3HNRA

Crystal structure of a probable methyltransferase bt9727_4108 from bacillus thuringiensis subsp. northeast structural genomics consortium target id bur219
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
193
structure length
193
Chain Sequence
DIQYKEVFAHYEDILEDVVNKSFGNVLEFGVGTGNLTNKLLLAGRTVYGIEPSREMRMIAKEKLPKEFSITEGDFLSFEVPTSIDTIVSTYAFHHLTDDEKNVAIAKYSQLLNKGGKIVFADTIFADQDAYDKTVEAAKQRGFHQLANDLQTEYYTRIPVMQTIFENNGFHVTFTRLNHFVWVMEATKQLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords probable methyltransferase BT9727_4108
publication title Crystal Structure of a probable methyltransferase BT9727_4108 from Bacillus thuringiensis subsp. Northeast Structural Genomics Consortium target id BuR219
rcsb
source organism Bacillus thuringiensis serovar konkukian
total genus 68
structure length 193
sequence length 193
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hnrA00
3KPYA 1I1NA 1NBIA 1UFKA 1N7JA 3GWZA 3GXOA 3DR5A 3EGIA 4X61A 3B3JA 3V97A 1NW3A 2P35A 2VDWA 3LSTA 4RTJA 5G02A 3KQOA 3SXJA 1MHTA 5DM2A 5EZQA 1XTPA 2IPXA 2GPYA 1XDSA 2PKWA 1VL5A 2HR1A 1X19A 3G89A 1V39A 1YB2A 2I7CA 4HGZA 5EG5A 4PYJA 3NTVA 4O29A 2UYCA 5CD1A 4RTQA 4E30A 3GRYA 1VP9A 4DCMA 1G55A 1KIAA 1HMYA 4LG1A 2PX5A 3THSA 1VE3A 2PVCA 3OPNA 4LWPA 2YTZA 1VIDA 3FTDA 4PYLA 5D1NA 5DRTA 5K8VA 3FUTA 5FA5A 2IH4A 2BH2A 1XCLA 4IWNA 4PYKA 5IKMA 2IH2A 2ZCJA 3ERCA 2I6GA 3IYLW 1ZG3A 2IFTA 2AOXA 2F8LA 4RTPA 2I9KA 3G5LA 5DT2A 5GIOE 1NW6A 5BXYA 5EIFA 4PYIA 5GWXA 3G88A 4E2ZA 3IV6A 3OZRA 3OFJA 3DULA 2P3OA 2VDUE 3A7EA 4P7JA 1F3LA 4E31A 3NVMB 5DSTA 3KR2A 3I5UA 2ZSUA 3LKZA 5EEHA 4CTKA 1JQ3A 2YVLA 3EVDA 4BLVA 4OX9Y 1R8YA 4DKJA 3VC2A 5BW5A 4E2WA 2ZW9A 3ELWA 4C04A 3RW9A 2OB2A 4JXJA 1L9KA 5LQKA 4FGZA 3PFHA 3LCCA 4QDKA 1QAMA 2LD4A 1D2GA 3BZBA 4MTLA 3KQWA 3R24A 3CCFA 4PYQA 5EOVA 3UJ7A 4DA4A 5JR3A 4AZSA 1VP3A 3HVHA 3MCZA 3P9IA 2XVAA 4LWOA 3FUUA 1MJFA 1I9GA 2JG3A 2QRVB 2ZBQA 3LBFA 3G2OA 5FTWA 5H02A 4F84A 2CWWA 1R8XA 2VZ9A 5K09A 3LHDA 2P40A 1QANA 3A26A 3PX3A 4MHTA 3MGGA 3HA7A 3KKZA 1KYZA 3CGGA 1FPQA 1IXKA 1KR5A 3AJDA 3BKWA 3C6MA 3G2MA 1RJDA 2WA2A 3O4FA 3SSNA 4RYLA 3T0IA 2AOWA 3M6UA 4R6WA 4QTUB 5FHQA 4M7RA 4CWAA 5DX0A 8MHTA 4HTFB 3D2LA 4BY9E 1JQEA 4HG2A 1EJ0A 2ZBRA 3MHTA 2QRVA 3B7PA 3ER8A 4MWZA 4RWZA 2A14A 2FRXA 3LX6A 5DX1A 2FHPA 4DMGA 5LSAA 2YXDA 1NW8A 3UJCA 5FHRA 3P2IA 1UWVA 4GF5A 5EMJA 5K01A 3LDGA 4B17A 5K0BA 3KQTA 2B3TA 3MAGA 1YZHA 3VYWA 3B3FA 4X41A 4PYMA 4YUVA 5K0JA 4A6DA 2PXCA 5GINE 4IKPA 1NT2A 3LECA 2CL5A 2G1PA 4FSXA 1JSXA 2PT9A 4FZVA 4HTFA 2P41A 2YUIA 1NV9A 4OBWA 5DSXA 3P97A 4BLUA 4C07A 3R0QA 5M5BA 1NV8A 1ZQ9A 1BKYA 4GEKA 3C3PA 4U7PB 5EGSA 5K05A 4ER0A 5KS2A 4NECA 2WK1A 4RVHA 2ZLBA 3IHTA 1WY7A 2Y1WA 3HEMA 2B9EA 1JG2A 3I53A 3KQYA 3NVKI 1M6YA 5DWQA 5HIJA 3EGEA 3S68A 3EEOA 1BOOA 2OPBA 2ZFUA 3NDIA 4PWYA 3UJ6A 3VSEA 1R74A 4BLWA 2AZTA 4GOND 4M38A 3MERA 3REOA 2IH5A 3DUWA 2JHAA 2JHCA 2AOUB 4PGGA 2NXJA 4KW7A 2XYVA 2EFJA 4F86A 2JHPA 3JWGA 2NYUA 1JG1A 4HGYA 5HFJA 3HTXA 3GGDA 4ER7A 2ONYA 2UYOA 5E2BA 3EVAA 2PX4A 3EVFA 5FWAA 3DXZA 2ZULA 4PINA 3A7DA 2AS0A 2DPMA 2O05A 3B5IA 5E8JA 5E8RA 5C9ZA 2PX8A 5CCBA 2XYRA 2GA9A 3UJ8A 3EMBA 5FQOA 3TM5A 2UYHA 5GOZA 3KQSA 2I62A 2P7IA 3P2EA 2AOUA 4FT4A 3HVKA 5ICEA 3EEYA 2VDVE 1IY9A 3MQ2A 3QOXA 2QY6A 3HM2A 1EIZA 2VS1A 2YX1A 2PSSA 3KU1A 3HVJA 2HV9A 2YXLA 1ORIA 2CMGA 5DRYA 5ICCA 3DXXA 2FK7A 3DMFA 4R8RA 4YV0A 5CVJA 3ER9A 2R6ZA 3G8BA 5T67A 1Y8CA 4X60A 3AWIA 4PYNA 3UJAA 2OB1A 3QV2A 5EKXA 1JQDA 4RTNA 3FPJA 3FPGA 3P71T 5C1IA 4YUWA 4ER5A 2HWKA 3TPZA 4GUAA 1SQFA 1G8SA 2BR3A 3CJTA 3P8ZA 2IDJA 5K0EA 2PXXA 2GS9A 4DCGA 1XDZA 2AN5A 2OO3A 5LQUA 2G72A 1UIRA 2QE6A 1P1CA 4CKEA 1RJEA 4E2XA 3LKDA 3ELUA 3UJBA 2C7QA 3BT7A 5EMLA 2OBFA 4FR0A 5EMKA 5LQRA 3PX2A 4RX1A 1I4WA 3HCEA 4HSGA 4Y2HA 5ICFA 2IIPA 3C3YA 3EVGA 4GC5A 4QTTB 2C7PA 1BC5A 3M6WA 1X1BA 2H11A 1FP1D 1XDUA 3NWEA 2ZBPA 3K6RA 4IV0A 3GO4A 2JH8A 2BM9A 1JTFA 4PYOA 3KPVA 5DM4A 4CKCA 1SVUA 2KW5A 3FZGA 5CVEA 2ZTHA 3SSMA 4EKIA 2PV0A 3EPPA 4KRGA 3LCUA 5DTMA 4LECA 1OR8A 3MCTA 1YZ3A 4C06A 3JWIA 1SUSA 1PJZA 2UZ4A 3KQQA 3TKYA 2V7EA 4RTRA 2CMHA 3T7SA 2DULA 2NXNA 3M6XA 2IDKA 3DP7A 1ORHA 4P7GA 5DTQA 4AZWA 3PT9A 2AN4A 4DZRA 5K03A 1JG3A 2NXEA 5EHGA 3SSOA 5HEKA 4EQZA 1EAMA 2AR0A 5CIYA 3SR4A 4KWCA 2FK8A 1Z3CA 4RTOA 2FYTA 1JG4A 4EK9A 2K4MA 4PIPA 2PT6A 1NBHA 3GJYA 4XCXA 2ZZMA 3JWJA 4MIKA 1G38A 3SGLA 2PX2A 4ISCA 5HZMA 1L3CA 2P7HA 1YF3A 4GQBA 4M37A 5EEGA 4ER6A 5E1DA 4PONA 4R6XA 3PS9A 3E23A 5EMMA 5C0OE 4EMSA 3OZTA 2B78A 3K0BA 3PLAE 3BGIA 4Y30A 1P39A 1INLA 3BGDA 1ZHFA 4PNEA 1KHHA 2GH1A 1G60A 2CKDA 1DCTA 3GRRA 3DMGA 2AOVA 3TKAA 1IM8A 3PFGA 2XBMA 3TMAA 2XYQA 2ZZNA 1X1CA 3G5TA 3E7PA 4IV8A 5K0CA 2HTEA 4KVZA 2QYOA 5JUWA 4GBED 1ZGAA 3O31A 3P9NA 4YMGA 4RSRA 2O07A 1AF7A 2EX4A 2V74B 3T7TA 4EVIA 3CC8A 4GOOD 4E33A 2ONZA 1HNNA 3DLCA 3HCAA 1QAOA 4E32A 3B3GA 5GIPE 1VQ1A 3M6VA 2ZIEA 4DM3A 3LDFA 5P8WA 9MHTA 2ZZKA 1NKVA 1PRYA 2WA1A 3EMDA 4X1OA 5CVUA 3V8VA 5IH3A 2PY6A 2PWYA 4PCLA 5FWDA 10MHA 5DTRA 1WS6A 3PTAA 2BZGA 3TM4A 4X63A 3BWYA 5FADA 3ME5A 4YUZA 3R9XB 2FPOA 4WVLA 3I9FA 1QYRA 3GCZA 1XJ5A 3FYCA 3CVOA 1N7IA 4FT2A 3THRA 3EVCA 5HIIA 4RTMA 2AVDA 4QPPA 1G8AA 3NDJA 4L7VA 3NJRA 5FA8A 3T7RA 4RTSA 5DPMA 3UA3A 1D2CA 4AUKA 4DF3A 1KP9A 5E9JA 3HCBA 3KQVA 1WZNA 3FRIA 2HMYB 3KQPA 1X1AA 5MHTA 5BW4A 3PB3A 3R3HA 1WXWA 5EKUA 2AVNA 1KPGA 2OKCA 4C05A 5LQAA 1AV6A 1DL5A 3C6KA 4KDCA 1RJGA 1VBFA 5BP7A 2GAFA 4EKGA 3FTEA 3CJRA 1FBNA 1XXLA 1XCJA 2ZIGA 3C0KA 2ZVJA 1EG2A 3FTCA 4RVDA 4A6EA 2FCAA 4QVKA 4U7TB 3GRUA 2PJDA 3P9KA 3PVCA 4UOEA 5KQRA 1VLMA 5EHIA 3HA5A 2EG5A 3E05A 3OE5A 5F2KA 5K0GA 4C4AA 5LR6A 1JTEA 1JR4A 2ESRA 3FUXA 4QVGA 1Q0TA 3BWBA 4ZTBA 3UA4A 5B1SA 5FULA 2YXEA 2BR4A 3GRVA 3G7UA 3UJ9A 3DLIA 5CVVA 4H0NA 4KDRA 3GDHA 4F85A 2E5WA 2PGXA 3SX0A 3KR1A 5EPEA 3M4XA 4K6MA 5DLYA 2P8JA 4YV1A 1U2ZA 4AX8A 1YFJA 3NMUF 5EQJB 4GC9A 2G71A 4OQDA 1KXZA 1L3BA 5KYGA 2AN3A 1R00A 2P3QA 4M36A 3FPFA 1TW3A 1RI4A 2Y1XA 4R8SA 4RV9A 3UWPA 5ERGB 4HH4A 3CKKA 1H1DA 2NNWB 4OBXA 1WG8A 3A25A 3AY0A 1FJXA 5HIMA 1QZZA 2NXCA 2OYRA 1M6EX 3GIWA 3VC1A 5FCDA 5T64A 1AQJA 2ZIFA 4GOLD 5E2AA 1R18A 2P1DA 3EGVA 3U81A 1D2HA 2BR5A 3CBGA 3OU7A 5T6BA 3TFWA 5KVAA 2HNKA 4R05A 5HILA 1O9GA 1SG9A 2AOTB 3LCVB 2OZVA 5DXAA 3G2QA 5DXJA 3LBYA 1P1BA 2XVMA 4QQKA 3HCFA 1KPIA 3LGAA 5E9WA 1TPYA 3OCJA 3QOWA 5K0FA 3HCDA 3MB5A 3OE4A 4RVGA 3FUVA 3ORHA 3TQSA 3Q87B 3HVIA 4HRAA 4POOA 2ZWVA 5EIWA 1TW2A 2H1RA 3O7WA 4XUDA 2PBFA 3UFBA 1O9HA 3HP7A 1BHJA 4HC4A 1SUIA 3LDUA 1T43A 5CUQA 4V0QA 3G8AA 3GU3A 3L8DA 3BWMA 2AOTA 2GB4A 3FYDA 4PIMA 3FTFA 2UYQA 1EQAA 2ORED 1AQIA 3IEIA 4AZTA 3X0DA 1M0EA 2NP7A 3GRZA 3BGVA 2ZWAA 5D1HA 1G6Q1 3KR9A 2IGTA 5U4XA 2OXTA 4BP1A 4E2YA 4RTLA 5LQCA 4C03A 4QDJA 5LQNA 2G8NA 2JH9A 5GM1A 2PXAA 3TOSA 2PLWA 5KQSA 2P3LA 2Z6AA 1X1DA 2IP2A 1Q0SA 3TRKA 3KPUA 5E1BA 4FP9A 1RI2A 3JWHA 3B89A 5EC8A 2G70A 2IBTA 3LL7A 3OU6A 3SMQA 3DMHA 2JJQA 3F4KA 3FPHA 3AXSA 4YUXA 5E1OA 1SKMA 2NP6A 1XVAA 3KPWA 5CVDA 5EZSA 5K0LA 3BKXA 5HIKA 2Z6UA 2BM8A 5DX8A 3WSTA 4AZVA 1FP2A 1RI1A 3FPEA 4KIGA 2YR0A 1B42A 5E1MA 3DH0A 3CJQA 3TR6A 2R3SA 3A4TA 5CM2Z 3DOUA 2PWPA 1P91A 4YUYA 2C7RA 4E70A 5HOQA 3OU2A 3G2PA 4P7FA 2QM3A 3TLJA 2ERCA 4C08A 3Q7EA 1L1EA 2ADMA 2O06A 3SVZA 5EVJA 5LQJA 4WXHA 3BWCA 1RI3A 3LPMA 3UJDA 1L3IA 2O0LA 2O57A 4OQEA 2N47A 3FUWA 4QQNA 3EVEA 5FQNA 3ANXA 3I64A 3KQMA 3UZUA 1YUBA 4FSDA 3EVBA 4V0RA 3ELYA 3BUSA 2H00A 3KR0A 3OFKA 1F38A 2YQZA 5FUBA 3ID6C 3M70A 3FRHA 5GM2A 2IBSA 2EJTA 3ELDA 3E8SA 2B25A 4DQ0A 1ZGJA 3OZSA 3AXTA 1R6AA 4P7KA 3DXYA 4G56A 4RVFA 3HCCA 5DM1A 1ZKDA 4P58A 1YFLA 3KPJA 3DTNA 4FS8A 1WXXA 2VP3A 2OY0A 2Z6QA 1RJFA 3A27A 3GNLA 1DUSA 1EJ6A 5E9QA 3EVZA 3BXOA 3MTEA 2B2CA 2GLUA 3SM3A 4CTJA 3UBTA 3I58A 5DM0A 1KYWA 3M33A 3KHKA 1SQGA 1QAQA 2EJUA 1NW7A 3NWBA 4PGHA 4QPNA 4PCAA 5GP1A 1O54A 1VPTA 3H2BA 4YV2A 3P2KA 3MTIA 4CXMA 2C7OA 3P9CA 1NW5A 4XUCA 4MQ4A 4OA5A 5K0NA 4Z2YA 5F2NA 1N2XA 4RTKA 1RI5A 7MHTA 4YMHA 4ER3A 4XUEA 4BP3A 3RODA 4CKBA 3HA3A 5F2OA 4ATNA 1NE2A 4GOMD 3HNRA 3R6TA 3RIEA 1KPHA 1JSZA 4KIFA 5ICGA 5CCXA 4OA8A 2Q41A 3NW9A
chains in the Genus database with same CATH superfamily
1NBIA 1QG2A 3ODPA 4EPXA 2RIRA 1P2BA 2JAQA 1R8JA 1I7LA 4Z99A 1JHRA 3KQOA 1H2RS 3NHLA 1Q44A 5C8YB 2FX3A 2HXYA 2O50A 1S01A 4U5QA 4Q47A 5DVZA 1KEEA 1AQUA 1EIWA 1MN6A 1JS1X 1X19A 4TMTA 3R9IA 1ZM3A 4A6PA 4U0KA 2GYWA 3TAHA 3T3PB 4WX2B 4LOLA 2NV6A 3D6HA 5ALIA 1Y3AA 4W7IA 2E82A 1XZNA 3BFJA 3QMPA 2Q3LA 2GUGA 1IJFA 2D2EA 4NOLA 4W7SA 3WHIA 3QFSA 5CPBA 2RARA 4BBPA 4BX8A 3MEQA 3PNSA 2A30A 5FA5A 3R0IA 4G85A 3V3KA 5TT1A 1CR0A 2AI3A 3AHJA 4DIDA 2IXEA 4GX0A 3PEWA 4RH3A 2IV2X 1LSOA 3K4QA 3ZHYA 2XNJA 3FNFA 3HBNA 3DOHA 3J81k 1T8TA 3MPUA 1KAOA 3WB0A 1K66A 5JASA 4XYLA 2HY7A 1R7RA 1U0NA 3NFYA 4QHSA 2GRAA 4OOEA 2PFKA 4MKXA 1PP4A 2H16A 2WJPA 3CH6A 3BEOA 1WQ1R 1PUXA 1TK3A 1CJKC 5JXJA 1GTRA 3EA0A 1GAJA 5EEHA 1CJUC 5JFTA 5JJCA 2UVPA 4W9NC 2CJWA 2A78A 2GNPA 4P4SA 3IEPA 4H77A 1UM8A 4YT2A 2YNMC 3EEBA 4AY2A 1YGPA 2PL5A 4AKIA 4LTMA 1L4BA 3GEBA 1KYXA 3I04M 1ADGA 3R24A 1EEHA 4WAUA 1N5IA 4AZSA 2EGGA 5F1OA 3EXAA 4REQA 1YE5A 3QTLA 3MFYA 5CITA 4Q1EA 3KWJA 2ZBQA 3INRA 2RGNA 3W2EA 1T25A 2EW8A 2HA7A 4NXMB 4EEZA 4GL2A 3WGNA 1R8XA 4MUGA 4CEIB 2DE0X 4K9KA 1WW8A 2VPYA 2PV7A 1A2BA 4G67A 1NN3A 2JEYA 3BWDD 3KB6A 1YDFA 3NANA 2CNOA 4RJIA 1R3DA 5FL7A 1L5GB 3TSYA 3WLQA 4ANFA 3C6MA 4NHOA 2FLVA 4B47A 3BC1A 4DLRA 3QKRA 3A6DA 3AI1A 4R1QA 4U2GA 3ZQUA 5BRJA 4ZOEA 1B73A 2BL4A 1K06A 2I34A 1FFEA 2YYYA 3H0EA 3D2LA 1ZU5A 3GGSA 4HTFB 4TWJA 4B7UA 3B9QA 5JCPA 1HH4A 2GF9A 3ROFA 2Z6VA 1TLLA 2RG7A 5KZMB 3BRWD 1ESDA 1PZEA 2FUKA 4HEA6 4OFWA 3LFUA 3WLOA 5B4VA 2VRNA 1XFAA 4AWXA 3GVIA 1VI2A 4MW0A 4BX3A 4RIEA 4LXQA 1KNXA 2Q5QA 4MLPA 4WH0A 3BMXA 4U8HA 3UWSA 4W82A 1OXXK 4QYWA 2V5VA 4X41A 3TF5A 4QQFA 4ALIA 4UZEA 1L5OA 1QKIA 1QMPA 2G6TA 2G80A 4NE7A 3ZYCA 4ZZ0A 4IIGA 1JPUA 4N9WA 3P5BA 1E32A 2M98A 4C07A 3SJAA 4IHQA 4HWPA 1A72A 3SSAA 2V7QA 2JAUA 4OH7A 4PGMA 1CJMA 2XVZA 4HGRA 4JC5A 4C43A 3OBIA 4MS4A 4NECA 1DIGA 2J0EA 2ENWA 2ZLBA 4PVCA 3GLHE 3I2HA 1SG6A 4KJXA 1C30A 1JG2A 1JKJA 3KQYA 3VMFA 5DWQA 3IKTA 2HK9A 1AHHA 2PJZA 3HPRA 3JZMA 3W06A 4Q1BA 3WBKA 2ZYHA 3IKVA 4QGGA 1N2IA 3QBTA 1C1DA 4BBJA 1DJQA 4BZPA 2PH1A 5H3HA 2AJDA 1JMYA 1G21A 5JQGA 1OSNA 1KOJA 1NC3A 5JCOA 1M0SA 5TDHA 1RAIA 1JG1A 2NYUA 3H9BA 4B31A 4QA9A 2J9ZB 5IHXA 1GZDA 3N2NA 4B81A 5SZHB 1QHHA 4GYWA 1T91A 4KK4A 5K8CA 3TZHA 4UDXX 1RP1A 2CXXA 3REQA 1ZXLA 2C2HA 3N2GB 1WBJB 2IELA 3OT1A 4YCCA 5HPYB 1EVLA 5AR1A 2ES4A 4QO8A 4HGNA 4C9BA 1ZC3A 2H2HA 5AXAA 1Z8HA 2OQVA 5LMZA 4KN9S 2BDUA 3DBHA 3EQ9A 1A9XA 2DTXA 5DCWA 3RYFA 1EM8A 2EFGA 2BJHA 3P2EA 4FT4A 2Z9DA 3OIYA 1T6ZA 1DV1A 1A96A 1YIAA 2VT3A 2YJ4A 4XIFA 3VHXA 4E5UA 1GXSB 1ISHA 1G18A 1K63A 4TLBA 5H80A 3U3ZA 4DNFA 1HZJA 2C57A 2X0JA 5DI3B 3BQMB 1W2HA 5CVJA 1FQOA 1KSGA 1WLSA 4YMVA 3WLAA 4R98A 3K70B 4ALKA 1YVPA 3PDJA 3AF0A 4MUXA 2KI5A 3H9UA 3NPMA 5CFRA 1UDCA 2W6CX 3ICVA 5J1TB 4ZT6A 4QUHA 1IB0A 1MVNA 1SHJA 2J87A 4ZC1A 4BU1A 5K0EA 3THWB 1DAMA 2VYVA 4PRLA 3N0VA 3U13A 3LKDA 3PJGA 1MDFA 1Y6QA 4RF4A 2DYKA 5LYJA 3GLFA 2ZG6A 3K1JA 5BSWA 7ABPA 5LP6F 1N1DA 3ZVKA 4DRZA 4DBLC 1SU7A 4ZQHA 3OVMA 2ZJ7A 3CX7A 3F2VA 3AFOA 1YJ8A 2ZBPA 5A03A 1QFYA 1GPYA 4HS4A 2BM9A 2Z9CA 1ZUNA 4PYOA 5DM4A 1ZHOA 2FSIA 4EGAA 3IMFA 3Q9LA 4IMIB 5ALHA 3I6IA 2A9QA 3SOZA 3WLSA 3MCTA 1SUSA 4LY3A 1PJZA 4YAUA 2UZ4A 1AXRA 4EECA 4P9NA 3NNSA 2X5OA 3OFNA 4B35A 3D8BA 3DDSA 4CI9A 1D9XA 2EQBA 2ZUFA 1I36A 4W1QA 1H66A 4UHCA 4H2DA 3OPVA 3KTDA 5T41A 2DU8A 1L6RA 4FIZA 4EQZA 2G9ZA 2VAMA 1KMIY 3L05A 1FFSA 1DKQA 3IT0A 3QPDA 1JG4A 1L7EA 1YE8A 3NHFA 4DC1A 1V7ZA 3UAGA 1JR2A 1OPXA 3QUQA 5ALLA 2ORIA 4YXFA 4KACA 4Z53A 2NIPA 4I5DA 1A8IA 1F60A 1OTXA 2Q1XA 1IPHA 3G6WA 1XLVA 1ZLXA 4U39A 3HP4A 1SM4A 4CV0A 3GJXC 5KNCA 3ER6A 4EF4A 5I45A 4ARZB 1H2XA 1ARZA 1HFWA 4JODA 4LQCA 4NJEA 1VLJA 1YT5A 1SXJC 2IDMA 1KVTA 2QJRA 2NU6B 2Z4SA 4RMIA 2MYUA 1RWPA 2PTGA 4BP8A 1WMSA 1EVIA 1A04A 3ZU6A 1X13A 5FI3A 1JBEA 3MUNA 1PEYA 2ZZNA 1OLUA 4JJZA 3WWZA 1FFXA 3L41A 5LB4A 1N2CB 3G13A 3BXEA 3MT8A 5LBIA 3PNVA 4CM5A 2PMWB 4RSGA 3GFVA 1WXQA 2IL1A 1RFLA 4DMLA 3F3YA 3TIIA 1OZ0A 4KQJA 4MQMA 5FI1B 1ZIYA 5LWHA 1TFUA 3L3BA 1KH1A 3DO8A 1D4OA 1UADA 2VJYA 3AWDA 3PT5A 3FNHA 1V8OA 3G7SA 4V39A 9MHTA 1GTVA 1ZGBA 4RF2A 1Y3BE 4AS3A 5JY6A 3V4RA 4OHKA 2HPVA 3TBFA 3WDMA 3TWOA 2P9YA 1WHTA 1KIMA 1UBOS 4ZMSA 2GEFA 4B87A 5AKIA 1G66A 4B7XA 1N5MA 2ACEA 4XM2A 3SYLA 4WVLA 1QYRA 3HBMA 1PUJA 4EEKA 5AVRA 3QENA 1BDMA 5E3JA 4O3MA 1RPJA 3THRA 2FUG6 1EDBA 3PFKA 4LYEA 5EWMA 4M8LA 5LWQA 621PA 2A9VA 4KXNA 5FA8A 1PD0A 2W6OA 3VR5H 3ETHA 4YRMA 4MQFA 1KP9A 3R3SA 3ZGOA 1Y9DA 2GBFA 4C0AC 2E4UA 1MH9A 1O58A 3KQPA 1G21E 2ERYA 3W7AA 3ZVRA 3HBLA 4MV1A 3L0DA 5KWSA 2IZOA 2P75A 1GHTA 2ZTLA 3EGCA 1DL5A 1PQ4A 4LJ9A 2DETA 3GEIA 5IN4A 3NAMA 3UAYA 2CZGA 3MW8A 1A9ZA 1GVHA 3AEQA 3OZ7A 4TLEA 1EX7A 1G5FA 2ETVA 3GBPA 4WY2A 4N47A 1W5BA 3D3EA 4A6EA 3ZWDA 3ETCA 1L5ZA 3DOFA 5LDGA 3OEHD 4LYDA 3MB8A 3Q3CA 2VOJA 1FS4A 2Q4RA 2VSFA 3ZHSA 4C4AA 3VH1A 1DELA 4O4IB 2QVCA 1NU6A 1D4FA 3MBIA 3UB2A 2ESRA 4JWTA 1IEWA 3QHPA 4CQLA 2Z5VA 3MG9A 2COUA 5BW6B 1SXJB 2Y1FA 4QKQA 3KJZA 2XNKA 1X94A 3U4QA 3Q4GA 1L6IA 3R40A 2HW8A 5SICE 4FBGA 2W2KB 3C6QA 3KUCA 1VDMA 3L9WA 3P9QA 4C4RA 3H75A 2QG6A 5HNKA 4HXYA 4WZAA 4C29A 4OQPA 1LC0A 1EFCA 2Q3CA 4H7HA 1XP5A 4GC9A 3IA7A 2ZDQA 4Y1FA 2HXSA 4BV2A 1DQSA 1ZEJA 1IY1A 5JO9A 4YMGA 1DE0A 4F1JA 3DAGA 2FLWA 2FZCA 5TPWB 1XO1A 3SKYA 2QAGC 4NK5A 1LLQA 1H1DA 5IT5A 1CUGA 1L5KA 1J97A 1KZ9A 4HQ0A 2IEGA 4M2LA 2CUNA 2P78A 1IH8A 1NLMA 2W2LA 1DBSA 1ZY2A 1PZGA 2W93A 3NJ8A 4WINA 3W5CA 3GLFE 5K5EA 3T1HB 1SAYA 4HJXA 4E7PA 1D2HA 1J0CA 5E6RB 3WTBA 2H6EA 2FSSA 3I9V1 3KVVA 1WD5A 3KYDB 4QUGA 2P5UA 2ZJ1A 3LCVB 1WTAA 4RD0A 1UC4B 3JD0A 4KCGA 4L5CA 1IZ9A 1JJAA 1GG9A 3BDIA 4QRIA 5D8DA 4EDFA 4EYSA 3ASUA 1TYDE 4DR7B 1UDAA 3OPQA 2GK3A 2ECFA 3CPSA 1W1UA 4S04A 4JIGA 2SNIE 1GNRA 1O94C 2FQWA 3A1DA 3GT0A 2G09A 3OTOB 3STVA 2ZYDA 3WA6A 1F5NA 3DONA 2AEEA 3G9UA 3GVCA 1XVUA 3UFBA 3VUEA 1JFTA 5DSZA 5AH0A 1BVRA 2BGRA 1OFHA 3CWCA 3TLXA 4BGEA 4GMHA 3VPHA 1O4WA 1B0AA 2WG1A 3DEAA 1P7CA 3KJNA 1QR2A 4ZYXA 4OHMA 1QIIA 3ULKA 3DBRA 3DMDA 1SK9A 4DV2B 4DLBA 3L0PA 2HHLA 4XGQA 2P9TA 3PUKA 2CE7A 2ZP1A 4FS3A 1NYTA 5LQNA 2O23A 4V0NA 2D5CA 2P6PA 1XTZA 4JGIA 1D3AA 1OCEA 5AI6A 4WGFA 4FWTA 1W75A 4ZCPA 5GV7A 3A6HA 4BP1A 1SKYB 2JLAA 2IYRA 3EZXA 3BCSA 5E3IA 3FVRA 4I19A 3ZIUA 1TMGE 4YRSA 1R4MA 3LBNA 1IHUA 1D5CA 3AF3A 5KI6A 3AIIA 2ATCA 4C2TA 1GG5A 5AXBA 4D97A 3C1TA 2C5HA 3F67A 4MA4A 5E6SB 1YVDA 1W94A 1UBKS 2BMEA 3C3BA 3HYRA 5A0TA 1FP2A 4Q7EA 1YZTA 3DH0A 2A9KA 3LC0A 4K8RB 1VFNA 2RAUA 4U6QA 3UWPA 1P91A 4C0BA 3RO7A 3DNMA 1E2EA 5HOQA 1XRQA 1UXGA 2X40A 5JJIA 1UQRA 1U8ZA 1N8SA 1NBMA 2GCGA 4DYVA 5C5IA 2HRRA 5AW1A 5LQJA 3GD7A 3A1EA 3EIFA 3LPDA 1TDJA 1L1QA 2QAGB 3OKFA 3LNCA 5EJ8A 1F7UA 1T9KA 1YVRA 2GPJA 3DQZA 2ACVA 1O2DA 1ZMXA 1GQYA 4LF6B 4R8VA 2BJWA 2XA1A 2YFQA 1QZ3A 2I2BA 5AVZA 5IVKA 3TINA 3HCPA 1EPUA 4JBIA 1YUBA 1EFAA 1HDCA 4UBOA 4HGQA 1GTL1 3HB4X 1CIVA 1C0EA 1F0NA 3OFKA 1KMMA 4WN9B 4YAIA 4QE3A 5GM2A 1QE5A 1T24A 3H1FA 3ID6C 2LV8A 5ES4B 4N03A 3PIIA 4B3HA 1MO4A 3AXTA 2JGLA 4M1TA 1T5TA 1UAGA 3HCCA 2P90A 5A5GA 5CLIA 2RC6A 3ANLA 4I99A 1WZCA 2YWEA 3RIYA 5FL3A 3ACDA 1BVUA 1CG6A 1LI4A 2B2CA 4RDIA 3BH0A 4PLGA 3ZHRA 5KAPA 3WLIA 2ZIAA 4MEJA 3PHHA 1UM9B 4OI2A 5MN6A 1GA1A 2WB2A 1KORA 1N3BA 3U4DA 1P2TA 4I8DA 1QNFA 4XXHA 2WI8A 5DK6A 3V2HA 1JB9A 1ODLA 2G5TA 4FN4A 2JFGA 2ZTSA 3OJLA 4IR7A 3PUIA 3ZZMA 4AICA 1LV7A 1NJ5A 1VMKA 1IZZA 2QHXA 2ZTUA 5F2OA 5ED4A 1JLRA 1YCGA 5HCNA 5BVHB 4RD4A 1DSSG 1N25A 1UPUA 3FSGA 2UXBB 1M72A 1FZTA 2P2CA 1EUZA 2ZBDA 1GP2A 2GQ0A 5IAOA 3GWGA 1EQUA 5B36A 1MRZA 3WLRA 1GDHA 4FOPA 4J9UE 1KVUA 2VEDA 3RRZA 2VIIA 4BCBA 1WIWA 4EHFA 3RGWS 2J6BA 3G89A 5AHOA 4CIBA 3WAGA 4FCVA 2WMOB 4WZAE 3ZBTA 5JNSA 1AH2A 2OZLA 1ECJA 1LBIA 3PCXA 4L73A 2WTMA 3ZTYA 3KJQA 3NFRA 1K88A 1E77A 1PR3A 2R5NA 1FS6A 2M32A 3KKOA 4HAXA 4S1OA 3TG2A 4B2PA 1OXTA 2QVLA 4LBVA 4ZZ1A 3WICA 5C4GB 3SDBA 1VM6A 4LOJA 1RBYA 1AU9A 1PJ3A 1RHQA 1GG8A 4IXDA 1QORA 2IFTA 3HGMA 4KQHA 3UMRA 4EAAA 5KX5B 1WETA 4TTSA 3E9YA 5GIOE 3PWTA 1DFHA 3II6X 5EIFA 4EI2A 1XD2A 4YBRA 4M49A 2N3ZA 5TB5A 3NHZA 1IIRA 5A5DA 1ZOPA 2IXDA 3WGTA 2V9ZA 5IC6A 4BMXA 2ZRBA 3JQEA 1F3LA 2OORA 1HQCA 3E5NA 5THQA 3EEOA 2OLJA 1J70A 4FMDB 3WSTA 2SICE 2PKQO 1RFGE 4UU0A 3OLXA 4N49A 4UEJA 5GY7A 2QUHA 1C9MA 4QUJA 4UDNA 4E2WA 5IJZA 2WILA 4WKPA 3L06A 2Q4BA 3S2ZA 1TU3A 2AMFA 1XMJA 1DIRA 2V0CA 3BAFA 3CLRD 4QFDA 4RFSB 1G5TA 2OAGA 1Y1QA 3HXKA 3OWXA 1PN3A 4G0PA 1VLZA 3EZNA 1QAMA 2IYOA 2Y68A 5DBHX 3RB8A 3IBYA 2QUKA 3F47A 4FUTA 3OPYB 4YECA 4PXYA 1XJQA 4YQEA 3T7DA 3MRSA 1SC6A 4Z49A 4RIFA 3AVUA 3H1AA 3ORFA 1XUOA 1CYDA 2QLNA 3L7DA 2CB0A 5DW3A 5K6AA 2VHWA 4FFRA 1RPAA 3FA2A 3LBFA 5IJAA 3TLAA 5AVTA 1E1YA 2OHOA 1PLJA 3SYKA 3WKCA 1OUMA 3IDAA 2OXIA 3MD0A 4Q9NA 2VZ0A 4GPZA 1P33A 4GKVA 2WTAA 1YD7A 3VM6A 3L8FA 1W5EA 3MTDA 3GRAA 1RKVA 1SHLA 2QUBA 3DWEX 1RRPA 1RJDA 2R1VA 3Q1KA 1WSDA 3ZGLA 3LTNC 1CEEA 1TKCA 3EG9A 1GRQA 5AVWA 4TS1A 5NULA 1U8YA 2Q5JA 3TIGA 1M6WA 3G0IA 3RANA 5J5CA 1RPTA 4CMIA 4DG5A 3FI0A 1THMA 1A7JA 1E3SA 2FDRA 4L2IA 2PUEA 1HLDA 2LTAA 3FMVA 1NRJB 1YCDA 4HWRA 5CMLA 3BE4A 3IPCA 3FHTA 4B4DA 1YZHA 2VOEA 2IPLA 4I14A 4JD5A 1NBME 1JHMA 3BIOA 1WPXA 1BX3A 2NOAA 1GFIA 2W11A 4ND8B 1UPBA 1BMQA 1XRJA 3SS7X 5K3DA 2BUAA 4OP2A 4ZZIA 1RHMA 3IDFA 4N3AA 1GQ2A 5IKPA 1OFTA 1PVVA 1VYHA 2GO7A 3DT8A 3OQPA 4HY3A 4INZA 4K5QA 4R9SA 4QGSA 5J4VA 2GM5A 2WK1A 1X3SA 1ZRMA 2EV9A 1N8KA 1OHHA 2NZYA 2R62A 3LV8A 4NG5A 4RPJA 1QTIA 3Q5EA 5IZCC 1OZAA 3BK2A 3NDIA 1D2RA 1MAWA 4QWWA 3N5KA 5HG0A 1BIFA 4OQXA 3ZDQA 2YL2A 1BJTA 5KSZA 2ON6A 2BGNA 4ZVVA 4IMPA 2JCVA 2NXJA 4UTOA 2OCGA 3Q6MA 3V2IA 4ZYLA 2JHPA 1K6XA 1R0LA 3RBXA 3CX4A 3FKSA 1E9FA 4QDZA 3DP9A 4G1VA 3R7AA 1RT9A 4DA6A 1L4UA 2YC2C 4KR6A 2QGNA 3BXPA 3IUSA 4LJKA 2R6GA 3SXPA 4WXRA 2NQ2C 1ZOIA 2AK3A 1P73A 2ZULA 3ZI0A 2EGUA 4EI8A 1UPTA 1FFGA 3L0BA 1JDVA 5DGHA 5A02A 5C9ZA 3HO1A 1YASA 4C0QC 1MQSA 4G5YA 2QV0A 5FO0A 1EGHA 1X3LA 2WAXA 3BQNB 4MA5A 2YWFA 2P7IA 3K32A 4P4NA 2O4CA 2IYZA 4BASA 4DILA 3L7IA 3RROA 1TC1A 5G0UA 4CI0B 3WBJA 1VLLA 4QYMA 5FR2A 1WCIA 5BNTA 4NDZA 1UP6A 4R54A 3C7CB 3L8HA 2NUTA 2FW1A 2AGVA 2WM8A 4D9GA 1PJ4A 1XN1A 5B3AA 1GO2A 3HO8A 3FLAA 1L5WA 3VPXA 2H7CA 4AY3A 1A9OA 3MGAA 4FR5A 1UUFA 3LVRE 2W71A 3B2EA 1G8SA 3CJTA 3PNOA 1VKOA 5L51A 5LLTA 4LCJA 2WVJA 4LJSA 3WRYC 2G72A 1TCCA 2Y66A 1BDHA 4IM7A 4OXRA 3CLUC 5BNZA 5DHFA 4JAVC 4LKOA 1W93A 3HU3A 1QIMA 1BEUB 5LQRA 1OKKA 2VTDA 1XTKA 2ZXUA 1O6ZA 2DR3A 1YIOA 1XB2A 4W6QA 3G2LA 3SIWA 4Z0PA 4B43A 2QF7A 4AO6A 1X8LA 2BSQA 2KW5A 1PGOA 1ML3A 1PV1A 1XI2A 1ECFA 3P1JA 3PP8A 1Q3TA 1ZH6A 3PE3A 2W2MA 2B4YA 3SM9A 1DQRA 5BYKA 3HZHA 1N0IA 2WE7A 3F6PA 3KQQA 3ACCA 1QCDA 4HNSA 5CLFA 3AF6A 2J5RA 4M8SA 4D6XA 5DTQA 1K6MA 1NSYA 3ML1A 5CYOA 1G0OA 4ARBA 2V7XA 1FTQA 4FYWA 2CLMB 3DYIA 4AK9A 2XR1A 1T13A 3TO5A 4CCSA 5JJKA 5AOVA 3VO1A 5HEKA 3JATB 4FXOA 3Q3GE 3NP9A 1SWVA 2XB2A 4GIBA 4CEHB 4ND7A 5JCZA 4LDAA 3ORYA 5C8XA 2XITA 1NLUA 2I6UA 3U40A 2XADA 3D8HA 3WK7A 3OA2A 3ZXYA 1ULTA 4JB2A 3L7BA 1CZLA 1KSHA 2DOKA 2JKVA 4KDEA 4WXEA 3ZHXA 2R1ZA 2CXNA 1XZIA 3K0AB 3TZEA 3QVSA 5CT6A 4FDLA 2B78A 2H06A 3CX6A 4NZ9A 1VYVA 2PMDA 2K2WA 3CF4G 3KXPA 3QEMB 3R3VA 4XYMA 2GK7A 2AE2A 4PV7A 1IULA 1NXSA 4LV8B 3L8YA 4ZJUA 2CXOA 5D6OA 1N6HA 1HFEL 4G8CA 4J0GA 4C7BA 4ABYA 1Z5NA 1GIAA 4PO1A 3DVQX 4GQIA 4PLCA 5JDCA 5K0CA 1J8VA 1A5AB 4KVZA 3BD8A 1GUBA 2C3MA 2H7YA 4TKLA 4D4LA 4TLDA 2F3TA 4C21A 3IR7A 3TI9A 1DWOA 1YI1A 2YZKA 3IPLA 4IIHA 4OK3A 4BB5A 3J81A 2ZUBA 4FFSA 3E22A 1AA9A 3DLCA 3ZDRA 3GUVA 2JFQA 5GIPE 1M75A 1VQ1A 3KCNA 2WU4A 3QTTA 4LKRA 3WS7A 4D9IA 2PKXA 4MR8A 3KVOA 3T15A 4AJKA 4G0UA 1YHYA 1GFWA 3OIWA 4MV9A 4PZZA 2GK4A 4RXUA 4DB4A 3JYHA 4Y2RA 4L0MA 3KZVA 1P80A 2ZKIA 1NP6A 4OHWA 1GUDA 5IT9A 1C3VA 1WS6A 3PQFA 1UXIA 2QMEA 4YMSA 5DTRA 1PLLA 2YZNA 3U48A 5CB4B 5KJ6A 1R8SA 4TM7A 3ME5A 1VA4A 2RCNA 5L3RA 2HYDA 1R64A 1HE1C 3QELB 1AGNA 3ANTA 3RTEA 3UKJA 4U2EA 1H4QA 1OQAA 2OXCA 1N4AA 2XPCA 4R8KA 1R0BA 4FT2A 4DR5B 2CJPA 2YMMA 3THOA 4CHTA 3DLPX 1Z4PX 1QGYA 3G6KA 4UAVA 2NPFA 2VYFA 3VKHA 4BE9A 2AJCA 2P65A 3MMNA 2C2MA 2X5XA 2OO7A 3HYLA 1P0FA 3N05A 3DBLA 4LE1A 4RZXA 5F1PA 3AI2A 4EMTA 3HU1A 4EUNA 4QUKA 2HGSA 3QFTA 1R66A 3WLHA 1AV6A 3AUUA 4S1VA 2J9FA 1VBFA 2OTCA 1XC7A 2CVOA 2XQIA 3DC7A 3HR8A 5LZ5A 1HI9A 5LOVF 4IKOA 2RHJA 3JWEA 5IASA 4FFDA 4DJEC 3X1KA 1G64A 1Y5RA 3F9RA 2AKYA 2W6MA 3VDMA 2OK8A 3PRYA 1PL7A 1KI3A 1CQZA 2BGJA 3VYTB 4RLHA 3DXFA 3ZQ4A 1ZOSA 1RZRA 4MP8A 2H5JA 2HLDA 1E7RA 1MZVA 4CHGA 1JTEA 5T3YA 4DA7A 2BGUA 5F23A 1WP9A 3R23A 3AYZB 1UQUA 3EZYA 1AUQA 4LRXA 1CXZA 1YHZA 4JNCA 1GNLA 4GGOA 3TTXA 2DLDA 2QN8A 3SC2B 1ICEA 3CVWA 5CT5A 3P9ZA 2IOQA 5HF5A 1HKHA 1XA4A 3OE7A 5EQJB 4LTNA 3PPXA 1L3BA 4RHFA 3CN7A 4UBKA 3HSKA 5EUMA 2ZI3A 3LZCA 3COYA 1IATA 1RI4A 5CIQA 3RSCA 4RZ2A 2ZSDA 3BL6A 3E8MA 3FUCA 3CKKA 4OBXA 1JHUA 5DKFA 2AJ8A 1YDGA 3E03A 4DRYA 2QU8A 2ZYTX 1V1MA 4TWRA 1U8XX 2WZQA 3RG2A 4ENVA 1T8WA 5T64A 1P1JA 4L76A 4QG7A 2RI6A 2IDZA 2VBCA 3L7CA 4X84A 5F77A 1QKKA 4I0WB 1G20B 1WEHA 2H52A 5SZKB 5BN3A 2PL1A 4W5JA 1F8YA 1FP7A 1PV2A 2FPLA 5CA0B 4YONB 3PEEA 5G1NA 2DP4E 2DWOA 1FYXA 2GJAA 4A36A 1X6VA 2PRIA 3GQVA 4I4CA 3RH0A 1M73E 2FR1A 3D6JA 4QLBA 1MQ9A 5IULC 2FG7C 2Z2JA 4JVOA 4XUDA 1O4VA 4UPEA 3ZD8A 1UZMA 1P5RA 4A0FA 1IUNA 3B38A 3N2LA 1T4GA 3NNDA 3X1ZA 3HSSA 4AMUA 4DANA 2A58A 2WW8A 1Y4SA 1DARA 3FYDA 5K4HA 1H5UA 4DDTA 3NHWA 4DQDA 3D3JA 1BEZA 1JWLA 3SLRA 2NAPA 1HYGA 2B21A 3AGQA 2C00A 4QASA 1E5LA 5FNVA 4F38A 4IJMA 3HDVA 5B58T 5KVCA 5AKYA 3ZKWA 3ETNA 2GTIA 1JDSA 3B6KA 3A0RB 4OJMX 3U4GA 4K6HA 4CKZA 3C85A 3CLTC 2Z6AA 4UEWA 3DAYA 2DUMA 4KAFA 3KD2A 3OKPA 2PQ6A 1QIFA 4N12A 1IBMB 1TGYA 4LDPA 2Q27A 5FBKA 2AFHE 3QXSA 5IJXA 3BHJA 3C7KA 4OHRA 1UDWA 4HMQA 2P4EA 3PQ3A 2XNDA 2ZBVA 2C5EA 5JV5A 4MVJF 3A9SA 3A2MA 2J48A 2VCHA 4K88A 2IPMA 5K4GA 2HBZA 1LH0A 1SD2A 5AO9A 4G5HA 1UKCA 3ASYA 2NO5A 4I9HA 4GPEA 4ISBA 3R7LA 3UQYS 2P6RA 4ZVMA 4UATA 4ICIA 1JAXA 4AP5A 2LRHA 1ZNXA 3AKEA 1I7NA 3M2TA 4IXNA 1L5HA 4NIMA 1M10A 2A35A 1CUAA 1BD4A 1G5QA 1VDZA 1MO5A 3FTQA 3GGOA 3H5OA 3V4FA 3T1YB 2WHRA 2WFLB 4I55F 3U4AA 3NAQA 5FP0A 4D6YA 1G3RA 1SCDA 2JFFA 4O4HB 3LRXA 3ZN2A 3LYUA 5J47A 1J8FA 3LO5A 4NAVA 3AI3A 4WXHA 1U0LA 1VYTA 1XDDA 1YDMA 2HGZA 2PUVA 2Z5FA 1J56A 5CEEA 3L6RA 4C2BA 3MAAC 4PLWA 5E95A 4I08A 3VZPA 2AMLA 2A0UA 5C4MA 1RCFA 2ZQYA 5JZ9A 1WSBA 3UW3A 4PO8A 1UZLA 4K9RA 5FQNA 1ZK0A 3K0SA 3PXGA 4RFVA 4WZZA 3ABSB 2A6PA 2O2ZA 4Z9BA 1G98A 2H00A 5JAZA 1I0IA 4N5MA 3TTTA 4BKMA 2YWHA 4D4MA 3A4VA 4ZXFA 1FP4A 2OP0A 2O7VA 4KC0A 4YYZA 6REQB 2R751 4CKBB 2Q5IA 1RLIA 2OY0A 4CKYA 2XKAA 1LK7A 4H15A 4J4BA 1NUHA 5JVDF 1GKUB 3FCCA 1G8MA 1N0VC 2JGAA 4IWYA 4TN1A 4CNQA 1PFWA 1JKIA 4UHBA 5DM0A 5DWVA 1NNEA 4JI6B 4PZCA 3CPEA 3M5CA 3I1FA 4NLLA 4C78A 1XDBA 5FTKA 3BPSA 5A9SB 5KYYB 1LRKA 2E5LB 2J5BA 2HREA 4EHBA 3UK0A 2ZVPX 2ZYIA 3DCJA 3PZBA 4F3CA 7MHTA 3TI7A 4HRVA 2Z95A 1GR1A 3PQEA 4MPDA 1OLSA 3OWOA 3FFAA 4KXYA 4RTJA 3GMIA 3ZIAA 1MX1A 5ICGA 2HLPA 2W48A 3WWDA 2ZPAA 1WKVA 1SHKA 3LBHA 3VBEA 5AJZA 1ZUD1 2AMJA 3GWZA 3GXOA 2VH5R 1Z18A 1ZI6A 6PFKA 3VTZA 5I7FA 5G02A 4BVBA 4O4LB 2EBHX 3HL0A 1W36C 1MHTA 1JLMA 3DM5A 2YNMA 2IEZA 1KMHB 2HRZA 5GPBA 4DLAA 2PWAA 1S5PA 2I7CA 2JGDB 2DQZA 5DHQA 4PYJA 5ALNA 1KS2A 2QVYX 1JXMA 3SQMA 3N2GA 5EJ7A 5ERYA 3HEBA 1G55A 1KIAA 3ZXIA 1HRDA 2RE8A 1P7VA 3MJSA 3MC1A 3QNUA 4LWPA 3S2FA 1E2KA 4JJEA 1VL2A 4I1RA 4WOCA 1K86A 4L1KA 1KO1A 4B6RA 1HL7A 4LF4B 1QX3A 2CJXA 4KQCA 1YUMA 1U2DA 3H1TA 3CEMA 2E87A 2KQUA 4X20B 6Q21A 1SQSA 2EAUA 4X1IB 1EFPB 3FE2A 3FNRA 3MWLA 3OOWA 5ANRB 3OZRA 3D8UA 2HWUA 2R9VA 3OFJA 4K6GA 1VPEA 2DR0A 4RS4A 3ETJA 5DI3A 5EXDA 3PX7A 3I45A 2Z57A 3CNNA 2HCFA 5DSTA 4RGBA 2ZRGA 2H65A 2BPOA 1T6XA 4CL3A 4Q5IA 1IDOA 1M2WA 4DMKA 2Q5LA 1E8DA 1JXAA 2QM7A 3AKDA 4A2WA 3F0TA 3JVDA 4G1FA 1QS0B 1XNJA 4D9BA 1TC2A 3EZ7A 3K1AB 4RF3A 4IDBA 4RUKA 3UQZA 3CVXA 2FMTA 3TL6A 3OJOA 5G3YA 5DBEX 4QTXA 5C52B 2P6OA 3A6FA 4KMOA 3ZU5A 4GE0A 1UJ2A 5KOJA 2B8NA 3NEPX 4BOYA 5DZSA 4NNPA 2ZROA 1XPRA 3L18A 4BS9A 1YOVB 2QRVB 5AKEA 3MJ4A 4BKRA 1OPRA 1JBQA 3O1HB 3OO0A 1R5JA 3O4HA 4CMEA 4EL0A 5JD6A 3HRIA 5TX7A 1OBFO 2X2OA 3EGDA 3I39X 5A4IS 4MHTA 4QJIA 5B3JA 1ZCAA 1RLMA 8OHMA 3ZV3A 1B0PA 2HDHA 1MEEA 1KYZA 2NYAA 2BM0A 2ZSBA 3BKWA 4PNHA 3TVDA 5IJ0A 1BCRB 4D9FA 4C4XA 1MFZA 4MWCA 3H3JA 5DWDA 5DYIA 3ZCVA 2XDWA 2VA9A 2CD7A 3SR0A 4BY9E 5H59A 3B3AA 5BN5A 2PMBA 2XCLA 4QJBA 1R6TA 1DKOA 3NM5A 1AG9A 1PGQA 2YVAA 4PNZA 1W36B 4ZDJA 4C30A 3O8LA 2NU8B 1JFRA 3BRWA 4DR3B 3AVTA 4GP9A 5DX1A 5B7PA 5F9HA 1TRKA 1WVIA 4QEZA 3UJCA 2BFEB 221PA 5A0VA 4R41A 1UJMA 1OAAA 4UVEA 2DFNA 2VNSA 2WG0A 3PXEA 4YC7A 3T0GA 1DX4A 3OQHA 5TGZA 4M55A 5KOIA 4JGGA 1OTYA 2CEAA 2QLFA 1ONNA 1F8GA 3K94A 1JLSA 3O1IC 4N0PA 5B2ZA 3IJRA 5BQFA 3ADKA 1II8A 2FG6C 3EVNA 3UOAB 2WTNA 2JGIA 2BFBA 3GLTA 4ZVOA 4AJ4A 2P9GA 4MUJA 3L6UA 4BV9A 1FMJA 4BBZA 1J2RA 3THYA 3B48A 5JRDS 2QQ0A 3T7CA 3NYWA 4B6OA 3FPSA 2ZAMA 1EFUA 1FVHA 1NTOA 1T4BA 2KYRA 2Q5EA 3BORA 3VNSA 1N34B 1NUUA 1NFQA 3FIUA 2H2GA 1IJEA 4RWEA 1C1XB 1T0BA 2I4TA 2IX9A 3JQ8A 4WUTA 4OBEA 2XRZA 2JHAA 1P9OA 1OAOC 3NTLA 2WP8J 2P9ZA 2UVQA 3ZXUB 1W9MA 2HIGA 4HUQB 2B69A 2D0IA 2C7VA 1QV6A 5GVSA 5TARA 3OIUA 2H3EA 2JFWA 3DSRA 3VO9A 5FTLA 4O5OA 4B6SA 5FPKA 2Z9BA 3IIMA 3H6HA 3H05A 1XKXA 2CLSA 4ARVA 3OEYA 3VKUA 3JAKB 4PZEA 5LJLA 1PK8A 2GEDA 3V4PB 4I2VA 2EIHA 2OCPA 2WIGA 3M4JA 4TZTA 3H5RA 2ZAOA 3B12A 1G5PA 4L8GA 5ER6A 2KLBA 3A0UA 4A4DA 3IAEA 1Z0FA 1QHYA 1X7WB 3VH4A 1T9HA 2ACKA 1XLWA 1EIZA 2P77A 4NPHA 2ECPA 2VS1A 1DBPA 1T10A 3ETEA 4YJFB 4ZHQB 2FWAA 5A9TA 1PQPA 1X2BA 3O94A 5ALRA 4B2LA 4KODA 2FK7A 5KPDA 2DKNA 2CF5A 3U6KA 2F17A 4RKEA 1W0CA 3FPGA 1ULUA 3W5BA 1N7HA 4AF6A 3P8ZA 2FWPA 3PQCA 1QYWA 2OENG 4UCFA 3VYUB 1JHQA 3W77A 5BVGA 5LQUA 2OBNA 2JLRA 4INJA 3N6VA 1MB4A 3AJ8A 1KKUA 3AP1A 1YJAA 4NOMA 4LQ4A 4NMLA 1FMCA 1NMQA 1Z8DA 3I2IA 3KZOA 1TM2A 3UK2A 4WKNA 1R12A 4Y2HA 1BU8A 1FNNA 2H9AA 2PMEA 4A15A 2YOFA 1W34A 1FP1D 4J8PA 3U56A 4GFDA 1OOEA 5LB2A 1GSAA 3BMQA 3ZNQA 4KI0A 3L0OA 2EKPA 4L75A 1JTFA 4C0LA 4LI0A 2R85A 3C5HA 1MOZA 3OD1A 4UXIA 2WKQA 5LA6F 5TQ2B 3TQQA 2QD3A 2OCIA 2Y1EA 3V80A 2B4TO 4C7OA 3QFHA 4GLOA 3O4JA 2F4NA 2J3DA 2XQGA 3JQFA 4QYIA 3U44A 4P08A 4DCPA 3OI7A 1KYTA 2BGGA 1QIDA 5DLEA 4ACBA 1VGQA 3QOFA 3PT9A 5TPWA 3RFXA 3T5TA 1W4LA 4E12A 1QF6A 2AC7A 5GONB 2ISQA 4I4TF 5KYUA 2E37A 4D57A 2OHGA 4CODB 1M66A 4G8DA 4AMGA 2I4IA 1IE3A 3SR4A 4ECAA 4JXZA 1M2JA 5IEBA 4RTOA 2FFHA 2I2FA 3CWQA 2FPXA 2NT4A 2Q8NA 3LWNA 4PWZA 4G5FA 4ZI7F 1PK9A 1X8KA 3EA5A 5IMSA 5ECWA 1EXWA 3QX7A 4J43A 2JFHA 3GMSA 3FGNA 1TQ6A 3JALA 1WSWA 3KYDA 4KKXB 3MWDB 3Q7SA 4KSBA 1VSTA 4IEEA 2Q21A 1M2KA 4A03A 4ETIA 4MDEA 1R4AA 2FWBA 4JT9A 4DVJA 2WJWA 5EMMA 1Q0RA 2X7XA 4UHHA 4YMIA 1A5ZA 3A1SA 4JT8A 3UN1A 3R3YA 3JD3A 4RESA 1GTSA 4ZT3A 1P72A 2PS3A 3H0CA 2X9NA 1B8UA 4GYKA 4IZHA 1Y8ZA 2QL5A 2GH1A 1XE3A 2Q3HA 1BW9B 3I6MA 4BC0A 4PFSA 1PFYA 3GRRA 4M89A 2V55B 4QJ3A 1ZNZA 1N2SA 1QIKA 3VMMA 3W1VA 1CE8B 4L9SA 5ALWA 1KY4A 5DYNA 2GXSA 1M76A 4PXSA 2ATVA 4BO5A 1QF7A 5HZHA 3I05A 1ZWLA 2ZIXA 1NOKA 1UP7A 3ESBA 1M34A 4QEDA 1Q19A 3KVYA 2BW0A 1UEJA 1RWKA 2HL6A 3SK0A 1HT0A 2QQFA 4YALA 1D1SA 3DE0X 4YRLA 1B0ZA 1LQTA 1KA9H 1L5SA 1M5UA 4FHZA 1M1YA 1B6RA 1T9GS 4OHYA 3F6BX 1ZZEA 3ONWA 1D5WA 2QP4A 3A9UA 3WLTA 4A8HA 4AJJA 3CTPA 1S3FA 2ZRIA 3OM1A 4H59A 3M6VA 1GQRA 2ZIEA 3T99A 4YEDA 4EG3A 1X0VA 5HRAA 2W6ZA 1PEAA 2CFIA 2QTAA 2XMQA 5CNMA 3WKBA 4B45A 5AW8A 2AQ8A 2QMOA 1NKVA 1OXBB 3PRHA 1Y3DE 4P80A 1T4MA 2IRWA 3D7NA 1Y42X 3ZOZA 1CF9A 3BQ9A 4J0QA 3OZWA 4DC0A 1NY5A 2XQVA 5FWDA 3VYVA 2QK4A 4TXNA 5EUQB 3CN9A 4RULA 4FUQA 4AY6A 1KU6A 2BT4A 4J0FA 1FTNA 1MJNA 3OCCA 3CLVA 3WZLA 1K6IA 2B4QA 1UMKA 4KQWA 5D3ZA 2R6HA 4BNUA 2JEZA 3QWAA 1SOWA 2RJOA 4NJOA 5EZYB 3FYCA 1N2CE 3A05A 4Z4HA 4ZU1X 3DEJA 4NR0A 3PWZA 2B1QA 2OM6A 3ZVNA 5DBOA 2ZR7A 3G0CA 1T2UA 2QRQA 1SRQA 3FWNA 4G01B 5DPMA 3FGPA 1ORTA 2HN9A 2WWRA 2JIRA 1IZ7A 4YVFA 3FCAA 5A3VA 4LDJA 4OLJA 4DNXA 4KXLA 1XELA 2IXGA 2Z2KA 3DYBA 2WJAA 3TD9A 2CEKA 3AVOA 4DJDC 1ZD4A 2Z2IA 4JOQA 4DPMA 1RJGA 2DFVA 4FDMA 4KPUB 3COPA 3QP9A 4L16A 2SKDA 3GG9A 4QU0A 1YZFA 3E15A 3RNOA 5CLJA 1U28C 1KY2A 1ZH2A 4H3HB 2VN8A 4DBLE 5LDHA 1QQ6A 4UHKA 3NHBA 2PAAA 5LIPA 1KDRA 2QW8A 3KAPA 1OGIA 1X80A 2PJDA 3C3DA 3KP1A 3PVCA 4UUNA 4I4TB 4EO4A 2IUSA 4R8MA 1IQ0A 3T7IA 1Q16A 2PBZA 1IHPA 3RAJA 3S7TA 4BQNA 2AG5A 3JYOA 4UTXA 4EG8A 3GP5A 5CA1B 3CMCO 1IAQA 1B26A 3OG9A 5DF1A 1KGDA 1KWKA 4ZI7B 2IHVA 4R9UC 1KI8A 3PGXA 4YRTA 1V8BA 3R7BA 5HQ3A 3TFOA 1YC5A 3EB9A 1YHNA 3DLIA 3QKSA 1BXGB 1NVMB 4NCJA 1UBGA 3RYCB 1FRFS 3KR1A 3M4XA 5BMVB 5ADHA 4YV1A 4XJSA 2VZLA 1M6VB 4CTNA 3EIWA 3E9CA 4DKXA 3AP2A 2LIPA 2VHJA 3JQAB 4ESVA 1QVRA 2A7XA 2Y1XA 3FOCA 3GJ4A 4TV8F 4ZK6A 3QE0A 1ZGCA 2HFJA 3K70D 1FSPA 1FRZA 5I7HA 2VH2A 3QX8A 5H81A 1BJRE 4G07A 4GXTA 5IHPA 2VP2A 3NOXA 1P1KA 3PDCA 4IYRA 2HT1A 3B6MA 4TRNA 1GAEO 2QTVA 2MIIA 1UJBA 2PM8A 3KLMX 4XJVA 4Q1DA 1K8ZB 5TT0A 1OXSC 2W8ZA 3JQBC 3R5SA 6CHYA 1SG9A 4MLCA 3UW1A 5AKJA 2FQ1A 1B6TA 4XYEA 4OI1A 4EG6A 2XVMA 3L6BA 3SLKA 4QUDA 4LMAA 4WNYA 1HKUA 5ALPA 3OLVA 1DG1G 1PX0A 3KZ1E 4P0TA 3WGQA 4MJXA 3Q10A 3HCDA 3C1OA 1GCGA 4WADA 2XUHA 1PT6A 4HXGA 3DFIA 3R7DA 1TW2A 3OJXA 1JFSA 2X9VA 3VR2D 3MOIA 5IW8A 3HP7A 3NETA 1X74A 3QWFA 3LA8A 4YGXB 2A0XA 2FN4A 2JKYA 4YWHA 1ZDMA 1IY8A 1U7OA 2CZQA 1POXA 1YR2A 4FKMA 4MB2A 3SHFA 5EUCA 3CHYA 4Z9FA 2ERXA 3RRBA 4D4HA 3I9NA 3ICWA 1TMYA 2JI4A 2EVWX 1LJLA 2JCGA 2VDPB 1YQWA 3HDHA 3IJEB 3VNRA 5J2UF 3W5AA 1WMFA 3BGVA 4PPGA 4PPYA 1QLWA 2W2XA 3IH5A 3CZMA 1AM4D 3DEFA 5IBQA 2B36A 1L4FA 4K2HA 1G8JA 4E5DA 5JS7A 2X9QA 4WFJA 4XB2A 4NU5A 5EE0A 3WNVA 2GD0A 5KQSA 4NP6A 2IP2A 1P4HA 3CB2A 1DQYA 1U8UA 2GEJA 5E1BA 3AEKA 3OEED 1HM5A 2CL7X 2H8GA 3DFFA 4YNBA 4BQOA 5CYGA 2IOFA 4M22A 5JW6A 4N41A 2G70A 4CMKA 4FR2A 1X86B 3UMGA 2JB9A 2ZE6A 4YPVA 1WXHA 1P0PA 4MV6A 3DB2A 1I2CA 5CJPA 5AKXA 4O63O 5IXSA 4NCNA 3D7LA 2ID7A 4NBRA 1UBMS 1Z8FA 3H42B 1FQKA 4EHAA 4GPAA 3U4HA 1D9ZA 3QUSA 1MIOB 1M2HA 4J6FA 4YJHA 3UWKA 5A2QA 5JSFA 1NQXA 3WLMA 1N1GA 2QN1A 2YUTA 4W9RA 5IAKA 4MVYA 4XX0B 1KFKB 2OEPA 4P7FA 5I6DA 1M1YE 2AMYA 1O0SA 4JLPA 3WB1A 2XXAB 4ZQCB 2QR3A 4OMFG 3PC6A 3URMA 4FGKA 4YS6A 3HJBA 1OGJA 3U80A 4E3ZA 4ZVTA 4BQEA 2FFAA 3ZWWA 4F92B 3ZWAA 2N47A 3WIUA 1ZH8A 2OUKA 4A0HA 3TQHA 4B3TB 5REQB 4L9RA 1CU1A 1F8UA 2Q9CA 5KKCA 1PFKA 1GGVA 1QU3A 1XRSB 1YZQA 2QD4A 5TVKA 2DQ4A 3KQMA 3TQFA 3UOGA 1J9GA 2EIXA 2HSDA 4TV8B 3R6DA 2OV6A 4Y2UA 1FBTA 3PSAA 1V1JA 4IX9A 3I5MA 5ADUS 1CY7A 1K6EA 1ZAKA 2DY0A 1N6RA 4JB3A 1JFFA 4Y6RA 4AJ9A 4Z1MD 4GKBA 4JMPA 1ZGJA 2ZU0C 3W78A 4P7KA 1PQWA 3FMGA 3LT2A 3F5SA 4DHWA 2VDOB 3WGHA 4MXDA 4TUYF 3DE7X 2CMDA 4OBBA 3UCFA 4YPOA 2E2WA 5A9RA 4DA9A 3H5LA 3UBTA 3FAKA 1WPGA 2HQSA 1KARA 4EB6A 1Z2OX 4CU2A 4YT4A 1ZMTA 1XLUA 4XI9A 4RQUA 1ZJJA 1Q91A 1JEQA 3LHFA 2CF6A 3ROMA 4BVKA 3NBZC 5EJ4A 1F0PA 3T4PA 2OE2A 4X8HA 4CCWA 2J4CA 4Y1GA 1QF9A 1Y3HA 4ER3A 2W42A 4U63A 1J33A 2ZDHA 5FFMA 3K6SB 1D04A 1K5PA 1NE2A 1RJ9B 2RIPA 3UT5A 3FW1A 3KVNA 3ZHZA 4BX2A 4CZ2A 3PENA 2H0AA 5JTUA 5EE1A 3ZQKA 4JLJA 1XTRA 1CEQA 1KEPA 3KPYA 1UFKA 1YV9A 1M2OB 3KV1A 3AZQA 3OJ0A 5I48A 4JR1A 5KYXB 3WGGA 4TSKA 3WQRA 1XDSA 2C9DA 3PZRA 4DLXA 4GBJA 3N8KA 4Q15A 1UOQA 2QX4A 5AVOA 2OCLA 1KSJA 2X23A 3QF4A 4FHEA 1KYVA 1SXJD 3WWPA 3S8EA 4G8BA 3WGZA 3L8ZA 3ZD6A 4LZAA 2QDKA 4IVRA 1HMYA 4RZIA 3IMGA 4IGAA 4NY1A 4MZXA 1AB5A 1V8DA 2V7UA 3VR4A 2NP7A 1VIDA 3FTDA 3DEKA 2GCOB 2OG1A 1AGXA 3HKBB 4LOIA 3M3PA 4F0JA 1H2AS 2C1XA 1CULC 3QVVA 4PCUA 5B1IA 1WUHS 5PNTA 4NC9A 3HY6A 3DWFA 4FB4A 1Z5GA 4MX8A 2VHCA 4ZT5A 2GFQA 1OXVA 4JOBA 1QQTA 5DCYA 3IALA 3CLKA 4BZWA 3JYNA 1R0SA 1ZJYA 3PDIB 4HD8A 5EP1A 3T7AA 4GZ6A 2Q1YA 4IFIA 4R2HA 5AT1A 5TF4A 1Z12A 2JD0A 1CKEA 1FFYA 3B1YA 5J5VA 1J22A 1SKBA 1ZISA 4LXHA 4HAIA 5DYYA 1AY0A 3U44B 2PH3A 2DPYA 1FYVA 3W5IA 2WHQA 2HDNB 1IN6A 2PT7A 5H8WA 4HDRA 2I7VA 1SVSA 3I01A 2ATIA 3MRXA 4ND4A 4AYWA 4CV2A 4OXKA 1L9KA 4LV6A 5FBWB 2VPPA 3VU9A 1CK4A 1XVVA 2W2VA 3FX2A 3LCCA 3ENQA 1MORA 5FTNA 4OP3A 2FN9A 2YFYA 4CU5A 2C84A 3O9MA 4MNTA 5BW8A 5JR3A 4K81B 1T2AA 3VV3A 3SXUB 3GEMA 2XVAA 5DXFA 3DFMA 1T0HB 5LJIA 3T5DA 4H6XA 5IG2A 1Z6QA 4YRFA 4DUZB 2PZEA 4TUYB 3BOSA 5FWNA 1TIKA 4H7EA 2OGTA 5CD9A 2LIVA 2HV8A 2ZTMA 5IZCA 1C3JA 5AJXA 1JR3D 1VBKA 1QE3A 2FOXA 1EK2A 1FPQA 2VC2B 3KKZA 4MQ5A 5B55A 5CB8A 3RASA 3X1WA 3SP1A 4J0DA 5KNDH 2W7TA 2PZAA 2IOFK 2P9QA 3RABA 4X24A 4ZIRB 3ADCA 3D8NA 2NG1A 3LF1A 2PUHA 3HJNA 3WLEA 1LTHR 2BFWA 3ANMA 3ICPA 4YDSA 2ROQA 3WMEA 3DNFA 1YQEA 1Z0IA 1KWGA 2YHUA 3MHTA 4KUEA 1CEYA 1J8QA 1RNLA 3B6EA 2EP8A 3B7PA 4R1OA 3RJTA 4FX2A 4RWZA 4EJ0A 1QQAA 4X45A 1E1QD 4Q4JB 3FNIA 3TLKA 1NW8A 3RWOA 1X1SA 4P1ZA 3WLFA 2NUAB 3P2IA 3X3HA 5JY1A 5HFAA 1Q2UA 3LDGA 2VCYA 1U1IA 1FX0A 1IWOA 1TMOA 2AIRA 2B3TA 2YWDA 3GELA 3I5AA 3NR2A 4L4ZA 1LSUA 4IZIA 3D7RA 3PF8A 5KNCH 2IEAA 1H2YA 3DA8A 2ZAYA 1TZ2A 2JC3A 2GEVA 2VDLB 2UUOA 5CH5A 3VISA 2WTUA 3O73A 1T6BY 3PFNA 1WKCA 3N8NA 4F3RA 4ZFNA 1NUQA 5ALJA 4RD2A 5DEOA 2YOHA 3MLAA 4YJ2A 4L28A 4Y67A 2J0UA 1B23P 1ENYA 3CKMA 5A3JA 3KAJA 3QUCA 4DLNA 2QX8A 2W6PA 1EGAA 3I53A 3M0EA 3QSGA 2HCTA 2N1BA 4N54A 3UJ6A 5EP2A 3SKVA 3QLVC 4D8UA 2H1SA 1RPNA 4B1FA 4YLEA 1PV4A 4EZIA 1GGMA 3TD6A 2W4IA 4CQMA 1R0KA 2D1FA 4CMBA 4EM6A 3F5QA 4IOKA 5DN9A 3H7IA 2HF8A 2AFIA 1O94D 1AF4A 2I7XA 3EVAA 3RU2A 4H1UA 3LWZA 1JNXX 5FWAA 4BLSA 2ZRAA 1U1GA 3W0LB 3B5IA 2DPMA 2OSVA 4XAQA 5E8JA 4M21A 4HADA 2CGEA 2W90A 3RS9A 3W3AD 5CVTA 1NBOA 5KJEA 4F21A 1ZJZA 4MW4A 4D96A 2O8CA 3VYSB 2A5DA 3EEYA 2YV1A 3T5AA 2PLRA 4XQEA 4G89A 1FZQA 4RGYA 4MGHA 2IZ6A 3L6OO 3AJEA 3AU8A 1Z13A 2JRLA 2XIJA 2V6BA 4JJ8A 2HV9A 5F33A 4ML3A 1ORIA 3RRYA 3WX0A 2D5IA 4FYHA 3G8BA 4H4CA 4O2BA 1Z4NA 2QT1A 1CY6A 1EMDA 2PWBA 3QV2A 4HN4B 3BBPA 1O96B 4YI3A 4M9UA 3V1MA 3UGJA 3TPFA 2VT6A 3RSGA 1GRRA 2GJKA 4DJAA 1Y8QA 4LRWA 2JK1A 4L3VA 4DG9A 1Z2NX 5AQ1A 1LX6A 4EEXA 3RS0A 4GM0A 1J2TA 3MBKA 2CNBA 3R77A 4OQMA 2JLCA 1RAFA 2EW1A 1ISRA 4EJSA 3Q8KA 3REQB 4A5OA 5GJVC 5A04A 2NZXA 3HCEA 3HJCA 4MRVA 5EAIA 3L8MA 2F62A 3PHLA 2CJYA 2V3VA 3VPAA 1TUGA 1DB3A 3M6WA 1NJ6A 2H11A 3N5CA 1V48A 3PC8A 4AW9A 1DO8A 1YL5A 1E2HA 4BFVA 4BKUA 2D59A 3NLLA 2AUNA 1Q57A 4UFOA 4R5MA 1ZCJA 1L7OA 1PJRA 2BEWA 2VDKB 3JWIA 4ONEA 2BDEA 1D1QA 2RCYA 1S3SA 2VHEA 4LHXA 4OF4A 5ARCA 3JY6A 2Q9UA 4CPDA 5LNK6 3LUJA 4PE5B 1LLCA 4NULA 3VO8A 4V03A 1H2WA 4JBNA 1QH0A 4L0CA 2J30A 4QYXA 4YROA 2JAWA 5T4EA 3VR6H 4CF4A 4S05A 4DV1B 1X9GA 2MU1A 2V6IA 3H8VA 3EH2A 1UMCB 2ZITA 4S0XA 5MN5A 2OG2A 4NYJQ 2FK8A 4INPA 4KVFA 4DDHA 2EU8A 5CDUA 3MJFA 4FNOA 2E55A 4IH1A 3EQ7A 4JCOA 1YRLA 2F3PA 1OWLA 4IDHA 1XCGB 4PIPA 4EK9A 5IWCA 4TKZA 3NTXA 4LNAA 5KNBD 5IRCD 2O1SA 4URVR 1KNQA 2P7HA 5BYBA 2CKMA 2WYVA 4TTVA 3QNMA 1GDDA 3LQYA 2QKYA 4R6XA 5E1DA 3KBOA 3IIJA 4YDHB 2E85A 4HUJA 4F5WA 4PN7A 4EBBA 2VDMB 4FFLA 3WAKA 3TNJA 5KBYA 1CUDA 1P77A 2ST1A 3N6RA 4KAJA 3C1UA 4A9AA 3K1TA 3RJ9A 4WOJA 4PNEA 1EFVB 3UT6A 1B6SA 2JVJA 1K68A 1QRDA 1QK5A 3NCTA 5CFQA 4FGLA 3KIPA 1QHNA 2EF1A 4QGHA 1YS1X 1B3RA 3GN1A 2F3SA 2G88A 5TJHA 1QIJA 4O3FA 4YR9A 5HDQA 2J41A 2M9MA 4PAWA 1RKBA 4ARCA 3QXXA 4WBNB 1JHXA 3L07A 2QYOA 3QVXA 5NLLA 3BTOA 1U3FA 2I1WA 4AG3A 4RY8A 4II3A 1Z7GA 2GGSA 2IYUA 4Q48A 2LCIA 5HF6A 3H5NA 1ZU4A 4W8OA 4B32A 1VHDA 5BURA 3A1FA 4FDTA 2HD4A 1Z5WA 4RIGA 1ZBQA 2KX7A 9ATCA 4O08A 1U63A 3TLMA 1S1CA 1ZI9A 2PUJA 5CK4A 2QRUA 1ZKMA 2CVPA 3CZCA 3IGFA 1NX9A 2YHAA 3VOSA 4DMRA 4ZI3A 1PRYA 4X1OA 5CDTA 1V2HE 3C16C 2WUFA 1RE1A 4UFPA 4ZJZA 3LGXA 2VYND 3KKQA 2ZBUA 5DNWA 2PWYA 4J1SA 1OFUX 3EGWA 4ZDWA 2Z1DA 5DGIA 2VRBA 3BRSA 4FCWA 4CFSA 1OBCA 3OM8A 4YUZA 3OHSX 3K0FB 4IQ8A 2EX0A 1CFJA 3QG5A 3FOWA 3ZE9A 4E6PA 1YOBA 1ISFA 2ZEJA 3IC5A 3N39C 3QLUA 5TVGA 3R0XA 4OSEA 3UATA 3T3OA 5C5CA 3L77A 1UPXA 5F5XA 4MS1B 3SI7A 1CP3A 3OY2A 4QPPA 1PQYA 1JHVA 5JEEA 2WVAA 1FC0A 1L7DA 3G8CA 3LHIA 2JIOA 4JKOA 5BMVF 5EE9A 4KPEC 2X3FA 4DUYB 3ZV7A 3FPLA 4LMRA 2GBLC 4WESA 4B44A 2OHIA 3GD5A 1U0OC 2ZYVX 1E96A 3A6GA 5D7BA 3ANNA 2AFIE 2OKGA 1WULS 5A1TA 3PKZA 2KHZA 3T3EA 4M99A 1IIBA 1RP7A 3DO5A 4I8IA 3JQRA 1EG2A 3ENZA 5AM4A 4KU4A 4AQDA 4TZ6A 1Q3KA 2FPWA 2VWQA 3N6XA 3RSLA 3O74A 3T38A 3HA5A 3ITKA 2QY9A 2W8BA 5JSZB 1O08A 3PQ6A 3KBBA 1GITA 5DHAA 5F76A 3CG0A 5DEIA 2I80A 2JCYA 3WDSA 1JR4A 2D5BA 4TN5A 2LWIA 4QVGA 1XP8A 2BE9A 4PPQA 1S2DA 2BCJQ 3DZBA 4LXYA 3G7UA 2IEBA 4RJKA 1SCKA 1AN9A 1MU0A 1VE9A 2QOEA 3E3MA 4Q4LA 4WT7A 1ZIOA 3ZDZB 3FHLA 2V0NA 1ODIA 2XMGA 2JA2A 4XPIB 4M86A 4WXYB 4HFMA 2O8DB 2GFHA 2HRQA 4QPDA 4FFNA 2CDBA 3A11A 4HNQA 1BWSA 1TTQB 4Y2XA 5ERGB 4I46A 3BMNB 4S1WA 4MRNA 3LUGA 1JEYB 1DRKA 1IBRA 4JP5A 1CUIA 1QZZA 5BR1A 2OHHA 3GIWA 3C98A 3CH4B 5FCDA 1AGRA 2ZAGA 3H9EO 2P2NA 3ZD9A 2ASEA 2GWHA 1GR0A 3PF9A 4BMSA 1KZ7B 1NXOA 1UBFA 1UOEA 5A7FA 5DXAA 4KX3A 1QPGA 3OPXA 2WT9A 4P83A 4PNPA 2QTTA 3I9KA 1FU7A 1ZGZA 1UMBB 2FWMX 2IIQA 3KD3A 2Z8YM 1BXKA 1ILWA 1C3EA 1Z0UA 3QOWA 4MRAA 5K0FA 1E61A 4K3UA 1PVOA 3KS9A 1II0A 1JDBC 1DMRA 3E9ZA 2BAGA 3TDNA 3VYRB 3O1LA 3KYJB 4GPTA 4IDGA 4DUGD 1ZVKA 5KQLA 4X6YA 2ZETA 4BUZA 5JH7B 1DAOA 1R9NA 2PMCA 4UREA 1HFJA 2HH9A 3RK1A 3AUJB 4RSMA 2BTOA 1C8VB 5HKKD 1IXSB 2QN6A 2ZANA 2QTZA 3L8DA 5HA5A 3TUZC 4LZPA 2C5FA 3T5PA 3A6PC 4G81A 5SYAA 1P9NA 3DOIA 3VAAA 1AD2A 1KFEB 1LJUA 2OV8A 5HKAA 1JKFA 2IZ7A 5EHNA 1JYSA 2W2OA 1VBMA 3TZCA 1YQTA 2VAVA 4FFVA 4AB1A 1E9RA 5DIFA 3TECE 2BEJA 2BFCB 2CHGA 3C4QA 4OTZA 4JLNA 4ZQBA 4FOLA 2J5QA 5AI5A 4B73A 3CW2A 4YRDA 4CKXA 2ZAIA 2O2IA 1TCAA 4FP9A 1AA6A 2G4VA 1YB5A 3VFDA 1AOXA 1NOJA 1UODA 3OQIA 4EF5A 1Y9AA 2G9QA 2IS6A 1QS0A 1Z68A 3FMIA 3RFVA 4C88A 4RPIA 3R6WA 1EP9A 1SKMA 4BWGA 4EG7A 1OV4A 2IZ0A 2NZVG 1NM5C 4C4PA 2C5BA 4ZOLA 1YULA 2P2GA 3QVUA 2VPWA 4RNCA 1R1DA 1E1CA 3AX6A 2XA9A 4KIGA 3RWMB 5E1MA 4BNTA 5C46F 4RZ3A 4WD3A 2OCBA 2X0EA 3U7QB 2R3SA 1VJDA 1J25A 1QRRA 3EJ6A 4PLHA 6AT1A 3ESYA 4DLZA 3TRJA 3KEFA 4ZCQA 1P4SA 1G2IA 1JMKC 5H70A 1V4NA 1GTG1 1QO9A 4LMPA 2EJCA 3ZWPA 5B1DA 2HU5A 3LY5A 2YY7A 2FKAA 5TY0A 2CSXA 3JTMA 3VC3A 5FLKA 1S2IA 3ACBA 4IICA 4CWAA 2C5SA 3O8NA 3IESA 4AYXA 2RGUA 1SELA 5AW3A 1VJRA 3UAVA 3ZWQA 2G5PA 1J4AA 2V0GA 4MW7A 1HWYA 1I3MA 3CLUD 5K3FB 3EVBA 4C0WA 1CJSA 1ETUA 1NXXA 4V0RA 3PE6A 2Q9BA 3E7DA 4N18A 2CUZA 1BS1A 2AN1A 3H5AA 3IBSA 4QQ8A 2AW3A 2QMZA 3KE9A 5HQJA 4BN0A 2OBYA 1B74A 3I8SA 1VOTA 2CXQA 2QUIA 4Q6WA 3M6LA 4KE8A 1DC4A 1S8NA 1JDBB 3FHJA 3HLKA 3MXTA 4CVNA 3R5HA 3NC4A 4NENA 3PNYA 3MIZA 2QN2A 3GJ5A 2RGBA 2VXOA 1BFUA 2GJ4A 3A27A 3Q8WA 3TVTA 1G8PA 1AZTA 1CZNA 1L5MA 2R8RA 4NV3A 3HL4A 1TGVA 2WM9B 3F6EX 3IJPA 4MAAA 3SM3A 4CDMA 1BO6A 4AS2A 4CIXA 1C7JA 1P3JA 2X22A 4GNRA 5DISB 1RW4A 2A9OA 4EYOA 3B82A 2R25B 3KM0A 4KRXA 5CAEA 2X1HA 4AJ1A 2I71A 3K92A 1SBYA 2I67A 1BKSB 4IUCS 3SJZA 5JNLA 4M6WA 3TCKA 3CZAA 2II6A 4AKHA 3T4EA 1FMLA 3LHSA 2XJ4A 3TW4A 4B3IA 2HWXA 4L27A 3QGMA 3ZBQA 1T0UA 3HB9A 1SC3A 3BSYA 4G1BA 2P30A 3EHEA 1P5FA 3RODA 3NYIA 3SHQA 4ATNA 4F8YA 1Y1TA 3GAMA 3M6IA 4C7MA 2DHDA 4B6PA 1EB8A 1NYLA 2VKQA 4MUAA 1WVMA 1IC6A 1I0ZA 2GM9A 3P45A 1E79A 1Z16A 3L6DA 4JHXA 2G7ZA 3PFIA 4Z3KA 3EGIA 2X1MA 5KTYA 3MINA 2VDWA 2A5FA 2VNIA 5K03A 3WLPA 2EEZA 3PU6A 1USIA 1YA8A 2FB9A 2JI7A 3LXUX 4BTEA 3X1MA 3S27A 1AXGA 4LNUA 4S2EA 1YB2A 2QP9X 1XEXB 1REQB 4HZIA 4XTCS 4GXQA 1G6HA 2PH5A 4RCZA 3E9MA 2PK3A 4NV0A 3WMXA 4BC1A 1NZDA 3AZOA 3EOAI 2UUPA 4I50F 4OHPA 4P82A 5PGMA 1JQAA 1THGA 3H2IA 1UXOA 4PLYA 4WOBA 3GLKA 5TF0A 3F5FA 2IYAA 3HKDB 4LBWA 3VZDA 4OFZA 1F12A 2XYPA 4HL6A 3T3HA 2ZSIA 3GJZA 4N0MA 1OGYA 3B1KA 3BX1A 4YJFA 5FYQA 3LUAA 1VCNA 2X5JO 4RD3A 4KGVA 5KYKA 4U4AA 5CXSA 1I6MA 3KB1A 5H68A 4QBTA 1BA3A 1IPFA 2AD1A 1NR5A 1Q77A 4JL6A 5C8DA 4LGYA 1TT5B 2QLJA 4FD2A 5DYGA 1MFPA 3RV4A 5LXTB 1MABA 1V47A 1TI7A 4HLNA 3K71B 2B37A 3G5MA 3D2CA 4WZBB 3ZE8A 3FB1A 2IIBA 1ECGA 4JBWA 4NI5A 1RYZA 2NO9A 4GDFA 2QWXA 4UZFA 3V9PA 3S2GA 5LQKA 3BGOS 3MS7A 4P81A 1IN4A 1M0TA 4LC1A 3JRXA 4NZZA 5LCXA 1RC8A 5HS4A 5E2IA 1DTWA 1V8FA 3CCFA 3FTNA 2I4OA 2A1UA 4LDNA 1TKBA 3RRXA 2D7DA 4FE7A 3WTCA 4TTQA 1V6SA 2WYHA 3GA5A 1MJFA 4XWKA 1K2WA 3HKEB 4RMJA 3WHPA 5TQ2A 5LQDA 1YZNA 2C7PA 3BVPA 5G0WA 1GU1A 1UKEA 3FWYA 2IW1A 3B1JA 2P1RA 3OF3A 3PNPA 3PE4A 3V1LA 1E3LA 1XF1A 1VE5A 1VG1A 2JGNA 2R1UA 2FZEA 4DM7A 4OHZA 1MA3A 3NJ4A 5AIAA 1OAOA 2CMFA 3U7HB 2XGOA 4RHUA 5DX0A 3LQQA 4LXTA 4UBLA 3A32A 3KDAA 4PHGA 1Q74A 2MSNA 1P2DA 1XD8A 2PU5A 3ZK9A 4KTVE 2ZB8A 2BF7A 1Q1AA 4M0MA 2G36A 2XECA 2YXDA 1JBKA 4J49A 3T1QA 1HA3A 3ZZTA 2JCXA 3ISVA 1WXDA 5F35A 1QR6A 4KR3A 1K3TA 2CCKA 1DAFA 4A0QA 3HDYA 5F4BA 3GEPA 5BWLA 1TVMA 4MLZA 4DGQA 5K2OA 3V8PA 4DDWA 1NT2A 2IXFA 3P4YA 1X92A 2H4WA 5G4LA 4LF9B 3ILVA 4B4WA 4ZVRA 1AKMA 3S29A 1RRMA 1YVUA 4G0WA 1B14A 4FMBB 3L0YA 1C1YA 1NV8A 5M5BA 4GI7A 2OSBA 4AT1A 4D0RA 3U6BA 1FXSA 3LT0A 1IDN1 4OL9A 1SBIA 3ROGA 1PIWA 2ATEA 5I4CA 2C9BA 1ODSA 2CXTA 3FWPA 4IDNA 5JZMA 1JB1A 3AESA 4B6JA 4B5LA 3B3QA 2AWNA 4TT3A 5BSTA 2FUCA 3GPDG 3C3CA 5LQMA 3MERA 4L22A 3TLZA 5AVUA 4TRRA 3WVNA 2QIOA 4CRWB 3CS3A 4H4EA 2G4LA 1Z4LA 3LUBA 2RGWA 4D74A 4FYXA 3WK5A 3DBIA 2WV9A 1SCIA 1L4LA 1J5PA 1R0ZA 5C7YA 1ZM2A 4HQ6A 4CF7A 2JKZA 4NBSA 3OM0A 1QVZA 1YBVA 3HCRA 2G1UA 1DOAA 2CY0A 2PRJA 4WKBA 1ISSA 2IU4A 2OO5C 2X9GA 2GZSA 5JNWA 3PQ4A 4UM5A 4M9XA 5FQOA 2HPHA 4AX4A 3BRCA 1KH3A 1OI7A 2FDCA 1L8OA 4JKYA 2B82A 1XTTA 3RAEC 1ACLA 1EKXA 3MQ2A 4QT4A 3JPYA 1OVGA 1QLJA 2F48A 2PH7A 4IFEA 5COQA 3OECA 2CNDA 1RHKA 3OQNA 2Z5LA 3X2SA 5ULLA 1HDOA 2YXLA 3DZIA 5KC9A 3FOEC 2QT9A 2O2DA 2QRJA 3DL7A 1Q1BA 1YZVA 2FFRA 3IAAA 4DCJA 1PW5A 1KAQA 3O5AA 3AEZA 2OILA 3F7MA