4Q3OA

Crystal structure of mgs-mt1, an alpha/beta hydrolase enzyme from a lake matapan deep-sea metagenome library
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
317
structure length
317
Chain Sequence
EVPIPQSISAEFKAALAQYPTPSVEEARSFVPTTAAQWRDYVQATNKMQKTKIKNMRKHYGVTVELLDIKGVTVRKITPKSLSPEFKDHVYIDIHGGAYVLFAGLPSIEEGILIAHRLGIVVYSVDYRMPPAYPFPAALDDVKHVYRVLSQQYDANHIFMGGTSAGGGLLLAFVQGLIENGVATPRAIYAGTPWADLTKTGDSLYTNEGIDRILITYDGTLGASARLYAGNTPLTHPKLSPIYGDFTDFPPTFLVTGTRDMFLSDTVRVNRKMRDAGVTTVLDVYEGLSHADYLVSHQTPESQSVYRQLKRFLVGFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pressure adaptation is linked to thermal adaptation in salt-saturated marine habitats.
pubmed doi rcsb
source organism Unidentified
molecule tags Hydrolase
molecule keywords MGS-MT1
total genus 118
structure length 317
sequence length 317
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4q3oA00
2XMBA 4C4XA 4PNZA 1W76A 4XWGA 1P0QA 5A7HA 5BOVA 2WQZA 1MPXA 1YR2A 2ES4A 1SCIA 4H77A 4LXIA 2HA4A 5KREA 4CIBA 3KOOA 3FBWA 4ZRDA 5HZGA 3ZI7A 3LCRA 1EI9A 4HVTA 4E15A 1YS2X 1LPAB 2Q0XA 1R1DA 2GBGA 5HQ3A 2ZJ6A 4WY5A 5LYYA 4U2DA 2QRUA 1EB9A 5E4TA 4KRYA 2XUAA 1BN6A 1DTEA 1WHSA 3LP5A 3L1JA 1VKHA 2YASA 2G5PA 2AJLI 3AINA 5EHXA 4C4YA 2GBFA 1QLWA 3W05A 4UBNA 2WHRA 4QZVA 2CEKA 1R50A 4OUKX 5AKEA 1LNSA 1FFCA 5C8XA 1AZWA 4OU5A 3F9CA 3HLKA 3O4HA 1B41A 1VLQA 2QTBA 2WUDA 1QZ3A 1L7AA 2I3DA 3WKBA 1F8UA 2J4FA 1ZIXA 3WL8A 4GBGA 2QR5A 4P08A 3IDAA 1R9MA 4BE9A 3ICVA 1THGA 2JGMA 2RIPA 1GXSA 3STUA 3B12A 1VA5A 4KACA 1MJ5A 1CUVA 3M83A 4X90A 1HDEA 5JD5A 3G9XA 4BCCA 4FKBA 5D6OA 4QDUA 3FYUA 1E89A 1MN6A 5AM0A 3W9UA 4DM7A 2XQJA 5EIHA 5DWDA 2FUKA 3WYDA 4XIIA 2AJ8A 4JYMA 2PSDA 1CVLA 2ACKA 2WJ4A 4DSZA 1QFSA 4H7HA 3TGLA 3TRDA 1RP1A 3WJ1A 3O4IA 3QMVA 5I8PA 2E3JA 4H7EA 1EK2A 3WWDA 3HXKA 3IUQA 2WJ3A 3FVRA 1CRLA 4QDTA 1DQYA 4B0PA 2OGTA 1CUAA 3H2HA 4X85A 2PU5A 1LPMA 2RAUA 3PDCA 1XKLA 5CURA 3D2BA 4Q3OA 4FNGA 1F6WA 1O6GA 2ACEA 5CT6A 3M82A 1XQVA 3OG9A 4DGQA 1C4XA 3K6KA 4Q1VA 4QEKA 4UFPA 1QIKA 4N5IX 5DTJA 3G02A 3WWEA 4F21A 4QDOA 4ARAA 3ESCA 3JYHA 1QIHA 1CUEA 1XQXA 3STTA 2I03A 1A8QA 2B9VA 1HQDA 1YB7A 4FLMA 5E4YA 4UBMA 1Q83A 5IVKA 4HRYA 4Q05A 2OQVA 4CI9A 4KJXA 4KAAA 1FFBA 4ZXFA 1R3DA 2WFLB 4G1FA 3ZPXA 3T52A 3MVEA 3D2AA 4M0EA 5A62A 5YASA 2YH2A 1UKBA 1X2EA 3DYIA 2GYUA 2HA0A 5CH5A 2C5GA 3I1YA 1JU3A 3FSGD 3W04A 4P93A 3NOXA 1GPLA 1DX6A 3ICWA 1R4ZA 4IH4A 2HA5A 3EIOA 5LLSA 3H1AA 1UKCA 2K2QB 3NWOA 3R40A 4NZZA 3DKKA 2OCKA 1ZI6A 5LZ7A 4JNCA 4GWLA 4H7JA 2WM2A 3HABA 1GT6A 2PSEA 4KE6A 5D3KA 1LPSA 1IMJA 1UXOA 4ARBA 4AX4A 3H2IA 2QKYA 3C6ZA 4W63A 2I78A 4BAUA 1ZD3A 4WFKA 1IVYA 4FTWA 4U2CA 4AZ0A 2X5XA 3VVMA 1LBTA 4M0MA 3V1NA 3I28A 5K3BA 2H9YA 2GYWA 4RPCA 5K3DA 1RWQA 2XUPA 2H1IA 4UBOA 4UPDA 2Z8XA 4GLBA 4GW3A 1GPNA 3WA7A 4U2GA 3QBJA 3LIPA 3BIXA 2C4HA 3GBSA 3A70A 1E8NA 1LBSA 3SC2A 2HDWA 2NW6A 4BATA 1XQWA 4J3JA 1UT6A 4YASA 3WI7A 1EH5A 2OGZA 4F60A 5JARA 1E8DA 4KYVA 4DMHA 4L0CA 2VT7A 2PSFA 4KAJA 1LLFA 4EY4A 3DOIA 4PSDA 4AO6A 4V2IA 2OCGA 4RGYA 1IUOA 3O9VA 3WKDA 5C81A 3DLTA 5HF6A 2WFMA 4WFJA 4X92A 2C7BA 5HKAA 5LKAA 5BV7A 1XZDA 4QWWA 5IVHA 3VDXA 1DWQA 3EQ9A 1UK7A 1FFAA 3LIIA 4OB6A 4BRSA 4MYDA 4DNOA 2V98A 3F8SA 1XLVA 3WL7A 1D07A 1G5FA 2PUJA 4FLEA 5KBYA 5CBKA 4BC1A 2JGLA 3H2GA 4W1PA 1CUJA 5CH3A 4PO3X 2JGKA 4G5XA 3R3WA 4FDMA 1FJ2A 2DHEA 2BKLA 1WB5A 5JD4A 3N2ZB 4HRXA 3DYVA 2WHQA 2OG1A 1H2ZA 1WM1A 3VVLA 1U8EA 4UBKA 2BAGA 5DNWA 3QVMA 5AIBA 4AN1A 1N8SA 4AQDA 1XROA 3T4UA 1A8UA 5JANA 2ZYRA 4ROTA 2BUAA 1ODSA 1ACLA 3FVTA 4PSCA 1DT3A 4GECA 4G9EA 2XUOA 3AIKA 1DWPA 2OCLA 5DTIA 3I2HA 1ZJ4A 2HU7A 3CXUA 1C7JA 5AM4A 5CXXA 2XLCA 1QIGA 4BBZA 3G0BA 2H7CA 5AO9A 1XLUA 4PSUA 3WKAA 2DQZA 4FNMA 4JEIA 4Q82A 4BE4A 2DFPA 4Y2QA 2WHPB 3JWEA 3C43A 5AKYA 3ILSA 5ALOA 1YS1X 3FWHA 4I3FA 1JI3A 3WMRA 3W06A 3PF9A 1AQLA 4GHWA 2PM8A 3C87A 4N8EA 2Y6UA 3OM8A 1Q0RA 4RE5A 1WHTA 2IX9A 5T4EA 1EA5A 4S0XA 1F0PA 4Q3KA 3CN7A 5AKXA 4YX9A 5BWBA 4X93A 5LKRA 1J07A 4C87A 4K6KA 1Q84A 1ZGBA 3I2KA 5HFAA 2QOEA 3OC0A 1EB8A 2JGEA 4N8DA 3MUNA 1GKKA 3HRHA 4BVKA 1VA4A 1CPYA 2WTNA 5D3ZA 2CMFA 2VJCA 5K3CA 1TK3A 1NU6A 3EF3A 4I19A 3YASA 3D3NA 2P8SA 4UUQA 3PUHA 4HXFB 4PQEA 3WZLA 3WKCA 3R3ZA 5FV4A 2CZQA 4X71A 1WPRA 1R9NA 1AKNA 2D5LA 2QZPA 3CCBA 3U0VA 3A2NA 4ZI5A 1EHYA 3GUUA 2O2GA 3LLCA 4DMCA 1JMKC 3BL8A 1XKTA 2XI4A 5JZSA 2CBGA 1PFQA 4EZIA 5FXMA 5ALRA 3H1BA 3DS8A 3FYTA 1P0PA 2HIHA 4H18A 1DWOA 2HL6A 2HFJA 3PFCA 1NX9A 1J2EA 3V1LA 2WU4A 5EIAA 5C7YA 1CUFA 2B4KA 3IUNA 2WFZA 3FNBA 3WJ2A 2WU3A 4BCBA 4A5SA 4B80A 1CQWA 4YPVA 1Y7HA 4LKOA 2EEPA 2C58A 4ETWA 3A2MA 4Y2RA 4Y9SA 5E2IA 3VJLA 3WYNA 3IURA 5AOCA 2PBLA 5ALDA 2H7YA 4G8CA 5AICA 4ZWNA 4UHHA 3SWWA 2J3QA 1LPPA 3QYJA 2O2IA 1JKMA 4Q34A 4ZREA 4J0GA 1FFDA 4BZZA 4K5QA 3ZLTA 1UKAA 3C6YA 3WWCA 4X6UA 3V48A 1W75A 3W2TA 5ALEA 4AO7A 4EB0A 3R3VA 1EVEA 4MEAA 2RHTA 5AM3A 3WIBA 3VXKA 1CUSA 3FLAA 2XT0A 4DNPA 3C8HA 1KEZA 3LS2A 4DMKA 4AO8A 2HA2A 1H2YA 5HK9A 1JMYA 1W6RA 1YASA 3EBLA 3FSGA 3O95A 3I6YA 2QXUA 3GROA 5AHXA 2VF2A 4QNNA 1K63A 3BDIA 4BTLA 4FBLA 3WK5A 5EGNA 4D9JA 4EUSA 2O7RA 1MU0A 4G4JA 1FSSA 1DU4A 4WY8A 3UMJA 2WJ6A 4DNQA 1G4HA 4RNCA 3AZOA 4GI1A 1M33A 3A2LA 1G66A 4W1QA 3H2KA 3F96A 1E3QA 2ZVDA 3WLAA 1H2WA 4HZGA 3H0CA 4OSEA 2ZYIA 4O08A 3HYSA 3I2FA 1T4MA 1EDBA 1JJIA 1BCSA 5LZ4A 4KE8A 2JF0A 4QE3A 3ZLVA 1FFEA 1VE7A 2BGRA 1AGYA 5FP0A 2XMCA 2QMQA 4MJ3A 4XJVA 1E8MA 3I2GA 2DSNA 1T2NA 5ALYA 2DHDA 2HRQA 3DL7A 4X6YA 1AUOA 1CUYA 1EVQA 5EIEA 1A88A 2BCEA 1R88A 3QMMA 1XZEA 3QPAA 1JFRA 1Z68A 5CT8A 1N5RA 3HEAA 4H7KA 5EHZA 2ZJ7A 4B82A 3BE8A 4JUIA 4L9AA 3WQHA 3VJKA 3STVA 3UUFA 1DT5A 5ALTA 2WIKA 1CV2A 3G0DA 3WK6A 1ISPA 2JGIA 5SYNA 4G4IA 4IH1A 5I9IA 1PJAA 5JYCA 3C5WP 4Q3LA 3VKFA 4UBLA 1S8OA 1IUPA 1X70A 5T4HA 3V1KA 4HXEB 3M81A 2ECFA 1CUGA 2VT6A 1XZGA 3DKRA 6YASA 2JIDA 5HF8A 5IVDA 5K3FA 4M0FA 5LIPA 3W9BA 4HTAA 3L1IA 2QS9A 3GELA 1J06A 5AKIA 1EX9A 4KE7A 3WK7A 2XQGA 2JGFA 1EDEA 2Z8ZA 1CUCA 4LXGA 3WK9A 2XUKA 1H2XA 5ALFA 4C89A 3D2CA 5JD6A 4FFWA 1TRHA 3EQ7A 5K3FB 4FHZA 1XZLA 3PE6A 1MAHA 1CUDA 4EBBA 2QUAA 3PF8A 1MTZA 4MWSA 1BROA 4TVKA 1UOOA 4AZ3A 4B6GA 3F97A 2PKYX 1G42A 4UFOA 4Y2VA 1QJ4A 5JAHA 3G0GA 4MQLA 2OLEA 2W6CX 1WB6A 4BVLA 1LZKA 5CMLA 5AI9A 1L7QA 5EI5A 2FX5A 2Y2VA 4JH0A 1YA8A 5E4JA 4YK7A 2C0QA 2HRRA 2HADA 1DQZA 4KRXA 4Y2UA 4CG1A 4HXGA 4OYYA 5IH7A 2XQIA 1K8QA 4FOLA 2JEYA 4Y2PA 3K2IA 4BTVA 3IIIA 5JADA 2VAVA 3QITA 3CCCA 3E1GA 1ORVA 3HJUA 2XMQA 4HAIA 5A7GA 4B9EA 2VTVA 3IBTA 5JATA 5J3JA 3G9UA 5CT4A 3STYA 4E46A 4K6GA 5CT5A 4H35A 1XRRA 4UHCA 2BUBA 3DCNA 7YASA 2D0DA 1AURA 3VISA 2ZYSA 4X94A 5AJHA 5EFZA 1SCQA 3NGMA 1WPXA 2BUCA 3C6XA 1YSCA 2ZJFA 4Y2JA 4UFNA 5HCUA 2VSQA 2OAGA 2OCIA 2CJPA 1MX1A 2HU8A 3WL5A 5HK8A 3NUZA 1CEXA 3FYUB 4H7IA 5AKLA 2WIDA 1YAJA 2DQYA 1BS9A 2XUIA 3HACA 1CLEA 4K2AA 1Q0ZA 3TJMA 4BAZA 5LZ9A 3WIOA 5IVIA 5KWJA 3S8YA 4X7BA 2RONA 3AFIA 3GFFA 2HA6A 4NMWA 1CUBA 2OAEA 1ZGCA 1Y7IA 2QJRA 1XLWA 5JZ9A 5ALQA 2FJPA 1VZ3A 3O9MA 4X00A 1LPNA 4WCVA 3AILA 4QDXA 2WIGA 5JALA 3AIOA 3WK4A 1QIEA 1UK8A 2XMGA 4OCZA 3G0CA 2PSJA 4QDZA 2R11A 2ONCA 4FBMA 1HBJA 2J4CA 5FPPA 4J0DA 1XZMA 3D0KA 5JASA 4UHFA 5A7FA 4J0JA 1OXMA 2PPLA 4C01A 1SCKA 3IULA 3F67A 3AUKA 1TAHA 2Y1KA 4BP8A 5DYWA 4WDQA 4FWBA 5CW2A 1XZKA 4MQMA 1AMNA 5JAUA 1VZ2A 3N0TA 3R3YA 4EY7A 4EY5A 1BU8A 3DOHA 3WL6A 4EY6A 3KWFA 4BCDA 1UWCA 2HA3A 3QPDA 5ALMA 4ZV7A 4B0OA 2Y6VA 1USWA 1XZFA 1GQRA 5ALUA 5LZ5A 1DX4A 3BJMA 5AKKA 4WDRA 1EXWA 1YA4A 2AJDA 1UOQA 1YB6A 2V96A 4UHDA 3I2IA 4FMPA 2Y2UA 4U2EA 3WWPA 4J0KA 5K3EA 5AK5A 1B6GA 2FJ0A 5AIAA 4N5HX 1ZIYA 2B61A 4RE6A 3FCYA 3E3AA 4PW0A 2JBWA 4CCYB 4QLOA 4CCYA 3FLEA 1MNQA 4BDTA 5AKHA 3RK4A 1HL7A 4B84A 1LZLA 4BB0A 3OPMA 3AZPA 4C4ZA 2WUFA 3DDUA 3JW8A 1WB4A 4IQ4A 1H22A 1QONA 2XMSA 1L7RA 3KWJA 4G8DA 4J7AA 3F98A 4B7ZA 2CB9A 2R8BA 1LPOA 4AMZA 5HF5A 4BVJA 2DR0A 1ODTC 5AM1A 4EY8A 2VEOA 4MWTA 1BEEA 1RYYA 1UOPA 4KE9A 4QLAA 1MNAA 4AMYA 3AJAA 2BGNA 1BN7A 4BAGA 2BJHA 4XVCA 2IIVA 2GBIA 2QT9A 1O6FA 1SOMA 1QGED 3PICA 1MAAA 1IZ7A 1ZICA 4X97A 5AH0A 3I1IA 5ALWA 2XLBA 3STWA 4L72A 3H2JA 2WIFA 4Z49A 1MO2A 4CG2A 1CUHA 5I7UA 1JJBA 2WHPA 5HKBA 3IUMA 5EHNA 1JT2A 4LYEA 2Z3ZA 2RHWA 5HQ3B 4J0IA 3I2JA 5AI5A 5AI0A 3RARA 3HI4A 4GXNA 1U2EA 3DNMA 5ESRA 1QIJA 3ESBA 3ZV7A 2QM0A 1KU6A 2PL5A 5T4FA 5FUMA 3ZLUA 5C8ZA 4B85A 2XMZA 4Y2XA 2XUJA 1JJFA 3FAKA 3RLIA 2EDCA 1HLGA 1CUIA 3G7NA 1X2BA 1AC5A 3QM1A 4N8SA 4NVRA 2GZSA 1JU4A 4K6HA 4TPKA 3DQZA 2V9ZA 4PF1A 1K6EA 4U2BA 3H19A 4DLNA 3FOBA 3R41A 2XUHA 2HU5A 3A6ZA 1UFOA 5AP9A 2GBCA 3FYUC 1PV1A 1XQYA 4UHBA 3WA6A 1BEZA 5IKXA 4IHAA 1CUZA 3IA2A 3Q8WA 3BXPA 3QH4A 5ALXA 4C6HA 4DSAA 3K9BA 3IVMA 3DD5A 5AK6A 2WILA 3ED1A 2PVSA 3HZOA 4X6XA 5HF9A 4B81A 5SYMA 3H04A 3KXPA 1TCBA 1CQZA 2WUGA 1MX9A 2DCMA 1XZBA 3G9TA 5AKZA 2OQIA 5H3HA 1QE3A 2LIPA 5DJ5A 4DMFA 2VATA 1NU8A 1ZOIA 2JEZA 3H18A 3EQ8A 2VQ6A 4XX1A 3HC7A 2HHAA 2X76A 1XRNA 4AB1A 2VJBA 4GDMA 2I3ZA 3DJYA 1XRQA 2HA7A 2G63A 2WG2A 2ZSIA 1CR6A 5K5EA 3PI6A 3KSRA 1XRPA 3C5VA 2OPHA 3P2MA 2QJWA 2ROQA 3OTQA 3DEAA 4NS4A 5HFNA 2WTMA 5DYYA 5LP1A 1BCRA 2ZSHA 1W4LA 5FRDA 2J3DA 5ALPA 4A23A 2C0PA 5A71A 5DYTA 2C5FA 4G9GA 4AN0A 5CRIA 1XZCA 5EHQA 1GPKA 3QPCA 5ALVA 1ODCA 2AJBA 2ORYA 2QXTA 4BDSA 1OCEA 4OB7A 4BYMA 2XQKA 3PUIA 4X3CA 5CXUA 3M3DA 4BRZA 2JGJA 1CIJA 3BDVA 1BRTA 2H7XA 3D7RA 1VXOA 2VJAA 5ALSA 2PX6A 3C45A 1CFJA 1K5PA 4QA9A 2XUFA 4LIPD 3O4GA 4Y7DA 2IITA 5JAPA 4X91A 4ITVA 4L3WA 2VA9A 4BZWA 3QMWA 3ZWQA 3IUJA 4CIAA 3MUOA 3V9AA 5ALLA 2UZ0A 3PFBA 4E14A 4OPMA 3MGAA 5F4ZA 2VAXA 1E66A 1ETHA 4TGLA 4G8BA 3WWOA 2V97A 3BWXA 5KWIA 2Z5GA 2HM7A 1QFMA 2OXEA 5ALKA 4OD0A 1EK1A 5AK3A 3DL4A 3SX4A 3H17A 5ALGA 1N5MA 1QIFA 2RGUA 5FDFA 2YYSA 3BF7A 1U65A 3FLBA 3VJMA 1ZD2P 1XFDA 3C70A 5ALJA 3BF8A 3B3QA 1N1MA 1XZIA 4E11A 3OURA 5A6VA 3G8YA 3E0XA 1SC9A 1VE6A 4P9NA 1ZI9A 1KU0A 2WSLA 3O0DA 2PSHA 2AXEA 4CCWA 3FCXA 4GEGA 4C88A 2XDWA 1EDDA 1P0IA 4U2FA 4W9RA 2W22A 3S2ZA 3G0IA 4UBIA 4Y2TA 1ZI8A 2VJDA 1VXRA 5ALIA 4IH9A 1MT3A 2WLSA 2O2HA 3WK8A 5LZ2A 1EINA 4W1SA 4MXDA 4W1RA 2X8BA 1MX5A 1QO9A 4I4CA 4UHEA 1XZJA 5FOQA 2WG1A 5JZBA 3I6MA 2QVBA 4WFIA 5DNUA 1VJ5A 1P0MA 3Q0TA 1QOZA 4J03A 1I6WA 3QZUA 4UBJA 5C8VA 3GA7A 2AJCA 2XMDA 3ANSA 5JIBA 4DIUA 1HPLA 3E4DA 1XZHA 3R0VA 4J0HA 3WKEA 1A7UA 4G4GA 4DYHA 1ORWA 2G4LA 1W52X 4H0CA 5DNVA 1XRLA 5FKJA 4Y2YA 2ZYHA 3OOSA 1QTIA 5K3AA 1THTA 4X95A 5ISMA 3HSSA 5LZ8A 3SK0A 1A8SA 2CUTA 2DHCA 4QWMA 4B83A 1AX9A 1YCDA 3CN9A 5AM2A 3ESDA 4BC0A 4PV7A 5T4BA 1C7IA 4HS9A 3ANTA 2B20A 4MYSA 1UK9A 2GZRA 1CUUA 5ALHA 3O4JA 1ACJA 1QTRA 3KDAA 3RKSA 1IZ8A 4IO0A 1QIMA 3I6ZA 4KAFA 4F5ZA 5AK4A 4DTCA 1GGVA 3UUEA 5AM5A 4BP9A 4EHBA 2WFLA 4H7FA 4OYLA 3TEJA 1BE0A 5ALZA 3ESAA 2XMRA 5AI8A 3R3XA 1XRMA 2G5TA 1QO7A 1QIDA 3R3UA 3C6BA 1GKLA 4OB8A 4ZV9A 1CUXA 5AI4A 5CTAA 1H23A 3AZQA 1OILA 2RI6A 4B9AA 1K4YA 3KD2A 5A2GA 2QUBA 4FLFA 4J0CA 3D4LA 3B5EA 4MEBA 5AKGA 3U1TA 1U4NA 2O7VA 4P92A 3GZJA 2XE4A 2BFNA 4LXHA 2XB6A 4LYDA 3BJRA 1IUNA 5CH8A 3L1HA 5AOAA 4AXBA 5FPQA 1DINA 5DLPA 1ZD5A 2YXPX 5ALNA 3RM3A 2Z3WA 4OU4A 1UZAA 2WG0A 3C8DA 5JAOA 1TCAA 2XQFA 1F0NA 1E5TA 2XUGA 3IB3A 4CFSA 5AOBA 4ZGBA 1J1IA 3BIWA 1LPBB 4CG3A 1QIIA 3D59A 1WOMA 2XUDA 4DNFA 3D5EA 4Y2SA 2EDAA 4INZA 1UK6A 5CT9A 4H7DA 1TQHA 2WUEA 1VOTA 1TCCA 2WKWA 3V1MA 2XUQA 3X3HA 4KR0A 4FFVA 1WCYA 1ZD4A 1W1IA 1XZAA 1SFRA 4JYPA 1CUWA 3STXA 4F0JA 2HFKA 5AI6A 4WJLA 1GZ7A 3AIMA 5FLKA 4KEAA 5BWCA 4EA6A 2PUHA 5AKJA 2CKMA 3WZMA 1TKRA 2OGSA 1LGYA 1GQSA 5D7BA 2PU7A 2WIJA 2GYVA 1ZJ5A 4LHEA 1YAHA 4A16A 1Y37A 3G9ZA 1TIBA 1HKHA
chains in the Genus database with same CATH superfamily
2GLUA 3HHPA 3O8OB 1SUCA 1KFBB 4C4XA 5E6RA 3ZBQA 3I05A 1NVBA 1DX9A 2Q1YA 1M6YA 3OKCA 4Z2YA 3D4BA 1RKXA 3EMVA 4RIEA 3LUKA 1U81A 2FMKA 1CX9B 1EHCA 1HWYA 2QTVA 4RANA 1SCIA 4ZAGA 3T9CA 2HLDD 2BFEA 1WULS 1Q1QA 2HA4A 4GMHA 1XDZA 2A5YB 3MMPA 4HHEA 4NX2A 4WXHA 4O02B 1XTSA 4TZTA 5BYKA 1LSSA 3ONEA 1VSVA 3FBWA 4NFLA 3S1AA 3TFWA 1YXMA 4AM8A 5LWQA 3QKSA 2JFYA 3LV8A 4NPHA 1HYQA 4BLPA 4UATA 1XEXB 3TPCA 3IELA 2OENG 3V1UA 1S2LA 3VAAA 4C0QC 4P7JA 5DTRA 2Q0SA 3NDJA 4IV0A 4RTLA 1NVWQ 1TM7E 2C84A 7ABPA 1AV7A 4GNRA 5IH3A 3RSOA 5L4SA 2XTNA 1PS8A 1R1DA 5FNVB 3WADA 5A4FS 1P4HA 2W83A 5HQ3A 1ZQ1A 1ZNYA 2ZJ6A 2GD0A 3JQCA 4WY5A 1IWPB 5A5FA 1A7JA 2OD9A 3BZBA 3OA2A 5LYJA 1WR8A 3WY9A 4CMEA 1EB9A 5E4TA 5EJAA 2EV9A 1PS9A 2OFWA 1GTMA 1XK6A 2WTEA 4OKIA 2WT9A 3FOZA 1SBQA 4ZIRB 1DTEA 1JQAA 1WHSA 1RMQA 2ONKA 1EGVB 3AI1A 3EYAA 3LP5A 1GRVA 2ENUA 4OGWA 5EESA 1EK0A 4KQWA 3DA8A 4C0SA 1C0EA 4FCTA 1Q16A 3AINA 3FDJA 2GBFA 4PLZA 421PA 3U7FB 5IUNC 4NCKA 2IYRA 2WHRA 4J3FA 2EU8A 1IEQA 4DCJA 4ETIA 3EIQA 1XMVA 3BG5A 1QNFA 1J1ZA 1RPAA 2FWBA 4RWZA 4D7AA 1T4BA 2V7EA 1TMKA 4DLRA 3RUEA 4OQPA 2V5AA 3EUWA 1UC4B 3L43A 3SHOA 3C74A 1VHDA 2P1ZA 2F1OA 2QQEA 4W5WA 2AEFA 1PUIA 2IYOA 1E1YA 5KVQA 3RE1A 3DG9A 1ZM9A 3L92A 4Z0TA 1P29A 4JNKA 4R5MA 3PD0A 3F9CA 4YQEA 2CL0X 5C1PA 2O7QA 2VYNA 5I4BA 4XQ9A 4OUDB 1P2DA 4L95C 1UWVA 4QJ5A 4H6PA 4RA6A 4RZ3A 1F8UA 2R1TB 2J4FA 2NO5A 4PYIA 3RRFA 5KJCA 3TQTA 1CJSA 2GZAA 3P0HA 5TGTA 5JNLA 1ZIXA 5CAEA 3NNDA 121PA 3F71A 4KX3A 1L5LA 4ZT6A 3RIGA 3FHLA 5TF0A 2QR5A 2AH5A 4D3SA 3UMBA 1K7SN 1Z2CA 3EAQA 4PO1A 1ESEA 1C9MA 3IDAA 3T1NA 5BUQA 1IB0A 8AT1A 1LVGA 1EEHA 1QGYA 2RHBA 3I83A 1L8LA 3KHUA 1G0NA 2X41A 2YWDA 4QO7A 2A1UA 2OBFA 3AUSA 3QW4B 3CGGA 2C2WA 2AR7A 2B98A 1CUVA 2Y1XA 3IB6A 1ISHA 1UFRA 2ZBDA 1JA9A 3FIJA 4NP6A 1DAEA 4TX1A 3EVTA 4X90A 1KJQA 4MP3A 2FR8A 2M1ZA 3DLAA 2DECA 1RMYA 3OLZA 3SC3A 5JD5A 3T3GA 1P9RA 1AKEA 1OI3A 3IALA 4FKBA 4Z8YA 5HQTA 1IHPA 2JLAA 1E89A 2IEYA 1MN6A 4TT8A 4AN4A 4C0AC 2R86A 1NJ8A 3CR7A 3W9UA 2W2PA 5I7FA 1XDGA 1F7VA 4LF8B 1RI3A 4DM7A 1T1EA 1H1TA 2QD4A 3UCFA 3FHJA 5LWHA 2P9ZA 3K53A 5DWDA 5ADUS 3FHTA 4XIIA 2C00A 4LCEA 4IJWA 3MQ2A 1UT5A 4EGAA 3S8EA 2V8OA 4BNHA 1FNSA 1L9KA 1MG5A 2PSDA 1JFLA 1AHHA 1JPUA 2VRWA 4YMUA 3S2GA 5CYPA 4U8GA 4B4OA 4O5AA 4DSZA 4US0R 2VSNA 4RGVA 4KGDA 4J49A 4OGLA 5F78A 4ITRC 4WEOA 3JYNA 3TFOA 4QX6A 1G6OA 5GADl 1N36B 2EQAA 2EFYA 3B1XA 1G0OA 4KQ9A 4C4AA 1QRRA 1W49A 4M76B 4QAJA 3TZCA 3KU1A 1AUPA 3TRDA 4LZPA 4CT0A 4EJFA 3CMMA 3D7NA 4NU5A 4OREX 3HM2A 1ESNA 2G67A 1NUQA 4HEHA 2P91A 3ZYCA 1E1QA 2CCKA 1JSXA 3PDHA 2JEOA 2GK4A 2JGDA 4KAXA 3PQFA 2ZUTA 3BWDD 5JS2A 2ZVPX 3S28A 1EK2A 1XL1A 2WSBA 3NT4A 1D4ZA 4N5DA 2ABWA 2HEIA 2XIQA 4Y9UA 5SY6A 3EOAI 3DNPA 3FVRA 4LZZA 4UCWA 3MFQA 1EFUA 4X9XA 1GCGA 4MWGA 2OGTA 4DG8A 3FFTA 1OXXK 4L4SA 3ZHQA 4BEWA 1FSGA 1KI6B 1SB9A 3HQ4O 3LW8A 3CH5A 4ZI7A 3PDCA 4ZQGA 4Z54A 4LDRA 1C30A 4B8ZA 2ZWOA 1NRWA 4PAGA 2HWYA 4Z86A 5AVSA 5CURA 5DGXA 1RJEA 5LQRA 2RB5A 2HMYB 3CEJA 4UZEA 1M1XB 3FTPA 2EZ4A 1UDRA 2PZFA 4WNAB 1Y4ZA 1IN5A 3TRKA 4A0GA 2WVAA 2OCPA 4BNJA 4QRHA 2WM3A 1VKOA 1BMFA 1F6WA 3C3AA 3H87A 3L79A 3FDIA 1QX3A 4HZUA 4LG1A 4LVUA 3LGAA 3QVLA 2OHOA 2O50A 3GNQA 1DNPA 1F17A 2ZITA 1D2MA 3NVAA 4NNJA 5LQAA 1K3UB 3X2SA 3IIKA 3EVDA 4FFMA 3VR6H 4DCNA 1MHTA 1ZIOA 1WIWA 3HVRA 1TQ2A 2NADA 2AK3A 4DKJA 3K6KA 4DOMA 2KLHA 4QEKA 1SBCA 2QU7A 1RZ3A 3AX6A 2QL6A 1NUTA 3C3YA 3CS3A 3GP5A 4PX3A 4D8UA 2VIIA 3UENA 1QIKA 4LA4A 5DTJA 3RVQA 3WWEA 2CLHB 1R9JA 3GJXC 4QQ8A 5F1OA 5KMGA 1MOSA 2V6IA 3RIXA 4YBZA 4HLNA 2MSEB 1SUWA 2QQGA 1VBMA 3TJRA 4EHFA 1B8VA 1QIHA 4MS1B 1XQXA 1XYGA 1COWD 3ILYA 2J32A 3PR1A 3WNVA 3F1KA 1NBME 3ZD7A 2JASA 2OKCA 3OICA 1LDMA 2I03A 3KG2A 2X0IA 1OXTA 1EUDA 1SHKA 1RWVA 3NFRA 3IVGA 1Q1GA 1EX6A 1YB7A 2BM1A 4GMKA 3EPLA 5DP2A 1CF9A 2GS9A 4KNYA 1YR7A 2QHXA 4GP6A 4FR5A 3D3JA 1EGAA 1PWZA 2A14A 4FGZA 4DSTA 1BMDA 5F2OA 5IVKA 4HRYA 4DYDA 1PQPA 1E3WB 4Q05A 2IXBA 4LUCA 2G1PA 1BD4A 1QKIA 3R5SA 3FDZB 4LW8A 4PBSA 2VHZA 4B33A 4CI9A 1I10A 2QNRA 2WRZA 3PT9A 4N5NA 3NVKI 4L51A 4MUYA 1XTZA 2W6ZA 4AZ3B 1NP3A 4EB6A 4G1FA 5A6SB 2GPNA 1C1DB 3OHMA 1DBWA 5CIWA 5EPUA 4YMWA 3MVEA 3ZPXA 4BVBA 2QNBA 3D2AA 3EVCA 4DS3A 4PNEA 4TYQA 2AMFA 2QN6A 1JHXA 1PR3A 1VHWA 2WOJA 2IXTA 3AF2A 4JFRA 1GYPA 4MLPA 1QWSA 4EZBA 3GMSA 1OBVA 1MORA 5FUQA 5K3OA 1P4RA 3QXXA 2GYUA 1GKUB 1GPMA 1XCGB 2QY6A 4B31A 5CH5A 3PHIA 1IRIA 1Z4JA 3MINA 1Y5IA 3I1YA 1OB5A 4J9UE 1JU3A 4BU0A 1VLMA 2BGMA 2P30A 5DLEA 3ZHRA 1GXSB 3NHKA 5BQ5A 1KVUA 2ZRGA 1MMFB 2YHSA 3B1FA 4QPDA 1DX6A 1RXYA 3CZQA 3OF2A 4LDJA 1UC5B 1E79D 3G5MA 2H2FA 1U3VA 2R9VA 4JXZA 3VQTA 3IHLA 4QU8A 1R8YA 4HNUA 2GPSA 3EIOA 3T9BA 3TXAA 1UBLS 3A7DA 3H1AA 3VSCA 2DFDA 1T5LA 2XODA 5ED0A 4ZVQA 3SQDA 2CHGA 1S2MA 3B48A 3VC1A 2IS2A 3HJCA 4JENA 2VWPA 4II2A 1IXYA 2FW1A 1TYCA 4HXYA 3SJBA 5GY7A 1Y7LA 4Z9YA 3JQFA 3ASVA 5BNFA 2IH4A 2IELA 2NXNA 1TAGA 1U9IC 3ET5A 5AVJA 1DHTA 1KETA 1LXCA 1OY1A 2ALJA 2NM0A 2EZ9A 2Q50A 2WM2A 3HABA 1GFZA 3OCYA 4JJ8A 4REMA 5D3KA 1LPSA 4ZVMA 5P21A 3OU7A 1UXOA 1A3CA 2VTKA 2H31A 1D5CA 1KXZA 3QVGB 4RMNA 2GN8A 1RVV1 2OY0A 4Q47A 1P4GA 1GZ6A 4Q7LA 1B0PA 2QKYA 3DM9B 3L4BA 2SKDA 1L5YA 1ODJA 4GR4A 4WK0B 4PXAA 4W63A 4BO3A 4MRNA 4BAUA 5I4CA 3DH0A 4URHA 3WRWA 1GEGA 3UHOA 1IVSA 3FPSA 3OU2A 4GGMX 4WFKA 1SBTA 1EJ2A 1N2OA 1EWVA 1IVYA 1QSGA 4FTWA 1B6TA 1L7DA 2QN1A 4YEDA 3VVMA 4F84A 2HV8A 1V6AA 4TS1A 5IKMA 4ILKA 4NICA 4MW2A 1L4YA 2VG8A 4TSFA 3IQGX 5FO0A 1BIFA 2PGDA 4MAFA 1FPQA 4S1VA 2L17A 3B3GA 5B7PA 1XD9A 3EVNA 1EM8A 1RWQA 3BB4A 2O52A 2VPPA 2XUPA 2Y9MB 3K05A 4EX6A 2H1IA 4UPDA 3COYA 2GESA 3HUTA 1L3IA 3KWMA 3P27A 1XMSA 2Z43A 2K7ZA 4U2GA 4UASA 1FUEA 5EWLA 4J1TA 4UXIA 4WNYA 5FTKA 2EW2A 1JG2A 3LIPA 4MRAA 1M1YB 2GN4A 2Q9UA 3FYSA 4GGPA 3V2IA 1C30B 5BSTA 1LVUA 2ZXEA 3EXHB 4EF6A 1BW9B 3BIXA 5E9WA 5KQGA 2PXXA 5A0VA 1Y3AA 3A70A 2NUPA 3PE4A 1E8NA 2OAQ1 4Q7MB 5MN4A 1AOXA 2HDWA 2IEGA 2VZEA 2WZQA 2ZIWB 1N6PA 3O2QB 4QVKA 3U3JA 2CVFA 3VZRA 2LNDA 1ANKA 4FOSA 2X4GA 3LU1A 2WSSD 5AVTA 2CK3D 4YASA 3WI7A 2Q3FA 3LECA 3K0BA 2X3FA 3ZCQA 2ZPTX 1WZIA 1R8JA 4DPLA 1G3QA 3K1ZA 4U02A 5DK6A 1Q91A 4KYVA 5EZ6B 5HGXA 2DWUA 3OT1B 3KJFA 1CQJB 1TM3E 3OHSX 3ZXXA 5K7SA 4O3MA 3DP7A 1JP7A 4JS0A 4PHHA 3REGA 2ZWIA 4HDSA 2J0QA 3FCOA 4HEA1 1PKEA 4ZAVA 4LRSB 1S2IA 2WVJA 1K7CA 2NSLA 3KR2A 2V59A 3DOIA 4PSDA 4TYNA 2PWPA 4WBNA 2XDQB 4ZDJA 1YK0A 3GZTB 3KTAA 5DX8A 3JASB 2NV2B 1ABFA 4RGYA 1NN0A 4IIJA 3WKDA 4NENA 4ND8B 1GTG1 4G4SO 4CV3A 3L8GA 1I2BA 4ZI3A 2I9KA 1LY1A 5CDFA 5GTDA 2GKGA 4AROA 4CKEB 1ZC3A 2PDAA 4MV4A 1MKYA 5HKAA 4H59A 2JJQA 2YXDA 3LVBA 1IBCA 1S02A 5LKAA 1Z6AA 3HFSA 1E9VA 1XZDA 3F47A 5TS3A 1ZM2A 2Z4TA 3VDXA 1NIPA 5TR9A 3VOTA 3ZXUB 4MGIR 5FLEX 2ZJAA 1GDTA 1ZRNA 1F20A 2J0UA 5ESWA 3COJA 4W5NA 1M10A 1TA9A 1WXDA 4BV3A 2VTEA 1K7XB 5F21A 3OMWA 3HCCA 1XFAA 3PQEA 1P3Y1 2IDJA 3RS9A 4RPLA 3VPSA 3GU3A 3JWJA 2O8VA 3MRSA 1I0IA 1XLVA 3QVXA 4NHEA 2M32A 3BERA 4ZZ2A 1EFCA 1R6UA 5FFNA 1D07A 4EAQA 1Q2UA 2OBXA 2ZYWX 4UULA 4EJMA 5HTOA 2RE8A 2CW5A 2PUJA 2FVXA 3I64A 1WDMA 4COKA 5KBYA 1Z4OA 2OV6A 2VRCA 3QFSA 4BC1A 1O77A 3I32A 2JGLA 4BO0A 3H2GA 1GQOA 3FJYA 3P2OA 4W1PA 3WLEA 1CUJA 2BIFA 4ZU1X 5AUNB 1X80A 1T2EA 2LW7A 4CQMA 3O83A 4W9NA 2AL7A 2CLKB 2BKEA 2JIMA 2EP7A 2QYSA 1GUFA 3DD1A 1FJ2A 4R0MA 1P44A 2PK3A 5L9AA 2ZBRA 3HVJA 1C8BA 3S70A 1CETA 1F2TB 1KKUA 1UANA 1WB5A 2RHJA 2XECA 4KIFA 2GQ0A 3N2ZB 5JAIA 5EJFA 3VTKA 4I50F 3P7MA 3HKEB 2Q29A 4P7BA 3F1LA 2Q5IA 3RWMB 4J6EA 5JAZA 1H5UA 1FP1D 2YWFA 1WUKS 3RRBA 4CMGA 2XEDA 1HTTA 1U8EA 1CJVC 2X1VA 2WW8A 1VLHA 1H85A 1M0TA 4TMYA 4UBKA 4GPBA 1JEYA 4GP9A 2WKSA 5F1KA 1WMEA 4YJ3F 1I6LA 3N1UA 3R7FA 3SEAA 1D2EA 2QTCA 1P33A 3AP1A 3F3KA 2IW1A 4RHXA 2D1YA 1S3IA 4B74A 3OU6A 1A8UA 1OBOA 3IUYA 1ZPDA 5EPOA 3PENA 3CFYA 2IXGA 4ROTA 5JANA 1K2WA 2BUAA 4PZPA 1ODSA 2RAPA 4O4HF 4PSCA 4NE2A 2D00A 3ZQKA 2CNDA 1C3JA 5JE8A 2EBFX 1JDVA 5GIPE 1MAWA 4BXOB 1RMTA 1OFUX 2HWXA 3I2HA 4PG4A 4ZQEA 1GYQA 2PRJA 5LVAA 3SVTA 3KETA 5JMWA 3I04M 1KK2A 3KFLA 1BTOA 3QUBA 4QFCA 4HQNA 3CXUA 3MCTA 4Y6QA 3MHTA 3PJRA 3OO0A 5TGDA 1B14A 4HWKA 4L5AA 1ZSNA 2CEAA 3A10A 4MB0A 3AOEC 3C8MA 3NIDB 4UTXA 4Q4CA 5C9ZA 3O8RA 3AHEA 4ZRNA 2C7GA 1QIGA 2CLMB 2GRUA 3HS3A 5AO9A 1JGTA 1QE5A 3GMTA 4A6PA 1JWLA 4CETA 4PSUA 1OZ0A 4GYJA 1T10A 3WKAA 2F3SA 3MJHA 4Q82A 4BKMA 1XWFA 1L5ZA 2ZU0C 3UJDA 1AD2A 1AUQA 3WIBA 5LLTA 4JB3A 2DFPA 1NBMA 2ZB2A 3PDUA 4DGSA 2UYYA 3N39C 2LGJA 3I3SR 3EY9A 4NAVA 4IJVA 4I5FA 4Y2QA 3JWEA 4TSKA 4G37A 4COOA 1XEXA 5AKYA 1V4VA 3CLTC 4TYMA 3ZVRA 1Y1RA 1SUPA 1PV4A 4GEKA 3E18A 3ZDFA 3FWHA 4PZEA 5DX0A 3SXUA 1Z35A 1NAHA 1L6RA 2I2FA 4TRMA 3W06A 4BY9E 1XTQA 1F4LA 3WNDA 4C1BA 3GJQA 2Q0HA 3ZCRA 1AQLA 4GHWA 4BO8A 2ATEA 2CVPA 3L5OA 1DDOA 3CNBA 3ZZTA 4HAZA 1JE1A 5ENVA 2Y6UA 4RPJA 2Y9PB 2QENA 1I7PA 4ZI7B 3E5RA 2ZI4A 5TT0A 2EIXA 4RE5A 3RD5A 4EHNA 1BQEA 4QG7A 5D2CA 1KKMA 3PP8A 3UW1A 4S0XA 1V96A 3L8ZA 2G76A 4NMMA 4Q3KA 1CJUC 3LI2A 2D54A 1SU4A 2E87A 3CN7A 1E2DA 1FFHA 2Y1LA 3R5FA 5CVUA 2P67A 3TNYA 3ZYZA 3S6JA 4OLJA 2XITA 2J5BA 4ZEVA 2PYIA 1L4UA 3R6WA 2GCIA 3ZNQA 4HVCA 4K6MA 1RPTA 1WDWB 2C82A 2HUNA 4F56A 3GN1A 2D2XA 1EP9A 5DPMA 2CK3A 4WZAB 1VC2A 4DB4A 1U1CA 4OH7A 3TMYA 3DMNA 3B1ZA 5I4KA 3WNCA 3I2KA 4O0LA 3TAUA 3AF0A 5HFAA 1D2CA 2QOEA 2H1VA 3K2BA 2QTFA 3FPGA 2IZ6A 4KOAA 1ZCFA 3MRVA 1EB8A 2JGEA 4Q9DA 3QXSA 3UPTA 1K8ZB 1NW8A 3MUNA 3PPVA 2VPTA 5K99A 4QOIA 4LOIA 1PK9A 1RWPA 4TLAA 2WTNA 1J97A 4LJ9A 4RFSB 5KQPA 1U7HA 4D43A 3HN6A 1ULBA 1A71A 1O3YA 4ENQA 4I19A 3D3NA 4ZAWA 4CG0A 1OI4A 4OJMX 1A4UA 3LYAA 3U62A 1T9HA 3K8OE 3PUHA 4UUQA 1KDZA 4HXFB 3FSEA 4CLEA 2P3OA 3A2KA 2DFKB 1ISMA 3MFYA 1ZN7A 3RBXA 2W71A 3JVVA 3QF4B 2OCDA 3TNDA 2XSZD 2ZULA 1AKNA 2DQSA 4HG2A 3GLRA 1GQYA 2B78A 2D5LA 3ESRA 2YY5A 3ZS8A 1A2OA 3IJPA 1AUXA 2YJNA 3BMNB 3CGWA 1ZVVA 3U0VA 5A5VA 1E98A 3BQ9A 4PIMA 1UT8A 2VN8A 3NAZA 3WV4A 1EWYA 1BE1A 2JANA 3TZQA 5CCXA 1RBQA 5F7JA 2O2GA 4U7HA 3PWSA 1X87A 4PZCA 3BD8A 3OHPA 3SX0A 4WACA 1KDRA 4FYJA 3BL8A 2YUIA 2XI4A 4HNAB 4YACA 3ROFA 1PNVA 3C24A 3CBGA 3K0FA 4Y8VA 3O03A 4MKZA 1I80A 1PEAA 5JZSA 1AQNA 3Q8XB 5KTYA 1P4SA 1P18A 2X0FA 3INTA 4R71A 3KDSE 4EZIA 2YVAA 4RK4A 3MTGA 4HDRA 1HF3A 5EJ8A 3T7EA 2O2DA 1ZWKA 4HDSB 5HJ7A 3NDBB 4HK4A 3FYTA 2QZJA 1YJBA 3PNBA 5ITSA 5KU7A 4QDJA 1HETA 1T6NA 3DVRX 4H18A 1G5QA 4IHQA 4PS0A 1DWOA 5ECWA 3BK2A 2OWDA 3ZJUA 5AESA 4F97A 3KQUA 5FWXA 1WABA 2HL6A 5BSMA 2OZKA 1SJ9A 5FEUA 1CNEA 4CYMA 2HQBA 3LGSA 1H8EA 2H5JA 2YRWA 2YFYA 4GZ5A 1GRCA 2WU4A 2W0MA 2ZRKA 1I1NA 1DJMA 1JQBA 2ZJYA 3QVOA 4WK4B 1A9TA 2QAJA 1G64A 2GEBA 3A6KA 1L5HB 5T3UA 1BWPA 3CLUC 1XMOB 4DR6B 2B1RA 3KYDA 2R62A 3L6CA 4FCVA 4IMJB 5CVJA 4KQIA 4YUZA 3JYQA 5HKKD 2BGTA 3WG9A 2WU3A 2JIQA 2VJOA 5DRTA 4DL9A 1T9GS 2YHIA 1GPDG 2YZMA 2Y92A 2GPBA 3OT5A 2OLJA 2PQ6A 4QU9A 3M0EA 3CUWA 621PA 3U16A 3DEZA 2QZZA 3O0TA 3OX3A 4INOA 1ZC4A 1JJVA 4LKOA 2EEPA 4MR9A 2GF9A 3H05A 3JRXA 4WECA 5E38A 4BP3A 1FZTA 1QHEA 5E2IA 4D26A 4V0QA 3G2LA 4ZYUA 1ESCA 2RKWA 2XCIA 5EZSA 3GLSA 3P2IA 3TQFA 2EWMA 2H7YA 4CU2A 3BRSA 2QBYB 3KQOA 2PCLA 3LYLA 2HCBA 1LPPA 3G2QA 3KJGA 3OECA 1IJKA 2JJ2D 1SCBA 4LHZA 4PZ0A 1E94E 2PQMA 3LUCA 3UVEA 4ZREA 4J0GA 1FFDA 3GB9A 3KYDB 4K5QA 3WWYA 4OBXA 2FN3A 4I46A 1D1TA 3WGQA 2NLOA 3C6YA 1IULA 1HFKA 4ZOEA 4CFZA 1XVLA 3M6LA 2D1RA 4REOA 2DBZA 3E70C 4RSGA 5DHFA 2EJUA 5DTQA 1WXQA 5D8DA 4M1MA 5ELMA 2VDWA 3RK0A 4BL5A 4EPVA 5EWJA 1FLVA 1J8YF 2NZUG 2QAGB 1PNOA 1N5DA 1TX4B 2D4HA 2I4TA 5ALEA 1JIVA 3VX4A 5C7LO 5ADVA 3GDWA 4I3HA 4EB0A 3B1JA 3PRKE 4GPAA 1FFXB 1PR5A 4B6PA 1EXVA 1RRCA 3G89A 2SCUA 3NU1A 4HQ6A 1KRXA 2OORC 1D9ZA 1VRCA 2PEZA 5KJFA 4FDTA 3K3PA 4DA6A 3M8KA 3NATA 4PFQA 2R85A 2GXUA 1ONSA 2UZ3A 3FOAA 2VYQA 3GZ4A 5ETJA 3DLPX 4YN3A 1NN5A 3KOUA 4MKRA 3ONWA 4RA9A 5BN4B 1YZ3A 1CUSA 3WV5A 2B4YA 2GLXA 1HFEL 4A1OA 4B3SB 3VPXA 1EU1A 1RQRA 3M2PA 4CMJA 2C31A 1PKXA 4KXLA 4DC1A 3R6DA 1NQAO 1PQYA 1YL5A 4LE1A 1ZNXA 5TQJA 4DMKA 1E9FA 2FRXA 3KQVA 3MJEA 3L0DA 4JLVA 3TGPA 4PLCA 2PTHA 4CLOA 4TYWA 3AFHA 4NABA 4CDMA 5JHHB 1NJGA 3RVRA 3HV0A 3WLFA 3WSVA 3L7KA 1TL7C 3B7WA 4NARA 1W6RA 1WXGA 3C7DB 4UPVA 3UJHA 4Z4IA 3QVVA 2H4JA 3T1VA 1FW8A 1FFGA 1KI4A 2L2QA 3QBVA 6AT1A 5J4VA 3HCAA 2PZJA 4B6SA 3G3EA 4TV8A 1PFKA 1QK4A 2VUIB 4QNNA 1D8TA 3L04A 3RTCA 3I6IA 1KOJA 3GUZA 1WMBA 3KVNA 5LBTA 1CEQA 2QSYA 3WK5A 5HZHA 1O9BA 1MPTA 2WA2A 2O48X 4EUSA 2PA3A 4G65A 4FDLA 4L07A 2CDNA 3VA7A 4LJLA 3LPNA 4WY8A 2P90A 3KEGA 3IUPA 2XHEA 4KLZA 4D6YA 1DJLA 1PJSA 3SKXA 4RNCA 4F2GA 3AZOA 4QPPA 1Y63A 4GI1A 3FWNA 4Z8XA 2VKQA 2EATA 4W8GA 2OXTA 4LVCA 1NQTA 3EB9A 4QJBA 3FKSD 4HDMB 4MVCA 3A2LA 1Y4DE 3DDOA 4JQCA 4DR4B 4YRNA 1XLTC 4OHFA 1CEEA 4XCXA 5HPYB 1OT3A 3K0EA 5ITWA 4QQFA 4FFBB 2N42A 5A4DA 5KVVA 2I4RA 1YE8A 2N75A 2Z08A 3F96A 4WRRA 4BNWA 4JJKA 4ZK2A 5BNWA 2IPXA 2AEEA 2VLBA 1H2WA 1DXYA 1E3DA 3F9RA 2ZI7A 3H0CA 2ZJ2A 1H6BA 3FFWA 3HKDB 4ZO4A 3JRNA 1II8B 2PRZA 4RY2A 4DR1B 2W2QA 3CRRA 4LS3A 3W4KA 1GN8A 3FNIA 2HIMA 3LPCA 4KLRA 4Y6RA 4D92A 1GTVA 3NMUF 4P38A 4K87A 3SEZA 1AK1A 2L18A 4AP5A 2W6PA 3AFNA 4QE3A 1LI7A 5IABA 1Z0KA 3ANMA 5A5DA 3CW8X 2FWMX 1FFEA 3U3KA 4M1OA 3NH6A 1BXGA 2HBRA 2K4MA 2BPOA 2XMCA 3PA6A 3LDGA 1Y3BE 4C7XA 2X8LA 2JRCA 5GONA 1QGZA 3REOA 2P5YA 2R751 2NU8A 2D0OB 1KY3A 1V3QE 3CEPB 2DSNA 3CISA 1G5TA 4GOMD 5ALYA 1XMJA 4LXYA 4BFWA 5IX8A 3B6ZA 4JUFA 5JYEA 1KF0A 3PUJA 1P60A 3DTTA 1SC1A 3MAGA 3ELYA 4CIVA 4LGYA 3EXIB 1WPQA 2WFAA 1AUOA 3EXIA 2D59A 1B3RA 4G1EB 1S96A 2COEA 5EIEA 2WSIA 1MVNA 4S3MA 4HLDA 1JEDA 2P9GA 5U9CA 1E3EA 2PRKA 3AVYA 2BCEA 2CLSA 1R88A 1XNQB 4N12A 3DVSX 2F3UA 3AR4A 1O95D 3K09C 3WLIA 1NSTA 1Z68A 3K96A 1U8FO 1N5RA 3JYPA 3L7LA 4J0FA 3EXEB 5SV2A 4YRIA 4QELA 1SXIA 4Z2AA 1I6KA 3GGSA 4JUIA 3SDBA 2ZE6A 3VHLB 1YTLA 1O97D 3KQPA 4HYQA 5HDQA 3WQHA 3MMZA 3E53A 2BEVB 2IYEA 3QPWA 2X9NA 2YBDA 3OPVA 5J4LA 4OXXA 5CB4B 4MRSA 3PQ4A 5I6DA 5G4KA 4KSCA 3R7BA 1SUBA 4Z1OA 4E88A 3JTMA 4KMSA 1VL2A 3W3AH 1NDUA 4KYIB 1UBRS 4BN5A 4CEIB 2J5XA 2BFFB 2GJ8A 2O0KA 3G0DA 3WK6A 3E22B 3GEGA 3PQ2A 5A02A 1T0UA 1WLSA 4OI4A 4P6VF 1ISPA 1F3OA 2A0WA 2JGIA 1E60A 1YB1A 4JQOA 3O3NB 3HUFA 3CNHA 1JEOA 1YI0A 5H80A 1WUTA 1NWCA 3IX7A 3SJ7A 1FJHA 1D2GA 3M9WA 1ZR4A 1JB9A 1E6CA 5JYCA 1TD9A 4FX2A 1VIVA 2ZB7A 3GPDG 3L06A 1QH1B 1W59A 3E9RA 1I9GA 1EK6A 4FKZA 4TMVA 1ITZA 4YAFA 4Q6WA 1S8OA 3ANNA 1UMDB 3ITNA 1DBRA 1QK3A 4JVNA 3O84A 1BX1A 2D7CA 4D5GA 4XH9B 3A3NA 4X1OA 4HXEB 3NYRA 2NQ2C 3M81A 3B7GA 2VDVE 1I2ZA 3V2GA 2OCBA 1KGSA 5HF8A 1TI7A 5IVDA 3TD6A 3KSMA 2O59A 5EC8A 1E1NA 2GM4A 2HJWA 2JIRA 3W9BA 4CFYA 4BMYA 3L1IA 4DWJA 2FFBA 2QS9A 1E6MA 1J06A 5AKIA 1GG8A 1JEEA 4KE7A 4IJUA 3E5MA 1QG6A 1JWBB 4Q6BA 5JS1A 3PCTA 1LTKA 1T36A 2EFHB 2AR9A 4R4JA 4DRXA 1VIAA 3I12A 4MDEA 3HYLA 1EDEA 4JKYA 2CMGA 2F3RA 4LXGA 2GYYA 4M1KA 2OZLA 1BWRA 4JEUA 1K1EA 5JT1A 5KU1A 3SYRA 2B30A 1H2XA 1XWWA 2V7WA 1I7QB 5ALFA 1HE1C 3Q15C 3PD7A 2FUG6 2O4CA 2NU7B 4GPD1 2CUNA 4O4LB 5L3QA 4LOKA 2JBHA 2VP9A 4GF5A 3GNSA 4G4SP 4FVTA 1QXSA 5T8KA 3SN6A 1T9AA 2BI4A 2DWPA 1ADJA 1A7KA 3EQ7A 1E2EA 3NHJA 2SCUB 3KOMA 4FHZA 3C16C 1Z6GA 1QC5A 2FMXA 3C3JA 5IM4F 3PC2A 1IIRA 3OZAA 3PF8A 3L2OB 4C6TB 4PLYA 2BHTA 1UWKA 3WNZA 1Z28A 3TBKA 1V95A 2QLBA 2DYKA 1DTSA 1R6TA 3TLXA 1T2VA 1BROA 1URPA 3CF2A 1C7QA 2OZPA 3D64A 4F7DA 2XTMA 2C2XA 5BV0A 3A4LA 1G20B 1UOOA 1AG9A 1XCPA 1HOXA 3AHDA 3JQDA 4JBIA 4TLLB 5J5CA 2H6EA 5DDIP 3SVZA 2ZBGA 4IIJB 4QGSA 2X0JA 3R3HA 2OGWA 2GEVA 1WVGA 2GOYA 4MWEA 2PKQP 1F6DA 4Y2VA 2OUIA 1T91A 3GFGA 1VPWA 4ZAFA 4EG0A 1QJ4A 4ND2A 1KKLA 3B5IA 5JMPA 3SZ3A 2EJTA 1W8IA 5K2OA 4MUJA 3Q3GE 1E0JA 2H07A 4M21A 4MGEA 5LP6F 2R00C 1X1DA 4FHEA 1N2GA 5FAKA 5JAHA 1NLZA 2COUA 2WWXA 4J07A 4QYTA 1XAIA 2ZBVA 1U9IA 2JFWA 3HGTA 4GX1A 5AVVA 2I1WA 2QX9A 3AL3A 1WV0A 5LB4A 1BS2A 2B2XA 3TFQA 2ZAYA 4KIGA 1E62A 4MQLA 1Y8QA 1V2GA 1FXWA 2BMWA 1VHQA 4XR4A 3M6VA 3TAHA 4EJ2A 2IY9A 4AKGA 2G72A 2R6FA 5FT9A 4ITUA 1NM5A 1RHJA 2QPOA 5EI5A 3SZUA 2JLBA 4AKTA 3D3WB 4PY2A 1JLRA 1K4MA 3K1AA 4L2IA 1HNXB 3LCJA 3ITDA 4JH0A 5BUZA 3C5HA 4L9SA 2H4HA 3E23A 3QBDA 2IYFA 3L07A 3RABA 1XN1A 5BRJA 2C0QA 1MJGM 3UMVA 1XDSA 2RBEA 4EG5A 5FOTA 1N2JA 2B4QA 4K9KA 4XZ3A 2OQ2A 2F55A 4IZOA 1M75A 1Z74A 3VR4A 4UDOA 2VK4A 1OIWA 2XQIA 4Z4CA 2YOGA 5BRAA 2YN2A 3I30X 4NBNA 5H4GA 3H5OA 5B64A 1EM8B 4F3YA 4F4JA 3L9XA 4M86A 2DBRA 3EZLA 4MR8A 2CV2A 3L46A 4HAIA 5ILGA 1Z3CA 4B9EA 1X74A 3ZCPA 2DY1A 3LX4A 2VTVA 3IBTA 1DIAA 3QE3A 2EXXA 4RESA 1FYVA 3ZX5A 4MKXA 2DT5A 2OBNA 5IN4A 3SF8B 1RJDA 5E1OA 2RG7A 1PVOA 1EAMA 1TCVA 4FMDB 4ZC1A 4C2TA 4YPOA 1LLCA 1ZSYA 4HQOA 3STYA 5C53B 2NOAA 3PUZA 4D45A 3LBHA 4RK5A 1NVEA 4XEHA 3WYBA 4E46A 1RVDA 2J0EA 4K6OA 3WGLA 4YECA 3WRYC 3DHEA 4UU7A 4U9UA 4CMEC 4BNIA 2PUFA 1SOAA 3QVGA 4TXJA 2Q99A 3IXMA 4OGFA 4OMCA 4RM3A 5KHAA 3FGOA 3I01A 4AY3A 4NOKA 3EHEA 4UHCA 3DCNA 1P6UA 3A1NA 3KKOA 1ZXLA 2RH4A 4AY5A 1M8KA 1VPDA 2ATCA 2XCQA 1SNYA 3M6WA 1G60A 2ZYSA 3OZRA 4JLDA 4K9SA 4EPYA 5K20A 3Q7SA 2BVNA 2MDTA 5C4GB 3WNBA 4G0WA 1K0UA 3F5SA 1VSBA 3DAHA 4ETMA 3N8HA 4DLSA 1YZFA 5AK0A 1W30A 4L76A 3C6XA 5TE9A 3LK7A 5B57C 4XRRA 1E1CB 2V6GA 3ACCA 4LMAA 1YR9A 3ZU5A 4F2HA 3DAGA 5DO9A 1UODA 4HGQA 4AQYB 2OAGA 3EMBA 2IPLA 3GLFB 1EVKA 2JLRA 4IDEA 2EW8A 2H11A 2GZ2A 5HK8A 2I67A 5FPTA 3WL5A 2BZSA 2OR3A 2R79A 3IH5A 5HILA 3TUIC 1CEXA 2XT6A 2Q5EA 3LFTA 4XDGA 3VZQA 5KSOA 2JIPA 1KK0A 3R0XA 4LHYA 3ANXA 2YS6A 1M6VB 1YZQA 2WIDA 4YT5A 5EYPA 2B9EA 2DQYA 1IN6A 1BS9A 5KYGA 4X7PA 1KEEA 1YZHA 4X62B 4P2BA 1TTTA 2P68A 2XUIA 3UWKA 1V71A 1NDHA 3K32A 2NPFA 4BAZA 2O5VA 4NATA 1R4NB 4HNHA 1Z5WA 5C8DA 1O8BA 5HIIA 2W11A 4R6XA 2Z1DA 3RTBA 1YUMA 1QQTA 4MJXA 3SJCA 1B74A 5KWJA 2F7SA 3B78A 3S8YA 3CONA 2CLEB 4KCGA 5BSFA 4QUAA 3I9FA 4UTVA 2BTQA 5KPDA 2JFQA 5DNDA 2W2VA 1SEVA 1OX4A 4NMWA 3TL2A 1U1IA 3MWDA 4MR7B 4MA0A 1N7HA 4KWTA 4Z1MA 3KOXA 4F4FA 4YCAA 1OFGA 3DR3A 2VQFB 1LQUA 4IG4A 4URYR 1I7SB 2A30A 1YUNA 3GP8A 4N41A 5C1OA 1QVRA 2AN4A 4A0FA 4IBOA 1NA5A 4Z0NA 3AY3A 1X7ZB 2BISA 3DAYA 2CVQA 2J9GA 3ML1A 3QYAA 1TO1E 1VZ3A 5DLYA 4DY4A 4EIWA 3QUCA 4XUGB 3ZH9B 3WS7A 5KTNA 4URXR 2QAGA 3DKPA 5CJPA 1WETA 4BUCA 5MF6A 3BT7A 4PVCA 3MWGA 1ZAYA 1N9GA 3GWZA 4CM4B 4ZC8A 2C97A 4QGFA 5FHRA 1JLKA 4MOWA 5JALA 1NFFA 2F1IA 4H3VA 4UDNA 5IXYA 2H1CA 2ZR0A 1EFAA 1C7RA 1QIEA 1RM5A 1UBCA 2DTEA 2FQ1A 3MWLA 2ZAGA 3G2NA 2V4MA 3H9QA 5F2KA 2E5LB 4OCZA 4HUTA 4CXMA 3G0CA 2PSJA 4A8TA 3OCXA 4QDZA 4IDQA 2R11A 1KRHA 1DO8A 2ONCA 3PUKA 5K4AA 1CZNA 4FBMA 1GJRA 5L7YA 3V3KA 2IHNA 3IV6A 4QNMA 4JEHA 2J4CA 4BNLA 1OHHA 1TMYA 1FXWF 2VK2A 1HQKA 1XZMA 3E9CA 5DEOA 3W5UA 3HPQA 3MTQA 3KTOA 4GWKA 1QAMA 5JASA 1U8CB 1DRKA 1M2WA 2Q3MA 3O5AA 4PQFA 4QSMA 5FA8A 2JVJA 4WUTA 5EWMB 3REFA 4X8HA 2RHGB 4BNMA 3FROA 4HX5A 4NPCA 1CS4C 1G8SA 2XF2A 1GGNA 2FEXA 2OHIA 2PPLA 3EZ9A 3MLAA 2CHVA 1Z0JA 3L0YA 5JH7B 1WQ1R 2A9PA 3IULA 3SVLA 3F67A 5DW0A 5IRCD 3WBJA 4E7OA 2ZYUX 1QP8A 1YRAA 1ZOOA 2GBPA 2GAIA 2FZLA 2OHJA 2YHIB 2GI4A 3Q7QA 4CIWA 2NZ8A 2Y1KA 3ZGZA 5CP8A 2H3EA 3OQNA 3LUAA 3I9JA 3GXOA 4M9ZA 4F2WA 4QU5A 1PL8A 3EX7C 2PWZA 2YZGA 2BMJA 4RK0A 4ATNA 4XJTA 2HLPA 2AQ8A 3PWKA 1EUYA 5CW2A 2UXDB 4ESHA 4Y3UA 1RFLA 4MQMA 1M2KA 3PR2B 4RD4A 1KO4A 4BKQA 3ESYA 2R7AA 2RHDA 1IJEA 4OBEA 3T9FA 3R3YA 4D97A 1QU3A 1GQFA 2BHLA 1S2DA 1BU8A 5BSGA 3ORHA 5BWLA 3HKEA 2HAEA 3FE2A 4ZVLA 5D3QA 5FWXB 2VPWA 3N2LA 1F2TA 3MSXA 4KZKA 3ZW9A 4TT3A 2EAUA 4DG5A 1PK8A 1U31A 4KRFA 4D1YA 3QPDA 5BW8A 3QWHA 4ZV7A 4B0OA 1YQ9A 5K0BA 1LH0A 4XDZA 4RKFA 2ZRNA 5EQTA 2YINC 5LD2C 3OTHA 2ZCVA 4JQYA 4D02A 1USWA 5JRZA 1OE0A 1JBKA 3JARB 4HCJA 1TUEA 3BEDA 4L3VA 3UWDA 4B73A 4EHKA 2YV1A 4MQEB 4P7GA 4E6EA 3TQOA 4EO4A 1M5RA 1RCTE 3F7MA 1EP2B 4Z4EA 2YQ4A 1RPZA 5J1TB 3B3JA 4KWEA 1P4AA 2ARKA 3D4PA 2O4UX 1U0FA 2V96A 3II6X 4LXXA 2QUJA 4MIYA 1II9A 4MO2A 2B4AA 3I2IA 4KZPA 4D99A 3O1IC 4FYKA 4J0KA 1U3CA 2ID4A 3L7MA 1GL6A 4DRXB 2XTZA 4TKUB 5K3EA 3BD7A 2REQB 3O94A 1P9WA 2LIVA 2IK8A 3DZ8A 5KSZA 2PZ8A 4CKYA 2VTBA 4EHHA 2RD2A 4N5HX 3UUGA 4PC2A 3P9XA 3FRHA 4FDAA 4PSAA 2QT0A 2I34A 2VNKA 4KTVE 3H9CA 3FCYA 5HM6A 2D0IA 4PW0A 2JBWA 4PHGA 4YUWA 3NKFA 4IIHA 2PX8A 1I3KA 1PQ4A 2C2KA 1NKSA 3FLEA 2RBKA 3FNHA 5BV1A 2FSHA 2ZWAA 2VPZA 3FUUA 2OO5C 2FWPA 4KTTE 3CH6A 3OLYA 5AKHA 1Q3KA 4PC1A 4P82A 2ZIXA 5KNBA 2A1TR 1EBBA 2O2ZA 3LXXA 3F9IA 3OPMA 4UEJA 4F9GA 3ZZ0A 4RULA 2R66A 3AZPA 3GBPA 5JXWA 3UXHA 1SQSA 1SY7A 2GTIA 2IXAA 4URUR 3T1HB 1WB4A 3QPVA 4IQ4A 1H22A 3FMOB 5IZCC 3QBEA 5KTMA 2YWBA 4R05A 5COBA 4ENTA 1R10A 1PF7E 3ZHTA 1VIYA 4HQFA 4MS4B 4DLLA 4U7JA 1WS6A 3WL4A 3E7WA 3REQB 5IAOA 3I39X 4B7ZA 3E22A 1FDRA 2WIBA 5K8VA 1L7NA 1LPOA 2PKRA 4BKOA 1SXPA 2C07A 1KJWA 3HUUA 4DMMA 4YMLA 4M99A 3HEMA 2DR0A 1ODTC 4RKEA 1SGWA 1U8AA 5CG1A 4LJRA 4BNYA 5F7OA 4HJRA 2GT1A 4YMSA 2AOUB 4JI2B 4E2WA 1HDYA 3KZCA 4MI6A 1MNAA 1V9SA 1EPUA 3EMKA 4UU1A 4BAGA 1Q77A 3W6PA 3VVCA 1BNCA 2VJNA 5H02A 2WMDA 3F2VA 5JWHA 2IH2A 3VKUA 4OFZA 2AG6A 3A3OA 1O6FA 3KEQA 3LHDA 1PJTA 4X1KA 5EIFA 5JCJA 5E8RA 4PQGA 1AKTA 1SKQA 3G2MA 1E5QA 2R4UA 3IP1A 1PWEA 2QP4A 3PICA 4J8PA 1P80A 1E6KA 1A0OA 4F9EA 1D09A 5CA0B 1YFKA 2Q8QA 2V03A 3I1IA 2RJOA 1VLZA 5AH0A 4BQPA 1XNHA 3Q1KA 4JOQA 4II7A 3MAJA 2QP3A 5AOVA 2F00A 4YI3A 4R9RA 4ZIRA 4CUJA 2Z2IA 3E9YA 1ZU4A 3SMQA 1YL7A 4JBXA 4MV9A 1RJFA 2XYPA 3ETLA 4R8SA 5HDBB 4CG2A 4UD6A 2CBZA 3HB9A 3L7OA 4G0PA 1RBYA 2P9JA 4AJ9A 2CMDA 1JTEA 4G5OA 3X1MA 5I8WA 2VSXA 1DPGA 3DONA 2O8EA 2BCJQ 1JJBA 1HH4A 2IZ1A 2F1JA 2WHPA 4L02A 4CL3A 1QBKC 1JT2A 4QO8A 4CKCA 4R9SA 2GEFA 5HQ3B 2QX7A 3C6QA 3NONA 5C5EA 1FSZA 4L7VA 4RVGA 1XUOA 3TVYA 2KW5A 1EFDN 2AC2A 5AI0A 3HV2A 1W36C 1NMQA 1RWKA 1PVDA 3RSQA 3VO8A 1M74A 3I0MA 3OZSA 1OLUA 3KQQA 2NZ2A 2A4KA 1OHHD 1TRKA 2ZUVA 1B8NA 3X44A 4LOLA 4YMGA 3VV2A 4MNTA 3ZJ4A 1NYRA 2M98A 2IYQA 3A3KA 1U5BB 2WTBA 3GCXA 4HPJB 4M4SA 4QXPA 3I58A 5ES3A 2PPVA 2PL5A 3FSRA 3N70A 1Z06A 4M7RA 3ZV4A 2GZ1A 2YVLA 3C3BA 1V9CA 2XUJA 1DRUA 3IBFA 4IQGA 4MVJH 3FAKA 3GVHA 3TN7A 3FUWA 3USZA 4QUKA 3U6BA 4FFSA 3H0KA 1N5JA 1NBOA 2ZXUA 1SKYB 1WNTA 4HATA 4C21A 1Z7GA 4K1LA 1T2DA 3I5XA 1CUIA 4ZHSA 3OCJA 3G7NA 4DADA 4JJGA 1G2IA 1X2BA 3K6JA 2EHDA 1OTHA 3E3LA 3I5AA 2O14A 4HAOA 1MA3A 1QO0A 3UA4A 1JU4A 4GBMA 4K6HA 4QEDA 4TPKA 3ZY3A 1TGVA 4M8IA 4WNCA 2WMOB 2VQ3A 3AB8A 5JNSA 3SBDA 3U7EB 4UHJA 1PGPA 4QXQA 2PGAA 1M2VB 2CD9A 4U2BA 4DLNA 2EKQA 2IPOA 3FOBA 4P81A 4E12A 4IHKA 4DDVA 4GPZA 2PKCA 2RGNA 2IU4A 4ZCTA 5IXJA 1E9CA 3ACBA 2HU5A 1QF9A 3HJRA 3MS4A 2G5GX 1FRNA 1UFOA 3K1YA 1MXHA 4JVLA 1GPUA 4L22A 1CYDA 1NYLA 2A2ZA 4UHBA 2GJAA 5KX5A 1BEZA 1RM3A 4EQ6A 1M1ZA 1CUZA 1YHYA 4IYJA 4UZFA 3Q8WA 4AK9A 3WYGA 3DEJA 4IDNA 4R2XA 3BXPA 1EX1A 1VL8A 5KNLA 2ZG6A 3QH4A 2XNKA 3AVWA 4OXIA 1Q14A 3TVDA 4GD3Q 3FPCA 3HG7A 3WLQA 1KORA 3OE5A 1RADA 1GTJ1 5FQOA 3KAJA 2NTNA 1SA0B 3A1WA 2C83A 4W5RA 2YCLA 2WILA 1LVHA 4FZJA 1N8NA 5IJAA 2E5WA 1CS0B 1G21A 5BSKA 5JH7F 1EWKA 5A3SA 4X6XA 4B81A 3H04A 4G1UC 4Q9KA 3VDNB 5FUWA 4Q9IA 1IONA 1TCBA 4O2AA 1CQZA 1Z82A 2ON6A 5K2MA 3ZV5A 4UNIA 3PEWA 5E95A 2C57A 4YRJA 2FPXA 2WSSA 2JCVA 1GZ4A 3EE6A 3KHTA 3WHPA 3ZEIA 1JYFA 1PNRA 4CF4A 4YRGA 1RLMA 2ZW9A 3UFXA 1C5KA 1L4FA 1QLHA 2QXYA 4MW4A 1UZLA 3DQPA 5ICEA 4Y1RB 3TPZA 1XA4A 1Z38A 3TRIA 1A5BB 2VATA 1N0VC 1S2GA 1NFRA 2VWQA 4DMFA 4HAWA 1T5SA 4E5YA 4ZT5A 2FZCA 1ZOIA 1JKXA 1AKVA 1EG2A 4PO8A 3UM9A 3V1YA 1KJ9A 4DLBA 3MBKA 3PGJA 1B26A 3AO0B 2WTUA 4Q15A 2HHAA 4HFNA 4HWOA 4M1QA 2RGRA 1DXOA 3NTVA 4A2QA 3TK1A 1IATA 1PYDA 2C5LA 1GSAA 2JH9A 2J08A 4MDHA 1NATA 1P3DA 1C9EA 1WQ4A 2DUNA 1T9ZA 2GFIA 3EIXA 1JH8A 1JLMA 4MJ7A 3RCBA 2G63A 3GDGA 2YHBA 3BMCA 3ZOZA 1T1GA 3THWA 2X5JO 2QM7A 2E48A 2ZYAA 3KSRA 2I7DA 1RAEA 2GPYA 3MEQA 1B1CA 4ZYVA 4EHIA 4FIDA 3UKOA 2RBGA 4N9WA 3N59A 3SIWA 2DUWA 3EDMA 3OIYA 2E49A 3DEAA 3A1VA 4FM9A 2AE1A 3C3MA 1E3IA 3L8DA 5G3YA 3BBLA 1Q2XA 2QTMA 3BE5A 4WVFA 2R8YA 1TYZA 2C3OA 3IJ5A 4PN3A 1E4EB 1OWMA 2WTMA 4JJEA 5DYYA 2Z95A 3SBXA 1FVOA 4EMSA 4AUEA 1T4CB 3KPVA 3U7QB 3ZGYA 3C5EA 1W4LA 5FRDA 3UK1A 3WC4A 4WESB 2A9JA 4XAQA 1TU3A 4QBKA 5ALPA 3VAYA 5EGSA 1T25A 2IKQA 1K4KA 3DQQA 3QJYA 1E5DA 2PGIA 1QS0A 2FLVA 3NHMA 3O93A 4G9GA 5A3QA 5CRIA 1QF6A 3IEPA 1ZK3A 3L6OO 4OAOA 2Z83A 4IIJF 1GPKA 5I9BA 3V6LA 1XAHA 2XOKD 3K4PA 3QPCA 2VHEA 3AEXA 3NI2A 5HBRA 3DDHA 4ZN6A 5I7RA 1MB3A 1GOTA 3IBYA 4CT5A 1D6NA 1TFUA 4QXMA 1HT1E 1SULA 4DB2A 4RPIA 3DOFA 3HSYA 4BDSA 3I9KA 2FU5C 1JWAB 4OB7A 1PD1A 4D96A 2QG9A 4X3CA 5I51A 3EIUA 2BR5A 4AJKA 1QTQA 3SC6A 3VSDA 3NOQA 4IGEA 4AZWA 3OZXA 5D7NA 2ODEA 1MIHA 4KNWA 3GJ4A 4Z99A 3UK7A 1J0XO 1RAIA 1BCSB 4D4LA 1SCUB 3A6DA 5LXTF 1VL0A 2IYPA 3LSYA 5CJ2A 5EXSA 3SC4A 3W5IA 3ZBTA 2O9JA 2REXB 4HDCA 2DPLA 2OXCA 3IQZA 3TCKA 1KWGA 4MUHA 3GLGA 2IV2X 3NXKA 5A4JA 2GARA 1KBOA 2C59A 1M1NA 2ZUBA 3FYDA 5ALSA 3TKYA 3UC5A 4DQ0A 1PLJA 5EP1A 5HNKA 4DIFA 4DWVA 1CFJA 2ZM5A 2IYSA 2RGYA 1NOKA 3HJGA 4E2XA 1A82A 1WMAA 3O4GA 1HLDA 1QC5B 3JD3A 2IITA 3LQFA 3NHLA 4NQZA 1CRPA 2ZRBA 3GIDA 3QLUC 4X91A 2PLWA 3R8XA 4HH4A 1F9EA 3C3EA 4L3WA 4PTYA 4G07A 3OO1A 3DFMA 5HX7A 2VA9A 1JIIA 3AUFA 3BGWA 3ELUA 3HU3A 3QMWA 3QY9A 5FUYA 2AYZA 1EUQA 3N07A 5BXQC 3IUJA 3NHRA 1MG0A 4H27A 4CQJA 2H5EA 2DVMA 2OZLB 4TV8F 1BSVA 5EXTA 2I2WA 3V9AA 5HZMA 2HI0A 3FUXA 4R2MA 2UZ0A 2VHYA 1ODIA 3EPRA 3PFBA 2FZ4A 3IJEB 3ORRA 2ZE7A 1R6BX 5C8ZA 1NPDA 4RFSA 2FPUA 2NV6A 4BMCA 1EJ6A 1XX6A 5F4ZA 2VAXA 5EVCA 4NOJA 1RQ2A 3DFKA 2V0NA 3LG2A 3O31A 4TGLA 5GONF 4LY0A 4Z1MD 4DR3B 2ESRA 1DAPA 5C4IA 2C2BA 3HO8A 1IEVA 2V97A 3BWXA 3LHKA 3NORA 2Z5GA 5KWIA 1BHJA 4D8VA 3DTYA 5JI2E 1G6Q1 2J6IA 2G06A 2P6UA 5EE3A 3WGOA 1V16B 1W2HA 2VF8A 3Q6MA 5EFOA 7MDHA 4ESVA 4OD0A 1EK1A 5EG5A 1WU8A 3LHFA 2ADFA 2MU1A 3M6UA 3QKTA 4RJIA 4TL9A 3T61A 1DAFA 1DXQA 1OB2A 4EYOA 3OIVA 4FNOA 3TNFA 1J0AA 1NBMD 2FB9A 3H17A 3SX4A 4UAVA 4A0QA 5FF9A 4DDUA 5B2FA 5BN3B 4LY9A 3P4XA 3M33A 2I8LA 2DFVA 3QSGA 2YYSA 4PIPA 1PN3A 3JVUA 3T7TA 3W3ZB 1U2GA 2QAGC 3BTUA 4L73A 2ZJ4A 3RYTC 3UN1A 3PZBA 1U65A 1NKVA 4P5EA 2XRZA 1QGUB 2O05A 3ST7A 1Z39A 1YZLA 3ZTTA 4L3OA 1EEXB 4KDRA 4AJNA 5BOSB 3DOUA 5D85A 3TG8A 5HFJA 3OURA 5K0LA 5DNYB 5IPFA 1EXDA 1XPUA 3G8YA 4TZ6A 3IERA 1RBMA 3PRYA 3AI7A 3QKRB 1BXRA 2DG2A 2IIPA 2PANA 1AT1A 5A9TA 3ZDRA 5LP6B 3PFWO 3GFTA 5LQUA 4TV9A 4IUCS 3RVSA 4D4MA 4AY2A 1U1EA 2MSNA 1JZQA 4I3GA 2G08A 3K6SA 5CX1A 3UXYA 1WBBA 4LV5B 5G4KB 4LE2A 4HAYA 4M7OA 2C7PA 1GPAA 3QA3E 3GRFA 3IR5A 2PSHA 5CB4A 5I7HA 2AXEA 3Q3HA 1MB9A 2LKDA 3DOOA 5D1HA 5JTUA 3HJNA 4TTQA 1GNSA 3LL7A 2CE2X 2QQFA 1HG0A 1R5OA 3FCXA 3NYQA 3ZHOA 4H3SA 3ZWYA 1G7SA 3DPIA 4JSYA 2W2KA 1N25A 1QANA 2P2DA 3QPBA 4C88A 5GZ3A 1EDDA 4J76A 1P0IA 4U2FA 1FLAA 3TJZA 5HUJA 1DKMA 1W4RA 4CV1A 4XA8A 2W22A 3JAKB 4XJXA 3VTAA 2FPPB 4UBIA 4M9XA 1C0LA 1YF3A 1DQPA 2VJDA 4FEGA 4HPXB 1KSHA 4Q4HA 5DLQC 3U1BA 1ADGA 1YS9A 1NNEA 4G24A 4GSKA 4CF6A 3W5CA 3ZK8A 3V4OA 3EVZA 1H4VB 3PXAA 4HQLA 2VWHA 2WHYA 2Y93A 2WLSA 3ZZNA 5CFQA 3SZOA 3TZLA 1BS1A 1FVFA 1KXJA 4WE3A 5H70A 3DTVA 1I2MA 1NRXA 2JRLA 4WJZA 3COSA 1YJCA 4XUEA 4YT8A 1QO9A 4Q4DA 5A1JA 1QQ6A 4UHEA 1A2QA 3SYKA 4YV7A 1Q0HA 2C8VA 3L0BA 1U0SY 1Z22A 3IXLA 1FXUA 4BFUA 2UYCA 4XWKA 4HGZA 2C5EA 4M8SA 3L6BA 4I0WB 3WFIA 1H65A 3AKYA 1IL0A 4GI5A 2PIAA 1XTVA 1VJ5A 1UBHS 4F92B 3O8LA 1QOZA 5AVKA 3WGNA 2VBIA 2R8ZA 13PKA 4RKWA 5GPBA 5B37A 3ZZUA 1K86A 2Q27A 1CDDA 2VXCA 2ZSEA 5DU2A 3DGEC 2AJCA 1ZNQO 2P41A 2XMDA 3IEIA 3FPFA 5J40A 1PEYA 2N1MA 3EOZA 4D8TA 4MP6A 5IKPA 1QQBA 4NMHA 4M87A 5K01A 1HPLA 2O06A 3E4DA 4Q7EA 1M6WA 3R0VA 3EZ6A 5DM60 4E6PA 5KQMA 5A0TA 2C96A 3NBMA 4B4UA 1MGOA 1RRVA 3A04A 4CDGA 3CX7A 1Y4AE 5CPFA 1Z5VA 3T5MA 1A7UA 5DHSA 3JD2A 1QVWA 3U9TA 3VV3A 4RYDA 1YOVA 3AR8A 3B9RA 4M83A 5JROA 2RGDA 2P9CA 3SP1A 1HO3A 1SCAA 1N8TA 3BRWA 5CJJA 5DNVA 2HHCA 3Q5EA 1B8OA 1XRLA 1EBUA 3CJQA 4ZANA 3OF3A 2V1UA 3KEOA 2ZYHA 4X66B 1ZH6A 1EGQA 3LNCA 4EHLA 1SXJB 3QLJA 2Z98A 4XX0B 1QR2A 3BK7A 3KK0A 3O21A 5JAQA 4X95A 1SR8A 3GG9A 3QP9A 3UK0A 4DMUB 3AEUB 5ISMA 2JA2A 4ZVNA 3W5VA 4IF4A 5LZ8A 3TSZA 1YI8A 3M70A 4J9VA 3ZG6A 1T2FA 4AJ1A 4RDHA 3U48A 1PBNA 1J9GA 3RUFA 3KBBA 2H51A 1JZSA 2CUTA 3T3EA 1HV8A 1BGXT 4B83A 5GP1A 5ITZB 2E6UX 1X7ZA 2NUBA 4GBJA 1A77A 4YXFA 5KOHB 2AW5A 5FD8A 4I9UA 2ZRJA 2Q21A 4HYTA 3GRUA 4ZA2A 5CHEA 2BEWA 4BKPA 3B53X 3UB2A 4NK4A 2INGX 4BC0A 3JQ7B 1P0FA 4ESOA 4ND8A 2B5VA 1CQXA 3W5DA 3X1XA 3DOEA 4GUDA 4D9IA 3UPUA 1G5RA 1D7AA 1ZJ6A 1QHNA 2VAWA 3OCUA 2OMEA 3WQRA 1E1LA 2POCA 1UFVA 2A0YA 4LGVA 2OLKA 3DEYX 2B20A 2GZRA 2AK2A 1RYBA 2AFIB 1UIMA 4ZVKA 4BX2A 1E7QA 1OLSB 1QTRA 2PHZA 3PHBE 4EITA 1LK7A 3KDAA 4YDHB 3FRJA 1G4UR 2I4MA 2B25A 3RKSA 1QIMA 3KFVA 4E21A 5KYWA 1IBLB 2CSXA 5F3DA 1H2HA 2NAPA 4RHFA 2GUGA 4JI6B 1TYBE 3OZIA 3M4NA 2PH3A 5WRFA 3BQNB 2ZCUA 4AKEA 5AK4A 2H1HA 1U8YA 3N2NA 4RPKA 4QRDA 1HE3A 3BFKA 1Y1SA 2QRGA 3G88A 5ILQA 2FRDC 4ZQHA 5BQOA 1IIBA 2HSWA 1ZVKA 2IWRA 4AMUA 5EKDA 4B34A 4QNRA 4Q66C 1DP4A 3TIFA 1RYNA 1A95A 1BE0A 1YONA 3ESAA 2QSJA 2W9XA 3EGDA 5EE9A 4TTPA 2FPGA 4G0YA 5AUOB 2D2VA 3KKZA 3R3XA 3F90A 3MM4A 5IBPA 3F6YA 1XRMA 4L8GA 4M9CA 3Q3IA 2G9UA 3E05A 2C94A 4XFKA 3P1JA 1RQGA 3D6NB 4MQFA 3Q7TA 1TPZA 2RGWA 4Q4AB 1TTHA 4WD3A 4EF4A 6REQA 4GQIA 2P79A 4OB8A 1IBMB 5I9LA 2Q2NA 3U4MA 1E1QD 3RC3A 2Q6VA 1REQA 3BE6A 2Z6QA 1NT2A 4F86A 3IDFA 2IP4A 2UYGA 3DEKA 4KXXA 4TUYB 3KQYA 4EK9A 1JH9A 4GOXA 4Z3DA 1DRWA 4FNAA 5LPNA 2YVQA 3AZQA 1W94A 2GEUA 1Z17A 2RI6A 2QK4A 5FORA 3FCSB 4EPTA 2F3PA 4G0NA 3DZCA 1EVZA 3A4NA 4DMGA 1XT6A 4PZYA 4LZJA 1QV6A 4I1IA 2PZLA 1UBEA 2G77B 2ZSJA 2AD1A 1SWWA 2NUAB 5BR7A 2PX0A 3AIIA 5HSGA 2WU8A 4PG6A 3UANA 3B5EA 4V0NA 1IQPA 5BSRA 1EE1A 1A9XB 2VSFA 1YC5A 3QKSB 2JBAA 3GRVA 5AKGA 1HDRA 3F7TA 3T5DA 4J1NA 1M6NA 3U1TA 1U4NA 4RBNA 4CIXA 3VDMA 2XWQA 5FBQB 3BWCA 5IM4A 1J39A 1M34A 2BFNA 2Z8YA 1I01A 3NHSA 4LXHA 4LYDA 3R7WB 4D3FA 5CTJA 5CBPA 2V4ZA 2ACWA 5CH8A 2JI9A 2VF5X 3EWSA 1JVSA 3JZAA 2ZEJA 1HR0B 2QLNA 4AXXA 4AXBA 4E3ZA 1DINA 4IQFA 5DLPA 1E0AA 1A1SA 2JJ1A 1A5AB 4DR7B 5DT9A 1ZMXA 4NG5A 4LRXA 1RYDA 1L8QA 4MV6A 2KBEA 3SS7X 3NM6B 1JJ7A 1UBNA 3LBIA 3WMXA 4RJLA 3IO3A 3WTBA 2C9DA 3WIDA 5IFKA 1VKZA 3FBGA 3D3WA 4CM8A 3CM0A 2JCXA 4F4IA 3E03A 1CRZA 4RHCA 4IGKA 2BZ0A 3OPQA 3EU