1VGQA

Formyl-coa transferase mutant asp169 to ala
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
427
structure length
427
Chain Sequence
TKPLDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRGWLQDKPNVDSLYFTMFNCNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANEHLKVYENVAQCSGGAAATTGFWDGPPTVSGAALGASNSGMHLMIGILAALEIRHKTGRGQKVAVAMQDAVLNLVRIKLRDQQRLERTGILAEYPQAQPNFAFDRDGNPLSFDNITSVPRGGNAGGGGQPGWMLKCKGWETDADSYVYFTIAANMWPQICDMIDKPEWKDDPAYNTFEGRVDKLMDIFSFIETKFADKDKFEVTEWAAQYGIPCGPVMSMKELAHDPSLQKVGTVVEVVDEIRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLKELGLDDAKIKELHAKQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and mechanistic characterization of the formyl-CoA transferase from Oxalobacter formigenes
pubmed doi rcsb
source organism Oxalobacter formigenes
molecule tags Transferase
molecule keywords Formyl-coenzyme A transferase
total genus 148
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.8.3.16: Formyl-CoA transferase.
pdb deposition date 2004-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 1vgqA02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 1vgqA01
1XVTA 2VJPA 1T4CB 2VJNA 1XA4A 1PT5A 2VJOA 1Q6YA 2GD0A 2G04A 1P5RA 1VGRA 2VJKA 1Q7EA 1XVUA 1PT8A 1XA3A 4ED9A 2YIMA 1PT7A 2GCEA 2GD2A 2VJMB 2GD6A 2VJLA 1T4CA 1XK7A 2GCIA 4HL6A 2VJQA 1XVVA 1PQYA 2VJMA 3UBMA 1P5HA 1T3ZA 1VGQA 1X74A 1XK6A
chains in the Genus database with same CATH superfamily
4YJGA 1SXGA 3VU9A 2B2XA 3BT7A 1JFVA 1SBZA 2R60A 4OL9A 3QY9A 1WABA 5BPHA 1DZIA 2PKRA 4I4NA 4QZVA 4IVNA 2GM5A 1R0KA 3FRHA 3G2NA 4CKEA 4ZI7B 3EEQA 2OESA 4CKCB 2IEDA 2IYSA 2RC6A 1YR9A 2H07A 3HGQA 4X3OA 5F4BA 3OUTA 2C7PA 1LDYA 2O48X 5H02A 3WYGA 2WIJA 3MWFA 1HI9A 1M0SA 5JT1A 2ZIXB 2ZUTA 2AR9A 4H17A 4LV8B 1XV5A 3JZMA 2BSXA 3O03A 1XNGA 1CB0A 3MOSA 2DR2A 1ZSNA 2FX2A 1VCMA 3ESCA 2PS3A 3WRXC 1IATA 1WRBA 1GGEA 5DCWA 5FLKA 3WLPA 1LX6A 1PQYA 1GP2A 1O9HA 3BMQA 5EIOA 3L0YA 2WRZA 3QBEA 1YCFA 4X9XA 4AZTA 2JFGA 1C7JA 4MVJD 3RK0A 1CY4A 3DM9B 1NVWQ 4E32A 1ZD3A 1X2BA 4D3YA 1EVIA 1RC0A 4LA4A 3L79A 3O82A 2REQA 3DW1X 1Q1EA 2NO5A 4OQYA 2EJUA 1RM4A 2HU8A 3AHDA 3B2NA 2ZRCA 3EVGA 4DDVA 1KSJA 5JNUA 3EOAI 5KOHA 5C51B 2B3DA 3FHLA 3FKJA 2Q7OE 4E5PA 2AI2A 4IJ6A 2GAOA 4IUDS 4FZ5A 3E7PA 4B34A 3SLRA 1V4VA 3JXEA 1UDBA 3TG2A 3H19A 3IPCA 5LMZA 4IEEA 5BO5A 2X3UA 3U19A 3OF2A 1F0YA 4OUDB 1T9KA 4ZANA 4D3FA 3THXA 1X77A 3Q2IA 3HZHA 4DKXA 3TK1A 2VRWA 3ZE9A 4QE3A 4D8VA 2QUHA 4FYVA 5FTJA 1VHDA 3UB3A 4PWZA 1SC6A 2PVCA 2H4ZA 1EK2A 3U1TA 1J6UA 3D64A 2RGNC 3RJZA 1VSBA 2GNPA 1XNJA 2BKUA 3NQ41 1FRQA 4U5QA 5ICGA 1P0MA 4LOAA 5HNKA 1LZKA 2HLPA 2ISCA 1YIAA 2MT9A 5DM60 1XRRA 1QWSA 1ECCA 4RSMA 2G7MC 4RGQA 3MT7A 1O77A 3ELYA 1U2DC 1ECLA 2GBPA 1EVZA 4C0WA 5KNCH 2NZXA 1SCJA 3L43A 3PGVA 1VGQA 1XZFA 3H9BA 5AVRA 1CLUA 3L6OO 2BTQA 4JGGA 3TGPA 3OQHA 1BXGA 3ZXYA 2ZUBA 2AS0A 1OOEA 4CMJA 3L4EA 3SFTA 4JYBA 3LQ2A 3BGSA 4GLLA 4TTJA 1HRKA 3QFSA 4DA6A 3I8SA 3DWFA 1X3LA 3G7NA 4GWKA 1QH1B 4QGBA 1X8XA 5K4GA 2JBWA 2GFIA 3VO8A 1PCXA 2XCUA 4V02A 4EW3A 1JSCA 1EFTA 1KPGA 4F71A 2WT8A 1DC5A 4EY6A 5A02A 2X13A 3TQIA 3NTLA 5TY0A 2VDQB 4CHTA 2AQ8A 2GARA 2WUVA 3KZMA 1YFKA 3LF1A 4U6SA 2CLCX 1KOGA 2W6JA 4EATA 2VNJA 2VYND 1AKRA 3LQKA 1Q7RA 2BGNA 1QE0A 5J1SB 2PKWA 3JQFC 5F5NA 2Q5HA 1A8SA 3U4CA 4Z54A 3B5JA 4XUCA 1QVRA 1EJ6A 2VH2A 3BS4A 2HFJA 1YBAA 2X86A 1TTQB 4LE2A 2AHRA 4OATA 3BWXA 3KQPA 2JKYA 4TL9A 3SQDA 5G3YA 2V6MA 1JSLA 4RACA 4ON9A 3G5TA 3PVZA 3ZDXB 2FE1A 2JCXA 1FUUA 3DLCA 5B1SA 1AO0A 1KC3A 3KJHA 4J1TA 1KVRA 5MFPA 4HLUA 1DRWA 4OGWA 4V0OA 1JKFA 4Q15A 3T61A 1N78A 3D4OA 1FDTA 1QM5A 3HDJA 2V58A 4P98A 2G71A 2J33A 1K6MA 1WTAA 2EJBA 4WH0A 4QT0A 5CDFE 2J3LA 3O4VA 3PUYA 3DUWA 4RTNA 3IC5A 2OQRA 2C4HA 2PX3A 1I1QB 1OGJA 4F9FA 2WI8A 1QGDA 2QYSA 2L19A 4MB0A 3DHNA 4O4LA 4N7JA 1ENZA 2O8BB 3HYRA 1XPJA 3TWOA 3G2MA 5H68A 2OK7A 3JPYA 4I81A 4MRMA 2AFIB 1LNSA 1MN6A 5T57A 5FWYB 4DN6A 3KQHA 4EGAA 1BGVA 5K5EA 1OPRA 3ANNA 1JA0A 4BO9A 3I6QA 1FFAA 4XOIA 3P5BA 5ILGA 2TMGA 3BRSA 3H9QA 3VH1A 3FFAA 5FOQA 4P4LA 1QTRA 2OQIA 4R7GA 5TPWB 5K01A 3AVPA 3WSTA 2VAPA 1RBYA 1ZW1A 1E3QA 2B8JA 2KBEA 3EGVA 3HU3A 2F2TA 2H08A 2B8EA 2JA1A 4MP3A 4ZTUB 2J6IA 3T0FA 1GZVA 2ZRMA 3DEZA 4NJMB 1RKVA 2WP0A 3L7AA 1DRJA 4II7A 4IOKA 2KHZA 4LYEA 5AI4A 3TTYA 3P45A 5JWRA 2JGKA 2YJNA 2PKEA 3C8ZA 3LE8A 4HNRA 3JWHA 4B8ZA 1IC6A 1Q83A 3LGXA 4YWHA 5JD3A 5U1PA 5DN6D 3QE9Y 2XKJE 3N7TA 4BWGA 1BHSA 4TSFA 1YC2A 1MZVA 3U48A 5I4BA 5FX2A 3W5DA 1B6RA 3LW8A 4RQBA 4K9QA 4CKZA 5HMMA 8ADHA 2JEOA 4DY6A 3WMXA 2WSIA 3K94A 3LDUA 2OC9A 1DQNA 1IHXA 1J7JA 1QYRA 1JU9A 3DMGA 4C2AA 2J3HA 2IXEA 3G8YA 1Y9DA 3DYIA 3NOOA 3O92A 3TBKA 3S1SA 1XN4A 3DVAA 2RI6A 5H4GA 1N6RA 3DR5A 4UHJA 3VPAA 1E9FA 2VUTA 1TC1A 2ZBFA 3TE7A 2I99A 3UUGA 5HS6A 5A4AA 1QK4A 1V71A 3UAVA 1C7EA 1NULA 1YQXA 1Z8HA 3DQQA 2GCNA 3JVDA 5F23A 2QN3A 2DTDA 1EG2A 2QPLA 1PT5A 4PHTA 3KKMA 4TS3A 1JRLA 1GTJ1 1N75A 5DLQC 1L7QA 5I5EA 5JLJA 4CHGA 2DBRA 3HLTA 2J30A 3GPCA 3JQAA 1GNTA 4QOJA 3MYYA 4WRRA 3T12A 3QPBA 1UKYA 1PGJA 3TSCA 3OZSA 1USIA 4HYTA 1FP1D 1XTRA 2EBHX 1G21E 2JZCA 3C6MA 4QGFA 2I2DA 4X41A 2MYNA 3P2EA 3PDCA 1N5MA 1PZXA 1CV2A 2GKOA 1NVGA 3DEFA 5D1HA 4YMUA 3GFGA 2O0HA 2IW3A 1QP4A 1UJBA 4J3NA 4MX8A 5K4AA 4NBVA 3SC3A 4CZ2A 1J0BA 1LKZA 2EFDB 2J9XB 2VF7A 4W9NA 3HA5A 3AILA 3VR3D 3OG9A 3FNRA 2CJWA 4M37A 4WN3A 1Z5GA 3ULKA 5JTUA 2V98A 2W6QA 1BAPA 5J3JA 1RTTA 3OCZA 2ANBA 3PFNA 2QTZA 1FL9A 3JASA 2IYZA 1PV4A 3E03A 4X7BA 3JS5A 4AP6A 2NU7B 4JCOA 1V3QE 2HF7A 3Q87B 1JF8A 4LXHA 4M0EA 2TMYA 1R88A 3CLVA 3BL8A 4IDFA 4P4TA 1XI2A 2PSHA 4MRAA 4DUZB 3IQZA 1T9GS 2AN1A 1H2FA 2VS1A 4RPIA 3IVRA 4KW7A 5TVGA 3S5UA 2FHSA 3V7FA 4E31A 5KOIA 5EXSA 4FZRA 1U9IA 3AEUA 2ZE8A 1DPFA 4O02B 2QL6A 2Y27A 3CURA 1CD5A 1J5XA 3I4CA 2XMBA 3NGLA 4OMUA 4JDPA 4RTJA 3J80A 3RV4A 3HADA 2HK8A 2YNMD 4EELA 2H2AA 4P3KA 3WGVA 4JI1B 2CL6X 2Z95A 5CM9C 1DU4A 2FU5C 3RYIA 3H5LA 3WWYA 4TL6A 2JGEA 3ZZMA 1ZQ1A 2PD3A 1UM9B 4DDUA 3WK4A 3ASVA 4P83A 2IYQA 4GOLD 1ZJ5A 4MB2A 1HL3A 3NEJA 1RAEA 2O8DB 1P8AA 1KZ6A 2VHYA 4KDFA 5ARDA 4RLSA 5F33A 3W5SA 3FWKA 4R1MA 3QXJA 4DLTA 1OBHA 1CSEE 3QV2A 4J3FA 4BQSA 3MCWA 1MO5A 3G3EA 4L4SA 3V55A 2JIQA 5I7SA 4KV7A 5JH7B 1YNSA 3GLGB 4GYKA 3NXKA 4OY3A 2IL1A 1MIHA 3Q4GA 3EC2A 1L1FA 2HOQA 1MTOA 2MMCA 2PH1A 2GUGA 4D42A 2A5YB 1H6CA 1G41A 1FJ2A 2VP0A 2V7PA 5LBIA 3AW8A 2Q3JA 1WCYA 4MJXA 4JI2B 4CMIA 4E22A 1Z29A 2H8GA 1T0UA 2CZQA 4XWOA 1J24A 5C7LO 5IKPA 1JDSA 1DUVG 3ESAA 3OT4A 2IWHA 2LKDA 2QJFA 4DCTA 3RVLA 5K3FB 2IS6A 2WU0A 2GKSA 3CH4B 2XRFA 1R0XA 4CE6A 1SXJA 3H5AA 5IFLA 3AHCA 3JAWA 1S7GA 5AO9A 5KKAA 1XTZA 4XPIA 5KWSA 1H2WA 3NKFA 1GY8A 1QQ7A 5G4KA 2JHAA 1L4GA 2WAXA 3UPUA 4ZVOA 3B7GA 3V48A 2DF8A 3GEMA 1I3KA 1CFJA 3LH5A 4FEAA 2F9LA 1U8EA 4PHFA 4F4IA 1NBME 1XQVA 4IFIA 4JZYA 1POXA 4B6FA 2WF9A 5HJ5A 3BGIA 2YQZA 4BNNA 3CZAA 1O4VA 1ZJWA 3D1LA 1VPTA 4WXRA 4AZSA 1Q0SA 5E4JA 4BX9A 1OT5A 4WINA 5EXXA 4WX2B 5AW2A 2YJGA 3KV1A 1PAUA 1ACLA 3RFFA 4IUYA 1OU4A 1A4RA 1RI1A 3RW9A 3LECA 3N8IA 5D5PA 1FC0A 4KQ2A 1O58A 5LD2B 2WNIA 2W98A 5ISMA 4BMSA 5SY6A 2QBYA 3JQ8A 2AN4A 4F7DA 3CW9A 1X8KA 2H9AA 5HKLA 2PU7A 3L9WA 1YWGO 3KOWA 1YKGA 4LWPA 3UA4A 1RWKA 2FWIA 2GNAA 2QGNA 3PDUA 4FHZA 3M83A 5IANA 1N34B 3UG7A 1M75A 2I2FA 1RYZA 4BLQA 3VAZA 1YVDA 1K6EA 3EIEA 2JIZA 2GGSA 4UJ3A 5CLGA 3RWBA 3KTAA 3FCUB 4LW8A 2P30A 4RF2A 1ENPA 2J08A 3I3OA 4LJ4A 2I7TA 2XZDA 4O4LB 1XZJA 4LZJA 1QYIA 5D51S 1XEXB 2YJZA 1Y5MA 4INPA 1G20E 4U2BA 1PBTA 4XQ9A 5HFNA 3T8YA 3X43A 5GZ3A 1YACA 1T9HA 2H1OA 4LF5B 4OVKA 3IXMA 3S7TA 1L7AA 5LZ8A 3NBAA 1BVRA 1EE2A 4ZYVA 1SVMA 4I3GA 1XD8A 1NW3A 1NM5C 5CTAA 3UFXA 1RLTA 1MQ8B 1KO8A 3NONA 4JJ4A 5H82A 3TYXA 2Q6KA 3U49A 3UMCA 1GKUB 3ZE8A 2FQXA 4AX8A 4D46A 5FL3A 3E5NA 3OQIA 2OFFA 4MHTA 4M87A 4FOPA 3GUHA 2HN9A 3QTTA 4XM0A 3T5GA 1KKUA 1N7HA 1NTOA 1LLDA 2C4MA 3FDJA 5TF0A 3ONVA 1U65A 4NYJR 1WXWA 4LJ5A 4RX1A 2O2DA 4WSOA 4XDGA 5I8ZA 3T7AA 4BN0A 4QDZA 5I3ZA 4RV4A 1NOKA 3SZRA 1QQBA 4DMFA 2C2KA 2ORWA 1XZAA 2C5BA 4HF7A 5CM2Z 4M1MA 3Q3IA 1CR2A 1FXUA 4UVGA 5HZMA 3IPLA 1JB9A 4LYDA 3QMPA 5GPBA 5BUCA 2CMHA 4K05A 3SU8A 3V8MA 1IHYA 4DNFA 3SDBA 2R5NA 2WV7A 1P2FA 1CUAA 1YL6A 5SYNA 2F48A 5IUJC 1ESCA 4U2EA 5H0IA 1NBEA 1RD4A 4JT4A 3V8PA 1H0SA 5ITVA 5GVSA 4JB0A 3GG9A 4D45A 2AVNA 4E09A 1X3SA 3CPJB 1PNOA 5LP1A 5LOVB 2QY6A 4BO5A 1YQWA 1JDNA 2BR5A 3MOGA 4FCCA 5JO9A 4V1CA 1MOSA 1OWLA 3U4HA 4W82A 5HM6A 2GD1O 3G0GA 4PLCA 3TN7A 1C7FA 1PEYA 1S3GA 1XVIA 2WTAA 4NU6A 4OYHA 4J76A 3EVZA 4D8XA 1C41A 2B5OA 2IPXA 3L8HA 1FQKA 5HP4A 4BV9A 2E3JA 2M6SA 3X1ZA 1NRIA 3FA2A 2CD9A 4BVKA 2HQBA 4BTEA 4DT1B 1G5HA 1UAGA 1MAUA 1X7GA 2Z2YA 4TV9F 4W8OA 3OTOB 3WZ2A 1JEYB 3QFRA 2PGJA 2AG8A 3KQVA 5EQDA 1N6LA 1WEKA 2JFHA 3A4YA 1ZCAA 4DLNA 4BFUA 4RULA 2R4QA 1O57A 4FMDF 4DQKA 3P0JA 4Z9BA 5DI3A 3AP1A 3P9IA 2PZMA 3CRQA 4OGLA 4UFNA 2GBLA 2H51A 4MCAA 1J0DA 3WLNA 4QFDA 1E9CA 2WKQA 4ZYXA 2HNBA 3ROTA 4DUGA 4LZZA 3R7FA 1YMQA 1QF7A 4ND4A 4EHKA 2IS1A 1ACJA 4YAWA 3BXXA 2YNMC 5A5FA 1W34A 2QDXA 3DHVA 2XOKA 2H4XA 5KDLA 5BQFA 1FVHA 2HSZA 4K7JA 1M2FA 4KITB 2R85A 3FY4A 4EZEA 1W8DA 3UAOA 4NV0A 1CS0B 1KF0A 2Q0HA 4FJ0A 3VR5D 4AG5A 3A4TA 3DLHA 1Y1LA 3WAKA 1F8YA 3BCSA 3JVEA 3NHJA 3GU3A 4Y67A 3S2SA 1GN8A 4WK4B 2R8XA 1NU8A 2LDXA 2ZJ5A 5LZ2A 4QU8A 1BW9B 4FC7A 1TM5E 4C01A 4BE7B 2OT3B 1LWNA 3M33A 3W7AA 3IPYA 4D0RA 1NW8A 3OM0A 5LU8A 1EWRA 4JKYA 2A0XA 2N3ZA 2XYPA 3CEJA 3ND5A 4PWYA 4RD0A 3RO7A 4CIDA 2FZ5A 4BFVA 1U7TA 4LYFA 1KR2A 3G13A 4MRVA 4UM9D 2AXPA 3C7CB 1Y6QA 3S2UA 2AJLI 2JGLA 1S2NA 4XLZA 2CF5A 4F46A 5I4KA 1GG8A 3O4GA 2GXAA 4JI7B 1G7SA 1SC3A 5JAOA 3BRQA 3IKMB 1CQXA 1DV2A 3D2AA 4L6CA 2FEWB 3ZW9A 2WAMA 1S01A 4AF8A 4GGMX 3ZZ1A 2V03A 3EZYA 3IA7A 3F49S 1T4CA 1BHO1 3HUUA 3WRXA 1C0PA 2E18A 2IUYA 1A9PA 4D9KA 3GVCA 1RRVA 3DO8A 1J1IA 4PEVA 2DHDA 1R15A 4JEIA 4RJ2A 2GHTA 4UKDA 4ZO6A 1YS6A 2UZ0A 3UCFA 2FSVA 5JH7A 1SIWA 1F1JA 1P2DA 2GT1A 3IHTA 3M3HA 3Q3HA 4S1NA 5EHQA 5I5GA 3ZWNA 4XQ0A 4CN8A 4ZZ3A 1OZGA 3Q8WA 1A4IA 2C3MA 1FYVA 4IJWA 3D43A 4X1YA 4YV1A 1IXKA 3HHEA 5F7JA 2B20A 4CMEC 5IAAA 2IQ5A 3EGXA 3QMMA 3HKCB 4OP3A 3FMGA 4Q1CA 3CR8A 2WP8J 2Z2ZA 3L8ZA 1XA3A 4OLFA 1Z0AA 1QHHA 1K5HA 3AYXB 1REQB 3JCZA 5DTQA 2ODPA 5DWDA 3RSCA 4ETIA 2HNKA 3TI7A 5FD8A 2GS9A 3DHYA 2OCDA 3ICCA 3AJ8A 3O1HB 4OQZA 4Q1VA 4TM8A 5DNDA 3KXPA 1LXCA 3FYSA 4UBMA 1H85A 3GX1A 1CVIA 1DCMA 1GLNA 5FTNA 4FQ8A 3TJZA 1PJLA 1QIMA 1WB6A 3HCDA 1IUPA 1Z2DA 2PU5A 3FVQA 2Y77A 3CEPB 2PX2A 1CULC 3OF5A 2NSHA 2IZ5A 3ZIDA 5K99A 4GZ3A 3IEXA 3TL6A 5BV2P 3B1FA 4KVGA 1S3IA 1XTJA 3S29A 3SKYA 1J4AA 4XD7D 2GJSA 3EAQA 4LAFA 3RBXA 3TECE 3OIVA 2QG4A 5E1BA 3EAGA 4HEJA 2IPMA 3DDCA 1U1GA 1U3VA 2OFXA 1QOZA 2B34A 2D1YA 4KGXA 4KBYA 1TO1E 1U81A 2C5EA 2CW5A 2Q3FA 2H2FA 3ET5A 4OOFA 3UK6A 1U3TA 4HSEA 4JP3A 2WDZA 1ZN9A 3RODA 2XCTB 5HZHA 1D4ZA 2FF5A 2ZJOA 1SJ9A 3LBIA 2FSPA 1NP6A 4AIRA 1A9QA 4Q5IA 3WK8A 2M1ZA 3LUHA 1J1ZA 1XB2A 2W6ID 2XGSA 4H7FA 3RUDA 3W5UA 5A71A 1IQPA 1TUGA 3ZLTA 1R0YA 1QGED 2JK1A 4FFBB 4D97A 2QLMA 2ZIFA 1GPBA 3IMKA 3R24A 2IE0A 4G41A 1KSHA 4ZAGA 1SCDA 2IZZA 3HXTA 4KAXA 4CI9A 1W1UA 1PLLA 1V6AA 1R50A 1W4BA 4JJ8A 3P0RA 3RK4A 1K6IA 1PJQA 1BKSB 2JLQA 3CJRA 4MQFB 4NJEA 5C3MA 1RI3A 5AW0A 5C31A 3ABZA 1Z4PX 5F2KA 3LK6A 4FW9A 3QOXA 4BP8A 1R0SA 5JLAA 3IV9A 4Z1OA 3BJZA 3HXPA 1PFKA 3K9HA 1L5RA 2Z6UA 1H94A 5ELXA 1A9YA 4BBJA 1BWSA 1H05A 2LV8A 4PAMA 1Y6ZA 2AG5A 2BFAA 4BAZA 1V11A 2OBYA 4OB7A 4AT1A 4YAOA 3D59A 4DR5B 3R74A 3K53A 1SXIA 2W6JD 3JQ9C 4G5XA 4S24A 1GGFA 5D3KA 2QD5A 2DQSA 4DIKA 5ALRA 5AXBA 3EXEB 5TMDA 1Z5VA 4NBTA 1T8SA 4CEJB 2M1XA 4OFZA 4U7GA 1BE8A 4TLMB 4DYDA 5KNDA 4IIVA 5F5LA 4JXXA 4YAJA 4XVHA 5G0TA 2VJCA 2AZ4A 1Y1PA 1GV0A 2OCPA 1EFKA 4C7XA 3DYVA 4ZEOA 2WNHA 1CS4C 4MGEA 1L7XA 3IUBA 4ARCA 3GNQA 2K2QB 5KQLA 3TLEA 3L5OA 1CUCA 2CMDA 1LF0A 3GJRA 4PPQA 2IHZA 1JNXX 2Q28A 2EW2A 2W0SA 2CHEA 5FFMA 2J5BA 3D81A 2CNWA 1GQFA 4KQJA 1QHSA 3Q0TA 2AMJA 1A2KC 1J00A 2HU5A 2YV4A 3EC1A 5DSTA 5ANRB 4LOKA 1ZRMA 2ZB4A 1L4FA 1F60A 3L0SA 5A4MS 2FZWA 2ATIA 4B76A 5IZCC 2H48A 2R2AA 3SZUA 4N7BA 3FIJA 1G3QA 4RZHA 3WIUA 4DPKA 3IP7A 4RTKA 3GA7A 1N2ZA 4B82A 4Q19A 2VAXA 3IP3A 3H4VA 4KTTE 4WZAB 3PKIA 2N1MA 4MW2A 2OY0A 3W5HA 3I2FA 5F35A 2YVQA 4LI3X 1O96B 1DOAA 1WMBA 4PZZA 2J9FA 3DBHA 3JATB 2VWPA 3OEHD 3ONFA 4DDHA 4D5GA 4XYBA 4IOJA 2FQYA 3B9QA 1F1BA 4NNOA 1WHTB 4RZQA 5JUWA 1NASA 1TCAA 2BY4A 2ERYA 1N0VC 3EPPA 5D1NA 4PSUA 3W6UA 1IMOA 1L7NA 3EF0A 5CNIA 2JHGA 4RV5A 5DLDA 1GUBA 1L7PA 2ID7A 1YI0A 3E5RA 4G5YA 1LDNA 5JARA 3HCBA 1Z5ZA 2BFEA 3RFCA 5F12A 5IJZA 1G0OA 1IFXA 3PE4A 4MV1A 1DIRA 4H7IA 1TAUA 4JNCA 1UBJS 1JXAA 2NG1A 3KKLA 4GBJA 5E8JA 5EPOA 2R62A 3TPFA 2AZXA 3UF0A 4XCQA 1UEXC 1CUXA 2HMSA 1Q19A 4GBMA 5A9RA 1I51A 4A6XA 2VR1A 1SGWA 2I2WA 2QE7A 1JDTA 4HAWA 2FW8A 4K6GA 2NT3A 4MVJM 4Q48A 4I50B 5DNEA 3PV0A 3FIUA 1GGJA 3GRCA 3GJ5A 1X15A 3D3WA 4P4UA 3KYDB 3DULA 4K6KA 2F8SA 2GZDA 3L5KA 1E6CA 2CK3A 1EGHA 4AZ0A 2IXDA 4BYMA 2SKEA 4YQFA 2ZIAA 1W1IA 2YHIA 4C08A 2QN7A 4ND1A 2ZKIA 3KE9A 4RESA 3S81A 1OWOA 1NI4A 2PRIA 3FYUB 1Y9JA 3LDGA 4GOJA 4TSRA 1R5OA 3RUIA 1E9RA 3U6KA 1PYGA 3KEFA 5TRTA 1TYEB 4N8EA 3ZXUB 4HAYA 1R18A 3W6NA 3OIWA 1BEEA 1NBAA 1TUBB 5AM1A 3S44A 3H4TA 2JI8A 3ZYZA 2P2DA 4HNGA 4XYLA 3QY0A 4KUEA 3MC1A 1GRRA 1R9NA 2JIPA 2TECE 3JVIA 4M21A 1W5TA 3X1MA 4XR9A 3U5ZB 2Q07A 3CO5A 3D7RA 5AICA 3ZEAA 4MQBA 1YIDA 4EG3A 4GOND 4LHWA 1FXSA 3GCGA 5LQMA 1KEEB 1PEDA 3WLJA 1QYDA 5CXSA 3VSAA 2QHXA 1GL6A 2YZ7A 4F12A 4CKYA 2OHIA 1NJ1A 4KVFA 1DVRA 1MORA 1A2QA 1M9NA 2P35A 3JTEA 1P2UA 1MU0A 3IBCA 2RBEA 1C1DB 4L0DA 1PR9A 3VPCA 2Z5FA 2RHDA 3AHIA 2UVPA 4FCVA 2MSWA 2QZ4A 4LKRA 2ONJA 3SD7A 1ORWA 3DAYA 1TM3E 5DX1A 4KNYA 1J9ZA 1VLQA 3L8YA 1IUKA 4KE9A 3QU5A 4OU4A 3IP9A 3LI2A 3NBYC 3PUHA 1UMDA 1L8LA 1SVIA 4H59A 4YO8A 2OKGA 5AKIA 5FV7A 2XCSB 2Q99A 2Q2VA 4F1JA 2I71A 4Z4FA 2WD7A 1KJYA 2HD4A 1VJ0A 3E5HA 1DO8A 3EIHA 4GF5A 1VECA 3IDZA 1K1EA 3KD3A 3LHFA 1EWYA 2B5WA 2IOYA 4R7ZA 5COAA 3VYTB 1WVGA 1U0TA 3PKJA 1KE1A 5LQRA 1ZWKA 5J59A 4W5RA 2B99A 5EJGA 4KRXA 3TFWA 2YCBA 3TLAA 1VKOA 2VJMB 3K1TA 4PPFA 1COWD 3EN0A 1Z3IX 3E9EA 1GFZA 4JBWA 4AN1A 2C4UA 3D54D 5DHTA 3HGMA 4RXTA 3ABQB 5FOUA 3S2GA 3H0CA 3C4JA 3HWSA 1GVNB 2QR5A 3BMNB 3HRHA 4KLRA 5A2GA 2XB9A 4K0KB 3PFWO 1ZXXA 4BMZA 2BM0A 2VSOA 3A9TA 4YHHB 1Z4JA 3SBOA 4EHDA 2KLHA 4NCXA 3QKUA 4RKEA 3OTGA 1KDPA 1Z6AA 2CNLA 4ZREA 3UCXA 1T15A 1OA1A 4OCZA 2O57A 3IMEA 4KP7A 3P4XA 3WKCA 4AN0A 5K9ZA 2L17A 3LM8A 2XIJA 3X2EA 4GKVA 4BO8A 2W2NA 4RUKA 1W73A 1JDBC 2H5JA 2I2XB 3QXCA 4NCNA 4IOLA 2ZE7A 3M6MD 4EJSC 2ZRFA 1X39A 3GLIE 1KJWA 1U3UA 4KN9S 3TW0A 4MI1A 5JXHA 3LUJA 2O19A 5DLPA 3FPLA 3NDIA 3UJHA 2GF9A 5L4NA 3EDOA 4BNIA 2IH2A 2ZUWA 1QIJA 4HS4A 2VHEA 3IYLW 4G25A 4Q3NA 5H7XA 2HRQA 1UKAA 1XWFA 3O0DA 5FNVB 1ORIA 3ZZ0A 4AF6A 4BBZA 5TQJA 5KCZA 3GEBA 4D9CA 2YWXA 3HJRA 5LCXA 5I7AA 5LB4A 2YHSA 2A9VA 2JD2A 2LCIA 1DG3A 1EP2B 4WXPA 3DDSA 3E6AA 5TQ0A 2VP4A 5BQOA 3W78A 1XNQB 2I62A 2L82A 4CJXA 4N0QA 4MUJA 5BV7A 1MP0A 1SN7A 3W3AD 2KLBA 1QFZA 5C8ZA 1BTOA 3JD4A 3G2IA 5JCJD 2EQAA 3MM4A 3NKVA 1KBQA 1GTZA 3C8UA 2O0KA 4GEKA 4ZDJA 3IGFA 1NVXQ 4Q93A 3AUKA 1DKNA 4Z6KA 2AE1A 3P2IA 3K32A 1R4NA 1I4TD 4OXNA 2ATCA 5I7OA 3C85A 3TOVA 1Y0BA 3UW3A 1SWWA 1GUFA 1MQSA 1XZKA 1JZTA 4HDMB 3T0IA 2WG0A 1WUIS 3PTLA 4WLOA 3COWA 5DTMA 3CRZA 1C81A 5DMXA 3PWTA 5D5HA 2VJPA 3WNVA 1CDZA 1X1BA 4BNTA 3AM1A 3LC7O 2YIJA 3DO5A 4JB2A 3ASUA 1CZOA 1QTNA 3OZ7A 3Q8XB 4N65A 2EKBA 1VKHA 3M6VA 3PHJA 3VU1A 1GQRA 3Q1KA 2GR9A 4GEGA 2HMTA 3KL2A 1OI2A 2OHFA 4IGIA 2I2AA 3IJ5A 1MH1A 5ALKA 4L0CA 5LYJB 4Q3CA 5JAHA 1Z0IA 5L8VA 5K8IA 1CQPA 1THMA 2RGXA 3L93A 2PKYX 4JIMA 1XHFA 1SRRA 4BQQA 3AW9A 1REQA 2YH2A 4PLZA 1R3DA 2NSDA 2EKDA 3IPXA 2XTMA 3PEFA 5BN3A 3JQEA 1A76A 2P2SA 1ZH0A 2Q1YA 3LKZA 4TLAA 2HI0A 4M89A 4IVPA 1VIVA 4HUJA 3KPYA 3RUPA 4K8RB 1A8PA 3NHPA 2UYOA 3Q88A 1XALA 2I6TA 4MS3A 3GP5A 5MF6A 4DR4B 1OKKD 2FK8A 2HPHA 1KU0A 1QLJA 1EFRD 2PUHA 2X41A 3BICA 3GW8A 2XE7A 1X38A 4ZALA 1TJ3A 4LXUA 1F8XA 4UXJA 3T3OA 3VZSA 3H0EA 1LLQA 2XR1A 1UANA 2DBYA 3LX6A 1RRMA 1Q84A 2NU9A 4IFTA 4YV0A 2VNAA 3BAFA 1GUAA 3ZY3A 3K9GA 3FX2A 5JPDA 5JYCA 4CCSA 2Q1UA 5JWHA 2R7MA 1TF2A 1Z0KA 3VZRA 1RIFA 1PGOA 2PXXA 3WYDA 4L5AA 5LZ5A 1G1MA 2ZRDA 3MFYA 1AKNA 1DX9A 1N1EA 3ESYA 1JEQA 1I3NA 1OA0A 4H7JA 4YX9A 3LOUA 2XUJA 4O29A 1NUTA 2JRCA 1P6XA 2WJ6A 1CR0A 2DFKB 1T3SA 1YQQA 2FPIB 2P9CA 3GXBA 5I7EA 1T3HA 1FCJA 2UYQA 3MUNA 3WDMA 1GFSA 1C5KA 1NLYA 4JLWA 3ZCVA 1KK3A 4RA9B 2I80A 4ILKA 4N01A 1P80A 1T8TA 1JHZA 1SCAA 3OKAA 1SBQA 1XCLA 3DZIA 3S3TA 2QJOA 1OGIA 2C8LA 4MKRA 3IAXA 1P0FA 2QM0A 2VTBA 1AF4A 4YV2A 2AN9A 1T3GA 2YVLA 3DONA 3LIPA 3GLTA 2CZGA 2N0SA 4DC0A 4E46A 1KS9A 1DAGA 1YKSA 3WZMA 3GFFA 2H54A 1Q0HA 1GAQA 2FJUA 3H9GA 1EU1A 4F45A 1G4AE 4YASA 3SF8A 5AIBA 4QVIA 4IX9A 1XHEA 1UBKS 1KFCB 3X1DA 3ESDA 1PRYA 5EHIA 2GBFA 2AI3A 4N0PA 4GUAA 3SJBA 3PDHA 1Y5LA 3IIIA 4XRGA 4P3OA 4J2HA 5AOBA 2ET6A 4DYVA 4BEWA 2Z6QA 4RKYA 3CMCO 1ZYUA 5K2OA 1ZK2A 4URYR 4TL7A 4QODA 3WJ2A 1Z6PA 2BKEA 5AHRA 3IVGA 3E7XA 4HWRA 5C3UA 1GAEO 2IOQA 3KXDA 3L8EA 2V7GA 4RWZA 4C04A 4EYOA 3OZEA 1N5DA 1W2GA 4ZOLB 4QTYA 3LCCA 4F3KA 4WOPA 2FSFA 4C0AC 1GZDA 1QNFA 1YBFA 4MKZA 3IIKA 5T41A 5KCMA 2Y1GA 3FUXA 3URKA 4AWBA 4XTCS 1OXMA 4XWAA 1AHNA 3PRKE 4DIOA 3E84A 3THWA 1RWQA 3DE3X 2Z43A 4N18A 2ZT8A 1GXSA 4QYMA 2EL9A 1M72A 2F8LA 3KTDA 5B6IA 3TNYA 2Z98A 2FZCA 3KVVA 2O4UX 5B1YA 2EP8A 2UUOA 3VOAA 1MUUA 4DGQA 1IEWA 4RMIA 3A36A 1GPKA 3MWEA 2JIMA 3EISA 3E4CA 4PR3A 1YTUA 3GAZA 3DVAB 4KQGA 2NZJA 3WY9A 1ZS9A 4EZBA 1OFIA 1Q91A 3RF6A 1U8XX 2JKZA 1SXHA 1ZRSA 1HLPA 3SQMA 2O8VA 3HXQA 3I5XA 4DIUA 3GLSA 3GGSA 1VLJA 5JZSA 1NN0A 2IYUA 4PC1A 2P9TA 3NBFA 4H60A 3GP8A 4TQ9A 4TRNA 1TK2A 3B3GA 4FTWA 3BZWA 1JX6A 1FFCA 4G63A 4PAWA 3ROZA 2CSXA 4L9WA 4IIUA 4IPTA 4ZU3A 3ZLUA 1P31A 4B33A 4E2YA 1NI5A 4OJMX 4RTQA 2O5RA 1LC3A 4YRCA 3NHWA 3X1KA 3ETLA 2FRXA 3B6JA 1ZVMA 5A9SB 2HHHB 3U9TA 1PP4A 1S2MA 1D4AA 1U8ZA 1KRHA 1RLMA 4IQGA 3SXUA 2HWKA 3OZCA 5JQGA 4FYKA 1SHKA 5JV5A 1TYDE 2IEBA 1JBEA 2RGUA 3D1JA 4IRXA 2VT6A 3NJ4A 4J0CA 4ROSA 3EA0A 3GN2A 4UNNA 2PMEA 4L3OA 3ZDEA 1XDDA 2OCGA 4HD8A 2R1VB 2YY7A 1EK5A 3IQDB 4RK6A 4XSGA 3GD7A 1JAYA 1YK0A 3KSZO 2PHZA 4C3UA 3IKTA 2VSNA 4PTLA 4GDFA 1U0BB 4BJ3A 2D62A 4A16A 4CPDA 3H13A 1VDZA 4UEKA 3SY8A 1CXZA 1E1CB 1N6PA 1P0IA 3E22A 4F2DA 3JQFA 1W85B 3GLHB 4YXFA 4FR2A 3V1TC 1DQRA 4BQPA 2HUNA 3R9KA 3F4BA 1RWNA 3TL2A 5CBPB 4QM7A 1MX3A 1C1DA 3IUSA 3P0EA 4NIMA 5FUVA 3VHLB 2BFCA 3QOYA 1PEAA 2ONYA 4BO2A 1G98A 2JLXA 4HFJA 1RZUA 1ZIYA 4RANA 4UVDA 4EBBA 4X63A 1NX9A 2FW1A 3I3SR 3LLVA 3B52X 2QVCA 4CF3A 3VHQA 1ZP6A 2ERXA 1R66A 3QOFA 3ND7A 3NHYA 5CJPA 3AKZA 1O8BA 3LWBA 3ZBQA 3M9LA 3QVXA 4HB3A 4XDHA 5EVCA 1SZJG 4HQFA 3RAEC 1QZUA 3KLBA 4R8SA 5JQGB 2C82A 5ED4A 2ID9A 2NAPA 3VGPA 3CLUC 1Y37A 3E61A 2O7NA 3GFQA 4XFKA 4C2TA 4D4MA 2YCLA 1AB6A 2WUWE 2PX8A 2VZ9A 3U5TA 3Q41A 4LWQA 4MPJA 2VZEA 1AKTA 3KB6A 1OREA 4I1VA 2NZ2A 3O31A 4KFRA 3MVEA 4G0PA 1CQWA 2X0IA 3URMA 1Q1BA 3QWIA 4QXQA 5AJWA 5HKKA 3ZDBA 3RVQA 4CQMA 5L3RA 5D3MB 3AF4A 5EYPB 3QSYA 4ITRC 3LPLA 5CLJA 2G36A 1YZFA 1ZD2P 2GOYA 3LT0A 1SXJB 3FNHA 1A04A 1VC2A 4ILEA 1TTHA 5GINE 2F3TA 4RVNA 2IIPA 4QNMA 1GARA 4YGYA 2O4CA 5FA6A 5K0EA 3MJEA 2W6OA 3HV2A 5K8JB 2H31A 3WK9A 5AOAA 2ILTA 2PWYA 4YDRA 3TQFA 3ZWDA 1LSUA 1KRWA 2VYQA 3DWGA 1Z38A 4YYZA 3FH0A 1VKZA 2CMKA 1TCCA 3EGDA 3WYCA 4FHEA 4C7OA 2XWSA 3GCXA 4JLDA 1E3WB 2PZBA 1W0KA 3N59A 3TVYA 4BU0A 4F8YA 2OFOA 1VJCA 4GZLA 2O2EA 5IU6A 3AR7A 3L07A 3HB1A 1UBRS 3U0BA 2PUJA 1E98A 2BDTA 3I0NA 2XODA 1P1RA 2WAYA 4ZRDA 4Q9LA 2DH6A 2A5DA 4TZ0A 1V37A 4G5RA 5A0FA 3AI2A 3SK0A 3KU1A 1U4NA 3IAFA 1D2AA 1EVLA 4Y9SA 1TCVA 3E3OA 4FLFA 5DDIP 4ZMBA 3OQMA 3PYLA 2FF7A 3DOFA 2FUG1 2VG8A 5C5EA 3ACCA 2C77A 4GGPA 1OGYA 5FAKA 1HBJA 2BELA 1LX7A 3NYQA 3L8MA 2HSDA 2IYWA 1GYPA 3EULA 1IPFA 1KBOA 1V7PC 5FBWB 1G20B 4AJKA 1RXUA 3BK1A 3CCFA 3MF4A 4MUAA 4DFDA 4HWOA 1RI5A 4PFJA 4JVLA 4RM3A 2NV2B 2A9JA 3ER6A 2CB9A 1ZM2A 1E9SA 3G9ZA 4D96A 2KPOA 4XEUA 4F6LA 3C1OA 1OE0A 5P8WA 5CIQA 1TKAA 1XVLA 2DKNA 4RA6B 1GHTA 3JASB 3P2MA 2NTVA 4L22A 2UZ3A 3DGEC 3OLVA 3HJFA 2ZUVA 3ABSB 4YJFB 4U7WA 4M9UA 4BB6A 4Y6QA 2EQBA 3HU1A 3MTIA 3I9KA 4XCXA 3RABA 3E9NA 4X3CA 5EGNA 1MPXA 4E33A 5BNTA 1SNYA 2VF4X 9ATCA 3A4LA 1HYGA 2VRBA 1Z7GA 4ZO4A 3QE3A 1B3RA 2ZSAA 3I72A 5JSQA 5JPCA 1FZQA 3MS7A 1NQ5A 4I8DA 1DPGA 3GLQA 1D2RA 4J16A 5HVNA 1UWLA 2Y1WA 5CT4A 5LB2A 1G20A 1N6IA 2WTBA 2LIPA 4TN5A 1Z8DA 4TYNA 1Z4OA 5BMVF 2PUCA 3P4YA 3KZ1E 1TUIA 2C54A 3JQAB 4FILA 4J94A 5GQSA 3OUZA 4B3TB 3GJZA 1WCIA 1XQ6A 3RASA 3NEYA 6AT1A 1NKVA 4UU1A 4KQ6A 2GEDA 4M7RA 3SFZA 2BFFA 2WBLC 5DMHA 4Y0VA 2NTNA 1L5ZA 3KWLA 4P35A 4ACBA 1LI5A 2Z1DA 1GG2A 3U7RA 4HAUA 1E2HA 1CY7A 1XDBA 3FWZA 5IT5A 3EQ8A 4QHTA 2RBKA 5AK5A 3RVDA 2HSWA 2VJDA 1LS6A 2WKPA 3PGXA 4MI6A 1AD2A 4G0WA 3QM1A 3P5SA 1ZJJA 4B3RB 2FCRA 3C3YA 3MPUA 2BMWA 1XMPA 4RTMA 3QG1A 1WXDA 4H1WA 1G8GA 1HT0A 3WXBA 3A11A 1JZQA 1W2WB 1HK7A 2I1LA 5FA5A 3ZHQA 1DFIA 1JQJC 3LXXA 4RVDA 4IIYA 4K6OA 3O8RA 1IXZA 2DY0A 1CRPA 1P29A 4DDTA 3OQOA 5ETJA 4G2NA 2ACKA 1M73E 3EIUA 1P19A 1VMIA 2CE2X 4MVJI 5DHPA 3ISVA 2A88A 1OC2A 4UQPA 2CHVA 4P7FA 1J8VA 1S2IA 5HW0A 1JHVA 3FGPA 1VSQA 2VUSA 3TZLA 2CCGA 3VX4A 2JKVA 3SN6A 2JCVA 5CDSA 4JB3A 4QDUA 3ZJTA 2WWRA 2WWIA 1XVUA 1K3FA 3F2VA 3PTAA 2PTGA 2ON6A 1F8GA 3KVOA 3RR2A 5JS6A 2BI8A 1AMUA 521PA 1K3TA 1NRWA 4C6HA 3AVXA 3GFRA 1FOEB 3QXHA 1DBRA 5JNTA 4YMIA 4LQCA 3AI7A 2JGNA 3C6KA 3QFTA 1TPYA 2R7NA 5A9TA 1Y5IA 1XU4A 3HZZA 1RLUA 5I9BA 3BIFA 2OMKA 1KORA 2ZBVA 1NJFA 1U0FA 3H4MA 4CYMA 2QZ9A 3NUZA 1XNHA 3T7TA 1FYDA 2RB4A 4EECA 5KTYA 2BBTA 1P0CA 1S8OA 3IH5A 4QVGA 1CE8A 5SY4A 2WIBA 2XZOA 1P7YA 1Z5NA 2YHBA 3DOOA 2AVDA 4NARA 4IKOA 4TLBA 1G2OA 3VYRB 5C1BA 1DCKA 3MWDB 2IS2A 1OH8A 1Y3IA 1GPWB 4ID3A 1N4AA 3FR7A 1UFVA 1ZMOA 4UVHA 4BVGA 4M0CA 5IFKA 4ADSG 1THZA 3BHJA 2YYSA 2VPPA 4MS1B 2CLLB 3IR7A 4R1NA 2ODBA 3DE1X 3AZOA 1ZC3A 1IEVA 1IBRA 1QB7A 2Q3MA 4RMJA 2DGDA 3HCCA 1AQ6A 1G4HA 4BOYA 1P4HA 5IH7A 3IL2A 4ZTZB 4GRAA 4OFWA 1J42A 2COKA 3C4VA 3KWFA 1CQJB 3LLMA 4RY0A 2C2BA 4LISA 3AFHA 1TAGA 2HA0A 1YZVA 1ZL0A 1CJMA 1J2YA 1DRVA 1G5PA 3S8YA 4Y1RB 3MZ0A 3LPAA 4H7HA 2IBSA 2BZGA 5JANA 2OO5C 2A0KA 2P9BA 2W6CX 3AR3A 1TM7E 4JI0B 1QIFA 3AF3A 3K8OE 1BOOA 1L9XA 5CW1A 1NRXA 4J7CA 4QASA 4HLUC 1C7RA 1NVTA 3PWKA 4OOEA 1ECJA 1FX1A 3SR3A 1PQ4A 1VJ5A 5IJAA 2NAFA 4A0SA 1RE0A 1DIGA 4PLVA 2WWFA 5HRAA 4LDPA 4BUCA 1ZHFA 3KCQA 5T5QA 5JBIA 2ZDHA 4YJ2A 3TRHA 1MV8A 1U8YA 3ZQKA 1PFGA 4YP6A 2WB2A 5C1IA 4P0QB 3WE7A 1FTSA 4NBLA 3PF9A 4IIJB 5FWNA 1YB2A 5AUQA 2C2WA 4R2JA 2FETA 1V6CA 2JI7A 4Q9KA 1GL9B 2YWHA 3KZVA 5F9HA 4DADA 1CUDA 3O8LA 2Q46A 3R44A 4QAJA 5TGTA 2YL2A 5F9MA 3WNZA 2HH9A 3HN6A 3I9LA 3VHXA 5BQ3A 4N5NA 1VLZA 2QEQA 4V0NA 5M2QA 2BEJA 2C96A 3USCS 1R8YA 4PC2A 3WLEA 4FM9A 5K1ZA 4KHPB 5MHTA 1YULA 4HN2A 1W94A 5DGXA 3Q72A 1HPLA 4FGJA 4J7UA 4R9SA 3D8HA 3N2EA 1DEXA 5T8KA 4ZYUA 5AVWA 2V7UA 4OHRA 5T8KC 4EFKA 1HYQA 1QXSA 3GUZA 2NACA 3KXKA 5GONB 3K6SA 1KEEA 3QE4A 2QZJA 3ZVMA 5CX1A 1M2NA 4MJLA 1OU0A 5DT2A 5JI2E 4HNAA 3X1JA 1YCGA 3H1GA 4J0QA 1R27A 3HO6A 1CPYA 4Y3UA 3SBEA 3SEQA 4DC9A 1QZ3A 4R16A 5BSMA 3DUFA 2QGZA 4ZOCA 1D2HA 3OECA 2HJVA 3OT1B 4NQZA 4O5AA 3K5WA 4YI5A 5G02A 4AJOA 1CUWA 2H1CA 3C6YA 3EGEA 5GV7A 4MVJG 3L40A 3N0WA 1YR6A 2HMWA 5IG2A 4XB1A 4REMA 1AO3A 3UMSA 4Z0PA 3WP1B 5JFOA 4E21A 1T8UA 1JT9A 4UPDA 4UDXX 2HDHA 2Y2UA 4BCBA 4X85A 4NL4H 4CL8A 1AXEA 5JDIA 3DPUA 2QLNA 4WFQA 3F9CA 3RUFA 4AJNA 5BNIA 2BEVB 4GKJB 2OXIA 2LBPA 3WGHA 2HPAA 2ZI7A 1I10A 1Q17A 3CZ9A 1A69A 4GPD1 1CC1S 3KJQA 3PXUA 1K66A 3Q2OA 1KPIA 4FD3A 2XNDA 4FSXA 4EA9A 1ID8A 1R9MA 5EINA 1JIJA 2HL6A 1KXJA 4Z7OB 3C70A 3WL8A 4MMYB 1FFHA 2CB0A 1TQ6A 3A9VA 1Q0RA 2JCBA 3BC1A 3PA6A 1A0OA 3FPSA 3OBBA 1HURA 4JJKA 5AM0A 1K8QA 3HL0A 2W6PA 4MJ3A 2HPVA 5K0JA 4WNAB 3EVBA 5SZHB 3KP1A 4R9NA 1MAAA 1QWOA 1TECE 2KI5A 3AETB 4GBED 4ZAZA 5DM0A 3JAKA 3VZCA 3SKXA 1Z4LA 3ZKWA 4LC9A 3AOGA 3PNVA 1G9SA 2ADFA 1KDTA 3QTBA 1DAKA 4J1SA 4JLAA 3W2FA 4MCJA 2PS0A 4E14A 1U11A 4C14A 1EZ1A 1H69A 4OBEA 4ENVA 4GO1A 3CISA 4OMCA 2PSFA 1B41A 2AC2A 3A04A 3TZ6A 4OREX 4JP5A 2ZFUA 1UDRA 2E5LB 1B8NA 3FUWA 1ONBA 4EPTA 3ZZTA 2YYYA 3HNPA 5EUMA 2ZRNA 1PKXA 1ZH2A 5JECA 1TO2E 3T9FA 1PGPA 2WTNA 1BCRB 3C7DB 4X66B 2WMDA 1YE3A 1O9BA 3K20A 3MIIA 4HH3C 5JHGB 2YYZA 1J8QA 2EOAA 3SC6A 3TIIA 3G5MA 2PSDA 3JQGB 3JQ9A 1ZAKA 3G1UA 4M0PA 2HXGA 3BSSA 3PYMA 3FRIA 3TLGB 5KTPA 2B83A 2PGDA 3CJQA 3GRKA 3PFIA 1Y4AE 2YIDA 3EG9A 3RLIA 4EUEA 3DD5A 2FW6A 2X8WA 4M60A 3WL5A 1VMAA 4PNHA 4LF4B 1RRPA 4D0LB 1BWPA 4H08A 1VI2A 2I6FA 3FDZA 4NCIA 4HEQA 4JLUA 3SSNA 3O1LA 3UFBA 2QUAA 3QU2A 4INOA 4MDEA 3MJTA 5FDFA 3WWOA 4CMBA 1VPLA 3H84A 4KYUA 3H7IA 3SI7A 1ZZEA 4YLEA 3D3JA 2C04A 4QU0A 1W29A 2FI1A 1F0PA 4A36A 3WV5A 5KX5A 3OZIA 5B6JA 4JHXA 2YZMA 4Q3OA 5AJHA 3LP8A 1ORVA 2BBOA 1PJ4A 4ACAA 1QBKC 1V5FA 4HAVA 4XQCA 5A0VA 1GSIA 1T0IA 1DV1A 3LWNA 4ZN6A 3C3KA 4D9MA 2O8EA 2D3WA 3H2KA 1TIKA 4X44A 1RCUA 2QMHA 3PC3A 1Z0FA 3F6RA 3PHGA 3R23A 3DXFA 4KWCA 2ZWIA 3UMVA 3D0QA 1KO5A 2WSBA 3L0PA 3MRVA 3KQKA 2I4TA 1CUBA 3AY3A 2NUPB 1IQ0A 1L5VA 2XECA 4JLBA 5E6RB 1EI9A 5HWSA 3KYBA 3PSHA 1JEEA 5KU1A 5MN4A 1KDVA 4BC1A 4CGZA 3R3JA 1FUYB 2WZBA 3H17A 1C14A 1N5RA 4A03A 3FKSA 3DW3X 3TOCA 2VDLB 1L5FA 1TZJA 1VHLA 1G8FA 2TYSB 2QXTA 2XTNA 3MMNA 1B0ZA 4JA2A 4AZWA 2CCKA 3QVOA 4BX3A 5CG2A 4NMXB 2BT4A 5LMUB 1AKQA 1NR5A 1PK7A 4QDKA 5T3UA 1Z12A 1E6LA 1VG0B 5LQUA 1H23A 5LP6B 2JLSA 3AKEA 4CDRA 5DN6A 4IH4A 2OP1A 5IEBA 2DKOA 5ICMA 2IXBA 3H8VA 4F3TA 2FH5B 4YUZA 2GZ3A 2INGX 2AR7A 1QBGA 1PDWA 1US8B 1VE3A 2RG1A 3HSKA 3AUXA 3PBKA 2EC5A 4LC0A 3GRZA 5DKFA 1C30A 1EINA 3A14A 1QLHA 3M1AA 2PA0A 2MCFA 2NQ8A 4G81A 4Y2PA 5CHEA 4TMTA 4WESA 1QUFA 3UC5A 2EIHA 5H70A 3KTOA 2B94A 1P9WA 2ZUSA 3QRWA 2EBUA 5CB4B 3CLUD 4PYNA 3UZUA 3OLCX 1YK1A 4JQOA 4X93A 1WUYA 3RVMA 5CEEA 2JLVA 1GV1A 5ALSA 3H9JA 3MUEA 2Z09A 3BIJA 4E2FA 4OH7A 4HRVA 3GG2A 3TB6A 2EQ5A 1PN3A 2P6MA 3ABRB 4IY1A 4JSYA 5AK6A 4QNNA 1O2DA 3MCZA 4NOKA 4B6RA 5TR9A 5JSUA 3E81A 4FIZA 4OF4A 5DFAA 2W9XA 5JWOA 4LSMA 3W06A 3A2KA 4ZAFA 3T4XA 2I8LA 1CF2O 2Q2OA 1FU8A 4R8KA 5IF3A 2XUPA 2A84A 4E5MA 2FOLA 3DKIA 3WV4A 4IWNA 2ZWMA 1F9EA 5EE1A 4FSDA 4N5LA 4IGEA 4NE7A 3QW2A 2C59A 1T13A 2D59A 5AFSA 3LT2A 3PHBE 3I01A 1EX7A 3OVMA 3HS3A 3WDKA 4C0SA 5J2TF 4NFHA 1G59A 2PWBA 3CN9A 3NI2A 4URUR 4YQYA 1CCWA 3CH7A 3F9RA 4GR5A 4R5MA 3ZD9A 3PUZA 2B8NA 1EH5A 4HV4A 2G1KA 3MT0A 1TPZA 2I6UA 2EHJA 4UUOA 4UCQA 1GL3A 4I36A 4CKWB 4ZK2A 3HB4X 4FD2A 3ETDA 3WADA 4Z4CA 1RXIA 1E79D 2JJ1A 2M98A 2Q3CA 5ALXA 6LDHA 5JH7F 3PX7A 2CNNA 5DIFA 5IXSA 4QICA 5CPBA 1W0JA 3LVBA 2I3ZA 3ZNPA 4FGSA 1EVJA 4G0NA 4WLNA 1F5SA 2ADMA 3QX9A 4HNAB 3U16A 4YT8A 3GH1A 1JLLB 2Z1MA 4MGHA 4IG9A 1EB9A 1HDGO 1QE5A 4KPUA 4C0QC 4DV6B 2GM4A 1L3CA 1NFQA 1RXVA 3CW8X 1JAZA 3UHAA 2XXBA 1H1LA 3FPAA 4PYLA 5HIMA 3S1AB 3H42B 4AUKA 5H80A 3LAWA 3M5PA 4FKZA 5JNRA 1ZZGA 3Q11A 4DCNA 4U0JA 1Z6QA 4QELA 1AKYA 4RQUA 5ALZA 4WXYB 1B2LA 2P91A 1X8JA 2O2SA 3BXOA 3QKRA 4XX0A 2F90A 4TQUS 4BBAA 1Y89A 4ENQA 1UXJA 1X13A 3WAJA 2Q62A 1MMFB 2GJKA 4FKMA 5HCIA 3RYCB 3QEKA 4YDHB 3QYFA 3I09A 5HF5A 4C3ZA 4D99A 4J0HA 5KJFA 1HX7A 1WNFA 2PA3A 2R9VA 1M2HA 5L7TA 1W87A 3I5YA 1DBQA 4LMAA 4MEJA 4HQNA 1NBOA 1ZEJA 1FTNA 1YIOA 2HPZA 1LPPA 1ONNA 3FLBA 4TGLA 5COQA 1M34E 1RKUA 1E0DA 3FSRA 4BMXA 5C8VA 2J3MA 2VPXA 3M6XA 3X2FA 1ETUA 4Q9DA 3ZS9A 5IDXA 3AUAA 5IXJA 3HBLA 1UAYA 3PEVA 4XYGA 4IICA 3VUFA 1H1LB 2VDMB 3A3OA 2D2XA 2AG1A 1ULBA 2GA9A 3C3AA 3QXXA 2QTWB 2J5XA 2XB4A 1D7AA 4KAAA 4QUDA 3N9IA 4ARUA 1PWYE 4BXOB 2I66A 2F3SA 1IUNA 1MJHA 4Z86A 3F3MA 2AMLA 1SZCA 4UEJA 2B30A 3G0BA 1UUFA 3VM6A 1W76A 1ZFNA 1Z62A 3FR8A 4OQEA 5DULA 2VRCA 5DW0A 1TJPB 1TF5A 4AZ3B 1M7GA 4Z0NA 4BLUA 2QSJA 5GY7A 3GJSA 3ZK9A 4L9SA 3FDFA 1H93A 1I2MA 3PZRA 2FWJA 4TTVA 1N3LA 4NENB 2H85A 1X0VA 3JQ7B 4UUQA 1UMKA 3GLKA 3VJKA 4YCNA 4AMVA 2BFWA 3FSGA 1U2DA 4QULA 1U5CA 1T5OA 4U9HS 5EQFA 1ADGA 2WNSA 3KQOA 1RPNA 4OK3A 2G9ZA 3VKVA 4C7MA 1IXYA 3DEIA 3Q5GA 4A6DA 1QC5A 2JATA 1M34B 2JGDB 3LBNA 4BWFB 1W6RA 1IIBA 3MWDA 3BG5A 4D44A 3F7MA 4G0QA 4DSOA 3DBHB 2FRDA 1INLA 3ORYA 4INJA 1E3SA 1P3JA 4ER5A 5DTRA 4R40A 1OYOA 4KV9A 1GRVA 2EYQA 1FEZA 1N6OA 1PJTA 2R8PA 3OFJA 5AJVB 4CQMD 5B7NA 2QSUA 2X0KA 2A0UA 2YWJA 3LQ4A 4EQ6B 5IC4A 3DTVD 4I2NA 3KU4A 3GPIA 1MAWA 1RYMA 3TAUA 1V45E 1GGNA 2B0JA 2DUUA 4IZ6A 3TAXA 3O2JA 3ZV3A 4BLPA 4BCDA 4RKFA 4WI1A 1EUZA 1NMSA 2FOXA 2POCA 1N1DA 3C43A 3E1SA 3FKSD 4GPTA 2V7VA 3O73A 4RTRA 3A3PA 3E3MA 2JAQA 3T7JA 3MEQA 3OJCA 2YWRA 4FMCF 5FOVA 1U2GC 4Z5XA 2JVIA 1HTBA 3OT5A 3BIOA 1LJ8A 4QFBA 2NIPA 3GVXA 1FFEA 2QMUA 3VR1A 3IEKA 4P92A 3E9QA 1WQ3A 5F1YA 1NFRA 4ED9A 2V4MA 4HH1A 1BHQ1 2ID8A 4MNTA 4REQA 4WESB 5L40A 2ZB8A 4BVAA 3WO0A 3I6MA 4WE3A 1P1IA 4XB6B 4GOXA 2F43A 5DYIA 3UWPA 1Z17A 3DEAA 1GSAA 5JS8A 4GQAA 3SYTA 5JAZA 4Q9AA 1F2UA 1BVUA 4CLOB 3ZJUA 2P4UA 1L5GB 3T1NA 4CEJA 5L4SA 2FUG6 2CFCA 3DE7X 3EXEA 3GOHA 4NCJA 3QLJA 4A9AA 4DWWA 2LCQA 2I76A 2OD7A 2Z57A 3HJHA 1GAJA 4EO9A 1HA3A 4BLSA 3TOZA 5K7SA 1SCQA 1I4EB 4OKSA 1ODFA 4H7PA 4HNHA 2XCIA 3EGOA 4JL5A 1EGMB 1WVMA 2WYVA 1J33A 2VA9A 1XXLA 3JRWA 3OE5A 1EEXB 2UYYA 4LTMA 2D7DA 2YJ4A 4HQ6A 3O3MB 3ORQA 4Y6RA 4BXOA 5DGHA 2VHTA 4FBLA 2XEDA 2Z58A 3VVBA 1VCHA 1IHPA 4K9MA 2NUPA 3M5WA 2WHPB 5CA0B 4RE5A 4WK2B 1WHSB 4TUYF 4AN4A 1QG4A 4MRNA 5EMKA 5TXGA 4Q01A 3TTWA 1FNDA 3ZE6A 4WJZA 4GC5A 3TINA 2H2HA 1Q0PA 3W5JA 2Q8PA 3EXAA 3M6WA 2F64A 4TX1A 4FFBA 3AEKB 5IEJA 5FNZA 3BK7A 3VR4H 5DNUA 3E9MA 3LFTA 4UU8A 1PR5A 3KNZA 5EGSA 4OI0A 1TJ5A 1JILA 2HCFA 2OLJA 4MP6A 4OAQA 5G4KB 3Q6NA 3E9YA 2G06A 3NHMA 1NSTA 2VJLA 1KQGA 1JFTA 1CUJA 3PWZA 1WXFA 2WJJA 1H3NA 3OAAA 4I9HA 4UFOA 5EY5B 2VK1A 3PX2A 1L5WA 2R7KA 1HE3A 1V9SA 5EKTA 3GNTA 1C9YA 2QN9A 2W2TA 1CR6A 1V6SA 3C3WA 3OJ0A 4IV8A 4J91A 4ND8B 1E9DA 3K4QA 1DAIA 2VDWA 3IOYA 3OZRA 5ER6A 3RIMA 2OB1A 3SYRA 3TQTA 4H35A 3WLOA 4EARA 2VSYA 5KUTA 5DBEX 3E15A 5CLIA 2W2PA 1RI2A 3N2YA 3Q0EA 3AXTA 5ALQA 2OV2A 2QRMA 5YASA 5ITZA 1MNQA 3SNKA 2R1TB 4YAGA 3HCRA 4B3GA 5B3KA 1L7MA 3PNLA 1J0CA 3B5EA 3SIWA 3TPZA 1M1ZA 1RYBA 1RM5A 1X7DA 2D0DA 2DUJA 5G2OA 4HVLA 2QN1A 2YBDA 4DUYB 4E0BA 1U2EA 2NU6A 3ED1A 4K6CA 5FLXA 2X4LA 3BHIA 1OLUA 2M9MA 4F3RA 2O7QA 2C97A 3EDYA 4OU5A 3L8DA 1CUYA 4H0CA 1LZLA 1U1DA 4W5QA 5JISA 5HHTA 4MR8A 4QPDA 2FN3A 4BO4A 4LCJA 3AU9A 2HHLA 2ZYGA 5DPMA 1DAEA 4QQRA 4DA7A 5GADl 2J3EA 1GNRA 3P9RA 4MA0A 2RKBA 2NU9B 5KQMA 3ZBUA 5ES4B 1CUVA 2XTZA 1TX4B 1UBCA 3ESZA 1YQGA 3M1LA 4FNOA 4JOSA 2Y6VA 4ZQIA 5DNWA 1FFWA 4COOA 4YPVA 5FTLA 4WFJA 1K5DA 3C1UA 2O6HA 1QIGA 3OOWA 1WXEA 3JQCA 3PHCA 4IFEA 4DQVA 1U4SA 1LBSA 2WF8A 5L3SA 1WU8A 2O9JA 3C6ZA 2CKDA 2JHPA 3NCTA 4XDZA 2GCIA 3DNMA 1KZ1A 5FEUA 5DOZA 5CYGA 5KMGB 3PR1A 1UBHS 4F5WA 2ZTLA 3IB3A 4YQEA 3I28A 4ZICA 1LQUA 3ZH9B 3TUZC 3TOSA 1DX6A 4ZOAA 1DBIA 4CTJA 2QZZA 4A23A 1XXHE 3QVSA 3HACA 3GMTA 3ZDRA 4DLLA 5PNTA 4DMUB 1EJ0A 3LPCA 4C9BA 4UE6A 2R68A 1YR7A 2H1VA 1WUKS 3QWHA 4EUHA 2PUAA 1W46A 1ZOOA 4RHYA 3MJDA 4J0IA 4JP8A 4N0DA 4EOGA 2JFZA 3REQB 4IXTA 2BI4A 1YV9A 3NIGB 4MV7A 4HYQA 4KRYA 3DV9A 2Z8YM 1RJDA 1W5BA 3CCCA 1M2WA 1KVQA 3O94A 1WBDA 4EVSA 4URXR 1VB5A 4A6PA 2Y1DA 1M1YA 4RM2A 5KTMA 1D8AA 3BEDA 4GVXA 3VSCA 3T4UA 1LSOA 4TTAA 4F11A 3R8CA 4G1CA 3CWQA 1JG3A 5FH9A 4BFLA 2GF2A 2VT7A 4NG5A 4CUJA 1XPUA 1UBOS 4CMGA 3ADOA 3HP4A 3QSGA 2FYTA 1OWPA 3LLCA 5JSKA 1JFSA 1IY9A 1Y33E 1ZVVA 3IVCA 3AEXA 3DZJA 3N0VA 4HGZA 4YCMA 3H2IA 5H4HA 4P93A 2FN9A 2D7CA 2JLRA 3QKSB 1FDRA 1X92A 3ZN2A 1WCXA 3ZS8A 1RNLA 3RTAA 2VF8A 1EG7A 2ZSDA 1PEKE 4O4HF 3F96A 3NVAA 4ZJYA 4E5SA 3FZYA 2WFMA 3N05A 1WKBA 5JOQA 3TBFA 2YMMA 4DV4B 1DNPA 5L3ZA 4B7XA 2A5JA 4QXPA 1SKUA 1VBFA 1YS9A 3EGCA 3LX8A 4QX6A 3SGLA 4D2IA 4Y2YA 4F5YA 1E8NA 1N5KA 1SQ5A 1GNSA 3KB1A 4H1VA 4QPNA 3JVVA 1HDRA 4G24A 3ZKWB 4L0MA 2C9ZA 3CH6A 1ZM4A 4ZQBA 2HA2A 1UZAA 4DCMA 1PW5A 4S12A 1ZKDA 3O7WA 2C03A 3SXJA 1Z6GA 1QU3A 1I6KA 1PR2A 1J0EA 3HBNA 3MAGA 3GT0A 4PHHA 4YACA 1A1VA 1G19A 2PX4A 2PQMA 4RMNA 1ZG3A 1XLTC 4F9TA 3I12A 1CYEA 5EWLB 2WSSD 1D1TA 4I99A 1L4YA 1JG4A 1UMCA 1QP7A 1HEUA 5A6SB 3THRA 5JZMA 1EFVB 4K87A 5EE0A 2IYOA 2PSSA 4AS3A 1UPFA 2Q27A 4B3MB 5THKA 5FT9A 4EJ2A 4C78A 4QLBA 5I8WA 1JIXA 3A6GA 2FMUA 4R0VA 1HE1C 3WTCA 2I6GA 3II6X 2BEVA 5E2BA 5EWJA 3DC2A 3ZUPA 5KB3A 2G80A 4Z9AA 4LTNA 1TAHA 2H5IA 4KLCA 3V8NA 1M8GA 1IY1A 2YMLA 1A7AA 3H3XA 4ZGGA 4NKRA 5C4GB 4GBGA 3I2JA 4C0XA 3P9YA 3GEGA 3RH0A 3SHVA 2IP1A 3HABA 4FDAA 1XSEA 1O97C 2H1RA 1E9AA 1M7HA 1G3UA 1VSTA 3HFRA 3PCXA 1Z47A 3HJTA 3NH6A 3CHYA 2QR2A 1YA4A 4RVUA 5JMTA 1EPUA 4CKXA 4J90A 3EW7A 5AR1A 2QMYA 2OKCA 1BXRA 1GPAA 3ON5A 1WD7A 1E3TA 1TJ4A 2D54A 3KEOA 2C94A 3KJGA 4IIJF 1EDEA 2A78A 4LXXA 4OHCA 4PGAA 4WKGA 1XGKA 1FA9A 4N3CA 5CGZA 2DCUA 5FR1A 4GG1A 4LDNA 1CRWG 3B3JA 4WW0A 5EERA 2ZUUA 1PS0A 4KXVA 4WCFB 5F5XA 5L51A 4HOYA 4FIDA 1JN0A 5HM8A 1JHQA 2G9VA 4K9PA 5EL0A 1BD4A 1CZKA 3HUFA 3CEHA 4QSHA 5IKOA 2JCYA 4KFSA 4M6WA 1DWOA 1ODIA 1QVAA 4S35A 2AT1A 4FGWA 4K2AA 2WTEA 3D3WB 5AHOA 4ZCTA 1LPSA 5HK8A 2WILA 1UDXA 4MYCA 4U63A 2QX8A 4V38A 1R0CA 3STWA 4Q1EA 2OLEA 4G65A 1I24A 4M0DA 5LC1A 2CUTA 1I5RA 4BU1A 5KDOA 2MINA 5DBFA 1KQPA 1VKRA 1IEXA 3FVTA 2J07A 4Z4EA 3O91A 2YC2C 2Q7DA 3IMFA 3QELB 1YDHA 4DJEC 3LT4A 4NK5A 4PG8A 5LQJA 1OI3A 2ZANA 3ZYCA 3H5NA 1R74A 5E3HA 4E11A 2B36A 3PDWA 2P1DA 1OY1A 5HQ3A 2P2ZA 3OICA 3U17A 2XI4A 4OHYA 1TA9A 4KN6A 5DK4A 1IYZA 5D87A 4Y2JA 4I55A 1B7GO 2HF9A 2HMAA 1GZ4A 2XDAA 1MAVA 4L3VA 3ILVA 1PJBA 2DPYA 5IARA 4E2WA 2O54A 3PHIA 2P8SA 5L3SB 4M3NA 1XU9A 1HFWA 2QZPA 4I5FA 4LPSA 4C4XA 3HCEA 4B48A 5HGJA 2QA5A 1PVOA 2X7HA 2CLKB 4BRUA 4AECA 3ADCA 3KKZA 2OO3A 1PLJA 4GZ6A 1JEAA 4MUMA 1U31A 1K6JA 1K75A 1M0WA 2VUIB 5FQNA 5LFAA 5M04A 3HN7A 2PUDA 3FLEA 4R9RA 1OXXK 3MFQA 3OOJA 5KOHB 3AEYA 1ICIA 2ZYVX 3DLPX 4DRXB 1LDBA 4PSCA 3NJRA 4EUNA 2FW0A 3ZD8A 2XT0A 3PQ7A 1C29B 1T9BA 1XROA 2FPPB 3MQFA 1WPXA 4ATNA 1JT2A 1P2GA 3IVMA 2Z5VA 2GN8A 4D4JA 3BTVA 4ZI7F 3WL6A 4RVHA 4UJ5A 3RUHA 5CCBA 3GLIA 5IDQA 3KO8A 2FWMX 4WZAA 5L4LA 1V8OA 4NXNB 1FVOA 3NBUA 1TI7A 3FVRA 1S0UA 2ZTVA 5KYUB 2VXBA 3QVKA 3DCNA 3OJLA 1SHZA 4EY4A 3CNQS 3A0UA 3HE3A 5K8CA 2V7QD 1RDFA 2J85A 2W2KB 1YRYE 4TSKA 4DMKA 3GDGA 2IHUA 3C97A 3C3JA 4NECA 4DJJA 4UQLA 2PE5A 4ND8A 3TIXB 5DYYA 3TB4A 4K3VA 3ETJA 4YR7A 4HH4A 3OTQA 4N9QA 4BMNA 4MO9A 2EFEB 1NPTO 4K28A 3TKLA 2OGSA 4MUNA 3V1MA 4E1BA 3WGZA 4ZI7A 3JQRA 3W7BA 2R751 5ULLA 1QQ5A 4U00A 3MTQA 2QAJA 2YRWA 3K6KA 1SG0A 1TLTA 2OORC 1UK8A 2NV6A 3O83A 4LVNA 3PLNA 4R81A 5CB8A 2ZR9A 3DE6X 4HVTA 3Q6MA 5KINB 1KVTA 4RDXA 4D98A 4U2KA 4W1RA 1OMOA 1P4SA 2IUTA 4MI9A 4A26A 1FPQA 4ZHSA 2BGGA 1PJRA 4GVLA 4IILA 1T4BA 3FE2A 3FCCA 4MVCA 1ND5A 4PLTA 3U6BA 1HEYA 3CX4A 2I33A 4RYLA 3TSWA 5B64A 3SDSA 5T6BA 1Y8CA 4BNWA 2XAUA 4KYIB 1KO7A 4RADA 2RI1A 3WRYC 4O4JB 4QYIB 4QNRA 5CYFA 1ZAYA 2PJRA 4ZTBA 2WPDA 6PFKA 3GJ7A 1I1NA 4YO7A 2ESRA 1JIVA 3UJPA 1KZYC 1NDUA 3TIVA 1NPYA 1C3JA 2HA3A 3K1AB 3N5CA 3ZWQA 3EEOA 3W5AA 1JDJA 1T0JB 2FPWA 3U40A 1YJQA 5AW5A 4B71A 2OBMA 1XQ9A 4Z0HO 1ZUNA 2G3YA 3HR7A 4WOKA 1TXGA 2UVDA 4EEZA 3RANA 3HWRA 3FTPA 1MC1A 2OM2A 4FOTA 1HT2E 5U9CA 1J2UA 2ZSBA 4ZMSA 2VLBA 4RF3A 4QYWA 3FNBA 2YZ2A 4IGAA 1YI1A 5CT5A 5A05A 2BFBB 4CR6A 2IXGA 1XVAA 1U0OC 2FPGB 3R1IA 4TYQA 4RHFA 5AKYA 2F17A 4U39A 3LCRA 3ZHXA 4HDQB 4MR9A 4NVRA 1ZICA 2NUBA 2JARA 2H17A 4PNEA 3BTOA 5B2EA 3M4JA 4ISCA 1WW3A 3QYJA 2PTHA 5J1TB 1ZW6A 2LD4A 1C80A 3AEQB 3S2ZA 4JU8A 2ZRKA 1WLSA 3OIGA 4L74A 4QDOA 3A9WA 3FWNA 5K6AA 2Z4TA 3T35A 1OH5A 2V0GA 3JARB 4YP0A 3BMCB 1OYYA 4MKIA 1H2RS 2XAAA 4MAMA 4G1VA 2ZRGA 3VH3A 3ZVKA 4K88A 5AVUA 1SUFA 2PSEA 2D3TA 3GVPA 3A05A 4W5HA 1D2NA 2JH3A 5CFMA 3HLKA 3V2GA 3B8HA 3V2IA 1PW7A 1DP4A 3MGGA 3W6PA 4A15A 3L7CA 4UOEA 2XZPA 3UXEA 1IBLB 2FSGA 2PLFA 4DPLA 3I5MA 4EABA 5HXAA 4W5TA 1L5HA 4D80A 3JYQA 4N7RA 4JVNA 3D0OA 5J2UB 1OLSB 1X9HA 2W8BB 4A8TA 4BQIA 4G8JA 1XPRA 5M34A 1MXHA 3NAQA 1ZOPA 4WLVA 2ETXA 2HC9A 4FZVA 2YY6A 4UTRA 4EX7A 2UVQA 1GPDG 3WFIA 5ERGB 5LA6F 1MG0A 1U2PA 2B1JA 5EKUA 1FS6A 5AKKA 2I4LA 2CMGA 3LPMA 3VR4D 5FUWA 1KK1A 1KO4A 1ODKA 5IKXA 3GLRA 1K4MA 3R0IA 4M8NE 3FDXA 4LXIA 3LK7A 3QFFA 2FZGA 3CUKA 3O2QB 1PR1A 2Q49A 5IRCD 2YS6A 1ZGGA 3K09A 3IHWA 2E85A 4KR0A 2AFHA 4MGYR 4I55B 2CLMB 4HGNA 2F4VB 3WIVA 5TQVA 3KCNA 1ZXBA 2NSJA 1DQYA 2WEKA 3PNYA 4IYJA 1YHNA 4OQLA 2JGFA 4OMFG 3BJMA 5IDVA 2GPAA 3BE6A 1R8XA 3IILA 2KM1A 3HA3A 3IUEA 3WL3A 1FNBA 4LYHA 1MJNA 1XRSB 5DHUA 2QE6A 4G23A 1HNWB 1GT91 3VR6D 5GJBA 1VZ3A 1L0BA 1KC1A 2OEPA 2MSDB 4XH9B 4UBJA 1N25A 1Z7EA 2ZBGA 4A0RA 5FPHA 3LHKA 2GN9A 1UWCA 2PDAA 5EG5A 3T1VA 1DWUA 2HBRA 2A58A 4KR2A 1UEIA 2HTEA 4XASA 3L1UA 2BCGY 1ISMA 4Q16A 4KREA 2J4DA 2IYEA 3W7VA 3LFHA 3K9CA 3BDAA 4LJSA 3NEAA 4FMDB 1ZUHA 3H8WA 3KT6A 5ILQA 4Q9HA 4YUYA 4W5WA 1ZBQA 4OFXA 2XW6A 3WLIA 3H2JA 1FQWA 1FXWF 1V0JA 4F60A 2BGLA 2QN6A 2QU8A 4WECA 5CNMA 1TC2A 2GPBA 4D4GA 1T4MA 3KXLA 5JZ9A 2HW8A 5IN5A 4IDGA 2YHUA 1Q0LA 2ZR0A 4IV5A 4AKSA 2XA2A 4J9UE 2QDKA 2ZB2A 4TV9A 3KOXA 1VCOA 4BJ6A 3ND8A 3MWLA 4KE7A 1LBIA 4ME6A 4EIWA 3A3YA 3D4PA 4YCLA 2CFIA 4TMXA 5D3QA 1HETA 2HEGA 3MQ4A 2H6EA 3T3DA 2ZTSA 3Q3GE 1MRZA 5KTSA 4C2UA 4M46A 4CXMA 2WKWA 3N70A 4FOLA 4YJ2F 4AJIA 2I65A 2XGMA 4B7AA 3C5CA 1FNSA 4IX1A 1E1MA 3O8BA 1K7EB 2A57A 3JYNA 2FEPA 4TWZA 1R1DA 5EJ5A 4FYXA 3DDUA 5JHHB 4WNCA 2H0RA 4EH1A 2Z6AA 1UT5A 3C41J 3RIGA 3QLVC 4HRXA 1V8BA 3GBSA 3JD1A 4EG4A 3MINB 2QP3A 5E0OA 1F6BA 4HXGA 5JAIA 2WD9A 3GA0A 3FI0A 3OEEA 1JHYA 3FOBA 4PTZA 1D1PA 2G5GX 1RR6A 4JEUA 1HSOA 4LTDA 5HUJA 3Q8KA 4F4DA 2RAVA 1T2EA 1X80A 2QD2A 3C8HA 1E8DA 3KFLA 3OC0A 4HADA 5A4JA 1E2JA 1DINA 1FVFA 1UZMA 2R1VA 1O5TA 4L2IA 1WO8A 3KJXA 5CNJA 5KYXB 5LIPA 3T1YB 4CT5A 4HO1X 4IV0A 2Z2JA 4NZMA 4V1CB 1SU7A 1SC4A 2VP9A 4ZV4A 1K27A 2YUIA 4YT5A 4F72A 2UXCB 3OESA 4I8IA 4L57A 1WMEA 4P7GA 2OR3A 4MGIR 3GPLA 1EXMA 3L18A 1XMQB 4WJKB 4LNUB 4FE7A 4AO8A 5IM5A 3AF5A 1DDIA 1Y48E 3JD3A 3AB8A 2OCLA 3KVRA 2IP4A 2AOUA 2W48A 2Y0PA 4WQMA 3SSOA 2E89A 4Q7QA 2VZ8A 1XJQA 1UPTA 2G6TA 5C5DA 2F9FA 4CIWA 4ZDWA 4GI2A 2C31A 1BMDA 4MW0A 1Y3DE 4DXDA 2BJVA 1Q2UA 5J2TA 2ECPA 2V6BA 3OPYA 4FSHA 5BRAA 5CD1A 3EUEA 1FRFS 1T8WA 5FPKA 2DX7A 3T9CA 3C14C 1D7OA 2BBSA 5IKMA 1JDBB 3C3EA 1GL7A 1R64A 1XCJA 4KXMA 5ICEA 3IAUA 3UHJA 5GIPE 4I3FA 2YJTD 1DJLA 2C1EA 1PDVA 4M9SA 4BCCA 1Q1ZA 4Z9FA 1YUBA 2ZJAA 3EMBA 1AS3A 1XZMA 4FDLA 4BDSA 4HPWA 2MYUA 5B4UA 1E0SA 1G64A 3GUCA 4Z8YA 2ZETA 2GTHA 3DDOA 4TTIA 2KB0A 4KYVA 1K5GA 3GRVA 3AR8A 1JG7A 3U7JA 2ZB3A 3RYTC 1Y5NA 5DASA 3EFBA 2QZSA 1A1SA 2ASEA 4FYIA 3RU7A 3UK1A 3WDLA 4KIJA 2GERA 2O8CA 1XZQA 5KHOC 3SMVA 3ZBPA 3A6HA 3L7DA 1BH6A 4TT3A 2HLHA 1JDZA 4F4UA 3CZ4A 3SVTA 1Z4MA 2G0TA 1JGTA 2XYGA 4HDMA 4A5OA 2QTTA 1NMQA 3F8WA 1GNQA 1E32A 1DAPA 1OX4B 5D01A 1N2CA 4BB5A 3EZXA 3O1JC 4GLOA 4AJ2A 1O6ZA 3AUFA 4I4CA 1SHTX 3I9MA 5K3FA 2CJYA 3WOHA 4ZXPA 1KAEA 5LUBA 4D8WA 3FUTA 2GK3A 1QFXA 1Q3KA 1NWCA 3PICA 1PTKA 4IMJB 4XQGA 1QK3A 3LPNA 3OZAA 1IM2A 4LHVA 1M66A 2GLTA 4MINA 4PSVA 3RG2A 4JXZA 3SYMA 3G7UA 1U9IC 2VHUA 3JQGA 3MWYW 3NGXA 2YN0A 5L6LB 4PSDA 5KBYA 2O7RA 2R00C 1BS2A 1L1QA 2EZ9A 1ZIPA 4XYEA 3CF6R 3O8OA 3G59A 4FR5A 5JCOA 1NNEA 1KEWA 3NPMA 3AF1A 3F97A 2KS6A 2HYIC 4CTOA 2RHWA 1SOMA 4G4GA 3TTSA 4D9GA 3IAM6 5ALDA 3W34A 5JAQA 1FLDA 5FJJA 2X8BA 4XE5A 4DQLA 1N33B 1CJBA 5A3SA 4BWYA 3FDZB 3PFGA 5G1PA 1N5LA 5FA8A 2VDUE 1U8TA 1A4XA 1DO0A 2H92A 4RCZA 4BNXA 2XKAA 5BRNA 3AI1A 1Y4ZA 3T3MB 4D4HA 1R0WA 4KLZA 2VYVA 1ZCBA 3I6IA 3EEBA 1PL8A 4DCSA 4LZPA 2C57A 3QK7A 2CNWD 4EK9A 5F1PA 1ZOLA 4N5MA 3JR3A 3A9CA 1XX6A 5IYZB 1JR4A 1WNTA 2OK8A 3CLRD 1DT3A 2C2ZA 2QRUA 1ISJA 2R5FA 4HQLA 3ZE0B 3S99A 1SO8A 1RYNA 1RFGE 2C00A 3CNBA 4QOSA 5KNLA 2VAVA 2XLCA 1OAKA 1CEXA 1OZAA 3BIXA 1L2TA 1X94A 4MV5A 4S3MA 4ARBA 3KV3O 3BCRA 5AKHA 3OOEA 3GQBB 3HR8A 3AGPA 2ODTX 1PK8A 1M2KA 3DBIA 5EMJA 1R5NA 3NATA 4FFSA 4ZZ1A 4LHSA 4BMVA 2PR7A 5JZOA 1E1DA 4L9RA 4NZYA 5C18A 4YJFA 2GN4A 3TFOA 4BMPB 4OL0A 3KPUA 4UBIA 3RSGA 1ECBA 3ONEA 1UJ6A 2JI6A 4IJKA 1Y82A 5KJ1A 3GIDA 3D7LA 4GHWA 3LUGA 1SCBA 3H65A 1PLKA 3EZNA 1BDBA 1SZDA 2ISSD 4PGFA 4ECEA 1PZNA 1SUWA 2BZSA 3M9WA 3UMYA 1QF9A 3NTOA 2OVBA 4D1YA 2A3RA 3WLMA 5KWJA 4RHTA 4GR4A 1BE6A 4B3HA 1D04A 1EVKA 1M10A 1YZYA 2H5LA 5HOQA 4DLBA 4GGOA 1IB0A 4RAQA 4BZXA 3AMVA 4CL0A 1ARZA 2P79A 1N6HA 1DDOA 1A5TA 2IEIA 3AINA 3HDQA 5ARCA 3AVQA 4YJKA 3AERA 5LQDA 3MW8A 2HT1A 3CF0A 3I30X 1RWBA 5L6MB 2AB0A 1CJVC 1XZPA 1UBFA 3WGQA 3SS9X 3K0HA 1QLWA 2LKCA 1MO6A 4JENA 2RHRA 5AVXA 3EBLA 2WWTA 3R5JA 1QFMA 2HCBA 1KYWA 4GP9A 2H57A 3DZKA 4E13A 1KAGA 1KSFX 1Y1RA 2VATA 4P2BA 3LCJA 4YA6A 2XTJA 2Q5CA 2DBQA 1JLSA 2HIAA 4FR0A 2OCAA 5A2QA 1ULZA 4X3PA 4DDWA 1A77A 4INZA 3LC1O 5HS4A 4GXRA 3W1EA 4Q21A 3KD2A 2NW6A 4EY5A 3HDVA 1I3OA 3OHPA 4LSWA 4MYSA 4F3CA 1R6BX 3CGWA 1KDZA 1UXKA 3KM0A 3EPHA 4S1VA 1WD5A 2Q5IA 3EGDB 1MHTA 4S2EA 4TRJA 2NVOA 3IAM1 4AMUA 2PUFA 3AL0C 5KX5F 5IMSA 2AD1A 3T54A 2PZGA 4N54A 2N9UA 4Q24A 2ZT6A 1BKDR 5CLHA 5FBRB 4FC6A 2ZJ2A 3HDTA 3SJCA 3UT0A 2CFOA 2CXSA 2IEZA 5CFRA 4LYYA 4H4DA 4INAA 4M1TA 1E2EA 5H1YA 3Q40A 1SCNE 2P4QA 2WIDA 3DQZA 2JBAB 2H1IA 3WLFA 2O5VA 1XIVA 2RI0A 1UBTS 1ZK4A 2WJYA 2XYVA 3ZOKA 3TSOA 4KIGA 4HX5A 1XCOA 3ZHVA 4NAVA 2HRZA 3OZXA 2JBHA 1S02A 3IKVA 4KQWA 4U7JA 3DOEA 3UEOA 1U9YA 3EPRA 3IIEA 4RIEA 1P7ZA 3O2NA 3WSWA 1E2GA 1QRRA 4UCWA 1ESZA 3WGNA 3OX1A 4O2BF 3W4KA 1JU4A 1OVGA 5BOSB 1GCAA 3TW8A 2BN4A 3R5KA 4RMGA 3AFMA 3UV3A 4DILA 4KPEC 1XUOA 1EHCA 2IX9A 1F17A 1RHUA 1G3RA 3BXEA 3M8KA 3QENA 2R8EA 2QX7A 2HSEA 5JO0A 1X7ZA 4UCXA 3O0TA 1L4BA 3QVVA 2J5KA 1I7PA 3OQIB 3P2OA 3KWJA 4JODA 1A2BA 2HM7A 4Y8VA 4RFLA 2XT6A 3ROEA 1M2VA 5B1EA 1L6IA 1WQ4A 4CLEA 4LNAA 2AW5A 4I50F 4KQMA 2DSNA 3PKZA 1NVVR 1UQTA 2EEZA 2J9FB 1AVTA 3TI9A 4YT2A 3GJXC 3H1PA 3E8SA 4UM8B 2UU9B 4Q39A 2B7BA 4TL8A 1QH0A 3T3HA 1USUA 3L7NA 2PL9A 2UV8A 2NZVG 2XGOA 1Z2AA 3KELA 2ILVA 3HO8A 2Q4DA 3NB0A 3TSAA 5JR3A 2XUIA