1VGQA

Formyl-coa transferase mutant asp169 to ala
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
427
structure length
427
Chain Sequence
b'TKPLDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRGWLQDKPNVDSLYFTMFNCNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANEHLKVYENVAQCSGGAAATTGFWDGPPTVSGAALGASNSGMHLMIGILAALEIRHKTGRGQKVAVAMQDAVLNLVRIKLRDQQRLERTGILAEYPQAQPNFAFDRDGNPLSFDNITSVPRGGNAGGGGQPGWMLKCKGWETDADSYVYFTIAANMWPQICDMIDKPEWKDDPAYNTFEGRVDKLMDIFSFIETKFADKDKFEVTEWAAQYGIPCGPVMSMKELAHDPSLQKVGTVVEVVDEIRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLKELGLDDAKIKELHAKQVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formyl-coenzyme A transferase
publication title Kinetic and mechanistic characterization of the formyl-CoA transferase from Oxalobacter formigenes
pubmed doi rcsb
source organism Oxalobacter formigenes
molecule tags Transferase
total genus 148
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.8.3.16: Formyl-CoA transferase.
pdb deposition date 2004-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 1vgqA02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 1vgqA01
2VJKA 1XVTA 1P5RA 1XK7A 2GD6A 1T4CA 2GD2A 2GD0A 1X74A 1PT7A 1XVUA 2VJPA 4HL6A 2VJMA 1VGQA 2VJQA 2VJLA 1XA3A 1Q7EA 2YIMA 2VJNA 1XK6A 1Q6YA 3UBMA 1T4CB 2VJOA 1PT8A 2GCIA 2VJMB 1PT5A 2G04A 1VGRA 1PQYA 1T3ZA 2GCEA 1P5HA 1XA4A 1XVVA 4ED9A
chains in the Genus database with same CATH superfamily
1DO8A 5CT5A 2JBAA 1DBIA 3HJFA 5DM4A 4DZRA 2ZE6A 5IJXA 3AP2A 4CMBA 4HUTA 5DYWA 3HKBB 4PYNA 4Z2YA 3HNRA 2V5UA 2EDAA 2FAXA 5I01A 4RD0A 3GU3A 1NDUA 5JSKA 1NOJA 1KI6A 1VYTA 1HNZB 2RGEA 5FI1B 1QQ6A 3I28A 4EGFA 2JLUA 4OYLA 4DY6A 4K6HA 2ZAOA 5CDGA 3RSZA 1FLVA 2XI4A 3C5VA 3OURA 4ZI2A 5IT9A 3L7IA 4R81A 3IIEA 3ETEA 3IJPA 4P82A 4UXIA 2FDRA 4DG8A 3HKBA 4V1CB 4KR9A 3C15C 1DTSA 4GHWA 4TZKA 5ALHA 1NBMA 1QHEA 1CUCA 1XF1A 1KF0A 2CJYA 2J0UA 2QL7A 2QMZA 3PPYA 3PUYA 4H7FA 4MGZR 4NYIR 4JASB 4EKDA 3HVRA 3BXGA 3ZE9A 1QTRA 4JLMA 1YB4A 4YMUA 2H17A 2PNFA 3OPNA 4JGIA 4DNPA 2Q2VA 1J2EA 2FWNA 1MUUA 1QB8A 2HCRA 4FOLA 1AY0A 2C4TA 2AFVA 3HDYA 4MTCA 5KTTA 2E21A 3UGKA 1JJAA 2HMVA 1E20A 1Q19A 1SZJG 2WSIA 3HCCA 3I4LA 4LOKA 3TOXA 4D9NA 4Q4CA 1C29B 4B74A 5FBQB 2B69A 1UFRA 2WFZA 3WA7A 2PGXA 2OP1A 2OAGA 4JZKA 1PW7A 1TCCA 1HWYA 2X0KA 1QOPB 1OFTA 2CDAA 3R20A 4ZQBA 3S1LA 3IULA 1DQYA 3PXDA 2O06A 2E5WA 4XOIA 5EMHA 3EQ7A 4KFSA 5HZMA 1T26A 1L5NA 1R5NA 4XB6B 1W8DA 4P54A 4RHCA 1VCNA 1R50A 3ED1A 2C5SA 5DTIA 1L1FA 4OGKA 4ERXA 3MWGA 3PC3A 2DHQA 4LEIA 5FADA 4B32A 2QR2A 4YTEA 1E77A 1Q1EA 2AZXA 1Z16A 1KEZA 1IN5A 3MTAA 3X43A 3C8HA 1D0VA 5CA1B 1JKFA 3WQQA 1IYZA 1GR1A 3MS2A 2HJ9A 5YASA 2ZSHA 4IO1A 2MIIA 3BH0A 2KM1A 2UV8A 3GJ6A 3WGNA 4HFRA 1R15A 2DT5A 4YCCA 3QEMA 4WLUA 4XCVA 4UFOA 1LRKA 3O2NA 2WU4A 5ADVA 2NUAA 3REFA 5M29A 2ZYWX 1KVQA 2GEKA 3GUHA 4Q93A 4K0KB 3Q11A 3HNOA 3TAUA 4CCYB 5F2NA 3V1YA 5IBQA 3CA8A 2FG6C 4N9WA 3V7FA 2HK7A 3EPJA 4W9MC 5HJ7A 1D4FA 1FFGA 5IK2A 1CEXA 4FK8A 3TLKA 3VDMA 3EUWA 3Q6MA 4QYXA 2WMDA 5CH3A 2XDAA 3T3GA 1QV9A 3GI1A 4Q7EA 1B6TA 5B4UA 1VI5A 3WHPA 5E3HA 4C4AA 5FL7D 1NU8A 3W3ZB 3U7QB 3HVKA 4KR3A 3TMYA 1TLLA 1A1VA 3TQOA 1GNPA 3MMXA 3A9SA 2FUEA 1PWXA 1GAJA 3GLHB 1M6EX 5AVUA 1ZG3A 3R5HA 3KBOA 3C1UA 4I4NA 3MGCA 1Z47A 1L7PA 2GRUA 2R7LA 4RX1A 4P7JA 1E64A 4AJPA 2XUIA 2NSDA 2GARA 5TS2A 4PPYA 2QV0A 3GJ0A 3I9V1 3OPVA 1DHTA 5BWOA 1J0BA 3QHPA 3NETA 3Q0IA 1A1SA 4MCHA 5MF6A 3ONVA 1QX3A 1LZLA 2VTDA 3AETA 1R8YA 2JD2A 1DWQA 3GFTA 3GLHA 4RJLA 4DLRA 1W4ZA 2DQZA 1YBAA 4PQGA 3C5CA 3PWKA 2G70A 4RYDA 3HEAA 2HDNB 2BELA 4J9UE 4LXUA 4ENUA 4K0RA 1F7UA 2SICE 1SA0B 2VTKA 3RFVA 3F6EX 4BMYA 1V7PC 1TFUA 5K4HA 4MEBA 1I5OA 3HYLA 4TVOA 5JZOA 4IQ8A 3AFHA 4AG5A 3T9DA 3L8ZA 3LPNA 1J06A 3G2NA 2AOVA 4OQEA 3VJRA 1KERA 2IOQA 2O52A 1ZO8A 1UXOA 4AY4A 3BQMB 1M0EA 1R27A 4NV1A 3UFXB 1L4NA 1PQUA 2HPZA 4YDRA 1GCGA 1R6UA 1SEVA 1W88B 2V0NA 3QV1A 3I6MA 3NXSA 4LJAA 3QLUA 2BCJQ 4RPCA 4C7XA 1SA0A 3HBMA 4PZUA 3ANSA 2IS4A 1NVKA 1Y5NA 3ZDBA 2R6ZA 3LGSA 4RF3A 5A05A 5JH7B 4NG4A 2JFQA 2D5LA 2WFAA 4MV0A 1LI5A 1MRZA 3DE6X 3DO6A 1R6XA 3F5FA 1UXGA 3GJ5A 4AN1A 2D06A 4LRQA 3UFXA 1FP6A 5DHAA 1E2HA 1VDZA 1W88A 3LQ2A 3HU3A 5IKPA 1UFKA 3LM8A 3IV7A 5SYAA 5HIKA 2UZ1B 3GLFB 2WFMA 1SAYA 4ZODA 3WYNA 4ARSA 4NZ9A 3VISA 2H0AA 1IULA 4MMZB 1ZFNA 1ZM3A 1SOAA 3KXLA 4RIIA 4RMNA 4UMVA 4YRGA 5JH7A 2DJ5A 2POQX 2VA9A 4L27A 3P1JA 1EB8A 4RMIA 1K8ZB 4Y2XA 2NLOA 2VYND 2FHSA 1QCYA 2W22A 1Z07A 4WGFA 4FNGA 5EKTA 2WKSA 3BJIC 1EK6A 3L7KA 1G21A 3AIIA 1FVOA 2M6RA 3M6XA 1VHQA 3AB3A 3UEOA 4XYBA 4E5MA 3H13A 2BMAA 2X22A 5B5SA 5BSGA 2EKZA 4NSNA 4ER6A 5A4DA 1DAGA 5KOHB 4FINA 1IHUA 2GCEA 2BWJA 3VC2A 421PA 4HJXA 4FYWA 1HDXA 3ZLTA 3I42A 2YYSA 3DP9A 1KY2A 2FUCA 1DKUA 1RJDA 2AZ4A 1SXJE 1MRNA 2UYQA 4TKLA 5DYNA 1JJFA 2W6NA 1BW9B 1N3BA 5C2JB 2FE1A 1S2NA 1CLUA 3PHCA 2BM9A 5AOVA 5DI9A 4ZV7A 5AW5A 4H77A 1YFZA 2A3RA 4IOMA 1W76A 1V48A 5CFNA 4B3GA 1E98A 3CPJB 4QUAA 2A5LA 3DR5A 4QARA 4JT2A 3FHCB 3OPYB 1PLJA 3CRNA 4P93A 3M6IA 2FPLA 2G7MC 3E9CA 2ZSFA 4UU8A 4V0RA 2Q0QA 5AK5A 1L5LA 4E5KA 3M6VA 3QE0A 1J2RA 1I51A 4I5EA 4NF2A 1ZZGA 3C45A 3L8HA 1XZHA 2IQ5A 2W2TA 3RTAA 4BUJA 5HJ5A 3R0IA 3ZWAA 4HQFA 2Y27A 2HNKA 3BE5A 3FNFA 4Y6QA 3ADBA 1SZCA 3DKRA 2YCLA 4BO4A 1MHPA 3F7NA 1J8FA 3TAXA 4ZCTA 2PX6A 3L92A 4NENB 5SY4A 3T1NA 2O2HA 2GO7A 4OK5A 4DM4A 4F7DA 4ZC1A 2WKWA 5EPEA 3EZXA 1GZVA 3FKJA 4RZHA 1TQ6A 3ZW9A 2ZRJA 4MQFA 4J1QA 4WUTA 1C30B 4G4SP 1DT5A 1TKBA 4PGMA 4U00A 1C0KA 1DEHA 4JN6B 1UQRA 3NAGA 1R0KA 5JDCC 1WXDA 3JPYA 4HYEA 2XB8A 3AF5A 2C2MA 1FBNA 2JCXA 1GUAA 4NENA 1YQUA 5AW4A 5JBNA 5JWRA 3FNQA 4ZZ1A 1BDBA 7AT1A 4JWKA 4ZTUB 3IQEA 3NRJA 4K9MA 5BWMA 1G1MA 1UC8A 3GV0A 5FL7A 5BSTA 4D81A 4YUXA 1OIWA 4BO8A 4D8UA 5HSGA 3DFUA 3U39A 4EY7A 2P2DA 4G0YA 1IB6A 1NVVR 1ZINA 4V0LA 5T4FA 5BV7A 3IEUA 2GQ0A 2PXXA 2D3TA 4KX5A 3FPFA 3H5OA 4JKYA 1E2MA 2GHQA 4K9QA 2JCYA 3ADKA 2RB5A 3F5QA 4ZCLA 3ZQKA 2SKEA 2HT6A 2PE5A 1F20A 3DMDA 2NU6B 1ZIOA 3BIJA 4C4OA 4R98A 3K1YA 5L45A 1QF6A 3MCUA 4G8CA 4ZQGA 3W34A 4ARAA 4B3SB 5TX7A 1B15A 3N28A 1DZIA 3ESXA 4IUYA 5L6MB 3KXDA 4I81A 1EP3B 1KEEB 1AT1A 3LXRA 2JGDA 4ENTA 3ZWMA 4QIHA 2AXNA 4KYIB 4FZVA 3IB3A 4MVYA 3ZZMA 3SG0A 1RYZA 1S9DA 2B25A 4GYJA 4K8OA 3T12A 2PZAA 2V74B 1FDTA 3GDGA 3GMIA 1NXTA 2NU6A 1R37A 3A2KA 1QV7A 3AF3A 5CGZA 1A04A 1N5JA 2Z83A 1YFKA 2CUKA 1V9SA 3D5QA 5KJ1A 3ZHBA 1T36B 1KJZA 2VOJA 3K1AB 3WMRA 3T5MA 3L84A 2N47A 4K7JA 4XFJA 1KEEA 2O9JA 3ACBA 4F1JA 4BFYA 1EDEA 4OOEA 2RHRA 1U2DA 5TGTA 1NXVA 5DHFA 1C8KA 5HQ3B 4AXBA 3GX1A 1LDNA 2CVFA 1Y42X 1HDOA 2CLDX 4Q6WA 5TMBA 5CP8A 3ZJUA 2ZPTX 5D7NA 1T36A 2XQVA 3Q9SA 2WKQA 4KQEA 4ALNA 3HXKA 4FONA 4BNTA 4JOCA 2XCSB 3TTXA 1N6RA 4OSEA 4UDNA 5BRJA 1N92A 1ARZA 1Y80A 2Q8PA 4IUCS 4OFXA 4C4PA 1ZITA 3UHFA 2JIRA 3AI3A 3IQWA 3IBSA 4DCVA 4X65B 3N0WA 1CR0A 2AQIA 3AESA 4O2LA 1V25A 5ALNA 1YDFA 1K5HA 3DXFA 2C3MA 2J0SA 4XGQA 1MNQA 1T9HA 3C7TA 1A82A 1JQKA 2ZUCA 3T1VA 2IP2A 2JBWA 1J8DA 3C1AA 3LL4A 2ARKA 4X91A 3UCFA 4B0PA 3M6MD 4AT1A 4JA0A 5IUJC 2VYNA 4RXUA 4BP9A 1QFZA 5JEDA 1OH5A 1B23P 4X90A 4OX9B 1DKOA 1M6WA 4M1ZA 5EJ9A 3SYRA 4BOYA 1EESA 2X5NA 2FOIA 4Q15A 1GNQA 3NHKA 1U8CB 4HLUA 1GUDA 3V1NA 2QZ9A 1YIAA 4RK5A 1HQCA 4JCOA 4KBGA 2UDPA 5JLAA 5IAOA 3HCPA 3U37A 3HB5X 2OL4A 4CV1A 3W0LB 1XGKA 3I6YA 3LQ4A 3DF9A 3OX1A 3QY0A 2CFOA 2I87A 1ACMA 5K3EA 1J20A 5TQJA 4DE5A 1NBEA 4NDNE 5U4QA 5LD2C 4R0VA 2H2DA 4OGGA 3V3TA 3V4FA 1W59A 2IC5A 3BMNA 4MKRA 1XALA 2PUJA 2QZZA 1C8LA 1NRJB 4JB3A 2LTAA 1OI2A 3IYLW 4GGMX 2DY1A 3FSEA 4QT0A 3C70A 3ZWPA 4DSOA 2HZ7A 1IBLB 4OBEA 3MVEA 1VJ0A 4K2HA 4H1VA 2MR5A 5IDQA 2NPFA 3O8DA 3G3EA 5GGYA 2RHJA 1ODCA 2IDZA 2ZYUX 5EG5A 2XR1A 4YVFA 2WW8A 2ZI5A 1J1IA 2V9ZA 3DDZX 4W5TA 1UIRA 1AS0A 3ZHRA 1AUOA 4F1KA 3QHAA 2CKMA 1M6NA 2ODPA 1Z5ZA 2DUMA 2P2ZA 3GGOA 3GLQA 3IVXA 3N2KB 3QTTA 1Y63A 1D1SA 3M1AA 3GJ7A 4O0LA 2PZMA 4J0QA 5FWXB 3AJEA 2D3WA 5AKXA 2V5VA 2HWXA 3WRYC 4H7PA 4URYR 3EX7C 2ADFA 3VBCA 1KMQA 3CF0A 3D0RA 5HWSA 3OEWA 4XASA 1SVOA 1B6RA 3B12A 4IJWA 4LYYA 1I4WA 1SRQA 1Q16A 3MCWA 3OCCA 4AF8A 4DNXA 1EZZA 2IPOA 4QDOA 4JYBA 5T41A 3J81k 3PVCA 2XV1A 2RHGB 1QQTA 4H16A 5JPIA 4AUMA 1HE3A 1CZLA 1XHLA 4ZVPA 2BGIA 1H0HA 3TR0A 3LXUX 3S81A 1XVUA 4TMWA 1O8BA 2IKSA 5EE1A 5EWJA 4BVBA 4Z7OB 3T3EA 3V2IA 2F1RA 2BR3A 4ICIA 1SHKA 3DTTA 1U63A 4DCGA 3RSOA 1PBNA 3L0DA 2H4ZA 1QVZA 3D7SA 4MUEA 3RRZA 2ZT5A 2PR2A 4M38A 4R2IA 4KQIA 4DG5A 4E11A 1V3QE 3G02A 1K1EA 2QE6A 5EHXA 3DCJA 2EBUA 3CONA 1XJWA 3UWMA 3VOAA 3ZCTA 4PCLA 4KLAA 1UAGA 1BIFA 4K6MA 2X0DA 3R7DA 3VX3A 4COKA 2W0SA 2F48A 1CFZA 5K3SA 1AQIA 3TEMA 3KXIA 2WJZB 3COSA 4URUR 4J07A 3QOWA 5KINB 2DFNA 3CT6A 2C2ZA 4RMHA 1XDGA 3CLSC 2OP0A 4EJSB 2L17A 3OC0A 5IJZA 1HSOA 3RPEA 5ITWA 8MHTA 2ECOA 1GDTA 4MRPA 1B4DA 4OA8A 3RBVA 3RIGA 4LQLA 4QULA 4AC9A 4QRHA 5FI5A 5I4BA 3DE0X 3HL4A 1SIWA 2HA4A 3VNVA 5CITA 4J2OA 4C76A 4TVKA 1NATA 3GLGE 4KVZA 3S8YA 2VJMB 3D6FA 3R3YA 2JH8A 1SJ9A 3WMWA 3OICA 4XPZA 3TGPA 1XPRA 2IZ5A 3Q9NA 5FUQA 3X1JA 3JZAA 1SGWA 3A27A 4LVNA 4ZAXA 4LSMA 4EX6A 2BFOA 4J94A 4PRYA 1WEKA 3A05A 4LX8A 4E30A 1NFQA 3RJ5A 2VBFA 1QXSA 3LI2A 4Z9YA 3S0JA 2FW9A 4HEA1 2BFFA 4AF6A 4JQZA 5E1DA 4B6FA 4ROTA 4NCBA 4BNVA 3IV6A 2C88A 2H59A 2RKBA 4MIOA 3KTOA 1PR5A 5K3CA 1UODA 1VFPA 2F3PA 4QXMA 3M4ZA 5ALDA 2AOXA 2XGGA 5F3WB 1Z74A 2C82A 1O95D 3TXYA 4MI3A 1B76A 2IVZA 3L4EA 3IVMA 3HJTA 5DM70 4QU9A 4ACAA 4JI3B 2G08A 3F5DA 4Q4DA 3SF8A 2H9YA 2VLBA 3WV4A 1QK3A 3A0UA 4ESOA 2FWIA 5BSWA 3K71B 3MMNA 4OFWA 3HXQA 3UPUA 1HLFA 1XTZA 1Q7RA 5CJ2A 1LBTA 2BFNA 2MOKA 2GZDA 4CTMA 1QCDA 1XU7A 3M2TA 4DADA 1NTRA 3H87A 5DHQA 1DC8A 2QAIA 3TOCA 4MS4B 1CDZA 1CF4A 1GN8A 2G9QA 3OF5A 3SQXA 3BXOA 4FEEA 2PQ0A 2FPRA 2IHTA 2AJTA 4BQIA 1T9GS 3M0EA 3NX4A 1JLMA 1IIRA 3ODPA 2WEKA 4BJHB 5KQLA 3WGYA 3AHIA 3MTDA 4M0KA 4UQPA 1WVMA 1M8PA 2WHXA 3QW4B 4R7ZA 5KNDH 4MS4A 1YC2A 4R83A 4KAXA 5BNFA 3TLGB 1EFAA 1JLLA 3FLBA 6AT1A 2QIOA 3DMTA 2O0JA 2NSJA 3HJNA 3PUKA 4HWOA 5ISMA 3C87A 3ANMA 1D2RA 2P8SA 3AW9A 3O21A 3P4XA 1UDXA 3W3AD 4RD6A 4DIOA 2IVFA 3EULA 4H7DA 4J91A 3WHKA 1BH2A 1IN4A 1DQNA 3CB4A 3E5RA 1NI3A 2A9FA 3F1KA 4I9GA 3WFZA 1HXHA 1AX9A 3OCWA 2IU6A 5DASA 1JLHA 1Z5NA 2BM0A 4M1WA 3E9YA 5LZ4A 3THXA 1GHTA 5ERYA 3PCRB 3TLGA 3TTTA 2JFFA 2X1LA 5CW1A 5B1DA 3DZJA 4D8VA 4L57A 1D4OA 2LWIA 4RHTA 1NYLA 3R8CA 3SIXA 4EVQA 1WETA 3GFOA 4GLOA 4WESA 3OEYA 4UKDA 5K1ZA 1M9NA 5AI8A 1ZCAA 5AJZA 1A2BA 3HYTA 4MO9A 1T15A 2NUTB 3PXXA 3EF1A 4TTTS 4DANA 1FW6A 1N8TA 5F1YA 1L7BA 2QI9C 5JI3E 4GLBA 2IQIA 1A8SA 3FYUC 4JU9A 4YCAA 5FOWA 1DC6A 2CVOA 3RARA 1GG9A 4J0HA 5U1PA 5FA5A 3WLLA 1U3GA 1G3IA 3G8CA 5AI9A 4MV6A 2X14A 4MS1B 2ODWA 2IF0A 3HCOA 1H4VB 4JB0A 4UCWA 2XBMA 4K9PA 1L5SA 3PC8A 2NUTA 2XSZD 3U9LA 3KAKA 4IJMA 4KIJA 1UPBA 5CJPA 4B5KA 4BE7B 3MA0A 2YXPX 1DRUA 4DCTA 3W6ZA 1TXGA 2CXSA 2Y2UA 3CIFA 3S2FA 3RSFA 1WMEA 3R3XA 4HGOA 3BRWD 1XVTA 1A9PA 3NHZA 4M1SA 1TYAE 3IOYA 2UZIR 3VZCA 4EKGA 4L73A 1XCPA 4MS1A 4HDSB 4RPIA 2R8XA 5F73A 5K05A 2WTUA 3IALA 3F74A 4MLPA 1IY9A 3D6HA 2VT3A 4XPIB 3DZGA 3C3DA 2QN6A 2QPTA 4WWHA 1QV6A 3D3QA 4PR0A 4BZZA 1CS0B 1JJ7A 3QOYA 4P7KA 1BKYA 2A0FA 4YROA 4B4UA 2JPDA 1I3OA 4BEJA 4EDFA 1VLZA 4MKXA 4IP0A 4JP3A 3NPAA 3H9UA 1KGDA 2ISCA 2TECE 4U6QA 3TKLA 3AY0A 3SNHA 4EY4A 4DBLC 3ZBTA 1RT9A 4HDSA 3FUUA 4L02A 5E6UA 3VV3A 4V2UA 3D3WA 4M4SA 3E2MA 3S2GA 4XPIA 1OTYA 1DVRA 4RACA 3DCNA 1GOTA 3MCVA 4CDGA 3F4KA 2PZJA 1CS0A 4KTVE 4QPNA 2II6A 5T6MA 3TTWA 1U3UA 2XB6A 5L95A 2OXEA 2OZPA 1VL0A 5H4HA 3KETA 2CW5A 4LGVA 5I48A 3QIVA 4BQNA 2RAPA 2XY4A 3E53A 3CW9A 3KYDA 3PNBA 4JI0B 1WDMA 4EJ6A 1PVOA 1WXXA 1SK8A 3GF4A 4J29A 2JANA 3NTQA 7REQA 2E7ZA 3A1VA 1EXNA 3BE6A 4X1KB 4PNHA 3IT0A 1DADA 2F59A 4NBWA 4R05A 2UUAB 1FP4B 3E8XA 1GNTA 4QNNA 3CXUA 3EY4A 2O5VA 5ICCA 3MG9A 4U7DA 1P3Y1 2H4WA 4KN9S 5AVSA 4Z9FA 2O1XA 2Q7XA 2FW8A 1O95A 2R7MA 4RCYA 2F3UA 3HU5A 1E5DA 1SCUB 4H3HB 4Z86A 2FH5B 3OPXA 4URFA 3TZBA 4HNTA 5AVTA 2BDTA 1N2EA 1NVDA 3F1LA 3H1PA 4X1KA 4BO1A 3FOZA 1BYIA 2A5GA 4Q9HA 1FP4A 1SKQA 2W6JD 6LDHA 1XRMA 3DAFA 3QYPA 4R9NA 3U3RA 4B2PA 1G7CA 1TUIA 2I8AA 2XB9A 4LZOA 1MPTA 2VP0A 4PLHA 2EW1A 5GONA 5BMVA 5JAIA 1AMOA 3T3IA 3B51X 4F2HA 2NTVA 1J2JA 1JKJB 1SCUA 4J6FA 4LGCA 4C78A 4F91B 2NV0A 4X6LA 3TCKA 2JLAA 1HEIA 1DX4A 1P6UA 3WBBA 2SKCA 3AGQA 3I2GA 2HHHB 1PLKA 4GC9A 5JANA 3D59A 2VR1A 3KL2A 4FE7A 5CMLA 2EJUA 5C8YA 4ZI7F 4P7GA 2G36A 4U7WA 2Q5HA 3HYRA 2FZ4A 3SQDA 2BFBB 3QKIA 3RWMB 2C2OA 1SELA 2OLJA 1Q92A 3BGIA 5DULA 2QRGA 3OQOA 1G60A 1I1OA 2I0FA 2QI9F 2X4GA 5JJLA 4A27A 3CZ4A 3W3AA 3I23A 3FLEA 2BMWA 1X8XA 1E9DA 1B0ZA 4CV3A 1S8NA 3DZDA 4BWYA 2A35A 2QTNA 1IVYA 4G3XA 2AYXA 3U3KA 1RWOA 1G20E 5IDYA 2O5EA 2FFHA 1GVHA 3H2SA 3PJRA 4BQFA 2I4MA 1W5FA 1NJ5A 2BFBA 1XTKA 3DFZA 3PPXA 3WYEA 4YNBA 3EC1A 1WR8A 1VPEA 3JWGA 1ICIA 2EFHB 2PGLA 2WJHA 4Y0AA 5KNCD 3OBIA 4GT1A 3A0RB 4M0DA 3OP1A 5ENVA 3U4DA 2P9FA 3AL3A 4F3NA 5I9NA 1ZVVA 2HJGA 2P90A 5H7XA 1IATA 1L6RA 4AURA 4DG9A 2GEDA 3O1HB 3W2EA 3AFIA 2XVZA 4OHFA 3LZ6A 2ZQZA 1FDSA 1R1DA 3NBZC 4QAJA 1GFWA 4Z54A 2Q7OE 3EWSA 5DZSA 3GZ4A 2PMFA 2PIAA 2C5GA 4L08A 4ZALA 2QW8A 5L3SA 4OMUA 1D2CA 3MXOA 3CYFA 3LT5A 1GPLA 1U0HC 1P61B 5EERA 1WPRA 5BQOA 3D5TA 3T7RA 4Q5IA 4W8HA 3MQ2A 2M32A 5AKLA 5LDHA 3ZXUB 4C04A 1UBSB 4CHTA 1WD7A 1G4UR 2EG9A 3NWPA 5B7NA 4XX0B 2YQZA 1ZR2A 2ILTA 2DHDA 2BFCA 2Q5EA 5BY2A 3TIXB 4S2UA 2XSZA 3CBQA 2FMUA 4FLMA 5J2UB 1K6XA 3IR7A 3PGMA 1SPXA 4JP2A 1DLIA 4RD2A 4YFYA 3NTXA 3BUSA 1G4AE 3L02A 2PJZA 3MWDB 3F7TA 1TQDA 3BRWA 4NBVA 1SBYA 3PXEA 3ROZA 4RZUA 3G0HA 5CBPA 3PQFA 4XX0A 3RANA 4DR5B 4ZDWA 3QU7A 2O0HA 3WDSA 4KNWA 1M5TA 4LHWA 1G8JA 3IAS6 4KIFA 1T24A 4D46A 2H51A 2JIQA 3TI9A 1XTBA 4DTCA 3KPYA 4GOND 1YQXA 3DV9A 2PT9A 3GH1A 1ECPA 2B2XA 1GZUA 4HGQA 4QLBA 3CLHA 3UJPA 2I4NA 4A82A 3FH0A 2YHIA 4TYPA 5A7FA 4QGGA 3S6JA 4OXRA 5KDDA 4BNFA 4WNAB 3U7IA 1E9BA 5I8ZA 4LDRA 5T57A 3IHLA 2P3OA 3PCTA 2BRUA 2CZQA 4UUMA 2JLQA 4LMPA 4D9KA 1R4ZA 1QWOA 2HBRA 3QXXA 3BFXA 4WFJA 3SDSA 2CNOA 4XVUA 1N6PA 1WMAA 1FNMA 2H4JA 2HTFA 3MLEA 3THSA 4TVSA 3TYXA 4BNIA 4NARA 2VDRB 5AJUA 5EUCA 4UOZA 1CEYA 4RKEA 4UHCA 1K4YA 4XIYA 1XK6A 3RSLA 3T8YA 2NXEA 4WNAA 2OPBA 10MHA 4EZIA 3KJXA 4B3XA 3KZOA 4R7GA 4BXOB 1GGHA 2JIMA 1VE3A 2ZR9A 4N5LA 3OZDA 4F2GA 1XMQB 3S4YA 3OIFA 4BV8A 2P9EA 3DDOA 2NUBA 2C31A 3TMAA 1Z15A 2AN1A 3BTUA 4IH9A 1VG0B 4KMRA 4XE5A 3NHUA 4Q1EA 5IZCA 3DB1A 2XNCA 4Q19A 1ISHA 1C7RA 1L0BA 5JISA 5KYWB 1IMJA 4JS0A 2G9ZA 4CIDA 4DIKA 4BXOA 4WT7A 5WRFA 4P8RA 2V65A 4TL6A 2YTZA 2OYCA 4BZXA 3OIUA 4QPDA 1NIPA 4HJRA 1Z8FA 3M34A 5FPPA 2JBHA 2WFLB 3O8QB 4GIBA 1IONA 4TLAA 1XD2B 3ZCSA 1KP3A 3KZVA 3WXMA 4YIHA 3TUJC 5B55A 1VKRA 2XJ4A 2CGEA 1RBMA 3I0ZA 3PWTA 1T8YA 2IP4A 4NEGA 4KXUA 4P3XA 4R01A 5TQVA 3I61A 2FMTA 5LJIA 2JFGA 3VC1A 4PSKA 3LLVA 2DKFA 3EHEA 2GBCA 3N2EA 2NTJA 2HXYA 2P7IA 4DXAA 2QSUA 1CZNA 3C3BA 5G3ZA 3G59A 2WFLA 3NHYA 2AX3A 1XD2A 5K8LA 1V1MB 3KEOA 4B2IA 1II8A 3H3XA 3TCXB 2AW5A 1NAIA 1OBOA 5A3RA 4H7EA 2OCKA 3D4OA 3P26A 4JBNA 4DLAA 2I3ZA 3IFSA 2R4TA 3T1HB 2PEZA 3H97A 1WCV1 3WS7A 4L72A 4CL0A 1FFCA 1SHLA 1ZUHA 2X9NA 3EZ9A 3LQKA 4TV9B 1RYFA 1EZ1A 2AEFA 4FXPA 4PN3A 2WHYA 4PZLA 3LWNA 4TT3D 4NMMA 1X7YA 5AKIA 1X1EA 1V1MA 2NU9A 3C43A 4PY2A 3V46A 1RYEA 1RKVA 3IHKA 3ZGLA 4EYGA 2V1UA 3QUBA 5A4JA 3LHFA 1NXOA 2IHNA 5FBWB 1WX1A 3AUXA 4PX3A 3DOHA 3FGPA 4M0FA 4CODB 3CE6A 3ITNA 1AIPA 5EL0A 3QVSA 4HAUA 3VSDA 1E59A 3DV0B 2Q3EA 4TV9A 5EIOA 1JHOA 1K4KA 4WI1A 1Z34A 4G0QA 1EZ4A 1C4WA 4H4CA 3U4GA 2WT4A 4N65A 2Q41A 3LUAA 4I2VA 1IQUA 3WFJA 5PNTA 2RHTA 2R68A 5F1OA 1L5WA 1ST2A 3GT7A 4CR7A 1WZUA 1AUXA 1O7JA 3IA7A 4FSXA 1QYRA 5KOJA 4E07A 5CIWA 3ZE6A 3V97A 3BGVA 2QTVB 1DQSA 5DXAA 5C7YA 2QJFA 1ZJ5A 3I01A 1XUOA 1XHFA 1CLEA 3DV0A 2GBFA 1JHQA 4MO2A 1SKYB 5B7QA 4G0UA 4BVAA 1IXKA 2C0QA 1LF0A 5JXJA 4B1FA 3LA6A 3M49A 4QPPA 2Y05A 1DV2A 2HLDA 4FWBA 1I36A 3HCAA 4JUIA 3E6AA 4MRRA 3EYAA 5IN5A 4QFCA 4Q47A 2GNPA 4UCQA 3D1VA 4E46A 3WHIA 3ZHUA 4JUFA 2PX2A 3EGCA 3TVYA 1IZ0A 2ZR7A 3QEOA 4WACA 4CMKA 3C3YA 1JHYA 2FN4A 4NV0A 3VR4D 4F72A 4H1HA 3TB6A 1SH7A 2W37A 2HBQA 3A37A 1OT5A 3R6WA 4BN5A 2H00A 3L7AA 3MINB 4LKRA 1TLFA 4N1AA 2HGSA 3I6BA 2ZBGA 3C5HA 1FRQA 4EO4A 4MX8A 1Q77A 2AC7A 1JEQB 2P9GA 1VBMA 4DUYB 4OJNA 4EFMA 1SQ0A 3IQXA 1TD1A 3SLGA 1B42A 4LXXA 5FA6A 1DG1G 2LDXA 1MN6A 1N6NA 2WAYA 2Y1GA 3PDUA 1TX4B 4KO1S 5F2EA 5E38A 4HN9A 2A92A 3WYCA 4C3ZA 5JD5A 5CB4F 1YNOA 2HLPA 2GM4A 2BM8A 1T0UA 2JLSA 3D6MA 2JARA 3B5EA 3ISJA 1M1XB 2BH9A 2WTEA 4GI2A 4B3DA 1JEQA 2EX1A 3Q4GA 2NO4A 4K5QA 4ZO4A 3TWOA 2TMDA 4PZCA 3F6SA 1Q2XA 2XUHA 4FS8A 5L4NA 5KPJA 3GEPA 3L6CA 2YJ5A 5K99A 1IHXA 3LXXA 4QYIB 3GEDA 5JMOA 3DBLB 1S1MA 1IN1A 5CYFA 4BB9A 5JSQA 1Z2NX 2V7QD 2J3EA 3A1TA 2GJ8A 1IPHA 1TLTA 3NV9A 3FF4A 4QFBA 3RTBA 4AJOA 5FBVB 4ZOLF 5E7QA 5JSZB 1EDBA 3R0ZA 5LMZA 3Q5GA 1KOGA 2VVTA 3OP4A 2WG0A 4BVKA 4LHSA 1I4TD 5AM4A 1GEGA 2RGDA 4QYIA 4PX5A 4YJ3F 5F21A 3DBLA 2O0MA 3OD1A 4PICA 4U7HA 1X7WB 2ZU6A 3GGGA 1GRQA 2FSPA 2CDCA 1CB0A 3BBPA 3G5LA 2K4MA 3IP7A 2D7JA 1L8XA 2JKZA 3B9QA 1NYTA 3EXFB 3KBBA 3RI3A 4JP1A 1EVLA 2GKOA 4RQAA 1FLDA 1S4MA 2QG9A 2JIZD 2TRSB 4ZCPA 4CLRB 5JSZA 4DV7B 3LQRA 2NZWA 3CLRD 4PLWA 3AVUA 3LMKA 5ALUA 4CIXA 3MJVA 5ENDA 2PYIA 4R3UC 3TNFA 2PKQP 3BCUA 4WEQA 4F9EA 4LJ5A 4KWEA 5JRJA 3GNSA 2UUOA 2IW3A 1VE9A 1UDAA 4G0XA 4HEJA 4B4OA 4LI3X 5K5EA 1X7WA 3QKRA 4C7OA 2Q5QA 4V0ME 2QN2A 2VI5A 3IGFA 2V58A 3FRJA 3LVBA 3HDGA 4GWLA 3VV2A 4Z8XA 3KQKA 3STVA 3MPUA 3R24A 5AICA 3O84A 1U4SA 2HY7A 1FJGB 4C5AA 1XRNA 2VQ6A 4IG9A 2XLCA 4FZ3A 4CI0B 3KLOA 1NSYA 1QHNA 4FJ0A 5BN5A 16PKA 1Z4NA 2FWAA 5LZ7A 5ECDA 1KAEA 2CSUA 4P4GA 5FPSA 4REQB 4ITRC 3IDAA 1Q57A 1SQ5A 2NW6A 2CZCA 3TIVA 1MMFB 3K0FB 2WWIA 3TLZA 1QIHA 1QOZA 1WV0A 1TGVA 4DC1A 2WUWE 3PQ3A 3W5AA 4TWRA 1VJRA 4IFBA 4TTAA 1AURA 1EXMA 1UXJA 1B2RA 4LVUA 4TT3A 3NHJA 3TRHA 1YZUA 2FF5A 2IV2X 3TRDA 2J3IA 4X97A 4M22A 3RS2A 3LCUA 1EKXA 1X0VA 4GMKA 4OBBA 3LUFA 3P9YA 1EVYA 3H2GA 4REQA 2QD2A 1EX7A 2BBOA 2B36A 4NFYA 1X1RA 4RLSA 1RJGA 3OX2A 1KPGA 4G0MA 4DDVA 2X5KO 5LP1A 2E37A 3HCEA 4O8ZA 4V03A 3A6HA 3O1LA 3D8SA 5JPDA 1AXRA 1VJTA 2X7JA 3L7JA 5D51S 3PUIA 4DM3A 2P4SA 2D0PB 1JTFA 3R9XB 2Y77A 3H1EA 3WMFA 2X4IA 4MJ3A 4PS1A 4RDHA 1KARA 3EVFA 2HF9A 2A0XA 2QM8A 1CQJB 8OHMA 1Z2OX 2DWCA 1MTOA 3RK4A 1H1LB 5EXEA 1YFJA 1QKKA 5LYJB 3GA7A 1L4UA 2A5DA 3Q10A 5DBIA 1YXMA 2QYSA 1XEWX 4FD3A 4RHUA 5K0NA 2C4NA 2J9ZB 4W9NC 1Z6XA 1U8UA 4WASA 1RAEA 1N5RA 4NK5A 3UMFA 3R9XA 4M1OA 4RIEA 2FX5A 4RKYA 2OXRA 5E9WA 1Y7PA 3H2HA 1CQJA 3LQFA 4PYRA 1XF9A 2O1WA 4W4TA 3GFQA 1WB5A 3I64A 1I14A 2WJVA 3TE6A 4HATA 3K0BA 3X0DA 4B33A 2XE4A 4MR8A 3WGHA 3WK5A 1QYVA 3IUMA 2H6EA 3HCFA 3KXKA 4HMQA 4JKOA 3SHFA 5CB8A 1E1LA 4KQKA 3QKTA 3ZUGA 4CT5A 3VR4A 1RRVA 1O4VA 1V11A 1CJTC 2ZI9A 3BTVA 3ZTTA 2QBYB 4XARA 3G8DA 3S8MA 5JMTA 1GTJ1 1LU9A 3GDFA 3IAM1 5FO0A 1PJ3A 3UK2A 2CF5A 2CE7A 2P11A 4LOJA 1E61A 4MVJP 4ZCQA 3WI7A 1CE8A 5FA8A 3QZUA 1NGSA 1ZPDA 3K30A 4W5JA 5TQ0B 3NTRA 1FRZA 4GMGA 5D5PA 3QE4A 3G9QA 9LDTA 1AUQA 1JQ5A 1WNTA 1JIVA 2MJLA 1W85B 2MT9A 3H1GA 4MVJE 5FTWA 3WG9A 5GIPE 2QBYA 3L82B 4MPTA 3E0QA 1ID8A 4CMAA 4BEVA 3THYB 1YASA 2C57A 3FWZA 2EERA 4KRGA 4Z4IA 3I52A 3AHHA 3B89A 2QDKA 3KJQA 3JASB 4L15A 5HP4A 2BDEA 1JI3A 1E58A 1P1IA 3MQ4A 5TQ0A 4IIYA 3LX5A 1JKMA 2VQFB 3P9PA 4KIGA 4KRXA 2DBZA 3WHLA 4LYFA 4WVFA 1P9WA 5BQ3A 1P1RA 1W85A 4F9FA 1G6Q1 1GQFA 1EGVB 2PR7A 3B78A 2IODA 4MHOA 4PANA 4UEKA 2V7QA 2QNRA 2VDJA 1PS9A 5EEGA 3T3PB 1JXMA 3LX6A 2GCOB 1YH3A 1Y4AE 2A1UB 4KBFA 1TADA 1Y4UA 2ZROA 5AKHA 2LW7A 3O7WA 4L5AA 4DDTA 4JNCA 2VTBB 5JNWA 4H1TA 3PIDA 4C0SA 1C1YA 3HZOA 1GPNA 4D97A 5BWCA 3TSYA 3KUKA 4MJ7A 5B4TA 2PLNA 2JLZA 1Q3KA 1Z88A 3ORFA 3WDMA 2XDYA 4PO3X 1ESDA 3AIOA 3IP5A 4PC2A 2GCOA 2ZYRA 4EG0A 1YL5A 1CS4C 2A1UA 2JIZA 3NOVA 1G17A 4P53A 5TF4A 4YUWA 4EG1A 5IWAB 1LH0A 1TF7A 2PSHA 2QTFA 3L06A 3TFOA 1J4AA 4IBOA 4QYMA 1TT5B 2X2FA 2C20A 3V8BA 1MNAA 4LF6B 1QORA 2B92A 2PRJA 4ITVA 3FPEA 4S1PA 2ONJA 1B1CA 4TLEA 4ARIA 2BTEA 4RQTA 1F0NA 1CDEA 1PDVA 2V9PA 1LPMA 2X8WA 1UBRS 5IAAA 5J58A 2OD9A 3K9NA 3KKNA 4F4CA 3BZWA 1PT8A 3MGAA 5L8VA 4RORA 1TT5A 4JUDX 4C1BA 1G2QA 1PD0A 2R66A 2OCPA 2FPOA 2I78A 3BAZA 4JR1A 5TT0A 5A2QA 2VRNA 2OENG 3OZUA 1P2UA 5JJCA 4GL2A 2CXRA 2WZQA 4CWAA 1LI4A 1PJAA 3GG2A 3DHWC 2QLBA 1ZICA 5KYUA 4RTQA 1E92A 3FTFA 2DWUA 1QIKA 3KZXA 4I6GA 2EVWX 1GQRA 1A8QA 1L3IA 3NYQA 4PR3A 1DB3A 4W7IA 3TPCA 4DREA 5BSUA 2V6IA 3Q9LA 1V45E 2I3BA 4L8GA 4FB4A 3D31A 2QN3A 3AJRA 3CKLA 3WJ7A 4ATNA 5HKKD 1HE1C 1E6KA 5G0WA 2ZJ2A 2XF2A 5JZ9A 5H9WA 2NXJA 2GPJA 4DVJA 4XUCA 1HZJA 2FCRA 1U1FA 1V3TA 1Z7GA 5K3OA 3QFSA 3CBGA 3ZD7A 2O2GA 4PAGA 2BYTA 3B20A 2OGWA 3R3JA 4ND3A 5K8JB 1SU7A 2I7XA 1KZHA 1JKXA 4AMZA 1JPVA 2HRCA 2E4UA 2FXIA 1WMSA 2I8LA 3R6GA 1C1DB 3RT9A 5AW1A 3RIHA 2HI0A 3WB9A 2JA1A 1JB1A 1C1HA 1JDJA 4EVIA 3D2LA 1O54A 3TNDA 1H9AA 3MWLA 3EQ8A 3MTIA 3RVNA 4KUHA 2OFOA 1XIVA 1Z06A 3EIUA 1IN8A 4QHSA 4P3OA 3F5SA 4X0EA 1PJSA 3R0XA 2H54A 4YDSA 5JDCA 5AI5A 1LRLA 3IBTA 1C1DA 5D1NA 1QPGA 1Z28A 1JJVA 3EDRA 3TJMA 3ESQA 3REQA 2OSVA 4R69A 2H11A 3WL6A 3GXOA 3I8SA 1DPFA 2IV3A 1FRVA 4IQFA 4JGGA 2BGKA 3IPYA 5BSFA 1HQKA 1MABA 4OHKA 3O2JA 3PHHA 4GZ5A 4CKBB 4DA0A 5EHZA 4OAQA 1IBCA 1X13A 2XYHA 3DT8A 3O83A 4AY5A 2FPWA 1QMGA 2IYPA 1Z12A 4GGOA 3KHTA 3FSGD 2V7BA 4EGCB 3S40A 3QXHA 5IM5A 4DKXA 5DNYB 5JALA 2IJGX 5AM0A 1DG3A 2RD2A 1YDWA 3MLBA 4NCJA 1I4OA 5H82A 3SKXA 3LUJA 2CCJA 5JTTA 1PYOA 2O8NA 3GPBA 5TE9A 3OECA 1TB4A 4KQJA 4OLJA 2NSHA 3LYAA 4OAPA 5FAKA 2OLKA 4IXWA 1VE1A 3CNBA 1GGVA 3CLSD 1SXGA 3I32A 4TLLB 1KI7A 1Z0IA 2J9FB 1H2FA 2P5YA 5F1KA 2O8CA 3T1QA 2J32A 1ZISA 2BGLA 3L7LA 3OE1A 2ZI6A 4OMDA 3ZU6A 3C1OA 2JEYA 1H5NA 3O4JA 3ZW8A 1N5DA 3AHJA 3LAWA 2W2QA 2O3QA 4R1PA 1F3OA 3OLCX 4WTOA 2CD7A 4U2BA 4C2AA 1TC2A 2V6GA 1NW9B 1E9VA 3E15A 5EHGA 4Q4AB 2ADMA 2QTAA 3KG2A 4FGLA 1UZUA 3M4NA 4WOPA 1HC7A 3ZNNA 3D8HA 4BQQA 2H63A 1K6MA 5DYTA 2J9FA 4MDFA 3VYVA 3CX4A 3DAPA 4LGYA 4GRDA 3VYRB 5JCPA 1K7SN 2AG0A 2DWPA 4MPJA 3W9UA 4CDNA 4IGFA 4EDHA 3V4RA 4EP1A 5FNVF 4RTRA 4AZWA 1LC3A 2L2QA 2FOXA 2UXBB 1JS1X 4B5LA 1JW9B 3D4PA 1BS1A 2QW1A 1E7RA 4LCJA 3NCTA 1E6WA 2QMHA 1LSJA 4OQXA 2D1TA 1ONNA 3OHSX 4E0BA 5K8VA 1DEAA 4K88A 4B43A 3CGWA 1NKVA 3H83A 1RPNA 4URWR 2EFGA 2TYSB 5KVQA 3HA5A 3GLRA 2XNDD 1FUEA 1GPJA 4PVDA 3GP8A 2IZOA 2V8OA 1ZKMA 4K3VA 4OO3A 2I6XA 1U0TA 2I76A 4Q37A 1W19A 3O1IC 1MX3A 4C21A 4HH1A 4WCFC 1P2SA 5LD2B 3RC3A 1OXMA 3GRFA 4RLHA 4XCXA 5NLLA 2OKCA 1BVHA 1ND6A 4EI9A 1WABA 5CLHA 2IUFA 2I9PA 4DL9A 5BSHA 1C3VA 2VUTA 4MIYA 4AKEA 1NC3A 2I99A 4KMSA 3VOTA 2NSYA 5CLQA 1OY1A 3N05A 4EB6B 4FMPA 1VQ1A 1XMSA 4Z3DA 1ANKA 2RJNA 3PGLA 1YL7A 1TK3A 2MSDB 2TSYB 3HK2A 4CM9D 1R0SA 3T9FA 4LMBA 1Y8QB 4C0KA 3SX4A 1KEUA 3H86A 3NATA 4L1KA 1XL1A 3T15A 3U4QA 5CHEA 4JH0A 3BFKA 3P9KA 5HKKA 5EZQA 4WK4B 4AJ1A 2ONKA 1EE9A 3BMXA 4N5HX 4HZUB 5BURA 3ZLUA 3OUUA 4JMLA 1NQ5A 3RVSA 1SB9A 4W6ZA 2G82A 4ER3A 1MB4A 4HB4A 3KOXA 5G0TA 4ZMSA 5KNLA 4UARA 2BGRA 3EIXA 3HSYA 4HCJA 4XR4A 3R0VA 2JLXA 2EFDB 1QFXA 1H0SA 1JQ3A 3ZVNA 3FCAA 4OM7A 9GPBA 2WOJA 1J9ZA 1A9RA 1YF3A 3QGMA 3DMGA 2J3HA 3PC2A 3TVDA 5KTPA 1P74A 4Q9DA 1RKQA 4YK7A 3SKVA 4R2LA 3HY6A 3WRYA 3M33A 3LPMA 5KYXB 3CR8A 1WTAA 3NGMA 3LKZA 1PCXA 1AQJA 4Q48A 5A3QA 4UM9D 4V02A 4JQOA 1XTRA 3TPZA 4LQDA 3D2BA 5KQSA 1IZ9A 4P6VF 2Y0PA 5JSHA 1ZD1A 2VZ9A 2W2KA 1DC3A 2CFTA 1CQIB 4ZPXA 2AFHA 1OASA 1M6HA 2YFQA 3ITKA 1MR3F 3TUZC 3C8UA 3KSUA 5ER9A 3OZ7A 5KYXA 1XJQA 2PT5A 4QJBA 2P6NA 3E7FA 1E0SA 1Z33A 3T35A 1UADA 2WJGA 3DEJA 5C7OO 5BR8B 1CWUA 1TAGA 1YE3A 2CZGA 2ON6A 1P0CA 1MDFA 1GZ3A 1U3TA 3ANYB 3FSGA 3FZNA 5JY6A 3AC0A 1CQIA 1ZVQA 2FWJA 2R6JA 3QH4A 4MSUA 2C00A 3V8RA 2PBLA 5HZGA 4L3WA 1ADCA 2GK7A 2K6GA 3NRCA 5IU6A 3A10A 3E9QA 2F4VB 1YR7A 2J4CA 1XXHE 2L69A 2WIKA 4LDQA 1Q14A 3ONEA 3SZ3A 2X15A 2XE7A 3VOSA 4W9RA 5ECGC 2HRBA 5AK4A 2GVNA 2FR8C 3KCNA 3EC2A 3UAZA 5DK4A 5CDTA 3FW1A 1YA4A 1ZEMA 2B4KA 2W83A 5I8WA 2PKCA 4LSWA 2PUDA 3A6KA 4XM0A 2C1EA 3KAQA 4HAVA 4P34A 4AUEA 2C4UA 3WJ2A 4KXNA 4OXKA 3R4VA 5JZSA 2TMGA 5FBZA 2X0JA 4RF5A 5DYGA 3S28A 3MJDA 3R23A 5IW8A 4D3ZA 1EVKA 2EEZA 4WSOA 5JNLA 5K2OA 3RRJA 4B35A 4OSPA 2HWUA 1KRXA 4QUHA 2NZXA 4BIMA 4D4MA 1Y1PA 1KTIA 3A8TA 1OF1A 4JX8A 1P0IA 3ASYA 3JVVA 4D74A 3ZWWA 3QBDA 4ZCIA 4NNOA 4QGHA 5LNK6 1XU4A 4G63A 1XDDA 5HCNA 1QIMA 5A3JA 3BE4A 2UZ0A 4WOJA 3KZKA 4ZREA 2OGUA 4YMGA 3EFEA 1M10A 2OHVA 2VYVD 4MWZA 5EIFA 5BMOA 1NIJA 3UJ3X 3WADA 1ECLA 2Z43A 3DBRB 1U0BB 2FW7A 1ISSA 4HTAA 1SHUX 4XAQA 3TK1A 2R11A 3SM3A 5DLPA 1IIBA 3IRVA 5LBUA 2I2FA 1BHJA 3RRXA 3PQ7A 1AK1A 2FPKA 4PZYA 3GUYA 3IIMA 3RTEA 4IYRA 3UB2A 2X4DA 4LHXA 3F71A 5CXUA 2HQOA 4O5OA 5HX7A 4PGHA 1Z6YA 4UJ5A 5A4AA 2OVFA 5CVVA 3F97A 3KSBC 4NE9A 4LY3A 3DBRA 3LVFO 3EGEA 4NBRA 2GTPA 5DGCA 4QKQA 3B1XA 5A0FA 3FPCA 3MD9A 1Q0UA 2VF4X 5ED4A 3F6RA 1ZWLA 1I1HA 1FYDA 5AJVB 1PFGA 3DZCA 4MCJA 2HMSA 2NQ8A 2XYPA 2QLFA 1Z08A 5A5FA 5JJKA 4UHJA 3DXXA 4IF4A 2I9KA 1YB5A 4M54A 4YP5A 1Q7GA 2HCTA 2YFHA 3QMMA 4JENA 4GNRA 4OBWA 1Y48E 1Y3BE 3T7DA 4BO3A 1GAQA 4FHGA 3E70C 1M2WA 3RQSA 5D3MB 5FH9A 3CVWA 1QDUA 1RP1A 1U90A 4KWHA 2C8VA 2IUYA 4KWTA 3BXXA 2DE0X 2P2YA 3IJEB 4CM9A 1WU7A 4LY9A 4LCBA 2NZ2A 4ITUA 2CJPA 3PXAA 5ALWA 4A2CA 2Q5LA 1F2VA 1TQ2A 5ALYA 2JLVA 1ACJA 1KY5A 5L7WA 2I4IA 2V7XA 4B34A 2JFOA 3COPA 3P71T 1VXOA 3DPSA 4G9EA 1JXQA 1B00A 3HWSA 1G8GA 3VZQA 3O8RA 3IAFA 2VLIA 5IM4A 4DSAA 1VE7A 3GD7A 3LLCA 3SVZA 4IIUA 1P7VA 1ZD3A 3IHTA 1IQ0A 4CKWB 2Q46A 1KDTA 3SC2A 4NAHA 5JVDF 3W7BA 5AI0A 2OO3A 2XHZA 3AF0A 4KUEA 4UM9B 3QWFA 3OF2A 4UASA 1DOAA 2YDXA 4IEIA 4JLJA 3CF4A 3ROPA 1V3UA 3NTVA 4AKGA 3FYUB 1YZQA 1N0IA 2G5PA 2HSDA 2J33A 2O2XA 3DVRX 4ADSG 1V39A 3NO4A 5C4MA 2C9YA 2GERA 4X00A 2REQA 4LV6A 1EFTA 2JAWA 2O5RA 1W1IA 1XU9A 2HRQA 3A4LA 3L0PA 3LD9A 1EPUA 4UE3S 3CJQA 4E2WA 2P9YA 3QVJA 4F3RA 1UDBA 1VLQA 1D0SA 2Y9PB 1WCXA 5FT9A 3BE8A 4U8HA 2ZRCA 1BYUA 2CXPA 1Q84A 3FYUA 4NZPA 1HTTA 2XXJA 4X1YA 1RE1A 3NB0A 3ZLVA 4BJ6A 2IHYA 4HQOA 2PMEA 3ZGXA 1R8JA 1J39A 2R62A 3P32A 3ZE8A 2G6TA 4BFUA 2CLKB 3U60B 1HF3A 2EP8A 3QVTA 4GW3A 2PVSA 4RFLA 2OCXA 1U4NA 3PFNA 4MHSA 3I6QA 2HWWA 3SSMA 5AO9A 4AL4A 3DXZA 5F5XA 1TQ4A 5KX5F 2YN2A 2XF8A 2PX0A 3PCXA 4Q4HB 3WGTA 2QD3A 5EJGA 2NP6A 4DQUA 1I2AA 2OCGA 2E4ZA 4EO7A 1P4GA 3PE6A 1GL3A 2EJCA 4QPZA 4S1OA 4UUBA 2R1TB 3IQGX 5COQA 3X1WA 5AW8A 4X94A 1U0SY 1KK1A 3PK0A 3ZQ6A 1S96A 3IXLA 4EUFA 1RQLA 5HUQA 2FWMX 3OD5A 1R7RA 2REBA 1IC6A 1TKCA 2DLDA 4RD3A 4Q4HA 3VU9B 4BNUA 2WHQA 2BKLA 4FCVA 1N6HA 3IBYA 3FOAA 3O92A 2AC2A 3EW7A 4JUAA 4UULA 1UPFA 5A5VA 3DDNA 5B58T 2GA9A 3R74A 1U0NA 5CDFE 1R9NA 1FTSA 4S1NA 2DKNA 2CDNA 3B2NA 3ANXA 3L8YA 3OTHA 1F6BA 3E1GA 3URKA 4QUJA 1PAUA 1BCSB 1Z5UA 1T5DX 3VU9A 4ESHA 5BT9A 4PO9A 3W1VA 2LIPA 2YVUA 3K4PA 4DSUA 4D44A 3ORQA 4Z0HO 1L5QA 2B5VA 4N6OA 3SOPA 3NYRA 4YRNA 3JYQA 5EUQB 4QVGA 4DJTA 3EZGA 2WWFA 4J0CA 3R7BA 2Y4OA 2VYVA 4PAWA 4ECAA 1VCHA 2PV0A 4KO2S 1LNQA 2P0YA 2BCEA 2GK4A 5J2TF 3ZHXA 5J47A 4KJXA 2CLEB 1JIQA 1KJIA 1R6BX 1BCSA 1PGQA 1Z0JA 1XTIA 2HADA 2IGBA 2V4MA 1NLMA 3ZZNA 4MUIA 5F98A 3IMKA 3DYBA 1T5LA 1L5VA 1T43A 1R64A 4L6AA 3ICVA 3UW1A 5BR7A 4B75A 4RK6A 3GT0A 5IXJA 1GSHA 2QW0X 3QEJA 3V6MA 1A95A 3R0QA 3QELB 5EZ5A 3SE0A 4BB0A 2GEUA 3L0CA 4RTSA 5EVCA 5HTKA 1K3TA 1XZQA 1NF9A 4RA6B 1ORIA 2AFIB 3G2QA 3G2PA 3W5SA 2AT1A 4C08A 1L1EA 4BB5A 3W5DA 2VAXA 3NMUF 5TF0A 3ND7A 4ZZ2A 4FNMA 4BX0A 1M75A 3AY6A 3KWLA 3PKIA 3FNRA 4JDPA 2R1ZA 3QELA 3PJFA 3RNLA 4DMHA 1LQTA 2P7HA 4UCXA 1B74A 3RHTA 1KAQA 3CEMA 3H0EA 2JFPA 4RA6A 4U39A 4F4JA 3FNGA 3U40A 3JWHA 4BPRA 1B2LA 3AUAA 3T5BA 3B48A 2HZBA 3HMKA 4D9JA 5I47A 2QR5A 5BNZA 4D5GA 1CJCA 1U65A 4NU0A 1CD5A 1YCGA 1FP1D 4Z99A 2OA0A 1JIXA 1QCZA 1D7OA 3DE2X 2IWRA 4RM3A 3SEAA 4ZVQA 4ANFA 4B7AA 4JB8A 4JP5A 4QTUB 4Y67A 4AM8A 2ZJZA 4DR6B 3OE7A 2OB1A 5C1DA 4EKIA 1DCFA 3PPWA 4ZVNA 1J70A 4YV2A 1T5HX 1EVIA 3ER8A 2DC1A 3HCBA 1OLUA 3HP1A 3J7TA 4Q82A 4YV7A 1FNBA 3SZUA 3AZPA 1N0WA 4BGVA 2YINC 3PI7A 4JJZA 2PPVA 4MS3B 4OXYA 4NCNA 4OEHA 2HPHA 4PZDA 3QPWA 1GTRA 5HF9A 3UMCA 3LVQE 4O5AA 5HS4A 7YASA 3NJ4A 2QUAA 4IICA 3VKFA 4EQZA 1ZI9A 2NN3C 1ABEA 4NBUA 3KKOA 1CEQA 4FILA 2HA5A 4CKWA 4LIPD 2HM7A 3JWPA 4GOMD 5CT6A 3EWIA 4WLVA 5IPFA 3OTOB 3B60A 5DOZA 1FXUA 4C4XA 3EHDA 1G38A 2GLTA 4MS3A 1I3MA 3EG9B 1TJYA 1GG8A 2ZGVA 3L1HA 4O33A 5KI6A 4DMCA 3L93A 3ZH9B 4DMLA 4GPTA 1E2UA 5F9FA 3I01M 4KJZA 3FVQA 1E6CA 2VXOA 2ZIFA 2BBWA 3TINA 4PSUA 1XNGA 3B85A 2ZCJA 1EXDA 4AN0A 3ZKWA 2CWWA 4OMCA 4WY8A 2RIPA 1PWEA 2EF0A 3UPDA 3STYA 3DLBA 2VEOA 3JD0A 2F8SA 4DRXB 4E4TA 1RBQA 4ZZ0A 1OGIA 2ZIWB 3VC3A 3TZHA 5IXSA 1G3UA 1GITA 3DQZA 4L8YA 3A9CA 8ATCA 5GOZA 3OOEA 1LSUA 3SE7A 3MYYA 4G5OA 4B8WA 3HBJA 3HN6A 4WRRA 4EI7A 3AHDA 1K5GA 2ICAA 1V47A 1MXFA 2P65A 1UT6A 2WNSA 1RCFA 3FRIA 3WGUA 3GLHE 5K51A 3B1FA 2Z3ZA 1IVNA 1P0QA 4Z7NB 1FTWA 2HUPA 2J5BA 2OGSA 3EIHA 4CLDA 1RYYA 4DRXA 1XZGA 4K3UA 2IK8A 2RC5A 4Y9DA 4BGIA 3PX3A 2YS6A 3AIKA 4I4TB 2ERYA 3IBCA 3CEJA 1BE6A 3F3KA 2BONA 2VTEA 4ZWNA 3C6QA 3UQYS 3EMDA 1R3DA 3HBFA 4HNHA 3CSDA 3TGLA 4CT0A 1WKBA 5H0IA 2X0IA 5L3QA 4Q4JB 2NX2A 2NAPA 5HOQA 4CEIB 3MCZA 1GPDG 1FNCA 1PZMA 1PZFA 1JHZA 3RB8A 3FIJA 4L8WB 1N2JA 4US2R 4U9IS 2IOFK 1J21A 4LXQA 4M21A 1GFIA 4IQGA 1EK2A 3G1TA 4P36A 4P4UA 4UC0A 3OCUA 3T7IA 3U3MA 2XE8A 2JEOA 2YOFA 2G7ZA 1IZZA 1ORTA 2QT9A 2OOSA 1LJ8A 1GA1A 4AZVA 3AH8A 3G6WA 4DCOA 1NXXA 5DPMA 1MJNA 3MTBA 4Q4JA 3P0IA 1G8YA 1DP4A 2R3SA 1XMJA 5JAOA 4W6QA 3MNFA 4Y1FA 1ML4A 1XCGB 1SRRA 3OWOA 4IM7A 5MDHA 5CFOA 5HRAA 1U81A 3WAGA 3BGSA 4ZFNA 1KSHA 2GJAA 4GECA 1FQWA 5TS3A 5K01A 1EIZA 1ESZA 1EFCA 1TU4A 4XH9B 5KQGA 1R6TA 3ZX5A 4QJ4A 1VC2A 4WK2B 1N5LA 1UOEA 1SZPA 2F43A 5A5DA 3S55A 3EEBA 1LPSA 4MARA 5GM1A 1DKQA 1VPVA 4GBMA 1YU6A 2IXBA 2W0MA 4BQSA 4N4AA 2A3NA 5REQB 5JU6A 3I30X 3KVRA 1NV8A 1KAHA 2C3UA 1HYQA 2AE1A 1IUPA 5H3CA 2O1SA 1PUIA 3EODA 3K6SB 1SWWA 4QREA 2YMMA 3GLFE 3U26A 2XTMA 4M0LA 2VBGA 3RIEA 3DEHA 5EJ6A 1WA5A 2BEVA 4F6RB 1AKMA 1G2IA 2VH1A 3KJFA 2BTOA 3D7RA 1YBFA 2R85A 3EH2A 3A2NA 2CLIB 3IP8A 5FL3A 1CUBA 1DHRA 4G5RA 2M6KA 4AMYA 2X41A 5BXYA 4NZOA 5REQA 4FTWA 3WZLA 2FSGA 5DW0A 1N4DA 2P4UA 4ZOLA 5JR3A 4IXMA 2OWDA 4DCCA 3ILVA 3JQ8B 3G7SA 2VIIA 2QRVB 4PHFA 1E2LA 1JYEA 2EGUA 2PAAA 3DTNA 3ONNA 3AZOA 4P2BA 4TXHA 3ZLJA 4YJ3A 5F9HA 1PQ4A 4J3FA 3ZHQA 2BF7A 1C9MA 2QVCA 2XT0A 4R1UA 1E3DA 1L5MA 1RLUA 3CWCA 4GKJB 2EAUA 3L01A 3V33A 3I9FA 2P9TA 3IEMA 3QUQA 3EDCA 2B98A 3R7WA 2CJFA 3TGWA 4RKWA 5LA6F 4HRVA 4HWTA 1BHSA 4GLLA 3U0VA 3AV3A 4KPYA 3NIDB 3FBWA 2K7ZA 4ILKA 4UNQA 1L8LA 1NMSA 3HJUA 4M36A 1FSSA 3KVYA 5E1BA 2UYGA 1JR6A 2V9CA 1OXBB 3EXHC 1XP8A 2FUG6 3UXHA 2PGOA 1HY3A 1IY8A 5ALQA 1V1JA 3B38A 5HUHA 1DBQA 4MUJA 5FBHA 4JI6B 2CVHA 1C4KA 1JECA 1EGQA 1RM5A 4G1FA 5LPNA 1UKVY 3QBJA 2C98A 2QJOA 4TL7A 4MYSA 1JMKC 3ZOKA 3W05A 1KI4A 2R6AA 5FPQA 3VYTB 4GPAA 1LK0A 1J49A 4P4SB 1LXCA 1WNFA 1W1WA 4A2QA 1J8MF 4IY1A 2XRFA 2GT1A 4I4CA 4R6WA 4TWZA 5E4YA 3O4IA 4JFRA 4P0PB 2FX2A 1CZOA 4N5MA 3C6XA 3FYSA 4QOFA 3ROXA 3WBKA 3WYGA 4B83A 3AEQA 3PXCX 4GM1A 4O2BB 3K0HA 3DZKA 1SXHA 5CM2Z 4HNQA 2C94A 3D2CA 3ADPA 3SEZA 1Q3TA 1NNI1 2CFSA 4C4SA 1AV7A 4TWBA 3ZN2A 3BD9A 4PYKA 2FMKA 4TTSA 3HEBA 3KTFA 2CVZA 3K20A 4G4SO 4RFSB 2WSYB 3FSRA 4MYUA 3Q8MA 2A9KA 5EKSA 4XUGB 4X24A 4U7PB 4O2BA 3O90A 1SCDA 3EZNA 4XWOA 1PFQA 4PZAA 5FBLB 3FR7A 2B4YA 3Q0EA 2B61A 4GM4A 5D1HA 1EBFA 2Y67A 3KOUA 5KAPA 4ACBA 4P3YA 2JJ2D 2AHRA 1PJZA 5BR1A 2ZITA 2E87A 3FNHA 3N0VA 2C2KA 1T9DA 1Q7BA 2W6PA 5FPHA 3WJAA 5DX8A 5JXGA 3RYIB 4IJKA 1YQDA 4K28A 1PR9A 1J90A 2VSOA 3B6JA 3LG2A 4RFSA 5D87A 1DELA 3MJFA 2ZAMA 3L7NA 3C8DA 2ONZA 4MVJF 4CETA 1VYUA 5SICE 3ZOZA 3HNPA 3A1WA 1K3FA 4V0SA 3H5RA 1MENA 3PGKA 1PZEA 2J09A 2FSHA 2PX3A 3WL5A 2H3HA 1Z0SA 2YOHA 3ZE7A 4IJUA 2A5YB 4JXZA 4MV8A 2P1DA 1OMOA 4HLQB 5A7GA 4XQCA 1M6YA 1Y33E 1R4MA 3FPKA 4M9CA 1BD3A 5BQPA 4E1BA 4NOJA 1JHXA 3GBPA 1XEAA 4ZIRB 4MUKA 2EEPA 3M9XA 3MWKA 4BS9A 4OXIA 2YKGA 5AESA 1EUDA 1QGDA 4KYVA 4Q66C 3I9JA 1RMTA 1Z18A 2JAHA 2ZS8A 4Y2JA 2NSLA 1V16B 1CEEA 3TSWA 2ZP1A 3E7XA 4EGAA 3KKEA 3ZD8A 1F6DA 2H8KA 3NTUA 1MJFA 4O2AF 3VX4A 4LJRA 1LW6E 1PSDA 2IF2A 1USGA 4KBYA 4H7HA 5KCMA 4EB0A 4ZI7A 3Q98A 3ACCA 4B3HA 5C8VA 2KSQA 1IY2A 5TY0A 1FDVA 3S2EA 3LF1A 4HKTA 4ZRMA 3SEFA 1H2WA 3K8YA 1GKUB 5K3AA 3M6LA 2M6SA 4DV0B 3QUSA 3ZHCA 4X71A 4EYOA 4KWCA 1IM2A 1V16A 4LK3A 4Z0PA 4TKUB 2NU8B 4RJTA 4B8YA 1E2PA 1Q1QA 3HGMA 2IYTA 3BICA 2JH9A 4WZAB 2HC9A 3AERA 3HY3A 1H9CA 1GEEA 3KOYA 3Q9UA 3W79A 3W6UA 1UT8A 4FW9A 1SEPA 1N8SA 3AKEA 5KJCA 3IB6A 4R9RA 4UEWA 4GWKA 1K98A 3L0OA 3ICOA 5AQEA 1GGJA 4LWZA 1E79D 1PDOA 4YR7A 4B6GA 4ARUA 1E3LA 2J6IA 4MW7A 1UBOS 1Z0DA 2X9GA 1DX6A 3E23A 3EASA 2JLYA 1DRWA 2ZJ0A 3ECCA 3KUCA 3C3PA 4OHUA 2BSXA 2BN4A 3FFWA 4EPTA 1P60A 4DUGD 5CEJA 2ORIA 5DEIA 4Y9UA 1GA6A 2A0UA 2GN2A 3EEYA 1PJQA 4M37A 4QEZA 4XYMA 3U19A 1DAFA 1NP7A 2JAOA 2R87A 1G5HA 4LWPA 1LLCA 1JDBC 4QEKA 1RQGA 1J7JA 2H2IA 3RKSA 1BTOA 1ZN2A 4HEQA 3O31A 5DYIA 2ZBUA 1NRXA 4GUAA 5JNSA 1II0A 3E8MA 5KU7A 4JL5A 3JD1A 2OECA 2X1MA 3JQ9A 4I8IA 4YEDA 1CUUA 1MZVA 4TTQA 2XUDA 4LK2A 3N2NA 5JC8A 2QR3A 4HWSA 1AD2A 4LNAA 4UEOA 1S6YA 2H4HA 3SAJA 3VPFA 1NMXA 5COBA 3TQRA 2HJVA 4KOEC 4MQ4A 3LRXA 4LS3A 3E9NA 4N54A 2JFXA 2X0RA 3KOZA 2H57A 1C3XA 3TLAA 4MQ6A 1KR2A 3A4VA 1G2PA 2F3TA 4HDMA 3U61B 5BSKA 2VT6A 1N3YA 3MTEA 2F8LA 4JC4A 4KAFA 2OG2A 3SN6A 5CG2A 1DS6A 2YHSA 3K9QO 3LGAA 1BSVA 4MB6A 1YU9A 2PPLA 4L3VA 1W6UA 2HL6A 4F2DA 3Q7IA 4MYRA 4LF5B 1MA3A 4EPVA 1E0DA 4W9NA 1LF5A 4F3YA 2JC3A 3HYCA 2G83A 1QC5B 1YSCA 2BISA 1CQPA 3KO8A 3N53A 4EUKA 2PD6A 2Q2NA 2VP4A 1F14A 4ZEWA 4BMPB 5CFZA 2O8FB 3PGJA 4L7VA 4QG7A 1YDEA 2OZVA 1LI7A 1E1CB 3QF4B 3K4QA 2XMZA 3CPEA 1ZRMA 3D54D 4TXMA 2VDVE 4C20A 5AHXA 1IJFA 2YICA 1W87A 1CIVA 3VPAA 3ZU4A 4X61A 2PX5A 3DZFA 2WT8A 5DGTA 2WR8A 2WNHA 1X8KA 2GJ9A 2JJ2A 2XKKA 1CYDA 3GG9A 1NULA 4KACA 5BN3A 1I2MA 2UVQA 2KS6A 2B1GA 2E4VA 3K0EA 4OI0A 2O8FA 4G4JA 4RESA 5J9FA 1HG1A 4DYHA 3QF4A 1E1CA 3PFGA 4G86A 2AQ8A 1E8DA 2OHOA 2EFJA 2ZUUA 2H1HA 4KP7A 2PRYA 1ES9A 1SVSA 1U0FA 2J7KA 1G8FA 2HAEA 2ZRBA 4KH1A 3FYDA 5J5AA 3VUFA 1ZIPA 4FNOA 1GYRA 1T8UA 1B1AA 1JNXX 1XRQA 2Q28A 1KMIY 3I34X 2Y8EA 1ZW6A 4ZI5A 3W5VA 4ZEMA 3HJRA 2OMKA 2GKGA 4MV4A 4PIPA 4EAAA 3FNBA 4MQ5A 1SU8A 2OKGA 3CJTA 4J0FA 4NZZA 2CLHB 1Z6AA 4RY2A 1D07A 1VRCA 3D7KA 1HDZA 3WC4A 4URHA 2XQKA 4B87A 4HZGA 4BZPA 4DR2B 3CVUA 1QGUB 1KE2A 4JOBA 3LPDA 4DARA 3OWXA 3F7OA 1FVXA 2O8DB 3JQBA 1GNSA 3L1IA 4EUNA 2ZIXB 1E3MA 2GFQA 2YY5A 3ZWVA 4PRKA 2VAMA 4A23A 1JN0A 2PKWA 4BLVA 1RWVA 1HOXA 3MILA 4FQ7A 2VK4A 3OQMA 4L8FA 4X20B 1YL6A 1RHKA 1QHFA 1QGUA 1XZIA 2VXBA 3I3SR 5DXFA 2ESRA 3TR5A 1Q0TA 1K0FA 3U31A 1VI2A 2XDQB 1HT0A 4PLCA 4ARVA 1NP6A 2YBEA 3KJGA 4M88A 2V6MA 3NNDA 3AVWA 2ZIXA 3ECAA 2HCBA 3C74A 4FGSA 4L6CA 3CVJA 1VJ5A 3OOSA 3WISA 4KRFA 1GL7A 4F3TA 3DMPA 1HRDA 3QFRA 1R9MA 4DJAA 4RTOA 4CMEC 4F1WA 3EQ6A 3M3DA 3TQFA 1OVGA 3K6RA 3OJ0A 3UT0A 4HNVA 4HDNB 4Q7JB 3R5KA 3CLUD 2XDQA 1IEWA 3OH8A 4AS2A 5FNVB 4D3XA 3AUKA 1EP9A 2OM2A 1DIRA 2VHEA 1WRBA 4QUDA 4UUAA 3WL3A 2GAJA 1UP7A 1QIFA 2DPHA 1E79A 3EEFA 3P2YA 2GF9A 4RKFA 1WKCA 3WSTA 1Y89A 4AULA 4E4YA 5LZ9A 1E2NA 3K96A 1Y7IA 1KY4A 2V59A 1SWVA 2C2HA 2HXGA 3FMVA 5LQKA 1UWCA 3HBLA 3PF8A 4KV9A 4NCIA 2A59A 3PWSA 4Q9LA 4Z9BA 1Z6GA 4HDNA 3A6JA 3EXG2 4YRJA 1RHQA 3GBVA 4X7MA 5FNVA 4EHHA 3KQNA 4ZYXA 1NJ6A 4V0KA 5FCDA 5G2OA 4FEYA 4BNYA 4DUGA 3BB4A 3ZCUA 2OCYC 2PBRA 4YI3A 4RK4A 2CHEA 4DVGA 1M1ZA 1SUPA 1ENOA 2XA1A 1U28C 3K2EA 4PONA 1N2SA 4IRUB 5MGNA 3WGOA 4X54A 2CHFA 2QUZA 3J81A 1N32B 1D4AA 4XLZA 4BMCA 3VPSA 3UYLA 4LJYA 1RNLA 1JAIA 4JI5B 3ZW7A 1H4SA 1FFYA 3KQYA 3JD4A 4R71A 4UBJA 2EJTA 3C3MA 4NY1A 4WBNF 4DBVO 4CRWB 1RQPA 3X44A 2PN1A 3X1DA 1YMVA 1RWXA 1ILEA 1S8FA 1SNYA 4YMHA 4RTKA 2R8EA 5KMGB 3HA7A 2BDUA 4X84A 3HO8A 2E89A 3SYNA 3UHJA 1UQTA 1ZQ1A 3LP6A 4WN9B 2MMCA 3EPHA 2BAGA 1LW7A 2QTGA 5JATA 2C84A 2WSBA 1FUKA 3PVSA 1Q0ZA 2RCNA 1WXFA 3N0TA 2OYRA 4BQRA 3I04A 3JARB 1T2VA 1TJ5A 3GFGA 4TS9A 2ZSEA 1KE1A 2Z6AA 3LY7A 3KWMA 2RGRA 1LA2A 1OXSC 3HWRA 1TUBB 5DN9A 1PR2A 1CUSA 2AUTA 1AKRA 5KMGA 1ZH0A 2WVAA 3LOPA 3E9EA 4X8HA 3B7WA 5CW2A 2JGLA 4D6YA 1Q11A 4HB0A 4OHRA 3JATB 1FU4A 4P1ZA 1K89A 2H4XA 3NHRA 4ZPJA 2XWJI 1YZNA 3HVUA 3L1UA 3JARA 1JR2A 2V3WA 3FOCA 4LJ4A 1ODTC 1BG6A 2CMFA 3U4HA 2D1QA 2LBPA 4G07A 4LYDA 4LRYA 3P2OA 3AKDA 3VDRA 1RE0A 3QE3A 1XA4A 4M8SA 4Y0NA 1WHTB 1K2VN 2P6PA 3R9IA 4DNQA 1C7IA 4WK0B 4Y9SA 2D74A 1HFWA 1GQSA 2ACVA 3FZQA 4OP3A 4B8ZA 5I7OA 3K5HA 5AUOB 4LF9B 4QXOA 3HA2A 1LPPA 1UPTA 2E9SA 4IINA 2W6QA 4OUDB 1IRIA 1QQ7A 1YQTA 2QMEA 2GN1A 3PGA1 4CF7A 5HYVA 3TZCA 4EITA 5IHPA 2OBYA 2WA2A 5HCUA 4EGQA 1Z25A 1FS6A 2FW1A 3TN7A 2WBLC 1XPUA 4QYWA 1T8TA 1WHTA 5I9MA 3UN1A 5HBGA 2OTCA 3OMWA 4RJIA 2FK7A 1YCHA 3NWOA 1TMKA 2VWPA 3HVJA 2PQMA 4PZEA 4DBZA 4OUDA 4YA6A 2YBDA 2XYQA 4N8SA 2AIRA 4QUGA 2QTTA 3OTGA 2EV9A 4V3CA 4Z51A 5L7TA 3BDIA 3I8XA 2XMQA 1JR4A 4DB4A 2XWBF 4NYMQ 1SIOA 4BTEA 1U6IA 1ZNXA 3BFJA 3I39X 3OETA 3UUFA 3ND9A 1R3UA 5IKOA 3FZGA 2BFWA 4AQYB 5ERXA 4GGPA 3CZPA 5I7EA 1VMKA 3ENVA 4C14A 4DIFA 4JCCA 4KE9A 1REQA 3LBIA 4JJEA 2FMXA 1WU8A 4IHQA 2F1IA 3EBLA 3KVOA 5CIQA 4BKRA 4BX8A 3TM5A 3U56A 3SR3A 1DDIA 5U9CA 3H04A 4M0UA 5FTMA 2VP5A 2ORYA 3A3OA 4ISCA 4ZICA 4V24A 4F21A 1NNEA 3Q3HA 3EQZA 1PNOA 3HKEB 3TLJA 1NOIA 5ABPA 1MGPA 1BJKA 1XTVA 2VSQA 4TXJA 3I73A 1FSPA 1EJBA 2G77B 4CDMA 3ZQJA 3LZCA 4RE5A 4H2DA 1X80B 3TD9A 3TB4A 5GTDA 1MX5A 5CEEA 3WIOA 1X3LA 3EIFA 3TDKA 4WCFB 2H7CA 1ZIYA 4K9KA 2GFHA 3L1VA 5IYZF 2QN7A 2VEDA 5ANRB 2YUIA 4Q9KA 1J97A 4KYTA 4B40A 2REOA 2X2PA 3HKEA 4XJTA 4R31A 5I9BA 2OK7A 3F6PA 4J7CA 1HQYE 4PLYA 4WFKA 2ZDHA 1JDPA 4RD4A 4W8OA 4WZZA 1PV4A 4RZSA 2GN4A 2IDJA 1KXZA 1VG1A 3PF9A 1X80A 3KSZO 1SURA 4L75A 3W3AH 1UZMA 3ELBA 4LZNA 4WCFA 3MRVA 1AH2A 5IJWA 3H5AA 4W5RA 1XXLA 3PLRA 4KPFC 1YJBA 5KVAA 4FNAA 1Z6QA 5JXIA 5DSTA 2CBXA 4PM4A 4GXTA 3KR9A 1N1GA 2ZT6A 4QQNA 1X70A 4HAIA 4JR0A 4DLBA 3A14A 3H9QA 3NQ41 2IDMA 2ZEJA 4KQ9A 4CR6A 4N7JA 3Q7QA 2XECA 3IOBA 2GBLC 5C1BA 1TK2A 2WWGA 3DW3X 3BWMA 3E2IA 3PEEA 4A0GA 2C7GA 5IBPA 1TMYA 1ZSNA 3HWWA 1AQUA 1ONSA 4I46A 1SVKA 4U5XA 4ND2A 3A4NA 3DJYA 3I5AA 2I6FA 3QUCA 2JAUA 4UDYX 3C8ZA 1LLQA 2IX9A 1G7RA 3HUDA 3QXGA 4HOYA 4O4IF 2OXTA 3EGVA 1N5MA 5AI4A 4IDNA 1OSNA 3GLVA 5HIJA 1KWGA 2D13A 1X39A 1CETA 2RHDA 1Z36A 3FBGA 4N5DA 5JECA 3IE0A 4WZBB 4YUVA 3SF8B 1SN7A 2ZJOA 2OZKA 1ZVJA 4HR7A 4OYHA 4Y30A 3FGZA 4H31A 1C9YA 2V4UA 3T0IA 4EM6A 5DNUA 4CQLB 2J45A 3JAWB 4LA4A 4LPSA 2BD0A 4NOLA 4RAQA 2XEXA 2P6MA 4ZHQB 4BNNA 3VAAA 4WXYB 4YRDA 4R7TA 5HM6A 1KIMA 3RU9A 5DIFA 2MSLA 2PL5A 1DLJA 2YZMA 1GUBA 4E2ZA 3K2QA 3IQZA 4FWTA 1B0PA 2H1SA 4YMSA 1IG0A 1OREA 3PITA 2I4TA 3V34A 3A6DA 5L9AA 4BZWA 4MVCA 4Z1MD 1IPFA 3CEAA 3MOIA 1KDVA 4N47A 3T7JA 3AV0B 4CQLA 1VSQA 2R6R1 1P39A 1P2FA 3LTEA 4P92A 2C7PA 4D4LA 4ZHQA 3HN7A 3ZK8A 2G17A 3ANTA 4IR7A 3AFOA 2WYWA 5DRYA 4MLZA 2I2XB 5JAQA 3C7KA 1L5HB 3ENKA 1RWWA 4HAXA 3SBXA 1P33A 3AHFA 1V8DA 3B1YA 4GXRA 3QPVA 4K1XA 4AWAA 3B8EA 4OKSA 4E6PA 2Z98A 3N74A 1QIGA 3DLAA 4GPBA 4QYTA 4ZCSA 3WXBA 1GRRA 1VLMA 1UWLA 2V5AA 3JV7A 5CXQA 3IEXA 3CCFA 4M55A 4PLFA 4Y98A 2PS3A 1Y8RB 5CJJA 1NRIA 3GHYA 5JQGF 3ZIUA 4M1YA 3UJDA 3ZCVA 1CY8A 4RH3A 1SCIA 1FCJA 1NLYA 4H60A 1V1RB 3ESCA 3DF7A 4NBKA 4EA9A 3TTYA 1S8AA 2J9GA 1JFFB 5EMLA 5F33A 1PO7A 2GPSA 2J5XA 4NWIA 2OV1A 3E61A 3KQPA 4FQ5A 4RTLA 3UMRA 4DQXA 4RVGA 1EM8B 1NE7A 1C0LA 1ELOA 2E85A 2Z8YA 3DC2A 3INTA 4H3SA 4KTTE 3Q6NA 2RGNC 3F6CA 3CUSA 2GRJA 1SBZA 3COYA 3GZNB 1RXCA 2RI1A 4OL9A 1V1RA 1I4EB 1U7HA 2BGWA 4G8BA 1CQXA 2F64A 2F67A 1C4XA 3AJAA 3VPBA 4XUEA 4F3KA 2PXAA 1TW3A 1LPBB 3CEHA 3SNKA 2Y99A 4KITB 2Q5IA 5J4LA 4FUTA 1E32A 3G89A 4KGXA 5GIOE 3JQ6A 3G85A 5CTJA 4G25A 3BILA 1RIFA 5A4MS 4QQ8A 4B2LA 1UKZA 1Q1ZA 1JAZA 2NTEA 1XWIA 3GEEA 3RS0A 3HFGA 2JHAA 3AL0C 3JRXA 2NV6A 2I6TA 3NEJA 1OUMA 3HXPA 2G8LA 1WE2A 3BWVA 3VMMA 3PHIA 5HFAA 3U1VA 5B4VA 3J80A 1CY0A 4FDTA 4Y2TA 1RRMA 3PNYA 1T4MA 3PXUA 2D5IA 3NBYC 4IHJB 4AWBA 3DSRA 3IE2A 2I65A 2Q50A 4IJVA 3PFIA 1Z3CA 3ASUA 4TM7A 1RTKA 3IODA 2WTMA 4YRCA 1VLVA 5TMEA 1JF8A 3NVMB 4RANA 4RV4A 5ESDA 5FI0B 5FTKA 2FN3A 3A6GA 2I4LA 2W2MA 2XB2A 1E9AA 1UMCB 2PZEA 3P9XA 2AG8A 3ZWKA 4B46A 5IULC 1SULA 2VT2A 3OIVA 4R8RA 2BP7B 4JBIA 5FUMA 2VBCA 1KWKA 2CNNA 3QBEA 4OSOA 1XTQA 1YS4A 5JO0A 1XK7A 3BJEA 1FFEA 3OQVA 3QRWA 4GSKA 4QJ3A 1UANA 2FDXA 1CUXA 5IDVA 1LFDB 1NY5A 3VZDA 1TRKA 3EEOA 3OZWA 4R1TA 1T6YA 2D2EA 3Q7PA 4FOOA 3VR0A 1JDSA 621PA 4M9XA 1UMCA 3P4YA 3AVPA 2X6QA 2JVIA 3A9TA 2HSJA 3HPRA 3Q2OA 4ZMBA 3HDVA 5KNCH 2BP7A 2IIPA 2B3TA 2E49A 1RXUA 3RSSA 1J33A 1ORWA 4TYYA 3PDIB 2ZPUA 2IX3A 3RVLA 3ADOA 4RZIA 3EMVA 5FLKA 5L3ZA 5BO5A 1XCLA 3IMFA 4ISBA 3ODGA 2I03A 3RS8A 2ECQA 3OKFA 4NAUA 1V5EA 4U9UA 4B6SA 1YRAA 3BGWA 3VO9A 4HGRA 1RXYA 1G5RA 1KAMA 4M76B 4URZR 4KLNA 3ABOB 1WCYA 5TVGA 4OPMA 4WLEA 5IZ4A 2IEYA 3LCJA 2RGBA 2J9RA 4D4GA 3TECE 2B78A 5TLSA 4MGYR 5CA1F 2NVUA 3ELDA 3PDIA 2OHHA 1P7ZA 2ZSKA 2J8ZA 3HB0A 1RAFA 5BRNA 3TBHA 4C4TA 5LQMA 1INLA 1JSRA 2PTHA 3L8DA 3WOHA 2WI8A 3K15A 4WE3A 5KNCA 3X3HA 1PK9A 2AZTA 3L0YA 3L4SO 4G9BA 4H7JA 5EZYB 4CKEA 4Z4HA 4B3JA 3KT8A 3PUZA 1PEYA 2PZFA 4LPKA 1AB5A 1NBAA 2QRMA 4LY0A 4FSDA 3O4FA 2W6OA 3GUZA 4P80A 4BAUA 3ZQ4A 4KODA 4LECA 1N0VC 2Q6VA 4RQBA 1BWRA 3MJTA 4Z1MA 1X0XA 3TW4A 4A73A 1BAPA 3ZGNA 2BT4A 3UENA 1A8IA 1IBSA 1SKYE 4KFTA 1TZJA 2XODA 2AHOA 5EZYA 1UEJA 4H59A 3A9UA 2OILA 3V3KA 2L82A 1KAOA 1FDOA 3KR0A 1WZNA 3ER6A 4DCPA 4FYJA 3VR5D 1YS6A 4MWEA 2A33A 5HBRA 3IXMA 1OT3A 3DVAB 3K73O 1OH8A 1KK3A 3QU9A 3SC6A 3K32A 2WJ4A 5TMDA 3WMEA 4BB6A 5E6SB 3AU9A 4A3SA 4E2YA 5LXTB 5ELXA 2Q3FA 3A1NA 1ZCJA 5SV2A 2D5BA 4MQEA 3GGCA 2VDWA 1T2UA 2PX4A 2RH4A 2Y1OA 3NDPA 1ODSA 2F00A 4H1UA 4BX3A 4MDEA 3NT5A 3DE4X 2YV5A 2PH1A 1J8YF 1JE0A 3N6RA 5DB4A 1HX7A 4F96A 1MT3A 1Z56C 3DVAA 3ILHA 1U7ZA 2H4FA 3QX7A 4H35A 1ECFA 1L4MA 1CVIA 1RPZA 3GJRA 1MIHA 2I33A 2F1HA 1KHTA 2J6CA 3GGPA