3GEGA

Fingerprint and structural analysis of a scor enzyme with its bound cofactor from clostridium thermocellum
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
245
structure length
241
Chain Sequence
b'NRGVIVTGGGHGIGKQICLDFLEAGDKVCFIDIDEKRSADFAKERPNLFYFHGDVADPLTLKKFVEYAMEKLQRIDVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNKGRIINIASTRAFQSEPDSEAYASAKGGIVALTHALAMSLGPDVLVNCIAPGWINVTFTQEDCAAIPAGKVGTPKDISNMVLFLCQQDFITGETIIVDGGMSKRMIYHGDWNWFYKID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title Sequence fingerprint and structural analysis of the SCOR enzyme A3DFK9 from Clostridium thermocellum.
pubmed doi rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Oxidoreductase
total genus 84
structure length 241
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gegA00
4CM8A 3QLJA 2QIOA 1Y8QB 2YDYA 1UP4A 2YY7A 4JP3A 4AJEA 2NU7A 4GMGA 4WCFB 5ENDA 4DLAA 1PS8A 1T2FA 5ES3A 4GKBA 5DP2A 1IZ9A 3NGLA 4NU5A 3GLQA 1NXQA 4YVFA 1VJ1A 2G5CA 4XYLA 2B37A 2PD6A 1WMAA 1GQYA 2YZ7A 1EMDA 3GUYA 4J4HA 4RPJA 2P68A 2D0IA 2OBNA 1R4NA 5KVVA 4DUPA 4K6CA 1LSUA 1W0CA 4MP8A 4OH1A 1KVSA 1N8KA 1O0SA 2VZ8A 4IMPA 4JN6B 2PR2A 1PL6A 2PV7A 4I9UA 4NFHA 4ZJUA 4OO3A 1UXHA 4XJSA 4R16A 1PTJA 1CF2O 4G5HA 4CLOA 1Q2XA 2B4RO 4HFRA 3NUGA 1LU9A 1OI7A 1OFGA 3GVIA 3ZHBA 3O38A 4MVJP 2ZTUA 4FB5A 4DBVO 4M54A 2IZZA 4PRLA 2DLDA 4IDFA 2VN8A 3AOEC 1YDWA 2Q50A 1DAOA 1NFQA 3PGXA 2ZYDA 2H63A 3QVTA 1CIVA 3VZPA 2NNLD 5JYEA 4WLUA 1B8VA 2Y0CA 1R37A 2AHRA 3W8EA 1T25A 2PA3A 4QTZA 3AJRA 1JKFA 1PJ2A 2YQ4A 2I99A 5DP1A 1BW9A 3U4DA 5JLAA 3DQPA 1VL0A 4KWIA 5HS4A 1Q7BA 2V6BA 4LMPA 2AMFA 3OQ1A 1ZJZA 4JBGA 1AHHA 1VC2A 3JYQA 1NQOA 2PFGA 3DBLA 4N7RA 1YB4A 3U49A 1DC4A 5TNXA 2YDXA 1ZK4A 3KRTA 3HWRA 1EVIA 2OL4A 4EJ6A 4LCEA 3OECA 3V2HA 2I6TA 4BO6A 3GC6A 1ISIA 1F0YA 1Y8RA 1ZNQO 1BTOA 3GPIA 4W99A 4BNYA 2B36A 1XKQA 1E7YA 2QX7A 3UN1A 2EGGA 1XGKA 3GZ4A 3H3FA 1RM3A 2RAFA 3GZNA 1D8AA 1ZK2A 5DCYA 3E82A 3T4EA 1V3UA 1GEEA 3TL3A 3ZWYA 3TWOA 2Q1WA 1XR3A 3ZHXA 1GCOA 4I5GA 2DFDA 1P44A 2GN6A 3RUAA 4DBZA 5C5IA 1GQQA 3MOGA 2R00A 3DR3A 3DZIA 4Y6RA 1P77A 1W8DA 2RH4A 5L7TA 4E5YA 1PZGA 3VVCA 3PI7A 2XF8A 1GR0A 5KTKA 4Z9YA 5JC1A 3OQBA 3I6IA 3SXPA 4A03A 1IHXA 4MVJG 5KNLA 1QSGA 4J7XA 1ISHA 2HK9A 2O3TA 3QV1A 3LT0A 3AK4A 1GZ4A 2OXIA 3IKVA 2GZ1A 4YDRA 3GHYA 4XRRA 5EQFA 2QW8A 1ADFA 2GNAA 3SLKA 1GZ3A 4KUGA 5I9NA 1Z7BA 3OH8A 1SBYA 1RWBA 4JCOA 2Q1UA 4ZD6A 1LDGA 1Z74A 3ROPA 3GT0A 2V6FA 3PLNA 2BGLA 3OJEA 5CPFA 1GFSA 4B7UA 1B8PA 3L6EA 3IDSA 4D42A 4RPHA 2YFHA 4M8SA 5JC8A 4CLDA 3FBGA 5CDUA 1AHIA 4CL3A 1T4BA 2ILTA 4XR4A 1KBZA 1EDZA 1XLTA 1MB4A 2JD2A 2O7QA 1MC4A 5BNTA 2G76A 3AWDA 3MCVA 5BSGA 1FDSA 1QLHA 2X6TA 3RWBA 2ZQYA 4HFNA 4BNZA 2C29D 1E5LA 2IXBA 4I08A 4YA6A 1I2BA 4CMAA 4LVUA 3HE3A 1E7MA 1UJMA 4CMJA 3WS7A 1GV1A 2HCTA 1S7CA 3JQEA 4GLLA 1HSZA 4UVIA 2GASA 1ZIDA 1P74A 5G0SA 4ALJA 2B0JA 1NAHA 4D44A 4J7UA 3EMKA 3L6DA 1K6JA 4RLHA 1GDHA 3HDJA 4NU6A 4WLFA 1F17A 4R51A 1ISGA 3F1KA 4R3WA 5B4UA 3GRPA 4YT8A 1TT5A 2VT2A 1XYGA 4WOJA 1GUYA 2IRWA 1UDCA 1YONA 1Q0LA 2WSBA 4IDDA 5CHEA 2YV3A 1LC3A 3VC7A 4JK3A 5F1OA 2XOXA 4I5EA 3UGKA 1Y8QA 1B2LA 1X7DA 2I76A 3ANLA 4NI5A 4RZIA 4BKRA 4BKPA 1LUAA 3H9JA 2FWMX 1MXHA 2O23A 1NPYA 1O95A 5B4TA 1NQTA 4E3ZA 4PLWA 4OHUA 4I8XA 3W6ZA 1CYDA 4BGUA 3RC9A 4FJ2A 4ZQGA 1P9LA 1YOVA 3JQAD 4FC7A 4LW8A 2B5VA 3GG9A 4MVJE 3FWNA 2POQX 4E21A 2JD1A 1NPTO 4YYZA 2WE7A 4RJTA 1GPJA 3I9JA 2P91A 5G0TA 1VJTA 2CDCA 4O1MA 3TJRA 3E9MA 5BR7A 3JQ9A 4XQ9A 2J3JA 1K2WA 1HTBA 4XYBA 4BO7A 4JX8A 3F46A 2Y1EA 1DIBA 1YB1A 3ROMA 3QSGA 3KEQA 1EVJA 4LRSB 3B1FA 1C1XB 2FMUA 4XKJA 1ZBQA 4D0RA 4OXKA 5L45A 1I30A 1UP7A 4DTIA 1LLDA 3WLFA 3OA0A 3WMXA 2AA3A 3HHPA 1DO8A 4NNJA 1HE2A 3RVDA 4A0SA 3CE6A 4R9SA 4E31A 1Q0HA 5L40A 4U6SA 4XX0A 1DPGA 2DFVA 3SJ7A 1P3DA 4P4LA 4BVAA 4D3SA 1LI4A 5C7IO 1CETA 2DBVO 3GG2A 2GN9A 1L7DA 2Q49A 3O26A 3OIDA 5JBIA 1T2DA 2AG5A 2HRZA 1B3RA 3R1IA 1E1LA 1QYCA 3HADA 1E7RA 2P9GA 3OFSA 3RIHA 3ZWCA 5KVSA 2H6EA 2Y68A 3KXDA 4ZQBA 2W98A 2YV1A 1E92A 3H7AA 4JBIA 2O2SA 5IG2A 1KEWA 4WLOA 3SVTA 3QRWA 4E0BA 1KEVA 1EFLA 1Y81A 2V65A 2AW5A 1LA2A 2JHFA 3WX0A 3BTUA 4GAEA 3RBVA 2WYVA 1DOHA 3GR6A 3A28A 1AN9A 4UEOA 3GVHA 3VTZA 4AJNA 3WYBA 5JW6A 3VPFA 1PR3A 3PFFA 2AEFA 1D7OA 4MVJA 1BRMA 3DOJA 4L76A 4PLFA 2C7VA 5BNFA 1GV0A 4CLEA 3ZWPA 2OP1A 4JBHA 2ET6A 4KTVE 4N54A 3LK7A 1BXKA 1Z7EA 4IIUA 4CM3A 3F4LA 2O4UX 2VUUA 4DC0A 3UOGA 5AYVA 1GD1O 4GWGA 4L74A 3AOGA 4TMFA 3D4OA 4NMHA 5KJCA 4CPDA 1N9GA 1HT0A 3DZJA 1OAAA 5L3ZA 4R54A 2P2SA 2AQHA 3IUPA 5AXAA 4RF3A 4B4OA 4MPDA 2CY0A 4AFNA 1IB6A 1BXGB 4PVDA 1WNTA 4BGVA 4P8RA 1VL8A 2WD7B 2ZB3A 2BH9A 4GBJA 1QYWA 1LSOA 4FFOA 3PVZA 1MLDA 4DIBA 3ZWWA 4N18A 4BS9A 3JYPA 3DAPA 4NIMA 2ZK7A 1IZ0A 1Z75A 2NQTA 1MUUA 1K0UA 2PZMA 4XIYA 4ZVVA 2HO5A 3C7CB 3JD0A 4XJTA 4JNKA 3ABIA 1ONPA 4ZQFA 4A26A 2OFPA 3CINA 3GDGA 3GK3A 3DBVO 2CVQA 5COAA 3CPSA 5TS3A 1NR1A 2NSDA 4L75A 3UHAA 5COBA 1OMOA 1WXDA 2Y1CA 1GAEO 1N7GA 3IP1A 2OP0A 4WASA 2NM0A 5DF1A 1MG5A 2Q2VA 1UUFA 3IAHA 2A94A 1PZEA 3ZH2A 1ML3A 4D3DA 5JXWA 1KVTA 3D3WA 3KOUA 1DHTA 3CZRA 3RUEA 4UVHA 3RUFA 1T24A 3ZV4A 7ADHA 3ZI0A 3RUDA 3G0OA 1V8BA 3FHLA 4IJVA 1R66A 1PIWA 1ZK0A 4AJHA 4IUYA 3C8MA 1YL7A 3AUTA 4OKIA 3AU9A 1ZEMA 3WYEA 4F45A 3FWZA 4KWHA 2Q1TA 4KUEA 4Z9XA 3RI3A 5L9AA 3U3XA 4QECA 5KJ6A 3ZNQA 2F1KA 2BFMA 1HSOA 2OUIA 1E3JA 1R4MA 3RASA 4CMHA 1GEGA 1SB9A 3JQDA 4XYGA 4N5MA 2I3AA 5I8WA 3W8FA 2FPPA 1NYTA 1E6WA 1MFZA 2JKVA 2GDZA 2Q4BA 1F8FA 1U4SA 3VPGA 4CM4B 3F3SA 4OIMA 1ZSVA 1WDLA 2D59A 3ZWBA 4P38A 1XCBA 3I4FA 4WCFC 1JN0A 2O3SA 3TOZA 4BNUA 4UVGA 3FCOA 4RVFA 4EGFA 1NHWA 1A4UA 3LF1A 3CEAA 5L7YA 3E5RA 3INGA 1ADCA 1B14A 3PZBA 4G65A 1U2DA 4QSMA 4Z3DA 4B4VA 2J5KA 3CTMA 4RVHA 2OGUA 1CRWG 5JO0A 4XYEA 5THQA 3AOEA 3EK2A 4Q3DA 4A2CA 3TFOA 3BMNA 3ENKA 4M87A 2YUTA 1QMGA 2R2GA 3CKYA 3NTQA 2BFOA 1O94A 1LDEA 3BMQB 3JQ9C 3JD4A 3ANNA 1BXZA 2P9EA 1DIHA 2PKRA 5DNAA 2F00A 3TFQA 4CV3A 2FP4A 1ULUA 2X0RA 3C3XA 4GX5A 4W9NC 2Y0DA 4II2A 2WWRA 1UZLA 2BD0A 2P9CA 1VKNA 4GVXA 2Z95A 3TQHA 2RCYA 5JDCA 3AUAA 1B15A 3O03A 3AUUA 1X0VA 2HRBA 3HUDA 3AM5A 4RL6A 1K5HA 3UH1A 4U0KA 2E37A 5CDYA 3AW9A 1J4AA 4M55A 3WDSA 3CH6A 3WXBA 1PS9A 4HBGA 4X54A 4DYDA 4EEZA 4YRAA 4Y8VA 3WGHA 1P1HA 3KV3O 3AFMA 3I83A 3Q0EA 2J3KA 5LCXA 4B79A 4A10A 1E1NA 5G4LA 3KLPX 4ND2A 3EUWA 5A02A 5IDXA 1JTVA 4FIZA 3C85A 1EUZA 1LEHA 1DIRA 1H9BA 2HLPA 4WEOA 4JROA 1F14A 2DTXA 4J91A 2C2YA 1UXGA 4O59O 1ENOA 1QR6A 5TJHA 1PJSA 4HV4A 4RQUA 4HNHA 3FPLA 2X22A 2WJPA 2W8ZA 5DBGA 3P5SA 4CM6A 1I10A 4UVDA 1E3EA 3LT2A 4ZQHA 5I9LA 2BELA 2ZIZA 4EITA 2PGJA 1HDYA 3AY3A 3GFBA 4CM7A 4AJIA 4QEDA 3KEOA 1TA4A 3ZU5A 3JSAA 2EJVA 2TMGA 1PQWA 4GSKA 5HM8A 5I7SA 1LSSA 1HF3A 1Y9EA 4ONEA 4PLHA 3GGOA 4IQ0A 2YJZA 1NQ5A 4NBUA 4TRRA 5GZ3A 4FFLA 1O5IA 4GQAA 1B0AA 3RUCA 1M76A 1Q7GA 1BXGA 4YB8A 4XB1A 1A7AA 5DULA 1H6BA 2W2KB 3HDHA 1LDNA 4CM9A 1E6UA 3V1UA 2D1YA 2Y67A 4XYMA 4OQZA 1ARZA 2NVBA 2HJRA 4FS3A 3WOHA 3KSDO 4P4NA 3B6ZA 4BNKA 3N74A 3A06A 3KM0A 1ZK1A 5TC4A 1E1MA 1XIVA 1E3IA 1XU9A 2X0IA 4XD2A 3RC7A 3DFUA 3M6IA 4BNGA 4R1SA 3DOOA 4KP7A 1EUDA 3W4JA 1R16A 4AJLA 4RCVA 5G0VA 5L7WA 1RPNA 1TT7A 3D3EA 3L07A 4NJMA 2AEJA 1X0XA 2X9GA 3VH2A 3ZN2A 1IUKA 4A5OA 4TVOA 5A06A 1LRJA 3WSWA 3KSUA 2CDAA 1KC1A 1HDRA 3WLEA 1I32A 4DWVA 1NX6A 4CQMA 1IHYA 5F21A 4UUPA 3ZWVA 8LDHA 1WPQA 4E2WA 3S2EA 3NV9A 3PXXA 4BNIA 5HWSA 3PYLA 2AG8A 4FQ8A 3GRKA 1DRWA 2V6MA 2CVOA 1YB5A 2D3TA 4NBVA 2R6JA 4BHTA 4OMUA 3FRJA 4RVSA 4ZN6A 3K31A 5TT1A 3U09A 4KQXA 1WLYA 4FC6A 1YVEI 4IDGA 4D46A 2Y93A 4L73A 3BHJA 4P4GA 4PLVA 4DMLA 1E7WA 2JHGA 4RVUA 4WLVA 5KKCA 4R4JA 3DZHA 4DQVA 1DC5A 3ETDA 3ZWOA 1ZZEA 2OZPA 5EMHA 4ND5A 3WMWA 3B1KA 3ZW8A 4RPLA 4CM4A 4E5KA 2CD9A 4YQYA 3PFWO 2J3IA 5JCJA 3E1KA 3TZQA 4BNFA 2H1SA 3S1LA 4GMFA 4NK5A 3NT2A 4YR9A 2DPGA 3DMTC 4BO2A 4CMIB 2W2LA 3TZKA 1DLIA 1NPDA 6ADHA 3WR5A 3OJOA 5A5FA 4XEHA 1LDYA 4BNMA 1BG6A 3NJ4A 1T2AA 1VE9A 3MTGA 2QQ5A 3GF4A 3WTBA 1W73A 4DRYA 3DMYA 4MJLA 4LK3A 2EGHA 5TGDA 4MP3A 4PZCA 3TF5A 3FTNA 1U7HA 3MZ0A 1HDCA 1SNYA 2HDHA 4UVEA 1T2EA 3NTRA 3RJ9A 5JY1A 5IDWA 3EC7A 3LYLA 4IXWA 4DYVA 5TJ9A 3L6OO 1SEPA 7MDHA 4GH5A 5TF4A 2HMUA 3EYWA 4ND4A 4ITUA 3WWZA 3ASUA 1WP4A 1NFFA 1XWFA 1YS4A 2NWQA 2BKAA 3LF2A 3WNQA 1R12A 4NDNE 5JAMA 3V2GA 5IN4A 2HMSA 1Y6JA 1JWAB 5A3VA 2QYTA 5C7OO 3EZLA 9LDTA 1J5PA 3INTA 1B3BA 2DBQA 1QORA 4BUCA 4R68A 4BQRA 4FGSA 2VOEA 2P5YA 1X15A 4QO8A 3HDYA 3P2OA 1GUFA 4J2HA 3DONA 3PIIA 4N5NA 2EW2A 3JQCA 4TWRA 1ZUD1 2FPIA 2P4QA 3VH3A 4JP2A 3QVOA 3ZWAA 3ZHYA 5JDCC 3ZNPA 1DIAA 5HRUA 3Q2KA 1MXFA 4A27A 5AXCA 4DIFA 1SAYA 3RU7A 5B4VA 3H9EO 1EK5A 2YHIB 3FI9A 3OEYA 3MJEA 1B8UA 5I8ZA 3TZHA 4D79A 2G82A 1BGVA 1Z6ZA 2X4GA 1H0KA 2VHVA 5F1KA 4CR6A 5TQVA 1LXCA 5G0UA 2X58A 1U8FO 3VAZA 5BSEA 1ZCJA 1N1GA 1TB4A 1P1FA 3W4IA 5JFOA 3KYCA 1HE5A 3QP9A 3ANMA 3JYLA 2O3UA 1XQ6A 3ZHZA 3PK0A 4XGKA 3K96A 3QW2A 1P0FA 1C1DB 1Y9AA 2WYWA 1UDBA 2C0CA 1KC3A 2YW9A 1Q0QA 3HSKA 5IZ4A 4AJ4A 4BKQA 3RKRA 3NDIA 2BRUA 4YT2A 4QXMA 5JCXA 3IOYA 3PP8A 4RDHA 3TRIA 4B8WA 3RROA 1SO8A 1QRRA 1DJQA 2ZQZA 4WLEA 1I33A 1V3VA 1ULSA 1C0LA 5GY7A 5H81A 5CG1A 2W2KA 3NJ8A 1ZMOA 3Q6IA 4CR8A 1LQTA 1HRDA 5L95A 5JAIA 3PDUA 1MX3A 3AUSA 4PLCA 5EQDA 4BO9A 3WNVA 4EBFA 4WGGA 3VZSA 3ONEA 3JQFA 3CMCO 4PLGA 4YACA 1KVUA 4GX0A 2CVZA 3RCBA 4CLRB 4HNGA 1ISJA 3WGYA 4IS2A 1YL6A 3FD8A 5CG2A 2VZ0A 3IUSA 1D1SA 5DOZA 1QP8A 3H2ZA 1WVGA 4E4YA 1NHGA 3LLVA 3PTZA 1U28A 1JAYA 1EBFA 2FN7A 1WZEA 4QT0A 1KY5A 1C0IA 5JMWA 5IXSA 4BQPA 4TZTA 5F5NA 3KETA 2VCYA 4UULA 3JQBA 1K3TA 1LJ8A 4WECA 5B37A 4W82A 2HK7A 4IJWA 5DBFA 3ZDFA 4YJFB 4IZIA 3CMMA 4J0EA 1ZJYA 3WFJA 1HZZA 3H65A 1N2SA 4LGVA 1BDBA 1CJCA 2EP5A 4OM8A 5KJ1A 5IXYA 5CEJA 3PYXA 4TZKA 2VWGA 3DAFA 3DTYA 3L77A 5C3MA 3UICA 4CLXA 3L0DA 2EWMA 1EBUA 2J5QA 5JAQA 3UAGA 1PGNA 3PGJA 4FW8A 1AXGA 1HWYA 2OOSA 3ETGA 4U8GA 2OO5A 3S2FA 5A9RA 3VKVA 4CV0A 5BSFA 1PL7A 2IEDA 5G2OA 4L0QA 4YJHB 1N1EA 3N7UA 4D45A 4XGNA 4E32A 1AE1A 2PK3A 4BO5A 3I9KA 1E3SA 4CUJA 1E6EA 4HUJA 1LDMA 3QWIA 5JO9A 3ULKA 4BB5A 1FDVA 3DHNA 4BO3A 1P31A 1N5DA 4CM9D 2CF6A 1E1KA 4WCFA 1KVQA 4CMIA 4UEJA 4WKGA 4J4BA 4EZBA 1JU9A 4LMRA 2QHXA 4BO4A 3X2FA 4PG8A 4U7WA 1T1RA 3MJSA 3I6QA 2IZ0A 1JWBB 1ZXLA 4DL9A 4E33A 2A9FA 4O0LA 2J3HA 4PLPA 4CQLB 3UVEA 3VPHA 2PH3A 1U3VA 5K6AA 4LISA 3OICA 5AQ1A 3JQ8B 4NG5A 4PG7A 4MKXA 4Z0TA 1HE4A 3AY7A 4ZU3A 4M89A 2O3QA 4CQMD 1OC2A 2EJWA 4CM1A 1WMBA 1GU7A 3GPDG 4W9NA 3U5TA 4PVCA 3GEGA 2V6GA 1IULA 2GUGA 4ZA2A 2WM3A 1DHRA 4DPMA 5DT9A 3K8ZA 3A1NA 2A4KA 4BO1A 4FJ1A 3ONFA 5EPOA 4WUVA 1U5AA 4YBZA 4AJJA 1HDXA 5CDTA 3STHA 1UP6A 5DN9A 2G0TA 2ZYAA 3DC2A 1I8TA 5DDIP 3GQVA 4FGWA 3WFIA 1X7HA 3H2SA 3IMFA 3OQ6A 5DZSA 5DCUA 2BI8A 2GYYA 2AQ8A 4ID9A 1K89A 6LDHA 3C7DB 4KUHA 1DBVO 1IOLA 1NM5A 1X1EA 2QRJA 1KOLA 2DM6A 5FYDA 2PLAA 1YDEA 3HG7A 2AXQA 2SCUA 1V3TA 3H5NA 2GCGA 3ZNOA 4PG6A 1NNUA 3VDQA 2LDXA 3G79A 5CP8A 3L4BA 2EKQA 2FR8A 4Y67A 2H5LA 1MA0A 2YHIA 2IE0A 3W4KA 4ZICA 3DXFA 1H5QA 4IQ8A 2RH8A 2CF5A 2G17A 1OBFO 3AI2A 4E5NA 2W2LD 1VLLA 2HK8A 5A9SB 3SBOA 3ASVA 5AOVA 1H6AA 1I36A 2HJSA 3V5NA 3K2BA 4TRMA 4ALIA 2C59A 5G0WA 4H15A 1PJCA 5T5QA 4NHEA 3M2PA 1PWXA 4C7KA 3I52A 5K0ZA 1C1DA 3AU8A 5CDSA 2BGMA 3VOSA 1UXJA 2RHCA 5A1TA 5CEEA 1UXIA 1OZAA 2ZB4A 4DMMA 2O3JA 3FN4A 2HUNA 1YRLA 2RHRA 2X86A 2ZTMA 4L4SA 4TROA 3ITKA 2UV8A 4JXKA 2Y66A 1PU2A 5AVOA 5JS6A 1GCUA 4L8VA 4DQUA 5FWNA 3QVXA 5T8KA 2VRCA 4K26A 2GZ2A 1DB3A 4XDZA 4EEXA 4EUEA 1IYZA 2WYUA 1CEQA 1I3MA 2E82A 4AJPA 2DQ4A 3K2EA 4IGEA 1A4IA 1C0PA 4FR5A 4MIOA 3PJFA 1SEVA 4PLZA 3SEFA 4YAIA 3IS3A 2AQKA 1I0ZA 3M1AA 3MWDB 4JJGA 4RV9A 1PL8A 4Q3BA 4OGWA 3JQFC 4IDBA 1FMCA 4G81A 2A92A 4PRKA 4Z9FA 3ONDA 5MGBA 1ZSNA 2Q4EA 3C24A 1I3LA 4M49A 2B69A 3LU1A 4B4UA 2X9VA 3FR7A 3ICCA 2IEBA 2NLOA 1M6WA 3M2TA 4YJFA 2CUKA 3LZ6A 2Z1MA 1O8CA 2JCXA 4BNXA 3GDOA 1ZO8A 1HLDA 1A71A 4BIIA 3PHLA 2BFPA 2GZ3A 4CM5A 2J8ZA 1EZ4A 5JSFA 3JQBC 4BNNA 3NYWA 1EUCA 3JQAB 3KZVA 1U1IA 4IIVA 4OKNA 1E7QA 3PHIA 5T6BA 4CJXA 3H5RA 2DU8A 5IZCA 3EVTA 1MP0A 1U7TA 1MGOA 4RORA 3SJUA 1QYXA 4PN3A 2FHSA 3Q2IA 4MKRA 4ND3A 4WPGA 3I3OA 4FDAA 1EFKA 3LT4A 3OMLA 4Y98A 3VH1A 3G3EA 2E6UX 2HAEA 5KVCA 4IDCA 1LBEA 3OP4A 1E3WB 3EDMA 4XZ3A 2C2XA 1U9JA 1IL0A 1P0CA 4B3IA 3TNLA 3W8DA 3DMTA 1JA9A 3FTPA 1WWKA 3HB5X 5BT9A 1TLTA 4I5FA 4PLYA 1P45A 4NBTA 3FNEA 5L4SA 3E9QA 3E03A 3RFTA 4R9RA 1XELA 4IINA 5IF3A 1V6AA 4IQGA 1IY8A 1SPXA 2B4QA 5JPIA 3WQSB 2AE2A 5AXBA 1H6DA 4MDHA 3WWYA 1B16A 1Q1NA 3K6JA 4E2ZA 4PCVA 1EE2A 4R69A 3PRJA 4CQLA 4ESOA 3PJEA 2AQIA 3JQ8A 2BHLA 1QYDA 2NTJA 3KO8A 2WDZA 4MVJF 4QFCA 2PKQO 2DC1A 2VOJA 2W4QA 3BA1A 1RJWA 1M66A 5T64A 4UREA 4ALNA 4YJGB 4RDIA 5L4NA 4EJMA 1SC6A 1VSVA 1C1XA 4JGBA 3R0IA 4RF5A 3JQ6A 1LLUA 5K6AC 4YT5A 1PZFA 1X7GA 3I4CA 3JV7A 2J6IA 5JYDA 1EK6A 5I7VA 1KEUA 3NAQA 3ZW9A 1R4NB 1PQPA 2GGSA 3ADPA 3UUWA 5CDGA 2TMDA 4FSHA 5EJ2A 4LCJA 1H94A 3WYCA 1I2CA 2EG9A 5A03A 1T4DA 1WZIA 3VDRA 1LLCA 4HX5A 3QA9A 1PJBA 3HFSA 3F9IA 2UAGA 3NX4A 3E18A 2NTVA 4H3VA 3N58A 5C7LO 5TLSA 1X14A 1P1KA 1L7EA 3L9WA 3FF4A 2DBZA 1WW8A 4RVGA 1DC3A 2QG4A 3SC6A 2I5PO 1JLLA 1WDMA 2FR1A 1ZXBA 2VYVA 4HFMA 4YCAA 1CQIA 1ZFNA 5HA5A 3GVPA 4EDFA 5A9SA 1YXMA 3U4CA 4HWKA 9LDBA 2E4AA 2Q45A 2WE8A 1ZK3A 3EW7A 4OOFA 2VT3A 1VJ0A 2B83A 1H2HA 1ZSYA 5JDIC 3L4BC 3Q9NA 3BTSA 3OJFA 4RLSA 1JDJA 1YBAA 4JJIA 2Y1DA 3PJDA 4TSKA 4J49A 3QIVA 1ZEJA 4FBGA 3HB4X 1RYDA 2JAPA 1E0DA 3QWAA 3UCFA 4KOAA 2CSUA 1JVSA 4PG5A 1JQBA 5U9CA 2HMTA 2QRLA 5A05A 4GLOA 2NU8A 1UZMA 1UDAA 1XA0A 3ETEA 1T2CA 2DTEA 3RQSA 1YBVA 3WGGA 5ENVA 3TPCA 4LVCA 1D3AA 2ZJ1A 2C82A 1O89A 4G2NA 2E48A 4B8ZA 2VYNA 2ZCUA 2C07A 2UYYA 3O4RA 3PWZA 2JAHA 3Q9UA 2HKIA 2Y1FA 3HFGA 4U0JA 3IKTA 2WD7A 4XA8A 2P4HX 3VTFA 4YAJA 3RD5A 1P1JA 5T8KC 2O50A 3KHUA 4OXNA 2NU6A 4BNHA 4CLHA 1C14A 2DVMA 3EZYA 1HZJA 1A72A 1V0JA 1BSVA 1PJ4A 2EEZA 1NWHA 1XDWA 1YGYA 1YQGA 2VNSA 2WD8A 2Y0EA 4AJ2A 4H16A 3H3JA 4AJOA 3DFZA 4J43A 3NKLA 4CMGA 1E7SA 1BVRA 2Z5LA 4RZHA 4M86A 1ORRA 2NV6A 4J2OA 4RO0A 4LRTB 2EKLA 3VHRA 3NRCA 4KQWA 1CQJA 3KYDB 1JKJA 3LDHA 3R3SA 3RBZA 5I7EA 3GAFA 3BAZA 3OSUA 1YQDA 2DTDA 4RF2A 3U4HA 1HYEA 3KTDA 4WEQA 1KETA 5JE8A 3I9OA 3TDKA 1ONNA 3JQGB 2VRBA 4WCDA 4QUKA 3WSVA 2JD0A 4MVJD 5JMPA 1A7KA 3A4VA 3D7LA 4Q39A 1QLJA 1GTMA 4JLWA 1Y5MA 1PS0A 5U1PA 4TVBA 1PEDA 2C7GA 1ADBA 1UAYA 2NUAA 5T57A 3C1AA 2Q2QA 2B4TO 2XPCA 1CDOA 1PGQA 3RFXA 3FNFA 1O9BA 4JIGA 3MJVA 4IMRA 5DBIA 1YQXA 4S3MA 3HZZA 2D5AA 5TX7A 2QRKA 1IE3A 3UKOA 2DT5A 2ZTLA 4B7XA 3GNTA 1WDKA 4R3NA 5IZCC 4MIYA 5G4KB 4Z3KA 4MO2A 4PZEA 2OORA 5GMOA 4KDEA 4PIVA 5F1PA 4TRNA 2RIRA 4ND1A 1Z82A 4YWJA 1C0KA 4YQZA 2GERA 4K1LA 3GVXA 3P7MA 1BMDA 2D5CA 4IS3A 5THKA 3CIFA 2WTBA 1DFIA 3HN7A 1V9LA 4FFRA 4MIEA 4XCVA 4BKOA 1ISMA 4WLNA 1A5ZA 5H82A 3QWBA 2EERA 4LN1A 2JCYA 2GD1O 1R0LA 3GDFA 4OAQA 4GVLA 4Y6SA 4UUNA 1LDBA 1U2GA 1GL3A 2AE1A 1M2WA 3EGOA 2B5WA 5IDQA 3QWFA 1QXSA 5CFZA 5CAEA 1EE9A 2CFCA 3RAJA 4B4WA 3UFXA 4O6VA 2PNFA 5B12A 1NP3A 2YQ5A 4OYRA 4GWKA 4PG4A 3V1TC 1K6IA 1V35A 3V2UA 4W6ZA 3VZRA 2O4CA 3BMQA 4IDAA 3OA2A 4GI2A 5ITVA 4D7AA 2I66A 3F1LA 5ICSA 2Y1GA 3U4IA 4I9HA 1OOEA 1YOVB 2GO1A 4RPGA 1YL5A 5L51A 1GZ6A 3GHHA 3UF0A 4W4TA 2X0JA 2I9PA 3T7EA 3LSYA 2IYOA 1S6YA 3S2GA 4BMVA 3D5QA 4R41A 3QVWA 3RSHA 2Q46A 2HMWA 2OHXA 1DRUA 1DIGA 3H8VA 4K28A 1AGNA 4K9DA 3V1YA 3ENNA 3S2IA 1DFHA 4E2XA 2CZCA 2FRDA 1QYVA 2CMDA 3HNPA 4W7IA 1EVZA 3DB2A 1Z73A 2IDZA 1TXGA 1HEUA 4KMSA 1MC5A 3IL2A 1PZHA 3K92A 4BNTA 1SOVA 4H7PA 5EN4A 4QFDA 1GYQA 4J6FA 4CMCA 4TKLA 1EQUA 2I65A 3GN2A 4ZHSA 2NADA 1I3KA 3DHEA 3QWHA 4E30A 2PZJA 4B3HA 4J90A 1DFGA 4ZQEA 4NZ9A 3I1JA 1EEHA 1F06A 1N7HA 3CUKA 1XG5A 4F6CA 4XQCA 3L9XA 4J4TA 5JY6A 1GYPA 3U0BA 3T7CA 1P1RA 3ZU3A 2JL1A 3ADOA 3ZCXA 2Q3EA 3ZWMA 1NAIA 5CPBA 3FPCA 1LX6A 1LRKA 2GLXA 5IN5A 3H9GA 3WJAA 3DBRB 5T67A 2UUPA 4BNVA 3GN1A 4O63O 1UXKA 4MOWA 4ZGWA 4FPXA 1NWCA 1PJLA 4BV9A 4YPOA 1BVUA 3KUXA 3P19A 5EINA 2VUSA 4YAKA 4RQTA 4Z6KA 1ENZA 3BHIA 2IXAA 2PY6A 5IDYA 5KWEA 4NFYA 3OIFA 2PD3A 3WGTA 1I01A 4ROSA 2ZB8A 1LRLA 2FSSA 3RUHA 1UZNA 4WJZA 3ZV5A 1IPEA 4F46A 1ENYA 2Z1NA 1R0KA 3C7AA 3RC1A 2PGDA 4FFPA 1T26A 1DDOA 3ZZNA 3PWSA 1YJQA 2C54A 2ZB7A 1FDUA 3GEDA 3WGIA 3B20A 1CERA 5FF9A 1VI2A 4Y9DA 1ISFA 4E2YA 1U3UA 1ZMTA 1MV8A 4I1IA 4BB6A 1P1IA 1ZW1A 1PGPA 1U3WA 3O9ZA 1A9ZA 3MEQA 3FSRA 5A3JA 1P33A 2VYVD 1R0SA 4CUZA 4CUKA 1I2ZA 2D4AA 2HQ1A 1N9GB 3K30A 4XGIA 1KEPA 4GL4A 4IPTA 2P5UA 4E6PA 2PZKA 3KYDA 1K6XA 1SCUA 4W7HA 2O7SA 1Q7CA 2JFFA 3H5AA 4YRDA 4Q3AA 1LTHR 5EIOA 2CDBA 4EUFA 1XHLA 3HQ4O 1HETA 3QHAA 2NVWA 4L4RA 4M1QA 4JQCA 2GF2A 3DWFA 2A35A 4U6QA 2BFAA 1GPDG 1H2BA 3JQGA 4J1QA 4O5OA 4JJFA 3WIDA 1NFRA 3CXRA 3I9LA 5F3RA 3WIEA 3RC2A 4BNWA 3PQFA 1A27A 4MP6A 5F5LA 5ADHA 1GADO 3GUCA 4AG3A 1DRVA 1PGOA 4IDEA 3VZQA 3UXYA 4CMBA 3TZCA 3WB9A 5ILOA 4J3FA 2VHYA 5TRTA 5ICMA 1LC0A 4ZRNA 4BO8A 2XXJA 4CMEA 4KZPA 3BMCB 5BSHA 1U8XX 1J6UA 3D4NA 5I7FA 4OJNA 3KB6A 1XSEA 4E5PA 3QE3A 1Y7TA 3BHMA 1PJQA 3IJRA 3UCXA 4QX6A 2VYND 5G4KA 3EVNA 1LSJA 2E49A 3G49A 3B1JA 3BYZA 3NT4A 2FY8A 4BO0A 3D3WB 1J49A 1PSDA 2PGLA 3ROQA 5EESA 4YAGA 3D5TA 3MJCA 3AM4A 3GGPA 5BQFA 1ID1A 3JYOA 3UCEA 1DC6A 2HU2A 3G1UA 3EHEA 3NT5A 4XB2A 4HY3A 2FSVA 3UW3A 2BI7A 3CZMA 1YBMA 2O2YA 5U4QA 1ENPA 3AM3A 3DO5A 3GY0A 5FI5A 3JCZA 4DA9A 1N92A 1R4MB 4IJKA 3SLGA 1LLQA 2C5EA 2W90A 3EAGA 3MTJA 1VPDA 1VSUA 3SX2A 1NBOA 3M1LA 3MOIA 1KYQA 3MJ4A 3Q1LA 3GH3A 3D1LA 3PLRA 4UAGA 4FJ0A 2NACA 3DEYX 4EJ0A 1PQUA 4TRJA 3S8MA 4D43A 4L9RA 2VQ3A 4DXHA 1UR5A 4INAA 4GX1A 4Q9NA 2WEKA 2X0NA 2EP7A 1NVTA 1YO6A 2FOIA 4TKMA 4YRBA 4R5MA 4PFJA 3ITDA 1D4FA 1FDTA 2VNAA 4MVJI 3TZ6A 2B35A 4WNCA 2EXXA 3DZFA 3AFNA 1BWSA 4L4XA 3G1TA 1C3VA 3WBFA 4YT4A 3OM9A 3GA0A 2I67A 4FOOA 5I9MA 5L4LA 1W4ZA 2EV9A 4CODB 4CL8A 1KVRA 3BMNB 1FXSA 1BDMA 4AICA 4FD3A 4N5LA 1WAMA 3BZUA 3H9QA 3ZWXA 4J1SA 3PQDA 1X1TA 3E9NA 4IM7A 4NBRA 2H9IA 1VL6A 2OMEA 4DLBA 1HXHA 1DAPA 1XU7A 4Z0PA 3VKUA 5JCJD 5JDIA 4Q3NA 4R1NA 1GY8A 1I24A 2FZEA 3NEPX 3VPXA 1IPFA 4U5QA 4J7CA 4ILKA 1A9YA 1NASA 1B26A 4BL5A 2V7PA 4NQZA 2VZ9A 4DIOA 1FK8A 2EHDA 1DXYA 2LDBA 4D3FA 1LNQA 3RFVA 3HDQA 5KOIA 4J9VA 2VWQA 1M6HA 3NDJA 4RPKA 3ZNNA 1B7GO 1PJ3A 1YKFA 3BMOB 3PIDA 3DBRA 3BTOA 4WK6A 3WGZA 3RBXA 2YFQA 3O8QB 2GR9A 4I5DA 4ALLA 1HYHA 5KVQA 4R01A 1JAXA 3OJLA 3AI1A 1NQAO 2X9NA 3H6KA 3LLSA 5TIIA 2X5KO 2ZYGA 3W1VA 2GN8A 4ZRMA 2J5RA 4IY1A 1XQ1A 4YTEA 3DZBA 2QZZA 3PQEA 3FNHA 4AJ1A 4GX2A 3WQRA 2ZTVA 3EY4A 4YEDA 1G6KA 2D2IA 3GNSA 2QZ9A 2NVUB 2BGKA 1HKUA 3WTCA 3Q3CA 3K73O 1HDZA 3P2YA 5EERA 2C5AA 2ZATA 3KBOA 3F5QA 4D41A 5H83A 2NU9A 2X7HA 3S55A 4CLRA 2QYSA 2IODA 4FN4A 2ZKLA 1PX0A 2VTEA 3DL2A 3FBTA 2Q2WA 5ILGA 3KLMX 3LC7O 1FF9A 3K5PA 3DAGA 2VWPA 4PLTA 4BOYA 1H93A 4ALMA 1O6ZA 3W6UA 3B70A 4ALKA 4UEKA 2PD4A 4HFJA 1TVEA 2R00C 1TI7A 2AEMA 1LQUA 4BMNA 1R15A 2Y1OA 5DOVA 3D0OA 1RM0A 2CNBA 2BLLA 2VTDA 5TSDA 4XDYA 5A4DA 1ADGA 1ONOA 3R3JA 1J0XO 1ZVMA 1F12A 2EF1A 4EYEA 4XQGA 1YH3A 3CSDA 2JJYA 4HP8A 2PTGA 4MVJM 4IBOA 2DUWA 4WOKA 3TOXA 4AL4A 1MFPA 3JD1A 3ZU2A 4P22A 4I9NA 4PZDA 4HXYA 2DKNA 3KYBA 1PR9A 2UUOA 3LC2O 4IXTA 4II3A 5KIAA 3F4BA 3LQFA 3SC4A 1G1AA 4RF4A 4YAEA 2JFGA 3BMCA 2JFHA 3JQ7B 4NJMB 2YV2A 3DBHB 5GZ1A 4YJHA 1QV6A 3D4PA 1KERA 1I3NA 4XR9A 2XXBA 4GGPA 1RM5A 5DCWA 3IJPA 3GAZA 2YYYA 4DVJA 4CQMB 4DPKA 4WNIA 5IAAA 3VVBA 5KCZA 4CMEC 4GKVA 4OQYA 3Q11A 5COQA 2Q99A 3COSA 1Z45A 5FFFA 1UH5A 1FJHA 1SOWA 3JYNA 3JTMA 4FFNA 2X1HA 1MG0A 4LSWA 1U4OA 4OOEA 3MJTA 2NTNA 2UVDA 4EUHA 3PZRA 1M75A 4UUMA 3GNQA 5C37A 1XEAA 2FR0A 4BGIA 1Y1PA 3ICPA 5CEFA 3A14A 3R6DA 3BTVA 2IYPA 5A04A 2VWHA 5ITWA 4URFA 4NBWA 5LC1A 1CWUA 1HLPA 3FR8A 3A9WA 4LSMA 2BMAA 5BNIA 3C1TA 4R5HA 2XAAA 2FZWA 2PZLA 3LVFO 3OBBA 1H6CA 5KJFA 3PPIA 3KSZO 3OIGA 3E8XA 1PJTA 1D1TA 1RYEA 4MINA 3OEWA 1EQ2A 5ER6A 5KKAA 1G0OA 4F6LA 4CM8B 3OJ0A 1UAGA 3WQQA 4OXYA 5FEUA 2EIHA 2PH5A 2RBEA 2VHZA 2IZ1A 2PWZA 3LT1A 3WGOA 3NTOA 4HADA 3AI3A 4NH4A 4MKZA 4IZHA 4J1NA 4K6FA 4WE3A 1EDOA 4FFMA 3DZKA 1HL3A 4XRGA 1JKIA 3IQDB 5ER9A 4HKTA 1DLJA 1U3TA 2GPTA 4D0SA 1I5RA 2X5OA 3FNGA 2HSDA 3DTTA 3JD3A 1R6DA 4Y6PA 4CMKA 2O48X 2GSDA 1NVGA 2DUUA 2HMVA 5FI3A 2ZCVA 8ADHA 1U5CA 3PHHA 4QQRA 4CLOB 1NTOA 3DZGA 3HN2A 3WBBA 4AVYA 5TT0A 1NR7A 1QKIA 3MWEB 4NJOA 4R1UA 1EVYA 3GMDA 2C20A 1W6UA 1AXEA 5K9ZA 1SZJG 4XQEA 3GGGA 3PHJA 3TSCA 3ZWNA 3WICA 4NFSA 3IIEA 2DBRA 4KDFA 4A73A 3PJGA 3I9MA 5HBRA 3E5MA 4UUOA 3ZGYA 4NK4A 1ZKMA 3F6YA 1QV7A 3F5SA 3JD2A 4CR7A 3U9LA 3BMOA 1BW9B 1FDWA 3PEFA 2UDPA 3O8QA 4F3YA 1NVMB 5LDHA 3K9QO 4CV2A 5L53A 5A9TA 3ON5A 3E48A 3VH4A 2O3RA 2PKQP 1DJNA 3L4SO 5A5EA 1G0NA 4OSPA 4IJUA 3DBLB 2VUTA 4BKUA 4DQXA 3HJAA 3OETA 3ZV6A 4B7CA 1JVBA 4J1TA 3E6AA 4C7JA 4A7PA 3KVOA 1X13A 4XWYA 2X23A 1YE3A 2JCVA 2NVUA 2VHWA 4CV1A 3ROKA 1HDGO 1Y8RB 2GN4A 3IC5A 4GGOA 2NQ8A 4DREA 3ZV3A 1M67A 1GUZA 3KYCB 5EL0A 3V8BA 5MDHA 3DHYA 3GZNB 3QQPA 3TL2A 1RM4A 2Q1SA 1KIFA 1L1FA 4J9UE 3PYMA 4S1VA 4DLLA 4GSLA 1RKXA 3PWKA 4MVJH 2D8AA 4QO7A 4BMSA 5LDGA 4J0FA 3ZU4A 4E13A 4Q3EA 2BF7A 1OC4A 1DEHA 3GMSA 4RVDA 4E12A 1QG6A 3WGQA 4IGFA 1E77A 3U62A 3D64A 4R1TA 1AUPA 4GPD1 5AXDA 5HTOA 1VKOA 2YHUA 3F47A 3NGXA 4KTTE 4BNLA 4PGFA 1H9AA 1DSSG 4BV8A 4OSOA 3OHSX 5HS6A 4EI2A 3VPSA 2FPGA 1JW9B 3GOHA 3PDJA 3RJ5A 2G1UA 3H9UA 1YJ8A 3G17A 3QY9A 5J23A 4J16A 4YXFA 4E5MA 3QJ5A 1HYGA 2X8LA 3T4XA 3JQAA 4FCCA 4AJKA 5IFLA 1VM6A 3GFGA 3I5MA 1PGJA 3JQ7A 1T1SA 3OF2A 3DBHA 4XIJA 4Q3CA 3WG9A 1E5QA 4BGEA 3GVCA 4NR0A 1SB8A 2GRAA 3LC1O 4DGSA 5JNLA 3INRA 1HE3A 3BXXA 2WMDA 4TQGA 4EW6A 1E3WA 3DDNA 2EKPA 3AY6A 3C1OA 3DOCA 3RKUA 3TN7A 5IJZA 4OL9A 1ZH8A 1SMKA 2VRCD 3H4VA 3I9NA 1HDOA 3NDRA 3BIOA 5JAZA 3ST7A 1KS9A 1VRWA 2OBYA 1PWZA 4RGBA 2EW8A 4B3JA 4C4OA 1GYRA 1E3LA 4BNJA 3GEMA 3RUIA 1F8GA 3WJ7A 3X2EA 2I3GA 4NPCA 2Y05A 4DC1A 4Z0HO 2ZJ0A 1BHSA 1Y5RA 3ORFA 5KJEA 2DAPA 3QVSA 5GZ6A 2X5JO 1TT5B 2VHXA 4YJDA 1KY4A 2Y99A 4FOSA 1GQ2A 3I23A 5B1YA 3PHGA 4DPLA 4YJGA 2DPHA 1TEHA 1YWGO 3IP3A 3RU9A
chains in the Genus database with same CATH superfamily
1YK0A 4X94A 1R6TA 3MNFA 1IK4A 6REQA 1UP4A 2C5LA 1GA6A 5HMLA 4QD3A 4WCFB 5ENDA 5JQGB 5ES3A 5FCDA 2VVTA 3NHZA 2A5GA 4GKBA 3AKDA 4DZTA 2QM7A 1PP4A 3AF4A 3NGLA 4NU5A 1LFAA 2IHUA 4Q4JB 1OA0A 2MSLA 1VJ1A 2G5CA 3HXLA 1BCRA 2YZ7A 2EBHX 1GQYA 2YUIA 1F0KA 3GUYA 4IFEA 4RPJA 4FGKA 4ZAYA 2B4KA 3RRZA 5BYJA 1IHPA 3LX6A 3W77A 5CA1F 1MOSA 4DUPA 1NXWA 4RAOA 5LQKA 1LSUA 1W0CA 2QRVA 1J99A 4MV1A 4OH1A 1NW6A 1QHSA 3AONB 1ZIXA 2PR2A 1PL6A 4B45A 1EVQA 4ZJUA 4OO3A 3D02A 1UXHA 4K6HA 4XGQA 4KQ2A 1UMCA 2BJHA 1UPAA 4GP7A 4BTVA 3D8RA 1OZHA 4BLVA 4G5HA 1HPLA 4Q47A 1NA5A 1CR1A 1HQCA 3TMYA 4Z51A 2QX4A 3NMUF 2H2GA 2C99A 3NUGA 1LU9A 2A1TR 3LRPA 4UARA 3DAYA 4MVJP 2BWJA 2ZTUA 2CXPA 3PDCA 4AZWA 4M54A 2DLDA 4IDFA 4W6QA 2RHHA 1QFZA 1J07A 2J1LA 4IDOA 1SURA 4UBIA 1P61B 2D13A 4CFZA 1FFXB 1NFQA 2ZYDA 3GPBA 3RTGA 1YAHA 2MSCB 3RG8A 4FFWA 4WK0B 4RIEA 4ARUA 1GKKA 3WLAA 2XVMA 4L5BA 1JDNA 4NMWA 4WLUA 4B81A 4CIXA 1R37A 2O2IA 2AHRA 3A3KA 5G41A 1T25A 3W8EA 4YMWA 3AJRA 4B32A 5KNDD 3UYKA 4CHTA 1YZKA 2D2EA 4TUYB 5AUQA 2XA1A 3PXUA 4YRTA 3B7GA 2DXIA 1NV8A 4AZVA 1MAAA 2DE0X 1IMJA 5JLAA 1VL0A 5EKXA 5HS4A 2XW6A 1V9SA 3D8NA 2QXTA 2G63A 3FNRA 2CZGA 5DHUA 1W49A 4ERXA 1IQUA 2E1PA 2SCUB 1VC2A 5CGZA 5EE5B 3KOWA 1P3Y1 3JYQA 3IE0A 4N7RA 4BQFA 4MHTA 4CCWA 1KYYA 4X8LA 4AECA 5TNXA 2RGNA 2IYUA 1ZK4A 3LI2A 4N4AA 1Y0BA 3BD6A 4D6XA 1Z4LA 2KSQA 3FZEA 1SHTX 1WHTA 4I6JA 4JHXA 1SIOA 4BO6A 2BKVA 2J9XB 5JH7A 4JBNA 1BTOA 1Z4OA 4W99A 1RQLA 1ZVJA 4FYWA 4YAFA 1MPTA 2ZIFA 2GXSA 1XCMA 3B6EA 3EGXB 2EGGA 3H5VA 3UN1A 3FKSD 4DDTA 3H3FA 1M6VA 5FL3A 3W5SA 1J2RA 1D8AA 4CL2A 4QOGA 3T4EA 4IJQA 1VA5A 2JGDB 4TLMB 1GEEA 1ZNYA 3H6HA 1R0BA 3TB6A 2Q1WA 3TWOA 1T4CB 3ET5A 4U2KA 3ZHXA 3SF0A 5FPTA 5E0OA 1DG3A 3HHEA 2OLKA 1E2KA 1WMSA 1P81A 2DFDA 3TQTA 3RUAA 1U81A 1ESZA 3C14C 1GQQA 1PT5A 3HWSA 3K0KA 3MOGA 2NZJA 2R00A 5C5IA 4AUNA 4Y6RA 2JIOA 4NCBA 1W8DA 3VOBA 3PXDA 3ZGOA 3PF8A 3C7TA 2Z2JA 3OESA 2NP7A 1GR0A 4Z9YA 3OQBA 4C2TA 4A03A 2RSLA 3IQZA 4CTOA 1CFJA 4NE7A 2EFEB 3EIEA 1EP2B 1UC5B 5AWFC 5KNBH 2QTNA 4M99A 1OW3B 5C9ZA 1DP4A 2IT1A 2QI9C 3E7FA 3QV1A 4MEBA 3LT0A 4BRSA 4YV2A 4G3XA 1TUGA 1BOFA 3QMPA 1SHKA 2OXIA 3UIEA 1JR2A 4YDRA 3GHYA 1J25A 4XRRA 4RTLA 1ADFA 5LMNB 1KZ9A 1Z7BA 1U9IC 2BGJA 3OH8A 4LJ5A 1LPMA 2EZUA 2IUTA 4O4HA 4JCOA 4QSHA 5FB3A 2J0VA 3T5MA 4EK9A 4XWOA 4ZYLA 3ROPA 3A2KA 3GT0A 2BGLA 3DGFC 4I81A 2OGSA 2NO4A 4B7UA 1GPLA 1TCBA 4ZI7A 1KPHA 1FYFA 4XVRA 4B6EA 5A2QA 1SC3A 1VHWA 4G5GA 2IKSA 4H17A 5K1ZA 3CCCA 1ZICA 2Q62A 1AHIA 4Y1RB 2FX2A 4FFSA 3QUQA 3FRHA 2HWXA 4J3JA 2DR0A 1A7JA 3I1IA 4XR4A 4L4UA 3RK1A 3W9SA 1AMUA 1L7BA 5CFMA 3FCYA 4H6VA 1BX1A 1UK7A 3QUCA 3SWWA 2O7QA 1ODIA 3U4QB 2F1IA 3R9XB 3T5CA 3CS3A 5BSGA 3NFYA 3HU3A 1L3CA 2QL6A 3ZHVA 5JRJA 1E98A 1KO8A 4BNZA 4P4UA 5ILQA 1E5LA 1PFKA 1RW4A 3JW8A 4OJKA 3S99A 3GT3A 4IGKA 1FJ2A 4LVUA 3HE3A 4CMJA 4QG3A 5LFAA 1Y4UA 3JQEA 4GLLA 1SD5A 5F9MA 3H2BA 2GBGA 2GASA 2IEGA 4IXMA 1K4MA 2B0JA 3TX6A 1IH8A 4J7UA 3HJUA 3IVCA 4JD5A 2L19A 3OT5A 1GDHA 2IYFA 3HDJA 4IF4A 5IVDA 4FINA 2O8EA 1S2GA 3EPKA 1WP9A 3GRPA 3E3OA 2BN4A 3GBPA 3OOSA 4YO8A 4YT8A 4XXHA 1TMGE 5CIYA 3DQZA 3PE6A 5IC4A 1YONA 2CFIA 4IP0A 5AKZA 4HDSB 4IDDA 1SCBA 5FUVA 4F84A 3LT5A 4JJ8A 1LC3A 2ZB2A 5A5VA 3K35A 3UGKA 3V46A 1X39A 2XOXA 4I5EA 2D0PB 1B2LA 1GAQA 2I76A 2FK7A 4YP1A 2CYBA 1KQ3A 5J43A 3PCXA 4FHZA 1LUAA 3CZCA 2FPPB 3D0QA 3H9JA 2Y0PA 2C5SA 1N5OX 1KYWA 4QUJA 4GF5A 1GRNA 3N0XA 4OHUA 3L8FA 3W6ZA 1G18A 3HJGA 3DWEX 4KQ9A 5CIWA 3D4IA 4W5JA 3JQAD 3I9FA 5ESXA 1C1HA 1YR2A 2BV3A 3R7NA 2ZJ7A 3O74A 2C2WA 4RV5A 1FXWA 1Y7PA 4YYZA 4PSKA 2I6QA 2WE7A 1T6NA 2ECQA 2I1QA 3GRVA 3KPYA 3F3YA 1DRKA 2P91A 1H66A 4IRMA 4O4LF 5G0TA 5AJZA 5EIBD 2VEOA 3E9MA 3JQ9A 2FXVA 5TQ0A 5L3RA 3UAXA 4YAOA 1E2NA 1HTBA 4XYBA 4F0JA 4R0MA 1VJRA 2DY0A 2VJBA 1H23A 1PR1A 3H2JA 4HAIA 1XK7A 2FSIA 4QDKA 4ZTBA 4QTYA 1QFSA 1KDPA 1KYVA 2E4VA 2ORIA 4D0RA 1XPUA 4ABTA 4OXKA 4JELA 2GBLA 1UP7A 1PTJC 2O14A 4L15A 2YWFA 4GD3Q 4QQNA 4TXJA 4V0QA 2NPIA 1LLDA 1CS0B 2ANCA 5C5DA 4MS1A 3WLFA 4UQOA 3O93A 3VDMA 1XP8A 2F43A 3OA0A 1ORDA 3WMXA 4G09A 1JNXX 3HBAA 1HE2A 1TO1E 5HXAA 2GJ9A 1HI9A 3CE6A 4YALA 4ARZA 1Y4SA 2X40A 3OKFA 4BDTA 3SJ7A 2I3BA 2DFVA 4D3SA 4EGCB 5C7IO 5DGDA 1CETA 2BGWA 4V38A 2ZBQA 3GG2A 2FRXA 3CF2A 1Z5ZA 4ASUD 1QRTA 3SVZA 5FPPA 1T9AA 2OT3B 5JBIA 2HRZA 4B2YA 3LWBA 1KZ7B 1E1LA 1D0VA 5EUCA 1XZMA 3R8XA 2IP1A 2Z6UA 1QP0A 2XSZA 3N0VA 4B6PA 3ONWA 3KXDA 2W98A 4GL2A 3Q12A 4B0PA 1KBOA 3CCBA 3F78A 3QRWA 1ELOA 1G6HA 1K5DA 2O0MA 5IWCA 1EFLA 2FDXA 1TAQA 1JR3A 1LA2A 2AW5A 3WX0A 1MBZA 4PPYA 3VV2A 1JFTA 1IBKB 4C0JA 2JBWA 3GROA 3A28A 1NT2A 4GOMD 5IJWA 2F64A 2VJCA 4Q9AA 3ZLVA 2PG3A 5CVVA 3GVHA 3LA6A 4ZDKA 3WL5A 1D07A 1XEWY 4JJAA 1DEKA 1QUFA 1A2BA 3PGMA 3VTZA 4Q16A 2HF7A 3NPAA 1HLGA 2JLRA 1QGOA 5EVCA 1PR3A 1BN7A 1X7XA 2A6PA 2CCGA 2AEFA 1BRMA 1VSTA 2X42A 1GGHA 3KYJB 5BNFA 1GPUA 3BIWA 4CLEA 2OYSA 4CIAA 4FYJA 1ZL2A 2I4RA 2QN7A 4EY3A 3LHDA 4KCGA 1JFLA 1BXKA 2A58A 4IIUA 1J7KA 2G25A 1COWA 1Q1ZA 1FRQA 3WA6A 2QMOA 3DW3X 2NU8B 3NP9A 4WH0A 1GD1O 1WB6A 4M8LA 4PPNA 5HFJA 5LMCA 5E6RB 5CCBA 4ZANA 3VNAA 3AOGA 1VRCA 3TG8A 3ANSA 5KMGA 4NMHA 1IMOA 4RGVA 4B6OA 4CDRA 3R4VA 1HT0A 1RWQA 1OAAA 4EVQA 3G82C 2P2SA 2AQHA 1M83A 3KAQA 4LYGA 4HCJA 4X1KB 3NDBB 4MPDA 4QBGB 3ELYA 2AC2A 2B2XA 1FFGA 2LNDA 3MGBA 2Y3IA 1IB6A 3HR4A 4YCSA 4PVDA 1QH0A 2JHAA 5DI3B 2O2XA 4M7WA 1VB3A 1VL8A 1TLFA 2ZB3A 3HABA 2PGOA 2BH9A 4GBJA 2AKEA 3U4MA 2I1WA 4U1RA 4RTSA 1QYWA 1LSOA 4M4SA 3ZWWA 4K9PA 4DWWA 3O4HA 2H4XA 3T94A 1ZG3A 3ADBA 4YUXA 4WXPA 5KTYA 1UKBA 3DAPA 2HDNB 1R27A 4NIMA 2ZK7A 1QIHA 5D5HA 2VPTA 1BEEA 1EFVA 4FDLA 1YI1A 3ANTA 3TOVA 4JI5B 1FSPA 1RE1A 4ZVVA 2HO5A 2RGAA 4RKRA 4CKWA 2O0HA 3T9FA 2XUQA 1KI1A 2WT4A 4D9FA 2WIGA 3GDGA 4K3VA 4INJA 2IZOA 2WKWA 3TTVA 4TGLA 3BCSA 1YZNA 1T9HA 2PBZA 5CTAA 2P2LA 3BICA 2BE7A 2AUNA 3R2JA 5HMMA 2O7NA 4L75A 5TS3A 1IIRA 1K8ZB 1ETUA 4JZYA 4OD0A 5HF5A 4I99A 2K6GA 1JSZA 4Z4CA 1OMOA 5K4HA 1DQRA 4ZDJA 1TAUA 3BDAA 1PSWA 1N7GA 2OP0A 3DJFA 1X42A 2HGSA 1MG5A 2F90A 2J5BA 3GI1A 2FUG6 4R84A 4ZK2A 3IEVA 2MYUA 1K88A 1KSHA 4KGDA 1F1BA 1KVTA 4Z1MA 3RUEA 1DHTA 3CZRA 1T24A 2XDWA 7ADHA 1K1EA 4WCVA 3G6WA 4AUMA 4RA6A 4LV8B 1XT6A 2WVHA 3X1YA 2PUEA 1UJ5A 3ZXIA 3H8WA 5H8WA 4R1LA 1R66A 1PIWA 1ZK0A 1XMXA 2BFEB 5CA0F 4RCYA 3PVSA 4JR1A 4C5BA 1L4NA 2X41A 2CLCX 1O2DA 2BUBA 3BN3A 3BE6A 2KHZA 1DWQA 1N75A 3KAKA 3NWJA 1IM2A 5DU2A 4B2LA 3RI3A 4NENB 1ORTA 3PNLA 4C6HA 3ERCA 2V7UA 1ISSA 2E6KA 2P9JA 1HSOA 4G36A 3EHDA 4W8OA 1YDGA 1UM9B 4MQFB 3RASA 4C7BA 4KWCA 4FZ5A 4N5MA 3RTDA 4DRXB 4DR1B 2RHTA 2VDUE 3T1NA 3DZCA 3HUUA 5AFSA 1MFZA 3ZE2B 1U7PA 1JB1A 2Q4BA 2GKSA 1U4SA 3W3AA 3FOWA 2VPZA 1L5MA 2IYVA 1EI9A 2AOUB 1KJIA 2TSYB 2VA9A 3A0UA 3TI9A 3F3SA 4YV7A 2O54A 1UZUA 1ZC3A 2ZXUA 1PEKE 3NHRA 1WDLA 4Y2QA 3IP6A 1JFFB 3QELA 4PYLA 3FIUA 2AC7A 3HB1A 3BB1A 3VR5A 1CW2B 2IYNA 1Z17A 1WXHA 1ZA1A 2F62A 3TEMA 3FCOA 2WFAA 1NHWA 3DVRX 3QEAZ 1A4UA 1GGMA 1ONSA 1IVSA 1V48A 3E5RA 3X43A 3PZBA 4JGIA 1L8XA 4M9UA 4QSMA 4DA8A 4N6OA 1Q7EA 2FJPA 3E3MA 4OEHA 3F6RA 1ODCA 1CRWG 2OGUA 1HYBA 4XYEA 1QU3A 1EKXA 2I1LA 3BGOS 4UAUA 2BJVA 2XD4A 4A2CA 4Q7MB 3UJDA 3UJHA 3ENKA 3LBFA 1C3EA 1JH8A 1NLFA 1QMGA 2YUTA 5LR6A 3CKYA 5TMBA 5FLXA 4KPEC 1JEQB 4WFQA 3N76A 4AY4A 4BBAA 1DIHA 4B9AA 5AOAA 3SIXA 4CV3A 2FP4A 3C3XA 3QV2A 1MVLA 4GX5A 3KR0A 2OC4A 3DXXA 2DPLA 4JVSB 4K0RA 2WWRA 1UZLA 3LXMA 3STVA 5HPYB 1QIJA 3NBQA 4HK4A 1YU9A 1KDVA 2H1HA 5ALQA 2VXYA 3TQHA 2V9ZA 5JV5A 3QEKA 2BZGA 3P9XA 2NTEA 5J4YA 2DLNA 3FSGD 3B82A 3FF1A 3SQXA 1TEVA 3EXG2 1B15A 1IWPB 2O8DB 3LP5A 1UK9A 3BXFA 2P11A 1GQOA 3UH1A 3J81k 3I09A 5CDYA 5HOEA 3AW9A 1XRLA 2ZSEA 1TQ8A 2QJWA 3KJZA 4P53A 2C1EA 3MQFA 5ENZA 3RSLA 3ZDZB 4YMVA 5BP7A 1QIIA 4HBGA 1RHMA 2WKQA 3GB9A 4RY9A 2A1IA 4X54A 5DTQA 4DYDA 3VMMA 1DL5A 1P1HA 4AIRA 4C22A 5JAOA 3UXHA 4MROA 1GSOA 2XZLA 1O95D 4M8KA 2PX0A 1HH4A 2J3KA 1JLKA 5DE3A 1WPXA 1IB0A 1PR4A 3USZA 4MUIA 4FVTA 4A10A 4B79A 4ZYTA 1E1NA 1VKJA 3EUWA 2R65A 3HRIA 4GM4A 4CF7A 1EUZA 3EPLA 5C8ZA 2GH1A 2QBYB 4AKGA 2OVFA 1VSBA 2GO7A 4IIYA 1UXGA 3AMVA 1ENOA 1UC8A 1ZI6A 3NQ41 3W5IA 3D8UA 4DAOA 2ZAOA 1G55A 3K6SA 2X22A 1G5PA 2W8ZA 3GH1A 4ECAA 3OQOA 4CM6A 1I10A 3VJKA 5BSVA 5IH7A 4Q3LA 4ZV7A 3L0BA 5TQ2A 1GAWA 3DFMA 1E3EA 3LT2A 4RFSA 4G97A 3LECA 2SNIE 4AMVA 2A0UA 2NT4A 4PU0A 3HXPA 1RRFA 4D4GA 4QEDA 4KFCA 4FZJA 2TMGA 1PQWA 1YNOA 5DBEX 2GEJA 1OH6A 1HF3A 1FLAA 4NNOA 2NT3A 1QFXA 3EVCA 4UD6A 1BA3A 2F1JA 1IN8A 3I6MA 3MD9A 5EJFA 5BPHA 3C6QA 1H0HA 5C3UA 5GZ3A 3G5LA 5IRCD 2GTHA 4KE6A 1B0AA 3RUCA 2XBLA 1Q7GA 2EWWA 1IPHA 2WNHA 1NNEA 2WD9A 4PGAA 3KL2A 3E5NA 1RZRA 2W2KB 3FCEA 2FFBA 2KS6A 4P93A 1QH1B 3O75A 3V1UA 4OQZA 2AFIE 1M7BA 2NVBA 4FS3A 3PKIA 2AV6A 1XLVA 1EP3B 4A8TA 4BTEA 3U7HB 2XVXA 4PGMA 3TLXA 2F4VB 1DT5A 1ZOOA 3A06A 2H48A 5TC4A 1E1MA 1O6BA 1XU9A 1UAAA 4NC9A 5I7OA 2F1HA 5KSPA 5JT1A 1EVLA 4O4IA 2GUWA 3M6IA 1R8YA 1AX9A 3K1ZA 2Q3HA 5IVKA 2P6OA 1I0IA 3QBJA 4Q9HA 4RCZA 4AJLA 4DE5A 1FSZA 5KHLB 2R87A 3CVVA 3DMDA 1TT7A 4KPUB 4NJMA 2X9GA 1X0XA 3NH9A 2WLSA 4U7DA 2EWVA 4X64B 3WSWA 3B1ZA 2CDAA 3VYUB 1I32A 1IUPA 4CCYA 1L3IA 5DRYA 1IHYA 3EXIA 2SECE 5CVTA 3CG4A 3WWOA 3JYHA 4KQKA 4UEWA 1I7LA 2Y27A 4E2WA 3SQOA 2XYQA 3PXXA 1TU4A 2E2WA 3HB9A 1U8ZA 4PNZA 1L4YA 2P7IA 4EH1A 3GRKA 3H05A 1RCFA 4FGZA 4URHA 3A2NA 2HDOA 4NBVA 1T5TA 3AZPA 5JFGA 2WB2A 2HHHB 3L0IB 2EFGA 3AVPA 2P2CA 4ZN6A 2VNHA 5JNRA 4NLLA 1OXUA 3HU2A 4KQXA 5J5CA 3ZHCA 4PINA 1GSAA 1OYVA 1WLYA 3ZD7A 3OWHA 4FC6A 4BN5A 3UMYA 5KDDA 5E9QA 2BZ1A 2ZKIA 4F4FA 1N36B 2A2ZA 4KO2S 3FVWA 4D9IA 4DMLA 1KMIY 1XALA 4JSYA 4HVLA 2JHGA 3P9RA 1M34B 4WLVA 1OBCA 3AVTA 3B6JA 1KI9A 3OQNA 2Z8YA 1TUEA 3CLSC 1RP7A 2H5IA 3ABZA 3QMVA 1MZPA 2B3TA 5EMHA 1KDTA 2XUDA 3K1YA 1EDEA 3B1KA 1FMLA 4RPLA 1EFRA 3ZE8A 5ISMA 1LPNA 3PC8C 4P98A 4CM4A 3EOZA 1AA6A 3GP3A 4FCWA 2GM4A 4A6EA 4BNFA 3T06B 1WXXA 2IX3A 2H1SA 1T1EA 1R5JA 4GMFA 4NK5A 2PGAA 3NEJA 2DPGA 3DMTC 4YR9A 5DV9A 3I9V6 3AQIA 1U94A 1L7RA 4XPZA 2AFIA 4J0JA 4YRNA 3TZKA 3L1IA 3U5ZB 2MIIA 1SC4A 2O2DA 2Q3CA 5A5FA 4XEHA 1LDYA 2IS6A 1BG6A 1JJIA 3MTGA 3RNLA 3B85A 2LTAA 3DMYA 1RBZA 1E6CA 2EGHA 2H1LA 3E70C 3F4KA 3LO8A 3O7MA 1G38A 1XJ5A 2C03A 5HDBB 4P34A 1AK2A 2OAP1 1G7SA 1B93A 1SNYA 3VTKA 3PQ3A 2B1JA 5JD3A 3NTRA 3FPBA 4JASB 5JY1A 2OZVA 1ZITA 2ZSIA 3EC7A 5FEMA 4UHEA 3AHEA 4LI0A 3L6OO 1W4AA 3N8GA 2M9MA 4MI3A 1OT5A 2WNSA 4GH5A 4OYHA 4X95A 5FPYA 4IFIA 3SX4A 4XWKA 7MDHA 2PQ0A 4ND4A 4ITUA 2XOKA 5CX4A 4AY6A 1WP4A 2NWQA 1XWFA 1YS4A 3MWEA 3LF2A 1U2DC 2XE8A 2VSNA 1AKWA 2WIAA 2QZPA 3OZVA 4NDNE 4OHBA 3WB1A 1UBOS 4C7VA 4F2PA 2ADMA 5JAMA 4B6FA 5A3VA 1ZISA 4I36A 4OP2A 5T3UA 3F2IA 3FTCA 5ALVA 1FTGA 5EOVA 9LDTA 4L8WB 3FMIA 2DBQA 4R68A 3OOHA 4F3NA 3KX2A 4LDPA 1CUBA 1O94C 2VOEA 1FYWA 3MJDA 1X15A 4RKQA 4QO8A 4DIKA 2WUEA 1BQEA 3C3YA 1QZUA 2Q5IA 3P2OA 4DEYA 4EY4A 1NE2A 3DONA 5AW9A 2B1QA 2PUCA 2EW2A 2YRXA 4TWAA 5CB4F 4W5RA 3TD9A 3EWIA 3TVDA 2FPIA 3B6IA 1OLUA 4PSCA 1L4GA 4RA9A 3UK7A 4TM8A 1VE3A 1PT8A 2G5PA 5E6UB 1P2VA 1PNQA 5HRUA 2O1XA 3IE2A 3WRXC 4M76B 5GV8A 5HUJA 1BOOA 3A3NA 1VMAA 3HXTA 2B4AA 2BKEA 4DIFA 1SAYA 1Q21A 3LIPA 4IO1A 4EENA 3X3HA 3ZS9A 4E7OA 2PH1A 2ZE5A 4BQNA 3FTEA 2JIDA 2PRYA 4DY4A 1PZNA 3BL8A 4RNCA 4EVRA 1ZHFA 3C6XA 2VJDA 1K2VN 1Z6ZA 2X4GA 3LUBA 4B75A 2G9QA 4V39A 2VHVA 2QEQA 1W48A 4Y2SA 4ZPXA 3EEOA 5HKBA 1UBJS 4G4SO 1XTPA 5TQVA 2X14A 1AKEA 4Q00A 3EH1A 2EZ8A 2XMCA 3VAZA 5BSEA 1NW3A 3CBQA 2QR3A 1P1FA 2JIQA 3W4IA 5JROA 3KYCA 4LDZA 1HE5A 2X6QA 3CV3A 3ANMA 3ZBQA 4MVYA 4FYHA 3KP1A 2CXRA 4KQIA 3EVFA 3K96A 3G5TA 4KQ6A 4XUEA 4HRAA 3GFSA 1TKCA 4XWWA 1P7VA 1NTRA 1J97A 1KQFA 2XCOA 1M2NA 1Q0QA 1BXRA 1WEHA 1R0ZA 1HQYE 1BQ4A 1CLUA 2KJQA 4NULA 5GP1A 4BKQA 2QTLA 4KSBA 5J2TB 3IOYA 1C3OB 4RDHA 4IH1A 3TRIA 3IILA 1VDMA 2H92A 4B8WA 1XXLA 4ETIA 2DPXA 1SO8A 2QSZA 1DJQA 4G9GA 5DEIA 4NAHA 5A3RA 2A3NA 3F5FA 1JJ7A 1ULSA 1V3VA 3HCDA 1Z33A 5IS2A 1C0LA 2VDOB 5JCPA 2ZBUA 3X1XA 4ZDWA 3MXOA 3DVAB 5P8WA 3QG1A 2JJQA 3SDZA 3OT4A 5EHIA 4ZAWA 3LW7A 4K9QA 3PDUA 3AUSA 5EQDA 3ZCSA 2AR9A 4B3TB 1Y3CE 3ONEA 5TY0A 1JHMA 1IRIA 3JQFA 1SKMA 2YWGA 2JI6A 1M6YA 1KVUA 3SSAA 3RCBA 4Z7JA 2EL7A 1XVIA 1RJEA 3FDIA 3NS7A 4KL8S 1GZDA 1O0BA 1YL6A 3DOHA 2QNRA 3AI7A 3NW9A 5DOZA 4YMLA 1G1MA 1VP9A 3LLMA 2M2IA 3OC6A 4Q4HB 2FMKA 3OQVA 3D6AA 4CRWB 1NHGA 4E4YA 1U28A 1JAYA 1QAQA 2HLDA 3FYUC 3D0KA 1J1IA 1KZ6A 2PTHA 3EUEA 1EB8A 5HQTA 3R3UA 3HCBA 1C0IA 1JJFA 1Z39A 1GWNA 1MRSA 3PQCA 4U00A 3K0CC 3JZFA 4D9MA 2VCYA 4UULA 3JQBA 1GCIA 4IIDA 3E9EA 3PUYA 1OH8A 5B37A 4W82A 4AJ9A 4LOHA 2FQWA 4ZT2A 3KSRA 5T3YA 3UO8B 2IH5A 4RFLA 3HVHA 3O8BA 5IKOA 1WE2A 3ZDFA 5I7RA 1ZC4A 4J0EA 3SF8B 3H65A 4KVGA 3MIIA 3N6VA 4S1TA 3THYB 3FSEA 1BDBA 4UUAA 2YXBA 3PYXA 4TZKA 3DKIA 3L77A 1SRQA 3K0EA 4EBBA 4GMHA 3O3CA 5C3MA 1EUCB 2VPYA 3UAGA 1Y5LA 1DG9A 3LGSA 3OOEA 4O2AB 5A9RA 3B1YA 3UA3A 3VKVA 3VYWA 1K3UB 1IM8A 3ENVA 2IEDA 1BA2A 1M1YB 2CWDA 2ID7A 1Q44A 5G2OA 4LFCB 3GP5A 3V32A 1QHEA 2VSQA 2V7TA 4Q34A 4MGZR 4D45A 4TZ6A 4KWTA 3HVIA 3IO5A 3PNPA 3TRDA 5DM70 2Q27A 4LX8A 1ZRSA 4WZAB 4BO5A 1GT91 1NUSA 1USWA 2FUG1 5EMJA 2CVPA 3VNRA 4CUJA 3L8CA 3ULKA 3E5HA 4YRLA 5EFOA 4BO3A 4F9FA 2PU5A 1N5DA 4EA9A 5LM3A 3DULA 3R44A 4MUGA 1XEWX 2CB9A 3EQ8A 1QV9A 3W5CA 1NE7A 4WKGA 4BX8A 2PGNA 3Q87B 4AY5A 3IP9A 3I42A 5F98A 5A5GA 2BEVA 1XCGB 3ZY3A 2C2HA 4JL5A 3X2FA 3DLIA 1WU8A 3CQ9A 3CRZA 4GBED 1JWBB 4G25A 1PEYA 4CN8A 4HNVA 4ML3A 1UWCA 4O0LA 2DETA 3T7IA 1ZONA 1NSTA 3DDHA 2BFDB 2BGTA 1VYHA 1B23P 4RSMA 2PPVA 4CIBA 4UNQA 4PG7A 1FP6A 4MJXA 4ITVA 1RZVA 1HE4A 2Z56A 4N6GA 4OLFA 5L3QB 4UHJA 1WETA 1P6UA 4M89A 3TLJA 3MUOA 2O3QA 4NU8X 3H5IA 2H3HA 3SXUB 1TK9A 1V71A 1XX6A 3HCEA 4NCXA 1L8LA 3F5DA 3HKEA 3NNNA 1TTQB 4PHTA 1A0OA 2B34A 2IDKA 2QTMA 3AKEA 1MIHA 2GUGA 2D0OB 3EIOA 1R8QA 5B58T 5K51A 4MQLA 4KIGA 5INTA 4BO1A 5LOVB 1S8FA 2HQRA 3I5YA 2IYXA 4LYFA 1PV4A 5IVIA 1Y4AE 4YBZA 1EP1B 3P9SA 3EFOA 1D4OA 1YS1X 1J1ZA 3WGUA 1PFUA 3DC2A 4TLAA 3GJ8A 1ZR2A 3GQVA 3HJNA 3WFIA 1KMHA 1RQXA 3OQ6A 3W0LB 4HDKA 5DCUA 1BKYA 1Z0KA 5EYPA 4X7RA 3GGSA 2AQ8A 3ENZA 1K89A 1CUIA 2FWRA 1IJKA 3C7DB 1DBVO 1H3FA 1VKHA 1JEEA 3AVOA 4P1ZA 4RIGA 5FYDA 4DW8A 2A78A 2J46A 1SUWA 2PLAA 2NPOA 3Q7SA 5JMOA 3E2MA 2ATEA 2AXQA 1YC5A 3DF7A 1V3TA 3HG7A 4O5AA 4KE9A 1JHRA 2GCGA 3CRQA 1GTL1 3IUBA 4MTCA 3D4LA 4QULA 5DGCA 2PFSA 4G0PA 3LUFA 3ZNOA 4C3ZA 1UC9A 4DJ5X 3F8WA 3L4BA 3SICE 2DZDA 2EKQA 1MA0A 1Z8DA 2HFJA 3LQ1A 4XUGB 1DKMA 2G1AA 3GLKA 4CKYA 2V96A 4IQ8A 4Q4AB 5EY5B 2CF5A 3EQ7A 2GOYA 3DEFA 4H7HA 2CXTA 2WHQA 2C84A 2PXCA 1LJUA 4U9IS 2F4NA 4JLBA 4MQMA 1Z13A 4ZHQA 1PHRA 5IHXA 4OH7A 3V5NA 4F85A 3MRVA 2C42A 4WN9B 2H9AA 3BIFA 4FZRA 4KG7A 4OXQA 5DW3A 4ALIA 2L69A 4RX1A 2A3RA 1M0EA 3EEYA 4MYHA 2VPXA 3SHFA 3AVWA 4DA6A 1PVOA 5L6LB 2JAUA 5ALNA 1XD2A 3NWBA 5CURA 3PXGA 3V42A 3A6HA 1XCJA 3GIDA 3KKQA 1NP7A 1C1DA 4RAQA 4MWCA 1P7PA 2YCLA 2B7BA 2RHCA 3MFQA 1UXIA 3LDUA 1SUIA 2ZB4A 1FUEA 5BSTA 4ZOLF 2VDKB 3QKWA 3T8YA 4WNYA 4A91A 3L43A 4BV3A 4ZIRB 3HVRA 4WJLA 4KXFB 4R0VA 2X86A 3JVUA 5BMVA 3AHGA 3JZMA 4DCGA 2HQOA 4OCZA 1YR7A 2OFOA 4JXKA 4EDHA 3TBKA 4L0CA 1RCTE 3HNRA 1V1MB 4MB2A 5J9FA 5FWNA 1Q1QA 4WZBB 2BEUB 2IZ6A 3PC3A 3QVXA 1V2HE 4JI3B 3QKSB 1IEXA 2O05A 1NY5A 5KYYB 4OXIA 4ZI3A 3E7XA 3IH5A 5ARDA 1Y9JA 4LHWA 3M8KA 5DLYA 1YACA 2E82A 3OX3A 5ALGA 3Q3EA 3T3EA 3VPCA 1ZJ5A 1A9XA 3P0HA 3LQRA 2NYAA 1RYFA 2R6GA 3CPHA 3C4QA 4PLZA 2QX6A 3T1QA 4AI6A 4YJKA 1NYLA 4BWGA 2PLWA 3FYUB 4Z9BA 1RKQA 1R9MA 3M6XA 2QL7A 2PSEA 3LS2A 1VFNA 3ZW7A 5LYJF 1YQUA 1I0ZA 3ZOZA 4QLOA 3MWDB 3TBFA 1RLMA 4RV9A 5CNIA 1PL8A 1QAOA 3A6DA 3T9AA 1QU2A 4OGWA 1K7CA 2OD9A 4IDBA 4X41A 3AEKA 5MGBA 4XOUA 2I29A 1I3LA 4M49A 3RC8A 3KZMA 3OPYB 4LZAA 3TRFA 3UY4A 4B4UA 2X9VA 1TW2A 2X3YA 1US8A 4E51A 2Z08A 2DSTA 1WQ3A 2OZLB 1KDOA 2G04A 4IOKA 4YJFA 3RIXA 3UJAA 3LZ6A 1Y63A 1P5FA 1CE8A 3HDVA 1O8CA 3PEUA 2LCQA 2D3WA 1YRAA 1NMYA 1XJ0A 3GDOA 1HLDA 1K27A 5JECA 5LVAA 4C89A 4N01A 3P8ZA 4H6WA 1PQ4A 4GR5A 1CY0A 4INPA 1QGUA 3KB2A 1DTWA 4LC1A 3GRRA 4MGIR 3AESA 3PHCA 5H5JA 5BWNA 4PGGA 1A69A 1E7QA 4LQ4A 5AVVA 5DWVA 3PXCX 4F4CA 1AO0A 1N8SA 3SJUA 1U7TA 1GPWB 2VK4A 2IHVA 3Q2IA 1FVOA 3COJA 4ND3A 2Y0BA 4RLFA 3KTAB 4BEJA 2VO1A 1OI4A 4Y98A 2PSJA 3IPAA 1EVKA 3OZBA 1DI0A 4Y2YA 5KVCA 1K6MA 3OFKA 3OP4A 1KF0A 4GZ3A 4WBNA 3EDMA 2C2XA 3HZRA 1P0CA 2BBOA 1ZUWA 3CM0A 5HIMA 3TNLA 3WHKA 3G2IA 1D09A 1MQAA 3F6SA 1MIOB 1EGAA 1FZQA 3ND5A 3SDBA 3CUVA 1X38A 3CN9A 2C8LA 5H4HA 3K09A 3FNEA 4QELA 5L4SA 1OBVA 4R9RA 1ZD5A 1LV7A 2QNIA 3DEAA 2OWEA 3IBTA 1V6AA 1IY8A 2V4UA 2B4QA 4YMIA 3S4YA 5JVDA 1GVNB 5EXPA 3PC6A 4MDHA 4ZZ2A 3FETA 3NAMA 3IKJA 2HHCA 4X60A 3ZX4A 3C70A 4EGAA 1HEIA 4C4XA 1ZJJA 1VLZA 4KQJA 2OV3A 4PCVA 4R69A 3PPWA 3PRJA 4CQLA 2WG2A 4N47A 3SYLA 4EL5A 3DZDA 1M8KA 4F04A 1MO4A 3QPCA 4YLEA 2B92A 4I50B 1R0RE 1W85B 1QYDA 2NTJA 3AHHA 3KO8A 5U4XA 2NZXA 2PKQO 1P2UA 1IVNA 2DC1A 3IXQA 3GWGA 3BA1A 3A6LA 3C41J 5JPCA 1EAMA 2PKWA 5JWHA 1IONA 1EXVA 4UREA 3M6WA 3RVQA 2QM3A 4BB0A 4H60A 5JSKA 4A16A 4RDIA 2YFKA 4TKUB 4DCNA 1B1AA 1FPMA 3RAFC 5ERYA 3PICA 3KFVA 1KS2A 4X8OA 1W2HA 3ZTWA 3IXLA 4DFDA 1UPTA 1L4HA 1VSVA 3I9V1 2XTAA 3WWEA 3AF6A 2JH9A 4RF5A 1U1DA 1DJLA 4YT5A 1PZFA 1X7GA 3JV7A 4R1QA 2J6IA 2PUAA 1EK6A 1G8YA 2AI3A 1KEUA 1WXWA 5LBUA 1FOEB 3CZPA 4DXDA 3NAQA 3TE7A 7REQA 1E96A 2P3QA 1PQPA 1SVKA 4AWXA 3GRUA 1KRHA 3YASA 5E7JA 4DZZA 3MRTA 5CDGA 5LZ7A 3DMGA 4DV1B 1XZQA 2IU0A 4J0HA 4LXUA 4BLWA 5KYTA 5ALXA 1JFSA 3WYCA 1T4DA 1UMCB 3R5KA 4EY6A 1LLCA 5ARBA 1HOTA 1YE5A 1PJBA 3QA9A 3F9IA 2UAGA 3RYFA 3E18A 5JAPA 1WG8A 1W29A 4H3VA 5C7LO 1X14A 1P1KA 1JYSA 1XQXA 1T3ZA 2VHEA 2FPRA 1L7EA 4JT8A 1I7PA 2V0NA 2PR7A 3L9WA 4KGVA 2XAUA 2QYHA 1E64A 2DBZA 1NIJA 3LZCA 4OK3A 4RVGA 1V37A 2QG4A 4NEGA 4AB1A 2I5PO 2K4MA 1WDMA 3DUFA 1XQWA 4HMQA 3H97A 3N8DA 3MS7A 2VYVA 2QN8A 4WGFA 4YCAA 4DC9A 5HA5A 5A9SA 1I4WA 3IQWA 3CT6A 3ZHSA 4PW0A 1OGJA 3RYIA 4D96A 2WWVD 4HT3B 1NN3A 2WE8A 3A1VA 1ZK3A 3EW7A 4OOFA 2DB3A 1VJ0A 2BAGA 1VIAA 2B83A 1DAHA 2OK7A 1PR6A 2P9ZA 2XMQA 4NMXB 1KA9H 2WIKA 3OJFA 3Q9NA 4HDMA 3BFKA 1CG6A 3VYTB 5IU6A 4FLMA 1O1YA 1BS1A 1ECGA 1TZBA 3IHKA 3HBLA 1XD8A 3IMEA 4RH1A 1ZEJA 3PKZA 3L46A 5FNVA 3A4IA 4B6QA 3AHDA 1QVRA 2Y92A 4PFSA 2C2BA 4V0SA 4DDMA 4F4HA 3TUJC 5M04A 1QZZA 5F76A 5FJIA 1SOMA 1JVSA 1L8AA 3B1VA 4TQAA 2P2ZA 3RSCA 4TVSA 1GDTA 2OHOA 4EUNA 4WK4B 3D6MA 2GD0A 1Q15A 1XA0A 3EDRA 3COWA 1Z83A 1T2CA 2DTEA 2MSDB 4XSGA 3RQSA 2IW1A 4DJAA 3WGGA 4ZV4A 2IA5A 2PL9A 1X92A 3OT1A 5K3FB 3TPCA 5KSYA 4GRAA 1GM5A 3U17A 5KNBA 1D3AA 4JU8A 2AJCA 2ZJ1A 3RVKA 1WHTB 2C82A 4DCOA 1Z0UA 4B8ZA 3MRSA 2HSZA 2OCGA 4EPYA 3GLHB 4DV3B 5EJ8A 1LTQA 1OAOA 1JTEA 3MBOA 3O4RA 4BBJA 3G85A 5IKXA 4AS1A 3VR6H 2Y1FA 1Z7GA 4ZO6A 4KQ1A 4C4SA 2Q6OA 2WD7A 4XA8A 3COPA 3S81A 1XRQA 4URWR 3LDFA 5JEDA 1LKZA 2W0MA 2W6ZA 3UYLA 1MORA 1JEYA 3KE8A 4C7XA 3FGOA 3NHKA 3SYMA 3HSYA 2ZBPA 1QK5A 4UU0A 5T8KC 2UXCB 3RF7A 2NU6A 3QU5A 3LGXA 2DQSA 4WXRA 5KQPA 1E63A 1HZJA 1FFAA 3GJYA 1PJ4A 5A4IS 4HPJB 1DWPA 2EEZA 2ERYA 4ED9A 4F9EA 2VNSA 5AH0A 1XTIA 5IHPA 5JZ9A 2WD8A 2Y0EA 2W9XA 3RVLA 3VC3A 4C0BA 3H1EA 1CK4A 3NKLA 4D6PA 2X4DA 1BVRA 1PNVA 3MHPA 4L3WA 4RZHA 4WNAB 4QNRA 5DYYA 4TYYA 4IRXA 5EIHA 5IJXA 4P7JA 4MGEA 2B5OA 3LDHA 1JKJA 1SCUB 2CNWA 2OUKA 2MR5A 3GAFA 3BAZA 4GMXA 4LX0A 1RXSA 3DHVA 3IOCA 4CQJA 2RGRA 3U7QA 3VR6D 4M36A 3D4BA 1HYEA 1TTPB 4M9CA 2BGGA 5FTLA 4TLLB 3I9OA 4LJ9A 3TDKA 5F64A 4WCDA 4MVJD 4QLBA 5JMPA 3QLTA 4HGYA 2DR3A 1A7KA 1X80B 2BBWA 2NAPA 2ZIWB 3D7LA 1GTMA 4ROTA 5AVYA 2DECA 1SUAA 1XZJA 2ZT6A 3IBCA 1FQOA 1R6VA 1SBCA 1PS0A 1T36A 2RGYA