4CM8B

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 91
structure length 251
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm8B00
1U8XX 2G76A 1EMDA 1R66A 4INAA 4WOKA 3S2FA 3UAGA 3UFXA 2Q2QA 4KDEA 4BGIA 3BTOA 1EVIA 3VHRA 3FNEA 4U0JA 4XYBA 5TJHA 1RM3A 4TSKA 1N92A 1T2DA 2OO5A 4BO5A 1LRKA 3WGZA 2NTJA 4D0SA 4W9NC 4BNUA 1J5PA 1PJTA 4EJ0A 3ZN2A 1M76A 5BSEA 1SOVA 1C1XA 4WJZA 3TN7A 1NPYA 5CFZA 1R15A 3B1JA 4IDCA 1LDYA 2JJYA 4AJEA 2X9NA 5C7OO 1KBZA 3EVTA 2OBNA 4C7JA 5AXAA 2C82A 1H9AA 4PRLA 4KUHA 1EEHA 1EBFA 4BMSA 3DBHB 3E8XA 8LDHA 3JQ9C 3FNHA 5EQFA 1B3RA 3UOGA 4XRGA 4WASA 2GASA 4ID9A 4RLHA 1G6KA 4NI5A 2JCXA 4MIEA 1NAIA 3OICA 4PCVA 4BO1A 4C7KA 3O03A 2CD9A 2NWQA 1E0DA 1KEUA 4I08A 2PA3A 3HB5X 1W4ZA 3F1LA 4YAJA 5HTOA 1T26A 2O3QA 1ONOA 3QWFA 4RF3A 4RORA 2PLAA 1PJLA 3IDSA 2PGJA 4J4BA 1JVBA 3SXPA 3ZU5A 3G17A 1IUKA 1KYQA 1ZSNA 4IDBA 2NTNA 2VNSA 3HDYA 3CE6A 5IF3A 3CINA 1DRUA 3P7MA 3GR6A 4PLGA 3K30A 1HEUA 3QV1A 3U49A 4YJGA 7ADHA 3DAFA 2OMEA 3OJFA 1SEVA 3JQAB 1U28A 4E3ZA 1BW9A 1WDMA 3DDNA 1HDZA 2Y99A 2R00C 4M86A 5IG2A 5TQVA 4GX0A 2OXIA 4F3YA 2D5AA 4DGSA 1KC1A 4J9UE 4R5MA 3TZHA 5I9NA 1R4NA 5JCXA 3NGXA 4NDNE 2J6IA 4I5DA 2FPIA 4EEZA 3QP9A 2HSDA 5F5NA 2J5RA 3JSAA 4YEDA 4XIYA 3AUAA 1E1NA 3C3XA 4FW8A 3QA9A 1OC2A 1PJ3A 1DLJA 1HYGA 3E03A 4JBGA 3A28A 1UXGA 2QHXA 3IC5A 4E32A 3NTRA 1HF3A 2Z5LA 2NU6A 3BMQA 4DYVA 4YRAA 5CDUA 5JYDA 1DRVA 1NPTO 1WWKA 4MVJP 2VRBA 1I3LA 4IINA 2VRCD 5ICSA 2YQ5A 4NJOA 1JWAB 3PZBA 4HV4A 4CV2A 4BQPA 1HKUA 1WPQA 2V6BA 3U9LA 2AEFA 2AG8A 2Q3EA 1BVRA 1BGVA 1M2WA 4RVGA 1ONNA 2BGMA 5LCXA 4E2YA 1DIHA 1M67A 2JD2A 5KKCA 1BTOA 1GQQA 1H2HA 4BNJA 1PJQA 1PS9A 1I0ZA 2GSDA 2QYTA 4HNHA 3R3SA 3Q9UA 5DCUA 5HM8A 5I7VA 4DWVA 3AFNA 5JPIA 3FNGA 1UZLA 1Y8RB 2D5CA 5FF9A 3V2GA 1OAAA 3I9OA 3KBOA 4R1UA 4GSLA 4YDRA 5LDHA 6ADHA 1T2CA 1XHLA 1FXSA 2RH4A 1YH3A 3ZWPA 3PFWO 1LLDA 3LQFA 4BO8A 3ZV5A 4LRSB 4W82A 4NFSA 3I4CA 4CMEC 1E3SA 3GGGA 3LC7O 4BNTA 3AY6A 3Q11A 5JYEA 1DB3A 3RFVA 3PWKA 3SX2A 4BNXA 1H2BA 5IAAA 1D8AA 3ZNOA 1C0IA 5CEFA 3W1VA 5JW6A 4YA6A 4DPMA 2X8LA 3W8FA 1TEHA 1LNQA 1MB4A 1WW8A 3QSGA 4BHTA 3ZWBA 1EK6A 3TQHA 3X2FA 5DBIA 3MJTA 2RBEA 4FGSA 2W2LD 2Q46A 3VZQA 1HYEA 4CR7A 2JHFA 4J49A 4XGIA 5CG2A 4RL6A 1R4MB 1QSGA 3VPHA 3PJDA 3AI3A 2D8AA 2AEMA 2Y1CA 3K9QO 5A9SB 1XR3A 4IXTA 2JCYA 2XPCA 4PGFA 4CMIA 4PVCA 1I32A 4QO7A 5B4UA 2BI7A 4UUMA 2WM3A 2X7HA 2QRLA 3C7DB 3I52A 4J43A 5JAQA 4L73A 4EUFA 5I7SA 1BG6A 4OKIA 5IN5A 2BF7A 2C07A 3NJ8A 3RU9A 2CVOA 4YWJA 3CEAA 3KYBA 2TMDA 1XGKA 4XQGA 3TL2A 4DVJA 3H8VA 3NAQA 1HZJA 3ETEA 1ZW1A 2AG5A 1Q0HA 3UKOA 1HZZA 3VDQA 4IXWA 4NU5A 5JAMA 3D3WB 3CXRA 3DOCA 2W4QA 2J5KA 1GUYA 3EC7A 1A7AA 4CQMD 1UXJA 1RM5A 1QXSA 4E13A 4OAQA 4CLRA 5G4KA 3WGTA 2JCVA 4RF5A 1E7SA 3SJ7A 3JYLA 4B7XA 2UAGA 4YT4A 4RGBA 3PIDA 3AU8A 1HDCA 3HFGA 4PVDA 3RUIA 2E82A 2Y67A 4P8RA 4Z9YA 3PXXA 4RDHA 1JLLA 4TVOA 4A03A 1G1AA 4YJHA 1P74A 5DT9A 3WS7A 2AW5A 2WDZA 3EY4A 4FIZA 3NRCA 2H6EA 1P9LA 2PV7A 3DBLB 4K28A 1DEHA 4AJLA 5AXDA 3ZWOA 3PYLA 4QXMA 1IPEA 5KVVA 1JA9A 3PJEA 4CUZA 3AY7A 5L40A 4FB5A 3TF5A 1ZMTA 1QKIA 1U3TA 1LSJA 4TVBA 3UCEA 3SJUA 3H5NA 1GYPA 1LTHR 2FRDA 4O6VA 1LEHA 3DEYX 1O5IA 1NYTA 1EBUA 3JQFC 3I6QA 5EINA 1YE3A 3UN1A 5EIOA 4CQLB 1H5QA 1PGOA 4LRTB 3RUEA 3ZNPA 4BGEA 4BNHA 5IJZA 3GF4A 3OIGA 4RVUA 1EUCA 4ZU3A 4YAGA 2AE1A 5AOVA 2NU9A 4URFA 4XGNA 2FR8A 1LLQA 1ZEJA 3KLMX 1JKFA 1JQBA 1W8DA 2D0IA 1YJQA 2CFCA 1HE5A 3PLNA 2V6FA 1I30A 3JCZA 4BNYA 4GL4A 4S1VA 5J23A 4EW6A 1V8BA 4WE3A 3QQPA 3SC4A 1IZ9A 1ULSA 2B37A 3DO5A 4GWKA 3VDRA 2ZCUA 3ULKA 1U3UA 1HETA 2UYYA 1Z82A 3VAZA 4AVYA 2I9PA 4BNMA 4CM4B 5KTKA 1LLCA 2Q99A 2IZ0A 2VHXA 2B36A 3EUWA 2CUKA 1DIBA 2O3SA 1SO8A 4O59O 2NQTA 3VZPA 5A05A 1UP7A 2DQ4A 2VUUA 3IOYA 1ZSVA 4WLUA 3DOOA 5DBGA 4EUHA 2VYND 1LRLA 3OQBA 4AJNA 4ND5A 4XDZA 2YY7A 1A27A 5TT0A 4E21A 4RZIA 4IDAA 4MVJI 4XDYA 1N8KA 2HRBA 2ZB7A 3QJ5A 1PL6A 1HDOA 4OKNA 4Q3NA 4XCVA 1T24A 1TLTA 1XIVA 4Q3DA 4Z0HO 4KTTE 4ZGWA 4GLLA 4N54A 3GPDG 5CDSA 2B83A 3H3FA 3SC6A 3W8EA 1EUZA 1V6AA 3F5SA 4OXKA 4XB1A 4XR9A 1Q7CA 5JAIA 2YV3A 4XYEA 1GTMA 5KIAA 2ZTMA 3E1KA 3F4LA 1GCUA 3MTJA 4CM7A 3SBOA 4OO3A 5ENDA 4DPKA 2IYOA 4YQZA 4R3WA 1I3NA 3MOGA 4E6PA 1WMAA 8ADHA 4PLWA 1PIWA 1ENOA 4Q3CA 3PGJA 4N5MA 3WOHA 3QRWA 1RM4A 3C7AA 2Y05A 5L7TA 1GEEA 2C54A 2ZYGA 1Z74A 4GX1A 4J1SA 5GZ1A 4WLVA 3IJPA 3UICA 1MGOA 1YDWA 4YAEA 1NHGA 3U4CA 3B1FA 5B37A 1ZXBA 4XEHA 4YBZA 4XWYA 3AOEC 4OOEA 4JCOA 3WNQA 1XWFA 4DBVO 2EKPA 3RC7A 5JMPA 3SEFA 5F3RA 1HDGO 3OA2A 1F0YA 1PWZA 2D4AA 1K6IA 3TZ6A 1PSDA 4P4GA 1ADGA 1F06A 2D3TA 1CEQA 2WD8A 3RU7A 5IZCC 2BHLA 3ZWMA 2NM0A 1XCBA 5JMWA 4EBFA 2DFVA 1NQTA 4PZDA 1X1EA 2HQ1A 2WWRA 4XKJA 3H5AA 2XOXA 1RJWA 1BWSA 1XU7A 4R9SA 4ND3A 3VPXA 3DFUA 1H9BA 3BHJA 4L0QA 2Y0CA 4BOYA 4KUGA 1X0VA 1I8TA 1J4AA 1I01A 3MOIA 4BNGA 4D46A 4HFNA 4EITA 4J1QA 1E1KA 4PLPA 4MPDA 2GLXA 4YAKA 1M66A 4PZEA 3KETA 2Y1EA 3GVPA 4KDFA 2EKQA 2FP4A 3DZJA 3VH4A 4B4VA 3ORFA 5A1TA 2YDYA 4DA9A 4PRKA 4AJKA 2GNAA 4S3MA 4U5QA 1YBMA 1UZNA 2V6GA 4FSHA 1JDJA 3LDHA 5KJFA 1NVGA 4B4WA 4IDDA 1XU9A 1VSUA 2X6TA 4KWHA 1Q0LA 1C1XB 1QV6A 2PD6A 3ZWNA 5BSGA 1VKOA 3GAFA 4JQCA 4WKGA 3RIHA 4ALLA 3PJGA 1VPDA 1NBOA 4D41A 1K5HA 1DHTA 1N2SA 1QP8A 3PYXA 1GYQA 4O0LA 2W2KA 4AG3A 4PG4A 4QTZA 1LDMA 4BMNA 5L4SA 5EQDA 1UAGA 1LU9A 1UR5A 2GN9A 3DL2A 2HMTA 2EP7A 4Y6PA 3LVFO 5KKAA 1GV0A 1Y9EA 2JAHA 1T4BA 5IDYA 4DBZA 3RBXA 4BQRA 3BTSA 3RJ9A 4II2A 2VUSA 1U7HA 4FJ2A 3AJRA 4BO3A 4HUJA 1I36A 1ISHA 4YJFA 4R68A 4J0FA 1HLDA 3LT1A 3U09A 3ZWYA 3S8MA 3HB4X 1C1DA 1DRWA 3JD2A 2BELA 1OMOA 2VQ3A 4WLNA 2EW8A 4Q9NA 2IEDA 2Q45A 4NJMB 2X9GA 5L3ZA 5B4TA 3TL3A 4CJXA 1UXHA 2VWQA 4XX0A 4UAGA 1BW9B 3A4VA 4DUPA 2C2XA 1YBAA 3EVNA 4GKVA 2RHRA 4UVEA 4MVJE 4KTVE 5JDIA 1ZFNA 1E6WA 1GADO 2CVQA 3BMNA 3ADOA 3AW9A 5EMHA 5JAZA 2JFGA 4DTIA 2FPGA 2IRWA 4ZRMA 1GAEO 2ZB4A 3WJ7A 4D0RA 1LDBA 3WX0A 1IULA 3UH1A 1ISIA 3Q3CA 1DC5A 3CTMA 4WNIA 4BNVA 1Z7BA 2P4QA 1X7HA 3BXXA 3IMFA 3NDJA 1EQ2A 5DOVA 3BMQB 4D7AA 3INGA 3K92A 3F5QA 4GQAA 3FHLA 3UHAA 4J4TA 2YHUA 4LW8A 3JQ8A 4NFHA 1J0XO 1Y5MA 2AMFA 2TMGA 5TF4A 3HG7A 1KVSA 4XYGA 2BKAA 3ZWAA 5BNTA 3TSCA 1Z45A 4DLBA 3K6JA 3GC6A 4I5FA 1T25A 3K2BA 1KEVA 5TIIA 1R0LA 4A0SA 1E3EA 3TPCA 2J5QA 3ZHYA 4DIOA 5CDGA 3KEQA 3QWHA 1E6UA 1QRRA 3F46A 4MVJF 1LI4A 4H16A 1WZEA 3H3JA 4JBHA 3PHHA 4CM6A 1J6UA 3WLFA 3PHIA 3TWOA 4B8ZA 4G2NA 3PYMA 4FFMA 4W7IA 1I3KA 1CETA 3ETDA 4XQCA 2OP0A 2WD7A 3ITKA 1YDEA 3NYWA 1NWHA 2P9CA 4JP2A 5JY6A 1XDWA 3KYCA 3ONFA 3B20A 4BNZA 3JQGA 1B15A 3GNSA 2CZCA 3WQQA 4CV3A 1QORA 2VHZA 5A02A 3ZWCA 1YRLA 2O3TA 4I5GA 2BMAA 3QY9A 1SCUA 4CMBA 4CPDA 2X23A 4TRJA 2W90A 3ZZNA 5G2OA 2ZB3A 3VPSA 1JAYA 4XJSA 4GH5A 4EGFA 2AE2A 2E37A 1I2CA 2O23A 4NBVA 1NXQA 3DAPA 2ILTA 1VE9A 3EHEA 3GNTA 5IZ4A 4IDGA 4K6FA 2DTDA 4PG5A 4RCVA 2NLOA 3DTTA 4CQMA 4ZD6A 1B26A 4WLFA 4YJDA 2ZQZA 1W0CA 3LLVA 1H94A 2Y0DA 1PZHA 4CMIB 4R16A 3AU9A 1F12A 3BAZA 3RKRA 2C59A 5A5FA 1DO8A 3M1AA 4CM5A 2Q49A 2ZB8A 4ALNA 1BVUA 2E4AA 1IHXA 1W73A 3GHHA 3WYBA 2W8ZA 4L74A 4F46A 4YXFA 5DOZA 4YYZA 1GZ6A 1GV1A 1UAYA 3GN2A 4JJIA 3RROA 5A04A 2EERA 2QZZA 4CM3A 4XYLA 5L53A 3E18A 4XRRA 4YAIA 2PNFA 4Y67A 2Y1OA 2EEZA 3QVXA 2R2GA 3WGHA 5U9CA 4HBGA 3AUUA 4Y8VA 3WQRA 5F21A 1JAXA 5DBFA 2HMWA 2FZWA 3UXYA 5TSDA 2D2IA 1L7EA 4BO2A 3RUHA 3WG9A 4CLRB 5G4KB 2NACA 3D4OA 3E9MA 4K6CA 3WYEA 2JFFA 1X0XA 4RDIA 4XD2A 5K6AA 2NVUA 3D64A 4MO2A 4E5KA 2I76A 4UUOA 4LISA 1FDTA 4WPGA 3K73O 3HDHA 1Z75A 1PJBA 4YJHB 3ZWVA 2CDCA 3HDQA 3PQFA 3RI3A 2B69A 2UDPA 4NFYA 1YOVA 4MP6A 1LUAA 1Y6JA 1ID1A 3JYPA 4MINA 3RQSA 2P91A 1AXGA 2PWZA 2VCYA 4IIUA 4GX5A 4IJKA 2X5KO 4TQGA 5L95A 1KY5A 1P3DA 1ZVMA 2GZ2A 3IL2A 1LQUA 4IS2A 2CY0A 2VYNA 4J2OA 5LDGA 4IY1A 4JBIA 2YZ7A 4B3HA 1EUDA 4MIYA 3HN7A 2GPTA 2OBYA 5L51A 3RUCA 5IDXA 4IMRA 1UDCA 3NT2A 3VH3A 2CDAA 4KMSA 3FBGA 3LT2A 4XZ3A 3TZQA 1NR1A 1O8CA 1KOLA 2Q50A 3BHMA 4WK6A 2PD4A 3M6IA 4ZA2A 2VNAA 4E5PA 1HDYA 3GVHA 4E5YA 3EAGA 2OHXA 4H3VA 2X9VA 1T1SA 5F1OA 3WGIA 3ZHBA 3VPFA 2EXXA 3GVIA 1PR3A 2Q1WA 4A27A 1B0AA 4DC0A 3NDRA 3JQDA 4L75A 4YRBA 4N5NA 3VTFA 1R6DA 1XKQA 2O4UX 3BMCB 3DONA 4QFDA 3WMWA 2FPPA 3C1TA 1GPJA 1IY8A 2O3UA 5HBRA 5A9RA 2FZEA 4BL5A 3E5MA 4NNJA 2GYYA 4GWGA 5T67A 3U0BA 1S6YA 1TXGA 1U5AA 2OP1A 3FI9A 1KS9A 3WMXA 3IKVA 4FOSA 4Q3EA 3DZHA 1QV7A 2CVZA 2I65A 5KWEA 2FSVA 2Z1NA 3MJVA 3BA1A 2XAAA 3OIDA 1R12A 5I8ZA 4IS3A 1PL7A 4U7WA 4YRDA 2CSUA 2ZJ0A 4DMLA 4L8VA 5B12A 1UJMA 2OFPA 2WJPA 4FQ8A 2C2YA 3HE3A 3O4RA 5KJ6A 4ZICA 1DC6A 4U0KA 4DQUA 3O38A 3ZH2A 2E49A 2WYUA 1OC4A 3W4KA 4EEXA 2IEBA 1DAPA 4BS9A 1P1HA 3JQEA 2ZCVA 2C5EA 1DAOA 1BXZA 4KP7A 3ZU4A 2NUAA 3OECA 2UUPA 3KSZO 1FDUA 3PHGA 4Z6KA 3COSA 3JD1A 3Q9NA 1HDXA 3Q2KA 2HMVA 4WCFA 1HYHA 3E9NA 4M8SA 3JYOA 2PKQO 3TRIA 3VZSA 4DLAA 1D1TA 2V6MA 1V9LA 4PLYA 3QVWA 3AOGA 3WFJA 4TRMA 3TOZA 4M55A 2EWMA 2PGDA 1PGQA 2EGHA 3LC1O 4YCAA 1TT5A 1UDBA 4G5HA 1H6CA 4OXYA 1U4SA 5HRUA 4GAEA 1SB9A 4CL3A 3RBVA 2ZTVA 1NHWA 2DPHA 2NV6A 3A06A 3MJCA 4ZN6A 3DB2A 4KUEA 1U3WA 3WFIA 1R0SA 2G1UA 2H5LA 4BKRA 3VC7A 4IJVA 1C0KA 2DFDA 5KNLA 3PQDA 3D4NA 4FFNA 4X54A 3L6EA 3UW3A 3W4IA 3D5TA 4FC6A 4HNGA 4OGWA 3RSHA 2CDBA 4GMFA 4Z9FA 3RC2A 2FHSA 1PGJA 3K5PA 3FRJA 4R69A 5ADHA 1LXCA 3NEPX 3BYZA 3K8ZA 2CMDA 1DSSG 2VZ9A 3O8QA 1T1RA 1WP4A 2WE8A 5G0TA 1JW9B 2VHWA 3ZV6A 2QX7A 2YHIA 1HWYA 2YJZA 3T7EA 4CM8A 1VI2A 4RJTA 4R9RA 3FN4A 1YL7A 3H9UA 2O50A 3MCVA 2O4CA 3MZ0A 1IPFA 2DLDA 4YQYA 3GGOA 2BGLA 1BXKA 3NUGA 1NX6A 4CLOA 4R1TA 4YT5A 5JBIA 3AFMA 1XYGA 1AN9A 4I9NA 3OJEA 2HKIA 1NFQA 4NBUA 4CMJA 2CF5A 4U6SA 2R6JA 1YL5A 4E0BA 3A14A 5KJCA 1BDMA 1XLTA 4E30A 1QLJA 1KY4A 3I4FA 3AUSA 3I1JA 3L9XA 5THQA 1DFGA 4AJIA 4OJNA 2B0JA 4WCDA 1DLIA 1UUFA 4DQVA 3BMOA 1ISJA 3ENKA 4PG8A 5CEEA 2DBQA 3AM4A 1DDOA 1N9GA 3GEMA 5CP8A 5KCZA 3VTZA 4NZ9A 5L4NA 3B1KA 3GDOA 3H6KA 4PZCA 4HX5A 5JNLA 3FR7A 3WGOA 1QR6A 4J91A 3A9WA 2W2KB 1IZ0A 3L9WA 5CG1A 3ENNA 3F3SA 1T2FA 1P1RA 5C7LO 2O3RA 3I23A 3FF4A 2GN6A 3AUTA 1RM0A 4KQWA 5I7EA 1KVTA 4P4LA 3KRTA 4JJFA 5IDWA 5MDHA 4FPXA 5DF1A 1DJNA 2AXQA 2YV1A 1GFSA 3N58A 3PFFA 3GRKA 4GMGA 1TVEA 1LSUA 1KEWA 2NSDA 1PJ2A 4EUEA 2HJSA 1X7DA 1Y5RA 3LSYA 4YJFB 3ABIA 1UXKA 3QLJA 4FGWA 3RUFA 1N7GA 3IKTA 1ARZA 5JDIC 2DBVO 4O1MA 4W4TA 5B1YA 3DHYA 1GEGA 1C1DB 1LSSA 1ZJYA 2PGLA 4Q39A 3DR3A 1OZAA 4IUYA 4CMCA 3D3EA 2J8ZA 2HAEA 3E82A 4JP3A 3KTDA 4H7PA 3E9QA 3D0OA 5JFOA 2O7QA 1KETA 2Q2VA 1JTVA 2HK7A 3HNPA 1ZK3A 1ENYA 2O48X 4I9UA 5BSFA 3NV9A 1ORRA 1HE2A 3IUSA 3K2EA 3GQVA 2G82A 1E7RA 4Z3DA 3VVCA 4RF2A 1KC3A 2RHCA 4NHEA 3BMNB 3RAJA 5DCWA 1MV8A 4D3DA 4E5NA 3QIVA 1V3UA 3N74A 3ZI0A 1ZXLA 3GLQA 3OETA 4IDFA 1UDAA 1X7GA 4W99A 1ZSYA 2SCUA 1N1GA 2C5AA 4RPJA 2IZZA 1YQGA 2DUUA 2X0JA 3TZCA 4UVGA 1X1TA 3INTA 4A2CA 1E6EA 2XF8A 1EVZA 1H0KA 2BGKA 3S2EA 3OJLA 3JQ8B 4MJLA 4ALJA 5A3JA 4W7HA 3ONEA 4PG7A 2JHGA 1EQUA 2FSSA 1P1IA 5LC1A 4BGUA 2J3KA 1ZZEA 1PZFA 3KSUA 1QYWA 3V2UA 3DBRA 2GCGA 4AL4A 2FOIA 4JX8A 4LSWA 3PVZA 3SLGA 1H93A 1RPNA 2J3HA 1WMBA 3B70A 1UXIA 4FBGA 2HDHA 3BHIA 1ZK4A 2A9FA 3JQ6A 1B8VA 5IFLA 2PR2A 1TB4A 2JL1A 2FR1A 1QLHA 2C7VA 4NG5A 5L4LA 3U4HA 1JN0A 1DFIA 5GY7A 4R54A 4QUKA 5I9LA 4D43A 2ZYDA 3JV7A 3S1LA 5BQFA 1NQ5A 4MOWA 1E3IA 3PPIA 3KYCB 4NPCA 1E5LA 3ZNNA 3JQGB 3ICCA 1ZIDA 1QMGA 1PU2A 2PKRA 4CMGA 1ADBA 3VH1A 4CUKA 3ANNA 4C4OA 2X58A 4J1TA 1R16A 1E77A 3T4XA 4A10A 5HS6A 2QRKA 2DBRA 3F4BA 1K2WA 4BB5A 1Y8RA 4J16A 1EVYA 2ZYAA 1E5QA 3DQPA 3I9MA 1ZH8A 2X5OA 3IP3A 3NGLA 5JDCC 4CQMB 4FFLA 2DVMA 3PWZA 3PQEA 1MXHA 3S2GA 4AFNA 4UUNA 3PHLA 2XXJA 4L9RA 4NR0A 3KEOA 4II3A 3W6UA 3PJFA 2F1KA 2QYSA 3TDKA 1DFHA 3C24A 3M1LA 4QO8A 3U5TA 1TI7A 2C0CA 1YWGO 3CMMA 3QWIA 4OMUA 3RBZA 5B4VA 3G0OA 5U4QA 5JS6A 4RVSA 3LU1A 3UUWA 1RYDA 5K6AC 3ZWXA 3I5MA 4DRYA 1VC2A 1E3LA 4B7UA 2BI8A 4OHUA 1SAYA 2A35A 2GD1O 1CYDA 5T6BA 2WSBA 4EZBA 3JYNA 3TZKA 1U5CA 5L45A 5COQA 3DMTA 2PZLA 4M54A 1N1EA 1IB6A 5DP2A 3VVBA 2GUGA 5COBA 1YVEI 3ANLA 2JFHA 5DDIP 5EL0A 1MC5A 4UREA 3JQBA 4R1NA 4BMVA 1R4MA 1JVSA 1ZMOA 3TFOA 3WIDA 4YTEA 1IYZA 1P0FA 5A9SA 1P33A 3P2YA 3ZHXA 3ZW9A 1I10A 1P1JA 3P19A 3PK0A 1H6BA 5TT1A 3OMLA 4JIGA 2AHRA 1DIAA 1P77A 4TRNA 4JROA 4LMPA 4DIBA 2DPGA 4LVUA 4OQYA 3SVTA 1YOVB 4TKMA 3KB6A 1QYVA 1VJ1A 1NPDA 1CERA 3F6YA 1F14A 1HLPA 1YXMA 2DKNA 4PLTA 3WQSB 4BGVA 3GEDA 4EI2A 2E6UX 3DZGA 4QQRA 1HDRA 1SPXA 1D3AA 2BFMA 3D3WA 1EDOA 4GX2A 3ROPA 3GDGA 2X0RA 5BNFA 2HMUA 4BO0A 3G1TA 4J4HA 2LDXA 1Y1PA 1L1FA 3CKYA 3RD5A 3H2SA 1YKFA 3GZNA 2Y1GA 4FJ0A 1KEPA 1Z6ZA 4RVFA 1YO6A 1O94A 4ZQGA 2P5YA 5H83A 4ALKA 3MJEA 1GD1O 4ND2A 3QVTA 2A4KA 3BIOA 3U3XA 4IQ8A 2YQ4A 2ZK7A 4XB2A 1KVRA 3IIEA 1DC3A 4TRRA 4YJGB 2HRZA 4FJ1A 2E48A 2P4HX 3ONDA 1O6ZA 1P31A 2BFPA 3R0IA 4F45A 4HY3A 9LDBA 2QZ9A 4E4YA 1EK5A 5ILOA 3CZMA 1PS0A 3FNFA 4HWKA 1N7HA 2OORA 3EK2A 1DIGA 1NAHA 4GGOA 2V65A 3TNLA 1R4NB 1K6JA 2EW2A 1PJCA 1A71A 5JSFA 4PN3A 1DBVO 2BD0A 1WDKA 1DHRA 4NK5A 3JYQA 4R01A 1UP4A 4E5MA 2GZ3A 4CV1A 4WCFC 5G0WA 1M6WA 1V35A 3HZZA 3PRJA 1XA0A 2EJVA 2X0NA 1LDGA 3E5RA 3EZYA 5ER9A 1SZJG 3NT5A 3G3EA 2VTDA 4MIOA 2EIHA 4ITUA 5A5EA 5JO9A 4CM4A 4IQGA 4UVHA 4WLOA 4B7CA 3PHJA 1HT0A 3OH8A 3HADA 1BDBA 5FI3A 3IS3A 3WJAA 2PY6A 4WCFB 1I2BA 1GZ4A 4HFMA 5T8KA 1V3TA 3DC2A 2Q1SA 1MLDA 2VWGA 4FFOA 3GPIA 4PIVA 4BO4A 1VSVA 2HCTA 3IAHA 4U8GA 1YJ8A 3KYDA 2GZ1A 2G5CA 1TT5B 3GZ4A 3S55A 1GQ2A 2P9EA 3KHUA 2O2YA 3WSWA 4OL9A 4GBJA 1NR7A 1Y8QA 2PKQP 1XELA 3C8MA 5ER6A 4Z3KA 3EW7A 3LK7A 3WIEA 5GZ6A 1LLUA 4IZHA 5KJEA 2EP5A 4BO9A 4CV0A 4MKZA 1RWBA 2O3JA 4ZQHA 4BKQA 5A4DA 3JQAD 4JXKA 3RC9A 4XJTA 2GRAA 3GHYA 3JQ7A 2B5WA 3F47A 3VH2A 4WOJA 3QW2A 4D42A 3CUKA 1E1MA 3KM0A 2X1HA 4NMHA 3GOHA 2ZATA 2NNLD 2VHYA 4GVXA 2YFHA 3GRPA 4RPLA 4ESOA 3L6OO 3O8QB 5GMOA 3TFQA 4UULA 3PZRA 2YHIB 1LC0A 4D3FA 3WB9A 4CM8B 3GVXA 3NTOA 5CPBA 4A5OA 1XEAA 5ICMA 4HFJA 3V5NA 3I83A 2I3GA 4BKPA 9LDTA 4WEQA 3HUDA 1A9YA 4JK3A 2BLLA 5A06A 3ZW8A 1HE3A 3DTYA 1T4DA 3ROQA 4K9DA 3PEFA 4BNNA 3QWAA 4CLOB 4AICA 1SC6A 4YT2A 2ZKLA 3FPCA 2X5JO 5GZ3A 1NFFA 4UUPA 4Z0TA 1SBYA 1NASA 1CDOA 3PDJA 4NH4A 4RQTA 4N18A 3C7CB 4R4JA 2HK8A 1SOWA 4ND1A 1A4UA 1FDSA 1YONA 3MEQA 2NTVA 3R3JA 4QT0A 2I6TA 1CQIA 1IL0A 2P9GA 3BMOB 3BTUA 3Q0EA 1QG6A 1Z73A 4UEJA 5JO0A 1L7DA 3H7AA 4J7CA 4E2XA 4IBOA 1C0LA 1S7CA 2VT3A 4J0EA 3GAZA 3F1KA 4BKUA 4E33A 4JGBA 1F8FA 4CMHA 1DXYA 3HFSA 5KVQA 1GUZA 4R51A 1AHIA 4Z0PA 3VZRA 1D4FA 1GUFA 3WXBA 2GR9A 3GMSA 2WE7A 3G49A 1VL6A 1YQXA 3DMYA 3OIFA 1WNTA 1SB8A 4IGFA 2VWHA 1MX3A 3I9KA 4OH1A 1FDVA 3TJRA 4ILKA 5JE8A 2CNBA 2YDXA 1HSOA 1NFRA 1CWUA 3GUYA 5I8WA 1IHYA 4FD3A 4NK4A 2Z1MA 4FFPA 1OFGA 1ENZA 3WNVA 4LCEA 3GG9A 3HJAA 1SNYA 2VZ8A 2H63A 4TWRA 1IE3A 1MXFA 2AA3A 2OUIA 3WWYA 3WGGA 3DFZA 4NBWA 2FWMX 4MVJD 3FTPA 1E3WA 1B7GO 3W4JA 4NBRA 2O7SA 4BIIA 2Y93A 1V0JA 3UGKA 3P2OA 4LN1A 1PJSA 2EKLA 4J7UA 5CHEA 3QWBA 1JKJA 3NT4A 3MTGA 1WLYA 4R41A 1NM5A 1P1KA 4Y9DA 3H4VA 1AXEA 3H5RA 4FFRA 2DAPA 1CQJA 1LX6A 4I8XA 1K0UA 2G0TA 3GFGA 1BXGA 4YPOA 1A5ZA 1NNUA 3CSDA 4B4OA 3KO8A 4Y6SA 3BZUA 3QVOA 2PZKA 5TGDA 1ENPA 3ROMA 1A9ZA 4NJMA 3GUCA 3UF0A 4YB8A 3QHAA 2ZQYA 3IQDB 3DBRB 4UVDA 1PX0A 2V7PA 5FWNA 5KOIA 2POQX 2RH8A 1O89A 2GDZA 2EG9A 2I67A 1YBVA 4NU6A 5ENVA 5BNIA 3L4BA 2Z95A 1EE9A 2PH5A 2PZMA 3QE3A 4PLZA 3RKUA 2X22A 4YVFA 1PS8A 1U2DA 4IPTA 3WYCA 2AQ8A 1NWCA 2AQKA 4IQ0A 1EFKA 2NADA 5IXSA 5AXBA 3ITDA 4QECA 4WEOA 1PZGA 4GLOA 2NVWA 5TRTA 1GPDG 1QYCA 4AJOA 4ZQBA 4D79A 1FF9A 4WLEA 1DPGA 1E7YA 1Q2XA 1U9JA 4CLEA 4YT8A 5I7FA 2WTBA 1MUUA 1E3JA 2ZIZA 3I3OA 4RVHA 3ZV4A 5BSHA 5FI5A 1PGPA 1CF2O 2Y68A 3UVEA 3RFXA 4YR9A 5K0ZA 3H9QA 1MC4A 2OOSA 4FDAA 3CIFA 5HWSA 5DCYA 1RKXA 1ZEMA 1O0SA 4O63O 4CM1A 5T57A 5CDTA 3LT0A 3D1LA 2NQ8A 1I2ZA 3HWRA 2IXBA 3HN2A 4I1IA 1VM6A 3STHA 5TC4A 3WGYA 2QIOA 3HSKA 2CF6A 2HU2A 4TZKA 2I66A 3Q1LA 4OYRA 5DZSA 4BVAA 5ILGA 1EVJA 3W6ZA 4CM9A 4EDFA 2DC1A 3EMKA 4O5OA 2DT5A 4I9HA 4LMRA 3INRA 1B14A 1LRJA 2FR0A 4M89A 1EDZA 3PWSA 4P4NA 4AJ2A 5THKA 3RUDA 3ZU3A 3V1UA 1A7KA 1YGYA 3AY3A 3NKLA 4CLHA 1I24A 1AGNA 4HXYA 1FK8A 3WLEA 5ITWA 1W6UA 3DMTC 2BH9A 2X0IA 3DZFA 3WTCA 1K89A 3Q6IA 2RCYA 3PIIA 1WXDA 2B4TO 4KOAA 1PQPA 3OSUA 4IMPA 3JQBC 4DIFA 3VKVA 2WYWA 3GEGA 3DAGA 1O95A 2IYPA 1E92A 1M75A 3L07A 1UH5A 2IODA 5BR7A 1CJCA 4PLVA 1I5RA 3ASVA 1PJ4A 4UEOA 4DYDA 5IN4A 5AYVA 2IE0A 1PGNA 3OJOA 3VOSA 1XG5A 3GNQA 4MP8A 5JY1A 2NVBA 4B79A 4B3JA 3D4PA 4D3SA 1ADCA 4Y98A 2ET6A 2PH3A 3DOJA 1K6XA 4FN4A 5BT9A 2P68A 2PZJA 2VYVA 2X86A 1T2EA 4DPLA 3JD3A 3KVOA 2DM6A 3F9IA 1CIVA 4OIMA 2DTEA 4TMFA 5L7WA 4W6ZA 1X14A 1NP3A 1AE1A 2JAPA 2FY8A 3NDIA 4N5LA 1GL3A 1PZEA 3GA0A 3GY0A 1U4OA 1GYRA 2QW8A 3WICA 1ISMA 3FPLA 5I9MA 4ZRNA 3JQCA 2C20A 1YB5A 1ISGA 4OOFA 1ISFA 1NVTA 4PLHA 3WGQA 2H9IA 3VPGA 2WEKA 2LDBA 1I3MA 1X13A 4M1QA 4QX6A 1MG5A 1PQWA 3M2TA 1IOLA 1KIFA 3DZKA 3EYWA 3ST7A 4XQ9A 1Z7EA 1H6DA 2WYVA 2VWPA 4DXHA 3DHEA 4ROSA 3V8BA 1ZJZA 2HJRA 4XYMA 1NTOA 2RIRA 4LCJA 5A03A 3LT4A 2GERA 2QQ5A 4RQUA 1LBEA 3GZNB 2P5UA 1A4IA 4GGPA 4MVJH 4ALIA 4JJGA 4JN6B 4M49A 4NBTA 5JLAA 1V3VA 1VJ0A 1TA4A 4HKTA 4J90A 2D59A 3O9ZA 2Y66A 1MP0A 3PDUA 4PLCA 4GKBA 3FBTA 5CEJA 2Y0EA 3AM3A 3DBHA 3MJSA 4HADA 4PFJA 4FCCA 4XR4A 3HHPA 4PLFA 4CMKA 1DOHA 4W9NA 4AJPA 3G1UA 3DBVO 5H82A 3L0DA 3UCFA 4CLDA 3C85A 4CLXA 5EESA 4H15A 5C37A 1LDEA 2HUNA 3FTNA 5F1PA 3FR8A 1N5DA 3AWDA 4B3IA 2HLPA 4L4SA 4IJWA 1ZUD1 4A7PA 3EGOA 4B4UA 2EGGA 2YV2A 3H2ZA 4J7XA 1KVUA 2Q2WA 3IP1A 4LK3A 3ASUA 1X15A 3H9JA 3JQ9A 3C1OA 3ZWWA 4CODB 4M87A 4KWIA 3H9EO 1QYDA 5AVOA 1WDLA 4KQXA 4L4XA 5T8KC 1NQAO 1E7WA 3DHNA 4FR5A 1LC3A 1PEDA 5G4LA 3OJ0A 3OEWA 4ND4A 2OZPA 3AI1A 3WR5A 3K31A 3QVSA 1VKNA 5CAEA 3JQAA 5MGBA 2O2SA 4D45A 2J3JA 3CMCO 3D7LA 3FD8A 1MFPA 2DUWA 3LYLA 3BMCA 1JU9A 4YACA 3CZRA 1U3VA 1B8UA 1R0KA 3GN1A 5EPOA 3OBBA 3OFSA 5TLSA 4ZJUA 2RAFA 4RO0A 3E6AA 3ZCXA 4GPD1 1E1LA 2DU8A 4Q3BA 3RCBA 3LC2O 2C29D 1VLLA 4BNIA 1MG0A 4QSMA 3KYDB 1Y81A 5AXCA 1C0PA 3ZDFA 1EFLA 1HXHA 4GVLA 4Z9XA 4QEDA 2JKVA 4J2HA 1PQUA 4XA8A 4DMMA 4CR6A 3ON5A 3FSRA 1YB4A 1H6AA 3M2PA 2WD7B 4IJUA 2R00A 1UP6A 3IJRA 1Y8QB 2C7GA 4AJJA 2X4GA 1BMDA 2Q1TA 4RPHA 4TROA 1YL6A 3KV3O 4UVIA 2PFGA 3DZBA 3MWDB 5FEUA 4D44A 1VL0A 5JCJA 4MDHA 3L6DA 2EHDA 2GGSA 1Y9AA 3GH3A 5AQ1A 3KUXA 5CDYA 3G79A 3JQ7B 4RLSA 4ZQFA 3H9GA 2VT2A 1WAMA 4XIJA 3OM9A 1AUPA 5EERA 3VKUA 1WZIA 5FYDA 1F17A 4AJHA 2AQIA 1FDWA 3ZHZA 3V2HA 3OEYA 3KSDO 4GSKA 2YYYA 3PP8A 1PL8A 3CPSA 2PD3A 2Y1DA 4F6LA 1LDNA 1Y7TA 3L4SO 1ZO8A 2IDZA 4J3FA 3LF1A 2B5VA 2BFAA 4BUCA 1VJTA 3T4EA 5L9AA 2GO1A 3PTZA 1GDHA 4FC7A 4OQZA 3ICPA 4F6CA 3LZ6A 2GF2A 3ADPA 2GN4A 3GMDA 3KOUA 1HL3A 3MJ4A 2Q1UA 5C5IA 3I9LA 2YW9A 1ZK0A 4R5HA 4HP8A 3OQ1A 3AI2A 4ONEA 5KJ1A 3K96A 1SEPA 1A72A 4QFCA 3KXDA 3V1YA 2VZ0A 4CM9D 2XXBA 1YQDA 3RC1A 4CMEA 1U8FO 4K1LA 4DREA 1BRMA 5ITVA 1VL8A 2PTGA 4MVJA 3I9JA 4EYEA 3GT0A 3FWNA 3S2IA 1RYEA 2AQHA 2HO5A 3U4IA 5DN9A 3ZNQA 4ZVVA 2NVUB 5HA5A 1DJQA 1C14A 3E48A 3NJ4A 4ZHSA 2VTEA 5COAA 4CL8A 2VUTA 3H65A 3U62A 5T5QA 5DULA 5FFFA 4BO7A 5G0UA 1Q7GA 4TKLA 1OI7A 1ULUA 2HMSA 2UV8A 3RVDA 4RF4A 2JD0A 4IDEA 5KVCA 3ROKA 1F8GA 3OF2A 4E2ZA 2G17A 1XQ1A 1LA2A 5A9TA 4Q3AA 2BRUA 5IXYA 3T7CA 4MKRA 3NTQA 2UUOA 3OP4A 3B6ZA 3KLPX 4TZTA 1G0NA 4DLLA 4G81A 1P1FA 3EZLA 3ZGYA 2VYVD 1FJHA 3GGPA 2HK9A 3ETGA 1QYXA 4LGVA 2PK3A 3TOXA 3WWZA 4BB6A 1E3WB 5DP1A 4XGKA 4IGEA 5TJ9A 2W98A 4IZIA 2YUTA 1EZ4A 1MFZA 3U4DA 3RUAA 2VOJA 5TS3A 2DBZA 2QRJA 2ZTLA 5H81A 1HSZA 1JKIA 4J1NA 2FMUA 3UCXA 2YFQA 4CUJA 4G65A 2EF1A 1DC4A 3DZIA 1U2GA 1GY8A 3DBLA 3GG2A 5C3MA 4BV8A 2BFOA 1PR9A 3L4BC 1KERA 1D1SA 4L4RA 5DNAA 1GR0A 1BXGB 3CH6A 4ZQEA 2JD1A 3R6DA 4IM7A 2NU8A 3OHSX 1ZBQA 5A3VA 1ZK1A 1B16A 1CRWG 4WGGA 4L76A 2AEJA 5JC8A 1PWXA 4GI2A 4BO6A 4OSOA 5ES3A 3ZV3A 4B8WA 2VRCA 5CPFA 4CQLA 3HQ4O 4MVJG 2P2SA 6LDHA 3WDSA 4LSMA 4RV9A 3I6IA 3DWFA 3X2EA 4FOOA 2OL4A 4E31A 4K26A 1NQOA 3DXFA 5F1KA 1KVQA 1GZ3A 1Q0QA 4BNFA 4DL9A 1YS4A 4OSPA 3NX4A 2A92A 3AM5A 1ADFA 3JQFA 2H1SA 3O26A 4DQXA 4I5EA 3JD4A 3WBBA 1ZCJA 1D7OA 1LQTA 3LF2A 4HFRA 5JC1A 1Q1NA 3GDFA 3Q2IA 2J3IA 2IZ1A 2Q4EA 2VOEA 3GVCA 1K3TA 7MDHA 4U6QA 3RASA 1GU7A 1BHSA 4JLWA 2NU7A 3EDMA 1MA0A 4J6FA 4RVDA 4LVCA 4FS3A 4R3NA 4IIVA 4UEKA 4BKOA 1BSVA 4P38A 3JD0A 2VN8A 5F5LA 1LSOA 4PG6A 3JTMA 4Y6RA 3FWZA 3FCOA 1R37A 2DTXA 3W8DA 1ZNQO 3N7UA 2Q4BA 3GFBA 4N7RA 2GN8A 5TX7A 1YB1A 4WUVA 2I3AA 2ZTUA 1GCOA 3BTVA 1U1IA 1PTJA 4XQEA 1O9BA 3MWEB 4MKXA 1B3BA 1EE2A 3RJ5A 1Q7BA 3PI7A 1ML3A 2A94A 1DIRA 4A26A 1J49A 4E12A 4BNWA 1E7QA 2WMDA 4RPGA 2B4RO 2W2LA 1FMCA 3WTBA 1TT7A 4EJMA 1NVMB 1P0CA 2F00A 1OBFO 4R1SA 4MP3A 3WBFA 4A73A 1HE4A 1B2LA 3OA0A 3RFTA 5L7YA 3LLSA 1T2AA 1I33A 4MVJM 5EN4A 1M6HA 3HDJA 5G0SA 2I5PO 3L77A 2EV9A 3C1AA 4WECA 3RWBA 1G0OA 4DC1A 1P45A 3IUPA 2Y1FA 2EJWA 1UZMA 3ZU2A 3R1IA 1U7TA 4NQZA 3WSVA 3A1NA 1E7MA 4RZHA 2OGUA 5K9ZA 4P22A 3KZVA 2I99A 4ALMA 1ZKMA 3ANMA 1XSEA 5U1PA 1XQ6A 5JCJD 1WVGA 1B8PA 3OQ6A 3PLRA 5EJ2A 5G0VA 2VHVA 2B35A 4WNCA 5IDQA 5TNXA 2ZJ1A 4AJ1A 1JWBB 1C3VA 3AK4A 4EJ6A 1VRWA 4KZPA 4BV9A 1ZK2A 2QG4A 3SLKA 3V1TC 4OXNA 3GK3A 2IXAA 4JNKA 1P44A 5HS4A 1SMKA 1LJ8A 1OOEA 1GQYA 3AOEA 3P5SA 1N9GB 4NIMA 5KVSA 5T64A 1AHHA 3I9NA 1HTBA 1ONPA 4RPKA 4E2WA 5C7IO 2UVDA 5JXWA 4CR8A 3D5QA 4CMAA 4AJ4A 5JDCA 2B4QA 4OM8A 4J9VA 3PGXA 2FN7A 5IZCA 1HRDA 2D1YA 4BNLA 4BNKA
chains in the Genus database with same CATH superfamily
1EMDA 3UAGA 1UFQA 4I8IA 4WRRA 2AN9A 4KDEA 3AQ4A 1AZTA 3BTOA 1OPRA 2G80A 3CCBA 3FMIA 5TJHA 4JT8A 5E2AA 1T2DA 3I1YA 3QFFA 4UD2A 1LRKA 1JFVA 4DCJA 3E9RA 1J5PA 4F72A 1MH9A 1N57A 3ZN2A 1XP5A 2DX7A 5AJXA 3HYTA 3T7KA 4WJZA 4YY3B 4OQXA 5CFZA 1R15A 5CVTA 2BR5A 2JJYA 2VBIA 1O5TA 3E0QA 1BD3A 1SD1A 4TSFA 3EVTA 4HDMA 3L5KA 4C7JA 1QX3A 2WU1A 2X41A 1US8A 3QEJA 4Q4HB 2XCSB 4CIWA 4RFLA 2GN0A 1XV5A 4Y2QA 1XAHA 3E8XA 3RBAA 4YPFA 1N6KA 5JT1A 2PQ2A 4G41A 4JSRA 2PT5A 3UOGA 1G9SA 1U0TA 3BFPA 1YT5A 3D7MA 2GASA 3MT9A 3AUKA 2XCUA 4EUSA 1L8QA 1SUBA 1THGA 2H17A 1G6KA 2YWEA 3LBYA 4H4EA 2VAWA 1NAIA 2R84A 3INNA 3OICA 4RHEA 4U63A 4HZGA 4C7KA 2CMKA 4ZYUA 1Y37A 2VRWA 4Q3OA 2PA3A 4YAJA 3T3EA 3EARA 2J4FA 4BLUA 4KQJA 4CW7A 1ONOA 1N6LA 2VP6A 3C3YA 2PLAA 4RV5A 1J06A 4KMRA 4UNRA 2HWYA 5JCPA 2P9TA 1REQA 1R64A 2IQ5A 1V37A 4PWZA 4R40A 4V2UA 5E6RA 3ZU5A 2BFEA 4BP3A 2DEUA 4B3DA 3WLPA 1N0VC 4AY4A 3P8ZA 4RABA 3CX4A 2JFUA 4IF4A 3LW7A 1EU1A 3A4MA 2WY2D 3AEYA 1YCGA 2FEXA 3QV1A 1IVYA 2CXHA 3CLSD 3DD1A 4GW3A 2MSCB 4YPVA 1ZA1A 1RXIA 1SH7A 3DA8A 2EDAA 3W1WA 1WCIB 2GAJA 1VLQA 1W5FA 2R1TA 2ZT7A 3GFFA 3G5UA 4QOSA 5GGXA 4KNYA 2ISSD 4AKSA 4F86A 3DDNA 1WDMA 4NY1A 5KX5F 3I2GA 4PCUA 4FSXA 1BKSB 2Y99A 3KT8A 5EHQA 3I1IA 5E4TA 3U3DA 1KC1A 4MRSA 4J9UE 2J7PA 2EX0A 2V9ZA 2IE8A 1SHJA 4NDNE 1FYWA 1AC5A 2J6IA 4JP8A 3F6EX 4NOKA 4WNAA 2HSDA 1PFQA 2J5RA 3Q85A 4YEDA 1DKMA 1W5EA 3Q8KA 2WINI 1URPA 4YXWA 5CB4B 2VQFB 4D4JA 2ZSDA 2XQFA 2XCRB 3E03A 3A4IA 2GJAA 5IABA 4DY6A 1UXGA 4NEQA 1TUBB 1W5AA 2RHHA 3IC5A 5K8LA 4OFZA 2C8JA 2G9ZA 2Q5OA 1N6IA 2NU6A 3G1WA 3MC1A 1VCHA 4BFTA 4KHZA 4CIDA 4D74A 1VPEA 5CDUA 5IJ0A 5J4LA 4FUQA 2VJYA 1OTHA 2VRBA 2YY5A 2RHMA 1I3LA 4OGKA 3W78A 1DX4A 2KW5A 5TMBA 3OO1A 4NJOA 2XKKA 2G7MC 3DVSX 4CV2A 5JU6A 3SSMA 4KACA 4N03A 3P0FA 3U26A 4MGHA 5IT9A 2AEFA 4P7BA 3GXOA 3NB0A 1ORHA 4RVGA 1S8NA 1KYXA 2OVBA 4A0QA 1ONNA 1Q57A 1HK7A 4E2YA 1IM5A 1M67A 6AT1A 3RADC 1NVFA 2RHTA 3K9GA 4K03A 2NG1A 2XBUA 3VC1A 2DQZA 1SPBS 5E7IA 3R3XA 2QYTA 3T5MA 3VR5H 2BOVA 4TVKA 5DCUA 3HCEA 2OAP1 1Z2DA 4DWVA 2UVPA 3AFNA 2ZZNA 2YFYA 3FNGA 3DT8A 1TPYA 3UAXA 4BPBA 3ZQ6A 4LIPD 5LYJB 3KTOA 4CVNA 1AMUA 4BC1A 3I8XA 4HLNA 1OAAA 4YDRA 2WUEA 4LF4B 1V2HE 1QZ3A 3FDZB 5HRCA 1GQFA 3BF7A 4LZWA 1T2CA 1RQXA 1XHLA 3NPAA 1XL0A 4KIFA 2EFJA 4TUYF 1RRKA 5FO0A 1V7ZA 1YH3A 2NAPA 3ZWPA 1ECFA 3BK2A 5C1PA 2ZRGA 3LQFA 4BO8A 2AKYA 1W25A 3B3JA 3Q40A 5LQSA 1JSCA 3DP9A 1C3LA 1IN8A 1KJQA 4Z4GA 1JR2A 5KQMA 4X7PA 1GSAA 2HTFA 3O0DA 2XUOA 2QTRA 1C8BA 1UF9A 1WVMA 3PWKA 4X6XA 3RFVA 1H2BA 3SX2A 1D8AA 3UC5A 1EQAA 5EJ6A 5IAAA 2V5UA 6Q21A 1XF9A 2PQ6A 5JW6A 2XWPA 4YA6A 4Q9JA 4HQFA 1YS1X 1GZUA 1XT6A 1DAMA 2OVFA 3S0JA 3SZLA 4UBKA 3TYXA 3WV5A 5IBCA 3OKCA 1NKVA 3G8YA 3QTBA 4WNYA 4EVSA 1KDTA 4HMOA 4UCQA 4W6QA 2J9FA 2RBEA 1JQKA 1JBKA 1Y48E 2W2LD 3NETA 1TO1E 4GYWA 2Q46A 3CT6A 4UKDA 1KMHA 5I47A 2JHFA 2FRXA 4G4SO 2P2CA 1VMAA 2Y0PA 2ZB2A 4TWIA 4S04A 3PJDA 3PVSA 5AKGA 4RTKA 1OWNA 3K9QO 3WLNA 2VJNA 4R8KA 4X62B 1R6UA 2JCYA 3LPAA 4IKPA 2OQ2A 4JQOA 4JODA 1Z28A 1Z0UA 3S29A 3UATA 2YMMA 3WGVA 2P6MA 1NOKA 1I32A 3MSCA 2VDLB 1ZNZA 2GYUA 4EGAA 2QRLA 1LW7A 4RE5A 5EUBA 4L73A 3IAFA 3X1JA 4LE2A 3TLYA 5I7SA 4OKIA 4LJKA 5IN5A 5C1OA 4R98A 4ZGGA 2ZLBA 5EC8A 4KVGA 2VPQA 2TMDA 3N2NA 4QTYA 4YP1A 3MLBA 3BK1A 2R11A 4D4GA 2NYRA 1HZJA 3R4CA 4ZODA 4CHGA 5JBNA 4MQ6A 4JYPA 3KU4A 3G9XA 1ULTA 2Z2XA 4O02B 4V0NA 2NOAA 5FD8A 3KFLA 3IE1A 2P3QA 3KQPA 1IK6A 3FH0A 1W9MA 3ZK8A 3I09A 4HDCA 4YP7A 4DSUA 2OHFA 4OJTA 5ALPA 1U2GC 2IP1A 1FBNA 1OX6A 2JZCA 3LHSA 2J5KA 5ETJA 1A7AA 4CQMD 5BORA 2GPAA 4IIJF 3S70A 4E13A 5FOSA 5G4KA 4X61A 2Q4DA 2CYBA 2JCVA 5IFKA 1LW6E 1UK7A 4PONA 1M8FA 4QULA 4RGBA 5CT4A 1VE7A 1PT7A 2PUTA 4PHGA 4NHOA 1IOZA 3E5NA 8ATCA 1YFZA 5EPUA 1YR9A 1F9AA 4TYNA 1WF3A 4TVOA 3BWMA 3TUIC 2NYUA 3VC3A 5CLJA 3VNRA 4EGQA 3AF3A 2C83A 2PV7A 2PX3A 3DBLB 1WU7A 1YBFA 2D7JA 4EKNB 1YKGA 3T61A 5KTTA 1COWD 1QQ7A 3FZQA 3PUJA 2D1TA 3RQIA 1OLUB 4LK2A 4MJ7A 2R4UA 3HJHA 4Q6BA 2FG5A 1P2UA 3SFZA 1BVHA 5AVKA 1ZMTA 1JUDA 3U19A 1H2RS 3A6EA 4LWOA 1LTHR 3V8EA 1SCJA 3VFDA 3JQFC 1NYTA 3KDSE 4W9RA 2HA6A 4X1KB 5EIOA 3SIPA 4CQLB 3ZHOA 3KEGA 3DULA 4LDJA 3SFVA 1XZQA 4EPTA 5AIAA 3GLUA 4R3UC 1JDVA 3OIGA 3CUEF 2DLCX 1VL5A 3GV0A 1T8YA 3K16A 1PF7E 4YAGA 4LZLA 2AE1A 2PMCA 2YJGA 4RUKA 4L0MA 3CEHA 4UJ3A 4URFA 1JE1A 3KLMX 3VMFA 4WH0A 2ZETA 2W48A 1YAHA 4MKHA 2WP8J 1TD9A 1G42A 2XOEA 2A6PA 4MQ4A 4ZC1A 1NZDA 4GHWA 4GL4A 3ZBTA 4KMOA 4L3OA 2C2BA 5B58T 2B37A 5EI5A 3M89A 3L1IA 1XZJA 5BRJA 4RTMA 5FOTA 4EPWA 3ULKA 4HYYA 4OI1A 4QM6A 2JDID 2IIBA 1NNLA 1ZJ4A 2I9PA 2ONZA 2I7VA 2XIJA 2YBEA 4QEZA 1LLCA 2YRXA 2SNIE 3SLRA 2Q99A 2W00A 2NU7B 3TLAA 2WZQA 1NSFA 1DP4A 1UP7A 2VUUA 3MPOA 2FX3A 3NTXA 1X92A 2IX3A 3ZCQA 1E2MA 1K08A 2Q0XA 2VYND 3MLAA 3QUBA 2SECE 4YROA 1UBSB 4BKMA 5LKRA 3O83A 5GJCA 1W76A 5FH9A 5HYVA 1A27A 3HUEA 1KK1A 4P5DA 2V3CC 1VJGA 1YR7A 2IPMA 3FUVA 3ZR4B 4PNHA 3E9EA 2I2FA 3GRUA 4KPUB 2HEIA 4JXXA 1A2OA 3QEAZ 1FFGA 1XIVA 3B85A 4HXEB 1Y42X 4Q3DA 3VZDA 3RAEC 4ZGWA 1G4AE 3B3AA 2Q8NA 5CDSA 3OY2A 3O6VA 3W8EA 2OZKA 4RHTA 2KMLA 3SGLA 3BILA 4X1IA 4XB1A 3VSAA 2ZZKA 4XR9A 4TLAA 1GZHB 5HKKD 4KC0A 3DCNA 5JAIA 2ZT6A 4XYEA 4D56A 2EZ4A 1FMTA 3TVTA 5KIAA 2ZTMA 5GGYA 1GCUA 5EYPA 1QO0D 3S44A 3HSSA 4JYZA 1F6BA 1RJ9A 5GJVC 4D26A 3KJIA 4NE9A 2CKMA 4HAXA 2I87A 3OZGA 4DM3A 4E6PA 5CBPB 8ADHA 1IXRC 3KPUA 1ENOA 3COZA 1K98A 4N5MA 1AA9A 1J42A 3B1ZA 1SC3A 5JQGA 5C9ZA 1M2EA 3KOXA 3VHQA 1D6NA 1M0SA 4URZR 3QKWA 5GZ1A 1U7XA 3MCAA 3IJPA 3UICA 3WKCA 1MGOA 1YDWA 4RJ2A 2FZ5A 3DE1X 1VJDA 1XVTA 1MOPA 3OIWA 2JCBA 4L3VA 1RXYA 4P81A 3SM9A 5A0VA 2WLTA 3FRHA 4YBZA 4Z1OA 4EQ6B 4PPGA 2ECQA 1XD9A 3W5IA 3WLTA 1J0EA 4C0JA 2EKPA 3RC7A 1Q14A 1RBQA 2EATA 5EKUA 5F3RA 1HDGO 1PQ4A 1Q20A 2Q5HA 2Z3VA 4JYBA 1GUAA 2WFZA 4OF4A 4PAOA 4E2FA 1XJWA 1PWZA 4GMDA 2WNHA 1Y3FE 3NHFA 5KYUA 5JHHB 3VYTB 3RS9A 4P4GA 2G25A 4QVKA 1F06A 1S7GA 2D3TA 4Q48A 2WD8A 4UE3S 521PA 5SYNA 3RU7A 3V80A 4ZI3A 3EEFA 3GYGA 2FMTA 4TMXA 4TLLB 4HNTA 1R18A 3CX8A 1ACJA 2ROQA 1JMKC 1KKMA 2ISQA 4QRDA 4XKJA 1G5RA 2QUJA 3MJRA 3P0RA 3W1EA 2PFSA 4TL8A 4B6FA 3VPXA 4D6PA 3WAGA 1ULAA 3HI4A 2QX6A 1XXLA 1V7CA 2OO5C 4RIHA 4KUGA 5DLDA 3UMBA 3EA5A 1JSRA 2JZOA 1X0VA 3IOEA 1I8TA 1E1CB 1Q1GA 4HQOA 4UFOA 5ALWA 1E3QA 1DADA 1QONA 2GARA 3V9PA 1NXTA 2HFJA 4EJSB 1KSFX 2JHPA 2WOJA 3M5CA 4J1QA 4EITA 1YDFA 3WDLA 5IMSA 5AK3A 2WIAA 4PLPA 2WA1A 1NXPA 2Q1XA 3AJ9A 2GLXA 3CEPB 4MPDA 4E5VA 4MDEA 4KO4S 2J9ZB 4FYIA 3A3NA 4BQIA 2PXAA 1EYZA 2VDPB 4UCFA 3UFXB 2FE1A 4EO4A 3GVPA 3O91A 2H8GA 2EKQA 5A1TA 4B4VA 2BKVA 3C6ZA 1SR8A 1EI9A 1P0PA 5FNZA 1DNPA 2OXFA 4S3MA 2DWCA 1UZNA 1WDWB 5A4AA 1JDJA 3LDHA 5AI9A 4ZYVA 2FDCA 1MQAA 2OWDA 4IDDA 1XU9A 2O8CA 4KWHA 3D3NA 1S8AA 1C1XB 3JPYA 2PD6A 3KZCA 5AM1A 2Z83A 4EUKA 1G7CA 3L0IB 4XE5A 1QVAA 3RIHA 3VYSB 1ZH2A 5BR4A 2QW1A 2JVIA 3PJGA 1KH3A 2B21A 1PT5A 5EIBC 3UHJA 5CA0B 4Q4LA 1VPDA 1FRVA 3GLFA 1K5HA 4J75A 3IMGA 4KOEC 3FDFA 4HO1X 1V1RB 1C8LA 3KQWA 4U7JA 3SHVA 4CFYA 2LVBA 1RRMA 3LY7A 4FFVA 4GRIA 4S24A 1JSLA 4OXXA 4QTZA 3L6UA 5L4SA 5EQDA 4OXQA 2GN9A 3DL2A 4G1FA 1FYVA 1PVDA 4X20A 4Y6PA 3LVFO 4BRUA 1TCUA 5KKAA 4BU0A 1GFIA 2CXRA 1I51A 2REBA 3DSRA 5IDYA 5CB4F 4BQRA 2YJTD 4EAQA 1BDJA 3VXKA 5BN4A 5BP7A 3DV2A 3OE5A 1FL9A 2FVYA 2VUSA 3T6KA 1Q83A 4URVR 3ICEA 3UKDA 1J24A 1T9GR 3C6KA 1IHOA 3PBKA 4NPHA 3L43A 4BO3A 4D0LB 1YA4A 3KX2A 3URKA 1W30A 3VO8A 4R68A 2O2CA 1DS6A 4XJVA 3VJMA 5F9FA 3G0IA 3F96A 5I4IA 3JWJA 4HG2A 1DRWA 1P5HA 1YIDA 3HCBA 3S8EA 2JJ2A 3QKUA 2VF5X 2R6R1 5FQNA 1J70A 1OMOA 3H2KA 4N5IX 4WLNA 3R8CA 5LD2B 1FW6A 4MW7A 1IMOA 2V54A 2IEDA 5GONA 5ALVA 2BMFA 3MGKA 1FQOA 3OCCA 4DA4A 2PGAA 5B4TA 1CJVC 3ORRA 4K8RB 4DKJA 4RK0A 2BZGA 3ZBUA 1WULS 5FULA 3R0QA 2ZIEA 5BR8B 4UAGA 1BW9B 1R0XA 4J0IA 2BHNA 2CMHA 4TVSA 2JLZA 1YBAA 1D07A 4GKVA 4MVXA 2Q5LA 4LUCA 3NALA 3W2HA 2O9JA 3E9DA 4KTVE 3K2IA 4RE6A 3X43A 4CWAA 4QUAA 5JUWA 5KNBH 4ZVRA 2JIDA 1M34B 4GPBA 4IFEA 4P34A 2FWAA 2PUDA 1GADO 4MSUA 5EVCA 1DC7A 1NLMA 1UL1X 3BMNA 3T1QA 4E5UA 2M6KA 1D2MA 3LKBA 1D4OA 3R0VA 1AZLA 1MOQA 1LDBA 3WX0A 1IULA 1XDZA 1WBBA 1U99A 1M5RA 3LDGA 3UH1A 4KFCA 1LX7A 3Q3CA 4XDHA 1OLOA 3JALA 1JPNA 1Z35A 4WNIA 1OU4A 2BGTA 1ABFA 5AM0A 1J39A 1X7HA 5CIYA 1A5BB 3BXXA 3OOHA 5G41A 5DOVA 3WB1A 5TS2A 2WAAA 3K92A 4GQAA 1T3SA 3FHLA 4N0PA 4J4TA 3E05A 4LW8A 4MW1A 3CEJA 4NFHA 4ATNA 5I45A 2AMFA 2TMGA 4O3MA 3IT3A 3IVRA 4KXYA 2ZE7A 3L40A 4A0RA 2H29A 1KVSA 4PSUA 4XYGA 3TQQA 1R9NA 2IXDA 5DM0A 5JWOA 1PZMA 2GAAA 5BNTA 3JWIA 1HT2E 3LZCA 4DLBA 3GC6A 3K71B 1A76A 1CXZA 1I4TD 1ZYUA 3DVAB 5BUQA 3COPA 3EIQA 1FPMA 4AI6A 3ELWA 4OI2A 1M2JA 1E3EA 4A0SA 4ZVKA 5IDVA 3ROEA 1BCSA 3I9FA 1PAUA 2PX4A 3VTKA 3ZHYA 1GGJA 2OPBA 4DIOA 1A9OA 1CQXA 3E70C 1E6UA 1LS1A 1QRRA 2B8JA 5BYAA 5AOAA 1LI4A 4H16A 1WZEA 5AH0A 3H3JA 3N0XA 3WL6A 2WWHA 5DHTA 4TGLA 2R8OA 3ZTTA 4LYDA 4CM6A 2BVNA 3T9DA 2GKOA 3FKJA 2QJRA 4MQFA 3WJ2A 3FX2A 3ZWQA 5ADVA 1IH8A 1G20B 3NBXX 2IP2A 1ZJJA 4GZLA 4S2EA 4XQCA 3Q87B 3K4QA 4X64B 1SZPA 4LJRA 4OQNA 1UBTS 2R65A 3R5KA 4FZVA 1PP4A 1R5NA 1E60A 1C2YA 4JA2A 4P08A 4P80A 4G3XA 3ONFA 4PZLA 4E7PA 5IYZA 3HM9A 1FNCA 1QRAA 5HQ3B 3B20A 1CUSA 1EBBA 4UTOA 5AFSA 5DHRA 3UMRA 1L8XA 1IY9A 1T3GA 3Q72A 1GNTA 4FXOA 5D51S 4GOJA 5CDFA 4C21A 1WUJS 2A59A 2Y9PB 4UUQA 4DCTA 2F1OA 2VHZA 2ZR0A 3DXZA 4LRWA 4Q9DA 3TW8A 4QWMA 1MB2A 3T4UA 3SS9X 1YRLA 3N6VA 2AR0A 4I5GA 2BMAA 4CMBA 1CUEA 2O2XA 1V5EA 2X23A 3P96A 2W90A 4TRJA 4ZEMA 4G0VA 3ESAA 2Y2VA 2I3ZA 4I4CA 5G2OA 3TSYA 1Z06A 1UBFA 3VPSA 3X1ZA 5JADA 3LM8A 3BD7A 3KDAA 2AN3A 4I1SA 3G0HA 4RC9A 4NBVA 5A1JA 5FLXA 2GEJA 3PE6A 1E4EA 1TEXA 3G7SA 1DAHA 2FPLA 1PV4A 1T1IA 3GAMA 4RCVA 4FWBA 2FLVA 5CJPA 2YASA 4G9GA 3SSOA 2YJ4A 2W2TA 4C06A 1HO3A 5D1HA 2UXCB 2QVYX 3NBYC 3ND7A 3C5HA 4MW0A 4ABYA 1L7VC 1HZZC 4BB0A 3PNLA 4ZV4A 5J2TB 1W44A 2X8JB 3AU9A 2IS1A 1KRHA 3RKRA 1BFKA 1B8OA 2O6HA 1AUXA 1T6BY 4LFBB 1ZBDA 3R3UA 4N9QA 1G6Q1 2Q49A 3V1LA 1XZAA 1QF6A 3I9V1 3IVMA 3C14C 4G8JA 2RHBA 1GRCA 1BVUA 2H4HA 4P33A 5BUCA 3UWOA 4L74A 4F46A 3TLCA 1GZ6A 5INTA 1GV1A 5AM3A 4JJIA 2WWIA 2XMPA 1EDBA 2HWXA 1KE1A 4TLMB 3T34A 1P8AA 3SFTA 2VP9A 2VQSA 1RZRA 4XRRA 2PNFA 2VK2A 4Y67A 4Z5XA 2YS7A 2RHGB 3U9TA 4OHMA 4M6WA 2QU7A 2BJVA 3DE4X 3JY6A 2D00A 1TYBE 3V8QA 1RR6A 3LDUA 5HRAA 4D25A 1N2ZA 1P61B 5DEOA 2GILA 3SEZA 5F21A 4Z7JA 2GPBA 3QLVC 5IRCD 5DBFA 2C3YA 5EXSA 4U1RA 1H3FA 3CNBA 3KVNA 5HCNA 3WV4A 4TV8F 3G6WA 4JLOA 4BO2A 2ZRJA 2NACA 2XGMA 4K6CA 3WYEA 4OXRA 4B0OA 3GLIB 1X0XA 3DTVA 3O31A 4RM2A 3D6TB 3UCEA 4HAYA 5DI3A 2J1LA 2NVUA 3D64A 4I1UA 4MO2A 4DS3A 1TCBA 1MIHA 3QXSA 3MCTA 4LISA 4PAGA 4QU9A 1HLGA 3UANA 2KX7A 1V71A 4M21A 4A0HA 4CKCA 4WKNA 2WYIA 3EZ6A 4YJHB 4CTJA 4I1RA 1MJHA 2XT0A 2FWPA 4DG9A 5KPDA 4PPFA 2IYQA 1TZCA 2G3YA 4IEIA 3RI3A 4PPQA 4EENA 4ZVOA 3GLGB 2GOYA 4OB7A 4MP6A 4I1OA 3RQSA 1OXSC 1NQVA 2P91A 1KSGA 4CEIB 1JPVA 3K9HA 4MUNA 1ZP6A 4JLVA 4MUXA 4OJQA 1SXHA 5AW3A 3JWGA 1C8KA 2B20A 4GX5A 4ZCSA 8MHTA 2ZJZA 2A1UA 3WSTA 1LS6A 1VHQA 5KYXA 2JANA 2Q2OA 3L05A 4LY0A 1ZVMA 1KYIA 1YA8A 4ZYTA 4IS2A 2CY0A 2CHUA 2AX4A 3MJHA 4IY1A 4JBIA 5LDGA 2IU0A 4ZMBA 4RZ2A 4KAAA 1EUDA 1PN3A 2GZHA 3S7ZA 2V7WA 3HN7A 2GPTA 2WUWE 3RS8A 2L0XA 5L51A 1Q11A 3FNBA 1ZUIA 4DZTA 1UDCA 2XVAA 3EXG1 3NT2A 3TUJC 2BSQA 4XZ3A 1NRWA 1Y9DA 1FVFA 1O8CA 4QJBA 5GIOE 5HQJA 2B61A 2QSUA 4JLMA 3LBFA 2VCEA 4WK6A 3W9BA 3UHOA 3C7TA 2WG2A 4EKIA 4ZA2A 2VNAA 1U5BB 2AGVA 4E5PA 1QRSA 1P7YA 3IUYA 3QFHA 1ORTA 1ZM9A 1T1SA 5F1OA 5IEBA 3WL4A 4CIBA 3ZHBA 5JH7A 1RI4A 3Q3GE 3VPFA 1O0BA 2AG1A 3SOPA 4R2XA 4UBNA 4ZAWA 5EJ4A 3G89A 3KFXA 3MJFA 1VBNA 4YRBA 3W5AA 3DONA 5DNYB 3IEPA 1GPJA 5EKTA 3ICQB 3D2BA 4QU8A 1D6JA 1RI2A 1VE3A 4YCDA 3F8WA 3W9UA 2QTVB 1U5AA 3JVDA 4CHTA 3IKVA 4FOSA 3LBNA 2PUEA 2BT4A 3A3KA 1Q21A 1TFRA 2PS1A 2I65A 2O2HA 3D2AA 3IRVA 1OW3B 5ALEA 3BA1A 2XAAA 5KWEA 3QLTA 5IW8A 3WK5A 4DSZA 1O94D 2MYPA 2O5VA 3K8QA 4DMLA 4GR9A 3SE7A 2JI7A 2OFPA 2Z2KA 3REFA 3OHMA 5KJ6A 1PYDA 5JR3A 3ZVKA 4PEVA 4U0KA 1MBZA 1Q77A 5DGTA 3KQHA 2MYNA 2BSAA 1OC4A 3GRFA 2XJ9A 3EW9A 3HRIA 4FFDA 4RD4A 4Y2JA 5LBIA 1DTWA 3M5PA 3I0ZA 3IPRA 4C87A 3HNOA 5MF6A 5AO9A 3ZV7A 3V32A 5AM5A 4FEEA 3QVMA 2UUPA 2XTNA 1E2JA 2OILA 3CUWA 1FTWA 3H5OA 2G71A 3KSZO 4QBIA 2HU5A 3TVYA 1VFPA 3K9LA 4DJTA 4WA8A 1LBQA 1JIJA 3Q9NA 4WCFA 4NC9A 3AL2A 2H54A 4FI3F 2J08A 4JVNA 4LDZA 1Q0SA 2PKQO 4D02A 3JVVA 3T5GA 2V6MA 4I3GA 1V9LA 3O2SB 5DTRA 1AKTA 4BV2A 2R8BA 4U2DA 1RMYA 3LGSA 3PUZA 5JSQA 5FOXA 1QH1A 4EB0A 5SICE 2B0CA 2EGHA 3LC1O 1SCNE 1KXJA 2AZDA 5K8IA 4B6EA 4BLVA 4G5HA 3V4FA 3PFHA 3UZUA 2BP7B 5HRUA 5I48A 3R77A 1NBEA 2ZTVA 4N6NA 3U80A 1NHWA 2NV6A 3TD6A 4A91A 5AHXA 3DB2A 4R2JA 1RXEA 2R4QA 3L1VA 4YECA 3K53A 5M04A 3HS3A 3CWZA 4XUDA 3UEOA 3N07A 2D5BA 4TN5A 3VC7A 1Z5PA 4IJVA 4M98A 3UBMA 4A8PA 5HUJA 4RDCA 2HI0A 3KT3A 2I6FA 2JBAA 2QJOA 2VHQA 2AOUA 5ENZA 5IUJC 4LHVA 3W4IA 3HL0A 3ISJA 3N1UA 4NJEA 3VR4A 4NL4H 5EIHA 1GA4A 1GA1A 2CDBA 2J0UA 4GMFA 4BFXA 1IBKB 2VDNB 2HGZA 3UA4A 1P1CA 3NVDA 2FHSA 4WN9B 4RW0A 1GNVA 3RC2A 3LL4A 1YB7A 4YQFA 1VIMA 1XLUA 5P21A 5CA0F 1AQ6A 5CTAA 8GPBA 2E4WA 1LXCA 3OFND 3BYZA 2YOHA 4EKGA 2O8DB 1P0IA 2CMDA 3PFCA 2HU8A 1DSSG 3ICWA 2VZ9A 2CVHA 2IIPA 3LUAA 3Q3HA 1T1RA 2JFVA 2WE8A 2WSSA 4L5CA 4NKRA 5FBRB 4YIKA 2RI0A 3DVQX 3L1KA 1M34E 1HWYA 4P82A 4UATA 5K3DA 1B1CA 1ZH4A 3JAWA 4CM8A 1KO1A 1C5KA 4BMOB 4GZMA 1AV7A 4JEHA 5CM2Z 3UWKA 3EISA 4FSDA 3AKCA 1IPFA 5EQTA 4XGRA 4DNXA 3I30X 4C6SA 1SQ6A 2WTEA 1H8HA 2AX3A 3FFAA 3O8BA 2DKOA 3FHJA 5IX8A 3HCAA 1EPUA 4YT5A 3RGGA 1RI1A 1XYGA 1Z8DA 4LCBA 1UIRA 1M72A 1ND5A 1AN9A 2H7YA 3NHRA 4NBUA 4CMJA 3UJ3X 2CF5A 4F5YA 1SWWA 2GBFA 3C0KA 5FBZA 1XLTA 2HCJB 1JLKA 2VEDA 3LCCA 3I4FA 4PX5A 4BJ5A 2I55A 4MJXA 3NDBB 3DPSA 2RGNA 4R8VA 5D5PA 5FBVB 3A1DA 5JNSA 2C9YA 2B0JA 1NSYA 3M33A 1DAEA 1H0RA 2XWSA 3BMOA 2P27A 4HCJA 4IX9A 1ISJA 3TFWA 5KHLB 2WM9B 1KIMA 2WPDD 4X65B 2C5BA 3EQ2A 3GEMA 2FA9A 5LXTA 1K7FB 3E0XA 1EIWA 3VTZA 4NZ9A 4POOA 5L4NA 3B1KA 3GDOA 3H6KA 3TCXB 3FR7A 3NQ41 1VPWA 4BXOA 5TGZA 4TSRA 4DE5A 2O6LA 3ENNA 1HMYA 1P1RA 1KFJB 3KJEA 2BGGA 1KRXA 3AUTA 4YP5A 3LKZA 3GJYA 3ZDYB 3L0PA 2WUFA 2WJ4A 2YH2A 1G20E 1JQ5A 3VVLA 1MDBA 5IDWA 1DJNA 5LKAA 1NLZA 1V3QE 2AXQA 2YV1A 1U90A 3TNJA 1NATA 7REQA 1YIAA 3RU2A 2O0KA 2CUNA 2QP3A 4RXTA 4D3YA 4HDOB 3F90A 1XZFA 1ZISA 2HJSA 3HBFA 3ZGVA 1X7DA 2RC6A 3ZY2A 1KFBB 3LSYA 3Q9LA 1O4WA 4WVFA 1UXKA 3QLJA 1Y33E 4FGWA 4HRYA 4P35A 3ESQA 3IKTA 1GPLA 1ARZA 1F4PA 4QDUA 1ST3A 2ODEA 1OUMA 2RHDA 3RHZA 3RDPA 1LSSA 1ZJYA 1QVRA 4I5IA 1B93A 5FPHA 2W70A 3EODA 4GM1A 1TIPA 4CMCA 1OYYA 2HAEA 4F4HA 4JP3A 1XA4A 1JI0A 2FYTA 1T9AA 5DIZA 1EM8B 1XMPA 3E9QA 4HYQA 1ORDA 4BCDA 4DJEC 3V4SA 5C18A 1FFXB 2QY9A 3ZG6A 4YMLA 5LOVB 1U0OC 2GH1A 3OAAD 4WK4B 1DT5A 2Q2VA 2C31A 4H1VA 2AOXA 1D9ZA 3TSAA 4NZZA 3L4EA 1IG0A 4D9JA 5DNDA 4Y9RA 2W2XA 5D5QA 5EIFA 1VA4A 1RQRA 2MSWA 1XXHB 3M6LA 1T8SA 3Q0IA 4NVRA 2C77A 2F3TA 4PPYA 5H16A 1RNLA 4PCLA 5L3VA 4CCSA 4RF2A 1ZJ5A 2C96A 4BMYA 1I7DA 1XA3A 1XLWA 2FUNB 4Y2PA 3Q98A 3UMGA 3E22A 3NIDB 1VB5A 2DWPA 2H0AA 3A4NA 3MD0A 3QIVA 4IUDS 1SHTX 1AU9A 3M6WA 3ZI0A 2CL5A 1J2EA 5AJZA 3SQOA 4F9GA 3EXIB 3O8NA 1MA3A 4W99A 2SCUA 1QNFA 2ZEJA 4HDAA 2C5AA 4E30A 2IZZA 1A96A 2FPWA 3EQ6A 3I0NA 1IN6A 2O1EA 3ZYCA 2BH2A 5JJIA 2R7LA 2ZI6A 1H0KA 2BGKA 3E3LA 1CNFA 4L8FA 3JQ8B 4BZQA 3ORQA 3ONEA 5MGNA 1NNSA 2JHGA 4BGUA 3IH5A 1KI4A 3OLQA 4MUKA 2J3KA 5HZHA 3WGKA 2FZ4A 2WUDA 3O74A 4AKHA 3LXUX 1P17A 1QYWA 4MK4A 4AL4A 3DBRA 2BKXA 2GCGA 2P6UA 3GGSA 1QZTA 2YWHA 4JJ7A 1EM6A 3ET4A 4JVSB 5JXIA 3O73A 3NRBA 3PVZA 3VKWA 2XQJA 1I4LD 2BGRA 1RPNA 1ZGHA 3FSGD 5HOQA 2GEFA 2CNDA 5EZSA 3GLIE 3B70A 1A4RA 1TM7E 4FBGA 2CFIA 5KWJA 4S0ZA 5AHOA 5IMBA 4BU1A 4E22A 4F5EA 1UQUA 3JQ6A 1B8VA 3TL6A 1TK2A 4NG4A 1TB4A 3E4CA 1FP6A 1QLHA 3IT0A 2E1PA 3JPWA 2IPOA 5CFPA 5J2TF 2VTVA 4CCAA 4RZXA 5L4LA 3U4HA 1JN0A 1YJAA 2QJFA 5GY7A 4EJ0A 2PL3A 4B17A 3GEPA 5DJ5A 2IXTA 4TZ0A 5I9LA 4HX9A 4TMTA 5FL7A 1CIPA 2VBFA 3H16A 3JV7A 4D43A 3GLGE 2C2GA 2I91A 1QM5A 5BQFA 3V4RA 1XZGA 1R88A 1E3IA 2V6IA 3PPIA 1E1RA 3LHDA 4WGFA 4AYTA 3V8RA 5T6MA 5DU2A 1OX5A 1OWOA 2XXAA 3ER8A 3O2JA 3TEFA 2O57A 1VJ5A 2C99A 2PKRA 4PNPA 4DGQA 3ZHTA 1ADBA 3QKIA 3E7WA 2NSLA 3HLYA 2XZPA 2OFOA 5C34B 4AG6A 4GRDA 2HSWA 5DI9A 2ZU0C 4J1TA 4QOGA 3T4XA 5HK9A 1H2EA 3GP8A 4A10A 5DW0A 2G67A 4KH0A 2W6JD 2B9EA 5BXQC 3I6MA 1K2WA 1KYYA 3QU2A 2DY1A 2AUNA 5I01A 4DJAA 2I3DA 3WQHA 1KHHA 1NKTA 2H1LA 2JKYA 1UFOA 1U7DA 1W46A 1Z13A 4HH4A 3LO8A 4Y9SA 4UAUA 2P6NA 3WIOA 3DQPA 3NGLA 5ES4B 1ZH8A 2X77A 3IBTA 2A8YA 4YUVA 1AVTA 3AUYA 3LE8A 1GWNA 3H1BA 4FHCA 4IIGA 4OGFA 1OGYA 3SNKA 4AX8A 3L7MA 4EF6A 2GZSA 3UK6A 2DVMA 3E15A 2BJWA 4Q05A 3HWX1 3ERCA 2C7BA 5CB0A 4UUNA 4ADSG 4DB2A 4L9RA 3DKIA 4X60A 3ZE8A 1A5SB 4YJ2F 4ND6A 1GRVA 4EABA 3TDKA 3A26A 3AFGA 4QFMA 1RXUA 3CFYA 3U4QB 3FDIA 3CMMA 1YWGO 4OMUA 2Z8YM 4EI8A 5B4VA 4I81A 2BJHA 5U4QA 5KNDH 1AH2A 1FMFA 1Q1QA 3LU1A 1RYDA 4OP1A 1QP0A 3HWWA 3I5MA 1VC2A 2O8BB 1E3LA 2E9SA 4LNUB 2ZJAA 5F2EA 1RLOA 3FVRA 3AZPA 1LZLA 4EZBA 3HTXA 2HA3A 3JYNA 3WGMA 5L45A 1AKVA 4BHTA 1A9QA 3E3MA 1XTZA 1ZN8A 1JDPA 2PZLA 4NYIQ 3GA7A 1N1EA 4EA6A 1K9VF 2MYTA 4EATA 3LP8A 5BWLA 4JI2B 1IZ8A 5EL0A 1W1UA 2FZKA 2QM0A 3O90A 4LE0A 4LI3X 4UM7A 4UREA 1FSPA 3JQBA 1JVSA 2P4EA 3KZKA 2A2ZA 3TFOA 2IS4A 3LVQE 2W2PA 1IYZA 5K3AA 1RTTA 3WO0A 4YIHA 2IV7A 5C5DA 2WKSA 5IK2D 4AKIA 5ITZB 4LPSA 2W5UA 1PR5A 3ZW9A 2CYAA 2VP3A 1I10A 3ZLBA 1XMXA 3QELA 4KQ9A 4CI9A 4NU8X 3A1TA 2IH4A 1U4NA 1CBUA 2DXIA 2EVWX 1RZUA 4TRNA 2YR0A 4LMPA 4LYHA 1Q92A 1V6SA 3HJGA 4BNDB 1E4OA 2OC9A 2O0MA 3CKKA 2NO5A 3KTFA 1BE6A 4RTRA 3TE6A 1YQQA 5CT6A 3N2GB 1CERA 1QNLA 2C1EA 4BRSA 5BV0A 2PH1A 3IDOA 1EKXA 4NYMQ 1YXMA 5LL6P 2DKNA 4LNHA 3WQSB 1W49A 4JL8A 4BGVA 1MGPA 3DZGA 1U7PA 3A9SA 2FQ1A 2Q41A 3TIXB 2J9YB 3CCCA 4HGPA 5T4HA 5AI6A 4G4GA 3S7TA 3GDGA 1R0ZA 3W6OA 3CM0A 1MU0A 3G1TA 4LTDA 3MK31 3D3JA 1U1DA 3GZNA 1W36D 5BRAA 4O4IA 1KEPA 4RVFA 4AF8A 1GSHA 3AHIA 4FCWA 1DV2A 1OFTA 2Q6OA 2IHKA 1IXZA 2VDMB 3R6TA 4U4AA 4ZT5A 3QU5A 1EFVB 1A1VA 2A4KA 5CK5A 3ROXA 5JNWA 3U3XA 1U7OA 3FSJX 2I2CA 1XDGA 1RWKA 2HJWA 4P53A 1DQSA 3IAXA 4JT9A 5JQWA 1XRMA 1H1LB 2FSVC 2A0YA 2WIGA 2YNMA 3OZWA 5TPZA 3KJZA 2AVNA 2QZ9A 9LDBA 4WN3A 1ZJ6A 3L7BA 2JFOA 3ZJYA 3O4VA 1N7HA 3HCOA 2OORA 4FDUA 2I6QA 2AD5A 2FPPB 4JLJA 3H2IA 1DIGA 2BGUA 4GGOA 4MVCA 1TA9A 2Q3LA 2R6DA 2BM9A 2BFBA 3W5UA 4ERNA 3W2GA 1KI9A 2PFKA 4I6JA 5JSFA 3GX1A 5FORA 4GKAA 1P4SA 4WZAA 1Q74A 3CY6A 1DHRA 4NK5A 3B48A 5E9WA 1JLHA 3RSQA 4QICA 1G6HA 1K3UB 2F43A 2OCPA 2XA2A 3P20A 3LX4A 3FDXA 4B74A 2C5GA 2O8FA 3N53A 1QX4A 3ESZA 5H8WA 1U98A 3AG6A 4E15A 1QVVA 2EJVA 4EHJA 5ER9A 2QRNA 2QL6A 2RC5A 3M4NA 1XN1A 2AKAB 5HE9A 2I7XA 4MITA 3NBQA 4JUBA 1L5HA 3ZQ4A 4AZ0B 2EIHA 3WWOA 3F67A 3THWB 1KS2A 3C4JA 3M4JA 1F2TA 5CYOA 5EUQB 5NLLA 4CM4A 2BFCA 4K1XA 4B7CA 1HT0A 4QTTB 3Q41A 3RK0A 1LD3A 3IS3A 1SY7A 4ARVA 2OXRA 3BJRA 2IUEA 2IQIA 4HFMA 4RLFA 4D97A 2AOTB 4GFDA 4B6JA 3MGAA 4MA4A 4ZV7A 1VSVA 4RMGA 3HP7A 5G53C 2QXTA 3WE7A 2ZAYA 1YJ8A 5AKIA 3KYDA 1XAGA 2VDKB 4N3NA 1G19A 1TT5B 2QLJA 3GZ4A 4H1TA 4WXHA 1JHPA 1ZAKA 3FUCA 3HY3A 1D09A 4QPJC 1K6EA 3TLBA 3ZDXB 4CT4B 4F85A 1RVDA 3WSWA 1X80B 3R5SA 3IQXA 4FZRA 1Z22A 4DCOA 1XELA 3C8MA 1N5OX 3GCGA 5ER6A 1MCZA 2IA5A 3EW7A 2H2HA 4C0BA 2QK4A 3H4IA 2VA9A 2YWCA 3MWDA 3WIBA 3WIEA 1I4WA 5GZ6A 1FX0B 1LLUA 1ZRMA 5K09A 2EP5A 4BO9A 1M2OA 1NG9A 1L7BA 4MKZA 1NBWB 4KVZA 4K9QA 3ZBPA 4XJTA 3GHYA 1W75A 4Y2HA 4F96A 2W6CX 1YI0A 2B5WA 1UPBA 3NOQA 3VH2A 1XQVA 3AVOA 5BOVA 1N8NA 1XRJA 1D2HA 3CUKA 2HXYA 3KM0A