4Q3OA

Crystal structure of mgs-mt1, an alpha/beta hydrolase enzyme from a lake matapan deep-sea metagenome library
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
317
structure length
317
Chain Sequence
EVPIPQSISAEFKAALAQYPTPSVEEARSFVPTTAAQWRDYVQATNKMQKTKIKNMRKHYGVTVELLDIKGVTVRKITPKSLSPEFKDHVYIDIHGGAYVLFAGLPSIEEGILIAHRLGIVVYSVDYRMPPAYPFPAALDDVKHVYRVLSQQYDANHIFMGGTSAGGGLLLAFVQGLIENGVATPRAIYAGTPWADLTKTGDSLYTNEGIDRILITYDGTLGASARLYAGNTPLTHPKLSPIYGDFTDFPPTFLVTGTRDMFLSDTVRVNRKMRDAGVTTVLDVYEGLSHADYLVSHQTPESQSVYRQLKRFLVGFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MGS-MT1
publication title Pressure adaptation is linked to thermal adaptation in salt-saturated marine habitats.
pubmed doi rcsb
source organism Unidentified
total genus 118
structure length 317
sequence length 317
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4q3oA00
3R3ZA 5YASA 1AX9A 2RAUA 2Z8ZA 1O6FA 3L1HA 2HDWA 3G9UA 2XQFA 3GBSA 3R40A 5ESRA 3S2ZA 4IQ4A 3I2IA 2XUJA 2QMQA 3DS8A 1CUEA 1EA5A 1QIKA 2C5GA 5LP1A 3N0TA 2RGUA 4KRYA 1VOTA 5SYNA 2QKYA 2QOEA 4QDTA 4OYYA 5A7GA 5AM3A 4HRXA 3DYVA 3O9MA 3WKAA 4XWGA 3HEAA 5LZ8A 1UKAA 5A6VA 1XLUA 1W75A 1QFSA 2H7XA 2RI6A 4JH0A 3JYHA 5CRIA 2Z5GA 4Y2VA 2BKLA 1P0MA 4ZREA 5ALGA 4O08A 2HA3A 2WU4A 1L7AA 4X85A 3QMMA 1JKMA 4J7AA 4TPKA 4BP8A 1MNAA 1CUJA 4Y9SA 4XJVA 5AIBA 1FFAA 2XUPA 5H3HA 4OUKX 3GZJA 3D4LA 5ALIA 3H2JA 5C8XA 1L7RA 3QH4A 4D9JA 4Q34A 2C0PA 3I1YA 1H23A 1W4LA 5K3FA 2AJBA 2BUAA 4J3JA 4EB0A 5EGNA 5JZBA 4LYEA 4Y2RA 1TCAA 3A2MA 1EK1A 5FOQA 2C7BA 2PL5A 4H7JA 2HU8A 3ZI7A 2X5XA 1A88A 1IUOA 3H2IA 5FP0A 4ARBA 1PFQA 3ESBA 1BCRA 1XZEA 2ZYIA 5T4EA 4HZGA 2G5PA 2ZJ6A 3G0IA 5E2IA 1W52X 4KJXA 3M3DA 2WHPA 4ETWA 4DSZA 5ALKA 3WIOA 4QWMA 2ZSIA 3WQHA 3GUUA 2WFZA 1ZD4A 3D5EA 3BJMA 3AJAA 3BDIA 4H35A 1LLFA 4N8EA 5JALA 3DNMA 4B81A 4U2CA 1YAJA 3ED1A 1UZAA 1WB4A 2WFMA 5AM1A 5CT9A 2DFPA 1WHTA 4DMKA 3PF9A 5JD4A 2VAVA 1K8QA 3MUOA 4DTCA 3KOOA 4J0GA 1QFMA 3PI6A 2VA9A 4QWWA 4QNNA 2H1IA 3ANSA 1QIIA 4UFPA 5EI5A 1JMYA 1EB8A 4FBLA 3FLAA 4KACA 4Y2YA 5AI4A 5D7BA 1WCYA 3CCBA 2PM8A 4FBMA 5ALMA 4QLOA 1ZIYA 1CUZA 5FXMA 4HXFB 1YASA 5C8VA 4EY4A 2OAGA 1MAHA 4OB8A 3AIOA 3WA7A 3QBJA 3C8HA 4UFNA 2WKWA 3QPCA 5JARA 3U0VA 4PSCA 1UWCA 1XZMA 4EY6A 1XRNA 1GZ7A 1JMKC 3WIBA 3DL7A 3HZOA 1ZD2P 4C4ZA 1XZCA 2ZVDA 4BB0A 4FLFA 3GELA 1ORWA 3H1AA 3DLTA 1EDDA 4DMHA 1ZOIA 4OPMA 2JBWA 4BCDA 3WK8A 1ZI9A 3V1NA 4BZWA 2WLSA 1XLVA 1MX9A 1YB6A 2CZQA 5AO9A 2O2IA 3GA7A 4N8DA 2VSQA 1VJ5A 1WM1A 2EDAA 4Q3KA 2RHTA 3SC2A 3OURA 5KWJA 5JANA 2GBFA 2GBGA 1R9NA 5D6OA 1R88A 3LCRA 5I9IA 1QIGA 1CLEA 4INZA 4TGLA 4IH4A 4UUQA 3IULA 2CMFA 4DMFA 3G0CA 3STYA 5CMLA 2J3DA 4FDMA 4I3FA 5IH7A 1UK8A 4BAUA 1JU4A 1R1DA 2P8SA 1H2ZA 2HFJA 1YAHA 2O7VA 4J0IA 4ZV7A 3TRDA 5FDFA 4DMCA 5K3EA 1NU6A 5JAOA 1RP1A 3H2KA 3D2CA 5AKGA 4A16A 5HQ3B 4F60A 3JW8A 3QMWA 1XZKA 2JGFA 4FLMA 2ACKA 2PUJA 1CUWA 1IZ8A 4JUIA 3W9UA 3D59A 3B12A 1QOZA 5AI9A 5AKIA 3ZLVA 4J0CA 5BV7A 1EB9A 4H77A 2XMBA 4GHWA 1DT3A 1VZ3A 1UOPA 1U4NA 1GXSA 4U2FA 3ICWA 5ALZA 3PFBA 4PSDA 3MVEA 3CXUA 5CT8A 4QEKA 2XDWA 1ISPA 2BGRA 3FLEA 4FFWA 3DKKA 2PSFA 4E11A 4J0KA 1MN6A 3A2NA 2XMSA 3FBWA 3F8SA 3WL7A 4G4JA 1VA5A 4KRXA 1J1IA 2BUBA 1R4ZA 5ISMA 1DWQA 5LLSA 1H2YA 1XRMA 2LIPA 5CT5A 4EY8A 1UFOA 4Y2PA 3U1TA 2VJDA 4CCWA 1QO9A 1BRTA 2GZSA 2OCGA 3PFCA 3QPDA 4DSAA 3I6ZA 4AO7A 2QM0A 4CCYA 1VKHA 5JAHA 3F96A 2GBCA 1LPAB 2J4FA 3H0CA 3STVA 2C0QA 2VT7A 2JGMA 1GPLA 5HF5A 1CUXA 1VE7A 1CUCA 1XFDA 4Q05A 3G8YA 1DQYA 2YXPX 3FSGD 2HA5A 2WTNA 4CFSA 4N8SA 4QA9A 5AI5A 3IUMA 4ZXFA 4G1FA 5FLKA 5D3KA 2HFKA 2OAEA 4UPDA 3TGLA 4BE4A 2R8BA 1RWQA 4DIUA 1GKKA 4X91A 2XUHA 4B85A 1R3DA 1XRQA 3TEJA 3HC7A 4CI9A 1QJ4A 3I1IA 2IX9A 3ZLTA 1WPXA 1LNSA 3CN7A 4B7ZA 1LPSA 3STUA 1SCKA 4Q3OA 5JZSA 1CUSA 5T4HA 2DQZA 3C8DA 4E14A 1MT3A 1EDBA 4EUSA 4DNOA 1LBSA 3WZMA 4GDMA 2K2QB 3I6MA 4UHCA 4Q3LA 5AKLA 1LPOA 4AQDA 1YS1X 4NZZA 4XIIA 1MTZA 1W76A 4CIBA 1Y7IA 5AI6A 4DYHA 1VLQA 2WHRA 1VA4A 4N5HX 3ZV7A 2HU7A 3W04A 4BC1A 5AICA 1FJ2A 2WJ3A 5DYYA 3WWEA 1N5MA 1J06A 4OSEA 4W63A 4UFOA 2H7YA 3Q0TA 5A7HA 4FNGA 5EHXA 3STWA 4PNZA 1AKNA 3AILA 4WFKA 3WJ1A 4AO6A 3IA2A 5CH8A 3E0XA 4AN0A 3WWDA 2I3DA 1G4HA 4BYMA 4YPVA 5CT6A 4G9EA 2ZSHA 5CH5A 1P0PA 3V9AA 4KAJA 2CUTA 5DWDA 4BC0A 1GT6A 2E3JA 1AC5A 3Q8WA 4RGYA 5JAUA 2VQ6A 4EBBA 5BWBA 3R41A 5AI0A 4X6UA 2OCLA 3OPMA 4FHZA 5HZGA 4GBGA 3C6YA 4Y2XA 1JU3A 2XMCA 5T4BA 2WU3A 4GLBA 4G8CA 4UBLA 3LLCA 2QS9A 2CBGA 2BGNA 5DLPA 5A62A 2FX5A 3OM8A 5C7YA 2WIDA 4G8BA 5FUMA 2HA6A 5AKXA 2XE4A 4KE9A 2DHDA 4I4CA 5ALSA 4BVKA 3G7NA 3I2GA 5K3FB 5DTJA 1N8SA 2GYVA 3VJLA 4KR0A 1CVLA 2BJHA 2OCIA 3WJ2A 4MYSA 4QDZA 1USWA 4IO0A 4AN1A 5HCUA 1JJIA 3WWCA 2O2HA 5DNWA 2ZJFA 4WY5A 2WUDA 3BF7A 2Y1KA 1NU8A 2XMZA 4UBJA 1Q84A 4BVJA 3C45A 1CUGA 3L1IA 2B20A 3FAKA 2HA0A 5FPQA 4F5ZA 3IVMA 1DWOA 2V9ZA 3BF8A 4GI1A 4IHAA 2WHPB 2OLEA 2I78A 1XZHA 4X93A 2HA7A 3V48A 2WG2A 4JNCA 5EFZA 3O4IA 3ZWQA 3IIIA 4QDUA 5E4JA 1K63A 2XUDA 3DEAA 3I28A 3NOXA 5ALJA 4U2BA 5ALNA 1DWPA 1H22A 3E3AA 5FV4A 4BDTA 2XLCA 1BN7A 2BCEA 5LKRA 4P92A 1UKCA 3WWOA 1QIHA 1XLWA 2PSDA 3WA6A 2QRUA 1MX5A 3TJMA 2OCKA 4UBKA 3QPAA 1X2BA 3T52A 4OYLA 1FFEA 3E4DA 1BN6A 1H2XA 2RIPA 3BDVA 2AJLI 2W22A 2XUGA 4ARAA 3WK9A 3FLBA 3R3VA 2X8BA 2GZRA 5EHNA 2FJPA 4U2EA 5AP9A 2DHEA 1O6GA 4K6GA 2CB9A 4ZGBA 3H2HA 4FWBA 2PSJA 4C4XA 5AKJA 5IKXA 1EX9A 4HXEB 1CUBA 1OCEA 4BATA 3S8YA 1N1MA 3I2KA 2VJCA 3FNBA 5ALLA 2C4HA 3F67A 2WIJA 3WL8A 2X76A 3QYJA 1YSCA 1UOQA 4W1PA 5T4FA 1VE6A 4MWSA 1Y37A 2XUFA 3QVMA 1FFDA 5D3ZA 4B80A 1SCQA 1E89A 4G9GA 4UHEA 2O7RA 4AX4A 3BIXA 1CQZA 1CQWA 2D0DA 3IBTA 3K6KA 4KE6A 3ESCA 3F97A 5K5EA 4FOLA 5BOVA 3O95A 4F21A 1LPMA 5LYYA 1UOOA 1QIFA 3HSSA 2XQGA 4BBZA 4F0JA 4C88A 2WIFA 3PICA 4JYMA 1L7QA 1HLGA 3GROA 4QDOA 4P9NA 5AOCA 4I19A 5CXXA 2PSHA 2XQJA 4AB1A 3K9BA 5LZ5A 1XZFA 1E8NA 5AHXA 4LHEA 1MX1A 3ZPXA 3D3NA 1E5TA 4C01A 2Y6VA 1EINA 1EDEA 4AMZA 1M33A 1U2EA 4Y2TA 5LZ4A 1TAHA 5I8PA 4RNCA 1MNQA 3EQ8A 3NGMA 4MQLA 3UUFA 2QVBA 1QO7A 3FYUA 2PVSA 2HM7A 3LP5A 2HA2A 5F4ZA 1T4MA 3FYUC 3PUHA 2JF0A 2WTMA 2EEPA 2PX6A 1LZLA 5EIAA 1TKRA 2XUIA 3BJRA 3CN9A 3C43A 2PKYX 3IURA 4G8DA 2JGEA 1A8SA 4PV7A 3DOHA 1OXMA 1SFRA 2HADA 2AJDA 2G4LA 3D7RA 3G0DA 5ALEA 4P93A 4BRSA 4WDRA 3VDXA 5AKEA 3WLAA 2YASA 3SWWA 1CUDA 4KE8A 3L1JA 4GECA 1CUIA 3AUKA 3HI4A 4QLAA 1BROA 4W9RA 4X95A 1XZLA 3HJUA 2ZJ7A 4A5SA 2HRRA 1EK2A 4NMWA 1UT6A 1IUNA 1Z68A 5DNUA 5AK3A 2RONA 3VVMA 1CEXA 3BIWA 1YA8A 1U65A 2W6CX 4J03A 4AXBA 4AZ0A 4EA6A 3EQ7A 4OU5A 2DR0A 4ROTA 3M83A 4M0EA 1BEEA 3C70A 1IUPA 1QONA 2FUKA 1EI9A 3A2LA 2YYSA 2VT6A 1WPRA 1CUUA 1DINA 3O4JA 3K2IA 2J3QA 1BEZA 3UMJA 1J07A 4ZRDA 2AJ8A 4X90A 4LXGA 1ZIXA 4XVCA 5AK6A 1I6WA 4UBOA 4KAFA 3ILSA 2JGKA 1UKBA 4X6XA 3IB3A 3EF3A 4CCYB 3SK0A 2WG0A 3G9TA 1QGED 2QJWA 2JEZA 5HF8A 3OTQA 3RKSA 3LS2A 2D5LA 4BAZA 3DL4A 1ACJA 4KEAA 3AIMA 3M82A 5K3BA 3C6BA 5ALFA 2OGZA 1ZJ4A 5HK9A 1CUFA 4J0HA 5A7FA 2WFLB 4H18A 5EIEA 3O9VA 4BCCA 1A8QA 3MUNA 3FVRA 3A6ZA 4E15A 1VZ2A 4V2IA 4DGQA 1CUVA 2GYUA 1PV1A 3STTA 5ALYA 1MU0A 1CFJA 1DQZA 2AJCA 5FKJA 5FRDA 1K5PA 3MGAA 5C8ZA 1X70A 4FKBA 3EBLA 2CJPA 2WG1A 1MPXA 5JAPA 1ODCA 4BP9A 4H7IA 3G0BA 1J2EA 5DYTA 3OC0A 3D2AA 3EIOA 1DTEA 1YB7A 4KAAA 4W1QA 3DQZA 5ALTA 1AUOA 4ZI5A 2QJRA 3O4HA 1HKHA 4HTAA 4GWLA 2G63A 5ALDA 1HQDA 3DD5A 3IUNA 4B6GA 4FFVA 4X97A 3F98A 2DCMA 1W1IA 3KDAA 2ES4A 4HS9A 3FCXA 3LIPA 3WWPA 3AZPA 1HPLA 1VXOA 1QLWA 1ZJ5A 4L3WA 3IUQA 1QE3A 3C5VA 3PE6A 3P2MA 5LZ9A 3I2FA 3H1BA 4H7DA 4AZ3A 2VTVA 3B5EA 1YA4A 1K6EA 1AQLA 3WK7A 4RE5A 1WB5A 4GEGA 1DT5A 1IZ7A 3VISA 3H2GA 5ALQA 1UK6A 5EHQA 4U2DA 3WI7A 4X92A 4L9AA 3A70A 4B0PA 1LBTA 3G0GA 1B6GA 4JEIA 4C4YA 1WHSA 1THTA 3QITA 5DNVA 3GFFA 5JZ9A 1QIDA 2G5TA 4X94A 1QIMA 5K3AA 1XZJA 3R0VA 2OXEA 4LKOA 1KU0A 5AJHA 5KREA 2PBLA 1F8UA 5ALPA 1ZICA 3D0KA 1WB6A 4K5QA 4X7BA 4ZV9A 3VVLA 3G9ZA 3I2JA 5AH0A 5AI8A 3WMRA 4MQMA 2DHCA 5AM5A 1QIJA 4DLNA 1TRHA 2C5FA 3W2TA 2VATA 5DJ5A 1UXOA 4AO8A 2VEOA 3ZLUA 5J3JA 4AMYA 1ZGCA 4L72A 4C89A 3FYTA 2HL6A 1S8OA 3R3UA 1ACLA 1JFRA 1GQRA 5AKHA 1GKLA 4B0OA 1AGYA 4B9EA 4N5IX 3FSGA 3D2BA 4W1SA 3HRHA 2HRQA 1XROA 2JGIA 4Y2JA 2WJ4A 3QMVA 2XQIA 4BVLA 3KWFA 3H18A 2ROQA 4QDXA 4Y2UA 3DKRA 4B84A 4J0DA 3BXPA 3IUJA 4BCBA 5LIPA 2OQVA 3DCNA 4Y2SA 2XMQA 3RLIA 4YX9A 3WZLA 1QTIA 1HBJA 2WIGA 3ESDA 2WIKA 1N5RA 3HACA 1RYYA 1DX4A 1GGVA 2C58A 5CH3A 2HU5A 3R3YA 4KYVA 1QIEA 5AK4A 1XKTA 3WKBA 2Z8XA 3IDAA 4UHHA 6YASA 1CR6A 1E66A 4B82A 2BFNA 4UBIA 3W9BA 1G66A 1CV2A 3HABA 2ONCA 5JADA 1ORVA 5C81A 3AZOA 1SC9A 2XQKA 3PDCA 5EIHA 2HHAA 4FMPA 4UHFA 4BDSA 5HF9A 4YK7A 2QXUA 4OD0A 1CRLA 1QZ3A 4K2AA 1F0PA 1CIJA 1Y7HA 5JATA 2QTBA 4IH1A 3YASA 3DJYA 3RM3A 3VKFA 2Y2VA 3C6XA 2B9VA 1H2WA 1THGA 4U2GA 1FFCA 2WILA 5AKKA 2QUAA 3WYNA 1EVQA 4QE3A 1ZD3A 5AM0A 2PU5A 4K6HA 4HAIA 5AKYA 1JJFA 4PQEA 4E46A 5DYWA 4UBMA 5A71A 5IVKA 3PUIA 3ANTA 4FLEA 2R11A 2XUKA 4DNQA 1UK9A 1C7IA 3V1LA 1XQWA 4HVTA 2O2GA 4J0JA 4K6KA 4HXGA 2UZ0A 3N2ZB 1CPYA 4EHBA 5IVHA 3F9CA 2PU7A 3H19A 4Z49A 1R50A 2FJ0A 4NS4A 3LIIA 1ZI8A 1IVYA 5ALRA 1JI3A 4WDQA 2I3ZA 4BAGA 2JEYA 5CT4A 3AINA 5E4TA 1BE0A 5HF6A 1K4YA 5SYMA 1E8DA 1XQYA 2VJBA 4WFJA 1YCDA 5HFNA 4OB7A 1XZDA 3DOIA 1XRRA 4L0CA 4XX1A 1LPNA 2BUCA 3WYDA 1LPBB 4QZVA 2GYWA 3B3QA 4MWTA 1IMJA 2OGTA 5LKAA 1XQVA 1C4XA 2B61A 2Q0XA 4UBNA 3FYUB 2QT9A 1KEZA 3R3XA 1CUAA 2XB6A 4OU4A 3BE8A 2QXTA 4H7KA 4PO3X 4H7EA 4P08A 4X3CA 4BTLA 3VJKA 5KWIA 2JGLA 4MJ3A 3KWJA 3O4GA 1LPPA 2JIDA 4S0XA 1HL7A 3C5WP 4MEAA 5HKBA 5KBYA 5CXUA 2ZYSA 4LXHA 4TVKA 4A23A 2I03A 4BZZA 3G9XA 1SCIA 4WJLA 1P0QA 1G5FA 2ZYRA 4LYDA 5AM2A 5JIBA 3UUEA 1MJ5A 5AOAA 1ODTC 2V97A 5CURA 1MO2A 4G4GA 3V1KA 1ODSA 4IH9A 2XMGA 2HIHA 4BRZA 4DNFA 1CUYA 4C6HA 5AKZA 4EY7A 3STXA 4BE9A 2WUFA 3OG9A 1GPNA 1C7JA 1NX9A 4LXIA 4JYPA 3T4UA 4H0CA 3EQ9A 1TCCA 2BAGA 3WK4A 2IIVA 2XT0A 4OCZA 5K3DA 4FTWA 1D07A 5LZ2A 3DDUA 4X6YA 5CW2A 2CEKA 3FWHA 1F6WA 1DU4A 5A2GA 1XZGA 1A8UA 4M0MA 3CCCA 2OGSA 1TQHA 2Z3WA 4G5XA 3ICVA 4DNPA 1XRLA 5ALXA 3O0DA 1TCBA 2VJAA 3M81A 2PUHA 2Y2UA 4GXNA 2YH2A 1GQSA 4B83A 2XUAA 1EHYA 5ALOA 4X71A 1PJAA 2J4CA 2WHQA 5HQ3A 2WM2A 4CG1A 5CBKA 5AOBA 2IITA 4MYDA 4NVRA 5FPPA 4C87A 1Q0ZA 5AK5A 1CUHA 5CTAA 1ZD5A 2EDCA 3X3HA 5DTIA 1EH5A 3KSRA 1YS2X 2QZPA 1BU8A 3ESAA 2NW6A 1MAAA 2ACEA 2DSNA 2XMRA 5AM4A 1XKLA 1R9MA 1EXWA 4Q82A 1P0IA 2WUGA 3AZQA 4DM7A 5EHZA 1F0NA 3FOBA 1XQXA 1XRPA 5JD6A 3WKEA 1ETHA 3WK6A 1XZIA 4ITVA 4WFIA 5HKAA 3HLKA 2CKMA 4RPCA 1WOMA 3AIKA 4ZWNA 3I6YA 3DYIA 1JT2A 2H7CA 4H7HA 1ZI6A 2GBIA 2RHWA 4PF1A 4UHBA 1EVEA 2AXEA 3FCYA 1XZBA 3SX4A 4KE7A 5JYCA 3HXKA 5ALVA 5I7UA 2ORYA 2WUEA 2H9YA 3VJMA 5ALUA 5JASA 4WCVA 4UHDA 3E1GA 3I2HA 4G4IA 2WSLA 4X00A 3C6ZA 4WY8A 3QM1A 2PSEA 5ALHA 1HDEA 1LZKA 3KXPA 4GW3A 4CG3A 4MXDA 2VAXA 2OQIA 3QZUA 1E8MA 4FNMA 4OB6A 5LZ7A 3BL8A 2WFLA 3OOSA 3C87A 3H04A 4YASA 3NUZA 1TIBA 5HK8A 2HA4A 2DQYA 2XLBA 3KD2A 1W6RA 4Q1VA 2PPLA 3FVTA 1Q0RA 4EZIA 5HFAA 1A7UA 2XMDA 2ZYHA 4Y7DA 2VF2A 1LGYA 3RARA 2WJ6A 1FFBA 1G42A 4H7FA 7YASA 3WKCA 4HRYA 4M0FA 1YR2A 1DX6A 1AURA 5JD5A 3G02A 2V98A 1QTRA 3WKDA 4Y2QA 3HYSA 1Q83A 3JWEA 3W05A 2ECFA 1GPKA 2B4KA 1FSSA 5BWCA 1OILA 3R3WA 3NWOA 2XUOA 1BS9A 1JJBA 4PSUA 4CIAA 1UK7A 5K3CA 2JGJA 1U8EA 4BTVA 3RK4A 3V1MA 2OG1A 4B9AA 2XI4A 4CG2A 1T2NA 4LIPD 1KU6A 5AIAA 1BCSA 1X2EA 4PW0A 4RE6A 1AZWA 2QUBA 1SOMA 1ZGBA 3PF8A 1B41A 1VXRA 2Z3ZA 3VXKA 4W1RA 3WL6A 3W06A 5IVIA 2V96A 1XZAA 5E4YA 3WK5A 2OPHA 3H17A 3BWXA 1E3QA 2WQZA 1AMNA 5ALWA 1TK3A 4EY5A 2XUQA 2Y6UA 5IVDA 4MEBA 3AFIA 2QR5A 3WL5A
chains in the Genus database with same CATH superfamily
5IAGA 2BFOA 1BS2A 1VYTA 3R3ZA 4KBYA 1YBFA 2DX7A 1AX9A 2EJBA 4PQGA 1Z6GA 1ZGGA 1C2YA 5HOEA 3AC0A 1P1KA 4CHTA 4NV3A 2FN3A 3A9UA 5F7OA 4EYKA 5CTJA 1M2WA 3IVAA 4GMFA 3KT8A 1MC5A 4B4OA 5JY1A 1U2GC 4DV2B 1QG4A 3A06A 5EAIA 1BHQ1 1ZA1A 2EGGA 3WSWA 3G1TA 5EJAA 1CHDA 1NDUA 3TPZA 2VXOA 2J30A 5FUQA 4FGKA 3BTSA 3R40A 3AFOA 2Q7OE 5L3SA 4LF5B 1NNUA 2V8BA 3I2IA 4R68A 2Q9AA 3AG6A 4S1OA 3SMQA 4C7OA 4LX0A 4H4EA 3TB6A 1U3DA 1CUEA 1E79A 1XF9A 1QIKA 3DEJA 2PFSA 2M6SA 4KRYA 4UW9A 5D51S 4UKDA 3ZBTA 1DG9A 1VOTA 3BIOA 2CHVA 4L2IB 1F2VA 2PT6A 2VJPA 2FSFA 1ZISA 2QOEA 2Y0EA 1V96A 4FGWA 4QDTA 2IUUA 1TK2A 4V0OA 2GVNA 2PUEA 4G0NA 4W4TA 4RSRA 5AVTA 4N48A 2NV2B 3E5MA 4ADSG 1ZBQA 1O9GA 1OT5A 1SHUX 2OP0A 3AR8A 4IHJF 4X8HA 1SBYA 1TZBA 3A8TA 1WMEA 3SMVA 2GUWA 2K6GA 5CDFA 2P2LA 1E1QA 1S4MA 2JJ2A 3DYVA 2W4IA 2OGUA 3HFSA 1EAMA 5CFNA 4XVQA 1TT5A 4H59A 3WGTA 1KORA 4B47A 5TF4A 2YCBA 2VWPA 2DRIA 5UKDA 3I9KA 5LZ8A 5LNK6 1A82A 4CTMA 3WO0A 1YFJA 2B83A 5A6VA 5KMGA 2QB5A 1P4HA 2ABWA 4UTOA 1CF9A 5EIWA 3KKKA 3ROEA 2OZPA 3HFGA 4I9UA 4JH0A 1PS9A 3ZD8A 4BQSA 3WISA 1KETA 3M6MD 4DABA 1XCOA 3JYHA 2Z5GA 4FONA 5BN3A 1HI9A 1NZFA 1GZUA 2BKLA 3BL5A 2PZEA 3L5KA 5CAEA 1O9BA 4INJA 3T9AA 5IKMA 3H0KA 4HT3B 3DOUA 1OSNA 1G0NA 2HA3A 1XTTA 1JXQA 1OU0A 2BHTA 2GD1O 3TDKA 1SVLA 1J0XO 5WRFA 3SF0A 5BVGB 4X85A 2WF8A 3WLKX 4YDQA 1ENPA 2QBYA 5KAPA 3IIJA 3BTOA 2CV2A 4J7AA 4DCSA 3CZAA 1AZLA 1MNAA 4CQLA 3DT8A 4FCCA 5JG7A 3GEMA 3TI9A 3ASUA 4R5MA 4M46A 1UC8A 4HO1X 4B6FA 4MROA 3X1WA 1GDHA 1E3MA 3EXFA 4D46A 1VL0A 2FFBA 4IMIB 2HR1A 5H3HA 3V5NA 1YJXA 4A7PA 4LRUA 3FPAA 4HMOA 4GD3Q 4OUKX 3PDJA 4HTFB 2B9EA 1EM8A 1MXFA 4QBIA 3K1ZA 3H2JA 5ALIA 4ALNA 1D1TA 4Q1EA 3FYDA 4K87A 4EB8A 5C5EA 4TMVA 1P2FA 3CFYA 3DULA 3NHZA 4F12A 1NXVA 1YC2A 3ZE8A 3ZGLA 4C4PA 1W4LA 1SCUA 3H6KA 1ZKMA 1EG7A 5ER6A 3VKGA 2BUAA 4J3JA 4MUMA 4NJMB 5EGNA 4AMUA 4A2WA 2VS1A 1JLRA 1TCAA 1MO5A 1WXIA 3U4HA 3S3TA 4YFYA 2PLNA 4QPZA 1OXUA 3ND8A 4KDFA 2MINA 4HAOA 1JQAA 2RCYA 3RWMB 3O93A 5CFQA 3IUPA 4ZQGA 3I9JA 1A88A 4U9HS 3H5WA 3UZUA 3H2IA 2Q41A 5FP0A 2JL1A 4QECA 4DZTA 4P4NA 1PFQA 1KY4A 5A6SA 2WWYA 4DPKA 5H82A 5KCZA 2FOLA 1BXGA 4PLZA 3C3EA 1W8DA 1L5GB 3CRW1 1ZCJA 1Y80A 2P0AA 4D9MA 2VF8A 1F2TB 3GEBA 4WKOA 3JZMA 5KDDA 2ZB8A 1FVXA 1WXWA 3CURA 1EX7A 3GJ0A 4JJKA 1QHSA 3I6BA 2CYCA 2P65A 2BKVA 3TZBA 2BCJQ 3U4GA 1PEYA 4DLWA 3P2IA 1RLMA 2B8NA 4P6VF 4CTJA 4YP7A 1BMFD 2VHXA 4O4LF 3M3DA 1RHKA 1T6XA 2JB9A 4JITA 1G9SA 1P2UA 4GMGA 4DSZA 2Z2KA 5ALKA 1YZUA 4IDFA 2NLOA 3GO4A 1SULA 4IJ5A 2BHSA 4IOMA 1M1NB 4QWMA 4G1VA 1ADGA 2JD1A 3S81A 4E3ZA 1IH8A 3DFZA 1T4DA 3HCNA 3LPMA 1Y4AE 4EH1A 3HA7A 4CMCA 1KEEB 2EU8A 3MS4A 3B1FA 3PL5A 1CZLA 4IPTA 1AXEA 3GLTA 5FJIA 3WTCA 1JA0A 1KAEA 4EB6B 1ULTA 1C3LA 2QVYX 1JIXA 2ZATA 3N53A 4K8RB 3MA0A 4YRSA 3F3SA 1U8AA 4BKQA 5GVSA 3AJAA 3LXUX 3EBOA 3KPYA 5DP2A 5KDLA 2FAXA 1N36B 4YECA 4OK3A 5JDIC 1AUPA 1KFBB 4ZEWA 4EP1A 1YAJA 5JEDA 3F4BA 1R8QA 1FUIA 1S2IA 3DWEX 3ED1A 1W29A 2VO1A 5AVXA 3ABZA 5AM1A 1U99A 5CT9A 5LA6F 1WHTA 1MAWA 4WWHA 2PRJA 2ECOA 2QN8A 2Y1OA 3R7LA 4DMKA 4JOBA 3ET4A 3DAFA 3EBPA 1QK5A 3PF9A 3ZVLA 4A0RA 4CM9A 5FAXA 4AS1A 5JUWA 3RUPA 4JP2A 5TE9A 1FP6A 3EDQA 3H75A 3UJ9A 4DTCA 2XE6A 3FMGA 4HX2A 5FWAA 4NOMA 3T1NA 1UDRA 4HYEA 3QKIA 1BOFA 1QFMA 4WZBE 1PD0A 2G06A 3EUAA 4QWWA 1U0JA 5F35A 2B4QA 3BB3A 4N0DA 2CXSA 4YP1A 4MR8A 5EJEA 1QIIA 3P9RA 3NUQA 5BW6B 2ZRJA 5JOQA 3P9XA 2IX3A 1LB1B 2FCRA 1RE1A 3QFSA 3W6UA 5AI4A 4KACA 1DOHA 1E9AA 1HEIA 1SXIA 3KQWA 5EY5B 5C1DA 1H3EA 4EATA 1NA5A 3A4IA 3A4NA 2J3EA 1IOLA 4ZU6X 3RANA 2ORIA 1WCYA 3PPWA 3AGPA 4JBNA 4NH0A 3A6JA 4XSHA 4ND5A 1LSJA 3EZXA 4A1FA 5KINB 1IRIA 3CCBA 2PM8A 2ONZA 4Z54A 2CUZA 4Y9RA 1FYVA 2R00A 3LYUA 1A97A 2A0FA 4U0KA 2P27A 5AYVA 5LLTA 1RQPA 1V8ZA 3ZU6A 4M0LA 3OUUA 1BDJA 2Q46A 2WJIA 2QTRA 2NUBA 5C1OA 4IGFA 3AW9A 4Z5XA 3CKLA 4OB8A 5ERXA 3FMPB 3NCTA 1X87A 4TXMA 5JARA 5KEIA 1HRKA 3QPCA 4MI6A 5CGQB 2GILA 2H1SA 1VJ1A 2AXPA 1VB5A 2FPOA 4NEQA 4PSCA 4V1CB 2DMRA 4OBXA 4MTLA 1T1IA 1DXQA 1UWCA 2I6TA 1A2QA 1E2DA 4EY6A 3AK4A 1JMKC 4BMPB 4KQHA 2RAPA 1IDOA 1BRMA 2YVKA 1X9IA 4MVJP 4YS6A 5EIBD 2OYCA 3SZUA 1E2BA 4YAKA 1X42A 4CLXA 2D5AA 4C4ZA 5EQFA 1PR0A 3UT5B 3T5CA 4EFKA 4B3RB 3R4CA 3BK2A 3AESA 3ERCA 3ZY3A 4MGIR 1J49A 2CC2A 2WY2D 5IANA 1E7YA 2AMJA 1SOWA 2L42A 2YJ5A 3COZA 2LDBA 3KL2A 1L0BA 3NMUF 2BBTA 3E18A 1I1QB 4BB5A 1PJTA 1X0XA 4LOIA 3VU8A 1NPTO 3WNBA 4EF5A 4KXUA 2DT8A 1EDDA 1FDRA 1HNNA 3QU7A 3EEOA 1O94D 3P2KA 4LYJA 3KQLA 2JBWA 3EPKA 4BCDA 4OBBA 5LBUA 4YV1A 3V1NA 1XVAA 2HBQA 2RB5A 5J5CA 5KYTA 2QW0X 2IHBA 3M5DA 2NUAA 4QJ3A 5KSYA 2QTWB 1C50A 1GZ3A 1CLUA 1C1XA 3HGMA 1YB6A 4OQMA 1PG5A 4GKBA 3GMTA 1AD2A 4I3GA 4U02A 1UJMA 3RBZA 1SXJE 4PG8A 3GA7A 5A9RA 3TKYA 2YZNA 4LOJA 2IXTA 2GAOA 3C2QA 4HUQB 3ZHCA 1BZYA 1Q0SA 3PCRB 1N2IA 3KZNA 1N57A 3OH8A 3NHYA 4Z2AA 3DE2X 2CJXA 3Q7QA 2FFRA 5LD2B 3FOWA 3FD8A 2YVAA 1RXYA 1OU4A 3DDSA 2ZR9A 1A3CA 3FPHA 4QX6A 3A1WA 1SUWA 2Y1FA 3D3WA 4ZOQI 5LJLA 2IS4A 1DBWA 1M8FA 2EBWA 3ADOA 4Q7KA 4KPYA 5FBKA 1MZPA 4NICA 2R1TA 1F5SA 1U9JA 4V24A 2OD2A 2TMYA 3F78A 4YR7A 4QPNA 1XDWA 3H86A 1QIGA 2C78A 4LWQA 4MV9A 3BE6A 5BV1A 4YIHA 4GM4A 4QOGA 5FI5A 3AUFA 4INZA 3QJGA 4PC7A 3N6XA 5THKA 2B92A 1SPXA 3RU9A 4MV7A 2CMFA 5LWHA 1H2BA 3TZQA 5K03A 1KEPA 2A1IA 4YV2A 5B55A 2V7TA 4JJ7A 3LCMA 2GEFA 3Q2OA 5K6RA 3RTGA 5DHRA 4BMZA 2XUZA 4HLDA 4J07A 5CMLA 3WGNA 2J3DA 3DR3A 4I3FA 3K4HA 3OA0A 1UK8A 3DMTC 4CIDA 1Y3HA 3VDMA 3J81k 2QW1A 4DPMA 1JU4A 1WOYA 4TV9B 2J9YB 2P8SA 2QD1A 2PRIA 3CEAA 4K81B 1WQ3A 3VU9B 4P53A 4ZZIA 1AKUA 3ZLJA 1PGQA 3IP5A 3NDBB 1PYGA 3DCIA 3TRDA 4QSHA 2ZR8A 4AWBA 4DMCA 5DNEA 5K3EA 1L4KA 4ZZ2A 4A6DA 5IF9A 2RHRA 1R37A 3B1KA 3H2KA 3S1LA 5HQ3B 1JG2A 2C88A 4BN4A 1Z4NA 2AOVA 1CDZA 2BFWA 2YJ3A 3GCDA 3MD9A 5I7HA 821PA 1T2DA 3TIGA 5CJJA 4LEIA 4Z3DA 3LJKA 2PUCA 1J1UA 4NG4A 4X45A 2DPGA 1P0CA 2EFDB 3E1SA 4JUIA 4OG2A 4RC9A 4OH7A 2ZI7A 5D7NA 4H4CA 3QOFA 3I9OA 2P6UA 2BE7A 2I5PO 5L4NA 2ZJYA 3Q7RA 3IPYA 2Z8YM 3T5AA 2P75A 3CCFA 3PFNA 3EXAA 1NYQA 4H1TA 4HVAA 3P0EA 3MCWA 4QG3A 2FFJA 1VLHA 4RA6A 5FTJA 1RRPA 2R97A 2GK4A 1JKJA 5E9WA 2EGUA 1QVRA 2ZSEA 4PZDA 2NX2A 4FVTA 1YKFA 4Q1DA 5HJ7A 4F1JA 4H6VA 4DLBA 1VL8A 4P83A 5CPBA 3KQNA 1VMDA 2ZB7A 1X3SA 2XMBA 4W5QA 4IOJA 1DT3A 1VZ3A 1Z6QA 3EVBA 1T3GA 4KWHA 2TSYB 4U39A 3GL9A 2I67A 3U48A 3K9CA 4PO8A 1HF3A 1YH3A 3KTDA 3L49A 4KUEA 5FOUA 2WEKA 2W70A 2FW1A 3ICWA 1FYDA 3PHLA 5HMMA 2QVCA 4F3TA 5DASA 2GA9A 4B76A 5H7XA 6ABPA 2AR0A 3GFRA 1Q0QA 3MVEA 3MGBA 4B48A 1EFKA 2LKCA 3LY7A 2AVNA 2BLLA 5FYDA 5EG5A 1GG2A 1TNDA 5EYPB 3RAJA 5JT1A 1C3OA 2EZ8A 4R9NA 4MB2A 2EOAA 5KHLB 3LLVA 5H02A 2OMEA 4V1CI 3AKEA 2Z2JA 2PSFA 1Z2CA 1CQIA 4ZU1X 2AA3A 3A1TA 4KW7A 2CJWA 4KK3A 3LYHA 5EVJA 3UMCA 1T24A 1OZGA 3CE9A 2A14A 3KZKA 5IBRA 3ZNOA 1H2AS 2X15A 3UW1A 3IQZA 4DBVO 2RDMA 1M72A 1XMJA 4G5FA 2CY0A 3WL7A 2Z57A 4CMKA 4D0RA 5IPFA 4KLAA 3LC0A 4MV0A 1Z5OA 1Q7EA 4G4JA 4MDHA 4ZKDA 5ADWA 1VM6A 5KNBA 1QYVA 4R8KA 4IO1A 4FOSA 3DZIA 4OFBA 1JB1A 4WZAA 1M6VB 4JEMA 4PLGA 1MJGA 1R4ZA 1NVFA 2CMDA 5DBOA 5ISMA 1DWQA 3MJEA 3ONDA 2IQ5A 5F78A 3SKXA 4CT4B 1XCLA 1J8MF 4EKDA 4LGMA 1J23A 1CNFA 2D74A 1QORA 3NO4A 2NPFA 4C43A 3H2ZA 5AXAA 3I0NA 4D9IA 1JHMA 4Z51A 4FDVA 4Z2YA 1RLUA 3R9XB 2FWRA 4WAUA 1U1CA 1L4MA 2ZJ3A 4O25A 7GPBA 5A1JA 4O8ZA 2P5SA 3G9QA 1OD6A 4N0EA 1ZK1A 3HVUA 5BUCA 3O8RA 2DVMA 4GOND 1D2GA 2RC6A 3PFCA 3X0DA 3OKCA 1Z4MA 3SE7A 4JBIA 5C2JB 3COJA 3GFQA 3DMNA 2IHTA 4FDAA 4COKA 1YOBA 3I04A 5IT5A 3H3XA 1UJ4A 3ZCQA 1IJEA 2Q07A 1R0RE 2A0WA 3EGIA 4KSYA 5K8TA 5BSWA 2IP4A 4MV5A 1ZD8A 1FMFA 1WZEA 2AYZA 4QXPA 3ZHQA 4M3NA 2I6QA 3BS4A 1KP9A 1NOKA 2QX7A 3E48A 4HNAB 5E6SA 1N0UA 5GWXA 2JGMA 1JQ5A 1ZOPA 4WLNA 5FPKA 4YJHA 1UBGA 2XB9A 3R5KA 3ZZUA 4AJLA 2ASEA 4Q05A 4TRRA 4TVBA 1ZX1A 3RLFA 1EFPA 3RPEA 1LLCA 3L7JA 3NNNA 2JNWA 4KUGA 3B82A 4P4UA 1WU8A 2CLOB 3LPAA 4AQ7A 1T29A 1J90A 3W5JA 1KVTA 5L4LA 3TK1A 2HA5A 2WTNA 2AD1A 3QKSB 4LE0A 4O1HA 4RVFA 2DZDA 3RFFA 1E2GA 3T1QA 1GAEO 5FLKA 4AJJA 2R87A 3K53A 3AMVA 1U11A 1VIAA 3D4BA 4UUAA 5DM2A 1UBCA 3DGEC 4RHEA 1IZZA 4X1YA 4UPEA 1CK4A 4IS3A 1P3Y1 1G21E 3CKYA 1V4VA 4WLOA 3EVDA 2CT8A 5KOJA 1PGPA 3GCZA 5J2TA 1JR2A 2XUHA 1B00A 2JA2A 4G89A 4L5CA 4OGKA 2IV3A 4M0CA 4TTVA 4ZO4A 4EJ6A 1DAPA 3EK2A 5E2AA 3QE0A 1NQUA 1HTTA 1T4GA 2GO7A 1RQRA 2R7MA 3OKFA 4ID3A 4MO2A 3ZIAD 5T7BA 2AFIB 5FUYA 3D6MA 4BLPA 4ZDJA 3HCRA 1O58A 2DGDA 1L6IA 4KFUA 4B44A 2OD7A 4CEJB 1GQQA 2ZUFA 1E0AA 2NTVA 1SVOA 2VSOA 5DIZA 2G08A 1LNSA 2NO4A 4CF6A 5DI9A 4LMAA 4B7ZA 1B8NA 1LPSA 4RTOA 4QQ8A 4XGKA 4YLYA 2I71A 4P86A 4RZXA 1NAIA 1QHGA 1MABA 4KIFA 4RWEA 3P4XA 1UIRA 1YB1A 1AKVA 2IP2A 2PT5A 1P7YA 3DL0A 3F2IA 4Q3OA 3D3JA 1L7EA 3PNLA 3ABIA 4EJSA 3E8MA 1MT3A 3AH8A 1O08A 3T3IA 3LUPA 4HFMA 5EUBA 5M5BA 1G5PA 2AOXA 3R7SA 2A1TR 4IJKA 1MRSA 4Z4EA 3B36A 3TW4A 2DBZA 3MOSA 1Z62A 3GGJA 3I6MA 3ACDA 4YPFA 4UHCA 4Q3LA 1GUYA 4FYKA 1NW5A 4WN9B 2Q1YA 1V5GA 4RD3A 1YJ5A 4AQDA 1N4DA 1RYMA 4F5YA 4NZZA 1EEHA 1PR1A 3CWZA 2W00A 2ZE5A 4U8GA 2G9UA 4NYJQ 1XNGA 4XIIA 3VHXB 2QD2A 4MWZA 4YMWA 2AMYA 1TYBE 1KJIA 4CIBA 4D02A 2JIPA 1NC3A 2GBPA 5AI6A 4DYHA 4FSHA 4GPZA 1QC5B 4G37A 4HB3A 2W0SA 3KZVA 4N5HX 5AVJA 3X1DA 4A0SA 2V5UA 4D44A 4ZYXA 2AZ4A 2HU7A 4M8IA 3SCZA 3W04A 3ZJ5A 1DEKA 1MA0A 2BFDB 2H9IA 2Q3LA 1PL7A 2X41A 3DWFA 3H6HA 5AICA 5DWVA 5BYBA 1IEQA 3VBCA 5B7QA 5IC4A 3LX6A 3K9HA 2WJ3A 5DYYA 3LRTA 4KGZA 3WWEA 3WXMA 1ZIDA 4KBGA 3W79A 1WVMA 3CG4A 1P4JA 3DOCA 4OSOA 3OU6A 5DO9A 1U0HC 1L8AA 1QQ6A 1CQJB 4ZQEA 3Q0TA 3MW8A 1BGVA 3NM4A 5BSTA 3LI2A 1T8SA 1JEOA 2HQBA 3G1WA 2HKIA 2Y66A 3E9NA 3STWA 3VR2A 5AVSA 2YXEA 3CPJB 1KPHA 4YRLA 1WXXA 4YHHB 3EIFA 3AILA 3MBIA 1G6KA 3K8ZA 4DLAA 5IVPA 5KYUB 4P7BA 4BNJA 3BX1A 3KUUA 4CT5A 2AOTA 2B7LA 5U4XA 5HS6A 3WWDA 3TF5A 5KQSA 1A9PA 4Y1FA 2AN9A 1CZRA 2IEGA 3OZIA 4DANA 4JLWA 3U3KA 4BYMA 5KYWA 2XA2A 2JBAA 1RWWA 2Y0PA 5IWCA 2C4WA 3TR0A 3VUFA 2B7BA 1O96B 4ENQA 3K70C 5DN6D 3FAZA 4HF7A 3ZVKA 3NVMB 4US1R 3ZDAA 2QVGA 2WTEA 4JLNA 4BEWA 1Z06A 1R4MB 2AZTA 2I2WA 4EW6A 3TH5A 2PCJA 1P0PA 1AKRA 3NEAA 3THSA 3HCFA 3AM1A 2RBEA 4G26A 4BC0A 1N1GA 1ONOA 1SU6A 2VDNB 2E3JA 2VJMB 4BIIA 1YI1A 3LTNC 4L07A 4UCWA 5IBPA 3G2KA 3D5TA 3F1KA 3Q8WA 1B76A 1LRLA 4RGYA 5JAUA 1QF9A 1NV9A 1YB5A 3Q6NA 3IESA 1D0IA 2PQMA 4EBBA 1ADYA 2BRUC 5B3JC 3ZU4A 3GUVA 2SECE 1IQRA 1UZMA 1RTKA 5B58C 4QULA 4U3JB 4B73A 5KNLA 4YUVA 3CUSA 4C0SA 2OWDA 3S1AB 4DS3A 4MCJA 4B31A 3DLPX 2DFVA 3PDHA 2ZWVA 3V7NA 4YUAA 1T9GR 1F1BA 3BYZA 3NHMA 3WG9A 2O19A 1UODA 2N3ZA 3O1JC 3Q2IA 3UH1A 5A3RA 3OPMA 1JJVA 1Z33A 3I76A 6NULA 5EE0A 4FHZA 3WQBA 5HZGA 3H0EA 2NZYA 2M6LA 4IDDA 2XMCA 3I42A 4HWPA 1G5RA 4WI1A 3BD6A 3QVVA 1P61B 2ZAGA 5I51A 5L3ZA 1FTWA 2VPZA 2AEFA 3PGKA 4C30A 3K6JA 2VKTA 3GC6A 4R40A 3BK7A 1FXUA 3HSYA 4TWBA 3U3ZA 4BNXA 3JYLA 1LXCA 4RF2A 4CQJA 1CZUA 5ILQA 4D9GA 2ESRA 3K0KA 3I9MA 2XZPA 1U7WA 3NP7A 4HEHA 1KJYA 1NVWQ 2MTBA 2PL9A 3BICA 5EJ4A 3MWJA 3WFJA 2FX5A 2R7KA 4IBOA 3UMMA 4AKIA 5C7YA 3TKAA 1Q0TA 4YWJA 2YWXA 2QUJA 4DCVA 1B43A 5IM4A 1SM4A 4O2BF 3H84A 2XCRB 4RD4A 3ANLA 1W8IA 2HA6A 4G0ZA 2VPTA 3HU3A 4TSRA 5ES3A 3K31A 3GYGA 5IXYA 2HBYA 1ZXLA 2KE5A 4Z1OA 5CDUA 3ORRA 2ZP1A 2QN2A 1G7CA 1MH1A 4I4CA 4HLCA 4KO8A 8ABPA 1IN4A 3AP1A 3G7NA 2FRDC 5BV0A 1A76A 2HMYB 4O2LA 4JKOA 4RJ2A 3DE5X 5ENVA 5FWXA 1YF3A 4F96A 3W5SA 4BPBA 3R20A 1AF7A 1SVIA 5DTJA 5SYAA 2HSDA 3RS9A 2YOHA 3LA6A 4OUDB 1N8SA 2OGWA 2ZJ1A 4WECA 1R0LA 1EUCA 4RJLA 2EFHB 2YYZA 1SUEA 1I7SB 1BMTA 2E82A 1VPDA 2NUPB 4QDZA 3GLGB 3FUUA 4RF5A 4LF9B 1B7GO 1TUEA 1X14A 4CLRB 1KYTA 2N9UA 4I1UA 4R5HA 1G38A 3URKA 3DYBA 5DNWA 1SO8A 4CMBA 2ZJFA 3GPCA 3ZY2A 4C2BA 5D84A 2OOKA 1YQTA 4D0SA 3BF7A 5A5VA 2J0EA 3U31A 3OOWA 4BXOB 1Q57A 2WP8J 1Q84A 3JQGB 4GUDA 1ZUIA 4OM8A 1I9CA 4UE3S 4CKXA 5IZCA 1CUGA 5I7VA 4TLAA 2MHCA 1CEYA 2HA0A 2JI9A 3OZEA 1DWOA 1V6AA 3GLFE 2ZB4A 2V9ZA 2ZGVA 4PPFA 4IHAA 3M1IA 2I78A 2KMLA 5EZYA 1X74A 4MS4A 5D1NA 3IUEA 2HK8A 3SS7X 1M5TA 5FEMA 4HB4A 3Q3VA 4HP8A 2WG2A 4JNCA 1TFRA 1EE1A 4QDJA 1NXSA 2Q5LA 4GZ3A 4WY2A 5BXYA 5KYYA 3DKVA 4FK8A 1T1RA 3ZWQA 4N82A 3O4RA 3ZZTA 2FPMA 1HXHA 3E82A 3SZ3A 4ZCPA 3I01M 5E4JA 2PFKA 1P2GA 2VWGA 4HLUA 4Y6PA 5ESWA 1NT2A 2C04A 2NVBA 2V9CA 2O8EA 1G5HA 3OWXA 2JJ8A 3E3AA 3PIDA 3WGUA 5FV4A 3K2QA 3HH8A 1TEVA 1BN7A 5HP4A 1B8VA 3B6MA 2AC4A 3V97A 1NIJA 3RTDA 1JFFB 3DMRA 1JALA 1N8NA 4KO4S 5LKRA 3W8RA 1J22A 3ZTTA 4BMSA 3HXTA 1DHTA 1D6JA 2A9JA 3JASB 3LO5A 4NMMA 1E2EA 2DQ4A 2GLUA 4JLDA 4NEHB 4P3XA 3W8NA 4CHGA 4S1WA 1BDIA 3E58A 2NU9A 5IT4A 1VL2A 6PFKA 1DRWA 1NVKA 1XYVA 1IAVA 3SS8A 2DY0A 5E3JA 2AFHB 3CJRA 2AIRA 3KJZA 1QYCA 5ICSA 1PL0A 3QVJA 5H83A 2JK1A 3ETGA 3LAWA 5INTA 2NVWA 4J4BA 4MUFA 4RSGA 1CR4A 4K6CA 2OXCA 4RL6A 4GGOA 3DZFA 2QF7A 1K75A 4PZ0A 2W2PA 1C9EA 1SQ5A 3VSCA 1MJHA 5K0LA 4DCCA 3O8QB 3ND9A 2AF3C 4MHSA 4MP6A 2BTOA 2YWGA 4OGWA 4S05A 2IXGA 1TPYA 3L7IA 3QF4A 3EAGA 4QBGB 1NW4A 1WO8A 4X3OA 2F6RA 3E4DA 4AXXA 3CMCO 2UYGA 1QVVA 1ZWKA 4QM6A 3L18A 1UADA 2CLSA 3QNWA 1KQ3A 4R2KA 3BGWA 4YJGA 1E59A 3GQBB 1V4BA 3HKEA 2AJLI 3M3PA 4EQ6B 3I4FA 5K7SA 5CNJA 3ZY4A 4NDAA 1WG8A 3LWZA 1GL6A 2GZRA 4LY9A 1KVUA 2PLWA 4ZVQA 2FJPA 3A7EA 4ZDKA 1ZH2A 4Q48A 4UUPA 4U2EA 1WQ1R 4PQYA 3RV4A 5AP9A 3VJRA 6AT1A 4BN5A 1P5HA 5EEHA 1O6GA 4K6GA 3N2KB 4C0KA 2I2FA 3H2HA 4RUKA 5H8WA 2G77B 3QWFA 4Q4AB 3ONFA 1S3IA 1MQSA 2A8YA 5IKXA 1G41A 4D8TA 2EL7A 2BFCA 2QVZX 2FFQA 4HXEB 5B1YA 2CGEA 5TPWB 3LKZA 2NU7B 3R7WA 4WNCA 3ZE7A 3L01A 5CFLA 3FF1A 2VRWA 4F2GA 2W6ZA 3GVCA 5HNKA 2B6NA 3L8ZA 1T3SA 4R1MA 3DBHB 2JA1A 2A57A 3FNBA 3IE0A 3IX7A 3R7BA 4W8HA 1L5YA 4NTZA 2JHFA 3WLQA 3F67A 2FWPA 2WIJA 1F2DA 4KX3A 3GFBA 4AYWA 3AB3A 4US2R 3ER8A 3EGXB 2E48A 1XTZA 4Q7MB 1ESCA 1RZRD 3P45A 1X92A 2UVPA 2X76A 1KVSA 1WUHS 3AI1A 2GNAA 1SJ9A 3F5MA 3QYJA 4UU1A 5JVDB 3W3ZB 3AFHA 3G2MA 4RH0A 4MWSA 3QVMA 5DNYB 2VQSA 1VRVA 2AK2A 1I14A 3I3OA 5EWLB 4X1IB 1E6WA 4UMEA 2V6JA 5JFGA 4QU5A 2HSGA 5JECA 4B7XA 2B0JA 1E89A 4Q5IA 2FPRA 4DBLE 1WWKA 1NQAO 4JUAA 5EMLA 4GT1A 4H7PA 3G89A 3MQ4A 1CQWA 2DT5A 2O14A 1W93A 4GR4A 4OGLA 3U60B 1FU8A 1R4NA 3AKDA 3FDZA 3GHHA 4PINA 1UC5B 5IJXA 2OBXA 4CMJA 7AT1A 4LISA 2VTBA 1YUNA 1GTMA 3ISVA 3DBRB 2I4TA 1JG6A 3DA8A 2OV4A 5KJEA 4FOLA 2P4QA 4ILEA 4KN9S 4F2DA 1JV2B 2W0MA 1N2HA 2YX1A 2H3HA 3I1JA 4FILA 1U3UA 3HJFA 3PKJA 1UPAA 4BBZA 5J47A 3AVQA 3PICA 5AVWA 1CNEA 5DK4A 3P2EA 4QUBA 4RPLA 2VYQA 1KQNA 3RSSA 3RG8A 2UXBB 1E9DA 3O26A 3OO1A 4MTCA 3EW9A 3D6VA 4B3GA 1YQ9A 4P9NA 3IEIA 4NJEA 3E9RA 5L53A 4MQEA 1R3UA 2I7TA 4Y0NA 2FSHA 4N49A 2CUNA 1QYDA 2IUEA 3Q11A 2I29A 4D6YA 1YBMA 4DIFA 2O3QA 3L2OB 2NPOA 3MXOA 1A4RA 3GDOA 3QLUC 1E4VA 2B8WA 5FCDA 4KV9A 2XW6A 3VO8A 2B82A 2WUWE 5A1TA 1XZFA 5C51B 3O3CA 2Q3JA 5HSGA 3RF6A 2VSXA 5ETJA 4KH1A 3WGJA 5HOQA 5JRDS 1P7CA 1P31A 2F62A 1WW8A 1RAAA 1PDWA 2PN1A 3T1VA 1KYIA 2P5TB 4Y30A 3HN6A 1GLNA 4C01A 1G6HA 3SLKA 4TVOA 1S2OA 3CEJA 5HXAA 3IAAA 3QV2A 1M33A 3ITNA 2FOXA 2TS1A 1ESEA 4RY9A 1AKEA 2F2TA 2X8JB 3BCRA 1U2EA 4Y2TA 2R79A 3EOZA 5B3AA 5KX5B 5LZ4A 2XXAB 1IZ0A 1FVFA 2HCFA 2ZM5A 4RNCA 4MWOA 5IJ0B 3FUCA 1K08A 3NGMA 1N8KA 5E95A 3BH0A 1K98A 4QNMA 1QO7A 3FYUA 2WWXA 1OH5A 2ODAA 2PVSA 1TVCA 4LHSA 3LP5A 4AUKA 4NLLA 5FA6A 1Z0KA 3MJDA 4F91B 4JUCA 1T4MA 3QE9Y 1RVDA 3A4VA 3ABOB 3QXCA 4FFSA 4ENUA 3MZ0A 3RYHA 3VR2D 5HKOA 3T4EA 1V9LA 3IO5A 3UXHA 1H85A 1OB5A 2EEPA 2ZIVB 2D3TA 3M6WA 1HSOA 2C2YA 1H4SA 3NHPA 1LI4A 4IJQA 4KYUA 4A2QA 1A9RA 2XUIA 2H52A 2PKYX 1L7OA 1NJGA 3ILVA 5K45A 4PV7A 4RHYA 1BH6A 4RFLA 1S5PA 2BFFB 3SNHA 4MWCA 2PWBA 3C1UA 1GPYA 2DKNA 2AJDA 4I5IA 4GP6A 4X20A 2DJIA 3ROXA 3VPSA 4BRSA 4NCXA 4P93A 2D4AA 2IUFA 3VZQA 1DADA 5EXEA 3VDXA 1Z2OX 4JSTA 3GNLA 3JARB 2H92A 2Q2OA 4LF7B 2DE0X 1L5HA 1YVPA 1YHNA 2C61A 2YASA 4D6PA 4KE8A 3SWWA 1WETA 1SVKA 5JXGA 1PQWA 4GECA 3AUKA 3IYLW 4XUGB 1Q20A 4QLAA 1RI4A 1BROA 4NHOA 1P1CA 1R0SA 3LCCA 2QEQA 3HJUA 2ZJ7A 1Y9AA 4TTIA 2IOQA 3LQFA 3QBEA 4WOBA 4RVSA 4ZANA 3E9ZA 4CUJA 3RYTC 3V00A 5P8WA 1L8XA 1T4CB 3UQZA 3QKUA 2C2WA 1Z73A 1ML3A 3GLQA 3PFKA 2ODWA 4Z0PA 3VR6H 1CEXA 3BORA 1CP3A 3WBBA 1Q0HA 4QYIA 1RHJA 1YRYE 5B37A 2W6CX 1OAAA 1TD9A 4PX5A 4AXBA 1M1YA 3OZVA 2VBGA 4AZ0A 4EA6A 5JPCA 4X84A 4XD2A 4PE5B 4DV1B 3FPKA 2IZ7A 4JI5B 1E1NA 1F2UB 5K99A 3TXXA 1IPEA 4PZYA 3NS7A 3MT7A 2JFHA 4PPGA 2CVOA 3DLAA 5K6AC 1QBGA 2FQYA 5JLJA 3MEQA 3G2NA 4N4AA 4YLGA 5TT1A 2AQHA 3C70A 3H13A 2C2BA 3AEUB 1EI9A 2W83A 1IU9A 4C7BA 5JSZB 1FX0B 2AN4A 4RQUA 3PUZA 2YYSA 4RTKA 1W5TA 1SOVA 4OL0A 4Y9UA 1R0KA 3EXHA 3GLHA 3NU1A 4WNIA 1WPRA 2VJQA 3H1TA 3HG7A 4KYTA 1TB4A 1ZH6A 3EYAA 1JPJA 2AOUB 2HIGA 3FKSA 1US8A 4Q3NA 1J99A 4Z7NB 1OLSB 3EPPA 2WMOB 4A8JA 2YWEA 4MIKA 2J3QA 4C05A 1WZ2A 2DR3A 2EX4A 4BRUA 3TIIA 5FUVA 1IL0A 1BH2A 3AUJB 3VH4A 5ECDA 4G41A 1W88A 5TVKA 4BJHB 3MT8A 4K1XA 4JP1A 3Q15C 3LDFA 5AK6A 4XVCA 3R6GA 1E4EB 3UJ7A 3D6FA 4DN6A 4UBOA 4GL2A 2QN7A 2XDAA 1QYIA 1VKOA 4OH1A 4X6XA 4DUPA 2QPAA 1SXHA 1ZNXA 3M4JA 1VSQA 4WTOA 4CCYB 2A33A 4LCBA 1OUMA 4PICA 1Q1NA 1U8XX 4N3BA 3AI3A 1K3UB 3GZ4A 5DCYA 2OCBA 3NRCA 1Z5NA 2IV7A 3WMWA 1Q1EA 3SZLA 2DWOA 3A2KA 5HF8A 3QEAZ 3OTQA 2VUUA 1JXOA 3EVEA 3LS2A 3SS9X 3CBGA 3KHTA 3QKWA 3DL4A 3FJYA 3PEWA 3C48A 3UV3A 4YVFA 3KX2A 1Z37A 1WUIS 2F9FA 2FLWA 3GGSA 1NYLA 3W1EA 5FTLA 4OXYA 2GI4A 3M4NA 4WXMA 1I7QB 2AHOA 1FMLA 1H8EA 1Y42X 1BOOA 1B4DA 4D9NA 3ML1A 1L5MA 4Q18A 3RVOA 2OGZA 2NVOA 1SUBA 1T26A 2FXIA 1LJ8A 5HK9A 1B26A 1CUFA 5BMVA 4OI0A 3GGPA 4WACA 1YJQA 3QEJA 1TO6A 3Q6IA 2WSSD 1E94E 4WJZA 2RGNA 2AW3A 3G1UA 1VIDA 4QYSA 4D8XA 4HNVA 5JNVA 3U5ZB 2PPVA 2Y68A 3W1VA 4D2IA 4D45A 1WABA 2F9MA 4L3VA 3EDOA 5FL7A 3P9IA 1E5QA 1H8HA 1DQRA 2WFLB 3FWNA 3TLJA 5KNCH 1O97C 3PEEA 2ZYUX 2GGSA 1ISRA 4WKNA 2R1VB 3MBKA 4NZ9A 1WF3A 1GA4A 3O7WA 2RGWA 3B48A 1DC6A 2H7VA 4U6SA 3A6ZA 1XEXB 2W4MA 1Z22A 2EW8A 2H11A 4F4HA 3U16A 1QMGA 5FOTA 1NI5A 5A04A 2ZI4A 1YJ8A 2LPMA 2IY8A 3N2NA 4K9LA 1NXQA 3QFTA 4OV6B 4WVLA 5JC1A 1CUVA 3KLOA 3VNUA 2A86A 3BWYA 4TLBA 4NBSA 3A0UA 2VXYA 1KE2A 5B4UA 4BQOA 3B1YA 3LWDA 1MU0A 1PNOA 2WOJA 3TSCA 1B6TA 5AJVB 1XF1A 1CFJA 2MJLA 5A9SA 4HNTA 4URHA 3LGXA 1VLJA 4B3IA 3IIKA 1YQUA 2O8NA 3GGGA 3MGAA 1X70A 2VYFA 3A3OA 3HU2A 4FKBA 3UMVA 5BN5A 1RZ3A 3EJWA 3SC3A 1Z26A 4EKYA 2ZBDA 2BMVA 3PHJA 4LN1A 1UBMS 3KPVA 5JPIA 2G0NA 3DPIA 1MT0A 5IFKA 3ETLA 3GDFA 3PENA 2RCNA 4OGFA 4YDHB 3MWDA 2WVGA 4MB0A 3LECA 5EZ6B 3ZWKA 5JDCA 4IFIA 3EIOA 4X0EA 1YB7A 4OQXA 4WX2B 16PKA 3Q98A 1P1FA 5C31A 4W1QA 6REQB 1RWPA 2QRJA 1GIAA 1GLVA 3TW8B 1H93A 3BQNB 1Z4QA 5D3QA 4DIKA 1HNWB 3U7QB 2H4JA 2NT4A 1JYFA 2HJSA 1KPGA 1HORA 1KHHA 3NJ8A 3P9YA 1SXQA 4R41A 2J1LA 4P35A 5JD3A 4B35A 3O4HA 4XD7A 3OCUA 3NM6B 1HKHA 4H6WA 4IIEA 1IN1A 2F00A 1ZVVA 1UEXC 1ESZA 3MJSA 5BSGA 3FPCA 4I55A 1EMDA 3AFMA 3DD5A 3WMGA 3JD3A 4AU1A 2MYTA 4D57A 4QUAA 1XTVA 3VFDA 3CIOA 1EK6A 3P2YA 2B25A 2HJGA 2ZRQA 3PC7A 3D8UA 4HS9A 1YZNA 3R7AA 1L9KA 1GNVA 3ESYA 2XDYA 4N47A 1OREA 3DLCA 4KMOA 4MQUA 3WMFA 5A06A 5KYGA 3PJRA 4ZYWA 1M34A 1LRKA 1OFHA 3IPLA 3T41A 5JBIA 2J5QA 3RAPR 1H9BA 2L19A 1M2EA 5DW3A 2VA8A 2VFAA 1MOSA 5TMPA 1SBCA 2CLMB 2H65A 4AJOA 1UUFA 4L3WA 1YR7A 4D99A 1CR0A 1P7ZA 3C5VA 4RBNA 3VPAA 4WXRA 3VR6D 1KMNA 3UH0A 2ODPA 4PSVA 3GLKA 3P2MA 1GSIA 3JAKA 3AYXB 3F6SA 4H7DA 5EE5B 2GEJA 4A6XA 4YQEA 2CNNA 1N6LA 1Z2PX 2A30A 3WFZA 2AKYA 3O8LA 3WK7A 1O77A 3KB8A 3AR6A 3PUKA 4IEFB 4JR2A 5COBA 5JVDF 1WB5A 2NADA 1Y8QA 1DT5A 1LS6A 5HUQA 5A5DA 2XZLA 4B4DA 4OJTA 2B5OA 4E21A 3OIVA 5I4BA 2ZAMA 2JAOA 3FMIA 3HJTA 4EJMA 4PC6A 3ESZA 5IH3A 1HEYA 3AHDA 2C07A 1O89A 3QGMA 4U2DA 4Z8XA 3V6LA 1VE5A 4X92A 4J4HA 3OZUA 5EWJA 4MQFB 3RIEA 1VP3A 4CV2A 3QENA 1B6GA 3OMLA 4PGMA 4IDQA 4MAAA 1JYSA 2DCUA 3EOAI 5KWEA 3E23A 1JIKA 5I3CA 1S2NA 3HVKA 3GFFA 2QRQA 4NL4H 1QIDA 2E4XA 1LI5A 3NGXA 3BWDD 4OQPA 4WK4B 1QIMA 3TBHA 1WRBA 5K3AA 5I47A 2QZJA 5HYVA 3ADBA 4KITB 1JPVA 4DB4A 2X0DA 4CR7A 1TEHA 2BZ0A 3IT1A 2J3MA 1A98A 4C7OB 3ED5A 5AJHA 4RX1A 3ZWCA 1YONA 4U4AA 1X7XA 4NU5A 3LQKA 3MWYW 1Y4DE 2CXRA 3NKLA 4MUNA 4MRNA 1N5IA 4RJTA 1UQTA 1Y5MA 5ALPA 4D4JA 4HL6A 5KTSA 4LHZA 5GONA 3T1YB 1WB6A 4X7BA 4H27A 1ULUA 1UP6A 3A11A 3UMBA 3UGJA 1VYUA 1IXKA 3IOYA 1A4UA 5TNXA 4AECA 4ARZB 1M2VA 4IKOA 2UVDA 4PM4A 3WMRA 4FXPA 1VSBA 5L3QA 3PXGA 3NIBA 4J94A 1G1AA 5K0NA 1O9HA 2WU0A 3R9WA 1DI0A 4UMVA 3OE4A 5BOSA 3MELA 1UQUA 2WPDD 1VMAA 3TVYA 4GBMA 2W2XA 1OJ7A 1IHPA 1BVYF 1UXOA 2I80A 3R23A 1HG0A 5E8JA 1E3TA 3U9LA 4G97A 1GQFA 3ELUA 4R8MA 1ZGZA 4RVOA 1T3ZA 1FJXA 1C9NA 2HLNA 4XKJA 3RSHA 4OK5A 2AV6A 4FR0A 1KMCA 3GAAA 2BFMA 1PU2A 2KLHA 5DNDA 4ZAGA 5KNCD 4NNPA 1F4VA 2CL6X 3K0CC 1Q7TA 5CAEB 2BGWA 4LBZA 4TRJA 2YXDA 1GPMA 2O3RA 3T3MB 5G1PA 3GFVA 8ATCA 1YZ3A 2GWRA 2E4WA 2ID4A 4HNRA 1S8OA 3R3UA 2FXVA 5ES4B 1E9VA 3PFFA 4AKGA 1GQRA 1VPEA 3GRKA 4JMLA 3W34A 4B0OA 3HDYA 3TIVA 4CQLB 4OAQA 3FSGA 5DHQA 1YA6A 1RFLA 2AG5A 2HK6A 2D1YA 2FPUA 2UAGA 4V0NA 3HUUA 1T0HB 4PFJA 3HRHA 1MH9A 2ZJ5A 1RIIA 2P0EA 4EJFA 3UOWA 3DO6A 4LRSB 3VAYA 3W6NA 3BIFA 4AL4A 1KH3A 1OH8A 4MICA 1KI1A 1IPHA 1CZHA 1VSUA 2DC1A 3U62A 4JIMA 4BN0A 4EFNA 4PYJA 1NSTA 4EBFA 5CW1A 3DVLA 4FFNA 3UY4A 3C3CA 3EWSA 4MRAA 4HGZA 1C5KA 4OMCA 4CM4B 3JYOA 4Y2UA 4TL8A 3AFNA 3GP5A 3D7NA 2AMVA 2JFBA 4D79A 3N59A 1PNRA 1R7RA 2X19A 2ISQA 3A4LA 4L7QA 1ORTA 3F6EX 1KC1A 3L1VA 3G5MA 5EQDA 5A0VA 2JHCA 1TCVA 3DCNA 4Y2SA 4TOIA 3N28A 5ARDA 2XCLA 4RFSB 5KQMA 4AY2A 3KSAC 1V8DA 3RLIA 3H8WA 3WZLA 1U94A 4QXRA 4BUCA 4JB2A 2GJ9A 2GR9A 4L76A 1DG3A 5A6SB 1TZJA 3OIGA 4O2AA 5GGYA 5SYNA 2WIGA 3HFRA 3U3OA 2WIKA 5C18A 3WP0A 2QSUA 2XNDA 3UJ3X 4OJQA 1N5RA 1TMYA 3HACA 1S4QA 3KBBA 2WYUA 4C7JA 1B6SA 1KS9A 1RYYA 2I6UA 2I9KA 4YP6A 2YHIA 4QTTB 1BJKA 3NBFA 1N78A 4KYVA 4GPAA 1S7GA 4MKXA 1DUSA 4XOUA 3E9DA 4GXQA 3IQGX 1L5SA 2MSWA 2OC4A 1U9IC 3H4TA 3I2YX 3IV7A 4JENA 1PR4A 2Z8XA 3HFJA 3R7FA 1GUDA 2GAIA 1QU2A 1VRCA 3INRA 1OY1A 4PSKA 1OX6A 2FWAA 3I64A 4N0MA 3K8QA 4Q03A 1DXHA 4RXTA 1YOVA 5CNMA 3N2GA 3V4SA 4C0BA 1FL9A 1CR6A 1YS9A 3GZNA 3NKVA 3RIHA 4HH3C 5ULLA 1E3JA 2BFNA 4HZUA 4UBIA 2JH9A 1OGIA 3LU1A 3SDZA 4MKHA 1JUDA 5KYXB 1DDIA 5HZKA 2AI1A 2ZSJA 4FZ3A 3VO2A 4C5AA 1SKQA 3LUAA 3LUBA 2VHUA 5HGXA 1PW5A 4F9FA 3ETCA 4EPYA 3ZGNA 1V8FA 2Z6UA 3LDUA 2ZUDA 4NYMR 1IAQA 5C81A 1A2BA 3QE2A 5JS8A 3AZOA 2JW5A 3CLSC 4JXXA 1EXVA 5HQTA 3U17A 5CEFA 3S1SA 3NDJA 3WLFA 1ANKA 2NUTA 1BW9A 1RYDA 5FNVA 2HHAA 3NCHA 5COAA 4DV3B 2O50A 4XYEA 4RS4A 1G20B 1WHTB 1DEXA 4HGQA 3IJ5A 3TSAA 3E1KA 2C7QA 4BDSA 3HNPA 2VRCD 1YQXA 4QPJC 3IH5A 5JNUA 2WT9A 2ORVA 1EG2A 4DSTA 1GL3A 1W1WA 2A5LA 4AD8A 3OZSA 3QFCA 5GTDA 2QXUA 3JALA 3H9GA 4I6GA 4UJ5A 1AU9A 5F21A 4A5OA 1DQNA 1CRLA 4H1UA 4HRVA 4ZO8A 5BRNA 4TUYA 3EFEA 4NK4A 3WLMA 5T8KC 3GD7A 2QGZA 4FGZA 1YK1A 1D3AA 2C2KA 1F0PA 1I3NA 1RIFA 3OEHD 2HHJA 4WV3A 2PCLA 1BXZA 2Q1SA 4NE7A 4Q7EA 1CIJA 3TLGB 4IGKA 3KBOA 5JATA 2ZRPA 3T3NA 3Q1KA 4MR8B 3SQXA 3O8OA 1SB8A 1Q0LA 3AJ8A 3VKFA 4UTRA 5JCZA 2PD6A 2ZPTX 1GUAA 5CU7A 3OQIA 1XEWX 1J09A 1L5VA 1F0KA 4UD6A 2B9VA 1XJQA 2ZWIA 3C7DB 3GJSA 2Z09A 5BR4A 3KHKA 1OTYA 2C7VA 2XYHA 4HPXB 4XX0B 5FJJA 1THGA 3CNOA 1HE5A 1X7ZA 2QUAA 2X2OA 1KHTA 1EVQA 4M36A 5AVVA 3V8NA 1ZD3A 1XR3A 1MB4A 3ILYA 5AM0A 3IKVA 1YIOA 2PU5A 2IHUA 4YA6A 4CCSA 2J3LA 3PD1A 5KU7A 1BYUA 2QZ4A 4JOQA 4EA9A 1RLJA 1XZNA 2ZRNA 2F43A 2R8ZA 1UM8A 5DYWA 1NBHA 3KYDA 4G5HA 1N9GB 1D2AA 2QTGA 2L0XA 3BM5A 4HWTA 4NDZA 4RD1A 4X1OA 3S44A 1H5QA 1JHQA 2ONJA 1TM3E 3PUIA 4NULA 1EJ6A 3W8EA 2R11A 3DAOA 4AIRA 4Z7OB 3A25A 4R2HA 1XQWA 3AGQA 1PJ2A 4UMFA 1ECCA 3V3TA 5AUNB 1YR9A 2OAP1 4LXYA 3CLRC 2X0JA 3NHLA 5DULA 3G6KA 1ODLA 4OQNA 1N2BA 5DGTA 3U9TA 3N2ZB 1CPYA 3L6EA 1YWGO 1J9ZA 1Q91A 4H31A 4JL6A 5F2EA 2W6QA 2GHIA 3PHCA 1EUZA 3OLCX 4UPVA 2IE8A 3OFSA 1M0TA 3OZBA 3H19A 3AESB 4BUZA 5HBGA 1R50A 3EPLA 3CEHA 2Y3IA 1CT9A 1K27A 1MDFA 2JLXA 1RYFA 3LIIA 2IYFA 3O47A 5BQXA 3VYWA 3IERA 1IVYA 2IIPA 5ALRA 3ME5A 4QYTA 4CL8A 4EVQA 1F06A 1QQ5A 3LT1A 5B7GA 3A6DA 2Y1LA 1AO0A 4IIXA 4BGIA 4WZBA 2IPMA 2C5LA 4M1YA 1TZ2A 4BAGA 2NP7A 2JEYA 4KGXA 1MIOA 1XU7A 2Y77A 3DZ8A 2NUAB 1PE0A 2WI8A 3VPXA 2UVQA 4I5FA 2VDUE 1V3QE 3CRQA 5IAAA 1KS2A 2CE7A 1XQYA 2ZQ5A 5EQJB 4G1EB 5KWSA 1YCDA 2ONYA 3ABQB 5ITWA 3JRXA 3R5TA 4OX9Y 2IH2A 1Y3CE 4HMPA 3DOIA 4RLHA 4GKAA 3OT1B 2VPPA 4ZEMA 1MVLA 1TIPA 4YGYA 4BWYA 2RGRA 3SX0A 4DQVA 3RBVA 3CXRA 4FB5A 2ZYGA 2VEDA 3K6SB 4CM8A 2HY7A 1J24A 4XX1A 3F49S 2PAAA 2GSWA 4C5CA 3LLMA 2HPVA 4MUKA 3WYDA 2JJ1A 4RKQA 1OFUX 2FPPB 5CA1A 3GPLA 1OW3B 3MMXA 3ZNNA 7MHTA 1AHIA 5H9WA 4MGKR 4ND6A 1WU7A 3B3QA 3KPUA 3P27A 4MWTA 2V3CC 3CU5A 2B1IA 2G5GX 2R1TB 2OGTA 3VYSB 5LKAA 4ZKEA 3TW6A 4AF6A 1C4XA 2XOKA 1YHZA 4FYXA 1PHPA 2EL9A 4RVNA 1XJWA 3MQ2A 4L16A 2FWBA 3PV0A 1HM5A 3QHPA 4O3FA 4BKPA 4U7WA 3V4PB 3A6PC 3VSBA 1VKNA 2R6R1 1PQ4A 1Y7PA 4E70A 4C0JA 3E2MA 1AA6A 2ETVA 1YGPA 2EBHX 2C77A 2QN6A 3DG9A 3DVAB 2O9JA 3I9LA 5H4HA 5IYZB 5LQJA 3B3FA 2YY5A 3O03A 1N2ZA 1QZTA 2FVXA 4NBLA 4RH1A 4V0RA 2NNWB 2EWWA 1KBZA 2YHBA 3QVGA 4X3CA 4BTLA 3VJKA 1K0UA 5LR6A 5KWIA 3AG5A 4K1LA 4MJ3A 3O4GA 2V5AA 4H60A 3I45A 5IHXA 1OA1A 5KSPA 4IJWA 3H1FA 4CR6A 4IDAA 1QOPB 1MD9A 1YCGA 2ZS9A 4U8HA 4DCOA 2JIDA 4B6JA 4S0XA 1HL7A 3LBAA 4MEAA 4OHBA 1SGWA 1U0SY 5KBYA 2FOIA 2Q99A 3TZLA 4HQNA 5LWQA 4GMXA 3C1AA 1NP6A 1QO0D 4WHMA 1CB7A 1USIA 3D4IA 1I33A 4A03A 1CG6A 2RH5A 4LXHA 4TVKA 5A03A 2H4XA 3CX8A 3GFPA 2I03A 3HBAA 4BZZA 4ISCA 5IF3A 1SCIA 4WJLA 5LJIA 1PJSA 2R62A 1P0QA 4JP8A 1M6WA 5I9MA 1G5FA 1UT8A 3CSDA 3HXPA 4UM9B 2IW3A 1NR5A 5AM2A 3N2YA 5FOVA 2P9HA 1MJ5A 1H94A 3JZDA 3TOXA 2PA3A 1U4OA 4WCFC 4YAEA 2V97A 1KSFX 4E6EA 4LJ8A 3WNZA 5F4BA 1QVWA 4IH9A 1T6NA 2WNIA 2XMGA 3A26A 3TBFA 3RYFA 2EFEB 2QZ9A 2CNWA 1M2HA 2I4NA 2QP3A 2PUTA 2RGEA 5EHIA 3CPEA 4WGGA 3VPGA 4BE9A 3OG9A 3OZDA 4HFJA 2YWHA 2YWBA 3G17A 4QBTA 2VDWA 1IQ0A 1HYQA 1SC3A 3EASA 1K92A 3OJFA 2MMCA 1NX9A 3QVOA 4J49A 2OORA 2JLBA 4AC9A 4R01A 4LSWA 1CVRA 3T95A 3NONA 3WK4A 1I4LD 1OI3A 2GS9A 1DPGA 3L7BA 4IIHA 4U5XA 2VNAA 3HV0A 1GGFA 2F3TA 3CINA 1HYHA 4JBWA 4RHCA 5EPOA 5HVNA 4JI3B 4OCZA 1E9BA 1K7EB 2NIPA 1JG1A 3MGCA 4JC8A 3MTGA 4EW1A 2VP9A 2CEKA 4RV5A 4B3BA 3WAKA 4QBFA 4ZZ1A 1GCAA 3FWYA 4JGBA 1YKGA 4L5IA 1E9CA 1NMZA 1ABBA 1CS4C 3IQXA 1C3OB 3IVGA 3MWKA 1KVRA 2EFCB 4I8DA 4JI7B 4HNGA 3L0CA 2GN8A 1H6AA 2FUG6 1QGOA 3NORA 4XWYA 2CJWB 5FI0B 3O0DA 2SCUA 1MV5A 3VAAA 3RC3A 2VJAA 4G5SA 1CY4A 2A94A 2K87A 5E6RA 4G5OA 3SPXA 2GWHA 2PUHA 2O7NA 2VHJA 3CBQA 4MR9B 2AHRA 2JVJA 4DJAA 1GR0A 1TAQA 1I1OA 1P8AA 4XI9A 4TL7A 2XUAA 3B2EA 2BEWB 4L78A 1PL8A 3UB3A 4EAQA 2IYRA 1TTHA 2P40A 4DLZA 4P80A 1OZ0A 1QR2A 4I1RA 3FW1A 2WWWA 5H81A 4KQ9A 3ZW8A 2RGBA 3LCUA 4RAOA 3TX2A 3MOGA 2BR3A 3HJAA 3OIYA 1KPIA 3KWMA 3FGPA 5DTRA 5B1DA 4IVNA 5BQOA 3ENQA 5B6IA 2IITA 4KB5A 3GNQA 4KMSA 4ZOLA 4K88A 1SNYA 4E7OA 2VRBA 2P3SA 3JATA 3FYHA 1R18A 1LDNA 2QV0A 1YS7A 4YIKA 3ECAA 4BKOA 2NXJA 1O6ZA 1MUUA 3DFFA 3X3HA 4BJ6A 1YE8A 4MWBA 521PA 1G3UA 1RLIA 3SN6A 5BN4B 1EH5A 3H5TA 3QKTA 1V35A 4MW4A 4JCCA 1ILEA 2V9PA 1L8OA 4X66B 2D1RA 3U7HB 4PG7A 4HAUA 2NW6A 3LVFO 2ADFA 2DSNA 4DRYA 4YAWA 4Q66C 4LJRA 4L9RA 1N8TA 4C4RA 1XKLA 4J8PA 3AOEA 2G25A 1EXWA 1P5FA 2EEZA 1S96A 3RROA 4BO6A 1YU6A 4CFZA 1HQKA 1MBZA 4YLEA 4ARCA 4PYOA 1JQLB 4DM7A 1PT9A 1Q7GA 5EUQB 1KOFA 4YJHB 3FPSA 1XQXA 1LSOA 1EVLA 1TT7A 3AJRA 3X43A 5A4JA 1PT7A 3HKDA 2RGGA 2WTAA 4Z4HA 5F77A 3F6PA 1F8XA 4KQJA 2P7IA 4URXR 5L3RA 3WV5A 3WLEA 1JJ7A 1VFNA 3TM4A 4C2TA 4WFIA 4YMHA 3ITKA 3MTEA 4P2BA 3AU9A 1ARZA 2QRKA 2WDZA 2ZAYA 2D5IA 3OLVA 4QFCA 5FI1B 2ZFUA 3C74A 4X1YB 2XIJA 4HFNA 1KRHA 1QHNA 4JVLA 3UTDA 4R3NA 2WMDA 5CNIA 3DYIA 1DJLA 1JT2A 2H7CA 2XCQA 3JQFA 5KOJB 3AUXA 2PWPA 2OHVA 3INNA 1V16A 4UHBA 7ABPA 1PT6A 1AQYA 1Z75A 2QLMA 2EKPA 1QFXA 4FIDA 2ZCJA 4NCIA 3V1UA 1IXYA 1WLYA 3QPBA 1IHUA 3ZH9B 4R9UC 3GAFA 3SX4A 2JLQA 5HDQA 4RENA 4XUDA 3VPHA 3RKRA 3HBJA 2PR7A 2HPHA 2GAJA 1RKQA 2ZBFA 2FMTA 1ICIA 5I7UA 4GRIA 1R66A 5EHGA 3B3GA 2O8BB 5ALUA 1GTL1 4H15A 2ATXA 5CJ2A 1NAHA 3SQOA 3VC2A 3SZGA 3HM2A 5CVDA 3SKVA 5F1OA 4MLZA 3BD8A 5DXAA 2XIQA 1DOZA 4UHDA 2E18A 4EJSB 3W7AA 2XV1A 2PBFA 3UHFA 2V7UA 4RJJA 4BNFA 3TJZA 1JLLB 4B43A 3CKMA 5LYJB 3PG5A 1UXIA 3FOAA 3K1YA 2J8ZA 4UQLA 5A3VA 3DEFA 3BQMB 5AHOA 5J5AA 4DIEA 2JJMA 4F9EA 3V8RA 1SKBA 4B3HA 1E1QD 1Z38A 3DDHA 4QEDA 4FEGA 4EGSA 4I36A 3G8AA 4YR9A 4GICA 1QTNA 4X1KA 1UMCA 3H9CA 5JJLA 3CA8A 4GW3A 4CG3A 4MGZR 3G88A 3FGOA 3OZCA 4EY3A 221PA 4I46A 2BGIA 2H8GA 1JW9B 1CTQA 2I2AA 2OC9A 4YP0A 1B8PA 1CP2A 1L8LA 3W9SA 3JWPA 2QLBA 1NMYA 2CMGA 4MV1A 4I1VA 2AN1A 4B09A 1NFQA 1MG0A 2W2KA 2GN1A 3H04A 5JQWA 4LSMA 1QGZA 1GTG1 2CCJA 1IXZA 3HR8A 3KSMA 4FFRA 3V8PA 1RC8A 4NAVA 1ZSNA 2B7CA 3VNBA 3VGPA 4F45A 3IIMA 2DQYA 4NV1A 2OLKA 5AVQA 2IYWA 1TA0A 3PQCA 1ZVQA 3E5NA 4WESB 3TO5A 1BYIA 1TA4A 1I7PA 2J9GA 3TECE 5E8RA 1CY7A 1X1QA 3LRXA 4BLUA 2HBZA 3ELDA 3N75A 4CKCA 3DLBA 4GZ5A 3WSTA 5CD1A 5KKAA 5EC8A 1C81A 1TYDE 4F4JA 1P9OA 3F6RA 4L50A 4J2TA 5EIOA 1DZIA 3EFBA 5ITZA 2ZBUA 1AQIA 1LGYA 1RYHA 1QVZA 2WJ6A 3K8YA 3NIDB 4UM5A 2HMVA 4ZJZA 4H7FA 3WKCA 3UJNA 1PWYE 2BGTA 1RWOA 2AOTB 3GRCA 2A5YB 2ADMA 3DP9A 2PANA 3GJTA 2CDRA 3PGMA 4HDKB 3IPCA 5BXQC 5ADVA 4M0FA 3KU4A 3R1IA 5EE9A 2C3MA 1DX6A 4CI0B 5A2QA 1AURA 2C0CA 2JBAB 2VH1A 1GCGA 3G02A 4K0KB 2IOYA 5JRJA 2XEXA 2NO0A 2V98A 4CLOB 1NVUQ 3NEJA 2Z5LA 3WKDA 4QBHA 1P1RA 1T3LA 3RRJA 2QD5A 3O21A 3EIWA 4ID9A 3ZI4A 4CWAA 4C0QC 3JWEA 4RKEA 2HJVA 5KZMB 5F7ZA 1UXHA 1N2SA 2O7SA 1KGDA 1LI7A 1ZD9A 4Y1EA 5C7LO 3NWOA 1JJBA 1N6RA 1XD8A 3BMNA 5EZSA 3PC4A 4P3OA 3RI3A 4J1TC 3KB6A 5ELXA 4AUNA 2OPBA 4AMBA 3AETA 3EGDB 4WXEA 2C97A 3NNDA 4HN9A 4P5DA 1UDBA 4Q7LA 5BW8A 4RTJA 3WGMA 1KERA 2ERCA 2IWHA 3TQQA 2YFKA 2OV6A 1WQ4A 4PC1A 2ECPA 2XVMA 4YO7A 4O63O 2VHEA 1T2NA 4WK0B 2Q4DA 3IP8A 1ZD1A 4N03A 5FHQA 1LTKA 4YQYA 1QDEA 4WKBA 3PHBE 1JSZA 1BCSA 2UKDA 2JIOA 1PIWA 3BXEA 4L1KA 4LRWA 1H3NA 4ZOCA 1LD3A 1ZJZA 3L7MA 1SOMA 4QVGA 1KQFA 3OQMA 4NR0A 3PF8A 4KQ1A 1B41A 2Z3ZA 3PRYA 3LPDA 3VXKA 4OAPA 1KOJA 1W581 1P5RA 3P7MA 2BFBA 1JEEA 1D4ZA 3V2IA 4GLOA 3W06A 1MOPA 3BD9A 2C8JA 5AJUA 3ZCRA 4Q7QA 3A27A 4PYIA 3NQ41 4OFXA 3ZQKA 4J16C 4HHEA 1ENOA 1DNPA 2P6OA 5G53C 1BDMA 3H17A 2FZGA 4KAXA 1E3QA