1Y1QA

Crystal structure of the uridine phosphorylase from salmonella typhimurium in complex with uridine-5p-monophosphate and sulfate ion at 2.35a resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
250
structure length
250
Chain Sequence
b'SDVFHLGLTKNDLQGAQLAIVPGDPERVEKIAALMDKPVKLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPMEFPAVADFACTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRRFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uridine phosphorylase
publication title Crystal Structures of Salmonella Typhimurium Uridine Phosphorylase in Native and Three Complexes Forms - with Uridine, Uracil and Sulfate.
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 78
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y1qA00
5KB3A 3ENZA 1FXUA 5IU6A 1SJ9A 1YQQA 2IQ5A 4GMHA 1NW4A 2QDKA 3ODGA 2OC9A 3EUEA 3LGSA 3E0QA 3FWPA 3FUCA 4LKRA 1NC3A 1A69A 1RR6A 1OU4A 3NBQA 3GGSA 4TTIA 4E1VA 1Z5NA 2A0YA 2ON6A 2HSWA 4BMXA 1JDUA 3E9RA 3KU4A 1PR5A 4L6IA 1I80A 4YO8A 2OC4A 4UC0A 1RSZA 4MCHA 4TXJA 2AI2A 1Z36A 4QAQA 4QARA 1YQUA 1JDZA 4TS3A 3PHCA 5F7XA 3SCZA 4NS1A 3T94A 1PR2A 1U1EA 1NC1A 4DAOA 1V41E 1CG6A 5EFOA 4K6OA 4M1EA 3FB1A 3UAXA 3GB9A 3OOHA 1VHWA 1Y6QA 2PGAA 5F7ZA 3DP9A 1JDTA 1Y6RA 4QEZA 3U40A 3NM6B 4QATA 5F73A 1PKEA 1YBFA 3BSFA 1Z5OA 4IP0A 1B8OA 1T8WA 4TXNA 1SQ6A 4L5YA 1RT9A 1Z37A 3MMSA 1OVGA 1Z39A 4LNAA 2A0XA 1Z34A 3UT6A 1RYZA 5F7OA 5F78A 4OGKA 4PR3A 1V2HE 3FAZA 2H8GA 3INYA 3F8WA 4DANA 3UAVA 2QTGA 1V4NA 4TYMA 3FOWA 3DJFA 4QFBA 3DPSA 3P0EA 1RXYA 3O4VA 4D8VA 1T8SA 1PR0A 4R31A 4DARA 1ODKA 3OCCA 1PK9A 3DF9A 5C80A 1ECPA 4OY3A 2A0WA 3IOMA 1VMKA 1U1FA 1U1CA 5DK6A 2P4SA 1A9SA 3K8QA 2OXFA 3P0FA 3KVYA 3OOEA 3ONVA 1Z33A 5JPCA 4YNBA 3C74A 2QPLA 3LA8A 4L5AA 4DA6A 2BSXA 4WKBA 4DA0A 1RFGE 1ULBA 4LNHA 1PWYE 2RJ3A 1V48A 1OTYA 1C3XA 4BMZA 3TL6A 1Y1TA 1TCVA 1A9OA 5CCDA 4H1TA 4DAEA 4I2VA 4DA8A 4WKCA 5B7NA 1WTAA 2HRDA 1A9TA 1Y1QA 2ISCA 3OZEA 3D1VA 3PNSA 1Z5PA 4PNPA 2AI1A 1PK7A 1TCUA 1JDVA 1OTXA 1PF7E 5CCEA 1ODIA 1Q1GA 4TXMA 4TXLA 1ZL2A 1JDSA 3BGSA 1U1GA 1RCTE 5FAKA 1VHJA 4DA7A 3PHBE 4MARA 1OV6A 2B94A 3BJEA 4TS9A 3IEXA 4RJ2A 4G8JA 5F77A 2HWUA 1Z35A 1Z38A 1JE1A 3OF3A 4DABA 1K3FA 5I3CA 1ODLA 4F3KA 3MB8A 3EEIA 1JP7A 1ZOSA 4NY1A 4MCIA 3EUFA 1QE5A 5F76A 1TGYA 4GKAA 4M3NA 1A9RA 2XRFA 4LDNA 4L5CA 4BMYA 1V45E 3OZDA 4YMLA 5CYFA 4WKOA 1SD2A 3NM4A 3K8OE 2QSUA 4U2KA 4WKNA 1VFNA 5B7PA 4QASA 1ULAA 3DDOA 4OF4A 1T8RA 2AI3A 4G89A 2OECA 4F3CA 3KVRA 5B7GA 5F7JA 3UAYA 4OJTA 1B8NA 3KUKA 1Y1RA 3NM5A 1YRYE 3OPVA 2GUWA 4NSNA 1PR4A 5K1ZA 4EB8A 1RXCA 3PNPA 4TTAA 1K27A 4OEHA 4R2XA 2Q7OE 1PR6A 5IFKA 5EPUA 4G41A 4TTJA 2QTTA 4JWTA 4FFSA 4GLFA 1LVUA 1TGVA 4F2WA 2HN9A 1LX7A 4P54A 5CXQA 1A9PA 4X24A 1XE3A 3O6VA 4M7WA 3KVVA 4L0MA 3OZCA 4ECEA 3KHSA 4KN5A 4JOSA 4D8YA 3EMVA 4EARA 1T8YA 1TD1A 1M73E 1ODJA 4D8XA 1RXSA 4F2PA 5EUBA 3OZBA 1JE0A 3BL6A 3E9ZA 4R2WA 1N3IA 4GLJA 4JP5A 1PW7A 2A8YA 4LZWA 1JPVA 4D98A 5ETJA 4F1WA 1T0UA 1Y1SA 1G2OA 1YR3A 1PR1A 3LBAA 1JYSA 2AC7A 5CYGA 1LV8A 4BN0A 3UAWA 1RXUA 4WKPA 3UAZA 4YJKA 1V3QE 4D9HA 1U1DA 5CXSA 1SD1A 2I8AA 1OUMA 5B7QA 3FNQA 4TXHA 1K9SA 1PBNA 1CB0A 2I4TA 4OGLA 1A9QA 3QPBA
chains in the Genus database with same CATH superfamily
1W29A 3B3FA 4H6XA 1V1RA 3M6UA 3FTCA 5H1YA 3VR6D 5C8VA 4BYMA 4X62B 5CH8A 3WIVA 4BU0A 5E6SB 1U7WA 1AHHA 3W8DA 3HJHA 4KBYA 1T0BA 2FSSA 5ENDA 1F7VA 4DR4B 2NSYA 2O3UA 3CJRA 3I30X 1JXAA 1HE8B 1P9NA 4UTVA 3FUCA 1T2AA 1NBME 4XUDA 3U9TA 3FOBA 2J0QA 1D4AA 4EJFA 1GNSA 2I3DA 1PZEA 2IPLA 4IGKA 4RS4A 2OBYA 2X3YA 3PUIA 4DADA 1XZLA 3BXGA 3U3RA 1GZ6A 4YR7A 5J47A 3VUFA 1BFDA 4D1YA 3W5AA 1Q92A 3H11B 1AUVA 1F20A 3I6ZA 3VOTA 5ELXA 3GLFB 1NXPA 2JEOA 2Q6KA 3HJRA 1ZJ4A 1P7WA 3F9CA 1M67A 4JT4A 3IAUA 4L9SA 2IPMA 1U0RA 3M70A 4ZV9A 4LWQA 4AJ1A 4BNDA 2ZTSA 2JKVA 3KKOA 2WTXA 3P9RA 4HBZA 1QDUA 4AWXA 3CC8A 4C3ZA 3PUHA 5KUTA 3CZMA 3FRIA 1EJ0A 1WY5A 4QJ3A 1DXQA 4ZU6X 3MHTA 3GJ4A 2WZCA 4C7VA 1S1MA 4MJ3A 3KU4A 1UCFA 2QN2A 3KL2A 3AY6A 1QRDA 3QM1A 4EO9A 3OPMA 2BEVB 4IIDA 2WBLC 1A50B 1JAHA 4DQ0A 2REXB 2DKFA 3OJOA 5DXAA 1QR6A 1E7WA 1F14A 2ESRA 3HUFA 4LWPA 3R1IA 5IKEA 1YZ3A 2P4UA 3SAJA 4E7PA 2WUEA 3LPMA 2HL6A 2AOTA 4PGFA 3T3PB 3TI7A 3OAAD 3L8GA 1L1RA 3UK2A 5KVAA 2XCRB 4KPUA 1U1EA 4K81B 2TSYB 4G5FA 3X2EA 3HBLA 1G63A 1SUFA 2E3JA 3W2FA 1S2DA 3IULA 1N3LA 2Q5IA 4AZSA 5CURA 2WVAA 3KPVA 2OLJA 2BEWA 4EHLA 2BDEA 3K70C 3DLHA 1XYGA 2A5DA 4GPBA 4AJ2A 3PPVA 4X45A 1DBQA 1P73A 5GM1A 2PS3A 5F7ZA 4I4TB 4UBIA 3OX2A 3TW6A 5BV7A 3QOWA 1YMVA 5JCJD 1IOVA 3JATA 3N2LA 4ZDIA 3SGLA 2AV6A 3NM6B 3BB4A 2OV4A 4KPEC 1XPJA 4E70A 1LPSA 3RT9A 1O08A 4W9NA 5TQ0B 1K6IA 4EKYA 4COKA 4M83A 1JEAA 4LGCA 4QA9A 3BSFA 1P4SA 3F4LA 3JX9A 4I4IA 4R1UA 4I5EA 5HW0A 4OHKA 2B4AA 4OXKA 1IUNA 1QO0A 3AMVA 1ZN8A 3A6JA 2JJ2A 1U3CA 4HH0A 1RRVA 2QRKA 4O0MA 1RFLA 5BSVA 4YRQA 5KNBD 2Q5FA 1JL3A 2N1BA 3ITDA 3HDQA 2IA5A 3G23A 5AI8A 3TR5A 5K3EA 1H6BA 1YR9A 4KLNA 4HH3C 1CETA 2CVHA 2Q0SA 1GSOA 3L5KA 4NPHA 3IPRA 4PYJA 4IDDA 4JC0A 5E6UB 4MB0A 1LPMA 2OAP1 4JBYA 4HNRA 2A0XA 2GBLA 1MRNA 4JELA 3VC1A 3G49A 4Q3AA 2RFLA 1P2DA 4MVJD 1T1SA 1P39A 2BGGA 5BO5A 4Y30A 1EGQA 3LQKA 3ZE6A 1PBTA 2XIQA 3FYHA 1VXRA 3ZXIA 3ZKWA 1RWXA 2GD0A 1XZHA 1OV4A 1ZK0A 2C5AA 2GFQA 3TQCA 4RD0A 4YP0A 2CVQA 3F3YA 4JLKA 4X00A 3UB4A 2IOQA 4QUEA 1W6RA 2DP4E 3W9BA 1UJ2A 2G8NA 3PDCA 1UKVY 1J9ZA 1HOXA 1X1RA 1DJPA 1MJGM 3EQ8A 4UD2A 5LQMA 3VR5D 3P2JA 2QMEA 4NYMR 4ICIA 1NVWQ 3VYUB 3ZLUA 3DJFA 4FE4A 3N05A 3OHPA 2ECKA 4ZT3A 3ZLTA 2FZGA 2PSJA 3ETGA 2WSLA 4AMYA 3M1AA 4CVNA 3DAOA 3ERCA 3UXHA 2FPPA 2HCFA 5CB0A 1GPH1 4CU2A 2DRIA 3WGLA 2QLMA 3D8HA 1J8YF 1KWKA 2Z83A 4TWJA 1P7YA 2YDXA 3LWZA 3MINA 5H4HA 3ZHXA 5FWYB 3AEUB 2DHEA 3TMAA 4JEIA 4OY3A 2JI6A 1P44A 1QLJA 1KYIA 4ZYZA 2A0WA 1CY8A 4Z9FA 4DNOA 4S1PA 1AQ6A 3PQ2A 4C5CA 4DUZB 2UZ3A 3BXEA 3F7MA 3AHHA 3NTUA 2C8KA 2ZI6A 4JLMA 2ZBFA 4YT4A 5CIYA 2I34A 1VG0B 3L7OA 2P9TA 2FPLA 4PPQA 4DFDA 4J0CA 4JP2A 3FSGD 1BW9A 4CNBA 1T91A 2OAEA 1G19A 4FYWA 3N2KB 1IZ9A 4IDEA 1P7CA 2O7RA 1JQBA 3NOXA 4AICA 1FMFA 3JQBC 1ZH4A 3I83A 1GYPA 2I4LA 4PTYA 5AW7A 3T3OA 1ZZGA 3M6MD 2BFPA 2BBOA 1Z8DA 4AUEA 3KCNA 3QF7A 1PG2A 4H3KB 1E0DA 3J7TA 4M8NE 1LLQA 4PYNA 4B3DA 4EYEA 3BIWA 1I5RA 3DEFA 2R0QC 2GCEA 1KO5A 2DQZA 4G8BA 5E2IA 1YTUA 1TQ6A 5EA2A 5JATA 1IBSA 1IWOA 1ZQ9A 4JENA 4RCYA 5CNMA 1Q22A 4YGXB 1ULBA 4BJ6A 4DA0A 1LI5A 1M1YB 3EGCA 4QLAA 4GYWA 1EFUA 5I7UA 1XEAA 2G5CA 1F6BA 2ZXEA 1SG0A 4IWNA 4D6XA 2W2LD 1DEKA 4OAOA 4BFCA 4YUAA 4JJFA 5K6AA 4S2EA 2XI4A 2BFCB 1NI4B 2O3JA 4MKGA 3GAFA 4S0XA 1TMYA 5IK2D 3U60B 1KY3A 1OZAA 1GFSA 1SZPA 2DBVO 3B2EA 4INAA 4UDOA 4X1YA 3SBEA 2BHNA 1B6RA 1A9OA 2ZB8A 4CKWB 4E5MA 3IKTA 2FDCA 3VR4H 4CLRB 2ZJ6A 3NBYC 4X0EA 2Y0DA 4B8YA 4GE0A 4D44A 2XWQA 4YIHA 4I2VA 3FFTA 1KQOA 5DLEA 3TEMA 1G7CA 4F3RA 2KSQA 1LBHA 5T3UA 3TB6A 2GEJA 2XTJA 1FUKA 3DTYA 5C32A 1WKCA 2EBFX 4Q00A 4UHKA 5FOVA 4CL8A 5CDSA 3ACBA 3V7YA 4DSAA 4E4TA 4OP2A 5TF0A 3HN2A 1GPYA 5CDHA 4HNSA 1NM5C 5DNEA 3ONEA 2PO5A 4PNPA 2WAAA 4JHLA 3OM9A 4FMPA 5EMLA 3VH2A 5F9HA 3E2PA 4FDVA 2XVMA 4RSRA 3VZSA 1OT5A 1ORDA 4I8XA 3TZQA 1L7VC 3KJZA 5KQPA 3GIDA 1RQRA 2X9GA 1LRJA 3AYXB 3TB4A 2C7QA 4E21A 4QWMA 2VDMB 3AF1A 3GGDA 2BCJQ 4IHJA 4HVLA 3I0ZA 5LA6A 1KK3A 1HR0B 4CMIB 3MGKA 1U1GA 4EZEA 4GC5A 3HUEA 1E1QA 1SRQA 3KQUA 1G9XA 1G60A 4CIXA 3M4XA 5JTUA 4DKXA 1X1QA 3K0BA 1G3IA 2WWGA 2PLRA 4RHEA 3U7RA 4IGFA 4M54A 2CZCA 3E2MA 4GBMA 1E9FA 1L8AA 3PPYA 4FR2A 4CMAA 3S2IA 1W46A 3W3AA 3FPFA 4G09A 1MJGA 4FOLA 3JZAA 4URUR 1SU8A 4L4XA 2Q8PA 1XMIA 1K3FA 4MQLA 1XXHA 3B3AA 5D6OA 2AEMA 2DCUA 2XB4A 4R1OA 5DI3A 2V7UA 3PHIA 3T5CA 1EMDA 3JAWB 1QYWA 4DIOA 2X76A 4Y2SA 3UN1A 1JP7A 2PGNA 1ZIPA 2WOJA 3W6OA 5LNK1 4OQQA 4IICA 4TYNA 1M7GA 3IV7A 1U5BB 3L8CA 1ZW1A 4N12A 4TMTA 3S2YA 3MTGA 1WP9A 5DKFA 2IHKA 5AH0A 4EFMA 1I3KA 4YR9A 3RRYA 2UAGA 2PFSA 2E7ZA 2VP9A 4JI8B 1N6HA 3I53A 1P2FA 2R7NA 1N1DA 1YBHA 2OCBA 2WV9A 2TECE 3OEEA 1T2NA 1YJ8A 3P2OA 4K40A 5AVOA 4ZFNA 1SD2A 3N58A 1G291 1VL2A 1ZMRA 3TSAA 2ZBPA 5DULA 5A7HA 4EQ6A 3EDRA 4L0CA 1MV5A 1TLTA 1MB4A 2JD1A 2H1IA 1N4AA 1NBMA 3QYAA 4HAYA 4FN4A 3WWOA 3IIIA 1Z9BA 1QZ3A 5HTOA 4FYYA 1NY5A 2QVZX 4X94A 5CK5A 2IU4A 3FN4A 1BCSA 2O2IA 4BLSA 3PL5A 1AHIA 2OD9A 4GPAA 3NWPA 4D26A 4UOEA 1VZ2A 1A1VA 3M49A 2V0CA 3TAHA 1E58A 2CNWA 3FXAA 1MNQA 4KNVA 4DY6A 2PY6A 2FEMA 2ZTMA 2NUBA 3RWOA 3NV9A 4GQBA 5REQA 1CVRA 1UH5A 3CLKA 3HYLA 5EZ5A 5KYKA 3A0RB 4MS4A 4AYXA 3EMBA 4DKJA 2VT7A 2YV5A 3O1IC 3EULA 2A1TS 3TYXA 4QECA 3KYIB 1OWPA 1V16A 4TV9A 3V4LA 2QTWB 2D59A 3M33A 1Q1BA 2I6TA 3HCBA 4G5XA 4M76B 3RC2A 4B73A 4EYKA 4XVRA 1ACJA 2W00A 1ILWA 2HMUA 4RD2A 4RLSA 2UUCB 2ZATA 4KK4A 2ZYAA 3BB1A 1NXOA 1EDOA 1T15A 1U28C 2Q0HA 5AVYA 2ZW9A 1KMMA 1UXOA 3BTSA 4ZQIA 1DIRA 3Q3IA 4PCAA 2CVPA 1LRLA 4PF1A 3X1ZA 1Q14A 5AHWA 1LPAB 4EM6A 1Z2PX 3K6SB 3GRYA 3GZNA 4NJEA 3SS8A 2E6KA 5BWLA 5J5AA 3W5DA 5CT6A 1QK4A 4FJ0A 2N46A 1IBCA 3TWOA 3ESRA 2ZRJA 4DB4A 2G5GX 5FOQA 3QNMA 5DNYB 3OEWA 4F71A 3C24A 2HIGA 3L7BA 2Q3LA 1AKEA 4H7EA 3TLGA 3NWJA 2WZBA 2EBWA 1I32A 3FGOA 4ZXPA 5ECWA 1YZNA 1ZKDA 3KDAA 4JVLA 4GLFA 1KHHA 3FTFA 2OD2A 4FCVA 2RGBA 1OT3A 1WO8A 5DM1A 2VPYA 4O59O 3C48A 5CNJA 4R3UC 3I42A 1CF4A 3QVVA 1A04A 3M5DA 2Q9UA 3L9XA 1PEDA 5CFMA 2MYTA 1TNDA 4Z4QA 4NEQA 5GWXA 1SFRA 2G9QA 4EUKA 3QITA 3T0IA 1LSUA 3AUFA 3TUIC 2X1MA 4WJKB 4CIDA 1TEXA 4KIWA 3KJFA 3VHQA 3G1TA 5ALPA 2X0FA 2F90A 4IXTA 2AH5A 3I1FA 3H7IA 4BWFB 2DUNA 3A4MA 3EY9A 4OL0A 3LCUA 5CEFA 5F3RA 2ZU0C 3DBHB 3VC3A 4ETIA 4A36A 1JALA 2V5VA 1TO6A 3WB1A 2IEDA 2HDNB 3RC7A 3JVEA 4DJAA 2ZYSA 4Q9JA 4AX8A 3ND6A 4QJBA 1C4KA 3JQ6A 1E9SA 2JPDA 1TZCA 5GGXA 4L9WA 3UJNA 1DWOA 2PWBA 4EVQA 2RHDA 1HV8A 1RXSA 2OCGA 1SC6A 1AD2A 3B20A 1BGWA 3HJBA 1J99A 1FLVA 3WSTA 1QMGA 4HAIA 2Y3IA 3L6DA 1E3IA 2IYTA 3F5DA 3G82C 5DGHA 3C1OA 2BFFB 2RH4A 2EG5A 4LQCA 5FOXA 3RK4A 1NQOA 3N0RA 1QRRA 1XEWX 4FOPA 5IM4F 5JADA 2ZWMA 4KV7A 2R6GA 4OHFA 1IATA 4A91A 5KOJA 4D6YA 3I04M 8LDHA 3S8YA 4XM1A 3IEVA 2ECPA 2X8LA 5MHTA 2C2ZA 1QM5A 5JMPA 1S2GA 1RWNA 4LZWA 2Z9BA 1QGOA 1LBIA 2WMOB 4QHYA 3MWDB 2WAMA 3ZGYA 4HDOB 3T38A 3K2EA 3H1GA 2HQRA 2WFLA 4WCVA 3C6YA 5AM5A 3MB5A 1Y81A 4YV0A 4H1WA 1W30A 3EZ9A 1FLDA 4AQ7A 2WIBA 4R40A 1VJ1A 3GD5A 5F3DA 3AFHA 5IKOA 4WKPA 3UAZA 2NXJA 2F00A 3GJXC 2HMTA 4D25A 4FWTA 1RPAA 2XW6A 2J7PD 3WHLA 2A35A 3LL4A 4TMVA 3JQ9C 4HTFB 2WSBA 4OXIA 2B6NA 1OUMA 2XMPA 1RLTA 4P32A 1HQCA 4EDHA 3VNUA 1Z62A 3JD3A 2ODBA 3ZI0A 4FEAA 1L5HB 2PG3A 2JLBA 3W1VA 4NCHA 1F0NA 2I7XA 4UEWA 4GKKB 1U3TA 1JG7A 2YVAA 2JH8A 4M1OA 1X1TA 3AHDA 2FU5C 1YXMA 4OK5A 2PJRA 1AXEA 4P3YA 2QROA 1ESDA 3ANLA 2DC1A 3KBOA 3ZY4A 5JYDA 1I7DA 5BXQC 1K6EA 1IEVA 3AUYA 3QPBA 4RHYA 4FK8A 4H0FA 4HCJA 3Q7QA 3DHYA 1AO0A 1X2BA 1G5FA 1W2HA 2OYSA 1ZWLA 1PZFA 1KAOA 2NZUG 1XYVA 4M9QA 2J0UA 5B64A 2B4YA 2WYIA 1JKXA 1QPGA 4RXMA 4JDUA 4FE3A 5F4BA 2DPLA 2QN8A 3QLUC 4MROA 4ZT4A 2RKBA 1UK6A 4MZXA 5JCOA 3WC4A 3U6BA 4YP6A 4IH9A 3QV2A 4JN6B 4LYJA 3WYDA 1MVLA 1RI2A 1XUOA 3CRMA 3GMIA 3L8ZA 3MRXA 4IDGA 4IV5A 1HYGA 1SIUA 1AUXA 4S35A 4EJ2A 2X5OA 1K5PA 5GJCA 4LPSA 5DEOA 4NU0A 5G3YA 3R3JA 3TINA 1W1UA 1MABA 1GZ3A 1X86B 5BYAA 4P81A 5ITZB 1MPXA 1PWHA 1XN4A 2O8NA 2YRWA 3FJ1A 3N7TA 3NBQA 3QVSA 1AKRA 3PI7A 4MYDA 3AVUA 1PUIA 2G06A 2D5IA 4RORA 4EA8A 1RQ2A 1AO3A 1BX1A 3CRNA 1X1CA 1MFZA 3I6BA 4NYIQ 2CXNA 3AY0A 5CYOA 1UDXA 2WJ6A 4JJKA 2VTKA 5TY0A 1EXMA 3HVUA 4FFPA 3U1VA 4CN8A 2XCIA 4GW3A 1KDTA 3TDKA 1SA0A 1SB8A 1BXGA 5JZMA 2KJQA 2J5BA 3B7WA 1SHJA 4CUKA 5J4VA 1OZ0A 3ZGOA 1YC2A 2IKSA 4KI7A 1PNTA 2JGDA 1FSSA 1B00A 4F4CA 4Q9AA 1WMEA 4Y2JA 4R0NA 1CP3A 5JFOA 3TRFA 4MCHA 4AFNA 1HT3A 1ZDMA 4REMA 4YUVA 3TUZC 2XKJE 2RHTA 4XVCA 1JHUA 3AZPA 2ARKA 4LMRA 1TVKB 4CV0A 1SQFA 3ANNA 2MSDB 3CLUD 3WKBA 4LE0A 2I3BA 3PNBA 3F7TA 4FWBA 4JR1A 3UHAA 1LJUA 2NSLA 1TT5B 2F48A 1QHIA 3U4HA 5L40A 1KJQA 3KEFA 1YZKA 2BP7A 3MSCA 3PTLA 3QPCA 4HN2A 1PR2A 4Z2YA 1EX9A 3U19A 1Y33E 4N39A 5GJWC 3ZCTA 4ENPA 4JLWA 3DL7A 3I04A 5KJCA 2Y1FA 4O2BA 3ZGNA 3QE4A 4G5GA 3ZDDA 3AUUA 2IHNA 1HYHA 1NAIA 2GOYA 1N8KA 4E5NA 5IT5A 2R8EA 5EHNA 1QB8A 4UVHA 2N3ZA 5C3UA 1KS2A 2HX1A 4WLNA 3ZHRA 3N3BC 1U2GC 3H42B 2OBMA 2TS1A 1G3QA 4GI1A 3KT0A 5FTLA 5LQNA 1P3DA 3ZGLA 4NOJA 2C7PA 4OYLA 5EL0A 3TTSA 5JJCA 1EX7A 5G40A 3STUA 1PKEA 4HDRA 4KYIB 1SBZA 1SCQA 2YKGA 2GZ3A 3IQXA 2W2TA 1OAKA 2Y9PB 4MHSA 3C3KA 5HKKA 1KAGA 3CF4A 4EY5A 3U7HB 1T8WA 3D7SA 1D2MA 3EVTA 3EIFA 2GK7A 1OFTA 4YCJA 1AQLA 1PDVA 2XF8A 3R3WA 3C3EA 2UYCA 1VCIA 3KXLA 2V6FA 3U37A 3HJAA 1G1MA 1W47A 2YJGA 2GN0A 3FHJA 3TPFA 1RWOA 3QWIA 1VIVA 3DTVB 3MCUA 3OJXA 5KAMA 3R44A 5KYWB 1YOBA 4C14A 1UK8A 1Z5GA 1LLDA 4LHVA 1RLIA 4JLAA 4Z0TA 4ALKA 4Q4CA 4YT8A 1EM8A 3ZGZA 1N5IA 2GPSA 1IN7A 5A6SB 4L5IA 1Z39A 3RG2A 1AK9A 3TNFA 3KKLA 3GMDA 4XYEA 4WBNF 3ZIDA 3DOOA 3DE1X 4JOBA 3TIFA 1LH0A 1XFDA 3ZWBA 4INOA 4CQNA 5DU2A 1E77A 5FAXA 3TE6A 1RYZA 3DW1X 3G1WA 5HM8A 2WB2A 1QYRA 4F12A 2NYAA 2VYVA 4YXWA 4K2HA 1NI3A 2OEPA 4ZI7B 4ZGGA 1MTOA 3MF4A 4TWRA 3NBAA 3U4IA 4EB0A 1ORIA 1FF9A 1J09A 1Y8RA 2FMXA 3D7LA 3SF8B 2A78A 3GRRA 3O4IA 4N5MA 1NYTA 5A0TA 1W0JA 3EA4A 3N8GA 4C01A 1F8FA 2QTGA 2DWQA 3OLVA 2HBQA 3A2LA 2W2KA 2EGHA 5JNWA 3C6KA 3AC0A 3OD5A 3CLRC 3D0OA 5TLSA 1XJQA 4GX5A 5F2NA 3BMOA 1KEUA 4GM1A 5AVQA 2HIMA 4X8MA 3IUJA 3ZDXB 3K3PA 1C80A 3L04A 4XX1A 2PKRA 4P7FA 5AXCA 1FU8A 1X42A 4BVLA 4M1YA 2G71A 1RMTA 3DW3X 4YCCA 1UC9A 4HWKA 4H4EA 3KTOA 4DR3B 2X4IA 1VKRA 4BE4A 1QHHA 2UV8A 3I9V6 1UMBB 5CCXA 2PU7A 1A9SA 4IDBA 3DLTA 1QFMA 3DTNA 2W4IA 1AUPA 1L5LA 1UP4A 2BMDA 1KORA 3L3BA 3SS7X 4F2DA 3ZEIA 1OLUB 5LVAA 3QMPA 4B6OA 5A5GA 3L6BA 5EJ8A 1YVEI 1PS9A 1L3IA 4FCCA 4KGVA 4LOLA 2Q62A 2Y6VA 3OPQA 1SUEA 2XTAA 4YJHB 1Q77A 1EVEA 5A02A 1IQ0A 1NI5A 3LC7O 4NENB 5T7BA 1UMCB 4EAQA 1RLJA 4YFVA 5AWFC 1TI7A 3UK6A 2O6LA 3VI3B 3F5FA 5J58A 4MO9A 5A62A 3KKZA 4KNYA 2JAQA 4JJAA 5AOVA 1Q11A 2ADMA 2PV0A 2VR1A 4TWIA 3VOAA 1J2EA 4GOOD 1P0CA 3GLSA 4OXRA 3R7LA 4BNTA 4IOKA 4JOQA 2CB0A 4PV7A 4YAWA 5A5FA 4FHDA 1JEEA 1DNPA 3BN3A 4K9NA 1P5RA 3PXXA 2QG9A 1FL9A 3IIEA 2NTVA 3KXPA 3BWBA 1NLMA 3Q0TA 5BMVB 3WGKA 1E18A 1S9HA 1F6WA 1OASA 2FSHA 2VDQB 2ZIVB 3BBPA 4G8CA 2OBBA 1XF1A 2FN7A 1S3GA 2KBFA 3ASZA 5BSGA 3CRZA 5KYXB 121PA 5AVKA 4EB6A 4MPTA 5J1SB 3I6QA 3ZU5A 3KXKA 3ZZNA 2VJPA 2YWJA 4BJ1A 4F4JA 5C5EA 4DA8A 3HV2A 5DH9A 3D64A 4WKCA 1IWBB 4CG2A 1QGZA 1XL0A 1AH2A 1LI7A 1WUKS 4QPNA 1BS9A 5IG2A 1IY8A 5C4MA 2PBFA 1D0IA 5LP6A 4WOCA 5AK5A 4HX5A 2Z08A 1EJ6A 1V5GA 3M9XA 4I14A 3GLIA 1M2HA 2B8TA 2QKYA 3TUJC 2IF0A 3GJYA 3LG2A 3AJEA 2XXAB 4EYGA 3PU6A 5K8LA 2VF7A 1TUGA 2V97A 2ZPUA 2R1VB 4JP8A 2UZ1B 3L79A 3TZLA 3OT1A 1QV7A 2CHFA 1DX6A 2P7IA 2WFZA 3DBVO 1YF3A 2FX2A 3L7DA 4Q6WA 1JQJC 3ZDRA 3LCCA 1V4VA 3PUWA 1RM4A 5GINE 4MCAA 5IC4A 2FHPA 3ZD6A 3ZV4A 2WIFA 3HUDA 5CDTA 1TX4B 2P90A 1IHOA 3GRUA 3MAJA 3HDHA 2QZ9A 3WTCA 2XKKA 1YZHA 4HC4A 2XCTB 2GN8A 1EFLA 1UJBA 2H2IA 2OV3A 2W9XA 3AJAA 3ES9A 4LY9A 2JIOA 1WKBA 3R7SA 3ICPA 4PHGA 3P5BA 4Q05A 3AVVA 1N92A 4MARA 2VZ0A 1XWFA 5ERXA 4HWGA 1WW8A 3HP4A 4Q5IA 2W98A 4U1RA 1T5HX 1HBJA 3IEXA 4EG5A 3RT1A 2PH3A 3V1KA 2ORYA 3B1XA 4ND8A 1O4VA 3GNTA 1NURA 2YNMC 3RADC 3OMXA 4XRGA 1P4RA 1PV4A 1KU6A 3C1AA 1P74A 3T0FA 1EFTA 4QXRA 2P1RA 2W4QA 3UENA 1HQKA 2R8PA 1R6XA 1TZJA 1QGUA 1MRZA 3EQ6A 3ZCRA 2YHIA 4DC1A 3NUGA 1EHYA 2C8JA 1ZOSA 4NY1A 5JZVA 3UWKA 1WTCA 1BKSB 4G0NA 3ICVA 3MELA 1I6KA 3NTVA 4C7BA 1J0BA 1DDGA 1BOFA 1Y5LA 4X61A 2QBYB 1H8HD 5CTAA 5CFRA 1UPXA 3IODA 1Y5IA 1XQ6A 1RHMA 1AIPA 2XRFA 4V0LA 1KDZA 5LOVB 4CEJB 2RCYA 2JCVA 1MJ5A 3G6KA 2PGOA 1OF1A 1YJ5A 4G0MA 2GKOA 2WJWA 4X85A 1ND5A 2B4RO 2Y71A 4QXOA 2QUIA 5F23A 4EMTA 4CFYA 4LECA 4P4TA 3WK4A 2LW7A 1OILA 4RDXA 1XQWA 4Z9BA 3LDAA 1FSGA 4YAFA 1P18A 3WWZA 4CEHB 1UDBA 4KQHA 1TU4A 4MGEA 1NDQA 2ZJ8A 5EHGA 3Q9LA 1T1GA 4ZI5A 3LYHA 1T9GS 2JFFA 2H9AA 5A9SB 1J2JA 5JH7B 2J0EA 2V55B 4HDKB 1CQPA 5B53A 3ZE7A 3RSQA 5KZMB 3EXFB 1PT8A 2RGWA 3E5HA 4QTUB 1IXZA 1FNMA 2R86A 1RBQA 1GFWA 5ALEA 10MHA 1T8RA 4LY0A 4DM7A 4YRSA 3X1YA 3I8OA 2WJJA 4QOSA 3D6HA 1Z0FA 2JLAA 4ALJA 3UT5B 4QDOA 4KX3A 4I19A 2G4LA 4KDEA 3EK2A 4G89A 3U3JA 3JPYA 4YMHA 4ZICA 3PNOA 2OR3A 4ZOLF 4ZQGA 2ZSJA 2VBIA 3OTHA 1JFLA 2D7DA 4QDTA 4GPIB 2J3JA 3Q3HA 4LQLA 1MJFA 5ALDA 1AKNA 2PUEA 2CFSA 3LF1A 2WUFA 2AJDA 3A1SA 3DBIA 3ZN2A 3V42A 4IHKA 1CNEA 2ZSDA 1CR0A 3IEUA 2V9CA 1BH6A 3AEKA 4N3NA 2ILTA 4ZAXA 4MVCA 5CAEB 4FDTA 3LBNA 3NAZA 1P2TA 4LXHA 4Q3KA 5D3KA 4UCXA 2DXIA 1M5RA 1AGRA 1QIKA 5D3MB 4NQRA 2ID7A 2ZIWB 3MEQA 2FNAA 4RY2A 3HMKA 1RC1A 3WAJA 5AJHA 4MTLA 2ZAOA 3TD9A 1E3QA 2WW8A 3R3SA 4I9FA 3SZRA 1VPTA 4D3YA 1MB9A 1I3MA 2RKOA 3IAHA 3IQFA 5GONA 1LCIA 4HSEA 4F6RB 3DPIA 2J6CA 1J22A 2OM2A 5JFTA 2Z9DA 3NGLA 5I9SA 1JLHA 4TLCA 2RIRA 2QGFA 2EGGA 3EXHB 3MM4A 4PLWA 2VJMA 2VJDA 2XKBA 2LVBA 1KAQA 4Q3BA 1U99A 3L77A 3GT4A 4P4LA 5HMMA 3GDWA 2XQFA 3PNKA 1YDWA 1WZEA 2A9JA 3B36A 2RK4A 3QBTA 2JFUA 3EIHA 1HG0A 1YK0A 1VLZA 2A5LA 1DG1G 2I22A 4B7XA 5KPJA 2DETA 1U7XA 4M7WA 1NU6A 1EFPA 2PS0A 2P3QA 2RH9B 2VOJA 4L0MA 3OZCA 5NLLA 3FHLA 2HZ7A 3V32A 2OZPA 3EODA 3WY9A 1UBHS 4F8YA 3E58A 4KN5A 5G0VA 2G9NA 3PNYA 4PFQA 3HP7A 3O8QB 3AZOA 1NRXA 3PWZA 3R41A 4YPFA 1T8YA 4O02B 1Z4QA 3D2BA 3X1DA 4AJOA 2N42A 5J2TA 4L6CA 3KYCA 1U8XX 4IF4A 4XWOA 4Z4CA 1KR5A 1ZESA 2O0HA 1S7CA 1JJVA 3O26A 3Q6MA 1ZOOA 4N6OA 4ENTA 4IR7A 4P0QB 3PD0A 1NMZA 1YBVA 2ATEA 3OWXA 3Q11A 4IDQA 3G9XA 4RPJA 4B4VA 1THGA 2VYFA 4RKRA 1VC2A 1KR2A 4ARVA 4C43A 3EVGA 4S1WA 3IMFA 3CPSA 4WZBA 4A92A 3CH4B 2K2WA 3OTIA 4D7AA 2V98A 4LRUA 4IW3B 4B6GA 2IV3A 2E21A 4YMVA 1J7JA 3G02A 2VPZA 4R2WA 4GSKA 2O48X 3ZTWA 1CD5A 2YXDA 4QT0A 1HYQA 1UT5A 3KAKA 3LDGA 3T35A 1O2DA 1ABBA 4FR5A 2ODWA 2XVZA 1X1DA 2D5AA 1LWOA 3HXPA 4D74A 3CLUC 1A4XA 1GZHB 5C34B 3IXQA 4ER5A 1R7RA 3BMCA 4H4DA 3T1QA 1T0UA 3NNSA 4URVR 1NRWA 4Z3KA 2QRVA 3G2MA 2AW5A 3V8NA 2BBTA 2DLNA 3HBJA 1HKUA 1A97A 1GZDA 2R8ZA 3A6KA 3IT1A 4LY3A 4UPDA 4UHDA 5J23A 3VR2D 4Q3OA 5FPYA 3STWA 4YRZA 3JARB 1FRNA 4N18A 4Q93A 4YJKA 4HGRA 4QPCA 4Y6OA 1LLUA 2CJWA 1X74A 4CT4B 1I7QB 2WD8A 2HU7A 1PHRA 2WWVD 2I8AA 4JLSA 1S4MA 1MX9A 3PYLA 3GJ0A 1HE4A 3DAHA 3JW8A 3FNQA 2OP1A 4X7RA 5DIFA 2GPJA 1I33A 5J9FA 5FXMA 4D3DA 4DNPA 3DB2A 1XTZA 1CB0A 2FXVA 4Y9TA 4N6GA 3AL3A 3GW8A 5CR9A 3UUFA 1KFEB 2PL3A 4B74A 4Q1BA 3COYA 4BAGA 4G1FA 4XSGA 2MYPA 4K9LA 1F2TB 4KLCA 1IUOA 1MOZA 4U7TB 4M0LA 4C0LA 1TYDE 1DMRA 5F52A 2ISSD 5AVRA 4YAIA 2GD2A 1IN5A 4V0ME 3GG2A 2B4KA 4BO6A 2G77B 4FGJA 1SJ9A 1KFCB 3KNZA 2XV1A 3R6WA 4Z7JA 5LP1A 3QKIA 2PKYX 4U3JA 4UAJA 4LDAA 1M54A 3T5TA 3ODGA 1U0FA 3W6NA 3IEKA 4KHPB 5L45A 4PIPA 1W48A 2IDMA 2Q7DA 1T5BA 1DU4A 2E48A 2H18A 2PSDA 3M6XA 3F96A 4L2IB 2LP4Y 1U2DA 3EUEA 2DMRA 4YJ2A 1RRMA 4FFNA 3NDRA 3E0QA 4F85A 2IYQA 1JEOA 3SKYA 4BMPB 2PGXA 3KO8A 3WYGA 4N3AA 3EVEA 3HGMA 5GVSA 5JR3A 2PKXA 3M4NA 4QQ8A 4QPJC 1CP2A 1OIVA 2HF8A 3MWGA 4HGQA 1KYVA 3AJRA 3PF8A 2ZUEA 1ZJWA 2C2WA 4Z8XA 2IOFA 3HDJA 4FCTA 4X6XA 3ZWNA 3ZDZB 1ZNYA 1HE2A 1LK7A 1P61B 3G0BA 1L4MA 1DUIA 3W4IA 2IOHA 5HKAA 1WXEA 2V8BA 4XH9B 1JDUA 3EXEB 2VTVA 4LJRA 2GEBA 3BH7A 2CL0X 1GN9A 4LXGA 4MKHA 1B74A 3E9RA 4QIHA 4BHTA 1TJYA 1VI6A 2QF7A 2FPXA 3SMVA 1SK8A 3ZWKA 4YHHB 1KO7A 5H3LA 1L1FA 2J5KA 1SOUA 3VUEA 3TPCA 1N6OA 3FCCA 1Z36A 3QW2A 1FFCA 3OUZA 1A9ZA 2F8TA 2OHJA 3E18A 2H57A 3GWGA 5L7TA 1JIQA 2JJ1D 1BD4A 3QW4B 1QF9A 2P5SA 4MA4A 5T64A 3TQSA 1UM9B 2OHOA 4ZDJA 5JH7F 4URHA 1U5CA 2Q3JA 2BF7A 3M3PA 5HBRA 3U26A 1RI4A 3QXSA 5EZYB 2E4XA 4Z4EA 3FNEA 5FX2A 4MR9B 4QNMA 1C3EA 3KRTA 4DAOA 1PR9A 4J8PA 4JQZA 5JLJA 4RD3A 2R6HA 2VYQA 2FDXA 3HCCA 4G4GA 3W8FA 2O2YA 4ZVSA 3LXXA 1VSUA 1B3RA 1ZXLA 4CM4A 2E18A 2IJGX 4MUEA 3SQXA 3CEMA 4WLEA 2YDYA 3F71A 2HCBA 4KLAA 3TLXA 3EIUA 3I9KA 2PGAA 2BMFA 4L8YA 1H0HA 4QRHA 4PWYA 1NQTA 2Z9CA 1R6TA 4F91B 1JVNA 3C8ZA 1POXA 1YT5A 1Y6RA 3HRIA 1VLJA 1AKYA 1N4DA 3UK7A 4ESHA 3P26A 2AOUB 4ZIRB 1N3YA 1TFUA 5B1HA 3UCEA 5FTWA 2WJYA 1M0EA 3FE2A 1FSPA 3L1KA 1XDUA 4DMCA 5ESDA 3PQ7A 3V8VA 2F8MA 5KYNA 1ID8A 2C1EA 2P2DA 3SKXA 1QH0A 1XRJA 2VT6A 1G6Q1 2OLEA 3HPQA 1EE1A 2GZ1A 5CFLA 1N36B 2A9RA 2ZCUA 5TSDA 5M29A 3SJUA 2MSLA 5IKPA 2VUUA 4LX8A 3K0CC 3A4VA 3OE7D 1WB9A 1PGJA 1DRJA 2QAIA 2VHUA 3V5NA 1AQJA 2HY7A 1Z37A 2RAVA 1KVQA 4U9IS 2POCA 2ZJ5A 4LI0A 3KT6A 2XOXA 3MA0A 5DYWA 5LLSA 4LNAA 1XLWA 2YY7A 1C0PA 4ZZ2A 4AF7A 2OUIA 4QQKA 1SQ0A 2XGGA 2J6BA 4HG2A 4A7PA 1JT2A 1Z34A 3SXPA 2BFDB 1JPUA 3UT6A 221PA 1JBQA 1XCGB 1I0ZA 3FG9A 4B9EA 1AQYA 3NALA 3OPYA 5EYPB 4CF4A 1U04A 5H16A 1PUXA 3AR5A 3P0RA 3KE9A 4ZANA 3ZLBA 3UY4A 1EXDA 4MR7B 4FZRA 3ICOA 4LWZA 2FEAA 1BGXT 4KN8A 4M37A 4ZVQA 3UMFA 3BIJA 5GPBA 1MQSA 1ODSA 3VISA 4ND6A 1ZI6A 2WU0A 1ILEA 4E5UA 3DLBA 3H8WA 3T7JA 2BYTA 1U0TA 1VLLA 4N7MA 3KHUA 3X1JA 1A72A 1FDVA 4GT1A 4OKSA 3P0EA 4GEKA 4IQ0A 2WF8A 1OBFO 4QDXA 1T8SA 2G7ZA 4V0OA 3R4VA 3DCYA 2EWWA 3LBIA 3JALB 4Q9IA 4ZPXA 4DARA 4JYAB 1JTEA 1K2VN 5BWNA 1WD5A 3MXOA 1C0LA 3SQDA 4G1EB 2ZJ3A 3WDKA 3OJCA 4OA5A 3O1JC 2IE8A 1R8YA 3PUYA 2PKQO 4BVAA 2ZULA 3K0AB 1KDOA 3CNOA 1PCXA 3WI7A 4RHXA 3VVBA 4DR2B 2OZLA 2AHRA 4MWGA 1PEKE 1RZVA 1RACA 2IHVA 4FKBA 4YAOA 3WLLA 1E2IA 2FSPA 3KTAB 3T34A 2GN2A 3HKEB 1XT6A 3H86A 3N1UA 4LC9A 2HU8A 2X8JA 3EOAI 1R0ZA 1UDRA 1YB7A 2XYVA 3A1CA 4QVIA 1XZ8A 1LQTA 1QHFA 3RYFA 4XX0A 1E66A 2GLTA 1RRKA 3ZGXA 4INZA 4ZJUA 3CNHA 4G0UA 3R3UA 2FUEA 1V47A 3FNBA 2DT5A 2HNBA 2Q3BA 5BV8A 3EVBA 4WESB 1J8FA 3DZ8A 4KMSA 1FS6A 4WXPA 4ON9A 3GJ6A 4C5AA 4XIYA 4Y2HA 5LKAA 4DCUA 1JZQA 1W88A 1N6PA 3H0CA 5AW1A 1PNOA 3L4BA 2AHOA 1Q3TA 3L8EA 3PG5A 4FFDA 4BEBA 4ER7A 2CV0A 2B9EA 4Q7EA 4KWCA 2I03A 4P31A 1BMFD 1DLIA 5JY1A 4KIJA 2BEKA 1RFGE 5AKEA 4UU7A 5B36A 5KWIA 4ZJYA 1EVJA 3DEIA 3DTVD 1ENYA 1IVNA 4FD3A 5AIAA 3TX6A 1HE5A 3FZYA 1I4EB 1WL8A 3DV0A 2XE7A 4HL6A 4IEIA 4L28A 3T0GA 3B8HA 3EN0A 3HY4A 4PG4A 3WYEA 4II2A 2O8EB 4XB1A 3WKCA 3IIJA 1JA9A 1Y1TA 3WFIA 2R84A 4D8UA 4E2WA 1JHYA 3D3EA 4F45A 3FYUB 5LMNB 2V5UA 4D0LB 1GY8A 4G6ZA 3F6CA 4JJGA 4F4IA 3FMGA 4UFPA 3CCBA 2ZQZA 4GHWA 3VMFA 3QVTA 3R0IA 3MFYA 3USZA 3C5WP 4ZVOA 5BSKA 1U0EA 1T5TA 3B3QA 4KE6A 3HXQA 2QJOA 3RCBA 3NW9A 3MD0A 1Q7GA 4YJFA 5FUYA 3RUHA 3E3NA 4PAOA 4IG9A 4EPTA 3IQGX 2OL4A 4CNQA 3BICA 3LLVA 3N86A 4QEKA 1XA4A 4MIEA 3JCZA 3TW4A 3K1ZA 1VKNA 3D1VA 5DFAA 1QNLA 1WCWA 1GDDA 2R00A 4ZP1A 4DVJA 3EPPA 4TKZA 4ZCMA 2FPKA 5DBEX 1X77A 2X23A 4LMAA 5HA5A 4AKIA 2DJ5A 2C7GA 3NHRA 5EJGA 1CQWA 1D5WA 1PEYA 5C7OO 2RI6A 3GMTA 4PC2A 1Q16A 2WMNB 1ZMOA 1MPTA 3JAKA 4R2KA 2YHUA 1FYVA 4AF6A 4EGAA 1FW6A 2VF2A 1SO8A 3KFLA 2DBZA 2OCDA 4F0JA 3EUWA 4WERA 1NNSA 5DN6D 4CETA 3BTVA 1AM4D 4TMYA 5JBNA 3B5IA 1Q1GA 5L9AA 1QZTA 4ZEVA 1QVAA 5LUBA 3KYDA 4F97A 2C2BA 4CKBA 1IULA 2RK6A 2ZBQA 3H05A 4Q4AB 3WK7A 1MMFB 3W9SA 3PHBE 4YCMA 2G0AA 3ABQB 4L08A 2PL5A 3P4XA 1M0TA 3BMQB 3ZX5A 5COAA 1EVKA 4PAMA 3PTAA 3BREA 5JZSA 3I39X 4B7AA 3GJQA 1JE1A 1N0HA 3OF3A 2VRCA 1DV2A 4LTMA 4AS2A 2GERA 4CQLA 2H4JA 1YBAA 2CLLB 5JD4A 2PZJA 4UUMA 3ND9A 3BXOA 3KJQA 3FZEA 1SWVA 4FWIB 4EG0A 4V3CA 4RZUA 3HVJA 1A7JA 3A3YA 3AM1A 1E1YA 1R37A 1NIPA 3LPCA 2AIRA 2GEVA 4BQEA 1UBFA 3SFVA 4FYIA 1WJGA 1Q0RA 5FT9A 2REQA 3P9PA 3D6JA 5D5HA 3NHMA 4XEHA 4ZV7A 3NBZC 2JIBA 4FFBB 4E3ZA 1I0IA 2EFDB 4JC8A 2C59A 4OTZA 1OZFA 1WDMA 2PA0A 1FQKA 2YINC 3OE1A 4NAHA 1G16A 4V0MA 2X77A 2XB6A 4PYLA 5LYJF 2V74B 2O8FB 1NVVR 3KR0A 4XQEA 5SY9A 2HU5A 1SWWA 3C97A 2WP0A 4IKEA 1LF0A 1ISFA 1DIAA 2RH5A 4II3A 4BMOB 4I0WB 3K92A 1WHSB 4OB7A 4F5EA 2A1IA 1P1JA 3DE6X 4G0YA 4ZMRA 1KFBB 4DMHA 4CF7A 3AINA 2F4NA 3D4IA 1JR2A 3DE4X 4QODA 1KGSA 3TGWA 1DELA 3P4UA 4YK7A 2GJSA 3H4MA 4YRAA 5A5EA 3ZH2A 2Z2YA 3SMQA 3EEBA 3FTNA 5HE8A 5JWHA 3ZJUA 1HQDA 4NK4A 1MA0A 3KOOA 5EJMA 3CZ4A 3DT8A 3GRCA 1ZUHA 2WWFA 4LWOA 3ZBUA 2H48A 4FYHA 5IVIA 1PTJA 1LW6E 3PFKA 1ST2A 4A8JA 3TECE 3E3MA 4MW1A 4DGSA 5BNTA 2ISQA 3H13A 3JQPA 3T3DA 1DBWA 1GTMA 5FQOA 5ECDA 3UAYA 1D0SA 1G8SA 1MAAA 2X3UA 3PC7A 4OMCA 3Q7SA 1ML4A 3MIIA 1BDBA 4OO3A 4UAUA 1OE0A 1ICIA 2RKWA 3SBOA 1MC4A 1YJCA 4EA7A 4B3RB 1TA0A 2GETA 1R0XA 5B4UA 2MT9A 3Q7IA 2W0SA 3HJFA 2B83A 1RVDA 1X7XB 3OWHA 3UNXA 1EUQA 5EP2A 4IIUA 2Q7OE 3HU1A 5CVDA 1P1HA 4G3XA 4UBNA 4KE7A 5HHTA 2CMGA 1M7BA 4RHCA 1YMQA 4JXZA 2JAOA 5B2ZA 2P6PA 4YJ3A 3D0RA 3H1EA 3M81A 4NNPA 1J2UA 2VQDA 4ND5A 3W8NA 3W4KA 1ZCZA 3A9RA 2A67A 1ZVKA 3RGGA 3KFXA 4GI3A 4LVNA 4I5FA 5HEKA 4J7AA 4B4UA 2SCUA 3AEQA 1NWHA 1B0ZA 1WXFA 1R3DA 2A0KA 1NL3A 2PX8A 2XUZA 3FDJA 1MIHA 3KB6A 3UMJA 3QKRA 4X95A 2RHGB 1MT0A 5BQFA 1EE2A 3OFND 2NPOA 5HILA 4RTMA 5KYYA 5FUVA 4CW7A 1K75A 2ZRKA 1QPBA 3E81A 2ZKLA 4UQLA 1EFHA 2I7TA 4I50B 5IDVA 3NGMA 4QDZA 4TLMB 2NZ2A 4Y8VA 2GAFA 3MS2A 4ZU3A 3TBHA 4MPJA 3Q15C 2A5YB 1KH1A 4C08A 4D42A 3EMVA 3B1KA 3TX2A 1I94B 3PXAA 1SVKA 4BJ5A 2YJTD 3LX8A 3P8ZA 1QP8A 5CJ2A 5J3JA 2PMFA 4Y2TA 4NHEA 3G13A 4HQOA 4QRIA 3JXEA 3X1WA 5AKJA 4C03A 4DWOA 4D4HA 2FZ4A 4GOMD 4IVNA 1N34B 1M5UA 4HATA 5T8KA 4M86A 1AXGA 4KITB 4FJ2A 1YE3A 1UAAA 4BO8A 3DFFA 4B4OA 1AGXA 1YZLA 2W42A 1JHRA 1UMDB 2J46A 4V2IA 2A1UB 2VIIA 3ZK9A 1I1NA 4XE5A 4TSFD 1R5JA 1C9KA 1SOWA 4IRUB 4JT8A 3ESDA 2PXHA 4M9XA 1PFVA 2O0JA 3O90A 1W4RA 3H9CA 2ECOA 1KMNA 2DTXA 3A4TA 4ZHQF 4JODA 4Q66C 4NI5A 3LSTA 2NVUB 1HRDA 4JYZA 1Y42X 3B9RA 1SEPA 1DG3A 2XTMA 5JMWA 4C4AA 1JKJB 1OLSB 2NVOA 3H7AA 4J0GA 5JECA 5EHXA 4HAXA 2BGMA 1Z7GA 3ONFA 3UHOA 5KOIA 1GKYA 1G20B 1VGRA 1PR1A 3LBAA 1H4VB 3L41A 1KYQA 2IEIA 4BS9A 4XUEA 5FPHA 1EGAA 2VF8A 3LQYA 1U94A 2NU9B 3VH3A 5BN5A 1SHKA 3O4GA 4I1OA 4M1ZA 1SY7A 4LHXA 2BM1A 4WA8A 1O54A 2XYQA 3P2KA 4L4YA 4MAFA 3KQNA 1T5IA 3WFZA 5F98A 3VNSA 1IZ7A 2G4CA 4I1IA 5EP1A 1V3QE 1DKUA 3GFSA 5EE0A 1CUDA 4HJXA 3WE7A 2HRZA 2JFNA 4JL5A 1SXJB 1U1DA 4D9HA 2C9ZA 2OB1A 3VJRA 4OKIA 1D1TA 5BQPA 5B7QA 3JZMA 3WAKA 1P1IA 4IIJA 3SQWA 3PDIA 3LY8A 4WV3A 4TVSA 4L9AA 3D3WB 1L8LA 5D1HA 4DV3B 2DUWA 3CZ5A 1BE6A 3LXUX 2R5FA 5LZ4A 2QSJA 1K8ZB 3IKLA 4ZCRA 3T3EA 1IDOA 1PL7A 2RHMA 1YULA 2NUAA 2FZKA 3WP1B 2BCGY 3IE1A 1WDWB 3ZD9A 3EZFA 3K0HA 3SHWA 1OZHA 5BV1A 4C2TA 2QVXX 5THKA 1UBSB 3OCVA 4M1KA 5ARBA 5HXAA 3VPFA 1LDNA 3K0FA 4QBKA 4G2NA 4HDQB 5BT8A 5LQAA 3TLBA 2PSFA 1V2GA 4A0QA 5D01A 1ESZA 1TCBA 3OTOB 1PYGA 1XTRA 2HF9A 3P1JA 1VMAA 1INLA 1ZINA 4PQGA 3IO3A 2BGWA 1LUAA 4RJLA 2IGTA 1CJVC 2NU7A 2OO3A 2Q41A 2XZDA 4JK3A 4OB6A 2VUTA 4WBSA 1COWA 2AX3A 1TPZA 3NVDA 2HFJA 2VZEA 4FMDB 1S8NA 2IHYA 4MP3A 4HV4A 1QCCA 2ZVDA 4G0XA 2QUAA 4HNGA 3LA6A 1JEYA 5JU6A 3KQHA 3EIOA 2WWWA 2RHCA 3P7MA 2QRNA 2R1TB 4KYTA 4GPD1 4OYHA 5JPIA 2Z30A 4Y6PA 5ERYA 5L3ZA 1QAMA 4M55A 1T5SA 1WUJS 4ADSG 3AHIA 3IP9A 1EU1A 4DVGA 1M6YA 2QLTA 3OIVA 2HHLA 1KSHA 3L84A 4UARA 5CD9A 2R6FA 1C7IA 5FL7D 1H1DA 3PD7A 2Q1SA 5KQLA 3G89A 5KVQA 4BMNA 2R97A 3R0VA 4PW0A 3RAPR 2GM9A 3NDBB 1N6NA 3PQ3A 3GN2A 1V7CA 1QX3A 5DGTA 1Q84A 3DMYA 3HU2A 1GUZA 1ULHA 4HF7A 1GITA 1O96A 4JU8A 4M2LA 5LDGA 2G0NA 1LPNA 2V0NA 3IMGA 2VAPA 3HBAA 4LA4A 4HAUA 4ESVA 1NZFA 3MOSA 3D7KA 1JLRA 2IXDA 2OCKA 4RCZA 4UBOA 3RHSA 1E0SA 1FP2A 2BC9A 2XXJA 2XNCA 3HFRA 4KUHA 3ZWCA 3UJDA 2NVBA 1T3LA 3B53X 3NEAA 4FDAA 2X8AA 3SXUA 3O2SB 4B6FA 3RKSA 4WGFA 4C2UA 4UU8A 2A58A 4HFJA 4K3VA 1E4EA 1FRFS 3DJYA 1KC3A 1NLUA 4UE2A 2KX7A 3DE3X 3FLMA 3GUVA 5MFPA 4CM9A 4KREA 1E9CA 4QPDA 1Z5ZA 2P9HA 1EH5A 3W05A 4LYYA 2H0QA 2MYUA 2XF2A 4FW8A 1GPJA 3VDXA 1D6JA 4UXHA 3HYCA 4RV4A 4RZSA 4DGQA 1WG8A 4E4RA 1AURA 2HPZA 1B73A 4X92A 1NE7A 1FJHA 1E1RD 3HABA 1Y8QB 3WADA 3WL5A 1P6XA 2G9ZA 2R66A 4NPCA 4FUTA 4YPVA 2G36A 2Q6TA 4RETA 1E98A 3PXDA 3STYA 4BGUA 2PGDA 3T7EA 4IUBS 1T34A 2HMYB 4B7ZA 1VDZA 3CMMA 4KRGA 3VPCA 2XRZA 1KQ3A 3D43A 5TEWA 4Y0VA 3IPXA 1JG3A 1ADYA 2RE8A 1J0CA 4YLGA 2AZTA 3VZRA 2P77A 4R8KA 1I13A 4IBOA 2J59A 1T1IA 4WNIA 1XCLA 1P5HA 2PCJA 3QE3A 5EE9A 3UAOA 1XDGA 4IZHA 4HNQA 1T9ZA 4EX6A 2QLFA 4MB6A 1S2LA 2X8BA 3C6ZA 4JB3A 2W2OA 3NNDA 4O1IA 5E9JA 1CDDA 3PNLA 2IY7A 1RRPA 3MVEA 4R0VA 2BJVA 3AF5A 2A9OA 3ISTA 1EQUA 3SS9X 4KRFA 1NRIA 2PZFA 1VECA 2O07A 2AGVA 2PFGA 3SHFA 2LIVA 5CVVA 2CXHA 3A37A 1FXSA 3ROXA 4DA4A 2C1XA 3D4OA 2XGOA 4MLZA 3HUUA 2Q3DA 4CKZA 5ENVA 1UF9A 3DNMA 4BNXA 3F73A 3LC0A 2F43A 1M75A 1KYYA 4OP3A 1NR5A 1GSHA 3N0VA 4FYVA 4J2HA 1X8XA 4LEIA 1C9NA 5ILQA 1SCKA 3CJTA 4PYOA 2ZDHA 4TRNA 1GSAA 5FV4A 1R5OA 4XD7D 5KTTA 4ZMBA 1Q0SA 1OI2A 3V8PA 4LRWA 2FKNA 1VYVA 1Z75A 1NW8A 3PC4A 3QEJA 5FADA 3T9FA 4U6SA 1NUTA 2F1OA 3FPKA 3OMWA 4HY3A 1YJXA 3I3SR 5FFFA 4BQQA 3D8BA 3QWHA 2AKEA 1NVKA 4WW0A 4FGLA 1BU8A 3A1FA 4LHEA 2G08A 3KAPA 2CT8A 1JDPA 1SQSA 1G55A 3PC8A 4RVGA 1U3GA 1O94D 4RS3A 4UREA 4XWTA 2GCNA 1HLFA 3QLVA 2XT9A 3KOYA 5I8ZA 3S6JA 3BK2A 3S1AA 5COQA 4BEVA 1KRWA 5IJAA 2YBEA 1B15A 3VZCA 4PSKA 2RONA 1ZH2A 1Y3DE 3BULA 2AQIA 4JL8A 4KCGA 4ZA2A 2FFAA 4EJSB 2FR1A 4YY3B 1SXQA 2O8CA 1VMKA 1DEOA 3HK2A 1FPQA 2B7BA 4ENSA 1QLWA 1U2SA 4YAEA 2P9QA 3BOSA 2Z2IA 3R0XA 1AB5A 3A1EA 4QDKA 3QJYA 4RMHA 4RPHA 1QZZA 1T8UA 4R1LA 3N7AA 1OD6A 3H65A 2GWHA 4JJ8A 1PJ8A 3ONVA 1F7UA 1Z33A 3BEDA 4YNBA 1GVNB 4QBGB 2ZVPX 3OZSA 3PHGA 1M33A 1RAHA 3V34A 3JQFA 3O8DA 4OK3A 1WB4A 4L0QA 3S2ZA 1BFKA 1HE1C 3DDHA 1R88A 2J6HA 3HDYA 3LKDA 4IDOA 4M0FA 5CT8A 2OESA 3FYCA 1O95C 4HXGA 2CK3A 3MRSA 4MR8B 3ANXA 4UHHA 4A8HA 1CQXA 1PG5A 1IY0A 3IJPA 4WXRA 4D9BA 3THWB 2UXCB 1XTIA 3R5XA 1SG9A 1QVVA 2PYIA 3NHAA 1NBEA 2IL1A 2IP1A 3QI2A 4J16A 1WDKA 2QM8A 5DV9A 3ZQJA 2Q6VA 1UBUS 4B6QA 2Z6UA 3ENWA 2COEA 4G9GA 2BFAA 1M8GA 5ALSA 2OQVA 3EIEA 3Q8WA 3TNJA 2G1UA 1I3LA 4FMCB 2Q8NA 2KS6A 5BNIA 5FWNA 4QJ5A 5CCDA 1U2RA 4HAVA 1E4VA 4JUIA 3H2YA 3ROEA 3OA2A 4TQUS 3PHJA 3EWSA 1NVXQ 3F6EX 3R9WA 2GZSA 1XIVA 4WMLA 1LKZA 2VQ3A 3QYJA 4ND7A 3ZHCA 5KNCD 3M2TA 4LRYA 1OBVA 4NCXA 4Y1EA 3G7SA 1E64A 1F4VA 1A9XA 3TTWA 1TLFA 3V1NA 3M1YA 2ISCA 3PNSA 1M8PA 2J45A 2V54A 4OLBA 3U80A 3DEHA 3H2HA 1WBJB 2CVFA 4OUDA 1H5QA 1O9BA 4BJHB 4LF4B 3DDCA 4CCYB 3AQIA 3GFPA 2ONZA 4FZVA 2HSGA 2D00A 3U7EB 4LCBA 3H2ZA 1EI9A 3KALA 1YASA 1D1SA 2OQRA 1N9GB 4YBRA 2JFVA 4MK4A 2AWNA 5JSKA 2VYND 3AOEA 2V1UA 4OHYA 4DSNA 2QMYA 2B78A 3KPYA 3M6AA 1D2NA 3HN7A 4MS3B 2YJ5A 4IXDA 3S99A 3GGCA 3SZ3A 1LSJA 4IGIA 4S1VA 2VP3A 4Q34A 3SQMA 1UOPA 2H17A 9ABPA 3IL2A 4I55A 3FPSA 2W2PA 1N9ZA 3LUAA 5ULLA 1HDOA 4HRVA 2NAPA 1WZNA 3AVOA 3ND5A 4FJ1A 3EFEA 4RAQA 5THQA 3ENQA 4EI9A 4A10A 2DFLA 4RBNA 1H6AA 1YKSA 2H0RA 3DDSA 2QNIA 1RRCA 2HWUA 3CUWA 4LSZA 2JHPA 1Z8HA 3T7TA 3CR3C 1I4WA 3TTYA 1SPBS 4C6TB 3CUUA 4HGOA 1W0KA 5I3CA 2WD9A 3P94A 1QDLB 1L5RA 2YXNA 4ED9A 1NF8A 4AJHA 5IJXA 4FGKA 2DUUA 3R24A 4NEGA 3LBFA 2OCAA 3Q8MA 2NNWB 4O29A 5EESA 3I2FA 1BX0A 1YHZA 2BR3A 4ND1A 4P0TA 1WMDA 1TGYA 1WD7A 3GJZA 1J8VA 3CTPA 3O84A 1Z3IX 1Z22A 4URWR 1A9RA 1ADFA 4UE3S 3R7DA 3EXAA 4HQLA 5DRTA 2Q2NA 1RS0A 2ETXA 2A14A 1V45E 3H4TA 4A82A 2P2NA 3SOZA 4AP5A 4BN5A 2DOKA 2IYNA 4EJ6A 3F1KA 3DNPA 4JDPA 2X4DA 5CVEA 2FX3A 5GOTA 3RREA 3GWZA 1JFSA 4E22A 4GQIA 1FFSA 3NM4A 5AK6A 3H3FA 5DHTA 4BRWA 1IHPA 2WD7A 2F3UA 2WWTA 1JRLA 2Q07A 3HYTA 3RROA 1HX7A 3PUVA 4AUMA 1JWAB 2PD4A 4WKNA 5GADl 1FVOA 3K09A 3ZXUB 3WQBA 2MINA 3H6KA 5BYJA 1ADGA 4WL0A 3MJCA 2XMCA 4B09A 1J0DA 1DO8A 1Q1AA 2XMQA 3B1WA 2BMEA 1IQRA 3K71B 3TD6A 4F04A 1ECCA 4Z49A 4BNDB 1AE1A 2DLCX 2RB5A 4CR8A 1OSNA 5JS8A 3R6GA 1EWRA 5ESXA 2L0XA 4BFLA 4R16A 4Q21A 3FR8A 3CEPB 1LJ8A 5CMLA 1TYZA 3OKCA 2MTBA 1PZMA 3KQMA 1BKYA 2QX4A 3FOFC 1GRCA 1G42A 1OI3A 1Q7CA 2ODTX 2XZTA 1JPJA 2X0IA 3W5VA 3KUKA 4OQEA 5J4YA 1UBOS 4PTLA 4EF4A 1P19A 2VAXA 3OY2A 3U7IA 1L6IA 1N0VC 3AHFA 4LI3X 2DECA 2O0MA 4XJTA 1XMVA 4M1TA 3L1VA 2QLBA 1PJLA 2BDTA 3KHKA 5I9BA 1UK7A 4NMWA 2QLLA 3TFOA 4ZPJA 2WJAA 3LXMA 1XWWA 1PI3A 4R9SA 2HCRA 2Q1WA 2AOTB 2P1DA 2Q4EA 3R23A 3ROPA 1YL7A 2XH8A 3TLEA 5J2UB 2CLSA 2D8AA 4J6FA 4TV8A 4UM8B 4KPUB 2HA5A 3EBOA 4ML3A 1IB6A 2C9YA 3CLTC 4KWIA 3IESA 3MG9A 3MYYA 4GWKA 1K7YA 5EEGA 3RVNA 1FVXA 4DJJA 3RVPA 4PLZA 4ZVVA 5AQ1A 4FI3F 1XVUA 4XR9A 1VIAA 1U7HA 4ARAA 1ZD2P 2BEWB 2Q1XA 1X7HA 2W6CX 2ZT6A 3GAMA 1HLGA 1WPXA 3ORRA 3AIKA 4IDPA 4WZ6A 4C4XA 2ACWA 2H7CA 3QXGA 3A6HA 4YT5A 2SKDA 5HBGA 3AO0B 1PFUA 5CFZA 3WBKA 1DLJA 4GR5A 4HQKA 4MLDA 3LO8A 3WK5A 4EK9A 3L6EA 3JATB 4P54A 1KY4A 1S3FA 4M46A 2JLVA 1R4ZA 4LC0A 5CXQA 4H77A 3KKQA 2J3LA 3EQ2A 3QVGA 5IH7A 1K8XB 1V8OA 2P67A 1PUJA 2WM2A 3RIEA 3S1LA 3TSCA 4DPLA 1NJ6A 4CKYA 2PE5A 2IS6A 5GV8A 4P9NA 1Z0SA 3UXEA 2IRWA 1TTPB 1K7XB 1ZD9A 4U9HS 4RELA 2H4WA 3KK0A 3WLNA 3FTDA 4IZ6A 3TOVA 4US2R 1JILA 4D8XA 1EHCA 4YQYA 5EJ2A 5K3BA 2X9NA 2MHCA 1M2JA 3MWEA 2HMVA 2WOOA 1MTZA 3ZCUA 4EW3A 2W6ID 3KT3A 1U8ZA 2R6R1 1DPFA 4BNUA 4PFSA 3IHWA 3IVRA 4LC1A 4MYHA 1X7YA 2W83A 3VPBA 2FFHA 3AWDA 1TTHA 4TQ9A 1EFDN 5E38A 3Q0IA 4I5IA 1BS2A 3H4VA 1NF3A 3LCRA 1DJOA 1L7NA 3IAFA 1RYHA 3KJXA 3CPEA 2XMRA 4OHWA 4YP5A 4KKXB 5DGIA 3KOXA 4A8PA 4JP5A 5H80A 3NBXX 1Z73A 4B17A 2EFEB 1NJSA 1JR4A 1QUEA 4WFQA 4FPXA 4FIDA 4LJAA 1ZGJA 1HFWA 3VU9A 1VSQA 5E0KB 2QAGB 1IBMB 4CIYA 1N25A 4AIIA 4D0NA 1JSRA 1SBNE 3IMKA 1XU7A 2VP6A 2HA2A 3GN1A 4MQFA 2WJHA 3BQMB 3RHFA 1FFEA 2NYVA 3I5YA 1X19A 3EGEA 3LT2A 2Z4RA 3UAWA 5C1DA 1DAKA 4QG7A 3KEQA 3AM3A 4AM8A 1U8CB 4GOLD 4K2AA 3ABIA 2FPPB 4NCAA 3A28A 3V2IA 5E0OA 4LVOA 3MGGA 2CDAA 5LBUA 4GI2A 3X2SA 4V39A 3F5SA 4N54A 1QHGA 1XQYA 3MINB 4IM7A 4NCKA 4HXEB 1A77A 1VCHA 1NTOA 1E2GA 1JFFB 5I3ZA 3RU9A 3FOEC 4I08A 2WUGA 1SXHA 5ENZA 1E0JA 1HWYA 1PT6A 3IE0A 1F9AA 1R27A 2OA0A 3DHEA 1K9SA 2XBLA 1L4EA 2ZIFA 4NBRA 5H02A 4BN4A 4EDFA 4EX7A 4GOJA 1DAPA 5E9AA 4CR6A 4QLBA 1G3RA 2K87A 3H9QA 2IH5A 3AERB 4DRYA 4DUGD 1G1AA 1YUMA 2I91A 1BW9B 1Y63A 2Z5FA 5JXGA 3D54D 1L9KA 4Z86A 4RSGA 3ENZA 4X6UA 2WNHA 2PX3A 3AY7A 3IAAA 1C3OA 3RHTA 1CZUA 1H2AS 2Y0BA 2NO6A 2BEJA 3MQ2A 4A6DA 3ZHBA 5JRJA 3I76A 3F6PA 2BSAA 3P45A 1HK7A 5TDHA 3PGXA 3WGIA 3CNQS 1JTFA 2PUBA 5SZJA 3MWYW 2CL5A 1SC1A 4ENUA 3KD2A 3L0YA 2I2CA 3AR7A 4BDTA 5JVDA 1KYWA 2BKAA 4N5DA 4A8TA 4LXXA 1W19A 4C88A 4GL4A 1DP4A 2XE4A 2NADA 1FCJA 1L4YA 2OVFA 5JAQA 2Z0MA 3C3JA 3P71T 3W7VA 3I3OA 4BO3A 4EA6A 2FN8A 3G7NA 2C31A 3N2GA 3KR1A 2AVDA 5CM2Z 1F0PA 3KWJA 5JZBA 2M1XA 2D2VA 2JFHA 3Q0EA 2POQX 4GF5A 1HMYA 4X1YB 1DRUA 4KN9S 3BCUA 3S44A 4X64B 4GBJA 3WQQA 4BNJA 1YKFA 1YCGA 3BH0A 2PVSA 4N9QA 2P79A 5DPMA 2XRMA 3OLXA 2GYYA 5BSRA 3U3ZA 4DHEA 1WOMA 3UJ9A 3IT3A 4IQFA 4AB1A 3DXXA 4U2EA 1O5IA 3DAGA 4PS1A 4MPDA 4XR4A 5ICFA 3IP1A 4Q37A 3ROFA 3A04A 4ZAFA 3E9QA 1PR5A 1F51E 1O94C 3SJCA 4TUYA 2ORWA 1GDHA 2HLDA 1PD0A 3PX2A 2E37A 3NB0A 4MWEA 4Q03A 3KSAC 5AJWA 1ZN7A 4PYKA 5DHAA 3WK9A 1RVV1 3FCSB 4EY8A 3FZNA 4QYWA 4ZCIA 3QX7A 3ML1A 2Y76A 5CT4A 1D1PA 3PFGA 3U7JA 1Q1NA 4CMGA 4X8HA 1SXGA 4GYYA 4UUNA 5TJHA 3JQBA 1SXJD 3RS3A 4TS3A 5EXPA 1L7MA 3SD7A 4K9RA 3EASA 1L6RA 4IXNA 3ILHA 2AR7A 3EE6A 3QPDA 4JLOA 2JFGA 4IHJB 1IXRC 3T94A 5LA6B 4JB0A 1QJ4A 4G25A 1FRZA 1I3OA 3W6PA 2NXEA 1ZUIA 4IUDS 5I7FA 3KSDO 2FN9A 1H2BA 1LF5A 4MVJE 4RKFA 1RWQA 3L0OA 3OJWA 1JA0A 1EP3B 2CJFA 2YFHA 4RFVA 1OFIA 2IUUA 4D9MA 1XB2A 4IDHA 5JBIA 4PXYA 2BSQA 5LA6F 1NVFA 1Y6QA 3OOHA 4ZYXA 1P1BA 5CEJA 2VNAA 2Z57A 2R1UA 3P52A 1UXJA 4V0NA 3EDCA 1XXHB 1HURA 1KDPA 3P2YA 4M99A 5FORA 3VR3D 3LV8A 5DI3B 4FYMA 3HXOA 1SCJA 1PTKA 1SURA 2DFDA 4RC9A 4CN9A 1BDIA 1IL0A 4I9HA 3UFBA 2OXRA 2ZUBA 3DLIA 5EQDA 5EINA 421PA 3K53A 1E5XA 1GL7A 3TW8A 3UF0A 1WEKA 1DKQA 5I01A 2VAVA 3LHIA 9MHTA 3WK6A 3ZX4A 4FU0A 4UKDA 4KVGA 3NWEA 1CJBA 1B8UA 2P3OA 3UK0A 2FVYA 1NVGA 2OXTA 1NM5A 4C7MA 1J1ZA 4B71A 4CGYA 5D87A 4Y18A 4EQZA 2R1ZA 3A2NA 3MMSA 4M7RA 5J4HA 4LE2A 3AHEA 2FK8A 1X1EA 3TDNA 1RM5A 5KSPA 5K8IA 1C1HA 2ASVA 1KRHA 3D7RA 3SFZA 2LCIA 2WM3A 3SZUA 1KYTA 3TNLA 4CFSA 3MGCA 1JQDA 4MUBA 2WQ7A 5HZHA 1JIXA 2I1WA 4CBVA 2DFVA 4F96A 1GLNA 3EFBA 1V3UA 1HG1A 3UCFA 4HEA6 1Z63A 1BCSB 3D8SA 2ZSFA 4Y0AA 2NO7A 3WTBA 3QVUA 4R5MA 5IBCA 3PKIA 2WWYA 3WNBA 1E3WA 1TUBA 2FEWB 4IEFB 5K0EA 1Z17A 1N0WA 4N8SA 4BNHA 3HN6A 2OO7A 3WMFA 1EFKA 1ZM9A 2QX8A 3QKUA 4TYMA 3EVDA 4GZMA 4J2OA 1KZ4A 2JLRA 5REQB 3A4YA 2QW8A 1UDWA 4L50A 1H2ZA 1CUVA 4MS4B 4QYTA 4C78A 1OH7A 4L51A 1DADA 3CEAA 1XVAA 3F6RA 5CLJA 2WVGA 4D9GA 3OZGA 3SC3A 5JAIA 3RUDA 1E1CA 1MZVA 3BORA 4LHWA 1TJ4A 3O5AA 4MW6A 3ORQA 1V16B 4P82A 5AVWA 2H65A 2BRUA 2BZSA 4EYSA 3F2VA 4EUEA 4J0FA 1M2EA 1IPFA 1OX6A 2P8SA 2YVLA 3RRXA 2G5TA 5J63A 4EI7A 4ABYA 5KTYA 5TMBA 1Y9DA 1O9HA 2QPAA 3J80A 1TAUA 2PRYA 1XG5A 3DM9B 3PK0A 1XOIA 3L7MA 3CZRA 2BGJA 3ECCA 2AG0A 3GZNB 4LY6A 1JMKC 2C61A 2J87A 4NJEB 3UOWA 3AZQA 2QTNA 4ZGBA 3WOHA 1GPMA 3KSUA 3H8JA 3UT0A 1UC4B 3O82A 5B55A 1N7GA 4HT3B 2GGSA 4C0JA 1E69A 3C74A 2DSTA 2D62A 2R44A 2MSKA 3FVTA 1GN8A 4NOKA 2XE8A 3DV2A 4L5AA 4YWHA 3TLGB 2FN3A 3D4BA 4D9KA 2ABWA 5T4HA 3RVDA 3FYUC 4P3OA 1PFYA 4AY6A 1MEEA 2VT3A 1X2EA 2YMPA 4ID9A 3RFFA 3ROKA 4J0QA 4ETWA 2JEZA 2JJQA 4LF8B 3GRPA 4U5XA 1YRQA 1H8EA 4YMSA 5CDUA 5INTA 2GAIA 1BMDA 3RB8A 1EWVA 1Q6ZA 2YZKA 1ZLYA 3R5TA 4LYEA 3TTUA 3KPWA 1QQBA 2PUWA 4K6FA 3M9WA 1NWCA 5D5QA 5C8ZA 1EQAA 4YRMA 1TCVA 1F8UA 2DBRA 3EOZA 4GIBA 4Z9XA 1CERA 1E5TA 1VIMA 3ZHSA 5CU7A 3AHGA 3DMGA 1ZO8A 3HWX1 4ZN6A 3JU3A 2JCXA 2F3PA 5IT9A 4YV1A 4JUFA 4H1TA 4V3BA 1QQAA 3BIXA 2HV9A 4A23A 5F64A 4PNEA 4S2UA 5FR1A 2QLJA 2WKWA 3U6KA 3LX4A 3OEHD 1UJ4A 1IM5A 1P2UA 3D1LA 3KQPA 1VBFA 4K9KA 1GJRA 1NLYA 5IAEA 1A9TA 1P6QA 4Z4GA 2EBHX 4RQUA 2HC9A 4J76A 5F2OA 1U28A 1QANA 4KH0A 1T25A 4C7KA 4GKVA 1MB2A 2HT1A 2X2FA 2C77A 1Z5PA 1RCFA 2GYWA 1R00A 3A8TA 2ZUUA 4CU5A 2R60A 2YFYA 3HADA 1NUQA 4JLPA 4P8RA 1TYEB 2CJYA 1BWPA 5KOJB 1AF7A 5H8WA 1XMOB 2IGBA 5K3SA 1AJEA 4WCFC 3LX6A 1BFUA 1M34E 4O33A 2OKGA 4BO0A 5BN4A 1QIDA 4MVJM 1IXKA 1JHQA 1ZIYA 1E79D 3RGWS 3T4UA 5BRAA 5FPPA 4PLGA 1G17A 1ODIA 2WFLB 3EDQA 5CHEA 1NN0A 1VXOA 4EATA 1ZICA 2YTZA 2P6RA 2NP7A 2B82A 1TJ3A 1VL0A 3UWMA 1CUEA 1F5NA 3UOAB 4AZVA 1YA4A 4YRNA 4ZT6A 1RLMA 4FMBB 1BOOA 3R9XA 1GKIA 5CD1A 1GZSA 3GAZA 5T57A 1IG0A 3UYKA 2RGRA 4Q9NA 1GLVA 3TQFA 4QKQA 4DCCA 3A70A 4U00A 4BMSA 4DABA 1UFQA 3IOEA 2FW1A 5AI6A 4BATA 1QH9A 2QY9A 3IQEA 3K2IA 3PUJA 4R2JA 5H68A 5FLKA 2RGDA 4RTRA 3GLGA 1J0EA 1XDBA 2WR8A 2VH5R 3QU5A 3WZMA 4EG1A 4IJWA 4ALLA 2Y1LA 2OK8A 2IPAB 1TKCA 3HCAA 4KJZA 5AVVA 3CGWA 3SSMA 1S4QA 1YS6A 1XNGA 4CCAA 2ZYTX 4RANA 2GXSA 4YH1A 3JWEA 1F12A 1XEWY 2C5SA 1LBSA 4WDQA 3UHJA 1XD2A 1HDIA 4IDAA 5E9WA 1WUTA 4CLHA 4J43A 4JXJA 3ZZ1A 4JGIA 2J0UB 1E6LA 1RKQA 4BMYA 1E5VA 3MWFA 3ORSA 3ZQKA 5JRZA 3I8SA 2BE9A 2WSSD 3MJHA 3CT6A 1J0AA 3DWFA 4DE5A 2F17A 4J0DA 3AUSA 1TMOA 2FLVA 2FRDC 3OQJA 5IYZA 2QTHA 2ZBVA 2HB6A 4D4LA 5FPTA 4LX0A 5DTQA 1CR4A 2G83A 2XQJA 1XU4A 3FPGA 1K6XA 4HWOA 1ZSVA 4EG4A 5EKSA 5CVUA 4OG2A 4KKVA 4LGVA 4UEQA 3OAAA 5FL3A 5E7QA 4B3IA 1BS1A 4U0KA 5B7PA 3RKUA 1FNCA 3R6DA 1IMJA 2ZRCA 3BMNA 1ULAA 2JJ8A 3UUGA 1B76A 4NL4H 4URZR 3WHKA 1DOAA 2VAMA 2XQGA 1NG1A 3OZAA 3O2NA 2I5PO 4LNUA 4M7PA 2EOAA 3GLHE 3VHRA 1UJNA 1AV6A 4QNNA 2FWRA 1RYMA 2K4MA 1ZU4A 4JI5B 3ZOKA 3FFWA 1XJCA 5AMXA 1JAXA 1SA0B 1SULA 3QOFA 1BXGB 4AJIA 3JQ9A 1VCNA 4FD2A 4A03A 2OQ2A 1JUDA 1T1EA 4W1RA 1KDRA 1ZHHA 4W5OA 4DLKA 4XM0A 3FOZA 3BD9A 1RQ7A 4IIGA 2HWKA 4PPYA 3ADCA 2QUKA 1QVRA 2XQKA 2JGDB 5DNUA 1V1MA 1EP9A 1HLPA 3ESCA 1MQ9A 2ZAMA 2NQ8A 4FCWA 5DE3A 1FRQA 4JUBA 3ANSA 4B2YA 2PAFA 5JJKA 3EFOA 3HCFA 4R1NA 3FTQA 1M66A 4J1NA 4K5QA 5HFNA 5KKNB 1P8AA 1M10A 1FNDA 4JLDA 3OZUA 3PFWO 3REQA 2VJOA 4MYUA 2QWXA 4ZJPA 3HRHA 3QLUA 2BGLA 3AWIA 4ILKA 2EARA 1ZFNA 2GWRA 3EY4A 1SVMA 3DHVA 4MPPA 2H06A 4XOUA 4ZQHA 4LYHA 5CLLA 3VBCA 1GQQA 2OHIA 2RGXA 4L9RA 4O2BB 3WGMA 2CZQA 1U0BB 3KU1A 1F4PA 4ISBA 1P77A 4GXRA 4MVJA 1IEXA 1PJCA 1AOXA 4YUWA 5ALNA 3D9QX 3A05A 4RESA 2NYRA 3U48A 5JCPA 3LX5A 3ICWA 4EI2A 5CVJA 3TE7A 1P9OA 1ELOA 2W0MA 5A1JA 3A1DA 2ZE5A 1J56A 2KYRA 2Q5CA 2WPDD 1XA0A 5IS2A 4NBVA 3VPXA 3W78A 4HDRB 3KHSA 5EWMA 5A3QA 2AXQA 1QRAA 3MT7A 1JLLA 4C0HA 3WRWA 3WVNA 1DV1A 1APBA 1LLFA 5EJEA 5DN9A 4HYTA 2I6FA 5C8YA 4M6WA 3SQOA 2AFHE 1ODJA 1A5BB 3SIXA 4HB0A 3TZEA 4DL9A 3E35A 4BZXA 2PZBA 2H85A 3MUOA 5F5LA 4EP1A 3B7GA 1EM8B 1II0A 2A59A 4O2AB 4HQ0A 1JE0A 1U6JA 1RTKA 2FWNA 3MW8A 3G2JA 4EGJA 3ME5A 4OJKA 5FLEX 1P5JA 3CRRA 2OILA 2PEZA 3PYMA 4DJTA 2OFPA 1N3IA 5C9ZA 3DUFB 4UJ5A 1SGWA 2Q4TA 3RFCA 1II9A 1Q20A 4O2AF 3ZJ5A 4M0DA 4TRJA 1GRRA 5FV7A 1SXJC 4MV3A 3VOSA 2CSUA 1JPVA 4IIFA 5ETJA 4LFCB 5CLGA 1Y8RB 2WM8A 2XVXA 1CZHA 1U8TA 3BD8A 2J4DA 3DO5A 4F92B 2ZIXA 4AN0A 4FDUA 3PIIA 4J6EA 1W52X 4U2BA 3IDQA 5B6JA 4A4DA 1HT2E 4RF3A 2W2KB 4RA9A 1VZ3A 4TT8A 1W1IA 4XASA 1XRNA 5FUWA 3TRDA 4AP6A 3A4IA 4KQ1A 4PSVA 1RLOA 4DMFA 3KT8A 3VZDA 4YAUA 3C43A 2YXBA 3BMOB 2I9KA 1K2WA 5KO2A 1T2FA 2FV8A 4Q39A 4LYGA 4RFSA 2FUKA 4MWZA 2W2LA 3T54A 3VM6A 5FBLB 2AZMA 2ZRFA 3IUEA 4JROA 5JYEA 1DJMA 2QT9A 1Z56C 1KSJA 1S6YA 1Z4IA 5LDHA 2I3ZA 1QHHB 2JJMA 1E20A 3EWNA 3UFXB 5MFZA 4Y0NA 1N0UA 1QAOA 2JBHA 3Q8XB 3R3VA 2R7LA 5FWAA 2WVJA 1TEVA 4Z1OA 1Z29A 2DERA 2HI0A 3LAWA 1QU3A 4BP1A 4IIEA 4MRPA 4AJNA 5CFOA 3R8XA 2E2WA 1BQEA 2AYYA 4UNRA 1TMKA 5G0TA 4YRKA 3O95A 2WHQA 5EUQB 1DB3A 3PRHA 2PYDA 2HYIC 4G0WA 4J1SA 2WDPA 1QZUA 2JIZA 3N8DA 4J4HA 4TRRA 1A76A 1G8YA 1KMIY 1CJTC 1TEHA 1Y6ZA 2NACA 3K2BA 3QU4A 4ZEMA 1NW7A 2IDJA 1QO0D 2JI8A 1DEHA 2JK1A 3CIOA 3MQFA 4HLNA 4OK6A 1GUBA 4EG7A 1OYOA 1KNXA 3FMOB 5FI1B 1YWGO 1G5QA 1MG0A 2JJ2D 3VTZA 4CHGA 4E3WA 3EGOA 1QNFA 4OBWA 4RQTA 3GOQA 1ZW6A 3ZR4B 1H0RA 1BMQA 3E70C 1P3Y1 3I4CA 2CVOA 2ZUCA 1N6KA 5CG1A 1V37A 2PLWA 1RKXA 3BFXA 3LUKA 1U2ZA 2WKRA 4JNKA 5AW3A 3PCTA 4HVTA 4NJMA 1JYFA 3BE4A 2APJA 1E94E 3PFFA 4L85A 4OLHA 4Q4HA 4QXQA 4M38A 5CT9A 5E4FA 4DDWA 4Z7OB 2RBEA 4EB6B 2V5AA 2I78A 4FOTA 4AY4A 2HJGA 1EYZA 5EPEA 5K4GA 4JKIA 1K3UB 8AT1A 4B3MB 2C97A 4EFLA 1AT1A 1Y48E 2GJ8A 1YVDA 1SUAA 1MU0A 3C14C 4YRIA 5JIBA 2V6BA 2YIJA 1L5WA 1Y82A 4MDEA 4QYIA 4OHMA 1U4SA 4P93A 4DUYB 3DHWC 4HZUA 1LX6A 1BIFA 4OU4A 4W8GA 2OYRA 5LP6B 3QQPA 5AQEA 3GJSA 3UWPA 4J4TA 1Z2EA 2DU8A 2QX9A 3OKPA 3VVLA 3MBKA 3GLIB 3GU3A 1RKVA 4C1NA 4QFCA 2W2MA 2A9VA 3CUTA 1DQYA 4JV5B 5TS2A 1N5OX 4W8OA 3U9LA