1VGQA

Formyl-coa transferase mutant asp169 to ala
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
427
structure length
427
Chain Sequence
TKPLDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRGWLQDKPNVDSLYFTMFNCNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANEHLKVYENVAQCSGGAAATTGFWDGPPTVSGAALGASNSGMHLMIGILAALEIRHKTGRGQKVAVAMQDAVLNLVRIKLRDQQRLERTGILAEYPQAQPNFAFDRDGNPLSFDNITSVPRGGNAGGGGQPGWMLKCKGWETDADSYVYFTIAANMWPQICDMIDKPEWKDDPAYNTFEGRVDKLMDIFSFIETKFADKDKFEVTEWAAQYGIPCGPVMSMKELAHDPSLQKVGTVVEVVDEIRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLKELGLDDAKIKELHAKQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formyl-coenzyme A transferase
publication title Kinetic and mechanistic characterization of the formyl-CoA transferase from Oxalobacter formigenes
pubmed doi rcsb
source organism Oxalobacter formigenes
molecule tags Transferase
total genus 148
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.8.3.16: Formyl-CoA transferase.
pdb deposition date 2004-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 1vgqA02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 1vgqA01
2GCEA 1PT8A 2GD2A 1T4CA 1T4CB 2G04A 1Q6YA 1Q7EA 2VJMA 2VJMB 2GD0A 1P5HA 2GD6A 1T3ZA 2VJNA 1XK6A 1X74A 1VGRA 1PT5A 2VJOA 1XVVA 1XK7A 4HL6A 1XA4A 3UBMA 1XVUA 1P5RA 2VJPA 2VJQA 4ED9A 1XVTA 2VJKA 1PT7A 1VGQA 1XA3A 2GCIA 1PQYA 2YIMA 2VJLA
chains in the Genus database with same CATH superfamily
1R0LA 3IAS6 4Q05A 4RL4A 1WW3A 1KY2A 3RJZA 4NXNB 4TLMB 3O4IA 4UM5A 4KTTE 4NMLA 1WV0A 3DBOB 3UAZA 3CUWA 5ALFA 1N9GB 3SVTA 3QFFA 2PUJA 2WSYB 4FT2A 3RC1A 3PD7A 3WGGA 3WP0A 3ZV5A 3P2OA 5BT8A 4DXAA 3HABA 3M5DA 3V9PA 5IJAA 3VAZA 5CA1B 3NWBA 1KY5A 3D0RA 5HKBA 3U81A 3S40A 4GFDA 1E9CA 1KEEB 1OFUA 2VLIA 3WLOA 4QJIA 2G6TA 2J7PD 4PX9A 4C29A 1M73E 1F4PA 4D3XA 4LGCA 4DQVA 2HMYB 2IWRA 4JK3A 2RDMA 3M82A 1G60A 1PE0A 2C77A 2Q9AA 2IITA 4WLNA 5J4KA 3IDAA 1P19A 1SC3A 3R0XA 3CEAA 4M6WB 3KUUA 1PD0A 4MROA 4YCBA 3TSWA 2WYHA 2IUTA 4BRSA 3UGKA 1KRWA 2OT3B 3DZHA 2ZIEA 4H7HA 3TTWA 1VMIA 2ZANA 3A4MA 1ITZA 4KQCA 1GYQA 1HGXA 1EVEA 2QIOA 3QFSA 1G5FA 3VNAA 2OLJA 4FE4A 1IXRC 4MV6A 4YRKA 1C9MA 2HMAA 5MFZA 2IYUA 1SIUA 3DL4A 3ZQJA 5C7OO 1Z6ZA 2VRCD 3ESXA 3DB1A 3D7NA 3X1YA 2Z09A 1JXOA 2R8PA 4ZVVA 5KNBH 4NBLA 4MGKR 4BO5A 2JCSA 4LCEA 3AEKB 2GESA 2SICE 2ZIAA 4MS3B 2IX3A 4IIYA 3NO4A 2DQZA 1QH8B 2JGKA 4QTZA 1ADGA 3M1AA 5EZYB 3W2EA 3SQXA 4UE6A 4Y8VA 2FI1A 1BEUB 1YRHA 1BA3A 4JJ6A 4RJKA 3FX2A 1VL0A 5AKYA 5DLYA 1KJJA 4PN3A 3WAJA 4U7GA 1H2ZA 4PLTA 2DHCA 4R2HA 4KYUA 4OFBA 4PLGA 1P74A 3TLAA 3K8ZA 3KD3A 2G5PA 4WZAA 3HRKA 1YACA 1AA9A 3C5VA 2W6JA 1X7ZB 1VE9A 5DHPA 3RSFA 1E4OA 2QUIA 5HP4A 5DZSA 1UBMS 1YVEI 2G08A 5EYPA 4IH9A 1HTWA 4M9XA 4B6PA 5ICEA 4WNAB 3BJIC 4JQCA 1EP3B 3GJSA 4JUFA 1Z5UA 4TKVB 2FB9A 3M9LA 1XNJA 4H4DA 4R2XA 5AI8A 1DIAA 3EQ2A 2BSAA 4I50B 4O1MA 1HYQA 3CVWA 1QORA 1UZMA 5FO1A 4I46A 4BBJA 5HHTA 1KC1A 5FTNA 2B94A 3GGCA 3QVWA 1TM5E 3E1KA 2W6ZA 3G7UA 1RAGA 3P9NA 3A3YA 3O8RA 5T8KC 1P4JA 4PZAA 5GP1A 4A8JA 2GDZA 4JLWA 4Q1VA 5I9NA 5K0JA 4MVJG 2R6HA 4AMZA 1VKJA 1Z8DA 4JENA 5AI0A 1L8XA 1MQSA 1RLIA 3E9NA 1TU0A 2FY8A 1VG0B 4FMPA 1JT9A 2XUDA 1PR5A 1Z2DA 1FVFA 2SHKA 3A1SA 3F3SA 3R2JA 5TSDA 2HA7A 1QJCA 1TF5A 4HWKA 4RHUA 1CB0A 1TF2A 2QTNA 1FFAA 3G1WA 3OZSA 4DLAA 3D8SA 2CZQA 2AMJA 5KBYA 2HAEA 4QULA 1LUAA 2EJBA 3QVGA 3QXXA 5FA8A 1RYMA 4MKZA 2WAYA 4UMEA 3GAAA 1N6HA 1SMKA 1RAFA 2D3TA 3MEQA 2IBMA 1N57A 1JDNA 1BHSA 5CB0A 2DR2A 1TK9A 5CDFE 2HLNA 3OZUA 1MRNA 1HLFA 3PNBA 4C5CA 1MZVA 3VV2A 1ESCA 1ZIXA 1C0EA 4FR2A 2G9ZA 3RS5A 2JLZA 2WPNA 3MVEA 1B7GO 3U7IA 4ND6A 2O2ZA 2BVNA 5FV4A 2PKYX 5ALOA 2GA9A 7REQA 1BXRA 1UFQA 3PL5A 1XL1A 2XVZA 2W00A 2ZUDA 3OF3A 3TQFA 2YWCA 5BV8A 2VYQA 3PZBA 3QHPA 4UU0A 4AJEA 4E13A 4U3JA 4HC4A 5ECYA 4ZVTA 1C0KA 4HYYA 3UMSA 2GSWA 3VDNB 1Y3IA 3D2AA 3PEEA 4O2AF 4BGEA 2C1EA 3PPYA 5JSQA 2X6RA 4Z1MA 1IEVA 3P9PA 3RTBA 3OJLA 1ADJA 4JB0A 2EOAA 4ON9A 5AJTA 1EYZA 2J85A 2QD1A 2B83A 4EG6A 5JPIA 2APJA 2LD4A 3AHFA 1M2NA 4FMDB 4YJKA 1ISIA 4B3IA 2FFJA 4HQKA 2PPVA 4MR8A 3UWKA 3MGCA 4JVLA 4FHGA 4TQ9A 5DX0A 4GS5A 2CVQA 4Z9XA 1Q14A 4B3JA 4EHFA 2DJ5A 2ODEA 2VDQB 3BN3A 4JUIA 1SUFA 5CYPA 5FEMA 1AJEA 1Q1NA 2FU5C 2YINC 3IMFA 1ZU5A 3QKRA 5CDYA 4YRJA 1NRXA 4FB5A 1PN3A 1U7UA 3O91A 4JP5A 5EE5B 5TPWA 1NBOA 2RBGA 4MEJA 3JQ6A 5T41A 2ZE7A 2FPXA 2IXBA 1JEJA 1V8BA 2EFJA 2LR0A 3BQNB 3H8JA 2PWZA 3IKVA 5MHTA 4UEJA 3U4CA 2JFYA 1ORDA 1JHQA 5H80A 1R0YA 2OXIA 2Z9CA 3ED5A 4KIUA 4QUGA 4OUKX 1JJIA 1J9EA 3OX3A 5GJVC 4RJTA 2F9MA 4ALMA 3KE8A 3L0SA 5TF4A 5TV2A 1C3EA 4EJSB 4AWAA 1S3GA 2YNMD 5J47A 2QRKA 2I6GA 1TC1A 3ZD7A 1YTLA 4E70A 3KKKA 1YZVA 4KDEA 3UAGA 3L1HA 4Y9UA 1P4AA 1N36B 3HDYA 3IOCA 1QJ4A 4W1QA 1AVTA 1OCEA 2VPXA 3TQOA 3R5HA 4IJMA 2PD3A 2FQYA 2AFRA 4B3RB 2EZ4A 3FYCA 3KQWA 3HEMA 3UB4A 4WACA 5KUTA 3PFCA 2ZAGA 5CVUA 1W48A 4KKVA 1E5QA 1YB1A 4I2NA 4QFCA 4AXBA 3VU0A 2FGKA 3DBVO 3IHTA 1LS1A 2W0MA 4XXHA 4P0QB 2NSLA 1AKRA 5CIQA 5HF6A 3GBVA 4Q5IA 5DKFA 4CGZA 1D0IA 1YOBA 4I8XA 3RSLA 4F56A 2RHHA 4UPVA 1LZLA 4BN5A 4JYBA 4RA9A 4U2CA 5DYNA 1JDVA 3NWJA 1MB0A 3AIOA 5GGXA 3TM4A 1QNLA 1P0IA 3A2LA 1CUHA 5EUQB 3WLQA 1HE5A 3EVDA 4GPD1 2ZRNA 5B7PA 5G02A 5DLQC 3LKBA 4LF6B 3FOEC 4AJPA 2HBQA 4HLUC 4EL0A 4KC0A 3KETA 3UCXA 3ZK9A 1D8TA 1UFKA 1WMSA 2X7JA 3PQ7A 4ESEA 4C0BA 5KKNB 2VEOA 2ZAYA 4KPEC 4YT4A 3KB2A 5FOVA 3VISA 5BP7A 1F4VA 4A91A 5JJLA 1FX0A 2DULA 3K0CA 3OM0A 2BOVA 2XBMA 1CEQA 1T25A 4IIJA 3FTEA 1LTHR 2XQKA 3KKEA 3KHUA 4MQBA 4EUNA 2FKNA 3RVKA 4MJXA 1OU4A 5K0TA 2I6FA 2J7PA 3NBUA 4JJAA 3ZGZA 2GCGA 1M34A 2R751 1BDJA 5BSEA 2XZOA 5B4UA 5H9WA 2F8TA 2WM2A 5KQLA 1XYYA 3AWDA 4WOJA 1GG8A 4XJVA 5EJGA 2JG3A 1T9GS 3RAJA 1DHRA 2BSQA 4UOEA 2C3OA 4NZ9A 4V03A 1S9HA 2UDPA 1IOVA 1H4VB 3E5MA 4OQLA 1NQTA 4ZP1A 1M8GA 4F3KA 2XBUA 2AD5A 3OAAD 4UBLA 4D9FA 2W48A 4YAKA 3ZXYA 7ABPA 1OXMA 1ML4A 2R6DA 2ZUWA 1YB5A 5KKAA 3WK5A 3X1DA 4B3GA 4HJRA 1N6KA 2CFCA 2FWAA 5E6UA 2R00C 1RYBA 4Z0NA 3ONVA 3ZWDA 3ODGA 4RTPA 5FUXA 3T7KA 5AIAA 2CL5A 2E6KA 4TV9A 1II8A 3F6PA 1L8AA 5AK5A 2J3QA 1ZJJA 3BRQA 3OX4A 4ZEVA 1QG2A 2PKWA 2WF5A 3FNGA 4L3OA 3TTTA 3KHSA 1T2EA 2ZVJA 3LUHA 3M7IA 2EVWX 3AF5A 5G0TA 3UPDA 2HUNA 3HU2A 3EGDB 3DVAA 1MT0A 1Z18A 2JIOA 1T5LA 2O7QA 2W6ID 3IUEA 2Y8EA 4GKBA 5G0SA 5J43A 2AWOA 4KQ9A 4UU8A 5HSGA 3PF8A 3PIIA 4L1KA 3F5QA 2F62A 3HCBA 3R3VA 1JSLA 1G8JA 1L4BA 2R6AA 1PUIA 4K03A 3EXHA 4P98A 1T1RA 3Q7TA 1RYYA 3CIFA 4RXTA 5BO5A 2I0FA 5JZVA 2QR3A 1CWUA 1GNVA 2ORVA 3KOXA 3HTXA 1IUPA 1G63A 3I09A 3WWZA 4HNUA 2HLDD 1B8OA 4NOJA 1UPCA 3DLCA 4E33A 3EDCA 2I99A 2PX4A 4RJIA 1ISSA 4UVGA 1WMFA 3RS9A 4AJ1A 2A0KA 5ILGA 4GEKA 4RD1A 5H8WA 1QP0A 3PDJA 2BEUA 2XSZD 1G8YA 3C3BA 4KRXA 5EMHA 3R7SA 3K05A 1QGUB 4QBTA 1WP4A 4UREA 5C8XA 2EJTA 3PSAA 2BUCA 2SNIE 3ZGVA 4QBHA 1OH8A 2EZUA 1L6RA 5EI5A 4HSGA 4WOKA 4G23A 2I8CA 1NJ2A 4MQ4A 1FTGA 2P8SA 4QPJC 5KAMA 1Y6ZA 4PSVA 3JS5A 3LBAA 2VHYA 2W6PA 7YASA 1XWFA 1NR5A 5J3JA 2IEBA 1T6NA 2XVAA 1HFJA 3ESAA 4GOND 2ERCA 4U2DA 1ZR4A 3IMGA 1F7VA 2WD7B 4GWKA 3V6MA 4LI0A 5EEHA 5BYBA 3JQQA 3AHEA 3JQAA 1P4HA 1CQJA 3KYJB 1JPNA 3I01M 4FSHA 3A7DA 4TMZA 2LCIA 3VHXB 1QAOA 3GGSA 1AOXA 6REQA 3C3PA 4A3SA 1M3SA 2HUPA 4J0CA 4TMVA 3QPBA 4FMBB 4DIBA 3INNA 5B2ZA 4HMPA 2WJYA 2P4UA 3ZE1B 5LNK6 9LDBA 3NHAA 1MQ8B 1DS6A 4PZ0A 4XIJA 2A5YB 3GFOA 1IPHA 1JIUA 1ZICA 1LFAA 1MH1A 2UXDB 1RI3A 1Y1PA 4QYIA 2C3PA 2WZDA 4C0KA 3B1KA 4FJ0A 2P2CA 2FWJA 3KXPA 5EGNA 1Z7EA 2EFGA 3BGDA 3TPCA 2YMMA 3VR1A 1E3SA 4GOLD 3WNDA 5CXUA 4D7AA 1AKQA 3QOYA 1V3UA 4B43A 5LQKA 1E63A 2B5OA 2WTMA 1RBMA 2HK6A 2ZCUA 3WK4A 2WYVA 5HFJA 2FPGA 3B53X 1PK8A 3ZW8A 2I76A 1D2NA 3RYCA 2C1ZA 1XA0A 2IHZA 3KHKA 4OQYA 1MEOA 3GRCA 4YLGA 2HHHB 4RM3A 2QPTA 2O8CA 3ZY5A 1FFBA 2I80A 1P8JA 1TZKA 1W29A 3ESZA 4FFVA 3L6CA 4UDYX 4X62B 4EW1A 2PUGA 4UNSA 1NQXA 4D8UA 2FPMA 4Q01A 4M36A 1K66A 1EB8A 1FXSA 5ULLA 5BVGA 1WTCA 2FUCA 3HL0A 4KQKA 2BEKA 2G1AA 2NQTA 2WKQA 4G1MB 5K3FA 4F91B 4KVAA 1MX3A 5GZ3A 2R6JA 1JG3A 3RBAA 1LK0A 3AF3A 3U9SA 1M2EA 2QXYA 5K2MA 4EJFA 3JQ9C 1CYDA 5IXYA 1WF3A 3R3SA 1MO2A 4NAUA 4MKRA 3O03A 2XAUA 4HNTA 2QX9A 1EINA 3I8XA 5BSRA 1E2NA 2O54A 4O0MA 1MTZA 3PA6A 4KUGA 3RBVA 4CM9D 4AS3A 4DANA 4L5AA 4BO4A 4YAWA 5AFSA 5DEOA 2ECQA 4B2PA 1QLJA 3IOMA 3IPLA 4BO1A 5BNIA 4BNKA 5C7YA 3K1AA 4ZYTA 1USUA 3HA7A 4B09A 4AG3A 1FNNA 3ASVA 4A0RA 1TPYA 4JX8A 3H4MA 1TMOA 2XF2A 2YNMA 4HQNA 3MFQA 5BOVA 4JQZA 1FF9A 2IUFA 3ZHOA 4OYYA 3ZJYA 4Q7QA 2ZQ5A 3ZLUA 4AMYA 3NH9A 1U2TA 4GBMA 4A15A 4R16A 1JEEA 5L3SB 2YJ3A 3E70C 4L02A 5ALZA 3KSZO 3LJKA 2VKTA 4I1SA 1E6CA 4OL9A 2PO7A 5LPNA 4R9SA 2OMKA 2BTQB 1IBKB 3FHTA 1ZWKA 2VPIA 4DEXA 1E3TA 1BX1A 3W6PA 3EW7A 3QIVA 4JEHA 1JBEA 2GXUA 1QH0A 2J3KA 3GV0A 5B1HA 5E4JA 2I4MA 2OFWA 2Q3FA 2VNAA 5CJJA 1ZMXA 3CX8A 5CFLA 5LOVB 3HJUA 1KI6A 1DLIA 2FOLA 1SKQA 4JLPA 4R1UA 3GDGA 1GGKA 4RUKA 1H4TA 1TZCA 4FHDA 4I6EA 1SBCA 3BGSA 4XI9A 1F3OA 3HA3A 1ST2A 1N6PA 1FDSA 2QKYA 2XNCA 3EFOB 2O5VA 4XSGA 1GQQA 1TEHA 3UYLA 1A50B 1NT2A 2GMWA 2J5QA 3FOCA 4M98A 2FDRA 4PGMA 3K09C 4CZ2A 5M5BA 2K87A 1G2OA 4YRRA 3DO6A 2HNKA 5K6AA 4DA9A 3HG7A 2DY0A 2MINA 4K2AA 4RZSA 5TMDA 2QJFA 2XGOA 4AWBA 3F2VA 4G0MA 4GYYA 4IZOA 4L95C 3RIMA 4CI9A 4KMSA 4BB6A 3UVEA 1N8TA 2V4ZA 3LVFO 1GT6A 1NUAA 3HZOA 3LF2A 3GT0A 5H3HA 2ENUA 4EMSA 4EK9A 5FUQA 2QTWB 2PZFA 1R64A 1A5BB 4K6CA 4ZRNA 1ORIA 5KWSA 2PUAA 2VQEB 1D0VA 1R50A 2XD9A 1JT2A 2BZ0A 4KHZA 4I1IA 3UMFA 1QHGA 4BUZA 5BR7A 4MVJP 2HIMA 3WJ2A 4RS3A 2QF7A 1Z5NA 1SC1A 2UVPB 3IYLW 4EUEA 4QUIA 4Y2HA 1IEXA 1G6HA 4HQ0A 3ACCA 1XCOA 3GA7A 1CS0B 3DNFA 5SZHB 1NX9A 5AVKA 2XMBA 3EARA 2ZUUA 3FVVA 3OAAA 5LB2A 1ZK0A 4U7WA 1G8KA 4PZEA 5LP6F 1TKCA 1VI5A 4TRNA 1CK4A 2B5VA 3VC2A 1SFRA 1SXPA 1KKMA 1DTSA 2FQQA 1KFEB 1GLVA 1MC1A 2FPOA 1IAVA 4NJEA 3S8YA 1EXMA 2ESRA 4YJGA 1U8EA 1K7XB 4C6RA 2CNLA 1EBUA 1TUEA 1ZJZA 2V7EA 3HDHA 1EVJA 3FTPA 4J43A 3C0KA 2I22A 4WNYA 3SLRA 4ZAYA 3SP1A 5C8DA 3L4JA 2OOSA 3Q40A 2Z6AA 4KO8A 2EJCA 4NDNE 4MI9A 1O0BA 2VNJA 1K8QA 3AUKA 5C0OE 1PL0A 2JH8A 2F17A 5FBQB 4ZZ2A 4EJ2A 1ACJA 3W9UA 3ZQ6A 4D0GA 4D0SA 1BQEA 3DFMA 3DW1X 3LBIA 1YR6A 3OM8A 5FLYA 3D5EA 4OGWA 5A7HA 3SJ7A 4GYWA 5AW6A 4NJMB 2CV0A 2GPBA 4JDUA 3TCNA 3R7FA 4ZZ3A 3VR4A 1H4QA 2V3VA 3WRVA 1MIOB 1I3KA 1JHAA 2VDWA 1Q12A 3OE5A 5H5JA 5JH7B 3ZH2A 2OBXA 1G7TA 3FPFA 4I3HA 5A5GA 2Y0PA 3FPHA 1R8SA 2ODQA 3G2MA 1UJCA 1VYTA 1WABA 2C99A 4CQLA 3C87A 2CLHB 2RJOA 2G4CA 1CR4A 3KX2A 2RGXA 1USGA 2CHEA 4L50A 1SD5A 1BIFA 3AVOA 3F71A 1IY2A 2PZKA 4JYMA 5DEIA 1E9RA 2CCKA 4C7BA 1IQRA 1RWVA 1Y63A 2F59A 5JANA 3KR1A 4NCIA 2GRJA 4OH7A 5FUWA 3KYCA 3UGQA 1O8BA 3RUHA 4B3TB 2BIFA 1SQGA 3PZRA 4MI6A 1XB2A 3E7FA 1AHHA 1MMFB 3ND7A 1WVMA 1R4AA 4DZRA 1GFZA 4GSYA 2JLVA 2EX4A 3AGPA 3E2MA 3PJGA 1RWMA 1RM3A 3A6KA 4TTQA 4C2AA 4TT3D 9LDTA 3A04A 3IAM6 1GZUA 1KSHA 3AI7A 4XCXA 5EHNA 1U0BB 1LFDB 3GHHA 1LWNA 1Z16A 2R65A 5HK8A 5HA5A 5K51A 3VRHA 3ICOA 3EHEA 1E59A 3CRW1 4V0OA 1H1LA 4X95A 2LGJA 3WWYA 3CVUA 2R6FA 3IHLA 3QUSA 1KIMA 4GP6A 3D64A 3V1KA 2UYHA 1JA0A 1EDBA 2RARA 3O8QA 3OFKA 4XVUA 4V1CI 5IN4A 1K06A 5F3WB 1V4BA 1C81A 4E5MA 4E2YA 3TUZC 4WN3A 1KARA 2FP4B 2VDNB 2JIPA 3MNFA 4YRIA 5KC8A 2XI4A 2I66A 1UMCA 2ECPA 3BXFA 3W06A 1PKEA 4OXYA 1DXYA 1K7SN 4K9RA 4TRRA 5T64A 3QX3A 3KFLA 2CWWA 1ZIYA 3OFJA 2O2HA 5EIFA 2J6BA 3ZYCA 4LKOA 3LY7A 4WFQA 1XCJA 3ZTYA 1G59A 5KOJA 2QMHA 1G21A 1C2YA 1GXSB 3ELBA 1Y4AE 3OCZA 2GXQA 2IUEA 4G1FA 4JGBA 3VJMA 3C6KA 3D7LA 1YBAA 5BV1A 3CCBA 2D0OB 3NBKA 2Q6OA 3RJTA 5EA2A 3FYUA 4J90A 4NBVA 2CBGA 2VG8A 1T36B 3RAFC 4TV8F 3NALA 2OHHA 4AW9A 5DK4A 2C8LA 1DFHA 2GOYA 4C30A 2QTTA 3VSBA 1RE0A 4CETA 3IELA 2VA9A 3AJRA 3ZE8A 4UD6A 5AW1A 2WIGA 3PC6A 1A2QA 3IAUA 1ND5A 2AXEA 1TYBE 3W5AA 1IN6A 1KZ7B 4ZCLA 4JQSA 1FFYA 2X4GA 5KQGA 4MHSA 4J76A 1Z33A 1XJ5A 1OBFO 4OP2A 1Z5ZA 5HBRA 1FDVA 4BLVA 1QH9A 1HDCA 3WDLA 3WLKX 2C97A 2EXXA 4MLDA 1W25A 2C98A 4O2BA 1U3TA 3AO0B 4CKCB 1AKNA 2FPLA 4WCFA 3VJKA 4DMLA 1VFNA 4N47A 3FAZA 3VMMA 2ZRQA 4I4TA 1IHPA 5AW7A 4MYRA 4ZO4A 4ZZIA 4U2EA 1JZQA 1DO0A 4A36A 2Y05A 2JAXA 4CM9A 4HBZA 4A9AA 4YI3A 5C1BA 4PAWA 1ZMTA 5ADVA 4DCGA 4Q7JB 1OIXA 4G5XA 4S05A 1W59A 1P0MA 2GPJA 3ANMA 3PFKA 2YIJA 4ZEOA 1WXEA 1JN0A 1L7QA 2JHFA 3FETA 1AK9A 3PRJA 4MV1A 5DGTA 3MWEB 1EAMA 5EY5B 3WSVA 1V45E 5DN6D 1WCIA 1EA7A 2FEPA 3KOMA 4XJSA 2C4VA 1O7JA 1CUEA 3NYQA 4ZQBA 4AZ3A 4BNIA 4KBFA 2ZROA 4IO0A 1D07A 1JZTA 1Z4NA 1YRBA 2OMEA 2O48X 1XDGA 3G0BA 2EYQA 3ZDDA 1K27A 4HH0A 2FSSA 4O4IB 5DNCA 5HS6A 1HF3A 2GZ3A 3IT3A 4G0YA 5CB8A 2P2YA 4E4TA 4JGIA 1KZYC 2PT6A 2OCIA 3SIWA 3TOXA 1Z0FA 2A3NA 4HWGA 1XMVA 2EP7A 4JC0A 1VIYA 4DQLA 3CO5A 1G8PA 1Z3IX 1EK0A 3WOVA 4JB2A 1PJCA 1OKKD 1GA6A 2ZGVA 1QE3A 4ARSA 4U02A 3K72B 3LUFA 3KKLA 4XVQA 3EOAI 2L0XA 1Q0ZA 4PZZA 3AKZA 2X0NA 2D59A 3BZBA 3EOZA 3AL0C 1HQCA 2PZLA 5CPFA 1ZITA 2FWIA 2ORWA 3W90A 3ZV3A 4LK2A 4YT2A 1O8CA 1QV9A 2Z8XA 4D26A 1S01A 1O3YA 2WJ6A 3O2SB 3ZU2A 2X9LA 4CLDA 4DBLC 4QLBA 5B3LA 5C2JB 4G3XA 3PNQA 2PMFA 4QPDA 2UYGA 4AUEA 2HMVA 1XZIA 2FK7A 1J1IA 1LY1A 1TA4A 2UAGA 1OI3A 3BE4A 3BWDD 3M3HA 3NP7A 3GLIA 2W22A 3OCWA 5CJ2A 3EEQA 2OFXA 2YZKA 4IXDA 1HFEL 1O6GA 3HDQA 3NHBA 5KOHA 5C4GB 4LVCA 2NZ2A 2WWHA 1CERA 2GZMA 3QX9A 4IRUB 1JQDA 5FP0A 4MQMA 4JBHA 4WI1A 1R5NA 4PZUA 5JNRA 1HKHA 5CYOA 3HV2A 3GFPA 4YCAA 6YASA 2YZMA 4TTAA 1FC0A 1H1TA 4FDUA 2V4MA 1AIPA 2RGYA 2GN9A 4MWDA 1DCTA 3QLTA 1ISHA 2QQ5A 3N2NA 2ZAIA 4KFSA 4KGDA 4ENSA 1DVRA 5JO0A 2IIVA 4IJ5A 4OLFA 2O8FA 2PZEA 4XIIA 1ZD1A 3AUAA 4UVDA 1WW2A 1K6JA 3E23A 3QLVA 3KEFA 3T1TA 5F2EA 5BWNA 3E5HA 3GJTA 4OI0A 2HHJA 2UZ1A 3FFBA 3P94A 1G18A 1ZM3A 2PBLA 3C7KA 3GPBA 4K9SA 4QUDA 3H05A 1FYVA 4P35A 1EG2A 1RPNA 3R74A 2Z2IA 3B6MA 3PDHA 4GHWA 1KNQA 2VPTA 3FPSA 4PSKA 7MDHA 4RK1A 1NJ6A 5MDHA 4RDCA 1POWA 5LBIA 3ZX4A 1VPWA 9MHTA 4D99A 1VJ5A 1EE2A 1WB5A 3CT4A 3FGNA 3GMTA 4EPTA 1K92A 2QW1A 4CIDA 2ZRGA 3BF7A 2NN3C 1EKXA 4WNIA 3RAPR 2FF7A 3K9CA 3OP4A 4CKWB 2HY7A 4XWGA 2ASVA 2QRVA 2JFFA 2CLMB 3D4LA 2X0DA 3MPOA 2GD0A 1VJ0A 3IDOA 3RYHB 3TM5A 3UFBA 4LSWA 5CBPB 4HWRA 1ODIA 1KMIY 5A6SA 3B7WA 2P9CA 1K7FB 3WHKA 3KVYA 4CCAA 3PSHA 3NIFB 1TUGA 3RGGA 4GM4A 3W3AA 3ZZTA 2VL7A 3G23A 1L4NA 1B6RA 1KJYA 1MG5A 3D1VA 3DTNA 3HR7A 3KZOA 3CF4G 2JFPA 3JATB 5HMMA 5B3JA 3VH4A 1NVEA 1NI4A 3BCHA 3KJIA 3T4XA 5GY7A 3KLOA 3U4HA 3NP9A 4DV0B 2PT5A 1GTMA 2HCTA 3HB4X 4PLYA 4HBGA 2HW8A 1V3TA 3SE0A 4DV5B 4M1WA 1DIHA 4XKJA 1E4YA 2EC5A 4Y30A 1M7BA 2QZ9A 3D5TA 4IIBA 4IX9A 2R7KA 2GEUA 3QEKA 5FWNA 3NTLA 4WOBA 1LD3A 1CEXA 1GKIA 1XG5A 3LK6A 4LJ6A 4QAJA 4C4OA 1W36C 5TJHA 4Q6BA 4KLZA 3EEBA 4OX9Y 1M6YA 4JVNA 1T9GR 2B8EA 4HRXA 4EBFA 4TQUS 2ZYUX 3BXHA 1F2UB 2X76A 5I7HA 5KWJA 2EWVA 1BKYA 1UEIA 2FJPA 3LQFA 4ZJZA 4RFSB 1LF5A 2H1SA 3JD3A 3WL7A 1VMAA 1Z35A 3MIIA 5K4GA 4J9UE 2W2QA 2VI5A 3IUNA 2RIPA 1AHPA 1A98A 2IVFA 5CLIA 1RNLA 1NA5A 1XMXA 1T0UA 1E6MA 2GNPA 3N58A 1G17A 5JS8A 1Z06A 3DMDA 1KS9A 3CJTA 1ZMRA 2GFHA 2PWAA 4P5EA 3RBXA 5AW5A 3MWFA 5FWYA 5BVHB 1KVQA 5HZMA 4RXUA 1Z4MA 1GWNA 2GZSA 2IEGA 1Q19A 3L0OA 2OAEA 4R8LA 2M6KA 3UPTA 1QRSA 5AK0A 1BQ4A 1M1YE 3GPDG 1C3VA 4QQKA 5FLXA 1W0KD 4TWBA 4EDHA 1FYWA 1F48A 1L7EA 5TMPA 2Z1MA 5IX8A 3WK7A 1RHMA 3COJA 2AQHA 2EBWA 2WWTA 3CM0A 2CYCA 3PQ6A 3B60A 4PBRA 3I05A 4EMUA 1WPXA 4PQEA 4EHJA 2VUUA 4MIEA 2IXDA 1E60A 5JQGA 4C0QC 1C9DB 1R8XA 4R2IA 2OYSA 3FZQA 2XT0A 2GN4A 3L0YA 1S8OA 4FX2A 5TF0A 2AFHB 3TW6A 4X90A 4BFLA 1T1GA 2KSQA 4BP9A 4A0SA 1F8XA 3ELYA 4YJHA 3TH5A 3B6JA 1AN0A 1VZ2A 3CNLA 4BL5A 1EFVB 4CKXA 4P36A 4KIFA 1A9ZA 1RABA 2QORA 10MHA 1U6IA 2I29A 4D6YA 4MVJI 1TB4A 4X7MA 4A82A 1L5FA 4DDUA 3O9VA 2HJ9A 2QUAA 2B4YA 1AMUA 4L3WA 4BO9A 1DTEA 3FD8A 4C4XA 3I28A 2BHRA 2VDLB 2SECE 4BMOB 2F1RA 1TGYA 5CUQA 4YPFA 4BTLA 3ROKA 3KO8A 1E0DA 3PGJA 5TS3A 3CSUA 2AA3A 3C85A 5DLPA 4GWGA 3GFSA 2V7QA 1VHTA 1I7DA 3WV4A 1N9GA 4RQAA 5C8YB 4YRAA 4OQ4A 3ZKWB 5JAHA 3K0AB 1BFKA 4Y67A 4NC9A 4QBFA 2P5UA 3ME5A 1OZ0A 1P60A 4JXKA 2UYQA 2B7LA 1KEEA 1QG4A 4P33A 3JQ7B 5DASA 1B76A 2OV6A 2ZSFA 1DRJA 3IB6A 4QDXA 4PFSA 4X60A 2VDPB 2CNOA 1CVLA 4WFKA 4XTCS 5J9FA 4DMGA 3TZKA 5KTSA 3DOOA 1NVFA 5CFRA 3GIDA 3OQIB 1WG8A 2G0TA 2YWJA 4M6WA 1UBHS 2VF4X 3HHPA 3HXPA 3PQCA 4GRDA 4KOAA 3RT7A 1ZO8A 2ROQA 4LTDA 4BRZA 4EITA 1FP6A 1ZOSA 2YXPX 2ZI3A 4JJGA 2V7GA 2LE0A 4ZRDA 5DYWA 1NG1A 4NMXB 1D09A 1D1QA 1UKBA 2OGTA 3L1KA 2V58A 4AS2A 2QVBA 3OZXA 4ZMRA 1N2ZA 3SYRA 5K3BA 4ABYA 1L7XA 2YH2A 4IHAA 2FW7A 2OQIA 3TX6A 3UWMA 4CQJA 1L5LA 3UJCA 4AUKA 4DTCA 4G5YA 4RVUA 1L9XA 4ZWNA 2IXEA 3A32A 1W49A 3AEKA 5KTRA 3M70A 2R4TA 2D6FA 1VPDA 1K0FA 2FXVA 4GEGA 1QH8A 4U2FA 4Q4DA 2JLCA 2YVKA 4E11A 1GRCA 4JP1A 3IIEA 2BFDB 2DF8A 3UNXA 4CR6A 4M9UA 1Q7BA 2V9ZA 3EW9A 2FDXA 4HADA 4IQ0A 5DM4A 5SICE 2C5EA 2P9YA 3QA3E 3CURA 2CB0A 1DI0A 3DZBA 1OFGA 1DMRA 1X7ZA 5C34B 3TUJC 1V9LA 2CXTA 4G8CA 3GROA 4DJ5X 1E1RD 4FM9A 2XYQA 1FS5A 4GKVA 4WJLA 2ERXA 3P19A 1O6FA 1U1EA 3PFBA 4WNAA 1PTJC 1QZXA 2OFPA 4JBIA 4KFUA 3KCNA 3QJYA 1CG6A 5ENZA 3VR5D 4I50A 1V7CA 4OK6A 1VLJA 2JEOA 2OE2A 3QPCA 3WHLA 3GYBA 1ODCA 1QPBA 2O2CA 4PC2A 4I9NA 1W0JD 5E95A 2AL7A 4M49A 1AV7A 4LMAA 1W6UA 3D5QA 3JY6A 1ZH2A 2ZE5A 4C4SA 2OCAA 4N7JA 4FHZA 3UJNA 1TTQB 2V65A 4YRGA 3EXIB 2JCBA 3HUTA 2ZUBA 1MJGA 1UMDB 5CNMA 3X1XA 2P9BA 1W94A 2VTDA 3FVRA 1QH1A 3EG5A 4HEJA 1LRLA 3GJZA 4TVOA 5I7RA 2WA2A 3LP5A 4DJDC 1JH9A 4HJXA 4KDCA 4B32A 1ESEA 1XT6A 4RH1A 1UM8A 3I37X 5JD5A 1EBFA 2R97A 1P2TA 1KH2A 2FWPA 2YVLA 1RPZA 2P4SA 2YYSA 3EZYA 1QF7A 4C4YA 4UHCA 2ZBFA 4DR4B 2OGWA 5TEWA 4F5DA 5LQSA 1JR6A 4OAPA 4JUDX 4FLMA 4UAJA 3KXLA 4HN2A 1KETA 2VHTA 1JU3A 3VUFA 1ZDMA 3KQKA 3AB7A 2L42A 3IVMA 1CQIA 3OWXA 1JMYA 5HBGA 1CR2A 5I7WA 3MTBA 3IB3A 3WGQA 2HWUA 3W1EA 4WBNF 4V0LA 1E1YA 3U80A 5KQPA 6ADHA 4IIUA 1B16A 4BFTA 3AVXA 3CH6A 2EGHA 2FV8A 4RMIA 3DKRA 1EUQA 4PE5B 2O1XA 1ZC4A 2XIQA 3C6BA 4PPFA 5ED0A 4ZAFA 2VN8A 2B4AA 1WB9A 2FW9A 3IJPA 1YB7A 3LL4A 3P45A 4PLZA 4GLJA 5GOTA 3TLGA 2CFTA 5A4AA 4YRNA 2A4MA 2PL1A 5AJHA 5EKTA 4D9KA 5A7GA 1U8FO 4MP6A 4NBWA 5EPUA 3UOWA 4HDNB 4Q03A 4YUYA 1I2ZA 3DLBA 5E2BA 1J00A 4J0DA 1T6BY 1T9ZA 1IWOA 3NVMB 4ZODA 4TWRA 1RLUA 2Q4OA 1WQ4A 4N40A 3LQ2A 3UZUA 1P2DA 1J8DA 1U2GA 5BMOA 5LDGA 3CUTA 1WSBA 1NP3A 3FNBA 4DZZA 5KDOA 4Z3OA 4S1PA 4E2ZA 4N8EA 2WE8A 2X8BA 4NX2A 1UP4A 4D42A 1KC3A 1N5JA 4S0XA 1DKMA 3LY5A 3H5VA 1OZHA 3MOGA 2A33A 2I3DA 1EH5A 4NE2A 1RRKA 3KUCA 1FTNA 3HZRA 3K92A 1E7YA 4FCCA 3T3GA 5E1MA 2K5UA 2NNLD 3H3JA 4N0QA 5E6RB 1YIDA 1G0OA 2D0PB 3T4PA 4JXZA 1JLRA 1Q0QA 2JCYA 4O2RA 4UNPA 2H16A 5DE3A 3PQ2A 4NEQA 5HTOA 1XAIA 1E9VA 3PFHA 4HEA6 3EPLA 4N76A 3ABOB 3SN6A 3P5BA 2C95A 1Y5LA 4UUNA 1M83A 3R5KA 5BSVA 3NC1C 2QLBA 1Z0SA 4DIKA 2N3ZA 3AW8A 4EJSA 3BFXA 4E6EA 1QFZA 2YJGA 5CM8B 4Z86A 3PGA1 1S4MA 1U7OA 2IOFK 1CR1A 1Q0LA 1Z82A 3WAKA 4MVJF 4RSRA 3BICA 4AB1A 1HK7A 2D5BA 4H1TA 4RMJA 1N0UA 3VU1A 4KITB 1LLCA 1H8HA 1KBZA 3HKEB 3A8TA 3P2KA 2OFFA 4K9QA 3VO1A 5K3OA 5I4IA 2JJ2D 1E2JA 4BBAA 1U3UA 2I78A 3IALA 1ZHFA 5HIMA 4KAXA 4ZOLA 2NU6B 3UK2A 4MUIA 2FZGA 4TGLA 1UQUA 2G1UA 2DT8A 3MPUA 4LDAA 1HE3A 1DB3A 2Q2NA 2HPZA 2ZG6A 4Q4AB 1SCBA 2Q49A 2GCEA 1NLMA 4KSYA 3EIWA 4UVIA 3SIPA 1QGYA 4WKNA 1D0SA 5TQJA 3MINA 1GJRA 1KVRA 2V97A 4WXHA 5MGBA 1QZ3A 3NBYC 3OPXA 1FFDA 4FE3A 1ZN8A 3ZDFA 1XRNA 2YFYA 4KSBA 1MXHA 2A5FA 3C4VA 2ZPTX 1GSHA 1V5WA 5JVDF 4WCDA 1XOIA 3RRYA 2XECA 5K0FA 2EKPA 5E6UB 1N5KA 3NYWA 1W34A 3LOPA 2YUTA 2HF2A 4ZVUA 4FYKA 1V7ZA 4HVTA 1N6IA 1CNMA 3GH1A 3NXKA 1XC7A 1AC5A 3RF6A 1Y3FE 4JR0A 1CRWG 1X86B 3E05A 3GEEA 5B7QA 4YMGA 4ZO6A 4FYPA 3L7CA 1T3SA 3MZ0A 4OQQA 4AIIA 2BKUA 4F1JA 1S7CA 3IUSA 1IWPB 1BRTA 4JJIA 4YCMA 3AR7A 1OH7A 4CTNA 5FBZA 5K3SA 2Q5EA 2RGRA 3M6VA 3WAGA 3N5CA 4AN0A 3N2ZB 3RT9A 1SWVA 2I6TA 3AFHA 1PNTA 3QKSB 5LIPA 2RCYA 2B37A 3V3TA 1RT9A 3V33A 1R4MB 3WC4A 3SZ3A 4CLRB 1RZRD 4RETA 2B92A 4ZT5A 2XXAA 1ZY2A 2QN2A 5EKXA 5C5EA 5LMCA 1AGRA 1OROA 1GZSA 3DMNA 1KR5A 4E31A 4FQ8A 1QV6A 3U9LA 5FOSA 5D86A 3KRTA 5ALRA 1W46A 1PIWA 2OHIA 1FB5A 2O0HA 2PL5A 4YDRA 4OBEA 1M7GA 2AVDA 3E7DA 5HTKA 4ZVMA 2Y99A 3W5JA 1HNNA 1QVVA 1UJBA 2PZ8A 2ZWAA 3FKQA 3HCDA 3IEIA 4HVAA 4IF6A 1YOVB 4K86A 2VSYA 4WVLA 4C4RA 3PUVA 1IJKA 4H4EA 3PEWA 2F55A 1ZOIA 2GS9A 3DEZA 1IBLB 2B9EA 4P4NA 1X7WB 4OH1A 4OI1A 3CLUC 3K4HA 2OCBA 5DWQA 1FXWA 3B3FA 3VAYA 2XKJE 4OK3A 1E99A 3EGDA 1I9GA 4U6NA 5ETJA 3T6KA 5JS7A 2C5HA 2JDIA 4WXMA 1QKIA 1VLHA 2A9KA 2GCOB 3NGXA 2GZRA 2WJPA 4NCJA 3MRVA 4Q24A 3B1YA 3K2QA 3GRRA 4OGGA 3GRKA 4PWYA 4ADSG 1FDUA 2PLRA 4FFBA 1TPZA 3BMNB 4L15A 2OZKA 2VO1A 4HGOA 2RD2A 1IM8A 2ZDQA 3EPKA 4RO0A 2VF5X 2WBLC 5AYVA 2Z04A 4BO3A 4AJ9A 4LE2A 1M74A 1G8AA 4D46A 4BKMA 1H8ED 1M66A 1SURA 2DTXA 2PXXA 3RROA 4ZU1X 1D4FA 4RGYA 2VUTA 1QR2A 1QE0A 1UF9A 1W0JA 1QGUA 2V98A 3GP3A 4UEKA 5FPHA 5IC6A 3W9SA 1OLXB 2IXTA 4NBRA 5D5QA 1TM7E 3K9WA 4FIZA 1FLNA 4WFJA 3JQBA 4DLVA 2PU7A 2EQBA 3KS9A 3TL6A 1HQKA 2QE6A 1YQEA 1SVNA 2K7FA 1JS1X 4JEMA 5KTOA 5KVCA 4DXDA 3PUWA 1OUMA 3EJWA 2VKQA 4QD3A 2H8GA 2WD7A 3BMOB 4MGZR 3L6EA 5GAJA 3TRFA 2VZEA 5EP2A 4Z4HA 5AW0A 1U04A 4UTPA 1QHXA 2WSLA 4ND4A 1PG0A 2XB6A 4RU1A 2E82A 3L5OA 2QJWA 3HBLA 2FSVA 3VHXA 3AEZA 3OZEA 1NQUA 1VB5A 4O4HB 5IW8A 1NRJB 2MSEB 5ISMA 3GLGE 5IN5A 4RV4A 1MT3A 1Q0RA 4B75A 4JL6A 3D3WB 4G84A 3C8MA 3TNLA 3GJ6A 4MRMB 2Y1WA 4ZT3A 4NBTA 1M9NA 1YH3A 3H0KA 1RDFA 3LU1A 2EBUA 3R9XB 5CH8A 3M9XA 2TRSB 4LXYA 3UYKA 1A8HA 2FN8A 3RSHA 3MS4A 4EFDA 1VRWA 2IHNA 2PA3A 3BTOA 1WE2A 2PLAA 4QNNA 1FBTA 4RIFA 3SU8A 1ZMBA 4KVGA 2X40A 1KU6A 1D5CA 2GSDA 1FMJA 3AJAA 2O8FB 4WV3A 1NDUA 4GXQA 1MC5A 2B3TA 1E2FA 1O4VA 1XHEA 2P2DA 3DKKA 1T8TA 4EH1A 4ZJPA 2EX1A 2OPBA 2PRKA 2CW5A 1E96A 3FUVA 1B3RA 3HCPA 4HHEA 2ODPA 4R71A 5HUHA 2A1TR 5FB3A 2ADOA 1VKOA 1UC9A 1XTRA 1CRQA 2FN7A 2XVMA 3MCZA 3RG8A 1U4OA 1JE0A 2D7DA 2Q3JA 4JBXA 3KLMX 3FTCA 2VDRB 1N9ZA 1VI6A 4J7UA 2XMZA 5H82A 3OY7A 3PHHA 1J21A 3H2JA 4XJTA 5JZSA 1UJNA 1IUOA 2EJUA 3G6WA 4LIPD 1XZFA 2Y92A 4IICA 1RC0A 1BCRB 2OZLB 4KFCA 1MA3A 1QB7A 4YK7A 3NTRA 3A2NA 4LI3X 4UM7A 1TQ6A 1WQ3A 1XP8A 3LIIA 3B85A 1ESNA 1NXXA 5B3AA 1J2TA 5K0EA 3KPVA 1K4KA 3LXMA 5IF3A 3FVQA 1MHPA 1NXOA 3BK2A 2NXCA 4FR5A 2NV2B 2LVBA 2Y1DA 3UF0A 4US2R 4FGLA 1YRYE 2BDEA 4NBSA 4TKMA 4M4SA 4EF6A 4QXRA 1UOPA 2WINI 1SEPA 1Y42X 3OE7D 3M3DA 2R87A 4R1SA 1SOWA 4OJMX 4XX1A 2CFRA 3QPVA 3ROQA 3PLNA 3W5BA 2PX5A 4L16A 1WNFA 5HW0A 4ND7A 4Y9TA 4D82A 4HQOA 4L6AA 4W9MC 3VJLA 1U8YA 5EG5A 3ZCSA 3DUFA 1M76A 1PAUA 2M1XA 5K3CA 1HOTA 4R05A 4UQLA 3R3ZA 1H5QA 2PFSA 2MYTA 3QH4A 1HT3A 4I4LA 2PNFA 1XZNA 3KTDA 5JXGA 5L3SA 3FY4A 2JLUA 5AM4A 3SBEA 2PKCA 3PJDA 1Z7BA 3ID6C 3L2OB 5E1BA 2LDBA 2BTQA 3WL4A 4DQKA 1U7HA 2L18A 2JJ2A 1YBMA 3EYAA 4FMCF 4X00A 3WDSA 2W2XA 3TTUA 1CP3A 3OEYA 2QW8A 4GXRA 3PNOA 4IVNA 2JI7A 2WG0A 4BFYA 3DFKA 3A4IA 3N0WA 1IDOA 3X1ZA 2TSYB 4HUQB 2HD4A 1PFWA 2P91A 4IIJF 4MR7A 1NPDA 3DE1X 4RZUA 1QP8A 5LOVA 4FYHA 1QTIA 2HEIA 4YHHB 3SIXA 4LE0A 1MJNA 1KXZA 4W9NC 4BIMA 1BU8A 4OSPA 4U5QA 4R69A 1EVLA 1V2GA 2FQXA 3MJDA 4JGGA 2VVTA 4BVFA 1WPGA 3EFOA 3BJEA 3I04A 5ELXA 2QQFA 3DZIA 1H05A 1Y6JA 3JVVA 2P68A 2X3YA 1ZW1A 2YRFA 1HLDA 4BV9A 2AJ8A 1I1QB 3ESQA 3Q3GE 4ZI5A 2IHUA 1VL2A 1J20A 3LWDA 3VPSA 4B84A 5BYAA 1D4AA 1SQ5A 4LDRA 4MW5A 5GZ6A 4YY3B 3M5WA 5F1OA 2XNKA 1Z2PX 1FU8A 3ADOA 2GH1A 4OLHA 4M7RA 1PS9A 1RCUA 1VKRA 3NOVA 4AKTA 2Q8QA 1NW5A 4WVFA 1PJLA 4MKXA 2WSSA 2IGTA 4JC8A 5FBWB 5KWEA 1O94C 4G24A 3AL2A 2SBTA 1RW4A 1MDFA 1V1RB 2REOA 3ADPA 4PSAA 4EF5A 4F3NA 5HK9A 1JSZA 3DWFA 4D4KA 1AXRA 1TM4E 2J87A 3OFNA 4Y18A 4DA8A 1RZRA 1TD9A 3CB2A 2Q8NA 4E2WA 5LA6B 5LKRA 2BGJA 1TCCA 2YRXA 1W8IA 3KVRA 3GCGA 2UVPA 4KVZA 3WGHA 4PLPA 1YB6A 2N0SA 1TVCA 3OIWA 3TEJA 5LWQA 1U0EA 1CS0A 3BPSA 3V4ZA 1FNMA 1Y9JA 1KYYA 2O06A 3FNQA 5I01A 1SHJA 1B15A 3QELB 4HAYA 3PB3A 2I3ZA 3VSCA 2QTCA 1MX1A 3RJMA 121PA 1TZBA 3NR2A 2Q3DA 5KU7A 1HRKA 1JSRA 3Q88A 3SHWA 3OIYA 4EJ6A 4EQZA 3OSUA 4EABA 1YL7A 4P81A 2C7PA 2HHCA 1ID8A 1U7PA 3AZQA 5M34A 4IUDS 4B6FA 5IEJA 4IIVA 1ISMA 4X3OA 2RGUA 1MB2A 3K7EA 5IMSA 1ENZA 1AN9A 2JZOA 3G13A 2H2WA 3RANA 3UTCA 1XXHA 4IJ6A 2ZM5A 4MGHA 3H4IA 4RE5A 3ST7A 2JJQA 3KP1A 4NJMA 1S4QA 1X7YB 3ZWAA 1P8AA 1NWCA 2QDXA 2J3MA 5FOXA 3WB2A 4FFPA 1MIOA 1SOUA 1YS2X 2WUWE 4WLEA 5D3ZA 2XY4A 4PRYA 1I2CA 1N2CB 5JH7A 1QRRA 4HNSA 1RYEA 4IJWA 1E1DA 3UQZA 3DLHA 3LUKA 2QTHA 3DLAA 1MBZA 4UNQA 2AB0A 1J2UA 5DNAA 2AIRA 4B4OA 4INPA 1OIWA 4RA6A 5CDSA 4H0NA 5B4TA 3VNSA 1W5EA 2QLTA 1NF2A 2XB9A 4AJLA 4UQOA 3K1YA 3TFWA 2GNOA 5IVDA 1FDTA 4N8SA 5F2KA 3F1LA 1WD5A 4GU5A 1RHJA 4KQ1A 4YQEA 4AZ0B 1SB8A 2DWOA 2DQ4A 3HCAA 2UZIR 2ZDGA 1E2HA 1IU9A 3KFVA 2XCRB 2VWQA 1M1ZA 3GL9A 3O9MA 1Y1QA 4B46A 1LKZA 2XOKA 4RHEA 5DW0A 1I5RA 4M0CA 3KJQA 3NIDB 1CJMA 3WGLA 2QSYA 4AP9A 1DL5A 1ONPA 1EFCA 2HXGA 3QEOA 3I5MA 3N8IA 5A62A 2OLEA 3RAEC 3L7DA 2I3AA 4HDKB 2L17A 3TEMA 1E2MA 2QD2A 3CCCA 1BZYA 3IP8A 3IAXA 3IP6A 4OXQA 1ILWA 4OI4A 5LM3A 5KCZA 1I2AA 1KMHB 3O8LA 5L45A 4P4UA 2VT6A 3H8VA 3LV8A 4E30A 5KU1A 4M1OA 5LQCA 2QP4A 1Z2NX 2P9FA 3RTAA 2FP4A 3ZJ5A 3SD7A 1KNXA 2VSOA 4QPCA 1NUUA 2HTFA 1AO0A 4DVGA 3BHNA 2J0SA 3AINA 3YASA 3W8EA 1BE1A 1RP7A 4K6MA 4JP2A 3R5FA 3IBGA 1XDDA 1C30B 1IZYA 1IN8A 3GFBA 1L1QA 1J06A 1DDIA 3QLEA 2VP6A 4B17A 1SKYE 5K0LA 1M2FA 4C2BA 4AZTA 3WLEA 4Y2TA 2AYYA 1IY0A 2VK4A 2HKIA 4MAAA 3SOZA 1JHPA 3SICE 1JDBB 5SZIA 2PFKA 4G4SO 4KXMA 5IVKA 1K3FA 3PGKA 4BB5A 5AHOA 3B1XA 3IV6A 3K9QO 1QFYA 3L49A 5IKEA 4I5DA 1JA1A 1IHUA 6CHYA 1O1YA 4GGPA 4NHOA 4KUHA 1LBTA 3PXEA 3EXG1 4NCNA 4C9BA 4RZQA 1G64A 1XHFA 4WXEA 4YJ2F 4FYYA 5C4MA 4P83A 1JYFA 1JGTA 3CVYA 1NW6A 4S3MA 3CCFA 3RM3A 2G1KA 3HJTA 4RTSA 5LLTA 2R8XA 1RYHA 3NM5A 3SYNA 1CUVA 4G1BA 4CFYA 4J0HA 4BCCA 1HTTA 1OTYA 1YK1A 1BOFA 2DQKA 3LE8A 4XASA 1Y4UA 1LBHA 2A78A 4LWPA 1EFRA 3H7IA 2XQGA 3T7TA 4CKCA 5EMLA 4CM7A 4G0PA 2GKGA 4DB2A 2YJ6A 3V8PA 3QI7A 4GL2A 3AETA 4OSOA 5JSZB 2IOHA 1O9GA 3HNPA 4Q21A 5AKXA 3QENA 1RYNA 2ZPUA 1YJQA 4QXAA 4A23A 3MM4A 3A6JA 5IJZA 1VLLA 3OE7A 2ADMA 2C9BA 2QRPA 3ICWA 4JOCA 1PV1A 2QA5A 1II9A 4EHNA 3WB9A 2D5CA 2GEBA 1YTUA 5BV7A 4AKEA 2B25A 1U2PA 5E38A 3TW8B 2NSHA 3MWEA 2C5SA 3PDWA 1Y0BA 5JYCA 4IIEA 3FOWA 2XWBF 1Q6ZA 2AXQA 2Y1XA 5HX7A 5EUMA 4NDAA 2RAFA 2PGAA 2UVDA 1C9KA 1CUWA 2WU8A 1GG5A 1NVKA 4IINA 4HRVA 1FRFS 2EP8A 4IOMA 3EIEA 3V2IA 3X2SA 621PA 4R8KA 1GGMA 4PLHA 4O4IA 2QL9A 1C8KA 4ZMSA 2JIQA 4L78A 5BSTA 3OPYB 3HUDA 1ZR2A 1RHKA 3A6HA 2PGLA 4ZTZB 4BNNA 3BKXA 2XZTA 2YW2A 3NTUA 4X8LA 2OP0A 5B1YA 2CCJA 2JKVA 1RYZA 3NDRA 5C53B 3RVNA 13PKA 3SNKA 5JHHB 1YBVA 3ABZA 4ITVA 2P2SA 5AD1A 5IH7A 1ZZGA 1G4UR 3L5KA 3RS0A 4A7PA 1J97A 4Z8YA 3C70A 4P7FA 2QTVB 1F51E 3KV1A 1GL7A 4EEXA 1PNRA 1TI7A 3L1IA 4NMMA 5GV8A 3U1VA 3B5EA 3CYFA 4H3HB 4WK6A 3ZZ0A 3CE6A 2Y71A 5KNBA 3I92A 4YP0A 1MZPA 4E1VA 4FT4A 3L8CA 2IUSA 2ONKA 2V8OA 4U7PB 3HJCA 3RSQA 4RS4A 2REQB 1TT5B 5ALPA 3TE6A 1PZGA 4QUJA 3DLTA 3LHIA 4IDNA 3I32A 4MB0A 2I5PO 2IIQA 2QQ0A 2M98A 2HIGA 1ZAYA 2I1WA 3UXHA 3U61B 3ELDA 4G5GA 4E7OA 2AJDA 2EKDA 3LCJA 3AR2A 3N0RA 2AZMA 3V4FA 2DLCX 3PFIA 4QXOA 2H57A 4J0QA 2JIBA 3DKPA 2Z83A 3WGNA 4RIGA 4IL5A 3OPVA 3IBSA 1Z0IA 2D00A 2IWHA 3O9ZA 4L0QA 4NAVA 1KO8A 2WF9A 1PQYA 1KEKA 5KVSA 4FCTA 1MRSA 4CR8A 4GKKB 1A9QA 1APBA 1KI1A 4ZCQA 1NVDA 1CZRA 2BEWA 4OHYA 3K0FA 2BH2A 2QE7A 2WF6A 1V11A 3PC8A 1VL6A 4MWTA 3RFFA 2QRZA 3R20A 5BN5B 2DFDA 5BWOA 4B4VA 2OVFA 2VXOA 5BN3B 1JDZA 4YACA 5JAUA 4HCJA 3Q3HA 2AW3A 2XMRA 3UJPA 1D9ZA 3CUVA 1M5UA 1RI4A 2PKQO 3GNSA 3OEHD 4IXNA 4PNZA 4QU5A 3DE6X 1DKNA 4QT4A 3GT3A 1YMVA 3BFJA 3UBTA 5EJMA 2ZRDA 1ZONA 1SM4A 3CPEA 4GUDA 2H18A 3NTOA 1K89A 3F4KA 5KO2A 4UUAA 1IQPA 1A8UA 3HO8A 1BE0A 1K68A 2ZTHA 1P9WA 2AI1A 3HP1A 1J2RA 1N0HA 1UEJA 2ICAA 3D7MA 2NO1A 4BLRA 3AJ9A 4FFRA 4WTOA 3GA0A 4CKWA 4ZVRA 2QLMA 1G8GA 2PUEA 1HORA 5CBPA 2B8WA 3DBIA 3H65A 1JHMA 3OMXA 4JODA 4WLVA 2OO5A 3PQ4A 3BJZA 1CEYA 4QTUB 4BECA 3WMGA 1WNTA 1B6SA 4MS4B 3SXUA 2WTBA 5K8LA 2NPOA 5CAEB 4RACA 3X1MA 2ZYWX 4TTVA 3R3HA 4RHXA 1OZGA 3PKIA 2QBYA 1RQPA 2ZBQA 2G17A 3EF0A 5LQNA 1ZVQA 5JDIC 1IUNA 1KI7A 4EQ6B 2GAOA 4JUBA 4P3YA 4KQEA 2OHGA 3B3AA 3ZDQA 3GFFA 1WR8A 2XYHA 2ZJ0A 4ZOQI 2QPLA 4ZOCA 5MN5A 4GZMA 4TQGA 1QUEA 2R47A 1R9NA 2BFPA 2QRNA 4B44A 4D3SA 3RVPA 1QIMA 4DBZA 1SXHA 4XQGA 2UXBB 2D13A 4OKIA 1X7HA 3LT2A 1F2UA 2Z2KA 4X5OA 5DCYA 1AS0A 3A6PC 1PYGA 1KDPA 5DTQA 1NN0A 2R8OA 1UAAA 2X77A 4TRJA 1OREA 1Z25A 2AEJA 3D6JA 1PT9A 3V8VA 1WJGA 3U5TA 5DX8A 2XCOA 4Z54A 2A9OA 1ECCA 4WQMA 3CLKA 3F8WA 1E98A 2K4MA 4Y1EA 1M1YB 4GMDA 4I3GA 1MX5A 1XN4A 2GASA 3FPGA 1A2KC 2YYAA 2WJGA 4XZ3A 3BILA 4U7DA 1XDSA 1TKRA 2WPDD 4J91A 4MWCA 2XA1A 1MB4A 4E14A 4ALIA 3LRTA 4PONA 4Z53A 2B2XA 2BM0A 1SBZA 1RWXA 1LBSA 3GN1A 3FXAA 4HPJB 3TLXA 3WYFA 2JBWA 3TBHA 1HX7A 1IOWA 1BJTA 2J41A 3OZRA 4YMLA 4M7PA 3DDUA 1DQSA 3VVLA 3HYRA 2QEQA 4M0UA 1VI2A 1JR3D 4MUAA 4O2BF 4R8MA 3FKSA 5C52B 1KR2A 4QFMA 1GPKA 4N3NA 3SQMA 4MDHA 4S1WA 4IG9A 4I4TF 4X20A 5BQFA 1X9GA 2JIZD 3GAMA 1FQJA 4HAZA 1TW2A 1US8A 1Y7HA 2J9GA 3HMKA 3R40A 4XGQA 2AFHA 3FSEA 4GRAA 2JFHA 1D1PA 1OFHA 1NU6A 2JZNA 3DXFA 3M6XA 3VYWA 2X0KA 3UN1A 1WUTA 4RVCA 2BCJQ 3SLKA 3H13A 4L7VA 1EFVA 4DLXA 1FYDA 3CZ4A 3GQBA 1O54A 3ZBPA 4HVLA 4IBOA 3V1UA 1EUZA 1I7LA 1FP4B 5L3RA 1D2HA 2XCQA 3ZHQA 1I0LA 2RHOA 2QTLA 2MT9A 2PMWB 4D25A 2RKOA 3HFJA 3R24A 3RHTA 3ZD6A 4BS9A 1PQUA 4D4IA 4PG5A 5KOIA 5GONB 1R0ZA 3IC5A 2ATIA 2HJVA 2ZWMA 5EFOA 2LBPA 4DCUA 3T52A 2HJGA 3NHRA 1M7HA 3C43A 4EYSA 3KQYA 2ILVA 5AI5A 5FCDA 2DBVO 5C8YA 4M0EA 5FNZA 1GN8A 4RHFA 3ZKWA 4FSXA 2M9MA 2OHVA 1Y3HA 1G4AE 2WM9B 2DPHA 3Q8XB 5CTAA 3ZIAD 2HSDA 2Q9UA 2PX8A 3CPJB 3FBGA 4YIKA 3S5JA 1V3VA 4BFWA 4MW7A 2FDCA 2QVLA 4NZYA 2H0AA 1JWLA 4O59O 1UXHA 4LRSB 1NAHA 3EF1A 3ZDRA 4EHBA 1ZNZA 3VH1A 3WGIA 2POCA 2ZCVA 1DXOA 2VJAA 3AERA 1PFKA 1AQUA 2F00A 2P9HA 4LYJA 5DNUA 3AUTA 4BNFA 3IP9A 3OQIA 1OC4A 2X0EA 4ZCTA 5AW9A 3HRIA 1DO2A 1C8VB 4FCWA 1WY5A 2X2OA 4C3UA 3WWPA 1AQYA 2G4LA 5KJ1A 2D2FA 3ILXA 4MEBA 4CNBA 2MSLA 3FVTA 4UFNA 3V2HA 1H2FA 4UXJA 3V1LA 1OI2A 3K70B 1GFIA 1R4NB 4IO1A 1NBHA 4XSHA 1OBVA 5JRJA 3JQRA 4DUGA 4ES6A 3QV2A 4LBWA 3EGVA 3WGKA 1YC2A 1RMTA 3MBKA 2JNWA 2JLSA 5FTKA 1E1QD 3STTA 1U0NA 3H2GA 1B00A 2Y66A 3H5OA 4JSRA 4CKBB 1UADA 3F0TA 3TI9A 1FUUA 4YO7A 3TQRA 3LUAA 5LCXA 4ASUD 3QMVA 4HLQB 1QK5A 2BFDA 3E8MA 4TMFA 1EEHA 3WL3A 4BVHA 4LNAA 1E62A 1DJPA 4I9FA 2WILA 5ALTA 1Y6GA 2B7CA 4HZIA 2QRJA 1FYXA 2ISCA 1KZHA 4JLUA 2JGMA 4NHEA 4TL9A 5EMJA 1QX4A 4ATNA 1HE2A 4C7MA 2WIAA 3NFRA 3OQBA 3QTLA 1DINA 4CUKA 2V9PA 1YZHA 1VMEA 2FEAA 2G07A 1PTKA 4S1VA 2VOJA 3LYLA 3QP9A 2C9YA 4R40A 5KCMA 1HLPA 1ZN7A 2DWPA 2P0EA 2J3DA 3JQ8B 3PDIB 4TKZA 4UXHA 2BTOA 3S7ZA 2ILTA 5BOSB 2W6MA 1X8LA 4RK5A 1TZMA 3EXIA 2X8LA 1U3GA 3P4YA 4ZQCB 4JA2A 1ODJA 4JYZA 3O4HA 5AM1A 1UMDA 3L7LA 1TAQA 1DJNA 3O1LA 4GPIB 3M6UA 1DWUA 1EGQA 1U28C 3U56A 4EZBA 2X1HA 3RKUA 1LSSA 3IJ5A 1BWRA 4F9TA 4YCLA 3N3BC 4F8EA 4BUJA 3ETCA 3NEAA 4NZPA 3RDPA 5JY1A 2NT3A 1E61A 3C3CA 4D5EA 2WYUA 5LYJF 3NBXX 2W42A 3QNUA 4UUPA 1Q22A 5CDFA 5B6IA 1RRGA 1N9KA 4DFDA 4HKTA 2JIMA 4P4LA 1CQPA 2D7CA 1XWIA 2ZBRA 4QQFA 1AV6A 3DR5A 3OX1A 1ONBA 2XPCA 1YU9A 2GM9A 3TYXA 4L4YA 4AX8A 3ZV4A 2P90A 4C6TB 4EYKA 1ZYUA 1E9SA 2XVYA 3L8DA 1TJYA 4I8IA 2PMCA 3FG9A 2KM1A 2DCUA 4QRHA 3VC1A 1H2AS 1U63A 2P30A 3I1YA 3FWKA 3FZYA 3JPYA 4HLNA 1J5EB 2B1IA 3FZGA 3DKIA 2VF7A 1WCV1 2H00A 3MT9A 1WHTB 4QAQA 3WTCA 4S0ZA 3LZ6A 4HZUB 4Q00A 4UHFA 2NU9B 2FSHA 4ENQA 1DBWA 3TLMA 2EIXA 5HUQA 1TQDA 1N7JA 3MLAA 4BO8A 1HETA 1NZFA 3K9NA 3H0CA 3U39A 1LVHA 1UK8A 3IMKA 5E7MA 3TVDA 4AMBA 4GX5A 1ZESA 5FIUA 3K9FC 4HDNA 4R01A 3TXYA 1NDQA 4Q1EA 1VDMA 4ZCRA 3V1NA 2ZT8A 5TVGA 4D0LB 2XKKA 4C78A 4TYNA 2ZYDA 4BC0A 2WUDA 3CSDA 7GPBA 1DUIA 5ERGB 4BQQA 5A4JA 5F21A 1N5OX 2BMWA 2OL4A 5ECDA 4BRUA 3WK9A 3L7MA 1J8FA 1TAGA 2BBWA 5KC9A 1SO8A 1U9JA 4NE9A 1XO1A 2R66A 2Y27A 5EE1A 4XWKA 3I58A 3G02A 4PYRA 1C4KA 1RRVA 1RHQA 1J7JA 1EWRA 1TTPB 3GP5A 4PICA 4J2HA 1T24A 5TARA 2C2ZA 3SF8B 5E6RA 1UWLA 1V8FA 1CVRA 5KB3A 5JJKA 5DXAA 3DTTA 4MUNA 4ZI2A 2PJRA 3GGPA 4IFTA 3ZVRA 2WT8A 2R1VB 2GD1O 5IDWA 1PFUA 2WAOA 1P29A 1SIWA 1CW2B 2WPDA 4LEIA 1AZWA 1X14A 3JVEA 5BRNA 5IAEA 4BWFB 1N3IA 4HSEA 5HQTA 1K97A 2G82A 3P71T 5JZMA 4C88A 1XFDA 5AWFC 4ZEWA 1OYWA 1O5OA 3QKTA 2PTHA 4AURA 2Q4TA 1GNRA 2IYRA 3A3OA 3U60B 1FFHA 4BC1A 3DONA 3V1MA 1YQQA 4R7GA 3CNEA 3GZ4A 4AQ7A 1LPAB 1HEYA 1WZCA 1B8VA 1OYYA 2HTEA 2Y6UA 1YS6A 3RVOA 2ZVDA 1XAJA 2MU1A 3HKEA 2JIZA 3SSMA 1G16A 5TPZA 4RF2A 1L8OA 2W4QA 3R8CA 1TYDE 1V1JA 1XVUA 1W36D 3SYLA 2RHTA 2KI5A 2HPHA 3JPWA 1ACMA 5CBKA 1A7KA 3TQIA 4CJXA 3A9RA 3I76A 4EEKA 3H9CA 4Q4AA 2QN1A 2FZVA 2V74B 2HYIC 1U4SA 1NURA 5FL7D 3A1VA 1L1FA 4W5QA 3NDIA 4B5LA 4CM8B 3DEIA 2WKWA 3G49A 4JI8B 3D1LA 3NFYA 2BM8A 2PPLA 4WGFA 2GZDA 5CA0F 4M38A 1XZJA 2EKBA 4D6PA 3DEHA 3C3JA 1JLLB 2ES4A 2GWRA 3OJOA 2VQDA 4J4TA 4KQXA 4LXTA 4PFKA 1T15A 1QQ5A 2IJGX 2CHQA 3ZJ4A 4O3FA 4NEHB 5BMVB 4LV6A 1RS0A 3IA2A 5BNZA 5F35A 3ET5A 3QTBA 1H85A 3HN6A 1GGFA 1L5OA 2IYVA 2H2FA 5DBEX 2V55B 3BBLA 1OILA 3GLKA 3HP7A 1JIIA 3HA2A 2EF0A 3N59A 3ZU5A 2QX7A 4EYOA 3AFIA 1VB3A 3TKLA 3OZCA 2ODBA 1D4OA 3SR0A 3OQMA 2C3YA 3K9BA 2HSGA 3QKSA 2HA4A 4CG3A 5HIJA 4ZTUB 4FVTA 4M9SA 1RHUA 1JEQB 4A5OA 1S2NA 4NENA 3E9ZA 4PAGA 4YP1A 2P27A 1FDWA 1QQBA 4QE3A 3S4YA 4Z1MD 3LQRA 3TL2A 1BROA 1SK8A 4PVDA 2RC5A 4UBNA 1GNTA 4Z99A 5B53A 1L3BA 3UK0A 2YWRA 1NXWA 5AVUA 2FWBA 1K7CA 3C1AA 2CKMA 1HR0B 3NCHA 4UAVA 2J1LA 2C3UA 3FUCA 4B7UA 5I4CA 5G40A 2ZRBA 1YOVA 3GUVA 2PUVA 2AQIA 2DPGA 2O8BA 3ZWNA 2G25A 1Y1RA 1J25A 3P27A 4EF4A 1EESA 5ARDA 1X7WA 2BL4A 4AP6A 4DLSA 3RREA 3ZI4A 5E9QA 4ETWA 4C2TA 1SH7A 2CVHA 2GCOA 2OKCA 3O75A 1SOVA 4ASUA 4DCNA 1WWKA 1BXGB 3TRHA 2VDMB 1UKYA 2HFKA 5KEIA 4QPNA 1Q5PA 4QPPA 3LGAA 3V97A 4EHIA 2OD2A 3BMNA 3ZGYA 3Q15C 4M1YA 3ZWYA 3PHLA 4CEHB 5DMXA 3U17A 2WHPA 4H08A 3I01A 5CVEA 3KSMA 3OD5A 4MW6A 3T3PB 4PGHA 4E3ZA 3AUUA 4TQAA 3E81A 4BNHA 2D1FA 1INLA 1DEAA 4ZAVA 1A9XB 4D3ZA 3RGWS 2O5RA 1ACLA 1BTOA 1EI9A 1F38A 3JVUA 3Q8WA 2R62A 3QOWA 5J1SB 1DEOA 3CRQA 3R1IA 5BUSA 1OLXA 3RK4A 2GCPA 3P52A 3L6RA 4RK4A 3PE3A 4TWIA 1YIAA 5BSHA 1I30A 3HB0A 1ZJYA 4D6XA 3VPDA 3H2YA 2DSTA 2QT9A 1NHWA 1Y1LA 4FEEA 3AY3A 1TXGA 2RI0A 4V0SA 1NWHA 3I1IA 2VOEA 2PBRA 4WEQA 3DE0X 3ZVNA 4FDLA 1IJFA 2INGX 2XRYA 1USKA 3LT1A 3BIOA 1RWNA 2QGFA 4GOXA 1SXIA 4UOQA 3TQCA 1M1XB 2IYNA 3ROXA 1HLGA 2X1LA 1SCUB 2IYEA 3M5PA 4Q6WA 2D1RA 1DQPA 4IY1A 4F6RB 4Z49A 4ZOAA 1KTIA 4PFQA 4B71A 3CEPB 2E18A 3G9XA 4Y2JA 2Y1GA 3R4CA 2FPPB 2WNSA 1MJ5A 4AJJA 1MAVA 1X1BA 1KSGA 1Y8AA 1Y3BE 1U1DA 4IGKA 3VKVA 2HA3A 5FEUA 2F9FA 2HJWA 4MV7A 3MGBA 1UP7A 4MRMA 4RD4A 3EXFA 2OQ2A 2XTNA 2NVWA 3LGXA 3PDUA 3QF4B 4W9RA 4UCXA 2C7RA 1YA6A 1E2KA 4X63A 2AGVA 3T54A 5A02A 1J0DA 2HEGA 3R9XA 1FY2A 5HCIA 5LBTA 5TGDA 5K3EA 8MHTA 1ZWLA 1ZNWA 1KK2A 3FKJA 3EG9B 1A7UA 2GBPA 1NG9A 2DUNA 1TGVA 1R3UA 1U3FA 2XWJI 3JWIA 2C7BA 4JUCA 1YONA 3OM1A 2RCNA 4LDJA 5D1NA 5B1DA 4CF4A 2YIVX 5B57C 3MXOA 1U80A 3H04A 2QTRA 4R3WA 3HS3A 1NXTA 1PWEA 2BEVB 4PNEA 3QPUA 4A1FA 5D87A 1LDMA 3UWDA 4XQEA 3B2NA 4R9RA 3E1GA 1CUDA 1WOMA 2CDNA 4W8HA 2JJ1A 3Q5EA 4IP0A 4H27A 5DCWA 3G5AA 4ZDIA 1TJ4A 3TRIA 2P5SA 3H4VA 4ZO7A 1JB1A 3VZQA 4JXXA 1FSFA 2OZLA 5EP4A 2Y9MB 3WP1B 2HA2A 4Q4JB 3R9WA 3TLYA 5D6NA 4RPCA 3PXBA 2OENG 4XEUA 1ADBA 1IHDA 3M6IA 1GM5A 2VT7A 4LVOA 1SBQA 2DVMA 4J49A 3QM1A 3O47A 2CLDX 2Q1WA 4RELA 3LT0A 1R5OA 1WCXA 3WWCA 4FKMA 3LAWA 1V5FA 4ER6A 1Z2AA 4ZK6A 5BSKA 2WU1A 2VJNA 3CN9A 3LX8A 1P80A 4GIBA 4DIOA 2IODA 1QBGA 4JA0A 4M1MA 4FE7A 2YVAA 1USWA 2OK7A 4JI5B 4B2LA 4GDFA 1K3UB 5HOEA 5DIFA 4EFNA 1MAHA 4RHCA 4ZOLF 4KXLA 4GPZA 3CLHA 4WXPA 3LPAA 1S3IA 4YH1A 1M0WA 2HCBA 1T8RA 5EMMA 4BLWA 1P5RA 2H1VA 3LZDA 4QUHA 2Z58A 4FGUA 1EX7A 2HX1A 5EXTA 4L8GA 3PD1A 2YS7A 1JIQA 1FMLA 4QOJA 2VDVE 1JX6A 4Q9KA 1Y8RB 1L5RA 1JHOA 1KRHA 4GPAA 2XCSB 1U9IA 1P2UA 2OECA 5FYQA 1YS7A 4UCQA 3MBOA 2NV0A 4QOIA 1SBHA 2CMDA 4X84A 4J9VA 3MTGA 2DBRA 4KX5A 1Y33E 1RI2A 3PEYA 1R6XA 2ZJ5A 3ZNPA 4NI5A 5G4LA 3ABSB 2FZEA 5CNJA 4GR9A 3MYRA 1ZM7A 1KFCB 2ZBEA 3DBLB 4HUQA 2C00A 1N6NA 4TL7A 4DC1A 4BCDA 2DKOA 4EA9A 3JWEA 2GTPA 1QS0B 1D3AA 3GPCA 1QCZA 2HPVA 4HAOA 1NIJA 1FQWA 1JQEA 4CU2A 4HAUA 4ZC1A 5AJXA 1UKEA 2MIIA 3B9BA 4W63A 5TS2A 3HI6A 4BZZA 3P2YA 1G38A 4MYTA 4PYIA 1PSZA 1FNBA 4ML3A 4BJ3A 5ERXA 2I7XA 3RS3A 1EPUA 4J1TC 4WHMA 4L5CA 4O8CA 5D51S 3THXB 3WA7A 4LNUB 4V0RA 2QWXA 4JL8A 4LYAA 3QI2A 4MR9B 1NMEA 1V9CA 5FAXA 4QNRA 4GVLA 4AX4A 4A73A 5JQWA 1R12A 1PVVA 1KEWA 2ZWIA 2D3WA 3KDSE 4D9EA 4B81A 3GHYA 3ZVMA 1OH6A 4AUMA 5AR1A 1JHRA 4RTRA 1C7ZA 1L4GA 2VRWA 4QIHA 4L51A 4L5JA 4WBXC 1VCIA 3TSOA 4N6GA 4FINA 2HRRA 1UT8A 4NQRA 3CWQA 4BKQA 1LSOA 1V1RA 2XB8A 5JAQA 4LY0A 1JTVA 2P35A 3VDXA 5AQEA 5KYNA 1BEEA 3PHIA 1ZHOA 1BRMA 1YV9A 5IJWA 2OV2A 2VSQA 1HZZA 4RY9A 2A86A 5DTIA 5LA6A 3HQ4O 2EJWA 2ZVPX 1GZVA 3M83A 4K1XA 3U4AA 3NWPA 3PPXA 2E5WA 3GVHA 3LPLA 4URXR 3AOEA 4W6ZA 4LWZA 2CVZA 1NBAA 1R6AA 1S2LA 1ZI8A 2LDXA 3HKCB 3ACDA 4TLAA 4ND8B 2QGNA 3ASUA 4XARA 3TLCA 4ND3A 1D6NA 4WMLA 2BKVA 2N42A 2BGKA 3C24A 4O6VA 4RJ2A 4BGUA 1LLQA 5F3RA 5FXMA 2VYVA 5ESRA 2ST1A 4CDRA 1N2SA 2DE0X 3W77A 4IWXA 1RXYA 3AKEA 3U49A 3FYTA 4MLCA 5JAMA 3D4IA 4NOLA 1FRQA 2GLTA 2VHVA 3LUCA 4KXXA 5JMWA 1GLGA 1KJIA 3A1UA 3C7CB 3LW8A 4PG6A 1SIBE 1XLTA 2DH6A 2WOJA 3ONFA 3HLKA 4PCLA 3ZNNA 4U4AA 4BIIA 1XCPA 5SYNA 3HXOA 4TTJA 3QU9A 1BJKA 2P2NA 1PHPA 4Y98A 1V48A 4HEHA 2NO0A 3L92A 1YZLA 2EW2A 2J07A 4FK8A 1X7YA 4RHYA 3GIWA 1TKAA 3MUNA 3SDZA 2RKBA 5FJJA 1UZAA 4HT3B 4EFLA 4X91A 1N25A 2GPWA 3BORA 5H16A 5BSMA 1J07A 1SHLA 5KTMA 2QYSA 1DAHA 3UG6A 2G36A 2H4HA 3FIUA 3RCBA 2QV7A 2WFLB 3E3OA 5A3VA 1RKXA 4UD2A 4ZVSA 1DOAA 1PCXA 1Z88A 2PQ2A 2QYTA 4HH3C 3RF7A 4B8WA 2XB4A 3AG5A 4DDHA 3TBFA 3GUYA 3H4TA 1URPA 3LSTA 4QICA 4ROSA 5IP5A 2MSWA 2X1MA 4P93A 1TE2A 3QWFA 5HKLA 2NZ8A 3ROMA 1J22A 2V6GA 5FJIA 2XRFA 1CUUA 1RWWA 5KQSA 4BQOA 3VU8A 1IHOA 4AZ0A 1E3DA 3OE4A 5GTDA 4YAEA 1TA9A 2OD7A 1VHDA 3B1ZA 1E94E 3P0IA 7MHTA 2DR0A 1VJGA 4KXFB 3OEWA 1BG6A 4KWCA 2NPIA 3OHSX 3IQDB 1NNI1 4I0WB 2BT4A 4I1RA 1Q7CA 4DWVA 3CLUD 1B3BA 3N70A 5I5GA 5AW8A 5CX4A 4IPTA 4HNQA 4HDKA 3RSSA 3T5AA 4HX2A 1QHSA 3E2IA 5C5CA 1KMHA 1Q1BA 1B8UA 2DHRA 5L4LA 4FYVA 3SC3A 1T8SA 1OX6A 2OD9A 3OTWA 3L8EA 2GHIA 3FZEA 1SKYB 4UHBA 4EKYA 5KTPA 4N41A 1QVZA 5CLQA 4R83A 1TUBB 2BKXA 3V4RA 3RSCA 3CWZA 1WUYA 5D85A 4B87A 2FCAA 3DTVD 1MORA 4GI5A 1MNAA 1AGYA 4AI6A 3B6IA 3NDBB 1C30A 2HRDA 3IP7A 1P91A 2Z8YM 3NNDA 3R09A 1W35A 4PQFA 1ULSA 1X39A 2HCFA 4QDTA 3WL6A 2LXNA 4GZ3A 5LUBA 3U6BA 4YRBA 5KYKA 2CF5A 2YWGA 3FCEA 1TL7C 4YUZA 2FZ4A 2JHGA 1BXZA 4MMYB 5D3MB 1XFAA 1RADA 3TJMA 1SCKA 3FBTA 1QONA 3A6FA 4F4FA 2DUMA 2HRBA 2FPIB 4KO4S 4TZ0A 1KXJA 5KSWB 1H66A 1VYVA 2CXRA 3F98A 2PUHA 3LHDA 4KIWA 4NYMR 4P4SB 1ZUNB 2H1CA 3KZVA 4K6GA 1Z0JA 4YJFB 4YALA 4DJFC 3FNIA 3W78A 4DV4B 3HFRA 1IOZA 3D9QX 3ILYA 4BKUA 3EPJA 2VDUE 1WX1A 1BDMA 4LYYA 1NI5A 4MV0A 1ZL0A 2Y1LA 3SEFA 3TIVA 3VR6D 2B8JA 2PM8A 1NW9B 4AN1A 1KH3A 2BGMA 2CXNA 1GUAA 4QDUA 4YRCA 3VAAA 2VS1A 1Z45A 3P5SA 4RCZA 1RMYA 1IL0A 3F6CA 1GRQA 3KWFA 1IB6A 4QXPA 5G3ZA 2JAWA 2GA8A 4O33A 3DO5A 1U1CA 1V7QA 4JOSA 3WFZA 1PW7A 4F3YA 4G01B 5CLGA 1YSCA 1HA3A 3PNMA 4S24A 2CJWB 1FL9A 2KLBA 4AS1A 2ZZMA 5K8VA 3OZGA 5BQPA 1GUDA 2OORA 4M83A 4CTMA 2AG1A 2HBYA 1LV8A 4M99A 3DHWC 3AI3A 1TJ3A 5U4QA 2O7RA 2Z3ZA 5JSZA 2UUOA 1R9MA 1U5CA 2NWQA 1XD2A 3VZBA 4LOAA 3JSXA 4N65A 3VC7A 2ZT5A 4Q3EA 1PL8A 2JJYA 1MENA 1JALA 1L5QA 3MK31 1S7GA 1ZK4A 2PL9A 4DREA 5ICCA 5EIAA 3LQQA 2Q3MA 2VJOA 5COAA 3TW8A 3ZCPA 2PR7A 3ZY3A 4JP3A 2PRZA 3R6TA 4Z9AA 2VRNA 4M8LA 1LPMA 1UZUA 3PQ5A 1NF8A 1FP7A 1T0PA 2Y6VA 3TSCA 2Q46A 4DCMA 4Q66C 5KYXB 1UWVA 2CEKA 3CXUA 2QPOA 1ZMOA 3EVZA 1C1YA 2ZJBA 4FGWA 2XUQA 4WJZA 1NBMD 4NNPA 4N5HX 4RMGA 4BVLA 2HDHA 3EC2A 1OBOA 3GVIA 1XALA 5L51A 1RI5A 4LYDA 3QF7A 4DMUB 2NAFA 3PQEA 4C3VA 4PZPA 1H6CA 5J2UF 4RD2A 2OG1A 4F6CA 1OYOA 1U65A 4LYEA 2XWQA 5CFMA 4FYMA 1YKSA 3DMFA 1PI3A 3NHMA 5H4HA 4F9FA 1I1OA 5CLJA 1NVUQ 3MB8A 1BMFD 1N2EA 2XQJA 2ZKLA 2TECE 3P26A 1Z5WA 2D4HA 3ZWXA 4CMEC 3K70D 1OR8A 3OQOA 4EHHA 4DYDA 1DKOA 2OHOA 3RC2A 2QTVA 4FDMA 1V4NA 2CL6X 5A2GA 4DCOA 3WMFA 4DKXA 4XIYA 4RKRA 1YB2A 2WT9A 3CUYA 1YZFA 4QJBA 4YUXA 1A4IA 2EARA 1PFQA 2WKRA 3OJFA 3Q7RA 5B2EA 1RIIA 1BMDA 3MELA 4U39A 1P1KA 5B58C 2REQA 3PR2B 2PIDA 1TYEB 2XYGA 1NYLA 1KZ9A 5GVSA 1WSWA 4OHMA 3LUJA 4R5HA 1LGYA 3NRBA 4PXYA 2XTJA 1Q1AA 5BN4B 3LPDA 3VSEA 1IN4A 3OIGA 4NOKA 2B36A 4QUAA 1ORRA 5EKDA 2G9RA 3WKEA 5FULA 4BJHB 2UKDA 3WMRA 4H7FA 1G2QA 3H18A 4EB6B 2WWYA 5C81A 2I4OA 3R7WB 3D6AA 3K5HA 1QYVA 1G5HA 4E1AA 1N34B 4Z0HO 4IILA 4WK2B 5EHXA 1JTEA 3CEMA 3UAYA 1R0XA 1UDCA 2HC9A 4RAOA 1WMBA 5EXEA 1I5OA 3LCUA 4DSOA 2OC4A 3CZPA 3QWIA 4DUZB 1QR6A 4LC0A 5ICGA 4CL3A 4HI0E 4Z7NB 3ZHRA 4ZMBA 2PRSA 3CLSD 1PJ2A 4ROTA 1NMYA 4JP8A 4UU7A 4F96A 1AK2A 1L4EA 1CLEA 3LUPA 5FA5A 1T1EA 1P2FA 4M1ZA 3QK7A 3EUAA 2VWPA 1IMJA 1PWHA 1JMKC 4KH1A 3DUWA 3A6EA 4OXXA 1JYSA 1D2GA 2W6NA 3HPRA 4NDZA 1QP7A 4J1QA 3PHCA 3FNRA 1B8PA 2NYUA 4E03A 3MG9A 4KRGA 1VJTA 1T9BA 3WS7A 4RTMA 3L1JA 3AX6A 1VPTA 2J4DA 3DULA 1J1ZA 1EE1A 3JTEA 4AN4A 3SBXA 5EMNA 5CNKA 1I3NA 4V02A 2DEUA 1JU4A 1E8NA 3LRPA 3NZEA 4HLCA 5D2CA 3QU5A 3ZE9A 2XE7A 4BDSA 5B30A 3PQFA 5LZ7A 4RVOA 4CIBA 5EQFA 1GQOA 1G55A 3CKYA 3L6BA 4AF8A 4ARAA 1T9HA 1A27A 3TSAA 1E20A 3PYLA 3GUZA 3CVVA 1O94D 1EVYA 2W8BB 4IF4A 1DFGA 1E2IA 4P6VF 5FUBA 5K05A 1MPTA 2DHDA 4F2DA 1XTQA 4N0PA 5HWSA 1KQ3A 4N18A 3KJFA 4JASB 4V39A 2Q5CA 3L93A 2QX6A 4QU0A 5DM70 3ONNA 2QM7A 3T0IA 2RAVA 2X7HA 2OCLA 1WKCA 4JAVC 4MUEA 1N8NA 4EQ6A 4OYRA 3ZUGA 2Q7OE 4I5FA 4FDAA 1BU5A 1E6UA 1JHDA 2I8AA 4Y2QA 5DW3A 4DW8A 2XV1A 4YLYA 2BHLA 4EFMA 5EGSA 2Q62A 1TK3A 2AZDA 4W5WA 2NP7A 5G3YA 4BP3A 3UB3A 3O0TA 3QA9A 3BMCB 2C8VA 4TWJA 4W4TA 2QL6A 3IBTA 3BX1A 4XRGA 4MUGA 3ADKA 5EQDA 3TZCA 2GYVA 5ADHA 3EIOA 2VCHA 5JZ9A 2BBTA 3W5IA 5CH5A 1L5MA 3OJCA 5ARBA 1PT6A 2NMVA 4EKNB 1Z74A 3MCTA 4GYKA 2VP4A 2VTVA 3KOUA 4JXJA 4S1TA 1M1YA 4KFTA 4KXYA 1GHTA 2IBSA 1P1HA 1ZD8A 1HDYA 3RUCA 4RPJA 1SXQA 1VBFA