3GEGA

Fingerprint and structural analysis of a scor enzyme with its bound cofactor from clostridium thermocellum
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
245
structure length
241
Chain Sequence
NRGVIVTGGGHGIGKQICLDFLEAGDKVCFIDIDEKRSADFAKERPNLFYFHGDVADPLTLKKFVEYAMEKLQRIDVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNKGRIINIASTRAFQSEPDSEAYASAKGGIVALTHALAMSLGPDVLVNCIAPGWINVTFTQEDCAAIPAGKVGTPKDISNMVLFLCQQDFITGETIIVDGGMSKRMIYHGDWNWFYKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequence fingerprint and structural analysis of the SCOR enzyme A3DFK9 from Clostridium thermocellum.
pubmed doi rcsb
source organism Clostridium thermocellum atcc 27405
molecule tags Oxidoreductase
molecule keywords Short-chain dehydrogenase/reductase SDR
total genus 84
structure length 241
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gegA00
3CH6A 5C5IA 4FC7A 5COAA 1G1AA 3E82A 1EFKA 2FZWA 4HXYA 3I9JA 3GHHA 1HDCA 1GYRA 3D3EA 1WPQA 1WZIA 1GV1A 1E7YA 1WDLA 5KIAA 1R16A 5KVSA 5LC1A 5KCZA 3GY0A 4BQRA 3HN2A 3ZH2A 1WW8A 2W8ZA 3TZ6A 4BNKA 3OP4A 1KC3A 1E6EA 2VRCD 4O1MA 3BMOB 4B7UA 1ZJZA 1U4OA 4NQZA 4BVAA 4XB1A 1VJ0A 1Z45A 4Y8VA 1ZNQO 1WNTA 1NM5A 3GQVA 5HM8A 4FOSA 3OICA 3C1OA 4O6VA 3WGQA 2AQIA 4E31A 1MG0A 3WBFA 4U5QA 3FNGA 3F1LA 2R00A 2HMWA 4CQMD 4I1IA 2D8AA 3K2EA 3ZNOA 3MEQA 3OJOA 4GI2A 1LDYA 3HADA 3OJFA 4DLAA 3PGJA 4RQTA 3G0OA 3ENNA 3WWYA 3WJ7A 4MVJG 4DBVO 2EERA 4J43A 5L7TA 4Q39A 4GPD1 1DLJA 4DGSA 3QV1A 4S3MA 2NU8A 2XXBA 3B1JA 4D46A 2JFHA 4RO0A 4FQ8A 3JQ7A 1LNQA 4PLCA 5DZSA 3WNVA 2PH3A 2BKAA 2DBQA 2AMFA 3AOEC 3GFBA 3OM9A 3MWEB 5A03A 3WXBA 2OORA 4PVDA 4BMVA 1N92A 3N58A 4AJPA 3WICA 3ON5A 3U4CA 3JD1A 1JKJA 3JQFC 2BFOA 4KWHA 5A9SA 1QP8A 4CLXA 3OBBA 4BNYA 2BHLA 1U8XX 1EUZA 4A27A 4CMGA 3PLRA 5A9RA 3KEQA 2FR8A 3HG7A 1CEQA 3WBBA 2C2YA 4LGVA 5KJEA 5COBA 3WTCA 5KOIA 1O0SA 3I9LA 3CIFA 3IS3A 3QVSA 3ZHXA 3ETGA 3MCVA 1QLJA 3PHIA 2O7SA 2PGDA 2HK8A 4TWRA 3ETEA 3PZBA 4NBRA 3UH1A 2UUOA 3ULKA 1LBEA 4QO7A 3RI3A 3FHLA 1KEUA 4YTEA 2EP7A 4GX0A 2WSBA 3GNSA 1BRMA 3MJCA 2HUNA 4DLBA 3E48A 3VZSA 2NSDA 4IBOA 5JCJA 1ULSA 1HLDA 3JQ9A 2EWMA 2CMDA 5C7IO 2CZCA 5KTKA 3AWDA 3F9IA 2OHXA 3PI7A 1CJCA 3UW3A 1ID1A 4P4LA 1ZBQA 3LLSA 3VH3A 1O94A 3O26A 5L4NA 2BD0A 1EUDA 1P1IA 3IC5A 3JYLA 3FPCA 4J4BA 1P1RA 3C7CB 2ZYAA 3AUUA 2H1SA 1E5LA 3L4BA 2JFGA 1EQ2A 3EK2A 2G82A 4BNZA 3JQGB 4NJOA 5IXYA 5L9AA 5CFZA 1NQOA 1NWHA 3A4VA 3E8XA 4CLEA 3F4BA 5FEUA 2ZCUA 3O8QB 4PRLA 4RVFA 3ST7A 2NNLD 2POQX 3GVHA 4PVCA 2Q99A 1P74A 1J5PA 3CXRA 1YL7A 1SMKA 4IJUA 5TS3A 1BSVA 1U7HA 3WYCA 3ZWVA 4R41A 3MJEA 2EEZA 2BMAA 4NI5A 4RV9A 2AQHA 1ZH8A 3OIGA 3UCXA 1P1FA 4WLVA 1KC1A 1XKQA 2AQ8A 5L7YA 5BSFA 2J5RA 1Y8RA 3P7MA 4I9HA 5EPOA 1VL6A 2PA3A 1YS4A 1F14A 1Q7GA 1Y8RB 3DB2A 3PLNA 3UICA 5DULA 4GBJA 2B5VA 1HXHA 1D1TA 1XSEA 5EERA 4J6FA 4PLWA 5GZ3A 1PS8A 4RPGA 2B36A 5JE8A 3PIIA 4J7UA 2E82A 4J16A 5GMOA 5A05A 3W4JA 4BKPA 4EJ6A 5KJCA 1PJ2A 3SVTA 2ZTUA 4KUGA 3P2YA 1WLYA 5AXAA 1DJNA 4PLVA 5CDYA 3U3XA 4WOKA 2VT2A 3H9JA 5ITVA 1VL8A 2O48X 1R15A 1UAGA 1DIGA 1GEGA 4ZJUA 2GCGA 3JQAD 4HWKA 3UOGA 4K26A 4Q3NA 4CR7A 3LC2O 2E4AA 2I76A 1PJBA 4XJTA 3WQRA 2VHWA 4JBIA 3PEFA 4PLZA 3DZHA 4BKQA 4IINA 1LU9A 5CEJA 4Y6PA 2HMTA 3NDJA 3F3SA 3AUTA 3PWZA 4XYLA 3PJGA 1PR3A 4J7XA 1JAYA 3VH1A 3PDUA 4UREA 1WAMA 2Y99A 1XWFA 2JHGA 4CM8B 4MOWA 1C1XB 2YDXA 5TC4A 2LDXA 2Z95A 1M6WA 2VT3A 1I3KA 2G5CA 2AE2A 4TRJA 3D5TA 2PKQO 1A9ZA 3AY6A 1EFLA 3K30A 3VHRA 3RFXA 3IQDB 2QRJA 1I24A 2RHRA 1LTHR 2GR9A 3UXYA 5BNIA 1JAXA 4ROSA 2B4TO 1QV7A 5DP1A 3RVDA 3ZWYA 1BDBA 3QWHA 4AJNA 4PG7A 1YH3A 3VVCA 3BMNB 4I5DA 3GG9A 4ZRMA 1ISMA 3EMKA 4UUPA 3S2EA 1LQUA 4XYEA 4IZHA 2HO5A 3C7DB 1VM6A 1A5ZA 3LF2A 5JO0A 9LDTA 4W9NA 1LRKA 3E9QA 2EKLA 3HNPA 2X6TA 4K28A 3BZUA 4BL5A 5JDCA 1NPYA 2YFHA 4P4GA 4EUFA 2VUSA 1DHTA 4XYBA 4IDDA 1XQ1A 2VHXA 1E77A 5DOVA 3EZLA 4E12A 2H6EA 4Q3DA 1EBFA 4NBWA 4ND1A 2QQ5A 4DA9A 3H9UA 4G65A 1I5RA 3ZWNA 1E7MA 3W6ZA 1PZFA 4WLOA 2P9CA 1O9BA 3NAQA 2EJWA 4FPXA 4AJOA 4WCFC 1LSOA 1HT0A 1HYHA 2OFPA 1ULUA 4ND5A 1CF2O 1H6CA 2VCYA 3U4HA 4FFOA 2QYSA 3UF0A 3V1YA 3V1UA 2WYUA 1FDVA 1ADCA 3KYCA 5DCUA 2X9VA 3NX4A 2NWQA 2BGLA 3S1LA 2ZTVA 5THQA 4BNVA 1H5QA 1HL3A 4A0SA 3ROKA 4MVJM 3PQDA 4OOEA 4BUCA 1X7GA 3KUXA 2EGGA 3AI3A 1QRRA 4ALIA 3L07A 3O9ZA 1BTOA 4RLSA 4BNFA 1LI4A 1ISGA 1DAOA 3EGOA 1P0FA 3WFIA 2X5OA 3RUFA 1PJLA 1UZLA 3GHYA 2GPTA 1TEHA 2OOSA 1DIRA 2A35A 2P9GA 3PWSA 4CMHA 3Q0EA 3OIDA 4XB2A 1D1SA 1SZJG 2DBZA 3RBVA 3RUAA 4ZQEA 4MP8A 1E3IA 1ZSNA 3DTYA 5MGBA 3F5QA 5B37A 1H9BA 3WSVA 2OBYA 3CZRA 4XR4A 1UXGA 1CIVA 3D4NA 5EN4A 1YBAA 2JKVA 4FN4A 3RU9A 5LCXA 2PFGA 3GNQA 3JV7A 3CTMA 3M1LA 1YO6A 1EE9A 4OMUA 1TT5B 2X86A 4IJVA 1DB3A 1IULA 3MWDB 1TT7A 3PGXA 2BGMA 4YDRA 3VVBA 3MTGA 5JBIA 3ZWOA 4LRSB 3KV3O 4ZA2A 4RCVA 3WG9A 2Y1FA 1ENOA 3RIHA 4FD3A 1H9AA 3JQBC 3GDOA 3DDNA 1SB8A 4I9UA 3I9KA 2VYND 3RC9A 3ZV6A 4UULA 1PQPA 1T24A 3L9WA 1GTMA 1V9LA 1ML3A 2O4CA 3PPIA 3NGXA 4FFPA 2C0CA 1I32A 4JK3A 2EW8A 1CDOA 3AW9A 2ZYGA 1IYZA 1GFSA 3LC7O 1P31A 4NBTA 2H9IA 4EEXA 4K6FA 2QRLA 1JU9A 3CUKA 1XDWA 4OHUA 4Y98A 4I5EA 3F6YA 3TOXA 4FJ0A 3QJ5A 4UEKA 2FMUA 4OYRA 3T4EA 3QP9A 5IFLA 4F6LA 2ZYDA 4TQGA 2HJRA 3DMTC 3EAGA 3C3XA 4DWVA 1C1DB 1QSGA 1XYGA 2JCXA 2Q50A 3PJFA 3NDRA 2PGLA 2JHFA 4L4RA 5JAZA 2DQ4A 5A04A 1ISHA 1DOHA 4TVBA 4FFRA 4R54A 5TNXA 5J23A 2EKPA 4NZ9A 5AVOA 4GL4A 3VPFA 4B7XA 1ZEMA 2VWGA 2VHVA 2AE1A 4RL6A 1XHLA 1E7WA 4DQVA 4YXFA 2JD0A 1P1HA 2O3SA 4GGOA 2RH8A 1K6IA 1FXSA 4GX2A 1I0ZA 4I5FA 3K2BA 4N7RA 3VOSA 4YRBA 1QV6A 3RWBA 5G0UA 5ILOA 3WOHA 1PU2A 3DONA 5G4LA 3RKRA 4AJ1A 3JYPA 2B37A 1QG6A 3WFJA 5JNLA 4RDHA 1E3JA 4HUJA 4ID9A 1DJQA 5JPIA 5I7SA 4TZTA 4BMNA 2D59A 2ZQZA 2HJSA 3L6EA 1C0LA 1KVTA 4JN6B 4EI2A 1HE4A 5LDGA 1YBVA 2OP0A 5F5LA 4HFJA 3OH8A 2I67A 1D4FA 1YDWA 3E9MA 5FF9A 3RC1A 3UHAA 3U4IA 4QQRA 4EITA 2YFQA 4M86A 5L40A 2A9FA 2VHYA 3ZWMA 4EUHA 2DTDA 6LDHA 4IY1A 1KVRA 4MVJH 5H81A 1ZCJA 2CY0A 2IRWA 1QKIA 1X7DA 2NQTA 3PIDA 4PIVA 3RUIA 1WMBA 5G4KA 1UP7A 1WDKA 3INRA 3MOIA 4W99A 2PTGA 5TSDA 1ZW1A 3O03A 4AVYA 2OGUA 2B69A 3C8MA 4IM7A 2VYNA 4HFMA 4YRAA 1R0KA 1YGYA 4JP3A 1DXYA 5FI3A 1DFHA 3EVTA 4RGBA 1DRWA 3E6AA 1MP0A 2X7HA 3OEWA 3G3EA 5F1PA 3BMCB 3JQEA 4AJJA 3UCEA 4CJXA 1K2WA 4YJHA 3U09A 3Q9NA 1LSJA 2IODA 4R3WA 3EW7A 3H4VA 5CDSA 5JY6A 3K8ZA 3KSDO 4R01A 4A7PA 2JAPA 2O23A 3RSHA 3LZ6A 1U3UA 4MKRA 3R3SA 3INTA 5B1YA 2FSVA 3AM4A 1H2HA 2WMDA 3NT4A 4LW8A 4CQLA 3BTSA 4Y6SA 2A92A 1UXJA 4R9SA 1MLDA 1UZMA 3V2GA 1QYXA 1LSSA 3KLPX 2HK9A 4XCVA 5TT1A 4EW6A 3KO8A 1CYDA 4OOFA 3QRWA 5C37A 3L6OO 2DU8A 3CE6A 1LLDA 2E49A 4RVSA 3H8VA 1YE3A 4RVHA 3ZDFA 1E3EA 3K73O 4NPCA 3CINA 3IL2A 1PTJA 4B4VA 3RC2A 3WWZA 4BNGA 4GH5A 1YQXA 1JWAB 1YDEA 4D43A 1W0CA 5HA5A 4CMAA 1MV8A 3I4CA 4GX1A 4P4NA 1X14A 3S2GA 3ZW9A 2IZ1A 5A1TA 1ZSYA 1XU7A 2NUAA 3GDFA 5CDGA 2VRBA 1MFZA 3QWFA 1EEHA 1V0JA 1D3AA 3X2EA 5CPBA 3PYXA 1OOEA 2G76A 3IP1A 4EJMA 2YUTA 3Q2KA 2BLLA 2WDZA 1TT5A 2EV9A 1PJ4A 3AU8A 1AXGA 2J3IA 4Z6KA 1XCBA 4YB8A 3K96A 4R4JA 5CDTA 1QMGA 4PLHA 3U0BA 4CR8A 4DMLA 5U1PA 3DHYA 2HMSA 5JC1A 1ONOA 4R9RA 1FDWA 1R6DA 4FFMA 2ZB8A 1X1EA 1WZEA 3QY9A 3GEDA 5JYEA 3WB9A 5KKCA 2C07A 3OECA 2B5WA 1PGPA 3W4IA 1GZ6A 5BNTA 3W4KA 1J6UA 3BHMA 4GVXA 4OSPA 1NHWA 3GMDA 2X23A 1BMDA 2OUIA 3H3JA 3BMQA 4MJLA 3Q9UA 4NBVA 1YL5A 4INAA 2Q1SA 4HFRA 4L0QA 3WMXA 3GZ4A 4ILKA 4B8WA 5L51A 4M89A 2BFAA 4UVIA 5CDUA 1W4ZA 1QLHA 3WQQA 2XXJA 5CPFA 1E1KA 1U5AA 2CDBA 4HADA 4PZEA 3SLGA 3D4PA 3RBZA 4ZHSA 3RFTA 5AQ1A 8ADHA 4PLGA 4QEDA 1F12A 4QT0A 3TN7A 1PR9A 5GZ1A 3GZNA 3PHHA 2VZ9A 5F21A 4FDAA 4RLHA 2X0JA 3V8BA 2D0IA 1DRUA 3OQ6A 4XGKA 3ZV4A 4EUEA 1PGNA 1JDJA 2WE8A 4JJIA 4RVGA 4NK4A 4U6QA 2EKQA 3PJEA 3QWAA 2EP5A 2PD3A 1T2FA 3GLQA 4TSKA 3D4OA 1OC4A 1PZEA 2FP4A 1RWBA 5TIIA 1Q0QA 1GU7A 1M67A 3ONFA 5CAEA 1W6UA 4AJKA 3HHPA 4F6CA 2XAAA 1MX3A 2W90A 4Q3AA 4FJ1A 2UAGA 4YRDA 1R12A 5ENDA 2PV7A 3S8MA 3TZCA 1R4NB 4IS2A 2F00A 2Q3EA 3DZGA 3FRJA 3GN2A 3GVXA 1L7DA 1DC6A 4ZRNA 3R0IA 3WGIA 5FI5A 3E18A 3HDQA 4J1SA 2RBEA 3S55A 5TGDA 4YYZA 5A5EA 4BKUA 3WYEA 1P3DA 4LVCA 3W8FA 4MVJI 3MJSA 3SBOA 3HDYA 3IIEA 4B4UA 3ROMA 2DTEA 3X2FA 1TA4A 4B4WA 4BO1A 2PZMA 3MZ0A 4TVOA 3VZRA 1SCUA 1SBYA 1BWSA 3MTJA 2EXXA 3ADPA 4CLDA 3GPDG 3NKLA 4BHTA 1DFIA 3QHAA 1ISIA 2TMDA 3IUPA 1Z73A 3JQFA 4DYVA 1X15A 5CP8A 4CV0A 2AXQA 3JYOA 4IQGA 5I8WA 4E5MA 1X0XA 1YB1A 1LDBA 3HWRA 2VNAA 4FBGA 5G2OA 1D7OA 2G0TA 1EZ4A 1RJWA 1KY4A 2PH5A 3RJ5A 2IZZA 2H5LA 3SLKA 1K5HA 2O2YA 5I7VA 3ANNA 4ND4A 1JVSA 1P9LA 1VJTA 4D45A 3KRTA 2Q2WA 5FWNA 3QA9A 1ZMOA 3TJRA 4H15A 1BW9A 2J6IA 4O59O 1I33A 3W1VA 3ZWWA 1EVZA 1DO8A 3EYWA 2Q2VA 1ENYA 2NM0A 3NTRA 4IMRA 4YAIA 2YQ4A 4CMJA 4CMKA 4NNJA 1HLPA 3VH2A 2R6JA 3GF4A 4DC1A 4JBHA 3KLMX 1XU9A 1C0KA 3H5RA 3INGA 4OO3A 4IQ8A 2PKRA 1PJQA 5JFOA 1PS0A 5ENVA 4II2A 2HAEA 3DFZA 4E3ZA 5CG1A 3GEGA 4PCVA 1E6WA 3E9NA 3FWNA 2Y67A 4DL9A 3GGGA 2Y0DA 4ALJA 3Q11A 2ZATA 2NADA 1GY8A 4FCCA 4IMPA 3JYQA 2VNSA 1LEHA 2CVZA 3LYLA 3JQDA 3FBTA 4IGFA 5DT9A 3EC7A 3DOJA 4GGPA 3QWIA 1BXGB 4JLWA 3QWBA 4FGSA 4UUNA 3C1TA 4YJDA 3GEMA 2I6TA 3DHNA 3QIVA 3B1FA 1LXCA 4DREA 3D5QA 4O5OA 4GKBA 3ONEA 3DZFA 4Y6RA 3ZV3A 1B7GO 3NEPX 4AICA 5IN5A 4R1UA 1NP3A 3I6IA 4KOAA 4Q3EA 3H3FA 3IJPA 2C2XA 4L74A 2IYOA 2YY7A 5AXBA 2JJYA 4K6CA 4BO5A 3M6IA 3TRIA 4E30A 2Y1DA 3WGTA 2J8ZA 4YPOA 1BVRA 1P77A 3LU1A 1PSDA 1P1KA 3GN1A 4K9DA 1UXHA 2R2GA 2EHDA 2UDPA 3AFMA 3LT2A 4IS3A 1KVQA 1LQTA 2Y93A 2Z1NA 4MPDA 4OJNA 3EHEA 4UVHA 3PK0A 4CM4B 1NPDA 1ADGA 4PZCA 4B3IA 4NFYA 2RCYA 3L9XA 1I8TA 4NU6A 1MGOA 5B4UA 1V6AA 4E2ZA 2EF1A 3KVOA 4R1SA 2P2SA 2X1HA 1SC6A 4QFDA 1KEPA 3BMCA 3I52A 4MVJA 2FSSA 2PD4A 3DAFA 2F1KA 3GVCA 1DC5A 4JBGA 5JDIA 1UH5A 2GN8A 2FPGA 5I9NA 2I65A 4M54A 3RUCA 2HDHA 4UEJA 3OA0A 1EK6A 2FOIA 1OAAA 2XOXA 4MIOA 4YT4A 4CV1A 4E2YA 1N7GA 3GH3A 5EESA 4II3A 5A06A 2VRCA 1DRVA 4XQEA 1VL0A 1U1IA 5KJ6A 3STHA 1PL7A 4P8RA 1F17A 1HSOA 1WMAA 3D0OA 3FTPA 3H7AA 2Z1MA 1C3VA 3R6DA 1JN0A 3VTZA 4F45A 5ER9A 2I66A 4QFCA 2GF2A 3PXXA 3JCZA 1ORRA 5CEFA 4RQUA 4IIVA 4U6SA 4E2WA 2PD6A 2QG4A 2GN4A 4YJFA 5JYDA 1OI7A 2C82A 3EVNA 1AN9A 1ENZA 4RDIA 2QX7A 1SAYA 4EDFA 1KYQA 3RC7A 4W6ZA 1JQBA 3ZWCA 4MINA 1O89A 2H63A 1ZUD1 3R3JA 4MKZA 4NR0A 1I3LA 2Q4EA 3GC6A 4A10A 2AEFA 2NVBA 1GUZA 4ND2A 4PLFA 3LLVA 4GSKA 1A27A 3HN7A 4BB6A 4ZGWA 5ADHA 1P44A 1ARZA 1A4UA 1I3NA 1PX0A 4OM8A 3WNQA 1XELA 3KYCB 4CMIA 3A9WA 3AY7A 1NPTO 1R4MA 1HE5A 1SO8A 3KYDB 4B8ZA 2HKIA 1H2BA 2FY8A 4W7HA 4UVGA 2AEMA 3G17A 2XF8A 3DBHB 4A26A 2ZIZA 2FZEA 4YWJA 4J1TA 5H83A 5T57A 5JS6A 5KVVA 4JIGA 5G0TA 3L77A 4WLNA 2I99A 1T26A 1ZK0A 3IUSA 3OETA 4YA6A 5GY7A 1H0KA 2NTVA 4S1VA 1Q0HA 2O4UX 3CMCO 4CLRA 1K6JA 5IF3A 1LUAA 4N18A 5HRUA 3FR7A 4E5PA 2AG5A 2VHZA 1VKOA 3OIFA 4CR6A 3VZPA 3GFGA 1VLLA 2HMVA 4XZ3A 2EJVA 4CM7A 4LCJA 1D8AA 2O3RA 1NR1A 3NTOA 4N5MA 5IG2A 1HSZA 5L3ZA 2R00C 1UR5A 4NK5A 4CV2A 3OQ1A 3BHJA 1SNYA 2B35A 7MDHA 2VOEA 1OMOA 1XIVA 1GQYA 3PHGA 5H82A 5HS4A 3JQCA 2QIOA 3DZBA 2WEKA 1GADO 4JX8A 4NDNE 2W2KB 1B8PA 3NDIA 3ANLA 1NASA 1VC2A 2QZ9A 3K31A 3WTBA 4DRYA 3BMNA 1M76A 4XGNA 5ICMA 3VPSA 1O6ZA 5JXWA 3PYLA 4XQ9A 3RBXA 4UEOA 3E5MA 4G81A 2GRAA 1EQUA 1YOVB 4MKXA 2CDCA 1UP4A 4BNIA 1V3TA 7ADHA 1YOVA 2E48A 1VJ1A 2JL1A 4PFJA 3V2HA 4CM4A 2UYYA 4EJ0A 3WGYA 4E5NA 1LC3A 4CLOB 2V6FA 4YQZA 6ADHA 1YKFA 1NVMB 2WD8A 1NYTA 1ZZEA 3SJUA 1DPGA 3M1AA 4CUKA 3JD4A 2P5UA 4PG4A 4CLRB 1Z74A 4L8VA 4ZQHA 4C4OA 2Q49A 3NV9A 3BA1A 4MVJD 1O95A 1I3MA 2DBRA 1HKUA 4ND3A 1GPJA 2VUTA 5U4QA 1LX6A 3U5TA 4J0EA 4JP2A 1ZXLA 5JCXA 1BG6A 1TB4A 3CKYA 4MDHA 3ZCXA 3L6DA 1RYEA 3KYDA 1LSUA 1TVEA 1FK8A 4L4SA 4CLHA 3ADOA 4ONEA 3KXDA 2BFMA 3P5SA 4GSLA 4A73A 1K3TA 4BO8A 3GPIA 1GUFA 4NFHA 4UVEA 4DBZA 3DEYX 4L75A 1EK5A 3KSUA 4J1NA 1P0CA 2IDZA 4DYDA 1KOLA 4CQMA 3WX0A 3PYMA 4JJFA 2XPCA 4ZICA 1PJTA 3DMYA 1VSVA 3DBHA 4P22A 4CM6A 1XLTA 1MUUA 1BW9B 2CDAA 1OZAA 3DMTA 3GVPA 1FDUA 4HBGA 1PZGA 4ZN6A 1JTVA 1HWYA 2O3UA 1QXSA 5G0WA 1NBOA 1NQ5A 2D2IA 2VN8A 3KYBA 4L73A 5DOZA 3VZQA 3AFNA 5C3MA 1Q2XA 1KETA 1U28A 3I6QA 3WGOA 3PQFA 5JY1A 3G79A 3VH4A 4CL8A 1SOVA 1CWUA 2DTXA 3DBLA 1YXMA 3JQ8B 4IDGA 1AHHA 4OXNA 1EMDA 1OC2A 1JKIA 4ALLA 1FMCA 1M2WA 3I3OA 3QVWA 5IDYA 5DBGA 1GZ3A 3VC7A 5THKA 5ICSA 1KEVA 1VPDA 4AJLA 1WP4A 4HX5A 3JSAA 2G1UA 2Q1TA 4OAQA 1K89A 4B7CA 2IZ0A 5A3VA 4UVDA 1FDSA 2Q1UA 2YV2A 4BV8A 3FNEA 1WVGA 4R69A 5JC8A 1HE3A 1HZJA 3OFSA 4Q3CA 5A3JA 4H16A 1HDOA 2NACA 4B3JA 4BO6A 1PGQA 3CSDA 4BB5A 2WD7A 2NVUB 4M49A 3KSZO 2HU2A 2HQ1A 3L4SO 1RKXA 1NNUA 5AYVA 3GDGA 4FS3A 2X8LA 1IHXA 3GUCA 3NJ8A 4MP3A 4OXYA 3R1IA 3VTFA 3D3WB 4J90A 1IZ9A 3V5NA 4CMCA 4X54A 2Y1EA 3AJRA 3O4RA 4BIIA 3ZU5A 3P19A 2IYPA 1A4IA 4HNHA 3FF4A 3Q6IA 4EBFA 5JAIA 4W4TA 3QE3A 2GZ1A 3RKUA 1PJCA 1HETA 4CMBA 4J91A 3IAHA 1U9JA 4M8SA 2ZTLA 3ABIA 3BTVA 1MC5A 1R4NA 5JO9A 1EDOA 5ES3A 4BNUA 1I2BA 1C1XA 4WUVA 4I5GA 1Z7EA 4IUYA 3NT2A 2BELA 5KNLA 1U3VA 1ZJYA 3ZHZA 3F5SA 5EL0A 2EGHA 4H7PA 4QUKA 2Q46A 3IMFA 2NV6A 3JQ6A 5JMPA 1G0OA 3KETA 2PKQP 4WLFA 3HFSA 3ZNNA 1BGVA 4WEOA 3TNLA 1LLUA 3SX2A 4XDZA 3RUEA 4XGIA 2DUUA 4TRRA 3TSCA 1UDAA 5TJ9A 1SPXA 4EEZA 1AE1A 4ZU3A 2HRBA 4RF4A 5KVQA 5IJZA 1HYGA 3LSYA 1TXGA 4IQ0A 4QXMA 1KERA 4R3NA 1PWZA 4J9UE 2W98A 3KB6A 3ZZNA 1YJ8A 3AK4A 2DC1A 5DCYA 1RYDA 4B4OA 4H3VA 3NYWA 4TROA 1H6DA 4KZPA 4D3SA 1N9GA 1PEDA 4Z9XA 1NR7A 2I5PO 3FR8A 4NFSA 4WK6A 1B8VA 3L0DA 3HUDA 1L7EA 3WDSA 1Y8QB 1OBFO 2C5EA 1UXIA 3ZHYA 2BH9A 3OEYA 3Q3CA 3JD2A 3OMLA 1PGJA 2UUPA 3ZU2A 1XG5A 3WGZA 2E6UX 1R66A 2GUGA 2BF7A 4C7JA 3SC6A 4F3YA 3EDMA 4EYEA 1YRLA 3DC2A 3RAJA 3KEOA 2FPIA 2PNFA 4IXTA 1BDMA 2ZTMA 5C7OO 1WXDA 1MXFA 2OBNA 2OL4A 4WLEA 3AUSA 1N7HA 3N7UA 5T5QA 4ALMA 4HKTA 2AW5A 2ET6A 3MJ4A 3RU7A 3O8QA 1Y9EA 1HYEA 4IXWA 5B4VA 1KY5A 3KM0A 2D3TA 3PTZA 5FYDA 3OJLA 4DIBA 4TKMA 3QLJA 1DEHA 1GQQA 1MC4A 5K6AC 4FB5A 2GDZA 4DVJA 2Q4BA 2VTDA 5CG2A 5T8KA 1W73A 4WGGA 1U5CA 2ZB3A 1ADBA 1HEUA 3COSA 3VPGA 3DBVO 4AJIA 1YL6A 4YJHB 3JYNA 4R51A 4BO3A 5A4DA 2AG8A 3WQSB 5I7EA 2HMUA 2P68A 2VUUA 4J4TA 2GGSA 1S7CA 2VWQA 2VZ8A 4B3HA 1Z6ZA 1DIAA 4PGFA 4J1QA 1VE9A 2Q45A 2GD1O 2PGJA 1HF3A 3CPSA 3PP8A 4NMHA 3KOUA 5I9LA 1AXEA 4ZQBA 3HFGA 3FD8A 2ZKLA 2C54A 3JQBA 4PG6A 1GCUA 2X0IA 3PFFA 4CV3A 1T25A 2CVQA 3ASUA 2YHIA 1A72A 3AM5A 4JNKA 3UCFA 4ESOA 3GGOA 1NQAO 2C20A 1LC0A 4CODB 1IZ0A 3DWFA 1ZIDA 4GLLA 1FJHA 3OJEA 4ZQGA 3DZIA 4A03A 4YAJA 4D41A 3K9QO 5BR7A 4JJGA 4DTIA 5KVCA 1C0IA 1MXHA 1XQ6A 2GN9A 3JQ7B 4LMPA 4MP6A 2VYVA 1HDYA 4D3DA 4WE3A 4W82A 4IDCA 4QX6A 1VKNA 4OL9A 4LCEA 4XX0A 2RIRA 4J9VA 4KP7A 4ZD6A 1U8FO 4GWGA 2X58A 4FR5A 4KUEA 4ALKA 2DM6A 2Y0CA 5U9CA 4CMIB 1E0DA 1XEAA 3HZZA 4RPJA 5HS6A 2WYWA 4RORA 5EQFA 3ZU4A 1NHGA 1J49A 3H2SA 4NBUA 1BXKA 2YJZA 1E7QA 3QVTA 4YCAA 4CMEA 2FHSA 1B15A 3A06A 2CFCA 5JAMA 2C7VA 4UAGA 2YQ5A 3OJ0A 4YVFA 1B16A 2P4HX 3PFWO 2I3GA 4I08A 3K5PA 2B0JA 1DC4A 3UUWA 2ZJ0A 4DPLA 4WOJA 4XQCA 1PJSA 2P5YA 2X4GA 2V7PA 1PGOA 1RM4A 4RJTA 4PG8A 4LN1A 4BNMA 1MB4A 1LLQA 4U0JA 3WR5A 2DFVA 4N5NA 3PQEA 3QVOA 3DBRB 3VAZA 4CPDA 4LK3A 4TZKA 1E1NA 4E21A 4NU5A 3ZHBA 4E5KA 4IDFA 5COQA 4YT5A 3ETDA 3GAFA 3GRPA 1GD1O 1UP6A 1Q0LA 2Y66A 5AOVA 4R5HA 3ZNQA 3ZWPA 4LMRA 2NTNA 3IJRA 3QVXA 1E1MA 2HLPA 1EVIA 4YJGB 4R68A 3TDKA 1U2DA 4Y67A 1QORA 4BNHA 3DOOA 1DHRA 4NJMB 4Z0PA 1EVYA 1AGNA 4WCFA 3GGPA 4CQLB 4DIFA 1M75A 3HQ4O 3F4LA 3ITDA 4BS9A 5TX7A 3H5NA 3PZRA 1BVUA 2BI8A 2E37A 1GV0A 2HCTA 3DHEA 4TMFA 5L7WA 4GLOA 3LT4A 4FOOA 3VPXA 1IOLA 1UUFA 1P1JA 4R1TA 1X13A 3D7LA 2OO5A 2SCUA 3ZWXA 4DQUA 2NQ8A 3DZKA 4BV9A 1YBMA 2HK7A 2P91A 1LDGA 3ICPA 1I2CA 4GQAA 3ROPA 1Y81A 2GSDA 2AHRA 4TRMA 1MG5A 3ROQA 2JFFA 1V35A 2D5AA 4EGFA 2OMEA 2W2KA 1V3VA 4B79A 5TT0A 5BSEA 3RFVA 3BHIA 4BMSA 1PQWA 3FSRA 2X5JO 3PHLA 2DAPA 3WMWA 3WIDA 1LLCA 4JQCA 2DBVO 4IPTA 3U9LA 2RAFA 1I36A 3JD0A 3DBLB 4KDFA 5JW6A 3MJTA 3TF5A 4LVUA 1EUCA 4ZVVA 3N74A 4YBZA 1DC3A 3H6KA 3DL2A 3HE3A 2J5QA 2B4QA 1T1RA 3Q1LA 1V8BA 1YONA 2CD9A 3UFXA 3SC4A 4BKRA 4MVJE 1B3RA 3ENKA 1R0SA 5I9MA 3A14A 3WLFA 1IHYA 3ICCA 5A9TA 3WLEA 5T67A 2O3TA 3GUYA 4IGEA 3RUHA 3ZNPA 4D0SA 4Z0TA 4WASA 4GKVA 3WJAA 3CZMA 3LT1A 3PVZA 5L45A 2JD2A 4GAEA 4RVUA 3RJ9A 2Z5LA 3NJ4A 1IL0A 4KDEA 4W9NC 3S2IA 4XIJA 3G49A 4GX5A 5FFFA 5JDCC 1DBVO 4FSHA 4QSMA 1JKFA 2DPGA 1ZEJA 3H9GA 2RH4A 1HTBA 3GA0A 3ZU3A 5LDHA 1ZSVA 3I23A 3HB4X 5B12A 1EE2A 1Y5RA 4O0LA 3MOGA 3O38A 2X9NA 1GR0A 1T4BA 4Z9FA 1RM5A 4YQYA 4MO2A 4DXHA 3TL2A 3U62A 4M1QA 1FF9A 1ZK4A 3CEAA 1LDEA 1FDTA 4R16A 4BNXA 2P4QA 5DP2A 1YQGA 1LA2A 2QRKA 3RUDA 2J3HA 2X5KO 3BTUA 3E03A 5DNAA 3TZHA 4XA8A 4J49A 3EY4A 1DIHA 4Z3DA 1NTOA 2UVDA 1IE3A 4BGUA 4AJEA 4XRRA 3TZQA 4BO4A 5T6BA 3JQ9C 3HJAA 3ORFA 4CUJA 2W4QA 4YEDA 2WYVA 3EZYA 1VI2A 2GYYA 2NVWA 3LQFA 3PDJA 4ITUA 1ZO8A 5L95A 3VDQA 4QO8A 1F06A 2Y1OA 2VQ3A 2VZ0A 5IZ4A 2YHUA 1NQTA 1NX6A 4PLTA 5CHEA 3L4BC 1Q7BA 2X0RA 4UUMA 2B83A 4C7KA 1JW9B 3NUGA 4HP8A 1MA0A 5IZCC 4IDAA 5I7FA 2FR1A 5HTOA 1E5QA 1PIWA 2QYTA 4D3FA 1E6UA 5IDQA 4G5HA 4HFNA 5T64A 4CM8A 3H65A 3BTOA 5IDXA 1IPFA 2Y1CA 3F1KA 4J2HA 1F8GA 3HB5X 1PS9A 4YT8A 2V6GA 3ZV5A 2GNAA 2BGKA 2YYYA 4RF3A 5MDHA 2YV1A 8LDHA 1PQUA 4IDBA 5G0SA 3W6UA 3TL3A 1SEVA 3KBOA 1CQJA 4CM5A 1G6KA 3B6ZA 2DT5A 4NG5A 1WWKA 1JVBA 1NAIA 2YW9A 2PZKA 4KMSA 1MFPA 1BXZA 4L9RA 1E3WB 2PLAA 2PK3A 2QW8A 1A71A 4HV4A 5L4SA 3C24A 2I3AA 3PRJA 4NJMA 4WLUA 4R1NA 2D1YA 1ZK3A 4YJGA 1E7RA 1J4AA 5JSFA 3AY3A 4XKJA 2DPHA 4WECA 3VDRA 2V6BA 3FI9A 3GVIA 4FJ2A 3B70A 3PJDA 4WNIA 5EMHA 2X0NA 2FN7A 1DLIA 2PZLA 4D7AA 2FRDA 1F8FA 3SEFA 1E3LA 3OSUA 3AUAA 2VYVD 4J2OA 2J3KA 1QYVA 2ZQYA 5DF1A 2DLDA 1R4MB 1YQDA 4XR9A 4LSWA 4FC6A 4FW8A 2VWPA 3GZNB 1BXGA 5C7LO 4CL3A 1QYWA 2NTJA 2TMGA 1ZMTA 4ZQFA 4U0KA 2Q2QA 1B26A 5A5FA 2JAHA 1QYCA 3I9NA 3P2OA 1Z82A 4BO7A 1S6YA 1U4SA 3TZKA 4YR9A 3KHUA 3ZI0A 1N9GB 4A2CA 1PL6A 4U8GA 3DFUA 3OF2A 1M66A 3C85A 4FFLA 1LDMA 1UDBA 1HDGO 1C14A 4FGWA 4OIMA 4XWYA 2V65A 5DDIP 3F46A 4BNTA 3WYBA 4LRTB 3UN1A 3ZW8A 2C7GA 3HDHA 5TQVA 1CERA 1YVEI 3B1KA 1DIBA 3MJVA 1HDXA 1R0LA 2GZ2A 4J7CA 1R37A 2GN6A 4U7WA 5JLAA 4F46A 3JQAA 3I83A 4PLPA 4XYMA 1JLLA 2ZB4A 5KKAA 1QYDA 3GAZA 3DZJA 5EINA 3ONDA 3ZWAA 4LISA 2JCVA 2DUWA 3SXPA 5F1KA 4AJHA 5AXDA 4GMGA 4IIUA 1UJMA 2YHIB 2YZ7A 4Q3BA 3AM3A 1GEEA 4OQYA 2LDBA 3I5MA 1ADFA 3E5RA 1H6AA 3DXFA 5IZCA 4M87A 3QQPA 2X9GA 2AA3A 4OGWA 1NFQA 3BIOA 3ASVA 3H9EO 3DOCA 4N54A 4BGIA 1U2GA 2C29D 1O8CA 4J3FA 5BQFA 2NU6A 1M6HA 2Y05A 5K6AA 1N1EA 2IE0A 3NT5A 4MVJF 4WJZA 4Z3KA 1ZK1A 3GG2A 2CVOA 3PWKA 2O2SA 5T8KC 4BNJA 1GQ2A 4JGBA 3D64A 4BOYA 5A02A 3IP3A 2EIHA 1XR3A 4XD2A 3LC1O 2Y0EA 3IDSA 3RASA 4WEQA 1B2LA 2FWMX 5GZ6A 4Y9DA 2HSDA 5IXSA 1O5IA 2GERA 5F1OA 3FN4A 2JD1A 1RM3A 3D3WA 4YACA 3WS7A 4RPLA 4GMFA 1N8KA 1SEPA 1DSSG 3U4DA 3AU9A 1HDZA 4A5OA 4YAKA 2P9EA 3UGKA 1X7HA 3C7AA 3GMSA 3H5AA 1NFRA 1ZK2A 1N5DA 3WSWA 5ER6A 5JCJD 3T4XA 1H6BA 5K9ZA 4QECA 2PWZA 5DBIA 3V2UA 4AJ4A 1T2DA 5L53A 3OHSX 1CRWG 1H94A 3M2PA 2OZPA 1U7TA 4RF5A 4AG3A 3BXXA 4DLLA 1E7SA 1Y8QA 1Y1PA 1GUYA 1HRDA 2VOJA 2EW2A 4LSMA 4D42A 4WCDA 1IB6A 2BI7A 2NLOA 2O50A 1LRJA 3ANMA 4D79A 4DPMA 4WKGA 3ZN2A 1IUKA 3BMQB 3H2ZA 2O3JA 4E0BA 3LT0A 1ONPA 2OP1A 4AJ2A 4J0FA 3T7EA 1ENPA 1I30A 2YV3A 3TWOA 4JROA 3I1JA 1GYPA 1V3UA 2FR0A 3E1KA 4PLYA 5BSHA 3F47A 1I01A 3QSGA 4E33A 3JQAB 1H93A 1GZ4A 3A28A 3TFQA 4YAGA 3FPLA 5BSGA 1Y9AA 3D1LA 1NVTA 5HBRA 5AXCA 1DAPA 4RPKA 2D4AA 3I9OA 3JTMA 3VKUA 1ZKMA 3DAPA 1LJ8A 4E6PA 3ITKA 3GK3A 4XDYA 1E3SA 4XIYA 3KZVA 4E4YA 1EVJA 1NVGA 4G2NA 2CSUA 4BQPA 2JCYA 4FFNA 3AOEA 1JA9A 4IDEA 2AEJA 3WGHA 4UUOA 2Y68A 1G0NA 1I10A 5ITWA 1NAHA 1F0YA 3W8EA 4BNWA 4CLOA 1E3WA 1I2ZA 2WTBA 3IKTA 4RZIA 4PG5A 1E1LA 2CF5A 2IEBA 1AHIA 4OH1A 1HZZA 1U3WA 2NU9A 2ZJ1A 1GYQA 4KQXA 3RD5A 4CUZA 4DQXA 1PZHA 3KTDA 4XJSA 4EZBA 2QZZA 3DTTA 4DMMA 4E2XA 3LDHA 2X22A 2WWRA 5EIOA 4I9NA 3WGGA 1W8DA 1GL3A 4DPKA 3G1TA 2A4KA 3JQGA 4KQWA 1ZFNA 2A94A 3TOZA 1BHSA 1RM0A 1K6XA 3LF1A 5L4LA 1ISJA 2GO1A 4IZIA 1KEWA 1A7KA 2GASA 4BO0A 3A1NA 4OKIA 3EUWA 1X1TA 3DR3A 3FNFA 4WNCA 1T1SA 3W8DA 4DIOA 4J4HA 1IY8A 2HRZA 2UV8A 4XYGA 1KBZA 1T2EA 2GZ3A 1ONNA 1B3BA 2PR2A 4I8XA 1UZNA 3GT0A 5BT9A 2IXAA 1VSUA 2W2LD 3GNTA 4BGVA 1AUPA 1X0VA 2C5AA 3FBGA 1P45A 2DVMA 5ILGA 4RVDA 2NU7A 1NXQA 1PL8A 4YAEA 2ZB7A 3FNHA 2NVUA 2WD7B 3BAZA 1ZVMA 2FPPA 1YWGO 3AI2A 1WDMA 1Z7BA 3BYZA 3ZGYA 1EBUA 1LDNA 4RF2A 5DCWA 2I9PA 3C1AA 5CEEA 1UDCA 5IDWA 3AI1A 2DFDA 5A9SB 3FTNA 3V1TC 3DBRA 1A7AA 5EQDA 3RCBA 2WM3A 2YDYA 5F3RA 5JMWA 3H9QA 1KS9A 1GDHA 1NFFA 3Q2IA 2ZK7A 3TFOA 1B14A 1GPDG 5JAQA 5G4KB 1KVSA 3I9MA 5B4TA 1KIFA 3BMOA 3LK7A 2G17A 5K0ZA 3JQ8A 1DDOA 4D0RA 4CM1A 3NRCA 1Q7CA 3UKOA 3RQSA 4KTTE 1Y6JA 4OKNA 5EJ2A 1LRLA 3UAGA 2QHXA 3WIEA 1ISFA 4CQMB 2ZCVA 3SJ7A 4QTZA 5TLSA 2J5KA 1ZXBA 1CETA 5G0VA 4PN3A 1YB4A 3LVFO 4E13A 3JD3A 3T7CA 4URFA 1N1GA 2WJPA 4E5YA 1RPNA 1B8UA 4OXKA 4K1LA 2OXIA 4CM9A 4AL4A 3DQPA 1OFGA 5DBFA 5JDIC 1TI7A 3OQBA 4YJFB 4R5MA 3U49A 4JCOA 4Q9NA 4CM9D 3ZWBA 4BO9A 1PWXA 4N5LA 3FCOA 4HY3A 3FWZA 4L76A 1P33A 1T2AA 5F5NA 1B0AA 1KVUA 3RROA 4ALNA 5TRTA 2PZJA 4KWIA 4D44A 1C0PA 1EDZA 4NIMA 4RPHA 3K6JA 4BKOA 2IXBA 1HDRA 2ILTA 1Y7TA 3GRKA 3VPHA 1UXKA 3PHJA 1K0UA 5KJ1A 4CMEC 3CMMA 4YT2A 4Z0HO 2VTEA 3IOYA 2Q1WA 2V6MA 4BNNA 3B20A 1N2SA 4M55A 2RHCA 4L4XA 1C1DA 3AOGA 4OSOA 4P38A 2D5CA 3TPCA 2EG9A 4OQZA 5KWEA 3NGLA 4HNGA 2DKNA 4BO2A 1HE2A 1JWBB 3GR6A 1XA0A 4CM3A 1A9YA 5I8ZA 1CQIA 3HSKA 3M2TA 4GVLA 2CUKA 1Z75A 4AFNA 4XRGA 1E92A 2BRUA 2IEDA 4KTVE 1IPEA 4XQGA 4DC0A 2AQKA 2O3QA 4JXKA 4PZDA 3K92A 3OA2A 4E32A 1DFGA 4NH4A 4PRKA 2C59A 4GWKA 4MIEA 2VWHA 3VKVA 4TKLA 1QR6A 4Z9YA 3NTQA 4BNLA 2Y1GA 4MIYA 4NHEA 1U3TA 2J3JA 3QW2A 5BNFA 5IN4A 2GLXA 3GOHA 4W7IA 1YB5A 3DAGA 5IAAA 2B4RO 1PJ3A 3I4FA 4WCFB 1T4DA 9LDBA 1TLTA 2CNBA 2PY6A 5DN9A 1L1FA 4FIZA 4XEHA 5KJFA 2W2LA 1GCOA 4IJWA 5TF4A 3TQHA 4MVJP 4RZHA 1Q1NA 1SOWA 3DO5A 2O7QA 3HDJA 1VRWA 1GAEO 4WPGA 1NWCA 3S2FA 4TRNA 4BGEA 5HWSA 4KUHA 3IKVA 1SB9A 1UAYA 1XGKA 2CF6A 5TJHA 3G1UA 2BFPA 1YJQA 4DUPA 4IJKA 2WE7A 4O63O 1T2CA 3UVEA 1Y5MA 1J0XO
chains in the Genus database with same CATH superfamily
4M0KA 4NCIA 4XFKA 3MMNA 1YZUA 2EWVA 1G1AA 3E82A 5HJ2A 5I7HA 5FV7A 4HMQA 5LVAA 3I9JA 3GHHA 2GD0A 1FVXA 1HDCA 4WA8A 1ESNA 1GV1A 1E7YA 2NZYA 2UZAA 3MWFA 1CFJA 2GS9A 4OAOA 3VKHA 1E1CA 3CE9A 3KNZA 2F64A 3PRYA 5FAXA 4BQRA 1KFKB 1WW8A 1W85A 2VJOA 2OFXA 2ZR8A 4RUKA 1V7PC 1QRDA 3LQRA 3I6MA 5IFKA 1SUCA 4O1MA 5ALPA 2IUSA 1N6NA 3HZOA 4NQZA 4BVAA 1GTVA 4XB1A 3P2IA 4OA5A 1KMMA 5K51A 1JQAA 1SGWA 4KQJA 4KYVA 4FEYA 5DE3A 3WMRA 4J3NA 5HM8A 2HWKA 4IGKA 3U81A 1C0EA 1ZIOA 3OICA 3IMCA 3BE5A 2AQIA 4E31A 5IYZA 3WBFA 4TLDA 3X3HA 4A0FA 3IQZA 2VR1A 2F48A 4E09A 4WMLA 3ESRA 2QXTA 4G1MB 2HMWA 4KAJA 3REFA 2G04A 4CQMD 4ENUA 5SYMA 3MMZA 1MO4A 4I4TB 4DUYB 1ADJA 3LYUA 4X97A 4GI2A 4HDKB 3DEKA 1LDYA 3BQMB 1FQJA 3K94A 3OJFA 3PGJA 5T4HA 4BNDB 4UPEA 1B93A 3CX8A 3GQBA 5K3SA 3FCYA 2G9NA 2BL4A 3VOBA 3W1WA 4ZHQA 2O59A 4IX1A 4RX1A 5ALZA 4J43A 4K3VA 5ALLA 4KXLA 4KRGA 5L7TA 1OBCA 4HRXA 1DLJA 1P2VA 1A4RA 5IEBA 3KU1A 5GGYA 1QOQB 1FMTA 1VL1A 4YJ3B 1ZL2A 2JI6A 1R8YA 2H9YA 1I80A 2J45A 2JFHA 3GD5A 1LNQA 1UPCA 4FQ8A 4ZREA 5DZSA 2DBQA 4Y7CA 5AW4A 5HJ5A 1J8MF 1Y3FE 3GLGA 1M1YE 2Z3VA 4C3OB 1BHJA 4UMVA 2IH5A 3WICA 3LPMA 3WXMA 3X1WA 1P5ZB 1CDZA 5A9SA 1QP8A 4CLXA 4DJDC 3FPJA 4GD3Q 4UTOA 3VFDA 3Q5GA 4BNYA 3R7DA 4LDJA 1O6GA 1CQWA 3AEKA 4BP3A 4CMGA 3PLRA 6ADHA 1OHHD 5DWDA 4EW2A 5KJEA 2DCMA 3PQ4A 1M1YB 3HP7A 2ONZA 2WTEA 3CIFA 3IS3A 3QVSA 3ROEA 1E8NA 4UTRA 3CURA 3BKWA 3PHIA 1THGA 2O7SA 1QZZA 2YASA 3PC6A 2WT9A 4NBRA 4EKNB 1BVHA 1P7PA 3JQQA 2AXNA 4LI0A 2YHBA 3R6WA 3TLGA 4BLOA 1YUBA 5KYGA 3K7EA 1SXIA 4QO7A 3SDSA 4YTEA 3IIJA 4Z7NB 3L2OB 3V7YA 1VSBA 1AXRA 3GNSA 3MUEA 1QM5A 5LBIA 3LDGA 1JR3A 1PBNA 3U48A 3WQHA 4DLBA 2V74B 1NW6A 3HBFA 3VZSA 2PRYA 4BKMA 4I2NA 5CW1A 1ULSA 1HLDA 3ANTA 2EWMA 2GBLA 3UA4A 1Q92A 2CZCA 4GLBA 3FA2A 4AQ7A 3OWXA 1SUWA 3F9IA 3UWDA 1CJCA 1OWMA 1KS2A 1QFXA 1ID1A 2OZVA 3PPYA 3LLSA 2FEOA 3NB0A 5L4NA 2B9VA 3DHVA 4G8JA 4DUZB 2OC9A 5CB4A 1NJ2A 1G8HA 3ELYA 4HDAA 4J4BA 2QMYA 3P4UA 2PGNA 3AUUA 2OHIA 3CRW1 3QNWA 1KI7A 3CVJA 3MTQA 2R4UA 1WX1A 1SD1A 3ME5A 1EQ2A 2QGNA 3NETA 4F9TA 4HDMA 4BNZA 5JS7A 2YRXA 5BOSA 5L9AA 4YMHA 4N8DA 2JGEA 1A50B 3VXKA 2BTQA 3NFRA 3F4BA 3M82A 2ZCUA 3O8QB 2XQJA 3B5IA 4RVFA 3ST7A 1KOJA 5DM60 4PVCA 3GVHA 2Q99A 3P0EA 3RAPR 2ZRIA 1VKZA 1WOYA 3CXRA 3IODA 1SMKA 2W7TA 3WDLA 1U7HA 4ZV7A 2P8JA 3NATA 4R41A 3MJEA 2Q1XA 2C42A 2XHZA 3DAYA 4NVRA 3H86A 1UPFA 3U2QA 3UCXA 4BTLA 3BGOS 1P1FA 3H0KA 3CNEA 3B60A 3MWKA 4L78A 4AQDA 4LUCA 1WSAA 5HZKA 3BAFA 2R62A 2QJFA 2VLBA 3VZCA 4ZVSA 3IGFA 3Q3JB 5CD9A 3ADBA 4INOA 4F84A 4TKUB 3PLNA 2VPYA 3SNKA 4PIPA 2V03A 1E79A 3HJGA 4O4IA 5IVHA 1HV8A 2W2QA 4JR0A 2JLVA 3ISTA 2NZXA 1Z13A 4ZVTA 1F0KA 4HXGA 2Q0XA 4RPGA 1EFVA 4RSHA 5C31A 1R0YA 3QE9Y 2CLMB 3IVXA 3MGBA 3MJHA 2O8BA 1LWOA 4J16A 3L41A 4RLFA 1PJ2A 4CF4A 3SVTA 4N48A 2ZTUA 4KUGA 1QS0B 1DJNA 4YQEA 1HYBA 1PR2A 3H9JA 4N03A 2XUFA 1W5EA 1GILA 1TK3A 2C2BA 3GJ4A 1GEGA 5DYTA 3T5GA 3AMVA 5DWQA 3I2KA 4Q3NA 1KYVA 3IDOA 1P4JA 2RH9B 2IK8A 3LE8A 4B83A 5GINE 1HFKA 4D9CA 2E4AA 2WFLB 2X40A 4UDYX 4Z86A 2O14A 2ZUCA 5DYYA 3WQRA 3WZLA 1DTWB 3N8DA 4JBIA 1M1UA 1XTSA 2FXVA 4ZARA 4QOJA 1OFUX 1FMJA 1IWBB 1K5PA 4QKQA 5JZOA 1LU9A 1UT6A 1Q0ZA 1XTKA 3GBSA 2W6IA 3GWGA 3F3SA 3PR1A 3ESBA 5KYVA 4IIXA 3SZRA 3PDUA 2AKAB 1FFBA 3N2KB 2JJ1A 3G2HA 1NBHA 2YINC 2OK7A 3OE4A 2PX3A 2VJAA 4F4HA 2YDXA 5TC4A 4FZRA 3P9CA 2LDXA 1DQNA 2Z95A 4W8HA 2V7VA 4UMEA 2AE2A 1IOVA 4KEAA 2QGZA 5IXJA 1XNHA 1PJZA 1EX6A 1QPGA 2G9VA 4TUYB 3PUYA 1RYYA 3O8LA 2Q5OA 2G70A 3VHRA 3IQDB 4LOKA 1I24A 3K1AA 1CUYA 1LTHR 2AKYA 3RSZA 2GR9A 5BNIA 1ST3A 4A2WA 4D99A 1QKJA 1JV2B 1W19A 1QE0A 3H4MA 2Y1WA 2JPDA 1BDBA 4OQXA 4IEIA 1EFPA 4PG7A 4IQFA 5B6IA 4G5XA 5LU9A 1REQB 3PC8A 5FJIA 2XA1A 3VVCA 1L4EA 3BMNB 4I5DA 2BEWA 1J0DA 3VR3D 3HXOA 2IC5A 2EZUA 2PBRA 2R11A 4UUPA 4H1TA 1L5GB 4U9IS 2HO5A 2J7PD 3LF2A 4WY2A 3WLIA 4AS2A 1TYDE 2IYFA 3LY7A 4DUGD 3AESB 3FMOB 4JR2A 4MGZR 5FWAA 2VPZA 2G9ZA 4GBGA 4C0KA 2QF7A 4BVGA 6PFKA 9LDTA 1NP6A 5EE0A 1NQXA 3SSNA 5JDCA 3IDFA 4RWEA 4MWBA 4JGIA 3ZJTA 3FZGA 5CVVA 4IAOA 5FH9A 2GOYA 1P3Y1 5HIJA 2G1AA 3ESZA 4AG5A 3OTHA 1O3YA 4Q9IA 3QMVA 3UWMA 4E12A 5AJHA 1DDGA 1G19A 4F9EA 3FFTA 4COKA 4BZWA 4ND1A 1ZKDA 3NGMA 3PE6A 3H9UA 4LQLA 1O97D 4ETNA 3K8YA 1TO2E 3B2EA 3DV2A 3NBXX 1CQXA 3BM5A 1TGVA 4IDNA 3NAGA 2OZKA 3H5TA 1F6BA 1M1NB 1Z6XA 3I0NA 4MHOA 4MA5A 2O8EA 2VQDA 1GQFA 2A5DA 1PQ4A 3R3YA 1ISPA 3NAQA 1MF7A 4Q1BA 4FPXA 4AJOA 2F3UA 4NOKA 3ECAA 3DEHA 2FPSA 1XL0A 2OFPA 1CF2O 1JMVA 1H6CA 2NZWA 3MWYW 2C4VA 2HDOA 3B5EA 3UF0A 3V1UA 4HDKA 1FDVA 1WXWA 3VGJA 3L04A 2X9VA 3VHLB 2KWIA 3I3SR 4P53A 5JQWA 2YICA 5DNDA 5TEVA 1Q1AA 4BB0A 1GXSA 1CZUA 4U7PB 4RZXA 2WA1A 2AFHE 3C3YA 1OT5A 1V5FA 2R6R1 3MIZA 4MH0R 3UMBA 5C7YA 3C3JA 4DHWA 1U5BA 5EC8A 1I7DA 3IEKA 1AQLA 1HQCA 1NN0A 1QRRA 1ZJWA 2C7OA 3O9ZA 3HA2A 4N82A 3OEHD 2B6HA 5HGXA 1WXFA 1ZOIA 5IJ0B 2C3OA 1LI4A 3G9TA 1T0IA 1FDRA 1M0WA 3B38A 4BP1A 3TBHA 3EGOA 4P34A 1DUSA 2XUAA 4O5AA 1UZLA 2J33A 2VF5X 1HM5A 1K97A 1TEHA 2JFWA 4I50B 4OQFA 4QAQA 4PV7A 3BWMA 4WVLA 4ZZ0A 1QG0A 2A35A 3PWSA 4CMHA 3Q0EA 4XJXA 3RBVA 1JF8A 5K01A 2DBZA 3SFZA 1B23P 2ZQ5A 2H48A 3TRHA 4A9AA 5MGBA 2WILA 3F5QA 1DKPA 5B37A 3QF7A 1U9IA 3SOPA 2I3ZA 5HJ7A 5IAGA 2IVZA 1GRQA 1UXGA 1QAQA 4H6XA 2YXDA 3D4NA 5EN4A 1YBAA 2JKVA 2OYSA 3ZS8A 1WBDA 3QQ5A 1RSZA 4RA6A 3A1CA 2VBFA 5EJAA 1X8XA 3VOTA 2FX5A 4C7OB 1DNPA 5HBGA 2X42A 3CTMA 3M1LA 1YO6A 2Z04A 2ZAIA 4OMUA 1TT5B 4FYHA 4Y2UA 4PPFA 5LZ4A 4Q1VA 2W5UA 5AQEA 4CKCB 1Y1RA 3D8RA 2FH5B 3PGXA 3FJ1A 3IMGA 3IBGA 3MPOA 4Q3LA 1R64A 3KV3O 3CPJB 3F8TA 4KXYA 4RCVA 4Y2XA 4EI7A 4ZTBA 5CFMA 1M1XB 4FD3A 2H1VA 3E7DA 4PS0A 4QUEA 3GDOA 1JHYA 1H1DA 5B1HA 2YYSA 3DDNA 5F76A 3TOSA 2FRDC 3VSAA 2IHUA 4O4JB 4UULA 1PQPA 2I9KA 1M83A 4RHYA 2F9MA 2AWOA 3FYDA 1ML3A 3G2LA 5BURA 2C0CA 1DEAA 1I32A 2CFTA 2GF9A 4I8IA 4YCJA 5F33A 5MN6A 2L19A 3PD7A 3DTVD 2IS1A 2BF4A 1P0PA 1EINA 2BBWA 2ZWPA 4GYJA 5FYQA 3KAPA 3LC7O 4UQOA 4OP1A 4DCSA 1E2PA 2FKNA 1JU9A 2CXTA 2X4LA 4GLFA 4OMDA 3CUKA 4OHUA 2DECA 2OGWA 2QJOA 3F6YA 3RSLA 2FWAA 4UTZA 1R0BA 1WTCA 3QK7A 4LF5B 2ZDHA 3A6LA 4RDCA 1JR2A 4U7HA 3T4EA 1PL0A 4ZVPA 4L7QA 1YZYA 4EI9A 4EO9A 3DMTC 4DWVA 2YVQA 3EGDB 4FFSA 1E32A 2X76A 1XYGA 2JCXA 2WJJA 4G0WA 1I7LA 4WV3A 3FF1A 4HS9A 4FNMA 3DWEX 1GAWA 4TVBA 1USVA 2I6GA 3LUGA 4D9IA 2PUWA 3T1QA 4NZ9A 4WBXC 1C7ZA 3BWXA 2V0CA 3EMBA 5AVOA 1U28C 1GGVA 3PF9A 2I6UA 1SUFA 1KQOA 4DQVA 1Z3CA 1KXJA 3P45A 4MWEA 4V0NA 3WIVA 4C6TB 4M0PA 5A6VA 2CV1A 2X13A 4GGOA 1WB6A 1K6IA 1UBEA 4GX2A 1CUEA 1GT6A 3PQ8A 3QW4B 5FP0A 4CL2A 1ZD2P 1P62B 2G28A 3VOSA 1JECA 3ZK7A 1I2DA 4C4YA 4YRBA 2KMLA 8ATCA 1EGQA 2APJA 5ILOA 2AJLI 4JSYA 5HF5A 1Q83A 2G88A 3RKRA 3DEJA 5HUHA 2GXSA 4ZO8A 2CDRA 1I7QB 1NVXQ 1M3SA 2P9TA 2PZGA 4ID9A 5LB4A 1DJQA 1QVZA 1KPHA 1NI4A 4H6WA 2AJ8A 4WNAA 4OY3A 4OI1A 4OHKA 1NE7A 3RQIA 2WWXA 3VSBA 2I6SA 1KDZA 2D59A 2ZQZA 4ZVMA 1B8NA 1UPXA 2QX4A 1NVKA 5TE9A 5LDGA 1LNSA 1YBVA 5F5LA 3RTEA 4PX2A 3EIXA 5F2KA 4ZOLF 1MAWA 1M2VA 4G0NA 4Q19A 3ZH9B 2PYZA 2FGJA 3U4IA 4QQRA 2RONA 4EITA 1WEKA 5L40A 1NI4B 1NX9A 5ALMA 4EUHA 1XVAA 3FHOA 5TGTA 2VSOA 4FN5A 1IQRA 4OV6B 4PINA 5H81A 2OESA 2IRWA 1QKIA 4Q03A 1Q1ZA 2NQTA 4PIVA 4KSCA 4S1NA 3RARA 3RUIA 2ECQA 3INRA 3MOIA 1IVNA 5CB4F 2PTGA 2H08A 4MR8A 3H1GA 4MUIA 3DCIA 3GUUA 2B69A 1N78A 4CF7A 3K15A 4HFMA 1R0KA 2QM8A 4Z53A 1XI2A 2YRWA 1DXYA 4QBGB 4RWZA 4R8RA 4H31A 5KSOA 1DFHA 4W5WA 4X66B 5KOHA 3E6AA 4OU5A 4R0MA 2O1XA 1U2TA 1GNPA 3G6KA 1DQZA 1DAEA 1II8A 3ODGA 4AJJA 4FLFA 1K2WA 2CXPA 3A9VA 3SHFA 2W11A 2IDMA 5DU2A 3NKFA 1NBAA 3BZWA 2P1DA 3IXQA 4NPHA 3BDVA 1A9RA 1JDTA 3W5JA 1FTGA 5LLSA 3K8ZA 4A7PA 1WF3A 2O23A 1V6SA 2HPAA 3DKPA 3KJHA 1QB7A 3LY9A 1JQEA 4IJ6A 5CXUA 5B1YA 4RNDB 2BCGY 2ECPA 2OE2A 2VSXA 3OZEA 1KY2A 4G1FA 4E15A 1H2HA 2ZGVA 4LW8A 3LBHA 1O0BA 1NBIA 2HF8A 1PI3A 3P9YA 3BTSA 1N2EA 2BEWB 2J0SA 3V2GA 1QYXA 3HYLA 2HK9A 4XCVA 5TT1A 3BXZA 4M9QA 1QF6A 1A5TA 2DU8A 4X94A 5BXYA 2E49A 1KJZA 2OBLA 4K5QA 4KO2S 1LKZA 2ECFA 1AHNA 4EMBA 3ZDFA 1E3EA 1GL7A 1XE3A 1JU3A 2OBMA 2PUHA 2AH5A 2WWWA 3CINA 3JYHA 1PTJA 5BSMA 4YUWA 3A6KA 4ND8A 2YQZA 1P5RA 3IBTA 3T0FA 1JL3A 1JWAB 5CVUA 2RHMA 1RYZA 5HA5A 2G0AA 1MV8A 1BEEA 3I4CA 4LY9A 4RY8A 1TJ3A 1OW3B 4YI5A 3ZW9A 3K4PA 1M8GA 2IZ1A 4X95A 3EGIA 4KODA 3EFOB 4BXOB 2IYUA 4I1RA 4D8YA 3UMMA 4XWAA 3ORRA 3UJDA 3GDFA 5CDGA 2A1UA 2ANBA 3QXJA 4Q66C 2G08A 4BE9A 1W5TA 1OF1A 1Z5ZA 2D2VA 1Z33A 3KB8A 5TVGA 1V0JA 3M70A 5B6PA 5CPBA 5FWYB 1DO2A 4EJMA 5CFNA 2FYTA 1N0VC 4D4JA 5FTWA 2MSKA 4HQ6A 2XMDA 3FKSA 3HMQA 2Y71A 1FFYA 2JFOA 1N5OX 4R0VA 4I36A 5I9TA 4EB3A 1C8KA 1MQ9A 3K96A 1J5EB 1TC1A 3OZTA 3PXAA 5K09A 4OJYA 5B58C 2XDQA 3PEWA 1E4EB 2PYIA 4HNAB 4MI1A 1O0CA 1KDVA 1ODCA 3B1ZA 1ONOA 1NUSA 4WN9A 5PGMA 3SE7A 1K66A 1R6DA 2CMHA 4FFMA 3W2IA 4ARVA 4BWVA 1WZEA 3KYIB 3BKXA 4JJZA 3BBPA 5BYKA 4RY2A 3GP3A 3WB9A 2BW0A 4YFVA 4W5QA 4F3RA 1E63A 3Q72A 4LJ5A 4FMDF 2QE7A 4M7OA 4PN7A 4QYXA 1XQYA 5BNTA 1XK6A 4B17A 1XP8A 5CIYA 3B13B 4OL0A 1P6QA 2VH5R 1H2RS 5AKIA 2FOLA 3D6NB 4LY0A 3SAJA 2OUIA 2HCJB 3QENA 4XARA 4D4KA 3Q9UA 4NBVA 4HFRA 5AVSA 4ILKA 3PLAE 1VKHA 3URMA 2NN3C 1XMSA 3WQQA 1SOAA 1XD9A 2JHPA 1TW2A 2WU4A 2XUQA 3D4PA 3BQNB 4YN3A 4HHEA 4DUGA 3VPAA 5C8YF 2GEVA 5C3UA 2J7PA 1F12A 1U99A 1VHTA 2PAFA 3MERA 4QT0A 4TTTS 1QFJA 4C30A 3TN7A 1K8ZB 1A9XA 1OGJA 2ILVA 3KD3A 2Y8EA 3OZAA 1TX4B 3QUCA 2H59A 4FDAA 4RLHA 5BRJA 5C53B 2LPMA 3KOXA 1NY6A 1QO9A 5AKZA 5H4GA 5AIBA 1JIJA 4R8LA 2P90A 3KKMA 1CS0A 1KYYA 1L5ZA 1XAGA 3DLIA 1L5NA 2CB0A 2CEAA 421PA 2ZIGA 1BO6A 2ZYTX 1EA7A 1V1MB 3OFNA 3LSTA 4PONA 3L7OA 1WUJS 4HATA 4ZMRA 3TQRA 1AZWA 1X3SA 4TSKA 2YWGA 3AYXB 4JD5A 5BV8A 2XTJA 4Z51A 5TIIA 3ZIUA 1WUYA 1EWQA 1Q0QA 2O05A 2OV6A 1TZ2A 2VDNB 1ZL0A 3ONFA 2GQ0A 4O2BB 4F6CA 5HR5A 3N6RA 5IVKA 2XAAA 2AYXA 1QIMA 1MX3A 2VP9A 3FGZA 2AF3C 2YZ2A 2FPUA 4BB9A 2YC4C 4IS2A 4OP3A 2HLNA 1VPLA 2Q3EA 3LCVB 3UAZA 2Y4NA 3F96A 3GN2A 3PXUA 3I39X 3LQKA 1XB2A 4BMDA 3O7WA 3V1KA 4C76A 5F2NA 4PFQA 5J2UA 1NYLA 2BEVA 1IUPA 3G23A 4GPIB 4TL8A 3RYFB 1LPAB 4A6DA 4J1SA 1X1AA 5CLFA 4HXFB 1MU0A 1P61B 1E2IA 4BKUA 1SUPA 2MU1A 1U63A 2GK3A 1J97A 1ZUIA 2D0OB 3M4YA 4TUYA 2O0HA 3U39A 3V8QA 4ZCIA 4D74A 4LVCA 1NMEA 1AS3A 1Q22A 3RNOA 3LQ2A 1EUQA 3SBOA 1MABA 2ODNA 2HIGA 3JQPA 2RI0A 4IXNA 1WF6A 5AW9A 2X1MA 3ND5A 5AI8A 4QVKA 3ROMA 4B4WA 4UUQA 2I4NA 2VJYA 1KI3A 3PNOA 3IEVA 3CRRA 4E1VA 3ADPA 4CLDA 4D2IA 1XF1A 3GGCA 4PX5A 2ZCJA 3UPTA 3V4SA 3K0CA 4CKXA 1W5SA 1KI6B 4JIMA 5FUVA 2ADMA 3KWLA 5E0OA 3FPBA 3IUPA 2AZTA 2D74A 3VJMA 5BXQC 5I8WA 3AQ4A 1X0XA 1OX4A 1YB1A 3IV9A 3HWRA 3NIGB 4E5MA 4EYKA 4Z4EA 2IYTA 4LYDA 2G0TA 4Q24A 1EZ4A 1RJWA 2EZ4A 3NWOA 3ZS9A 3BG5A 3VJLA 2G6TA 1SQSA 4OUKX 4PYIA 2P8SA 1EP3B 2YVLA 4FNOA 1RHUA 1T0PA 5AO9A 5I7VA 1PLJA 3QFRA 1JVSA 3BBLA 1RWMA 2DKFA 4ZALA 3WLQA 1CP3A 3KRTA 2OCPA 2QT9A 4ZEWA 3RHZA 3K9CA 1PCXA 2P2DA 1USUA 4NCBA 4TS3A 3IPYA 4K9PA 2YXPX 5LUAA 1AZSC 5K0SA 1PK9A 5KPDA 3IIIA 3QKRB 4IXDA 2IEZA 4BJ6A 2R4TA 3NTRA 5EEHA 4MR9A 1TVMA 1LVUA 2Q3LA 4TTPA 4CMKA 2DWUA 4LYGA 4NNJA 5AFSA 1D5WA 4ND7A 2ZRAA 4QUJA 3VNBA 1VCMA 2COEA 2Q07A 3H5RA 4OO3A 3SIPA 2ZR7A 4IQ8A 3RFFA 2DB3A 2NO1A 2Y0BA 5DBHX 4BDTA 1N5MA 3ZQJA 1US8A 1LV8A 2HAEA 3SKXA 1ST2A 5C2JB 1EFCA 4OX9Y 1Z06A 1T8WA 3FLBA 2QMZA 2QL7A 5TMDA 2MYNA 2Y67A 1PEKE 3K32A 1KAOA 1S1CA 2B8NA 1QQTA 4YCLA 1VJGA 2W6NA 4ALJA 1TFRA 2XECA 2ZATA 1Z9BA 3D4LA 4OQ4A 5FOVA 1FS6A 2I1VB 4PW0A 2VNSA 3GI1A 1LEHA 5B53A 2FG6C 3UIEA 2RI1A 1WQ4A 4J0HA 2QJRA 3EJWA 4Z49A 3FOCA 3EVEA 5DT9A 3EC7A 4GP7A 1L8XA 2SICE 1QO7A 4RHTA 4UUNA 3C1TA 1RWKA 5GJVC 2DGDA 2I6TA 3KC2A 1SG9A 5JPDA 4AP6A 3D5QA 1E2JA 1PWYE 4YRGA 5L3SB 4O5OA 1WBJB 1KJQA 2GPYA 4Y6RA 5JFTA 1M5RA 3ZV3A 3NEPX 5AMXA 2C96A 2FLVA 5BN3B 1DJOA 1NP3A 1YRWA 2BMVA 3HTXA 2WZQA 4A36A 2H9AA 2B21A 1E5VA 2IYOA 3CT6A 5AXBA 2Q9CA 1PG0A 2CFIA 1P5HA 5KNCH 1NLYA 4V03A 3M6IA 3ZCRA 4P7BA 5JNLA 3IILA 3LU1A 5EKTA 3T4UA 5AUNB 1FZTA 1SCBA 1UXHA 2GAAA 1SZPA 4OXIA 2UDPA 2RMKA 5IMSA 1U8CB 1E6KA 2IITA 4CNBA 2R9VA 1GKYA 2Y93A 4V1CI 1D04A 5C46F 4OJNA 4UVHA 5SZKB 3SOZA 3IHTA 4ENQA 8AT1A 1I6WA 1KYWA 2R5WA 4CM4B 3HB7A 4ZZ3A 1XZIA 1L5HB 4LJ9A 4D9KA 3SF8A 3ETHA 2R7NA 1ZRSA 1I8TA 4NU6A 4Y9SA 1UC8A 1MGOA 3G2PA 4G41A 4A2QA 5T3UA 4EG4A 2J4FA 2EW1A 4MW7A 1I5OA 3BMCA 4MVJA 3SYKA 4QTYA 2FSSA 2PD4A 3DAFA 1L7PA 1VGVA 2F1KA 2UZ1A 1U6KA 4FMBB 4OBBA 3EVCA 5EMMA 1JEYA 1EJ0A 4G97A 1UH5A 2GN8A 5JALA 1XZKA 5KOJB 2LD4A 4CG3A 1YIDA 3AR6A 3UMYA 5DH9A 1NVFA 4NJEB 2IBMA 2MSLA 3A6FA 3N75A 3OA0A 2XOXA 3TUJC 5D01A 2P75A 4DR4B 4FKZA 4MLCA 1QANA 3ZIAA 3L1JA 2CXHA 1C1YA 3FVVA 4KNWA 1YFKA 4XOIA 4JI1B 4C0JA 4EF6A 2FP4B 1RC8A 2VRCA 1DRVA 5B2EA 3M4ZA 4HWRA 4G9GA 4PM4A 1FZQA 2YN2A 3TM5A 2PV0A 1QNLA 1HSOA 1SURA 2CBXA 3D0OA 4FXPA 4YMVA 3T8YA 1J0AA 3EX7C 4LDAA 4UCFA 2G4LA 3G2MA 1W59A 2D7CA 3AP2A 3MWGA 4DY4A 1T5LA 3QVGB 3WLRA 3DM5A 4K2HA 2PKEA 4F45A 4U3JB 5EHIA 1B6SA 4NL4H 2PR7A 3CWZA 2XAUA 3E81A 4NZOA 3FWKA 4EUNA 4RQUA 3SDBA 2AUNA 1TAHA 1YA8A 3PDIB 2PD6A 2QG4A 5JYDA 4J0GA 3WK7A 1P9NA 2OORC 4J0CA 2OWEA 1ZGJA 3PNQA 2PKXA 2QX7A 4RDIA 4EDFA 2VATA 2AX4A 4CT0A 1H05A 1JQBA 2Z5VA 4K81B 1S1MA 3OSZA 5DM70 3U44A 4HOYA 3R3JA 1XZDA 1SBCA 1YK1A 2Q7XA 4KLZA 1PF7E 4HGNA 2Q4EA 3K1JA 4A10A 4YHHB 5ADHA 1V7ZA 3LLVA 3RYIA 3DPUA 3LUFA 1P44A 1ARZA 1SXJE 1MW9X 3T38A 1T36A 3UB2A 5HNKA 1YR1A 4NS4A 4CMIA 3FTDA 1BXRA 2FF7A 3DL7A 4JLDA 3RG8A 3N0RA 1Q0PA 2QRVB 3EZ9A 2OYCA 1KZ9A 3VDNB 4DW8A 2WJAA 1HE5A 4DA6A 1F2VA 2IUFA 4OGLA 4KAFA 1UBMS 2XNSA 2A5GA 3DVQX 1ZA2A 2FK7A 2GHTA 2XF8A 1M72A 4MDFA 4EGAA 4A26A 2RC5A 2ZIZA 3QJGA 4RACA 3U3JA 3EGDA 1Q19A 4J1TA 3GJ7A 1V2HE 4JIGA 1Z08A 5JBQA 3L77A 5EFZA 4H77A 4EO7A 3OTIA 5IK2D 2I99A 1T26A 2NAFA 3OETA 5LBUA 1FJXA 2Z9CA 1WKVA 5JXGA 5H80A 1H0KA 5KC8A 4Y2GA 1Q0HA 1XKLA 4CG2A 4F56A 1K63A 2QU8A 3EUAA 1T43A 1BHO1 5IF3A 5HRUA 2XIJA 3THXB 1N34B 1P2DA 2D2EA 3DE2X 3FR7A 4E5PA 5C1DA 1C7FA 3L6RA 3TRDA 2HL6A 5F1YA 1G55A 3OIFA 2MR5A 2EDCA 2EKDA 1PW7A 3VZPA 2XCUA 3AG6A 2WHEA 2Q9BA 2ZS7A 1PKEA 3NTOA 1E0AA 1ISRA 3NWBA 5DGCA 4LHZA 2YS6A 3K9LA 3LWZA 4NK5A 3O9MA 4CGYA 3V8EA 4FUQA 5YASA 3W5DA 2B35A 1ABFA 1DCMA 1I2MA 3KPJA 3PHGA 1GFIA 4MUGA 5JYCA 1Z28A 2YWXA 2F7SA 4D8VA 2IOQA 1GADO 1SKYE 5FBLB 1FEZA 1B8PA 2W2KB 3J81k 2ZYVX 1ODTC 1ZRNA 3H4IA 1CJKC 1OLSA 5EXTA 1CLEA 3Q87B 4DMCA 2ZIXA 1ICEA 1AS0A 2CSXA 1C8LA 1JALA 3L8CA 4IVQA 4ZCPA 4P7FA 3VPSA 4BMYA 2EX0A 5JXWA 1T3GA 4KIGA 1ZS9A 3ICWA 4IDOA 4EY6A 3NHSA 4UEOA 2YHAA 3E5MA 1P5FA 2W37A 4G0VA 4L22A 2VSYA 1KXZA 4EHKA 3KSAC 3DFFA 1Z5VA 4MKXA 2HA0A 3RGGA 3KZXA 4K6OA 3EZ6A 4PFJA 2AYYA 2UYYA 2E3JA 3F9RA 4JGGA 4YGYA 1QGYA 1RMYA 3TVTA 4E5NA 4TXNA 1O6BA 4YQZA 3L1HA 4MUYA 1NVMB 1WDWB 2NZJA 5ALTA 3VU9B 1TA9A 5ESDA 2BHRA 1Z26A 4IHJA 1GG9A 2NO4A 2WG2A 4PG4A 4L8VA 4CLRB 2Q49A 2HA6A 2WG1A 3TZLA 1XA4A 3F7TA 5CYPA 2HLDD 4HGRA 3T7SA 5IEJA 5P21A 4F2GA 3C74A 3VUEA 3P2KA 1HFJA 2RDMA 1XMQB 3JZFA 2R7KA 5BPFA 1NJGA 5FO0A 5JCXA 1KTIA 2A0XA 2OHFA 2PZ8A 4N3AA 4PQEA 1KQ3A 5EIFA 1NJFA 1OI2A 1V1JA 2KS6A 2W0SA 3KYDA 2Y6VA 3QIAA 3QVKA 3D7SA 4JLSA 4K86A 3C41J 3ADOA 3EGWA 4ONEA 3SCZA 4I81A 4KV9A 2DHEA 4BO8A 4EPTA 3GPIA 4COOA 3ZWQA 4NFHA 3DMGA 4L75A 1M8FA 1EK5A 1LX7A 5BVGA 3AJ8A 4Z3OA 1LI7A 4G5FA 4DYDA 3G7UA 3I28A 4ZC8A 4C7VA 1C4OA 1LB1B 1RZ3A 2AFIA 2YMQA 3D6VA 4JJFA 4B09A 3ZHTA 2G80A 5ARBA 1H3NA 2FMKA 2XPCA 1PJTA 4MR9B 3K1ZA 3AEUB 1QS0A 2DQSA 3ELWA 2XI4A 1VE3A 3QPUA 5DGDA 5LR6A 2PS3A 3ZOKA 1BX1A 1JDNA 1G3MA 1Z8FA 3DBHA 3MN1A 3PFKA 4M8IA 1MUUA 4ZANA 3TQOA 4RM3A 3X1KA 1XCOA 3CVOA 1NI3A 3DMTA 1UMDB 4TMXA 1TO1E 4BC0A 2AMVA 4MV9A 4OK6A 2OV1A 3DC7A 4MVCA 5JV5A 1QH1A 5KZMB 4DNOA 1HWYA 4MPPA 2XMBA 4XPZA 1X7ZA 2D2IA 2H18A 3EPPA 3KEMA 3KYBA 3P32A 3GDHA 4U3JA 2OKCA 4RVCA 2CNNA 5DOZA 5C3MA 1CSEE 1U28A 5K7SA 1NW8A 3PQFA 4LJAA 5CX1B 3H83A 4H1UA 4KWEA 1NXTA 3FJOA 3G79A 5HDQA 3SHWA 1JA1A 4CL8A 1MJGM 10MHA 1SOVA 3BGDA 1YJCA 2XE6A 5J63A 2IEYA 1KKLA 2BCJQ 4MARA 4U9UA 2O0KA 4B6RA 3BWVA 3K20A 4F93B 2JFZA 1R9GA 2FHPA 3H18A 2YH2A 4BAGA 4JP8A 1KDTA 1RAHA 1DWPA 4MQ6A 4ALLA 4G8DA 1FMCA 5F3DA 1S9DA 3BN3A 4XVQA 3QVWA 4HDMB 5DBGA 1GZ3A 5IDYA 4UNPA 2IGBA 3SE0A 3VC7A 5ICSA 3NBQA 4OXQA 5LZ5A 1BH6A 3IUEA 5D85A 2C77A 1KEVA 3C4VA 2I8AA 5JSKA 1WP4A 3UMSA 4HX5A 3OFVA 5IKXA 4NECA 4ZVKA 2E5WA 1U8TA 4ZXPA 4N0MA 3IAXA 1TLLA 1RWOA 3TTXA 1JH8A 1QZUA 4MYHA 2IZ0A 5SY9A 4B7CA 4Q4HA 4DTCA 1KZ1A 3NV7A 2ZDGA 3TFWA 4EMUA 1WVGA 3IPLA 4MQLA 2F67A 2W9XA 1LBSA 1SU8A 2WKPA 4G2TA 5JC8A 2MSNA 1VE1A 4M0FA 4QUHA 3NNNA 5FTJA 3OFSA 1W76A 2NACA 3DV0A 4X64B 2V5AA 3EF1A 1SQ5A 3Q0IA 1I1OA 1C3XA 2KSQA 3NC4A 2HU2A 5HYVA 2HU7A 4O4JA 4ETIA 1NTRA 2PU5A 2ZWVA 4HDSA 4D9HA 4QJBA 2YFYA 4QFBA 2IX9A 4KRFA 3DD5A 3P8ZA 3MUNA 1LQ2A 2EDAA 5ED4A 3VTFA 3D3WB 3DQQA 2VDWA 2WY2D 3MILA 1X7YA 1T8TA 3DV0B 4ZXFA 3E9DA 3O4RA 2ZIVB 4TTVA 3P19A 2MCFA 3CLTC 4BIIA 4YRRA 5EJ9A 1RJ9A 1M2OA 5L8VA 2W2VA 3QE3A 2GZ1A 5EHZA 4AMBA 4BCCA 1PJCA 1YDGA 4HDCA 5LL6P 2WYHA 1WW2A 3UWSA 5EMKA 2RGWA 4M8SA 4W5TA 2O8CB 1K75A 3ABIA 2PWAA 2HWWA 5DNWA 1RP7A 2RJNA 1RQRA 1XQVA 1MC5A 1VMEA 3ESQA 4HCJA 2V8BA 4UBOA 3PSAA 3RYCA 1ATIA 3LBAA 1J25A 2J0UB 2PBZA 4YRPA 3CLRD 2DR0A 2YYAA 4P3NA 4UE3S 5PNTA 1I2BA 1KI9A 2VPXA 3NT2A 4KMMA 1SY7A 3KE8A 1U3VA 3IALA 2MSEB 1M73E 2QGFA 3KQYA 2YWHA 2Z8XA 4C0BA 4YO8A 5FUWA 4AM8A 4DR1B 2Q46A 4EG0A 2JKZA 3IMFA 2ZSEA 4PPGA 2QNBA 4RK7A 4B9EA 1BX0A 4KO8A 4MB2A 1D4OA 4NFLA 1E2LA 3FPAA 2YN4A 4Y3UA 1U8AA 2UYGA 3RUEA 2QT0A 1EX9A 2WQZA 1U8UA 4Q3KA 4ETMA 3RC3A 2P3SA 1OVGA 2DUUA 1G8FA 1FFSA 1UDAA 4N0QA 4EEZA 2XCIA 1AE1A 4NE2A 2HRBA 3W34A 3TSZA 1YKSA 3GJTA 5THXA 3TLBA 2XCTB 1AZLA 4OLHA 2N3ZA 4YPFA 3L0YA 1X7XB 3CGGA 4MS3B 1VB3A 2VK8A 3U0VA 4F11A 3VVLA 3AETB 2OXEA 4D6PA 5IJ9B 1T3LA 4A6EA 2X5NA 2DC1A 5DCYA 3OUTA 4KREA 1U2QA 3L7CA 3BD9A 5E4FA 4R98A 2KW5A 1N36B 3G89A 3GIDA 2A9QA 2WV7A 4Z9XA 2I5PO 5K8LA 5A0TA 4QEKA 4B80A 2PA0A 3OOHA 2F62A 3LP6A 2HIAA 1PV4A 4WK6A 3L0DA 3PUHA 1D2NA 1NIPA 1JA0A 2CJWB 3HUDA 3JZIA 4R1PA 2WNIA 3WDSA 1Y8QB 2Q6KA 2Z57A 3BOSA 4EY8A 5IJ9A 2H51A 2J9XB 4J7AA 4QICA 3HWWA 2ZSKA 3SPXA 1KSFX 2OILA 3TQFA 3CRQA 3T7AA 2QTHA 1PV2A 1RQLA 2G36A 2E6UX 1R66A 1B41A 4FI3F 3LA8A 2P2GA 3DKVA 2ZT7A 5EMLA 4IYRA 3SC6A 1GRCA 2H85A 2QQGA 3TIIA 4EK9A 1BS9A 1EDEA 1SXJB 2FPIA 2PNFA 3RJZA 2PJDA 2ZTMA 4FE4A 4KZKA 5C7OO 3QM1A 2OL4A 4ALMA 4OEHA 1UFOA 2B0CA 1U04A 4R2HA 3ZXYA 2AW5A 2ET6A 1ZG3A 3DJFA 3FUVA 4YP7A 1L7XA 2ZSHA 1G8YA 2XMPA 1MIHA 5B4VA 1VJDA 3KM0A 1ZOPA 3CS3A 821PA 1T8YA 4Y1RA 1J00A 1Z34A 4GPZA 3B2NA 3I01A 1YDMA 1F38A 2QJTA 3OM0A 4LYHA 2Y1LA 2ZSUA 3QI2A 3TSWA 2VYQA 1GQQA 5KTNA 5K6AC 5HMLA 4ZU1X 1R1DA 4HJRA 2DPLA 1HLFA 5CG2A 1ZR2A 1IQUA 3UYKA 3SHTA 4CEJA 4WGGA 1XOIA 3PG5A 4P7KA 1JXOA 1U6JA 4GRAA 5CVJA 1JNXX 1UFRA 3DBVO 5K8JB 2OEPA 3DGFC 1YL6A 4HEQA 2NT3A 4AMUA 1JFFB 1O03A 5DWVA 5FL7A 2AG8A 3WQSB 5A4DA 2A3RA 2VUUA 3LBYA 2EKBA 4LPSA 3H2HA 4OREX 1MB0A 2XDWA 1VJCA 3BXPA 1D4AA 2VWQA 1YR7A 2QVBA 5KO2A 4B3HA 4INZA 1Z6ZA 1DIAA 1ZGGA 3JTEA 3PFHA 4M0DA 4PGFA 1LK7A 1U7XA 3N5KA 1YMQA 1IZZA 4WJLA 1GAJA 2DH5A 2J48A 5HKKA 3PXBA 4AZVA 5C81A 3CH4B 1BFDA 2ACVA 2BJHA 3FD8A 2ZKLA 3HFGA 2C5HA 4MNTA 3JQBA 2JDIA 3G9QA 2NV0A 5EI5A 2X0IA 4HS4A 1PUIA 2CVQA 3ASUA 3LWNA 3N8HA 5LOVB 3TW6A 1ZOOA 1LPOA 4POAA 2V97A 4RGQA 2O7VA 3G59A 1XRQA 1GGNA 3EEYA 1Y9DA 2EGUA 2XQKA 4WK2B 2D8MA 2NO5A 1FVHA 1SHTX 3DWFA 1COWA 1TNDA 4WBNA 4DZZA 3GAMA 3ACDA 3EWNA 1FJHA 5BV0A 2QAGA 3MJRA 1FXWF 4A03A 2Q9UA 4YAJA 5BRAA 5BR7A 5KWIA 1ZM4A 2WYOA 3DLPX 1MXHA 2AXEA 5D6NA 4ZAWA 5CAEB 4LMPA 1NRWA 2P40A 2P4EA 2ZVDA 3RDPA