3HNRA

Crystal structure of a probable methyltransferase bt9727_4108 from bacillus thuringiensis subsp. northeast structural genomics consortium target id bur219
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
193
structure length
193
Chain Sequence
DIQYKEVFAHYEDILEDVVNKSFGNVLEFGVGTGNLTNKLLLAGRTVYGIEPSREMRMIAKEKLPKEFSITEGDFLSFEVPTSIDTIVSTYAFHHLTDDEKNVAIAKYSQLLNKGGKIVFADTIFADQDAYDKTVEAAKQRGFHQLANDLQTEYYTRIPVMQTIFENNGFHVTFTRLNHFVWVMEATKQLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a probable methyltransferase BT9727_4108 from Bacillus thuringiensis subsp. Northeast Structural Genomics Consortium target id BuR219
rcsb
source organism Bacillus thuringiensis serovar konkukian
molecule tags Transferase
molecule keywords probable methyltransferase BT9727_4108
total genus 68
structure length 193
sequence length 193
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hnrA00
8MHTA 1T43A 1IM8A 2EFJA 3M6XA 2V74B 3I58A 4HGYA 4P58A 5HIIA 3VSEA 5CCBA 2ZIEA 3PB3A 2PXXA 3DP7A 1NW8A 4RTSA 1KXZA 3JWHA 3DUWA 3R9XB 2WA1A 1X1BA 4FGZA 2AN5A 4KVZA 3FYCA 3BWMA 2O07A 1JG2A 2HWKA 3THSA 4C4AA 2JH9A 2OYRA 3REOA 4C08A 3TMAA 2B25A 1RJFA 1NW6A 1TW2A 1RI2A 2AS0A 2PY6A 2IDKA 3FYDA 1KYWA 1RI4A 3EVDA 5GM1A 2P8JA 1KPGA 3DXZA 3G5LA 4P7GA 3CJTA 4PGGA 3TM4A 5LQCA 1QAQA 2GS9A 4K6MA 3ERCA 2GH1A 4PYLA 4G56A 1YFJA 3WSTA 2AOUA 5DM4A 3HCEA 3OE4A 3FTFA 1AV6A 1JQEA 2IFTA 1SUIA 2ZWVA 1MJFA 3P9IA 2ADMA 5K0NA 4X60A 1X1AA 5CVUA 5ICGA 2H1RA 4DM3A 3FUTA 2ERCA 5EZQA 5CIYA 1TW3A 5K0LA 4WXHA 4LWPA 3OZRA 2ZZKA 4RTQA 2OZVA 4QVKA 4AZTA 1BKYA 3UFBA 4R05A 4GQBA 3ANXA 2OB2A 2PX5A 4OA8A 5GINE 1RJDA 2BH2A 2K4MA 2O57A 3ELWA 3GRZA 3KKZA 4FS8A 5DX8A 4OQEA 3PFHA 1DL5A 2GA9A 5K0CA 1ZKDA 4X61A 3UJCA 3HA3A 1WG8A 2P3OA 3NWEA 2C7RA 3A26A 1HNNA 4AZSA 4E2WA 3NDJA 4R8SA 3NDIA 4OBXA 4MQ4A 3UA4A 2I9KA 5BW5A 4E32A 4R6WA 5T6BA 3X0DA 5K8VA 4X41A 1O9GA 3E8SA 2PXAA 4PYMA 3DXXA 4PCLA 5DM2A 2WK1A 3BUSA 4Y30A 3A7DA 1P1CA 4DMGA 1VPTA 3IHTA 1XXLA 4E2ZA 4U7PB 4X1OA 2P35A 3HA5A 2XYVA 3L8DA 3K0BA 1XDUA 4XUCA 4EKIA 3B7PA 3GU3A 1YZ3A 4PGHA 2YXEA 1QAOA 3EVZA 5DTQA 2PX4A 3FUVA 4DF3A 3P9CA 5KVAA 4RTKA 2GB4A 1R6AA 3LL7A 5FHRA 2F8LA 3PLAE 3EPPA 3UA3A 1MHTA 1SUSA 4GOOD 5CVVA 4DZRA 1O9HA 3GRRA 5KYGA 2FRXA 5EMKA 1WXWA 2QYOA 3BGIA 3ME5A 4FT2A 5KQSA 3PS9A 5H02A 1VBFA 1EAMA 3CJRA 2VDWA 2BR3A 3RIEA 2PXCA 4KDRA 4RTNA 3OCJA 4YMHA 1NT2A 2CKDA 5EGSA 3TKYA 1G8SA 4A6DA 1SVUA 1I9GA 2JHPA 3HVIA 1QAMA 1RI3A 3PX3A 3THRA 3DULA 4E2YA 2OBFA 5EVJA 3EEOA 3SSMA 3LDUA 1QZZA 2VDUE 3S68A 2XVMA 3FTCA 5ERGB 3LBFA 2QRVB 3DLIA 4AZWA 2AVDA 5DLYA 5M5BA 3FUUA 1R8XA 2V7EA 4E31A 3KPVA 2IGTA 3EVEA 3A7EA 3CJQA 5LQAA 2O05A 3GGDA 2NNWB 3PVCA 4HGZA 3TM5A 1FPQA 2Y1XA 1YF3A 3BGDA 4MHTA 3SR4A 1NKVA 3LDFA 2AOTA 2OB1A 3HCDA 4PONA 3HM2A 1X1DA 2N47A 1R18A 4XCXA 5E1MA 2PX8A 3O31A 2JHCA 5EOVA 2ZZNA 4XUDA 4XUEA 1ORIA 1SQFA 4RVDA 3P2EA 3A4TA 4EVIA 3CCFA 1NW3A 3EGEA 4R6XA 3RODA 1G55A 1AF7A 1D2HA 4ZTBA 2PBFA 1N2XA 3TKAA 4CKBA 3PFGA 2ZCJA 1VP3A 5C0OE 4E30A 3R0QA 2BR5A 4MTLA 1M0EA 3OPNA 5EZSA 3Q87B 1RJGA 2QY6A 4UOEA 2HV9A 2OY0A 4YUVA 4HTFB 2ESRA 3KQWA 2PKWA 5EC8A 5FTWA 1IXKA 3AJDA 5HOQA 4EQZA 2I62A 2IPXA 3LDGA 2ZIGA 1ZQ9A 4RVFA 5E1OA 5GOZA 2PJDA 2A14A 2AOWA 3HVHA 1EG2A 3LCUA 3GDHA 3OU6A 1JG3A 3R24A 4M37A 4C05A 5LSAA 4GOMD 2O06A 1L3BA 5DX1A 2ZBPA 4IV0A 4P7FA 3HEMA 3G2OA 3ELUA 3M33A 2ZZMA 1RI1A 3BKWA 1QANA 1VE3A 3NW9A 2VZ9A 4BLWA 4RTOA 1WY7A 2Q41A 5DTRA 3UJAA 3CKKA 3UBTA 4H0NA 3TRKA 5U4XA 1I4WA 2I6GA 2P41A 1TPYA 3TPZA 3SSOA 2UYCA 2GAFA 5FA8A 5F2KA 1JTFA 4ER7A 2ZWAA 5ICEA 4PYOA 2EX4A 5DRTA 4PNEA 1PRYA 1ZHFA 1Z3CA 5DX0A 2EJUA 2Z6AA 1D2CA 2HNKA 5DT2A 4RV9A 2YVLA 2G71A 3MCZA 3A27A 1H1DA 2CMGA 3R3HA 4F86A 4AZVA 3SGLA 3LSTA 1KPIA 2XYQA 4OA5A 4RYLA 4PIMA 2OXTA 4E33A 3BKXA 3EMBA 5FHQA 3HP7A 5FQNA 3EVAA 2HR1A 2Z6QA 3BT7A 3LKDA 3F4KA 3MTIA 1F38A 5CUQA 2BM9A 2IP2A 3ELYA 5DXAA 4ER5A 3B89A 4FR0A 5DRYA 2P7IA 5CVEA 5ICFA 4CTKA 3FRIA 2E5WA 4PWYA 4HSGA 1XCJA 5DM0A 3ORHA 4QDKA 2C7QA 2EJTA 3KPYA 4F85A 3T7SA 3C0KA 1G60A 2IIPA 2P1DA 3M6VA 2KW5A 5K0EA 4GC9A 4BLUA 3FPEA 4C03A 3C6MA 5D1HA 3P9NA 1IY9A 2G72A 2H00A 4HC4A 4PYQA 3M6WA 2B9EA 4FZVA 3UJ8A 4PYIA 4C04A 2PSSA 5HIJA 1V39A 1YFLA 2H11A 1KPHA 4M7RA 5KS2A 1YB2A 1KR5A 1FP1D 2DULA 5LQNA 3OFKA 4L7VA 1G6Q1 2AN3A 2QRVA 4IKPA 5E2AA 5K09A 5HZMA 2HMYB 3P8ZA 3E7PA 3IEIA 3PT9A 2UYHA 1FBNA 1R74A 3I64A 4MWZA 3GRYA 4M38A 3UJ7A 2YQZA 3LECA 5K0GA 1KIAA 1L3CA 2BR4A 4AX8A 3CBGA 4O29A 2ZW9A 4ER3A 3TR6A 3OZTA 4RTPA 4GOLD 3DMGA 4E2XA 3OZSA 5MHTA 3NJRA 3B5IA 4RX1A 2OPBA 3GRVA 1YZHA 1O54A 1VL5A 4DCGA 2XVAA 4DQ0A 5JUWA 5K05A 5CD1A 3JWGA 3G5TA 3D2LA 3M4XA 5IH3A 3TOSA 2OKCA 3GO4A 2YTZA 5EMJA 1FP2A 2FPOA 1DUSA 4JXJA 2NXCA 3MCTA 3MERA 4GC5A 4LG1A 5E8RA 4CWAA 2ONZA 3K6RA 3I5UA 4YUXA 1L3IA 1G38A 4RTJA 4RTRA 3OU7A 2NXJA 2AR0A 1R00A 2AVNA 5E9JA 5GM2A 5D1NA 3V8VA 5BP7A 5LQJA 2BZGA 1KHHA 3IYLW 3ER9A 1EJ6A 3FPFA 5K0BA 3FUXA 1ZGAA 2NXEA 2YX1A 3HCFA 4PYKA 3GNLA 4EMSA 2GLUA 2XBMA 3NVMB 2AOXA 4YUYA 3DR5A 2WA2A 2P3QA 2PVCA 5FWAA 1BC5A 1JQDA 5FQOA 4P7JA 5BW4A 4MIKA 2IH2A 3AXTA 2QM3A 4FP9A 3SM3A 3TLJA 4B17A 3ELDA 3B3FA 4PIPA 2JJQA 3LKZA 5HEKA 3HTXA 5G02A 4DCMA 3U81A 1NW5A 3HNRA 4RTMA 4GUAA 5T67A 2ZULA 2JG3A 3AY0A 4FSDA 4Z2YA 10MHA 2PWPA 3RW9A 3HVJA 4HRAA 5EEHA 5GWXA 3NMUF 3P71T 3C6KA 2FHPA 3G8BA 3MAGA 4GF5A 3JWIA 3QOXA 2P3LA 4OX9Y 3DXYA 4FT4A 4DKJA 2UYOA 5EEGA 4V0QA 4IV8A 1XDZA 3E05A 3T7RA 4BP3A 4POOA 2IH5A 2P40A 4QTUB 5IKMA 4YV0A 3AXSA 5DPMA 2PT6A 2QE6A 2ZBRA 3KQQA 4U7TB 3UJ6A 5CCXA 5LQRA 4BLVA 3EVGA 2R3SA 3T0IA 3BGVA 3UJBA 3KQPA 2B3TA 3FZGA 2PGXA 1X19A 1BHJA 2JHAA 4HTFA 3FRHA 1XTPA 3MGGA 5FCDA 4P7KA 3TFWA 4BY9E 5DXJA 5EKUA 1L9KA 4A6EA 5C9ZA 4ISCA 5EPEA 3G2MA 3KR1A 1NV8A 3B3JA 3LPMA 3P2IA 4QPPA 4R8RA 3KPWA 3FPHA 4NECA 1NW7A 1KYZA 2CL5A 3QOWA 4CKCA 4QTTB 1P1BA 3G89A 3KR2A 4C07A 3G88A 4KIGA 2P7HA 4KDCA 4QPNA 2ORED 1ZGJA 3LGAA 1JQ3A 4F84A 3CVOA 2B2CA 2AOTB 3KQMA 4KWCA 3I9FA 3V97A 3HA7A 3GWZA 3KU1A 5EIWA 7MHTA 3SSNA 3LHDA 1HMYA 2PT9A 4CXMA 1ZG3A 3KR9A 4OQDA 2VS1A 3PX2A 3BWYA 3VC2A 5C1IA 4EKGA 1UFKA 1JG1A 1R8YA 1NV9A 3OE5A 1NBIA 5HIKA 5EQJB 2JH8A 2O0LA 5EHIA 5CVJA 2Y1WA 1I1NA 2YR0A 1VP9A 3KQTA 3LX6A 4QQKA 5FUBA 3LBYA 2YXDA 4RTLA 3BXOA 4KRGA 3B3GA 1UWVA 4KW7A 1L1EA 2FK7A 3ER8A 3O4FA 4GOND 1UIRA 5DSXA 5E9WA 5K0JA 4LECA 4GBED 4OBWA 3HCAA 4C06A 3DMHA 5EIFA 3EVFA 5FA5A 2VP3A 4PINA 2GPYA 2ONYA 2PV0A 3LCVB 3GJYA 4RWZA 5DWQA 2UZ4A 1WS6A 4X63A 2LD4A 2VDVE 5LR6A 2YXLA 4FSXA 2ZLBA 3FTEA 3FUWA 1SG9A 3BWCA 4V0RA 1N7IA 4IWNA 3DOUA 3A25A 1RJEA 3GCZA 3NTVA 2G70A 1QYRA 2ZSUA 5EG5A 2ZVJA 1XDSA 2I7CA 3MB5A 2B78A 2PWYA 3FPGA 1F3LA 1VIDA 2PX2A 1PJZA 5P8WA 3CGGA 3EVBA 5EMLA 5F2NA 3PTAA 3DTNA 3M70A 1XCLA 3SXJA 4RVHA 5LQKA 5CVDA 3KQSA 2YUIA 5DTMA 4ATNA 4PYJA 1DCTA 2Z6UA 2CMHA 5HFJA 3NVKI 3C3YA 3KPJA 3UJDA 1SQGA 2ZTHA 1JR4A 4PCAA 5EMMA 2PLWA 3BZBA 1ORHA 5E8JA 2AOUB 3G8AA 5JR3A 2HTEA 2AOVA 3SVZA 2FK8A 4YV1A 2XYRA 3KPUA 4HH4A 4AUKA 3QV2A 2IH4A 1JTEA 1U2ZA 5DSTA 2BM8A 1G8AA 4ER6A 2G8NA 3VC1A 2IBSA 1VLMA 5EKXA 4KIFA 5GP1A 1YUBA 5F2OA 1Q0SA 5K03A 1D2GA 4GEKA 2G1PA 1XVAA 1NBHA 3IV6A 1BOOA 4DA4A 3M6UA 2C7PA 2DPMA 1JG4A 2EG5A 3TQSA 5K01A 5HIMA 3SMQA 4WVLA 3AWIA 4HG2A 3MQ2A 3UWPA 1EJ0A 4BP1A 5CM2Z 1KP9A 1XJ5A 2ZBQA 1FJXA 1JSXA 3EGVA 3I53A 3Q7EA 3G7UA 3EMDA 5E1BA 5FADA 2NP6A 1SKMA 3H2BA 4PYNA 3HCCA 4YUZA 5K0FA 1M6EX 2UYQA 4QDJA 3T7TA 3OFJA 3UJ9A 1P39A 4YUWA 3MHTA 5E9QA 3ID6C 1Y8CA 2FCAA 2AN4A 2FYTA 2CWWA 3KHKA 1EIZA 3JWJA 5ICCA 1P91A 4QQNA 3FPJA 3DLCA 3G2QA 1WXXA 3C3PA 5T64A 1WZNA 3HVKA 3P97A 4M36A 1N7JA 3P9KA 5KQRA 2R6ZA 4RSRA 2IBTA 1RI5A 2IDJA 1Q0TA 2AZTA 5DM1A 3LCCA 5E1DA 1EQAA 3GIWA 2NXNA 1B42A 1M6YA 3EGIA 1JSZA 4CTJA 4YMGA 5GIPE 5GIOE 4E70A 3EEYA 3R6TA 3KQVA 3KR0A 3SX0A 1INLA 3DH0A 2NYUA 3EVCA 4QVGA 3G2PA 3FTDA 1AQIA 3GRUA 2ZIFA 5FWDA 3O7WA 3DMFA 4LWOA 3GXOA 5FULA 2OO3A 1OR8A 3BWBA 2C7OA 3MTEA 5HILA 3NWBA 5EHGA 2ZFUA 5B1SA 4RVGA 1VQ1A 3KQOA 5LQUA 5E2BA 1AQJA 3UZUA 4CKEA 3OU2A 1X1CA 1NE2A 3HCBA 3CC8A 3KQYA 4Y2HA 3E23A 3VYWA 4ER0A 4EK9A 9MHTA 4YV2A 5BXYA 2NP7A 3P2KA
chains in the Genus database with same CATH superfamily
2IEZA 2JCYA 3B82A 1WKVA 3VSEA 3LVRE 2WUWE 4NH4A 4ZKDA 3AQIA 1G3UA 3SJBA 3TH5A 3I2IA 1MFPA 5KQMA 3AHDA 3GDFA 1EWYA 2B0CA 3WP1B 4NJMB 1NFQA 1USUA 1LJLA 4WY8A 2N42A 3TE7A 5BV1A 1QC5A 4ZAZA 2WNHA 3QFFA 4RD4A 3U1VA 1M2JA 5TX7A 1D2AA 4GRDA 1UINA 1RRCA 1F4VA 3EVDA 5C51B 1Z47A 1Z2AA 1S3GA 3G5LA 3PD1A 4BOYA 1VPEA 3OPXA 4UHFA 3WL5A 1RBQA 3FWHA 1CUDA 1P0PA 3T0GA 1U3WA 1KU6A 4BJHB 1EFVA 3A2MA 2X3FA 1KWGA 4TKLA 2WDZA 2PR7A 1XZCA 2KE5A 5HGXA 1W4CA 4MVJI 3ORSA 3LVBA 3IIEA 4GKAA 4U7GA 4MQUA 1QX3A 3C14C 4F1WA 3ANXA 1W5EA 2D06A 1U8TA 5A62A 5HP4A 4FS8A 1DIRA 1GR1A 1LNZA 2YHAA 4PC1A 3S70A 3JASA 1YBVA 1MDFA 2RCNA 2TYSB 3NWEA 3M6IA 2OBLA 5EXEA 2RAVA 4E2WA 1U7PA 1ORVA 1R0LA 4DIBA 3FDIA 5C7OO 1XKLA 3OD5A 4MQ4A 1P18A 3VHLB 4BX2A 3MWDA 5CEFA 5AK0A 3C7AA 4BMOB 3NGXA 5ESWA 3EISA 3Q11A 2ZR0A 1R15A 5IDWA 4TKVA 1NXTA 1W4LA 2IXAA 3JPWA 5K0EA 4XR9A 5E7IA 1ODFA 4J0QA 5EI5A 3E9ZA 3DDNA 4JLSA 1RKXA 4II2A 3AI2A 5D84A 4E2ZA 4IH4A 1LDEA 1MBZA 2ZROA 5FH9A 4TLAA 2D2XA 3B5EA 1E79D 4KQIA 4Y1EA 2W2NA 2DWOA 1D4ZA 3HBMA 2V7BA 2GBCA 1Y6QA 2RHTA 4TTJA 2WR8A 1X15A 3C5HA 5EIHA 4AN4A 1ZY2A 4YH1A 1XV5A 1H85A 3O4RA 3LL7A 5ALIA 1ULBA 3A36A 4IJWA 4WIAA 4XD7D 4QJ3A 3AU9A 3WGOA 4DZRA 4O5AA 4D8WA 5F9FA 2G0NA 3I0ZA 4YJ3B 1OH8A 1VMDA 3BGIA 2VA9A 1DV1A 4KPGA 4HEQA 3BA1A 1T4MA 3AETB 1PJRA 3PSHA 3QVXA 2BR3A 3ZHSA 2GAJA 5TIIA 2ONKA 1JHXA 3I6IA 1JQJC 1SZPA 3UMCA 4RTNA 5C8YA 2IZ5A 2WSBA 3M5WA 1GVHA 1RPTA 3TKYA 1G17A 1G8SA 2BFMA 2RFLA 3N76A 1JKXA 1OWPA 2RBGA 4CFSA 4YEDA 1GAEO 1XA4A 2W2MA 1O5OA 2XGOA 3LDUA 4IJ6A 5IEBA 3EEOA 3QHPA 5HQJA 2ALJA 2ZYRA 4B3FX 4QUBA 3WLLA 5JSQA 4DDVA 1N2CA 2Y1DA 4EO4A 2ZKIA 3JWPA 3OG9A 3B13B 5DI3A 3REQA 3HFSA 3FR7A 2L82A 2F3TA 4OF4A 2Z6VA 3DDHA 1I4OA 2WJGA 3FYUC 1CR4A 2R1TA 3IH5A 3Q7SA 4UUOA 5CW2A 5EOVA 3HN7A 5DBFA 1BEZA 1DBVO 1ACMA 3IELA 4MR7B 2QW8A 1ORIA 3EOZA 4C29A 1GGMA 1WDMA 4DG9A 1MB2A 1ZWKA 4KQFA 4LXIA 4RZ2A 4A3SA 3CCFA 1GRNA 3TMKA 2ZIXA 2KPOA 3D6HA 3D7KA 4Q9AA 4LYFA 4CM9A 1LC0A 1G3RA 3ZIDA 3NTQA 4MTLA 4INZA 4P8RA 2PKRA 2A9OA 3QMPA 4FWTA 4JVOA 1ZL2A 4WXRA 1X8XA 2I54A 5JNSA 3WYNA 1JJIA 1EU1A 2G4VA 2P30A 2VCYA 3HMKA 1NN1A 1O08A 2WVJA 4NMWA 3CONA 3UK6A 2BYTA 1IUPA 3HXOA 2Q5FA 2YS7A 3ER6A 4M1KA 1MABB 3OLYA 5HOQA 5EY5B 4BFWA 1JKIA 3GG9A 2GT1A 1O0CA 1OWNA 3WZMA 1YSCA 4W5JA 2DRIA 4EY8A 5K20A 5U9CA 3B7GA 2GAIA 2C00A 2ISSD 3MK31 1TX4B 2WC1A 3PR2B 4DJ5X 1XQ6A 4UMDA 5EWJB 1WBDA 2GZRA 3E9QA 1SKYB 4P83A 3EG9B 5HJEA 3IKJA 4ZHQA 1HDEA 4HBZA 3UBTA 2RGBA 4MIYA 2FDCA 4YRFA 2WWGA 4ESOA 2Q45A 1AF4A 2GAFA 4ECAA 2ZS8A 1T1GA 3ZCSA 2BJWA 3IEVA 3CLVA 2EX4A 5E7QA 1NP6A 3TEJA 2JAOA 4UW9A 3VPFA 1Y7PA 1WB4A 2EJUA 2I4NA 4AT1A 3K1YA 4WSOA 5AM5A 1LEHA 5JJCA 4JUDX 1ISSA 5JBNA 4OLHA 2GD1O 3T3PB 3HU1A 1KDZA 1A1SA 3BH7A 3IKLA 3B52X 3A27A 3CRZA 3JAWA 3HM9A 1T10A 4HJRA 3CZPA 3VR6D 4EKNB 5AUNB 2IEYA 2M6RA 2VOJA 1NI5A 1YK1A 3EAGA 3PUWA 1OFIA 3L8FA 2WFMA 4GZ3A 3AERA 4BJ5A 4CIWA 2Q8PA 1CYEA 3CFYA 3HY6A 4D41A 2IP2A 3K2BA 2WD8A 1A9OA 2UVQA 3ZCQA 2B94A 1UJBA 1B6TA 2J4FA 3KE8A 5CVEA 1Y8QA 2J09A 3N8NA 3FMGA 3TEFA 1O57A 3N2YA 3UKDA 4Z1MD 3TLBA 2QG4A 4RPGA 3WMFA 1HK7A 3ORHA 4E7PA 1K3TA 1CIJA 3A4LA 3NALA 3ZNNA 2QXUA 3S55A 4G97A 4EHLA 2F8TA 3BMQB 2YASA 5E3JA 5I9SA 3AY3A 2EU8A 1AM4D 4JOQA 1D4OA 3RIMA 4AW9A 1OZAA 3TSYA 3LXUX 3TX2A 1I30A 3IEKA 4ARVA 4NBRA 4C20A 4L0MA 4AJLA 4M0DA 1EZ1A 2AMYA 2C9ZA 3LLVA 4BWYA 2RH9B 3KZXA 1Y1LA 2QPAA 4ZQHA 4E2FA 3IRVA 1X86B 2GD6A 5DI3B 4TYWA 2E6UX 4OMFG 4YIKA 3DB1A 4ARSA 1TF2A 1PWEA 3UIEA 1BHQ1 3GLGB 5J2UF 3CUTA 1P3DA 1CCWA 1J2TA 2R6R1 3JQAD 5K0GA 4KBFA 1K86A 1Z2EA 3BAFA 4KQWA 1U5CA 2YRWA 3EK2A 3L06A 3O94A 3K6KA 3DMGA 3DCJA 1BX3A 2LP4Y 4YJGA 1R37A 5DN6A 2JCSA 2FPPA 3UXYA 1O54A 1E1QD 1UKCA 2W6OA 4G8BA 4JR2A 1MDBA 2HDOA 1T0UA 2OCBA 2Z3VA 5B30A 4FONA 5AHOA 1NRXA 3CM0A 1BMFA 1S96A 1JMYA 1WQ1R 1YMUA 3L1VA 4IO1A 4JBIA 3WYGA 1U7TA 4B4DA 5BWLA 2NVBA 4HWRA 3PEUA 1L8LA 1JEQA 4RF3A 5L4LA 3PPWA 2C07A 3E7WA 4I2NA 4UNSA 1WW3A 2ERYA 2OK8A 1FSGA 3JD4A 4DUPA 5DV9A 4PBSA 4NXMB 2F8SA 1XVIA 3FTPA 4BZXA 1P4RA 5FLEX 1NPYA 2LTAA 4PSKA 2QNIA 4WACA 1QS0B 1RAGA 2QN9A 2ZKLA 3AF2A 4TT3A 3FKSA 4TZ0A 3EFOA 2NWQA 3PCTA 2W6JD 3OEYA 4IOKA 3W6OA 3AF4A 3QVKA 4RW0A 4Q9HA 4EUFA 5JCXA 5LOVF 1J8FA 4LNUA 3BJEA 3RAEC 2X0RA 3IA7A 3V33A 3RRZA 3VO2A 3HI4A 4DY6A 1FUYB 3JWEA 4NAUA 2Q07A 2WF6A 3DFIA 3BMOB 1YI1A 3JVUA 2JBAB 3TLJA 4UE2A 1V5WA 1XNQB 1TA0A 4DCMA 5BORA 3KE9A 4YFVA 5LDGA 3O38A 4ABYA 3E82A 1N32B 3BSWA 3I9V1 3N0VA 3WQRA 2H5IA 3SBEA 1NI4B 4FGWA 3JASB 4OQPA 4R2IA 4E3WA 3FH0A 4HRAA 2XECA 1KI2A 2XGSA 5EEHA 3QKTA 1SJ9A 3C6KA 4LY6A 3SE0A 5HJ7A 3RHTA 5DN9A 3D6UA 1HQCA 1P9LA 1YTLA 3L7NA 4A16A 3QX8A 2O5VA 1BVYF 1B3BA 3CKYA 2MSNA 4TV8A 1QWSA 3D81A 5I7VA 4JUFA 4FDMA 3PDUA 5B1IA 3WWPA 3BIXA 4NABA 2WVHA 3ICPA 1Z2CA 3BJIC 3C8HA 3NYRA 4FILA 1R8SA 1BH6A 1D2MA 1E3WA 3F7OA 1OX4B 3KQPA 1HYEA 3M1AA 3S2EA 1ECJA 1HR0B 1T29A 4H1VA 1NNI1 1UT5A 3VHXA 2R25B 3FDZA 4P08A 5DNAA 2FEKA 2XJ4A 1JJFA 2VF8A 3L0OA 4FN5A 2AUMA 4IV5A 3N8GA 4HXFB 1O3YA 2FUCA 1U28C 2LVBA 3A58B 3WNDA 2AE2A 5FB3A 3RVSA 2CL5A 3WNZA 1SIUA 1U0GA 2GWHA 2HIAA 4YRRA 4DEXA 3U4HA 4ZZ2A 4X84A 2YFHA 1FFBA 2YCBA 3F47A 3RS7A 4C7VA 1F14A 1XRLA 2POCA 4OVKA 4CT4B 4GPIB 4ZKEA 2NYVA 4V03A 1TC2A 5HE8A 3U3ZA 2R7LA 4J91A 1UT8A 4LRTB 4D0LB 4Y7DA 3ZHTA 1DWUA 4WDRA 1Z9BA 1MG0A 4GD3Q 2VL7A 2IWRA 4FUQA 1PFKA 4KACA 1H5QA 1T4CA 4KE8A 3ZVMA 3Q8LA 1I36A 1VDZA 2FSFA 3WZLA 1AS2A 1TT5A 3ASZA 4W9NA 5EQJB 2JH8A 2R2AA 3DAHA 3RQSA 4DS3A 1R3DA 3G0CA 3NAQA 1Z0ZA 3TNJA 3BJRA 4QUIA 3FGPA 2ST1A 4ZT3A 2JRLA 3OE7D 5LB4A 4GP9A 3IC5A 3WRXC 5F7OA 3V1UA 1K89A 4IDEA 2FUEA 3I28A 4KLZA 3COVA 4AS3A 3DQQA 2OD7A 4D9FA 5LU9A 2XMCA 3O1LA 4ZJUA 3U5TA 3HGQA 3NX4A 2EEZA 1ETHA 5FA5A 3VX4A 1FA9A 1KI6B 2NUBA 3ZWYA 1KQFA 2ONYA 3ZV7A 1V4BA 4CR7A 4Q7QA 2LD4A 1NNUA 1FUUA 3F90A 3H4MA 2NACA 1WOYA 4ZC8A 3JAMA 2B98A 2TECE 3INNA 1DXYA 3CRMA 1YS6A 4GXQA 4JLJA 4OSOA 4TV9B 2IUEA 1US8B 2IYRA 2ZXFA 3UWKA 4D80A 6REQB 4UTVA 1GNPA 3MUNA 1Y5RA 2DFNA 3NUGA 5AJZA 4DJDC 4I9HA 3IP9A 2CK3A 2FZWA 5P8WA 3L8CA 2RKBA 3NWOA 2CD7A 2IC5A 1Y3FE 3JY6A 4EPYA 3SXJA 4RENA 13PKA 3C8UA 3FSJX 4BLQA 3W05A 2TRSB 2EJVA 4FFLA 5IVIA 3KPJA 3NH6A 4BQIA 3ZU4A 2Z2KA 3TQTA 5B4UA 2VXCA 3I62A 4EUKA 1UM8A 3BZBA 3EWSA 2HWUA 3CNEA 3PPIA 3T9BA 4BFUA 1HC7A 1LFAA 2ZYHA 2VHWA 3KQLA 4MNTA 2J9YB 3OEHA 1P2BA 2ADOA 4IRMA 5JXWA 2GN4A 3E9MA 3IO5A 1JPJA 4JHXA 3RNLA 4WN9B 1G5RA 1NQVA 1B8UA 3LJKA 3TIXB 3VC1A 1APBA 2OMKA 3ASVA 3DEKA 1QVAA 1MO6A 3QFTA 4C6HA 2J7KA 5ER6A 5F2OA 2ZDGA 1DQSA 4GGOA 1NWCA 5HKLA 1QMGA 2O2ZA 2RHWA 3LOPA 4J4BA 4RGYA 1SUDA 2DUJA 4BP1A 3KELA 1E2NA 1V5GA 1A2OA 1SBHA 2WLSA 2ZBQA 1PTJC 1L8AA 3MW8A 3K8YA 1IJEA 3VYRB 1CUUA 2HHAA 1NJGA 3EA0A 3EY4A 3A1UA 3HSYA 5CDUA 4BNXA 2C2YA 1PFWA 4PXSA 4WCVA 3L6CA 1J5EB 1WUJS 1AN9A 3ZDEA 1T5LA 2PVPA 1O5IA 1CQWA 4YAKA 5IX8A 3ROXA 3ZJUA 3ID6C 4HNSA 5JD3A 4BIIA 3CVVA 1RZVA 4OJKA 1IG3A 1HV8A 1KVQA 2QHXA 3F2IA 4IIVA 4D42A 3QEOA 3TVDA 5T3UA 1TK9A 4EPRA 3A2LA 3NIGB 3CXRA 4HUJA 1T2UA 3C5CA 2IDJA 4KEAA 3IHKA 2FR8A 5DM1A 1FTSA 1FDTA 4RF5A 3NC4A 2QUHA 4G37A 5KMGB 4C2AA 2N46A 3EGIA 4YJGB 4DFDA 5JPCA 2OV2A 1NVTA 3R6TA 1HG0A 5FTNA 2DKOA 4XM0A 5JSYA 2FJUA 5CX4A 1KBOA 1JLKA 4L8WB 3DVLA 3IR5A 3CX6A 3WAJA 3IHWA 1MO4A 4CI0B 2DWUA 2C7GA 4BXOA 4MS4A 4R1UA 1SELA 3VNAA 5CXQA 4CW7A 5E2BA 1ZA1A 3LOUA 4OLAA 2NU8B 4JJEA 2EERA 1PJLA 2D2EA 3CC8A 3CKLA 4KL8S 4KXMA 3W9BA 3DLTA 3A1DA 4EK9A 3ZGZA 5A3RA 3F5MA 1J9EA 1SXJE 2VHUA 1N8NA 2NO5A 4P58A 1E8MA 4QSHA 5CCBA 3D7SA 2I3GA 4RTSA 2LUOA 1L4YA 3WWDA 5JECA 4N76A 3KXPA 4FGZA 1ESNA 4KVZA 4LOLA 1C1HA 6NULA 1HTBA 3ZWXA 1EE1A 3EFEA 3REOA 2Z1MA 3HR7A 1SVIA 3G02A 3VO8A 1R0BA 1QZ3A 1A95A 1PHPA 3DUFB 4R2JA 4Y2UA 1GPLA 3E7DA 1W1UA 5JFTA 2XRZA 4YI3A 1U7XA 1F0KA 4BIMA 1QAQA 3CLUC 3NHBA 1FDOA 4QPCA 4AN0A 3EPHA 3UFXB 5D01A 4G5QA 1N0UA 3CUKA 3WSTA 5LOVB 3PJEA 3LQ1A 4RZQA 2WB2A 1XFDA 3GRAA 1MJFA 3P9IA 1L8XA 1D5CA 2GRJA 3SBOA 2DBQA 2F1OA 3DE5X 1C4KA 1N6LA 4NQRA 4ZGBA 3KSDO 4BKUA 1LPAB 1R9GA 5JNVA 1NF9A 2FKAA 4II3A 4ZIRA 4BKRA 4E07A 2ICAA 1BKYA 4GHWA 3AUYA 3UH0A 1XRRA 3ODPA 4Y1FA 3FSEA 1JR3D 2IHUA 2K4MA 1OFHA 2POQX 3C3MA 1IWPB 2WHRA 4JLOA 1ORWA 1WZEA 4WQMA 4AZ3B 5JAIA 3DT9A 1A9TA 1J9GA 2YWFA 4KZPA 4DWWA 3FKSD 3TVYA 1AKRA 3NBQA 3WTCA 1BWSA 4FEEA 5I6DA 3JQRA 1J70A 3TQRA 3ICEA 1UOPA 1FQWA 5TARA 4HNGA 1QP4A 2XLBA 4WZAB 5EHXA 4FPXA 2NZWA 4ZIRB 4ZVUA 2O54A 1MD9A 2PL3A 4L72A 1NM5A 2ZDQA 2VSNA 1WPQA 1PT8A 1UBTS 3KKOA 3EZGA 3QNWA 4H3KB 4HMQA 3MJEA 4OHVA 3C3BA 1XB2A 5EJFA 3JRWA 2XB4A 4DMGA 4E5MA 1DGQA 1MABA 3D6AA 3MTJA 3OQ1A 4LXQA 5JSKA 3ZVKA 4QJBA 4EKIA 2WJAA 2ZUFA 1HUQA 1UC8A 3GFGA 3I2YX 4I9UA 4PGHA 1NJ6A 2IYTA 4S0ZA 4GP7A 3VKUA 4BVFA 1CUIA 5FUYA 4B8YA 1E3LA 3U4QA 1H8HA 5EKDA 1NRJB 1Y63A 2PBZA 2PMBA 1XXHE 4N12A 4RTKA 1YZYA 2PX3A 3OIVA 4L08A 4TUYA 5FHRA 1SUSA 5I7AA 3KTDA 2HQ1A 1O9HA 3LWNA 5B37A 3DPUA 3VHQA 3W8RA 2EWMA 1SXIA 3DBOB 5EUQB 2GEFA 5KYKA 3AOEC 1P6UA 5IN5A 2QP9X 4AQDA 1MRNA 3NG1A 4B79A 4J8PA 3DTVB 1GTSA 3V7YA 1XALA 1A69A 1EP3B 3ADKA 2A5GA 4QL3A 3UBMA 1C1YA 3HRHA 1TCUA 2AUTA 4RNDB 5CTAA 2VPXA 3WY9A 1JX6A 8ATCA 3DULA 3GLFA 1AKNA 2ZJAA 4HDSB 4IIJB 3W1VA 2OE2A 4HNAA 2B8NA 2F62A 4AJPA 5HUJA 4GO1A 3LBFA 2AC7A 3DLIA 3TEMA 4BXOB 3B85A 1FSFA 3JQPA 1UZNA 2H48A 2QZJA 3MFYA 3NUQA 1EP1B 3ZQ4A 1CEQA 5CFRA 2VR1A 4PX2A 1AKEA 2NQ8A 4UEWA 3V2GA 2P4UA 1BXZA 3EVEA 1V1RA 4GE0A 4QJIA 5DGHA 3WDLA 2Z8YA 1W5SA 3CN9A 3SOZA 1HOTA 1A9XA 1VIAA 4RD6A 1TT7A 4B4WA 3LE8A 1VXRA 4OHBA 2Q29A 4DA8A 3UXHA 2AKEA 2QVBA 1ZPDA 4EJ0A 1Y9DA 4DC0A 4S2EA 4DLSA 4LGVA 3GEDA 3GZTB 1I80A 4AG5A 4BGDA 5IPFA 4EVIA 5L3SB 1E2MA 1NW3A 1ZESA 3ZWDA 4CQMA 4CTNA 1CC1S 1YS2X 8GPBA 4Y2XA 3AM5A 1N2XA 1E7RA 4TWJA 3DBIA 2ZUVA 4X8OA 4Q7MB 2WYWA 5DDIP 2BV3A 3PRHA 2QY6A 4IQ4A 2FSVC 2HV9A 3H04A 1W34A 4MZXA 3MBIA 1DBQA 4R68A 4D4KA 3BICA 3N53A 3JZIA 1RWXA 2WKSA 4MVJE 2I62A 4IXMA 1XZJA 2OEPA 3IAUA 2EJBA 5BPFA 1N9GA 4LDPA 5ECYA 5HQTA 2PZBA 4FFBB 2J5QA 4PSDA 3GDHA 3W4IA 2ZUSA 1DAEA 5DX1A 4FNMA 1RXCA 3BGOS 4B4OA 3BIOA 1G98A 2ZZMA 1T8SA 4BO8A 2QQ0A 3RI3A 1QANA 4NRDA 1FLAA 2Z2XA 7ABPA 3H2SA 1IXRC 3F7MA 3Q98A 2RB5A 4KN8A 2CW5A 1R6DA 2I6GA 3L8ZA 2R44A 4JJ6A 2PZJA 4FR2A 4LVCA 1Y33E 3SSOA 4NDNE 2HQBA 5B4VA 3PQ3A 2AB0A 4RAOA 4LOKA 1IN6A 1A7KA 3H1BA 4HRXA 5KNDA 1Y37A 1EUQA 3JQAB 3MJTA 4LOAA 4I14A 1HNXB 5DX0A 1QV6A 3F3KA 1Q19A 4OBEA 5I8PA 5K8JB 3R5XA 3NP9A 4MKXA 4BEVA 1P2TA 1FNBA 2QORA 2R7AA 3DMPA 1EK0A 3H8JA 2AUNA 2PT5A 4H31A 1BH2A 4P84A 3ICWA 3VDNB 4PN7A 4GNRA 2JLYA 1Z0FA 4YAFA 3BTUA 1PKEA 1PFQA 2Q0SA 3PGVA 3GJTA 3NS7A 1YHZA 1COZA 3DTYA 1C7QA 2H2FA 2PQ6A 4OHKA 4TKMA 3EQZA 4KVAA 4KXVA 1Z6XA 2WE8A 1NF2A 4MLCA 2Z6QA 4RIIA 4WBNF 5IKPA 5KDOA 1NPDA 4M0LA 1NSYA 1P2SA 1EVEA 1UDBA 3VTKA 2BLLA 3LCMA 2GZDA 3T5DA 4ADSG 2GNPA 2P7IA 6CHYA 3DKIA 1C0IA 1EX7A 4LC9A 5JQGB 3IL2A 5K09A 1KFJB 2H08A 2JFZA 2PRYA 3KXDA 1AXRA 4HSGA 1XCJA 5KHAA 3L79A 1OY1A 5TGDA 3T3MB 4I5DA 5ALMA 2R8EA 3QF4B 3ZJ5A 3OY2A 4CHGA 1KO5A 1KI1A 1N77A 1GGVA 3X1WA 4EYEA 3DZGA 1J49A 5JT1A 3UT0A 3ZHVA 5KTPA 4GDMA 4UU0A 4C01A 1GFWA 3VM6A 1GITA 4HJXA 5KMGA 1RLIA 1P5HA 4J2TA 5TF4A 4PS1A 4G4IA 2RG7A 2IYQA 5CA1A 4CL0A 1KMIY 3MOIA 3PGLA 4RZ3A 4IHAA 3TRFA 1U04A 1LDNA 2PD6A 2HWXA 2NO7A 2VQ3A 3ZNPA 4A1FA 3CVUA 2QRGA 3WIVA 3E9RA 4A8HA 4DILA 3WNVA 1WB6A 3NR2A 3PQ4A 3HWSA 5HZKA 3CISA 5EUCA 2Y2VA 3DNFA 3UYLA 4E0BA 1PDVA 1KF0A 5IJ0B 5JEDA 1QU3A 3IEIA 2FPSA 3FMFA 2G3YA 2MWMA 4IG9A 3RSZA 1UBSB 1OH6A 1QDLB 2BR4A 4M7OA 5LL6P 4AIIA 2XAAA 1KEWA 2UZ3A 1UFOA 3PTZA 1ADGA 3A6PC 5JNRA 3OZSA 2YRFA 1RQ2A 1NR7A 1TM2A 5FUXA 4D99A 5B6IA 1YZHA 3GYGA 4XIFA 3HWWA 4Z9BA 1SQSA 5F5NA 5A4KA 2Y05A 1GR0A 2H2AA 2QD3A 1L7QA 2OBXA 5KOJB 4BV2A 4W82A 5FKJA 1D4FA 1E6KA 3ADOA 2VHJA 4GP6A 3Q8KA 4CN9A 4ZK2A 3TSWA 2W93A 4BEBA 2D8MA 1Z0IA 2XX3A 1N3BA 2Q5QA 3N05A 2CUZA 1WKCA 4LJ4A 3STTA 4YP0A 5AM4A 4RTJA 1G38A 2WFZA 1C9KA 3HO6A 4R0VA 1MB0A 3BRWD 2OSVA 3I04M 4FMDB 5EKSA 5L53A 2J41A 2NM0A 1UBLS 4H4DA 4QGHA 2VCEA 3DE1X 4C7BA 4MITA 1JZQA 1ZGAA 2YX1A 1E60A 1PVVA 1AH2A 4BFCA 2NZJA 3IESA 821PA 3E8MA 4DWVA 2X9QA 3GA7A 5L40A 5B1EA 2QM3A 1RHRA 2PS3A 1X77A 5JLAA 1WVGA 3UC9A 4YPVA 1UC9A 2UZ1A 3B6IA 3R9KA 3U81A 1ZW6A 2REOA 1JKFA 3KKPA 4I2VA 1QG4A 2EP8A 2QW0X 3EW9A 5F33A 4FBGA 2XV1A 4ZI7B 2AWNA 4ACBA 9ATCA 1EUCB 1A76A 4MKFA 4J4TA 5CYGA 2JGKA 4XFJA 3EB9A 4ENVA 3M4YA 3RUIA 5L51A 4D9HA 4DTIA 3NHKA 4G01B 9GPBA 3TNDA 2G63A 2QR5A 3AIIA 1HDRA 3DYIA 3NWJA 3RJ9A 1JJVA 1R2QA 3F3YA 3FNRA 3LQ4A 3L6RA 4AUEA 3RUFA 1ZINA 3BRQA 4LNUB 4O59O 3AXSA 5DW3A 4Z4IA 3UAYA 1AGNA 3AVYA 2QJWA 2TMGA 2OCPA 2Y0EA 3DDSA 2R3SA 4BGUA 4FDAA 3VR0A 4QFMA 2PGXA 2V8OA 4NV3A 1OH7A 1KS9A 1KTVA 1J0BA 1K9SA 2ID8A 1OQAA 2JL1A 4HAZA 4BZWA 4E4RA 5EPEA 3FA2A 5BSHA 4Z4FA 4QUAA 3KPWA 3A0UA 4GYYA 4MGEA 4ED9A 4LZZA 2XOKD 2EZ9A 2AA3A 4MW6A 3G89A 3ET5A 4O4LA 4C89A 4EECA 2GD0A 5FPTA 4N7MA 1MUUA 4X3PA 5KU1A 5LLSA 3PNOA 4Q3NA 2BP7A 1JQ3A 1QO9A 4M8SA 2OG1A 1FNSA 2HRZA 4FFPA 2BBWA 2YV4A 5DYYA 1VGVA 2Z5GA 1TF7A 3FNHA 4XM2A 1ZG3A 1JDPA 2VWQA 3CUWA 2PUCA 4HH1A 4TZTA 3OLCX 2XDQA 3UKOA 3BEDA 1SMKA 3KVYA 2X7JA 3TW8B 4OHOA 1R16A 3RVJA 1X80A 4KWEA 2F64A 4RIGA 3TNLA 1CJKC 3H2KA 2F9FA 3NDPA 1FXSA 4YX9A 1GOTA 1IZYA 2WUFA 4UM5A 1ACLA 4LBVA 1VP9A 1QE5A 3RTBA 2D1TA 3A3KA 4WJKB 3FSGA 3RJTA 3ER8A 1UXHA 3VHXB 3W3AD 1IEXA 4BO9A 1KI9A 2GLTA 4UCQA 2ZSJA 2CYBA 3WK7A 2CVPA 3DMHA 5HRAA 1OTXA 2G67A 3AIOA 4UTZA 5DHAA 4XWKA 3G9XA 5HRUA 1RHKA 4L2IB 2Q3DA 3EYWA 3BMQA 1Y9EA 1PW7A 2XGMA 3H11B 3LNCA 4HQKA 3K70C 5JAMA 1LW7A 3KUCA 2W6NA 2PKYX 2WHQA 3BCUA 3ZV3A 5IEJA 1Z4LA 2QRHA 3OFSA 3TINA 2RHBA 1YVRA 2B6NA 3AUUA 1G7SA 4HT3B 2V4UA 3GNTA 5HTKA 1I0LA 3BPSA 4IUDS 3IIIA 3PD7A 5TQJA 3T5BA 1IOWA 4BVGA 3KB8A 4DCOA 1FXWF 1G16A 1OROA 1S1MA 2CXNA 2GZMA 1F6BA 16PKA 2DH6A 2I2XB 2V54A 3DZDA 1I7PA 4FDLA 1V1MA 4JA0A 2FPXA 4Z9YA 3AHCA 2H85A 4F9EA 5IYZA 1F8XA 3MWFA 5CNMA 5HS4A 2B20A 5JH7A 3C85A 1JAXA 3IEUA 3L1IA 1PL8A 4OGGA 1ISRA 3O74A 2XDAA 1VRVA 4YLGA 2B8JA 4GOJA 3ZDRA 1UPTA 4CT5A 1K7XB 3KYCA 5TPWA 1NMSA 2D2VA 4DBZA 2HU2A 4D8VA 1EG7A 1POXA 4PCAA 5JO9A 4A5OA 4PXYA 3BXZA 4AY2A 5CJJA 3MGKA 4WADA 2HTEA 3IUBA 1PN3A 2INGX 2WE7A 2YJ3A 1Y1PA 2AMJA 3CS3A 3KUXA 3QBTA 4M55A 4YJ3F 2CLHB 1IZZA 4PX5A 3EAFA 1EP2B 1KMMA 4W5NA 3EUWA 1CJSA 3AHGA 4RGQA 2IV3A 3VOSA 2PK3A 1XDBA 1PYGA 4KIFA 4KLCA 2IU4A 4WLUA 4QUEA 2VYND 4CKBB 1D2GA 5J2TB 5AJVB 4HWOA 3NDRA 4RY2A 1VL8A 3U6BA 4DT1B 2DPMA 2EG5A 3WGLA 5DASA 4GBGA 4WVLA 4AP5A 1RLUA 1ZLYA 4YFYA 3T4UA 4PFQA 1XJ5A 3JQ6A 3IUSA 3DWIA 3RF6A 4JGBA 2AIRA 2JI9A 3S2SA 4M86A 3HPRA 4RS3A 3U4CA 1M6EX 2WI8A 4BGEA 1GARA 2FE4A 3RO7A 2QZ4A 3DXFA 3FCXA 4PANA 1DCMA 1FF9A 5FNVF 1E2BA 5KSYA 3ROGA 1SEVA 2GXQA 4TTVA 3ZDXB 3F6BX 3Q88A 2VXBA 4YXWD 2O4UX 5BYKA 1FZTA 1DFHA 4F2WA 2KQUA 3UM9A 4LXYA 1GWNA 2G0AA 5E0OA 4PZAA 3L92A 5ADUS 1HNWB 3HYLA 3CO0S 5DEOA 1WNTA 4MVJA 3G0IA 3K4HA 2ZSFA 2I6FA 1C1DA 3UK1A 2B82A 1PR5A 4DLNA 3CE6A 3H86A 1DEKA 3IMCA 1FS4A 5JAQA 4MKRA 2J9XB 2O2YA 3H5NA 1AQIA 2ABWA 1QZTA 1WHSB 3I2HA 4UTXA 4GR9A 4L0QA 5GJBA 1PQWA 2JA2A 2SKCA 2W6PA 3I52A 4FZ5A 3TJZA 3V8PA 2LKDA 5FV7A 4EW6A 4BVJA 4JBWA 1E79A 4DLTA 1WUTA 4FMCF 1C50A 3C6BA 1EQUA 3TOCA 3VHRA 1GGJA 1PDOA 3D59A 4QTXA 4BNKA 1TZMA 4Y2HA 1N2BA 1U4SA 3ECCA 1NW4A 2CFSA 1STOA 2B4QA 3CXUA 3OZXA 3TMYA 5KHOC 4XSVA 3WA6A 1ECLA 4YONB 3AV0B 2Q1WA 4HD8A 3Q2OA 1QFJA 2C9YA 3T6KA 3N8IA 3OBBA 3MT0A 1KXZA 3PNQA 2FE1A 3PIDA 5C3UA 4KNWA 4E5PA 3KTAA 4LF6B 1KAQA 3AJEA 4PLWA 4GPBA 3PUJA 3LW7A 1FTYA 1N5IA 3FYDA 3PNPA 1DRKA 5GM1A 5FJJA 4A9AA 4P3XA 1RI4A 4CLDA 4OQFA 3TLXA 4MDYA 3DXZA 5KIAA 1I4LD 3AFIA 3DBLA 3NB0A 3OFNA 1WZ2A 4KNVA 3TM4A 5B6JA 2MJLA 3SZGA 2EX0A 4QFBA 3A05A 1N6KA 5KJCA 2V6BA 4PYLA 4CNBA 4HAUA 3M4ZA 3EGXA 4ETIA 4L75A 2OZLB 1DZ3A 1L8QA 2ZBUA 1G8GA 3CN7A 2GSDA 4UM7A 1SUIA 3TR5A 5A06A 1LLQA 1NP3A 4ZYTA 4IWXA 2PXHA 1EVJA 3U5ZB 4QXQA 1YH3A 3KYCB 5GONF 4FKMA 1JHZA 2FR0A 1YR2A 3Q7IA 3CZQA 4H7PA 4HAYA 4JBNA 4TKVB 5EZQA 5I5EA 3L01A 5REQB 1E94E 2AKAB 3PEFA 2QTFA 5EP1A 1P7CA 2DHCA 4HXEB 5DX8A 1T5TA 3DVAA 5A04A 1I9CA 4MUBA 3RS0A 1BCRA 5BMVF 4BCCA 4ZRNA 1ZXLA 3SJAA 2YJZA 5K3CA 3Q85A 3TNFA 3NHLA 5LZ8A 2RH4A 3TE6A 2QTRA 4R8SA 4NG5A 2JLXA 3S5UA 1Y34E 2R7NA 5EJIA 2ZBEA 4D6YA 3WK4A 4UQPA 1NF3A 4RPLA 2RHLA 3AVPA 1KVSA 4R6WA 3UT6A 4WVFA 1PR3A 3M2TA 1Z83A 2HI0A 1SC4A 4KWHA 4QRHA 1GQYA 1QHGA 2FEMA 1BO6A 5JSZA 1X9GA 2JBWA 4N48A 1P1CA 3RVPA 1ADCA 4Z1OA 2ZRGA 5JCPA 1M74A 4EHAA 2Z04A 3L0IB 1YRBA 4YJHA 3IBTA 4I3FA 5H9VA 1MPXA 2CY0A 4WXMA 3WLJA 4OQMA 2YZMA 3DKVA 1POWA 5A6VA 1RXUA 2ZJ6A 1N3YA 1SVMA 2ZI6A 1U5AA 3AG6A 1CUFA 1T26A 2BFEA 4L76A 4BJ3A 4D44A 4F3YA 3V4LA 4JXKA 3QELB 1XVTA 4FIZA 1BG6A 2OCAA 2PYIA 2WLTA 3MOSA 1QC5B 4H16A 1PT5A 3UV7A 3WJ7A 4AURA 2X8AA 3EBPA 3EDYA 3OE1A 1XZQA 3FPKA 3PHGA 3OPYA 2DHEA 2EFHB 3L4SO 2HFJA 1HWYA 4NQZA 3KJFA 4Q16A 1EVKA 4BLSA 4JLWA 4D3ZA 4HFMA 3UMBA 1FJ2A 1C14A 4TV8B 1Y5MA 2HC9A 4DQUA 5TXGA 2Y71A 2ZYAA 1P2UA 2Z43A 3DAPA 4TM7A 2IHKA 4CCYB 2PJRA 3THRA 1T9DA 2FQYA 2WHEA 3UGQA 4NZPA 4ZYUA 2EF0A 4B44A 2V6FA 1OOEA 2DEUA 4PAWA 4M1TA 3UPDA 2ZG6A 1CRLA 1QOQB 2HZ7A 4DRZA 1V71A 2W22A 4E51A 4JWKA 2NV0A 2RSLA 1G4UR 3ANMA 3A4MA 4LZPA 1E4YA 3BC1A 4E31A 5LBUA 2HIHA 2AG0A 3QLJA 1M34A 3R1IA 1KEPA 2JFGA 4GYJA 1YAJA 2RC5A 4PZUA 5CLLA 2WVGA 1L1FA 1M1UA 1C30A 5GZ3A 3JW8A 4P36A 2C98A 3GT0A 4R1QA 1FNCA 1MB4A 3UVEA 4MAMA 5A1TA 2W2TA 3ROTA 4LQCA 5A02A 3JPYA 3D1VA 2E1RA 1RQLA 3LT5A 2I1WA 1IOLA 3EGEA 3GP3A 3IA2A 2QTGA 3K20A 4XQEA 3CUYA 3SOPA 2RGRA 2Z30A 4MV9A 4XPIB 3CZRA 3GDOA 2CYCA 4OXQA 4ZTBA 5CNKA 2OQVA 3WZ2A 4NS4A 3KLBA 2Q4BA 4JP8A 3K0CA 3H5RA 1ZEJA 3R6DA 1ORTA 4QXOA 1DX9A 4YCBA 4UARA 4FFWA 4ZA2A 4KGZA 1N5OX 3ZCVA 3PJFA 5KTRA 4KQXA 2BGWA 1J97A 2OXFA 3ZXYA 1OX4A 2XR1A 4DCVA 1J1ZA 2JAPA 4S3MA 2ZPUA 2ZRIA 4ZARA 4B3TB 5K6AC 2WJ4A 3RSOA 2DQ4A 5GOZA 5TQ0A 3CTPA 1DCFA 3PWKA 4BCBA 5HDBB 5CDFE 1T5HX 5D86A 4RFSB 2LXNA 1RI1A 2JVJA 1Y8RB 3R75A 5BYJA 5K6TA 2Q41A 5DTRA 1WXDA 3H2GA 4LC1A 3VA7A 2GZ2A 3E3LA 1W93A 1DQNA 2EZ4A 3EDCA 4FBMA 4CV1A 3CNLA 3L82B 4HLUA 3CR3C 1N92A 1OREA 5CXXA 5CFMA 2JATA 3VC7A 1ZAYA 2DR2A 1IN1A 5IDVA 4XVUA 2VQ6A 3L3BA 2F00A 1V16A 4TYYA 5KNCA 1NU8A 2QG9A 1XPRA 5DYNA 3UB2A 5DT2A 3RHSA 2J0QA 3K32A 5KJ6A 3DV9A 4Y6LA 1BX1A 2WJVA 3G9QA 3OM8A 1FU4A 4MVYA 3MCZA 1TI7A 5TF0A 2W2LD 3K9NA 4ZO8A 5HW0A 4D4MA 1JAHA 4E33A 1O96A 3GH1A 4MX8A 3S2ZA 4QHTA 3BKXA 4YV7A 3QE3A 1E0SA 3BT7A 1DWQA 1LSJA 3TB4A 2QTCA 1PJQA 1GILA 2RIPA 3K0KA 3B89A 1QX4A 4BQPA 4RADA 2H4WA 4K8OA 4H1UA 3K72B 2CEAA 1R5BA 1TDJA 2OXEA 4N0PA 4Y2SA 5G1OA 2Q3LA 4QDKA 1U99A 4XVQA 1O87A 4EI9A 4Q5IA 1GIAA 4WGGA 8ADHA 4HNUA 2QLBA 3PQ6A 1MIOA 4EB8A 4U63A 2HA4A 2P9CA 3DC7A 3JQEA 2CNOA 5JS7A 2G28A 1EEXB 4DVJA 1OV4A 4YCLA 3ZQ6A 4AWAA 2ACWA 1G8JA 4HYYA 4QQNA 5C8XA 1RWKA 5EAIA 1RZRA 4H6VA 4ZCMA 3UJ8A 4C04A 3GFRA 3FNGA 2PGNA 4HEA6 3TQQA 2ZYUX 3TSCA 1AHNA 3P7MA 1IJFA 1SXJC 1ZU4A 1FP1D 2QRKA 1L1RA 3FAKA 4PAQA 4IH9A 4J07A 3K9QO 2AN3A 3MJSA 4H7KA 4AM8A 2WAAA 5TEWA 1T0JB 3N2KA 4RHEA 2VJMA 5LVAA 1AO0A 1W19A 2AW5A 1LDMA 1NLUA 2G5GX 5ALLA 4L3WA 4R3WA 3G5MA 3X2SA 2O8BB 1V7PC 2EIHA 4HB2A 4PLHA 5MHTA 2X76A 3W2GA 2P75A 2OPBA 4XWYA 1YRYE 2V0CA 3R0XA 2IW3A 2PKQP 3MINB 5L3ZA 4MCAA 1BGXT 3G5TA 4ZAYA 3MGCA 3OPYB 2O5EA 5DEIA 5L4SA 1UBKS 1NVKA 4ZT6A 2OTCA 4BE7B 1NKSA 1P0CA 4N6GA 5EMJA 2VT7A 1Y8QB 4IDPA 4I50A 1H69A 4ZVMA 3VZQA 4ZV4A 3DLPX 3EODA 4IGAA 2WTXA 2KLBA 4LOJA 4WEOA 4X71A 4YUXA 1KO7A 2OO5A 4AU1A 3IUNA 4S1VA 2PUWA 5BV8A 4EG4A 1KYXA 1SCIA 2QS9A 5BP7A 4AJIA 2GK3A 2VO1A 4W5QA 2HTFA 4GSLA 4KSYA 3FUXA 1WTCA 2V58A 3QXXA 5C80A 1KI4A 2JFBA 4QWMA 4JNCA 4LYJA 4C88A 1L4NA 3FKJA 2CE2X 4B9AA 1NI3A 1MEOA 2GLXA 1IY0A 3CSUA 4S04A 3AVVA 3WMWA 3JTMA 3N5KA 2J0UB 1U8FO 4O63O 2G9VA 3PDIB 4LYGA 4PSCA 3HZOA 5T5QA 3WVNA 3X3HA 3L7MA 4LFCB 1Z39A 4RA6A 4CG1A 2VZ8A 2RDMA 5A9TA 2IVZA 2QMHA 2ATEA 5DXFA 4OAQA 5JZMA 1OBOA 4Q9LA 1RRPA 4DLAA 4L0CA 2IU3A 3WBJA 1L7PA 1RQRA 3BIFA 3V1KA 4CM8A 3CB2A 1V48A 3TL3A 4DKJA 4WTOA 1UWKA 2WTMA 3EXFB 4NYMQ 4OHFA 4AS2A 4CLEA 2XA2A 3U3OA 2ODPA 5EUMA 4H0FA 2CMKA 1XU7A 2IDMA 3DL4A 1JW9B 2C0QA 3OJOA 2MYPA 5LQRA 4WNIA 3UGTA 3ESYA 4CIXA 4PGMA 4D02A 1BD3A 1FP4A 2H06A 4XQGA 5FYQA 4DWOA 4AJHA 3UWSA 3PP8A 3PGKA 1UH5A 2VQDA 2P9BA 2XSZD 5AK3A 2NSYA 4HS4A 4FNAA 5K2MA 1O95C 3KR1A 3CNQS 3LO8A 1IIRA 3B3JA 1GPAA 4LVNA 4QYIA 3KJNA 4R8RA 3TGWA 3AGQA 2O3SA 4MKHA 5H8WA 1RRKA 4M9UA 3SKVA 1C81A 1YR6A 1ISJA 1P72A 2G36A 3AW9A 4Q3CA 4XDZA 4YDHB 5E95A 1NX9A 1WOMA 4KIGA 1LK5A 1OTHA 1RRFA 1D0IA 2VBGA 4MPRA 1AU9A 1YA4A 4F84A 2R00C 1SOAA 4U2DA 3ZTYA 2YFYA 2OZEA 2IS4A 3CPJB 3KKLA 3LBHA 1U0RA 2XB8A 4IGIA 1X1SA 5AKXA 2HIGA 4L51A 5CAEB 4NK4A 2QL9A 4RV4A 1E3QA 3TZCA 4B74A 4UTPA 1SPXA 3DBVO 3Q5EA 1I14A 1OZFA 2C84A 1JDTA 4EKGA 5JPDA 1GG9A 3OD1A 3REQB 5I01A 5JU6A 1CJMA 1ECPA 4P3NA 4B2LA 1UDWA 3H9CA 4PLCA 1GYQA 1R64A 3HBJA 5HIKA 4NYJR 4L73A 4R7ZA 2D7DA 4RO0A 4P6VF 5FUBA 1KORA 3RIHA 1MO2A 3T3DA 3D4OA 3SP1A 2P6RA 1KDOA 1W8IA 2FK7A 1U63A 4K0KB 3AUTA 4U02A 3ZXXA 1Q2XA 2BBSA 3ACCA 4MI6A 2C2MA 1GGNA 3UJNA 4RKRA 1E0AA 2Q5EA 5AJTA 1QFXA 3U4MA 3JQ9A 4BRZA 3E9YA 4FOSA 4TMZA 3V6MA 1G5FA 3WE7A 1FYDA 4RS4A 4BRSA 4WZAA 1QCYA 5F1OA 5IAKA 4KHZA 4V0RA 2G7ZA 1S8FA 1Z4IA 4D9BA 4PF1A 2ZE8A 3MT9A 5BR8B 1KJYA 1ADFA 1B8OA 3JQ8A 1U8ZA 4YN3A 3KKNA 3TQIA 3CLUD 1DOHA 4MA5A 3KOWA 3DTNA 4XLLA 3B6JA 5EWLB 1Q11A 2DT8A 2HEGA 1EFHA 3HBLA 4HUTA 1N5DA 3NOQA 2PNFA 3CQ9A 4ZVNA 3TKLA 4PYJA 4B9EA 1EK5A 2ZR9A 4G65A 3NVKI 3FF4A 3FHJA 3ZEIA 3JQBA 5ENDA 4YUAA 4KR7A 4JI7B 4IS2A 5LUBA 1NATA 1A50B 1ZOLA 6LDHA 1WMDA 2WM8A 5DH9A 4PG7A 3KL4A 3U0VA 3UFXA 3PUIA 1NIPA 2QGZA 2WZBA 3EAQA 4RD0A 5J2UB 4EIWA 4EG7A 1UPFA 2PS9A 1QH1B 4MJ3A 1ZM7A 3WB0A 4PSAA 1NQ5A 2BM8A 4BMVA 3HLKA 4LXXA 3WGJA 3NOXA 4XD2A 1CB7A 4EGQA 3Q72A 3AVWA 1GPUA 2QSUA 2GYUA 4EL0A 4ZGGA 1XLTC 3ETDA 4J1TC 3AC0A 3QMWA 1D4AA 1NR1A 4B8ZA 5BSTA 4B6EA 2FVXA 4Q3DA 3DVSX 1JG4A 3HE3A 4F3TA 5HIMA 2UYYA 4HQOA 1Z5VA 3UWPA 5C5IA 4JI0B 2XWBF 1XZEA 3ZVNA 1B2LA 1GQFA 1Q2UA 1KR2A 2GEVA 3SF8A 2E2WA 4TLEA 4RCZA 3H2BA 5IBQA 3G9TA 3HCCA 1LF0A 3LC7O 1ZC3A 3L84A 4FZRA 1U1EA 2XUIA 1L7XA 1XD2A 3HY4A 3LTEA 4TRJA 3UJ9A 3F73A 1VE7A 2VHYA 3TLAA 3QUTA 4BUCA 5KNCD 2WU1A 1VSVA 4BP9A 2J45A 1W29A 3WGNA 2C5SA 3HCRA 1J8YF 3IFSA 5CJ2A 4AJNA 1WSWA 7AT1A 2BSQA 1PZMA 2AXPA 4LK2A 3BK2A 4YCAA 5EE1A 2P5YA 3DL0A 5IH7A 2W2LA 4D97A 4L4SA 1GNVA 3N7AA 4EMUA 2H7VA 3R77A 4GQIA 1IEVA 3ZE0B 5IULC 1EX9A 1SO8A 3A6DA 3T5PA 1VMEA 3GIWA 1DUVG 4KQEA 1O8BA 2CDBA 1JIJA 3TDKA 4FCCA 3AF0A 4CU2A 4W99A 4E6EA 2NYUA 4HN9A 1JKJB 1PFYA 1NY5A 3DZ8A 3E22A 3USCS 2HD4A 1UKBA 4FEYA 1UCFA 2VJMB 3E15A 2A2ZA 2VKQA 3DMFA 2EQAA 3GXOA 4CKCB 1A71A 5DNWA 4M4SA 1B26A 2NO1A 2RJOA 3BWBA 4R2WA 4FR5A 4JC5A 3GFBA 2Q49A 3IOYA 3PNYA 4KLAA 1X80B 4WV3A 2JVIA 5A3VA 2VZ0A 4OJNA 1AUQA 5E2IA 4IX1A 3UJ3X 2EW2A 3PV0A 1VE9A 5E6UA 3HCBA 3KQYA 3IUMA 2G0TA 4N3CA 5BWMA 3BF8A 1W5FA 3IQZA 1KDYA 3SDBA 4BV8A 8MHTA 1ESZA 2EFJA 3RYIA 3B1VA 1Z34A 3ZE8A 1KVRA 1XOIA 4NZYA 4NZOA 2N75A 3EX7C 2FN8A 1O94A 4OUDA 2RGYA 1G21E 4IILA 4QFDA 5BNFA 1P4GA 3GQBB 4G86A 4GZMA 2XTJA 2XNKA 2AK3A 3ZWPA 3IBCA 3W0LB 1N6NA 4LFBB 1ZU5A 2DFKB 3UUWA 2HWKA 2HN9A 3OWOA 4OQLA 2XTNA 1NZFA 3BZUA 3WFZA 2VTBA 3PNVA 4YRJA 2OCKA 1ECCA 2P4QA 1J99A 1GXSB 3EGCA 1N7HA 2IIBA 4P7GA 5D87A 3QG5A 1WCIA 5I7UA 1DKQA 3CGWA 5BY2A 4CHTA 3C4VA 3IP1A 4EHBA 1W0JD 5AHWA 4JEUA 3BHJA 5HS6A 1H6DA 3PEYA 4V3BA 3WKBA 2RHDA 3MNFA 3LXXA 2ADMA 2VP5A 5DTIA 3ZGXA 1PO7A 4G36A 4X94A 5I51A 4N0MA 2QUBA 2J8ZA 2GCPA 4C43A 4BE4A 3C3AA 2WQ6A 2P8SA 3H65A 3NRBA 1QTQA 3U13A 2GO7A 5AM0A 2W8BA 5AOVA 4OQEA 1R5NA 2XLCA 3OZGA 3TL6A 1JLMA 2XUJA 4OJYA 3UJCA 3O8OA 2W0SA 2D1SA 2AJDA 4X8HA 4RKYA 2DBRA 1YKSA 2DPYA 5BQPA 1BXKA 3OC0A 3TRDA 3VBCA 4IDAA 3FE2A 3H75A 4E32A 4UAUA 3X0DA 3II6X 3NQ41 5F51A 1VRWA 3BUSA 4ITUA 4Y2YA 4E3ZA 4MV4A 4DPMA 3S1SA 4V0KA 4B7XA 4NNOA 1XXLA 1WABA 1DADA 2ZTMA 4L4RA 4V0OA 2VG8A 1AKVA 1QDUA 2Q8QA 3ZWOA 2MOKA 1DZIA 1FDUA 1L4MA 1RNLA 4C4OA 1RWMA 1XDUA 1QCDA 3HV0A 3WOHA 1ZR2A 3V2IA 1SAYA 3IR6A 4WI1A 1CY8A 1QAOA 1XDGA 5A9RA 1K4KA 2FDRA 2N1MA 4EFNA 2WJYA 1R4NA 1XJCA 3P9CA 4UBJA 5B7NA 1GCGA 3I09A 1SUAA 2QQFA 2V96A 3HACA 3FVWA 4LYDA 4O2RA 5KYGA 4X1IB 1WXWA 2NN3C 5H4GA 3KDSE 2AJCA 2X5JO 3ORYA 4YB8A 5B1HA 4EF5A 3MUFA 3L7CA 1A2KC 1DIBA 1SOVA 3KSZO 5I3CA 1U4OA 1KWKA 3AT1A 2HRDA 5UKDA 2ZSHA 1PUJA 2UXDB 1E3DA 2XVZA 3LNTA 2O2IA 1JU9A 1DIGA 2CBZA 2ZWOA 3SHFA 3I0MA 3SQXA 1NFFA 2WNIA 4KO3S 2Y9PB 2Z08A 4RJ2A 3UV6A 2BFFB 2XUKA 1AGXA 3H19A 3CVJA 5BVHA 1XJWA 1EUDA 1LQTA 4OM7A 2XQKA 4KYIB 1QYCA 1RWBA 3I12A 2AQ8A 2A30A 4HX2A 4QBFA 3QP9A 2V55B 4LDNA 1LX6A 2AVDA 5BR4A 4X8LA 1DHRA 3DE2X 3B51X 4NFYA 3C6YA 4JSYA 4BNUA 5SYMA 3K73O 2NOAA 1XZBA 3FDFA 3A7EA 2I1VB 4JI2B 1I94B 1M6NA 2XNJA 4RBNA 3REGA 4BNLA 1U8EA 3CR7A 4V0SA 1BE1A 2E48A 4M8LA 1N25A 3IP8A 3LLUA 1QE0A 4IL5A 3RCBA 3OT4A 1T3LA 1QH0A 1D09A 5ESXA 4P92A 4E1BA 5IRCD 3IE1A 3P2EA 3H7AA 4MGYR 4OYLA 2VRWA 3TSZA 2W6MA 3CH7A 4MYUA 4R2XA 4REMA 3RODA 3SYTA 5JYEA 1L7MA 2PBFA 3EZLA 1G3IA 1ZFNA 2PVSA 4JC8A 2BR5A 1UBNA 4ZI2A 1RYFA 1SBIA 3QHAA 4YS6A 3V4FA 1GG5A 1XMJA 3PFBA 1ZNYA 3OAAA 4HTFB 3F6YA 2PKWA 5FPYA 4I55F 1DAHA 4KAJA 4OHCA 4OB6A 2HB6A 5CXUA 3V4OA 1U0SY 3J81A 4UBNA 4RVFA 4Q18A 2FPWA 3R3XA 5FEUA 1X7ZB 1MOQA 2BFNA 2PO5A 3NVAA 3WBKA 3KU4A 5ISMA 3AKEA 2ZE7A 1E6WA 4LC0A 1JSLA 5CITA 3ZY3A 4JKOA 2CC2A 1NRWA 2QTBA 4UOQA 3NW9A 3RS3A 2ZE6A 1TVKA 1I3KA 3I45A 1NVDA 1V8ZA 3N07A 2XF8A 4URHA 2ON6A 4G5GA 2VKTA 4KFRA 3MLAA 4ML3A 2JGDB 5C46F 5FV4A 3V4RA 2R6HA 4OREX 5DRTA 4C0WA 5CDTA 1HM5A 2YJGA 3MIZA 2QU7A 3D0QA 4FVTA 1J5XA 3UG7A 4WEQA 1RYHA 3O0DA 4GXTA 3UHAA 4F38A 1E1MA 2FF7A 3QX7A 3O21A 2A4MA 3T1TA 3GEIA 4G0OA 3BDAA 3FNBA 1OVMA 2MDTA 1IC6A 4O1IA 4XX0B 3KK0A 1EVLA 4C5CA 4F86A 3TD6A 5HSGA 2QZZA 4PIMA 2PH5A 3ON5A 4X65B 4N49A 1U9IC 1W9MA 1GV0A 1PLJA 2IZOA 3EVAA 5BT9A 1NAHA 3LKDA 4C4RA 2CXSA 1DBWA 3ELYA 3U26A 3KG2A 2FX2A 3IVRA 1N0VC 2ASEA 1Z3IX 2C9OA 1TCVA 1Z13A 4J29A 3HFJA 4U3JA 5DM0A 2QGFA 1F48A 1SUCA 4GGMX 4JVLA 4MI9A 3GZJA 3WGMA 5FAXA 1WIWA 2IEIA 5HJ2A 4CM5A 5LMUB 4N6NA 2VWPA 1K6IA 3KLOA 4OQYA 1CJCA 1JIQA 1TUGA 4QOGA 4WK4B 5LBIA 3WISA 4CDMA 2Z95A 4QYWA 3B2EA 4R8VA 4ZICA 3E9EA 4I19A 2OFOA 2VYCA 3VR6H 1IAVA 1HDZA 2HQSA 1J2EA 1XGKA 5JYDA 4IM7A 1XVVA 3FLMA 4ME6A 1REQB 3OTWA 4J0KA 5FJIA 2KHZA 3BXHA 1WSAA 1Y0BA 2G6TA 2IK8A 2VPQA 1EX6A 4LZOA 4QXPA 5JW6A 3ASUA 4DA0A 2FP4A 2UUCB 3WNBA 4ENQA 2LIVA 1PEAA 5THXA 5IVDA 2K6GA 2GF9A 2XMDA 4DMMA 3JQGA 1O03A 4L02A 2UKDA 3WMXA 4F1JA 6AT1A 2QV0A 2EHJA 1Y9ZA 2PPVA 3PCXA 5CHYA 4URVR 4KK3A 1KRHA 4V0ME 1JIKA 1ML3A 2HSWA 3TLMA 3X44A 4ZDWA 3IXQA 4DQ0A 2XVAA 5K05A 4FMDF 4K5QA 3MD9A 4MTCA 1E3TA 5LXTA 3RSFA 2I66A 1O97C 1CIVA 1KJZA 2NU6A 2YZNA 4GZLA 2OKCA 1PZEA 1E5TA 3KNZA 4GMXA 3TRJA 1HA3A 2YTZA 4UATA 2O0KA 3A3YA 2ZETA 1FP2A 2FUG6 1VL0A 1YB4A 2YHUA 3C43A 2XMQA 4EA9A 1RIIA 2JKYA 3N2LA 5JISA 3I05A 3V42A 3GLRA 3ZJYA 3ZHYA 5BMOA 2GFQA 2ODTX 2NZXA 4WOBA 1QJ4A 3BFJA 4LJLA 4WA7A 2VF5X 4MEJA 5HM6A 5GJVC 1FP4B 3VZBA 4ZHQB 4JBGA 3IOMA 3P2OA 3IYLW 4J3NA 4LTNA 2OOKA 2QYSA 2VOEA 5C1DA 1G0NA 1P9RA 1E7WA 3FPFA 3T5TA 2X2PA 4E15A 5C8DA 5CD9A 5FWNA 5IWAB 5BUQA 1A96A 2C96A 1DMSA 1V6SA 4AKEA 3QEMA 2NGRA 1MJGA 2R11A 4P7JA 2QF7A 3TOZA 4W1PA 4L5AA 1YJ5A 5HEKA 5BOSA 4IZHA 4J0JA 2V7WA 2X6RA 4G23A 1G41A 2W6CX 2YL2A 2JGDA 3UENA 4J1NA 1GL3A 1YBFA 2G9NA 2WABA 4WK6A 3E58A 2UV8A 1B41A 1QHFA 1GHTA 2HXYA 3MAGA 3H5IA 2F43B 1ADYA 3JWIA 2QV7A 4DREA 3U80A 4J7UA 4X66B 2R5WA 3HB0A 4KRXA 2HF7A 4DMFA 3FOBA 1M5RA 2HR1A 1KI7A 4EPXA 5EHQA 5IKMA 4YTEA 3JRNA 3X2EA 5EIBC 5KUTA 3L1UA 3THWA 5LMZA 4W9NC 2NQTA 1H0SA 1FYVA 1EUYA 2R86A 4R2KA 3ZKWA 5DP2A 1IBCA 1NP7A 4HTFA 3FRHA 3MGGA 3D3WA 3W6NA 2WIKA 1IK4A 3K16A 1ZIYA 5LU8A 5EKUA 1G3MA 1Z0AA 1A7UA 3HWX1 3P4YA 3PGA1 4Q39A 1NT4A 2OMEA 4XVHA 4XSHA 4I50B 2LRHA 5ALOA 3GR6A 4G5XA 1SUBA 4IDFA 5AI4A 1YS9A 1NLFA 4Y6GB 5AW3A 3HU5A 2O8DB 1KYZA 1BTOA 3PXUA 3AILA 1ZGZA 2Y76A 1J0AA 1HSZA 3L8EA 1UJ6A 5G0TA 5FUQA 2OHIA 3BMNA 3U48A 1O6FA 1XK6A 3I9OA 4CJXA 2QQ5A 3STWA 5KYYA 3EPKA 1E2HA 3PE6A 3ZE9A 5KPJA 4FM9A 2F90A 1ZI6A 2A33A 3CVOA 4QBKA 4G67A 1WMBA 2QIOA 3D8TA 2JD1A 3RWMB 1G7RA 3GJ0A 1CULC 3LHDA 5ANRB 4RAQA 3NHRA 1HE1C 3CRQA 3VC2A 1H8HD 3DHEA 5HMMA 5KX5F 2P9HA 4IX9A 1MB9A 3AF3A 4F45A 1Q12A 1WM1A 3CX3A 1EDOA 1RM4A 3QOFA 3N0WA 3WLQA 1URPA 3I9LA 3B7WA 3H1GA 5ADWA 3H5AA 1JU4A 1Q3HA 1F6DA 1NQUA 4KRGA 4PZLA 1AC5A 4Q66C 4B2PA 5KJFA 3U4IA 3VR2D 1CLEA 4NNPA 4GOND 4PG6A 5FWXB 1I7QB 1OIWA 4ZI5A 1E5DA 2XYGA 1G59A 1MX5A 2TMKA 1DKNA 4KO4S 3VO9A 4EY5A 4D5GA 2ZUWA 2GPYA 3K9GA 3F7TA 2PV0A 1MIOB 2I7TA 4G85A 4N9QA 1XT6A 3JYPA 1Z12A 1ZHOA 1TADA 5G0UA 1LI4A 5HIAA 1M33A 1OT3A 2JGLA 2QRMA 1E9FA 4HAOA 3WGUA 1RYYA 2NZ8A 2W7TA 1MH1A 4YVFA 2ZSUA 5SY9A 5LN1A 2VTEA 2E9SA 2ZVJA 4A6PA 1VECA 4A82A 4EG0A 3O0TA 3MB5A 3R6WA 2B78A 1YR7A 1HE3A 2A9VA 4MO9A 3RHFA 3ZCPA 4MRRA 2BW0A 2LE0A 2PIDA 2PX0A 5LQSA 1BNCA 4EJSC 3MILA 9LDTA 1ITZA 3OJCA 4BNFA 5LYJB 5EHZA 2OO7A 2Z6UA 3EGDB 5HFJA 1KZ6A 3O75A 3SKYA 2FPGB 4H17A 4NE9A 4LF8B 4IHQA 5DNUA 4ZALA 4D6PA 3BN3A 1C9NA 1IDN1 2IYVA 2DE0X 3GN1A 4CGYA 3PVZA 5CBPA 3G8AA 2IXTA 2O7VA 4YY3B 2QZPA 5DIFA 4YV1A 3O4HA 4EPWA 3DL2A 5FAKA 3FROA 3BVPA 1X70A 4C7JA 2BEUB 4DUGD 3P5BA 1ZH4A 1JTEA 1U2ZA 4MJLA 5BUCA 1N2IA 1QWOA 1YE3A 2JI8A 6REQA 3D4BA 2JFXA 1DQZA 1L7OA 1FP7A 4I9GA 1V11A 4MH0R 2X41A 1X7YB 1HG1A 1YE5A 3CZMA 2FSUA 5FOXA 1TQ8A 5KQLA 1LSUA 1NBEA 1P3JA 2A0UA 4GLLA 2HCBA 2I34A 1XNJA 2H9AA 1M8JA 1QKKA 3NP7A 5CVTA 5K01A 1G19A 2RGUA 2ENUA 4LHSA 3AWIA 3JQFA 4AF7A 3PKZA 4JEMA 4PQEA 1XMVA 3NNDA 2XCUA 4JX8A 4PLFA 4A7PA 5IVKA 2R6CA 3O9ZA 1PTJA 4RJJA 1E3JA 3CEMA 2X0EA 1SD5A 5GJWC 4YUWA 2V9ZA 1YQWA 5U1PA 3G2IA 1U2RA 2V6IA 1LA2A 2P9JA 5E9QA 5FBVB 2E89A 4YLYA 5ICCA 5HE9A 1MW9X 2C82A 2X5OA 3AESA 5H3HA 3CF0A 3A32A 5JWHA 5AXDA 3SNHA 4CL2A 1RU3A 3G2QA 1E2DA 1OAKA 1UQUA 3L40A 4FXOA 3D3EA 4CM3A 1KZYC 1QQ6A 2P77A 4X1YA 3M2PA 1NVVQ 1BYIA 4OLJA 1RI5A 1A98A 5AI6A 3S28A 3VH4A 4AO8A 1MN6A 4TWBA 4LUCA 3PBKA 1EA5A 1OHHA 2NXNA 4PHCA 4UHBA 5BW8A 1ZL0A 3CEAA 3PC8C 3WYEA 1WDKA 5FTKA 4L74A 4DB2A 4IBOA 3CUVA 3F96A 2J3KA 4DYDA 4RPKA 2XNHA 3G2PA 2UAGA 4LDZA 1U65A 1SURA 3K9HA 4F8YA 1CUEA 4MGKR 3PQDA 3K5HA 2VATA 3LLSA 4LDQA 4MVJP 1IPEA 1OV6A 4AF6A 4NYIQ 3RRJA 3UAXA 4CM4A 4BMXA 1Y8ZA 1E5QA 2CBXA 4HAIA 1I3OA 4X85A 2AFHA 4XJVA 4RVGA 1SCDA 4GMFA 4E6PA 2OGZA 1CS4C 3UB4A 1C7IA 1EE9A 2ES4A 2ZSBA 4K6FA 1E64A 4ZVKA 5AKKA 1Y98A 3RROA 4MEBA 3DP9A 3RG8A 4KK4A 4BBZA 5C5EA 4MQFB 4OYYA 3F8WA 3MPOA 3CZCA 1XCGB 4YQYA 2QTZA 1T43A 2OM6A 1BMQA 3GUVA 3M81A 4G81A 3M6XA 4GECA 4K2HA 2FFBA 3LC1O 3UEOA 4C4PA 3OQVA 4MAFA 4OQXA 4CR8A 4TROA 1KMNA 4LJ9A 3MYYA 2EKDA 4CLXA 2QVZX 3K2EA 2ORWA 5TT0A 4H59A 2HF2A 1UP6A 4M7PA 1K5HA 4GIBA 3DLBA 4WFJA 4HRYA 1KERA 1S8OA 4OGLA 1JG2A 5FOSA 4PFJA 3IQGX 5EJGA 3W6PA 3ZE6A 2B25A 2BE7A 4HDMA 2DR3A 2JFNA 1CHNA 4Y2VA 2V7TA 1FU7A 1L7AA 3A6HA 3O8OB 1Z28A 2W2XA 3KOZA 3DEZA 5HCUA 4JLDA 1V26A 2G40A 2ORVA 2GZSA 2QN7A 4CM9D 4J16C 4W7SA 3U3JA 3VYSB 1KZGB 3AJ9A 2VJAA 2V5AA 2HJ9A 3AR3A 5D8DA 1E1CB 3DZJA 3LU1A 4WECA 3UOAB 4DEYA 1U1CA 3SZ3A 4JC0A 5HMLA 5BN5A 2OPHA 3LVQE 4FFOA 3DWEX 4CLOB 1Q1NA 2RGDA 4JLNA 4YGYA 2X3YA 5FIUA 4KTTE 5A71A 3JS5A 4EI2A 5JD6A 5K0LA 3GPIA 1NG9A 2OAP1 3LX8A 1UK6A 2EWVA 1QV7A 1X2EA 2OZVA 1U7UA 2ZS7A 1C0EA 3R3WA 1H65A 3TG8A 2WJPA 2C29D 3TL2A 1V3TA 3UAGA 5IJ9B 4M8NE 4D8TA 3QMMA 1T4DA 3I2GA 1WCIB 1UT6A 3G82C 3K9FC 3ZWVA 3HGMA 4EG3A 3ETEA 3M4NA 4D92A 3GBVA 1NBWB 4AZSA 1E9BA 3NDJA 4AP9A 3RSHA 3TQOA 4EB3A 4EQ6B 3K9WA 1K68A 2AG6A 3L0SA 3NIDB 4TYPA 4RSHA 1E59A 2ETVA 1Z5NA 4AZ0A 4BNDB 4LBYA 4X41A 3E8SA 2MSCB 3L46A 3PC8A 4PYMA 2IX3A 1E20A 2Y8EA 4DSTA 4F7WA 3G8DA 3OWHA 2RJNA 2XBUA 1TMYA 3VKFA 5AW4A 3GDGA 5H68A 4ND5A 2GM9A 1BWPA 4NSNA 3SKXA 4UUPA 2DP4E 2XYVA 3VNRA 1U2PA 4XOIA 1S2OA 4DPKA 2JF0A 3L8HA 1TRHA 2J3DA 4DXHA 4JYAB 3WLHA 1H9BA 1HEIA 3L7BA 2PX4A 5DTQA 1USIA 2H29A 4J75A 1AJEA 4AKGA 1R4MA 1NNSA 3LOQA 1ZGHA 1G6KA 2XB2A 3AEXA 4A8TA 1QFYA 3CURA 5FBLB 1RRMA 1GPNA 1ZCZA 3MMSA 4EB0A 3REFA 3U7FB 1OZGA 2B4YA 3QW4B 1L2TA 2FRVA 2JAWA 3MAJA 1LD3A 3OY7A 1YXMA 3LUHA 1TTTA 3G23A 1K1EA 4XI9A 3RIEA 3ND5A 4RZXA 2XB9A 1XZIA 2P91A 5FBRB 3KKMA 4YQZA 4AQ7A 4M9SA 4FLMA 1IQ0A 1NSTA 3RUEA 3BGWA 5KYYB 3SYRA 4DR7B 1N2CE 1IY1A 1I5RA 1I1HA 2FU5C 2Q2VA 1NL3A 2BFBB 2C0CA 2DQZA 2GZ3A 2JIBA 2X8JA 3FFBA 3HL0A 1XYVA 3N70A 1SVOA 3CV3A 4C4XA 1MNQA 4KI7A 4B6PA 4GXNA 5DCYA 2WIFA 1U0EA 5EIBD 2XNCA 3M83A 2FGKA 2VBFA 4FMCB 4OMDA 5F4BA 4B3BA 1T2EA 1O1YA 4L6IA 3BE8A 3IE2A 3UH1A 6ABPA 1VRCA 4PW0A 5BN1A 3VRHA 3QOYA 1PQYA 1X1TA 2DTXA 4D8YA 1UZUA 2AOTA 4EYGA 2ZZNA 2PX8A 4TS3A 4UXIA 3E5RA 4BO4A 4QX6A 1LSOA 1MENA 1QZXA 2I2CA 2PCJA 521PA 2ZVDA 4RD2A 2ZB4A 4LZAA 1I0ZA 3ZOZA 4YRBA 2ZRJA 4B40A 4JI8B 1EZ4A 3NC1C 3I5MA 4QEDA 2ZU6A 3GX1A 3OF3A 2C5HA 3L0CA 1C80A 1FE8A 5JO0A 4H0CA 3Q87B 2QN8A 1E9VA 1SB8A 3BZWA 3LY9A 1ZK2A 1FRVA 2QMQA 2CVOA 1BCRB 1ZM9A 4H27A 2GKSA 4QWWA 4MCJA 3UC5A 1S4MA 4YP6A 4B73A 3ZHXA 2O8VA 2IPXA 3LKBA 5B6PA 1EA7A 4DXDA 3MGAA 6YASA 5KSZA 1G0OA 1RS0A 2GD2A 2ZPTX 3LCUA 3PUZA 4GOKA 4ZOLF 4Z3DA 2NPFA 3DS8A 5JHHB 4WBNA 1EWRA 2ZBPA 2KLHA 3RHZA 4JAVC 2A88A 4KI0A 3UATA 5I9MA 3EC7A 5L3RA 2OGUA 2E4WA 2PJUA 3D8HA 2EBWA 3EYAA 4LK3A 4M1ZA 1DEXA 3B6MA 3DOOA 2E4ZA 1T1JA 1TKRA 4F12A 5JG7A 1ZAKA 3IXMA 3TPZA 3QXGA 1UXOA 2DXIA 4E5VA 4Y67A 1JTFA 1UF9A 2OGTA 3KXKA 4RIHA 4PYOA