1SXIA

Structure of apo transcription regulator b. megaterium
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
273
structure length
273
Chain Sequence
b'TTTVGVIIPDISNIFYAELARGIEDIATMYKYNIILSNSDQNQDKELHLLNNMLGKQVDGIIFMSGNVTEEHVEELKKSPVPVVLAASIESTNQIPSVTIDYEQAAFDAVQSLIDSGHKNIAFVSGTLEEPINHAKKVKGYKRALTESGLPVRDSYIVEGDYTYDSGIEAVEKLLEEDEKPTAIFVGTDEMALGVIHGAQDRGLNVPNDLEIIGFDNTRLSTMVRPQLTSVVQPMYDIGAVAMRLLTKYMNKETVDSSIVQLPHRIEFRQSTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-resistance amylase regulator
publication title Structural studies on the apo transcription factor form B. megaterium
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Transcription
total genus 76
structure length 273
sequence length 273
chains with identical sequence B, D, G, I, K, L, M, N, R, T, W
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sxiA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sxiA02
3MYYA 4RXUA 5HSGA 3ILYA 1NXSA 5FWYB 2HPHA 4HYEA 2PL9A 1CYEA 3RVJA 4NCBA 4RKQA 3TD9A 3UK0A 5TQ0A 5IUJC 2B4AA 4RS3A 1DBQA 1TMYA 3TMYA 3NHMA 1VPWA 3CU5A 2FMFA 4YRZA 1Z15A 1JFTA 1MVOA 1QMPA 1RNLA 2L17A 2L18A 2R4QA 3OO0A 2PUDA 3EULA 3OLWA 2FEPA 3RVLA 3DLBA 1DJMA 5TPZA 3HV2A 2FSPA 5KC8A 1USGA 2IOYA 4UHJA 3JVDA 8ABPA 4MR7B 1NY5A 5FWXB 3SY8A 5IX8A 3F7NA 3H5IA 4JB2A 1LJUA 3Q7SA 4KK3A 4MR7A 4RK5A 4WWHA 4OLBA 5FWXA 1JFVA 1DCFA 5HQJA 4RY8A 2JBAB 2H3HA 2NZVG 1E6MA 3M9WA 1ZAYA 5KC9A 3H5OA 1M2FA 1XWWA 3HZHA 2JBAA 1VLZA 3KSMA 4KV7A 4IMIB 3A0UA 2ZAYA 2IYNA 2QSJA 1L5YA 3EODA 5D2CA 3SAJA 2V0NA 4W5QA 4MAAA 4B09A 1LJLA 4KK4A 3GRCA 4HNSA 4G0MA 5KI6A 3A10A 1PEAA 4Z9AA 3H75A 3VNAA 4PE5B 2PL1A 4G0ZA 2FQXA 2CHFA 2FQYA 2HSGA 2IPLA 3GWGA 4MYRA 2FN9A 3MF4A 2QZJA 1RZRA 1W9HA 2FLKA 2JVIA 3H6HA 4Z4HA 4XAQA 2A9QA 5IUNC 3DLHA 4H3KB 3BRSA 1U2PA 1DZ3A 3CLKA 3ROTA 5JNTA 4KREA 4UHKA 1QO0A 5IEBA 1GLGA 3LUDA 2ZWMA 1PNRA 4RU1A 4Z9BA 1FFSA 2NUBA 4EYOA 3O75A 1YK0A 3CTPA 4Z0NA 2XDYA 2LPMA 2A9PA 1NTRA 3I42A 3M6MD 3DGFC 2IDMA 5DGCA 1ZY2A 3QEKA 4EYGA 3MA0A 1VRVA 4ETMA 4JASB 3UUGA 1P6QA 3G85A 1J56A 1K66A 1P8AA 2E4XA 1I3CA 4DQDA 3KJXA 2TMYA 3FGZA 4LRQA 3ILHA 3OQNA 4KNYA 5IUKC 3CRNA 5IC5A 1IIBA 1JDPA 1ZGGA 2CHEA 2M98A 3LFTA 5KQMA 2LIVA 4EVRA 1Z17A 4WUTA 3H5VA 4MRMA 2LP4Y 3HEBA 3RVKA 4JAVC 3Q15C 2MSWA 4IMJB 4RK7A 2MSLA 4RSMA 4YR7A 2A9RA 1AB6A 3HS3A 3HK2A 3HM9A 3I09A 2VK2A 4L85A 2I6FA 1QP4A 1ZDMA 4MQFB 2VUHB 4W5NA 4EUKA 3S99A 4EGSA 3RVOA 3N0XA 3RVNA 4MR8B 4MS3B 3LUKA 2PAFA 5B3JC 3B2NA 4QYWA 1SRRA 4MR8A 1QQBA 1GCGA 4G97A 1JYFA 3BREA 3KLNA 3FFWA 3LUHA 3CNBA 4YV7A 5C5CA 5JNWA 4Z4GA 4Z4IA 3GT7A 4EYQA 4RKRA 2F8TA 1LBHA 1MAVA 1ZN2A 3KCNA 2E4UA 3QELB 4N0PA 4FB4A 1DRKA 3CKMA 4N41A 5IBQA 3QELA 2F8SA 3CHYA 4KPYA 1DC7A 3LKBA 4P98A 3C3KA 1YMVA 1DCMA 1Z2DA 4WXMA 3K4HA 2E4YA 2R48A 1BDJA 5DKFA 4MS1B 3T6KA 3RVRA 3QLVA 1BDIA 2L19A 1RPJA 1GCAA 3QLUC 3R0JA 4MS1A 2GWRA 3H1EA 3Q7RA 4N0QA 5TQ0B 3KLOA 4YO7A 4PICA 1U2QA 1WETA 3HJFA 3VNBA 1E6LA 3Q7TA 1F4VA 4QPJC 4ZMSA 3HXMA 5CHYA 2HQOA 4ETNA 4EYKA 2FLWA 1D1QA 2X7XA 3LUJA 1JWLA 2PUAA 4ETIA 3IPAA 2GKGA 2OQRA 4RK6A 4HNQA 1A2OA 1RZRD 1W25A 2MYUA 4IF4A 3A0RB 2RJNA 3JY6A 4G0XA 5BRAA 4F06A 2DRIA 2PUFA 3LUFA 3C97A 4MR9A 2HQRA 1QNLA 1JH9A 4JA2A 2WJAA 4EY3A 3O1IC 2IPMA 1QO0D 2NZUG 2WY2D 1JFSA 1M2EA 2FQWA 4NICA 1Z26A 4KZKA 4NCAA 1MB0A 2IKSA 1JHZA 4OTZA 3C3WA 3GV0A 3F73A 3H1FA 7ABPA 3FFTA 5EWJB 5HKOA 3ROFA 2P9HA 3BRQA 4W5OA 3K9CA 5KQGA 5EWJA 4G86A 4TN5A 1HEYA 3LUAA 4EVSA 3KS9A 2QR3A 4YCSA 2YHAA 1LBIA 3N0WA 4DN6A 3OMXA 5DLEA 1QKKA 3M9XA 1SXIA 5BQ3A 4F11A 1Z13A 5JNUA 4WXEA 4RWEA 1PNTA 1YMUA 4O1IA 3CG4A 3T38A 1D1PA 4S04A 4PEVA 2QU7A 3I5AA 3OLVA 3LTEA 1NXVA 4LE1A 3JS5A 3OQMA 2NT3A 1A04A 2QVGA 1DP4A 1JX6A 5DTEA 3QX9A 4KQCA 3LKVA 1SXHA 5FBKA 4G0PA 2FMKA 1KRXA 3W9SA 2J48A 6CHYA 4ZYLA 2E4WA 3RH0A 2GX6A 5IEJA 2WMYA 2VUIB 3CFYA 2IPNA 2JRLA 3N6VA 1ZHHA 3HSYA 3O2JA 3HVRA 1QPZA 2MSKA 2P4UA 4NQRA 2WJWA 5GQSA 3DGEC 3IPCA 2WRZA 3NBMA 5JNRA 4FE7A 3FFXA 4LDAA 1Z16A 4W5RA 1CEYA 3F6CA 3QK7A 1NXXA 4Z99A 1H9CA 1OXBB 5F64A 2L2QA 4IGAA 3EQZA 5I4CA 4OG2A 5JNVA 4MRMB 4P1ZA 1S8NA 1YVUA 4F12A 5CNMA 4RV5A 4MPTA 4RZSA 4OLAA 2JB9A 4E7PA 2FMIA 4LE2A 2GBPA 3E61A 4D6XA 1U8TA 3JPYA 1R8JA 1ABEA 3LOPA 3OM0A 1BVHA 2B1JA 3GBVA 1P2FA 4LDZA 3JPWA 1JBEA 3UKJA 5BR1A 4S05A 3QLTA 1DBWA 5ED4A 2E4ZA 2MYNA 3OLZA 3QEMB 2M1ZA 5CNJA 3MM4A 1ZVVA 3QEMA 1NXOA 3A3KA 4WT7A 3QX8A 2FVYA 2HQBA 1YIOA 2JK1A 3HUTA 1QQAA 1OXKB 4IRXA 4YWHA 1NXTA 1EWKA 2R47A 1D4ZA 5TPWA 3T8YA 2IPAB 1NATA 3GL9A 4HNRA 3SM9A 3H1GA 2RDMA 4YS6A 1Z18A 2ID9A 4XLTA 4MS4A 3SNKA 4KVFA 4D74A 4RY0A 3JVIA 1FQWA 1JF8A 3NNNA 2FW0A 2FTKE 1SD5A 4RK4A 3N75A 3KYIB 1TM2A 2PUCA 3OO1A 4KRFA 3MQ4A 2PUBA 1BDHA 1EHCA 4Q7EA 2LUOA 2PLNA 2FMHA 4JP1A 3HUUA 3TB6A 2PJUA 1FFWA 4RY9A 1EFAA 1M5TA 2W42A 2PE5A 3HDVA 2H0AA 4KQ9A 3BILA 3C6QA 4PZ0A 4M88A 4RDCA 4DADA 4MQEA 2FKAA 1DCKA 1DG9A 1NXWA 4N47A 3CG0A 4Z4CA 4YP9A 1AB5A 3HDGA 4RXMA 4O1HA 3O1HB 1DRJA 4MR9B 1URPA 1PUXA 4F3TA 1ABFA 5IULC 1TJYA 3GBPA 1A0OA 1Z12A 2FXIA 4F8JA 3OQOA 4CBVA 2PMCA 3KHTA 4XARA 5TE9A 3RQIA 5DCLA 1K68A 4IILA 3KTOA 5FWYA 4Y9TA 1RXEA 3P9YA 3CS3A 4QICA 4OBBA 5JNSA 2QXYA 3E3MA 6ABPA 1E2BA 5PNTA 3FDFA 5CNKA 1EAYA 4O5AA 1M5UA 1USKA 3HCWA 4TLMB 1QP0A 1P6UA 4QYMA 3RVSA 1BAPA 2R25B 4Q6WA 1TVMA 1DBPA 2Q5CA 3O2SB 2AYXA 3T95A 4N03A 3HO1A 2FN8A 2YHBA 4G0QA 2FEWB 3FMVA 1UDRA 4E7OA 4GNRA 4XXHA 3BBLA 3H5LA 1GUDA 1FSPA 3I45A 3Q41A 1SXGA 5B3JA 5JS2A 3O2QB 3EQ2A 3LMKA 4KMRA 1BA2A 1U0SY 1EWTA 1XHEA 4RXTA 4ZPJA 3DBIA 1NXPA 5KQLA 2NT4A 3GYBA 1XHFA 3NHZA 1CHNA 3JTEA 3KG2A 4G0YA 3DZDA 4Z4FA 1ISSA 1YS6A 3SQNA 3NNSA 3L6UA 2MYPA 4YLEA 5EWMB 2WB4A 1JL3A 3GA5A 5BRJA 2PUEA 3O21A 5EWMA 3RVMA 1L5ZA 2JCGA 1FFGA 3EDCA 4LE0A 3IP5A 1PHRA 1ZESA 1DC8A 4FE4A 4W5TA 4XASA 3QLVC 5TQJA 4YGXB 1YK1A 2JVKA 2OENG 4ML3A 1LK0A 1KMIY 2KYRA 3EJWA 1F51E 3QLUA 1PEYA 4LX8A 3O1JC 2RGYA 4Z4EA 1USIA 1D2AA 3N8IA 5E3JA 1ZGZA 3LUGA 1Z2EA 2A9OA 4LZLA 3H5WA 3L49A 5EWLB 2CWDA 3N53A 3O74A 4JOQA 1C4WA 1ZITA 3EGCA 5EWLA 5KWSA 2PKXA 4RK1A 4KFCA 1ZH4A 1E6KA 3IP9A 1YTUA 2AYZA 3N0RA 3SG0A 5CNIA 3KYJB 3H5TA 4JB0A 5KQPA 4Q6BA 2O20A 1Z25A 3URMA 1B00A 2MYTA 1VKRA 1APBA 2BGGA 3IP7A 3KKEA 2WWVD 2JVJA 3NNDA 5TPWB 2QVCA 5ABPA 2LBPA 1D5WA 3Q9SA 2PUGA 4MS4B 5T7BA 2N9UA 1T34A 1U04A 2VYCA 4D6YA 2ID7A 4N76A 3G1WA 3D02A 4TMYA 3IDOA 4TLLB 5JS1A 2GI4A 3MIZA 4MGEA 4MLCA 1ZH2A 1JDNA 4EVQA 4MQFA 1TLFA 1GUBA 2RJOA 1YS7A 3F6PA 3OMWA 1MIHA 3LUCA 4NV3A 3RVQA 1KGSA 4H3HB 2QW1A 3TX6A 4WZZA 3D8UA 2QV0A 2HJ9A 3OLYA 1KRWA 1EWVA 3MMNA 4MS3A 4RK0A 5FBHA 4PYRA 5T3YA 4ZMRA 1JLKA 9ABPA 3RVPA 3TO5A 4GPAA 1C0EA 1JYEA 4H60A 5TPZD 4MQEB 3IP6A 5C5EA 5HM6A 3EAFA 1RXIA 4L4UA 2FEKA 5GOTA 1QP7A 3OM1A 4ZJPA 3CZ5A 2E4VA 1MB3A 1ISRA 1Y1LA 4OATA 3H6GA 5TQ2B 2CD7A 3CZCA 4MLDA 4G0OA 4XFKA 5TQ2A 3C3MA 3OLXA
chains in the Genus database with same CATH superfamily
5LXTA 2MIIA 3EZFA 3ZV6A 3E1KA 4EEZA 4CM1A 5E0OA 4IIHA 3MXOA 4MVJF 1UPUA 4UMFA 4BGDA 2Y0EA 1NMEA 3BQ9A 2XDWA 3AHCA 3LI2A 4N39A 3TD9A 5C46F 1IN7A 2I4IA 4RS3A 3ORHA 2Z1NA 1KKMA 2I4NA 2WJGA 5IDVA 1N34B 1J2JA 1PFKA 4B7CA 3K1ZA 3IDZA 1ZBDA 3IB3A 3ADKA 1ICIA 2V4MA 2ECOA 1TW3A 1Q1ZA 3PA8A 5IAGA 1JSXA 1OI3A 3LV8A 3NJ8A 3WWOA 3EWNA 1EK0A 1OBHA 4HNUA 3HV2A 3V5NA 1FC0A 4PXSA 3AESA 5KC8A 3AKZA 3TMAA 2YJ5A 4JLSA 2J5RA 5M34A 3VUEA 4FI3F 5J23A 2ZXUA 2Z1MA 3D1JA 2MWMA 2XUKA 3MSXA 2GZ3A 1CE8A 4E4RA 5IJZA 2OHOA 5JS1A 2XW6A 4N40A 5DHUA 5BP7A 1VLLA 1IC6A 1LPAB 3FPSA 6GPBA 3BQMB 2IW3A 4O2AB 1M2FA 1GNPA 1IE3A 1NONA 3LPLA 3AI7A 1E6CA 3FTDA 1U31A 2AJDA 2I0FA 4KWTA 5JDIC 1AM4D 1MABB 4J9UE 4E09A 4R1NA 1NXQA 4W1SA 3EVGA 3L02A 5IKOA 1RR6A 4TM8A 4M86A 2HD4A 3EZ6A 3LF1A 2FQXA 2KX7A 4H6VA 4XUGB 3A3YA 3IJ5A 3V97A 4E2FA 4JVMA 3DPIA 2PTGA 5CDFA 1AZSC 3E22B 1X7HA 2NU9B 3VPSA 3W3AH 1I7PA 2GAIA 2WV9A 4LPKA 5AM5A 2JVIA 2H5EA 3QWFA 3IAS1 1F6BA 2PGAA 3DMTA 4J03A 2NTJA 3UHJA 1C4KA 1D6JA 4D41A 2PS3A 4XB6B 3V1LA 4A92A 3QIVA 4UCWA 2BFNA 3TVTA 2RONA 2OHHA 2XTNA 2C77A 2PKRA 4P93A 4TKUA 4FQ8A 2WHYA 1ZH6A 2Q1TA 1T25A 2QAGB 4KIWA 4ZAFA 3RUDA 1B8NA 1A2KC 2Q4RA 3OAAD 4CWAA 2O2HA 2AMYA 2C7GA 3TQQA 4EOGA 2GO7A 3VQTA 2FP4A 1O54A 2BTQB 4CDGA 4TYNA 3P20A 3EHEA 1Z8DA 5FX2A 1FZTA 1JWAB 4UHEA 4OUDA 3BN3A 4M8SA 4PHFA 4QUDA 3TX2A 1Y89A 3ZV7A 1QHNA 3FPCA 1KQOA 1RJGA 2XB9A 2YY5A 3HXPA 4PZ9A 5FR2A 3ZX4A 4TV8A 4K9DA 5CB4B 4DR2B 2HEGA 3IERA 1Y1RA 5DU2A 2XQJA 4RIEA 3O4GA 1EVIA 1QZ3A 2M98A 4RAOA 2D5LA 2RKBA 3S40A 1JVBA 1IB6A 1RXYA 1UZNA 3NHPA 4NRDA 4P5EA 1JB1A 4X92A 2X9LA 3LNCA 5DYNA 3T0GA 4UHHA 2OZEA 1J97A 1WB4A 1Z29A 4RSMA 5ICFA 1Y8QA 1ZRSA 5TJHA 5DX0A 2MCFA 4Z3DA 4LAFA 3IBTA 3RS9A 5F1OA 5BVGB 4W9MC 1E5TA 4FC7A 3L05A 4NS4A 3WMWA 1NBEA 1GARA 1RWXA 4B4OA 2V45A 4LGCA 4AURA 2Z5LA 4C89A 4EELA 1VSUA 2F8MA 3UICA 2Q1YA 1JP7A 3O8NA 4P33A 1G20A 4J43A 4HUTA 3BE8A 1DC3A 2XRFA 1KVSA 3LC1O 1KYYA 2QUIA 2HJGA 2G08A 2WT8A 4F4IA 5FNZA 2G80A 1KL7A 4N8SA 1XTBA 4N5DA 4BECA 2BBSA 1W44A 4ZAXA 3FFWA 3UT0A 2J0VA 2LTAA 2UYYA 4DDVA 2P5UA 4KQGA 1NM5C 3WV4A 4PHCA 1FSFA 1H22A 5EP2A 5A0VA 5E6SA 3GUHA 4EW6A 1U63A 1E7MA 3BCSA 4K6KA 3C6BA 3UVEA 1WDKA 1HGXA 2Q3LA 3KOWA 4I9HA 1P2VA 2F43A 2WOJA 1WMFA 2G7MC 3QFCA 1XRNA 4V24A 4DV4B 4NDZA 4R5HA 3IRUA 4JBHA 1V8FA 3WYDA 3M6FA 1HDXA 4M99A 1P1HA 4LV8B 2J45A 4WXMA 1VE7A 4Q4DA 3T9FA 4BX3A 2HO4A 1NYLA 2DPYA 1MZVA 1ZCAA 5DLQC 1G8KA 3RUIA 3M0EA 2QGZA 2AW5A 3LUBA 3B78A 4FMDB 5TF0A 4WFQA 2GPJA 2UUAB 2CMKA 4AJJA 3SGLA 1JR3E 4ZU3A 4EYKA 3UXEA 3KIPA 1P0QA 3GLFB 3LA8A 1I5OA 3JWJA 2OQRA 3V4OA 4S3MA 4M0PA 1A4IA 1DT5A 1Z08A 2BZGA 2ZUDA 5DGDA 4ZD6A 4B81A 5CEJA 1OKKD 4DABA 3GJYA 3T9AA 3PJGA 5EJ9A 1NKSA 1T4GA 4OJTA 4QU9A 4YJDA 1XDUA 2CNDA 1ADBA 4LSGA 5FTNA 1U9IA 2NTYC 1QO0D 3T9EA 1JVNA 3IVXA 1KOJA 1W88A 1GP2A 4L1KA 4OQDA 4R69A 4NZPA 3CF4A 4ENVA 5CG1A 1PT9A 5TDHA 1MB0A 4CG3A 3GV0A 3FBTA 4TLEA 4PC7A 5D00A 3RREA 5AI9A 1LEHA 1T2FA 3QLJA 2WIGA 3UQZA 2C9DA 4RANA 3C3AA 4I1PA 2J0SA 3U7EB 3QWHA 5JE8A 1O94A 1Y1QA 3F3YA 2YZNA 3B1YA 4OHKA 3ZZ1A 5MHTA 1EXMA 2OCKA 1F0YA 2FVXA 3TIIA 3UT6A 5DNUA 4EAQA 2JS7A 5TMEA 4UE3S 4HQFA 1GGMA 1JZTA 3RBZA 2BGLA 4ZT2A 5IW8A 2WFLB 1GPUA 4KUGA 2EZ9A 2QUBA 2QAJA 2XY4A 3PDCA 3PYXA 4JGBA 4S04A 4NXMB 1KXZA 5CLQA 4RD4A 4M6WB 1TD1A 1PS0A 3NOOA 3M3HA 4PX3A 4EMTA 3EY9A 2YFQA 1TK2A 2O2XA 3KQSA 5SZJA 5ALOA 3WK7A 3AETB 4QG7A 5EG5A 1KVQA 4R8MA 1NW4A 1TEHA 3JCZA 4HWKA 4TVKA 3I58A 1Q7CA 4UW9A 4ZOCA 1O89A 1X19A 4KAJA 4RL4A 3OUTA 4ZYXA 1XROA 3IE2A 2QNIA 3QUQA 4I9GA 3STYA 3F6RA 1Y8CA 4LYGA 4UVEA 3SR3A 4B8YA 5FT9A 1FTYA 3C41J 5J2TA 2MSKA 2VJYA 1RBMA 4D25A 3GDFA 1FFHA 4ZQFA 4B33A 2FPPB 2X5OA 4NK5A 5C1OA 3Q7IA 5COAA 2IH2A 3F6CA 3I4FA 4UM5A 3O4HA 1TEXA 4B3BA 4EY4A 1Z82A 3B1KA 5ECGC 1AS3A 1IUNA 4LDRA 1PK9A 2XB6A 4TV9B 4YT5A 3S8YA 2NZXA 4ZVUA 1XRQA 3P0IA 5JASA 5ESDA 1RQPA 4XGKA 4PYOA 4ZHQB 1HRKA 1JG2A 4MDEA 1J8QA 4WN9A 1QXSA 2VK8A 1EA7A 1EGVB 5CA0B 4KIJA 1G41A 1N75A 3NONA 4DR5B 3UKJA 2BGWA 4KHPB 3CLUD 3KQQA 4EMUA 3QP9A 3EMVA 3I9V1 1Y9DA 1X0XA 4I4CA 4MGHA 3OLZA 1FUEA 5U9CA 3WAJA 1OX6A 2FZGA 4BUZA 4ATNA 1UMDB 4QEKA 5A3JA 4YJ2B 2WU3A 3ETCA 4US1R 1IHOA 1T8RA 3RFFA 3INTA 2DQZA 2GXQA 3RRFA 3TR6A 2XDQA 3PL1A 2YYYA 2A78A 4KFSA 1D4ZA 3BICA 4G1MB 3SXUB 1R37A 2GOYA 4DLLA 2PH7A 3IOEA 5FPQA 3SI7A 4RY0A 1FFCA 2WYHA 4LHVA 1PQPA 4L8WB 4EDHA 4BFWA 5CMLA 4C9BA 3KOYA 5DTMA 3KLBA 1X1EA 1DO2A 3KPJA 3KXDA 5H8WA 4I1OA 3EVAA 4A1OA 4AJHA 2JH8A 1UIRA 2J9XB 1GFZA 2PGLA 4LBYA 1XALA 3ZK9A 2IS6A 1OXSC 2BFCB 3KYDA 4GLJA 5DTQA 1E2LA 2YJ3A 2ZTMA 5J9FA 3BD6A 3OTIA 4JP2A 4O0MA 4XM0A 4OYRA 2DHEA 2A1UA 3EYWA 5AW9A 1FP4B 4HKTA 4RY9A 3P5SA 2RGAA 4YAUA 2I1LA 3T4EA 5KYYB 4DIKA 3JQGA 1U2TA 1PR3A 2NG1A 3N5KA 4CQNA 4OCZA 4OQMA 2GARA 4OHUA 3ST7A 4G25A 3UK7A 3ZJTA 1Y3CE 3NEAA 1VE3A 4E32A 1CB0A 4QDOA 4TLBA 4RDCA 2ZR0A 4N5HX 4DADA 3V3KA 3G2JA 2PH1A 3TOCA 5BVHA 2VH1A 1YZVA 2RGGA 1Z4PX 3ZU6A 4RULA 1AB5A 4Y6LA 3WLQA 3HJAA 5B2FA 1LTQA 3ZLBA 4EGAA 3RRMA 1UFRA 2J7KA 2FE1A 1VYTA 4KQKA 5BUZA 1NZJA 5BNFA 3DF7A 3A05A 3GN1A 1IRIA 2AIRA 3V8VA 2JCVA 3RYHA 4M89A 1UFVA 2BJHA 2YFKA 3G3EA 3FPHA 5IRCD 3AY6A 1ZU5A 5HW0A 4GMHA 4LWOA 5JC1A 1W2GA 3KJGA 5DCLA 5A2QA 1VMDA 6REQA 3MWLA 3MMSA 5JZBA 4YCJA 3GLGA 2GHQA 4OBBA 3V9AA 3R0ZA 4FNMA 4MKHA 4BNKA 4CDNA 2I78A 6ABPA 2O3QA 1HX7A 2FEXA 4F38A 4IQ4A 1KI2A 2X19A 3FDFA 5FEUA 1OB5A 3WL6A 4HDRA 4EA8A 2QU8A 2O2GA 4V0LA 4Y2VA 1HK7A 1Y7TA 2L82A 1Q15A 2ZUCA 2NXCA 4BLOA 3QF4A 4CIAA 3FSGD 3O0DA 5JPDA 3TN7A 2QMZA 2QDXA 1SUWA 3JAKA 3T9DA 3IQDB 4AIIA 5BN4A 1MPXA 3PI6A 4XSVA 3ZHCA 2DSTA 2RAFA 3EW9A 2YWRA 4K1XA 4JT4A 2EZ4A 4XFDA 2AV6A 3CKYA 1A1SA 3CUEF 5JTUA 1HLDA 2QWXA 4XH9B 3SEZA 1Y48E 4ACAA 3ANSA 4A5SA 4F6RB 3E3OA 4KMRA 2F55A 5HOQA 5IHPA 3G8AA 1HQDA 4ZPJA 1EINA 3K4PA 3WHLA 4DR6B 1G3UA 4D8YA 3GUCA 6AT1A 1MC5A 1DDIA 1KJJA 1N25A 2NT4A 3F46A 3GROA 4H1UA 4PYJA 3K9WA 4BV8A 4TLCA 1RPTA 3E5RA 1ZW1A 3GIDA 4KE7A 1NUSA 1YS6A 2C2XA 1TVEA 4BFXA 5CA1A 1JA9A 4GZ3A 1BVRA 3I2GA 5EWMB 2VF2A 4C0JA 3ZKWA 1V6AA 3OZXA 4CIWA 3KJFA 3TG8A 1VA4A 5FEMA 4M0FA 1XB2A 2V58A 4G5YA 1AF4A 1QFJA 3OG9A 1P74A 2C8VA 5FFNA 2NPOA 1PHRA 1YRYE 5HF9A 2DJ5A 3THSA 2VDLB 2COUA 1CQPA 2VNIA 1GQYA 4LCBA 4MWOA 4ZT7A 3RHTA 4A82A 4B73A 3TLCA 5FTLA 5JCOC 4J1TA 3LDUA 4TX1A 4X65B 2YVLA 3ILSA 4JROA 4L5IA 3OEYA 1LDMA 1F51E 3JZDA 1A7JA 1JAXA 3QVGA 3QVTA 1I0ZA 4BUJA 1FYEA 2X2OA 3OECA 4ID9A 3DLPX 1ORTA 3K20A 2IV2X 4FJ2A 5I8PA 2OTCA 3N53A 1IQ0A 2IBMA 4WNAB 3FKSD 4QBTA 2Y1OA 3GAZA 1L8QA 1S2OA 5TVGA 5KWSA 2ZSJA 3DZJA 1TU4A 4WEQA 3TNDA 5DHSA 3M6UA 4KFCA 1JKMA 4XWYA 1HNXB 1EUCB 5LYJF 4BX9A 2ZVJA 3WL5A 4TVOA 1JUDA 1U9IC 1KQ3A 1UK9A 1XZFA 2CNWD 2R84A 1XDDA 3CRQA 3VR5A 4BP3A 3SF8B 2CCKA 4ZVOA 4BVFA 1RRGA 4E5MA 4RIFA 3FNRA 3UWMA 2ZVQX 4ZGBA 1TRHA 4JLVA 1P0PA 2X8LA 2ZJ3A 2IH5A 1PGQA 4QUIA 1J24A 3CH7A 3H1AA 3EZ9A 2GA8A 3DOEA 5I9TA 5JSKA 2VAWA 1ISHA 1W34A 5AVQA 3NAMA 3ANXA 4I36A 4JL5A 4ZVNA 5AOCA 1WDLA 2WVGA 3IUPA 3G1WA 3LQFA 1IK4A 2F3UA 1O94C 5EZSA 2R1TB 4F4UA 1HLGA 1CRPA 1PZGA 1A8HA 2AUTA 2NAPA 1YS9A 2BGRA 2ZRMA 4NF2A 3F6PA 2FG7C 2V7TA 4NV3A 3KWLA 1J39A 2ID4A 2W8BB 2GPYA 4O4IB 2VQDA 1RCTE 4DCCA 1PJSA 5F1YA 1B76A 5DYGA 3D8UA 2C4MA 2QV0A 3E4DA 3SSNA 4EL0A 3PQCA 5M04A 3MUNA 1D2GA 4RK0A 1EDZA 2Q8NA 2P68A 2NACA 1AKYA 3BWCA 3PX7A 2F67A 4LC9A 4JKIA 3ZQ4A 4MA4A 1NW7A 2RC5A 2WW8A 3WQRA 3TPFA 1ZHFA 4LZNA 1DHRA 4CCAA 4F2GA 3RSQA 2QLJA 2JFQA 3O3MB 1N3YA 4L4UA 4LIPD 1NUTA 2FETA 3PSHA 5ECYA 4XWTA 1UBNA 1R0WA 3MD0A 3G9TA 4OATA 3G88A 5ALTA 3WWDA 4D3DA 2C4HA 1HE4A 1U9ZA 1E1YA 4M4SA 3AT1A 2V6GA 5KHOC 5TQ2A 1I8TA 1O6GA 3OTQA 1ES9A 1KU0A 2C1EA 2B30A 3ENNA 2HOQA 3CZ4A 3QW2A 3RFXA 3NC0C 1SWVA 5FWYB 2XYPA 1T2UA 3L5KA 2HPHA 1KAGA 4J6EA 3VMMA 2FMTA 3FTFA 3UWKA 1L7RA 4OKIA 2B21A 4O4LB 2Q3FA 2HMSA 2X9GA 3KDAA 3M82A 3NX4A 3WFZA 5JFOA 3LKZA 4Y2TA 5I4KA 4E46A 5L7WA 4DNQA 3DBRA 3NHMA 5IVDA 3ZHQA 3I1JA 5FBVB 4N65A 1IZ7A 2LW7A 4H1TA 1T13A 1IOLA 3GJQA 3A36A 1GTSA 3RFTA 1TTTA 1USVA 1DJMA 5F9MA 4B8WA 4OMUA 2H0RA 4KN9S 1M34B 2AFIB 3DHVA 2LXNA 5EJGA 4YRFA 2X76A 1Z7EA 3EGDA 2BVNA 5IJWA 2QLBA 1E0KA 4FDUA 5LU9A 1EDDA 1NJFA 2GN4A 4MP8A 5F78A 3ZDYB 1PDOA 2H08A 4KK3A 4OB8A 2UKDA 2HO5A 2BW0A 1A5BB 2IE0A 4CM4A 3ZXUB 2NZVG 3TUZC 4WESA 1K8RA 3BM5A 4M0UA 4ME6A 1YI8A 3T5PA 1ZAYA 3ZDDA 4KYIB 2EX1A 3DMNA 3HB9A 3STUA 2JLAA 2WUWE 3JARA 2EFDB 1HEIA 3MC1A 4TMKA 2ZRHA 1X7YB 2ALJA 1Z83A 4ZOLA 4MKRA 2A1IA 1HZJA 4BO6A 2G0TA 3D8RA 5JZVA 3KT6A 1NDQA 1NQUA 3EG9A 4S1NA 5C3MA 3V8PA 2HSDA 1WZIA 1PSZA 3HRIA 1BXGB 3GWGA 3O91A 1JG6A 5ALUA 4NBVA 5FNVB 2NN3C 1A98A 2IEIA 3WA7A 3IBFA 1TUEA 3UATA 2K7ZA 4XOUA 3H6HA 5CH8A 2Z5GA 1PX0A 3MW8A 4JI2B 2PN1A 2Q9AA 3PQ2A 3FGNA 4NVRA 1KDVA 1E9VA 3GEHA 3U4QB 5A7GA 2EW8A 4P4UA 2FQ1A 1HC7A 2G3YA 2I6QA 2WHXA 3HE3A 2OHGA 1PNRA 4JLJA 4C05A 1YK0A 4W1RA 2XKJE 1BGVA 1WUHS 2A9PA 1L4LA 2P9TA 3DAOA 3KVVA 4QLOA 3O5AA 3CB2A 1Q0PA 5K0LA 2ZDQA 1NI5A 3OCUA 4Q18A 4Q3AA 2BHTA 1VRVA 4HX9A 3LBFA 3OUUA 4OHXA 1UOQA 2PX6A 1XYVA 3LDHA 2R3SA 3O9ZA 4Z7QB 5B64A 3DMFA 3IT3A 4L9RA 4YRPA 4NAHA 3B1VA 4KIFA 2TMYA 3JAMA 5JVDF 3TR0A 4DYDA 4HMPA 4KXVA 1IIBA 2EDCA 1PZNA 3N8HA 4KRYA 3LT4A 4UUPA 2V1UA 1G5PA 3NM5A 1RQLA 3ABSB 5A5VA 3C7TA 4RE5A 1HT3A 3JQ6A 3MFYA 2QS9A 4TYQA 3DB1A 2UUCB 1VJRA 3DUFA 1PW5A 3SJAA 4RK7A 1PJBA 1B4DA 4DDKA 2ZQ5A 2C42A 1V96A 4OQNA 3RSGA 2XQFA 1EFRA 3G2KA 4QPPA 2FR8A 2PZBA 3I09A 1K88A 1N1MA 2BMAA 1QHFA 3RF6A 5LDDC 3TIGA 2VDMB 2ECQA 3DJFA 3K9LA 1FFBA 2C5GA 1IDOA 2JAPA 1UZMA 1VIAA 2WOOA 2GPWA 4RM2A 5IZCA 4M1YA 1SCNE 1K7CA 3L06A 3QY0A 3IS3A 2Q6KA 1WUKS 1A82A 1HE5A 2J3IA 2YCLA 4H2DA 3F8WA 2MSCB 5G0WA 3VO9A 4DA6A 4IKOA 5B36A 3G6KA 1VHJA 4IV8A 4U7FA 4OHVA 5LR6A 1RLIA 4Z4IA 2CJPA 4DR4B 2OCLA 3GJTA 3ANTA 4M46A 3TAHA 3D2LA 4RPHA 4HZUB 1O9GA 3DH0A 4RPCA 3N2GA 3QELB 3L04A 5E2BA 4LJKA 4FB4A 1XMQB 1KY5A 4EEKA 5JI3E 5IJAA 2XMDA 3WKCA 2MR5A 2V6MA 1XWIA 1GTRA 4FW9A 3GCDA 4X6UA 1HYBA 1QAMA 1V7ZA 3DBLA 4OHCA 5B6PA 5KJFA 4TT8A 1XJCA 2J31A 2B5VA 4MRNA 3AF2A 3I9OA 2FPLA 4QECA 4Y6QA 5CIQA 5DKFA 3T61A 1JLHA 4J1TC 3T6KA 3O8LA 3A1EA 3I9JA 5CM8B 2YWGA 2ZYDA 3MWGA 2D7DA 1JKJB 1UCFA 3IQHX 4UUOA 4DWVA 2O57A 3PKZA 1C8LA 2Z2IA 4QJ5A 1LS1A 4C5CA 2XBUA 3ZWNA 1M1YA 2J4CA 3FYCA 1HFWA 4EO7A 1G18A 1THZA 3B6KA 4I2NA 3WDMA 3ZJ4A 3DZKA 4NESA 2E85A 4O2BF 1R9GA 3HVHA 2GYUA 2ZCVA 4R2WA 2X4GA 2VP0A 1GQRA 1LZLA 5KVAA 2ZLBA 2H5LA 4JUCA 3I37X 1T1RA 4OK6A 1C7EA 1B0PA 2EZTA 4RHUA 4KQHA 1K1EA 4D0LB 5DI3A 3C97A 2HQRA 1ZQ1A 2R6AA 1B6GA 1JH9A 4AUNA 1HURA 1XBTA 2A7XA 2OV2A 2GAAA 2I1VB 2VPPA 3OJ0A 4NIMA 5EJ8A 3PUKA 4O8ZA 4BU0A 3I53A 3L46A 3ZWQA 4ETWA 1CY2A 4KFRA 3N2KB 1WKVA 1U7ZA 2H1LA 1Z26A 5AUQA 1L1EA 2A5DA 2N1MA 3Q9NA 4R41A 2VZEA 1PL8A 4BP9A 1DUSA 2BHLA 3DOOA 3DL7A 5FQOA 2CSXA 2AF4C 2CUTA 1J20A 2IZ0A 4L9WA 2I91A 5BSRA 3FUXA 2PMWB 1Y6FA 3ELUA 1WSDA 1TEVA 2F6RA 1GGFA 1E6UA 1THMA 2ZVDA 4FKBA 4UFNA 5I8WA 2BCEA 4E1VA 2XGJA 1DRVA 3FKQA 3SYKA 2D1YA 3IODA 5DTIA 1J0DA 3C70A 5DO9A 1LBTA 4MVJP 1V8OA 3SE0A 5AVZA 2XIJA 4GC9A 1U0HC 2YWDA 3D4NA 4O1IA 3IQEA 1S0UA 1U8EA 2FWAA 4DRXB 4JMPA 2FSSA 1Q0SA 2QU7A 3Q3IA 1IHUA 4D80A 5GP1A 5EJIA 5FPKA 2Q2WA 3DTVB 3HCBA 4L2IB 1PVVA 4RCVA 1ZN8A 3G0BA 1QCYA 4NAUA 5KOJA 4M8KA 1ESNA 2PGNA 5KTOA 1DU4A 4GI1A 3KP1A 3SX2A 3T5AA 4G1CA 2JEZA 1NN1A 2FMKA 4KAAA 5AJWA 4DM3A 4PZPA 5C8YF 2J48A 1FX0B 2OFXA 3KQWA 1EXVA 5A6SB 1XVTA 3IAXA 3O4RA 3DG9A 1WG8A 4JU9A 3VDQA 3PZBA 4E70A 5IAOA 3PF9A 3UJ6A 3WKEA 1YA6A 1M7HA 3N6VA 4CF4A 3EA0A 2WAYA 2P4UA 1IOVA 3IPCA 3MRVA 3RKSA 2AXQA 2D0OB 1YFLA 1DBVO 1YGYA 2VYVA 3E9QA 3JVUA 1ZVMA 1F2DA 2ZDHA 2WD9A 2GBCA 5IM4F 4CIYA 3WZLA 4JP8A 1YFJA 3L5OA 2G5PA 2LWIA 1ZVQA 5CLHA 1ODSA 4FT2A 1JFRA 3EHDA 4MQ5A 5D3KA 5IKXA 3CEMA 4QTYA 3N2EA 3TGPA 1Z06A 4AY2A 3B3QA 1KBOA 4QD3A 5HG0A 1IH8A 2HMTA 1N0UA 3WG9A 1NQWA 2WMNB 3E61A 1V45E 4BTVA 2E5FA 2XTZA 3T94A 3BC1A 4M1EA 1U90A 121PA 1FDTA 1NNUA 2XMPA 2ZRNA 3KPUA 1W5TA 4FDTA 5LC1A 3V8BA 3PLRA 4G63A 5JH7A 1QWOA 3JWGA 3TZKA 2ZB7A 4J75A 3C7KA 3HKCA 1K7YA 4UBIA 5L4SA 1K4MA 4URFA 2OYCA 4W5HA 4I55F 4FQ5A 3RK0A 2WG0A 2O54A 4IDNA 2DP4E 3TUIC 1GO2A 3QKSB 3RJ9A 3VU9A 1TGVA 2H1FA 4F97A 4JCCA 3RO7A 1D6SA 1P9NA 2NU8B 4BMYA 4A10A 1AKVA 1GTMA 2JI4A 3RVDA 3DLCA 4DG9A 5K6RA 5C32A 2KJQA 4M8NE 1C9YA 4Q4LA 2IPAB 4D9GA 1XEWX 2HTFA 3N0VA 4INZA 4CKCA 4MINA 5H4HA 2M1XA 1IUOA 1ACJA 1FSSA 4GMKA 4JB3A 5CT6A 2VP3A 1L3CA 4C1BA 4GP9A 3DE2X 1JDBB 4M22A 3JTMA 3KO8A 1KVRA 4UCFA 1XF9A 5CGZA 5B2ZA 3TUJC 1ZIPA 1CJUC 1TM2A 4N48A 3AZPA 1TZKA 4QOIA 5FORA 1LX7A 5H3LA 2Z1DA 4ZV4A 3OO1A 2SNIE 4GLLA 2EP8A 5I7WA 4KRFA 1BDHA 1UH5A 2F48A 3MS4A 4LFCB 4WOKA 4WY2A 1ODIA 3TRHA 5KPDA 1RXUA 3CKKA 3GJ4A 4N3NA 3IXLA 3CJRA 4REQB 1P77A 4OIMA 4CN8A 2R1VB 4YY3B 2I9PA 2F1HA 1MVNA 1P7CA 1JPUA 3Q11A 3HFSA 1VYUA 4ZVVA 4ZIRB 4K0KB 9MHTA 1DCKA 3QYAA 1W73A 3EIQA 4WCFB 1O9BA 4O4JB 4E15A 1E4OA 2GBGA 4PZUA 3FYDA 3WP1B 4YMHA 5A4IS 3NP7A 5D87A 3PNOA 3LPAA 1KZHA 2R44A 3NTUA 4EA7A 1YJ5A 3G5LA 1VTKA 4KQEA 3MINA 3C48A 3ZK8A 3KQUA 2PYZA 4F3TA 3EISA 2IUUA 3ENVA 3L7JA 4IXWA 1Y3IA 4QYXA 5LN1A 2YV2A 4I9FA 5AK3A 2VP6A 4ZU1X 4US2R 3EGWA 1CK4A 5KOHA 2QR2A 5JZMA 1UBMS 3VPXA 2XXAB 3L7CA 1OI7A 2DM6A 3F6BX 2GETA 1N3BA 3HC7A 2IIPA 3QPWA 4WADA 3FFAA 2PZEA 4HX2A 2FH5B 1JTEA 3QF7A 1I33A 2FR8C 3R6TA 4QSHA 1ODTC 3X1MA 3RD5A 1XDZA 4A8PA 2ADMA 5JBQA 2O8DB 4MO2A 5IZCC 2H48A 2FN8A 1CJCA 3EK2A 1G64A 3UOAB 4F2DA 2ZOSA 4HFRA 2R5NA 2XQVA 4XXHA 4DMFA 5FOUA 3GT3A 4BNWA 3F5DA 1CR6A 4ND4A 2GUGA 5LSAA 2QNRA 1OTYA 1SAYA 3BMCB 4DR7B 1TM1E 3P19A 3PCXA 3GZTB 3LC0A 2X6TA 3LG2A 4X8MA 1ZI9A 3MJRA 1D0SA 1HWYA 1RYEA 1M7BA 4KSCA 3VC2A 3FHJA 4Q7LA 5CIWA 4WACA 3UWOA 4IYRA 2W6JA 2MYPA 2Y99A 2GK3A 1DRUA 3ETGA 3GA5A 3HL4A 4HEHA 3AL3A 4ABTA 2JL1A 5TS2A 2DKFA 1RJ9A 1L5ZA 4LMBA 3PEEA 1ZXBA 4DRYA 1YE8A 5LKAA 1K97A 1WZEA 1IXRC 1DTSA 1F8GA 2ZRPA 3D0QA 4XYMA 1N9ZA 3W90A 3FZQA 1W5BA 1UANA 3DCNA 3O4IA 1EMDA 4OP2A 1UT5A 5JG7A 1I4OA 2J8ZA 2QGFA 1FUIA 2VDRB 3CVOA 3SYRA 3UYLA 3DE7X 1Z6GA 3NOXA 3CLVA 3MK31 1L7MA 4KQ1A 2RI1A 4ZGGA 3I12A 2GRAA 5FTWA 4ER7A 2CC2A 3D4LA 4BGUA 4AKSA 2GM5A 1Q1GA 2IZZA 4Y2XA 3UT5A 4O3MA 1E77A 3CNOA 4RHXA 1E7QA 5DSTA 3A4VA 3T5MA 1NR5A 3K9HA 1HRDA 2D0DA 1ZVJA 5CVEA 2UZ1B 3D0KA 5CNIA 5AKJA 2CLSA 4YQEA 4DQUA 3IVAA 3HY4A 4QWWA 3URMA 4F72A 1U65A 1CJBA 1QIKA 2QRNA 1SEPA 3OZFA 4MITA 3LFUA 3RGGA 1UXGA 4ZODA 5H7XA 5KVCA 5HOEA 4XPIA 3IUQA 1HZZA 5EZYF 4C3ZA 3L4JA 4BDTA 1D5WA 1PR4A 2JIQA 4FYHA 4I1IA 3FPFA 3IIKA 1TM5E 1P7VA 2J1LA 2QXTA 2BT4A 2PU7A 3TCKA 5JFTA 4I4LA 5AIAA 1QC5A 2AG8A 5IARA 4X93A 4RPGA 3VHLB 1TYAE 2BMJA 3WBFA 4C0SA 2B6NA 5C7OO 2QQGA 1BW9A 1BROA 3F49S 5EKXA 5TX7A 4ZTZB 1WLYA 3SQWA 2H4YA 1JR6A 2ZRIA 1T35A 3HJRA 5EGNA 4H7KA 1ZMRA 4KGVA 5A4FS 3QPUA 2CFTA 2RGUA 3TKLA 5IVKA 1G5HA 1OFUA 2WYWA 3CUUA 4D4MA 5KSYA 1NKTA 2XODA 4PQFA 2IZ1A 3ZGZA 5ESWA 2CV0A 4LYYA 2WYOA 1IM2A 1E79A 4H7HA 2HA5A 2R2GA 1NVAA 2TMDA 2Y6UA 4MV1A 5KYWA 3NHBA 2JANA 4FYVA 1SCKA 4LBWA 3MGAA 1PWEA 3V8NA 3W78A 3WLFA 4E2ZA 3AC0A 4TKVA 4AY6A 2CHGA 5E6RA 1C7JA 5C5EA 4GM4A 1EP9A 1RXIA 2FEKA 1SVIA 1DADA 1UJBA 4UHDA 3G8BA 5B1IA 2ASEA 5LP6A 3AY7A 3E03A 4DNPA 1Y1LA 3NBKA 5TGDA 2EGHA 1K3UB 1T36B 2OL4A 2YMQA 3DOUA 1I4LD 1SURA 5J59A 5ILOA 1G1AA 3BPSA 4ZJZA 1FUYB 1OOEA 1SC1A 4BCCA 4EB6A 4QEZA 2OGSA 2V7WA 3MUEA 2IFTA 4Q66C 4QOGA 2OZLA 4B6JA 4Y98A 3KKOA 4AF6A 4KSYA 1CY7A 3R3SA 1U1FA 3IVRA 4GG1A 2H4ZA 4BAUA 3B13B 5E4YA 5ILQA 4A4DA 1XJWA 4BFSA 5I9NA 1KYXA 3NJ4A 4LVNA 5DHPA 1JA1A 3GJ7A 3GGPA 1HOXA 1Z62A 2L17A 2L18A 2PYIA 3JSXA 4K9QA 3UGJA 1E0SA 1TJ3A 1ZXXA 4YH1A 2FKNA 4CQLB 1OBOA 2G82A 2Y8EA 3EGOA 3H2SA 4XR9A 1BXRA 1TVKA 4UBJA 4MYCA 4ENWA 3WIEA 1TYCA 1ZUHA 1Z68A 3S1AA 5BNWA 1AXRA 4OLFA 2HLDD 2R8PA 2VNHA 2J3LA 3LQ1A 4FFRA 3DXXA 1KZ9A 4QDZA 1DDOA 3I8XA 1PQYA 2Y92A 1E9DA 1ZGJA 5DBOA 5IAEA 3UHOA 2CJWB 4DG5A 1TPYA 1G8JA 4UVHA 1VP3A 2VTVA 4EPXA 3L7OA 4DCVA 3NBFA 5KC9A 1XWWA 2WUDA 2DH6A 3DWIA 2QTVA 2SICE 3KJHA 3L92A 4OH1A 4IIJB 4D3SA 4MIYA 4FGJA 1WBDA 2QSJA 1K3FA 1L5YA 3ZW8A 4URYR 4ZZ0A 1ZSNA 1Q17A 2Q6OA 3H65A 4K9MA 3V3TA 2PV0A 1LA2A 1A5SB 3GDGA 1C1XB 1PEAA 3VHQA 1Z22A 2D7JA 4I4TF 1MZPA 2HJWA 2QENA 2C20A 4LFBB 2BFDB 3F7OA 1BEEA 3P9QA 4FWIB 2DUJA 3TINA 5K3BA 2QJWA 2IRWA 3WAKA 1ULZA 3KBBA 4EPVA 2VP5A 4AD8A 2QTNA 3K2IA 3Q85A 1CULC 3VC3A 2CDAA 4UHKA 3LRPA 3R77A 5JJKA 4MVCA 2I6UA 2OGUA 4TTRA 4ZRMA 1VKJA 1WNTA 2K87A 3Q88A 4FDMA 4O63O 4XFJA 3EW7A 1BYUA 1EU1A 4M7PA 4TLDA 3THYB 1PVOA 3RFUA 3KU1A 1YOVA 3QFRA 7ADHA 3H99A 2ZANA 1JJFA 1KVUA 2WIBA 3PHIA 4DEXA 4Z51A 3PLNA 2TSYB 4UFOA 2PWPA 1B73A 2PL5A 2IITA 2WNSA 3LOQA 3BXFA 1Q1BA 4XZ3A 3WO1A 3OKPA 3U44B 3UUGA 4LN1A 1NFRA 4A6XA 3W6UA 1BGWA 4JJZA 1C0LA 1R6BX 3AOEA 4KB5A 2AWOA 1AKUA 4LXYA 3VTZA 1CDEA 3H9JA 3EASA 2RK6A 3TL2A 4P2BA 2LGJA 4QUJA 1CEQA 1DIBA 3BXPA 4CMEA 4PQEA 1JZQA 1F2UB 4YJ3F 5BPHA 4WH0A 3CCCA 3GCGA 4TXNA 3K70D 1I4EB 1FOEB 1LFAA 1TF7A 1USWA 2I66A 4UTNA 3VI3B 5E1MA 4BO0A 4DMHA 2XYGA 1AUVA 3M33A 2ZB2A 3NIBA 3KR2A 5LNK6 1D9ZA 1WQ1R 3F9IA 2IHVA 2WAXA 4DNFA 3E7XA 3AI3A 3GRPA 2FX3A 1XZLA 3NT5A 4RZ2A 4PY2A 2BFPA 2WNIA 1SXPA 4E51A 2PPLA 2ISQA 4NATA 4MRVA 1KYTA 2GQ0A 2HIMA 3LUKA 1I4WA 1QHXA 1TA9A 5BYBA 4RTNA 3QNUA 4XDHA 1W76A 1AJEA 1ODKA 4XWGA 2WJVA 4AMVA 5JXGA 2XGMA 5DBGA 1WMSA 4GKAA 3FZGA 2QBYA 3KU4A 1Z5OA 3DVSX 4M21A 3BUSA 4P7KA 4C6TA 4WY8A 1E1CB 4HUJA 2WTAA 4M9CA 4EARA 3AHHA 4MMZB 5BXYA 3STWA 5E9AA 2D4AA 1IHDA 1MX9A 2YRXA 5L53A 2RHOA 4ZEMA 4OSOA 2ZCUA 1Y6GA 3KSDO 5BN3A 7MHTA 2VQSA 2JHPA 3W79A 3W9YA 2VP2A 5LZ4A 2B4TO 2WLTA 4HZIA 1N2ZA 1PV4A 1QB8A 3C3KA 3IOBA 1UBFA 1Z4QA 5JY6A 3O94A 4TMTA 1I5RA 1SXJA 5FOSA 2IWHA 4K9SA 2P79A 1KO1A 2COKA 3H11A 1C9EA 3D5EA 2VYNA 3CR7A 4L16A 4MGZR 3CM0A 4TGLA 1Y7LA 5CLJA 1RMTA 2FA9A 2HK9A 4MQLA 2OE2A 1EQAA 5ITSA 2SECE 2YHUA 1E6LA 3KBOA 5K09A 5HIJA 1RKBA 1W36C 2ZJZA 3N07A 4MVJI 3NGMA 1D7AA 3LO8A 3FOEC 2J32A 4LZZA 5B30A 4MYTA 4E2XA 2ZSHA 3GG2A 3I2HA 4JGGA 4ED9A 3HSSA 3KHUA 4MW5A 5CJ2A 3S4YA 3TQHA 1M8JA 4B6RA 4WBNA 1UPCA 2X40A 1JLLB 4UVIA 5EE9A 1IFXA 1BDBA 1Z5VA 3NLLA 4B71A 4D8UA 3HPRA 1EM6A 4XYBA 3VOTA 1UJ6A 2QTWB 3KJIA 3V6LA 1WOYA 3H8VA 5LMNB 1SUCA 1HZZC 2DUWA 3PQ5A 5DWDA 5FPPA 2Q7XA 3GOQA 3K8OE 1OZGA 4EB8A 1CP3A 1Q92A 3S8EA 3C8DA 1ZI6A 4TUYB 3LT1A 5CJJA 2BKLA 1JSZA 1PQWA 5ITZB 1CUUA 3B51X 3FYUB 2B5WA 5TSDA 4LGMA 3QXHA 4BNDB 1T3TA 4DV2B 3BRWA 2GNOA 4KTTE 3JASA 4NOLA 4BQRA 2HBQA 1ZM3A 3IE1A 4EG0A 4MQUA 4QBGB 2CBZA 2VHQA 1LBIA 4RM3A 3FTCA 4DGQA 3H1PA 2OBXA 3ROKA 2IJGX 2OEPA 2QRMA 2VJQA 4LHXA 4URZR 1G6HA 5JJLA 1NLZA 5JJCA 1DEHA 1G19A 1BEZA 1H6BA 3OZSA 3TL6A 4LRUA 4I3FA 4GRDA 3OLVA 5FL7D 3EPRA 4H77A 4R4JA 4EENA 1CHDA 4B6GA 3ADBA 1CZHA 4OHBA 4DG8A 1BX0A 4PG4A 4FD3A 4IEEA 5IH3A 2C2ZA 3TFQA 2PKWA 3REQB 3AEKB 5IJ0B 4BN4A 5LA6A 4N9WA 2W5UA 1C3OB 5A5FA 4LXIA 3MBIA 5ICSA 13PKA 3EVZA 3OJEA 5LP6C 1T0BA 5JHGB 1C14A 1PT5A 3OM9A 2A0WA 2D74A 2QDKA 3EWIA 1ULHA 821PA 4CFZA 3HVRA 1QPZA 3K15A 3MPOA 4JXKA 4Q7KA 2J9FB 3ECCA 1R4MA 4HLDA 3AVYA 2R7MA 1ZD2P 5A3QA 2PSHA 1FQJA 3C0KA 3HP4A 3WA6A 5I8ZA 3QOXA 1GNLA 5HX7A 4C7OB 5A9SA 1L5VA 4KXXA 2LD4A 4J2OA 1I5EA 4K6MA 3BK2A 1VHTA 1RI5A 4J29A 3UGKA 4LE2A 2PS9A 5FL7A 2W83A 4U7GA 1C4XA 1N6PA 4KYTA 1PTJA 1DWPA 4KLAA 3QVKA 1SBIA 1CSEE 3HCNA 1GPYA 3G5UA 1NPYA 3JPWA 3QTBA 1BCRA 4W8HA 5BR1A 4XWKA 1CDDA 3HKEB 1O6ZA 5AW6A 3UOWA 1XRSB 2NXEA 2VNJA 2FPSA 4B75A 4GECA 3O8CA 3ESZA 3VNUA 1MO3A 3QEMA 1QRRA 3OJWA 1FP6A 2VCHA 4KMMA 4PRKA 1DEAA 5E7QA 4D8WA 5AUPB 2ZAMA 3DHEA 3H3FA 3GXBA 1KOLA 4X3CA 3FNGA 4DQVA 2HCTA 5KAPA 4UOZA 5AW1A 2NNLD 4XVCA 5GGYA 1NXTA 1O6FA 1NUUA 1XLUA 3W06A 3A9CA 1EUQA 4KODA 2XMGA 4HRVA 1QJ4A 4WZAA 5C52B 1D9XA 5ULLA 2BEVA 3QBJA 3ICOA 3RC9A 1II8A 1MCZA 2EQ5A 3K2EA 2CL6X 4WFIA 3WLSA 1NYTA 3OPYA 4CUKA 3GJZA 1G5TA 2DYKA 4H08A 1US8B 1KP9A 2VUSA 1IB0A 3PQ4A 3VOSA 4MCIA 3W2GA 2A0FA 3HXOA 1G8PA 1Y5LA 4OSPA 4Y6OA 2PUCA 2R85A 3S8MA 5K0BA 1X1TA 1KJQA 3GEEA 1GEEA 1BJKA 1G4AE 1JT9A 1K63A 1KRHA 2GXUA 2YJ6A 3PGKA 2G5TA 4K05A 4KCGA 3PHBE 3DKVA 3OU2A 3I2JA 5DWVA 5JSYA 4JV5B 4QQ8A 2FSUA 2IZ5A 3LH5A 5TARA 3TB6A 4YXFA 3TTUA 1LD3A 1QUEA 4FNOA 3ZJYA 2IQIA 2J5XA 3D2AA 3ZOZA 1F0NA 1SZJG 5DX8A 4PZ0A 1WXIA 1VHDA 2D1SA 4IS3A 5CD9A 2XXAA 1XZCA 4R2LA 4RIHA 1REQB 2SCUB 2FI1A 2YIMA 5BPFA 5H80A 1SQGA 3EC2A 4RNDB 3STXA 4ZVQA 3LYUA 4YV1A 4ZDKA 3C14C 3KUXA 2AEEA 2XAAA 1LNQA 4JJIA 4NCJA 3SHWA 1JJVA 2OZVA 4CT4B 5EQJB 4EITA 3AP1A 1G9TA 4JYBA 3JALA 3AOEC 2E87A 2DG2A 1Z12A 2GVDC 4TS4A 4U7PB 5FYQA 3IHKA 4HVAA 2PMCA 2ZE7A 2ZYVX 3MHPA 1K68A 2Y05A 5TMPA 4A0SA 3UO8B 1JA0A 4CMEC 4UTPA 1GL3A 1N92A 3IC5A 3NT2A 4EFDA 4H1HA 5JALA 3RHSA 1IEVA 3KOMA 3P4UA 1YZFA 3MTGA 1GU1A 1NT2A 3QKRA 3TZ6A 3IBYA 1JFFA 1T43A 3W5SA 4LZJA 4OU4A 1KETA 3BSWA 5LZ9A 3DKKA 1U0BB 4UAGA 2O2SA 5IEJA 2VAVA 3ORSA 4RQBA 4K8OA 3F5MA 2ENWA 4X90A 1K5HA 1ARZA 1OIXA 3O03A 4KPUB 4MDYA 4GNRA 2HWYA 3W4KA 1S02A 1UODA 2VKTA 3EBPA 3LWBA 2HPZA 2EZ8A 1P5JA 3HFJA 1NNSA 4H7PA 3UG6A 1H8EA 2D0PB 3O2QB 1DKMA 3AYZB 2D54A 2C7QA 1H1LB 3TRKA 3DV0B 3GEBA 4ZCLA 4CFYA 4ESVA 4NHEA 1QYRA 4PLCA 5KVQA 5BOSA 1EUYA 2EP5A 2QQFA 2NO4A 1NLYA 4P7FA 5TV2A 4BO8A 1Y7HA 2PRJA 1UMKA 1PX2A 1XA3A 4TM7A 5FLKA 5HKBA 4IIGA 4YLEA 5F73A 5EUMA 1PJLA 1QGYA 4B6SA 1DTWB 2BH9A 1Z4MA 2Q8PA 4MYUA 4Q82A 4ZI7B 3K16A 2UZ0A 3U39A 1I2AA 2N0SA 3K1AA 1SXJC 1QF7A 1VL8A 2BHNA 3S27A 5BSGA 3WDKA 3UC5A 2XNSA 4ZKDA 2I67A 3PDHA 4B3RB 4P0QB 1Q84A 4WFKA 4X20B 1LVHA 4HGQA 4JX9A 1XR3A 3PTZA 3U40A 3D3EA 1AQ6A 2I71A 2YYZA 3AR2A 4R51A 3O1JC 1V5FA 2X1LA 2DPLA 2YN0A 3B9BA 1BOOA 2GJ9A 1KFEB 3N8IA 4RF3A 5FBLB 4BCBA 4EM6A 4U3JB 4EATA 4CMKA 1R5JA 1UQUA 2X3YA 3AG6A 3D8TA 4JOQA 1C4WA 4F0JA 2O14A 2ATCA 3THWA 1HQKA 3KTAB 5KSZA 4NL4H 1NMZA 4ECAA 1YZYA 4WKPA 4ZEOA 3DFKA 4GM1A 5FKJA 1RLOA 3N0RA 3ZQKA 4M9XA 2RKOA 3CX3A 3A7DA 3IHWA 1QRTA 5REQA 2LE0A 2VSYA 3ZVLA 4DDMA 3HKDA 4PG5A 3V1YA 3ZVRA 4MUKA 3P5BA 3A4YA 1KTVA 2W2QA 4DDWA 2QOEA 5CDYA 4YHHB 3I6IA 2IPXA 4BNYA 2WFMA 4YXWD 4WHMA 3DBHA 2WKSA 2IYAA 3R7AA 3RG8A 2EKPA 1X7ZB 3RRXA 4A15A 5EIHA 2B1IA 3OBBA 2BF4A 1LV7A 1ZIOA 3VJKA 4E5DA 3NHJA 1TM3E 1QIFA 1XZEA 4MLZA 1M6EX 2EWMA 1QX4A 5AXBA 1R0RE 5LWQA 3ODPA 5K2OA 2JJMA 4W99A 1GU7A 1O97C 1YB2A 4L95C 4IZIA 3QPVA 2QMUA 4JS0A 3UMYA 3DDOA 5TT0A 5AM3A 1TLFA 2PO5A 4JA0A 2QUKA 3NUGA 2P9GA 1T10A 4YNBA 3JZIA 4XCVA 5EZ6B 4ZOQI 5C5DA 4OHFA 1ANKA 1GQ2A 4B4KA 3JR7A 4NPAA 4AP9A 3ITDA 3MVEA 3RI3A 1YIDA 2XITA 5KNBH 1QUFA 4LTMA 3BWEA 1CF9A 1VXOA 1V26A 3FF1A 3GDWA 3LQ2A 2FW1A 3ENKA 5ALLA 4NEGA 4U8HA 1LRLA 5IDYA 4U9IS 4DWJA 4OD0A 1KS2A 2IX9A 5BUCA 2IGTA 1GILA 1WHTA 2FOLA 3IKLA 1CDZA 2O48X 2J4DA 2PS0A 2PXHA 3U13A 3V2GA 4YXWA 1ZHOA 2HFJA 2NZJA 2WT9A 3EPPA 2XB8A 1NQTA 3GUUA 2E48A 2VWQA 3DM9B 3MXTA 4E30A 3UPTA 3EDQA 4FYIA 1GCIA 3UWSA 4WLUA 3H9GA 5ALYA 3SSMA 5LXTB 2VDJA 3O8DA 2IHUA 2OB2A 4AJ2A 5A1TA 4RXUA 1K5PA 3P9CA 1P9RA 3HZZA 3QVVA 2PJRA 2ZJFA 3ZWDA 5AFSA 2HNKA 1RHKA 1XTTA 3AFGA 3L8CA 3QH4A 1Z6QA 1E1RD 3I01A 2AZXA 1ZH0A 5DRTA 5DTRA 3ON5A 4HDNB 4UDOA 1TMYA 2R60A 4A0FA 4JC0A 4X54A 4Y6GB 4D9IA 2GPAA 3EVFA 4I1VA 1CV2A 1BVUA 1R7RA 3W2TA 1PTJC 4YRZA 3QE2A 4B3CA 1YS1X 5IC4A 1RNLA 2ZBGA 1K7EB 1W49A 2GBIA 3EULA 3AESB 3DLBA 1PYOA 1XMSA 1L7PA 4D7AA 3NUQA 1USGA 2C9YA 3K5IA 4OQQA 2FUEA 2J6BA 4MI3A 3WGOA 7GPBA 4PU0A 2ZRJA 2WABA 3A26A 3RSZA 3SFZA 4NMMA 1WVMA 3SVZA 3EFBA 5T67A 3ZV4A 3B6MA 1ULAA 5TS3A 3RROA 2QL6A 1JFVA 2WIFA 3JD1A 3ETLA 3W77A 3RNOA 4EJ0A 3EPKA 3IILA 3WOHA 2G71A 3OF2A 1VGQA 1G2PA 5CB6A 4HBGA 1Z4KA 3HZHA 3PJFA 4C08A 3M1LA 3RTEA 2O2ZA 3HI4A 5FP0A 1KH1A 1SZDA 2YXBA 2ZU0C 3SZOA 1NMYA 2D4HA 3EODA 2IHBA 5HKLA 2G9NA 3WVNA 1KYWA 4Q15A 3LDAA 4O2RA 3TBFA 3K0AA 1W4BA 3L7LA 1UWKA 1PNOA 5CIYA 4G0MA 2YS7A 1FU8A 1N5LA 2BTEA 2PL1A 3P9IA 3KTFA 3OETA 2FDCA 5KTNA 2BCGY 2QTTA 1I6MA 1Q19A 2I7XA 2UVPA 3C6YA 1PJ2A 4XRRA 1PG5A 2FWMX 1P5ZB 4WJKB 1MAHA 1O08A 1T0JB 4S1VA 4BKRA 4X00A 1Q3HA 3P94A 4L7VA 5DIFA 2FFRA 3AZOA 4FINA 1I6LA 4IH9A 1Q7GA 2CK3A 2Z5FA 3IUNA 2FPIA 1J1IA 2NAFA 4G5RA 1J33A 4EK9A 1MF7A 1NV8A 2P6PA 2PTHA 4FMBB 2IYEA 1J0AA 4AQ7A 5MDHA 3HP7A 4EG5A 1FRQA 2XB4A 5TR9A 1FFSA 3FWNA 3OJOA 1N36B 2FCRA 2NUAA 3ZE1B 2FP4B 3Q12A 3W3AD 3QFSA 1U94A 3RS0A 3ZDEA 1AK1A 3C6ZA 3MGBA 2AJLI 3HUFA 2X22A 1WDMA 3N2YA 1SGWA 3AH8A 1ABBA 4C43A 3WO0A 1JHVA 1U5AA 1JN0A 1GZ6A 1NI4A 2JFFA 1JMVA 4MIKA 3BDIA 2Z2XA 4O4HB 4OVKA 3LX5A 4EHFA 1Z6AA 4JQCA 2DY1A 1UJ4A 1DEOA 5EHGA 3ZCRA 2Z6AA 2B8JA 2QG9A 1DAGA 3A8TA 4WXHA 3VZDA 2VATA 1D1SA 1OWOA 4FP9A 4P36A 3ABIA 1JJ7A 3O95A 3GEGA 4G4GA 4J0CA 5LYJA 3C3EA 4TWJA 3DVLA 3RKUA 1JBQA 1Z8FA 4UDYX 1VSVA 1D2RA 3ME5A 2P7IA 4TTTS 3LLSA 4QPZA 1Z17A 2R66A 4RMHA 1PFQA 3L8HA 3KT8A 3Q3VA 1P33A 3ZU5A 5GZ3A 4RZIA 1OAOC 5FA5A 5H68A 2HDOA 4P7BA 5K3FB 1A9YA 4HPXB 4LHSA 4W63A 4DARA 5C1BA 5CFNA 4YR7A 4K9KA 1R9MA 2OBLA 3AIMA 4YALA 5E4TA 3UJCA 3ND6A 2Q4EA 3ZX5A 4KW7A 1E9EA 2LVBA 3W3AA 3S1LA 4N3CA 1G2QA 2O3SA 3KZKA 3VAZA 3SQMA 1G20B 2FN7A 3S99A 3PQ3A 1LX6A 1XTQA 4JITA 2YZ7A 3RVOA 2M6RA 1P44A 2Z30A 1ZCFA 1ZMTA 1KJWA 1L6IA 1QORA 1ZMXA 4INOA 4F9FA 2TECE 5LQNA 2BGTA 1NN3A 3EH1A 1MNAA 1TQ8A 1SJ9A 3EOAI 3CRVA 4HC4A 4D3ZA 1CUVA 4R8SA 1HDZA 2GRUA 3WJ2A 2VJMB 2H92A 1DG1G 5AOBA 3AEQA 3EVCA 1KMCA 3DT6A 3CF2A 1MAVA 3DCIA 1DKRA 2F43B 1ECGA 3TCXB 2Q5FA 1PZEA 3E4CA 3W5HA 4TL8A 4TYPA 5L3SA 1GUAA 3FSRA 4JL6A 5IBQA 1JIIA 1P8JA 2I5PO 3OHPA 3CHYA 3LKBA 5KWEA 3JQRA 1CF4A 5I9SA 3JAWA 4FR5A 4FGSA 4HWRA 5EINA 1XDWA 3QI2A 4Y18A 4RCZA 3RM3A 4C2TA 4PYIA 1PFVA 4JLDA 1NZDA 5LOVB 3LCJA 3P32A 3ZD6A 1T5DX 3MLAA 2Y77A 4MP3A 1Z0UA 2AOXA 2R4TA 3CJTA 1QQ6A 2L19A 5TQ0B 2EFCB 4U9HS 4F8EA 4IDCA 4V39A 5A4DA 4MDFA 1U2QA 3IUJA 3TSCA 3D3QA 5CX1A 2OV6A 3E9DA 4QJ3A 3QGMA 2Y2UA 3LPDA 4QAQA 3V4LA 3WXBA 1PL7A 1J6UA 2JAXA 4NV0A 1MXHA 3LUJA 2B7BA 1D2HA 4MEAA 3B70A 3PWSA 1IVYA 2HK8A 5K8VA 2INGX 2MYUA 4R7GA 1ATZA 1ZRMA 4G0XA 1XAHA 4NBWA 4QVIA 2H7XA 1OXUA 1VGRA 4U5QA 4MW7A 1SOAA 2DWUA 4MJ3A 4IJWA 4QU0A 1W88B 4HRYA 4RNCA 1ZD8A 1DQRA 4PTYA 2I6SA 1KK0A 4I6GA 2BGNA 3A4IA 1D8AA 4IWXA 1UAAA 4IHAA 4IP0A 2O23A 1FMLA 5ED0A 3CZAA 1N5MA 2VTEA 3UA4A 1KEKA 3U5TA 1JFSA 5KJ1A 2JW5A 1N2HA 2H11A 2YWFA 3JZMA 3Q8XB 2WR8A 4N6OA 1WBBA 4DAOA 2GCNA 4KWEA 2AR9A 2QGNA 3EIFA 4C14A 2H4HA 1OFIA 2VBFA 3GUVA 4R9RA 2DFTA 2C3PA 2ZCJA 2GF9A 4KXWA 2X0JA 1RAAA 5CBKA 4CR8A 3HJUA 1U98A 4PZDA 2NVOA 3H6KA 4TN5A 2KLHA 4YDHB 1HEYA 3TZLA 3V4RA 2QR3A 5FOXA 1QHEA 1LVGA 2D59A 3B52X 4YMIA 3HY3A 4YRRA 2W2NA 3VHXA 3L7MA 4C4XA 1XTUA 5LJIA 2G6BA 1F3OA 1T2AA 3G2MA 4F11A 2V9CA 1UKYA 4RWEA 3DVAB 2WJIA 3KQLA 3PEUA 2X3FA 3ADPA 4DY4A 2IY7A 1TGYA 3HVJA 4RMIA 1XG5A 3EG5A 4Q4HA 5F35A 2R4UA 3U31A 2HRDA 2YWEA 2ZTLA 4HTFA 4TTPA 3RIGA 2XRMA 2YQ4A 5G4KA 1C2YA 1XKTA 1J09A 4V2UA 4KSBA 4PANA 3M34A 2WI8A 3BGSA 1ZUNA 3IAUA 4RHFA 3UMVA 2ILTA 4RLFA 1WL8A 2C2BA 4DJTA 4EHIA 1OJLA 5L3QB 4WCVA 1QGZA 2WMYA 3DEKA 3K6KA 2AZ4A 2FHPA 1FXUA 4WOPA 2GEDA 2YW9A 5HIAA 4FFLA 2V3CC 3HSYA 1V3TA 2J0EA 1T5SA 3FLMA 2HSWA 1IJFA 1F8UA 1QK3A 3NBMA 4NEHB 2JZCA 2BHRA 3I9LA 4W5RA 2V4UA 4GMFA 1A69A 2C2GA 1KK1A 3DDUA 3VM6A 3AM3A 4LRYA 4IGAA 4ZVPA 4DV5B 1Y8RB 2HL6A 5HXAA 2VBGA 3CR8A 4EMBA 2X1MA 3BGIA 1J5PA 2IS2A 4PGMA 3WGLA 2QTRA 2W6QA 2WQZA 3E8MA 4G0NA 2VOEA 2BM8A 1BX3A 4PF1A 3FBWA 1MFZA 2O0HA 3X44A 4BJHB 4URXR 2FMIA 2XGOA 3VAYA 4XM1A 3HEMA 4BASA 1UAGA 2ZJ4A 1SQFA 4QGHA 4RENA 4DV0B 2ZRLA 3LOPA 3RS7A 1M2HA 3TTTA 4QUEA 3IPXA 2B1JA 3RAGA 4EABA 1X6VA 2AN4A 3MTIA 3R3JA 5AKZA 1OZHA 3CZMA 4JDPA 3H4TA 3NBAA 4NAVA 5GOZA 1AH2A 1KERA 1EDBA 3RJMA 2EBHX 1BHO1 1IBSA 2YV3A 5CNJA 5LDGA 4CTNA 5CFOA 1F6DA 4RJLA 4LJRA 2AMFA 1LB1B 1K86A 2FWBA 3ZYZA 2XDQB 2C1ZA 1SBQA 5KTTA 1BFKA 1IY9A 1QQAA 4R98A 1KDRA 2I7TA 5EFZA 1EZ1A 1EXWA 1OXVA 3EAQA 3RYTC 1EFHA 1B3RA 4N54A 3E8SA 2PY6A 5EYPA 3VJLA 4BX8A 1JEEA 3RW9A 5F3WB 1MOPA 1YRHA 3FTEA 5CVUA 3L0IB 1VB5A 2NO7A 5I7AA 5BSWA 3PJDA 1ETUA 1Z28A 3EOZA 1JG7A 3KYDB 4P4TA 2XTJA 2YXLA 4M53A 1XQXA 4TT3A 2A1UB 4KQMA 2O2IA 3KZXA 2B94A 1F0PA 3ECAA 3TNLA 3D4BA 3DVQX 3JQGB 3PD0A 1HEUA 1H3NA 3TBHA 1Z73A 3PNVA 3ORFA 1FJGB 3F7MA 1J0CA 2DFPA 3SX4A 5H83A 3WSVA 5C7IO 1R4AA 3X1KA 4EG4A 4V2IA 5BMVF 1DJOA 2HIGA 2JKYA 2WPDD 1F2TA 3AKEA 3E8XA 3MT8A 3QZUA 4FOTA 3TZQA 4COOA 1M6HA 3QNMA 2FKAA 1JEQA 2ZI9A 2YMLA 1EFDN 3ODGA 3ZI7A 4IX1A 1IN6A 1L7EA 1YB4A 1YV9A 3F6EX 4IOMA 2FPKA 4BXOB 3GFRA 4WKOA 3G2PA 3RYHB 1EFKA 3ZDZB 4OL9A 4CLOB 1PFGA 5HQTA 3BFJA 1PWXA 3WJ7A 3MG9A 5ALXA 4E03A 4YRCA 3EN0A 3R5KA 3AF6A 4KH1A 6REQB 4F8JA 1XLTA 2BP7A 2AE2A 2YIDA 5G2OA 1QQ7A 5FAKA 1QTIA 1M6NA 1XE3A 4WINA 5CXSA 1E3SA 2CYCA 3U17A 1AUOA 1RYMA 4MI1A 4E11A 3N2NA 1H66A 2HA4A 3T06B 4YREA 4HLQB 3TQIA 1XNHA 2FMUA 5JNSA 3OCWA 4P4SA 4M83A 4HDRB 5HJ2A 4YROA 5F77A 1D5CA 1II0A 1YR1A 5AVTA 2CBXA 3QFTA 5JADA 2E3JA 3U16A 4W7HA 1P61B 1ZM4A 3AJEA 1A9RA 3QF4B 1ISPA 4O5AA 4YP5A 5FUVA 4DEVA 3CE6A 1NBME 2WVHA 4OI2A 2FW6A 2G4VA 2RGNA 3FDZA 3PKJA 2WPDA 1KPIA 2P9CA 1GGVA 4ISCA 4XIIA 5DGTA 1RWQA 1V3QE 1TVMA 3EC1A 4J4BA 5BN4B 2GPBA 3BX1A 2Q5CA 3ORYA 1PR2A 2XADA 4JLAA 4P92A 1LPPA 1RXCA 2ONYA 4XQ9A 2XNHA 3UXMA 3VU0A 3RYIB 4ER6A 1WKCA 3FI0A 1MPTA 3RQSA 4PM4A 4B34A 4NBSA 3JATB 3W9UA 3MJTA 5CW2A 5BWMA 1DPFA 1JHOA 1Z2OX 4CIBA 5JS2A 3ASYA 4TMVA 5DXAA 1EA5A 1BA2A 4FN4A 5D8DA 1DOHA 2OC9A 3P4YA 1UPAA 2R6CA 3NHZA 6ADHA 5CA1B 4NG4A 1WMAA 1X7GA 1KSJA 2G06A 3R8CA 1Y6QA 2VHEA 1MABA 1UPXA 1VDZA 3SQNA 2P1ZA 2R68A 3PRKE 3E35A 1JL3A 4GLOA 1SG6A 5HR5A 5JPIA 4J3NA 4IR7A 3OX1A 3DOJA 3ZYCA 5DYYA 5JO0A 1L7VC 1CTQA 5BN5B 3AXTA 4ERXA 3DBOB 5LQCA 3IAEA 3ZGYA 1PWZA 5FO0A 1AURA 1R6UA 4YT8A 3WK4A 1T5IA 1RWOA 4RPJA 3ZDRA 1GZ7A 2AQHA 2ZAGA 1KMIY 3G13A 4KUHA 4Y2HA 3OQIB 3VU1A 1U7DA 2K4MA 3L0DA 1WZCA 4MZDA 1NA5A 2HU8A 4HEA6 2W6MA 1YHNA 4LI0A 4M1MA 1USIA 3RG2A 4OJYA 1K6MA 4DLRA 1IYZA 1T8YA 2ZSDA 4X60A 1DAMA 5BV0A 2BZ0A 3TLYA 2QAGA 1CF2O 3O74A 4R1TA 4MUNA 1NC3A 1H3FA 2GJAA 3DDWA 3FUWA 1F14A 4HF7A 4ESHA 5DWQA 4YMUA 3P8ZA 3BE4A 1KFKB 1ID1A 3IP9A 4A0HA 5L4LA 2BBOA 4GWLA 2C2YA 3LVBA 1QF9A 2GFQA 3MWFA 3PPXA 4PIMA 3HHEA 3P1JA 2AE1A 3PIDA 1U7UA 1IRXA 4MB2A 1TLTA 5AKLA 3U7HB 1DAKA 5HQ3A 1NMQA 2AN9A 4X63A 1E9FA 3IP7A 1II9A 4LK3A 5CB4A 3AVTA 1DFHA 1RIFA 1XVAA 2YMMA 2A8YA 1WWKA 3B1FA 2V1XA 3M5DA 4DLZA 4DLKA 1FB5A 4CKBA 2OBFA 1J7JA 1M2NA 2BMWA 3H1BA 2JD0A 3VYVA 1DKLA 2P9ZA 5C4GB 2O3JA 3FUUA 3VKUA 4A8JB 3I83A 4B5LA 1UBTS 3IUBA 5BXQC 1B2RA 4HXYA 2Y1GA 4RHTA 1T9ZA 4G0WA 1CJTC 4I9UA 4N76A 4J4HA 3ISVA 3KPVA 4NNPA 1UPFA 3GRUA 2VJBA 4NFYA 2FZLA 3RC7A 4CODB 5T4BA 1JG4A 1U5BA 2DX7A 5BVGA 3ZHYA 5KNCA 2AG5A 1JR2A 5LIPA 1UBJS 2PX3A 4B3JA 5ADHA 1J22A 3QVLA 1CJMA 1RRFA 1ZOPA 3BZWA 3QUTA 4GPD1 1DAFA 2XT0A 1KRWA 1EWVA 2ZRKA 3I8SA 1WDWB 1T9DA 2FFHA 4PYRA 3H18A 4ND8A 1U8UA 1JLKA 1V25A 5AKKA 4PXYA 3STHA 3T3OA 1C0EA 2O0KA 1JYEA 3L1HA 3BIOA 4H35A 3K9GA 3IUYA 2ETVA 1AO0A 2ATXA 1JS1X 1LPBB 5EHNA 2HCBA 2HA7A 2KMLA 3V7YA 3CZ5A 4DCNA 4HI0E 5BW5A 4LZPA 1R8SA 4DBVO 3ZLJA 5TQ2B 1V4BA 2G9QA 2B36A 2H8GA 5CDSA 3EY4A 3CZCA 5HCNA 3LPNA 4FR2A 3SN6A 2ZETA 3JYNA 1Q0HA 4C0AC 3HEAA 4FFBB 1UC9A 5NULA 3A04A 4N5LA 2W90A 4RHCA 5FWNA 1OI4A 2CB9A 2JHCA 2Q46A 3ZZTA 5GIPE 3KVOA 3FAZA 3O38A 2PSDA 1MC1A 3H3JA 4TQ9A 4BNHA 3RBVA 5KTRA 2IS1A 1B14A 1WW3A 4MKZA 4RTRA 1I10A 1E2MA 1I3MA 1SHZA 2ZYAA 3CLSC 4JJAA 4GX1A 4L6CA 3NYIA 3SBOA 5EJFA 2FFQA 3RVSA 1KEUA 3T3MB 2GPNA 2OV3A 3OO0A 3GLFA 1QYXA 3RRBA 1OYYA 1T9GS 3T3HA 1SBZA 3HU3A 4DA7A 2HB6A 4DNXA 1TK9A 3EGDB 1IBMB 4LF8B 2I34A 2OPHA 1ZOSA 4FWTA 3H5NA 1PGJA 1WXFA 1GT91 3ZBQA 1X74A 4UNNA 1OZ0A 5BY2A 4WVLA 1LJUA 4Q9KA 4UD6A 5FWXA 2ZQYA 2QMYA 4PLYA 2IHYA 3ETHA 1YVEI 1E6MA 1VL5A 3JARB 3QNWA 1BTOA 2YZGA 2GNPA 2GSDA 4ZOLB 5E2AA 3G0DA 4BRUA 1T1SA 2IYRA 1NZFA 1C4OA 4AY3A 1P17A 2IPOA 2EARA 4PC2A 1SQ5A 3BL8A 2C8JA 2LIPA 3EAGA 3H75A 2HJVA 1V9LA 3HBJA 4XB1A 1ATIA 4XGRA 4HGYA 2FN9A 3UMSA 1GZSA 3L4EA 2ST1A 5HRCA 1XL0A 2VOJA 4A6EA 2X1VA 1E9SA 3ESDA 3R3HA 4Z4HA 1XQVA 2K2WA 2A9QA 1H8HA 3D1LA 2FDXA 1GR1A 5JNTA 2W0SA 2Q2NA 3BFXA 3DO6A 2VBIA 4H4CA 4WASA 3WMXA 4B83A 5DHAA 1I13A 1RRMA 3BT7A 2VSNA 2EJWA 3HDQA 3VBEA 1D2MA 1P9WA 4GVXA 3REGA 2NUBA 2WVAA 4N8DA 3AETA 4BTLA 4G9EA 2HXYA 1YB6A 3PDIB 2WUGA 3D6JA 4HNGA 1T9CA 2JAOA 4I1RA 2HA2A 4ENPA 1DIRA 1UL1X 1SH7A 4OGKA 3QEJA 5CCBA 2CMGA 5FBWB 1ZY2A 3QEKA 3BZBA 4L3VA 1IWOA 2B37A 4JASB 1SKYB 1P7PA 4UUBA 3QPDA 1P6QA 2E0IA 3C8MA 2E4XA 4GPBA 3ICQB 3I6MA 1XLTC 3DMPA 2FPPA 2RGRA 4I7EA 1PYGA 1WIWA 3WQSB 4DSNA 1SM4A 3CZRA 2J67A 1CT9A 3HPQA 5EE0A 5JO9A 5F7XA 5JUWA 1RBYA 4HYTA 3DUFB 1UWLA 4TV9A 4WUTA 4EY5A 1WVGA 2Q3MA 2XCUA 3RDPA 1MR3F 3DXYA 5EKDA 1AQLA 4DVJA 5JLJA 3SZGA 2PRSA 2JZOA 3RUEA 4JUAA 4BJ6A 3AKYA 4ZHQA 3A2MA 5I7UA 4PQRA 3K2BA 2RGNC 2F1JA 2IYTA 1NLMA 3OBIA 2VK2A 3C1UA 4OQYA 2I6FA 4GQIA 1ZDMA 3QMMA 1PL0A 3EUAA 2VUHB 3ZQJA 1B74A 3V6MA 1H3EA 4GRAA 3LU1A 1PSWA 4RD6A 1AS2A 2XA1A 1W59A 3B1XA 1TM7E 1XCBA 2FUG6 4RH0A 1CEXA 2JK0A 3V34A 4POAA 3E9YA 4L22A 3L6DA 5LLDA 1ZUWA 1YWGO 2QVZX 3WWPA 2VDVE 1SRRA 3WISA 1HBJA 1RFGE 4R0VA 3UV6A 1QYDA 1N6OA 2JJ8A 3GFGA 4WN3A 1QQBA 1VMAA 3S5UA 2OUKA 5CLFA 2RHRA 1JR4A 2Y1KA 4A5OA 4BNZA 2W93A 1BXKA 2VWGA 5ICMA 3SXUA 2C5SA 1TRKA 5J2UF 4HD8A 1LBHA 2AJCA 2BWJA 2J9ZB 4FXPA 3MERA 5DM4A 3C24A 5F52A 4CGZA 4B3IA 2BELA 4R1UA 3E7DA 1CR2A 3PGVA 3DBLB 3H87A 1K0FA 5JROA 2I55A 1VC2A 5GJWC 1HFEL 1GGKA 3WGKA 2Q3DA 4BEJA 2BFCA 3ADCA 1O2DA 3VPBA 3CW8X 1QFYA 3A6EA 5CFRA 1X9IA 2R7AA 4KXFB 5JD6A 4II2A 1LPNA 5A05A 1FP4A 1WBJB 3KQKA 4MS1A 4RLSA 1T2CA 1UJMA 2Y9MB 4PICA 4KO1S 3HJFA 2WWWA 4EZBA 3CWZA 3EQ6A 4B0PA 2QAGC 4ND1A 4C4TA 4B4DA 3S3TA 3TSWA 1TUIA 4ETIA 2GKGA 2HH9A 4RK6A 2VF4X 1N2CE 4MKGA 1LLCA 4M54A 4RMNA 1Y9JA 1YZQA 1AA9A 1C9KA 2GBLA 4EKGA 1CD5A 1U81A 2AUMA 4OGFA 3IV7A 4GD3Q 4MAFA 5H5JA 3ZWMA 4K9PA 4OYLA 3V33A 3ZHRA 1POXA 1V8PA 3FHLA 3RIYA 1MJFA 1U7PA 1DKPA 3L8GA 4LZAA 1OFHA 2ZIGA 4RORA 3GFSA 4M0CA 3MWYW 1X13A 4EPYA 4Q4CA 4KXQA 5EE1A 3PRJA 3WIOA 3F1LA 4BO7A 3WR5A 3CWQA 3R6DA 3K0KA 4NCAA 3FZYA 4XGIA 1MD9A 1H6CA 3H1FA 1G3IA 1Q0LA 4GXQA 1YJ8A 1T0UA 4MMYB 3KZOA 3K0BA 2IF2A 1UDCA 2GXSA 5ENVA 5EWJA 3UEOA 3QEAZ 3U1VA 4WZBA 2PQMA 4IINA 3ZS8A 1Q91A 1VGVA 3AWIA 2G72A 3JRNA 5B1YA 1DJLA 1TQ2A 2ECKA 5LWHA 1GZVA 1DPGA 1QKKA 2OCBA 3G8CA 1GQFA 3OWOA 2QTAA 3L0PA 1Z13A 4YBRA 4JI1B 3S1SA 3GLHB 3FJ1A 3LFHA 4X6XA 3ZEAA 3C43A 4QDXA 2OSBA 1EVJA 1VG9B 4L72A 5KOJB 2IQ5A 3EIXA 4K9NA 3OKAA 3LY9A 1KQNA 4TYWA 2GN6A 3FYSA 3VKGA 3TIXB 3QX9A 2EHJA 3AVOA 3LP6A 3EXIA 2HHAA 4MQMA 3R40A 4TSFD 3AUAA 3FWKA 2CXPA 3I01M 5FL3A 1HH4A 1QOPB 2F3RA 1AQYA 2YTZA 2GX6A 3EEYA 3OD1A 5DH9A 1S1MA 1P3DA 1U0LA 2IXGA 3LAWA 5U1PA 2NWQA 5IM5A 1A27A 1LTKA 1FYDA 1ZD1A 5B3KA 3FOZA 4Q3DA 3QA3E 1OX4A 1ILWA 3RE1A 5CDFE 3IUMA 3OT4A 1T1GA 1XZKA 4XLZA 5KNLA 3SBXA 4ZTBA 4HG2A 4ALJA 1JFLA 1Z16A 2WF8A 2POQX 1X92A