1SXIA

Structure of apo transcription regulator b. megaterium
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
273
structure length
273
Chain Sequence
b'TTTVGVIIPDISNIFYAELARGIEDIATMYKYNIILSNSDQNQDKELHLLNNMLGKQVDGIIFMSGNVTEEHVEELKKSPVPVVLAASIESTNQIPSVTIDYEQAAFDAVQSLIDSGHKNIAFVSGTLEEPINHAKKVKGYKRALTESGLPVRDSYIVEGDYTYDSGIEAVEKLLEEDEKPTAIFVGTDEMALGVIHGAQDRGLNVPNDLEIIGFDNTRLSTMVRPQLTSVVQPMYDIGAVAMRLLTKYMNKETVDSSIVQLPHRIEFRQSTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-resistance amylase regulator
publication title Structural studies on the apo transcription factor form B. megaterium
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Transcription
total genus 76
structure length 273
sequence length 273
chains with identical sequence B, D, G, I, K, L, M, N, R, T, W
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sxiA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sxiA02
1JDNA 2PLNA 3HVRA 1RPJA 1F4VA 5HQJA 5CHYA 3JPYA 4MLCA 5EWMB 1PUXA 5DGCA 4W5RA 2L2QA 3LFTA 3OLZA 1BDHA 3M9XA 4F11A 1KRWA 4ZMSA 1GCGA 5IC5A 3IP9A 3CLKA 2RGYA 3MMNA 4Z4HA 5KQLA 3L6UA 4O1HA 3OMXA 3S99A 3TMYA 3IP7A 2J48A 5JNWA 3DZDA 1DRKA 5FWXB 3IPCA 3DLHA 1P6QA 4Z0NA 1HEYA 3EODA 3H5TA 4NQRA 2PAFA 1EFAA 4MLDA 5KWSA 1YK1A 4IMJB 2HQRA 2M1ZA 2R47A 5KQPA 5ED4A 2IPMA 2E4YA 2WMYA 2PUCA 3LUFA 1ZGZA 3CG0A 4W5NA 1NATA 1Z2EA 3CZ5A 3TX6A 3VNBA 4WXMA 3HM9A 3UK0A 1DBPA 1MB3A 4ZPJA 2FTKE 4NV3A 4ZYLA 3KLNA 3CRNA 4HYEA 2NT3A 5KC8A 5FBHA 1DZ3A 2PE5A 4RK7A 1T34A 4MQEA 1DP4A 3EULA 1QP4A 2E4XA 1LK0A 4RU1A 1CEYA 3W9SA 3ILYA 5JS2A 2CWDA 1JHZA 5EWLB 3N0XA 2LIVA 2MSWA 1R8JA 1P8AA 4RS3A 3HS3A 1DG9A 1Z15A 2A9QA 4QYWA 4KRFA 3QLTA 5T7BA 3NHMA 3MM4A 4PZ0A 5PNTA 2JBAA 3QEKA 2LP4Y 3LKBA 5IUJC 3HO1A 3O21A 3LKVA 3O1HB 3Q9SA 3O2QB 4MS4B 1ZY2A 2RJNA 4MQFA 1JL3A 4PE5B 4EYGA 3HZHA 3A0RB 1ISSA 1YK0A 1AB5A 2HSGA 4JB2A 1CYEA 4QICA 1F51E 3T95A 5TQ0B 1U04A 2FMKA 2MYUA 2VYCA 1YMUA 3MQ4A 1J56A 4OLAA 2PMCA 3CNBA 5TPZA 4G0ZA 1RNLA 3H5OA 4H3HB 2PL9A 3LUDA 4TMYA 2QW1A 3I5AA 4Z9BA 1SXGA 2FLKA 3O1IC 3LUKA 1PNTA 3HDGA 1NXOA 3IPAA 2HQBA 3HCWA 3SG0A 2F8TA 1EHCA 5DKFA 2P4UA 3JY6A 3QK7A 2CHEA 3HUTA 1VPWA 3H5VA 2R25B 3Q41A 4G0QA 4OG2A 4ETNA 3SM9A 3JTEA 2VK2A 4MRMA 3TD9A 5FBKA 1JF8A 1LBHA 1PNRA 2M98A 1APBA 2FMHA 1FSPA 2WB4A 1K66A 1QQBA 2H3HA 5IX8A 4PICA 5GQSA 3LUJA 4RK5A 1U2PA 4JASB 4TLLB 4EYQA 3LOPA 4WWHA 3CTPA 4EY3A 3KSMA 3N0WA 1GCAA 1Z12A 4EGSA 4ETIA 2HJ9A 3NHZA 5CNJA 3SY8A 1XHFA 5CNIA 1L5YA 3TB6A 3K4HA 5TQ2A 6CHYA 5TPZD 3OQMA 4Q7EA 3OQOA 4LDZA 3B2NA 3MF4A 2QSJA 4MR9B 3F6PA 4MS3B 2WJWA 2QVGA 3O2JA 2L18A 1JYEA 2NUBA 1NXTA 4ZMRA 4HNSA 3QLVA 3H1EA 4RDCA 2V0NA 4XARA 3EJWA 4MYRA 5DLEA 4LRQA 4NICA 2ID9A 3JS5A 5KI6A 2LUOA 2FW0A 4TLMB 4CBVA 3OMWA 4N03A 2E4ZA 3C3WA 4KK4A 4EUKA 4OATA 4XAQA 3H6GA 1U8TA 3IP6A 2NZUG 1QQAA 3KLOA 3RVRA 1QNLA 3QEMA 1VRVA 4B09A 6ABPA 3O2SB 4LE0A 1U2QA 2N9UA 2FEWB 3JVIA 3A10A 1A0OA 1KRXA 3EDCA 4L4UA 2RJOA 4N76A 1ZHHA 3NNNA 1TMYA 3DGEC 4YLEA 1XWWA 3QX9A 2PL1A 4LX8A 2DRIA 2FQXA 4Z4CA 1BVHA 2GBPA 1PHRA 3LTEA 3MA0A 4LDAA 1NXPA 5IULC 4NCBA 4WUTA 1M5TA 2PUBA 4EYKA 3G85A 1QPZA 1E6LA 2QVCA 3LMKA 1JYFA 2IPLA 1Z26A 2LPMA 4RK1A 4DN6A 1JLKA 1NXVA 5EWJB 4E7PA 3BBLA 5IBQA 3QLUC 2CHFA 7ABPA 1PEAA 4KQCA 2AYXA 2QU7A 3GT7A 3I45A 2E4UA 4WXEA 4JOQA 1E6MA 3CS3A 1D5WA 4OBBA 5BRAA 3DGFC 3A3KA 2VUHB 2YHAA 1E6KA 3CG4A 3O1JC 5TQ0A 4JP1A 1C4WA 2P9HA 3SNKA 2HPHA 3GL9A 1JH9A 5HKOA 1B00A 4M88A 3HDVA 5HSGA 4RY0A 3C3MA 1DRJA 1XHEA 3CU5A 3LUAA 3KS9A 3URMA 4MAAA 2NT4A 2MSKA 3DLBA 2PUAA 1ZDMA 3EAFA 1A2OA 1YIOA 2FKAA 3FFXA 3K9CA 4Z4FA 3HSYA 4G0XA 4YWHA 3HUUA 3C97A 3F7NA 4MR8A 1SRRA 1TJYA 5JNUA 2QV0A 1EAYA 1M2EA 2GI4A 3KCNA 3KG2A 1P2FA 3QELA 1E2BA 3OM0A 4D6XA 4KPYA 3I42A 1ZH4A 5T3YA 5TE9A 1MAVA 3NNSA 1VLZA 3H5LA 3GBPA 4N0QA 3C3KA 4LZLA 5CNMA 3I09A 5I4CA 4RY8A 1NXXA 4MR7B 1VKRA 1NY5A 2MSLA 4RWEA 1D4ZA 2Q5CA 4EVSA 2TMYA 4N0PA 3DBIA 2PUFA 1KMIY 5FWYB 4OLBA 3LUCA 2H0AA 4MS1A 4RKQA 4MS3A 4YP9A 1YS7A 4RSMA 4MQEB 3C6QA 2PUGA 2FQYA 1EWTA 1OXKB 3JPWA 4P98A 4RK0A 4EVQA 2WJAA 3ROFA 3GBVA 2X7XA 5C5EA 1Z16A 1W9HA 2NZVG 4W5QA 4YS6A 3N75A 3TO5A 2QXYA 1FFWA 1AB6A 2FMFA 3VNAA 5B3JA 4KMRA 2WY2D 1YMVA 4HNRA 5BR1A 3KKEA 4QPJC 4RXMA 3OM1A 3BRQA 2JBAB 1BDIA 2ZWMA 1CHNA 1TVMA 3BILA 4UHJA 4FE4A 5EWMA 1QMPA 1ZAYA 4KZKA 4XLTA 1A04A 1NXSA 3SQNA 3A0UA 4S04A 5BRJA 4L85A 5TPWB 4YCSA 4F06A 3GYBA 2JCGA 1DCMA 3O75A 3Q7SA 3Q7RA 3OQNA 5BQ3A 4XASA 2IPNA 4Z4EA 1USIA 5FWXA 1RZRD 1FFSA 3EQ2A 4YRZA 4KFCA 3FGZA 1LJLA 4IF4A 8ABPA 4TN5A 5IEBA 3M6MD 1TLFA 3L49A 2A9PA 1DBWA 1L5ZA 5TQJA 4KNYA 4KVFA 3T6KA 1SD5A 4MRMB 5EWJA 3HK2A 1YVUA 2FLWA 4Q6BA 4KV7A 4PYRA 1Z13A 1W25A 1QO0A 4YV7A 2OQRA 4RK4A 3FFWA 3ROTA 1USGA 4GPAA 5HM6A 4Q6WA 3G1WA 3MIZA 1P6UA 3EQZA 3LUHA 5IUKC 1Z17A 1QP0A 4UHKA 4RK6A 4KQ9A 3O74A 1FFGA 3CHYA 4O5AA 3GV0A 5EWLA 3P9YA 2VUIB 5TQ2B 9ABPA 3QLVC 1USKA 3E3MA 4PEVA 4YO7A 1D2AA 2E4VA 3H6HA 2QR3A 1Z25A 2ID7A 2PKXA 5CNKA 2FSPA 3RVQA 1JWLA 1DC8A 4MS4A 1JBEA 2CD7A 4H60A 4QYMA 1MB0A 3N6VA 3H75A 4KK3A 1ABEA 1ISRA 1PEYA 3RVNA 4ETMA 5KC9A 5KQGA 4JB0A 1QP7A 4G0MA 2JRLA 2HQOA 4RKRA 1DC7A 3H5WA 1Z2DA 2XDYA 3CZCA 2IKSA 1GUDA 1EWVA 5E3JA 1U0SY 1QO0D 2JVKA 3OLWA 3T8YA 3HXMA 1WETA 4F12A 1DJMA 1ZH2A 4JA2A 3M9WA 4WZZA 1URPA 3BRSA 4EVRA 5ABPA 4MGEA 2IPAB 4MR7A 1ZN2A 3JVDA 1DBQA 3UUGA 3D8UA 1C0EA 2IDMA 5DCLA 5IEJA 4E7OA 1M2FA 3QEMB 4IGAA 3RVLA 3OO0A 5JNSA 3H1FA 4XFKA 1DCFA 1JFSA 4FB4A 2FVYA 4FE7A 1SXIA 4IRXA 1UDRA 2GX6A 5FWYA 1BA2A 1BAPA 2B1JA 2GKGA 1YTUA 5JNRA 4KREA 4YR7A 1QKKA 3T38A 4LE2A 4GNRA 3IDOA 1JFTA 2IYNA 1H9CA 2GWRA 2FMIA 2MYPA 3OO1A 2O20A 1LBIA 3RQIA 2FXIA 4XXHA 3F73A 3Q7TA 2WRZA 2MYTA 1I3CA 1EWKA 3GRCA 3KYJB 1NXWA 3FDFA 4N41A 1GLGA 4JAVC 1YS6A 4G0PA 4O1IA 4RY9A 2PUEA 4D74A 1JDPA 2FN9A 2KYRA 3CKMA 3UKJA 4D6YA 3OLYA 3QX8A 5C5CA 3FMVA 2E4WA 1ZITA 3HV2A 1ZGGA 2PUDA 2R48A 4P1ZA 1RZRA 4IMIB 2YHBA 4MR9A 2B4AA 5IUNC 2L19A 5TPWA 3KHTA 1M5UA 4G97A 1TM2A 5JS1A 1GUBA 4N47A 3R0JA 1S8NA 1Z18A 2JB9A 3MYYA 4OTZA 4Z9AA 3RVSA 4Z4IA 3RVJA 2A9RA 2MYNA 5D2CA 4F8JA 2FEPA 4G0YA 3KTOA 4W5OA 3OLVA 4Z4GA 4Y9TA 2L17A 3BREA 2WWVD 4ZJPA 2I6FA 5F64A 1BDJA 3H1GA 1KGSA 2JVJA 3LUGA 4H3KB 1Y1LA 3KYIB 1D1PA 2PJUA 2LBPA 4NCAA 2RDMA 5GOTA 4S05A 4MR8B 4MQFB 2OENG 1ZESA 1ABFA 1NTRA 2BGGA 1JX6A 4G86A 3QELB 3N8IA 3FFTA 3NBMA 2AYZA 4RXTA 4RZSA 4LE1A 3E61A 3H5IA 3IP5A 5DTEA 3EGCA 3N0RA 2A9OA 1IIBA 1K68A 3ILHA 4ML3A 4MPTA 1SXHA 3RVKA 1ZVVA 3HEBA 4HNQA 4RXUA 3KJXA 2ZAYA 3CFYA 1D1QA 2JK1A 3RVPA 3RVMA 4RV5A 4MS1B 2F8SA 2FQWA 1MVOA 4IILA 3F6CA 5JNTA 5JNVA 4YGXB 1MIHA 3SAJA 2W42A 5B3JC 3GWGA 3N53A 4W5TA 4G0OA 2IOYA 3RH0A 1FQWA 3HJFA 1OXBB 2FEKA 3RVOA 1JFVA 3NNDA 1RXEA 3D02A 4Z99A 4DQDA 5KQMA 1RXIA 2R4QA 4DADA 3OLXA 4WT7A 1DCKA 4F3TA 1LJUA 2QZJA 4EYOA 3Q15C 3GA5A 2FN8A 2JVIA 3QLUA
chains in the Genus database with same CATH superfamily
2OD7A 1S8OA 2PLNA 1QM5A 3FSGA 3EYAA 3S2UA 3FUCA 3IT1A 5HQJA 1ZK2A 4GZMA 5BVHB 4GOKA 4MLCA 1OZFA 1Q0ZA 3TRFA 1AMUA 1PBNA 3P2MA 4K3UA 5JMTA 2P77A 4OQMA 3OZVA 3LLMA 3M9XA 3BXOA 1MOQA 2JCXA 3VR3A 3IP9A 3IEMA 3NOQA 1U28C 1WEHA 5JADA 3LVRE 2WWHA 2DLNA 1BMTA 2JLXA 4DCOA 1DKRA 4RF4A 2PKQP 3N2KB 4DLZA 1MO4A 2XQGA 1E3MA 1TC1A 2P5UA 1QXSA 2LD4A 2LDXA 3P9QA 5H9VA 2Y9MB 4MQLA 4Z0NA 4UM9D 2CHVA 2HMTA 2Z56A 4AULA 4BYGA 1HLFA 4XH9B 5L3SB 3K09C 4B43A 2ROQA 3PFGA 5CK5A 2A33A 4RIFA 5EIXA 1ZFNA 4E3WA 5ENVA 1X7WB 5F2EA 2BHLA 1JI3A 3FPFA 4M86A 3UJ6A 3L02A 2EQBA 1KMHA 3ONVA 4UQPA 3RRMA 2QQFA 5L8VA 4D9KA 4Z4QA 3WWCA 4AECA 4MVWA 3LWNA 1EDEA 3TQFA 4E2FA 3O73A 2WQ7A 3VR4D 4FNGA 4IGFA 4LOAA 4TM8A 1C30B 3VNBA 2VDJA 4BLVA 3TTUA 2ZUCA 2IFTA 4ZYLA 3GGOA 2JKZA 4NV0A 2OV2A 4H0NA 2FPIA 3C3PA 5EZ5A 2X4IA 4C76A 1IHDA 5G0SA 1ZLXA 3B60A 5EJEA 1RYMA 4MQEA 3UMGA 3L2OB 1X39A 1VKZA 4X54A 5TV2A 3O93A 4D44A 5C37A 2PFGA 3AETA 4RU1A 1UIRA 4PSDA 5JFOA 1CY0A 3IAS6 5BUZA 2XCRB 2C5GA 3FOBA 4BFUA 1R8JA 4DE5A 3G2KA 1FFDA 2VZLA 4GVLA 4MAMA 3PNOA 2ZAOA 4ZZ1A 2QTWB 3ZZ0A 1BEUB 1QH1A 3DL0A 3U13A 4BRZA 4P81A 1QS0A 4J91A 4QGFA 2GPAA 2BZ0A 3IJRA 3W8FA 2XZTA 1JHMA 3FIJA 2OO5A 3KTDA 4JI4B 2JHFA 4HH0A 4YH1A 2IQ5A 1ENZA 2II6A 3FY4A 4HAZA 4ACBA 2C3OA 1ISSA 1V1MB 2Y27A 4UOZA 2GOYA 4E5PA 1Y89A 2AKEA 1DTEA 1VMEA 4XKJA 2FMKA 4GDMA 1F8GA 4OXRA 1VLMA 2XHZA 3AW9A 4RENA 5J47A 3TRKA 1X7HA 1QOZA 3OT1B 5TPZA 1GOTA 1MR3F 2OGSA 3JVVA 3GAFA 3KFXA 3TCKA 3GPLA 4BEWA 1ISJA 4TMYA 2UYQA 2H1HA 4K9MA 5JBIA 4W1PA 3K70D 1N5IA 3IV7A 4NBRA 3G82C 5B4VA 3B1WA 3LUKA 1XCJA 4GAEA 3C8UA 5BOSB 1UM8A 3NC4A 2IBMA 4C4XA 5I4BA 4OQPA 1ONPA 1YWGO 4EW3A 1GY8A 6YASA 2ZI4A 4K6OA 3AG6A 1UQTA 2QP3A 1VPWA 3LPMA 1CVRA 4QXAA 1YZNA 2FSFA 3FN4A 4YAOA 1YZQA 3OWOA 4Q1BA 2AMVA 4PQGA 2B1QA 2IHKA 2MU1A 2PJDA 2QG6A 5CDSA 5ISMA 3KJNA 5CD9A 1RC1A 1WP4A 5AHWA 1V1RA 1V4BA 1W19A 2X13A 4ARIA 5JQGF 2ZUVA 2C2WA 2WHQA 3IUPA 3H83A 3M5CA 2QZPA 3AGQA 1SELA 1Y9ZA 1L8XA 3I73A 4X8LA 1EI9A 3N8HA 4I4LA 2DWUA 4FD3A 3V7YA 4NE9A 4OI4A 3PTZA 5BT9A 3RC9A 3ENKA 4HRAA 3NHZA 4ZU6X 2XIJA 4O3MA 1GR1A 1Z7YA 9GPBA 3DEHA 1E3JA 4ND2A 3BGVA 5EP2A 4AUEA 5DYTA 1G19A 1IRIA 1GPBA 1Y9EA 2QDXA 3L8GA 4C6HA 1VJ5A 4FDMA 4HUQB 2HRBA 1JYEA 2L18A 2XOKA 3B5JA 3Q2KA 4QOFA 3WLFA 4XJSA 4BX3A 1MNAA 4OHPA 4D92A 4ZMRA 3Q11A 5I7FA 1EDBA 2BSQA 1K5PA 3WGTA 2WT8A 1JECA 2PPVA 4X1IB 1U1DA 1Z68A 2RC6A 3QV1A 2DYKA 3SHFA 1P6XA 1A1VA 4B47A 1JDTA 1N3BA 1ZK4A 2PYDA 4RMJA 3VA7A 4IEIA 1Q1GA 1R3UA 5HKLA 1VPDA 2IODA 2YV5A 4UPEA 1D5CA 1GL6A 2A88A 2BZGA 4GLJA 4XDGA 1FP4B 4NZPA 3WL7A 1OIXA 1E18A 2GDJA 1LK5A 2IHUA 2YX1A 1JN0A 1N2OA 2R85A 3ESCA 2DPYA 1YR8A 3ONNA 4KK4A 5AI9A 3CSUA 3BF7A 3IJPA 3JQAA 3MQ2A 2NVBA 4PG7A 1B1AA 3MOGA 3QEMA 2P9GA 3PUKA 5BNFA 3HWSA 1VKHA 5FEUA 3NTLA 1K75A 4GRIA 4EPVA 3ZHZA 4GP9A 2FEWB 4OQZA 3KOZA 5ALEA 4F4IA 521PA 2RJOA 1IN7A 2HK7A 2R66A 3GMSA 1A9XA 4U7DA 4GSKA 1N5KA 5IZCC 2X76A 3NVKI 2PX2A 3JQGA 4MA4A 4RPKA 1FA9A 5KAMA 4AMGA 1D2GA 4X85A 2NV6A 2QPTA 4QFBA 2WA1A 2CXXA 4ERXA 5TJ9A 3VZPA 2IYWA 2Y67A 4PLGA 3TBFA 2PS0A 1M1NA 3ZI7A 3WLSA 1PR9A 4MRVA 3S2EA 1TECE 1K1EA 2A8YA 4UM9B 1PT7A 2DHEA 1H5QA 4OB8A 1JLRA 5JOQA 5ILOA 2PMEA 1VI6A 1PEAA 4HX2A 3W4JA 2QU7A 4KN8A 2X2FA 3R41A 4FQ8A 1VBKA 1J4AA 4RNDB 1T36A 1CBUA 2YJ3A 4D79A 2FP4B 2IH4A 3R4VA 1CY1A 1INLA 2GPTA 3I39X 1DIHA 3RRBA 2MOKA 4ZVNA 3V32A 1V8ZA 3H1TA 4F91B 1EB9A 1NVEA 1CQZA 3E58A 3MTBA 1FTSA 5AKJA 4ZV7A 2V55B 5TNXA 4POOA 3V00A 3DNFA 5SY4A 1SUWA 4US1R 1W6RA 5DLQC 1S9HA 2HM7A 3G5TA 3PNMA 4L15A 2QJOA 4P84A 3RRZA 1K92A 3ZGNA 2WD9A 1GG9A 1HSOA 1AGYA 4N9WA 2WHYA 2VJLA 1QO9A 5A3QA 3HSYA 4O29A 2OFPA 4OHBA 1BS1A 1IBMB 2OV4A 3UMRA 4HDRA 4MR8A 1YL6A 3CJTA 1XDSA 4M1MA 4C43A 5BMOA 3DZIA 1KJNA 3KAPA 4MPDA 4X71A 3DC7A 3B12A 4OL9A 4REQB 3UGQA 1ZD3A 2WHPB 1TQ2A 2C5AA 1XP8A 2AK3A 3NGLA 3QY0A 4AYXA 2BFBB 5BN4A 3I42A 3IAFA 1DAOA 4C3VA 4IFEA 4S1PA 4EKIA 1XJ5A 4Q4CA 3RW9A 1R4ZA 4E0BA 1P9LA 4TSFA 3DDOA 3VNVA 1QJCA 2P2NA 2H29A 1ORDA 2ZJ7A 4NONA 1HY3A 3GJZA 2BKXA 4GP7A 2DFVA 2WC1A 3G8BA 4Z49A 3H5RA 3FETA 1KO5A 3ETJA 1HZZA 2CNBA 3FNQA 1VM6A 4DJ5X 4R0MA 5C4MA 2QMUA 3F0TA 4RZ2A 2P6PA 1WPQA 1OXUA 1SQGA 2DTXA 1OI3A 1KSHA 2IXTA 3K70B 2W11A 5IAAA 1Q14A 3GEGA 3A1FA 2C5LA 2D0PB 1ZVQA 1WB9A 2PUGA 1T0PA 1DJLA 2JIBA 2FK7A 5B2ZA 3D4NA 3AM3A 3GBVA 4OI2A 5KREA 4X66B 1R0CA 4WSOA 3PKJA 4YRJA 3G5LA 1E5DA 3U1VA 3SSNA 2Z5FA 5F9HA 3I5MA 5IAJA 3DB1A 3JV7A 3OQ6A 4G5SA 3A6KA 3GLUA 1V6AA 1EWRA 3Q7PA 4MI3A 4G1UC 1U3DA 3AEYA 3P2JA 4CIBA 4RQUA 3MAGA 2OV8A 2EJCA 1GTVA 4KLCA 4UHJA 3L0YA 3RRYA 4C5BA 4D25A 2OSVA 1BA3A 3ND9A 3CVWA 3FJOA 4YO8A 4B33A 4MNTA 1KSFX 3S2GA 1TB4A 4XYLA 5C5DA 3A0UA 3W3AH 1M1UA 3F78A 2CJPA 5GJVC 3T7JA 3DCYA 2TMGA 2IHVA 1EQUA 2CVOA 3L0DA 3E35A 2W0SA 3QTBA 3DC2A 3U2QA 3UTCA 1E89A 5FKJA 1F8UA 3HSKA 1Q19A 1Z0IA 3WYCA 4IIXA 4DCTA 4I2NA 3A7EA 2R96A 1W4AA 1WDKA 4IDHA 4ZOLB 2EX1A 2C3MA 4TL6A 5FYDA 1WXGA 2AEEA 4JBHA 3IEVA 5JAIA 3FWHA 3IVCA 2RJ3A 4PAMA 1L5ZA 1F3OA 1OX4A 1PLJA 2JFGA 2J3DA 2X77A 1K7YA 2ZJBA 3WAGA 2AD1A 4K40A 2C07A 4M0PA 1KOFA 1T5OA 3FKQA 1CHDA 2DKOA 2IP2A 1YJ8A 3X1JA 3GQBA 1DC3A 1Q0SA 1SFRA 1GRRA 2FAXA 1YZLA 4PNEA 1BE0A 5CA0A 4H1WA 1U7PA 5D3ZA 1UJCA 3R09A 3AF1A 3MIZA 1VGRA 1I0IA 421PA 3AJDA 4GXRA 1KFEB 5ITZB 3GN1A 4QG3A 2WZCA 2YVKA 3MERA 2P69A 1KEVA 3OX4A 1E3WB 3R8CA 1LDNA 2JJ1A 2NZJA 3JQ7B 3K1AA 3PZBA 2JARA 4LJ7A 1DIOB 5AI6A 3HKDA 1L5OA 4BO4A 4EHFA 1H05A 5JD3A 1YFZA 3GV0A 4X7BA 1UXIA 2RGEA 5AW6A 2VUIB 2VKQA 1NWCA 4J2OA 1QGUA 4NENA 4YO7A 1MV5A 1UKVY 1BXRB 1SVKA 2AQ8A 3DBVO 1C14A 4QNNA 2QR3A 4AX8A 3FBGA 5CNKA 3CVJA 3CVXA 3KUKA 3RVQA 1IN6A 4RKWA 4MW5A 4F2PA 1KP2A 1NC3A 2IYZA 3G2LA 2VP9A 2E2WA 3IMFA 1EXNA 1P5ZB 2KWIA 1H6BA 2W2QA 4HMPA 3ESBA 4KUGA 4GRAA 3RVNA 4YXWD 5IBCA 5LYJF 3KKOA 3GEIA 4D82A 2CVPA 3H5WA 5AJTA 5AVSA 5DLPA 4BLRA 5C1DA 4N01A 2FUNB 4FYHA 3UN1A 1WETA 3HKEA 3AEXA 4RD0A 1D2HA 3GN2A 1PWHA 4EVRA 5C32A 2PZJA 3S2SA 1C0EA 4RJIA 1RI5A 4JNKA 1LS6A 3UA3A 4BFWA 4FDAA 3CE9A 2DH6A 3CZMA 5H02A 4YQEA 3ZYZA 4L28A 3A9VA 4GMKA 3A9TA 1Q50A 3WXMA 4C5AA 2WIJA 2VDQB 5LLDA 1CEEA 1IMJA 4CKBB 1KDRA 3WYGA 1YTUA 4UMVA 1NPYA 1KY3A 5CXUA 1USUA 1JHQA 2W2OA 3SE7A 1C5KA 2V7GA 4L4XA 1AA6A 4C2UA 3KKQA 1UDCA 1GAEO 1ACMA 1VPTA 2A7XA 3GRVA 2CL5A 2FSHA 2V8OA 3QNWA 4FGLA 1RTKA 1SCIA 4D98A 3Q7TA 1ZCFA 2I34A 1VLLA 1YQDA 1V0JA 2EGUA 1ZNZA 3GRCA 3GFSA 3ZCSA 1NXWA 2B5VA 4DCGA 4PQRA 4ESHA 1M6NA 2IEYA 3I01A 2I2DA 4CU5A 4M0DA 3S5UA 3BD8A 1O03A 3O8OA 4MWDA 3QX8A 1Z33A 2VI5A 3N2GB 1VJGA 5AKZA 2YWGA 2NIPA 3PDCA 2PUDA 1RZRA 2C3PA 2RFLA 2UVPA 4QXMA 5BRNA 1GHTA 5HUHA 2Z6QA 4WBNB 4PWYA 2YYAA 1TCAA 4ZO9A 3GLRA 4MV0A 3BB4A 1YCGA 4BQOA 3PR2B 4IIJB 3A11A 1BVRA 3SFVA 1E94E 1GPMA 2P9QA 3FHCB 1FLNA 2QENA 2FEPA 3LQRA 4Y6GB 5GONF 3RS2A 3RUHA 5AM2A 3K9WA 1NF9A 4ZJPA 3PUWA 2EKPA 3T3MB 4AFNA 4ZIRB 3B6KA 5JRJA 3RO7A 2BJWA 2CDCA 4Y7CA 4BP1A 3IDZA 1KGSA 3LUGA 1SKYB 5AI0A 3T15A 3ZXIA 3AF4A 3E48A 3ASYA 3L43A 3QPVA 4GC9A 5C18A 3D3EA 5ERXA 1YR7A 2JFBA 4KYUA 2WJYA 3V1KA 1V2HE 2CSUA 3GH3A 5J1TB 1ZESA 3GGGA 2D2IA 3IT3A 5C8YA 1Z08A 2NGRA 3CUEF 1GEEA 2IIQA 5DBIA 2PS1A 2H31A 2G9NA 3ADDA 2VAVA 1H1LA 3DD5A 4RKEA 3AL2A 3FPLA 2QP4A 2XCOA 4CMJA 4DTIA 4EKEA 3E61A 1JPJA 3H5IA 1JMYA 2I33A 2AW3A 3LFUA 4GW3A 2XVXA 1PL0A 2QAGA 4P31A 2VG8A 3DCJA 1IIBA 3OEWA 2PXAA 1IG3A 2EVWX 3ILHA 4ML3A 1N36B 3BCUA 1U3CA 3DKIA 3ZV4A 2D7JA 4XVCA 3BYZA 3KK0A 3ZU5A 1G1MA 4KHZA 3RB8A 1THTA 1W1WA 4S3MA 2GHQA 4BFLA 2J0UA 1AZTA 3BEOA 4YQFA 5BN1A 1XAHA 5CP8A 1YO6A 4RV5A 3ZWBA 3OCCA 4CLRB 4ER3A 2PZMA 4GGMX 5DXFA 2ZRQA 3IQHX 3K9LA 5JARA 2W42A 4YAWA 1UBHS 2QA5A 5H3CA 2G5TA 5C5IA 3VAYA 2ODQA 1XJWA 3ZJUA 3P2KA 4CQJA 2Q5QA 3AZPA 4I9GA 1JFVA 1CR0A 5H4HA 2HA0A 5TT0A 2VQFB 3NBKA 1I51A 4ZVRA 3FZYA 2GFIA 3ADKA 1GFIA 5KNCH 2Y2UA 5EJ9A 4DUGA 2GARA 1MEJA 1Q0QA 1DT3A 3R0IA 1D4AA 4J0JA 1SXJC 1YL7A 1VL6A 5TY0A 2YV4A 5AW0A 3BBPA 2I3ZA 5LYYA 2C29D 5CFPA 4CJXA 5KYXB 4YGYA 5DGCA 4W5RA 2CHUA 1WMFA 4PRKA 4OHMA 3WADA 4FGUA 1VG8A 4OQYA 4YN3A 4UQOA 2Q4RA 2H92A 5F5XA 3BDIA 3ISJA 4NEQA 3RV4A 1KEEB 4L8VA 3S68A 2RGYA 1FU4A 3VUFA 5D1HA 2C1ZA 2AWOA 3JR7A 1KE1A 3AU9A 3ROZA 5EEHA 1ENPA 4WKCA 2B8EA 4RL6A 2CVZA 4U1RA 5FWXB 3KBOA 3WLLA 4G9EA 1ZJYA 1QQ7A 3F6EX 5SV2A 4G4GA 4HNAA 2QG4A 2QRUA 1W93A 2Q3LA 4O1MA 5LZ9A 2R1VA 3LL4A 4OSPA 1PW5A 2A3RA 4URYR 4U2BA 3V8MA 3AM1A 5JD6A 2RGGA 1N2CE 2IPMA 2WOOA 3OQ1A 5DU2A 1F6DA 2EYUA 4RIGA 3WDLA 3QIVA 4JLAA 2Z9CA 4DL9A 1UK6A 1IWBB 1SG9A 1D7AA 2CB0A 2OB2A 4JQYA 4M83A 1GN8A 2D62A 1CRZA 3STHA 5HQ3B 2FFHA 2I55A 3T5MA 4LGVA 3CWQA 3IA7A 2EZ8A 2G7MC 2NT3A 2YWJA 1RIFA 2FMUA 1IUNA 5BW6B 1R27A 2D1FA 3O3CA 3NB0A 1E96A 1FSSA 1N1DA 4M49A 1AKWA 3EQ6A 1DP4A 2G0AA 4YLYA 5SZIA 3R0VA 2PR7A 3U4QB 1GL7A 1KI4A 1GUAA 3NU1A 3WMEA 1UKCA 4H15A 1Z83A 4ONEA 4QREA 2LIVA 2D1SA 4FMCF 5JMWA 5JXIA 3DTTA 1GZVA 3C3DA 1P8AA 3G49A 4NDAA 1RXWA 1AGPA 2OESA 5DK4A 4DIEA 1NVBA 4ZGGA 4KRFA 4EX6A 4D0NA 3CRW1 3I1IA 4HMOA 1UKEA 1YBHA 1XO1A 3GPIA 3LKBA 1F2UA 1LPOA 3ZJ4A 2W9XA 1JSCA 3N74A 4HQOA 4DXHA 4EHAA 1N0IA 2EIHA 2FMXA 1GL9B 4KDRA 4C6TA 4YJ3F 1QF7A 1X8LA 2W83A 3QF4A 3FZGA 3ZKAA 3EPRA 1U5AA 3UWOA 4Y2JA 4PTZA 1N6IA 1Z29A 4QYIB 3AERB 3BWEA 4FT4A 4KH0A 4DVGA 4E94A 1CNEA 4DV2B 5J2TA 4YBZA 1K2WA 3LT2A 4EO4A 4AJLA 1A7UA 2HJGA 4G0ZA 1X74A 2EF0A 3BXXA 1M0WA 5DTQA 2DPMA 4UZEA 5G0VA 4HCJA 4Y98A 2PZGA 2WAOA 4UBKA 3RVOA 1RYNA 5A6SA 3WRXA 1KDPA 1CIJA 2D0IA 2FPUA 5F3DA 1FDWA 1HDIA 1TAHA 2PDAA 3T5CA 4R01A 3NAQA 4EW1A 2HNBA 1HYEA 3JQCA 5A1JA 2O54A 4EW2A 4EG5A 3QVXA 3IO3A 5DKFA 16PKA 1DNPA 1ZD4A 4LZZA 4ZEXA 3DKKA 4D4JA 1R4MA 2R25B 5JZBA 1SIWA 4OG2A 3EH1A 1N3IA 2I8LA 3H1PA 4UCXA 5AJHA 1R6UA 1NRWA 1P7WA 3NC0C 5DI3B 1CUEA 3NHLA 3RSGA 3T4EA 1XL1A 2QRZA 4IVPA 1E7YA 1JB9A 2JCVA 5BY2A 3P7MA 1K66A 4S1OA 1A88A 4ZYYA 1NQ5A 5A03A 5KMGA 4N7BA 2P2CA 2IPXA 3DOHA 3WC4A 1MRZA 3ORYA 3UAGA 5DSXA 1EBFA 3EIXA 4HDSA 5ICMA 3SYRA 1AHNA 1V7PC 4A16A 1C8BA 3L05A 3QA9A 4KAXA 4C5CA 4MGYR 3FWZA 2Q7OE 2ZWPA 4ND4A 3WTBA 3B85A 1XE3A 1H65A 1JEQB 1SKQA 5BV8A 1KZ9A 4IO1A 3LDUA 5CNIA 1Z4NA 1WKVA 5GVSA 1O6FA 3VSCA 3N2YA 4LN1A 5GGYA 3OVMA 2JI4A 4LHYA 5AFSA 1GRQA 3BMQA 4PCVA 3F6PA 1P4GA 1ZUIA 5KTTA 5I45A 1NBOA 1XGKA 2NQ2C 3MWJA 3O2JA 2ZW9A 2AR0A 5E7JA 1JIJA 1O7JA 3DMDA 2HDHA 3VVMA 2ZVQX 1C7FA 5E1OA 1Z6YA 3NKVA 1TTTA 3HDTA 1RRKA 2BRUA 4CIVA 2DUWA 2JIQA 4HPWA 5D3MB 5B6IA 4ED9A 4X90A 5DLEA 4CUZA 4FOSA 4ZV4A 3WK5A 1LX6A 3ZE7A 1XI2A 1VMIA 1G98A 3ZDZB 1KA9H 3E9QA 3JS5A 5SZKB 1OT3A 3I1YA 1AG9A 5JJBA 4CBVA 1YE5A 3VU9A 2R8RA 3IE0A 3UATA 3FTEA 1KNQA 1SBHA 2R6CA 3MRSA 1E9VA 2AFIA 3H6GA 1NLYA 5E7MA 4CDNA 4QJ3A 1QQAA 1PO7A 3CNLA 3DLCA 4QAQA 4YDRA 4LF6B 3BMXA 5HMLA 4E5KA 5B2EA 3NV7A 2G9VA 3HZZA 3SS9X 4HY3A 2CNWD 3IGFA 4U02A 1A77A 3O2SB 1LUAA 1EG7A 3HCBA 1SOAA 2H5JA 1I2AA 2Y1OA 3TNLA 4L4UA 4JC4A 3TTSA 5DM70 5LP6A 1P7ZA 1X1AA 2JAQA 2F43B 4NBWA 4OXKA 4NBLA 4BIIA 3OZ7A 1X0XA 1JEDA 2VF7A 2G83A 1JKIA 4PN7A 2JCYA 4LDAA 5F1YA 5GV7A 4Y30A 3E82A 2JHCA 4DCNA 3MMXA 1W85A 2QTNA 4G2NA 4EIWA 4F3RA 3CX3A 4Z51A 2JIZD 4QHSA 1ZHFA 3DHNA 2EKLA 3C3JA 4KWTA 2Q0SA 2FPPB 4EG0A 1DC6A 1M1YA 3HWX1 3MIIA 3VPFA 3I6BA 2HU7A 4QX6A 4KQCA 3WY9A 1VYUA 3GB9A 3GT7A 4A82A 4DPKA 2O4UX 1N2CB 1ITZA 4P7GA 1E6MA 4OD0A 2HPVA 3FR7A 1ZIYA 3L8EA 4U5XA 4XGKA 5J59A 3FLMA 2NV2B 5K51A 2C7PA 1L5GB 1WMBA 1OROA 1T35A 4EFMA 2Z57A 4JP1A 1J22A 1SD1A 3ZWVA 2BMWA 2G1UA 5CFRA 3SNKA 4K1XA 2IUFA 1JT2A 2JFVA 4G65A 5HSGA 4Y0VA 1J97A 3N3BC 1SC9A 2VPYA 2I6XA 1JBKA 1SQ6A 4P4GA 1I36A 1K8QA 5IT0A 2VJOA 4YHHB 1EGQA 1HPLA 1SZJG 3NRCA 1V4NA 4Z0HO 1IBKB 3D6VA 4YJHB 3GLHB 1K3FA 3F7NA 3TQSA 4H3SA 3L0BA 2VP4A 3QEJA 4YJKA 4YV2A 2G28A 4E4RA 1L7OA 4F5ZA 1SBCA 1GZDA 5IDQA 2O7VA 4EWLA 3IMCA 4P4UA 3D0QA 4IW3B 3FBWA 4ZV9A 3ZJ5A 1OU4A 3WV4A 3M6IA 4KW7A 4C0QC 4N0QA 4LDPA 2Y0DA 3G2QA 3R3WA 7MHTA 1MMFB 4AN1A 5AXCA 3E5RA 4JC0A 1QIKA 3DDUA 1J23A 1JAZA 2C4VA 3AXTA 4JLOA 3OJXA 3ZHCA 3T5AA 2CLOB 3E5NA 3V2UA 4EVSA 5IDYA 4R9NA 2VUUA 2BJVA 2WIDA 3BJZA 3IP1A 1HTBA 3PHHA 5MN6A 1ORTA 1E9RA 3DBIA 5JV5A 4CETA 1IAQA 4R9SA 3FDZB 3K1ZA 2REQB 3D0KA 1V8PA 4IS3A 3T34A 1EFDN 1B14A 3TDMA 1V45E 3OX3A 3ZPXA 1NVGA 3NIFB 2XXJA 2XYQA 5KSOA 5LQNA 2ZZNA 1YGPA 4NU0A 4P98A 3SJZA 3Q4GA 1SH7A 2ECPA 3H9GA 2FH5B 3DO5A 5KVQA 3QFSA 2EQAA 3OOHA 3IEUA 2M9MA 4LFCB 4R2JA 2R1ZA 1X77A 1UUFA 2H1CA 4YVFA 1G64A 1JR3E 3FRJA 3BSYA 1GUZA 3N59A 3QKUA 1FYFA 2VEDA 2ZQ5A 3ZCXA 3S70A 4ZT7A 2C8VA 4C2BA 3QEBZ 5I9BA 2XODA 4CPDA 3U7RA 4F71A 1DWPA 1XZFA 2FWBA 1NFRA 2HF9A 1UPBA 3FTDA 2QQ0A 1WB5A 3FYHA 4Y1RA 3GUCA 5E4YA 4C7OA 1LLUA 1C8KA 3OLQA 3KM0A 3B6ZA 4X6YA 5F12A 2PBLA 2R87A 3ICPA 4V02A 4MZDA 5CVUA 3I1FA 3AVVA 3AUUA 3CONA 4FOTA 4N3CA 4DRXB 4D42A 1AKMA 1T0HB 2EZ4A 3I72A 5ENDA 3ZDEA 3MXTA 4IFBA 4YRIA 1US8B 5B6PA 3W5SA 1W2HA 4EFDA 2QZZA 3E8XA 2XGGA 4PZ9A 1B0PA 1VBFA 2HXSA 2YV2A 3AEKA 3I6ZA 6LDHA 2OHVA 1UP7A 2WFZA 4IM7A 1FFSA 1XEXB 4JROA 2WKQA 4JYBA 3B7WA 1I4DD 4UFOA 1NIPA 2B21A 2JGMA 4LRYA 1Y8ZA 2Q6LA 3PHBE 1LFDB 5ARDA 1SEPA 2E3JA 1X1TA 3BCSA 4ACAA 1OI7A 5COQA 5B7NA 4S24A 1DO2A 2DTEA 2GYYA 2P0EA 2VAMA 2QRMA 3A2NA 3I2JA 4ROTA 5ES3A 3RUPA 2WIKA 1SZPA 5EKUA 2JJYA 1WY7A 4ND6A 1WQ1R 1YASA 1Z88A 1OCEA 2I4LA 3HFSA 3WQRA 4MDYA 1QCYA 2OYSA 2ZVPX 4ALMA 4EHIA 2C99A 2MR5A 5K3BA 1P61B 3CRZA 3EA5A 4GR4A 4TWAA 5I6DA 2HBYA 2PMWB 1VL5A 2VT2A 4EHLA 3AVXA 3MT9A 3WLJA 2WT9A 4BO3A 3OPYB 1MT0A 3U7HB 1WF6A 4GYYA 2R62A 4H7DA 3RYTC 1BHSA 4UHKA 3QE9Y 2HK6A 4QOEA 5DF1A 1ZNYA 1Z0JA 1HYGA 2ENWA 3JQRA 3RAPR 3ZCRA 1FFGA 1DARA 1SXJE 2H7XA 2XNSA 1MW8X 3NWEA 1HEIA 3QKRB 1UXJA 2ZUUA 3QLVC 1USKA 4N49A 1R6DA 2A9FA 4RZ3A 3JATB 4YCAA 2ZJYA 4DHWA 4ZGBA 4TTAA 2B8NA 3DHEA 4OP3A 3ZR4B 1RZ3A 1PQUA 5K0BA 2BIFA 4UDXX 3NTOA 4HC4A 1VHJA 4KL8S 5KTNA 1CY8A 1N8NA 1QGZA 3A37A 4I36A 4NARA 4GYWA 3HO1A 5I3CA 2CD7A 3GFBA 3C5HA 3HH8A 3MCUA 4RTKA 3ELUA 2CDNA 3ZG6A 5JY1A 4GWGA 5LOVF 2BPOA 3LIIA 3DZFA 3P9ZA 3WZMA 5KSZA 4NH0A 3L0OA 4A0RA 3OM8A 4C30A 1H6CA 1FRNA 4IQ4A 5A05A 1LV8A 2KMLA 2FN7A 4ZQGA 2WHEA 4BQQA 4PV7A 5G2OA 4EQ6A 4UMDA 4CNQA 5CFNA 2MR6A 1HO3A 1LQ2A 3GAZA 3PS9A 2C9MA 3NHYA 4MEBA 4MR7A 4QECA 1Q2XA 2VYVA 3UUGA 4BLPA 2D5AA 4LNAA 1JHAA 5HMMA 2I7XA 5JNSA 1HFKA 5EJ7A 4M0CA 1WHSB 3QXCA 1P2TA 4QNMA 4BXOB 1EWYA 3IAUA 4JQCA 4WLFA 1XR3A 2PU7A 1GRCA 3E1GA 1EM8A 2ZIWB 4WGGA 2SKCA 1QKKA 5HE9A 3RTCA 1C4KA 4CF7A 4D26A 2WP8J 1DO8A 1JP7A 1C2TA 2FQ1A 2IYNA 2CDBA 2W4QA 3VU1A 5JU6A 3VR3D 1HOTA 4FFOA 5KYGA 2EBHX 1C7JA 1RSZA 4EUFA 4IWYA 3TW0A 2QW0X 4NBSA 3U40A 2WD7B 1CZRA 1XD2B 3CO5A 3L0IB 2BF7A 4N5IX 5AMXA 3WB1A 4D3XA 1FUUA 3PUXA 3R7AA 1MLDA 5HNKA 2I6QA 3G3EA 3GT0A 3JZAA 1R12A 1Y5MA 2WSIA 4OO3A 4ZCPA 3WGNA 5CB4F 1SU8A 5K6AA 2LKDA 3UKJA 4O4JA 4JWKA 2QRPA 2GRAA 3FR8A 1VA4A 5J5CA 4RANA 2ZIGA 3ZXUB 1EX1A 5FL7A 4BPRA 3LGXA 1A5AB 1U2TA 2P9EA 3KPYA 3ZBQA 3K1YA 2E48A 3HCOA 4ZA2A 3BSSA 4ER0A 2W2TA 1XTUA 1CQXA 2GCOA 4FCVA 1WTCA 1VZ3A 1Z6ZA 3U3MA 4C7JA 3KQPA 1T1SA 3IPXA 2WWVD 5A4AA 1ZRNA 4ZVTA 3QA3E 4O2RA 3UHOA 2JFWA 1CVIA 1KFCB 2HDNB 3MJFA 4PM4A 3OEHA 4RLSA 1NUHA 3T4PA 3W2EA 4LZJA 1VE1A 1Z45A 4PZLA 2G5CA 1BCRA 1BW9A 4HAIA 3LY5A 2VT7A 1H2FA 2OENG 4PZZA 1LBTA 2K6GA 3TEFA 5JEEA 3ABZA 2DR0A 3ZWQA 1UJ4A 4MVJH 2DBRA 2VP0A 3OQIB 1E9FA 1JLSA 4MPPA 5J5VA 3WRWA 4RXTA 4AY4A 5EFOA 3IP5A 5JXGA 5CCEA 2BGWA 4JXJA 5FDFA 1L7NA 1KDZA 3PUHA 3Q6MA 3EEFA 4Z86A 2IOHA 4ETWA 2J0SA 3AONB 2NYRA 3WXBA 2R6FA 4L07A 1ZOLA 1SCDA 1T24A 3VC2A 1QAOA 1L7EA 4BVAA 2BSXA 4NV1A 5KUTA 2ZITA 3IKLA 2ODTX 5HG0A 2EFHB 4IAOA 1SWVA 1KAQA 2P5TB 3NS7A 3R9WA 1JLLB 2P4SA 1OYWA 2ODPA 1UQUA 3KKMA 4LQLA 1G5RA 5JNTA 1OF1A 3FBTA 3LDGA 1YS4A 2J4CA 4XYGA 2QX6A 4G0OA 4YRCA 3HJFA 2X8BA 4CFYA 2VDUE 5HTOA 5JJIA 1RXIA 5KX5A 1T5IA 1YA4A 3IURA 4WN3A 5A5FA 2QUKA 1HK7A 3P4UA 4TWBA 4UE6A 5LIRA 4JS0A 2JVIA 3LQFA 1UJ5A 3BWXA 1YDFA 4AL4A 4AKTA 2BFWA 3QLUA 4JKIA 5BSFA 2GCPA 3JARB 4NE2A 3PDIA 5JYBA 3ADBA 1WW8A 5AOVA 4FJ0A 1Q0TA 1W49A 3WGOA 5AHOA 2R11A 3PNPA 4MWZA 1OC2A 3LQYA 3MCAA 3WBJA 4KQ1A 1DELA 2QE7A 3RHZA 3DMYA 5BUCA 3AF5A 4JI2B 2WDZA 1UH5A 4MRRA 5JRZA 1KJQA 3QKSA 1AZLA 3VTZA 3RSHA 5I9TA 3SS7X 1E2GA 1SXJB 1U2ZA 2XVZA 4F5EA 1JIXA 1DFHA 2H17A 2Q2QA 1FTYA 3WHKA 3ZW7A 2WJVA 5C1PA 2G7ZA 1R1DA 3R0XA 3PC6A 1CW2B 5A3RA 3T0FA 1JAHA 3E7WA 1Y7TA 3DLHA 1SKAA 1T2FA 2JF0A 1A3CA 3OFSA 3CUUA 1CYDA 5CK4A 2XOKD 2ZSFA 5GONB 1IG0A 1OIVA 3VHXB 5KTKA 5LWHA 1EFAA 3I2IA 1J33A 2OBLA 3EZ9A 4KN9S 4EJSB 1M76A 2FFAA 4Q4HB 4WKOA 3M6XA 2AE1A 3KB8A 1Z2EA 4HZIA 2DG2A 1AKUA 4CGYA 2PKYX 1U3TA 1EIZA 4QTZA 2HTEA 2UYOA 3T7SA 4M89A 3TEMA 5DXJA 3EZFA 4GPBA 2LVBA 3MWLA 4KE8A 3UGJA 3MTDA 1PV4A 4EA7A 1RHMA 3P5BA 1DADA 2NU8A 3G8CA 3IE1A 1HQKA 1RABA 3DAHA 5DM2A 1IM2A 2B69A 4KXXA 2YZGA 4XD7A 4ZI2A 1L5WA 1YUBA 4PN3A 3RTEA 2HXYA 4TM7A 3AR8A 2XMSA 3HLYA 2F55A 1EESA 5EWLB 4UFPA 1G6KA 5DP2A 3E53A 2DQSA 4CE6A 3B82A 3Q5GA 4MCAA 2CD9A 1NR5A 2WTAA 3QLTA 4DCSA 1KI6A 2R8EA 3GGPA 3HU1A 3RT7A 4EH1A 5HJ7A 2NLOA 2BWJA 1KNXA 2LP4Y 5IUJC 1UDBA 4BNTA 4EF5A 1JG3A 4KNWA 4MV8A 2NTEA 4MWBA 3UJNA 5E2AA 2VTEA 2SKEA 1DWUA 3O92A 5FPSA 2CNKA 2XIQA 1A2KC 1LZKA 1U81A 1KK1A 5ECDA 4C01A 5J2UB 4ASUA 4CKEA 1WL8A 2VAWA 2E9SA 4QICA 3H4IA 4MROA 4QOGA 4FVTA 3GDOA 4RW0A 5G1OA 4E51A 1U1EA 4B34A 2H6EA 5K99A 3JQEA 1G21B 5M3BA 4QHTA 5KBYA 4JVOA 5F35A 1YBVA 2F6RA 4BC1A 3P2YA 4UUPA 1UPAA 3HN6A 3OJEA 1R8QA 2ID8A 3EVAA 4M7PA 2BFDA 2C2HA 2XQIA 3H11A 1QG4A 1E9DA 2IYUA 3VBEA 3ZQ4A 5L4LA 4GIBA 2ZM5A 1N34B 4OQNA 2IXDA 4I1UA 4YAEA 5LM3A 4RFSB 3L4KA 1J1UA 3UF0A 3P52A 2X41A 4HYTA 3D7KA 4G3XA 2C57A 1ZBQA 2Y1WA 4WZBE 1U8YA 4DAEA 4X44A 1E79A 4XOIA 2OPHA 1I2MA 1Y8RA 3E3OA 1PGJA 2QVLA 5FBKA 3FUWA 1L5NA 3CVYA 3H2SA 5ADWA 1Z4IA 3T1OA 3VYTB 4OHUA 1RYFA 2H59A 5GQSA 1D1TA 3GAAA 3IUBA 4L0CA 5AYVA 3PHJA 4WWHA 1DTWB 4UVDA 4TTJA 1P73A 3SF0A 2UU9B 1I6MA 1NMYA 4AKSA 4D41A 1EX9A 3NH6A 3DP7A 3CWZA 1WMSA 2Z9BA 4XYBA 2QQ5A 5CNJA 3ITEA 4TLBA 1XHFA 4XOUA 1L5YA 1SBIA 2VLIA 4F9EA 3OQMA 5FTNA 3HA2A 1V11B 4RM2A 5K8UA 1G8KA 2ZSDA 3A7DA 2GM5A 1CEQA 1ISPA 2QVGA 4JU9A 3V2IA 3NKLA 3K5PA 1BXKA 2HUPA 4DQVA 1G59A 1J39A 2NU6B 1QGAA 1P80A 5L7WA 1OKKD 2CKMA 4AO7A 1ZW6A 3PHLA 3V3TA 4F9GA 4B4KA 1LK7A 1J0XO 1F7UA 2Q49A 2IS4A 4MW1A 3H99A 4TRRA 2AOXA 4HNUA 1TCUA 3PC3A 4L22A 2EL7A 5FF9A 3ECSA 1TRHA 4JGGA 4UAGA 1NA5A 1JALA 2FW0A 3A8TA 3D4IA 2RH4A 5F7OA 1OH5A 1RYEA 4ITVA 3C3WA 3KQQA 3S27A 1ADYA 1QUFA 2N0SA 3ZQUA 4MEAA 5CR9A 3CA8A 3RHSA 1NLFA 5GJCA 1VRVA 2B2CA 2Z8XA 4J4BA 4TTSA 2PAAA 3CXRA 3THWA 2NUTA 4O3FA 4YPOA 5GADl 4YJ3B 1RLTA 1W9MA 2ZVJA 3CN7A 4YUVA 4EG7A 4YMGA 5HKKA 4KQMA 2X42A 2XUIA 3N39C 3TLAA 4C78A 5AH0A 1MPXA 3RAFC 1U63A 1PSWA 4CW7A 2P5YA 2H8KA 3ANYB 5BSUA 1NLMA 1KY4A 3CNNA 3DFKA 3FH0A 3LXMA 3QVGA 2REXB 4MB6A 4PXYA 2GZAA 3MD0A 3EEOA 5IULC 5CVCA 4XVUA 3NIWA 2MSEB 1DFGA 4I55A 1RWMA 1ZSVA 4PY2A 1Q0RA 2IPLA 4BKUA 1JLKA 4XSVA 4KITB 2RH5A 4HAVA 1KVRA 4CI9A 1GPUA 1M8JA 1CUJA 4QTUB 4ARCA 4AUKA 1X80B 2AFHE 1T9GR 2VHYA 4WXEA 1Z0SA 4DIDA 5EXSA 3GFVA 3ONFA 4DA6A 3KQUA 5BRAA 4IUDS 3WHIA 4NJMA 5CCXA 3OAAA 3WDMA 3CJRA 1L5HA 5CFMA 3A6DA 1YKGA 1FFXB 4EDFA 5J58A 4JN6B 3PGMA 3GDHA 4I9FA 4FKZA 5ALFA 4BVKA 1DAEA 1O0SA 2Y2VA 1DJPA 5F1OA 4CIWA 1ZIPA 2YY7A 1DVRA 5TC4A 1FVOA 1P1BA 5DNAA 5KHLB 2E0IA 3C24A 3PQ2A 4PW0A 3CU5A 5LB2A 4RCZA 4I5GA 4R1LA 3TDKA 4YECA 5BMVF 2IWRA 2FUG6 3LV8A 2MSKA 4DV6B 3DLBA 5T57A 1N5RA 3MMZA 3WMWA 1GT91 1UPTA 1E69A 1RQPA 3AHDA 3BE5A 2UXDB 2OGUA 1IXRC 1PS8A 1OYYA 2WF7A 3SR3A 3FVWA 3VH4A 4D3DA 3P9KA 2FZKA 3VPBA 1A7JA 4AF8A 3Q40A 3GRYA 3UK6A 1G41A 1P2FA 2W6CX 2A6PA 3O0TA 3UICA 3W5IA 2O3JA 4O02B 1MAUA 1N2IA 3O8NA 3NOXA 1P19A 1HKUA 3OZAA 4N3NA 4KXFB 4KUHA 1D2CA 3SS8A 4AS3A 2B8JA 1EZZA 2G9ZA 3C3KA 5DSTA 4R1UA 3ZEIA 3LHFA 2MCFA 3WOHA 3EASA 2QZ9A 4N1AA 2YCLA 1OLSA 3ZGLA 4AJJA 1FTQA 2H1LA 1BC5A 2JL1A 3G0GA 5EYPA 1G20A 1I24A 2VCYA 3U4MA 3MILA 3L8HA 1U90A 3DBLA 3OZBA 5D01A 3W3ZB 3DUWA 3GRKA 3ZWDA 3ER8A 1KMIY 4OLBA 4OBWA 2AVNA 1ATZA 1KXJA 1KMMA 1HYHA 2EIXA 4QQ8A 2NP6A 2QRVA 1JSXA 4RZHA 4NYJR 4HDNA 1UMDA 3VSEA 1U4OA 5C5EA 1W36D 4TTIA 3FYCA 2KPOA 3RC1A 1T1EA 4LRSB 2QI9F 5AUQA 5IMBA 1W2WB 2XGJA 3GCGA 3I2GA 1ZUNB 3NHRA 2FY8A 1YZKA 2BHNA 2NO0A 4KMRA 1KZYC 4UM5A 1UAYA 5BSKA 2H18A 4QBTA 4BFYA 3BRQA 1VLHA 2NUPB 3PT9A 5FTLA 2PZLA 4YQZA 2FDRA 3ASVA 1DRVA 2FEAA 3EW7A 1GRNA 2OD2A 1W44A 2ZB2A 4RSHA 3V7NA 5CU7A 4QELA 3N86A 1N5MA 1DRUA 4CF3A 4QGHA 5AVYA 1WBBA 1LQUA 2ZROA 3TVTA 3UWKA 4F5DA 3ZHVA 1QPGA 3V6LA 3FNIA 1Y4AE 4F2DA 3GH1A 3IKJA 4UZSA 4C0SA 2YJZA 4DLTA 4DR2B 1P2SA 1NVDA 2QUJA 2DPLA 2WJ4A 3OD1A 2IPNA 2W37A 4FBMA 4XASA 3VSAA 4AO6A 2FJUA 1R66A 2OBNA 1RZRD 3WKBA 1JAIA 2FPOA 1BKYA 4WKPA 2Y68A 5EMHA 4F0JA 4ZAYA 4D9GA 3PPYA 4XWWA 2WICA 4FS3A 1MGPA 1QIIA 4PC3A 1Y3IA 2F17A 2X0JA 3FRHA 1T15A 4KVFA 4IOLA 4Q18A 5CVEA 5DEOA 1OAAA 4KJZA 2VVTA 4ZO8A 1XAGA 1YDEA 2ZRGA 3MTAA 5FXMA 4MA5A 2HSJA 4J49A 2UZ1B 4CEHB 4Q3EA 5D86A 4BU1A 2BEVB 2PD6A 5E0KB 5BYAA 5FUMA 3JWJA 2DERA 1SVNA 3P96A 4JLPA 4A92A 3NHBA 1JHUA 3NORA 3K1TA 1TZKA 2Q3FA 4J6EA 3VVCA 4RK6A 5ESDA 2V7PA 4Q3DA 1E1RD 4TMXA 4TMZA 4Z7NB 1DXQA 1A76A 4WA7A 2AQKA 3PWKA 1O94A 1OOEA 1A1SA 4MW7A 2HDOA 4Q7MB 2HU8A 5DHQA 4HTFA 3C3BA 3U7EB 4L72A 4EITA 5KYYB 1H2HA 5F2OA 3GRFA 4PEVA 1SQSA 3MPOA 1CUYA 2J0VA 4ZRDA 2O3TA 4MQ5A 1Z7EA 4TUYA 3RFUA 1JT9A 1IY2A 1LPAB 5C81A 1FYXA 1Q1QA 3MFYA 1E5VA 5DCWA 5HBRA 4F6RA 5LUAA 2AJBA 3OIWA 4XYMA 1MB0A 1EDDA 1JG7A 3G7SA 3PUYA 3U7QB 1PTJA 1Y1QA 1PFQA 4TKVB 5SZJA 4JB0A 1KZGB 3HCRA 1YZUA 4MUAA 2OHHA 2HQOA 2E49A 3ZGXA 2AFHB 1GUDA 3BMCA 4X1YA 4JJAA 1IUPA 1I7NA 5HDQA 1AO0A 1M34A 4B3IA 1LSSA 5K3DA 3B3GA 3UGKA 1O6GA 3WWYA 4CEJB 2X0EA 3O47A 1GQYA 1T9CA 5JECA 3TBKA 4BNKA 1UBJS 4IWXA 1R8SA 4CR7A 1M2FA 3NHUA 4EABA 1DEXA 2NO7A 3OO0A 5CFZA 1DCFA 1AU9A 2J3JA 3GGJA 1II8B 1B0UA 2ZDQA 1NRJB 5LZ7A 1V47A 4PINA 4R1SA 4Y6OA 1GZ4A 3KU4A 4RKYA 2DHQA 4DA7A 5FYQA 2VA8A 1TJ4A 3ETHA 2J1LA 3MSXA 3WAJA 4X8MA 1SU6A 1PJ3A 1NYQA 1QK3A 3IDOA 3R3XA 3UMVA 2ACWA 3THYB 3FHLA 1Z75A 2B4YA 4XM2A 5FUWA 4ZC1A 1FFCA 3G79A 4NQZA 1PT9A 3FWYA 3TGWA 1GADO 1TAGA 2P9YA 4J16C 4H7HA 1RXYA 1TUEA 2O5CA 1ZOSA 1K8RA 4FYKA 1KAOA 5E38A 1QCDA 3FDFA 3R3ZA 2IH2A 3KYDB 4D4LA 3U16A 2C7OA 1TW3A 3L7CA 2HCFA 1TU0A 2KYRA 4O4IB 1BX1A 2YOGA 4PLYA 2XOEA 4C4YA 2JDIA 3RHFA 5B55A 4L8FA 1KJ8A 3RU2A 3ZI4A 2V6BA 2GF2A 3KHTA 4MRSA 2QLNA 1TM2A 2IYQA 3BGWA 3IAM1 4KWIA 1CFZA 4B3JA 4N48A 1V5WA 3ER9A 2QLBA 3HG7A 1C9NA 3IQIX 3DFIA 2Z58A 4NZOA 4JJKA 3HJUA 1T8TA 4YHBA 3EMBA 3IQZA 4W5OA 1BRTA 2W22A 4Y2TA 1QCCA 2B34A 2NZ8A 1BO6A 3OQJA 3KQVA 2J07A 2ZI9A 1Y1LA 3E8SA 4KXYA 1D1PA 1XEFA 4MGKR 3ECAA 3MJRA 4L8WB 1P1FA 1UODA 3LM8A 1G2PA 3MINB 4MWSA 1ICIA 3RIGA 4G9BA 1TXGA 3ANLA 3K0CA 2ORED 3NWJA 2J6BA 2YFKA 2MSNA 2QQGA 3NAZA 4B2PA 3OU2A 4DMMA 1EJ6A 3KR1A 1JJAA 1LSOA 2J85A 1M73E 4LYFA 1O9HA 4NJOA 4G86A 3P0RA 3QELB 4KQJA 1V5GA 3RARA 1T9ZA 1VBMA 5E1BA 2OAGA 4O2BF 3MTQA 1DT5A 4LYEA 2FG7C 2XUAA 4E31A 4J9VA 2QG9A 1G9TA 1U2GC 4D7AA 5EINA 3BGDA 3FOFC 1K68A 1F4LA 2BBSA 2FE1A 2F64A 2Q4TA 3QXXA 3L1IA 1HRDA 1SXHA 5FTMA 2NAFA 1H42A 1PV1A 1X7XB 1K63A 2DZDA 1PKXA 3L5OA 4JBNA 1QKIA 2CLMB 2VRWA 4UE2A 3EC2A 3PUVA 1KGDA 2XLBA 3NBFA 1BMFD 3DB2A 3RVPA 4OPMA 3OETA 1FRFS 4MS1B 5A04A 1IZ0A 4YROA 5WRFA 2EFDB 4AQYB 4RA6B 4AICA 3TZLA 3C6XA 1CQIB 1RJ9A 6REQA 4DJJA 2OMKA 4L8GA 5DI9A 1AUQA 4E2ZA 1Q74A 2W6IA 2ZPUA 3NNDA 2AN9A 1UP4A 1YC2A 4DLLA 3PGLA 2P68A 3DQZA 3PGKA 4WT7A 4ISBA 4QDKA 5F9MA 2H7VA 4CL3A 5KNDH 1NVVQ 3WNDA 2FOLA 1QRAA 4LOHA 4R5HA 5CM2Z 2IEIA 5ALKA 2BGNA 2V7WA 1XYGA 3V4RA 4NR0A 1KO8A 4RA9B 3RYFB 2CJYA 2HB6A 1E8NA 2JASA 5DW0A 3UJ7A 3K0AA 2O0JA 4OMDA 5D6OA 4HEA1 1TGVA 2F9MA 2PSSA 3S1SA 3W3AD 3ZH2A 2XDWA 3VR1A 5JPCA 1X1RA 4JCCA 1SUBA 5CXSA 5LQCA 3PVSA 1EBUA 2H0RA 3Q9NA 1V96A 4C6SA 2X3FA 4RLQA 3KSBC 1QHHB 3K35A 4Z4HA 3VI4B 2BR3A 3QBEA 1RWQA 2GBLA 2CE2X 1OV4A 2NWQA 4KQ2A 3KAKA 4O1HA 5COBA 3VPAA 1M72A 5KKAA 4B7UA 5KKNB 2I1WA 1M2WA 1GFSA 1U2DA 2XB4A 4LYGA 4ZDWA 4H0FA 2B8TA 5JYDA 1TW2A 3PYLA 2QYHA 1SJ9A 4J6FA 4W82A 3BFJA 4OV6B 4LDRA 2IITA 1KETA 1GQ2A 1PR0A 2VHUA 3WZLA 2BI7A 2ZDHA 2OILA 1GTRA 4AMZA 3HYSA 4NZMA 4TPKA 1QZTA 2OYRA 2JI7A 4BN0A 4Y18A 3WBBA 1GU1A 4INJA 4FGZA 4L78A 1T6NA 2FTKE 4CMIA 4WEOA 4YRGA 3EXG1 2BKLA 1NVMB 1K6JA 1HDRA 4OQEA 2FMTA 1UEXC 5HQTA 3HDJA 2Q5FA 3EVTA 4MQ4A 3VO9A 3X3HA 3UJDA 1T34A 1A9PA 1NE2A 1YRWA 1SHKA 1I5RA 4J29A 1U7WA 2V7QD 1OGJA 2HIAA 3EUAA 5FBLB 5LBUA 1UPUA 2C2BA 2O1XA 4IKPA 1QANA 4CV0A 1XZKA 2CWDA 4AURA 2HBRA 5IASA 3EUWA 3N0XA 1W88B 5IT9A 3TAXA 4ZTZB 4XM0A 2XH8A 4A8JC 3CLUD 4DR7B 3NHMA 4ZI3A 2CVHA 1E2NA 2FR8A 3EVFA 1E2QA 3IR6A 3Q9SA 2ET6A 3VH3A 2QE6A 1WNFA 3FB4A 1T8UA 2REOA 3NBUA 5CT9A 1JL3A 1JPNA 4KTVE 1W0CA 2YS6A 4MIOA 3G6KA 3GJQA 3WFZA 3SEZA 3NHJA 1ODKA 2A67A 1F51E 1IOVA 3GFQA 5HVNA 3FKSA 2I67A 3BK7A 1XQWA 4L7QA 5EY5B 2JKVA 3CNBA 3OU7A 3MWFA 4WY2A 5D3QA 3RSCA 4AZSA 1H3FA 5JPDA 1IE3A 2FRVA 5FA5A 2QIOA 3O1IC 4FEAA 1JKXA 1E4OA 1WPXA 2ZSHA 1AHIA 2FB9A 1CC1S 4F5WA 1PNTA 3CR7A 3HDGA 3NTXA 1PQYA 2GNAA 3CLTC 3LI2A 1HWYA 1TK3A 4PZPA 5K3FA 5E4FA 3TUIC 4YRNA 5GZ3A 3IP3A 1OW3B 3D8RA 4NNPA 1XXHE 2J7KA 2P4QA 2QYOA 1V71A 4HFRA 1ZM4A 3Q3IA 1NUAA 1R0ZA 3TD9A 1QRUA 3KL4A 3S1AA 1AZWA 4EELA 1FSPA 2YYYA 4MKZA 1RKUA 2YBEA 4HVAA 3A1WA 3B6IA 3SJCA 5EPOA 5JSUA 4KR6A 2BM0A 9MHTA 1T2DA 4KFTA 1FXSA 1VSVA 4DS3A 3W2HA 4LJAA 1RWBA 4EATA 3CSSA 2YZNA 5BYBA 5K09A 5KZMB 1PZFA 4DT1B 3MG9A 4JI1B 3RS7A 4C7BA 3OQOA 1TZCA 3Q5DA 2GNOA 4PHTA 3T9CA 4MR9B 4X6UA 1VBNA 1Y5LA 3TB4A 4KGZA 4TMWA 3GLIE 4HDMA 3ND7A 5AKXA 1JB1A 5IC6A 1VJCA 3WV5A 2Q3HA 3MVEA 2HIGA 4A0HA 4G4SO 5IK2D 1F2VA 2GRJA 1LZLA 2V0NA 3NXKA 4JX8A 2LCIA 5HXAA 3U0BA 3D9QX 2RMKA 4LBZA 4C88A 3CCCA 5KB3A 4CTNA 5U4QA 5IWCA 2VYNA 5K8LA 3HLKA 1IZYA 1KWGA 4TLMB 3WLRA 2Y1LA 5JDIA 4WFJA 1E7RA 2O2EA 1RAAA 1K9SA 2GD0A 4KVGA 4I1RA 1ZI6A 5HCNA 1U8TA 1XTZA 3BA1A 3OOSA 5ELMA 2X5OA 1YHZA 5ALJA 1KJ9A 2ZZMA 5BNZA 4TVSA 1KYQA 2DH5A 3STTA 3ZY2A 4LE0A 1SCKA 1PT8A 2O57A 2A0UA 3SBEA 1ZK0A 2QX4A 1W34A 3A10A 4ZTUB 1GPKA 3I8SA 1RPAA 5CT8A 3FCXA 4L76A 3UWPA 1OH6A 2RHJA 3CF4G 1D2EA 3WL5A 3EMDA 3UC9A 1ZMTA 3G0OA 4DNPA 4QZVA 1EXWA 3K2EA 4YAUA 1XQYA 1WXHA 1X8JA 1UBRS 1R00A 1RCUA 2JKYA 1II9A 2K2QB 3DV0A 3K7EA 5M5BA 3LFHA 1MHPA 5FPTA 1LI5A 5KCMA 5MHTA 1KHTA 3R3JA 2V4UA 1D2NA 5FTWA 2ZOSA 1QIMA 1C4XA 3G85A 3ZX5A 1ESCA 4EARA 4EPYA 3FOCA 1N33B 3QU9A 4AY2A 4DN6A 1AXEA 4HN4B 3Q3GE 4Q47A 4UM7A 2ARKA 1PTKA 5EZ6B 1VSTA 2XV1A 3CUVA 2VPXA 4L0MA 1L1EA 4A36A 4DCUA 3ETCA 4HNGA 3OJFA 2EL9A 4EUSA 1E3QA 4GOXA 3I9V6 1NBIA 1Z5VA 2R00C 1JE1A 2DUNA 1RP7A 1HTWA 2G17A 2VUHB 1GUYA 1K7XB 2J9FB 1P81A 2MINB 3C5CA 3JAKA 3W6OA 4CLDA 1AN0A 3U7GA 2WIBA 4J8PA 4FFVA 1K8XB 1N2EA 4D5EA 4IJ6A 1IN4A 3H0EA 3MW8A 2AGVA 2I7TA 1BS9A 3O6VA 4E2XA 1QLJA 4WL0A 4G5GA 2GN2A 5D51S 2Z3ZA 3PI7A 4L4RA 1E1DA 1UXGA 4DY4A 4YRPA 1Y3HA 1YAHA 4O4LF 3BTUA 1HSZA 5EHZA 2L69A 3EAFA 1YIOA 4J0EA 2HA2A 2VJNA 2OVFA 4Z4FA 5BN3B 1N2GA 4LQCA 5KU1A 2AC2A 2O19A 4YWHA 1GLNA 3E9EA 4LNUB 5AW8A 3E22A 4MVJF 1WV1A 1E4EB 2HJHA 3QU2A 4M4SA 2O8EB 1R5NA 1R64A 3KHSA 1F2TA 3PQ6A 3DMPA 5EXDA 4FB5A 2LCFA 2Y8EA 3G9XA 4TV8F 4FNOA 1NVKA 1ZH4A 2GD6A 2H52A 3NNSA 1VLZA 2NO5A 3SC2B 3U4AA 4EUEA 4LYYA 1YVPA 1JKJA 5ENZA 2P9FA 3A28A 3V34A 2ZBDA 4RY8A 3IVAA 2VJBA 4PNPA 3TR5A 3QVSA 4AMYA 1JS1X 1VKRA 5LQUA 3RYHB 3BHIA 1HRKA 4YMHA 1EG2A 4LHSA 1WSAA 3HR7A 2B5OA 3MRTA 2IBSA 1E2KA 4OGWA 1KIMA 3CUWA 1BGWA 4JJ8A 3BWYA 4B8YA 1EFPB 1QP8A 3TL3A 1WSBA 1QGOA 1WTAA 3FUVA 4B35A 5A9RA 4C1NA 3ESXA 2VYVD 2RHWA 4I9UA 5DHPA 1QIHA 2QV7A 4GVPA 2NO1A 1P1CA 4R1MA 1ZS9A 3EYWA 1L7QA 1Z4QA 1Z16A 1CQPA 1PCXA 1SWWA 1XXHB 2NZYA 3DYBA 3QUTA 4WCVA 5IYZB 4JYAB 4RAQA 1E5XA 2G25A 3QV2A 4TL8A 1OE0A 2PO5A 3AVUA 5KQRA 3RT1A 5B3JA 4C2TA 4A5OA 1TT7A 5JZSA 2LNDA 1O97D 1X2EA 1SHUX 1B3RA 1DEOA 1BHO1 4CM8A 5K3OA 4UPVA 3BILA 4R2WA 3SYLA 5EWMA 5KTYA 5EXXA 2X3YA 1MPTA 2W43A 5I48A 2Z2ZA 3WQQA 1KOJA 5JANA 3RS9A 4JBXA 1FYVA 1UM9A 3GRZA 3OZEA 2VJDA 3I5UA 3KDSE 4HQ0A 4HZUB 4XQ9A 2WFAA 2GDZA 1RAEA 3D54D 3ZIUA 1WD7A 3HXLA 3EXEB 3K6RA 4RHCA 1LU9A 1R3DA 5DHAA 3GLIB 1JVSA 1EE2A 2ZRPA 1C0LA 3LVQE 1OHHA 2M32A 1OU0A 3Q2OA 2AOTA 2WVHA 4O25A 1KBZA 1QHSA 4UNIA 1F9EA 5HOQA 3EPHA 3MEQA 3PR1A 4W7HA 1XVTA 1ZQ9A 2GZMA 1FJHA 3AFHA 3MWEB 1CQJA 1E3DA 2OSBA 2VTDA 4FFPA 4K2HA 4M60A 5BWOA 2BY4A 5JSQA 2EGGA 3G02A 1YVUA 3X1WA 1EDZA 2BM1A 2IUSA 1QQTA 3ZVLA 1SG0A 2ZZKA 2JFQA 3NUQA 1F7VA 3JSXA 3OEHD 4M1TA 3SHOA 1QYVA 4RVOA 4MITA 2H9AA 2DKNA 2DFDA 2IYXA 2Q5IA 4IH9A 3SMQA 2EOAA 1XTIA 2X8JB 2ZATA 4LSMA 3HXQA 1Z17A 5JNLA 2OAEA 4COOA 4PLPA 3RYIB 3PSAA 4UE3S 1F6BA 2KI5A 2VKTA 4AY6A 4E08A 3O74A 3NLLA 4XGNA 3PXUA 3A1DA 3ADPA 1OMOA 3AGPA 4BBJA 5AW5A 2VQ6A 2AG0A 5AQEA 2XMPA 1X7ZA 4QU0A 4GR9A 3D6NB 1H3NA 1HLDA 1FS5A 1M2NA 5C7IO 3B1VA 4OAQA 2A1TR 1AC5A 2XWSA 4MS4A 3QE4A 3F8TA 621PA 4JWTA 1X7GA 1ABEA 4KK3A 3QE2A 1ZM2A 3AV3A 4P54A 4AU1A 3E7XA 1R0SA 5JVDB 1CIVA 3IS3A 2QLMA 1LLQA 3L6OO 4FFBA 2Z04A 1PJLA 3T41A 1O6BA 3AR6A 3DMTA 2B3TA 1QO0D 1ZGBA 3ELWA 4TWZA 1RPZA 1OD6A 4IJMA 4WZZA 4XCVA 3D59A 4IHJB 1JFFA 3EIOA 2IPAB 4X24A 1ZN2A 1MA3A 1DBQA 1LLCA 3HWRA 5EMJA 1SN7A 4MIKA 2IXFA 4H3VA 3DPUA 2POQX 4E7OA 5LU8A 2QY6A 1YCHA 3SEAA 2WE8A 4C0WA 1H9AA 2UUPA 3G17A 3H9JA 4DR3B 2OKCA 5JBQA 3F5DA 3VC1A 1HDYA 4KREA 4S35A 5P8WA 4YR7A 4B5KA 2Z95A 1RAIA 2R84A 4PF1A 3G6WA 3RVBA 3S2YA 1JFTA 1WW3A 2H54A 2JGJA 1N92A 5KYUB 3Q0EA 2MYPA 3U9TA 5AVVA 3OO1A 1E8DA 3KB2A 3WYBA 3QMMA 4EKYA 1EUYA 4BVBA 4GHWA 4ZYTA 3F2VA 1I3CA 4YALA 1SVMA 4MX8A 1H3EA 1G3IA 4Z2YA 4OAPA 2YFYA 4J2HA 1XZGA 1DG1G 3AYXB 2R1TB 1H5UA 4DIFA 2HO4A 4RY9A 3FF1A 4ZO7A 1BOFA 2ZKLA 3R44A 5TEVA 2ZKIA 2VF5X 5C5CA 3FGOA 2DHDA 1JA9A 3HJCA 1E60A 1P1RA 4OA8A 4F93B 2WPNA 4RVUA 3H7IA 1TIBA 3IVGA 5ALVA 1L4GA 1OPRA 2X1HA 1W5SA 1IM5A 3E9CA 1LF0A 3BFVA 4JB3A 3KOWA 5JS1A 3ZWOA 2IEGA 1R7RA 3RVSA 1BYUA 1FTWA 2DFLA 4Z9AA 3SVTA 2BHRA 4J3NA 1DJQA 3EIHA 4RFVA 5B53A 3UMSA 4W8HA 3D3QA 1JWBB 3D8SA 1BEEA 3FFBA 1LLFA 5EJIA 3T7AA 5IH3A 2C88A 2GZ2A 3B1KA 4XUDA 4AMUA 2XZLA 2ERXA 4F04A 2LIPA 2V9ZA 4MYUA 4ENRA 2XA2A 1U5CA 3IQGX 3WOVA 4A0SA 5CX1B 1I9GA 1SCBA 2FR0A 2JGRA 1E9AA 3E1KA 3R5XA 3DF9A 3CLTD 2LBPA 3TTVA 3IB6A 2ZSKA 1PS9A 2C98A 4G4IA 2D5BA 2NG1A 4R69A 3ZIAA 1E2FA 3ZCVA 4WFQA 4DXAA 3UW3A 4IGKA 1R9MA 3KOOA 1GLVA 2OLEA 2HRRA 3QU5A 2PMKA 3UG7A 2BGGA 1C8VB 5TMPA 2A9KA 2GR9A 3DWEX 1OC4A 2WAAA 1FX0A 2QTFA 2FN4A 3CF6R 3PQ4A 3R24A 4Y2QA 1XDWA 4JMPA 5AK3A 1JPUA 4IEFB 5KNBD 1P9WA 1FPMA 2DQKA 3KDAA 3UJCA 2C9BA 2X1MA 4N0DA 4KQEA 4CCAA 3DLAA 2VJCA 2WVGA 3HEBA 5HGXA 4JELA 5THKA 5K8TA 4WLUA 1UDWA 1R8YA 3OFNA 3PTLA 2D2VA 3U80A 3DH0A 4C3OB 1UJBA 2DSNA 1BJTA 4Q21A 3RUIA 3F6CA 4XW2A 1H8EA 1QIGA 3UXYA 4BV8A 1BX0A 1PBTA 3MS4A 3HPRA 1IJBA 3U44A 3W2IA 2VSYA 1MRSA 1OH7A 4WKNA 1K4YA 1L3CA 3PEUA 1YBAA 3VDRA 1S3SA 4B8WA 1EFTA 4V0RA 2I0FA 3LXRA 2X4GA 1QYDA 2EP8A 2WUVA 2Y66A 1NN3A 3E7FA 1L1FA 2OCLA 4MQUA 1JDNA 1TQDA 5JR3A 3D6MA 2C4WA 3PUZA 5DTMA 2HCRA 1M8PA 4UUBA 3HLTA 2V6FA 3JZIA 4IKOA 4A03A 2G70A 1W59A 4YP1A 2ZM6B 3D3NA 1CZUA 2IYPA 1IZ7A 1YHYA 1GFZA 4LDNA 5AK5A 3G9TA 3DMFA 4R81A 5IC5A 4CDRA 2VT6A 4ALKA 3AQIA 1NQOA 2F8MA 1KYZA 2XMCA 4LGMA 1JQKA 3NYIA 3GD5A 3QKIA 1RI2A 4IUCS 4M22A 4RIIA 4CL8A 2V6IA 1XEAA 1H69A 4W9NC 5IHPA 4QASA 1PJQA 1ADBA 5TR9A 2G0NA 1JQ3A 2A78A 1ZCAA 3ANNA 4PXAA 4Y2VA 4ALIA 4LJ5A 4EY6A 2GKOA 3GZNA 2A0XA 2VQ3A 4Q1VA 2Q1SA 5EHXA 3RIXA 3Q2IA 1E1QA 1JIVA 1FY2A 3A4LA 5KKCA 5JH7B 5KQPA 1GM5A 2WU1A 3JWGA 2P3QA 1GAWA 4WK6A 1CNMA 1Z38A 1NASA 1J8QA 1MABA 2NO9A 3DTVB 3N5CA 1C3OA 4K8OA 1EK1A 2PMFA 2JGDB 2O3QA 4RHFA 1EFUA 5D3KA 1NBEA 5HJ2A 3OHPA 3V4FA 4C05A 1RE0A 5C8ZA 1VP3A 3HPQA 1E32A 3AHIA 3JRXA 5EZYB 3UK0A 4BY9E 5THXA 4A7PA 2XF2A 3S0JA 1QK5A 2ZI3A 5A3VA 4BWVA 1JHOA 4M8LA 3W6ZA 5FBHA 4D80A 5B7GA 3U09A 4QBHA 3RE1A 3PJEA 4BTVA 4MCJA 4K2AA 4YIHA 2H1IA 4YDSA 4O2BB 4ZICA 1DQPA 1UZMA 5FD8A 3CC8A 4MO2A 5HZGA 1KERA 3BOSA 1CVLA 1Z6XA 3VR5A 1YFLA 4LWQA 3PTAA 3I05A 1W29A 4C3UA 2B36A 3TTTA 1SXQA 4EFLA 3KKLA 4EJ2A 1Z6QA 2HT1A 3MTEA 1PD0A 6PFKA 2IP4A 5KTMA 5DNYB 3ZXXA 3NWPA 4RS4A 1JDSA 1CULC 5EFZA 4GR5A 4CI0B 1M2OB 4ISCA 5PNTA 4DPMA 1E7SA 3EXFB 4PQEA 2I65A 1SVWA 3NEJA 4JDUA 2GEUA 5E6RA 2D5CA 3PFIA 4LGYA 3C1OA 1UBCA 1REQB 4BX2A 4M37A 2EDAA 3TS1A 2NSDA 1AKRA 2QT1A 2XNDD 4BCDA 2AN5A 4A8JB 4PHHA 1A4UA 4FBGA 4XUGB 4NAHA 1EFHA 5DASA 4BWGA 2NADA 2RI0A 1F0NA 1FRZA 3BB1A 5BN5B 1G8YA 3DLPX 3SJBA 4BNZA 4ND3A 3LXUX 2DETA 3H5OA 1B74A 1DKMA 4JX9A 4KO3S 1H2YA 3VNSA 2WKPA 4XWAA 2SCUB 4DKJA 4RTQA 5CEFA 3FGPA 2VRCA 2XMRA 3E27A 4OYHA 1MNQA 1GKIA 4RHXA 1PZNA 1WWKA 2IYSA 2J5RA 1L8LA 4N3AA 1FXWA 2F8TA 3ESYA 4JLKA 1E1CA 4I99A 4C7KA 1PG5A 3PDJA 3TOCA 5LZ2A 1BE6A 4DWWA 3VPHA 1DDOA 2PWYA 2VP5A 3CY6A 3O8QB 1AO3A 4Y6QA 5A5VA 3SM9A 2VSOA 1Z28A 2VSXA 3DBRA 5CA0F 3I0NA 1U0TA 3U4IA 4OU4A 2PX6A 1JDZA 4PBSA 5EI5A 4U7WA 1HZZC 1YFJA 2H2GA 4IIUA 4XGRA 3GUHA 4FSHA 1S2OA 2ZPAA 4P58A 4DIMA 4JL8A 4PICA 2BN4A 4H1UA 4PLVA 1Q21A 3VPSA 5H0IA 2HF7A 5SY6A 1E5LA 1N6LA 2BEWB 1FFHA 4X93A 2OFXA 1WDTA 2W4IA 3CTMA 4YBRA 4CMAA 1DV2A 4LBWA 3URKA 3RRJA 1YU6A 1CUIA 4JZYA 3U1BA 4L50A 3Q3CA 1PZEA 2EP5A 4P0QB 4JA0A 3ZUGA 5TQ2A 3FAZA 2A84A 4B73A 1DJOA 1BRMA 4M0FA 1QV9A 1W5AA 2ZSUA 3NBQA 4MS3B 1AT1A 1SIOA 1B43A 1TNDA 5KOHB 2XEXA 3HY6A 4L75A 1SKMA 2OOSA 3LG2A 2ZYAA 1KFBB 2YOFA 3RRNA 2BCEA 2QLJA 1BMDA 5AHXA 3BMNA 4C0KA 1Q16A 3RBZA 1E2HA 2CFSA 3LCJA 2C61A 3V48A 1I1NA 3LDHA 1KH3A 4I9NA 1X1BA 4IDGA 2R6AA 4FIDA 1E0AA 3EC1A 3AESB 3GPDG 5C2JB 2JJQA 5A4IS 1E2IA 2XGMA 1A8UA 1NUTA 5FTJA 5GZ6A 5FUQA 5F7ZA 1JXMA 3H1BA 4EUKA 1J7KA 2IHZA 1CUHA 4MVJE 2JFYA 3L7NA 4ZQFA 2CXQA 2FUKA 2M2IA 1ULHA 3KLOA 2PSDA 4KX3A 2H5IA 3RVRA 5AIAA 2IZ0A 5C1IA 2CV1A 3GOHA 2VZ9A 1ZICA 821PA 4P2GA 1OREA 5F7XA 4OQFA 3RUFA 3F46A 5ALPA 3C41J 3GGCA 4GYKA 1JR2A 3F8WA 1DZIA 2EG5A 3G59A 1MIOB 4DTCA 4EI9A 4HN2A 3FNGA 1S2IA 4K9RA 5DM60 4YJDA 1XPRA 4GKKB 5DYYA 4LX8A 4E09A 4EMSA 4GX0A 3THRA 4O4HB 3VKFA 3ZY3A 1BVHA 3SYNA 1SY7A 4BE7B 2XJ4A 1UOPA 4FFMA 3TFOA 1CS0B 1JEAA 3D6AA 1Q0UA 2DQYA 4N6NA 5ALHA 2IUUA 1WE2A 4C14A 1COWD 3F4LA 4W7SA 3M5DA 2MTBA 1ZD1A 4V1CI 4RF2A 3WWOA 4JLSA 5FAKA 5LLTA 3SXJA 5ADVA 5CG1A 4QDZA 4B1FA 1PZMA 3A1VA 3H5NA 5HOEA 4DY6A 4UU0A 1GCIA 5HUQA 5C4GB 1H5NA 3P26A 4ND1A 1HBJA 5CURA 8LDHA 2WV7A 3ZDCA 2LWIA 1UPXA 1W75A 1RYDA 2BP7A 5C34B 3CH6A 3ZHXA 1X70A 2QPOA 2ZRCA 2UYCA 3TLYA 4WXYB 3CPEA 3C7KA 2XBUA 3CE6A 3W6PA 2O07A 1KMCA 1Q7GA 4IUBS 2BISA 4DKXA 3BS4A 3JQ6A 2XCIA 4OY3A 5HGJA 4BNGA 1B00A 1SUPA 2ZR8A 3I9LA 1T2UA 2I78A 4M9CA 1N9GB 2YY5A 4FR2A 4ZHQA 3PQCA 4B6PA 5LL6P 5K6RA 5DHRA 5BSRA 1NU8A 4CNBA 5C8YF 1QCZA 1WCXA 4AROA 4QC2A 5F3WB 2E85A 3OE1A 4L74A 3ZNPA 4E15A 2V96A 2DPGA 5EZQA 3PLRA 3SR4A 2XE4A 1FP1D 3HUUA 2A5YB 1CERA 3M6LA 4HLCA