3GEGA

Fingerprint and structural analysis of a scor enzyme with its bound cofactor from clostridium thermocellum
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
245
structure length
241
Chain Sequence
NRGVIVTGGGHGIGKQICLDFLEAGDKVCFIDIDEKRSADFAKERPNLFYFHGDVADPLTLKKFVEYAMEKLQRIDVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNKGRIINIASTRAFQSEPDSEAYASAKGGIVALTHALAMSLGPDVLVNCIAPGWINVTFTQEDCAAIPAGKVGTPKDISNMVLFLCQQDFITGETIIVDGGMSKRMIYHGDWNWFYKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title Sequence fingerprint and structural analysis of the SCOR enzyme A3DFK9 from Clostridium thermocellum.
pubmed doi rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Oxidoreductase
total genus 84
structure length 241
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gegA00
3HZZA 2HJRA 5BNTA 1Q0LA 1ZK4A 4QFDA 1ZK0A 1YQXA 2DVMA 1IHXA 5FEUA 1QR6A 1I30A 3N7UA 4ITUA 3K73O 3ZWWA 2W98A 4CUZA 3ZHXA 4E2WA 4JJIA 4QQRA 2NADA 3FNEA 2IEDA 3DBLB 3HHPA 1EUCA 5THQA 1ZKMA 3KTDA 5COQA 3ZN2A 3STHA 5A9SB 4PZEA 4GKBA 1I2CA 3GHYA 2I3GA 1RKXA 4TMFA 2CVQA 4CM1A 3PQDA 2B4RO 5TNXA 4YWJA 1SB8A 1MC5A 1QYVA 1O8CA 2VHWA 3FWNA 2YZ7A 4FFMA 4XYBA 1HWYA 1GTMA 4QO7A 4DIFA 4D3FA 4W99A 1R4MA 2QW8A 2VYNA 4B3JA 1LTHR 4BB5A 3ZHYA 3S55A 5DCUA 3JQ9A 3OEYA 3CE6A 2V6BA 2VQ3A 4PG6A 1P33A 4YBZA 2C54A 2J6IA 4L9RA 1I3KA 1UXHA 5ITVA 1GV1A 1DAOA 2CNBA 5KKAA 4CMJA 3OBBA 4U5QA 1B8PA 2SCUA 3B1KA 2GO1A 3TN7A 2Y68A 1N8KA 4Q3AA 5TGDA 4XCVA 4EJ0A 2VUTA 5JBIA 4IDBA 3LC1O 3KHUA 3MJ4A 1KVSA 1PGOA 2ZYGA 1KEVA 4BMSA 2ZB7A 1I5RA 4RF3A 4AJHA 4E30A 4IMPA 2BMAA 1D3AA 3JYOA 3GNQA 1ONNA 3RBXA 3CKYA 4YA6A 2JD1A 1U3WA 4J1SA 3PPIA 2C7VA 1DEHA 1MA0A 3QE3A 5L45A 1WNTA 1ZEJA 1YBAA 2C0CA 2CF6A 1YWGO 3O8QA 1P44A 3HDYA 4IBOA 1L7EA 1E1NA 1V6AA 4WNIA 1V3TA 4MVJF 2B4QA 2GR9A 4NNJA 4XRRA 3ZCXA 2V6FA 2AQKA 3ZNQA 3TPCA 1VKOA 3BTUA 4AJ2A 4AJKA 4WOKA 4DQVA 3CXRA 1YDEA 2OBYA 3TOZA 4CMIA 2VWGA 1MX3A 5JAMA 3JQ8A 5CG2A 5MGBA 1I01A 1R15A 4BOYA 2Y1GA 3ENNA 1BMDA 4HKTA 4XYGA 3ONDA 3VC7A 1E77A 1DC5A 1R4MB 2Y1EA 4E4YA 4YT2A 1UZMA 3RUAA 5JC1A 2O48X 2NV6A 5JY6A 4ND4A 2BHLA 2P68A 2NU6A 2WM3A 3C1TA 3RC7A 1G6KA 2V7PA 2I65A 5COBA 1AUPA 4W6ZA 5T8KA 1YKFA 5IDYA 1NPYA 3SBOA 5KJEA 1ENYA 3PRJA 5J23A 2ZATA 3TZQA 2YV3A 4TRMA 4Y8VA 3F1LA 1YL5A 2O4CA 3WBBA 1GAEO 1FDTA 1OZAA 1OI7A 1QYDA 5T8KC 2D1YA 5DOVA 1XELA 1XQ1A 4H15A 3W4JA 2FPGA 3VHRA 3ETDA 2I99A 1DPGA 4TWRA 1DJNA 3GPIA 2DAPA 1E7QA 3PWSA 3DXFA 3SEFA 4MKZA 3AU8A 1PL6A 4BMNA 1LLQA 1HTBA 3NT4A 3JYNA 3BAZA 5EERA 2GF2A 2YHIB 3EVNA 4FW8A 1XYGA 3QP9A 5JCXA 2UV8A 4FQ8A 3WBFA 4YT4A 1QLJA 3C3XA 4J49A 3WGHA 1M76A 2WWRA 4HXYA 3RU7A 3RVDA 5TQVA 2E37A 4DMMA 2OORA 3NTRA 3E8XA 5TLSA 1EVIA 4IY1A 1XWFA 2Z95A 1F8GA 1Y81A 2HAEA 1IB6A 4Q3CA 3MZ0A 3K30A 5FI5A 4YJFA 4XB1A 4LISA 1NVGA 1PJ2A 3LSYA 4DIOA 3FPCA 4XKJA 3EK2A 1V0JA 3C85A 4II2A 1Q7GA 3K8ZA 1ZXBA 1C3VA 3NYWA 2OOSA 3E9QA 1YONA 1QV6A 1VSVA 1Y5MA 2X0NA 3NT2A 3CEAA 3ROQA 3ZH2A 4LSMA 2EKLA 2EV9A 1EVZA 1Z7EA 4B4VA 4B4WA 3JQAD 3RUDA 3ICPA 2IZZA 3VPGA 1CQIA 5LDGA 4MIOA 1HDGO 1ZEMA 1O94A 2VTEA 4YRBA 3DMTA 4EBFA 4XIJA 1D1TA 1LLUA 1PWZA 5EINA 2I9PA 2Y66A 2Q2QA 3BHIA 1R12A 3PJFA 1ML3A 3IUPA 3DOCA 4CM5A 3IAHA 2NUAA 2BF7A 1DRWA 4GI2A 4E2ZA 2IEBA 2PGJA 2R00C 4NJOA 3DMTC 4PG7A 3RBZA 3DTYA 3RC1A 2G76A 1OOEA 1EK6A 4D45A 1C0LA 1BSVA 2PK3A 2DUWA 2BGMA 2G82A 3CH6A 4I5GA 4R51A 4XR9A 1UDBA 3UW3A 5IF3A 1PQWA 1VKNA 5I8ZA 4DLBA 3BHMA 5DOZA 4TRRA 4MJLA 3NT5A 1P1HA 2W4QA 4BO4A 2J3JA 3F9IA 3QW2A 4RJTA 4CM9A 2R6JA 4IS3A 3VPHA 4BNXA 5H83A 1ZXLA 5GZ1A 3GMDA 1ZW1A 2PKQO 4MVJE 4DPMA 4EDFA 5A04A 5JDCC 3DC2A 2HK8A 5HWSA 4P38A 4QFCA 4NJMA 3ZHBA 2P2SA 4FFOA 3ZWOA 4CM4A 2JCVA 2Q49A 3ZWAA 1EEHA 3E03A 1Y8RA 2PR2A 2WYVA 4NBUA 2G0TA 4P8RA 4CPDA 2D0IA 2EG9A 4DMLA 4YT8A 2EEZA 3PHJA 4NFYA 3BMNA 3WX0A 2JFHA 3VPFA 1AGNA 4ZQGA 3OHSX 3TL2A 4R54A 1W4ZA 3G49A 1EFKA 5IZ4A 4YDRA 2VOEA 1TT5A 1NFFA 4PVDA 3AM4A 1C0IA 3R3JA 3Q1LA 5KVSA 3RJ9A 4RVHA 1HRDA 2X58A 4FFPA 4D41A 2QYTA 3C7DB 3RFVA 2DBQA 1IHYA 2X1HA 2PZMA 1HL3A 1NTOA 1K6JA 4BNYA 4EGFA 3U62A 3E5RA 3KV3O 4J1TA 1E6UA 3BHJA 5KJ1A 3GHHA 1PL7A 4EEZA 4YRDA 2GN6A 4LRTB 5TT0A 3PDJA 2FWMX 1HLDA 4RGBA 1DRVA 2QRJA 1FDVA 3MJTA 3KM0A 1AE1A 4OL9A 2ZJ1A 5AXDA 4BGEA 1LQUA 3FPLA 4PLPA 4JQCA 2WTBA 4U6QA 3MTJA 5C7IO 2AQHA 3DZJA 1TVEA 4ALMA 3U5TA 4NJMB 4L4XA 2IDZA 2VNSA 1LU9A 4CM4B 2Z1NA 1NXQA 1VL8A 2BGKA 1PJ4A 4NFSA 3D4OA 1EUZA 1P0CA 4N54A 2FSVA 4OOFA 3JYQA 4ID9A 1T4BA 1PJ3A 2DLDA 2Q50A 4P4GA 1LC3A 4FDAA 5JMWA 3GY0A 1ONOA 3PHGA 5DCWA 2CDAA 1RPNA 4URFA 3RUFA 5LCXA 5T67A 3V2HA 3ITDA 3O03A 3HQ4O 3D7LA 3WB9A 2JHGA 2IYOA 3AOGA 4J1QA 4BVAA 5K6AA 1U7TA 4UUNA 2JAHA 4JP2A 4PCVA 3HN7A 2HLPA 4Q39A 3NDJA 4J90A 1E7SA 3NRCA 5JAIA 4GWGA 3QA9A 1PX0A 4CLOB 3OJOA 4PLHA 4L73A 1I10A 2A4KA 2Y67A 4KP7A 5U9CA 3AFNA 4IXWA 5K6AC 2AHRA 3LF2A 1DIAA 3E9NA 4O1MA 3FNFA 2YY7A 5CP8A 5BNIA 3OJLA 1V35A 2FZWA 3WS7A 4BNGA 4IJUA 4B3IA 1GZ6A 3VOSA 1E3EA 1DHTA 5IDXA 2O3QA 4OO3A 3EMKA 1NPDA 4GSKA 4A5OA 1JLLA 3SC6A 5I7EA 5L4NA 2RCYA 2W2LD 1A9YA 3WXBA 2P9EA 2FHSA 4N5NA 4GGOA 1WPQA 1EZ4A 5EL0A 5F1PA 3FI9A 5IAAA 2O7SA 4UREA 5KJFA 2ZCUA 1MGOA 4CM6A 4FFLA 1H9AA 1FK8A 2VN8A 3D0OA 3KEOA 4DA9A 4R69A 1R0LA 4E33A 3L9WA 1DIHA 2IODA 3I9OA 4RQTA 4YACA 2PD3A 4AJNA 4A73A 3OEWA 3H3JA 4XGIA 3G79A 4XYEA 2J5RA 5A4DA 1E7MA 3MCVA 4CUKA 1TEHA 4DC0A 3BMQA 1JN0A 1HYHA 1HDYA 3ZWMA 1DXYA 5TRTA 2D8AA 3K2EA 5JO0A 4YAJA 4D79A 1FJHA 4KUEA 3UVEA 5TX7A 2NVWA 1KOLA 2RH4A 4E2YA 3H5AA 2GD1O 2DKNA 2W2KA 4KOAA 1QV7A 1DFHA 1PJLA 2ZK7A 4M87A 4PG4A 4A27A 4J9VA 1MG5A 4M54A 4BO8A 4ZQBA 2DTXA 4PLYA 3H2ZA 1H6CA 2DBRA 3OQ6A 3CINA 4J6FA 3D1LA 1Q2XA 5HS4A 4WCFA 4XQEA 3KBOA 1CYDA 5IDWA 2EW8A 3F3SA 5JMPA 3LYLA 3ADPA 3D3EA 1R16A 3MJSA 1I36A 4EJMA 2NU7A 2X0IA 3IQDB 4FC7A 4W7HA 4EUHA 3TFOA 1Y9EA 3FHLA 3UUWA 4WCFC 1RWBA 4UVDA 3ZWVA 2UAGA 1YB1A 2VWHA 1KY5A 2Q46A 3P19A 4BO2A 5DNAA 2PNFA 4M1QA 1Z75A 4TVOA 5EN4A 3CTMA 1G0NA 4U0JA 3K96A 7ADHA 1T26A 2JL1A 3I3OA 4GL4A 4R4JA 5A5EA 1U2GA 2VHYA 1GV0A 4GMFA 5JAQA 4HNHA 4S1VA 4E2XA 2CSUA 4EUEA 4CQMB 3KYCA 2J8ZA 4CMHA 1YH3A 1KEUA 3M2TA 5L51A 3MJVA 5CEJA 2P5YA 3AUAA 2UDPA 4BNZA 1YJQA 5JE8A 4RLHA 1GCOA 4ALKA 2FPPA 1F14A 1KY4A 2EHDA 5COAA 1N9GA 4CQLB 2GPTA 1C14A 3C7AA 1BGVA 3IKTA 2C2YA 4K6FA 1EDOA 3H9GA 3WICA 2VNAA 3P2OA 3MTGA 3TF5A 5TT1A 4K6CA 2W2KB 3QWAA 3GH3A 2C29D 4CLDA 4IMRA 1A7AA 2X0RA 2DFDA 3PJGA 4FOOA 1DOHA 4CLRA 1LRJA 3HWRA 4LGVA 1WW8A 3ETGA 3E82A 1EVYA 3DOJA 3JCZA 1LRKA 1MG0A 3GDFA 3ZV3A 4WCFB 3DDNA 2J3HA 3HFGA 1VC2A 1WXDA 3GVXA 1HSOA 5DP2A 2A94A 4NPCA 4RLSA 4BS9A 3EDMA 3AK4A 1TT7A 4IDEA 4J4HA 3GDOA 4RVFA 4AJ1A 2IXAA 1LX6A 3JQ7A 4NI5A 3AM5A 1F0YA 1P77A 4LMPA 3PHHA 1HT0A 2HO5A 1E7WA 1DIRA 3DBHB 1ISFA 3ZDFA 1SNYA 4ZGWA 2EF1A 5CPFA 4ND2A 3Q6IA 2D5AA 1NFRA 2R2GA 3KYCB 4PN3A 1U4SA 4CV2A 1P31A 1V9LA 3AI1A 4KZPA 4MP8A 2DUUA 5HA5A 4BV9A 3ADOA 2TMGA 5L53A 3A28A 5EJ2A 5KOIA 2ILTA 4JGBA 2GASA 3RUCA 1O5IA 1N9GB 4P22A 4ZQFA 3NX4A 1BVRA 4ZRNA 3TZKA 1D8AA 4ROSA 1U5CA 5BSFA 4XYMA 2BELA 4ZN6A 1EVJA 3OETA 1EQUA 4A26A 3VVCA 3A9WA 3EZYA 4O5OA 2NM0A 2UUOA 3DAPA 4I5EA 4RF2A 3DZIA 1B26A 4CLRB 1XA0A 3ZWCA 1KS9A 1A27A 4BNVA 2NWQA 1MP0A 1DRUA 3UXYA 3GA0A 3LLVA 2PD4A 3AI2A 3DHEA 2Y0DA 4XX0A 5JY1A 3OF2A 1YQGA 3OIFA 8LDHA 4Q3BA 4FFNA 3RIHA 5A06A 1H2HA 1LA2A 4XEHA 5ICMA 1QG6A 4D7AA 1HDOA 3UCXA 3IOYA 3C1OA 4R5HA 2Q1UA 3ZW8A 3W8FA 5G2OA 5ICSA 2WD7A 1Q1NA 3GNTA 1LDBA 1N7GA 2YFHA 4RZHA 4MKXA 4BNMA 3OFSA 1PZHA 4C7JA 2VWPA 2O2SA 1UAGA 3JQCA 3LT2A 1CRWG 2JD0A 2ZQYA 3PIIA 4GMGA 4N7RA 4EUFA 1KEWA 2YJZA 4NMHA 2B36A 3QLJA 4CR7A 3H9EO 3HDJA 3GUCA 4EZBA 3E18A 2CZCA 2H63A 3LDHA 2EERA 2DBZA 3B6ZA 3LU1A 1A72A 4RCVA 1W6UA 1IY8A 3SXPA 3FBGA 1OBFO 1QLHA 4YJGA 4WLOA 1XR3A 3MWDB 5TIIA 1HE5A 4DYVA 3DWFA 3HNPA 3WWYA 2IYPA 4UVEA 2CMDA 1SC6A 1JKJA 3UAGA 2RAFA 1B16A 4UVHA 4HFRA 1B3RA 5TS3A 3DTTA 1WP4A 2F1KA 2IZ0A 3E5MA 4FCCA 1HZZA 4CQMD 1X7GA 2DM6A 4OIMA 1D1SA 2EGHA 2O23A 3DFUA 3H3FA 4Y98A 5DBGA 1P1FA 1NQ5A 5BSHA 4H3VA 1U9JA 3L4SO 1UP7A 4CL3A 4AJOA 3G1TA 3WGZA 4ALIA 5KWEA 3P2YA 5ES3A 1O6ZA 4B7UA 4XYLA 2PLAA 3HADA 4E32A 4N18A 1IE3A 4LVCA 4FJ1A 1E92A 1OFGA 2D59A 3JQ6A 4ND5A 5I9LA 2VYVA 1FF9A 1ARZA 5G0WA 3TNLA 1JW9B 1MV8A 1KVTA 1GUFA 3LT1A 4A10A 3H2SA 2WD7B 3JQGA 1GEGA 1K89A 5K9ZA 4B7XA 2VRCA 1GUZA 2YYYA 5ILGA 4MPDA 3JQ9C 4C7KA 3EYWA 3I4CA 1ISGA 1RM0A 3DZKA 1U7HA 5KJCA 3ROPA 3WQSB 2ZTUA 4D44A 3DR3A 4Z9XA 1MXHA 2Z5LA 1A4UA 3G1UA 4NK4A 1YVEI 4G65A 2ET6A 3DONA 4IQ0A 3WGOA 3WR5A 3MOGA 1HYEA 1NPTO 4CJXA 1LRLA 4F46A 3E9MA 3DQPA 4YJGB 2EXXA 2WE8A 3NJ4A 1LLCA 1ADGA 1DIGA 1H2BA 2JAPA 1XGKA 3NUGA 4PLGA 5TC4A 5I9NA 4H16A 1PQUA 2XXJA 3DL2A 2C5AA 5TF4A 4BMVA 1UXIA 4DUPA 4D43A 1Z45A 2AEJA 2NQTA 2NTVA 5ILOA 4J0FA 4OSPA 4MVJA 2CUKA 4U6SA 3TL3A 2GDZA 1NHGA 4OKIA 3W8DA 3QVWA 2Q2VA 3UN1A 3WG9A 5TSDA 5BSEA 2PFGA 1ZIDA 3ZNPA 2BGLA 4OXKA 4MIEA 1ZK1A 3LQFA 3P5SA 4GVXA 2HRZA 4JJGA 3ZWNA 4PG8A 4BNTA 3GEMA 1O89A 3KEQA 3VZPA 1W0CA 1ENPA 2E82A 3JQFA 2OL4A 3RUIA 2BI7A 5A9TA 1QORA 3ABIA 1X15A 3DOOA 3NGLA 2A35A 4YCAA 3JQEA 2OXIA 4QT0A 4R01A 1GYRA 5A02A 4Y9DA 1ZSYA 3JQGB 4YQZA 4CMKA 3JQFC 3TFQA 2GLXA 3TWOA 4IZHA 2GRAA 1LSOA 1Y9AA 3VDQA 3U4IA 4A0SA 4RPKA 4E3ZA 1HDCA 3KETA 1HSZA 2ZTLA 4RPJA 2Q1TA 5A03A 3WOHA 5C5IA 5L7TA 3W6UA 3FBTA 1GPJA 2NTJA 2PV7A 4Z9YA 1P1JA 4FB5A 4XJTA 3H9JA 2BFAA 2BFOA 3D4PA 3AY3A 1C1DA 2AMFA 2XOXA 4PVCA 1I24A 3AUSA 3O8QB 1ZZEA 4I8XA 4XGKA 2VHXA 5JSFA 1EQ2A 3BYZA 4JX8A 3PWKA 4HP8A 1KYQA 4N5LA 3HJAA 2FMUA 2AE1A 5T57A 3ANMA 1N1GA 3GQVA 5G4KA 1T1SA 3INGA 3FN4A 1LJ8A 4CMIB 2HDHA 1WLYA 4G5HA 3HUDA 1E3LA 4B8WA 3JQ8B 1AXEA 3KOUA 4IJWA 5L7YA 3V5NA 1XG5A 2EKQA 2X9VA 4TRJA 5CDYA 1ISIA 3L6DA 1SAYA 3U4DA 1J6UA 4W7IA 1X0VA 1WDMA 2Y1OA 1QMGA 2GUGA 1RM3A 4BO7A 1T25A 2H5LA 5CEEA 5AXAA 3TJRA 3GMSA 4KQXA 9LDTA 3LZ6A 3OQ1A 1ENZA 3W4KA 3S2FA 1HE4A 4P4LA 3ORFA 4DLLA 4RPHA 3GK3A 1ZUD1 2POQX 2EJVA 2HMWA 3GG9A 4RORA 4LW8A 1WMBA 1ZVMA 2VUSA 3V8BA 5B4UA 2BLLA 3NEPX 4PLWA 4OOEA 1XSEA 3PLNA 2O50A 1ADBA 4OSOA 2GZ3A 3LT4A 4ALNA 2GGSA 4B4UA 3LLSA 1MFZA 3JYPA 2I66A 1R0SA 4R1NA 3ZWYA 1UR5A 4QO8A 4NIMA 4DRYA 5C7OO 1C1DB 1GR0A 5IDQA 3NAQA 1LLDA 4J3FA 4BIIA 2HSDA 1BRMA 3L77A 4OAQA 1S7CA 4XRGA 2JFGA 5F1OA 4TQGA 1XU7A 4DXHA 4PGFA 1TA4A 4W9NA 3WMXA 1X1EA 3H8VA 2C07A 5TJ9A 2QYSA 1TB4A 3HB5X 4D46A 1CJCA 1I8TA 4MP6A 5G4KB 5L9AA 4BO3A 1PU2A 3RUHA 1QRRA 3P7MA 3H5RA 3VTFA 4A2CA 4XD2A 4ZHSA 3LK7A 4W9NC 1DDOA 1GFSA 3IJRA 5DT9A 2EW2A 2CDBA 4BO5A 1PJQA 2HMVA 2Y1CA 4YJFB 2HRBA 4NBVA 4KDEA 4U8GA 4YT5A 3WIDA 2VCYA 3NJ8A 1XCBA 4R1SA 4S3MA 2YUTA 2VHVA 1JDJA 2GZ2A 1J49A 3GEGA 3WJAA 4NZ9A 1UAYA 4PLTA 4WPGA 5JNLA 3W6ZA 1U4OA 1PIWA 3WGQA 1DAPA 1C1XA 2O3TA 3VH4A 4YJDA 3T4XA 5JCJA 5HBRA 3I23A 1JWBB 3RWBA 4INAA 2RHCA 1QYWA 4GWKA 5B1YA 1GQQA 1LBEA 5DBFA 3DEYX 3JYLA 4PFJA 4RO0A 4ZQEA 5CG1A 1L7DA 1BWSA 3F5SA 3OSUA 2X22A 5IJZA 5KNLA 2YDYA 3HSKA 5KKCA 3FNGA 2VYND 3BZUA 1KERA 1GD1O 2NQ8A 1AXGA 4GSLA 2FOIA 1UUFA 5DN9A 2BI8A 3L0DA 3GAZA 4IIUA 1GUYA 3LVFO 2W90A 9LDBA 1LDYA 1OAAA 3EVTA 4Z3KA 2X23A 5EQFA 1PSDA 3I9LA 2Q4BA 3I1JA 4TZKA 1NNUA 3AWDA 3ON5A 4LCEA 3CMMA 5I8WA 2CDCA 3JD1A 1H6BA 2B35A 4XZ3A 1PZFA 3BIOA 4XWYA 1TXGA 1Q7BA 1MFPA 4KMSA 4ESOA 2X9GA 3EW7A 3ZV4A 1ZFNA 4BKRA 1Z7BA 2VZ8A 3GGGA 2EP7A 1YL7A 4NBWA 3B70A 4ZQHA 3PDUA 4GLLA 2GYYA 3IMFA 3X2EA 3AM3A 3T7EA 4DPKA 1YOVA 1VM6A 5G0TA 3TSCA 3I6IA 5I7SA 3ZU5A 3B1FA 2EWMA 1ONPA 1CDOA 2QHXA 1KC3A 4CMCA 1Y8RB 1U3TA 3PP8A 4YB8A 1L1FA 1C1XB 4HX5A 1E3WA 1TLTA 1LUAA 2PWZA 1B3BA 3BMNB 3F1KA 2JHFA 2EJWA 4NBRA 2V6GA 5A9RA 1YO6A 4AICA 1JU9A 2I76A 3JQBA 2X5JO 1TT5B 1SO8A 3GVCA 2QX7A 4QXMA 1K0UA 4MOWA 4DQXA 4PLFA 1PEDA 3VDRA 1PJSA 1LDNA 4DBZA 2E4AA 4YR9A 4ZU3A 4KWIA 2EP5A 3FD8A 1NVMB 3G0OA 3I9MA 3OECA 4J0EA 4CV3A 4PRKA 2D5CA 4BO1A 2IZ1A 4M8SA 1E1KA 2CVOA 2RHRA 3QVTA 5G4LA 1YRLA 4RVGA 4G81A 1U5AA 4TKLA 5JPIA 2FY8A 4J43A 3O9ZA 3KB6A 4FJ2A 4O6VA 2NU8A 3MOIA 3VZQA 3U09A 2UUPA 3ST7A 4AL4A 2JJYA 5BNFA 2CVZA 4BKOA 3QWBA 4WEOA 1YS4A 4QECA 3BTSA 3I52A 2D2IA 2WJPA 1DJQA 4I9UA 2Y1DA 3O4RA 1HDZA 1XHLA 4IIVA 4W4TA 1YOVB 1KETA 4FC6A 3PGXA 2X9NA 3RROA 4W82A 2FZEA 3KSZO 3CZMA 2P4HX 4AJIA 1E1MA 4BGIA 4N5MA 1XIVA 4E5PA 3PI7A 4IJVA 1IPFA 1YBMA 3Q2IA 4TKMA 1A9ZA 1E5QA 1E3WB 5I9MA 1YB4A 1X7DA 2VT2A 1T2AA 4ZVVA 3EHEA 4QEDA 2JCYA 1NR7A 2FPIA 2Y0EA 2AXQA 1ZSNA 4C4OA 2HUNA 4KQWA 4PZCA 4LRSB 3OMLA 3UFXA 1UH5A 8ADHA 1GQ2A 4LVUA 3GFBA 1PJCA 2P4QA 1GQYA 1IULA 3TRIA 2I3AA 1WDLA 3GZNA 4L76A 1E6EA 4J7CA 1B2LA 3KYDA 4JBIA 4Q3EA 1U2DA 3RFXA 1UP4A 5DULA 3EUWA 5GY7A 3X2FA 4AJJA 1T1RA 1PR3A 1A4IA 2HQ1A 4IZIA 2NVUA 1A5ZA 3QWFA 3D5QA 4IPTA 2PKRA 5H82A 2NLOA 5I7FA 1I3LA 4U7WA 3RAJA 2W8ZA 2X86A 3DZHA 4I08A 2DQ4A 2NVBA 4GGPA 2VHZA 3D5TA 4PRLA 4JBHA 3INRA 5AYVA 1VL0A 1K6IA 3COSA 2ZTVA 1DLJA 3NDRA 1PQPA 5L3ZA 2Q45A 4EITA 2I5PO 3K9QO 5L4LA 5L7WA 4KDFA 3DMYA 4B79A 1GZ3A 1DSSG 4NK5A 5G0SA 4DIBA 4L74A 5K0ZA 4DLAA 1UXGA 2OP1A 2Q1WA 3PYXA 4JBGA 1EUDA 4Z9FA 3ZV5A 5JAZA 1JAYA 3MJEA 1GY8A 1M66A 4CV0A 4CMGA 1DLIA 3KLPX 2RH8A 3OICA 4CL8A 4YJHA 3IS3A 4CM9D 1C0KA 1ZJYA 3EZLA 4MKRA 3BMQB 1BTOA 3IJPA 3PIDA 5JW6A 3IL2A 2J3IA 2DT5A 1BW9A 5EIOA 3PFFA 2ZQZA 4IGEA 1LDMA 3HFSA 4TVBA 2B83A 2F00A 2P9GA 3PXXA 4YAKA 1JVBA 3GZNB 4NU5A 3WDSA 2X0JA 3KYDB 4O0LA 3L4BA 3ETEA 4GAEA 4HV4A 3JV7A 4HWKA 2DTEA 4GPD1 1V3UA 3NDIA 3Q2KA 4J16A 2XAAA 1SPXA 1GADO 2YFQA 4DBVO 4R1UA 1RYEA 3INTA 3GG2A 4BO9A 2P9CA 3L4BC 3BMOA 4YTEA 5IFLA 3VVBA 1MXFA 1Y5RA 1UXKA 4DC1A 4YYZA 2GN4A 3ONFA 1NAIA 3GAFA 4I9HA 1I3MA 2OGUA 2YHUA 3GZ4A 2O3RA 2C7GA 4JROA 3MWEB 4R41A 1VJ1A 3DB2A 3DBVO 1Y6JA 3R1IA 5T6BA 3I83A 1JQBA 1ENOA 3LT0A 4BNFA 1GDHA 5A3JA 1NASA 3OJFA 3SLGA 2HU2A 4NR0A 2GN8A 5LC1A 1C0PA 3PLRA 3VTZA 1G1AA 4PIVA 4Z6KA 3PFWO 4J2HA 4BHTA 2OO5A 5GZ6A 2PKQP 1F8FA 4WCDA 1JAXA 4MVJI 3IP3A 1D7OA 1KEPA 1LQTA 2PZJA 4MDHA 1BW9B 2YV2A 2GN9A 3M2PA 2DC1A 4GX0A 5AVOA 4UULA 3RJ5A 3HN2A 4WUVA 3I9JA 4F6LA 1U1IA 3GRPA 3NTOA 5C3MA 4FPXA 1E5LA 3H5NA 3PQEA 2AG8A 3UKOA 4CV1A 1ZCJA 3VZRA 3EGOA 4RDHA 1KC1A 3L07A 3QY9A 1IL0A 4WK6A 3QHAA 3G17A 3PVZA 4GX2A 3UHAA 1HZJA 5CFZA 2UVDA 1Y1PA 1GYQA 5GMOA 3DHYA 2QQ5A 4YAGA 3GFGA 4HADA 3BMOB 3ASUA 1Z6ZA 3FSRA 3PTZA 4Y6PA 3FWZA 3O26A 1KVRA 4CM8A 2HCTA 4EJ6A 3PYMA 3JQAA 1UDCA 6LDHA 4XJSA 1H0KA 4MVJG 3C24A 1B7GO 3ZU3A 3KUXA 3ZGYA 2DTDA 1HYGA 4ZJUA 1QYXA 5JXWA 3Q9NA 3JD0A 4I5DA 3JQ7B 2WD8A 5ADHA 1U3UA 4XDZA 4E6PA 3RC2A 2ZKLA 2VZ0A 1EBFA 1X1TA 3H7AA 4AVYA 3NGXA 1YQDA 4BO6A 5IXSA 3QVSA 4I5FA 4KUGA 1HKUA 3U0BA 1DFIA 5FI3A 1LEHA 3OIGA 4CLHA 4E5KA 2Q2WA 3WSVA 3I9NA 3S2EA 2J5KA 2CFCA 1VE9A 3RKRA 1SEVA 2AQIA 5T64A 3WYEA 1E0DA 1PZGA 3GVPA 3OA0A 4R1TA 3VZSA 2WSBA 4J91A 5DBIA 3FNHA 1JWAB 2JD2A 3G3EA 2XXBA 4NG5A 4Q3NA 3HB4X 1H9BA 3QJ5A 4PLVA 3Q0EA 4JCOA 4L4RA 3OA2A 1HLPA 1SOWA 3B20A 4O59O 1ZMTA 1E3IA 3QSGA 1NM5A 1VSUA 4FSHA 4WGGA 1UZNA 5CDGA 3W4IA 4IDCA 1VJTA 4JLWA 2JFFA 4RVDA 5JFOA 4FR5A 3AW9A 3RU9A 4HBGA 1YDWA 1V3VA 3UCFA 4FOSA 4PLCA 2Q3EA 4XDYA 4YXFA 3TQHA 1B8UA 1IZ9A 3JD3A 1KVUA 1JVSA 1GU7A 4FD3A 3PJDA 5L40A 1Q0QA 1M6WA 5EPOA 3OM9A 1T4DA 3WFJA 3TDKA 3F46A 3OQBA 1QSGA 4CM8B 4NU6A 4P4NA 1R6DA 1T2EA 3D4NA 2WDZA 4OHUA 3WTBA 5CDTA 3JQAB 3QQPA 4BQRA 2Q1SA 1Z73A 1ISMA 1WZIA 1YBVA 4II3A 4WASA 3TZCA 2XF8A 5CPBA 4WJZA 2O7QA 1CERA 3ANLA 1U8FO 2J5QA 1KIFA 3RCBA 5AOVA 3VH1A 3C8MA 1HDXA 1XLTA 3R0IA 4D42A 1JA9A 3GVHA 4FIZA 1FDUA 2IRWA 2G1UA 3VPXA 4A7PA 2C2XA 1B8VA 2G17A 5A1TA 3ITKA 1V8BA 3RKUA 3Q9UA 4BGUA 2Q99A 4F6CA 4YAEA 4R68A 3KVOA 4L4SA 5DF1A 2OBNA 1LSSA 3L6EA 4QUKA 2GNAA 4ONEA 1R66A 3QIVA 4G2NA 4CODB 4KTTE 3RFTA 1UZLA 2BFPA 1PS8A 1RJWA 1J4AA 4DWVA 4DYDA 1Y7TA 3DFZA 1PJBA 1U3VA 2FR1A 1T2DA 3FTPA 1YB5A 4UUPA 1KVQA 4BKQA 1NQTA 1EE9A 3F6YA 4FGWA 2ZTMA 3U9LA 3CPSA 3UOGA 3IC5A 3SC4A 3MJCA 5JLAA 3DZGA 1CQJA 4DREA 2PA3A 2YHIA 4L0QA 4MVJH 4RDIA 1ORRA 5JO9A 2X8LA 4ND1A 3W1VA 3AOEA 4Z0PA 3VPSA 5JYDA 1R4NA 3L9XA 1N5DA 1EK5A 2WMDA 1LDGA 2QG4A 3EY4A 4Z0TA 1ISJA 4IDAA 1T2FA 4K28A 2E49A 2B5VA 4ZD6A 3V2UA 2EIHA 1DC3A 3OH8A 4OKNA 1E6WA 4J7UA 5THKA 4TRNA 3ONEA 1JKIA 3AOEC 4FBGA 3ZV6A 3DBRA 2JCXA 1F17A 1GPDG 3AY6A 3HDQA 2RBEA 4BNJA 1N92A 3HG7A 4WNCA 3EC7A 1XKQA 4J9UE 1ULUA 3BXXA 3GVIA 3M6IA 2OP0A 1J5PA 2ZB4A 1JKFA 3R3SA 4GQAA 3S8MA 3D64A 4UUOA 4BUCA 3WNQA 2X7HA 1DIBA 3ZWBA 4RL6A 3SLKA 2Y05A 5U1PA 4WOJA 5IXYA 2VTDA 2DU8A 1QYCA 3A4VA 4LSWA 4JXKA 5F5NA 3UF0A 2Y0CA 4BB6A 1GZ4A 5CEFA 2W2LA 4HUJA 4CLXA 2GCGA 4OJNA 4XQCA 1D4FA 1PGJA 4NH4A 4CR6A 1SEPA 3FF4A 4R16A 4OYRA 2FRDA 5ENVA 4E12A 3ZNOA 1XEAA 1NAHA 2HMTA 2XPCA 2H1SA 3V1UA 1EDZA 3I4FA 1DC6A 1YE3A 4IDGA 1R4NB 3V2GA 4AG3A 4JNKA 3WWZA 3OP4A 3CUKA 1ZK3A 1Y8QA 4B7CA 1SB9A 2HK9A 3GN1A 4BKUA 1SCUA 1N1EA 5FWNA 2X6TA 4K1LA 5AXBA 4EI2A 2PH3A 3DBRB 4L75A 4M86A 1E1LA 1NQOA 1ZK2A 4R5MA 2DFVA 2PD6A 1H6DA 4XQGA 3C1AA 1DB3A 2CY0A 1DO8A 3QWHA 4MVJM 4RQUA 5DCYA 1QKIA 4GX1A 3KZVA 2O3SA 3NTQA 2AA3A 3GLQA 4WE3A 5F21A 1WMAA 2YQ4A 4IGFA 4DL9A 1TI7A 1B0AA 3S2GA 4BKPA 1KBZA 3O38A 4HFJA 3U4HA 3PQFA 2WYWA 2GZ1A 1ADFA 4D0SA 5B4TA 4KWHA 4BGVA 1PWXA 2ZB3A 1HXHA 3FRJA 5A3VA 1SZJG 3JSAA 3AJRA 2R00A 5HTOA 1MUUA 1IZ0A 2A92A 3PHIA 3ZU2A 4BNUA 3AFMA 3GN2A 3L6OO 3N58A 4IINA 4NDNE 4E31A 4BO0A 4HY3A 1S6YA 1AHHA 1YJ8A 1Z74A 4J4TA 2BH9A 3GUYA 4YQYA 2YQ5A 4A03A 5F1KA 3E48A 3RUEA 2B69A 1NWHA 1MB4A 1X0XA 3VKVA 3KXDA 2H9IA 3UICA 3SJUA 1GCUA 5DDIP 1ZBQA 3H6KA 4UEJA 4AFNA 1I33A 2JKVA 2ZB8A 2PZKA 1PS9A 1WWKA 4OQYA 1SOVA 4EEXA 2X4GA 5F3RA 2PY6A 2D3TA 2P5UA 3RBVA 1F06A 1VL6A 1CEQA 1XU9A 3WIEA 5JDCA 1NVTA 1Y8QB 1WZEA 1X14A 3WFIA 4UEOA 4X54A 2EGGA 4HFNA 3BMCA 2B4TO 4DPLA 3ANNA 4HFMA 4Y6SA 1A7KA 4DTIA 3C7CB 1PGPA 3HE3A 2J3KA 1SBYA 3BTVA 1FXSA 3E1KA 3OIDA 3W8EA 3WGYA 3SJ7A 6ADHA 4ALLA 3GNSA 3KO8A 1HE3A 4QSMA 4LMRA 3JD4A 1W8DA 2OHXA 1ZSVA 1VLLA 3SX2A 4KTVE 3JD2A 1P0FA 5T5QA 2ZCVA 1DBVO 2HK7A 4RVSA 1YGYA 4OGWA 3KSDO 2NTNA 2QRKA 4LCJA 1A71A 1BHSA 3MEQA 2VYVD 4HNGA 3LF1A 3N74A 5AQ1A 5A05A 1NYTA 4WLVA 5B37A 5IZCA 5KJ6A 3WQQA 1ISHA 4M89A 2NACA 2VRCD 4D0RA 4YPOA 3OJEA 1E7YA 4IUYA 1F12A 2IE0A 3JTMA 3RC9A 4RF4A 2LDXA 4QTZA 4XB2A 5ITWA 2D4AA 2GERA 3GDGA 3E6AA 3V1YA 5CDUA 2TMDA 2VRBA 2FP4A 4ZRMA 5IZCC 4XGNA 1UXJA 3RQSA 4TROA 1EMDA 5ER6A 3HDHA 2B37A 2EKPA 3PHLA 3K31A 2VWQA 2NU9A 5BSGA 3T7CA 4CLOA 1T2CA 4BV8A 4YAIA 2O2YA 2AEFA 3I9KA 1K3TA 5C37A 1DC4A 3WLFA 3ZU4A 4UVIA 2NNLD 3F47A 5CAEA 1K2WA 4RPLA 2FSSA 2Y99A 1X7HA 2GSDA 3LC7O 5U4QA 4XQ9A 5JC8A 4JP3A 3BMCB 4YEDA 3T4EA 3IUSA 5A5FA 3GGPA 1LC0A 1IOLA 4GX5A 4MVJD 2G5CA 3DO5A 3GT0A 4XA8A 1LI4A 1BXZA 2ZJ0A 1NWCA 1FMCA 3K6JA 4XIYA 3CZRA 2BRUA 3GF4A 2QZ9A 4E5NA 4F3YA 1ADCA 3RSHA 4J7XA 4MIYA 3GGOA 2C59A 2E48A 1P9LA 1CF2O 3PZRA 4I1IA 2OFPA 3DZFA 4M55A 3PZBA 3M1LA 1H5QA 1P1RA 3JQBC 1P1KA 1BG6A 4WLFA 3ZWXA 1U8XX 1BDBA 2Y1FA 2CF5A 3F4BA 4GBJA 4WLUA 2ZIZA 2WEKA 1CETA 5KVCA 1K5HA 4OXYA 3FR7A 2C20A 2V65A 3I5MA 4LN1A 1U28A 4BNLA 3ASVA 3ZWPA 1UDAA 4LK3A 3QRWA 4GKVA 3WGIA 1HDRA 4CMEA 1M6HA 5I7VA 2WYUA 3RD5A 3U49A 1MLDA 4PLZA 2DPGA 4AJ4A 3DAGA 1PGNA 1Q0HA 1WAMA 4JIGA 2WE7A 4JK3A 1P74A 4Q9NA 1DFGA 1CWUA 1NHWA 4CMEC 4ND3A 1LSUA 1P45A 4Y6RA 1B14A 1VPDA 5BQFA 2H6EA 1DHRA 3AI3A 3A1NA 3IIEA 1VI2A 5L4SA 3WSWA 3PJEA 3VKUA 1I2BA 3GEDA 3B1JA 1BDMA 4FGSA 2B5WA 1B15A 1EFLA 1EE2A 3VAZA 4WLEA 2QZZA 4J1NA 1XDWA 3V1TC 1T24A 2YW9A 4CMBA 1CIVA 1HF3A 4E13A 3RI3A 3PK0A 3I6QA 3ZNNA 1BVUA 5FF9A 2ZYAA 1ID1A 3LC2O 1Z82A 3ZHZA 4RZIA 5HM8A 3UCEA 4AJPA 2AQ8A 5ER9A 3PGJA 2FN7A 3QWIA 1NQAO 1RYDA 1P1IA 7MDHA 4R9SA 3A14A 4IQ8A 4UUMA 4CQMA 4OH1A 3H9QA 4RF5A 3GC6A 3GOHA 5KTKA 3EAGA 2OMEA 1ZJZA 1AN9A 1E3JA 2HKIA 5DP1A 3UGKA 1HETA 4BNWA 1EBUA 2I67A 3ULKA 5BR7A 5JS6A 4CQLA 4ZA2A 3PWZA 1P3DA 1W73A 4FN4A 1NFQA 2AE2A 3K92A 4MINA 1PS0A 3PEFA 2PGDA 1BXKA 3KYBA 1ZH8A 5DZSA 4EW6A 3GPDG 3WMWA 3IKVA 2RIRA 3KRTA 1HE2A 1NBOA 3K2BA 4WLNA 2A9FA 1BXGA 4WECA 5FFFA 3WGGA 5CDSA 1E7RA 1PZEA 3FCOA 4D3DA 1GEEA 4YVFA 4H7PA 1N2SA 3ZI0A 1PJTA 3ZW9A 3DAFA 3WYCA 2VOJA 4K9DA 4NHEA 1WVGA 4IS2A 2P91A 1WDKA 4R9RA 4Z0HO 1RM5A 1YXMA 1YL6A 2I6TA 3K5PA 4ALJA 4F45A 2AW5A 5CHEA 4OM8A 3WLEA 3Q11A 4CR8A 3ZZNA 3IP1A 3CMCO 4IQGA 2O3JA 4NFHA 4OXNA 3QVOA 3BTOA 4CM3A 4CLEA 1I0ZA 1H93A 1ZMOA 3SVTA 5JDIA 4BL5A 3UH1A 2Y93A 3QVXA 5AXCA 1ULSA 3DZBA 4IXTA 1O9BA 4PG5A 3DBHA 2O4UX 4FJ0A 3F5QA 3ROKA 3VH2A 4B3HA 4DQUA 4CM7A 1OC4A 5JYEA 1O95A 5JDIC 1GL3A 5JCJD 4TSKA 4JJFA 4UAGA 4DVJA 4MVJP 1G0OA 4R3WA 1I3NA 2HJSA 1JTVA 1R37A 1NP3A 3QV1A 2NVUB 5BT9A 1H94A 1LNQA 4QX6A 3ICCA 1SMKA 4UEKA 1O0SA 2X5OA 2QRLA 1FDWA 1PTJA 4B4OA 3WNVA 5L95A 4MP3A 2ZYDA 1Q7CA 2AG5A 3PYLA 1M67A 3H9UA 4ILKA 1BXGB 2PTGA 5H81A 1PL8A 4WEQA 4GH5A 3NKLA 2C82A 2DBVO 4PZDA 5HRUA 2VZ9A 3M1AA 3WJ7A 4R3NA 3FTNA 3KSUA 4AJLA 5IN5A 3D3WA 3AU9A 4IJKA 5KVQA 1OC2A 2V6MA 3R6DA 3H65A 4BNKA 4YJHB 3S1LA 2FR8A 3OJ0A 1UP6A 4J2OA 3U3XA 4BQPA 4EYEA 3VH3A 3JQDA 4RVUA 1IPEA 4UVGA 4YRAA 2BD0A 4OMUA 1NR1A 3GR6A 1X13A 3AUTA 3WTCA 1J0XO 3AY7A 2VUUA 4J4BA 5KVVA 2YDXA 4U0KA 4TZTA 2Q4EA 5FYDA 2QIOA 1K6XA 4GLOA 4Y67A 4E5YA 3DHNA 4RPGA 1LDEA 5EQDA 4BNIA 4E0BA 1RM4A 3AUUA 3TZ6A 2PZLA 4JN6B 3FR8A 1PGQA 4ZICA 5LDHA 4NBTA 2OUIA 1UJMA 1I2ZA 2PGLA 3U4CA 3NV9A 1XQ6A 3CSDA 4CUJA 4E21A 2FR0A 5ENDA 1NX6A 4MO2A 1VJ0A 5IG2A 2BFMA 4B8ZA 2PH5A 3DBLA 3GRKA 5C7LO 5EMHA 4O63O 2NSDA 5G0VA 4Z3DA 4GVLA 3Q3CA 5A9SA 2VT3A 1R0KA 3CIFA 1M75A 1ZNQO 4FFRA 2UYYA 4NQZA 2DPHA 3H4VA 4FS3A 3WGTA 4D3SA 3WYBA 1AHIA 1LXCA 5TJHA 3WQRA 4WKGA 4AJEA 4K26A 5KIAA 5EESA 3IDSA 4M49A 3BA1A 1FDSA 5IN4A 3ROMA 3D3WB 2HMSA 2B0JA 5B12A 3RASA 2LDBA 1GYPA 3F4LA 4I9NA 1ZO8A 1H6AA 1IUKA 3S2IA 4CMAA 1E3SA 2Z1MA 1M2WA 1OMOA 4IDDA 1VRWA 4XR4A 1I32A 4BNNA 5G0UA 2YV1A 4BNHA 2IXBA 1PR9A 1QP8A 4OQZA 1IYZA 5MDHA 2C5EA 3KLMX 2O3UA 5F5LA 2HMUA 4Q3DA 2X5KO 4DGSA 3TOXA 2E6UX 1N7HA 4L8VA 3TZHA 1HEUA 4E5MA 1QXSA 5B4VA 4IM7A 5GZ3A 2OZPA 3ENKA 4KUHA 1MC4A 5HS6A 1LSJA 2CD9A 4RV9A 3A06A 5KCZA 2AEMA 4IDFA 2BKAA
chains in the Genus database with same CATH superfamily
3V1LA 1ND5A 2FW6A 2GYWA 2GESA 1XZGA 1WF6A 1ZK0A 2WFZA 2DVMA 2ZRLA 3DXZA 3FJ1A 1KDYA 2IEAA 2M98A 4S0ZA 3G0DA 4NYIQ 3HFRA 1I30A 3N7UA 3TM5A 2GJSA 1JLSA 2ZE6A 1AF7A 4JWKA 4X6UA 4ZJPA 4ZFNA 1KAOA 2W98A 3L7MA 1D9XA 3PQ5A 4YONB 4IILA 3ZHXA 4D98A 1YASA 1TQHA 3FUXA 3K0BA 4QQRA 1M2JA 2IEDA 1DAMA 2RGNC 3FNEA 4I5IA 3QKTA 2EBUA 3HTXA 2BUCA 2FWPA 2QROA 3KXKA 4PYIA 5BRNA 1ZKMA 1ZNXA 2YWHA 2H7YA 3KTDA 1NRIA 3HUEA 3GLIB 3ZN2A 1BQ4A 5JOQA 1GNQA 1KK0A 1V7QA 3U1TA 2GA8A 2HSJA 1YS6A 3IVRA 5IVDA 4C21A 3GHYA 3I04A 2AEEA 2IZ6A 2I3GA 2QVLA 4NCHA 4PPGA 1V71A 3RYIB 2CVQA 3ENWA 1FNMA 4TTTS 5TNXA 2GJ8A 1OY1A 2GKGA 4C9BA 1QYVA 1X8KA 3FWNA 3Q7PA 2HR1A 3G9QA 1JHAA 1T15A 4QO7A 3EGVA 3COPA 4WCVA 5EKXA 2QU7A 3O3OB 3IE2A 1D0VA 1LFAA 2JLAA 4BLTA 3VI3B 2C97A 4XE5A 3EW9A 3E23A 3S55A 3BFVA 3TFWA 3ZHYA 4AZ3A 5JS1A 2PJDA 4NMLA 3P0FA 3ZJTA 1SUEA 2EKBA 3OEYA 821PA 2VQ3A 2NYVA 1KIAA 2FDCA 5JVDA 4JJ8A 3OFVA 1BKYA 3X1WA 4YBZA 2GRJA 3DA8A 2JZOA 1AQ6A 1UBJS 1UXHA 1DBPA 4R6WA 1MQ9A 5G1OA 1GV1A 4EYOA 1DAOA 1BCSA 4CMJA 2SCUA 3T9CA 4NPHA 4JHLA 3TN7A 2GD6A 2Y68A 1N8KA 3A26A 4IOJA 4Q3AA 4B82A 1U7ZA 3KDAA 1WE2A 5FLXA 2X13A 4IV5A 2O5VA 1QOQB 3MJ4A 4DMRA 1PSZA 2ZYGA 2ZB7A 3G9ZA 1W1UA 3EXEB 4AJHA 2IIPA 1LKZA 4E30A 4UNRA 4AQYB 1M6VA 1AT1A 2YXLA 3BFJA 1JSLA 4NE2A 1ONNA 3RBXA 5I5EA 2JD1A 4OHYA 3PPIA 1X1BA 2C7VA 2F1RA 1MA0A 3OMXA 1SQ0A 2FZ4A 3TB6A 4MWBA 3K5HA 1OKKA 4CL0A 5L45A 3OE5A 2CNLA 1ZEJA 3C3JA 4EFKA 3X43A 4IV8A 1FX1A 1YWGO 2JGEA 3AFGA 3KVRA 3P0EA 3GMIA 1L7EA 1QBGA 4BXOA 1GZVA 1PD0A 1V3TA 3JZFA 2D4HA 1GAWA 2R2AA 3FIJA 4NOKA 4NNJA 3IHTA 3ZCXA 2V6FA 1UJ4A 4JVOA 1SWWA 1VKOA 3OJCA 1MO4A 3OO1A 3AP3A 4LWQA 3CG4A 2MIIA 2VRNA 4M0EA 2OBYA 1P1CA 3FOCA 3TOZA 2O6HA 4CMIA 4NBLA 4LY3A 1U7PA 3JQ8A 5BSTA 4KDRA 1H4TA 1CUFA 1R15A 4L0CA 1SXIA 4O1IA 5C9ZA 2Y1GA 4DB2A 3WV5A 3FYTA 3ONDA 1HEYA 4I81A 3LBFA 5FR1A 4Q19A 5FL7D 1RI2A 4E4YA 5AVQA 2WHEA 1QVAA 3NJRA 5DNDA 5B64A 1C9YA 2ZAIA 3RUAA 5D1NA 2O48X 1ZM3A 3ZQKA 1V11A 2BHLA 2P68A 4KCGA 5JVDB 1HFEL 1KZ7B 2V7PA 1M7GA 4UD2A 3H2BA 2JIPA 2HO4A 5J59A 5T8KA 3CT4A 1OBCA 3SBOA 1BCSB 1ENYA 4XUDA 1KYIA 2SCUB 2P3QA 5IJAA 2QMUA 2X40A 3QUQA 4Y8VA 4YJ2F 3JXEA 1SG9A 3V48A 2L19A 3E9YA 4DZRA 1YL5A 1ZGBA 4IGAA 4EHFA 3TLXA 3NATA 3WBBA 1G21B 1R8YA 1TU4A 1GAEO 5CVUA 4ZDWA 2H00A 1FDTA 3ZDBA 2ID9A 1M72A 5KUTA 1NW9B 2D1YA 4YJ2A 3QK7A 2BEUA 2IU3A 2F59A 4O8CA 4BQQA 1Q16A 4OJQA 1ZONA 2DAPA 2RGXA 1YGPA 3GJ8A 1HMYA 1PF7E 3PWSA 3S99A 3UWMA 5LQKA 4JUCA 1DOZA 4WFKA 1E3DA 1LS6A 3NT4A 2GZDA 1JHXA 3F3YA 1O9GA 3CKLA 3I01A 3QP9A 4WKBA 3B52X 2UV8A 4LBYA 3LWDA 2FPMA 4MV0A 5JROA 2FX5A 3HJGA 3DT6A 4HK4A 3UMBA 4BXOB 1N6OA 3EAQA 4H77A 3WKEA 4Q18A 3UTCA 1S8OA 3RVMA 3C70A 3DNFA 4O2RA 1JYSA 2YOHA 3KZKA 1KXJA 3ELDA 5EKTA 4P7BA 3RQIA 1M76A 2EQAA 2UYOA 2C4NA 2WWRA 4HXYA 3RU7A 3WGHA 4YMWA 5TQVA 2E37A 4O4HB 2XUHA 4QM7A 3EXIA 4F4CA 2MCFA 2ARKA 1RYFA 1E2LA 1EVIA 1P2VA 2R5NA 2ZXEA 1V7CA 1F7UA 1Y81A 2GI4A 2HAEA 1YZKA 3D6AA 3RPEA 2A9RA 2KYRA 1LQ2A 2WJGA 2AYYA 2Z3VA 4WBSA 1ULBA 3KEMA 4QUIA 4ZC1A 3BSYA 5AKIA 5B7NA 1T3ZA 5TARA 4QATA 1SC9A 4XKJA 2A5GA 2QM8A 2PRYA 3EK2A 5J5AA 1N57A 4II2A 1MOZA 3SYLA 1Q7GA 5F52A 3MBKA 4R2WA 2D6FA 2EL9A 2COKA 3H5VA 1QV6A 1VSVA 2WILA 4AMVA 1V11B 3E8MA 4IOLA 3M8KA 3OZCA 3O0TA 4LSMA 3ZH2A 4B4VA 4PGMA 3PUVA 3JWPA 5C8YA 4NX2A 5DO9A 2PXHA 3UYKA 5PGMA 1IUNA 4C0SA 4BEBA 5HZHA 3TB4A 4XVQA 1T9KA 4TS3A 1V95A 4EF5A 1A9TA 1UFQA 2PSEA 3BVPA 1Z2PX 3DMTA 2QTNA 3JS5A 4FUTA 4IXMA 4QAQA 3UC9A 4EBFA 4XIJA 2GPWA 1PWZA 5EINA 3E5HA 4DNXA 1V47A 1VG9B 3BICA 5FOVA 4EB3A 1R12A 5EAIA 1KO5A 1U11A 3DOCA 2GF0A 3VX4A 4BJ1A 2BF7A 4F9GA 2UZ4A 1JFSA 1O94C 3ND5A 2HT6A 2PGJA 3LHIA 4KBGA 4LBVA 4IKOA 5HIAA 2PS9A 2ZJOA 1RKQA 4RXMA 2WV7A 4R8MA 2KW5A 2QM3A 3NIDB 4MJ7A 3W8RA 2GEBA 2QE6A 4QOHA 1VRCA 3MT0A 5ISMA 1QO0D 2GNPA 3R4VA 2BGMA 3SYRA 2RB4A 2G82A 3SZMA 3CH6A 4KLNA 4PQYA 3DT9A 2PQMA 1GTZA 1PQWA 3LGSA 4O29A 4G0YA 4PR0A 3D3NA 1EGAA 4GMKA 4DLBA 3FVRA 3BHMA 3R5HA 1W0KD 4U2BA 2ZPTX 2R9VA 3KR9A 3EXIB 3LH5A 4M8IA 3S6JA 4F56A 2X7XA 5C1DA 4ARUA 1KRHA 3CLHA 3QVMA 4LDQA 5ELMA 2J3JA 3QW2A 2J9YB 5CLGA 5FH9A 4HH0A 5BORA 1V5GA 1ZXLA 4ZVMA 3IKJA 3CVWA 1ZW1A 3QMPA 1JQJC 1KO7A 4LVNA 2PU5A 2PMWB 2RBKA 1NXXA 4V24A 2FSUA 3SP1A 3W90A 3E7DA 3WMGA 5AW0A 1BN7A 3MGGA 5GVSA 3VZCA 5I3ZA 3ZWOA 5ALLA 2IUTA 3ZWAA 3UANA 1EEHA 1PYGA 3H2HA 3E03A 1Y8RA 4NBUA 5E9QA 5H9VA 4AJ9A 2G0TA 1RCFA 4M9SA 3R7AA 4AX4A 4UHEA 4FNAA 2YVUA 3IPAA 3SN6A 1BH6A 5F12A 5FLYA 1NBME 1NN1A 1K7XB 2EEZA 5F78A 4ZCPA 4LDZA 4OHFA 5E7IA 3CVUA 2WPDA 2D1SA 3BMNA 4OY3A 3ED1A 3TMKA 5KDDA 1OPRA 2C9BA 3P27A 1Y5NA 2CV2A 3A3PA 1V8PA 1K98A 3OHSX 1AMNA 1YK0A 4PFSA 5A0FA 3WWPA 3LBYA 1UOEA 1U0JA 2V54A 5DW3A 1NYQA 2VAPA 3BB4A 3WQHA 4M76B 4A4DA 1VBNA 2VOEA 3FOFC 5H8WA 1XTUA 4PVDA 4DG5A 3WRXC 3PNSA 1A7UA 4NZOA 3ESAA 1KGSA 4HGNA 2XCTB 1I7PA 1BOFA 5LUBA 2X58A 1EHYA 3DDCA 4FFPA 1J25A 4KPGA 3ECSA 4HNSA 2PJZA 3A6LA 3C7DB 4PCAA 3ED5A 5CYFA 5DLEA 1HT1E 3N2GA 1W2HA 2C2BA 2X1HA 2PZMA 1GZ7A 3UB2A 2JAUA 3RG8A 1NTOA 2QTVA 4FSDA 1U6JA 3ETHA 2W43A 1VPTA 4RZ3A 4BNYA 5FUVA 3PEWA 4RU1A 4EHIA 4ZVNA 3T3NA 1KY3A 1RI3A 4JJAA 1QONA 2FMFA 2ZRJA 4FLFA 4YRDA 3K6SB 1VIMA 3OFJA 3LKVA 3CBQA 1WM1A 4FT2A 4L28A 5TT0A 3PDJA 4PIPA 5K4GA 3M6AA 1YB7A 2IOFA 2VSFA 4RGBA 4Z54A 3RC8A 2IFTA 4DR6B 1TA9A 3K1TA 3ENVA 3DT8A 4YRTA 4XCXA 4MGHA 3X1XA 2ZJ1A 5A4AA 5K45A 1FZTA 1ACMA 3KZNA 3W5JA 1D07A 4L8FA 4R83A 4MW7A 4B71A 4X20A 1UBUS 4A92A 4U6QA 1FZQA 2IY9A 4LOKA 1RR6A 1TVEA 3CLTC 5EIBD 2XMRA 2GD2A 4ALMA 4TPKA 3FGPA 4DEVA 3U5TA 1LU9A 1W0JA 4PY2A 3R0QA 4R98A 5LU8A 1NDHA 2EQBA 4WFQA 2Y1XA 1O0BA 1KKUA 1NVFA 3FVVA 5K3FA 4EFMA 5GIOE 2ID8A 2IKQA 4PWZA 2AN9A 4NFSA 3D4OA 5BQXA 1S2NA 4BQFA 1UIMA 4DFDA 3IP8A 2E4WA 4UBLA 1IIRA 1BWQA 3JYQA 1NUHA 2GJ4A 4F2WA 1T4BA 4URUR 3B3FA 2GCOA 3OT1A 5HEKA 4EG8A 4P4GA 1ZA2A 3EPHA 1ONOA 2FFJA 2KWIA 2O2JA 4U2DA 1RPNA 4C1BA 1QCZA 2P90A 3GFOA 3RUFA 1N2HA 1W94A 1L9XA 1XU4A 2V3WA 3ITDA 4X94A 5EIFA 3V2HA 3O03A 3HQ4O 1KJ9A 1SBHA 4V0OA 2FPKA 1B23P 1Z4LA 3FB1A 1Z17A 3AR6A 4PXSA 5IM5A 3JVDA 1A9SA 4UCFA 4BVAA 1RXVA 1A0OA 1PT5A 4CTMA 3AHHA 3STUA 2JAHA 4I19A 2Z09A 1QGDA 2XT9A 4LX8A 3IVGA 3NDJA 4OU4A 4EX7A 5KOHB 3AHJA 4J90A 1LBHA 4WRRA 1E7SA 3HA7A 4QUHA 4N5DA 4CNBA 2QTVB 1H85A 1ZJ4A 2PUVA 3OJOA 1L5RA 3IEPA 1A98A 3E9NA 1R5JA 4OM7A 1MT3A 4MVXA 1QFJA 5HP4A 1NVKA 3O4VA 5FKJA 3T9EA 1E9AA 3LQKA 1GZ6A 5AK3A 1E3EA 4U7JA 1C7IA 2O3QA 3OM8A 3TQQA 1NPDA 4GSKA 4K9OA 1CT9A 1IHPA 4IZOA 2W2LD 2A59A 4MZXA 4P6VF 4MPPA 3ZHCA 3ZLTA 1FQJA 5K99A 3EQ6A 3Q87B 2P9EA 1SBIA 4FK8A 2FGKA 1MORA 1GKYA 2PS3A 3BH0A 3M7IA 3OHMA 1IN8A 1RABA 4M1ZA 5EL0A 1U65A 1T36A 1SBTA 1X86B 5F1PA 3FI9A 1UEXC 1SVIA 1G42A 4UREA 2XZLA 3D7NA 1MGOA 2A4MA 3RK4A 3O73A 3ICWA 5LJLA 3EXHB 2QB5A 1VLHA 3GJ7A 2AJBA 2GM9A 5EP4A 3L9WA 2IS6A 4QG7A 2AJDA 1DJOA 1Z4JA 1EDBA 4JSRA 3VNUA 3MGCA 3LZCA 2PD3A 3EZXA 2UZ1A 1F60A 2RI0A 1GA1A 2NZXA 3GJYA 1KF0A 3G82C 4UQPA 4A73A 3QBTA 5AW8A 3MRVA 2GCOB 3HUTA 3NHJA 1OBVA 3OT1B 4MJXA 3EIXA 5A4DA 2J5RA 4KQEA 2OXTA 1R88A 4HB0A 3BXEA 4MUYA 3EBOA 4DC0A 3BMQA 2R8BA 4N7JA 3IDQA 3CRQA 4G86A 3AEKA 3B6KA 4D4KA 4G5XA 4Q05A 1DXYA 2WG1A 4MZDA 4Z4GA 3EQ2A 5SZJA 2PUGA 3E7FA 4JITA 1Q7EA 4ZEMA 3VOTA 1E2UA 5LR6A 1SZCA 2QT9A 2NVWA 5CH3A 2RH4A 3DP7A 5KDLA 1YUNA 1G5TA 1XTQA 2GD1O 1OIXA 1WCV1 2DKNA 2W2KA 4QUDA 5E3IA 3F49S 2EBFX 3MTQA 3R7WA 4L0MA 1QV7A 5A0TA 1SXJE 2ZK7A 3BKWA 3VQTA 5TMPA 1I5EA 2W6JA 4KXLA 1D5CA 3HGQA 5IVIA 2QRZA 3UB3A 1G4AE 1JZSA 4F06A 4YCLA 1K7YA 1QE3A 5IF9A 1A95A 5CNKA 2DBRA 4J6FA 3I9V6 4HRYA 4EAQA 2WT4A 4B7AA 4J75A 2CK3A 4FHGA 3L7AA 3PXCX 2FLWA 2ZSDA 2W0SA 3MNFA 4KYTA 4MRNA 3LYLA 3LTEA 5KX5F 3FSJX 3FKQA 5EUCA 1ZU5A 3D3EA 3MJSA 4UTXA 1DKQA 1I36A 2C4KA 1LJUA 4DSTA 5BRAA 1P91A 5B5SA 4FC7A 4AT1A 4AP5A 1O03A 2V8BA 1GGFA 1P0IA 1T36B 3FHLA 3G2OA 3HC7A 2XDWA 3PPYA 3LS2A 4GDMA 1OI3A 3IR5A 1FFBA 3F74A 4UVDA 4WCFC 4EO9A 5JMTA 3DMPA 1JBEA 1KY5A 2VWHA 5FD8A 3L2OB 2JPDA 2ZZKA 3Q3GE 4BO2A 4PS0A 4M1QA 4N82A 1W4CA 3CTMA 1G66A 1G0NA 3BWXA 2V9PA 3E1GA 3BGOS 2W8BA 3K96A 7ADHA 1AO3A 1ZD2P 3QQ5A 5IC5A 2JL1A 1QGED 5K8VA 1ULZA 4BUZA 1W5EA 2UZ1B 3U2QA 4S1VA 4MLZA 1SY7A 2WJWA 4FYIA 4CMHA 5LZ7A 2NIPA 2DRIA 5L51A 4Z1MA 1L8AA 2HPAA 4DJJA 2OXRA 2UDPA 2YMPA 4BNZA 1VHQA 2OGSA 3CUEF 1GCOA 4YPFA 3ZGZA 1RYHA 1JIQA 2XMCA 3HBMA 5DYGA 3ZQJA 1C14A 3IKTA 1RBMA 4R0VA 3IV6A 1IBKB 3H9GA 3VKHA 2VNAA 2FSFA 3R6TA 3P2OA 4GC5A 2FH5B 2WFAA 3SJBA 5I48A 3OUUA 1RE1A 3G2MA 4QDKA 4FYXA 4K6CA 2W2KB 5TT1A 3N3AC 1RNLA 3GLHA 4NYMQ 3R7WB 2OCPA 2KBFA 2DFDA 2JF0A 3L4EA 4E46A 4UHHA 3AZOA 4R7GA 1T4MA 4CLRA 4LF5B 2SBTA 3P9QA 1LRJA 4FNGA 2JLYA 1WW8A 2H4WA 3ETGA 3A1SA 2H1VA 3E82A 1YRWA 3KJGA 1MG0A 2OSVA 1IBSA 3BRWA 3FUTA 4JC5A 4C4YA 1YDMA 3DZ8A 4EB8A 4J94A 2V1XA 3DDNA 1OTHA 3U9TA 1QQ5A 2A9OA 2F1OA 3QSYA 2EIXA 1Z62A 2WWVD 3WWOA 4NPCA 1O5TA 4RLSA 5G3ZA 5C8YB 4QU9A 3NFYA 4OGGA 3VHXA 4C7VA 5HKKA 4AJ1A 4PC1A 4DLPA 1KJQA 2V4UA 4LMPA 3FRHA 3K4HA 4TXLA 3E22A 5K03A 2YIDA 5KPDA 1YDGA 4F2PA 2W8BB 1FS5A 3HB9A 2O2HA 4KXQA 1IBLB 1C9JA 2FR8C 4YJ3F 5ADUS 3DBHB 3DMFA 1XZKA 4NZPA 5CPFA 2R85A 4NV3A 4E07A 1QPBA 3Q6IA 3K0KA 2D5AA 3GJTA 3MXOA 4FD2A 1YD7A 1PR2A 4MCJA 4ZV7A 2PGOA 4ENVA 4MLCA 3D6JA 4YJ3A 1M1NB 4WK4B 4QPZA 2VF7A 2DUUA 2YXDA 5HA5A 4QIHA 2HZ7A 3A28A 3OUZA 2HRRA 1ZH2A 1OFTA 2XT6A 3JAWA 4P22A 1B74A 3IALA 1SXHA 4KGDA 4ZQFA 3SR0A 2C57A 4XPIA 2V7WA 3SS8A 1T0BA 5CFNA 4K9KA 4ROSA 3L7LA 1VE3A 1M8GA 1JHUA 3D7SA 1FCJA 5D5QA 2BELA 5DGCA 3KSMA 1DINA 1O6CA 3FMVA 1J00A 3GLHB 2O5CA 5DHRA 1QHHA 3T52A 5DNVA 2HGSA 3BILA 3EZYA 4O5OA 4DUGD 3DAPA 4LYGA 4CLRB 1AA6A 1XA0A 1ZQ1A 5ALGA 3R3VA 1A27A 1ODCA 1TUGA 2YZKA 2VJYA 3EZNA 1CDDA 4BNVA 4EVRA 1Q3HA 5J4YA 1YDFA 3AXSA 3VNBA 2WKRA 3Q7EA 2X1VA 3C5VA 3PFKA 4FFSA 4DLNA 1RWQA 3G9UA 2QY9A 3Q7IA 4QWMA 3ZE6A 2FEAA 1AJEA 1GGNA 1TF2A 1L5OA 4Y0VA 2FQ1A 1NONA 2OGTA 4JUAA 2WF6A 5A06A 2DXIA 3WDLA 1H2HA 1LA2A 4U02A 1CY2A 5SY6A 4PZ9A 2AX3A 1QG6A 1PG0A 2RMKA 3IAAA 1PYDA 4ZRDA 3UC5A 2KI5A 3NETA 2IY7A 1ZVKA 4IDQA 3ZW8A 4FX2A 5LQRA 1CUAA 1Q1QA 3D8TA 3DLTA 2BC9A 3GNTA 4RD1A 2XV1A 2XYPA 1IM8A 4I1RA 4MKXA 4RZHA 2RIPA 4TN1A 2O57A 3OFSA 5CT8A 3NEYA 2OCGA 4C7JA 5KQRA 2VWPA 4X66B 3JQCA 1TO1E 3E22B 4F4JA 2ZQYA 1JQ3A 4DSAA 4YI3A 3OPNA 4P86A 3HXTA 4QM6A 3PNKA 4EUFA 4R7TA 4NMHA 3HU1A 1QQBA 3K9CA 1XZLA 2R8XA 2EWVA 2W6OA 3AONB 2PGIA 3CLUD 3LDHA 2Q6VA 3B6ZA 3LU1A 4GHWA 4M99A 4OEHA 3NVKI 1A72A 1W6UA 2X4LA 3RHFA 1YA4A 3K70C 2H18A 4JYCA 4BWYA 1OBFO 3A1WA 4YJGA 3F5DA 1Y5IA 1DAIA 1GCAA 2IHTA 3MWDB 3DWFA 3AR3A 4YFVA 5JNTA 3JAWB 3HNPA 2GAAA 2VF8A 5ALZA 4XPIB 3F97A 3UAGA 2C2HA 2RAFA 3Q41A 3TI9A 3RVRA 1X3SA 3LP6A 3GFTA 2H7XA 1WP4A 2OD2A 3DTTA 4MW1A 1NC3A 3GRRA 3TUIC 2ZI6A 5BPFA 1QHHB 1EZ1A 3QEJA 3RRMA 1W29A 2B0CA 1T8RA 4CCAA 5KREA 1HZZA 1RFLA 4P82A 3WGMA 4OQQA 2PCLA 4JBYA 3DXXA 3H3FA 4Y98A 3R5TA 5DBGA 4Y30A 1T0UA 4NBKA 4JFAA 4D8UA 3ABOB 5IWAB 4H3VA 1TZKA 1U9JA 2BWJA 4CL3A 4ALIA 3N2YA 3WGIA 3DF9A 1XEWX 1PBNA 3KE8A 2PJUA 3P2YA 1FEZA 4DABA 3TW4A 1SCIA 2O2XA 2PLAA 1U90A 3NAMA 1T0JB 4LVCA 1Y4ZA 1W7AA 3RABA 3UOWA 1QFYA 2VYVA 2W0MA 3ILYA 3MS2A 1ODLA 1XZMA 5CXSA 5G0WA 4DIEA 2AOWA 9GPBA 3DTVA 5BO5A 1F7VA 1GUFA 3LT1A 4A10A 4EB6B 1K89A 2JGKA 4HTFA 2A1TR 5A6SB 2ZJAA 4D0LB 5K9ZA 2VRCA 5JTUA 1GUZA 4HYEA 5FTMA 4MPDA 3WLSA 1JEYB 3SMVA 4COKA 2A6PA 4PS1A 3GGDA 2NZUG 4QREA 2AKAB 1IM5A 4L51A 3GAMA 4D44A 1SM4A 1WULS 1Z4KA 2JIQA 3DR3A 2YVKA 3HCFA 4Z9XA 3QU7A 3TG2A 3UPUA 2DB3A 2NO1A 2CFSA 4B83A 3O75A 4NK4A 4ZIRA 1LX7A 1ZOSA 4R1OA 4I4TA 4MO9A 2OPHA 1C1HA 2P5SA 3WR5A 3SHVA 5BMVA 4F46A 3CG0A 2GK4A 4QXPA 2R6ZA 1GUAA 4YK7A 1L1QA 1GGHA 3C6YA 3DQPA 4YJGB 3GRUA 2EXXA 2WE8A 1LLCA 5BSEA 1ADGA 1DIGA 1RTTA 1H2BA 1OIWA 4B3TB 3VYWA 5GAJA 1SUWA 3NUGA 5H3LA 3U80A 4C7OA 2JARA 5TC4A 5PNTA 3UHOA 5BN1A 1F2UA 4D1YA 2XXJA 1N75A 3GBPA 4DUPA 1YVPA 2DT8A 1Z45A 2AEJA 1XZBA 2GVNA 3I5YA 2ETXA 2O8CB 4J0FA 3LQRA 2IWHA 1G2QA 3E2MA 4L5IA 1TLLA 3H1BA 2VDOB 3TL3A 3HCBA 2Q2VA 4ERNA 3EZGA 4MICA 2FUG6 4S1WA 4C78A 3WG9A 1EE1A 2M6LA 3PRYA 4KQ6A 3EEYA 4Z5XA 1E9RA 3IIKA 1ODTC 4HDAA 4OXKA 3LX8A 1VJRA 3SM3A 3R75A 5K2OA 4GVXA 4LTMA 3ZIDA 1CZHA 4JJGA 3ZWNA 1P29A 1QK4A 3ETJA 4DA7A 2IA5A 5AJVB 4YXWA 3U4GA 3JQFA 1W5TA 2D7JA 1IN7A 1JFLA 1E5DA 3NGLA 4YCAA 2CLIB 3TTVA 4ZZ0A 3FYUC 1Z0SA 3CNQS 3L02A 3DTVB 3KT0A 1TK3A 3QG1A 5CW1A 4Y9DA 4ZCQA 2O5EA 1L5QA 1ZSYA 3GLIE 4HTFB 3AL3A 1XHEA 2G09A 1IDOA 2X41A 5HCIA 1JQAA 2GLXA 3KALA 5GONA 1Y9AA 3U4IA 3LP8A 1HDCA 2V6IA 3I73A 2ZTLA 2PWYA 2XI4A 3LCMA 1MJGM 5FO0A 2Q1TA 1PR1A 3I9V1 5EJGA 4E08A 1JWLA 4JL5A 1PR4A 4LFBB 121PA 1SC3A 1XZEA 4MI9A 4P7FA 2VSXA 3CUWA 3PXAA 1QB8A 4MUXA 1CQXA 4I4TB 3TD6A 4XJTA 3H11A 5BMVB 4ZI3A 2BFAA 3PNOA 4MDEA 1SZDA 4NABA 2XOXA 3IEUA 1ZS9A 5HK9A 2XBMA 2F90A 3A32A 1MPXA 1BA2A 1DKMA 1TECE 3PNBA 3WGKA 3D8SA 4BLUA 1X6VA 1ZZEA 3AEXA 2WDPA 4I8XA 1CU1A 4XGKA 1CY6A 1KI6A 1Y3IA 2Z56A 4C7OB 4HP8A 4LJ4A 3K0EA 3HJAA 3HH8A 3DSRA 3TZEA 2YXNA 4ZC8A 5FJJA 5T57A 4KQJA 2QAGB 5IANA 3GQVA 4JAVC 4HQNA 1XUOA 5DLDA 1H4VB 1LJ8A 5JD6A 2M6SA 5BMOA 1KU6A 4KH0A 1AXEA 3GLTA 1HK7A 2GNOA 5L7YA 3VR5A 3V5NA 1LBSA 2V7UA 1JR3A 2HA6A 4TRJA 5CDYA 1AC5A 3PUXA 3JTEA 3P97A 2A9PA 2ONCA 4W7IA 2NO0A 4IF4A 3DL4A 1WDMA 4H6VA 4ASUD 4KQ1A 2HJVA 5AOAA 1EINA 4ESEA 1FFEA 3PX3A 1BQEA 3NB0A 2FZCA 4FNMA 4JKYA 5E8JA 3TJRA 1T0HB 3ETLA 3LZ6A 4N65A 4EI9A 1NW7A 2QG6A 5CB8A 9LDTA 1FFSA 1DI0A 1UCFA 3C3WA 3M5CA 4Y1FA 4PHGA 3LCUA 1DTSA 1L4YA 1UMBA 1JEJA 1H66A 5DISB 1FA9A 1EJBA 4HX2A 5GONB 1QHYA 3W9YA 2MINA 3IV9A 1WUJS 2VUSA 5AJHA 4RD2A 5B4UA 2J59A 4GBMA 1W5SA 3SE7A 2PSSA 4OOEA 4C4AA 1IAQA 1RAAA 2QVBA 2P6UA 1GTG1 2O50A 4OSOA 1DU4A 2GZ3A 2UUAB 2CZQA 1H2AS 3JVEA 2GGSA 3V4LA 1UBTS 3ZG6A 3AR5A 2ZJ7A 1O2DA 2EZ4A 1R0SA 1OSNA 1CUEA 1U4NA 2WAYA 3FZYA 4NIMA 1SA0A 3ZWYA 1GR0A 1QTIA 3G2PA 3NAQA 5IDQA 1LLDA 4N0EA 1M0TA 1RLJA 3VNAA 5KVAA 5IVKA 1BRMA 1S7CA 3MGAA 2JFGA 2EFHB 2QBYA 5LZ9A 5K0SA 5CUQA 5H1YA 1II0A 5JZSA 4C2BA 4GOMD 5KZMB 3WRVA 1APBA 4MPTA 3IEVA 4LZAA 3GLKA 2QYSA 1MF7A 3G0GA 4MV3A 3LHFA 3TIGA 2A0KA 4IDNA 4MP6A 3ONWA 1G21E 4HDKA 4Q02A 3ELBA 3WL6A 1KPGA 1OWOA 2WA1A 3H5RA 2V5AA 3UB4A 3VPBA 2Q2OA 5TEVA 4A2CA 1KP9A 1VPVA 1E1CA 1FNSA 1UBOS 3LK7A 4W9NC 5EIXA 5DT9A 3HLTA 5KTPA 1RYBA 2CN1A 4E1BA 1QB7A 1W44A 5B30A 2HMVA 4YJFB 4GU5A 4US2R 1N2GA 2J6HA 2KLBA 2J33A 4FR0A 1ZN8A 5LWQA 1JDJA 1H5NA 3GEGA 4P81A 3WK9A 3QXCA 2XDYA 3I4LA 4NZ9A 4YP1A 4CG3A 1ES9A 4OJYA 3KZ1E 4UXIA 3FHOA 2OVFA 4EJFA 3QPAA 4OAOA 1PIWA 1DAPA 1M7BA 1C1XA 3OPQA 2C5BA 1XVAA 2F67A 1OLXB 2W22A 2FRXA 4QTUB 4UTPA 1I4WA 4BMYA 5HBRA 1T0PA 3T5AA 2ZS8A 4EIWA 2RHCA 1DKOA 4INZA 1GQQA 5B1YA 7REQA 3GP5A 4MAAA 5DBFA 3RNLA 4CTNA 2UYQA 2MINB 4KBFA 5I4KA 5CG1A 1ZD9A 1WZNA 3RSOA 1DE0A 4TSRA 3B1XA 5B53A 3SBXA 3TFOA 2NGRA 4UZEA 2EHJA 3K8QA 5IUKC 2SECE 2H3EA 2QVXX 3ZVKA 4W1QA 2NQ8A 1N6NA 1GPAA 4GSLA 5GM1A 4BZQA 1EFUA 1MQ8B 3BC1A 1R6AA 1UUFA 3L0DA 3GAZA 2ZBDA 2HQRA 2PX5A 1H65A 4KXMA 1QRSA 4KLCA 4TYWA 1Z6PA 2JIZD 5JSZA 2OBBA 1C7FA 5EQFA 1P7YA 4N6NA 3UK7A 3NEAA 3I1JA 4TZKA 2O2DA 1AKYA 1D04A 1RBZA 3VOBA 3QI2A 4G1UC 2PQ6A 3WKBA 3ZDQA 1NNUA 4FEEA 4CYMA 3M89A 1L1RA 1TJ3A 2MTBA 3AWDA 3CMMA 1XRQA 3ON5A 4G26A 1SCNE 2B35A 4MQBA 3BIOA 1T6BY 1TXGA 4KXXA 1NBHA 4LY0A 1MFPA 4UHCA 3LUKA 4GNRA 4HDKB 4W5RA 4KNYA 4G5RA 4QJ5A 1GN9A 4IZ6A 2BCEA 1ZFNA 2OM6A 4R7ZA 4TQ9A 4DY6A 2R44A 2WNHA 1YOBA 2HSEA 4FGKA 2FX2A 1E1CB 2VZ8A 1E2JA 2PMFA 1F38A 2NZ2A 1MHTA 3B70A 1T8PA 4ZQHA 2X0KA 4GLLA 2GYYA 5C52B 1V5IA 3IMFA 3K0SA 2FEMA 2ZBRA 4BEWA 1YOVA 3O3MB 3TSCA 2OCXA 5I7SA 4PZUA 3B1FA 3QOFA 4JD5A 4UNIA 2J07A 2XECA 1T8UA 5KYUA 4GRDA 1KC3A 2WSSA 1L1FA 2RGWA 2Q9BA 2YBDA 1FYWA 1C1XB 2DR0A 3LHDA 1V5FA 2C2OA 4RMHA 3KDSE 3I42A 3R3UA 4L0DA 4RIIA 2HWUA 4B09A 2ZIAA 3NYQA 1LUAA 3VSDA 4XIFA 3BWYA 1X1DA 1XZHA 2ZSAA 3IJEB 3QFFA 4L5JA 2QLBA 1EU1A 3IPXA 2I8LA 1Z28A 1MDFA 2OWEA 3P2JA 4F72A 4FW9A 4GPEA 1GA6A 5A9RA 4ESVA 2R8ZA 3VHQA 3H2JA 3OWXA 1PFVA 1Y9DA 2PMCA 2I2BA 1PLKA 4PQGA 5E7MA 3PX7A 3L92A 3VO1A 5E3HA 1NMEA 2G1KA 2QX7A 2X2FA 1PUIA 1NE7A 2CBZA 5EJAA 3HP7A 4BNDB 1PFGA 4XFKA 4R8KA 4X63A 1I5OA 1LDNA 1P7WA 4DBZA 3W5AA 4RS4A 2XTAA 1GPYA 1YJXA 2EP5A 1Z22A 2OAEA 3S2SA 1FPQA 3GRZA 3I05A 2AUMA 1T9DA 4YI5A 3ZK7A 3T5TA 1TYAE 2D5CA 4BO1A 5JSZB 2YXPX 1JR6A 2AKYA 3HLKA 4QGFA 1NF8A 2Q5HA 3UK1A 3COZA 3V8EA 2NTYC 5DYIA 5AVTA 1DBWA 1E3TA 1JIUA 2E4XA 4TM8A 1E2PA 4F4UA 1DZIA 3A6JA 3OLCX 4TKLA 4YV0A 2FY8A 4G07A 2Y77A 4H1HA 3KB6A 2QLMA 1DBQA 2PT6A 4MAMA 2VDJA 1U0HC 3OKPA 2NYRA 2NU8A 2UUPA 5JBNA 4MUGA 3O1IC 4B3FX 4TS9A 4ZHQA 3SDZA 4PSKA 4BKOA 3IEMA 2PLRA 2A33A 2AW3A 4RAQA 3RRNA 1YS4A 3BIXA 2GH1A 4DQDA 3I52A 3A4TA 3KOMA 1GITA 2A7QA 2D2IA 2ZIFA 4I9UA 4ROTA 5AHWA 1CLUA 3VYTB 1HDZA 1XHLA 1Q2UA 1YOVB 4W63A 4AY2A 2JAQA 4IAOA 1P7PA 2GJAA 4W82A 1AKVA 1EB9A 3P9PA 4L8LA 3CYFA 1NUQA 1XJWA 3USES 3GA5A 2P4HX 3U39A 4AJIA 1E1MA 1X38A 2E4UA 2OOKA 3R2JA 3RAGA 3OQJA 2ZUEA 1Z37A 1N1MA 3PI7A 4KN9S 5B3JA 1YBMA 1E3QA 5B6IA 5K3OA 5CTJA 3KV1A 1E5QA 4O2BB 2GZAA 5I9MA 1YB4A 2FWNA 4HNUA 3H2IA 2XJ9A 4PBRA 2JI6A 1OH5A 3D6VA 4LDNA 2OWDA 5T3UA 3HYTA 4RD6A 2RKBA 4C3ZA 2A58A 2FUG1 3IYLW 1ZSNA 2O8EB 4I50F 3CURA 1C7RA 1L3IA 1SIWA 2H2DA 3TI7A 2XXAA 1TYCA 4QUBA 1SJ9A 1CY1A 2YS6A 4CT0A 2Z2IA 4UKDA 2H4JA 1TKRA 2B1JA 1RC8A 3FTDA 3GLUA 4RMGA 5GQSA 5BY2A 2B99A 4MYHA 2QPTA 2O7RA 4G0WA 2P4QA 3KLOA 4GMDA 1IULA 1C80A 1SKYB 3CNOA 3E8SA 3LTNC 4OP3A 1ZD3A 4YGYA 1WDLA 3GZNA 2PH7A 2ZJZA 5I9TA 2Q5EA 2R7NA 5FBQB 1NXWA 4WZAE 1GT91 1Z38A 3GFPA 5CT9A 3RIMA 3WZLA 3RFXA 5HSGA 1FMFA 5TPZD 5EIWA 1VHLA 4KQ9A 4U8HA 3IPYA 1T1RA 3KUUA 4FMDF 5CGZA 4J0CA 2QSZA 1NKSA 1CF9A 1GPUA 1QVWA 3KKEA 4YALA 4DVGA 3KQUA 1YSCA 4H6PA 2OV6A 3QWFA 4UMEA 3GJQA 3K4PA 3TLKA 2NU8B 4NDZA 2X86A 5I7RA 1HNXB 3CHYA 2YKGA 4ZHQB 4M1OA 3LPAA 4OJKA 2COUA 5D51S 1N4AA 4PRLA 3TRFA 4JBHA 4YR7A 2MYPA 1ICIA 1P4HA 2TSYB 1A97A 3O91A 1TKBA 4RSRA 4EHBA 2OFXA 3S7TA 1UF9A 2WJVA 4AF6A 4MK4A 3NDRA 4FB4A 3N2IA 1PQPA 4E22A 1VQ1A 2Q45A 4TSFD 5L7WA 4KDFA 2R6CA 4EY7A 1YCDA 2AFHA 3NIFB 1VP3A 1FVXA 1B6RA 4L74A 1AN0A 4TLAA 2V7VA 4R1MA 3OESA 4OQXA 3RVLA 2BZSA 1EUDA 1AX9A 4JI0B 2OZLA 2QQEA 2WM9B 5JAZA 1JAYA 3MJEA 3DEZA 4X61A 1M66A 1Q74A 1OI2A 5EWLA 3OICA 4Q4HA 2W2MA 4RKFA 3RRXA 4CL8A 3B85A 4FDMA 2Q8NA 5LYJF 2PDAA 3R77A 5KNCD 1C29B 2J9XB 4Q48A 3QHPA 3IJPA 3M4XA 1NXTA 1LPBB 3GXBA 4RK0A 4BRWA 3HDVA 2XXAB 5FNVA 3ML1A 4NZYA 4Y2QA 2PH1A 3L7JA 2GKOA 2QF7A 4JXXA 5LYJA 5CNIA 3PF8A 4NU8X 4BMDA 2XEDA 4GPAA 4MYDA 3FFBA 1EVQA 4JP1A 3GZNB 3O6VA 3JZAA 1NI4A 2X0JA 1OX5A 3A05A 3RVBA 4CN8A 4D9NA 1K06A 3EUAA 2J0UA 1TLFA 4TQAA 2B82A 4HWKA 1V3UA 2O2EA 3NNDA 5HJ5A 4II7A 4LQ4A 3RE1A 4MRPA 2YFQA 3CLRC 4UD6A 5FL7A 1O57A 1A9XA 1GGVA 3INTA 1WSWA 3GG2A 4D0NA 5AK4A 3L4BC 3WLLA 2IYTA 4G01B 3ZI7A 3CNLA 4HXEB 1W9MA 1Y5RA 4DC1A 1MQAA 4YYZA 3F4KA 5LP1A 2GN4A 3DE5X 3A3KA 1TFRA 3IT1A 1DX4A 4M0DA 2QZ4A 4I9HA 1QUFA 4J16C 1QZZA 3UMSA 4KQ2A 3TEFA 2OGUA 3SSOA 4PSCA 2YICA 1UWCA 5B1DA 1JFVA 4KMRA 3S0JA 1L4UA 3W7VA 5BQOA 3DB2A 3RVJA 4B9EA 3W5UA 4RPIA 3R1IA 3I83A 3AF1A 3LL7A 4G4SP 2AFHB 2Z9BA 5A3JA 3I12A 2IWRA 4B81A 3SLGA 5KINB 4UHBA 5D5HA 1A4XA 3SD7A 4CU2A 4JT8A 3EIUA 2YQZA 4ZV4A 1R0XA 2HUPA 2OZLB 1LW6E 4DR2B 2I78A 1M6EX 1MC1A 2V0CA 2LIVA 2JB9A 3QKWA 5EWLB 4N1AA 2HA7A 4I1VA 3EGEA 1P1BA 4LJAA 4Q4HB 4OGLA 4AP9A 1IY1A 4DV0B 1DXHA 2FQXA 5CU7A 1BFKA 5GZ6A 2CNOA 4LTNA 3IP3A 4G97A 4TXJA 1NT4A 1S02A 4DG9A 5F76A 2FPPB 5FNVB 4MDHA 3UGJA 1QRUA 3SVZA 5JRZA 1P2UA 4FZ5A 2YV2A 2GN9A 2DC1A 3IP9A 3ZGVA 4ZEXA 4HQ6A