3GEGA

Fingerprint and structural analysis of a scor enzyme with its bound cofactor from clostridium thermocellum
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
245
structure length
241
Chain Sequence
NRGVIVTGGGHGIGKQICLDFLEAGDKVCFIDIDEKRSADFAKERPNLFYFHGDVADPLTLKKFVEYAMEKLQRIDVLVNNACRGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNKGRIINIASTRAFQSEPDSEAYASAKGGIVALTHALAMSLGPDVLVNCIAPGWINVTFTQEDCAAIPAGKVGTPKDISNMVLFLCQQDFITGETIIVDGGMSKRMIYHGDWNWFYKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title Sequence fingerprint and structural analysis of the SCOR enzyme A3DFK9 from Clostridium thermocellum.
pubmed doi rcsb
source organism Clostridium thermocellum atcc 27405
total genus 84
structure length 241
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gegA00
2JAHA 4WNIA 3ZWOA 4BNKA 1Q2XA 4MVJA 4G5HA 5LC1A 1XIVA 3KETA 4FPXA 1DBVO 1Z82A 2HUNA 1BDBA 2HK9A 4OQZA 4YJGB 2QRKA 5FI3A 4YACA 2GYYA 1E7SA 5I7SA 4E2XA 1XKQA 4Y6PA 3LF2A 3SEFA 3FF4A 4OGWA 3WTCA 5I9MA 3SLKA 1HE4A 4OOFA 1M76A 4DIBA 4FFNA 2R2GA 3GVPA 4BQRA 3KYBA 4I08A 5CG2A 4FGWA 3QWIA 2AQHA 3VVBA 1QV7A 4J2OA 3ZU2A 2JFFA 1XELA 1UAGA 4L8VA 4CV3A 3L6OO 5I9NA 4BO4A 3WGYA 4Q3NA 4DRYA 5TX7A 1ZJZA 2J5RA 1E3LA 1GUFA 3KYDB 5T57A 4W9NC 4GAEA 5B37A 2DPHA 2FPGA 3MCVA 3CIFA 1E92A 1GU7A 2EEZA 2OBNA 2O3TA 2QG4A 2JD2A 2WD7A 3R0IA 4H15A 1HDYA 5DOZA 3X2FA 1B14A 4W4TA 1CQIA 4J9VA 1ZK3A 3NDIA 1MLDA 3S1LA 1JA9A 2GN8A 4A26A 4AJ1A 5JNLA 3WBBA 2WE7A 1PJ3A 1LDNA 3U0BA 3QVSA 2O4UX 5F3RA 2Y1EA 4PLVA 3S2GA 4W7IA 4DGSA 4DBZA 2WDZA 4AJPA 1NQOA 5CEJA 2W8ZA 2CD9A 1KVUA 2WM3A 4CQLA 1F8FA 2I76A 3TPCA 5CPFA 4CMEA 1AN9A 3BMCA 6ADHA 3QWBA 4IGFA 2AHRA 4NBTA 4I9HA 4N54A 4TKMA 1HDXA 3RFTA 3DQPA 3KSDO 1LA2A 1XCBA 4MIOA 4NMHA 1VSVA 4P38A 2VUSA 2JCVA 4UVEA 3CMMA 3RWBA 1VJTA 2G0TA 2UVDA 3O4RA 1BGVA 1EUCA 4IDCA 4L76A 3U49A 5K6AA 5JY1A 3E5RA 1HWYA 4D79A 3TFOA 3ANMA 1LLUA 1T1SA 1Y8RA 3F46A 4BO8A 1HDOA 4CMIA 2NNLD 4WCFB 3PPIA 1DRVA 4WKGA 1QYXA 1YWGO 3V1UA 4EEZA 4NU6A 1NVTA 4Z9XA 3ZU5A 4B7CA 1S6YA 3MJCA 2YHIB 4W6ZA 3UOGA 5HS4A 2PY6A 4JN6B 1GYQA 5JLAA 2BFMA 1HE2A 2JL1A 4C4OA 3AK4A 4YJFA 4YQYA 1DLJA 3KHUA 4D3FA 2PZLA 2FPIA 4L9RA 3WICA 1M75A 3RU7A 3RSHA 1Y7TA 3LT1A 4IMRA 4R5MA 1T2DA 3I23A 2GCGA 4WECA 4AL4A 3E48A 5T64A 4B3JA 2IYPA 4IXTA 4CQMA 3G79A 2ZB3A 4QXMA 3ZWAA 3OF2A 1U8XX 4FBGA 1IZ9A 4JROA 4BNNA 4J0EA 1EMDA 2YZ7A 3DZJA 2IODA 1T2AA 1GCOA 1V0JA 3W1VA 1N9GA 4O6VA 4RLSA 4CM7A 2YFHA 1P45A 3ITKA 3PGXA 4RF3A 1ENPA 2J5KA 4CMCA 5JAIA 4K9DA 5A03A 3QW2A 3QWAA 4E32A 3PLRA 3TRIA 4CV0A 5KOIA 3PJEA 5LDGA 2NU9A 4ZHSA 4MP8A 4BO1A 3MOIA 1YS4A 2LDBA 1ZEMA 2F00A 2HQ1A 1TT5B 1ZMTA 3L9XA 1DHRA 3I9OA 1ADFA 3VPFA 1WDKA 4QEDA 2NM0A 1YB1A 1LTHR 3RJ9A 1EUDA 5AXBA 4LK3A 4PLPA 1WLYA 3DOOA 5ILOA 2P91A 1RYDA 4PLHA 3IOYA 4RPKA 3C7DB 3OQ1A 1XGKA 1JQBA 1Z74A 5G4KA 4INAA 3VH4A 3P2YA 5TSDA 4R5HA 3U4IA 1DC6A 1ZK4A 1Z73A 1IE3A 2OFPA 1WMBA 2O4CA 4PLZA 1F0YA 5COQA 1PGOA 5F21A 4D7AA 5TLSA 1ZNQO 3DAGA 4AG3A 1GEGA 4RLHA 1DRUA 2E48A 1PS9A 4ZA2A 3GEMA 1XU9A 2Z95A 4XR4A 1IULA 3T4XA 4CL3A 1OFGA 3NDRA 3JTMA 3CE6A 3KTDA 4TRRA 1UXKA 4KQWA 3NTOA 2I3AA 3OA0A 3UGKA 3ZHBA 1EQUA 2AA3A 2OOSA 3E1KA 4M54A 3JQBA 1E5QA 4JJGA 1ISMA 4XA8A 3GHYA 3ASVA 5JMPA 2W2KA 4XYGA 1NX6A 3FBTA 2Q99A 3DB2A 5DZSA 3ZHYA 4G81A 4E31A 3WFIA 3U62A 3WQQA 4DVJA 2QYTA 3IC5A 1UP6A 1LSOA 2GDZA 3GFBA 4F46A 4HFMA 4NDNE 1ULSA 1NNUA 3FBGA 1HETA 3CTMA 4CM8B 4GMFA 1LU9A 1QSGA 1OC4A 2GSDA 4YRDA 4W82A 4M86A 2JFGA 3D3WB 1ADCA 1G0NA 1Y9EA 2IZ0A 4R4JA 5JSFA 1WAMA 3ETDA 3PVZA 4ZJUA 5A1TA 3N7UA 1QORA 1JW9B 2WYWA 5G0TA 3SXPA 4R68A 2X0IA 2VT3A 3RD5A 1VSUA 2B5VA 2TMGA 3EC7A 3GT0A 3F1KA 4ZGWA 2PR2A 3EUWA 3GVIA 3M1AA 3SBOA 4J7UA 3D5TA 1QYWA 2P5UA 4IM7A 3V2HA 4DQUA 3JQFA 4DYDA 3T4EA 4YWJA 5ICMA 5LDHA 2I65A 1Z75A 4ROSA 5TT0A 3H8VA 4EUEA 3GMDA 3PQDA 1QYCA 3WLEA 5T8KA 4TZKA 2I66A 3RKUA 1O95A 1HXHA 3BHJA 2X58A 4BNLA 4JP3A 4CM9A 3RBXA 4GI2A 5AVOA 3DBHB 4MKRA 3JQ6A 2VTEA 4FOSA 3WWYA 1K6XA 1W0CA 1RWBA 1KY4A 1YQXA 1IOLA 1FDVA 2C07A 2VCYA 4PVCA 1BXGB 4OOEA 4AFNA 2Y1OA 3HFGA 1YDWA 2DBVO 4J0FA 4YT8A 1J4AA 3EMKA 3BIOA 3GPDG 5BSHA 4BO6A 2BFAA 1T2FA 1JTVA 1JLLA 1A4IA 1P1RA 3AM4A 3KEOA 3H9EO 4RVGA 5THKA 4PVDA 4WOJA 4AJJA 4CODB 5ICSA 3H4VA 4QX6A 4Y6RA 3KB6A 4BKUA 3OJOA 5C7LO 1U1IA 1M6HA 2RIRA 3RVDA 1CJCA 2QZ9A 4NBVA 4NFSA 5CAEA 1KEWA 2IXAA 3UN1A 2V6GA 3OJ0A 4OSOA 5TF4A 4OKIA 2C2YA 4TVOA 3EHEA 3VZRA 1W6UA 3IUSA 3AWDA 3B20A 1Y5RA 3SVTA 2SCUA 2I9PA 1PL6A 3DONA 4A7PA 5DBIA 4I1IA 4IJKA 5ENVA 4OQYA 1B8PA 4CUZA 3MEQA 3DTYA 3ROKA 4CLEA 2W98A 5A4DA 5A9RA 5A04A 3Q1LA 3R3SA 5EQDA 1B3BA 5F5NA 2X9GA 1XQ6A 5T67A 3C7CB 1DXYA 4OHUA 3BHMA 3BMOB 4IGEA 1SPXA 4OSPA 3P2OA 2E49A 3EZLA 3QA9A 3M1LA 4R3NA 1PS0A 1AHHA 1FF9A 3FRJA 4RPHA 3C1TA 3H5RA 2AEJA 2YV3A 1T24A 2A92A 1D4FA 4MPDA 3WIEA 1F12A 2BH9A 1I32A 1UDCA 3DZFA 1F06A 4HNHA 2BMAA 1QV6A 4I9NA 3DZGA 2C7VA 3F9IA 3H5AA 4GSLA 4ITUA 2VNAA 3RUDA 4BKOA 4FS3A 4MIYA 3HE3A 4ND3A 4O5OA 4QFDA 4BO3A 1CQJA 2B35A 1UZLA 1Q0HA 6LDHA 2ZIZA 3RFVA 3Q6IA 3F5QA 4HFRA 4WLOA 3CPSA 5COAA 1DJQA 2HU2A 1CWUA 3HB4X 4OXYA 1K89A 2NQ8A 2GERA 2Q1WA 1CERA 5KJ6A 4G65A 1DC3A 2H63A 3CINA 1ONOA 2X4GA 2ZCUA 1FJHA 2O3UA 3TZCA 5I8WA 3FNHA 4UEKA 1RM4A 1EDZA 2Q2QA 4BKPA 2OL4A 1H94A 3QHAA 2FWMX 5IN5A 2CY0A 1E5LA 3GF4A 5L4LA 3S8MA 3R1IA 3IKTA 3MTGA 3PXXA 4RJTA 4EBFA 2OP1A 1TEHA 3IIEA 3IP1A 3AI2A 1PS8A 2PH5A 1U2DA 1ORRA 1Q7GA 3VH2A 3ONEA 3K2EA 1MGOA 1R37A 4PRLA 4WEOA 1I01A 4EYEA 1A4UA 1YRLA 4CM4A 1DHTA 1IZ0A 4IIUA 2B36A 2GLXA 1R4MA 1LX6A 2X8LA 3VPSA 1X7GA 3K31A 1A7AA 1QP8A 1NM5A 4D42A 5KNLA 2O2YA 1EFKA 3DZKA 5DNAA 1LXCA 1T4BA 2CVOA 2NWQA 5DF1A 3UVEA 3W4KA 4GVLA 4R1NA 1U2GA 1AXGA 2I67A 3QVWA 1R66A 1U5CA 3HDJA 4NBWA 4CLHA 1XWFA 4QO8A 2VYVD 5L45A 3BMQA 3I5MA 3OIDA 4II2A 2P9EA 1HSOA 2GNAA 2YW9A 5BNTA 3D0OA 3U09A 2PKRA 1R4NA 2Z5LA 2ZTMA 1N2SA 3W6UA 4ESOA 4NZ9A 3S2IA 2OUIA 1Q7BA 1KEPA 1G0OA 3DHYA 3GK3A 3LU1A 4CR6A 3ZV4A 5ITVA 3S55A 3H65A 4ONEA 4KTTE 4D43A 4XKJA 5L4NA 2G76A 1U3VA 4BNJA 3DZIA 3RBZA 5L4SA 4MIEA 5H81A 4R41A 3JYQA 5JFOA 3VOSA 1PZHA 3HDHA 3MOGA 3EDMA 2XPCA 2C7GA 3H7AA 1HEUA 1ZEJA 4CMHA 4NK5A 1E3IA 2X6TA 3BMNA 4IQ0A 5AXDA 4TWRA 1UH5A 8ADHA 5B4VA 1ZH8A 1I5RA 1NBOA 2C54A 3AI1A 5BNFA 4E33A 3AU8A 4C7KA 1ISJA 3QLJA 2CVQA 2O7SA 4B3HA 2PZKA 1FDTA 5GY7A 2ZTUA 3PRJA 4CMKA 4K6FA 1E7MA 2Y68A 4IS2A 2XAAA 4NU5A 4CM5A 2FPPA 3V1YA 2WYVA 3OQBA 4RPLA 3GEGA 3ZDFA 2DBRA 4JJIA 2BGMA 2JHGA 4PLGA 1I33A 5C7OO 3QY9A 4KDFA 4QUKA 3ZN2A 3ETGA 3HSKA 3UCEA 5B1YA 4NBUA 4XDZA 3OEWA 3H9JA 1LDBA 1PZEA 1Y81A 2C82A 2NU6A 1FDWA 3D4OA 4LRTB 5L3ZA 3VH1A 1LDMA 4TROA 4YXFA 5G2OA 3EZYA 4UUNA 4NJMA 2GD1O 4ILKA 4Q9NA 5JYEA 1FDUA 4CLOB 1K5HA 4YTEA 3H3FA 1BVUA 4Z0HO 2Y1CA 3L4BC 1PGNA 3L0DA 4XEHA 3VHRA 3K8ZA 3NGXA 3G1UA 3OECA 1UP4A 4ND2A 4U5QA 1GAEO 2JAPA 4CL8A 2BI7A 2Y1DA 4PZDA 5FI5A 1HZZA 3VVCA 1GPDG 5DP1A 3PJDA 1C1XA 1DIGA 3DZBA 3INGA 3GUCA 3LQFA 4KWHA 1GYRA 1UXIA 1EK5A 3IS3A 4B4WA 3AUAA 4E2ZA 4JNKA 1HE5A 3HWRA 3X2EA 1E77A 1NR7A 4IPTA 5JCJD 1LC0A 1NASA 1I2ZA 1XYGA 3IP3A 3OHSX 5JMWA 1QYDA 4BGUA 3JQCA 4LGVA 3DFZA 3DZHA 3DC2A 4AJKA 3BAZA 3GFGA 3JSAA 3ROMA 3F5SA 4XGIA 1NVGA 3QJ5A 2DM6A 3IJRA 3PIIA 4Z3KA 3FNGA 1KVTA 1JVSA 1A5ZA 2G82A 2W90A 1AXEA 4QECA 4I5FA 3PHLA 4Z9YA 1CF2O 1E1LA 5JCJA 4GX1A 1HZJA 3PWKA 4RPGA 3TZHA 3G3EA 3O26A 3VKUA 2ZJ1A 2YQ5A 2Q3EA 1YB5A 1YONA 1P1JA 3GZNB 1T25A 1WZEA 2VRBA 4YAJA 3AOEC 5HM8A 5IAAA 4FFRA 1X14A 2NSDA 3EYWA 4H16A 3GH3A 4CM6A 1PQPA 1YXMA 4DPMA 4BNFA 3UH1A 3JQAD 3QP9A 4U6SA 2VUUA 3LC2O 1HKUA 2ILTA 1B0AA 4J16A 4BMSA 2JKVA 3HZZA 4Q3AA 1FDSA 2EGGA 4J43A 4PLTA 4BO9A 2GN9A 3C1AA 1EBFA 3U9LA 2VYND 2X0NA 3SC4A 2QX7A 1ZBQA 4Q3EA 4FSHA 2POQX 3RC9A 5IDWA 5IZCC 3RUAA 3B70A 1E0DA 3GG2A 4GX2A 1BG6A 1GUYA 3JQAA 1Q0QA 1BTOA 2E6UX 3GVXA 3NV9A 4O1MA 4XR9A 1NP3A 3JYOA 1HSZA 1VJ1A 3RUEA 1V9LA 1KEVA 3T7EA 1X0VA 2Q1UA 5HBRA 3JQ7B 5AXAA 3ASUA 3KYCA 4KP7A 2P4QA 1NQTA 4WUVA 4NNJA 4BS9A 3BHIA 3QVTA 2Q1TA 3CKYA 4FFPA 3WGGA 4E0BA 2FR8A 5L53A 3RI3A 4PG4A 2IE0A 1XR3A 5AQ1A 5HWSA 3NGLA 4M8SA 4RVUA 4FJ1A 4FCCA 3AM3A 1YE3A 2EKQA 4GVXA 4KUHA 5JC8A 2FHSA 3P7MA 4Y98A 1KEUA 2H5LA 1KIFA 1NTOA 5JYDA 3LVFO 4IDAA 5F1KA 5COBA 4J90A 3NT2A 4JGBA 4CR7A 3TWOA 3E9NA 2D5AA 1DRWA 4YJGA 4ALJA 3QRWA 3VKVA 4GQAA 5IG2A 3GRKA 1CDOA 1N1EA 2WEKA 3F1LA 4MJLA 4MKXA 3ZV5A 1IL0A 3VAZA 3D4PA 4CR8A 4D3SA 1IPEA 1NYTA 1PTJA 2R00A 4FFOA 2O3SA 1LDEA 4IS3A 2QQ5A 3DMTA 4RVHA 1Z6ZA 2Q46A 3KRTA 2VWPA 3AY3A 5K9ZA 1ZSYA 1GFSA 1PJBA 1EVJA 4URFA 1GZ4A 1YOVB 1TLTA 3QVOA 3WJ7A 2D1YA 3OSUA 5H82A 3WOHA 3TL3A 4DQXA 4S3MA 2PA3A 3U4CA 4ZQHA 4E5YA 3JD2A 3AU9A 1P0FA 4UEOA 4XD2A 4PN3A 2ZYDA 3GNSA 1YBMA 1EZ4A 3BMCB 4B7UA 1WMAA 3ZWWA 2GGSA 2J8ZA 3GNQA 4FFLA 4W99A 2AEFA 3CMCO 5JBIA 3IUPA 1NAIA 1PGJA 5GZ6A 3CSDA 1IYZA 2PKQP 4XJSA 5L40A 1ISIA 1DC4A 1L7EA 5KVSA 4A03A 4PRKA 2HMVA 7MDHA 2YYYA 4KDEA 3DOCA 1M67A 4FN4A 4BL5A 2GZ1A 3LSYA 2PD6A 2Q2WA 1GQ2A 4CMIB 2HMTA 2P68A 4J2HA 4O0LA 3T7CA 4E5PA 4IDEA 3JQ9C 3QVXA 1ISGA 2V65A 4BNYA 4JIGA 3FSRA 4KUGA 4BGIA 2FSVA 5EL0A 1FXSA 3RC2A 3AI3A 3AY7A 4MP6A 3HQ4O 4WLUA 4YJFB 1Y6JA 4ND4A 4BB5A 1HTBA 1VE9A 5C7IO 1NHWA 1P1HA 4Q3BA 4P4GA 4XCVA 1VI2A 3AUTA 3DOJA 1JU9A 5FYDA 1E3WB 4U7WA 4EJMA 1ZCJA 5JDIA 4CQMB 2C0CA 3TZKA 3D3EA 2JD0A 4WCFA 3PWZA 5H83A 2OZPA 4FIZA 4EUHA 2EERA 5CPBA 4XIJA 5F1PA 4ALLA 1LBEA 1I3LA 2D3TA 1MP0A 1QLHA 2YHIA 3FTNA 1F17A 4UULA 2PLAA 4WGGA 3VPHA 4AJ4A 1CIVA 2ZCVA 2DT5A 3Q9UA 4DUPA 2DKNA 1SEPA 3GN2A 3W8FA 4NFYA 4XQEA 3FWZA 1E6UA 3GNTA 4IQ8A 4MDHA 2G1UA 2QRLA 5BR7A 4QSMA 1RKXA 3GY0A 1X1EA 2GN6A 1NPDA 1VC2A 2W4QA 3LF1A 1P9LA 5C37A 1A9ZA 1W8DA 2ZKLA 2HSDA 3WTBA 2ZYGA 2HLPA 3NKLA 4B4OA 2DVMA 1QG6A 2Y0CA 5A5EA 9LDBA 3ZWYA 4BKRA 1CRWG 2H9IA 3B1FA 5DBGA 3INTA 5EN4A 5ES3A 1E3EA 1NAHA 2VT2A 1B8UA 2CF6A 4FJ0A 4ZQFA 2EIHA 2F1KA 4ALMA 1JAXA 2ZTVA 3L6DA 1OZAA 4BNGA 3PQEA 5A3JA 7ADHA 4Q39A 3I3OA 1GR0A 2XXBA 1YL6A 3PZBA 1C0IA 4LSMA 3RC7A 3ZV6A 1TT5A 4E12A 1LUAA 1ZZEA 2OBYA 3FHLA 3PWSA 4F3YA 4BNXA 2BFPA 4U0JA 5TQVA 4WLVA 1ADGA 3Q2KA 4HXYA 1R0SA 3OFSA 3WWZA 2RHRA 4PG5A 4JJFA 1F14A 5IDYA 3AOGA 4A10A 1QYVA 3NYWA 3SX2A 3V8BA 1F8GA 3FNFA 3BTSA 2RHCA 4A5OA 2BHLA 2DAPA 4YYZA 3GG9A 2GASA 4HBGA 2W2KB 5G0SA 1T2CA 4GL4A 1DPGA 3IAHA 2J3JA 1DDOA 5EJ2A 5HS6A 3AM5A 4GPD1 5JPIA 4J4TA 4HWKA 2EW2A 4FGSA 3HDYA 1EUZA 1Q7CA 1CYDA 1X7HA 1YKFA 4PLWA 4UEJA 1SOWA 1DSSG 2RH4A 4OL9A 3WG9A 1JKIA 3L6EA 1VKOA 3WR5A 2IXBA 4ZN6A 3AFNA 5ENDA 1LEHA 4PZCA 2X0RA 3GR6A 3N58A 4R9RA 3F47A 1P0CA 1LLDA 4FB5A 4J9UE 4MKZA 1A9YA 1LNQA 1SMKA 3PJGA 4YRBA 1ZK1A 4TRJA 3WQSB 5DP2A 1XU7A 3NTRA 3PK0A 4Q3DA 1DFGA 2DTDA 3DR3A 3PYXA 2ZB7A 3WGZA 3L4SO 3OMLA 4WLFA 2OO5A 1JWAB 4NBRA 1LRKA 4FOOA 2I99A 2CSUA 4KWIA 2H1SA 4XZ3A 3V2GA 2RBEA 3GUYA 1QRRA 4WLNA 1RPNA 1HF3A 5KKAA 3FCOA 1I24A 1B16A 2AQKA 2PH3A 1SOVA 1B26A 1E3SA 2NUAA 1ISHA 4QFCA 2QW8A 1K2WA 4XYEA 4CMGA 4CMEC 2HAEA 4BKQA 1YL7A 3ABIA 2O3QA 1C0KA 4ZD6A 4YJHB 2NADA 1Y8QB 3LYLA 3VH3A 2GRAA 5U1PA 3WGQA 3WGIA 3ZWPA 3EW7A 4J1SA 2HCTA 1NQAO 4R1SA 4RF4A 5K6AC 3BTUA 3WGHA 2ZYAA 3DFUA 2D0IA 4RL6A 3K73O 3TZQA 1PEDA 1ONNA 5B4UA 4GX0A 2FMUA 3FD8A 3K2BA 1EQ2A 4QO7A 1UDBA 5L7TA 4X54A 3RCBA 3WXBA 1U7HA 2E37A 1FMCA 2B5WA 2BELA 1PJSA 4BO5A 1PX0A 4CMJA 1ADBA 3GGOA 3PJFA 4J91A 2OORA 4JXKA 1R0LA 4PGFA 5A02A 3GDGA 3ENNA 5I8ZA 3D4NA 5JDCA 3HNPA 2AMFA 1D8AA 2EV9A 1HYHA 4IDFA 3VPGA 1I3MA 3E8XA 5BSEA 3WYBA 3DBLB 5DDIP 2LDXA 1I10A 1LJ8A 3RUIA 5I7EA 4ZICA 3C85A 5HA5A 1JN0A 3TFQA 4YB8A 4GBJA 1WPQA 3VC7A 3H2ZA 5GMOA 3JQ8A 4FR5A 1PSDA 2VHYA 3ZNQA 3GZ4A 5U9CA 4DIFA 2QRJA 1PQWA 2YV2A 3I9KA 3ZNOA 3K9QO 3JYPA 4BV9A 1K6JA 5T5QA 5JE8A 4IXWA 3WBFA 1EE2A 1ULUA 4OYRA 3IL2A 3GEDA 1YGYA 2NU7A 4E21A 1PJLA 1IPFA 3ZHZA 1PJ4A 4UVIA 4OXKA 1XA0A 2J3IA 3ZH2A 3DBRB 1OAAA 4OM8A 3JQDA 4I9UA 4GWKA 3O38A 4WLEA 4NK4A 3HN2A 2HRBA 1DB3A 1PL8A 1CEQA 2VZ0A 3DHNA 4HADA 2J3HA 3PTZA 3WSVA 3PFFA 2P9CA 4PG7A 3DWFA 3FNEA 4K1LA 3JCZA 4RZIA 3WYCA 3RC1A 4BQPA 1OBFO 1B3RA 4L75A 3UAGA 4P4LA 4M49A 2OGUA 1YO6A 4U6QA 4KOAA 2JD1A 4HP8A 5BT9A 3ZV3A 3KV3O 2NTVA 2O23A 5EPOA 3VZSA 1JDJA 2D2IA 1E7QA 4YAKA 2P4HX 5JAQA 2VZ8A 2IZZA 4MVJF 2UUPA 1SBYA 2JHFA 4L4XA 5TJ9A 3L77A 3NJ4A 2GZ3A 3ROPA 4AJOA 1JWBB 3L07A 3E5MA 5CFZA 3RKRA 4PG8A 3PI7A 3CUKA 2G17A 4NI5A 1GDHA 4Z0TA 3UCFA 2VHXA 3OJEA 3EVTA 3JQBC 1GADO 4MOWA 2Y67A 2B4QA 2B4RO 3NDJA 1E7WA 4CUJA 2ET6A 1VJ0A 2P9GA 4ALKA 1QKIA 1SAYA 3OBBA 3Q3CA 3KLMX 3DHEA 2C5AA 4ND5A 2Y0DA 3KBOA 3MJTA 3ONDA 3PHJA 3PYLA 4JP2A 4OO3A 1XG5A 5EMHA 4BO2A 2CF5A 4XX0A 5C5IA 1G6KA 3GDOA 4DC0A 5IZ4A 3G17A 3ZWNA 2QHXA 3GVCA 4RQTA 3HN7A 4Z3DA 3E9QA 5C3MA 2YFQA 2B37A 3SLGA 4BO0A 4N5NA 1H2HA 4M89A 1Y9AA 3ADPA 3TQHA 2PD3A 3WQRA 1U3UA 3RASA 5IN4A 3ICPA 3Q11A 2X5KO 3O8QB 3JD3A 5CDTA 4IJVA 3HG7A 1HLDA 1ARZA 1UDAA 2HK8A 3VZQA 2YHUA 3OP4A 2D8AA 4AICA 2DUUA 3RIHA 3CXRA 5IXYA 2DUWA 3ICCA 1R4NB 3TOXA 3PHHA 5JXWA 4KUEA 2CUKA 1C1DA 3COSA 3JQFC 2QZZA 2RH8A 4CLRB 2D59A 1PGPA 3LLSA 1SO8A 1Z7BA 2VYVA 1BW9A 4E3ZA 5T8KC 2B83A 2NVUA 3VDQA 1Q0LA 1C14A 3WSWA 1J0XO 3JQGA 5G0WA 3TL2A 4CV2A 5A9SB 3KLPX 1DFIA 1PZGA 1R12A 4C7JA 3U5TA 4LVUA 1PJ2A 1OC2A 4CM3A 1IB6A 3HFSA 4RQUA 1DJNA 5T6BA 4BUCA 3RROA 3I9LA 5GZ1A 1ZJYA 1MX3A 2FY8A 4E2YA 1X15A 3WYEA 5DCYA 3JD0A 3MZ0A 4XYLA 4W9NA 1WWKA 2P5YA 5J23A 5IJZA 2WJPA 2B0JA 1OOEA 4FC6A 2NQTA 4DMLA 4J7CA 4XRRA 1U3WA 1V3UA 2DFVA 1R6DA 4EDFA 3UHAA 4F45A 1ENOA 4OIMA 4BIIA 3BXXA 3PHGA 5EIOA 1C3VA 4Z9FA 3IKVA 1RJWA 4GX5A 3ZCXA 1IHYA 3JD4A 5KJFA 1YJQA 3VTFA 2Z1NA 1XSEA 1ENYA 4IJUA 1GEEA 3GN1A 3MJSA 1AUPA 1PGQA 4WE3A 1DOHA 3I9MA 4NJMB 5B12A 1P3DA 1GQYA 1ID1A 4UVGA 4DTIA 2X23A 3FPLA 3WX0A 1DO8A 1X1TA 2I6TA 4DPLA 4HNGA 4RZHA 3TOZA 3JQEA 1WZIA 2UUOA 4BNWA 1PIWA 2AG5A 1N7HA 4BGEA 4JX8A 4TQGA 3ZWBA 1C1XB 4PLYA 3RBVA 2AEMA 4PZEA 1DIBA 4MP3A 5I7FA 4L74A 3A28A 5ADHA 4DLBA 4A27A 5A06A 1GV0A 3DXFA 1U4SA 3UCXA 2EKLA 3MTJA 2X7HA 3I9JA 1V35A 4R51A 4WK6A 5HRUA 1I2BA 1R0KA 3G49A 4EGFA 2HMUA 3GOHA 1T2EA 1KERA 4FW8A 4YRAA 4N7RA 1WP4A 2BF7A 3F3SA 3F4BA 1LI4A 1D1SA 4D41A 3RUFA 3OICA 4OH1A 4JBGA 4K28A 1MFZA 1YH3A 1HDRA 5TT1A 4DYVA 3M2PA 3GQVA 4JQCA 4FJ2A 4PLFA 1D1TA 3WLFA 1GQQA 3QSGA 4MINA 4I8XA 2ZK7A 3RUCA 4P8RA 4DWVA 2B4TO 2W2LD 3STHA 3WGOA 1V3VA 3GAFA 4L4SA 3MJ4A 4A0SA 5JAMA 9LDTA 4R9SA 4E5MA 1PR3A 4DPKA 3NT5A 3GZNA 4Z0PA 4D3DA 2OXIA 2VOJA 5CDYA 2XF8A 1HRDA 3D7LA 4YVFA 4WCDA 3F4LA 3WDSA 4BVAA 4EJ0A 3O03A 3C1OA 3DAPA 1I0ZA 1JKJA 1GYPA 5MGBA 3NRCA 1U9JA 1ZXLA 1ZIDA 1P44A 3GVHA 4TSKA 2A4KA 2HMWA 2VYNA 5L9AA 4MVJD 4DA9A 2EKPA 5JAZA 4RVFA 1VL0A 1EFLA 4NFHA 5LCXA 4XQGA 2VNSA 2DC1A 5CEEA 2VQ3A 3GC6A 4HFNA 2JCXA 3S2FA 5U4QA 2X0JA 3C7AA 3WMWA 3NTQA 1FK8A 4EZBA 1E3JA 5DBFA 1BRMA 4YAEA 4GKVA 2XOXA 4XB1A 1EVIA 4AJ2A 2PTGA 3RFXA 2X22A 3ORFA 1X7DA 3TSCA 4YAIA 1WXDA 1W4ZA 4DQVA 2DU8A 2X5OA 4FC7A 2J3KA 2YY7A 3JQ7A 4KMSA 1LSUA 4E6PA 1LDGA 3N74A 4NQZA 3H2SA 5A9TA 3M6IA 1SB8A 2DTXA 2EP7A 4A2CA 4AJIA 3PDUA 1WDLA 3A4VA 4ZVVA 4W7HA 5KJCA 1W73A 1G1AA 1C0LA 1I3KA 3WJAA 3DTTA 3HJAA 3W4IA 4PCVA 4E2WA 3U4DA 1BMDA 5FWNA 2P2SA 1XQ1A 3K5PA 3VTZA 2YUTA 5CEFA 4BNTA 2IYOA 4QT0A 3GLQA 2WD7B 2NVWA 3Q0EA 2PNFA 2Q45A 4IJWA 1MXFA 1WNTA 3OETA 3WMXA 5ER6A 3LC1O 4JCOA 4DIOA 4IDDA 2VUTA 1B7GO 1E6WA 3HB5X 4K6CA 1MA0A 2BKAA 1Z7EA 3KXDA 2EW8A 4IZIA 4H3VA 4WJZA 4J1QA 3H9GA 1LRLA 5CDUA 4CLDA 5G0VA 2HRZA 2BI8A 2FR1A 3PFWO 4J1TA 3ZU3A 3KYDA 4CPDA 4CQLB 2H6EA 3VDRA 2V6FA 2VWHA 4GKBA 2YDYA 2Q4EA 4DLAA 2ZB8A 3TJRA 4S1VA 3CZMA 4L4RA 1J5PA 4IIVA 1KOLA 1EK6A 1N1GA 1YOVA 2WYUA 3GHHA 3W8EA 4YBZA 4GGPA 2NLOA 3RAJA 1PU2A 5ITWA 1ZW1A 4B3IA 3K6JA 1SEVA 5KIAA 2PKQO 4KZPA 3Q2IA 1Y8RB 4WNCA 1ONPA 1DIAA 2EF1A 1JKFA 2HJSA 4BB6A 2O3RA 3A1NA 3EY4A 3GDFA 2OMEA 4BOYA 1L1FA 4E4YA 1A71A 4R1UA 1NPYA 3ST7A 4LRSB 1P33A 5ER9A 1BDMA 1P74A 4MVJP 4WASA 1MUUA 2IEBA 2WD8A 4PG6A 4B4VA 4Q3CA 5ILGA 1VRWA 2DPGA 4TMFA 4EI2A 4CM1A 1XLTA 4XWYA 4G2NA 1MFPA 5KWEA 1PWZA 5TC4A 1XHLA 3PDJA 1E1NA 2VTDA 1D3AA 3QWHA 1P1FA 1H6DA 1UAYA 1PZFA 1UXJA 1NFQA 3EK2A 2FN7A 1YBAA 2UDPA 3KEQA 3RJ5A 3NJ8A 5TGDA 2PGDA 1L7DA 1N8KA 3ZWCA 4RVSA 2EJVA 4AJNA 4CQMD 2DBQA 1B8VA 3NUGA 1TI7A 5IDXA 1UP7A 1AGNA 1N9GB 3OH8A 4LMPA 1UR5A 4RGBA 1KC3A 3OA2A 1K6IA 4ALNA 3WFJA 2JFHA 2VWGA 3R6DA 4XJTA 2NU8A 3FR7A 4QTZA 1NFRA 3C8MA 4E5KA 4AVYA 2QYSA 5F5LA 1E3WA 1NWHA 1RM5A 3QE3A 4IINA 3H9QA 4JLWA 2AQIA 4I5EA 5FFFA 1MC4A 3RU9A 2I5PO 1LRJA 4RCVA 1VL6A 1HDGO 3QWFA 5KJEA 3C3XA 1O5IA 2PZJA 3AUSA 1IHXA 4FQ8A 1H93A 3E9MA 2EHDA 3V5NA 4I5GA 3WGTA 1NPTO 2E82A 2IZ1A 3KVOA 4BMNA 1LLQA 3IQDB 4ID9A 4XGKA 1VKNA 5JW6A 3AUUA 1WW8A 3IMFA 4BO7A 3AY6A 2WSBA 4B7XA 1LSJA 4XQCA 4EITA 2B69A 4ZQBA 2RCYA 4XYBA 5CHEA 2PGJA 5G4KB 2X1HA 3A06A 2JCYA 4HY3A 2BLLA 2AG8A 3LT4A 4LISA 5EQFA 1RM0A 1MC5A 5JS6A 1P77A 3WNVA 3ENKA 4DMMA 1I30A 4BNUA 5K0ZA 4XYMA 4TVBA 4ND1A 4RPJA 4GMGA 3H9UA 4LMRA 3D64A 4D45A 1DC5A 3KM0A 1H6CA 4FFMA 4NPCA 3ZNPA 4MVJG 2V7PA 3AJRA 3DL2A 4KQXA 3UFXA 1YB4A 4TRNA 3ZGYA 5AYVA 3GA0A 4BNHA 4GH5A 1GTMA 2G5CA 1I8TA 4M1QA 2Y1FA 4BNIA 4LW8A 2ZQZA 2ZB4A 3KSUA 1IUKA 2EXXA 3EVNA 3UKOA 1ZXBA 4YCAA 4B79A 4D0SA 1U4OA 2J6IA 2Q49A 3PYMA 4P4NA 1YBVA 4JBHA 3QIVA 2PZMA 5TJHA 2V6MA 1TXGA 4OXNA 5JC1A 5GZ3A 1BXKA 1YVEI 3ZHXA 2HKIA 3ZWVA 2EJWA 5L7YA 4E5NA 3WS7A 1OI7A 2IDZA 5JO0A 4B8ZA 3K96A 4MVJI 1E7RA 1PQUA 3W6ZA 5TIIA 3KOUA 4EEXA 2CVZA 1GV1A 3H6KA 2O50A 4UUPA 2AQ8A 3JYNA 1EVYA 2O48X 2R00C 4ALIA 3UF0A 3U4HA 2GR9A 5DN9A 3C24A 3I9NA 1DAPA 3B6ZA 3MWEB 4MVJE 2YJZA 3DMTC 3INRA 3CZRA 4WOKA 4D44A 2VZ9A 4BMVA 3UW3A 3VPXA 4YPOA 2AW5A 3ITDA 1KBZA 5AXCA 1K3TA 4CM8A 2X86A 3I4CA 4UUOA 2CZCA 4XGNA 5EESA 1GL3A 1VM6A 2NVBA 1NFFA 1I36A 3NT4A 4DREA 3FI9A 3LT0A 4D0RA 3OIGA 1H6BA 3D3WA 1NR1A 3P19A 2WE8A 3PZRA 1E1MA 1U28A 1QMGA 1DEHA 1BSVA 1P1IA 3U3XA 4P22A 4RF5A 2Q4BA 4CM9D 4I5DA 1A27A 3RQSA 2DLDA 3WIDA 3TDKA 1I2CA 5TRTA 4CMAA 3DAFA 5EERA 3B1JA 4ZU3A 4K26A 4U0KA 3ANNA 3GAZA 2R6JA 1MG5A 1SZJG 3HUDA 3KO8A 1GZ6A 2QIOA 3PGJA 1YQDA 2O7QA 4YT5A 3ETEA 1DLIA 1M2WA 4J4HA 4YEDA 1AHIA 1KVRA 3DBHA 1SNYA 2C20A 1VPDA 3ZI0A 3FN4A 3OM9A 3K92A 1GY8A 4YJHA 1Y8QA 3ZZNA 2BRUA 2PK3A 1BXGA 1H9AA 3V2UA 2PGLA 2IEDA 2JJYA 1U8FO 2I3GA 2HO5A 2Q1SA 2YDXA 2ZJ0A 3D5QA 1EBUA 4WEQA 5JDIC 1Y5MA 1LLCA 3PEFA 1VLLA 1O0SA 4WCFC 3DMYA 2J5QA 3IJPA 4JK3A 4UREA 2O2SA 3WB9A 4EUFA 3I1JA 4OJNA 4F6LA 3AFMA 5MDHA 3JQ8B 4HX5A 5F1OA 4RDHA 2Y1GA 1UXHA 2HJRA 1O94A 1EE9A 3CH6A 2PD4A 4F6CA 4XQ9A 3F6YA 1J49A 3TF5A 3QQPA 4L73A 4RORA 5G0UA 3GGGA 1H6AA 3UUWA 2FRDA 2UYYA 3DBLA 1KVSA 1DIRA 1HDCA 4Y9DA 1V6AA 5IDQA 1DAOA 1A72A 2BGLA 1I3NA 2PFGA 2VHVA 3KSZO 3OJLA 3PHIA 5KKCA 3L4BA 4HUJA 4IBOA 4GLOA 1NHGA 5BSGA 3PIDA 4B8WA 4AJHA 4GWGA 1LC3A 2ZQYA 4Y8VA 1SB9A 1YQGA 2IRWA 2NACA 3BMOA 4NJOA 4OKNA 2GPTA 1MXHA 3R3JA 4BNMA 3JV7A 3LZ6A 2HK7A 1ZMOA 3G0OA 4LN1A 2FR0A 1HLPA 1N5DA 4HV4A 3DEYX 1D7OA 5FEUA 1ZSVA 2Q2VA 2Y05A 3RUHA 3K30A 3I6QA 3ROQA 3NEPX 5BSFA 3DBRA 1OMOA 1M66A 4HKTA 5IF3A 4J3FA 3E18A 4NR0A 5A3VA 1TVEA 1MV8A 3LDHA 3I6IA 3BYZA 4CJXA 1LDYA 4DC1A 1U3TA 2PWZA 3ONFA 2X5JO 3GMSA 4CMBA 4AJLA 5L51A 2OHXA 1PL7A 1PJQA 3AOEA 1ML3A 1KY5A 4MO2A 3CEAA 3DO5A 5EINA 1RYEA 1VL8A 1QLJA 3GRPA 5CDGA 3ANLA 4CM4B 3KZVA 3TZ6A 4YAGA 5I9LA 4D46A 1R4MB 4IMPA 3ZNNA 4DBVO 5JY6A 4RO0A 2GN4A 1RM3A 1GD1O 2Z1MA 4N5MA 1NQ5A 5B4TA 4NH4A 4O63O 4ZRMA 1LQTA 1BWSA 4TRMA 3ULKA 4XRGA 4J7XA 3S2EA 2YQ4A 1EDOA 4UUMA 4FD3A 1HYEA 4LCEA 4XB2A 5IZCA 2Y66A 1R15A 4J6FA 5TS3A 3VZPA 1O89A 2A9FA 2YV1A 4IUYA 4NG5A 4BGVA 5CDSA 3FPCA 4BNZA 4LSWA 1TA4A 4GLLA 3B1KA 2UAGA 4U8GA 3HADA 1Y1PA 3ZWMA 1BHSA 1DFHA 2BGKA 5CP8A 4ZQEA 2GO1A 3BMQB 1UZMA 3A14A 1H9BA 2HMSA 4YR9A 3MWDB 3LLVA 2DBZA 2VWQA 2X9VA 3JYLA 4RVDA 2DFDA 2ZTLA 4J1NA 1BXZA 2AE2A 1LQUA 1R16A 1C1DB 2CFCA 1MB4A 4RV9A 1TT7A 4JBIA 1GUZA 1A7KA 4GSKA 2NV6A 5BQFA 4J49A 5JO9A 4CLXA 4MVJM 2X9NA 3ADOA 3Q9NA 3TN7A 3DDNA 4J4BA 1BW9B 1AE1A 1V3TA 3BA1A 1GCUA 2UV8A 1H2BA 1YJ8A 1ZVMA 3O8QA 2NVUB 1TB4A 2E4AA 2BD0A 2DQ4A 1X0XA 3JQGB 1B2LA 4E13A 3I83A 3ZWXA 4CV1A 1T1RA 1E1KA 5KTKA 2Y93A 1HT0A 5DOVA 1CETA 2CNBA 3BMNB 4FDAA 1BVRA 2O3JA 4L0QA 3PLNA 1ZUD1 3H3JA 4CLRA 2D5CA 1T4DA 2WMDA 3E6AA 1X13A 2VHZA 4KTVE 2BFOA 5JCXA 2NTJA 1O6ZA 1HDZA 1H5QA 1XDWA 3HDQA 5KCZA 2CMDA 3ZU4A 1GZ3A 2CDBA 4M55A 4YT2A 1M6WA 1IY8A 1V8BA 1O8CA 1U5AA 2Y0EA 5A9SA 1ENZA 4UVHA 5I7VA 3FR8A 3IDSA 4O59O 5TNXA 2GZ2A 4DLLA 1DIHA 3ON5A 4AJEA 1PWXA 2PV7A 4R01A 2NTNA 5L95A 1XEAA 4ZRNA 2CDCA 1ZKMA 5JDCC 3L9WA 5THQA 3EGOA 4Y6SA 3BTVA 1WVGA 4RDIA 2EP5A 2EGHA 1YDEA 1N92A 3BTOA 3I52A 3LT2A 2Y99A 4B4UA 4M87A 5DT9A 1MG0A 1C0PA 1P31A 3PP8A 4PLCA 1QR6A 3SJ7A 4EJ6A 3NX4A 2VRCD 5IFLA 4TZTA 3AW9A 4PIVA 3UICA 1UZNA 4R69A 2C59A 4CUKA 4UVDA 3W8DA 4A73A 5DULA 3JQ9A 3BZUA 4LVCA 4PFJA 2VHWA 3O9ZA 2WTBA 4NIMA 3SC6A 4N18A 1T26A 2FOIA 3KUXA 1KC1A 3UXYA 1H0KA 2GF2A 4Y67A 2VRCA 4YA6A 4N5LA 4YQZA 1K0UA 4CLOA 2DTEA 1SCUA 4II3A 1JVBA 1ZO8A 3A9WA 1KS9A 3E03A 5KVCA 2VN8A 5L7WA 1KVQA 5A5FA 1E7YA 4HFJA 3JD1A 5KJ1A 2C2XA 5IXSA 4DXHA 3V1TC 3MJEA 2VOEA 2C29D 2HDHA 4E30A 1SC6A 3NAQA 4YJDA 1UXGA 1PR9A 3G1TA 1E6EA 2XXJA 3MJVA 3OEYA 2V6BA 1EVZA 1JAYA 2D4AA 1S7CA 4R1TA 1KYQA 5HTOA 3OIFA 3DBVO 1HE3A 5BNIA 4DL9A 1P1KA 1UJMA 3D1LA 2A35A 2C5EA 2EG9A 8LDHA 5KVVA 1HL3A 3E82A 4GGOA 4YDRA 2EWMA 2RAFA 2AXQA 2TMDA 4IY1A 4XDYA 4BHTA 4EW6A 3P5SA 2GUGA 2WWRA 5AOVA 5G4LA 2CDAA 4XIYA 1O9BA 1Q1NA 1HYGA 1LSSA 4BNVA 1KETA 5FF9A 1GPJA 1EEHA 2FZWA 3FTPA 3OQ6A 3FWNA 1ZK0A 3H5NA 1J6UA 4R16A 4IZHA 1QXSA 1ZSNA 1PJCA 4IQGA 4R3WA 1PJTA 5DCUA 3GGPA 4WPGA 3OJFA 2FP4A 2ZATA 3JQAB 3SJUA 2A94A 3PQFA 2Q50A 3HHPA 1N7GA 1YL5A 3WNQA 3LK7A 2FZEA 4MVJH 3ZW9A 1NWCA 4OMUA 2W2LA 4IDGA 4NHEA 2FSSA 1B15A 4QQRA 3KYCB 4RF2A 4BV8A 3W4JA 5A05A 4LCJA 1WDMA 3M2TA 4R54A 4H7PA 3LC7O 5KVQA 1UUFA 2AE1A 4ZQGA 2OP0A 3QV1A 4UAGA 1ZK2A 1NXQA 3EAGA 5CG1A 3GPIA 3I4FA 4OAQA 4YT4A 1NVMB 5DCWA 3ZW8A 4IDBA 1U7TA 4Z6KA 1ZFNA 3TNLA 1ISFA 4TKLA 1Z45A
chains in the Genus database with same CATH superfamily
4S0XA 2VJKA 4IIGA 1Q2XA 4HNSA 2F8LA 2XCQA 3KSBC 2OHIA 1DKNA 1KI3A 1Z82A 4PPGA 2HUNA 4OK6A 4PYKA 4RTSA 4L5CA 3T7AA 2ZFUA 2IYSA 2IYAA 2QRKA 5FI3A 3LK6A 4YACA 1ACJA 4MGHA 2IYVA 3UAWA 2GYYA 5I7SA 2Z83A 1XZJA 3V8QA 4NX2A 1OXSC 1R8YA 1ZU4A 3LF2A 3FF4A 5LP6F 1SVOA 5I9MA 3LWBA 1M76A 1GDDA 1C3OB 3PDIB 2ZSIA 4MAMA 3E84A 4N6OA 2IXFA 2PUBA 3ZOKA 3R5XA 1A88A 2Q6IA 3GVPA 3GPBA 1DTEA 4BDSA 1NSFA 2PU5A 1BIFA 5CB6A 5CG2A 3FTFA 5EKXA 5K3OA 4FGWA 1BYIA 4TYWA 1NF3A 1L4YA 1X2BA 1X9GA 3R3HA 5TPWB 1XTSA 3K0SA 3CPJB 4K9KA 1FRVA 4LNUB 1SXPA 2R6FA 1XELA 3AETB 3GJ0A 3KU1A 5EMLA 4EO9A 3TKLA 1X7YA 5A2QA 2FEPA 4JVLA 1VGQA 2NUPB 2AG6A 3L6OO 3MXOA 1XFAA 3KEGA 1P3JA 4Z1MA 2OYCA 4ARCA 2YWEA 3P97A 1GNRA 4ZCSA 2OZLB 4AYTA 4CGYA 2PFSA 2V5UA 2GARA 2GEKA 4FGKA 2WFZA 3WRXC 3RRXA 1E4OA 2VK4A 3FUUA 1ZH0A 2GUWA 2J5RA 1E3LA 1GUFA 1WLSA 2CLOB 3DCJA 1UK7A 3FOCA 4W9NC 1HT2E 3VU9B 4S05A 1AJEA 3UV3A 3BGWA 1GU0A 2DPHA 3ZXSA 4G0VA 3MD9A 5DHAA 1NV8A 1X1AA 2EEZA 4KWEA 2O3TA 4DMUB 1WHSA 3ROGA 2JD2A 2P5TB 1KO5A 1W48A 2X9QA 5CH8A 2Z6AA 3ZKAA 5K99A 3NDIA 4H6XA 4GQIA 1XDSA 1RXSA 1Y63A 2G40A 4HSEA 5E7QA 1DARA 4A26A 1ZOOA 1WF6A 4AJ1A 4BQQA 1U5BA 3WBBA 3ZXYA 1QGOA 2WE7A 3U0BA 2GB4A 1ANKA 2VAMA 1Q5PA 2W43A 3BULA 4H3HB 2Y1EA 3S2GA 1EIWA 3ROXA 4ZO9A 2DF8A 1OY1A 1PSWA 1THZA 2JCGA 5CEJA 4FHFA 4EG7A 2CD9A 2H00A 2P1RA 2LRHA 5JSZA 4CMEA 1U8AA 2Q5OA 2V59A 3K05A 6ADHA 4A6XA 4V38A 5HZGA 3PDCA 4PCAA 1OSNA 1TZCA 2AHRA 2YIDA 1A5SB 2B25A 4OMFG 1JEYA 3I01M 3DQPA 1XCBA 4N3CA 1CNFA 4PQGA 2HPHA 5FXMA 3TE6A 3QIAA 4BMZA 4P5PA 4DQKA 2C1XA 3O4RA 4IDCA 2J0QA 3DAYA 5IKPA 2P40A 1Y4ZA 3UXMA 5AVKA 3ANMA 1I80A 4L4YA 4A6EA 2RSLA 2FEAA 1HDOA 4CMIA 2NNLD 3EXG1 3HB7A 1QYXA 4WKGA 4EATA 4K46A 4EEZA 1WUYA 4NU6A 1GKIA 3R4VA 3C3MA 3O91A 4B7CA 4W6ZA 3UOGA 2JRLA 3COWA 3X44A 4C4TA 4NSNA 3NEJA 2VNKA 1EGVB 3GD5A 4ADSG 1XT6A 3VYUB 4RFLA 5KYWB 4G41A 2I6FA 4R8KA 1E9RA 1SCAA 3AK4A 3BWDD 4YQYA 2P3SA 3SQLA 4IAOA 4JYBA 2PZLA 2A8YA 1F6DA 1QVVA 2JAQA 3AINA 3Q9LA 4ZANA 3U3MA 4YV0A 3O1IC 2FPIA 5CVTA 4B3GA 1VMIA 1M75A 1EQAA 2C5BA 1S4QA 2ZUBA 3PE3A 4ZCTA 1NBHA 1ITZA 1SUCA 2ZRBA 1L4LA 4AL4A 3E3AA 5T64A 1CB7A 5EJIA 2IWRA 3DEAA 2WSLA 2LNDA 3DO6A 1DJOA 1EFDN 4EGCB 1T3HA 5CLGA 2XBLA 3CWCA 3RODA 1T9BA 5ED4A 2IODA 2HU5A 3OCYA 1T2AA 2XADA 4OF4A 2QX6A 3QYAA 3CM0A 3W1VA 2QUAA 1FZQA 1AG9A 1UBCA 3ND7A 4TQUS 4PIPA 4Q0MA 3TQRA 1K2VN 1ENPA 3V8PA 2JATA 1UQTA 4GMHA 1F51E 3GLHE 2OQ2A 3KZNA 3FSGD 4G5FA 4G5OA 5EHGA 3A37A 1UMKA 4DT1A 1TNDA 5JAIA 2WICA 4ZAFA 3Q8MA 4FYYA 2VAXA 1M2FA 4E32A 1P60A 2XZTA 1PL0A 1NONA 3GGJA 1EVEA 4CV0A 3UJPA 1SUAA 5KOIA 3PJEA 3BSSA 2O2GA 3NLLA 2RBKA 3EZ2A 4JJ7A 1RLUA 4MP8A 4R2IA 3AKZA 5JJKA 1C4KA 3MOIA 4Y2PA 3VR1A 2LDBA 1ZEMA 4F38A 3TG8A 1VSBA 4W1PA 2F00A 2ZRDA 4M99A 1Z16A 4RAQA 4PF1A 3I9OA 3O95A 4TTAA 2Z8YA 1VJDA 1WDKA 4I3GA 5CYPA 3AR7A 2NM0A 1J25A 3RO7A 4DFDA 3D5EA 3PB3A 4LK3A 1GNPA 3ETNA 3SMQA 3R9XB 5AVUA 3L7BA 1H23A 1L9XA 3A10A 3C14C 4QUIA 1RYDA 4XB6B 4D9JA 4RPKA 3TOCA 2VH5R 4W5OA 4A23A 1XGKA 3KQSA 2IP4A 5EOVA 2WJWA 1SBTA 1V3QE 3BK7A 3ZDYB 4ED9A 3VAYA 2EARA 2CC2A 1H8HD 4INAA 4Q9IA 3AP2A 4L72A 5BW5A 3PXUA 3UUFA 3H84A 3TZLA 5IF9A 5GM2A 3IDFA 4ZT6A 1C7QA 3LD9A 1ZK4A 4Z4GA 1Z73A 2CNLA 4NJEB 3LXRA 3IERA 3OCUA 3S7ZA 4AY2A 1IUOA 1LPOA 5K4AA 4TM8A 5MN5A 5TLSA 3S2UA 1ZHHA 3PNQA 2QRZA 3F9RA 2CBZA 2WJIA 5B6IA 1A1SA 1DRUA 1XVIA 4PPYA 1XU4A 1F0NA 2K4MA 2Z95A 3M83A 1RZ3A 2VJMA 3PTLA 5D3ZA 1ORWA 3NDRA 2D2XA 1B4DA 1NT4A 3CE6A 1GHTA 1KZHA 3MAAC 5LN1A 3OA0A 1EFPA 4EB8A 1EQUA 3E1KA 5KTOA 1ZYUA 3I5AA 4W1RA 3ZCTA 1ISMA 4XA8A 2DFLA 3L6BA 2R9VA 3ASVA 1EM8A 2JLYA 1MOZA 3D4IA 2HO4A 3HS3A 5DEIA 4CXMA 1P2DA 3DB2A 4HRAA 4JAVC 4D02A 2MSDB 4GLBA 4BB9A 4HDRA 1KP3A 3EXFA 2P4SA 3SDSA 1EJ2A 2VNIA 5TXGA 1NU6A 3GFBA 3D8SA 3TW0A 5BV7A 4NDNE 4YYEA 4L9SA 5BMOA 1E2UA 2DH6A 2D1RA 3A1DA 4GM1A 2C5HA 4RABA 3JZAA 4YRFA 5KYKA 3FBGA 4J0QA 4MWSA 2RGXA 3IT0A 1QSGA 2FFRA 2GSDA 4H4EA 2A3NA 3HYCA 4ZTUB 2M6RA 4M86A 4E7PA 2CT8A 3V80A 4MTLA 3D3WB 3OTOB 3SCZA 1XHEA 2ZITA 2A9RA 4R4JA 1W30A 1XBTA 1OV6A 4MCAA 2C04A 3DM9B 3GRFA 5A1TA 2ZI7A 5G0TA 2Q3CA 4MVCA 3WLLA 1Z4MA 1YA6A 4ZAVA 4QIHA 3MWKA 3AUXA 1TGVA 1FNNA 4ZGGA 2X0IA 2AZ4A 1O95D 4X41A 3K8QA 2NSHA 5GM1A 1VSUA 3RD5A 2B5VA 3EDQA 3K0AB 4FZ5A 3TSOA 1J8DA 2PR2A 3M1AA 1JU3A 1LF0A 3Q15C 4FGJA 2W8BB 1UMDB 2JARA 2P5UA 2Z4RA 3D5TA 4IM7A 4X7BA 4EI8A 1B0ZA 2XCOA 3BG5A 3DOIA 4DYDA 4IIJA 3W78A 5JNTA 1GRNA 1E60A 1Q3TA 1M34B 1DZ3A 3OHPA 5A4JA 5LQJA 1PLLA 3B1YA 2YBDA 3DFMA 1Y48E 2FZGA 3I01A 5AH0A 1L4NA 2J0UB 4HEJA 3I92A 5J2UA 1T0PA 3C3AA 4C6TA 1H1LB 4I4IA 3RSLA 4DC9A 1OWOA 1FFCA 4GI2A 3LUJA 1ZJWA 3DT9A 4JEIA 2VTEA 3E9DA 2B8NA 3VSBA 5CDHA 3L8YA 1FDVA 2R6HA 2VCYA 1Q12A 2BV3A 1XLTC 3KAKA 2NSJA 1YJCA 2EG5A 3HA7A 2H52A 4HQRA 2V96A 4J0FA 1KEEA 5FPKA 1J4AA 3Q72A 3RS4A 3GPDG 2JIQA 4FOLA 3JZDA 2BFAA 2C4VA 1T2FA 2QGNA 3KVNA 1JTVA 1JQDA 4PZPA 3SS9X 2QVBA 2R5WA 2RHOA 5AVTA 1G3RA 1YFJA 4UM9D 3D3QA 4MCIA 4KGDA 4Q1CA 3H9EO 4E7OA 4IEEA 1LCIA 4C7OB 4FCTA 3RR2A 1EB8A 3DLCA 2X8WA 1W85B 1KO4A 4QX6A 2BFBA 3I39X 5C7LO 5I9BA 2R1VB 1O4VA 5E8RA 5FWYA 3PUVA 3V8NA 1M6HA 3O1HB 2JEZA 1XTIA 1QFZA 3KQMA 3NTVA 3RG2A 1B6TA 1KP2A 2PKEA 5KTSA 2IPNA 4PQRA 2IXAA 3G2LA 3ODGA 5FL7D 5TF4A 1QRUA 4OKIA 3GLFB 2C2YA 4MLCA 2NMVA 1W6UA 2EZ4A 3S1AB 1BD3A 4XWKA 1Y5RA 1GSOA 2A4MA 1S1CA 2ZIUB 3KYJB 4ZCMA 1CNMA 1P91A 4MYDA 3DONA 3O3MB 3L8CA 3L41A 4QTUB 3U60B 1RXVA 4I1IA 5ENVA 4RKQA 1NUHA 3DTYA 3K5WA 4C3ZA 5C46F 2D7DA 3F74A 1HDEA 3D7SA 4LTNA 3R3SA 1YAJA 5EE0A 5F5NA 4Y2UA 3KQTA 3HY4A 3NB0A 3B38A 2QNBA 3HEMA 3A9VA 5IVPA 1DXYA 2X1MA 3FVVA 3PC6A 3BMOB 1I0IA 1N6LA 5FUXA 4TXHA 1RBZA 4F84A 1USWA 3M1LA 2O2HA 3H87A 5FOSA 5CBPA 1SURA 3WYGA 2X7XA 1BCRB 1MEJA 1VPLA 4TMWA 1DXQA 4ZP1A 5DJ5A 1FF9A 3BWBA 1PT6A 5SYNA 1JXAA 5JZBA 4RPHA 4KHZA 3TPFA 1NI3A 4KZKA 2XTNA 4C5BA 1J99A 3TGPA 1S3GA 3OE1A 3S40A 4RTQA 2JFOA 3DZFA 3RS9A 2G3YA 4P0PB 1FFXB 3O75A 2QRVA 1EA7A 4V3CA 4DOMA 4I9NA 3ZXXA 5JFTA 2MT9A 3A6FA 3FOFC 2C7VA 2QRNA 4C6SA 3H5AA 5JI3E 3QX9A 4GSLA 1TCUA 2VNAA 3TCXB 4AC9A 4CKBA 3RIGA 1IVSA 3IVRA 1RRFA 3N2LA 4DCJA 3ELYA 4QFDA 2ZTSA 2MTBA 2O2ZA 3CZ5A 4RNCA 3TRKA 2UZIR 1YVRA 4OGKA 5GOTA 1YIAA 4KYTA 3HKDB 1GGNA 2GNPA 2VHCA 3QENA 4QU9A 1LVHA 2OCGA 3RFVA 1NW7A 2C4HA 3F5QA 1CY2A 1QCCA 4WLOA 1OAOC 2A0FA 3NIBA 1HE8B 3FKSA 3QU5A 1K5GA 2FFBA 5KSPA 2WG2A 2NQ8A 2GERA 1JPNA 3ROEA 2Z58A 2HWUA 4DCOA 4ETIA 3OFKA 4LE2A 4LZZA 4MUAA 3SS7X 2YZKA 1QNFA 4ARIA 1DC3A 3AKDA 3QPCA 2VJYA 1MOPA 1QR2A 2GJSA 2XT0A 3EQ6A 5FUWA 1ONOA 2LD4A 4JR0A 1FJHA 3TZCA 1J23A 1H2WA 4XUDA 1EDZA 1L5KA 2JLVA 1QOQB 4BKPA 1T15A 4IOJA 2YIVX 2P41A 1NBMD 2FWMX 3QHAA 4RC9A 3MBIA 5LNK6 3GF4A 3OZSA 3UW1A 5ARBA 1V2HE 2XODA 3PXXA 1DI0A 4X94A 5IH3A 5C35A 2OP1A 2WPDA 5LMCA 4UUBA 1O7JA 5FIUA 1OI3A 3PQ8A 2PGIA 3CVXA 1WEHA 1U2DA 3VH2A 4QNMA 5FBVB 1O0BA 3GRCA 3F6SA 1SQ5A 3MUOA 1WD5A 4BN0A 6Q21A 3A3NA 1XZGA 3FDZA 3SE0A 4F1JA 3ID6C 4C0HA 1R4MA 4KFTA 1PD1A 5IKXA 3WQHA 1RZUA 2X8LA 3G13A 3MBOA 2QN6A 4D9CA 2EWWA 5I3CA 4EZEA 2HF8A 2KI5A 3QSYA 4Y6OA 3GXOA 3L06A 2HQRA 4DCCA 2LE0A 3RVBA 2OC4A 1KK2A 2A1UB 5DF1A 3FPBA 1SXJA 3B6KA 1FFAA 1GLVA 1T8SA 3CCBA 3EY9A 5CA0A 5JEDA 3RRJA 2O2CA 1NN1A 3PKJA 3THYA 5JJIA 3X1DA 1AXGA 1X7XB 2I33A 2EWVA 1U5CA 3AEUA 3BSWA 3FIUA 3LMKA 3QVWA 4L0DA 4ZEWA 3HDJA 2NG1A 2ID8A 3KLBA 4NBWA 3VR2A 2BBTA 4CLHA 5L3SB 2VYVD 4PGHA 5B1EA 3B82A 5L45A 2PKYX 3I5MA 4RK0A 3OIDA 2GPJA 2P9EA 4II2A 4TM7A 5ALLA 1Z2NX 2W0MA 2GNAA 2WWGA 1NUUA 2BKUA 1WRBA 3D0OA 2E1RA 3CUUA 3PXEA 2WVHA 1T3TA 2PLNA 2Z5LA 1R4NA 3L8GA 3UKDA 4PZ9A 2G83A 4Q82A 1HE1C 3NNDA 2WWHA 3B78A 4LI3X 4NZ9A 5IT5A 3K9LA 1KEPA 1G0OA 3L7IA 1E1CA 1W5AA 2XITA 4BLQA 3P9PA 4CI0B 2PAAA 4N82A 4U1RA 4D43A 5BWNA 2VDRB 2XMPA 4P5DA 4XKJA 4OAPA 3GV0A 4BNJA 1PYDA 4PNZA 5L4SA 2I4TA 1U90A 5H81A 4Q9JA 2ODQA 4C14A 5DPMA 1CK4A 5KOHA 3S81A 1BEZA 1RAFA 3JYQA 5JFOA 3LFTA 4JB3A 4G5QA 1ZOPA 2VF4X 4TV9F 3VFDA 3HDHA 4US2R 2C7GA 5FBHA 1VPWA 1YCHA 3VSCA 4FGUA 1HEUA 3PGLA 1ZEJA 1Z0UA 1Z4OA 3T7JA 1EJBA 2V7WA 4IKEA 2V7EA 1QIIA 4CCAA 2BRUC 2P9HA 3YASA 4TWRA 1EE1A 4GMDA 4PAQA 2DOKA 4Q4LA 2YX1A 3EGIA 3D0KA 2C54A 4Q4JA 2VL7A 2HBYA 4E33A 4C7KA 3I5XA 4B3HA 2A0KA 2FFQA 2PZKA 1FDTA 1DCMA 1T4MA 1KHHA 3A6LA 4HGYA 4G23A 3IPXA 3S2YA 5JVDA 3MVEA 4B32A 4MUJA 4BJ5A 1S2IA 3IESA 1X1DA 4K6FA 3II6X 4NU5A 1L4UA 3PUXA 4CM5A 1T5DX 3EA5A 2HF9A 1JYFA 2Q3HA 1OBOA 3E9CA 5BVHB 3CJQA 1FUEA 3A0UA 1JNYA 2GKGA 1O4WA 1U4NA 3RGGA 5FBRB 4BIMA 2C1ZA 4JJIA 3W5IA 1T1GA 3TXXA 1O2DA 1O94C 3DMHA 3ZG6A 4MS1A 2D6FA 4G1UC 3M5PA 4G84A 3ETGA 4A15A 2ODTX 3UCEA 3C87A 3OQNA 3C6XA 2YN2A 1FP7A 1ECJA 4UATA 2NXWA 1L1QA 3EFBA 4HAWA 4IG4A 4S1TA 1PZEA 2SKCA 4LRTB 1L8QA 2NU6A 1FDWA 1GRQA 1DXOA 2ZT8A 1P4HA 5HF6A 3SYRA 1RXYA 4TROA 1K7XB 2OLEA 4ZCPA 2F8MA 3NZEA 1KKLA 1NJSA 4J07A 2DHCA 4U7DA 4CU2A 1PQ4A 4UBIA 1GUBA 1FDUA 3LOPA 2FEOA 4M1OA 4A16A 2EBUA 3HKEB 4EGQA 3IQEA 4ZZ3A 1K5HA 3CUVA 4S24A 3H3FA 3CG4A 4OIFA 5H02A 3QUSA 5BRNA 4RD3A 4GLFA 3L4BC 1PGNA 3VHRA 2YXDA 4YCSA 2AFHE 4FDLA 4CL8A 3G1UA 4AS3A 1GVNB 1UP4A 3K3PA 2Y1DA 2P2DA 4PZDA 5FI5A 3UHJA 5MN6A 3CBQA 5GGYA 2ZJ2A 4ILEA 3D6TB 3WRYA 4FT2A 5JZMA 3IS3A 4RSGA 2RGAA 1IXRC 2R2AA 2RC6A 1XTBA 5ESXA 4E94A 3EOZA 2JA2A 1OR8A 3PUYA 4GVPA 3D2AA 2HGZA 1LC0A 1CUYA 4JI3B 3B5EA 4CG3A 4CEIA 1QYDA 2PUVA 4HDKB 3JQCA 1K4KA 3DZHA 4AJKA 4D4LA 3TX2A 3IKJA 4AP9A 2QYOA 1YTLA 3GLKA 4LGYA 1JHPA 3O94A 1UPCA 3K09C 3QITA 5AI6A 3RJZA 3J81A 2XYHA 3KQUA 1S2DA 2WZDA 1K92A 1NVGA 2V3WA 4MJ7A 4M0DA 1V9SA 2R8OA 1CF4A 4CT5A 3RHTA 3TGLA 4JXXA 1JVSA 1A5ZA 3GBPA 3O84A 4HDSA 4QECA 5DGIA 3GIWA 4D0NA 2YWGA 1QG4A 2J6BA 2QU7A 3EMVA 1MZVA 1US8B 2WYIA 5K0SA 3HXMA 3VKUA 5BUSA 1TEZA 1ODLA 5J40A 2X9LA 3UEOA 2Q3EA 1B8NA 3WIBA 2M6KA 2IHNA 1YB5A 1YONA 2ZIXB 3DTNA 5EZ5A 1R4AA 1EB9A 1L5VA 5HYVA 3S27A 5C81A 3P2KA 1Y34E 3PX2A 1XL1A 1M1NB 4JC5A 5BQPA 4CM6A 4D57A 1PQPA 1RWKA 4NECA 4P08A 3F8SA 3N86A 3UH1A 1RLMA 3Q9SA 3LC2O 3NH6A 1HKUA 1RQ2A 1M83A 4BMSA 1TUGA 3CURA 4ZHQB 2OLJA 1KRWA 2JKVA 1ES9A 4Q3AA 3IKLA 4JMLA 2PYIA 2GN9A 3C1AA 2YXLA 3TLBA 2DR2A 1JAHA 421PA 4DKJA 2XQGA 3JAKA 1WZUA 2X0NA 5AIAA 5IPFA 1ZBQA 4JBNA 4M98A 4B33A 4N3AA 3EAQA 4DSZA 1PK7A 3A6GA 5IDWA 3JALA 3AL0C 3FCXA 3MGKA 4D8WA 2ZWPA 4C3VA 4RD2A 3QE9Y 4HB0A 5A0FA 1BTOA 2E6UX 3MFYA 4O1MA 1YU6A 2BSQA 3JYOA 1Q1GA 1JIKA 3NKVA 1KEVA 4AN0A 2AC2A 1L8AA 1E1RA 2FSIA 2KBEA 5HBRA 1XZQA 2CN1A 5AXAA 1RJFA 3KYCA 1MIOA 1YQQA 1DV2A 3SXJA 2J4DA 4HO1X 4AMZA 4EHBA 1W5TA 1PN3A 2YRFA 5T3YA 5F1YA 4IR7A 1U1CA 1JIUA 4MQ5A 3BRCA 4JI0B 1ECCA 5HWSA 3NGLA 1WS6A 3V1KA 4WH0A 1Z36A 2BW0A 3AM3A 3LZDA 2P65A 3EXIA 4LJYA 2IYLD 4Q1VA 2NVOA 3N5KA 4P36A 1HFWA 3TSAA 1E0AA 1XJ0A 4CKCA 2ETVA 1N57A 1KEUA 4BFYA 1TCBA 3B7GA 2VO1A 1J0EA 1NBME 3F6CA 4YJ2F 5TR9A 5JYDA 1V7CA 2HJVA 3HKCB 5COBA 5F1KA 5EMJA 1QHHA 1QCZA 3DEFA 1VGRA 5DI9A 4CR7A 1F4VA 4UOEA 5LNK1 1UKZA 3IV9A 3REQA 4YJGA 2VTVA 5G02A 3QRWA 1TQHA 5J2TB 4NMMA 1J00A 3VKVA 4V0RA 1XTUA 5EHXA 3GRKA 1CDOA 4GP7A 1MV5A 1ZICA 3CV3A 1ZC3A 3F1LA 1IL0A 1ISPA 4I4TF 5K3FA 3VAZA 5FTLA 1Q74A 1NYTA 1VB5A 2O7NA 2R00A 1EVQA 3E35A 4MRNA 1J56A 1ZVKA 1Y1SA 1KSFX 2AJDA 1BOFA 2AUNA 1MABB 3DMTA 2AYYA 2DGDA 3VOAA 3H2IA 1Z6ZA 2Q4RA 4Z7QB 5ALJA 4TTSA 3VHXB 3ZE0B 4EVRA 1OU4A 1GFSA 1SG6A 3SF0A 1M6NA 1OROA 2KBFA 5L3QA 3DNPA 5C4GB 4AAYA 1JR2A 3PC8A 2CMKA 1GZ4A 2HY7A 3EBOA 4L95C 4O08A 3G9UA 3ANTA 2GHIA 1VKHA 7AT1A 3EOAI 3M4JA 3IO3A 4YAWA 3LXXA 4JKIA 4MYSA 3STYA 4RWZA 3TEFA 3U4CA 4ZQHA 3VU8A 2OM6A 4E5YA 4GLJA 2DRIA 3ITNA 3AU9A 1BO6A 2FUG6 4X1KA 1NOJA 4G9GA 2AKYA 2F1OA 4UXHA 2ZYDA 4HNUA 2YWFA 1ZXXA 1LFAA 2PO5A 2FX5A 3GNSA 8GPBA 1KZ9A 1ICEA 1N5MA 3ODPA 4BMYA 3KPVA 2G1AA 4MB2A 3LFHA 4B7UA 2X2FA 2Q9CA 2UXBB 2BP7A 4CIWA 2J8ZA 3C5CA 4FFLA 3CMCO 3SJAA 1K97A 1W2HA 2ZDQA 3A3OA 5FBQB 3IUPA 3C4VA 3SBXA 5CJ2A 2CL6X 1G2IA 3OMXA 4LK2A 4M0KA 4P86A 1KDZA 1KMHA 4Z4QA 5CD9A 1IYZA 3T4UA 2EJCA 1P75A 2FH5B 4IHJB 4D92A 4BRWA 4A03A 2HMVA 3MA0A 4FS8A 3EARA 4M53A 1QU3A 4WVLA 1QBGA 5M3BA 3IP7A 1ZRSA 5F5XA 3MT0A 3TR6A 2ODNA 4ZJYA 1J42A 3K6SB 3U80A 2P5SA 2P68A 3T7CA 4E5PA 1TTHA 4LJ8A 4XM0A 1E0SA 1QO0A 4FOTA 4COOA 5ALRA 4OLBA 1Z3CA 2QVXX 4MW6A 4HGZA 2GPAA 3F3KA 4I3FA 1TO6A 2R4UA 4MS4B 4YBRA 5BW6B 1VE6A 3LX4A 3AI3A 3AY7A 4CIXA 4RJJA 4MP6A 1NY6A 3H11A 4BB5A 1HTBA 3GNLA 3L0PA 5KUTA 3JR3A 5CCXA 4C9BA 2QRGA 1NHWA 2BFNA 2GSWA 1NUTA 2FMHA 2CDNA 3OFJA 4G5SA 4XCVA 1VI2A 5KYTA 2JIBA 4KPFC 1G8FA 2QI9C 1JU9A 4ZPXA 5FI1B 4DF3A 1YMQA 5JDIA 1RZRD 3H2HA 2XX3A 4EAQA 3OU6A 3TZKA 4PAOA 1NNI1 4WCFA 3PWZA 4R6WA 5KDOA 2JJ2A 3FDXA 2R7NA 1BJRE 1I2AA 5F1PA 2V7GA 1LBEA 3QPBA 3ZCUA 1GR1A 5CDFE 1WXEA 4RZXA 4J0IA 4UULA 2PUAA 1F17A 2QTRA 3ZIUA 3AW8A 4YRTA 3VPHA 3AR9A 5TMDA 1E3MA 2XTJA 4NCXA 3W1EA 4TT3A 5DT2A 5F3DA 3Q9UA 2DKNA 1P39A 4BXOB 3MTIA 3M4NA 1E2BA 4D4HA 2OCAA 3AHJA 3R0XA 1VZ2A 3KJHA 1JDSA 4OHCA 1E0JA 4MDHA 1WPXA 3RKSA 1GKKA 1SGWA 5BR7A 5FWDA 2J5XA 3FHOA 4US1R 3NVMB 3D0RA 5I7WA 4C01A 2VG8A 3A1UA 2P9TA 4G1FA 4V0ME 4G0PA 1P9LA 3PQ7A 4EG6A 4O33A 4JLUA 2IDKA 2RHDA 3FZQA 2HLPA 4RV5A 3SFTA 5K09A 1R0YA 1XZMA 3WYDA 4MI3A 5FPTA 2IPAB 1TJYA 2F67A 4C3OB 5GPBA 3ZWYA 1BVYF 4C0AC 2Q4OA 4BKRA 1UBLS 1IBRA 2VHEA 2Z2ZA 2N9UA 3B60A 4GUDA 4F8EA 4RLFA 1OBVA 4BLOA 4BCDA 4FJ0A 5KYUA 4HQOA 2QX4A 2EIHA 2QX8A 2ST1A 1CHNA 3AXTA 3WB1A 1M2VA 3IMEA 1QG2A 4BNGA 3PQEA 4N9WA 3PEUA 7ADHA 3BJRA 2YY5A 2JB9A 1GR0A 5DBOA 4LSMA 3RC7A 5L6MB 2DHDA 2B8EA 1TT5A 2R86A 4IWYA 5J4LA 4GOMD 1LUAA 3FHLA 5ALSA 1YS2X 2BFPA 4KREA 3MRVA 1FLDA 1BA2A 1ADGA 2GFQA 3N7AA 3P1JA 3Q2KA 4LI0A 1S7GA 4WLVA 1SHZA 3OFSA 1TA9A 1A9RA 2ZXUA 4NAUA 1A97A 3FRHA 4PG5A 1F48A 4JJFA 1DAIA 4P92A 4I6EA 1R5NA 1N78A 1QYVA 5FEMA 4J3JA 1M2JA 4QATA 1F8GA 3FGZA 1XPJA 3BTSA 3FNFA 3QOFA 3ZHTA 1UMBA 4DJAA 2RD2A 1VXRA 1ZJ6A 3D7MA 4UFPA 4EVSA 5H80A 3VSDA 2H18A 1KE1A 1IVNA 3GG9A 4E15A 1N25A 1QH0A 4F9TA 3VJKA 3A04A 5KPJA 2XCRB 1DPGA 1FNSA 1NRIA 4JOBA 4NC9A 5FUYA 4DZZA 1FS6A 5HS6A 3K1AB 1BH2A 1BKDR 3GRAA 4J4TA 4HWKA 4QOSA 3EA0A 4FGSA 5ABPA 3HDYA 1MOQA 1QGDA 1CYDA 4P4UA 4NOJA 5I5EA 4OL9A 1NRWA 1JKIA 3EMBA 3UENA 1VKOA 3E15A 3QTTA 4XOIA 1IDOA 5ENDA 2QT1A 1GVHA 3S7TA 2TS1A 5K3AA 1R10A 5FNVB 3W9SA 1G5RA 2Y9MB 3N58A 5E4TA 1DRJA 3H1BA 4A3SA 2SICE 4DA6A 4MKZA 4P4SA 1V1MA 3FSEA 4IZOA 5ERGB 3T7DA 1K98A 2Y27A 3HR7A 3OZAA 1SMKA 1VTKA 1W4AA 2ZRFA 3P2IA 5CJPA 4EJSC 4Z4CA 6GPBA 4TRJA 5A4FS 3OT1A 5HP4A 1L7BA 1U3FA 3WQSB 1BU8A 4N0DA 3PK0A 1GZDA 5E4JA 2HXGA 4IIHA 5LB4A 5EYPB 4ACAA 4MI9A 4P7KA 3OMLA 4WLFA 1TUIA 4BUZA 4NBRA 4FOOA 5LP6A 1IN1A 2CJXA 5EKDA 4NOMA 2CSUA 2IYNA 3OOJA 2H1SA 4K05A 2FWBA 3PNBA 4KWIA 5IKOA 3GUYA 3WWPA 3ACDA 3QE2A 5AKXA 3PV0A 2IU0A 3RYFA 3UT5B 5JAOA 2JK1A 4LDPA 2AI2A 2UXDB 1GFWA 4ER0A 2NUAA 5CNMA 2GO7A 1CUVA 1AN0A 1N6HA 4UNQA 1G3IA 3B51X 3E2IA 3KB1A 1BKSB 1J21A 1NJ5A 4HNRA 4KN9S 4WJKB 3PE4A 5DFAA 1NBIA 3WV4A 3WK4A 3KLNA 4IILA 1SM4A 1QF6A 4ZD6A 1AY0A 2XUIA 5TEWA 1M6VB 3TQSA 3VH3A 3JQRA 3F90A 4JQYA 1CZNA 4G2TA 4ZDJA 3IXQA 3VC3A 3WGIA 4YRRA 3AR4A 3DEHA 4J1SA 3ZK9A 4GYJA 4G36A 4CBVA 4LF5B 1NQAO 5DW3A 4EFDA 4R1SA 4FKMA 5K6AC 1IDN1 1XXHB 1YI1A 4GRAA 5FB3A 2D0IA 5HFAA 3K73O 1EINA 1JLLB 2GF9A 4M38A 1ONNA 5A4IS 3KKOA 4YRSA 2HCJB 2ZYVX 4GX0A 4HMOA 3R77A 5F2KA 1TPZA 2A5YB 4CKWA 1EQ2A 4QO7A 3O1LA 2RB4A 1E2GA 3TJZA 2E37A 4G9BA 2B5WA 4ZZ0A 3LDFA 3KZXA 1RMTA 2ZRNA 1LK5A 1RABA 2VXOA 4AKHA 1W4LA 1PX0A 4CMJA 1Y6FA 3GGOA 1T9AA 2VLIA 4JXKA 3WLQA 1R0LA 4RHCA 1R6VA 4BDTA 3Q3JB 1TJ3A 2JKZA 4M1TA 4PHFA 1LWNA 4OP1A 1U9CA 4Q02A 5D2CA 1V7QA 2RHHA 3WNCA 3HNPA 5CB0A 1SKBA 3D6HA 3WIUA 5KO2A 3HYTA 4IDFA 1MB0A 1T9DA 4FYIA 1U8ZA 1HM5A 5EIBD 1U1FA 2G07A 3WYBA 3H2GA 4JQSA 1LJ8A 3FMOB 3UIEA 3AX6A 5DTEA 3ZGXA 5I7EA 1AO0A 1BX1A 3CCCA 1I2MA 1JGTA 2QAGA 5IEBA 5DI3A 3LLMA 1WPQA 4G4IA 4Q1BA 4YP0A 1ND6A 1K86A 5GMOA 3JQ8A 2G28A 2AYZA 1LNZA 1FX0A 1G7RA 4GZ6A 5AJZA 3GJ7A 1DT5A 1VB3A 2CUNA 3G2JA 3K5HA 3OQHA 5HUJA 2YV2A 1IRIA 2XIQA 3WGMA 1RAIA 3HCEA 3ZNOA 4NZMA 1PQYA 4HH0A 4HYTA 3HUFA 5T5QA 1AA9A 1PFKA 4PSDA 1LPSA 1QQBA 4OD0A 5ITSA 5CCBA 4IXWA 1QHFA 4KQ2A 3G0CA 5H3CA 5AM2A 1YGYA 2OBLA 3WMRA 2G1JA 1LLFA 1MH1A 1PJLA 3B3FA 2IX3A 4M1ZA 1PJ4A 4MDYA 1HLGA 2HFKA 3RS7A 2BFFB 4EENA 1XA0A 2J3IA 2YNMA 3PG5A 3BJEA 3AP1A 1PFQA 4OM8A 4QHYA 3JQDA 3P96A 3U3OA 3ZY5A 4BWVA 1FMFA 3O38A 2Y0BA 4K9NA 1FYEA 2QM3A 4NK4A 3MPUA 2F3UA 3A70A 3G59A 2HRBA 4IH1A 4K9QA 2ADMA 2VZ0A 4OJQA 5THXA 5KHLB 2Z4SA 4L57A 2YXPX 1ZBDA 2WF6A 2I4OA 4OHXA 3WSVA 4ARZA 2GKSA 1CQJB 4K1LA 2UZ1A 4UUQA 1DIOB 3R8CA 3WYCA 5B36A 2R85A 3TQCA 1G3QA 2VK8A 3OKCA 4RY9A 1HNXB 1OBFO 1XCLA 4L75A 3UAGA 3R5HA 2E55A 1E4EA 2A1TS 1XXLA 2UKDA 5DGHA 5IJ0A 3AM1A 2FFAA 5DMXA 2OGUA 1C80A 3A6HA 1SU4A 3PFBA 2ZJ7A 1JA0A 2FJ0A 2JD1A 2JGDB 5FLKA 1QAOA 3KV3O 2NTVA 3IEUA 4P33A 2V9CA 4DG5A 4DBLC 1KI7A 4GM0A 3VI4B 1KI9A 4CCYA 3J81k 1W36B 1UXOA 1XEWX 4UEWA 4TV8F 1SBYA 4N5DA 3ECSA 1XAHA 2VUHB 2Y6UA 3NJ4A 4IRUB 3L07A 3K0KA 3PI7A 4JXJA 3EIXA 4M9ZA 4BZZA 3ZCQA 2W6JD 2IUFA 3SNHA 3EVTA 1ST2A 1G5QA 1P0PA 4MOWA 1HV8A 3LUAA 4AMGA 2QG6A 2XDAA 3EEIA 2ET6A 4PR0A 3OY7A 5B1HA 2X76A 4B0OA 3ACBA 1ZM3A 5KI6A 2N47A 3OPVA 5KC8A 2JHAA 3Q3CA 2WTUA 2Y3IA 3ILSA 1ZLYA 2FKNA 3KBOA 1KF0A 3PHJA 2Y2VA 3Q3IA 5EMHA 3RU2A 4AO7A 5KTTA 3SZOA 4ZOAA 2CF5A 4MKFA 3FI0A 1J1UA 4BC1A 1RRKA 3C3DA 3L0YA 1U0BB 1G6KA 2GCOA 1PV2A 4LHVA 2GXSA 3C5HA 3CUSA 2HXYA 4FR0A 3ZWNA 1UPUA 2CNOA 2VZEA 2I4RA 4CDGA 3SLGA 5EZSA 5J2TF 2Y9PB 3G89A 3BX1A 3THWA 2FXIA 3TQHA 2PD3A 3I2KA 4L3VA 2P6OA 4HAYA 4O2RA 3ICPA 2JAOA 3Q11A 3LL4A 4J0GA 2WAOA 1W0KD 2Y6VA 2ZI9A 4IJVA 3ZEAA 2F1RA 1ARZA 5HF9A 2HK8A 5DSTA 2YXEA 3O0TA 4CN8A 2PPLA 1W1UA 3OZVA 5KQGA 4CEHB 5F9HA 3OP4A 4AICA 1FTSA 2DUUA 3HSYA 3MWDA 1PJZA 1NW6A 1SUFA 3GI1A 5D3KA 5DGDA 3TL6A 4RK5A 5JXWA 4NCAA 3LGSA 4Y30A 2BEWA 3LW8A 1H4SA 3UMFA 4YMWA 3PEYA 1MJFA 1M2OB 3B52X 4NYMR 1E8MA 3JQFC 4GE3A 1OYWA 5EWJA 2QZZA 1A95A 2D2VA 1YC2A 2QSYA 2RH8A 5T4EA 4CLRB 5JS1A 3E7DA 1UODA 1Z7BA 2BR3A 3QF4A 3EIQA 5IH7A 1A1VA 2RC5A 4AKIA 2YXBA 1O95C 4M9QA 4I81A 4OI2A 4QVIA 2FCRA 3WSWA 2XMZA 2XYGA 3Q88A 2IV2X 5KSOA 5CLIA 1IZZA 1R0XA 3LKDA 4K9OA 3TE7A 2WWXA 2HT1A 1DFIA 4XVQA 5HQ3A 3DW1X 4E88A 1CFJA 5IYZB 1CR1A 1RXWA 1O3YA 2PX5A 3G0DA 3OOSA 1DJNA 1X7WB 1AZTA 2B4AA 4IHJF 3I9LA 3RROA 1ZJYA 1SOUA 3ISJA 3M9WA 3UWOA 4LOHA 4YXWD 3AYZB 3K0CC 1EA5A 3WYEA 2XEDA 2J31A 3JRWA 1WWKA 1X7ZA 5MN4A 2A3RA 2IU4A 5J23A 4M0EA 3RW9A 3KKPA 4PQEA 1FNBA 4HSGA 5CYOA 2OQVA 5HOQA 2EHJA 4FC6A 1K9SA 2NQTA 3I09A 4IZ6A 4QOJA 2ZJ4A 3DKVA 1BROA 4JBXA 3IEPA 4I46A 1R6DA 2QZ4A 3MFQA 4XFJA 1QVWA 4OIMA 1WCXA 1K1EA 3T9CA 3VISA 4BIIA 3ZS9A 5HZKA 4WKNA 2P75A 1YCGA 2P9BA 3FMVA 1RJWA 3H83A 3ZCXA 1IHYA 2P6UA 5B3AA 2RK3A 2X6RA 4LTMA 5DVZA 4D74A 1BN6A 1ENYA 3QG1A 4GPZA 4IJUA 3ER9A 2I91A 3SZ3A 1U0OC 4BX8A 3UHOA 2FV8A 3KR2A 1DOHA 1MENA 3M5DA 5BW4A 1U02A 4NJMB 3S68A 1XJWA 1UKYA 1P3DA 1Z25A 1QWOA 2ZULA 3EODA 3F0TA 3Q3HA 2H1CA 4LQLA 4UVGA 4DTIA 3G9TA 1KSHA 3H86A 4RZSA 4AX8A 1QOPB 2WUFA 1DO8A 4FI3F 5BORA 2WJAA 3CLSD 1W8IA 2V5AA 4F3CA 4ENWA 5KNDA 4FMDB 4HNGA 2JI6A 1IIRA 1GL6A 1LK7A 1OLOA 3HMKA 1B6RA 3NNSA 4MV1A 2VEOA 4PRZA 4X9XA 1PIWA 1IZ8A 1NL3A 2V03A 2WW8A 1SRQA 2D1SA 4HGQA 2CJWA 2VQEB 2LCFA 1V7PC 1Y3IA 3GLHB 1EXDA 1EWRA 3CZ4A 1UBHS 5JQWA 2A0YA 1QIFA 4U3JA 2A33A 4NAVA 2GEBA 5H68A 1CYEA 3AHCA 2WJGA 4UZSA 3PQCA 3FOZA 3CX7A 2R1TA 4GPTA 3DPIA 4C1NA 4DLWA 3HNRA 1V43A 2RHJA 3U37A 2GVZC 5A06A 2ILVA 3HP4A 4AS1A 1ZUHA 3UJHA 1L8XA 2EKLA 4EJ2A 3CNEA 2GN2A 4XASA 1R0KA 3F9CA 2ZVJA 3G49A 4KEAA 3TTVA 2NP7A 3LYHA 1T1IA 2MYUA