4CM8B

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 91
structure length 251
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm8B00
3BIOA 2P5YA 1D4FA 1NQ5A 5BT9A 3V8BA 1YONA 4NBWA 3E1KA 4R69A 3F4BA 2NTNA 4BNGA 1E3JA 2NSDA 2C29D 2OOSA 3KB6A 1IULA 2Y1CA 3WBFA 1NVMB 1HYHA 2GN8A 4XDYA 4W9NA 5EINA 1IHXA 3I5MA 1D7OA 3ANLA 1VM6A 4BO8A 3GAFA 4NBRA 1Z7BA 2YY7A 1CDOA 4I5GA 2CVOA 3I6QA 1R37A 4QUKA 4GBJA 5L40A 1DC5A 2DVMA 1GYRA 3JQAA 4JXKA 2D4AA 1PJBA 2ZTLA 2O2SA 2IDZA 4YYZA 4TRNA 1KEUA 4Z3KA 3M2TA 1ENZA 4OOFA 1L7DA 4PG7A 4AJEA 4I08A 1B2LA 4BNXA 2CZCA 1I30A 1JU9A 4K9DA 1J49A 1R66A 1LC0A 4MVJA 3ICPA 3AJRA 4PLHA 4OYRA 3NJ4A 4BO2A 2POQX 5TF4A 4U5QA 3LLVA 4D0SA 4PLVA 3WFIA 1KOLA 5A05A 5GZ1A 2JCVA 3LK7A 2Y0DA 3ICCA 3GVHA 4AJHA 1I2BA 1VLLA 2VNSA 3S1LA 1NNUA 2EJVA 3V5NA 1QP8A 2GN9A 5IN4A 4AJOA 2EP7A 4H16A 4DUPA 3VH1A 5JBIA 3CE6A 1R0KA 4PFJA 1P1KA 5T5QA 3W6UA 3RJ9A 3WIEA 4CV0A 5ICMA 3RASA 5IFLA 2BRUA 3HDQA 1EK5A 3RUEA 3WGHA 1N7HA 2PZLA 3A06A 2GZ3A 3E6AA 3PPIA 4M55A 3EGOA 5BSFA 2X58A 3KEOA 4FBGA 4ITUA 1LDYA 1H2BA 1C0LA 3GA0A 5LCXA 2C07A 3AFMA 3WGQA 4CMIB 4EI2A 4EUHA 5DCUA 4MVJD 2LDXA 5KTKA 1A7KA 2OBNA 4FC6A 3FI9A 2AEFA 1UDBA 2E48A 4MVJH 4CM6A 3GDOA 3DOCA 4IMPA 1C0IA 2DC1A 3H7AA 1ID1A 1QKIA 4A0SA 1SB9A 3A1NA 4J9UE 3L77A 4O59O 4F45A 3JYPA 4FW8A 3JQ9C 2Q1WA 4E2WA 4F6CA 2C2XA 4Y67A 4BGIA 5A4DA 2Y99A 3CIFA 5TT1A 2B83A 2XAAA 3DR3A 3CZMA 1B14A 1JN0A 1HYEA 1UXGA 4NIMA 1NPTO 5H81A 1FK8A 1RM3A 4XGIA 1XWFA 1Y8RA 4AJ1A 2OUIA 3GN1A 3GY0A 5JYDA 3PFWO 2IRWA 4R4JA 3JSAA 4CMAA 4KMSA 2VYVD 1WVGA 2GZ1A 3BMQA 3T7EA 1B8VA 4DLAA 4IS2A 5CPFA 1WLYA 4FGSA 4P4LA 4P38A 3HB5X 3LT4A 4GAEA 4RZHA 2TMDA 3W4IA 1EE9A 5KVSA 1DIHA 2CMDA 3LF1A 3IUSA 2YUTA 1TI7A 4HFNA 3GF4A 3KYDB 1WP4A 3D4PA 4II2A 4R1UA 1LSUA 1NASA 3C8MA 1PS8A 1F14A 3ZWPA 4GPD1 1A9YA 4NK5A 2PD6A 1U4OA 4WNCA 1XGKA 2QRKA 5A9SA 2D1YA 3FN4A 3JQFA 2X9GA 3F47A 2DPGA 4P8RA 2ZTMA 1ZMOA 2Y68A 1ZKMA 3UCEA 3GQVA 3PDUA 5A5EA 1BWSA 1NTOA 4HBGA 4J90A 3A14A 4W9NC 3AUAA 1NBOA 1WMAA 4W4TA 1MFPA 2GZ2A 1U3TA 2ZCVA 1I0ZA 3H5NA 3PQDA 1K89A 3VTFA 2IYOA 2JCXA 4YAKA 1P31A 5IZCC 1BGVA 1Y6JA 1GU7A 1YQGA 1FDUA 2HAEA 3H9QA 4B7UA 5A9RA 5L7TA 3BYZA 4HFJA 3KV3O 4RLSA 5L53A 5CEJA 4BO0A 5I9LA 3GHYA 3QQPA 1KC3A 4I5EA 1B8PA 4CM8A 2O7SA 4DBVO 1H9AA 3BHMA 4PRLA 5G4KA 3H4VA 3DZFA 3T4EA 1LRJA 2C7VA 4JBIA 2FSVA 1JDJA 3IS3A 3KYCA 3SX2A 2CFCA 4QO8A 4IM7A 5I9MA 2J5RA 5T8KC 4IPTA 4RVUA 3RC1A 1B15A 2O50A 1FDTA 3WTBA 3AOGA 4A03A 5BSEA 5L7WA 3PLRA 3VH4A 4NR0A 3DAGA 2GDZA 4GGPA 1XYGA 1ZFNA 3PK0A 1QV7A 3VPGA 4NHEA 1HDZA 4YJFB 1PEDA 1YXMA 5AVOA 4AJJA 2DQ4A 5ICSA 3QSGA 2Y1FA 3IP3A 3M6IA 3STHA 9LDTA 3ZZNA 5AXCA 3A9WA 5DOVA 5G0TA 3PYXA 5CDSA 3JQ9A 4YR9A 3LC1O 1O94A 2ZYAA 1K2WA 4ZU3A 1KEPA 2X0IA 3DTYA 3H9JA 3SLGA 2VT3A 1QXSA 4A10A 1HXHA 3TZKA 1PQPA 4NJMA 1NFQA 3BHJA 4R1NA 2GSDA 3H6KA 4U7WA 3WMWA 3LF2A 5TLSA 3ZV5A 3W8EA 2B4TO 4DQUA 3L07A 1I2ZA 1V3TA 5FI5A 5JE8A 4L75A 5CEFA 4DMLA 2F1KA 1PWZA 1BDBA 3P5SA 5JO9A 2XOXA 3JQGB 4D79A 3N74A 3NTRA 3VPSA 2C5AA 2HLPA 2TMGA 3WLEA 4BNTA 4IZIA 3JQBC 1YBMA 3UCXA 4XJSA 4YBZA 3INTA 4ALKA 2HO5A 4J1NA 2JD0A 1ZEMA 5KVQA 5B4UA 1KVQA 3SVTA 1YB1A 4OAQA 3B1KA 3AUSA 2I76A 4GMFA 3E18A 2I67A 1F17A 4J4HA 3JQAB 3I9JA 4EITA 4BHTA 1P1FA 1QRRA 1YOVA 2HDHA 1NWHA 4J2OA 1R4NB 5L7YA 4GSLA 1O89A 1DFHA 1EDOA 3JD3A 4FGWA 1U2GA 5MDHA 3KSDO 4QEDA 3NDRA 2BD0A 2PKQO 1DEHA 2VRCA 3DHEA 5TGDA 2R6JA 1KVSA 1X15A 2X8LA 5F5NA 2IEDA 1MV8A 1DLJA 3B70A 4IXTA 2P68A 4YEDA 1NPYA 3RFVA 1QMGA 1Y5MA 2PFGA 1CWUA 4BQRA 1DHTA 3HJAA 3ZH2A 5C37A 1P74A 3VH2A 1IUKA 3RUIA 4E2XA 3B1JA 1ISIA 2WJPA 1C14A 2O3JA 4J1QA 3HG7A 5FI3A 1GUYA 5C5IA 2HMTA 4YACA 2XF8A 3R0IA 2YHUA 4CMCA 3GPDG 2AQKA 1VC2A 4BNLA 4L9RA 1YJQA 2E6UX 3KLMX 2DAPA 4F6LA 1NQOA 3K73O 3LZ6A 4JQCA 5F21A 4IBOA 1PTJA 1DSSG 4CLOB 3ORFA 3GHHA 2VHZA 3CKYA 1QYXA 2RH8A 2AQ8A 3WQRA 3ZWOA 4BNYA 5ER9A 2PH3A 2HJSA 1KETA 1D1TA 2VCYA 1R0LA 4BNMA 3CH6A 3IAHA 5TJ9A 3QIVA 1B16A 1Q0LA 3ONDA 1LEHA 4N18A 1KY4A 1ISHA 4IJWA 3LLSA 4WJZA 9LDBA 1D8AA 1PL7A 2WE7A 3PZBA 3VZQA 1WZIA 3GUCA 1BXGB 4KDEA 1JW9B 4YTEA 1BTOA 3KSZO 4XB2A 3TWOA 3MJSA 2GR9A 1NVGA 3C1TA 3V2HA 1SCUA 3WS7A 4GSKA 2GD1O 2FR8A 5F1PA 3ROMA 4GLLA 4DVJA 1DIRA 1EVIA 4E5MA 5IF3A 1DFGA 2NADA 1U2DA 2NVWA 3L6DA 1PU2A 1N7GA 2HMSA 2Q2WA 3GG9A 4K6CA 4AJ2A 2ZB3A 4LCJA 4NFYA 4J4TA 3UVEA 2BHLA 3GFGA 1XLTA 2FPPA 3ANMA 3HQ4O 3NGLA 1I3KA 3O4RA 4XQCA 3W4JA 4BO7A 3PZRA 4AICA 1Z74A 4E32A 2CF5A 1YB5A 3GH3A 1GL3A 1N5DA 3MWEB 4H3VA 4H7PA 4ALLA 1KVTA 2VT2A 3FR7A 4MOWA 3VZPA 4YJDA 2EWMA 3S2EA 1EUCA 3DBVO 2D59A 3JQAD 5U4QA 1ZEJA 1YH3A 3NV9A 5JC1A 3SEFA 4WLEA 1X0VA 2P9GA 1JVBA 1H9BA 1R4MA 2NLOA 5ES3A 4DIOA 2EKQA 5F3RA 4Z9XA 3GN2A 4IDAA 4CM1A 4BNFA 3S2IA 5L4LA 3NDIA 3F5QA 2LDBA 2FZEA 4ALMA 3GAZA 4CQLB 3WXBA 4FOOA 1EQUA 3TFOA 2ZKLA 5JAQA 1AXGA 2PR2A 4P22A 4D41A 3GGOA 4ILKA 4AJKA 4K6FA 5JY1A 5JY6A 5KOIA 4I5DA 3W4KA 3C3XA 2YFHA 5A04A 1PGJA 2VHWA 4XWYA 1ZMTA 1XA0A 3ASUA 3VC7A 2X5KO 3KEQA 3VTZA 4EJMA 1PGNA 1P9LA 1Z6ZA 2AW5A 1RPNA 5DOZA 2PKRA 5B37A 3GK3A 2ZTUA 3WJAA 4BQPA 5IXSA 1ML3A 4BIIA 5JDCA 1E1LA 3PEFA 4RV9A 1U3WA 4M87A 4FS3A 1GEEA 2UVDA 2W2LD 4EYEA 4XA8A 4F3YA 1NR1A 1CERA 2W2KB 3OQ6A 4CLXA 1CEQA 3OJFA 4BKPA 4CMGA 2HMVA 4BGVA 5A5FA 4P4NA 3JD1A 4K26A 2VZ9A 1PZFA 4G5HA 4BNHA 2E82A 4OQZA 1X14A 4J49A 4NZ9A 4CV3A 2JD1A 4IJUA 1P0FA 3U5TA 2Z1MA 2ZYDA 4ALJA 4D43A 2VTDA 3U4IA 4QO7A 4GVLA 4BMNA 1GUZA 3AY7A 2HK7A 3QLJA 4FN4A 5DCWA 3TF5A 3QVXA 1MP0A 4A73A 4PLFA 3HDHA 3Q6IA 4UREA 1LBEA 5L4NA 1YE3A 3VPFA 4YAGA 1C1XA 3WTCA 4YAJA 3UXYA 3PXXA 3H3FA 1LDGA 3CSDA 3ON5A 4XYEA 1DJQA 1IPEA 1SB8A 3OP4A 4JJIA 1OFGA 1LX6A 2OHXA 1HKUA 3CINA 3FBTA 2IODA 2YZ7A 4XIYA 3VVCA 1M6HA 3IDSA 1S7CA 2G1UA 4IGEA 3AUTA 1WNTA 3VH3A 1FJHA 2C5EA 4QTZA 5F1KA 1XCBA 3AM5A 1TVEA 3H3JA 4YWJA 2EJWA 3OJLA 3DFUA 3RKRA 4ND1A 4TVOA 1N8KA 1ZJZA 1GZ6A 2Q2VA 3AOEC 3F5SA 4G2NA 1A72A 1KIFA 1DC3A 3LQFA 1K6JA 3C24A 3R1IA 4OL9A 4RORA 4DA9A 1DAPA 4YRDA 1J6UA 1HDCA 1PZHA 2I6TA 1LRLA 3C7CB 3MJEA 2HCTA 1PJCA 2A9FA 2DBQA 3UICA 5COQA 5KKCA 1VKOA 4U6SA 3ROKA 4LVUA 2O2YA 5DCYA 4F46A 4UULA 4KTTE 5JMPA 4TKMA 5JYEA 3UAGA 4PG5A 3OSUA 1BRMA 2ZYGA 3DHNA 4CM3A 1PGOA 3BTUA 1WXDA 4HKTA 3OF2A 4E6PA 2Y1DA 3DZGA 3WICA 5JFOA 2VOEA 4JJGA 1SZJG 3DZBA 3NRCA 1VJTA 4WK6A 4EDFA 2ZB4A 2HKIA 4E33A 1C1DB 1H6BA 3G17A 2B5VA 3WGIA 4PG4A 3G1UA 3KVOA 1JKFA 1NFRA 2Q45A 3IMFA 2SCUA 1XR3A 3RWBA 3UN1A 4PLZA 3AWDA 1UP7A 4J7UA 4J16A 1TEHA 4RDIA 1HTBA 1AE1A 1T26A 1XQ6A 3EW7A 1XDWA 3G1TA 3IIEA 3L4BA 3PP8A 4AG3A 4YQZA 1GYPA 1CQJA 3BA1A 2NACA 4BO6A 2OZPA 4BB6A 1J4AA 5KWEA 2BI8A 1F0YA 3U09A 1LDNA 2VHYA 2ZB7A 1GUFA 2QHXA 1VE9A 2XPCA 3PGJA 4ND2A 3PI7A 2QIOA 2OFPA 1ENPA 1B8UA 1LRKA 1WW8A 4E0BA 1XIVA 1ZZEA 1NFFA 1C0PA 5JCJD 4A2CA 5AXAA 4PLWA 4CLOA 5JO0A 2QRLA 3JQEA 4OQYA 1P33A 4M49A 2OO5A 4KQWA 5CDGA 1K6IA 5CDUA 4GVXA 4JBHA 4WOJA 2EXXA 3D3EA 1ONOA 2NQ8A 1X13A 3GOHA 1GQYA 3K30A 1O9BA 1PZEA 3IP1A 3DFZA 4IIVA 3O8QA 2VWPA 3R3JA 5KCZA 3ZU4A 1I2CA 1Q1NA 1FDWA 3K2EA 4IDDA 4PGFA 3EHEA 3JQDA 3DOJA 4C4OA 1I24A 4OKIA 1MXHA 5KKAA 3UW3A 1MLDA 1PJLA 4S1VA 4PG8A 3PQFA 3B1FA 4GH5A 4XQ9A 3BMNA 4D3SA 4WCFA 1DRUA 1XELA 5KNLA 3JYOA 1DXYA 4W7HA 3BMCA 4IUYA 3VZSA 5AYVA 3GZNB 3OHSX 5KJEA 3O26A 3PYMA 1E6UA 4NFHA 5DBFA 2GLXA 3QRWA 2P4QA 3W8DA 3BTSA 4MDHA 4WLNA 3JYNA 4ZQEA 5JAIA 1P1IA 2GO1A 1K0UA 4B8WA 4AL4A 3IKTA 3DC2A 4TVBA 1KVRA 3BMOA 3FHLA 2BMAA 4TQGA 2IZ1A 4GKBA 4JGBA 4NU6A 5TJHA 3ZW9A 5T8KA 3KO8A 4JNKA 3D7LA 2CD9A 4MKRA 1MB4A 3CEAA 3DEYX 3U4DA 2E4AA 5CFZA 1Y9EA 4WUVA 3EDMA 3G49A 5HWSA 4DTIA 3KXDA 3QA9A 3BMQB 4XJTA 4IQ8A 4N5LA 4OH1A 4BNKA 3U3XA 2J3HA 3ZW8A 4TMFA 4OGWA 5ITVA 3H9UA 3L6EA 2RAFA 4IINA 4OKNA 3LSYA 1AN9A 1KVUA 5DP2A 1KC1A 5GZ3A 1UXHA 3JQ8B 3FNHA 3MJ4A 4QXMA 3ZDFA 3SJUA 3QWIA 4FJ1A 3O03A 4ONEA 1P1RA 3PLNA 4J1TA 1WDMA 5BR7A 2YDXA 4QFCA 3ZNQA 4FFRA 3F1KA 4HWKA 4IS3A 3PJEA 2IXAA 3TZQA 4CM7A 4JJFA 3TRIA 3N58A 4CV1A 1DJNA 1I33A 2VHXA 3CXRA 4CUKA 1I8TA 3OM9A 4R01A 4EUEA 5JAMA 3TZHA 3QVWA 3K6JA 3GDGA 4B4WA 1F06A 4E5KA 3QVOA 4RPHA 4ZQBA 3R3SA 3EY4A 4J43A 3E5MA 4C7JA 2YV1A 3QJ5A 5B1YA 3DAPA 1PWXA 3WGOA 2B4RO 3IOYA 4UEJA 2IEBA 1HF3A 3OIFA 4M8SA 2VUUA 2PK3A 4RVFA 2BH9A 5CAEA 1ZCJA 3DTTA 1BSVA 2GYYA 3G79A 2YFQA 3DBLA 3MJTA 2NU7A 4Q3CA 4PIVA 5LDHA 1XU9A 3QHAA 5L51A 4L8VA 4YJGA 2VNAA 2WDZA 3OH8A 4QQRA 3DMYA 3RU7A 2H9IA 3ANNA 1B3BA 3Q3CA 5THKA 2JFGA 3AW9A 1A4IA 3FNGA 3K2BA 4TRJA 3GEMA 4NBVA 1A4UA 4M54A 4CPDA 5JAZA 5IDQA 1DIAA 1EFLA 4O1MA 3LC7O 3ZV6A 2GERA 5JXWA 1GDHA 3UUWA 3H5RA 4J7XA 2B5WA 4EEZA 1HYGA 3TJRA 1FDVA 1FMCA 4U0JA 4UUPA 1RYEA 1E7YA 3LVFO 1N1EA 3I52A 1PQWA 4D7AA 1F8FA 1ZH8A 3FRJA 4WE3A 1GQ2A 2CVQA 2BLLA 3DL2A 4WGGA 5JNLA 4OXNA 1T24A 2OP0A 5KVCA 1MFZA 4M89A 1W0CA 4EJ6A 3NKLA 2FN7A 5U1PA 4L4XA 2FZWA 1HT0A 2VRCD 4I9UA 3NDJA 1RJWA 1N1GA 1NP3A 4BB5A 3G3EA 2V65A 3LT1A 4LCEA 5JW6A 4G81A 3OEWA 4ND5A 2EF1A 2VYVA 3HFGA 1HE5A 4JP2A 3X2EA 5IXYA 4KDFA 1A27A 1X1TA 1CF2O 3E03A 2H5LA 4MIEA 3D4NA 1ENOA 1BW9B 3F9IA 4CLRB 3D3WA 3X2FA 4B79A 2GF2A 4LK3A 2PWZA 8LDHA 1P44A 1SBYA 4MVJG 5T57A 3UKOA 2CVZA 2OMEA 3NAQA 4BKOA 2QW8A 5K9ZA 1XG5A 2IZZA 5T67A 3KUXA 3VVBA 1R0SA 1TA4A 2X5OA 4DXHA 1C1DA 4QX6A 3KOUA 3PHGA 2PZMA 2WYVA 3GFBA 1NYTA 4LISA 3BHIA 1SOWA 2JAPA 3C1OA 3KHUA 2JHGA 4CM4A 1W4ZA 1Z45A 1Q2XA 1KS9A 1Z82A 1ZK1A 5A9TA 4LRSB 2OGUA 4IDBA 2NQTA 1WAMA 2ZTVA 3GVIA 4OIMA 3QV1A 4J1SA 4MVJE 4DBZA 5I7SA 1BXZA 1GPJA 1UXKA 2PZKA 3WOHA 3ROPA 4NK4A 3M1LA 3JV7A 4EW6A 4BNNA 4NJOA 1EEHA 1HEUA 4QSMA 3K8ZA 4NBTA 1SEVA 4S3MA 3ITDA 1OZAA 1V0JA 3IJRA 4DIFA 2B4QA 2NU8A 4XYLA 5C7LO 5A03A 1HE2A 4ZN6A 3RI3A 4JCOA 3WGGA 3ZNNA 1XEAA 2GRAA 4XDZA 5FYDA 2J8ZA 1B0AA 4YT5A 4BV8A 4PLPA 3P19A 2GPTA 1Z7EA 1NWCA 5COBA 2W98A 3GUYA 1QSGA 6LDHA 4HFMA 3H2ZA 4W6ZA 1YJ8A 3ONFA 4Q3DA 1YKFA 3DB2A 3HN7A 4UVGA 1PS0A 3S55A 1HE4A 4J2HA 1MA0A 1K3TA 1LDMA 2FY8A 2UUPA 3JCZA 4WCFC 1E3SA 4CQMA 1EK6A 4J4BA 4XQGA 1R12A 5K6AA 2AHRA 1EMDA 2RHRA 1LJ8A 3H8VA 3CUKA 4W7IA 4UUOA 3M2PA 3MOIA 1PQUA 3LT2A 4YJHA 5A06A 5BSHA 1EVZA 1ZK0A 1E77A 3I4FA 4Z0HO 2DBVO 4YDRA 3ZWYA 1E1KA 3WLFA 2GN6A 1PGQA 4WCDA 5CHEA 1ZSYA 4I8XA 1Z75A 2FWMX 3MTJA 4INAA 7MDHA 4EJ0A 3PHLA 5F5LA 3S2GA 3U9LA 1B26A 1BMDA 2X9NA 1I3LA 2EIHA 1NAIA 2I5PO 1U9JA 3DO5A 4R54A 4BNVA 1LC3A 2FMUA 4XCVA 4OOEA 1U28A 2UV8A 3GDFA 1YL5A 4HUJA 1YQDA 4D46A 1WZEA 1LU9A 1IL0A 4GX0A 4RVGA 4BUCA 2I65A 1PR9A 5HS6A 2NUAA 3C1AA 3FNFA 3Q0EA 4J7CA 1OMOA 2J5QA 3DOOA 1LLUA 1R6DA 2YQ5A 3DZKA 3UF0A 2Y1EA 1CRWG 4WEQA 4RF5A 1SOVA 2W90A 3WR5A 3E8XA 3PJDA 2E49A 3L6OO 4YPOA 3HUDA 3GG2A 4E4YA 3INGA 1R15A 2PV7A 1IYZA 2RHCA 3KLPX 4BO3A 1ZXBA 2O3SA 1DBVO 1LA2A 1V3UA 5TC4A 4L0QA 1SMKA 2GNAA 4CLHA 3UH1A 2QZ9A 1ISGA 3RC2A 1O8CA 2DPHA 2DUUA 3GGPA 4XYMA 4MP8A 1IZ9A 2C82A 3UHAA 2EP5A 5EN4A 5JS6A 3RKUA 1G0OA 3BAZA 1DIGA 3HE3A 3I83A 4JP3A 2D8AA 1ADCA 4RF3A 3FTNA 1H6CA 1QV6A 3UFXA 2ZK7A 3GNQA 3FPCA 1JWBB 4GMGA 4J0FA 4TKLA 3WB9A 5I7FA 1JA9A 2PH5A 3D1LA 2FPIA 1LLCA 3I9NA 3DBHB 4GKVA 3RC7A 1YDEA 1T2AA 1ZK2A 3F4LA 4JROA 1X1EA 1R16A 1DPGA 1GD1O 2DUWA 4N5MA 2YYYA 5L95A 2BGMA 3PYLA 2WTBA 5G0UA 5CDYA 3I6IA 4MVJP 2C0CA 4CMEC 3FCOA 1NHGA 2Q4EA 1XSEA 2BFPA 1I5RA 2QZZA 3JQCA 3GMDA 3OFSA 4D44A 4XQEA 1E7MA 2VWHA 4YJGB 4UEKA 1ADFA 3WMXA 2Z1NA 1U8XX 4TRMA 2PTGA 5CEEA 4PRKA 1RKXA 1H2HA 2X9VA 2JFHA 2VZ8A 4DWVA 4RZIA 5ILOA 3LYLA 3UCFA 4R5MA 2ZQZA 1T2EA 1LUAA 4E5PA 1ZJYA 2GUGA 4CR8A 4ZA2A 3WDSA 3L0DA 3RAJA 4D3FA 4CMBA 1E7QA 4HNHA 1PZGA 4LW8A 1EE2A 2WMDA 2PGJA 2VN8A 4WLOA 5EQFA 2YDYA 3ZWVA 1EFKA 5L45A 4KOAA 1NVTA 4L4SA 1LI4A 3F46A 2AEMA 3K96A 4IDEA 1ADGA 3BTVA 1WDLA 1U3UA 3OECA 2C7GA 4J6FA 4RQTA 3N7UA 1GCOA 2J3IA 1PL8A 2J3JA 4BNJA 1OI7A 3NJ8A 1XQ1A 1QR6A 3ADPA 4YCAA 2DFVA 2RH4A 1EBUA 4U8GA 1ADBA 1W73A 1WDKA 1Z73A 2O48X 4Z0TA 1GR0A 4MP6A 3ZNPA 2C54A 5C3MA 3RUFA 4PLTA 4PZEA 2ZATA 3DBRB 4UAGA 2ILTA 3PWSA 3O38A 4QECA 5THQA 3BXXA 4CR7A 1T4DA 1BW9A 3OIGA 4ZGWA 4J91A 5KJ6A 4Q3EA 1HLDA 5JSFA 3SBOA 1H6DA 1M66A 1PX0A 3GEDA 3HDJA 4FJ0A 3TN7A 3HN2A 2D5AA 4XX0A 3TL3A 2E37A 4HX5A 5AOVA 1ZNQO 1CJCA 4E2ZA 1VL8A 2IXBA 1PGPA 2EV9A 3HHPA 5DULA 4OMUA 3ABIA 3JYQA 2X6TA 4XYGA 3INRA 3NT2A 4BMSA 1HETA 3SLKA 5ADHA 1VL0A 3RBXA 1T1SA 3ZU5A 2WD7A 1ZBQA 1RM4A 3K92A 3VPHA 2X1HA 2Y0EA 5EMHA 1RWBA 1PS9A 1T2FA 2DU8A 2BFOA 3KYCB 1M6WA 3RUHA 2Q2QA 3PHHA 1GV1A 4XEHA 4OSOA 1L1FA 1Y8RB 3JD4A 4TRRA 5FEUA 1YB4A 2JJYA 3CMCO 5K0ZA 4KP7A 4B4VA 3U4HA 2I99A 4LRTB 4E3ZA 4BO5A 3WGYA 4JBGA 1E3EA 2ET6A 1C0KA 2WYUA 4CLEA 1DOHA 5KJFA 4YAEA 1E7SA 1GYQA 5H82A 2NTVA 1A7AA 3NT4A 1J0XO 4R41A 4YJFA 2Y1OA 5CG1A 4FFOA 3L9XA 3GRKA 4DPKA 2GN4A 1PJ2A 1GADO 4DPLA 1Y81A 3KYDA 1MXFA 3ENNA 4I9NA 1GCUA 5TX7A 3RBZA 3LC2O 4MIYA 2VYNA 1UR5A 2PLAA 4RPJA 1CIVA 1NR7A 2RIRA 4R9SA 1MGOA 3ETDA 4OXYA 1ARZA 1WMBA 5G0VA 3H2SA 3GLQA 3JQFC 3U49A 1DRVA 3OICA 2RBEA 1LLDA 3MTGA 3DONA 3NYWA 2EKPA 4MINA 5DBGA 3VDRA 5G0SA 1V6AA 2Y66A 2EGHA 5EQDA 5IAAA 4B3HA 4ND4A 1V35A 2BF7A 1A71A 3VZRA 2P4HX 1E5LA 2A92A 4CMKA 2X7HA 4R1TA 4WLFA 5DP1A 4RJTA 2YHIA 3QW2A 3PHJA 4LSMA 3E9MA 1MX3A 3MJVA 3QP9A 2HK9A 2VZ0A 3JQ7A 3O8QB 4WLVA 4YVFA 3NX4A 1X0XA 1LDBA 2ZB8A 4R3NA 2VQ3A 2CNBA 2H63A 4RVHA 1YO6A 4WLUA 1Y7TA 1ISFA 2O23A 3MEQA 3ZHXA 5IG2A 2DFDA 3OEYA 3WJ7A 1NXQA 5TIIA 4BKRA 3ZI0A 3ZWCA 5KJ1A 5TQVA 3O9ZA 3RVDA 4WCFB 5T6BA 3ZNOA 3ZWBA 2NWQA 2NVUA 2J3KA 3H5AA 3BMCB 3ZU2A 1MG0A 3RSHA 3GZNA 4RF4A 4XZ3A 4CL3A 1AGNA 2CSUA 1YVEI 4Q39A 4CMJA 4NDNE 1VSVA 4FFMA 2H6EA 2W8ZA 1DIBA 4DGSA 4YT4A 1I01A 3EVTA 3ZV3A 3I9LA 1HDGO 4CMEA 4DYVA 1UXIA 3A4VA 2BGLA 2PD4A 2YW9A 4NBUA 1QYVA 1BHSA 3BMOB 4HFRA 5IN5A 1YBAA 4NG5A 1V3VA 4E2YA 2O3RA 1OC4A 1K6XA 1ZUD1 2OP1A 3PFFA 3JTMA 4NI5A 3GVPA 4TWRA 1PJ3A 4TSKA 3RUCA 3AU9A 4DIBA 4NH4A 4KWHA 1YDWA 4MIOA 5HBRA 3OMLA 1DHRA 4W99A 2CF6A 1I10A 5AQ1A 1PL6A 5B4TA 4YXFA 3KZVA 5C7OO 2HMUA 1TXGA 2EERA 2DBRA 2Q1SA 3TZ6A 5A3JA 1P77A 1H5QA 2Q49A 5FFFA 3EYWA 1GZ3A 1Y8QA 3IC5A 4QT0A 3RROA 4K28A 3AI1A 3KETA 1Y5RA 1VRWA 1D3AA 1Q0QA 3ZWXA 1IPFA 3F6YA 3OJOA 3WG9A 2FSSA 4IXWA 4FDAA 4WKGA 1U5CA 3C7DB 2X22A 3JQBA 3BMNB 3QWHA 2R00C 4ALNA 3A28A 1E7RA 4E21A 1SC6A 2JAHA 4NNJA 4GL4A 1NQTA 4Q9NA 4LN1A 1ONNA 2B36A 1BDMA 1DFIA 2HK8A 3EZYA 3E48A 3JYLA 4NMHA 1WWKA 3I9MA 4DLLA 4L4RA 3GMSA 2NM0A 1OBFO 3KBOA 4YQYA 1EUZA 4TZTA 3QWAA 1MG5A 1ZXLA 1HE3A 1MC4A 3EUWA 3VPXA 4FFNA 5BNFA 5A1TA 3PQEA 4FQ8A 4CMHA 4XRGA 3DQPA 1FDSA 2XXBA 4XR9A 2G5CA 4NPCA 2J5KA 1E3IA 1PR3A 1U5AA 4CR6A 3Q11A 1GPDG 1H93A 2Z5LA 3IJPA 1TLTA 1YGYA 1G1AA 1Y1PA 3ZHZA 1GY8A 3ZCXA 2WD8A 4BS9A 3ETEA 3DDNA 2NVBA 3EAGA 4BOYA 3S8MA 2G76A 2NTJA 2YJZA 4AJNA 1U3VA 4BVAA 3COSA 4Y98A 4IIUA 1F12A 5GY7A 3WGTA 1UAGA 4FJ2A 1HSOA 2Q3EA 1DLIA 3DZJA 3WNQA 1MC5A 1HDYA 4O63O 1XHLA 3E82A 3JQ8A 2XXJA 4FR5A 3I23A 2VOJA 1TT5B 2X0RA 1LDEA 4D42A 3RUDA 4DRYA 2BFAA 3FWZA 4DYDA 3SC6A 4WEOA 3ZWMA 1VL6A 3EMKA 1QORA 5IDXA 1P3DA 1QYDA 3Q9NA 4RCVA 4FB5A 1Q0HA 3PTZA 4Z9FA 5TS3A 2QYSA 4TZKA 4PG6A 4ZJUA 5HS4A 1D1SA 5K6AC 3D64A 4ND3A 4N7RA 3RBVA 2GASA 2P9EA 4OM8A 1U7HA 2FR1A 1I36A 3F1LA 4IDFA 2D2IA 4ID9A 4W82A 5L9AA 3JD2A 2WYWA 3BZUA 4IQ0A 5EL0A 2PNFA 1P1HA 4GWKA 4PLCA 2B69A 4BL5A 4AVYA 1HDXA 2VRBA 5TNXA 1L7EA 1SNYA 3OBBA 3WBBA 3V1TC 2I66A 3ENKA 5DBIA 1VSUA 2Q46A 3D3WB 4GI2A 4XGKA 2I3GA 5IZ4A 3TFQA 3U4CA 1QLJA 3DWFA 2ZQYA 3K5PA 4LSWA 1M76A 4CMIA 3D5QA 4GX5A 3R6DA 1JTVA 2W2KA 5F1OA 2VUSA 1TT7A 3L9WA 4PN3A 5BNTA 2V6GA 5KVVA 3TL2A 6ADHA 5JCJA 1SEPA 3ASVA 2YV2A 4KUHA 1NX6A 4MKZA 4FOSA 4IY1A 5GMOA 4E31A 2AA3A 5B12A 4ROSA 4XYBA 1Q7GA 1AXEA 1E3WA 4C7KA 5IZCA 1O5IA 3E5RA 4ZD6A 2Q99A 3HADA 1C1XB 4CUZA 5L3ZA 5DNAA 1LSJA 5IJZA 1M75A 2AEJA 4GWGA 4FC7A 1QLHA 4ZICA 2X4GA 4EGFA 4E12A 3ZU3A 1GAEO 4M86A 4WNIA 5J23A 2R00A 1VJ1A 1R4MB 4EZBA 3RIHA 1UJMA 1Y9AA 4M1QA 4AFNA 2WE8A 1E3LA 1YS4A 2I9PA 1E92A 1YWGO 1LLQA 1HLPA 5TRTA 1RM0A 4NQZA 4CQLA 4X54A 3AY6A 4GQAA 2VTEA 4I5FA 4YRAA 5I9NA 4O0LA 2YHIB 2UDPA 3G0OA 4B3IA 1W6UA 5HTOA 1IZ0A 3P2OA 1LSSA 3GRPA 4UVHA 2W4QA 3IKVA 3RC9A 4A7PA 3HWRA 1X7GA 3OETA 4KUGA 5A9SB 3OA2A 2P2SA 1ENYA 2PGLA 4XIJA 1KEVA 1UP4A 2Y1GA 3QE3A 4IDGA 2OXIA 1QG6A 1MUUA 1V9LA 3MOGA 4NU5A 5KJCA 1PJSA 1ULUA 4BO1A 1EBFA 4EUFA 4KZPA 4MPDA 2G0TA 4ZQGA 3PJGA 5A02A 3P7MA 4CLDA 4PCVA 5ILGA 2QYTA 1DDOA 1B7GO 5DF1A 4ZHSA 2PA3A 3PIIA 4PZDA 2Y67A 2PKQP 3ONEA 1JKIA 3S2FA 5I7VA 4RO0A 2X86A 2VUTA 1O95A 3GT0A 1UUFA 2A94A 5T64A 3FWNA 3ZV4A 5EIOA 2PD3A 5JLAA 3SXPA 4Z0PA 2A35A 4A5OA 3HNPA 3QWFA 4HNGA 4WECA 4Y6RA 1AHIA 4B4UA 4R51A 3AFNA 4RPLA 4DL9A 1E1MA 3BTOA 4J3FA 4CL8A 4OSPA 5BNIA 2HUNA 4PVDA 3ZWNA 1HZZA 1T25A 3HDYA 3GVCA 4RL6A 4HV4A 3D0OA 1NAHA 4UVIA 1ZVMA 4OJNA 3TZCA 2BELA 2V6BA 1KYQA 5CPBA 1GFSA 3D5TA 1ISMA 4EEXA 3HB4X 3IUPA 1EVYA 3I4CA 2JHFA 1UZLA 2AE2A 5H83A 1PJTA 2CUKA 2V6FA 4U6QA 2AG5A 4XR4A 2AE1A 1YL6A 3VOSA 4MVJI 3OQ1A 4Q3AA 4OO3A 2B0JA 3ULKA 2UYYA 3EVNA 4ESOA 3QY9A 1M67A 1E7WA 5TT0A 3K31A 1PIWA 1ZIDA 4R16A 5JDIC 4IQGA 5BSGA 3NUGA 3KYBA 3I9OA 1FF9A 3WQSB 3AM4A 1T2DA 1KERA 4PZCA 1UH5A 4FCCA 1E0DA 2J6IA 4BNUA 3GNTA 1UAYA 1JQBA 4JN6B 3ST7A 3NT5A 3B6ZA 3EC7A 1O0SA 2X0JA 3H9GA 2IYPA 3MZ0A 4BNZA 1N9GB 4DMMA 1KEWA 3ETGA 4Q3NA 4A26A 4NJMB 4U0KA 4DC1A 2FOIA 2CY0A 2V6MA 4RDHA 4J0EA 3VHRA 5DZSA 3PWZA 4MP3A 3AY3A 4HP8A 4N5NA 1UDAA 5JDIA 2IE0A 3CTMA 2D5CA 2B35A 1U7TA 3V2UA 2Y05A 5G4KB 4BGUA 5BQFA 1E1NA 3MJCA 5EESA 2HRBA 3GPIA 1EVJA 3JQGA 4L73A 3P2YA 1DC6A 2WSBA 1O6ZA 3AOEA 4GX1A 2EGGA 1PJ4A 1M2WA 5COAA 2CDBA 2P91A 3E9NA 4MJLA 1GTMA 4UVEA 4EBFA 3Q2IA 1G6KA 4AJLA 3RFXA 4YRBA 1ISJA 4HY3A 4IDCA 4PVCA 1I3NA 2BKAA 4JK3A 3PRJA 3FBGA 5L4SA 4O6VA 2F00A 1X7HA 1YOVB 2WEKA 2Y93A 1LQUA 3WWYA 3AK4A 4AJPA 3HZZA 2HRZA 1HWYA 4FFPA 4L76A 4CQMD 1QYWA 3CZRA 1T2CA 3CMMA 4A27A 1IY8A 2HU2A 3W6ZA 3AM3A 1CQIA 3UOGA 2AMFA 5JMWA 1T1RA 4FFLA 1XU7A 5AXDA 1ULSA 2EEZA 3KM0A 5A3VA 3WYBA 7ADHA 5JC8A 2GCGA 3I3OA 3FD8A 1U1IA 2JL1A 1IHYA 2FP4A 4YT8A 2V7PA 1AHHA 3V1UA 4RF2A 3DBHA 3GZ4A 2YQ4A 2O3UA 3OA0A 4AJIA 2P9CA 3WFJA 2DLDA 1HSZA 1ZSVA 3GEGA 4O5OA 2FHSA 3GGGA 5C7IO 2NNLD 1ZK3A 2EG9A 1G0NA 1WPQA 5CDTA 4MO2A 3CPSA 3L4BC 5G4LA 5I8WA 4Y8VA 1VI2A 1I32A 1EQ2A 4E30A 1DAOA 4XD2A 4XGNA 2Y0CA 1E6EA 3H65A 2EKLA 3W8FA 1CYDA 2X23A 5DT9A 4R5HA 3WSVA 2FRDA 2C59A 5FF9A 1VKNA 2NV6A 2HMWA 3DAFA 2PGDA 4YB8A 1AUPA 2I3AA 4ZQHA 2Z95A 4DLBA 5MGBA 1SAYA 2VYND 2CDAA 4XB1A 1IB6A 5HA5A 1ORRA 1HL3A 4LMPA 1HDOA 2A4KA 3RD5A 1ZK4A 2DTXA 3C85A 1R4NA 1N2SA 4Y6SA 5JPIA 4YAIA 4R68A 3ZGYA 2ZCUA 3PHIA 1E6WA 5ITWA 3WQQA 3OJEA 4R1SA 3QVSA 4GGOA 1X7DA 2HSDA 4YA6A 2DKNA 2O4CA 4PLGA 3OQBA 4CM5A 3M1AA 4D45A 5IDWA 3HSKA 1E3WB 1K5HA 3PVZA 4MVJF 3TNLA 3DZHA 2Q1UA 4Z3DA 4R3WA 1XKQA 3WGZA 5KIAA 1VJ0A 3FR8A 1BXGA 2Q1TA 3I1JA 1U4SA 4B4OA 1UZNA 2DTDA 4ZVVA 4BO4A 1J5PA 2G17A 2P5UA 3AUUA 5FWNA 1LSOA 4HADA 4DREA 4DPMA 4DQVA 4RLHA 5ER6A 2JFFA 2ZIZA 4PLYA 1UP6A 2O4UX 3KRTA 2QX7A 3DBRA 3GR6A 2HJRA 3GVXA 1OC2A 4FIZA 5G0WA 1BVRA 4NFSA 4IJKA 3Q9UA 1P1JA 1JWAB 3EZLA 5I8ZA 4K1LA 3DXFA 1GEGA 5DDIP 5GZ6A 2ZJ0A 4CODB 2VWGA 3RCBA 4I9HA 3RFTA 3TQHA 5JDCC 3H9EO 3OJ0A 2DT5A 5EJ2A 5LC1A 4G65A 4LVCA 4CJXA 3DMTC 4B8ZA 2UUOA 3D4OA 3NTQA 5CP8A 3JD0A 4RGBA 5ENDA 1DB3A 1YL7A 4RQUA 1T4BA 1UDCA 2AXQA 3ZWWA 1EZ4A 1OOEA 5TSDA 2WD7B 2X5JO 3QVTA 2FPGA 1DRWA 1YQXA 4Z6KA 3MWDB 5HM8A 4E5NA 4CLRA 3WSWA 3W1VA 1P45A 1V8BA 3KTDA 4FPXA 3FNEA 1YRLA 4MVJM 3DMTA 2O7QA 2C20A 2D0IA 2WWRA 2H1SA 3JQ7B 3K9QO 2IZ0A 3T7CA 5G2OA 4KUEA 3ZHYA 1LXCA 3UGKA 2QRJA 1KY5A 2OL4A 4D0RA 3GC6A 3PIDA 3OIDA 4GLOA 3PGXA 1Q7CA 4KTVE 3VKVA 3DBLB 4E5YA 4WASA 4IZHA 3DZIA 4CM4B 4DC0A 1ZW1A 1DO8A 2CDCA 3TSCA 2JKVA 1W8DA 2DM6A 2EW2A 3E9QA 2NVUB 4BO9A 4D3DA 4WPGA 5U9CA 1JAYA 1U8FO 1DC4A 3U0BA 3I9KA 2AQIA 2ZJ1A 4BNIA 4UUMA 4YT2A 3C7AA 1H94A 2BGKA 5I7EA 1LQTA 1QYCA 2EHDA 3FTPA 1E5QA 4B7CA 1CETA 3ROQA 3FSRA 1SO8A 2VWQA 1F8GA 2QQ5A 2W2LA 3NEPX 3VKUA 1NPDA 4B3JA 2UAGA 3JQ6A 3KSUA 8ADHA 3V1YA 2O3TA 4Y6PA 4UEOA 3Q2KA 3RQSA 1Q7BA 2C2YA 4UUNA 4TROA 3WYCA 3AI2A 5LDGA 4P4GA 3T4XA 3SC4A 4JIGA 2BFMA 3ITKA 5EERA 4AJ4A 3AU8A 1N9GA 2DTEA 3WWZA 4ZQFA 2PZJA 5HRUA 4BNWA 3PJFA 1HZJA 1JVSA 4IJVA 1OAAA 1ONPA 3IQDB 4CM9D 2AG8A 1YBVA 3ZHBA 4FD3A 1HRDA 1B3RA 4LGVA 1UZMA 4MKXA 4ALIA 3HFSA 3GNSA 2D3TA 4RPKA 4N54A 4KWIA 5DN9A 1H6AA 4I1IA 1KBZA 3RUAA 4CV2A 2JD2A 2BI7A 1RM5A 3ADOA 1GQQA 3WYEA 1ZO8A 1LNQA 1I3MA 1PSDA 3TOXA 2Q4BA 1IE3A 1EDZA 3TPCA 3U62A 1BVUA 2G82A 2HQ1A 5EPOA 1FXSA 1BG6A 2EW8A 4RVDA 3TOZA 1BXKA 3WNVA 4BKUA 4CM8B 3RU9A 4OXKA 4XRRA 4BGEA 4BV9A 1NQAO 4OHUA 3WIDA 4B7XA 4ZRNA 2O3QA 4UVDA 4RPGA 3MCVA 4E13A 2FR0A 4CM9A 1JLLA 1S6YA 3VAZA 5JCXA 3AI3A 1SPXA 1GV0A 3DHYA 4BMVA 3FPLA 2AQHA 3PWKA 2OORA 4JX8A 1HDRA 5B4VA 3NTOA 2YV3A 2NU9A 4L74A 4HXYA 3ZWAA 1TB4A 5ENVA 1Y8QB 3VDQA 3IL2A 2RCYA 3EK2A 1C3VA 3FF4A 4RVSA 5CG2A 1H0KA 4FSHA 2PY6A 4BKQA 3RJ5A 3NGXA 4IMRA 4XKJA 1TT5A 3ZN2A 5IDYA 1EUDA 2JCYA 2QG4A 4GX2A 1NHWA 2Q50A 1VPDA 3SJ7A 1NM5A 2R2GA 4JLWA 1IOLA 2GGSA 4R9RA 3WX0A 4DQXA 3LU1A 1RYDA 1LTHR 4IGFA 1GZ4A 3F3SA 3L4SO 4Z9YA 4H15A 3Q1LA 1A9ZA 4KQXA 4ZRMA 1N92A 2WM3A 4CQMB 4Y9DA 3LDHA 4URFA 4II3A 4Q3BA 3B20A 1JKJA 2VHVA 1P0CA 4LMRA 3QWBA 4J9VA 4QFDA 3V2GA 3PDJA 1A5ZA 1JAXA 4YJHB 4WOKA 2B37A 2NU6A 1UXJA 3TDKA 5AXBA 2OBYA 4CUJA 1ZSNA 2DBZA 2X0NA 1PJQA 3LT0A
chains in the Genus database with same CATH superfamily
2QI9C 3O5AA 2NSHA 2IF2A 2TECE 3L4JA 1BH2A 4ENRA 1D4FA 5BT9A 3N0XA 3V8BA 4HEQA 2WYOA 3TLXA 5CCXA 5AMXA 5DU2A 4I99A 2OAEA 4ZEWA 2NSDA 2V59A 4W5JA 4X41A 2W11A 1X1BA 2QAGC 4PM4A 3KOMA 1NQVA 2X9LA 1NVMB 2Y1CA 4KV7A 1HYHA 5A7FA 2GN8A 2P78A 1JALA 3DTNA 5EINA 2QTTA 5AUNB 5B64A 3CUVA 2FPMA 2PSEA 4CRWB 3I5MA 9MHTA 1FY2A 1KZ6A 1X8JA 1Z4QA 4BWFB 4C4XA 1GUDA 3UXEA 1NJ8A 3GAFA 2XCLA 3ADCA 3QVGB 3ZD9A 4IWXA 5FWDA 2PJRA 4IOJA 2CVOA 4TKVB 4LJ8A 1R37A 2I2CA 3ESRA 1DC5A 2DVMA 1UC8A 2R8BA 3FYSA 3H9CA 4HLDA 2C58A 2ADFA 2D4AA 3J81k 5CB4B 1ZU4A 3N2IA 1RRVA 4YYZA 2IDZA 1U9IA 2W2VA 3CUTA 3VU3A 6REQB 1L7DA 4XVCA 1PKXA 4BNXA 4I08A 5BUSA 4XOUA 2QTHA 3C15C 2QLNA 4F86A 1U8YA 4OPMA 3OE4A 4JZKA 5EC8A 2VNHA 1QRAA 4PLHA 4LAFA 3NJ4A 3B53X 4DXAA 3I53A 3R41A 1SRQA 4UTZA 4MUEA 4U5XA 4ROTA 3SBXA 4Q4CA 2A9JA 3O91A 5MN5A 2ZM6B 4WVLA 4C78A 1O5OA 2Y0DA 3KKQA 5HBGA 5JAHA 4JH0A 5KWVA 2VNSA 1NNUA 2EJVA 2H3EA 1QP8A 2GN9A 5FTJA 3REGA 4AJOA 4H16A 3VH1A 1EZ1A 4JT8A 4RENA 3CE6A 1T5IA 4D9MA 3W6UA 1KFBB 4RKRA 1FXUA 3RJ9A 4G1VA 1JQ3A 1Z6XA 3RASA 3SEAA 2CLOB 4ASUD 1U1FA 2CXOA 2LRHA 5CJJA 1GN9A 5IFLA 1V3QE 4YP1A 4AZWA 5EYPA 3WGHA 3EZ2A 2JDIA 1N7HA 2PZLA 1EJ0A 1L6IA 3AEQB 3E6AA 4M55A 4IKOA 5BWNA 2EZ9A 1Z6GA 3QFSA 5FHRA 2J41A 3CZPA 4PZPA 2W37A 2X13A 1UKAA 2P1DA 2QPAA 4HYTA 1LDYA 1OB2A 1H2BA 1C0LA 1NBHA 5CLQA 3R5KA 1PZMA 4QLBA 1MC1A 2IYVA 4G89A 4NZOA 5B55A 5LR6A 1SULA 3ZZ1A 3AFMA 1PD1A 1MA3A 4QNRA 4CMIB 5IM4A 4MVJD 5KTKA 3D3JA 3UV7A 1JEAA 2OBNA 4JUDX 2HIHA 3S44A 5EIEA 4RS4A 1T0PA 3FI9A 5FBKA 4DCPA 3RYHA 4IMPA 1C0IA 5HQTA 3U3MA 1U4NA 4JJEA 1IQUA 5D85A 1QKIA 2XUHA 1D9XA 1SB9A 3UXMA 1OXUA 3S1SA 3L77A 3LBFA 1T5LA 3FIUA 1RDFA 4N7MA 4OP1A 2AI3A 2GYWA 4E2WA 2FSFA 4OHPA 3E23A 4B87A 4QQKA 4ZHQB 3L7CA 3KE9A 3K9WA 4J6EA 1YDHA 3SE7A 1YI0A 3CIFA 2EFGA 3MGGA 2ONCA 2VEOA 4KW7A 5CT4A 4BAUA 4WJLA 1JLKA 3FFAA 1HYEA 3H84A 3HR8A 3O9VA 4A5SA 3Q7RA 4LY6A 3Q40A 1UM9A 5AOCA 1GUBA 1Y8RA 4YRIA 4ZEMA 5IFKA 3LIPA 1Z8FA 2FFAA 3OJCA 2IRWA 5LZ7A 2VXYA 1PYGA 5FXMA 2AKAB 4R2KA 2VYVD 3FCAA 4MUMA 3RYFB 2JVJA 4G07A 3HTXA 4IS2A 2NU7B 1WLYA 3W1WA 4JXXA 1XROA 1ZNXA 4FGSA 2WM9B 2VJMA 1JXQA 4OHYA 3E5HA 3Q3GE 4GM0A 4TKUB 3F6BX 2IYSA 3C5VA 3PUZA 2TMDA 4IICA 2YUTA 3VSBA 3PU6A 4ZCQA 2NV2B 1I51A 4BLSA 3U17A 2ZXUA 2CKMA 1TZCA 3U60B 4HB3A 1QB8A 4BFXA 1L7PA 1OASA 5F5XA 3SY8A 3KOZA 1C5KA 1MJHA 3AL0C 3UH0A 4GLJA 1KXJA 3U37A 2PD6A 5F2EA 4WNCA 4C4PA 1XGKA 2QRKA 1DBWA 3FB1A 1CQXA 3B2NA 3FN4A 1E9DA 2OECA 4K6GA 1CUSA 2FN4A 2Z3VA 2ZTMA 2XYGA 1ZMOA 3U6KA 2Y68A 1ZKMA 3PGLA 3UCEA 1CHNA 3CNQS 2VAPA 5DTMA 2ZPAA 5C0OE 4A8HA 2OG2A 5IC4A 3FFXA 2NTEA 3AZQA 1E0SA 4W9NC 1NBOA 1TEXA 1EFPB 1MKYA 2QA5A 1ZOLA 1JYFA 4A15A 3N3BC 1PEKE 3EBOA 3OOHA 3VTFA 3H1BA 4B6QA 4K6OA 4RVCA 1M2EA 4YAKA 1ZR2A 3TLYA 3QBVA 4YJ2A 3DCYA 1GU7A 1JL3A 4D92A 5A4IS 5A9RA 1EP1B 4IW3B 2A0KA 4UKDA 1NXSA 5CDFA 3RTEA 3FMIA 3KV3O 1FXWF 1IB0A 4RLSA 4A6XA 2X15A 1KZ7B 4HDQB 1ZJJA 5KNBA 1VPWA 2I8AA 2BGIA 1T8TA 2XGGA 3QQPA 1FPMA 4OM7A 4QBFA 1TIKA 1ID8A 1E5DA 4CM8A 4JBXA 3THXB 4DBVO 3S68A 1XRRA 1QK3A 4XGQA 4BZWA 4PRLA 3H4VA 2KM1A 2EFDB 1TGVA 1QCDA 3GLSA 1FTNA 3B82A 2PKCA 4YUXA 5JMTA 4QO8A 4EGJA 5JWOA 2QLFA 4IM7A 4F4IA 2J5RA 4J0DA 4IPTA 2R8EA 5K0CA 1X1RA 2C5FA 2IVZA 4DA4A 4RVUA 1QBGA 3RC1A 1B15A 2VPTA 4YK7A 2A9VA 2PRIA 2XW6A 3AOGA 1YJXA 3ELBA 2EYQA 2P8JA 4F9EA 5BSEA 3PLRA 4H7KA 1TYDE 4NARA 1JT2A 3EGIA 3VH4A 3L4EA 3FMFA 4FKMA 4TYYA 3VYRB 3U3ZA 3DD1A 3TEJA 3A04A 5DM60 1IOZA 2SKCA 1XN1A 2ZBGA 2I7TA 3LTNC 5ILQA 1Z6AA 5EJMA 4HATA 2DFPA 1J8MF 2GEVA 1AB5A 1Z6QA 3GUUA 3PD0A 4G6ZA 2WU0A 2ZE8A 3FOAA 4NHEA 4Y6GB 5EIBD 4HVCA 2Z8ZA 1HDZA 2F8TA 4UCQA 4YJFB 3I62A 1RXIA 2H4YA 2DQ4A 3FW1A 1YBHA 3HB1A 3NANA 1NF3A 3M6IA 3O3CA 4MYHA 4I1OA 4HAWA 5JZBA 5EUCA 3RVOA 4JXZA 2G9RA 1BMFA 5BN3B 3HEAA 4JUCA 5J4VA 5CLJA 3V4FA 3LC1O 3WB9A 2ZYAA 4M0MA 3CRRA 4LI3X 2WWTA 4MICA 5J5CA 1K2WA 2TMYA 2X0IA 3H9JA 3PNMA 3R3HA 4EB0A 3OP1A 2WAOA 1PJRA 4ZARA 1HXHA 4TSFD 3UZUA 4S35A 4BJ6A 2OCLA 4LDAA 2C92A 4FMPA 4M9CA 4NJMA 4BLOA 1NFQA 1IEWA 4OQNA 4TMXA 3T7TA 5FORA 3LF2A 4BMPB 4UC0A 2ZRNA 3W8EA 4EB3A 3L07A 2NUPB 1I2ZA 3HV2A 2EZUA 3W5UA 3ODPA 1V3TA 5JE8A 3F3YA 3N2EA 2I8CA 2XTNA 2PUHA 3R77A 2JLRA 4UDOA 1ZIOA 3PKJA 2WIBA 5FTLA 4DMLA 2F1KA 1PWZA 1PQ4A 1U8TA 3AWIA 1E2IA 3JS5A 1J39A 1ZM2A 3P5SA 5AFSA 2XOXA 1M6EX 3CF2A 3JQGB 4C20A 2NYUA 3CVJA 1QIGA 2TMGA 3WLEA 1ZLYA 2OUKA 5CVJA 1OXBB 4IZIA 1YBMA 4XJSA 5K4AA 4L1KA 5JCOA 2HY7A 2FMTA 1WY5A 3G0GA 4YBZA 4ALKA 1CS0B 4J1NA 4IOKA 4CU2A 5KVQA 2JPDA 5B58C 1KVQA 4J03A 4D98A 4AKIA 1R0ZA 2ZT7A 3AUSA 3UXHA 4LQ4A 3F3KA 3E18A 1OZGA 5CVVA 4CWAA 2QK4A 3JQAB 1N6LA 3QXXA 1TM2A 4ZT2A 1P1FA 2PZEA 1OJ7A 4DCUA 4GZLA 4MDEA 1A9OA 4MKHA 4DR2B 2CCJA 4PN7A 4FGWA 5JSZA 4F1JA 1DEXA 2BD0A 5JCPA 5ALTA 5AJTA 5I7WA 5E7IA 2VRNA 3N0RA 1KIAA 2R6JA 5H80A 2COKA 5JZ9A 1KVSA 4WNAB 5T3YA 2HIAA 4C04A 2ANBA 3QF4B 3M6WA 1DLJA 1RKQA 1U5BB 4KRYA 1U81A 4PCLA 3O6VA 2X0KA 4IXTA 2I4IA 4RZ3A 4JASB 5KWJA 4YEDA 1EXVA 2FQ1A 1P7PA 1ZUHA 1G4HA 1WE2A 2C0PA 2VBCA 4JYPA 4Q01A 4BQRA 4DAEA 1L5FA 5AVWA 2IEGA 1CEEA 3HJAA 4IHJF 3ZH2A 2HEIA 1LLFA 2VDQB 4JI6B 5C37A 4DRXA 1ZH0A 1OILA 1AZLA 2OV3A 3GT3A 4ZPXA 5KREA 1PN3A 4XPIB 5IARA 1VIMA 1C14A 1GRRA 4Y30A 1T1IA 1GAWA 5FBQB 3TD2A 1QGOA 2R8YA 2BW0A 4X91A 4D3ZA 2D6FA 4NOJA 3AEQA 4KGDA 4B71A 3TKYA 4MVXA 4L2IB 3G0DA 1KAEA 1AKEA 4JI3B 4ZT5A 4CMCA 2HLHA 4OU5A 3UG7A 2QQFA 4KH1A 3AH8A 2FZGA 1V7QA 1C30A 4HNVA 2DAPA 4FHZA 3EFEA 4JI1B 5ITZB 2ZUDA 4ME6A 1YJ5A 2GNPA 4RY9A 2XD4A 3NHSA 4TQAA 5DASA 2CE2X 2WFZA 3R5SA 4JQCA 3SFTA 3KQNA 4IBOA 3GLIA 2QZJA 3LNCA 5CLHA 4CLOB 1KMCA 1UKVY 2QD1A 3ORFA 1FP4A 5BYAA 1IH8A 3I76A 2VHZA 1QYXA 3B7WA 1X7YB 3MB8A 2R5FA 4GPTA 4PW0A 5REQB 3WK6A 5B2FA 4XWKA 1ORVA 1KETA 1D1TA 4KKXB 4TGLA 1R64A 1R0LA 2VCYA 3GBPA 4I14A 1JUDA 4QG7A 2E4UA 2RJOA 3CH6A 1QHNA 2GAFA 1FLNA 5C34B 1R27A 2PVSA 5D87A 5TJ9A 3WLKX 3QIVA 1FSPA 5FL3A 4O0MA 1F0KA 4ZO9A 3UWSA 1Q0LA 2G9VA 2JGLA 3V8PA 3W5DA 3DOEA 5A71A 2XKJE 4N18A 1L4MA 9LDBA 3T12A 4UE6A 3T61A 2V0GA 2Q4OA 4QYWA 3ZWDA 2P3OA 1NNSA 3GUCA 2HPVA 1KK1A 1FUUA 3EVDA 3O1IC 1JW9B 1J70A 4KDEA 4QARA 1G3IA 1SCAA 4EK9A 4IOLA 3WL4A 1POWA 1N1MA 1VJ5A 3KUCA 3G89A 1PEAA 3WS7A 1OV6A 4GSKA 1N75A 1U1CA 1JEJA 5EP3A 4GLLA 1EVIA 4E5MA 4C4AA 5HUJA 4O2AF 1XZLA 3CQ9A 3FHOA 4PC1A 1N7GA 4N5IX 5LLDA 3GUVA 5LVAA 1T35A 3I09A 2E85A 3GFGA 2FPPA 3ANMA 3AXTA 4ZCSA 2WJAA 2EL9A 4BO7A 5BQOA 3MBKA 5JOQA 1ZAYA 2LR0A 4C29A 4AICA 3BFPA 1HH4A 4B5KA 4UHEA 3BWBA 5BWOA 1NC1A 2I1QA 1KVTA 2B78A 4C9BA 4RD3A 4YJDA 2WKSA 2EWMA 3VZPA 3S2EA 4D9GA 3NXSA 1A2QA 5FWYB 2D59A 1UPXA 2G9QA 1YH3A 1W5FA 1T9CA 2C2ZA 4IIJB 1X0VA 5ES3A 3TAXA 1Y34E 2BM0A 5F3RA 4Z9XA 4IDAA 4CM1A 1XMJA 4BNFA 1NN5A 3S2IA 1UBMS 4M98A 4PTZA 3OWHA 4ND6A 2FZEA 5DPMA 2WYHA 3B1YA 1ZESA 2OB1A 4BWGA 4C0LA 4CQLB 2UYHA 1X7WA 1VBMA 1O94C 1EQUA 2IE8A 2MSKA 2ZKLA 1VE6A 1AXGA 1G5RA 1YVUA 1NJSA 2Y2VA 3WKCA 4F8YA 3MGBA 3ZX4A 1ZHFA 3GGOA 3IELA 4K6FA 5KOIA 2Z09A 4CHGA 1M5UA 5KSPA 1V5WA 1DG1G 4X6YA 4XWYA 4U1RA 5SZHB 3DPSA 3DTVB 1WRBA 3V80A 4I3FA 3GCDA 2YWBA 4G1FA 2IY9A 1E1QA 3A4MA 4C7KA 4YALA 5EJGA 3WL5A 2A9KA 2QF7A 1UK9A 1UIMA 3FA2A 3V8NA 4EJMA 3CBQA 1Z6ZA 2NYAA 2AW5A 3WWCA 3WGMA 4N8SA 2EKDA 1DRKA 2QVLA 2RHWA 1ECCA 4FYVA 2Y0BA 5B37A 5LQDA 3LJKA 3TW6A 2ZTUA 5KSZA 3OCUA 3PEFA 3REQA 2JI6A 3ILYA 1OX6A 1X87A 1JJVA 3RWMB 1U3WA 3UJHA 3QLUC 2QXUA 4M87A 4TM8A 1GEEA 1ESMA 4XA8A 1UBKS 4Q02A 4F3YA 1T5TA 5ALSA 2W2KB 2BHRA 3OQ6A 4EG3A 2H7YA 5AQEA 2FMIA 4AQDA 4BKPA 1O57A 2PAAA 2WTNA 3O1HB 4PYMA 5KWSA 5KQRA 5A5FA 5D5QA 1I7SB 3H19A 1JT9A 3SP1A 3GT4A 1GZVA 1RXEA 4LZZA 2YVLA 3D81A 2E82A 1GGKA 3NJRA 2IHUA 2OD9A 4MUAA 3U5TA 3MS7A 1NV8A 2Z1MA 2ZYDA 3D0QA 1E3QA 4K3VA 4GVLA 3LUJA 3AY7A 2HK7A 3TZBA 3N9IA 3AEKA 1WU7A 3O9MA 2JIOA 1MP0A 5AW1A 1C1XA 2DR0A 3WTCA 5KNBH 5A5VA 1GZUA 5FJJA 1WXWA 3F90A 2B0CA 3FNIA 5AWFC 2J7PA 3UXYA 2I87A 1T36B 3C43A 4EY8A 1PP4A 1RXCA 4AN4A 3CSDA 1PLKA 2OKGA 2VFAA 2ZWPA 3I92A 3ZXUB 1JQKA 521PA 3PX7A 1RJDA 1RHJA 3OEHD 3R4VA 2HQBA 1YB7A 3WGKA 1IPEA 1SB8A 2L69A 1LX6A 3OTQA 4QOEA 2FZ4A 2OHXA 3DP9A 3FBTA 4XTCS 5DFAA 2HCJB 2IODA 4XIYA 3OHPA 1PT9A 3AUTA 5DRTA 4U9UA 1G55A 1WNTA 5HKKD 1NXOA 5K6RA 1FJHA 2C5EA 2VTBB 5LMUB 4DN6A 3NIFB 3TPZA 3AM5A 1CUWA 1TVEA 2FQYA 3A3KA 3H3JA 2YRWA 2H8KA 1NI4B 3FKJA 3IAXA 3EIOA 1ZJZA 2Q2VA 4QOIA 4G2NA 3ORSA 4GSYA 1K6JA 4I55A 1CUVA 1VZ2A 2Z3ZA 1BKSB 1LJUA 3R1IA 4S1OA 1DAPA 4YRDA 4HWOA 3L0YA 1LBIA 3QYJA 1QAMA 1RRMA 1IY2A 1F8UA 1HDCA 3H8WA 4LX8A 3V1NA 2O8FB 1X38A 2BFCA 4N82A 5FT9A 2VP2A 1N32B 1FS6A 3VSEA 1VKOA 4U6SA 3ROKA 2P2LA 1BCRA 2VPWA 3A6EA 4UCXA 4C0BA 4KITB 3MTBA 3WYFA 4YR7A 4F46A 4YYEA 1SHKA 3FMVA 1PFWA 4KTTE 3RIEA 1YIOA 5JYEA 5A0TA 2DCUA 4PG5A 1XCMA 1Q1BA 4HSGA 3STVA 4IHJA 3ZHQA 2WWGA 4UM7A 2XMCA 2I71A 2WF8A 4M2LA 1O97D 1IWOA 1QQTA 4JYCA 1RZ3A 4QM7A 2FXVA 3DHNA 3G0BA 1E66A 4HB0A 4ZC1A 4CM3A 4QATA 1CDDA 2QEQA 1EUQA 1ZD5A 3MG9A 4GG1A 3ZGVA 5I4KA 1UPAA 2C7OA 4R3UC 2VOEA 3A05A 2JJ2A 2O2ZA 2RGEA 2H5IA 2ZUUA 3DZBA 3IVGA 3MFYA 3WY9A 4A2WA 2ZR7A 3NRCA 1GRCA 4RANA 4WK6A 2M9MA 2O2EA 1F38A 2HKIA 2ZB4A 3A58B 2R97A 4E33A 4NXNB 3WGIA 4R31A 1KIMA 1EDEA 1IDN1 2A9PA 1EJ2A 4G5XA 4PG4A 1L5YA 5CTAA 2OFXA 5DH9A 1T8YA 3U31A 2Q45A 3EZ7A 3ZXIA 3M6MD 1L9XA 1HFEL 2SCUA 5DM0A 2L82A 1I4WA 3IBYA 2RGDA 4JBWA 4KPYA 4DDTA 4AJ9A 1T26A 2Q5HA 2WDPA 1LWNA 1GUAA 1PFVA 1SVOA 2ZI4A 3SAJA 1CQJA 4CKXA 2NZJA 1QZUA 3BA1A 5LP6A 3F0TA 3F6SA 2RGRA 2OZPA 3T0FA 1CFZA 4DG9A 5KWEA 1F0YA 4LNUA 4Q21A 1NKTA 3A9RA 2VHYA 2IS4A 4YH1A 1AT1A 1GUFA 2OOKA 4OG2A 4YUVA 1PDVA 2ZI7A 3PGJA 3LSTA 4PO3X 1GZHB 3MUEA 1O95D 2QIOA 3OPNA 4U2KA 2UUCB 1PV1A 3P27A 1WW8A 2MYTA 2BFNA 4TWBA 2BMDA 1NFFA 2PBZA 3L79A 3R7BA 1SBZA 4KL8S 3O4GA 4NCIA 3FH0A 5AXAA 3UOAB 5JO0A 4IMJB 1EEXB 1YRHA 2QRLA 4OQYA 3QELB 5F1YA 2QB5A 5REQA 5BV7A 1ILEA 2ZIUB 2ZWMA 2G9ZA 3P9CA 1IUPA 4NZMA 4F92B 3KALA 3PR3A 4B6EA 1RWQA 4JBHA 5UKDA 4M0KA 1WJGA 1F20A 1VMAA 2C4KA 1GGMA 2G04A 3H4TA 2WNIA 4CT0A 2NQ8A 5DCYA 3WZMA 1O9BA 3C6KA 2WIJA 3PD7A 4IIVA 4MQ5A 5EE9A 4C0KA 2VWPA 4C22A 3JARA 4ENPA 1THGA 2GX6A 3D8RA 1ZZGA 5EZ5A 1ECJA 2XX3A 1AQLA 3LCRA 4OAOA 1UBTS 2UZIR 3JQDA 3NC4A 3DOJA 3T7JA 4I4CA 1I24A 2JFWA 2VSNA 1MXHA 4WBNA 1DTWB 1MLDA 1JTEA 1PJLA 4X0EA 1KY2A 4PG8A 3IVMA 3EVBA 2UZ1A 3QNUA 1KH1A 3BMNA 3R4CA 5BOVA 4BE9A 5KNLA 2AR0A 2XZPA 1SBNE 3RIGA 2P9JA 4IUYA 3L6RA 3WDMA 2JGRA 3CW9A 3DPUA 2KLHA 2Z56A 1U98A 3HO8A 1E6UA 3BVPA 3LQ1A 1YAJA 2XCIA 3TZLA 5DGTA 3ZDXB 5A3SA 2NQ2C 4PANA 1M8GA 3AHDA 5IKPA 1FBNA 4WLNA 2XGSA 3IR5A 4P0QB 4PNEA 4ZQEA 4Z1MA 5JAIA 3OHMA 4KRGA 4UFNA 2A5LA 3W2EA 2MSDB 2ZLBA 3IKTA 2OC4A 3DC2A 5EZQA 2Q8PA 4OMDA 3DM5A 2CE7A 3S7ZA 4O4HB 1XVAA 4US1R 3U16A 3T1YB 3DOIA 3OQJA 3FHLA 3FRHA 2N46A 4HN2A 4HDSB 3VHQA 4TQGA 4EYGA 1V16A 2IZ1A 1TU0A 4NU6A 5EKDA 2JFOA 5T8KA 2F4VB 2HOQA 1MB4A 3GO4A 5TMEA 3DEYX 1O03A 3G82C 4KOEC 4Q3LA 4UCFA 2CV0A 3MB5A 4GPIB 4WUVA 5HQ3A 3EDMA 3OCZA 4B48A 3CV3A 4YJ3A 2VF5X 5BUZA 3HGTA 1YB2A 4N5LA 2GPYA 1KE2A 3LFUA 4BNKA 2ZKIA 2GARA 4F93B 1KI8A 1FYDA 1XOIA 4HEHA 3O8RA 3A4YA 3P0FA 5BMVB 3L6EA 2RAFA 3AHJA 3ZIUA 5TARA 3LSYA 2M98A 3RE1A 1KVUA 1SPBS 3LBHA 4OHFA 4CKEB 1USUA 1KC1A 1YB6A 4ZRDA 4B81A 5FPQA 4DANA 4JJ4A 4TQUS 1UXHA 1G1MA 2WF5A 1F0PA 3IPLA 4DNXA 5EKSA 4TTIA 2FG7C 5IHPA 4FZVA 5BR7A 1ZA2A 1WDMA 5HTKA 3IO3A 3LX6A 2VXBA 1RABA 1JJ7A 1SK9A 1U2QA 1DAFA 3F1KA 3KPWA 1O87A 4FFRA 3QUBA 2IXAA 4HWKA 4R1LA 5E7QA 3A6GA 3FTFA 2F1OA 2HGSA 4KQGA 4HG2A 3TRIA 3W3AH 1XPOA 1DJNA 1I33A 5FOTA 2ZU6A 4UHDA 4CCSA 4CUKA 3KZKA 4EUEA 3LP8A 3A1TA 2IOFK 4O4HF 1M2KA 3TZHA 2BE7A 4QKQA 1E2EA 3HDVA 1YFJA 4YMGA 2QN8A 1QE3A 2F9LA 5CHYA 5E6RA 2WSIA 3OLVA 5BYJA 4C3OB 1PE0A 4P0TA 4RPHA 4ZQBA 5ECDA 3W5IA 2YV1A 5JG7A 1DKUA 2MR6A 3DAPA 4UCWA 4BVFA 1S2GA 5CT5A 4G1CA 2B4RO 3TMYA 1K3FA 3V1MA 2F64A 3ENWA 3PFCA 3OIFA 2UXCB 2VUUA 4RFVA 1N2XA 1E2GA 2PK3A 2BH9A 1N0VC 2PSJA 2YXBA 4JMLA 4RVFA 1BSVA 2KJQA 4H6VA 2YFQA 1GNQA 2BHNA 1RC0A 2YOFA 5AKGA 2AC7A 5F98A 1XXHE 2YZ2A 5LDHA 1OSNA 2QD2A 3L0OA 3PF8A 1JDPA 2AXPA 2HWWA 3QHAA 3ZE9A 4BB0A 4ZK6A 2MT9A 3GLGB 1KI7A 2QSUA 2WDZA 2QUIA 3NM5A 3QPCA 1CUJA 4QQRA 3SX0A 5IULC 2WTAA 3ANNA 1B3BA 1KFJB 2BI4A 3Q3CA 4RE6A 4WESA 3MGAA 3U4MA 4M54A 4NHOA 4TTTS 2AC4A 2XUJA 5I7AA 1MGPA 3M4YA 1DIAA 4FFDA 3SNKA 4E6EA 2CL5A 1QF6A 2QW0X 2XGJA 4PC6A 1U2SA 4MWEA 3CBGA 2GERA 2BR4A 3CTPA 1IN1A 4ICIA 4M60A 1Q50A 3PDIB 1JXMA 4PQFA 4R2XA 1FMCA 2DE0X 2FQQA 3IDOA 3LVFO 2JK0A 1N1EA 3DHWC 1B23P 1PQWA 3MQFA 4JJ6A 4MUHA 3T3NA 2QAIA 3RT9A 3G7UA 1A9RA 1QPGA 5JNLA 2HQRA 3LOPA 4GLBA 4OXNA 1T24A 5KVCA 3GFFA 1W0CA 4R0VA 1CF4A 2SICE 1ATIA 1T1GA 3SU8A 2ES4A 2VRCD 2ZJAA 2BFCB 3MMPA 3NDJA 4MPTA 1N1GA 2FWRA 1IZZA 2R7AA 4R9NA 1J1IA 1NYQA 4X3PA 3FOBA 1SCJA 2QL9A 3WDKA 2BN4A 4Y0NA 1AO3A 1GNPA 1VHLA 1FRQA 3X1JA 1CUBA 4V0KA 3DOUA 1VG0B 2CYCA 3AHGA 3FTQA 3OEWA 4G81A 4ND5A 4CDMA 4FEAA 4JP2A 2W2XA 3HFGA 3NRBA 2AJCA 1WTAA 3OQVA 4IHJB 4GM4A 5JUWA 1SUIA 3D4NA 1YFLA 1IK4A 3OZUA 1BW9B 3F9IA 4QA9A 2B34A 3IR7A 4LHYA 1KRWA 5LJLA 3X2FA 1YF3A 1JQ5A 4JXJA 4MJ7A 2PWZA 3WB2A 3KD3A 8LDHA 4CIAA 1SU4A 5L8VA 1SBYA 2Y1XA 1T9KA 3CNOA 3ELDA 3I01A 4BKOA 5M29A 3IAS1 3NDBB 1XG5A 2IZZA 1Y3BE 3V8QA 2H3HA 1WTCA 2FE1A 1R0SA 1R9NA 1E4EA 4DXHA 4DKXA 3IMEA 3FLBA 3KOUA 2PZMA 4RS3A 1XRSB 3U44B 4A8JC 3TJMA 4IIXA 1SH7A 1F2VA 2JAPA 1V8PA 3KHUA 4N7JA 4YRJA 4CF3A 4ZCMA 4CM4A 1W4ZA 2QRMA 5HQ3B 1ZK1A 1QCCA 1WQ4A 2BTQA 1ZHOA 1LBQA 3MGCA 5FL7D 3FY4A 3BFKA 3GI1A 5ANRB 5EXXA 5D84A 3T7SA 4QAJA 3WGJA 5HJEA 3QV1A 4YAUA 2VYCA 3LKBA 4Y2PA 2WZBA 3T3GA 1BXZA 1GPAA 2AEEA 4EGCB 3CZAA 1F60A 1ZNWA 1M34A 4B6FA 1PRYA 1TAQA 1NZDA 4NJOA 1NN0A 4DSAA 1HEUA 3JZDA 4QSMA 3T3DA 2HUPA 1MW8X 1W48A 4NBTA 4TLCA 3AEYA 4S3MA 1Q3HA 3IJRA 3LHDA 4EABA 2B4QA 3LCMA 2Q3LA 4F91B 3NOQA 2WIAA 1HE2A 5DMXA 2O8CB 4X85A 3WGGA 2VDLB 2OGWA 3B1ZA 3JQRA 3IUYA 4MLZA 3ZNNA 4EG5A 5FYDA 1N33B 3H7IA 3DLCA 3HSSA 4N6OA 1ZD8A 4GZ5A 4YT5A 3SDZA 2V9PA 3HBFA 4PLPA 3WMRA 4BV8A 1NA5A 2IIQA 3HXPA 4CIXA 1MRZA 1HDIA 2W98A 4AZSA 4HFMA 4CKBA 3CC8A 3WRYA 3ONFA 1JEYB 2QUKA 2VJOA 3O4VA 2IWRA 4Q3DA 2A8YA 3WI7A 5GONA 1PK8A 3IRVA 5KOHA 3DV9A 1RI2A 2I34A 3S55A 4HMOA 4J2HA 4NZNA 2BHTA 3WWDA 2HBQA 2FX5A 2IQ5A 4LOLA 4MV3A 1YSCA 1JFTA 4QVIA 2C98A 4F5EA 4DR4B 4XQGA 5ESWA 3KOWA 4Y7CA 1MVOA 3FIJA 3OE7A 2BE9A 3H8VA 4QGAA 4C0XA 3IP6A 1DTWA 3L8GA 4W7IA 3Q3VA 4WGFA 1KF0A 4J1TC 4U2DA 1SXHA 5DV9A 3M2PA 4W5TA 4HS4A 3MOIA 1J0CA 2ZI6A 2CCGA 3P9KA 7REQB 2EGUA 1AV7A 4EJ2A 4F0JA 1UBLS 4HK4A 1KFEB 4ON9A 2C2KA 3EC1A 2HB6A 4HXGA 3UAOA 3V48A 2XF2A 3ZWYA 3PNKA 2ADOA 3SYNA 4S0ZA 4NC9A 1PGQA 4C0AC 1FNMA 5J43A 3WK9A 2FWMX 4INAA 4LDQA 2LV8A 4RLFA 3GPCA 7MDHA 3MLBA 1JI0A 2BM8A 3KYJB 5C4IA 5F5LA 3S2GA 4HDKB 1B26A 2FEKA 1KDPA 3TR5A 3CYFA 2EIHA 3Q7IA 2I5PO 1I9CA 4BNVA 1LC3A 5IK2A 5AM0A 2ZWOA 3V7FA 1XP8A 4QGSA 5IJ9B 1XLTC 2PLWA 4BUCA 4GX0A 1U2RA 2I65A 2P27A 3V8VA 1XZQA 2OXCA 3CONA 4EG4A 1U6KA 4UOEA 3KJHA 3HFRA 2XB6A 2HF8A 3B7PA 3L1IA 3TLAA 1FFSA 4MTLA 3KC2A 4F7WA 3DZKA 2QV7A 3DGFC 4DSOA 3PUVA 4WEQA 2GJ4A 2W90A 3Q3IA 3WLTA 4HF7A 1QIEA 1R0XA 3R5TA 3E8XA 4X71A 3LOUA 5B7NA 2E49A 3ZY5A 5DSZA 3H16A 4TLMB 2PV7A 5BMVA 1IYZA 2EVWX 3VKGA 4BO3A 1ZXBA 3N8KA 4HNRA 5TC4A 3UV6A 1Q84A 2CLCX 5EE0A 1WBBA 4HGNA 1SUAA 1GZSA 2OVBA 1GITA 2VQ6A 3D6UA 2PZGA 2WM2A 2GBFA 5E3IA 2FUG6 4TYMA 2PWAA 4WJKB 5DYTA 2P0YA 1N6OA 3GCZA 1YDMA 1M3SA 2QZ9A 1E79D 4M1MA 1O8CA 4CFYA 2BH2A 3GGPA 3NBYC 2PKXA 2OSBA 4HB4A 3P5BA 4PX9A 3H1TA 5FNVB 3A6ZA 3L4KA 5DJ5A 2EP5A 3ASZA 3MRVA 4R40A 3BAZA 4TMWA 1IRIA 5K4GA 5IANA 4JP3A 1D09A 1YZKA 4G1BA 2PMDA 4GBMA 4GMGA 1GPMA 5EYPB 5KBYA 1RNLA 5I7FA 4NRDA 3I42A 2FFBA 2SBTA 1DWOA 1C7EA 2F17A 4P9NA 1GT91 2PU7A 2AXNA 3ZVRA 1KPIA 1XZFA 4GKVA 4HYEA 1VHDA 4ZVMA 4KC0A 3DVSX 1HBJA 2NU6B 1ZM3A 1S2DA 3ABSB 1BQ4A 3CNBA 3F4LA 3EOAI 3O7MA 1DPGA 3ZBUA 1GD1O 5TPZA 1RFGE 1VECA 2WW8A 1FTGA 1ZHHA 2IY7A 1K7SN 3W2TA 2N0SA 4O4JB 4INZA 4DNOA 2F55A 3BZWA 2BGMA 1G8FA 3NRJA 3PYLA 4IDQA 4NONA 1CY0A 2O5RA 4DIEA 3I6IA 1QP7A 2ZPUA 3KQTA 1C3LA 2C0CA 4FYIA 1UIRA 3Q8KA 1XWWA 1G3UA 3QUAA 1L5WA 4TVSA 1U8ZA 1L8OA 2J45A 4P3PA 5JWRA 3OFSA 1QVWA 1NNI1 2PMCA 3GMDA 1W87A 2F90A 2ZDHA 2V4UA 2ZAYA 2R47A 2IITA 4UEKA 1DBQA 1Y3HA 2CFTA 1ADFA 2WJVA 4O2RA 1U8XX 4DJTA 1NBMA 1ZDMA 2ZR0A 4LF9B 3RK0A 1QLWA 4WZAE 1FS5A 3PUYA 5JD4A 2GBCA 1J5XA 3KR0A 4RZIA 5CT9A 4KVAA 1LK5A 1AGRA 3W77A 4D9IA 3OPYB 1BWRA 4KE9A 2YOGA 3DDSA 3A6KA 3DZDA 3LGAA 4RZSA 4WACA 1ZJYA 3OY2A 5KYVA 4YCCA 2GUGA 4DNQA 4RAQA 2NT4A 1KXZA 1RJEA 1L7QA 3MCZA 1IG0A 2CVPA 3FF1A 3HCPA 3QLEA 5F78A 4D3FA 3ABZA 4LYJA 1PZGA 4LW8A 4BZZA 1ZU5A 1EE2A 3G13A 2A5GA 4RM2A 3SI7A 3U48A 2WMDA 4WLOA 3RH0A 5BOSA 4KOAA 4D97A 3BSWA 1QYRA 4M8LA 3F46A 5HUQA 3K96A 2PR7A 4IDEA 1ADGA 1ESZA 2P41A 2QI9F 2BLNA 2R8OA 3BTVA 1OX4B 4G26A 2PL3A 4YECA 2IZ6A 5AW3A 4G0VA 4CNBA 5CA1F 4RQTA 1XNGA 1E4YA 2BFEB 1J23A 4NE2A 3MT0A 4ZOEA 5CURA 4DARA 2Q5QA 2YR0A 1OI7A 1VHJA 1XQ1A 3GRUA 3EDYA 2QTLA 3N7AA 1QR6A 4EATA 3LPCA 2WNHA 3N8DA 4Q1FA 3BD9A 3C70A 2OXRA 2XCQA 5ARBA 1KYZA 3QPVA 1CIJA 1H2FA 3N75A 1DCFA 4JEHA 3TZEA 1CUHA 1W5TA 5FTNA 3D4LA 2L2QA 1WDKA 3KSAC 5M34A 2O48X 1V47A 3ZNPA 1E2LA 1TFRA 2OHVA 1CZHA 1DZ3A 2QGFA 5JD3A 4JJZA 5DTJA 3TRHA 3U0VA 2F62A 5ETJA 4KAJA 1BDJA 4BP9A 4REOA 2VDJA 2W6ID 2QTFA 3PNYA 2DETA 1ODFA 4DLRA 1BW9A 4F38A 4PPQA 3AHHA 1O97C 2Q3JA 4F9GA 4YDQA 4PYOA 1UWKA 2ZZNA 4MVCA 3NHJA 3UJ8A 1C7FA 5EJ6A 3LW8A 4BDTA 3TNYA 1M66A 1PX0A 3HWX1 1DZIA 3DJYA 3HDJA 3HXTA 5A1JA 5DGDA 4BBJA 2AGVA 5B3LA 3C3MA 1ZNQO 1CJCA 2HMYB 2KQUA 3E5NA 4LXTA 1CB0A 3QPAA 2IXBA 4E2ZA 3UWMA 1PR0A 2FZ5A 4QHTA 1IMOA 1G8HA 2I4LA 2XOEA 4MV1A 3IT0A 2R48A 3BCHA 1XNJA 4QDJA 1PQYA 1ZGGA 3I12A 5E8JA 1KAGA 2PT6A 3NT2A 4BMSA 1HETA 2X40A 2YN2A 3BS4A 4A0HA 4C5AA 3VHXA 4D81A 3ZU5A 2H08A 1XD2B 5CVUA 5SYMA 1RM4A 4GGMX 3K92A 3VPHA 1IVYA 2X1HA 1JG6A 2P79A 1T2FA 2NAPA 3CKMA 1PNRA 1H2ZA 1ICEA 1M6WA 1XRLA 1Y48E 1SVSA 1AX9A 1DI0A 4M46A 4IVQA 4EFDA 4OVKA 1CP3A 3OCWA 4Y9RA 5I7RA 2F59A 3NBQA 4Z7JA 1S96A 1R6UA 1KR5A 3JD4A 5HIIA 1YB4A 2BJVA 3MD0A 5CEJA 2ORED 3FNBA 4X20B 5IKMA 4AXBA 3HLTA 3ACCA 4IH1A 1OD6A 2NXJA 3QE0A 4KNWA 1DOHA 4YHBA 3DAHA 1PT8A 1HDEA 3K2IA 1GYQA 1H1DA 3MXOA 3GPLA 5H82A 2NTVA 1M0WA 1X7XB 1J0XO 2GZDA 3KHKA 2BDEA 3NT4A 5CIWA 1OIWA 1JILA 3PX3A 4E09A 4OKSA 5BWBA 5CFNA 4U2EA 5E3JA 3SZUA 4FFOA 5CG1A 3L9XA 2GBLC 1C4XA 1Z62A 5GAJA 1QP4A 5JJ5A 1DMRA 2YBDA 2A7XA 3CE9A 2BZ1A 3IJ5A 1J2TA 4I9NA 5I9TA 4IDNA 4N6NA 1GCUA 4MSUA 3K5IA 2HSZA 4MIYA 1KDVA 2PLAA 3FVWA 5K20A 1CIVA 2YV4A 4AULA 3COPA 5K4HA 5FOUA 1RZRD 2NO6A 2VPQA 4B34A 1NULA 4R9SA 4TS3A 4ADSG 1AK1A 1G20A 4QXQA 2W6JA 3U49A 1G8MA 2NNWB 4NCBA 3ETHA 1LS1A 5HTOA 4ENWA 2XQKA 3RS7A 3NYWA 4GUDA 2WBLC 3E70C 5B5SA 4KREA 5MN4A 3PXBA 5E2AA 4XTRA 4BQQA 1Y3FE 4B3HA 5ERGB 4DBLE 5IAAA 3T95A 1A71A 2P4HX 3EVEA 1E5LA 2D4HA 2HDWA 2OM2A 4L8WB 4CMKA 5GVSA 2X7HA 5JWHA 5DP1A 1RIIA 2XSZD 2V7UA 2YHIA 2HF9A 3NWBA 3O8LA 4Y9UA 5L7TA 1GM5A 1TQ4A 3GJYA 1XP5A 4NVRA 3TIGA 4B3TB 3O2QB 3B13B 3ND7A 4OQMA 1QR2A 3QE2A 1K4KA 1NGSA 2A0XA 1G8AA 1Q1EA 5AXCA 3NX4A 4C43A 1WETA 4RVHA 4HS9A 2VQ3A 2H63A 4MB6A 1TE2A 2FUEA 4R1PA 3B3GA 3ZHXA 2XTJA 4ZK2A 2V7BA 1OVMA 3WJ7A 1NXQA 4ZCPA 5LQJA 3MTDA 3ZI0A 4ZWNA 1NMEA 3RJZA 4WK0B 3S27A 4JUFA 3D4IA 3WADA 4HAOA 3O9ZA 3ZWCA 5B36A 1TJPB 2O54A 3ZNOA 1UQRA 3JVIA 5JXHA 2GPBA 1FE8A 3ZWBA 3CKLA 2J3KA 4FFVA 4ZVOA 3RSHA 2KSQA 1KMHA 3D2AA 3GZNA 4RF4A 3UMFA 4F71A 2CEKA 2O14A 1NUPA 3VNSA 2CSUA 3ZIAD 5BSVA 2ZYUX 2HA6A 4JODA 4Q39A 1K4YA 2GRJA 4FNOA 3GEHA