4CM8B

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 91
structure length 251
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cm8B00
3RFVA 3IAHA 4MP8A 1JWAB 2R00A 3UCEA 3DFZA 4MKXA 4KUHA 4JP2A 1HDCA 3WG9A 1SAYA 1RYEA 2DT5A 5FEUA 1ZK4A 3DHYA 4NIMA 4B4UA 5DP1A 1KVTA 5G0WA 3RWBA 4BB5A 3EGOA 4WGGA 3KRTA 3X2EA 1FDUA 2Z95A 1GZ4A 3H9EO 3KYDA 5KVSA 5B37A 2VZ0A 4LW8A 1VJ1A 1Q7BA 1LDYA 4YT5A 1SOWA 2DPHA 3HQ4O 4XJSA 4RF5A 4Y6SA 2D5CA 4G81A 1K89A 4U5QA 4B79A 3DZIA 4DLAA 3WSVA 3OETA 2EF1A 5B4TA 5T8KA 1M66A 2NNLD 4UUPA 2X0NA 2E82A 3D64A 3BMOA 2EKLA 5TQVA 2HJSA 4FS3A 2I6TA 1XEAA 1LUAA 4FDAA 3IOYA 4CL8A 2JD1A 5U9CA 1PJBA 2BH9A 1U8XX 2ZATA 2OGUA 3NGLA 3WB9A 4BO9A 4E5YA 1DHTA 3TOXA 2I76A 2PD3A 3GHHA 5IAAA 1E6UA 1QKIA 4CM4A 1OBFO 2OUIA 4JQCA 1SC6A 3WGYA 5I7EA 2NVUB 1DC4A 2C7VA 4YJHB 4BKQA 4W9NC 3BMQA 1NXQA 3GDOA 5AVOA 1L7DA 3RC9A 3BA1A 3TL3A 1Y6JA 3ICPA 4K9DA 3T7EA 1U2GA 4D0RA 1I24A 5L3ZA 1S6YA 2O3QA 3IKTA 1EVJA 1H0KA 4YAEA 4E31A 4UVIA 3R3SA 3WBBA 4XKJA 3RC7A 3B1FA 3GNTA 1Q7GA 2A92A 3ZWBA 2Y66A 3BXXA 3AUTA 5HS4A 2RHCA 4M49A 4UVDA 1ENYA 2HMTA 5TJHA 4TZKA 3INGA 2CD9A 5TS3A 4D45A 1EQ2A 1HZJA 3JYNA 4J9UE 1YONA 3QY9A 2C07A 1C3VA 5KCZA 5F3RA 3V1TC 2DLDA 1HLDA 1E3IA 1F8GA 1X7DA 2IZZA 1E77A 3MJTA 4RVSA 3ZU4A 3ZHYA 3GGOA 2HRZA 1Z7EA 4CLRA 1VRWA 1ULUA 3IUPA 3FNFA 1I36A 3L6DA 3GFBA 3AW9A 2EJVA 4JX8A 2OXIA 2DKNA 4IINA 1P1JA 3WGQA 1R16A 5EL0A 4GSLA 5DT9A 3QIVA 1QYVA 4RVUA 1O95A 3TWOA 4Q3AA 3FPLA 2X0RA 5I7VA 4PLVA 4J1QA 1XR3A 3ANLA 1XWFA 2W2LD 2ZTLA 1VKOA 5LCXA 3FD8A 3RFTA 3PP8A 3QWIA 5DCYA 4A26A 2YQ5A 4BMVA 2D0IA 1V9LA 2VWGA 1NX6A 3FSRA 3PHLA 4II3A 1LLQA 4H3VA 4NFHA 4DUPA 4CQLB 2D3TA 4J4BA 4BS9A 4RPLA 4BGVA 2W98A 5KNLA 1UDBA 4L76A 4RPGA 4IMPA 1VL0A 1I3LA 1OOEA 4PG6A 3WWZA 3NT4A 5L40A 4L74A 1O94A 1ZW1A 2X9VA 1GTMA 4L75A 3ZHBA 4QX6A 2X22A 2Y0CA 3MEQA 1PL6A 1OZAA 4J4HA 1DPGA 2GPTA 4U7WA 1G0NA 4JJGA 4I08A 4YJFA 3HNPA 3EMKA 5LDHA 3DFUA 5F5LA 1CQIA 4JROA 1LRLA 2PA3A 2VHYA 4L0QA 4XIYA 4AJ4A 2ZTMA 4E0BA 4P4NA 1HDXA 3D4NA 1YQDA 1LSOA 3F1LA 5EINA 5L4LA 2IZ0A 2VUTA 3DTTA 3OJEA 4O0LA 4CLOB 2D1YA 5CHEA 1HTBA 2Q1TA 2ZJ0A 4CQMD 3JD0A 4RPJA 2VZ9A 3WMXA 3WTCA 5I7SA 4CLEA 4ZU3A 1YOVA 4I9HA 4K1LA 2BI8A 1IL0A 1ONOA 1QXSA 1MXFA 1MFZA 1YS4A 3ETGA 1ADCA 4E2XA 4YAIA 1YL6A 1R37A 1GU7A 1WAMA 2P91A 3GG2A 4DIBA 1D3AA 5TGDA 1TT5A 5ENVA 1NWHA 4MPDA 4IJVA 4IS2A 5C37A 3VVCA 3JYLA 1B3RA 1I30A 3ST7A 1EMDA 3NDRA 4GKBA 2HO5A 1IHYA 3BTVA 3TN7A 1ZUD1 1HE2A 4XEHA 2UVDA 3ZHZA 2PZKA 3NT2A 3OJFA 4HADA 2C20A 3RUAA 1ZMOA 3T4EA 2O3UA 1OC2A 2D8AA 5COBA 5A3VA 3E9QA 1H94A 5C7OO 4B7UA 2CFCA 4RPKA 3WTBA 3GR6A 1S7CA 5JYEA 1YL5A 2YYYA 3IQDB 4XCVA 4BV9A 1PIWA 3H5RA 1LC3A 1XA0A 4J16A 5KJEA 5JCJA 3ZDFA 1CERA 3D5QA 5JNLA 3UH1A 3KSUA 4YPOA 1IPFA 2IXAA 5G0SA 4Q3DA 4RDHA 4J2OA 1IULA 1PQWA 3DMTC 3RSHA 4IXTA 5A1TA 5BSGA 1RYDA 1J0XO 3Q9NA 3EVNA 4YT2A 1WDKA 3INTA 3O9ZA 1R0KA 1GD1O 3WQRA 1ML3A 1ZK3A 1XQ6A 4NNJA 3R0IA 2H5LA 3HN2A 4M87A 3HJAA 4G65A 4P8RA 4CMIB 3WGZA 4D46A 1U3UA 3VPXA 3MOIA 5DBFA 1B15A 4YCAA 3ZH2A 4JLWA 3GLQA 4WLNA 4UEJA 3IL2A 4XR9A 1KEPA 4N5MA 5HM8A 5JCXA 2B69A 1AHIA 4OXKA 3HDQA 5JY6A 2OP1A 3PJGA 2EGGA 1JDJA 1ENOA 2X4GA 5T64A 2ZCUA 3KOUA 3JQBC 1N8KA 1PGPA 3WGIA 4MVJG 5A3JA 4E4YA 3OH8A 4ND2A 3D1LA 3GFGA 2J8ZA 2AW5A 3UFXA 4BMSA 1T2AA 5JDIA 3PRJA 1PS9A 1UXJA 3AI2A 2VYVD 3P5SA 3EAGA 3PYLA 4XDYA 5BR7A 2E48A 3PDUA 3SJUA 1DC6A 1GZ6A 3GMDA 1EUCA 5IXYA 3PQEA 4PVCA 3B20A 1Y8RA 2AXQA 1B0AA 4RZHA 5B4UA 1Y9AA 3RD5A 2GRAA 4BGIA 4F6LA 2VRCA 4YRBA 1B3BA 1EK5A 2R2GA 4R3NA 4GVLA 1DFGA 2OOSA 1F17A 5CG1A 4J1NA 4J0EA 5DF1A 4MVJE 1UDCA 4CM8B 3ZNNA 2YZ7A 4D43A 3F9IA 3JQ9A 4KQXA 5HWSA 3VPFA 2UAGA 4Z0TA 3A14A 1GEGA 2VYNA 3VKUA 4E2YA 4W99A 5HBRA 1VKNA 1DC3A 1IHXA 2H9IA 4Z9XA 2PKQP 4BQRA 4DXHA 4EDFA 3T4XA 2HCTA 2YDXA 3RBVA 1P0FA 4PFJA 1X7HA 3OEYA 1VL8A 4N5NA 4QFCA 2QHXA 2FR1A 4M89A 2GN8A 2C82A 4WCFA 3ZWMA 2DUWA 4ZRMA 4QT0A 2DUUA 2GR9A 3W6ZA 1TB4A 3HSKA 1G6KA 4CLDA 1EBFA 1WZEA 4CQMB 4DC0A 2NSDA 2X5KO 2WSBA 3LT1A 3JQAD 3B1JA 1PZGA 2O50A 2NQ8A 4R5MA 3GH3A 4WLEA 1M67A 4IDEA 1VSVA 5GMOA 3JD3A 4CM1A 1FJHA 3RKRA 4CM9D 1ZJZA 3GUYA 4IDBA 2HJRA 4IDFA 5THQA 1PZEA 2EKPA 1NVMB 1YJQA 1HZZA 4XYGA 3VH4A 4LISA 4R4JA 1P1KA 3W4JA 2O2YA 1LRKA 3CZRA 3MJ4A 3UGKA 2BF7A 4UEKA 4DQVA 4IBOA 4QECA 4XD2A 4RPHA 1C0KA 3C7CB 3JQ8B 3L9WA 3RAJA 1BWSA 3GG9A 4HWKA 3OIDA 4FJ0A 1RM0A 1VM6A 1SBYA 4NZ9A 4BNIA 3W1VA 4I5GA 5JW6A 1KEUA 3VHRA 3PWKA 5JBIA 4OH1A 2DTXA 5CG2A 4HBGA 2O4CA 3DBRB 4FD3A 1Y1PA 1JKFA 2Q2QA 4JBHA 1KEVA 4DPMA 1ZK2A 2HUNA 3FWNA 3W8EA 2FY8A 4J4TA 2O7QA 1U4SA 5DOVA 5H82A 1I10A 1HRDA 1QLHA 2FSVA 4OXYA 3F5SA 3V2HA 1P0CA 3ANNA 2Q45A 5DCUA 5IXSA 4LCEA 5JY1A 2TMGA 2RHRA 4R01A 1IB6A 2X7HA 1NVTA 1P1HA 1NQOA 3E5MA 1BXGB 3D3WA 4KWIA 4BNHA 3FNEA 4TRMA 4Z3DA 4R9SA 3PJDA 5F1PA 4WCDA 3ZN2A 4NQZA 2EP7A 1CYDA 1E7MA 2PTGA 2XOXA 2ZYDA 1DO8A 2I5PO 5HTOA 4FFMA 4D44A 3O38A 5A5FA 1DIGA 3EW7A 2QQ5A 2X0JA 1YB4A 2WMDA 3DBHA 4TKMA 4F46A 4YTEA 1C1DA 2FOIA 3D0OA 3WFIA 5JYDA 5TLSA 2VOEA 1OI7A 4OHUA 4F3YA 4D3FA 4XQ9A 3GZNB 3UAGA 4TROA 1ZIDA 2X1HA 3GUCA 3TZHA 3VZSA 3S2FA 2VTDA 4LMPA 3PZBA 1XELA 2POQX 4HFRA 3KSZO 1Y5RA 1J6UA 1HE4A 2GSDA 3C7AA 4B3HA 3B70A 3UCXA 2EIHA 2HLPA 1E3JA 1DOHA 4UUMA 2WTBA 3P19A 1ISGA 4EUHA 1KIFA 3V2GA 4RL6A 2GD1O 1E1MA 4AJ2A 3LLVA 2DBRA 3IJRA 1O8CA 3LLSA 3DQPA 4XQCA 2O23A 1GUYA 2G82A 1E5LA 1LQUA 1PSDA 3KVOA 1O6ZA 3Q3CA 3WYCA 5DCWA 4A0SA 1DAPA 4I1IA 4H16A 3NTOA 4I5EA 1N7HA 3ON5A 1C14A 3CINA 1X7GA 1ZSYA 3RBZA 1PX0A 4IJUA 4OM8A 3A06A 4IZIA 4MVJA 4FB5A 1P77A 3ZNPA 1HT0A 3JSAA 1LI4A 4GMGA 1UAYA 4BNYA 4EUEA 4EUFA 1GFSA 1HE5A 2QZZA 3TZKA 3VZPA 5TT0A 3WX0A 3RFXA 5G0UA 2VZ8A 1JA9A 1ZXBA 3KXDA 4CUKA 3IP1A 4LVCA 3M1LA 3ROPA 4AJNA 4GL4A 4O63O 9LDTA 3A28A 4NU6A 2VT2A 4M54A 4Q9NA 3RIHA 5L51A 5JS6A 3DAFA 4JP3A 3V1YA 1BG6A 4CLXA 3CUKA 3ONDA 2NVUA 4JJFA 2O3RA 3ZCXA 1L7EA 4FJ1A 1O5IA 4Z6KA 1DRUA 5G4KB 4YJHA 4AJ1A 5L95A 3ZZNA 1BMDA 3FNGA 5I9MA 3I9NA 5A04A 1GPDG 3BTUA 2QYTA 1UR5A 3DOCA 3JQAB 7ADHA 2GCGA 4GH5A 4B4VA 2BFAA 4CL3A 4TKLA 4CMGA 4ESOA 4DQUA 4E32A 5EMHA 4EJ6A 1U7HA 1DSSG 3L6EA 3LF2A 3GF4A 3HHPA 3PJFA 4E5NA 2NU8A 4EEZA 4NFSA 4CMEC 1M6HA 2D2IA 3IKVA 4HKTA 3S2IA 4MVJP 2Y1EA 4ZHSA 4OL9A 4HNGA 4LN1A 1EEHA 4JNKA 1Z82A 2FZEA 1SB9A 5ES3A 1TVEA 3WGOA 1U28A 5CAEA 2V6MA 3BYZA 4YJGB 4ALMA 1T4BA 3NV9A 1U5CA 1LXCA 2ZKLA 4Y9DA 1R0SA 1E1NA 1YKFA 1VPDA 3BMNB 1QYXA 4OAQA 4ALLA 4MDHA 3PWSA 3HADA 1PTJA 3GNSA 1UXKA 4E30A 5IZ4A 4WJZA 1C0LA 1MG5A 2BI7A 1TT7A 2GYYA 4CLHA 3ZWPA 4WEOA 1EUZA 1E7QA 1PGOA 4XR4A 4HV4A 3DXFA 2VWPA 3NTQA 5ITVA 3BAZA 4C7KA 1R15A 5EQDA 3WIDA 3I83A 1T2DA 4OOEA 1MLDA 2AE1A 1ZKMA 5TF4A 1EK6A 1WP4A 3H9JA 3DZBA 4ROSA 5L53A 3IJPA 3TDKA 5JDCA 1CRWG 4XGKA 2R6JA 5TSDA 2OZPA 3CMMA 4CM5A 4M1QA 4MOWA 3WGHA 3E9NA 1H6CA 4NFYA 4J7XA 4RORA 2PH5A 1NM5A 1HWYA 2EV9A 2XAAA 5CPFA 2OO5A 1SNYA 2DC1A 5AQ1A 4FCCA 2GZ3A 5KOIA 2Q99A 4CQLA 3DONA 3FI9A 1QR6A 4N5LA 5DULA 3QHAA 4CUZA 4Z9FA 2B37A 3LDHA 4BO7A 6LDHA 4IMRA 3MJEA 4MIYA 2B4QA 1PZHA 3UF0A 4BKPA 1HDRA 3RBXA 1QORA 3K30A 4FBGA 5H83A 1KBZA 3GPDG 4R1SA 2BGLA 1E1LA 1SMKA 1U4OA 4FFLA 1I2ZA 4WLFA 3WSWA 5KVCA 1HDYA 2B83A 1YDEA 3NGXA 2NUAA 1XYGA 2EW8A 2OFPA 4WLOA 1RWBA 3ROKA 1WLYA 1I5RA 2GN6A 3SXPA 3FWZA 2BLLA 1XHLA 1N2SA 2WYWA 3I9KA 3Q2IA 4A73A 1BGVA 1PR3A 1UDAA 1FMCA 5JO9A 3AOGA 1LDEA 3E5RA 5JLAA 4CV1A 1V3TA 1PWZA 4L8VA 4BKOA 1LQTA 3ZHXA 3M2TA 4CLOA 1HLPA 1FDTA 2YV2A 2ZQYA 3AUAA 3DMYA 3JQFC 3BHJA 3VZQA 1U8FO 5IN5A 2VHWA 1GY8A 1GYPA 1A72A 1T25A 1ZJYA 4Q39A 2HDHA 4J9VA 2Q1SA 2VHZA 1D7OA 4NBUA 3OQ1A 1MUUA 4BNLA 2Y99A 1C0PA 2R00C 1LSUA 2XXBA 4IDDA 3DHEA 2O3JA 3L0DA 2JD0A 5F1OA 1X13A 5IDWA 1A4UA 2HMUA 1LA2A 1R6DA 1YO6A 3GHYA 4S1VA 4YA6A 4CPDA 3OA2A 3GQVA 3QWFA 3W8FA 2Y93A 3TFOA 4NG5A 3QWBA 2B4TO 4TMFA 5FF9A 4QTZA 4E5MA 1UZNA 3KEQA 2LDBA 4PG7A 4ZD6A 4U6SA 1WMAA 3COSA 3I6IA 4BHTA 4TSKA 4BV8A 4Y67A 4IGFA 2Y1CA 1K2WA 4MINA 3ULKA 5TIIA 1NFQA 1RM5A 4FQ8A 2Y0DA 2EWMA 4JGBA 1PJTA 1BTOA 2AQHA 5G0VA 4GGOA 2EG9A 3F4BA 3VPGA 1B16A 1P1RA 5IZCA 3ZNQA 3U4HA 2ZB7A 1XSEA 2GZ1A 4CV2A 3NDIA 4EJMA 1IZ9A 1GZ3A 1Z45A 3K9QO 3FRJA 5T8KC 2CSUA 1TEHA 2XF8A 5IDXA 1KY4A 1NWCA 3U0BA 4ZQFA 4AICA 4AJPA 2W2KB 4N18A 4TWRA 3NTRA 1P74A 1V8BA 2Z5LA 2NADA 4Q3BA 4UVGA 3ASUA 4DTIA 4HP8A 3NT5A 3PFWO 4QO8A 2OHXA 4NI5A 4R5HA 4RVDA 5JPIA 3B6ZA 1ARZA 3AI1A 4YBZA 1ZZEA 5COQA 3NX4A 5HRUA 1JTVA 2QZ9A 4FW8A 5ER6A 4NR0A 3ENNA 3WBFA 4AJHA 1NHWA 4LGVA 4BMNA 3P2OA 4PLGA 1NFRA 4GVXA 5L4NA 1P1FA 2HMWA 4FC7A 1ENPA 3ZU2A 5BSHA 3O8QB 4EITA 3GT0A 3LT2A 1K6XA 5T6BA 1DAOA 1I3NA 4DQXA 3OM9A 3D3EA 1FDVA 3GEGA 3ZWNA 4BKRA 4OJNA 5DOZA 4CMIA 5ICSA 5JO0A 1UAGA 3HDYA 2PY6A 2ET6A 1PJLA 2AQKA 1N5DA 2OMEA 3DZJA 1HL3A 4PRKA 2IE0A 2NLOA 3BTSA 4YAKA 3KHUA 3U09A 3AY6A 1GCOA 1XDWA 4Q3EA 3QVXA 3ZWXA 1LJ8A 4DGSA 3GRKA 2Y1OA 1G0OA 2FPIA 3KB6A 2ZYGA 4KWHA 1C0IA 5COAA 3C8MA 4OGWA 1YBMA 3RQSA 5A02A 3U49A 4URFA 5J23A 2HSDA 3CEAA 4IDAA 4XYBA 4QSMA 3JQCA 1T1RA 1CWUA 3I9LA 3FBTA 3HB5X 1ID1A 2B0JA 3ONEA 1T2CA 1M76A 3CPSA 2Q49A 2W2LA 1RJWA 2O2SA 5JC1A 3FCOA 3KLPX 5DBIA 3RUFA 1SOVA 4M8SA 3CXRA 2AG5A 4W4TA 3AUSA 5KVVA 1SB8A 4AVYA 1O0SA 3X2FA 1X0VA 1U5AA 5EIOA 5FWNA 4CMBA 5GZ6A 3HZZA 2J3JA 1A7KA 3JQGB 3AM4A 3EYWA 4BO0A 4TQGA 4CM8A 1YGYA 3Q11A 2O48X 3ZWCA 4JN6B 3SBOA 4DLLA 4BNUA 1WXDA 1E3SA 3MTGA 4IDCA 4E2ZA 2X6TA 1NR1A 4U0JA 1VL6A 3E03A 4B4WA 4K6CA 3OF2A 4G2NA 2EEZA 1PJ2A 4J91A 3ADPA 3KM0A 2BMAA 2FMUA 5EN4A 3KUXA 1RPNA 3CMCO 1XKQA 3TZCA 1YE3A 1MC4A 3DZHA 3DC2A 1A9YA 3LSYA 2UUPA 1MC5A 1ZH8A 4YAJA 4J0FA 1ZCJA 1GQYA 5TT1A 3VZRA 1XLTA 3E6AA 2FN7A 3HDHA 2OL4A 4RV9A 5KJ1A 4DPKA 2A9FA 4CQMA 4ZN6A 4BO4A 4R51A 4XYMA 3FBGA 1HDGO 4K6FA 3GEMA 4RVFA 3VH2A 3VVBA 5I9NA 5MDHA 2YHUA 4LK3A 3LT0A 5BSFA 5KJFA 2YQ4A 5A9SB 4PG8A 4ZRNA 4CR6A 1P1IA 2C5AA 2WEKA 3FNHA 3JD4A 4BNNA 3IIEA 4BGUA 4DBVO 4MVJH 1L1FA 3I6QA 4YT4A 5KJCA 3OICA 2Q4BA 1DXYA 3S8MA 4I5DA 3AFMA 3L77A 1QRRA 1X15A 4O5OA 4AL4A 1CEQA 1TA4A 4LMRA 3JCZA 2I3GA 1KOLA 2Q50A 4D42A 3ZV5A 3QJ5A 5K9ZA 3ZV6A 2NTNA 3ZV4A 1A7AA 1I3MA 4RDIA 5A4DA 2O3SA 3JQ8A 3PK0A 3H9GA 4K28A 2I66A 1HKUA 1DHRA 2HK7A 3RU7A 4LRTB 3IUSA 4O6VA 1QYCA 4JK3A 3TPCA 4L4XA 2QG4A 3DOOA 2J5QA 3PIDA 3OJ0A 4AJLA 1R66A 3DBRA 2HAEA 3VTZA 1QV6A 5L7YA 5ER9A 2QRJA 2AEMA 3F1KA 5ICMA 2DBQA 4A27A 1YRLA 1HSOA 3S2EA 4CR8A 2J5KA 3ETEA 3IC5A 3DAGA 3ASVA 3GPIA 4ILKA 4QUKA 3HDJA 4UULA 2EGHA 1LRJA 1WWKA 3KV3O 4WKGA 3RROA 2RH8A 4BNXA 1CJCA 3DWFA 1DC5A 3E48A 3BMCB 3ZU5A 4XRRA 1UP7A 5ITWA 3PEFA 2EERA 2DFVA 2IDZA 2C2YA 3PJEA 3H7AA 3MJSA 3FTPA 1BXGA 2XXJA 2BGMA 4RF3A 2Z1NA 3MWDB 4XGIA 3WWYA 3OIFA 3AK4A 1PJQA 2EJWA 3DZFA 4Z3KA 1N1EA 4R1TA 4UUOA 3I4CA 4HX5A 2G76A 3ZWYA 3MCVA 1BVUA 3FTNA 1IE3A 1T26A 1LEHA 2VYND 3BIOA 4NU5A 5L45A 4B7CA 4DMLA 4BGEA 2IEDA 2X9GA 1Y8QB 1O9BA 5T57A 3RUIA 4EI2A 4RLSA 3EDMA 3DAPA 4W7IA 1LSJA 1MP0A 3AJRA 3GZNA 2GO1A 4J7CA 1OMOA 4XX0A 5FYDA 2EKQA 4ALIA 5CDGA 3QVTA 1BVRA 3DBLB 4FPXA 5G4LA 4NK5A 2QRKA 3K96A 3G1TA 4JCOA 2CMDA 4WLUA 3TZ6A 4PLPA 2QW8A 2NACA 3HWRA 4MIOA 5I8ZA 1U1IA 2DAPA 4YR9A 1LNQA 4J7UA 2WYUA 1B26A 3RJ9A 4FOSA 4LVUA 1E7RA 1Y5MA 2VYVA 3FHLA 3PYMA 1I2CA 6ADHA 4E3ZA 4ITUA 1E92A 4Q3NA 1DBVO 1PR9A 2Y1DA 3H5NA 1SZJG 3CTMA 1KC1A 4P4LA 1ZBQA 4X54A 1Z7BA 4RGBA 2BGKA 2PK3A 4NMHA 1H9AA 3U5TA 2YJZA 2FPGA 3H6KA 4OO3A 3G49A 3DDNA 4XWYA 3NAQA 5A05A 2X9NA 5K6AA 1YH3A 1BW9B 3ROQA 2CDBA 5JDIC 3CSDA 3KEOA 4NHEA 1LTHR 3P2YA 4LSMA 4E33A 4BNJA 3UHAA 1ZXLA 4JXKA 1AGNA 2GN4A 1U3WA 3A9WA 3PWZA 3D7LA 3H8VA 9LDBA 3D4PA 3QVSA 1J4AA 3GN2A 3EZYA 3GDFA 1GYRA 1P45A 3DEYX 5G2OA 2PZJA 1GYQA 5F21A 1PGJA 2JCXA 4GX1A 1IYZA 1HF3A 4F45A 2X8LA 2V65A 2C5EA 4XGNA 1QV7A 3ZW8A 3RUCA 2ZYAA 4ID9A 5BNIA 3JQ9C 5GZ3A 4YAGA 5IDQA 3OHSX 1EZ4A 1N7GA 3UXYA 2IXBA 1I2BA 4BQPA 4L4SA 2YW9A 4ZICA 3NJ8A 1WMBA 4JBGA 1LLUA 4FJ2A 4UVEA 5BQFA 5G4KA 4DIOA 4BUCA 4XA8A 4BB6A 4WEQA 4P22A 3GVCA 3H9QA 3JQAA 4YRDA 1NQTA 1J49A 4Z0PA 4INAA 1VE9A 3NYWA 4DPLA 4OMUA 4CM9A 1K6IA 1YBAA 4H7PA 1WPQA 3RVDA 3EZLA 4WCFC 4YXFA 4CMHA 1EFKA 3TOZA 5IG2A 2FZWA 3K31A 3PIIA 2PGJA 4KQWA 3G79A 1M6WA 3GEDA 2OORA 1LBEA 3KTDA 1Z75A 2AMFA 5C7IO 3A4VA 2OBNA 5GY7A 3HG7A 2GUGA 1B2LA 2H1SA 1ZSVA 4BO2A 4YJGA 2HMVA 5CDYA 3JV7A 1G1AA 3KYCB 4ND1A 1I01A 2NVWA 4CR7A 2PZLA 3BMNA 4IDGA 4XB1A 4PLCA 1KETA 5C5IA 3VKVA 5BT9A 2FHSA 3RUEA 4NJMB 1DIRA 1R4NB 3SVTA 4E6PA 1DJNA 5DZSA 3LC1O 2Q46A 3BHMA 4HFMA 4PN3A 4D79A 3M1AA 1N9GB 3KO8A 3GK3A 5AOVA 1ISIA 5JAQA 1FK8A 1XU9A 3M2PA 2ZB4A 1HYGA 4O1MA 2TMDA 4PG5A 1JU9A 2FSSA 1VLLA 3PDJA 4RQUA 2GZ2A 1LDBA 4ZJUA 4RVHA 5L4SA 3D5TA 1I3KA 2NV6A 1ZNQO 4R69A 3QV1A 1Q7CA 4C4OA 3Q6IA 1QLJA 3H2ZA 1E6WA 1NAIA 2HMSA 2NM0A 2Y1FA 4BNKA 2PGDA 3UICA 4MP6A 1F06A 1EE9A 2QX7A 3OP4A 3C7DB 4OOFA 3RASA 5B4VA 1ZEMA 2Q1WA 4PG4A 1AE1A 4GQAA 3TFQA 1R4MB 1R12A 1X1EA 2VCYA 3WLFA 3GC6A 3C1TA 4P4GA 1U7TA 1WDLA 1EUDA 3LQFA 2JCYA 4MVJD 4CUJA 1CIVA 1A5ZA 3I5MA 2CUKA 3PQDA 1PGQA 4IZHA 3UKOA 3FN4A 2C54A 2X86A 1FXSA 2RBEA 3WICA 1QP8A 1H6DA 2W8ZA 3EK2A 3PGXA 4RF4A 3RI3A 3FPCA 4IQ8A 2VN8A 2Q2WA 1D1SA 4FN4A 4N54A 5JC8A 2IRWA 3RC2A 5G0TA 1YJ8A 3HB4X 5JAIA 2J6IA 4W82A 4U0KA 1CDOA 3W6UA 3V1UA 4B3IA 1E7SA 2B4RO 3AU8A 1ISJA 1PGNA 1F14A 4PLHA 3AM3A 2PV7A 2NU6A 1E0DA 3SLKA 3ZI0A 1RM4A 2FPPA 3I9OA 3WOHA 4DWVA 2VWQA 4GX0A 2P4HX 4KDEA 1BSVA 1AHHA 1PQPA 1TI7A 4EYEA 5A9RA 1PS8A 2AA3A 1I33A 1NASA 3RCBA 4LCJA 4E21A 1RKXA 2WM3A 4A5OA 5TC4A 3QVWA 5JSFA 2DVMA 3LK7A 2P4QA 3TJRA 1D4FA 3RJ5A 4EJ0A 1O89A 5EESA 4YQYA 3PYXA 1EBUA 1JN0A 3VDQA 4NH4A 2J3IA 1JAXA 4MKZA 4BO1A 3KYBA 4B3JA 1BHSA 4BNVA 4E5KA 4FFNA 5JMPA 3KETA 3VAZA 1UP6A 1ZVMA 2AQ8A 3MZ0A 2ZB8A 1VJ0A 5DBGA 1SO8A 1GEEA 1EE2A 3QP9A 4OSPA 1NPTO 4C7JA 3VTFA 4DYDA 1I8TA 4II2A 1KVQA 4L4RA 5BSEA 1YB5A 2HK9A 2Q1UA 2W2KA 4IIVA 3WQSB 1ISMA 2EHDA 4ND4A 1PJ3A 1E5QA 2B36A 1P44A 1VI2A 4IS3A 1PZFA 5HA5A 5FI3A 3H3JA 3ZNOA 1IUKA 3GY0A 4NBTA 4WK6A 4J1SA 5DDIP 4GAEA 2JAPA 3ZWOA 5B12A 3VC7A 1KERA 5MGBA 1LDGA 2J5RA 1Q0LA 2VWHA 3JQ6A 3NKLA 3PZRA 4BO8A 4XRGA 1GUFA 1NP3A 2BD0A 3K5PA 2CNBA 3AFNA 1T1SA 3WFJA 1NHGA 1W73A 1WW8A 1DIAA 1EDOA 3O8QA 2BKAA 2DBVO 2VHVA 3NJ4A 4GI2A 4DIFA 1E3WB 8LDHA 3N74A 1NAHA 1C1XB 2WD7B 1I32A 2UV8A 1JLLA 3TZQA 1PQUA 2CVOA 4AFNA 5U4QA 5CEJA 2WE8A 5CDSA 4R41A 4YJDA 4ZQHA 4FOOA 3L4BA 5ADHA 3GVHA 3OQBA 5AXAA 1NPDA 3SLGA 4BNZA 3ADOA 4NK4A 1GDHA 1MX3A 3UUWA 1HYHA 3LF1A 2GN9A 1YL7A 4W7HA 4WOKA 4E13A 3OECA 4D7AA 3E82A 3K6JA 3SC6A 5AXCA 3K2BA 1JQBA 3ITKA 2RCYA 1JVBA 2XPCA 5A06A 5JMWA 3L6OO 5CEFA 1P9LA 3MWEB 2ZCVA 5AXDA 3LU1A 4Q3CA 1K5HA 2AQIA 4H15A 1PWXA 2FWMX 3DTYA 5C3MA 4B8WA 2G1UA 1TLTA 1T2EA 4CMCA 4U8GA 3NUGA 4CMKA 1X1TA 3F6YA 4CM7A 4W9NA 4KP7A 4UEOA 3VDRA 1X14A 4YB8A 3WLEA 3LT4A 1GADO 2CY0A 2Y05A 4KDFA 4XYLA 2P9GA 4M55A 1H5QA 1U9JA 5CP8A 5H81A 1KVRA 3SEFA 4EBFA 4IQ0A 3JQ7B 4UUNA 4CMAA 3ZWAA 2JHFA 2IEBA 2F1KA 5JDCC 4GX2A 3UN1A 1LDNA 1YB1A 3JQGA 3WJAA 3I9MA 4HXYA 3BHIA 1LSSA 2AEJA 2CF5A 1PEDA 2C29D 3C1AA 1ZO8A 4J43A 1KY5A 3I1JA 3PLNA 1K0UA 1PS0A 2B5WA 3TF5A 4QFDA 5IF3A 3V5NA 2X58A 3L4BC 4KZPA 2QRLA 5A5EA 3PXXA 3ICCA 1XG5A 2VUSA 4Z9YA 1QSGA 3WMWA 5TJ9A 4YEDA 4EW6A 2Q4EA 1DIHA 2Y67A 3L9XA 1KVUA 2EXXA 2YHIB 4FSHA 5IN4A 1N1GA 4XQGA 2UUOA 4CM3A 1EVZA 1H93A 3G0OA 1HYEA 4XQEA 4EZBA 1ONPA 4GWKA 5BNTA 5LC1A 4A7PA 1B8PA 4BO3A 3E9MA 3OMLA 2FRDA 4BNFA 1U2DA 1ZK0A 2Z1MA 4CODB 4MVJM 5A9SA 1V6AA 3OJLA 3OBBA 1YQXA 2VNSA 3JD2A 2EW2A 4PRLA 1NQ5A 4PZCA 4J49A 4B4OA 3JYOA 3GOHA 3QSGA 4KMSA 2WYVA 4AJKA 3CKYA 4DYVA 4ND5A 4UREA 3BTOA 1YQGA 5L7TA 2I67A 4NBVA 4R16A 2G5CA 1E7YA 4GMFA 4PVDA 1ZEJA 2NTJA 2IYPA 3DOJA 5B1YA 2O3TA 3L07A 3LC7O 4RVGA 1IOLA 3GAZA 3U9LA 3W4IA 1F8FA 3ZWWA 4J3FA 4YQZA 3LC2O 3B1KA 4TRJA 2O7SA 2A35A 2BFPA 2Y68A 1H6BA 3WXBA 5L9AA 2EP5A 3E8XA 3AOEA 1U3TA 3HUDA 3JD1A 1IPEA 4KTVE 4OQZA 2IODA 3EHEA 1Y9EA 1ADGA 4W6ZA 3E18A 4BNMA 4J90A 1MXHA 1NR7A 5CPBA 3MJVA 3BZUA 3QVOA 3SJ7A 3H3FA 1WDMA 2YY7A 3MJCA 5KVQA 4U6QA 1KEWA 2C2XA 3R3JA 5TX7A 3GVIA 2W90A 5IZCC 3HN7A 3CIFA 3OSUA 3E1KA 3AUUA 3IMFA 4XDZA 3W8DA 4RLHA 1WNTA 4OIMA 4EEXA 3BMCA 3ITDA 1IY8A 2ZB3A 1OAAA 4FR5A 3GGPA 2V6FA 2BFOA 1DFIA 3H5AA 3ANMA 1GV0A 3MOGA 2DBZA 3HFSA 1PJ4A 1AXEA 3M6IA 3S55A 3ZW9A 1UUFA 1J5PA 1GQ2A 5IDYA 3KYDB 4R9RA 4LRSB 3WYEA 3HE3A 3WNQA 1VJTA 2E49A 3GZ4A 4AJEA 1T2FA 1Y8QA 1HDOA 4IM7A 5JE8A 1JKIA 5GZ1A 1HEUA 3ROMA 1P33A 4KUGA 1E7WA 1PL7A 2JFGA 5ENDA 3GAFA 2P2SA 4ND3A 3DO5A 3K73O 3O4RA 4GKVA 1NBOA 4J6FA 5DNAA 3TSCA 4ALKA 3AOEC 2O4UX 3DBLA 5KKCA 3BMOB 4OKNA 1E3EA 4JBIA 4GSKA 4MVJF 3DR3A 5LDGA 3CE6A 5TRTA 4MJLA 4Y6PA 1B14A 2GASA 4IGEA 3PVZA 1NQAO 2A4KA 3FR8A 3ZU3A 2IYOA 1K3TA 2P9CA 4PLYA 5EERA 3DMTA 1XQ1A 3QA9A 4BNGA 1Z74A 2YDYA 4D0SA 3CH6A 2BHLA 2JD2A 3G3EA 4IJKA 3DHNA 5KIAA 2BRUA 3L4SO 4FFPA 4CM4B 8ADHA 5KTKA 1T24A 4IJWA 4WASA 3U4DA 4XZ3A 3GDGA 2ZK7A 4ZQGA 3OFSA 3ETDA 4GX5A 3PHIA 4DC1A 5EQFA 2PNFA 1HSZA 5JCJD 1BW9A 2VUUA 1AN9A 1F0YA 2D59A 3HFGA 4ZQEA 1V3VA 3GMSA 3JYPA 2RAFA 3BMQB 4PGFA 3R1IA 3F5QA 5EJ2A 2PH3A 3I4FA 5THKA 3ZGYA 4AG3A 3O26A 1B8UA 1YXMA 2PKRA 3DZGA 4IIUA 2V6BA 4YACA 3WDSA 1HE3A 1K6JA 4O59O 3WYBA 1PL8A 1MB4A 4IY1A 4CV0A 3TRIA 1Q1NA 1M2WA 4YWJA 1EDZA 3WQQA 4DL9A 2PFGA 2WJPA 4HFJA 4Y98A 4PZEA 4RO0A 2WE7A 2I99A 5JAMA 3JQBA 3DL2A 3LYLA 2JAHA 3IDSA 3GN1A 4KTTE 1Q0HA 4DMMA 2DQ4A 2FR0A 2ILTA 5KJ6A 3SC4A 1QYWA 2X23A 2ZIZA 5ILGA 2YV1A 4ZVVA 4WPGA 1GCUA 5CDUA 3F47A 3C85A 2PLAA 1ISHA 4CMJA 2JHGA 3PHHA 4Y6RA 3K92A 2V7PA 3MTJA 4WNIA 5KWEA 2G0TA 1B7GO 3OEWA 4CLRB 1A4IA 3CZMA 3I9JA 3UOGA 1DRWA 4GWGA 2C7GA 2C59A 3DZKA 4HUJA 2GNAA 4PLZA 2PD4A 3STHA 3P7MA 1LU9A 2Y0EA 3PQFA 2WDZA 2P9EA 3RU9A 3OIGA 1NVGA 3F46A 1D8AA 2WD8A 2B35A 4FGSA 4K26A 3VPSA 3GA0A 1LX6A 1NTOA 3PHGA 4BIIA 3KYCA 2RH4A 4I9NA 1JKJA 3ABIA 4MVJI 1E6EA 1PJCA 3DB2A 2VRCD 1MV8A 4TVBA 1EVYA 4PLWA 2AEFA 2AE2A 4NJMA 1R4NA 1JVSA 1X0XA 4IPTA 2CVZA 4MKRA 1KC3A 4E2WA 3DBVO 1B8VA 1N9GA 5I8WA 4NBWA 2P68A 4D41A 4GLOA 2CDCA 1U3VA 1YBVA 4ZQBA 3KLMX 1CQJA 3KZVA 4DLBA 3GNQA 4RF2A 5DP2A 4YJFB 3WIEA 1P31A 1QG6A 1T4DA 3A1NA 4ALNA 1AUPA 1ZSNA 1ADFA 1ADBA 3K2EA 3JYQA 1Z6ZA 4OSOA 4D3DA 3EY4A 5I7FA 4DRYA 1FDWA 1MG0A 2H6EA 1R0LA 3WJ7A 3VH1A 3WR5A 2DFDA 2CZCA 2PKQO 1OFGA 2VNAA 2GDZA 2NU9A 4PIVA 3UVEA 2E6UX 5AYVA 3V2UA 3ZV3A 4E5PA 1R4MA 3AM5A 3U4IA 4NPCA 4GBJA 4J2HA 3C24A 1LC0A 3JQDA 1BXZA 3AY3A 1YOVB 3D4OA 1JWBB 1BXKA 1EVIA 4TVOA 1GPJA 2I65A 2IZ1A 2H63A 2PD6A 5TNXA 3TL2A 4M86A 4JJIA 2JJYA 2WWRA 1TXGA 4IUYA 4ALJA 3EC7A 1VSUA 4E12A 1ENZA 1TT5B 1W4ZA 2YFQA 4IQGA 2HKIA 3Q0EA 1EQUA 4IXWA 2DM6A 1NNUA 4GGPA 3EUWA 4XYEA 5CEEA 1H6AA 1DLIA 3IP3A 4FFRA 2I9PA 2YUTA 3AI3A 2DTDA 4QQRA 1OC4A 3QLJA 1H2HA 1GL3A 2CF6A 3AY7A 1HXHA 5JFOA 1GQQA 3EVTA 2AHRA 4WNCA 4CV3A 2C0CA 1F12A 1YVEI 3N7UA 2JFHA 4GPD1 1XIVA 1P3DA 1W6UA 3KBOA 3G17A 1A27A 5L7WA 1ULSA 3N58A 4AJJA 3G1UA 2JFFA 2PZMA 4PLTA 4DBZA 3PLRA 4ZA2A 3PTZA 2GF2A 2NVBA 1Y7TA 3H2SA 1NPYA 1NFFA 4A10A 3FR7A 4YT8A 4A03A 4A2CA 3Q2KA 1H2BA 1V3UA 1UXIA 1SEVA 2CDAA 3I3OA 2E37A 3NEPX 4D3SA 2GERA 1W8DA 2PR2A 5HS6A 5FFFA 5K6AC 4AJOA 3QWHA 3AWDA 3U4CA 3GGGA 3I52A 1UZLA 4L73A 4BNTA 1XCBA 2W4QA 1IZ0A 1SCUA 3H9UA 4RCVA 1MFPA 2P5UA 3Q9UA 4MP3A 1MA0A 3TNLA 2JKVA 4R54A 2VHXA 5ILOA 2I3AA 2CVQA 3INRA 4WECA 4BL5A 5IJZA 1KS9A 3WNVA 2Q3EA 1JAYA 4BOYA 1YDWA 4QEDA 1A9ZA 4P38A 5K0ZA 1UXGA 1DIBA 3ONFA 1MGOA 3C1OA 1Q2XA 3VH3A 4JIGA 4NJOA 3WS7A 2OP0A 5I9LA 1E3WA 4DREA 4HNHA 3WGTA 2QIOA 3C3XA 1C1XA 2HQ1A 5CDTA 2WD7A 3GRPA 2B5VA 2VT3A 3F4LA 1FF9A 4DA9A 2ZTVA 1HETA 1ORRA 1Y8RB 1UZMA 3FF4A 1LDMA 3V8BA 1V35A 4TRNA 1PJSA 2Y1GA 2FP4A 1GAEO 3KSDO 3ORFA 4Y8VA 1H9BA 1N92A 3NRCA 3ENKA 3O03A 4XB2A 2LDXA 3PI7A 4OXNA 4L9RA 2DTEA 1CETA 3T7CA 4XIJA 1D1TA 3JTMA 1DDOA 1XGKA 3I23A 4PLFA 1DLJA 4I5FA 4Z0HO 4G5HA 5T67A 3ZWVA 2DU8A 1UJMA 1DFHA 4F6CA 3U62A 1M75A 3PPIA 2HK8A 3QQPA 4KUEA 5CFZA 4FC6A 3OJOA 4R68A 2Q2VA 5A03A 3S1LA 5KKAA 1EFLA 4NBRA 4RZIA 1Q0QA 4WLVA 4MO2A 4RJTA 1BDBA 4WCFB 1JW9B 1WZIA 1CF2O 4FGWA 4CMEA 1SEPA 4WOJA 3Q1LA 3JQ7A 3QE3A 4BKUA 2ZQZA 4UAGA 2RIRA 3LVFO 2SCUA 4ONEA 3GVXA 4B8ZA 2VOJA 2D4AA 2NQTA 4R3WA 3H4VA 4LSWA 1DRVA 1ZMTA 2J3KA 4B7XA 4UVHA 3PFFA 2VRBA 1PU2A 5BNFA 3VOSA 5U1PA 1WVGA 2UDPA 1QYDA 2F00A 1AXGA 4TZTA 5IFLA 1SPXA 1ZK1A 5AXBA 4AJIA 1VC2A 1KYQA 2V6GA 4MIEA 4R1UA 4YYZA 3RC1A 3OA0A 2NU7A 3SX2A 4FFOA 3IS3A 3UCFA 5EPOA 1DEHA 2A94A 4YDRA 4OYRA 1E3LA 4KOAA 2J3HA 2UYYA 2YFHA 5JAZA 4QO7A 4BVAA 2YHIA 3S2GA 4OKIA 2OBYA 7MDHA 4CM6A 3WGGA 2AG8A 3UW3A 1ONNA 1KVSA 5FI5A 2NTVA 1DJQA 1GUZA 3TQHA 4R1NA 5F5NA 4OQYA 4BNWA 4I8XA 4DVJA 4RQTA 4J1TA 4WUVA 3R6DA 1ZFNA 2GGSA 5JXWA 2X5JO 4BO5A 1DB3A 3F3SA 5F1KA 1UXHA 4N7RA 2G17A 2PGLA 4YRAA 4QXMA 1LLDA 2HRBA 4XJTA 3QWAA 5DN9A 1HDZA 2X0IA 1A71A 3H65A 2JL1A 4YVFA 3U3XA 4BO6A 3RKUA 2BELA 1BDMA 2GLXA 3VPHA 5A9TA 3RUDA 1NYTA 2YV3A 1UP4A 4HY3A 4WE3A 2DPGA 3LZ6A 1Y81A 3RUHA 3W4KA 1UH5A 2VTEA 4I9UA 3D3WB 3NDJA 2JCVA 4FIZA 2X5OA 3OQ6A 1GR0A 4GLLA 4CJXA 4S3MA 1RM3A 5T5QA 2NWQA 2ZTUA 1BRMA 2P5YA 1ISFA 1XU7A 3QRWA 5C7LO 1I0ZA 2E4AA 3GVPA 2ZJ1A 1GV1A 3PGJA 1YWGO 4PCVA 3AU9A 1V0JA 1E1KA 3JQEA 4EGFA 4TRRA 2PWZA 3DBHB 1Z73A 3K8ZA 3JQFA 3QW2A 4HFNA 1FDSA 1LLCA 4ZGWA 1W0CA 2FR8A 1C1DB 1QMGA 3PHJA 2BFMA 2HU2A 2QYSA 4PZDA 4NDNE 2D5AA 2VQ3A
chains in the Genus database with same CATH superfamily
4LBZA 3RFVA 3AKCA 1JWAB 1JS1X 4Q1AA 2PN1A 1Z6YA 2V1XA 3CQ9A 1YRWA 5CMLA 1G2PA 4QA9A 5AUQA 4WH0A 3SQDA 3G5LA 1SBNE 3CN7A 4KUHA 1OTYA 2XGJA 1SAYA 4N03A 4YP0A 1I1HA 1ZK4A 3DHYA 2Q9CA 4HQOA 5AW8A 4B4UA 2C2BA 1E60A 1I6MA 4S35A 5DP1A 5DNUA 5EJ9A 5LSAA 1H42A 3WIOA 1GLVA 5G0WA 4ZVLA 4KRXA 2G63A 3TTWA 3RWBA 3EGOA 4PGHA 3T52A 1FPMA 1KBOA 1RQ7A 1G38A 1FDUA 1SHLA 2Z95A 1GZ4A 3KYDA 4ZQCB 3H42B 3GZTB 4X62B 5KMGB 1KXJA 4DLVA 3UPUA 1EXDA 1X38A 5J58A 4HAXA 2DHRA 4EGAA 1AUOA 2VF2A 5GV8A 4L08A 1SVSA 1U94A 2RJOA 4JC5A 4LXHA 4G4IA 4X1IB 5EP3A 1C9NA 3HQ4O 4IHJA 3OEEA 4RF5A 2WQ7A 1QU2A 1DO0A 2WNIA 4A8TA 3AJEA 1DTWB 1EINA 1YSCA 4B79A 2OD2A 3TLKA 1OKKA 2A2ZA 4FQ7A 4R9UC 4Q9LA 4ZVUA 1GDTA 2NNLD 2Y71A 2X0NA 2E82A 1EFPB 4YAFA 4XDHA 3CO0S 3JALA 2H08A 2QJFA 4YV2A 1KGSA 3R3ZA 5JFTA 3UJCA 3AF1A 4H60A 4WNAA 3TCNA 3URMA 5JYBA 5E3IA 3ER8A 2PZEA 1MORA 2FHPA 1CJMA 1O0BA 4BC0A 3BWYA 4UUAA 1SUAA 2OHFA 4HZGA 1GAWA 2N46A 4PYQA 3OX2A 2XCSB 3UT5B 1DMSA 1LTKA 2EWWA 4CL8A 4OM7A 1PJBA 2BH9A 3R0XA 2ZJYA 2D6FA 4V2UA 3C7TA 2OGUA 3WB9A 1U6IA 1N78A 3NH6A 2AVDA 3AFIA 3GHHA 3FPHA 4KN5A 5IAAA 1NBMD 1OBFO 4JQCA 4AF8A 2GA9A 4Q7MB 1SC6A 2VP6A 4KQMA 2PMFA 3P5BA 4Q9HA 1N0UA 3GB9A 4N41A 4MEJA 2JA1A 5CURA 1SHUX 4E51A 4YDHB 1EYZA 2PYZA 3CG0A 1A69A 3K9CA 1P3JA 3LQYA 5IYZB 3BMQA 1H3FA 1NN1A 3RC9A 1L7DA 4UDNA 5FPTA 3TL3A 4K9DA 4R8KA 1FW6A 1H1DA 1G7CA 3HO1A 5ALTA 3TGPA 3EDYA 3PRKE 5AJXA 4PFQA 2XWPA 3E0QA 3F96A 5FL7A 4KYTA 1AKEA 1PNTA 1WPGA 4KLZA 3REGA 3HN6A 4E31A 2NU8B 3G8BA 3LI2A 5LXTF 1TK3A 3LG2A 5I9SA 3RTBA 1UJNA 3RRMA 3SS8A 2Q41A 2JJ2A 3BWBA 3EAFA 4TV8F 3ZWBA 4EYSA 2ZRKA 4DB4A 4ZOLB 2CMFA 2VPPA 3QVVA 1P18A 1ENYA 2HMTA 4UNNA 5FJJA 2HIGA 1RBZA 2D4HA 4D45A 1GRCA 4J9UE 3QY9A 2HV8A 4QBIA 2C07A 1C3VA 5KCZA 1T4CB 2HT6A 3A36A 3HVUA 5AI4A 1TE2A 3AKEA 1OIVA 1HLDA 2IYXA 3UJHA 2N3ZA 5J2UB 1E77A 3R3HA 4JEIA 3SQLA 2RHMA 4OI1A 3MK31 1OWMA 4ND8A 1STOA 5ADWA 2OYSA 1CZNA 1JILA 4MYTA 4C89A 2YIJA 1XUOA 3GGOA 3NH9A 1U2EA 1CUUA 4CI0B 4CLRA 1CY2A 4WJKB 1ULUA 3IUPA 1JPJA 2CKDA 2C1ZA 3C3PA 1I36A 3FNFA 2I1WA 1MJFA 4D82A 4Q21A 5JANA 2Z5GA 5K03A 4ZV7A 2EJVA 1YMVA 3BF7A 4N65A 4EQZA 2GM5A 4AY5A 1KKMA 4OAOA 1K0FA 2R87A 1L3CA 3C3EA 3HKCB 5E2AA 3G6WA 2I4MA 3NHMA 1K63A 2X0RA 3GJ6A 3V4OA 3OIUA 3HRHA 3T5PA 1XR3A 4D9JA 2QNRA 2PTHA 1L7XA 3ANLA 2VSQA 4GZ3A 4LNAA 2HA4A 5LR6A 3C3KA 2FEAA 3FD8A 1AHNA 5DCYA 4H1WA 4RIIA 1RYMA 5KNBA 2YQ5A 3NV7A 1J5XA 3PHLA 4DSZA 2W4IA 3OZGA 4H3VA 4H59A 1ZR2A 4UBKA 4DUPA 4CQLB 4J4BA 4FYYA 5EIXA 2C4HA 4BGVA 4NDZA 1CFJA 2WBLC 3OU7A 1CB0A 3GWGA 5KNLA 2IBMA 2R86A 1UDBA 4A6EA 5KYWB 4RPGA 1YC2A 3ZTTA 1DX4A 4L6CA 2R4QA 3CLUC 4KHZA 4RLQA 3B7WA 1UEIA 2GT1A 3GBSA 4YLEA 2WKWA 2H4YA 1JHUA 2MYTA 3FFBA 2WFMA 5K3EA 5A7FA 5KOJA 1O94A 1U7PA 4DLXA 1I3OA 4QX6A 3T1OA 1ZHHA 1FLAA 5KSPA 4KYVA 1R6AA 3ZYZA 1KFEB 2QX4A 4M0UA 4U7WA 4OQDA 3RVJA 2XKJE 3BBLA 3OF3A 1E69A 2GSWA 3HNPA 4C2UA 2BUBA 1M34A 2W5UA 2JLZA 3NTVA 2V9PA 1G8FA 4I4IA 4DV0B 4MUIA 4C3OB 2NP7A 4E0BA 2P4SA 1HDXA 3D4NA 3FLAA 3PQ6A 5L4LA 2V9ZA 4O4IF 2IZ0A 3DTTA 1G59A 5K51A 2G5TA 1RE1A 3GXOA 4JEHA 4MH0R 2D1YA 4CLOB 4V0ME 1T0UA 2QM7A 4M8IA 4YNBA 3UMVA 4ZGGA 4MUKA 5JJKA 4GOJA 4RIFA 5JAUA 3NBUA 5DNVA 5G41A 2GAOA 2UVQA 3TLMA 3WTCA 5AVVA 2ALJA 2PZBA 4GRAA 2QD3A 2UZ1B 4HWOA 1MIOA 4Y0NA 2QAGB 4ZU3A 4CLEA 5E6RB 4AQ7A 4FFBA 1QXSA 1MXFA 1P2DA 1R8QA 5AJZA 1K9SA 5LU8A 4X97A 2WIBA 3BXPA 3DE0X 3ZKWA 1ADCA 2NO7A 4YAIA 1WBBA 4JASB 5CB0A 1XL0A 2ISQA 3BXHA 1WAMA 2P91A 4W5JA 3WWPA 2ZE7A 1D3AA 4D4KA 3D8TA 4ZOEA 5HTKA 5KHLB 1NWHA 4C2BA 1BE0A 1ST2A 2QZ4A 4MPDA 1C50A 3N6RA 1KO7A 1ZVQA 3QNMA 4HDOB 4C9BA 4FLMA 3JYLA 721PA 2J3QA 5IKPA 2YCBA 2W37A 1DBWA 5DASA 3LFHA 1UOEA 5AM0A 4C7BA 2HO5A 5CXSA 3ZTYA 1IHYA 1E3MA 3PKJA 4MYSA 2UVDA 2F2TA 4HPWA 4NRDA 4XEHA 3ZHZA 2BFCB 3QPDA 3DMNA 4HADA 1I1OA 3ZDDA 5HF9A 2O3UA 1Z6TA 3T4EA 4YMGA 2D8AA 2JFNA 1G5FA 2IZ6A 4KRYA 5AM5A 1KMHA 2YOFA 5G1NA 2C3UA 4B7UA 2ZWVA 3WTBA 1PEKE 3EZNA 4ETIA 1S7CA 3EZFA 4KG7A 5JYEA 4Q93A 4HDAA 4GSYA 1XZEA 3R3YA 4HB0A 1UBFA 1XA0A 1EVQA 4J16A 3CKLA 4FWTA 4DUZB 1U8UA 2A6PA 5E7MA 1R3DA 4KPGA 1OIWA 5IK2A 4C4ZA 3I92A 2PWPA 4QM6A 3UH1A 2H4JA 1N9ZA 3KSUA 1I4WA 4OBEA 5EPEA 4JLMA 3JAWB 2IXAA 2VF4X 4GLFA 4Q3DA 5TDHA 4J2OA 5KI6A 3TKAA 5HR5A 3RRJA 2XOKD 4X85A 4DLPA 4V1CB 4Y1RA 2OLJA 2ZLBA 1Z5UA 3FWKA 4HGQA 4IXTA 5FBZA 3Q9NA 5BQXA 3EVNA 4BMOB 1F6WA 2C92A 3HJRA 2QRVA 1DWUA 4V24A 4Y2VA 5HJ7A 2WHPA 4HH4A 1YRHA 4ZODA 3DPIA 2QRNA 2F8SA 1ECBA 2XDQA 4LJLA 4MW0A 1YI1A 3R0IA 1SN7A 1X7YA 2H5LA 1KP9A 2R1VA 2RG7A 4NS4A 3UJ7A 3KJNA 1FYDA 4P8RA 2AC7A 3RFCA 4CMIB 4D56A 4BQFA 1EFRA 1Y6FA 4LJRA 3MOIA 5FUWA 1V5WA 3AUJB 3GLQA 1NMEA 3DTVD 5LLTA 1WHTA 2Y4OA 5IRCD 2H57A 3IL2A 2XXAA 3GLGB 4MV0A 1YDHA 3BJMA 5KX5A 1UKVY 1GN9A 1AHIA 1U8TA 3HDQA 4Y2TA 4IIFA 1MPXA 4OBBA 1BMQA 3NOXA 1IQRA 2EGGA 1W46A 4PC1A 4POAA 2FPIB 1ENOA 2HQBA 2OO7A 4RFLA 5AW0A 2VPWA 3GA5A 3RYFB 4PZPA 1HURA 3H3XA 1XMXA 1A9TA 3QFTA 4ND2A 5K45A 2OBFA 1I5EA 2DPXA 3DFIA 3WLSA 2P35A 2OTCA 3GFGA 1NW7A 3UFXA 4BMSA 1MJHA 2WYIA 3RS2A 1ZOOA 3H5OA 5HYVA 4G67A 4CFYA 5AO9A 3PRJA 1PS9A 1UXJA 2GCEA 4B48A 1ABBA 1XEFA 3HXQA 1HQDA 1L8XA 1XRLA 2J9ZB 2VYVD 3WRXC 1PDVA 5DI3B 3G02A 3S5UA 4XDYA 1PT7A 1RLTA 2VAMA 3DNFA 3EODA 4GI1A 1K5GA 3BL6A 3E8SA 4H3HB 4B44A 2R6DA 1WA5A 4BN5A 4Q4AA 3TQOA 1KWKA 4GYYA 3T1HB 3GMDA 4FEEA 3IIIA 5IXYA 2FWBA 4IUCS 4LOKA 4PVCA 3B20A 2GK4A 1DAEA 2CSXA 1EFTA 2AXQA 3PDCA 4CGYA 4ZOQI 3L7MA 4F6LA 2YASA 4WXEA 5AMXA 1WCYA 3IP9A 1TQ2A 5M34A 4L9SA 3VR3D 1RAIA 2AUMA 4EBBA 5CG1A 1UOOA 4J1NA 4J0EA 3OP1A 5DF1A 4CM8B 1LK7A 3PUKA 1K7SN 2YZ7A 4H1VA 4N0EA 2P62A 5DXFA 3LPLA 1REQA 3ANSA 4C6TA 5HWSA 4B40A 1O0CA 2P5TB 4H0CA 4G8BA 4C6HA 2B8WA 3HWWA 3N2NA 1QK3A 4UBMA 1NI4A 3C8DA 1UQTA 2OG1A 3L6RA 4IJQA 3N3AC 1OPRA 2ERXA 2AFHB 4L5AA 3CLTD 5F3WB 3D4IA 1P9NA 4DADA 2G0AA 4AQDA 3H0EA 3I8OA 3PRYA 5HJ5A 1DC3A 1IHXA 1XDUA 2DWQA 2PKQP 2FWIA 3FGZA 4TTIA 1DQYA 3JARB 3OLQA 4ED9A 4B3SB 1FVXA 1P0FA 2H06A 4MUMA 1UK6A 3AGPA 1TLFA 1VL8A 4G1BA 4N5NA 1VA4A 3TR5A 5JTUA 4M89A 1U8ZA 2QMEA 2FEXA 4J6EA 2C82A 5CR9A 3LGSA 3AEQA 2DQKA 2DUWA 3VDNB 5DN6D 1DQRA 1V43A 1GFZA 2RK3A 2WUEA 4IV0A 4YS6A 5DWDA 2DUUA 3VFDA 2GR9A 3W6ZA 5TGTA 1TB4A 2PLRA 1CV2A 1W0JA 2M6KA 1T5TA 4CLDA 1Z2DA 2HYDA 4PSDA 2NSDA 3RYHA 4EB8A 1PVDA 2AL7A 3AP1A 5BMVA 3LT1A 1VGVA 3TDNA 2BPOA 4QXOA 3BL5A 2NQ8A 4R5MA 3GH3A 1R6UA 1GGHA 5CCDA 1KY2A 2Z2YA 3IFSA 2R7LA 4W63A 4Y18A 3JD3A 5GMOA 3UWPA 3ND8A 1G8SA 5FNVA 1ZJZA 2H3HA 2ZSDA 3CUSA 1YQUA 1ZU4A 1X8LA 2R8ZA 4KV7A 3SDZA 3TIGA 3VI4B 4JUCA 3H75A 3ZGVA 4DMGA 4DTCA 5IPFA 1I7SB 1HZZA 1SQ0A 2FPOA 4XYGA 4XOIA 3VH4A 4AKEA 2IJGX 4BFXA 2WIJA 1T5HX 2O2YA 4LDNA 5GQSA 3CZRA 4HRYA 3LSTA 1B0UA 1EXMA 2EIXA 2JGKA 4F3NA 4NJEB 4RD4A 3F98A 4UEKA 1VLVA 4KIFA 2AC4A 4ZK2A 4ZO4A 2GEDA 5B58T 3TD2A 1WXIA 3WGKA 1BD3A 1Z3IX 3C7CB 4HWKA 4FJ0A 1CUAA 4W1RA 1GTRA 1RM0A 3PCRB 1ATIA 2Z98A 2P78A 1RWMA 3MUFA 5JVDA 3AR5A 2WAAA 1MNAA 3AKDA 3CEPB 3DD5A 4I14A 2XIQA 4HZUB 1TUBA 3PE4A 5JW6A 4KE8A 2YC2C 1J33A 2ZROA 1FP4A 3MUNA 4LSZA 4OH1A 2GRJA 4XEUA 3TOCA 3U48A 1ZNWA 1SVMA 4JOBA 3DBRB 1Y1PA 3LOQA 1DG3A 4JL8A 2OECA 1ZK2A 3FTQA 1ZCAA 3ECSA 2OGTA 3WK4A 1VPTA 4CKCA 3QKTA 1C8BA 1JDNA 1UDWA 3HY4A 1HRDA 2ID8A 1KQOA 1QLHA 3MA0A 1JFFA 1JIQA 3I12A 4GOOD 2OXRA 1M0TA 2C5HA 4GR5A 5AKLA 1LD3A 2R84A 1FXUA 4LCEA 3HSSA 3O8OA 1K4YA 1MB2A 2ZYHA 4M8LA 5BO5A 2RHRA 4XM2A 4UPEA 4HDNB 3UOWA 1NLUA 2P2GA 2QRHA 2VA9A 3KKNA 3RWMB 4K3UA 4A1FA 3D3WA 5TGZA 3UAYA 4AG5A 4TRMA 4FDLA 4WADA 1WV1A 4V3BA 4IDOA 3LUJA 4UEWA 4CI9A 4WCDA 5BWLA 2EP7A 3DYBA 2XKBA 1QMPA 2MYPA 2YMQA 2ZYWX 2ZYDA 3CUWA 3ENQA 3NFYA 3QPCA 5K6TA 4DCTA 4FFMA 3BC1A 3ZLJA 3B6EA 3O38A 5A5FA 5IFKA 3EW7A 1V11B 1CUFA 2X0JA 1J0BA 2MIIA 4JSTA 4M0DA 2VXOA 1GO2A 1DG9A 4GP9A 4ECAA 1U1EA 1DAKA 2FLVA 2PSHA 4TKMA 4F46A 3AVXA 2PUVA 2BUAA 4OLJA 5JYDA 2GYUA 1BEZA 1Z68A 2VOEA 4KNVA 4OHUA 5F3DA 1UFKA 3U17A 2F17A 1OROA 1VBNA 3ZDEA 1XCGB 3AEUA 1IMJA 1FFXA 2XQGA 3QI7A 4KFRA 4KE9A 1R9NA 5F51A 3KTFA 3RDPA 3V1NA 1EIWA 2TMYA 2FUNB 3TZHA 5FOQA 1E4VA 5HHTA 2CJXA 3I04A 4A0GA 4L6IA 3BICA 3S2FA 1R18A 4DFDA 3SQXA 5CB8A 1HX7A 2YQZA 3EUFA 4LMPA 4OHRA 2DLCX 2POQX 1QZXA 2GZSA 3KSZO 4TTQA 1PVVA 1AIPA 3HY3A 3MCTA 4NONA 4UZEA 3AILA 4AO6A 2NZXA 2EIHA 3HVJA 3NBZC 4UM7A 2BFBB 1DOHA 4QWMA 2WTBA 3HA3A 3L4EA 5CDFA 4YCNA 3OE4A 4COOA 4PO1A 5EWJA 1QHHA 1F2TA 2G9NA 3WXMA 4DIEA 1KIFA 3W7AA 4RL6A 2GD1O 4DJFC 2HA3A 2BJVA 2VFAA 1BMFD 5PNTA 2HEIA 1Z83A 1TTPB 4AJ2A 3D6TB 4DV2B 4QQFA 2WWFA 3LLVA 1ZRSA 3L82B 4TWIA 4RTOA 3N2LA 1W59A 1F0KA 2GPYA 2QUJA 1CP3A 1GUYA 3K9HA 2H4XA 3KVOA 3GQBB 4LCBA 3UYLA 2CKMA 2R6HA 5DCWA 8OHMA 4BY9E 4ZV9A 5K6RA 2J6BA 3CINA 5ULLA 3FHOA 4OBXA 4MWGA 3UMYA 3QVGA 5EJ5A 3R3UA 4IZIA 3WLKX 4FB5A 4HEA6 3IP5A 1HT0A 3JU3A 3JSAA 1ZCZA 3WLQA 4E2FA 2AZDA 1C9YA 2AN5A 2LCIA 2IVFA 4TYNA 2QZZA 1K75A 3G2LA 4HDMB 5TT0A 3WX0A 3RTAA 3KX2A 3SCZA 2WVHA 2CL0X 1IEXA 2GTIA 2QYOA 4GI5A 3SBDA 4H27A 4DEVA 5J4KA 4IFBA 1EFHA 3RODA 5EYPB 1C30B 3BWXA 3NNNA 4P7KA 1Q95A 2ZU0C 1EB9A 1KTVA 1THZA 2RHDA 3OURA 5AW3A 4QBGB 1TA0A 3F3KA 4F11A 3NBAA 3V1YA 1J21A 4RACA 3VR2D 2AI3A 3CUKA 1P9WA 3CWZA 1LPAB 3L7YA 2C8JA 3LO5A 3WGJA 1HFWA 2J3MA 3AT1A 1YHZA 1Z8HA 3B1YA 1P2FA 1O5IA 4WXYB 2PJDA 3L8HA 3ZZNA 2D5BA 1Y4ZA 5I9MA 5A04A 4RHEA 1QOZA 2QYTA 1UR5A 3DOCA 1SXGA 3EIWA 4B43A 4UBLA 1AO3A 1QVAA 1OQAA 1JEYA 1MX9A 1FEZA 2JFWA 4L8LA 3ZI4A 4CL3A 3A4IA 4EK9A 3DO8A 1H4VB 2WKPA 5EMHA 4EJ6A 1U7HA 2QTVB 5ALVA 3L6EA 4HDRA 4KCGA 1QV9A 2EDCA 3LWNA 3T3HA 4E5NA 3EQ9A 3ABRB 2KB0A 3H1TA 3UMRA 4NFSA 1VCIA 3UJPA 1JIUA 2D2IA 1M2HA 1PI3A 3ZXXA 4V0LA 4MVJP 5KAMA 1G6HA 2Y1EA 3DG9A 3E3AA 5EHZA 4LC9A 3CRVA 4HNGA 2L19A 4LN1A 1JB1A 3L8FA 4KGDA 4RA6B 1F4VA 1Z82A 2G5GX 2PMBA 3HUTA 5ES4B 2ZSEA 1TVEA 3WGOA 2EQBA 3M6AA 3DLCA 2V6MA 4YJGB 4HAIA 1T4BA 3K1AA 2EYUA 3RSFA 2WAOA 3PC7A 2ZKLA 3HCRA 1TFRA 4MLCA 5DYIA 3SZMA 1E1NA 1JF8A 1MB0A 2EBUA 5ERXA 1JV2B 2IX9A 1VPDA 2CLDX 3L6BA 4NEHB 4DA7A 1UBEA 1QHGA 4I5IA 5IWCA 3PWSA 2QM0A 1GA6A 4RK1A 2BY4A 4KI7A 4XOUA 3RFFA 4MUGA 5IDVA 4ZO7A 1EUZA 1PGOA 1S5PA 4FUTA 3FPBA 2AKYA 4O2BB 3OFND 2VWPA 1UODA 3IQHX 4OGLA 1B41A 4DMHA 1R15A 4HNRA 1RLMA 1O1YA 4OOEA 3C97A 3EVFA 4V0RA 2OSBA 3NR2A 1ZKMA 1XV5A 1AD2A 1GPH1 5TF4A 2HR1A 4ROSA 4YRNA 3FYCA 1T4GA 1ZJ4A 2YXLA 5JDCA 1CEYA 3PUJA 4OYLA 1DPFA 2YRWA 5IVHA 1Z2PX 2C8VA 2IHTA 4M1QA 4URHA 1V9CA 1GSIA 2RHJA 3E9NA 4BKMA 1XCPA 2LIVA 4GP6A 4NFYA 3VU0A 1CQWA 2ZXUA 3JASA 3F7OA 1HT1E 5EIWA 3DUFA 3KJEA 1HWYA 1RXWA 4LXYA 1ECPA 5CA0A 3KSAC 5CPFA 2OV4A 1BKDR 2JI8A 4F1JA 2OO5A 4Z7NB 1PKEA 1IAQA 4FCCA 4Z7JA 2GWRA 4DLUA 2NUTA 4FN5A 4YAOA 5KOIA 4X24A 3D3NA 4KB5A 4BO7A 4A6PA 3MJEA 4U7TB 4R2MA 1PZHA 4AMGA 4LF6B 1T9BA 3ILXA 1QORA 5H83A 1YI0A 3JWGA 4M6WB 1QU3A 2GTHA 3GPDG 2VKQA 4R1SA 5FEMA 4XX1A 4KPYA 3H1PA 1E1LA 1SMKA 2CBGA 3BF8A 4EYOA 3W2TA 2QNIA 1LWNA 1NI3A 5KTYA 3ZHCA 1UT5A 1QFZA 2ADOA 3CX3A 4IWYA 3WSWA 1YDEA 4B46A 3C5WP 2NUAA 2XYGA 4LJYA 1FFHA 2OFPA 3ZVRA 5ISMA 2DECA 4KEAA 4QYWA 2CYAA 2I87A 2GN6A 4HXGA 1Q1BA 2BLLA 4X8MA 4BRWA 4A73A 3Q2IA 3V48A 3OHMA 5BR8B 5BN5B 1ZY2A 1QHNA 2WF6A 3CZ4A 1GG9A 3QHQA 1WXQA 5A4JA 4AJ9A 5JXGA 1LDEA 5FL3A 1IDN1 4JYCA 5JLAA 4AO7A 1MH9A 2AOXA 4L8VA 3WK9A 2JPDA 1HLPA 2ZQYA 3LPDA 1U8CB 2EEPA 2X3UA 2ZRLA 4II7A 5AM3A 3OWHA 3EDRA 3E9RA 4Q39A 7YASA 2VDOB 3PCTA 2HDHA 4DV3B 1K88A 2CB9A 2Q1SA 2RHHA 5AUPB 3T7RA 2YXNA 4NBUA 5DK6A 3Q3JB 1U2QA 3EGXA 3WI7A 3EVDA 1C0PA 1JALA 4WXHA 3MQ2A 2VJMB 3DHEA 4L5IA 1F9AA 3RO7A 4FR2A 2B7CA 5F1OA 1X13A 2HA7A 1X6VA 3HJTA 3I2FA 2J30A 4S1VA 3EQ6A 4YA6A 4F9GA 4JI1B 3OA2A 4FP9A 5FWYA 4KR3A 1E79D 1K6EA 1SU7A 1VECA 2WTXA 1W85B 3MINB 4NG5A 3CLUD 5FTMA 3K0CA 4UU0A 5FF9A 4QLAA 3PR2B 4IUBS 3VKFA 1XROA 1UZNA 2O8FB 2LDBA 5F7OA 4U6SA 1WMAA 3I6IA 4BV8A 2GZMA 1Y7IA 1XYYA 1ODIA 1YS1X 2Y1CA 5DXAA 1MJGA 3KJXA 4LYYA 4ZZ0A 2VQFB 1LBHA 2Q3LA 3GJXC 1SQGA 2VP3A 4GGOA 3F4BA 2VJLA 2C2ZA 3T38A 2YS7A 2J08A 1FNBA 2HC9A 2Y76A 3U4HA 2ZB7A 1XSEA 2GZ1A 3HSYA 1Z45A 1JJIA 1OJ7A 5T8KC 1TEHA 5C0OE 2GN1A 3C8HA 4KIJA 5IDXA 3A6FA 4NMLA 3AY0A 4K9RA 4ZQFA 3TR0A 3UK1A 3HCOA 3X1WA 3DXZA 4BRSA 1UKCA 1JRLA 3NTRA 3K6KA 5DX1A 5KQRA 3LHSA 3HTXA 1V8BA 1QF7A 2B78A 2NADA 3N70A 1M1YA 1CUWA 3NWPA 3KKLA 3PFWO 2HZBA 2DLNA 3QFRA 4NI5A 4OJTA 4R5HA 1TIBA 3UWDA 3V8VA 5K3SA 3ZGNA 3AI1A 1KY3A 2COKA 3R6GA 1GG8A 4IIDA 1MDBA 3AR8A 3WIBA 1XHEA 2I62A 4AW9A 3IHKA 5ER6A 4NR0A 4H6WA 1HG1A 3H5LA 1NHWA 1NW5A 1E2JA 4BMNA 3NM4A 1Y3FE 3LUCA 2G88A 3NKFA 5DSTA 3FOWA 1NIPA 1C0EA 4AI6A 4I1RA 4YYEA 1RRGA 3ZU2A 3BIJA 4U7GA 1I4LD 4EITA 2GKGA 5KQGA 3TGWA 2PMKA 3DKIA 5L3SB 3JRWA 3G0GA 1AMUA 2HJGA 4JLKA 3GEIA 2NSHA 4OJNA 2X1VA 1JLLB 5BOSB 4HVAA 3FDXA 5BT8A 1WNFA 1Z16A 2HDWA 4IVPA 2RMKA 5JHGB 2PY6A 2ET6A 1GRRA 1ZOPA 4HGYA 1ISSA 1C9MA 1HL3A 1K7FB 2XZDA 2WKQA 3BTSA 5KB3A 3PPWA 4LV6A 3H05A 5LYJA 4I81A 5A2GA 1XQYA 3KFVA 1SULA 3ZWXA 5JRZA 1G20A 3CCFA 1ATZA 1NNI1 3QKSA 2DETA 2X0EA 1QWOA 3R9KA 2W0SA 1TM2A 2UVPB 5F1YA 4F3RA 2JGFA 3QVUA 1FNNA 5EMJA 2FN3A 2ZYGA 1C0IA 4G85A 4Q12A 5I47A 3N39C 1MRSA 5A02A 2D3WA 4JEMA 4URFA 5J23A 3U56A 2AJTA 1RJ9A 1LW6E 3T0GA 2MINA 4MHOA 3RH0A 5LD2C 3W6PA 5CHYA 1C8VB 3JQCA 2P30A 3LT5A 1YB7A 1BJTA 2WIDA 1CWUA 1VPWA 2AKAB 3I9LA 1HBJA 3C45A 3HB5X 5GINE 1T2CA 1M76A 2JBHA 2TYSB 3FSEA 4MW7A 3RAGA 1T2VA 2W2LA 4CG1A 3KLPX 5J2TA 1Y9DA 2WV7A 1C3OA 4M8SA 4Y0VA 3G68A 2HADA 2JH8A 1SURA 5HG0A 4AZWA 4E88A 3C98A 4JWTA 3EPKA 3GJ0A 5AK4A 3X2FA 3VKGA 2R25B 4DILA 5FWNA 5GZ6A 3TW0A 2D0PB 4BMCA 2PX0A 3T99A 3O74A 4XVUA 3A3NA 1A7KA 1Y9ZA 2QL6A 2C5SA 4HHEA 4JKIA 4TQGA 1WUTA 1YGYA 2G8NA 1XALA 3IULA 4JN6B 4DF3A 4Q4DA 4BNUA 2FX5A 1RMQA 4BVHA 4TX1A 1GNRA 3DF7A 1W0KD 3EQ2A 1VL6A 2JAQA 4K6CA 4KI0A 3B5IA 5CW1A 3RARA 3KQHA 4XGRA 4B85A 2JJMA 4EP1A 3I6YA 1I4DD 1K3FA 1T9HA 1RPNA 3T3MB 2W6ZA 3CMCO 1YZLA 3TZCA 2FEOA 5T6MA 3CCBA 1MC4A 4TTSA 1N6RA 4US2R 2HBQA 1OXMA 3F8TA 3IAEA 4J0FA 4ZP1A 4P3YA 2EKZA 2B98A 4L8FA 3VZRA 2GXAA 1RHUA 3SVZA 2OXEA 2VYQA 2OL4A 4OY3A 5FLYA 1GPYA 3PNBA 4QGBA 1WUHS 2AXEA 2HXSA 3LXRA 3R6LA 4XYMA 1HDGO 3GEMA 4RULA 1VI6A 2D62A 2YHUA 4IOMA 2OBBA 2VBGA 1Y37A 1JL3A 4LDZA 4IIJF 5ITZB 4LHYA 2IXEA 2NO6A 5LZ2A 4M0PA 3ZJTA 1T8PA 2ZT5A 3CNBA 1AA9A 3L8DA 3CX8A 1OTHA 1YIAA 2EQ5A 4ZRNA 1P1IA 3SIRA 4PG8A 2AOUB 1WZ2A 4GPZA 2QGNA 4MVJH 4RJJA 2GKOA 2N47A 3OICA 4F97A 2PZGA 3EGDB 3LWZA 5EHNA 4OLFA 3L0PA 3CRMA 3L77A 3DGFC 3K8OE 4FKMA 5AD1A 4E09A 4WESA 3S5JA 1DUIA 1L7VC 2IEGA 2PANA 3R3XA 4S1WA 4RNDB 4TZ0A 2C9YA 2NTNA 3AB3A 4PFKA 1RRCA 1QPGA 1E99A 2W6JA 1V4VA 3VKHA 1XJQA 4HQLA 3SHFA 4Z4HA 5HPYB 1YZQA 2W0MA 4MS3B 4G3XA 1UBRS 1QE3A 1PJAA 4G4SO 1HORA 3SYKA 4K28A 5AJTA 1RC1A 4D8VA 2I66A 4PX5A 1DHRA 3RU7A 3H2IA 3PNOA 4DSOA 2O8CA 3TPCA 3UHJA 1CIPA 4ATNA 2JH3A 4QAJA 4PNZA 3DOOA 2X0DA 1U0BB 2NT3A 1CW2B 5AVQA 3AHIA 1V1JA 4Q7EA 221PA 3E7FA 3OJ0A 4NWIA 3C3JA 3GW8A 2HAEA 4GLJA 1M2NA 3JATA 3VTZA 2R4TA 3H84A 3NBQA 5L7YA 3F1KA 4PSVA 5DIFA 3BQ9A 4A27A 3D43A 5ICMA 1KQGA 1HSOA 1QGUB 3S2EA 3BK2A 4P98A 1T5IA 3CNHA 3DAGA 3IC5A 5FA8A 1Y1RA 5A7GA 2XZOA 2EZ9A 1DEKA 1TECE 1D4ZA 1JZQA 1SBTA 3GPIA 1SJ9A 3E22A 4ILKA 3OQOA 3HDJA 3HCBA 3KV3O 4IG9A 4WKGA 1JG3A 3QTBA 4JOSA 2JATA 3DWFA 3ZU5A 3M33A 3GJRA 1ODLA 5ITWA 4GXQA 3PEFA 2FUEA 4DQLA 4IFIA 3L92A 2YL2A 2PM8A 3S7TA 3I2YX 3FTPA 4PZ9A 3VYVA 3QEBZ 2C31A 2BGMA 2GPAA 2PNJA 5LMCA 4Y6GB 3U26A 3ZY5A 4UZFA 3WWYA 3OIFA 1X1DA 4Z4FA 4MTCA 3R77A 1RFGE 4MPPA 1EXNA 3W2IA 1IVSA 4Z3KA 2Q8PA 1N1EA 2MWMA 1KS2A 3HUFA 4D2IA 2QN9A 3ZWYA 1VYUA 1RAAA 1X1AA 1BVUA 5EZYA 5ICFA 2XRMA 1MABA 3LK6A 1T26A 1W4RA 3G5MA 3SR0A 4QTXA 1G3MA 1PFQA 4B7CA 2IEDA 4BGEA 1MW9X 1QFXA 2PCJA 1Y8QB 5K05A 1E9DA 1L8QA 1X74A 3EULA 2JDID 3PFBA 5IEJA 4MUXA 4RLSA 4IHJF 3KE9A 1N7JA 2IHVA 4RZXA 1XEWY 3EXFB 4TQAA 5D8DA 2GS9A 2XKAA 2XMBA 2C3MA 3AEXA 5FYDA 1JIJA 2PS9A 2EKQA 2WUFA 5CDGA 3MJDA 3OQHA 4EG3A 2VVTA 4M8NE 4NK5A 1QRUA 2ZG6A 4JXZA 3MQ4A 3DEZA 5DHUA 1FX0B 3SMQA 2BKUA 2NACA 3RANA 2IY7A 4DBLE 4LVUA 1RWKA 3EHDA 5E7QA 4FM9A 1Y5MA 2JKZA 2WINI 4QU0A 1E2HA 5D3MB 1G2IA 3ICWA 5E38A 1E9BA 4FSXA 6ADHA 4BVKA 1O54A 1DBVO 1V6SA 2ZIFA 1PR9A 3QKUA 4OB8A 5DWQA 2VSOA 3QF7A 5TEWA 3H5NA 3SDSA 4RIHA 1UWLA 4D80A 3CTMA 3L7AA 4PYKA 4DCVA 2QRMA 4YRIA 5ALOA 1P6XA 4DSTA 3CH7A 1H9AA 3V4VB 2BTOA 2CCJA 1PUXA 3C3YA 2VDRB 1J2JA 3DDSA 4HVTA 5F73A 1ZI6A 4O25A 1RR6A 1FL9A 4CCAA 5K6AA 4QRIA 3OC6A 4D1YA 2D7DA 5HCUA 3WSTA 4DJ5X 2PH7A 4NHEA 2PVCA 2Y1KA 5BP7A 4LSMA 4IICA 3ZDYB 4E33A 2AB0A 4JXKA 3CS3A 1RCFA 2GN4A 3HR8A 3T7JA 1MF7A 1IXSB 2QVBA 2WFLA 2I4OA 3ANYB 3WL4A 3BK7A 3NRJA 3TH5A 4B0PA 1DG1G 2HCJB 3AXTA 3D7LA 4L02A 1BU5A 9LDBA 1TTQB 3AJAA 4NEQA 3D4PA 5DHAA 1FQJA 3NPMA 3PXUA 3GN2A 1RXUA 1JR6A 4X71A 5ALDA 1TO6A 2AFIB 3HA5A 4LOHA 3SF8A 1G5HA 4LGCA 1PGJA 2JCXA 4X41A 4GX1A 1NA5A 1XTZA 3WRWA 1IYZA 1XB2A 4TM8A 2X8LA 4ARUA 4G5XA 3IEPA 1YZGA 5AKKA 3BIXA 5BNIA 5GZ3A 3VZBA 5IDQA 4YRRA 3WYDA 4Q66C 4AN1A 3BH6A 1N7GA 3UXYA 2JRCA 3SD7A 1M6EX 3VR5A 3NJ8A 5E6UB 4FYHA 1OXKB 4JBGA 4DIOA 1PFUA 2XMDA 1UMCB 4XA8A 4P22A 1YA4A 2O20A 2FEWB 3JQAA 4YRDA 3WE7A 4C7XA 1NQTA 2J6HA 3LQRA 1LH0A 2RK6A 4AKHA 2D1RA 5E6SB 2AJDA 3KT6A 2QYHA 3IR6A 4A91A 1YBAA 3ZZ0A 1XAIA 1WPQA 5KTPA 1G21B 3KOWA 1BD4A 1EFKA 1IIBA 2LNDA 2QPTA 4FGLA 4Y2UA 1CRPA 2FZWA 3LW7A 1RSZA 2LTAA 2HBYA 2OCAA 1C7FA 2AXNA 3ACBA 2YWFA 5LJLA 3G79A 2R9VA 1M6WA 4EGSA 1NMSA 1XTBA 2OORA 3CN9A 4FILA 4PZUA 4UAVA 3U4AA 5BVGB 1Z75A 4AUNA 3FYUA 1GTJ1 1TKAA 2OBNA 5IARA 4Z4GA 4W5TA 4F4JA 2W6PA 1B2LA 5AXAA 2H1SA 2RGYA 3S27A 4BO2A 5JH7A 1W2GA 2HMVA 1TJYA 3QUQA 4IYJA 1W47A 2QQEA 2HLDA 4O0MA 1G1AA 3QKRB 1ZONA 4ND1A 4L7QA 2HNKA 4I55A 3KKZA 4ZREA 3E9YA 3SX0A 4ZI7A 1A5SB 1J2UA 1KETA 4A9AA 2A0UA 4G9EA 3QU7A 1VB3A 3SVTA 4HPXB 1E6KA 3LC1O 3BHMA 1BCSA 5DBEX 3NJRA 4PWYA 2XECA 1U9IC 3RS8A 3LZDA 1FK8A 5JAQA 2Z30A 1XU9A 5MHTA 1Q50A 4QPDA 5HFNA 3TECE 4HSGA 1BX3A 2C9OA 2QL9A 2ZVQX 3KSRA 2PJRA 2Z08A 5DSXA 2CT8A 3V3TA 1IB0A 2EU8A 1E9SA 5DPMA 3THWA 2BR5A 3EXEA 2CXQA 3SFVA 3JS5A 4HQFA 4FZRA 4RQUA 2RCNA 4GXTA 4JT8A 4RVHA 4MKIA 4JHXA 1I3KA 1GUDA 1O4VA 3DKPA 5HJ2A 2OQ2A 4X84A 4AO8A 1OLSA 2C9DA 1Q7CA 4RKYA 2BV3A 3EZ6A 4C4OA 2OV6A 3H2ZA 4F93B 1NAIA 1WULS 1J2YA 4IIEA 4DC9A 3R8FA 3RRBA 4DT1A 2HMSA 2JASA 1JHDA 3KVYA 3SNKA 1DQPA 4KX5A 1EE9A 3EC2A 121PA 2I4LA 3OP4A 4TTJA 4R7GA 2H1FA 2Q1WA 1B0ZA 2WWTA 1ABFA 1W5AA 3EF1A 1AE1A 2PL9A 4M99A 3KU4A 5DLEA 3D8BA 5K3FB 1OREA 1DDIA 3C74A 1RHQA 2VCYA 1IM5A 4BX0A 3CYFA 3GC6A 4NYIR 4MR9B 1GNLA 1JJFA 1B73A 3EBOA 2OORC 2J0QA 3QKWA 6REQA 1WDLA 1PLKA 5DMHA 1SVNA 2NTYC 3MILA 3FJOA 2P7IA 1S89A 1OZ0A 3D2AA 5IABA 1IHUA 1PGQA 3FN4A 2VUHB 5C8DA 2YZKA 1YFJA 1Z36A 3R0JA 3WICA 1JYFA 2WWVD 5KC8A 2I7VA 4W9MC 2P9BA 4PCAA 4LIPD 2PUJA 3KYJB 3T9EA 3TBFA 5CXUA 5JATA 4BLPA 4PYRA 2I71A 3IO5A 2MSDB 3MAGA 3PGXA 4CKBA 4RF4A 5FPHA 3J7AC 4KQCA 3JYHA 1GT91 1KARA 3HUUA 4QTUB 1LBIA 3WIUA 2Q2WA 5JNVA 5K3OA 4JSYA 1GWNA 1QCDA 1QUFA 1V3QE 1V5FA 2QDXA 1MMFB 3AIIA 4ZOBA 4A0RA 2JIDA 5ESWA 4Y6OA 5E0KB 2A1TS 3TUJC 2C9ZA 4KX3A 1ZXXA 3H87A 4M3NA 3CKKA 3GH1A 3S68A 1ISJA 5FUYA 4WBSA 3ZTWA 1H05A 4BB9A 4L50A 1E0DA 1SR8A 3ZI0A 4JLNA 1RM4A 1SFRA 2WMNB 3DMPA 3FYHA 3WOHA 4DNQA 4DWVA 1Z0UA 1M1YE 5FIUA 2J9FA 1DV1A 5BW5A 1BSVA 3NHZA 4KQFA 3LP6A 4EYEA 5BUSA 5A9RA 2AA3A 1I33A 1NASA 3RCBA 4GM0A 1JWLA 3OI7A 2KPOA 1UJBA 2A9PA 4UBNA 1ZRHA 1GZHB 1IBCA 1UIMA 2WU1A 3FETA 3RS3A 1R10A 4AP6A 1ZUWA 5LFAA 4G5OA 3RJ5A 4EB0A 2DR2A 3OZ7A 4OA5A 1EBUA 4OXXA 3CLRC 4AZ3B 3P0RA 4MKZA 2YMLA 3KYBA 4WTOA 4H17A 1OBHA 4M1ZA 1Q77A 3WLAA 5I9IA 2P40A 2W6OA