4CM8B

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
251
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
molecule tags Oxidoreductase
source organism Trypanosoma brucei brucei
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
total genus 91
structure length 251
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm8B00
4AJIA 4M54A 3CKYA 1P33A 3OIFA 4RDHA 4TKMA 4A03A 3GVIA 1HSZA 4WLEA 4UUNA 4AJ2A 1HDOA 3D1LA 1ZW1A 4BMNA 2D3TA 3G1UA 1K0UA 3K9QO 3SC4A 4YXFA 3DB2A 4GMFA 1VJTA 2GNAA 3ANLA 3W8DA 1Y8RA 1HDGO 3D3WB 4IS3A 4GVLA 3KLPX 5EQFA 2IZ0A 4NBWA 3T4XA 3QWBA 3SEFA 1NFFA 5T8KA 4BHTA 4XGNA 3GUCA 4FJ1A 3WIEA 4E2XA 3EAGA 4OOFA 3DXFA 3F1KA 4AJEA 1GDHA 3NT2A 1KVTA 1M6HA 4PLCA 5LDHA 1PQUA 1U4OA 2XF8A 3BYZA 5JSFA 2GYYA 1DIGA 1KEPA 1U5AA 2J8ZA 5KKAA 4XZ3A 1F12A 2BHLA 3FHLA 3KRTA 3K2BA 3V2UA 1DAOA 1UAYA 2O3TA 3O9ZA 1NQOA 2G1UA 3H5AA 4TROA 4CLOB 1C1DB 3KBOA 1Y8QB 3LQFA 3ZWMA 3GZNA 4FJ2A 4EJMA 4Z3KA 2D1YA 4GQAA 2TMGA 4NHEA 1RYDA 4N18A 3DZKA 1NM5A 4K26A 5T57A 3GVHA 3D4NA 2BGLA 4PLVA 1VI2A 5G4LA 3OBBA 4CM5A 3H8VA 3WMWA 4IY1A 3N7UA 4Q3BA 1UXIA 1NPYA 1NPTO 4BQPA 1ZBQA 3OJEA 4RF2A 2AQHA 4R51A 5A9RA 4OO3A 4PVDA 3TJRA 3SJUA 4E5YA 2WD7A 2BFMA 4U8GA 1U1IA 1JKJA 3OJFA 1I10A 1WZEA 3ENNA 1LLUA 3JQ7B 5TT0A 4DIFA 1ZNQO 3PWKA 2X7HA 3OA0A 3RKUA 4BO1A 2WWRA 5U4QA 1S6YA 3WGGA 4BNTA 1E3IA 2R00C 2HMWA 4CQLB 3IOYA 3QVXA 5DCUA 4IJWA 5G4KA 4BNVA 1YQDA 3F5SA 4I8XA 1B16A 1XU7A 4MINA 2PH3A 1H2HA 1JKIA 1WDKA 4I1IA 5IDQA 5KJ6A 5A3VA 3TWOA 1SB8A 4IQ8A 4MVJG 1IHYA 3P2OA 1B8PA 1X7GA 1V9LA 1Z73A 3CZRA 5G0UA 4DYDA 2WD8A 2VOEA 5JXWA 3QWAA 1ID1A 2FZEA 1YKFA 1PZGA 4OQZA 1CQJA 1V3UA 1E7QA 3FF4A 1M2WA 3TSCA 2WM3A 3BZUA 1I2BA 3ZN2A 4JP3A 5JO0A 3JQ6A 2EKQA 3JD0A 1NWHA 2FR1A 2OHXA 4GLOA 4RCVA 2H5LA 4ROSA 3RAJA 1IUKA 1XDWA 4IQGA 4NMHA 2QIOA 3ZNOA 5TQVA 4PRLA 3LC1O 5A03A 1LDBA 3KEOA 3L0DA 1HZJA 1VRWA 3E9QA 4YTEA 1ZEJA 3NDIA 2VHZA 1SBYA 5JO9A 5K6AA 3K96A 5DDIP 4FOOA 2Z95A 1BXZA 3D0OA 3MEQA 3JQAD 2PD6A 1D8AA 4QT0A 1E1NA 3UCFA 4YWJA 1DC6A 2E6UX 5BSGA 3JQ8A 1E92A 5G0WA 3CUKA 4YDRA 3RFVA 5EQDA 3GGPA 2YW9A 3WWZA 2NVUA 2PGJA 5CFZA 4L76A 1I8TA 3PLNA 1MUUA 3GRPA 3WSVA 3A9WA 4N54A 4E21A 4MVJD 2BLLA 2QHXA 3DBLA 3I1JA 4ZQHA 1YONA 5FF9A 3X2EA 3NAQA 2YFHA 3ZH2A 3TZQA 1ZMOA 4XQGA 3D64A 1VKNA 4NK4A 1DFGA 1LRJA 3EYWA 2OBNA 4I5GA 4CMCA 4E33A 3B1KA 4RL6A 3PDJA 3ETEA 2NV6A 4GL4A 3VVBA 2VUSA 5EERA 2EEZA 5EIOA 1D4FA 4TWRA 1K2WA 3ZV6A 4CMEC 4IIUA 1HE2A 5COBA 2C82A 3B70A 4OXNA 4YR9A 2GR9A 1XQ6A 1E5QA 1U2DA 1I32A 4OAQA 2H9IA 4JCOA 3WYCA 4Y98A 4Y6RA 1PJ3A 3NDJA 1PGQA 2GN9A 2X5JO 4O59O 5IDYA 2ZYDA 3U4DA 4UUOA 1Z75A 2ZQYA 4ZRNA 5ILOA 1ZIDA 1QV6A 4E5PA 3D5QA 2P9GA 1A4UA 2NTNA 4O1MA 3I83A 1LQTA 3RUHA 4BNZA 4H16A 1ISGA 1BW9A 4OGWA 4PLZA 1I01A 1JN0A 3L6DA 2QYTA 4OKNA 4E30A 2YV2A 3WG9A 4BMSA 4MKRA 5I8WA 1EBFA 1JW9B 2WMDA 2YDXA 4HFNA 1RJWA 4R41A 3GR6A 5FYDA 4N5LA 3S1LA 3SVTA 4UUMA 3NTRA 3D3WA 1T25A 1LTHR 1X7DA 4IMPA 3FNFA 4UEKA 4Z9YA 2Y1DA 4DIBA 4E13A 3HDHA 1B7GO 1K5HA 1CERA 3E82A 1T24A 4DLBA 3OHSX 3IL2A 4I9HA 2IZZA 4ALMA 3G49A 2CDAA 2Z5LA 2CSUA 1P44A 3I9NA 3IC5A 3DTTA 4HXYA 4ALJA 2QQ5A 4J91A 3OJLA 3FTNA 2DVMA 3DFUA 1ZSNA 2BELA 6ADHA 5B4VA 2NACA 4J7XA 4BGVA 3D4PA 3M2TA 5TLSA 4FFNA 3JCZA 3WNVA 1WP4A 1X1EA 1PQPA 3MJTA 1ISIA 2W4QA 2OO5A 2AHRA 1SOWA 3BMOB 3GVPA 5TF4A 1ENPA 3WR5A 2ZATA 4PIVA 3WQRA 4BUCA 4BGIA 3INRA 4RPLA 5TX7A 3GFGA 4X54A 3EK2A 4TRMA 3QJ5A 2I3AA 3FBTA 1KYQA 5HS6A 1QV7A 1DIAA 3MOIA 3QP9A 1T4BA 1Q2XA 1MXHA 1CDOA 1HETA 2JHFA 3RC2A 5AOVA 4CM4B 4JJGA 4UVIA 2NTJA 3S8MA 5GMOA 1H0KA 5JFOA 4FPXA 1YDEA 2IYOA 3JV7A 3CEAA 5AXCA 2EJWA 2BH9A 1PJ4A 3JD4A 4M49A 4CLXA 2C5AA 4FC7A 4XKJA 5TRTA 2W2KB 1GCOA 1U8XX 3H7AA 5G0VA 1ISHA 3QWFA 4A26A 1GY8A 1RKXA 1UXHA 1ZCJA 2O23A 2ZQZA 5ENDA 2I65A 4Q39A 1B15A 3PK0A 4Z6KA 4DC1A 4YT5A 1EK5A 1B8VA 3BA1A 1XQ1A 2CF5A 2HK8A 4KQXA 2XXJA 3GPIA 3ITDA 2P68A 3L9WA 1U3UA 3RUEA 4AJPA 3PHJA 1A9ZA 1Z7BA 4ZQBA 4IGEA 5K6AC 4NU5A 3VKUA 5A9SB 4BO7A 2GZ3A 3DMTC 2O3SA 4HFRA 1M76A 3GHYA 4PLYA 5I7VA 4WLOA 1PU2A 3RCBA 4EGFA 2UV8A 1GPJA 4J4HA 4CMAA 1JA9A 1W6UA 3GY0A 3DHEA 1YL7A 2ZTUA 3I4CA 4WCFC 1QYCA 3RFTA 3ZCXA 4AJKA 3VH3A 2DTXA 2WDZA 2FR0A 2IEBA 1GUZA 4S1VA 4NI5A 3RI3A 3LF1A 5BQFA 4TSKA 3HN2A 1VPDA 3W4KA 1CETA 1GTMA 2WE8A 4GSLA 4MPDA 4F3YA 4NBRA 4BO6A 1W4ZA 3DR3A 3E48A 4NJMB 3H5RA 4GX0A 1AHIA 4Z3DA 2O3QA 1U9JA 1VL8A 2EKPA 4YRBA 3ZDFA 2DUWA 3A06A 4L73A 1DRVA 5KNLA 1HT0A 5HS4A 1JU9A 3UGKA 4CLRB 4XWYA 4JIGA 3H6KA 2D0IA 2EIHA 3V1UA 1WDMA 3QVSA 4M89A 3VZPA 4RQTA 1SO8A 1PR3A 1KERA 1NYTA 3A14A 3O26A 1LLDA 4E32A 3TFOA 4OJNA 2B0JA 3KYCB 1HLDA 4D41A 1G6KA 1ZJZA 4WE3A 5BSHA 2X9NA 2P91A 2ZJ0A 3U3XA 4IDEA 4U6QA 1EE2A 2D4AA 3QA9A 5BSEA 2X9VA 4IDAA 1UP4A 2JHGA 4JQCA 3K6JA 3E8XA 4DBVO 4WJZA 3U49A 1R66A 1CWUA 1W73A 2FN7A 4W6ZA 1ISJA 1ZUD1 3WBBA 2O3RA 4CMGA 4B8WA 1YO6A 4RV9A 4D79A 2WTBA 5L40A 3PJGA 1O9BA 4J2OA 4BNIA 4HWKA 3OFSA 4Q3NA 4BKUA 5IXYA 4LRTB 4YJGB 1D3AA 1HYHA 1EUCA 1OOEA 4PVCA 5GY7A 2P9EA 4PG4A 3Q9UA 2F1KA 3Q2IA 2ILTA 3G17A 4PGFA 4L8VA 1P9LA 5COAA 4YAIA 5DBGA 1ZXBA 1XLTA 3JQ7A 2JAPA 4I5EA 2DU8A 1EDOA 4HKTA 5EPOA 5KJEA 1BVUA 2HK9A 4PG6A 4BL5A 1G0OA 4CODB 1OZAA 3FRJA 2VYVA 5L4LA 2GSDA 4CPDA 3VH2A 3KHUA 3JYNA 4BMVA 4RVDA 3K73O 1XELA 1ENZA 4W9NC 1A4IA 3SLGA 3VZSA 4UEJA 5K9ZA 1W0CA 1F17A 3JQ9C 2PLAA 2B69A 4YJHB 3RBXA 2X5KO 1X13A 3C8MA 4F6CA 2B4RO 3A28A 3F6YA 3WGQA 4FIZA 3C3XA 3U5TA 1E0DA 2Y68A 3GUYA 3MTGA 2AW5A 2BFPA 1T2CA 5EL0A 1DXYA 1T2FA 3KYBA 3WOHA 2G0TA 3QVTA 5G0TA 4FGSA 3DAGA 3PTZA 2H6EA 5L4SA 3HG7A 2YY7A 4QX6A 1KS9A 3PHIA 1NQAO 4CM7A 1DLIA 1GD1O 1K3TA 2Q50A 4AJ4A 4D43A 5A04A 4D42A 4J16A 4UVHA 5KVVA 3HJAA 2GZ1A 3DEYX 3JQFA 4J4BA 1PL8A 4M87A 2RBEA 3ETDA 1PTJA 4IIVA 2OZPA 3GDOA 3I9LA 3IJPA 3BHIA 4FFMA 3JQCA 4E2WA 3WQSB 3I5MA 2J5KA 2OGUA 1QLHA 4DQXA 4ZHSA 1RM3A 2RAFA 4KOAA 9LDBA 1GZ3A 4O0LA 2DT5A 2EGHA 3DQPA 3NTQA 3RUAA 3L6OO 1WZIA 1UXKA 3AFNA 2O3JA 4B7UA 2Q1UA 2NVBA 3PWZA 2CD9A 1HSOA 3HFSA 1HLPA 4L74A 2Y93A 2O2YA 1BDBA 1IZ9A 3PHGA 1T2DA 4ALKA 4PLWA 4R01A 1ADGA 4LCJA 5EINA 5HWSA 4XCVA 5F1OA 1GUYA 1A5ZA 4CMJA 4UAGA 2VZ9A 3VHRA 2D5CA 4MVJM 3LK7A 3VOSA 3HFGA 4XYBA 4H15A 3OA2A 4OQYA 4II3A 4YRAA 1GQQA 2J3KA 1OC2A 4RPGA 4MKXA 1LU9A 4R69A 3NT5A 1XIVA 1LUAA 1JAYA 3R3JA 4IXWA 4XD2A 3UKOA 3UUWA 3ZWPA 3GMSA 4CLEA 4XQ9A 4BO4A 3SC6A 5IDXA 4JBHA 2EG9A 4FFOA 4IDCA 2EGGA 1T4DA 4IDFA 4EJ0A 5TC4A 4IS2A 5LC1A 4JN6B 4FFLA 3PDUA 1LLQA 1FMCA 1MLDA 3ZHBA 3O38A 1NHWA 4RPHA 3PHHA 4IM7A 1KVSA 1UP6A 1I2ZA 3JYOA 5JY1A 4YEDA 1UZLA 1X7HA 5HRUA 3RWBA 3I6QA 3JQ9A 4XB2A 2QG4A 1PGJA 2CZCA 3FWZA 5BNIA 2VYVD 2PTGA 4Y67A 4IJVA 5JDIC 1ZK0A 5JNLA 5ER6A 3AU9A 2V6MA 1H93A 4A0SA 3INGA 1ARZA 5IF3A 3AUTA 4AJLA 4CMHA 4RVSA 3CPSA 4CM6A 5JYDA 4QXMA 1E3LA 1UXJA 4GKVA 2BGMA 1ZK3A 1F8GA 3DBRB 5LCXA 2DC1A 4UVEA 3ROKA 1WAMA 3C24A 4XGIA 3HDQA 1Y1PA 3SX2A 3TDKA 2ZB4A 2AA3A 1N1GA 1V6AA 1LSSA 5KWEA 4WECA 2NU6A 1C0LA 3UOGA 1FDTA 4M55A 5CDSA 4E12A 4JX8A 3TFQA 4GAEA 3VDQA 1J4AA 2VWGA 4G81A 4OXKA 3RUIA 2FR8A 2E4AA 4CQMD 1E1LA 3BHMA 2EWMA 1ZK4A 3NDRA 3ZGYA 4DLLA 1PWZA 2D59A 1BGVA 3C7DB 5BR7A 1DDOA 2TMDA 4HNHA 1PEDA 2GZ2A 2C2XA 2ZB7A 1ULUA 4R1UA 1ZSYA 1GFSA 2O4UX 4TRRA 4ALNA 1X15A 1P0CA 3RBZA 2VOJA 2Y1GA 4EI2A 5EMHA 1E3JA 1Y8RB 1ONPA 3WTBA 4J7UA 3E5RA 3FTPA 5JLAA 1M66A 1U7HA 2BRUA 1D1TA 3BMCB 3O03A 1C1XB 1UUFA 4UEOA 1EBUA 3PFFA 3C1TA 4IMRA 4XYLA 3GNQA 5ICMA 1I30A 2O7SA 5BSFA 2BFOA 3ZZNA 1BXGB 2CVQA 1ONOA 2VRBA 2J3HA 3RJ9A 2JAHA 3WS7A 2HQ1A 3DTYA 5JAMA 2WD7B 2PGLA 3H9GA 4OH1A 4RVHA 3TZKA 4CM4A 2PK3A 1N8KA 5GZ3A 5L45A 2X0JA 2PV7A 1NQTA 5JCJD 2O7QA 1P1IA 1BVRA 4TQGA 1YB1A 3VPXA 4AFNA 5L7WA 4OMUA 4WLVA 5G4KB 3ITKA 4WASA 3EMKA 3JQGA 1PSDA 1FXSA 4WLNA 4YAGA 5GZ1A 2Y05A 3KLMX 4LGVA 5FFFA 4KUGA 1AXEA 2GN8A 3ADOA 4E0BA 3GDGA 1PR9A 3H3FA 5IJZA 2PFGA 3AOEC 4WEQA 2UUPA 3GAFA 4B4WA 2C5EA 3KSZO 3WFJA 2J6IA 4D44A 4P4NA 2HSDA 4FS3A 4PG8A 4PLFA 3LT4A 1JLLA 4BNHA 1GYQA 1PGOA 2BMAA 3PYXA 3EY4A 3KETA 2VWPA 1Q7GA 4J0FA 2VWQA 3D5TA 1LDGA 1YL5A 4BO3A 3HWRA 3JQAB 4FQ8A 5L51A 4HP8A 2B5VA 5EESA 1O5IA 1UDAA 4RORA 3ZWOA 5A4DA 3HADA 1QSGA 4RF3A 3T7CA 4A2CA 3STHA 3OEWA 3H9EO 2JD2A 3D4OA 4Y9DA 1TA4A 3EHEA 1R12A 5T64A 1PS0A 2GO1A 3D3EA 4IZIA 1Q1NA 4Z9FA 1FDSA 4JXKA 3PGXA 1YXMA 8LDHA 3RFXA 1A27A 4UREA 3BTSA 5L4NA 4W82A 3HB4X 2CUKA 3Q1LA 4M86A 3RIHA 2EERA 1UH5A 4YT8A 1LSUA 2B4TO 3QVWA 4BOYA 5TNXA 5A05A 1EMDA 4ND2A 4NBTA 3LZ6A 5F1KA 3H9QA 4RDIA 3ZNQA 1I5RA 1MFPA 1ZVMA 2YHUA 1KEUA 3DZIA 4K1LA 1DFHA 4J43A 4J49A 2OP1A 4PG5A 1PX0A 1SOVA 1NFRA 3DOOA 5DCWA 3VVCA 2HCTA 4YRDA 1I3MA 1Y9EA 4ZQFA 5TGDA 5G2OA 2XXBA 4EYEA 4B3HA 1EQ2A 2POQX 4AG3A 3PEFA 4GX1A 4TMFA 4GVXA 1LSOA 1PJ2A 3U4HA 4CV0A 1T2EA 2W98A 2GGSA 5B1YA 5A9TA 4NFYA 3I9JA 1RWBA 2WEKA 1LJ8A 1T26A 5I7FA 4QEDA 4DRYA 1LC0A 4I9UA 5JE8A 2VHWA 1M75A 5KTKA 1J49A 2A92A 3KOUA 5IAAA 3GFBA 3EVNA 1XKQA 3WLFA 1BW9B 3ON5A 1HRDA 1Y7TA 3V8BA 4CLOA 5L95A 4R1SA 4DMMA 1ADBA 3N74A 3W6UA 5AQ1A 3JD2A 1JAXA 3K8ZA 2Z1NA 4FD3A 3Q0EA 2YUTA 3WJAA 5KKCA 2X23A 3NGXA 1BRMA 2QYSA 3DBRA 2IXBA 3I9OA 1EQUA 5C3MA 1GEGA 4BO9A 5I9MA 5IFLA 1B26A 4A27A 5GZ6A 2DBVO 1KY4A 2GDZA 1EVYA 2Y0DA 1LXCA 4OYRA 3V1YA 4ID9A 4OL9A 3WYBA 4WNCA 4Y8VA 4AJ1A 3OETA 2Q2VA 3PYLA 3E9NA 4XYGA 4CJXA 1LQUA 3FNHA 4WKGA 3EUWA 2V6BA 2VHVA 3TRIA 4DYVA 5T67A 1O89A 4LCEA 4NK5A 4D0SA 1KVQA 3ANMA 3FD8A 3QY9A 4P8RA 1WPQA 4WK6A 3GN1A 2I9PA 1TT7A 1FDVA 2Q3EA 4BO8A 3ZU2A 4OM8A 1O94A 3T4EA 4KP7A 5DULA 2C2YA 3CXRA 1MGOA 3AY3A 1F0YA 2VRCD 3ENKA 2PZMA 1WXDA 3WICA 1ZZEA 3PQFA 1NAIA 1WMBA 4G65A 2DPGA 4BIIA 3VTFA 2LDXA 5JBIA 4BNGA 2YV1A 1KETA 1GPDG 3BTVA 3WMXA 4DBZA 4JJFA 3UCEA 2Q2WA 2W8ZA 1C1XA 3SXPA 4CM9A 1CF2O 5K0ZA 3W8EA 1E5LA 2PKQO 4L4RA 4LK3A 2ZJ1A 1L7EA 1B3BA 4BKQA 3F1LA 1T2AA 2QX7A 3WJ7A 4ZRMA 1LI4A 4Q3AA 1B0AA 3AUAA 2IZ1A 5JAIA 3W4IA 5CDGA 4L4XA 1XGKA 1M67A 2VZ0A 3BXXA 3VAZA 1PL6A 5DOVA 4I9NA 3I23A 3LDHA 1QORA 1YE3A 2DLDA 4YVFA 5F3RA 3TL2A 5AXAA 4P4GA 4DTIA 2VUUA 4OXYA 4B8ZA 4L75A 1GADO 3JYPA 2HMVA 4NG5A 1QP8A 3H5NA 3PQEA 1QKIA 4FN4A 1EVIA 1DHTA 1LA2A 5THKA 2DBZA 4DL9A 1HEUA 4PZDA 2HMTA 1EVJA 2YDYA 1DLJA 1ZJYA 3PLRA 3PJDA 1DB3A 3ZNPA 4AVYA 1R15A 3ZI0A 4II2A 3GGGA 4AJJA 3WIDA 3GN2A 1OFGA 1SB9A 2DTDA 4MVJE 1PJSA 1K6IA 4YCAA 5DCYA 3ZV5A 1UP7A 3ONEA 3NJ4A 4FB5A 2HMSA 3MJSA 3QWIA 3BTUA 2QRKA 3ZWNA 1K89A 2ZIZA 5ILGA 1N2SA 1A71A 4AL4A 1D7OA 2RIRA 5HBRA 3BAZA 2ZB8A 2YHIA 3CMMA 4P4LA 4E5NA 1VL0A 2HJSA 4BO5A 4A73A 2DQ4A 4R5HA 4W7IA 2H1SA 5JC1A 3A1NA 5DN9A 4ND5A 3ABIA 1DC5A 2PA3A 1ZFNA 5C5IA 3C7AA 3B1FA 3U0BA 1D1SA 3F9IA 1DSSG 1NPDA 2RHCA 4XA8A 4K6FA 4Q3DA 1MG0A 4YACA 2AEFA 4EBFA 4CMIA 3JYQA 4C7KA 2CFCA 4PLPA 1VJ1A 2AQKA 3WQQA 1N9GA 2P9CA 1UR5A 5I7EA 1GQ2A 3PQDA 4LVUA 5AXDA 1WW8A 2WSBA 4XJSA 2UYYA 1QYWA 2HK7A 2B83A 3E18A 3JQBA 2WYUA 1YJQA 3ST7A 4XEHA 3PZRA 3S2EA 3ZU4A 5JCXA 2CMDA 3RVDA 3GEMA 1PS8A 2A35A 4J90A 3KM0A 3Q3CA 1Z7EA 4IDBA 2GUGA 1ISFA 4YJFA 2GCGA 3OM9A 3KSUA 1P1JA 5F1PA 2BI7A 3HDYA 1PL7A 4W9NA 3B20A 4CMKA 3W6ZA 4HX5A 4L0QA 1ORRA 2OUIA 1OI7A 3F4BA 3F47A 2VRCA 4OIMA 3ZU5A 4A5OA 1MXFA 2IYPA 2C20A 2VCYA 5KJCA 5A02A 4R9SA 3PHLA 4DXHA 2A4KA 4YYZA 4NPCA 3WDSA 4RLSA 4WPGA 4YBZA 3TZ6A 3GVCA 1GU7A 3HHPA 4H7PA 1TT5A 4TRJA 4ZN6A 4RO0A 1KIFA 3MJVA 1YB4A 3CH6A 3AW9A 5I8ZA 1MC4A 4CR8A 3JQFC 3V5NA 3DBVO 2ZCUA 3WBFA 5A5FA 5ADHA 1IULA 1L7DA 2NLOA 2XAAA 3JTMA 3IP1A 3IKTA 4B4OA 2YFQA 1VE9A 4DPMA 4ND4A 2DAPA 1QG6A 1YQGA 2G76A 4BKRA 1E1KA 1JKFA 3COSA 3R3SA 3RKRA 4F45A 4F6LA 5LDGA 2GN6A 3SBOA 3GC6A 3ZWWA 3ZWYA 4Z0HO 1LSJA 3JQGB 1SEVA 4XIYA 4ALIA 1DPGA 4ZQGA 2VT2A 1PJQA 4JK3A 4CUKA 3ICPA 1PIWA 5ES3A 4AJHA 3ORFA 5L53A 4RQUA 4URFA 4DQVA 2NADA 1UAGA 2E37A 1VL6A 3RSHA 2IRWA 3GGOA 3I52A 1N1EA 2X6TA 3IMFA 3VPGA 2W2KA 4PFJA 5TSDA 5DT9A 1P31A 1KVRA 2NTVA 1MV8A 3BMQB 1Q7CA 1A7KA 2UAGA 2AXQA 2NNLD 3JQAA 5ER9A 4D3FA 2QZZA 4WCFB 3H65A 1BG6A 3LVFO 3VZQA 2FPPA 3ONDA 1KOLA 5I9NA 4IBOA 2YJZA 3RUFA 1PJCA 4HY3A 1C3VA 3C1AA 3CTMA 4YQYA 1NR1A 2EF1A 4NDNE 1I3NA 1UDBA 3WWYA 1DIHA 3BMNA 4DREA 4NU6A 4FFRA 2FSSA 1Z74A 3OEYA 4WGGA 4IPTA 5CG1A 7MDHA 1A9YA 3K92A 3GNSA 1R37A 3ASUA 4BS9A 4IJUA 4O6VA 1L1FA 2Y0CA 4PZCA 4EDFA 3HUDA 1DC3A 3WFIA 1F8FA 5CEJA 3QRWA 4O63O 1QYVA 1PS9A 3RJ5A 1DO8A 1E3WB 5F21A 3EC7A 3FPLA 2VHXA 4CQLA 2VZ8A 3UW3A 1Q7BA 2JD0A 5A06A 3QWHA 3WGZA 4UVGA 2JCVA 2CY0A 3H9JA 3OIGA 2BD0A 2PKQP 3VKVA 2PH5A 4E31A 1LRKA 1VKOA 4HFJA 4ILKA 4CV1A 3LSYA 3CIFA 5KVCA 5U9CA 1H5QA 4Q3CA 2PD4A 2VQ3A 4YAEA 4R5MA 3MTJA 5HA5A 5JDCC 5H81A 2X0NA 2Q99A 3UAGA 5FI3A 4KWHA 4KTTE 4PG7A 4RZHA 5COQA 2UUOA 4U5QA 2HJRA 3K2EA 1HXHA 4A10A 2HDHA 1I2CA 1ML3A 3OQ1A 3U09A 3VH4A 5CG2A 1M6WA 1HE5A 3GRKA 4Y6SA 1FDUA 1PGPA 1U3TA 2HLPA 3GEDA 1KC1A 5A3JA 1FJHA 3ZWAA 1FF9A 3ZNNA 1G1AA 4MIOA 4TRNA 1E7SA 2V6GA 1Z6ZA 3P19A 5B37A 1UZMA 1VLLA 3KB6A 4D46A 1E1MA 1S7CA 1KEVA 2EP7A 1SNYA 2EW2A 4LVCA 1BHSA 4W4TA 2J5QA 2PGDA 2D2IA 2DFDA 4N5NA 1EDZA 4FSHA 2VN8A 1SAYA 1HDCA 1HE3A 3LT1A 1LEHA 4CUZA 3LU1A 1JVBA 5DZSA 3MJ4A 3IQDB 2BFAA 2EKLA 1MP0A 1EFKA 4CMIB 1H6CA 1MB4A 4LISA 4CQMB 4JNKA 2X9GA 3DBHA 1UZNA 1P0FA 4O5OA 3PI7A 3IUPA 3ICCA 5FWNA 2B36A 1YBMA 2DUUA 4XDYA 1EK6A 1H94A 1JQBA 4IJKA 3WSWA 3WX0A 4GKBA 4WLUA 3ZHYA 2P2SA 2GF2A 3G0OA 2VUTA 4AJOA 4BV8A 2FZWA 2I99A 3JD3A 3NX4A 3DZHA 4GI2A 5HM8A 1HYEA 1ADCA 4DIOA 1QRRA 3I6IA 4BNFA 3U62A 1KBZA 1R4MB 4WEOA 1JTVA 2QW8A 1NBOA 1I33A 2ZTVA 2SCUA 3AJRA 1P1RA 1BDMA 1H2BA 3P2YA 4J6FA 3RASA 4JBIA 4R9RA 3R1IA 4EEZA 5JDIA 1V8BA 3TQHA 4PN3A 1X14A 3UHAA 2A9FA 1CRWG 2VWHA 4G5HA 4NIMA 1RYEA 2JJYA 3GT0A 4RPJA 1XSEA 1BMDA 2X0RA 5L3ZA 2O4CA 1E6UA 1GV0A 5CEFA 1GV1A 1ZKMA 5TJHA 3OQ6A 2X1HA 1Q0LA 4YJDA 4ND1A 1AN9A 1DBVO 1WMAA 1PGNA 3NT4A 2Q2QA 3ZWXA 5JMPA 1QLJA 1PZHA 2QRJA 4QSMA 2FWMX 1LDYA 3EZYA 3MWEB 3AU8A 4DUPA 3M2PA 4HV4A 3PIDA 4K9DA 4K6CA 5U1PA 1NAHA 4QQRA 3CE6A 3K31A 1PWXA 5L7TA 2HUNA 1ENYA 4JGBA 3U4CA 3PWSA 4MKZA 2D8AA 3ZHXA 1Y5RA 4J4TA 1XCBA 3FSRA 2NU7A 4P22A 3ZU3A 1P74A 3UH1A 4D3DA 2O2SA 4ZVVA 3DZBA 2NVWA 1J6UA 4DPKA 4MVJF 5BNTA 3NKLA 5JPIA 3DL2A 3BIOA 2WJPA 3ZW8A 3GNTA 2P4HX 2HRBA 4CM9D 4JBGA 3WGHA 5B12A 3VTZA 2C0CA 3GA0A 4MJLA 1NHGA 4BGUA 3E03A 4KUHA 2VT3A 2GERA 4DC0A 1B14A 1LDNA 2C07A 4OOEA 1T1RA 2OFPA 1IL0A 2O48X 4WCFA 2FOIA 3F5QA 1GAEO 1CIVA 1R0SA 3WXBA 3GHHA 4DQUA 4QO8A 5DBIA 1ZEMA 2YQ4A 2C54A 4DWVA 3IP3A 1WWKA 2R00A 4PZEA 1QMGA 2X58A 5JCJA 1TXGA 4QFCA 1R6DA 4BNNA 1C0PA 3VPHA 2FY8A 5JYEA 4J0EA 4LSMA 1R0LA 1DAPA 5KOIA 2Q49A 1P1FA 5CPBA 3PJFA 1I3LA 1P1HA 3VZRA 1BWSA 3O8QB 2ZYGA 3ANNA 1EEHA 1LNQA 2BGKA 1K6JA 2Y67A 3AK4A 3OECA 4BVAA 4CM3A 1IPEA 2PZJA 4KUEA 1DRUA 4B7CA 1OBFO 1EZ4A 3FWNA 3V1TC 3KYDA 3PJEA 1LDEA 5DBFA 3AM3A 2EXXA 4PLHA 1ZO8A 2X0IA 2Z1MA 2EJVA 2VYNA 2OL4A 4CM8A 2Y0EA 4JP2A 5ITVA 1H6DA 5FEUA 3K30A 3L77A 1WVGA 2DPHA 5CHEA 3P5SA 5F5NA 4FCCA 5BNFA 3V2GA 4BNWA 4XX0A 4E3ZA 1CYDA 3GLQA 2NM0A 3V2HA 2EHDA 3GEGA 4BV9A 3GF4A 1H9BA 4YB8A 1TT5B 3IKVA 2FRDA 3KUXA 3QV1A 1QYXA 3EVTA 1E77A 1A72A 5JMWA 4KDEA 1I3KA 3X2FA 2CVZA 3NTOA 3HNPA 1CQIA 3OICA 3MOGA 1X1TA 4JLWA 4M8SA 3SJ7A 5ICSA 3PZBA 2PNFA 1HWYA 2VTDA 1K6XA 4XR9A 1DHRA 3FBGA 3QHAA 1IHXA 2UVDA 4QFDA 1Z45A 2BI8A 5JY6A 3H2SA 1Y8QA 1E3EA 3ROMA 5JS6A 1WDLA 4GX5A 1EVZA 4BNXA 2CDBA 1U2GA 3NUGA 2I67A 4RVGA 1R16A 3KTDA 3MZ0A 1E7MA 5DF1A 5EN4A 2P4QA 5DP2A 2NUAA 3C85A 4A7PA 3LC2O 1O0SA 3UF0A 2NSDA 3QIVA 1GEEA 4EITA 1P77A 4RPKA 4RJTA 4NBVA 9LDTA 4ALLA 5HTOA 2JFHA 3DONA 2IXAA 1XYGA 3RUDA 1B2LA 2FPGA 4BB5A 1V3VA 4E2YA 4TVBA 2X5OA 5I9LA 3E9MA 4YJHA 4UULA 2G5CA 3NEPX 4J9UE 3GK3A 3KO8A 2GASA 3DHYA 3E1KA 4NZ9A 3VC7A 5KCZA 5C7OO 1XHLA 4MIYA 1YOVA 4B79A 4YJGA 4CM1A 1A7AA 3JD1A 2XPCA 4GGPA 3BHJA 3RQSA 1KC3A 2PKRA 1HDXA 1PZEA 1R4MA 2JCXA 1R4NB 3GOHA 4OHUA 1NVGA 3RBVA 2I66A 3I4FA 3GVXA 1N7GA 4E2ZA 4XIJA 1DC4A 4GSKA 1GQYA 2RH4A 2GLXA 4BKPA 2FPIA 2AG8A 4NFSA 2B5WA 4OSOA 3FPCA 3MWDB 2G17A 3N58A 4R68A 4KWIA 3LLSA 4CLDA 3AWDA 3GZ4A 4BKOA 4ONEA 1GZ6A 4FDAA 4C4OA 4IDDA 5T8KC 4Q3EA 1ZK1A 3W4JA 4TZTA 5T5QA 4CL3A 1Y5MA 2V65A 1F06A 2AMFA 4J1QA 2B37A 1SC6A 2AQIA 4DVJA 3O4RA 1AE1A 4CLHA 3FCOA 1JVSA 2DM6A 3JQDA 4H3VA 1TI7A 1KY5A 3IIEA 3QSGA 1BTOA 5AYVA 4I5DA 2ZB3A 1ENOA 3GG9A 1QR6A 4PLTA 3HE3A 3PP8A 2HAEA 2FHSA 4ZICA 1TLTA 4FJ0A 4AICA 2O50A 1U28A 4IQ0A 4R16A 3PXXA 2RCYA 3FR7A 3EGOA 3QQPA 1NXQA 4IGFA 2W2LA 1EE9A 1W8DA 1H6BA 4PRKA 1N7HA 2RH8A 3JQBC 2FMUA 5EJ2A 4KMSA 3RU7A 5A5EA 3QLJA 1EUDA 2ZCVA 1T1SA 2VHYA 3DBLB 2F00A 1ZMTA 5L7YA 1XA0A 3FR8A 2NU8A 4W99A 4BNUA 4RF4A 1QXSA 3H3JA 4GPD1 2ET6A 1V35A 2DBRA 3DOJA 3C1OA 1NQ5A 4OSPA 3DO5A 3AY7A 1NVTA 3CSDA 4PCVA 5MDHA 2AEJA 4E5KA 1LLCA 4U0JA 3H9UA 2OXIA 4YA6A 1E7YA 4KQWA 4WOJA 3P7MA 4N7RA 3DBHB 4TKLA 4I5FA 4BGEA 2Q1WA 3CMCO 4E4YA 3Q6IA 3DFZA 3ETGA 1X0VA 5B4TA 3PGJA 2RHRA 3S2FA 4R4JA 3IUSA 3RC7A 3Q2KA 4NBUA 1E6WA 4DMLA 4L9RA 4CMBA 4E6PA 4INAA 5C37A 3DOCA 2VYND 4GH5A 4ND3A 5CAEA 2R6JA 3ROPA 4D0RA 4CMEA 1H6AA 3A4VA 3KYDB 4Z0PA 1SPXA 2AE1A 1JDJA 2VTEA 2I3GA 3M6IA 3ASVA 4XYMA 4B7XA 1E7WA 4CM8B 3HZZA 3RD5A 2X4GA 4B3JA 4NJMA 4EUHA 2HU2A 3AUSA 2BF7A 5IG2A 3PRJA 4LN1A 2PWZA 1I24A 3FNGA 3UCXA 4J7CA 3AUUA 4WCDA 5KJ1A 1U3WA 3ZW9A 2ZK7A 4GX2A 4W7HA 5JDCA 1XWFA 1FK8A 2GPTA 4MP8A 4BNKA 3ULKA 1XU9A 4B4VA 1FDWA 3RC9A 1P1KA 4HFMA 3TPCA 3UICA 1YJ8A 4B3IA 5TIIA 3DHNA 2YV3A 3G79A 3L6EA 3C7CB 4XQCA 1JWBB 1IPFA 4CV2A 4BNMA 1Y6JA 3WB9A 4MDHA 4KZPA 1VM6A 4JROA 3DAFA 4IINA 1VC2A 4FR5A 4ITUA 1DIRA 5IXSA 4ZQEA 4MOWA 3MJCA 1XEAA 3BTOA 4UUPA 1U3VA 2IE0A 2Y1OA 4GLLA 1PZFA 3AFMA 4DGSA 5I7SA 1YB5A 2FP4A 4IXTA 4ZGWA 2Y1EA 1HTBA 2V7PA 1DJQA 5CEEA 1V3TA 1X0XA 3BMCA 1U4SA 3TOXA 1IY8A 3GDFA 1U7TA 3MJEA 5TS3A 3NJ8A 3TZHA 2HKIA 3LYLA 4EEXA 2E82A 3UN1A 1HYGA 2YYYA 3K5PA 3M1AA 1BXGA 4GBJA 1IE3A 3L4BA 1NWCA 5J23A 3EW7A 2HRZA 5CDUA 2E49A 4RVUA 1G0NA 2HMUA 1RM4A 4R3NA 3ONFA 2Q46A 2OBYA 2WYWA 3ZWBA 2X8LA 3UFXA 3BMOA 1GL3A 3JYLA 4R1TA 2EP5A 1OAAA 1ZH8A 2G82A 3UVEA 1JWAB 4LW8A 1IZ0A 3M1LA 4XJTA 2B35A 3R0IA 4MP6A 3TZCA 3GAZA 5IZCA 4I08A 3KV3O 2NQTA 2OMEA 1R0KA 1YOVB 1J5PA 2XOXA 3TOZA 3RROA 5IN4A 3AI3A 1NVMB 1O6ZA 2Q1SA 3LLVA 1Y81A 4IDGA 3ZHZA 4MP3A 2Y1CA 1B8UA 3AY6A 2CF6A 2AG5A 3BMQA 1I0ZA 4OKIA 1R4NA 1YVEI 4R1NA 2CDCA 3I3OA 4MO2A 2EV9A 3VH1A 4J3FA 4CR7A 3O8QA 1LBEA 4D7AA 3IAHA 2DBQA 2EW8A 4MIEA 4Q9NA 2GRAA 3FNEA 3PYMA 4QTZA 4UVDA 1LC3A 5CDTA 1MA0A 5ENVA 4XR4A 4MVJI 3B6ZA 3NYWA 4FW8A 3GZNB 4M1QA 2JFFA 3LF2A 5L9AA 4NNJA 1BSVA 3GG2A 3DZGA 3Q9NA 3F4LA 4EW6A 1E7RA 4D3SA 2J3IA 5CPFA 1YS4A 3TF5A 3TN7A 1TVEA 1V0JA 1YDWA 4GGOA 3Q11A 3WYEA 2ZTLA 4R3WA 4TZKA 4ZJUA 1E3WA 1MG5A 4HADA 3S2IA 4HUJA 3ADPA 5G0SA 4HBGA 3B1JA 4AJNA 1XR3A 4NH4A 1NX6A 1H9AA 2NQ8A 2X86A 3OSUA 4MVJP 4FOSA 5KVQA 5KJFA 5A9SA 3RC1A 4TVOA 1ZXLA 5CP8A 3PVZA 3DC2A 3RUCA 1DEHA 5B4UA 2DFVA 4K28A 1AUPA 2P5YA 2GN4A 5JAZA 4YT2A 2NU9A 3KEQA 2CNBA 4J1SA 4NR0A 5MGBA 3HN7A 4Z9XA 1DOHA 3GPDG 2OP0A 3S2GA 1YWGO 3BMNB 3NGLA 3LT2A 1ZSVA 3LT0A 2W2LD 3L07A 8ADHA 3L4SO 1PJBA 1Z82A 5TJ9A 1KVUA 3HDJA 2PZLA 3HB5X 4NJOA 4R54A 4BQRA 3AM4A 3SLKA 3VPSA 4EZBA 1Q0QA 4D45A 4YAKA 1NASA 5IZ4A 2Q4EA 4XDZA 2NVUB 2ZKLA 5AXBA 3PPIA 5THQA 4EJ6A 2J3JA 1B3RA 3ZV4A 1DIBA 3OP4A 4RF5A 1P3DA 4YT4A 2C29D 3F46A 5H83A 1U8FO 3UXYA 4PLGA 4EUEA 2WE7A 7ADHA 5IDWA 1BXKA 3F3SA 2IDZA 3H4VA 5C7LO 3AI1A 3QVOA 2JD1A 1YH3A 4BNYA 1MFZA 1GCUA 2D5AA 2AEMA 4J1TA 2PY6A 5DNAA 4ESOA 3OIDA 3ROQA 4WNIA 3INTA 3KYCA 4WOKA 4F46A 3G3EA 4RGBA 1HE4A 2FSVA 3OQBA 1F14A 2R2GA 2JL1A 5BT9A 1WLYA 2DKNA 1TEHA 2GD1O 5C7IO 5JC8A 4U0KA 1RM5A 3CINA 2PZKA 4XB1A 3VPFA 2VNAA 4NQZA 4GWKA 4IZHA 4XQEA 1E6EA 4XRRA 3L4BC 1LRLA 3L9XA 1AGNA 3FN4A 2JKVA 3HSKA 3ZWVA 3OF2A 3AOGA 1SCUA 3FI9A 2OORA 1YQXA 4CL8A 5FI5A 3GMDA 3WGYA 4QO7A 1NFQA 3R6DA 4LRSB 4DLAA 3OJOA 1HKUA 1PQWA 4HNGA 3ZWCA 1N5DA 3KVOA 1HF3A 3IS3A 3OJ0A 3QE3A 4Z0TA 1HZZA 1WNTA 1C1DA 4FFPA 3WTCA 4B4UA 2IEDA 4BO2A 1GYRA 3JQEA 1VSUA 3H2ZA 1EFLA 2JCYA 5KIAA 1LDMA 4FGWA 4IUYA 4WUVA 4YQZA 3NRCA 1NNUA 2AE2A 4J9VA 1C0IA 2NWQA 3DMTA 1XG5A 3TNLA 2E48A 4ZU3A 4RLHA 5TT1A 4MVJH 2QZ9A 1HDRA 4U7WA 5JAQA 1UJMA 1VSVA 3DZJA 4EUFA 2V6FA 3MCVA 1ONNA 4CQMA 1GUFA 1AHHA 5JW6A 2C59A 4JJIA 5A1TA 4CV3A 3U4IA 1MC5A 2LDBA 4P38A 2W90A 2Q4BA 1CJCA 4LMRA 1QYDA 2PD3A 4WLFA 5IZCC 1P45A 3WGIA 1NP3A 4LMPA 3AM5A 2Y1FA 5H82A 1YRLA 1OMOA 2C7VA 3WGTA 3GH3A 2ZYAA 3AOEA 4CUJA 4XRGA 1PJLA 2OOSA 4Y6PA 3EDMA 2Q45A 3E5MA 1DJNA 2JFGA 2P5UA 3I9MA 1DFIA 3GQVA 4KTVE 3WGOA 2B4QA 4KDFA 1N92A 5DP1A 1E3SA 2VNSA 4E5MA 4QECA 1KEWA 1YL6A 2Q1TA 4DA9A 3PIIA 1NR7A 1U5CA 1ULSA 1SEPA 1O95A 2ZTMA 4J2HA 3WLEA 2O3UA 2C7GA 2H63A 1LX6A 1MX3A 2UDPA 4J1NA 6LDHA 1TB4A 3I9KA 1GR0A 2BKAA 5F5LA 3AI2A 3KSDO 4U6SA 1OC4A 4BNJA 4XGKA 1PJTA 2YQ5A 4NFHA 4YAJA 3PFWO 2AQ8A 3OH8A 5CDYA 2QRLA 1GZ4A 3WNQA 3NV9A 5T6BA 2YZ7A 2PR2A 1HL3A 3LC7O 5KVSA 4L4SA 1UXGA 1YGYA 4CR6A 2HO5A 4LSWA 2J5RA 3TL3A 4BB6A 4BO0A 5ITWA 3JSAA 1C14A 3JQ8B 2Y66A 3S55A 4XYEA 4YPOA 1ZK2A 3DZFA 1C0KA 4GMGA 1I36A 5AVOA 4GWGA 2Y99A 1ISMA 5IN5A 1AXGA 3HQ4O 4QUKA 4C7JA 3E6AA 1O8CA 3T7EA 3VDRA 1DRWA 2I6TA 1ADFA 1SMKA 2WYVA 1J0XO 3ZV3A 1RM0A 5DOZA 1Q0HA 1VJ0A 1YBVA 1N9GB 3OMLA 4RVFA 3QW2A 4RZIA 1EUZA 1HDZA 4BNLA 1IOLA 2X22A 4MVJA 4ZA2A 3RU9A 2I76A 3EZLA 1YBAA 1Y9AA 3KZVA 4N5MA 1CEQA 2DTEA 3G1TA 3W1VA 4FC6A 3CZMA 3DAPA 1NTOA 2IODA 3KXDA 4YJFB 3IDSA 3W8FA 3D7LA 1GYPA 1IB6A 2CVOA 4ZD6A 3U9LA 3DMYA 2I5PO 4DPLA 3IJRA 1SZJG 1UDCA 2YHIB 4FBGA 4S3MA 1HDYA 2A94A 4CLRA 3DWFA 1IYZA 3DDNA 4G2NA 1RPNA
chains in the Genus database with same CATH superfamily
1H3FA 3FOWA 4HS9A 1P33A 1OASA 4CRWB 3GVIA 4WLEA 4KPGA 3UCFA 2RK6A 3A6JA 1MAAA 3CKLA 4UJ3A 5CFQA 4X92A 1A77A 2CCJA 3EFBA 2NX2A 6YASA 4YXFA 5AW5A 1L7PA 3DB2A 1ZG3A 4LSZA 3FVVA 2PM8A 2PYZA 1L4EA 4OLJA 4TXNA 3UJHA 1GIAA 1D07A 4X8HA 5IJAA 4KR7A 1H2WA 4RA6B 2B0CA 2CUZA 2FXVA 3MYYA 4F1JA 1RPJA 3TLEA 1NMXA 3ZS8A 2IIBA 4BU1A 3B5JA 4W9RA 1RBQA 1Y5LA 3RAPR 3LCRA 4IR7A 4FJ1A 4BWGA 5C1PA 4LYEA 2WICA 3PPWA 2CYCA 4LHZA 1OVMA 4E2XA 4XDHA 5JMOA 1R88A 2E55A 1D5WA 5GJWC 3IEUA 4DMGA 3VR5D 1Y4ZA 1OGYA 3F1KA 1GLVA 4AB1A 1T9CA 4LOJA 4UXJA 4XGQA 1QFYA 5K0GA 3NT2A 1KVTA 2QN7A 5LDHA 2B1RA 4DHWA 2OBBA 2CE2X 3BYZA 3HXLA 1QF7A 3UT6A 3ACCA 4AIIA 5JSFA 1IIBA 3IUBA 1GZ7A 2QVLA 3DT9A 3IPLA 1U5AA 2ZS9A 1JI3A 1CUJA 2VK4A 3FAKA 4EQZA 2J6CA 1J33A 5DM2A 3W3AH 2P9TA 4TTJA 2JBAA 3FHLA 3KRTA 4OY3A 4HX2A 1UAYA 2O3TA 1GT91 1V5WA 1W85B 4L5JA 4BBJA 4URXR 3H5AA 3D0KA 2IYFA 3ZVRA 3KBOA 1Y6ZA 2AV6A 2J7KA 5E8RA 4AMBA 3WL7A 3BBLA 3LA6A 1BQ3A 5I7WA 5D3MA 3H2GA 3GCZA 3VYRB 1JG2A 2UZIR 4Z3KA 1CKEA 1Q0ZA 4GQAA 4REQB 1M1YA 1YU9A 3WHIA 1LKZA 4N18A 3DZKA 4K26A 4CEHB 1UJ4A 2JW5A 1VI2A 5F1YA 2O8CA 4I2VA 3ECAA 1SM4A 2YWEA 4C0AC 4IY1A 4V0ME 3OX3A 3EPKA 2NUAB 1JQEA 4Q3BA 1B0ZA 4BLPA 1KAOA 1SHJA 1XMPA 1FFSA 1CF9A 1ZBQA 1HE8B 3OJEA 3T5CA 4LRQA 3GFRA 3LVBA 1X8XA 3U3OA 2B8WA 2C97A 1A04A 1MH1A 2QI9F 4TS9A 1RZRA 2WD7A 4U7TB 5CLQA 1YJCA 3T0IA 1Y98A 1PRYA 1Q50A 3PS9A 1U1IA 1Z38A 5ADVA 2OBLA 2WJJA 3S27A 4M1WA 4X94A 2Q9UA 3VNAA 4DAOA 4QL3A 1IRXA 3E7DA 4FFBB 2AKAB 2KM1A 3E4CA 4FCWA 2OHJA 2YMQA 3OA0A 4O4IB 3RKUA 2HT6A 4JD5A 4BO1A 1IWBB 3MJFA 2R00C 2HMWA 3A1UA 2A9OA 2W6ZA 3AY0A 3QVXA 2MYNA 3LWDA 4HNAA 4IJWA 1YQDA 1DCMA 1H8ED 5G4KA 1Z6TA 3IO3A 3F5SA 2ZR8A 4I8XA 1DT3A 1GUBA 3BC1A 4LF4B 3ACDA 2H9YA 3IIKA 3Q7IA 4DB2A 4N8DA 1JDBC 4I81A 3AP2A 2RH5A 4HN4B 4MVJG 3P2OA 4JI0B 5DK4A 1B8PA 1X3LA 1ESMA 3D81A 4QBTA 1NX9A 5E6RA 4DMRA 1EP9A 3BVPA 1EINA 3OCVA 3R77A 3SY8A 3V1KA 3FA2A 5J43A 3GARA 3R5SA 4YP5A 1ZISA 3IP9A 4HQFA 1YKFA 1ZNYA 4QOIA 2WVGA 1M5RA 1PZGA 4OQZA 2QT9A 1V3UA 1C9NA 1E7QA 3FF4A 1XPUA 4QQ8A 1OTYA 2GM9A 4FE4A 2O14A 4HRAA 1KAQA 3NHJA 2EKQA 3OOYA 4M8KA 4REMA 4GLOA 1QHGA 2DQYA 1IUKA 1XDWA 4IQGA 1QTRA 3OEHD 4PRLA 5DYWA 3CE9A 3LPAA 2ZROA 1E63A 2YIMA 5FLXA 1QJCA 2OYSA 2PL1A 3OJCA 4EJSA 1P2FA 1ECPA 2A57A 4TSFA 1QQAA 1SBYA 2QN8A 4R1SA 5CUQA 4GOND 1N2IA 2XUAA 4FOOA 4ZYYA 3GFFA 2EFGA 1CDDA 1G66A 4QYIB 1JJ7A 4HJXA 3SEZA 2Q41A 3N6RA 4E07A 5K3CA 3TUIC 3JQ8A 1SXIA 1TFUA 3G0HA 5B30A 2X41A 5G0WA 2FLVA 2XMZA 3CUKA 4ZEOA 1H0SA 4RSHA 3S7TA 4CIAA 2VUHB 2X3YA 1OLSA 1U80A 1JDVA 4DBVO 2A84A 1GN9A 2BEJA 3ADKA 1NN0A 1XL1A 3F6BX 3OE5A 4JBYA 3ZGNA 4D0GA 2PGJA 3SDBA 5CFZA 4L76A 1CG6A 1SCIA 2B98A 2Z8ZA 3AF0A 3PLNA 3GRPA 4XDGA 3WSVA 4AXXA 1W0JA 4PX9A 5EP3A 4MVJD 2BLLA 3ZDAA 1A8SA 1SWVA 2YVLA 3DBLA 3X2EA 1UOPA 3H8WA 4MZXA 4OHBA 4LYAA 2AMYA 5B3JC 4Q4JB 1ZMOA 1XPOA 4HEQA 4NK4A 5F4BA 2OBNA 4E33A 1KI4A 3KSBC 1LW6E 2B8JA 2OQVA 4TV8A 3E7FA 1A9RA 2J59A 4NABA 4ENSA 4GBMA 2XKKA 2ZUTA 1D4FA 3K0BA 2C7RA 1G8AA 5DBEX 3SAJA 3T3HA 5DVZA 3YASA 3EPLA 1FYDA 3S5UA 3E7XA 3IV6A 4IIUA 2IHUA 4RCZA 5COBA 3EVCA 3RFFA 1E2HA 4YR9A 1XQ6A 1U2DA 2GMWA 1T0JB 4N5DA 1ZN7A 2BEVA 3CO0S 3UAXA 5K7SA 5KNCA 2H9IA 3WYCA 2QN1A 1GNRA 3Q8XB 3X3HA 4K9RA 4W8HA 2H17A 4MKHA 3ES9A 1Z36A 1PGQA 4L50A 2X5JO 5TEWA 1OBVA 5F33A 3FFAA 4UUOA 2ZWMA 3TBFA 4F3NA 3PCRB 1L4LA 1JR6A 3DR5A 4EG4A 4QQFA 4ICIA 4A4DA 4QJIA 5DJ5A 4I1YA 4BNZA 4CIXA 5FX2A 1ISGA 1TU3A 1AQLA 2J4FA 4B3FX 3L4EA 3UJDA 2WMDA 2YDXA 2ZIUB 4PQFA 4HFNA 2RGGA 4YRNA 2XBMA 3OFKA 1J42A 4N5LA 5TF0A 1XROA 1KQGA 4C2TA 4AUNA 1VRCA 3HBFA 1CQWA 1LTHR 4IMPA 4DILA 3FNFA 5KC8A 2WZDA 4UNSA 4BUZA 2Y1DA 4E13A 3F5MA 3A1FA 2VPWA 2GS9A 4MPTA 3KPYA 2OFOA 3W1EA 3QVMA 3IL2A 4I9HA 3G49A 2MT9A 2BKEA 2VDUE 3HCAA 5CCBA 1E0AA 5F7XA 1KP3A 3OQHA 2CSUA 4G5FA 4KXQA 4C43A 4HXYA 2YNMC 4MQLA 4RMNA 3RODA 4ALJA 3LGAA 2Q0SA 3CVXA 3LPNA 2E5LB 4J91A 3EEYA 2PL9A 4RC9A 4R2LA 4YRSA 3C39A 2C4MA 3M2TA 1OLXB 5JS7A 1GNVA 3JCZA 4JHXA 4XPIB 4JI8B 1UPAA 4QU0A 3HY3A 3MJDA 5KINB 3WNVA 5CK5A 3FDJA 2JKYA 2A7QA 4CG1A 1ISIA 2W4QA 3AC0A 5HKKD 4GXRA 5FPKA 1SOWA 4EYGA 1E6MA 3GVPA 2FPKA 3OCZA 4BUCA 4PIVA 3H97A 4LJSA 3IE1A 3CR7A 1KBOA 2BFEA 3EYAA 2L0XA 2IY8A 3GFGA 5TX7A 1WRBA 4H3KB 1DGQA 4X54A 2NO1A 4TRMA 4L5AA 1GCAA 4Q4AA 3S28A 1T0IA 2VJYA 1JFFB 4WA7A 5EVJA 4BP8A 1QV7A 2QAGB 4NYMQ 1DIAA 3MOIA 3QP9A 5HRCA 4FSDA 1MXHA 3MIZA 5AOVA 4HEA1 4D4KA 2P1DA 4HTFA 4MI9A 4EY6A 2O8FA 1AQJA 2O8EB 4US0R 5AI0A 1Z2EA 3S8MA 2LZ0A 1BWQA 5JFOA 3UM9A 3WRWA 2HSJA 4FPXA 5DK6A 2W6CX 5AXCA 3WLQA 1ORTA 3KG2A 1E8MA 2VFAA 3JD4A 3QX9A 4XUCA 4O2RA 4OP3A 1IUPA 2WJHA 3IQEA 2FX5A 4GM0A 3SE0A 1LBTA 4XKJA 5IT0A 2YWFA 2W2KB 4Z7QB 3OKPA 2DR2A 3H7AA 5KOHB 3AJAA 1ISHA 1QGDA 3MG9A 3QMWA 1RKXA 4I6EA 2FE1A 1B41A 1US8A 2FK7A 2O23A 4IIBA 4K0KB 2O2DA 2ZQZA 2GBCA 1DI0A 1L3IA 1NU6A 2UZ4A 4C6SA 2OHHA 1KDZA 4QICA 1MPXA 1R0YA 1B8VA 2RHMA 3BA1A 3ZIAD 3G2IA 2UXBB 2QT0A 2ERXA 1QHHB 2GYUA 3OKCA 3E53A 4YRKA 4OJYA 1OU4A 3IERA 2HXYA 2AH5A 1F2DA 3OAAD 4AJPA 1NF2A 3DM5A 2BGWA 3P27A 1Z7BA 4C7MA 1RC0A 4YNBA 4BQFA 5KHOC 2C3UA 3IBTA 3NHPA 5DGCA 1G63A 2IF0A 3QLVA 4J0HA 2ZJ6A 5HK9A 3PKZA 4RXUA 5I7VA 2Z9BA 3GHYA 5KDOA 3MD9A 4WLOA 1GOTA 1T4GA 1VIDA 3K09A 4C4TA 1P0MA 5HPYB 5B58C 3OFJA 3V7FA 4CMAA 3DDOA 1HURA 3GY0A 1YL7A 4QG7A 2PUCA 5C8YB 3RC3A 3I4CA 4UAUA 1K5DA 3T3DA 4PYQA 1QLWA 4FYKA 1S8FA 5EJ6A 1JKMA 1CQJB 1QCZA 2FR0A 3V8QA 4S1VA 2EL9A 3P8ZA 1ZOIA 3LF1A 2OHIA 4UPVA 4TSKA 1ZM9A 2HA2A 2ZXFA 1GTMA 4BWFB 2DX7A 4NBRA 2XITA 4BO6A 1KEEB 1W4ZA 3E48A 3EIXA 1CFJA 3DUFB 2QMZA 2ZBEA 1PV2A 3LUDA 5EIWA 5IVPA 2O3QA 1U9JA 4PZAA 3MTIA 1O94C 4Q1FA 1ESZA 2REQA 5K1ZA 3T1NA 4C0HA 2DUWA 1B2RA 3WDLA 2ERCA 3A06A 4DEXA 4YRMA 4OGFA 5JAOA 2HDNB 1DRVA 1WG8A 1QH8A 5JSYA 2R7AA 3GJTA 4AJ9A 2H1FA 4X1IA 2G40A 1V43A 3R7LA 2PUDA 2HWXA 5FTLA 2BM9A 2YOGA 4H3HB 1TUBB 1MBZA 2PMFA 4UDXX 2FEXA 4XWYA 3EJ6A 3WHLA 1XCPA 4KL8S 4JIGA 5A6SA 4LDZA 1QKKA 1H4VB 2D0IA 2EIHA 2JAWA 3C6MA 3FG9A 5LJLA 1DAGA 4FD2A 2KBFA 2AC2A 4IO0A 3ZXYA 3NBKA 3O26A 4IJQA 2OYRA 1EB9A 1JQDA 3TFOA 1OXMA 1WUIS 2B0JA 2WNSA 5E1MA 1MNQA 3U31A 2QM7A 1DAKA 1UK9A 3KFLA 4WE3A 2JZNA 2X9NA 5BSHA 7YASA 5C53B 2ZJ0A 3K5HA 3ZQ6A 1V95A 2VYCA 3R5XA 1DJLA 4PBSA 2X9VA 2GEKA 2IPNA 5JD6A 4LXHA 2P1ZA 4F60A 1L0BA 4GE0A 2JHGA 2RC6A 4JQCA 5FTMA 1NNI1 1V16B 2H1HA 4ZMBA 3P9XA 5LD2C 1P7PA 4EA9A 1N3BA 1CWUA 3UGJA 2ZJAA 5AOBA 3VJKA 2FN7A 2GEVA 1ISJA 4LF5B 3WBBA 3HR8A 1YZGA 4B8WA 1IAVA 3M5PA 2YKGA 5ALGA 4Q1CA 2ENWA 3I1FA 3G0CA 5TR9A 3K2IA 2CMFA 1YZUA 4YH1A 5L40A 4CDMA 1NQWA 3GLRA 1RAHA 4X3CA 1GQRA 4L9SA 3AG6A 3W2GA 3U3MA 2YL2A 3Q3EA 5IKEA 1SU4A 1D03A 1CZNA 4FMDF 2BUBA 4G9EA 4NXNB 4HNVA 3NAGA 3EB9A 3OPMA 1T6ZA 1OOEA 2PNJA 2QP3A 5DNWA 3E81A 2P9EA 2ZRNA 4JJKA 4N3AA 2ILTA 2FMKA 1UBHS 3KDAA 1Q6ZA 4PGFA 3P0IA 3SYRA 1G8SA 5JSQA 4L8VA 3TQFA 1NVXQ 1P9LA 3T61A 3FJOA 4MEJA 1L5NA 4YUZA 5K0TA 5DBGA 1ACLA 1T8SA 2EC5A 5FL3A 1UXOA 4F9TA 2VJCA 5F9FA 1GTG1 5D1NA 4OHVA 5TPZA 3RDPA 2JEYA 2WU0A 5KJEA 1XVLA 3KKNA 2ZRLA 3D6MA 3KEFA 4BLRA 1ZL0A 4HXGA 3V4OA 2IEAA 1AQUA 2P40A 4EARA 3KHUA 1X42A 3JYNA 5BUQA 3K73O 5BSVA 4NESA 5HFJA 3ZHCA 1NQVA 2IBTA 1GG5A 4W9NC 1A4IA 4U00A 5J2UB 3SF0A 1E9AA 2BFFA 2H2DA 2JJ8A 3I34X 4NCHA 1W0CA 2A1IA 1II9A 5G02A 1KMIY 1CUBA 1WQ1R 3W0LB 3VISA 2SHKA 1YQTA 2X5KO 3QELA 4N8SA 4RSGA 3IKLA 3OCUA 4F6CA 4MKFA 4DLXA 4FSXA 3UATA 5A4AA 2HJVA 3TLMA 1E0DA 2N3ZA 3BIJA 1GFWA 1I9GA 2N1MA 1ORHA 3LGSA 3GUYA 3LHKA 2FWAA 2PGNA 4OB6A 3SZLA 3WK8A 4B2LA 4M22A 4ZOEA 2AB0A 4CT4B 1YZQA 1NVDA 1T2FA 2WJ3A 3AR6A 1NMEA 4MAFA 5HW0A 1U1FA 3HNOA 3DAGA 1QIEA 3M6MD 4F4FA 5L4SA 3LCUA 4TS1A 2R1TA 3AX6A 3CGGA 3G1WA 4QX6A 1KS9A 2QD2A 3M6WA 1NQAO 3Q4GA 3PFNA 5ECDA 1XLUA 4CM7A 3TBKA 1GU1A 4X41A 5E4JA 1IXKA 2R8EA 3B2QA 5KVVA 2G09A 3KTFA 1NUAA 2CFRA 3JQFA 4GUDA 4V39A 3VR2D 4C22A 4AN4A 3SEAA 4L4YA 3TLGB 1HEYA 1PTJA 1U04A 3GH1A 4XOIA 3B51X 2W42A 3IJPA 3BHIA 4FFMA 3JQCA 4LZPA 4E2WA 4WNAB 3HK2A 2FEWB 2ZRIA 2R1TB 4DCJA 3TTTA 2XR1A 5AICA 2D1FA 2QSJA 1PBNA 2B8EA 3CLTC 5FORA 9LDBA 2ZZNA 3OT1B 3PICA 1YB7A 2FSPA 2YZGA 2DT5A 2EGHA 3DQPA 3GMTA 1X1CA 3ZD9A 1U0BB 2IYLD 4M9RA 4JI3B 3P2KA 4KPFC 2WTNA 4XLTA 2JK1A 4RHEA 2O3JA 4MUFA 3S68A 4CEJA 1N8SA 4QJBA 4LX8A 1NRJB 4JVNA 4RA9A 1RI5A 3PPVA 3W3ZB 2O2YA 4PX2A 3ZQ4A 5B5SA 2JDID 4YP0A 5EIEA 4ZAWA 5GONF 1OX5A 3OHPA 4PLWA 5CJ2A 4E7OA 1ADGA 1EK1A 5EINA 3K70B 1TYEB 4PC7A 4XCVA 2YV4A 3I61A 5F1OA 1VLJA 3BXHA 3IBCA 1CLUA 3E7WA 2RJOA 1HQCA 1P60A 1XEWY 2O06A 3U80A 3VHRA 4TKUB 3FOFC 5DNEA 1KSGA 1EX7A 1T8WA 3FFXA 3LK7A 1JHMA 1CXZA 3VOSA 3VHXA 1YMVA 4XYBA 4H15A 4GDFA 2OM2A 3AHHA 3BXGA 3AV0B 4DM4A 4X62B 4II3A 5CTJA 1GQQA 1FSFA 2DP4E 4RPGA 1LU9A 2VJLA 3BIWA 2ZWPA 3R3JA 4V24A 5JASA 4ZXPA 4CLEA 1X9GA 3RF6A 1XRLA 2IS2A 3HWX1 3EVZA 2EG9A 3CRNA 4KFCA 4Q4DA 4FFOA 1LVHA 3HFRA 4YV7A 4N9WA 1NM5C 2WD9A 3CHYA 3VMFA 3ORYA 5TC4A 2HIGA 2RAUA 3AJ9A 4IS2A 4I4TA 4ZVSA 4WACA 4YQFA 3T1HB 3CVJA 3OG9A 1FMCA 1MLDA 2V74B 3C3DA 3EAFA 2OD2A 3IXLA 3O38A 3ZJUA 1E1RA 1NHWA 1OUMA 3NBQA 2Y76A 4KQCA 5JD5A 3R5JA 3TD2A 2MR6A 5L3SB 2J31A 3ZJ5A 1CUWA 1M2OA 1W47A 4CCWA 1T4CA 2Z9CA 5DCLA 3EJWA 4J3NA 5HRUA 2E6KA 1D6MA 4XB2A 3U44B 3EXFB 2D00A 2CZCA 2G7ZA 1M0WA 1X1AA 2Q6KA 2VYVD 4NWIA 4TYQA 1ZKDA 1O6BA 4X20B 5BSKA 3ZXXA 2QBYA 3AU9A 3KQMA 1RE1A 1JX6A 4GKAA 4G23A 2WUDA 3AUTA 4CMHA 4RVSA 1V4VA 4DB4A 4JB0A 2DFKB 4RD0A 5JYDA 4QXMA 2IX3A 3KT3A 1ZRHA 1VCOA 4UBLA 1FOEB 3GLUA 1DP4A 4RWZA 1AMUA 1EGVB 1F8GA 1FTQA 2WNHA 4GLJA 4M0MA 2DC1A 4UVEA 4OB7A 1WAMA 4XGIA 2FN8A 4BFWA 3TDKA 1WZCA 2ZB4A 3D6JA 1ZOLA 3SE7A 3VX3A 3OM8A 1D0SA 1LSSA 4HVAA 3CSUA 3R44A 2NU6A 4QBHA 3UOGA 2QRVA 1M33A 1WB5A 2OWEA 1VG0B 3AW8A 3RB8A 1Z26A 3FNQA 4MI3A 1GAQA 3HCDA 1UCFA 2ASEA 1WXEA 1PNVA 2CHUA 4GAEA 4JX8A 2L69A 1J4AA 2LXNA 4ER5A 2QENA 3RBAA 3RUIA 1T13A 3R8FA 4LHYA 1R5OA 3QENA 1EPUA 2Q21A 1C1HA 1E1LA 1Y8CA 1DAFA 3BHMA 3Q5EA 2B92A 3SPXA 4CKEA 1P2DA 3N05A 3UWDA 3CGWA 3ZGYA 5AI5A 1PCXA 1PWZA 2FKAA 3DLCA 2F1RA 4HTFB 2O8FB 1C9KA 3BL5A 1SVNA 1DDOA 4HNHA 2Q28A 2ODPA 2GZ2A 2IUUA 1HEIA 1SCAA 1N2JA 1Z4QA 3OOWA 5KU1A 2MSWA 2ZB7A 1IBCA 1KBQA 4JJAA 4B3SB 4M0PA 1JJBA 3UFBA 2O4UX 4ALNA 2WKQA 3K0CC 1AKTA 3L8ZA 2VOJA 1WLSA 4YMUA 3HPQA 3REQA 1Y8RB 4WK0B 4XVCA 4YUWA 1ELOA 3TDMA 1ND6A 1P6UA 2BLNA 2WMYA 3H1BA 4J7UA 1V8FA 2J33A 1M66A 3NATA 4EATA 4D0LB 3O03A 2GZAA 4XWKA 1C1XB 1UUFA 2X8WA 4QNMA 4L7QA 2OBMA 4I5IA 3I2YX 3CLUC 1NOKA 1EBUA 3PFFA 1OXKB 4X44A 3C1TA 3KXIA 4IMRA 3VQTA 3K0AB 2CVQA 3LW8A 2GZSA 1AKMA 2ILVA 1YRQA 4OHZA 2J3HA 4AY6A 1SCQA 3WKEA 1E94E 5CJPA 1JMVA 1V8PA 1OE0A 2FW0A 3BWYA 5ESDA 4YCCA 2ZJ5A 4E08A 5BP7A 3DLTA 4RVHA 3TZKA 1JSZA 3ENZA 1TLFA 3CT4A 4IOKA 3E8MA 3DWGA 4KR0A 4ZALA 1QFZA 4X60A 4JC0A 1FMTA 4JLMA 1IVNA 3EFOA 3VPXA 1OBHA 4KXUA 2MWMA 2SBTA 2UYQA 5AHRA 3DFKA 5LZ7A 4DDVA 2B4KA 5EAIA 5JXGA 2Y1KA 5G4KB 1RJ9A 2DUJA 1YS7A 4GNKA 1GA6A 2VLIA 3F2IA 4K05A 4XVHA 2PYIA 2XX3A 2IDKA 2XQJA 1NBME 3JQGA 4JR0A 4QASA 4TV9A 2CL6X 4GPAA 5FFFA 1P2VA 1AXEA 2GN8A 3ADOA 3OE7A 1G20B 4KUGA 1KI3A 1PR9A 3GDGA 3H3FA 1CJSA 4PHTA 2PFGA 2PX0A 4WH0A 3SJBA 2ATVA 5B64A 1P4SA 3PC2A 2UUPA 1PFGA 2CFIA 5LFAA 1GNSA 1JPVA 3WFJA 4D44A 1ECGA 3ERCA 2HSDA 3J80A 1RAAA 1BEUB 1XTZA 1JJFA 5EWJA 1E1QA 4BNHA 2GZMA 1GYQA 1KDPA 1PGOA 1P2TA 1Z13A 3EY4A 1SPBS 3L93A 2D7DA 4K2AA 3P45A 1Q7GA 2H18A 2XDAA 1NLYA 4ESVA 4J0FA 2UXCB 5IKXA 3O8OB 4MJ7A 1WABA 3QU5A 4IV8A 4Q4CA 3ROXA 1QFMA 1M1YE 4HQOA 4LHEA 4BTLA 1UJBA 4NAUA 4FXOA 1RZ3A 2W2OA 3UC9A 2B5VA 1JJAA 1O5IA 2RB5A 3ZWOA 1RZUA 1HRKA 3UWKA 4FUTA 1QSGA 3AVVA 1GGNA 2GZRA 1IQRA 3Q5DA 2C88A 2XYHA 3QXXA 3T9EA 3S1SA 3H9EO 3K70D 1XJWA 4O4JB 2EX1A 3D4OA 1OA1A 1VE6A 4WFJA 1Y3CE 4Y9DA 5D85A 1KRWA 4ZI3A 4H4CA 1PS0A 4HLUC 4RGYA 2GO1A 3D3EA 5EGNA 3BWXA 4Y0VA 3CH7A 3PGXA 2WAMA 5AJVB 3NIGB 4DLUA 1T9ZA 1YXMA 3IQGX 4ZFNA 2HA4A 4JJ7A 3L8FA 4BVHA 4UREA 3QKUA 2F67A 2PMCA 2V59A 1YDGA 3HB4X 3LQQA 3NEAA 3OWHA 1SVSA 4M86A 2OLKA 4AKEA 1WXGA 4DY6A 5FOSA 5TVGA 4NC9A 5D3QA 1R00A 3BS4A 5EP1A 4BOYA 4EHJA 5A05A 1EMDA 2QVZX 4B6FA 5DLDA 4PGGA 2JIOA 4C3VA 5JVDA 1QH8B 1CJMA 4MS4B 5CX4A 3H9QA 3DGEC 3KC2A 2CXPA 1I80A 1P3JA 4KQ2A 5GM2A 3VMMA 3ZNQA 4D4IA 2OCAA 2ZUEA 4FOTA 1MFPA 3IEIA 4K1LA 2Z1DA 3DZIA 3L7OA 4RIGA 1SOUA 2F8LA 1DFHA 3WV4A 4MYRA 2F4NA 3WGUA 2I0FA 5B55A 1AIPA 2P6UA 4G07A 4J49A 4RH0A 4G5QA 3RRBA 4G63A 5AVXA 5DCWA 3VVCA 2WZBA 3FPSA 4OXQA 3SGLA 3QHQA 1OIXA 3L7LA 4N12A 2JIZA 3KT8A 3MERA 3DEIA 4ISCA 5AM1A 5KYYA 3LYUA 2RK4A 3KPUA 4ZT7A 3ESAA 2F1IA 2EFHB 3O9VA 3PEFA 1WCIB 1SR8A 2VPXA 3IQWA 4J16C 4LZZA 1C7RA 4TMFA 3U4HA 2W98A 2X2EA 5FCDA 4GOMD 1Y7IA 1OY1A 2F43B 2AOUB 4H1TA 1U1GA 1WB9A 5FAXA 5I7FA 4QEDA 5BPHA 3Q3HA 1K3UB 4LVNA 3ZU6A 1LC0A 1J49A 1SVLA 1WA5A 4RKEA 1CZRA 4BVBA 4DANA 2GD6A 5HMLA 2F3SA 1ADYA 3PHBE 4E51A 4EMTA 2XZOA 1XKQA 3WLFA 2IZ5A 1SUFA 2KBEA 4LMBA 5K8JB 3KPVA 3VDMA 5SV2A 1QK5A 3SK0A 4K9MA 3T7AA 1ADBA 1XJ5A 2O9JA 3DQZA 1IQ0A 1P18A 1TK9A 5DGTA 5HKKA 1EUCB 3D3KA 3KYIB 3CVOA 3LTEA 2ZBRA 4B6QA 2WUVA 5K0EA 4IP0A 4KGZA 1YRAA 5C3MA 4BO9A 5I9MA 3IFSA 5FO1A 4ZZ3A 1L9XA 3EXG1 1O0BA 2RSLA 4DABA 5BN4A 1EVYA 4LZNA 2Y0DA 5LIPA 4OYRA 1TADA 1T0PA 3TVDA 3FNRA 2HNKA 4Y8VA 4A6EA 3GJ0A 5CYPA 2RGWA 1RWMA 1FP4A 4WESB 1Y3FE 3HABA 3HPRA 3SFVA 4C0KA 1H4TA 5HUJA 2ZPAA 3EUWA 4HX9A 4PFSA 1O89A 1W581 4WXHA 5AJTA 4D0SA 1KVQA 1OCEA 3QY9A 4O1HA 5BW8A 2JLUA 2V54A 1K08A 4BTVA 2IY9A 3E9RA 2O1EA 1L5FA 5JJBA 1RLTA 2AXEA 5T6MA 1XF1A 4BVKA 4HXFB 3MUOA 2R48A 2VATA 3EWNA 3P94A 3T4EA 2XHEA 4IHAA 1RBYA 1Y80A 1MGOA 3P71T 1R27A 3AY3A 4QOEA 4OBEA 2Q3JA 2BFEB 3ITNA 3KJQA 4ZTBA 3TXAA 1WM1A 4HRYA 2PH7A 5ALRA 3WJ1A 3EBPA 1MB9A 2R6CA 1DCKA 2J85A 2DPGA 5IJWA 3L6BA 3KFXA 3D6NB 1MB2A 1C29B 4N1AA 5DBHX 5AKLA 4YJ3B 1VCHA 3NIFB 5E6RB 2OQ2A 1BOOA 4UCQA 1BHO1 3AILA 1VFNA 3KUKA 3TOVA 3SXPA 4WK2B 1R0XA 3WKBA 1KY2A 3IX7A 4L72A 4MRRA 2WIFA 4L4RA 2B3TA 5TDHA 2LD4A 4LK3A 1ZPDA 4AX4A 2W6MA 4RU1A 1N6NA 1L7EA 1B3BA 2A9KA 1J56A 1DDIA 3WJ7A 3D6FA 1MRNA 2EFJA 1OZHA 4DSAA 2D0OB 3WWOA 4N6OA 5JAIA 3W4IA 1XGKA 4XXHA 4BMDA 1M67A 2OLJA 3OPXA 3BXXA 1E2DA 3O84A 1NNEA 4EI9A 1X7ZA 3LDHA 4X45A 3RGWS 2DLDA 2C9CA 2I4OA 4M1EA 5F3RA 4DTIA 2VUUA 3A36A 3H2HA 3QH4A 4GP9A 4OXYA 1GADO 4HTAA 4IX9A 3MT8A 4MLDA 1NI4B 1LA2A 2JCSA 5THKA 3V80A 4DL9A 4ITRC 2QORA 4PZDA 2QJWA 3OC0A 3IEXA 3D02A 4IFBA 1FFYA 4I3HA 3PLRA 3ZNPA 1DB3A 1RJGA 1VL2A 3ANTA 4ENTA 2OEPA 3NLLA 6ABPA 4DR3B 1EVQA 3GN2A 1D2HA 1SB9A 1PSZA 1P4RA 1W5EA 3ZV5A 5DCYA 1UP7A 5IJ9B 3U61B 1P7WA 3NJ4A 2P35A 3ESYA 4PYNA 2ORWA 2J3DA 3HRIA 1KDRA 4KGXA 3O8DA 2P30A 3VHXB 3L4JA 1K89A 5ILGA 4AL4A 3CF6R 1Q19A 2HA6A 4OATA 2RIRA 1ODCA 2BJVA 2YHIA 3CMMA 3K4PA 4U6NA 4F5WA 3HVKA 1V7ZA 1S8AA 2PWYA 4E5NA 5CW1A 2DH5A 1VL0A 3OO0A 1FZTA 2Z4SA 4A73A 5AVZA 3BXPA 3SJZA 3R7AA 2J6BA 1IY1A 3D31A 5JC1A 3A1NA 3HS3A 5DN9A 2FPOA 1DC5A 2PA3A 3ABIA 4ND5A 4I55B 2OQRA 3CNQS 1FDRA 4EK9A 3MQ4A 3RG8A 1NPDA 2OORC 5E0KB 3V7YA 1TDJA 1Q74A 3CLUD 3E58A 5DNCA 1EIWA 1P0IA 5C4GB 4PCLA 1VHQA 4BC1A 2C2WA 3JYQA 4JQZA 4C7KA 2YOFA 4DLZA 3N39C 3ICWA 1YFZA 1QHSA 4GU5A 1QH1A 1N9GA 1RXVA 1Z5WA 3NHBA 5EG5A 1NBAA 2NG1A 3FVWA 2JVJA 4FKMA 4UFOA 4V3BA 4LVUA 4XJSA 2UYYA 1QYWA 2QJFA 3Q8WA 2HK7A 3EEQA 3E18A 4M0LA 3ZU4A 3U44A 1Y6QA 3RHSA 4NHOA 3STYA 3RVDA 2FEAA 5CGZA 4J90A 3KM0A 1Z7EA 5ABPA 1EJ6A 1YJXA 3GO4A 4PR0A 1Z06A 4BCBA 2OAGA 4KX3A 4D9IA 2GJ4A 4ZQCB 1BKDR 1KJ9A 1MORA 3HDYA 4NZOA 3P5BA 4B84A 4Q5IA 4PC3A 4HH0A 3RRZA 1SA0B 2NZVG 4CMKA 1X2BA 2Z04A 1WCXA 1XMVA 4FYHA 121PA 3FZNA 4DMKA 3DXYA 3Q1KA 5K09A 2H4JA 1LJLA 3U4QB 1EFDN 1OD6A 3VZDA 2M32A 3F47A 3F4BA 2FPWA 3EY9A 4A5OA 5JJCA 4YRCA 3LQ1A 3RANA 1R4ZA 4DT1A 5KJCA 3UB4A 3L0IB 4US2R 1AV7A 1Z8DA 2CNWD 3VOBA 4F4DA 1P9NA 4RIFA 2VJMB 4YYZA 4NPCA 2VAVA 4RLSA 4AMZA 4MW7A 1ZMXA 1SUIA 3KOOA 3W8RA 5HZGA 1OYWA 1BYUA 4JODA 2A30A 3HHPA 1XZBA 2OCDA 4TRJA 4BLOA 1H42A 3T4UA 3PGVA 2BSQA 1LVUA 2ADOA 2AMLA 2CUTA 3EZNA 5TQJA 1TOAA 1IY2A 3JQFC 3DBVO 3FUCA 4AD8A 4S24A 2C42A 5ADHA 1VJGA 1VE1A 3SVZA 4EAAA 3AEYA 4B4OA 3ZCPA 4DPMA 5EIBD 1XDUA 1COWD 3O91A 2P8SA 2WWGA 1PJAA 1SHZA 1YQEA 5CVDA 3SQWA 5P8WA 3C8UA 9ABPA 3JVUA 1RDFA 1IJEA 1XK7A 4MWCA 3OY2A 5CX1A 1E1KA 3RKRA 3CYFA 4QZVA 2QZJA 1YRYE 2YJ3A 3QUSA 3ZD8A 4DCOA 1GPYA 1KOJA 3KAKA 1DBPA 3N8KA 5G53C 4ZEXA 5ICFA 4GEKA 3NBAA 4POAA 3QVVA 3RV4A 4F4IA 4ALIA 1SEVA 4ZQGA 3ZHRA 4ZV9A 1UPFA 1PJQA 2JI9A 4Q02A 1JR4A 4EHFA 1TZMA 5ES3A 4LZOA 1IEXA 4AJHA 5JANA 1CY0A 3ORFA 4OL0A 4Z4FA 1V8OA 2C5GA 4RQUA 1T9HA 3TXXA 4KI7A 4ZMSA 1UAGA 1ODKA 4IF4A 3RSHA 5C8VA 4B7ZA 2R8BA 3PEEA 3I52A 2OENG 4ZEVA 4GVPA 3IMFA 1SU6A 1DOZA 2X6TA 4Q34A 3WIUA 3L8MA 1MAWA 1XNGA 2F8SA 2PFSA 3MCZA 5K6RA 4RVNA 3GCDA 4QEZA 4UFPA 2BBOA 2NTVA 3GJSA 4D8VA 2HREA 2NUPB 3UT5A 1EVLA 1QGUA 2QMHA 2FUNB 1Z0UA 3BSWA 3KKKA 5ER9A 3UYKA 4D3FA 2QZZA 4WCFB 2VDRB 3FPHA 4D2IA 3LVFO 4R8KA 4JLUA 1KOLA 4MB6A 5GJVC 2YJZA 4HWPA 5LVAA 2PU7A 3FDXA 1QIKA 4PBTA 4HB0A 1W0KA 2HEIA 1SURA 1M34E 1TJNA 3C1AA 3A1EA 4Q66C 4RM3A 3SYNA 5JNUA 1NR1A 2EF1A 2Y8EA 3TCKA 1I3NA 4L2IB 2YY5A 5A4MS 1DIHA 2KX7A 2OV1A 3BMNA 4NU6A 2X2OA 5FQNA 2NSLA 3TG2A 2C4KA 2H1OA 4L6CA 4Y18A 2FSSA 3RHTA 1IB0A 4ND7A 4HC4A 3K92A 5J2UA 3EXEA 2G7MC 1Z8NA 5AIBA 1N5LA 3F97A 4PZCA 3HUDA 1D2GA 1P5FA 2DFPA 1F8FA 3JAKA 5CEJA 2GF9A 3QRWA 4O63O 5B1HA 2CB0A 3L0YA 3AEKA 1I1HA 3EC7A 1QX3A 3BN3A 4AO6A 2PQ6A 1N5MA 2JFYA 4D6YA 3E22A 4R2IA 3QWHA 3ZDRA 4DNQA 4UVGA 2JCVA 5EXDA 1E9SA 2YNMA 3R3HA 2PKQP 4ZYTA 1WCWA 3E27A 2V7GA 3O8OA 1G8FA 3OZWA 4RA9B 5E9AA 4DDHA 2H4WA 1ZITA 1GPH1 3LSYA 3CIFA 2J87A 2WSMA 3B6MA 1H5QA 4Q3CA 5JJ5A 1J06A 1DTSA 2PD4A 2VQ3A 2IELA 4WK4B 2AYZA 4YAEA 4Y2YA 3AB8A 2RGYA 4BCCA 2FN3A 3MUEA 4G5OA 1T3LA 5FB3A 2ORED 2Q99A 2ZUDA 3ELBA 5THXA 2NU9B 5FI3A 2GEJA 3UAGA 4JXZA 4U8HA 5LLDA 2R8RA 2X7XA 1IN5A 4M7PA 3KEGA 4PXYA 4GKJB 3BULA 4LC9A 4B5KA 4W5WA 4QM7A 5SZKB 5DB4A 3G6KA 3W5IA 1ML3A 3OQ1A 3SXJA 2ETVA 3C3KA 1OYVA 3RGGA 2PGAA 2PRIA 3VH4A 4FGUA 4H18A 1Z56C 3EEBA 3HZRA 1M6WA 1JHRA 4IUBS 3PKJA 3VR4A 4DR7B 2VSQA 1EHCA 4H7EA 3TOCA 5EJ7A 4QTUB 3IPCA 3DNFA 1ST3A 1QQ7A 3IPRA 1FF9A 5CVEA 3EGIA 1ZC4A 4WBNB 3H84A 3KJNA 1E7SA 3JWGA 5FV7A 4MWTA 4I4TB 2V6GA 1Z6ZA 3L7KA 1UZMA 4MRMB 3E4DA 1WV1A 4QBIA 1PWEA 4D46A 1T35A 5LYJF 3OFVA 4KACA 3UG7A 3VR0A 4U39A 1O08A 2UYOA 3OZGA 3WI7A 3B82A 4W4TA 1O1YA 1ZN2A 4LWZA 2VHCA 4URUR 2H0QA 5AJHA 4KAFA 4MAAA 3ZJYA 2VSYA 1KOGA 4TYWA 3S3TA 1MEJA 4FSHA 3ZVMA 1OU0A 1A8UA 1SAYA 1HDCA 4OFXA 4AUMA 3LT1A 4ESHA 4HYEA 1JVBA 1GPAA 1S3SA 1WDWB 4I55A 3MUFA 4TLLB 1AJEA 3O4JA 4WXMA 2BFAA 2EKLA 2A9PA 5AVTA 2I7VA 3IJEB 4CMIB 1H6CA 5I9SA 1MB4A 1D1PA 2GXQA 2XMPA 4LISA 2YXBA 1F4VA 2YYZA 4CQMB 1EG7A 2X9GA 3D7NA 5B2ZA 2YJGA 3P2IA 5J9FA 4AY4A 2QXTA 2Q5JA 1XTTA 4O5OA 4CNQA 5CITA 4LJ7A 4HL6A 4MHOA 5FUYA 1TGVA 1R5NA 3AONB 3FI0A 1BE0A 2Q7DA 1YBMA 1PNOA 3P9NA 2VI5A 4O2BB 2D1TA 2H08A 3WSWA 3PIRA 5B3JA 2C4NA 3WX0A 2SCUB 1A5TA 2I29A 1J7JA 3RSZA 4B6SA 5ITZB 3UQZA 4C4XA 4N01A 4AJOA 3WAKA 4G2TA 3F6CA 3G2HA 1Y1KE 2EYUA 3C3CA 3DZHA 1JLSA 3AR2A 5HM8A 3BICA 4BDTA 1ADCA 1KK3A 1E5XA 2GRJA 2H1VA 2YVUA 2YXEA 1XEXB 2VF2A 3D8RA 4LE2A 1OPRA 4M37A 4E3WA 1O57A 4GR5A 4PIMA 1R4MB 3QPCA 4ROTA 4PR3A 4XPIA 3GLFE 3KZCA 1G98A 3UIEA 2QW8A 4YMWA 2A0UA 3F3MA 3AJRA 1P1RA 1MENA 1FDIA 1H2BA 2FEMA 3P2YA 3DNMA 3PDHA 4M8IA 4M46A 5AK0A 3RASA 2RHTA 5LZ8A 1Y0BA 1X14A 1NUHA 3T1TA 1CRWG 1XZJA 3E9CA 3GT0A 1T3TA 4U5XA 3T5AA 4FGLA 3WIOA 5L3ZA 2WTMA 3T8YA 3A4MA 1G5IA 4PZLA 5I8PA 5IVKA 2REXB 2OYCA 5CEFA 1GV1A 5TJHA 3RG2A 4QM6A 2ADMA 2X1HA 1Q0RA 4K46A 1E60A