCSA 4H7DA 5CA0B 3C3EA 4XWKA 3N53A 3UOAB 4C0AC 3GYBA 4CYMA 3QVLA 2V6MA 4ZANA 3ZW7A 1X7GA 1AQJA 3PTZA 4TT3D 3KETA 3EVNA 1KWGA 3BWCA 1L7RA 2Q3DA 5ICMA 3LOQA 1HFWA 4CLHA 1XVUA 5CDYA 1B6TA 5LDGA 4WCDA 2XHEA 4OSOA 3UCFA 3G2MA 3WE7A 4BUJA 1EFRA 4K46A 3IP6A 5HIIA 4QDOA 5MDHA 4PGHA 1P1JA 2ZRGA 3IVCA 3NEJA 3T4EA 3U7QB 2HJRA 3M5DA 3DMNA 3JQFC 2DXIA 3KKQA 2EFJA 1C7JA 2AW3A 5KOHA 3NP7A 8MHTA 4C5BA 4HYQA 1YMQA 3CH5A 4FYJA 4J43A 4NZZA 4FSHA 4DLPA 5HKBA 1MHTA 3AYZB 1TCVA 3R77A 1WHTB 4FFRA 5HDBB 3DLAA 3BDIA 3UJCA 5EZYB 1CUIA 1F60A 1BQEA 5I48A 2VYVD 1X9IA 1EIWA 3V8NA 3HI4A 2XTAA 3KTOA 2V8OA 3EASA 3EAFA 3GAMA 4BNUA 3LLSA 4BVAA 1EUCB 3T1NA 1W93A 2PTGA 3BCHA 3R1IA 1G3IA 5KDOA 4RY0A 5IBCA 2QVYX 2WU0A 2RKBA 4JI5B 1KFKB 3GWZA 1JKJB 4HLQB 5LXTB 4XVCA 1CXZA 4QVGA 4J0KA 4B46A 3RDPA 2F8LA 2GDJA 1ETHA 4CZ2A 3JVDA 3ZGOA 3KV1A 1C0EA 3EBPA 2OVBA 3Q15C 4HB2A 5FUVA 1QQ7A 2WYWA 2NZUG 1FMCA 2BIFA 2WKSA 3NTOA 1EJ0A 5E0KB 2FWMX 1DGQA 2Q4OA 4WY8A 4MVJA 1TOAA 1Y82A 3NNDA 3FH0A 3OEED 1NDUA 4RETA 4M0LA 1WSDA 2Q41A 5EIBD 2ZTVA 2EC5A 1P9OA 2WWYA 2I3DA 2I6GA 2RHMA 2AC7A 1BU5A 1V4VA 2AC4A 2LCFA 2O6HA 2R8RA 2VRWA 3FCCA 2ET6A 4J7XA 5EFZA 1W88A 2G4CA 4KBYA 3ZNOA 3RVRA 3WYAA 3GLIA 4HZUA 3FE2A 5ECDA 4FWTA 2PH5A 4O4LF 1U8CB 4DIKA 1PL6A 2OCGA 5IBQA 1IWOA 4Q3LA 3IAM1 3KEGA 4JI1B 3ZE0B 4LG1A 4YLGA 3M49A 3QRWA 4Q1VA 2VZ9A 1RU3A 2F1HA 1X92A 2VUTA 2BD0A 3F5DA 2IYAA 4HGPA 4HZIA 5ITSA 2AD1A 2UVDA 5K0GA 1DIBA 3PIRA 1VKNA 1WXFA 1UEXC 1RHRA 1NXOA 2ZT8A 3INGA 4AP6A 1Z0FA 3BULA 3GUCA 4RGYA 1WY7A 3B78A 3QG1A 4MJXA 3GU3A 3KSZO 3AVVA 1PVOA 5HFJA 2HJGA 3U31A 4UULA 3EBLA 2QN8A 4RANA 2Q46A 5DNYB 1Z6GA 3A9UA 1CJVC 2NU9A 2EGHA 2L19A 3K9GA 3OZTA 3WIVA 3I62A 3VX4A 2O2SA 3OPYB 2IELA 2FZGA 2YDYA 2P4QA 2IYUA 4A0RA 2O14A 5JS8A 1K6IA 4C7VA 3H99A 4JGIA 4EEZA 5EHZA 1AKVA 3WV4A 1YR2A 2W98A 1G6Q1 4J4BA 3FBTA 5J43A 4ZAWA 4YJFA 4KHPB 3WXBA 1JHMA 4DC1A 4DIEA 1Z18A 3DP9A 1TUIA 4OYLA 2IPNA 4B6GA 2YNMA 4JB3A 3ZBUA 5DWVA 4V2IA 3HDYA 2DFNA 2IT1A 3DEKA 2B9EA 1QYCA 3I3SR 1EGHA 1Y4AE 5F76A 3U9SA 3RANA 4LXQA 3DPIA 5JC1A 3BCRA 2W2OA 3DKVA 2HRBA 4L4ZA 5CA0F 3NEYA 1LBHA 3VHRA 5EJIA 1HOXA 4TRNA 5LZ2A 3B20A 3H9JA 3MC1A 2VA9A 1AKRA 2DJIA 3F5SA 4RABA 4C01A 4IWXA 5TV2A 1D3AA 1XRLA 2G4VA 2NPIA 2GCIA 3AHCA 3GRUA 4HAOA 4KW7A 4UHCA 5FUBA 4ERXA 1H1TA 5CVUA 1C1XA 2F8TA 2D4HA 3OZBA 4YDSA 1Z5VA 2VBIA 4GMDA 4HPXB 4A0FA 4BQNA 5CT6A 3MXOA 4AW9A 2J3EA 3DUWA 4GMKA 5TPZA 4IIJB 4CM1A 2Q3JA 3IJRA 3KQVA 5CDUA 1Z8FA 5C2JB 6PFKA 5DB4A 3T1OA 5IT4A 1KQOA 1OAOA 1XCLA 2XB6A 3DHNA 2IUSA 3CNQS 1TM4E 1ZX1A 2Q1YA 3UH0A 3DM9B 9GPBA 3LSYA 1RMYA 5ALDA 4A23A 3KFLA 2X8JA 4WXRA 5IXJA 4UDOA 3MWJA 1UK7A 1LVHA 4LDRA 2E5WA 3UAWA 1MNAA 4II2A 4R01A 5EZYF 5AVJA 1DBSA 3EA0A 1OAKA 2RGEA 1T0BA 2D2IA 4FDAA 3BEOA 1UBTS 4F5WA 3EQZA 4GXQA 3O8NA 4M1ZA 4ZYUA 4FEAA 1EJBA 4NL4H 4DPMA 4F9TA 1ZR4A 4OOFA 1DL5A 5KC9A 1B43A 4I55B 4O8CA 3TG8A 3NIGB 1ELOA 2RK6A 3D4PA 3SQMA 2C1ZA 2C5EA 2QNBA 1GNLA 3DF7A 1GNRA 3GLHB 4KX3A 1HT3A 4PC1A 5LXTF 1IJBA 3I5YA 4RA6B 1HL3A 4FGZA 4FONA 3VPXA 2POCA 2O8CB 1PK9A 3DE7X 1TT5B 3OUTA 5HJEA 2VT6A 3AETA 1L9KA 1E3SA 4OQZA 4C3VA 3WKBA 3JAKA 1MB0A 2CLOB 5GGXA 3BMOB 5FTKA 2V0GA 1GRRA 4MAAA 2H1HA 3KFVA 3LT0A 2ZYWX 3RHTA 2H1FA 3G0OA 3QFRA 4XAQA 2A3NA 2GPJA 5FH9A 3O4VA 2MWMA 2FY8A 1W1WA 4MLPA 4BFYA 5JJIA 3R3XA 1DFHA 1GFIA 1U0EA 3WGQA 2BHTA 2NO7A 2RSLA 4G24A 4BLUA 1HTTA 3BE6A 5FKJA 2D5CA 4ETIA 2W42A 1BVHA 1TF7A 1OTHA 3VU3A 3C5VA 3LA6A 1Q7GA 3SJZA 5DHRA 4Q3BA 3R6GA 4YX9A 1LA2A 3U9LA 2F64A 3L6OO 1BA3A 4U63A 4A9AA 3X1KA 5F21A 1VHLA 1NXWA 3VR0A 1E6CA 4I3HA 4ZZ1A 4IDPA 1YFKA 2B99A 2A9OA 1DG3A 2L2QA 2QDKA 3CT4A 3QFHA 4IIFA 3ZUGA 3Q0IA 2PSEA 1EP9A 1CQIA 4YRFA 3HFRA 1H42A 3U4HA 2J6HA 3OU6A 3QU7A 4HDAA 3VC3A 2BT4A 2HV9A 2I4MA 5EHIA 3G49A 3KD2A 4BN0A 4BMCA 3E22B 3K5IA 2GZAA 3SSAA 4D99A 3TCKA 4OGGA 3MWGA 1OU0A 2GPYA 4DB4A 2X0KA 3ESYA 3SLGA 4RVFA 2PSHA 2RK3A 3LHIA 2JIZD 2JGAA 4CKEB 1HDGO 2J3JA 3H1EA 1T9AA 3U7RA 1TO6A 5BN3A 1QH0A 1PFVA 3L79A 1BEZA 5I9SA 1XRNA 4MUFA 3G2IA 3GELA 4AZ3B 3HBFA 1G2QA 5BW4A 1NW3A 2QJRA 1Y8ZA 2D0DA 4RWEA 5KNCA 2ZJFA 3SVLA 2R25B 1SURA 1YCFA 3IURA 2YZ7A 9ABPA 1Y9EA 3KC2A 5AJYA 1DC3A 4G4IA 1M2HA 3LTNC 1IN8A 1DJPA 2C77A 1K6EA 1NVBA 2HRDA 2J4DA 3ESQA 4DYDA 4DBVO 2COEA 2HHJA 2CF5A 4PXYA 5JLAA 4F2DA 4JK3A 3QLJA 3GZ4A 5K3SA 2AR9A 1XOIA 2I8CA 2QRNA 3FUTA 4OG2A 4YP0A 4EYEA 4NOJA 4DCMA 2IU0A 3ANTA 2QUIA 1KYQA 3CNNA 4I1SA 4IXMA 3WIDA 3EZYA 1LVGA 1R0WA 4ZARA 3Q3EA 4KR0A 2E5LB 3TLKA 6REQA 1AMOA 1BD4A 4MLZA 3N8HA 3PFGA 3PXBA 4FX5A 3Q0TA 4BNVA 2DUUA 4I46A 3QEBZ 4ARIA 4B31A 5I8ZA 3WLMA 4AKTA 4IM7A 4Q12A 1J2RA 4IIJF 4WASA 3L8DA 1SQFA 2FPXA 4WXYB 1IVSA 1XYVA 2FPGA 2X4GA 2YXDA 2C2HA 2CYCA 2XTNA 2YWXA 1KAHA 2HF9A 2WE8A 2XNCA 4GMHA 2QQGA 2HQ1A 2MMGA 1BVYF 1DBWA 1DTWB 3E18A 4HX9A 1GSAA 4XDZA 4AVYA 5BQFA 4DR5B 4RMJA 1JQLB 3WIEA 1J0EA 2WWRA 4F1WA 1OCEA 3TLAA 1D0IA 1KO7A 1SCAA 2GK4A 4IQ8A 5DP2A 4U2DA 1E1QD 4MWCA 1YZNA 3AZOA 2NUTB 4OHBA 2NVUA 3GZNB 1SBTA 4FMCB 3ZQJA 1CUGA 1VJRA 3ESCA 3GLFA 2GN9A 1NLYA 3OT1A 4QPDA 4TLEA 1RXUA 1KI6B 3IB3A 1GL6A 2QQFA 1K7CA 3IRUA 1TLTA 2VDRB 4I55F 1BJTA 1PJZA 1CY2A 4H1VA 4OP2A 3C5HA 1M8GA 5KSOA 1QO0D 3I76A 4LAFA 5D01A 3WICA 1GUBA 5CBPA 4GKKB 3G13A 5WRFA 3RC8A 4PV7A 5AW8A 4Y9TA 3IHTA 1TZ2A 3RVSA 4RPGA 1NF2A 3E5RA 1JZSA 4BFXA 3RJ5A 4PCLA 2C4HA 2QM0A 4CM8B 1WF6A 3LUPA 4WE3A 5CLQA 1ZXBA 4HB0A 4CBVA 1NFRA 4I3FA 4MPDA 5KPJA 3GJ0A 4JUAA 2RGDA 2IZZA 1YFLA 3OWXA 5L7TA 1ESNA 3M1IA 4DY6A 2P6OA 1USGA 3TNJA 2PKXA 4JUDX 1P29A 1RIFA 1LSJA 2I7VA 1BMFA 4I9FA 4XD7D 3UW1A 3ICCA 1B00A 1TA9A 1UBLS 2P7HA 4PS0A 5A3RA 3E9NA 3DFFA 2M1ZA 4D0NA 1IC6A 3D2BA 3U26A 3L1JA 5HOQA 3TBKA 3KYDA 2Q6VA 2Q5IA 4JB8A 4N03A 1DT5A 1KU0A 3AM3A 3CC8A 3USCS 4Z5XA 4HLCA 5HS4A 3NG1A 5HF8A 1M0TA 2C2XA 4DRXB 5JJLA 4L8VA 1RRVA 3OJ0A 1N6RA 5IAGA 2GJKA 3QYAA 3EUAA 5FOXA 1M2WA 2BUAA 2Z9CA 3JAWA 2XDWA 4PO3X 3HYCA 3N74A 4RSRA 2F1IA 3CIOA 4O63O 3ZNNA 3NUZA 2B6HA 3FSEA 3NHAA 4E21A 3SFVA 1D1TA 1U9IC 3J81A 1W49A 1YJBA 3U44B 5AVUA 2FWRA 4LNUA 2JH3A 4MS1A 3OOEA 4K0RA 5C8YA 1BN6A 2GHIA 2IIPA 4KWEA 3AOEA 4KVFA 2CEKA 2C0QA 2QT0A 3TTTA 1PWYE 3FPGA 2B4YA 5LQKA 1DX6A 1BXGB 3QHAA 4UHHA 5J5VA 4RHTA 1CZUA 3S4YA 4AF8A 1KEKA 5E2AA 3I32A 4F8EA 4CIBA 4CUJA 2LE0A 2NXNA 4KQGA 2PUFA 3GUHA 1NIPA 3SLKA 2EDAA 3NT2A 2C9MA 1TTHA 2P0AA 4RH3A 5IUKC 4V2UA 4FK8A 3CJTA 4GSYA 5AOAA 1KMCA 3RTEA 2PX6A 3ZHSA 5EJGA 4DLKA 1W46A 5JXJA 1PHPA 4H35A 3UK7A 1NDQA 5G0WA 1G8SA 2W2KA 1CV2A 3PC8A 4WFIA 5HK8A 4OHOA 1KE2A 3RD5A 1ECJA 4CFYA 1RVDA 2J32A 5SYMA 3PYXA 1DAGA 3HGTA 4INAA 5ILQA 4FCWA 3MMXA 3ELYA 5CX1A 5TQJA 2PZEA 1SCDA 2E4VA 1WG8A 4FD2A 5D87A 3ND7A 4NBVA 3RV4A 3X1XA 4LEIA 3EGEA