3HNRA

Crystal structure of a probable methyltransferase bt9727_4108 from bacillus thuringiensis subsp. northeast structural genomics consortium target id bur219
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
193
structure length
193
Chain Sequence
DIQYKEVFAHYEDILEDVVNKSFGNVLEFGVGTGNLTNKLLLAGRTVYGIEPSREMRMIAKEKLPKEFSITEGDFLSFEVPTSIDTIVSTYAFHHLTDDEKNVAIAKYSQLLNKGGKIVFADTIFADQDAYDKTVEAAKQRGFHQLANDLQTEYYTRIPVMQTIFENNGFHVTFTRLNHFVWVMEATKQLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable methyltransferase BT9727_4108
publication title Crystal Structure of a probable methyltransferase BT9727_4108 from Bacillus thuringiensis subsp. Northeast Structural Genomics Consortium target id BuR219
rcsb
source organism Bacillus thuringiensis serovar konkukian
molecule tags Transferase
total genus 68
structure length 193
sequence length 193
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hnrA00
4QDJA 3TR6A 5EQJB 2OPBA 2IP2A 4GOLD 3T7RA 1NE2A 2GS9A 4PYMA 2P3LA 4C08A 3AJDA 3OU6A 2H00A 3GO4A 1NKVA 3DXYA 5DM1A 3HA5A 3HP7A 1FP2A 1KHHA 3DULA 4QDKA 1DUSA 1RJEA 2B9EA 3R3HA 4RWZA 4C04A 4CXMA 3ER9A 3HCEA 5CVDA 2ONYA 3DR5A 3FPEA 2B3TA 5K09A 4GUAA 2UYQA 4P7GA 1G6Q1 1EJ6A 3LX6A 4PYQA 3X0DA 9MHTA 1N7JA 2Q41A 4GOND 4GQBA 3TKAA 2OO3A 4RTRA 3FUUA 2JHCA 4V0RA 1Z3CA 3UJ7A 3UZUA 4C05A 1XDZA 2PSSA 1G8SA 3K0BA 4RTQA 2PKWA 2EX4A 3I5UA 4DF3A 2BR3A 1H1DA 2FCAA 3LCCA 3PTAA 3AXSA 2PXAA 3HCDA 3LECA 2PY6A 4WVLA 3P2EA 3QOXA 5ICCA 2ZZNA 3TPZA 3LBFA 3SVZA 2N47A 4HGZA 1WXXA 2AVNA 4OQDA 1O54A 4P58A 1JTEA 1ZKDA 5BP7A 3KQWA 2EJUA 1X1AA 5C0OE 2O06A 1R74A 2AN5A 1JSXA 5LR6A 2Z6QA 2ZCJA 3BGVA 4AX8A 5T64A 4BLUA 4PGHA 1SVUA 3C3PA 3G2QA 3MHTA 3JWJA 3O4FA 1M0EA 3UA3A 4YMHA 1L3CA 3CJQA 1IY9A 3LHDA 1P1CA 5DPMA 1N2XA 2QRVA 4EVIA 2VS1A 2PWPA 1P1BA 3I53A 4BLVA 4G56A 3K6RA 3P97A 3R0QA 5E2AA 3UFBA 3CKKA 3CVOA 3M6WA 5EIFA 4CKCA 4PIMA 4RVDA 2VDWA 4CKBA 3MQ2A 3MCZA 4CWAA 4WXHA 3OPNA 3L8DA 3FYDA 3FZGA 3REOA 3GXOA 2JH9A 1YFJA 2AOWA 3ORHA 2XYQA 5JR3A 3VSEA 1EIZA 1XXLA 2C7RA 2YR0A 2H11A 2P41A 4HTFB 4L7VA 5KQRA 3MERA 2Y1WA 3OZTA 1KPIA 2WK1A 1FJXA 2OYRA 3LL7A 4AZSA 3M6UA 3GRZA 1SQGA 2HMYB 5LQRA 1VIDA 2AOTA 2LD4A 3FUWA 4M7RA 1HNNA 3TRKA 5ICGA 2IH5A 4R8RA 2CL5A 3KPVA 4YUYA 2OKCA 2VDUE 3ELDA 1NW6A 4MWZA 4AUKA 3C6MA 3I9FA 1KR5A 1FP1D 4ER3A 3ELUA 3OZRA 5K03A 1G55A 3THSA 1JQEA 1X19A 4KVZA 4YV2A 2B78A 2YXDA 3KQTA 4U7PB 4LWOA 3BWYA 2IDKA 3P9IA 3NJRA 3P9NA 4RVFA 4LWPA 2O0LA 2ZWAA 1M6YA 2I9KA 3KQYA 2QM3A 5EKXA 1FBNA 2GA9A 2GH1A 3G8BA 3HVKA 4HC4A 4M38A 5DM0A 3M6XA 4A6EA 4QPNA 5E2BA 3HVIA 2ZBPA 1AQJA 1ZG3A 1VPTA 1ZGJA 4F85A 2P8JA 3DMFA 4HG2A 4UOEA 3I58A 2AZTA 5CD1A 2ZIGA 5CUQA 3CJRA 1NW5A 5FWDA 1ORHA 4HH4A 5HFJA 2BZGA 3HTXA 2GLUA 5GIPE 5K8VA 5HZMA 1XVAA 3DMHA 3KQMA 1NW3A 4CTKA 5BW5A 5EZSA 3UBTA 3C6KA 1L1EA 4LECA 3NDIA 4DA4A 1RI1A 3UJDA 8MHTA 4GC5A 3IEIA 3OE4A 1BOOA 5JUWA 3EEOA 2O07A 2ZIEA 3E23A 3DOUA 3IYLW 4E32A 1I9GA 2BM8A 5DX8A 1NW7A 3KQPA 1O9GA 3BT7A 1V39A 2PX5A 3PT9A 4QTTB 2YXEA 5DTMA 2JH8A 4P7KA 5EKUA 3UA4A 1BHJA 4ER7A 4C4AA 10MHA 4DZRA 5EPEA 1SUSA 5LQJA 1Q0TA 1WZNA 1F3LA 2XYVA 3BGIA 4PINA 5E9WA 4CTJA 5E9JA 4DCGA 1WG8A 3KU1A 2ZFUA 4IV8A 4RSRA 3AXTA 3SSOA 4R6WA 1HMYA 2ESRA 4QVKA 5E9QA 5EG5A 5EMMA 3C0KA 4GF5A 4GOOD 3Q87B 2HNKA 1L3BA 3HCFA 3VC2A 4U7TB 4ER5A 2P7IA 4A6DA 3OCJA 1R6AA 2F8LA 4ZTBA 5EMKA 1RI2A 3UWPA 2Z6AA 3MB5A 4RTMA 2R3SA 2NP6A 3AY0A 3G8AA 4YV1A 3EVZA 3PS9A 5DX0A 3EVFA 4R8SA 2AVDA 4X61A 2O05A 3GIWA 4BP3A 3LDFA 3UJCA 5CVEA 3GU3A 4AZVA 2PX4A 1KXZA 1D2HA 4RV9A 4YUVA 1R18A 4YMGA 1L3IA 5LQAA 2G1PA 3BWBA 3DLIA 2NYUA 1KYWA 4Y30A 4DCMA 4PNEA 1ORIA 5DT2A 2VDVE 4FGZA 4RVHA 3SSMA 3MAGA 2B2CA 3IHTA 1NV8A 2V74B 3KKZA 5KVAA 3ID6C 5CVVA 5EHGA 5MHTA 3ANXA 4FT2A 3LPMA 5E1MA 4ER6A 1NBHA 5LQUA 3DH0A 1O9HA 3HCBA 2HWKA 1PRYA 1Q0SA 2NXJA 2PVCA 2YQZA 5HIIA 3WSTA 2KW5A 3M70A 5FWAA 3UJ6A 2FYTA 4X60A 4RTPA 5DLYA 5HIKA 3OFKA 4GBED 5F2KA 3NTVA 4RTJA 5FADA 4GEKA 1AV6A 3O31A 2QRVB 4IWNA 2ZWVA 1T43A 2NXEA 4QVGA 2PT6A 1WY7A 4OBWA 3T7SA 1I1NA 3FPJA 3E7PA 3M6VA 5EMLA 3MCTA 5E1DA 3R6TA 4HGYA 5DXAA 5C9ZA 4FZVA 1XJ5A 4QQNA 4Z2YA 1VP3A 2IH4A 3OU2A 2PLWA 2ZSUA 4JXJA 3MGGA 3GJYA 4OA8A 3NVKI 7MHTA 5P8WA 3SMQA 2OXTA 4RX1A 5E1BA 3ER8A 3G5TA 4HSGA 4RTOA 4QPPA 4PYOA 2ADMA 4GOMD 5ERGB 2R6ZA 4V0QA 4BP1A 5E8RA 2AS0A 4X63A 3FTDA 3BGDA 5T6BA 4XUDA 5LSAA 1NW8A 1G60A 3A27A 2I7CA 4RVGA 1BKYA 3EEYA 2AOTB 3GRYA 3HVHA 2YX1A 3KQOA 1VL5A 1VQ1A 1WXWA 3EMBA 3P8ZA 2UYOA 2ZW9A 5EVJA 3BUSA 4M37A 4RTKA 3FTEA 5H02A 3TOSA 1R00A 1R8YA 3FPFA 4PYJA 3KR9A 1DCTA 3A26A 3DLCA 3FRIA 4E2XA 1D2GA 1YZHA 1JQ3A 3IV6A 5GM2A 3FPGA 3P2IA 3QOWA 2K4MA 3PFGA 5K0NA 5M5BA 2QYOA 4LG1A 5EZQA 2OB2A 4DMGA 2P1DA 3P2KA 3LCUA 3T7TA 4RTNA 2FPOA 3RW9A 3G88A 3LKZA 3SGLA 1SQFA 3LSTA 3T0IA 4CKEA 2O57A 1VBFA 1JG2A 1UFKA 4P7FA 2B25A 2UYCA 4PWYA 5CCXA 2JJQA 3PX3A 3SSNA 3DXXA 3TM4A 2IH2A 2UZ4A 4E70A 3LDUA 3C3YA 3PX2A 2EFJA 2PX8A 5HIMA 5EC8A 2WA1A 4IKPA 2CKDA 1YF3A 4MTLA 2XVMA 3GWZA 3KR2A 3M33A 4KIGA 3TQSA 4OX9Y 4RYLA 3GGDA 3E05A 3SX0A 4PONA 3HNRA 2ZLBA 1VP9A 2IBTA 1M6EX 2ZBQA 5GWXA 3CGGA 3U81A 4MQ4A 3KQVA 4PCAA 5GINE 3B3GA 3NW9A 1NBIA 2AN4A 2JG3A 3PFHA 2ZZKA 4KDRA 3UJAA 2PT9A 2IPXA 2C7PA 1U2ZA 4XUEA 2G71A 1KPGA 3FTCA 1SG9A 4EQZA 3R9XB 1MJFA 2E5WA 3JWHA 3V97A 4EMSA 4DKJA 2IBSA 3CJTA 3LDGA 4E33A 5K0JA 1YFLA 2AR0A 2Z6UA 1RI3A 1Y8CA 4OBXA 4F86A 2OY0A 4QQKA 5K0FA 4M36A 1NV9A 2FK7A 4RTLA 2P7HA 5EGSA 3FRHA 3KPWA 3RIEA 2ZIFA 3AWIA 3EVEA 3KQQA 2I62A 5DX1A 3MTIA 2NXCA 4RTSA 2PWYA 3GNLA 2AOUA 3B3JA 2NNWB 3BWMA 5LQCA 2P3QA 3S68A 4E2WA 5DSTA 3DXZA 3NDJA 3GCZA 1JSZA 3A25A 3GRRA 5EHIA 3TMAA 5FULA 5BXYA 5KYGA 5FA5A 2BR5A 2ORED 2OZVA 3CBGA 3H2BA 4X1OA 5K0EA 1EG2A 2G8NA 2PGXA 2ZBRA 3NVMB 5D1HA 2QY6A 3DMGA 5FQNA 2HR1A 3ME5A 4ER0A 3V8VA 3JWIA 1YZ3A 5D1NA 5K01A 4EKIA 5F2NA 4FP9A 4KRGA 1TPYA 3G2MA 3TFWA 3UJ8A 2FHPA 5E8JA 4GC9A 3SXJA 5EIWA 4AZWA 3KPJA 3KHKA 3LGAA 3G2OA 1KIAA 2DPMA 1EQAA 5IH3A 2PBFA 3HEMA 2QE6A 1G38A 3M4XA 4F84A 3VC1A 5BW4A 4EK9A 3ERCA 4PIPA 1XCJA 1B42A 5KS2A 1L9KA 1JTFA 4PYKA 4HRAA 2IFTA 5EEGA 3FUTA 5K0LA 4OA5A 1N7IA 1RI5A 2C7QA 3UJBA 3R24A 2GPYA 4P7JA 1ZHFA 3EVBA 2XVAA 3DTNA 4R05A 1RJDA 5FHQA 2HTEA 1XTPA 2G72A 1RJGA 5GOZA 4YV0A 1INLA 1IM8A 1OR8A 1ZGAA 1JQDA 2FRXA 3EVAA 3HM2A 3G7UA 3NWEA 4X41A 2AN3A 4KDCA 2GAFA 5ICEA 5GP1A 3MTEA 4XCXA 3GDHA 1AF7A 2IIPA 4PYLA 4AZTA 3PB3A 4KIFA 2PXCA 1PJZA 2CMHA 5K0BA 1KYZA 1F38A 1DL5A 3P9KA 2YUIA 5FUBA 2YXLA 3BXOA 5U4XA 4B17A 5FCDA 5GIOE 1JG4A 2JHAA 5EMJA 5GM1A 3EVGA 5DM2A 3RODA 3A7EA 3B7PA 3G2PA 4E2YA 3G5LA 5FTWA 1WS6A 1SKMA 3DUWA 5FHRA 4FSDA 5DTRA 2DULA 3EVCA 3SM3A 5E1OA 1RI4A 2AOXA 2G70A 4QTUB 1FPQA 3VYWA 4ISCA 5DXJA 2YTZA 2OBFA 1YB2A 4POOA 1UIRA 1NT2A 3BKWA 1X1DA 1QZZA 3B89A 3FUXA 5EOVA 1BC5A 5DM4A 1SUIA 4OQEA 3KR0A 3THRA 3CC8A 3KR1A 4NECA 4YUWA 3B3FA 5FQOA 5F2OA 2Y1XA 2ZTHA 1MHTA 3BZBA 5T67A 2NP7A 3OZSA 2A14A 4Y2HA 4HTFA 5HOQA 1EAMA 2YVLA 3QV2A 3PLAE 4C03A 3HA3A 4E30A 3FTFA 1P91A 4IV0A 5DRYA 1TW2A 3A4TA 1JG3A 4MIKA 3OE5A 4DQ0A 3GRVA 3OFJA 5DSXA 2XBMA 5EEHA 2UYHA 3HCAA 3F4KA 3KPUA 3DP7A 3I64A 5CIYA 3EMDA 4ATNA 4FS8A 2PX2A 4KW7A 1EJ0A 5K0CA 5K0GA 4BY9E 2PV0A 1JR4A 1QAMA 2WA2A 3JWGA 3FUVA 3FYCA 2OB1A 2BR4A 3TLJA 3EGEA 1TW3A 1KP9A 3BKXA 3TM5A 5KQSA 5LQKA 1QAOA 1XDSA 5DWQA 2IDJA 3OU7A 4O29A 5DTQA 2I6GA 3ELWA 3P71T 1JG1A 2P3OA 3KQSA 3A7DA 3HVJA 5CVJA 4PYIA 1X1BA 3LBYA 3D2LA 5FA8A 1G8AA 1KPHA 5HIJA 1QANA 1VE3A 2BM9A 2ZVJA 2H1RA 2ONZA 1XDUA 2CMGA 4PGGA 5CM2Z 4YUZA 5B1SA 3BWCA 4YUXA 5LQNA 4C06A 5HILA 5IKMA 5DRTA 2EJTA 3EVDA 2FK8A 1UWVA 2HV9A 1YUBA 2VP3A 3ELYA 4FR0A 3SR4A 1RJFA 4BLWA 1P39A 2ZZMA 4KWCA 1QYRA 4H0NA 1XCLA 3NMUF 5K05A 5G02A 3TKYA 5CVUA 2ERCA 1I4WA 3O7WA 2EG5A 3UJ9A 3FPHA 3LCVB 2AOUB 2C7OA 2PJDA 2V7EA 4E31A 3PVCA 4DM3A 3B5IA 3GRUA 4PCLA 4PYNA 3P9CA 4MHTA 2P40A 3EGVA 1QAQA 5C1IA 4E2ZA 2P35A 3HCCA 3Q7EA 3EPPA 2NXNA 1X1CA 2PXXA 1IXKA 1ZQ9A 3NWBA 5CCBA 3CCFA 3KPYA 4XUCA 2CWWA 3EGIA 4C07A 4FT4A 4EKGA 1VLMA 3HA7A 5HEKA 3LKDA 2IGTA 3G89A 2VZ9A 2AOVA 4K6MA 4FSXA 3E8SA 5ICFA 1R8XA 2JHPA 2XYRA 2ZULA 1D2CA 2BH2A 1AQIA 2GB4A 4R6XA
chains in the Genus database with same CATH superfamily
4UM9D 5JSFA 5DSZA 1Y98A 3ESZA 4HDAA 3KSRA 4DN6A 2HDHA 1Q0HA 5F2EA 3CMMA 3TB4A 4MAMA 3IRVA 5BQPA 1L5NA 3VX3A 5ALOA 2RH8A 3C4VA 4V0SA 5K8LA 2WJGA 3T9CA 4G5YA 2C4HA 1P60A 4GUAA 3HSSA 4UNPA 2VQDA 4M0LA 4QU9A 4CCWA 2B0CA 5JZBA 1KMHB 5CNJA 1TRHA 3F96A 5AW2A 4IZOA 4L78A 1H2BA 3OEWA 4P0QB 1O95D 2BI7A 4DLPA 1LPAB 4TOIA 3SPXA 2EG9A 3M6LA 3JATB 1YHZA 2X14A 3TTUA 4DRXA 5EL0A 2ZDQA 3CZAA 4UNNA 1OREA 1ZGHA 1K6JA 2EVWX 4HGZA 1PG0A 4S3MA 4Q9DA 2FSHA 1TQDA 2R8ZA 4LJ8A 2XY4A 4AK9A 4YAGA 1DCFA 2PLAA 4GPTA 4XR9A 4LHXA 1ODTC 1SU6A 4YP6A 3N8GA 3ZQ6A 5KSWB 1KFEB 1A4XA 1QX3A 2JVJA 3JQBC 5G0SA 2P4SA 4MV3A 4D4JA 5ALPA 3QNMA 1KFKB 4XGRA 1QQ7A 2JEZA 3Q9SA 2VPWA 1NU6A 3GUZA 3WFJA 1RC8A 1NJ1A 3X1KA 4BLVA 3FKSD 4MHSA 2NPOA 3R0QA 1G291 3AEXA 4CMCA 4BZQA 3CQ9A 5I48A 4X20A 1ZWKA 3CN7A 1Z37A 3OF5A 2ONKA 4U4AA 3SF8A 1IZZA 1D4ZA 3GR6A 2J5QA 3H5NA 5SV2A 3L8DA 4CQNA 1M75A 2WUDA 4MWGA 3RIMA 1PR9A 1EXNA 1TUGA 2IU6A 2CUZA 4NBNA 4PC3A 3UOGA 2CUKA 3SJBA 5CLIA 1LKZA 1V47A 3OZTA 2VZ0A 4PPQA 4R31A 1LV7A 1U7TA 1XA3A 2B92A 3I92A 4G0XA 5F5XA 5LYYA 3RRZA 4ZT3A 4BFLA 1LFDB 5AK4A 4IJWA 2LD4A 3KZ1E 5E38A 4DUYB 1ZGBA 2IH5A 2WM2A 5FB3A 4B7AA 4N0EA 5KNDD 4AIIA 1KR5A 2QLJA 1ZFNA 2FRVA 1YK0A 2IU3A 2QR5A 2O2DA 4YV2A 1UEIA 1JJAA 3Q10A 4KXXA 2ZCJA 1T2VA 1WUTA 4LWOA 4C4SA 3I39X 3G7NA 4FMBB 1P1KA 3P9NA 4EHJA 3NANA 4J0JA 4JJFA 3PK0A 2YKGA 3ICQB 4GMFA 2UYGA 4IDDA 2IWRA 1BCSA 4P0TA 5BMVB 1DAGA 3ON5A 2XNDD 3KAQA 1P74A 1HM5A 2GH1A 1E9RA 2G80A 4I50B 5AR1A 4EG6A 1OFUA 4NCIA 4RDIA 4MR7A 1AX9A 1KVRA 3IEXA 2JS7A 4KWEA 2JDID 4FINA 621PA 1E3LA 1H3NA 3EAGA 2YBDA 4WUVA 2QRJA 1M1YA 1AC5A 1K5DA 3TD6A 5HFJA 2C8LA 3KD2A 2BFBA 2C78A 4QG7A 1XYVA 2HLNA 4UHBA 2O8EB 2FAXA 3QZUA 4GX5A 1QZ3A 3IMCA 1XA4A 4CM5A 2VT2A 4FE3A 4PPFA 1O6GA 1T8SA 4EGJA 2F1HA 1EJBA 5HX7A 4W5OA 5JNUA 4F5EA 2SBTA 3GFQA 4KRYA 1N9GA 3MF4A 4HDMA 4O5AA 5A6VA 1LW7A 2I6TA 4KUGA 3KBOA 1HL3A 1OC4A 4OI1A 4L4SA 4K28A 5EWJA 3ZD6A 3PE4A 3CU5A 3A9VA 4N40A 2G1JA 4Q18A 2V8BA 3FTQA 3O1IC 2NTEA 2R1ZA 4LJ9A 5KKNB 2C88A 1BZYA 5HK8A 3FGPA 3EG9A 2P62A 2V9PA 4IGKA 1RPJA 4IRXA 4L9RA 3CISA 4CN8A 3UGJA 4NV0A 3T1HB 4IH4A 1JVNA 4PSDA 3IUMA 1OLXA 1PZFA 4TYYA 4DBZA 1E1LA 2V45A 4GS5A 1NMXA 4P3NA 4TLDA 2F1JA 3DXFA 5EKTA 2AI1A 4KC0A 2BPOA 4DLZA 1Y9DA 4MYUA 4RAQA 2ATVA 2R60A 2D2FA 2PAAA 1U1CA 4U7HA 2AJTA 4R8SA 2XB6A 2AVDA 2RKWA 3DTYA 1XIVA 3EGWA 2GNPA 1Z2OX 2FFHA 2ZAMA 3DKRA 4GX0A 4IDHA 4XLLA 1XZBA 5E6SB 3VVCA 5L53A 3UK6A 1KAHA 5FOTA 4R0MA 5KREA 3K9CA 4LNUA 3QWFA 3M3DA 1KY2A 1U2DA 3WBFA 3D0OA 3ZLVA 5AJUA 4DARA 3QEMA 1CG6A 2PKRA 4O4HA 5EWLA 3ZX5A 1VJ0A 2ZTLA 4IWXA 4QUKA 1PDVA 1WRBA 3ESAA 4DCMA 1T3ZA 2CNWA 4TMZA 2AI3A 4MSUA 1IHDA 4X85A 2WUFA 4PBSA 3UW3A 1TZBA 4FB5A 1GTZA 2DFKB 3OHPA 1VL2A 1GL6A 2ADFA 2F4NA 4N8EA 3IBCA 5LQUA 3AB8A 3PUYA 1ARZA 3CFYA 2X86A 3U62A 2BP7A 2QTMA 4M9RA 5H83A 3TLYA 2D5LA 5LC1A 4E46A 3TQCA 1Y3AA 1AKNA 3UJ6A 4RTPA 3HC7A 5HIKA 3DAHA 5F23A 3DOIA 4JBHA 3OFKA 4ZC8A 2HRZA 2PH5A 2ZRLA 3OZDA 1BNCA 1VOTA 3OQ1A 2X9QA 4M1ZA 4QVGA 1U6JA 5LA6B 1PCXA 1HKHA 1Q7BA 4IL5A 1OC2A 5EMLA 1VKNA 3AP2A 1I6KA 3KJEA 1SWVA 4C7MA 5DXAA 4DIUA 1A50B 1K6EA 4FZVA 3P0IA 4G1VA 4J2HA 5UKDA 1NLUA 4G4SP 2Q2WA 5DHFA 4ND3A 2QB5A 1FRFS 1KDTA 3FWHA 1H93A 2VEDA 4TQ9A 4TUYF 5C51B 4RX1A 3T3DA 5KOJB 2ZIXA 2PT5A 4A2CA 1YDEA 3O2QB 4ZO9A 4PY2A 4ZGWA 1JKFA 4FDLA 4WINA 3ZE8A 2CEKA 1TM3E 2DPGA 3GUUA 4JLJA 2BEVB 4HLNA 2GFHA 1GCAA 2A67A 4RHTA 3KYDB 2EEPA 2J9ZB 1BKYA 1KDPA 3CUSA 4AXBA 1B7GO 1U8UA 2XLCA 1DXQA 1VQ1A 2YX1A 3P8ZA 3RYFB 2ZW9A 4J0HA 3BUSA 1PFKA 1H0KA 1R8YA 3S81A 2D5AA 1AZSC 3H4TA 5KX5F 2PZBA 2AG5A 3ICOA 3AJRA 5E0KB 1KI2A 4E5PA 1YZHA 2P0AA 1HC7A 5FF9A 2I7XA 3B6IA 1WCWA 3UMRA 1W8DA 2OMEA 4OP1A 2EARA 3K3PA 4KE8A 1A77A 3P2IA 2CYCA 2ZT7A 2BMDA 5FI1B 2OZLA 4Q3CA 4BNDA 4RDXA 1OH7A 5IPFA 1EX7A 2V0NA 4DMGA 1X8XA 4L76A 1M10A 3JARB 2P2DA 2BHTA 4FKZA 4ZCQA 3UK7A 2XCRB 3OT1B 4QECA 4EQ6A 1C29B 1OWOA 1ELOA 2NSDA 5EXEA 1V37A 1C1DB 1FSGA 2H0RA 2O57A 3SSAA 4D02A 3FIJA 4DWOA 1K9VF 1T2NA 4KGXA 2HF7A 3GQBA 3WNVA 4AJ4A 1UODA 4NHEA 4B75A 4UHHA 3CLRD 5IJAA 2V7QA 2CJFA 3KSMA 3PX3A 4K6OA 5ELMA 5E9AA 4BN5A 3TM4A 4G63A 3RSLA 3S4YA 2I4LA 2DCUA 1NJGA 1TPZA 3C3YA 4QIHA 2JASA 4F1WA 2O8BA 3ENVA 2CKDA 4TMTA 4J0FA 5K2MA 4AX4A 4F9GA 5HZHA 2H63A 3BERA 3X44A 1OTYA 5LZ9A 2C4TA 4L8VA 2HU7A 1PG5A 3HZZA 3H8WA 3U56A 2GEUA 1NE7A 3UW1A 1CSEE 5HDQA 4YJGB 5AVSA 1IPFA 2VH2A 1JDTA 4L5AA 4W8OA 4Z49A 2FRDC 2WAAA 4EY3A 2P2YA 1BS9A 4D26A 3WWCA 1NYQA 2WKWA 4WE3A 1T2AA 1XMVA 4XUEA 3TE6A 4BLQA 1JIUA 3GV0A 5H82A 3DD5A 4FE7A 1A98A 1N57A 3MXOA 2G9ZA 4OB6A 1L6IA 2CNOA 4KQWA 1Y8CA 2XB4A 4LZJA 3L8CA 2X8BA 2J59A 4OSEA 1ZNWA 4M36A 5G1PA 3KETA 1XMSA 3HUTA 1QXSA 3F97A 3KQQA 4FUQA 5DEIA 4CR8A 3HFJA 3JZAA 3V1TC 2CL7X 2PV7A 2PWYA 3R75A 1EUCB 2E2WA 3LC0A 3LZDA 2RGNC 2VDMB 2QJWA 3O4JA 3OX3A 4YDSA 3U5TA 4C7XA 3JQ7B 1Z4OA 3I01A 4N0MA 3LNTA 1RVV1 2J9FB 4AO6A 5JH7A 2J09A 1JG7A 2E49A 1XDDA 4B82A 1OVGA 4IG4A 4FNGA 2WJ6A 4F4DA 3LUHA 1RQNA 3AIKA 3KUKA 1D09A 5D7BA 3SX2A 4TRMA 4LYYA 2WP8J 1B93A 1DUIA 1H8HA 1YVEI 5DLPA 2JGNA 2FSGA 1TVKA 3WB0A 3QHQA 1FP4A 4RJJA 5I4KA 4QZVA 1H2XA 5IAKA 2P2LA 3FLAA 3KHKA 3B85A 3LUBA 2GM4A 1UFRA 4CTNA 1DE0A 1R4MA 3Q9UA 4ZDKA 3INNA 2Q7OE 2QPLA 5A7GA 4QYIB 2ODNA 1L9KA 1SU8A 1ZN8A 2G8LA 2DBVO 4LRWA 3RYHA 4Z7JA 2FPUA 2PSDA 2G08A 1MHPA 3M8KA 5DB4A 4MQ5A 1KZ4A 5KHAA 5J47A 3TXAA 4RCZA 1GL9B 1ADYA 1UADA 4OLHA 1JFRA 4U6NA 1DJMA 2OVBA 4MS4B 1RE1A 2HV8A 1SCAA 2BGGA 1DX6A 2FGKA 4JJ8A 1R0CA 4Q0MA 1AJEA 4O0LA 3W3AD 2RHBA 3VPHA 1Y1PA 2A6PA 4RJ2A 2JLCA 3AHGA 4ZKEA 2PUDA 4NCKA 1GR0A 2XDYA 3MMXA 2VATA 4FMCF 4OLFA 4YP1A 3NUZA 5GP1A 3SDSA 4F3TA 4AZTA 5LDGA 2KWIA 3A4LA 3BB4A 4WBNA 3HKDA 4NFHA 1GZ4A 4YT2A 4CMIB 4EEXA 5M04A 3TZEA 3ZZTA 4C6SA 5DYGA 2Z3ZA 4QGBA 2Q7DA 4OJMX 5JCJD 1PSWA 4FW9A 2YH2A 3QUTA 1MLDA 2O19A 2WYIA 2PCLA 1UFVA 2DOKA 2WVJA 3G5LA 1DAEA 4OO3A 2NU7B 3BN3A 1EBBA 3OG9A 3PRKE 5FUMA 3RKRA 5FJIA 2QENA 4D3FA 3VYWA 4KMMA 4CRWB 2O52A 1XROA 3QKIA 1ETUA 3I45A 1D5WA 1XHEA 4PZZA 3R8XA 1AK1A 2FUG6 3ZQUA 5AUOB 4BVHA 4IIEA 1EK0A 4AG3A 1LGYA 3LFHA 2CVPA 1U0FA 3MCAA 3C3KA 5J5AA 4JLPA 3KJGA 2YN2A 4BQRA 3EGDB 1T0BA 2HO5A 3G59A 3RJZA 4F6RB 1KRXA 1RYEA 3PLAE 3FTFA 5L7WA 2H1CA 4N01A 3K7EA 4CLOA 4CKEB 3D81A 5AK3A 1G19A 1NN0A 4JWKA 4LRQA 5K4AA 1J2JA 1EFRD 3E7DA 1NJSA 4BJ3A 1KR2A 1GN8A 2EXXA 2XNHA 4IGEA 1SCBA 1VPVA 3ONFA 4X45A 2A7XA 4EF6A 1EJ0A 4NULA 4ZVKA 4UEKA 1QAMA 2EQAA 3ACCA 5HUHA 2HB6A 3CVWA 5HHTA 4GR4A 5DI3A 3F1KA 4PNHA 2G1UA 2I2WA 4ZT7A 2OECA 2ZIUB 2YVKA 3BWXA 5JXIA 1E99A 3OU7A 1E2PA 4UVDA 3O5AA 4UDXX 4C6TA 2WQ7A 1SQ6A 2BI8A 4KYVA 4CM8B 1H6AA 1GTSA 2DWCA 3M3HA 3H8JA 3SYNA 2FTKE 5CPBA 3RAEC 5LQNA 1T8TA 4YUXA 3LC7O 4ETNA 1X9IA 2IYRA 3FCUB 2RFLA 2QVYX 1PIWA 3ES9A 4XCQA 4A0QA 3TYXA 1WEKA 2ZRGA 4KVGA 2HV9A 5BSHA 1MB9A 3COVA 3KSAC 4S1PA 2JBWA 3K70D 5I7EA 3ZPXA 4MUKA 2W83A 1Y8ZA 3F3SA 3IT3A 5DP1A 5CB4B 1ETHA 2IL1A 3RS4A 3V8BA 4B09A 2P2CA 1NDUA 4GZ5A 5F76A 3OUTA 1MGPA 3WLMA 4OKNA 5ISMA 1OA0A 4OYRA 4DUGA 4UTXA 3RG2A 1EGVB 3WZLA 2W6CX 2EWVA 1P1IA 1G8GA 2CNDA 1F8FA 3WQQA 2ZYIA 2Q21A 2UXCB 4X8LA 3EPPA 3NTXA 4UCWA 5H1YA 1R6DA 5KNBA 1TM2A 1ID1A 2IEDA 2BMWA 1KERA 3DE0X 4KPFC 3K4QA 1EBFA 2PCJA 4H4CA 4NFSA 2C04A 3SZUA 4BP8A 3D5EA 1HLDA 1VYTA 1Z12A 1RVDA 3GH3A 3L6EA 5J2TF 4KXNA 1NULA 2XYRA 2OCPA 4CIDA 1LK0A 1PFGA 2GB4A 4GSKA 5LOVF 2OPBA 1PT5A 2Y3IA 2KI5A 2QP3A 3FZQA 1FFWA 2IW3A 3LQQA 1KEVA 4MRNA 4RIEA 5DM1A 4LRTB 1YR6A 1FDVA 4QDKA 2R8XA 4CM7A 5AI0A 1SUFA 4EB8A 3E9ZA 2I5PO 3QNUA 1I14A 1P3DA 1X42A 4JEIA 4RPJA 4PYQA 3GAAA 1E62A 1HFEL 1KMNA 3OZGA 1FTQA 2PANA 5EJ8A 3U19A 1EK1A 1XD2B 2IA5A 4CODB 4EFDA 1T9HA 3FCXA 2NTNA 1NM5A 2HK8A 5CT8A 3KOXA 2EX4A 2DQYA 2G6TA 4IHKA 4V3CA 2FLKA 4JSTA 1GVHA 2QA5A 1M2KA 1U0HC 3PCTA 3PI6A 4W4TA 5E4YA 3IO3A 3D31A 2R66A 1LPBB 2JFGA 5A5FA 3LM8A 2JLVA 1UOEA 2LE0A 5IN5A 3BJEA 4DEYA 1WXXA 2V0GA 4HYTA 5J2TB 2YZNA 2D1FA 5GY7A 2XCUA 5K6TA 1E6WA 3H5VA 1SFRA 4NPCA 1FF9A 3JQEA 4WCFC 3D4PA 5L6LB 3MHTA 4XAQA 3ZE0B 1DCMA 3IR5A 4BXOB 2Q29A 1OZFA 2D4AA 4C2BA 1M54A 4P22A 4GI5A 4YCMA 1N1EA 3QYFA 2IYZA 2PWPA 3FDZB 1P1BA 3OM8A 4BL5A 4RTJA 4MUNA 2XRYA 1SOVA 4ZANA 3QPVA 3U6BA 2J6IA 5C52B 1FIUA 1YZTA 3PDWA 4HAYA 2Q4TA 3D1JA 2CJWA 2YWCA 1ZEJA 3MCZA 4AJOA 3AVYA 3NQ41 2AK2A 5IVKA 3EC7A 1RYNA 2WSIA 4MQEA 1BTOA 4WCVA 1C9EA 1FSPA 1I2ZA 2EERA 2BUCA 3LLMA 3MERA 3HR4A 3ZV4A 1BX0A 4B31A 1SQGA 4EJ6A 1HDOA 4IAOA 2C83A 2ADOA 5JS8A 1M5UA 3WO1A 3OQBA 1KO1A 4G25A 1AN0A 1SVNA 3SFZA 5IK2A 3GEEA 3Q88A 4ZQBA 4MUEA 1Z5GA 2YV4A 5CFPA 1S7GA 1N1GA 2QAGC 5CM9C 1JAHA 5AH0A 4KJZA 1FSZA 1KEZA 4B2YA 2XKKA 1UBHS 2O7SA 1V8ZA 3V9AA 1H2RS 3ENNA 1K75A 4C5AA 4LWPA 2PD6A 1A76A 4QUEA 5CBPA 3OC0A 2GPWA 2Z43A 2YFQA 1Y6QA 3HYNA 4JWTA 1H4VB 1SVWA 1LI5A 5IKMA 4ZHQB 4QQRA 2IT1A 1S0UA 3KHSA 3RT1A 4B7CA 4BLRA 3Q8LA 3M82A 3PXEA 3TR0A 4C7VA 4RLHA 2FEMA 1XQYA 2BKAA 2WZCA 3TTTA 2XUDA 3L4JA 5CJPA 1OXSC 5JSZA 5K99A 3BREA 1OASA 3EAFA 3QOYA 4IJ6A 1CNEA 1Z6GA 4DEVA 3ZCSA 2YOFA 1OKKA 3IVRA 3O4GA 4GPZA 4WFQA 1HYQA 2OGZA 3U7QA 3D6FA 2O5CA 3EA0A 4D0RA 3KQMA 3HDHA 4CTKA 1BDIA 5FTNA 2HWYA 1L4HA 2OLKA 1JFFA 3QU9A 1H65A 3C6KA 4ALKA 3IAM6 3OJLA 2JJ2A 4XQ0A 5A6SA 2H9IA 4P08A 3TQIA 2PUHA 4E15A 5L3QA 3RYCA 3D6AA 3QVJA 5GJVC 3DA8A 3E23A 5KPDA 1H5QA 2IOFA 4YT5A 3VA7A 4ND2A 4UU8A 3A31A 4WV3A 5CIWA 5H9VA 3R7DA 1M9NA 3C6XA 3DTVB 5K6AA 1V39A 2YXEA 4BECA 1KARA 1N2SA 3IJEB 1TTPB 4Y1GA 2F2TA 4LC1A 2EJCA 4H6PA 4N6NA 2R6AA 1QYWA 2CHQA 2VSXA 4NZ9A 1SIWA 3R0XA 4F5WA 1GKKA 1CJBA 1A1SA 2XZPA 2YINC 3IPYA 4IV8A 5CK4A 4R6WA 4KXQA 4QTXA 4R1PA 4UQPA 4DCOA 5BXQC 5KC8A 3AR5A 5E9QA 1K97A 3W7AA 3C0KA 2AJLI 2CBGA 2H48A 2HNKA 2PBRA 3QY0A 4JJ6A 3I23A 4KQJA 2ZJFA 4Q4AA 1LH0A 4ZTBA 3UWPA 2WYVA 3UYKA 4AAYA 1A4UA 1PU2A 1X8LA 4L57A 1D0SA 4RTMA 2R3SA 2NP6A 1B6TA 3RB8A 1QP0A 4MUMA 2H2FA 3G8AA 5JAMA 2R96A 5CVCA 4XB2A 3EVFA 1P4SA 2YWRA 3I9KA 1KDRA 3OFNA 4ZK6A 3GIWA 2BEUB 3UJCA 1E1NA 4B4OA 2FWJA 2A0XA 1DWPA 3KYCB 4G9EA 2N42A 1CZLA 1MUUA 3N2GB 3BWBA 5KWEA 3LQFA 5IZ4A 2JLWA 2PWBA 3DZFA 3UV3A 4PSAA 2VAPA 2G9VA 2WWIA 2VTBA 1I3MA 1WMBA 4HHEA 4I9GA 4RVOA 1MH1A 4ASUD 1OLSA 1V8BA 3PVZA 3PGMA 1PRYA 4UAGA 3PDIB 1YZUA 4F0JA 4JSYA 1NMZA 3SHFA 4O2AB 3UWDA 3AY6A 3GT3A 1JVBA 1GV1A 2RGRA 4FR5A 3TTVA 1Z6XA 3C5HA 1LDGA 1XXHB 4FFBB 1AV6A 1L4MA 2QRVB 4R41A 4KN8A 3WWZA 5KJCA 1D2EA 1TM4E 1WY7A 1NVKA 2DF8A 3TOZA 4DDHA 1UQRA 2XQFA 2OA0A 2XXJA 5KJFA 1X6VA 4DMLA 2UUOA 4XD7D 1G20E 3OY7A 2WU0A 2HA0A 3D7NA 4DV7B 1YRWA 3LVBA 2QVCA 5TARA 4ARAA 3TIIA 3AM1A 2AG1A 4Z9FA 3D4BA 4JB8A 3JR7A 4ITVA 3F5FA 4IVNA 4B34A 1Q1NA 5BSEA 2IYYA 5JDIC 3ER8A 4JCOA 2F6RA 1GAQA 4ZYTA 1BEZA 2BMJA 2AFIA 5ALFA 4DG9A 5JD5A 2H06A 2LXNA 2NZ2A 3NBAA 4G5RA 4HX5A 16PKA 4D98A 1Y1RA 1H6DA 2EFYA 1M6NA 3N2IA 3IBFA 1J25A 2B21A 3EARA 4EMBA 2NIPA 2OCGA 2R6JA 4M37A 1QS0A 4OGLA 2FN8A 1KTIA 5EE9A 2CMFA 1J0DA 2ODTX 3EZ2A 3RASA 4JI8B 4BVFA 1GZSA 3EUWA 2O4CA 2GHTA 3PUJA 3UICA 4BQPA 2HO4A 2HSWA 3FBWA 2VAWA 3ZE6A 1UOQA 1DTWB 1KAMA 2QLFA 2TMKA 3ITEA 3K2IA 3PQ8A 3RS7A 1I32A 2K4MA 3KV3O 5G4KA 2DFVA 3NYRA 4BVLA 4EWLA 2OZPA 2B5OA 4M0MA 4TVBA 2ZI7A 4CCAA 4OMFG 3VPCA 3PQ3A 4U2DA 1GRCA 2H18A 1PJBA 5B36A 5YASA 2ZS9A 1EWYA 1YQXA 3ZJUA 2QM7A 3CUVA 1V7ZA 1E6EA 3ANLA 2H29A 3LSTA 4GKBA 4C5CA 5B58C 3MM4A 1QE3A 2EWWA 2HUNA 4RWEA 2WWVD 2WY2D 3GGSA 5FLEX 3TCNA 2AF3C 4J91A 3OI7A 4UUOA 4Z6KA 5T4HA 1B76A 1Y8RA 1BG6A 2BKVA 3BJIC 5JXGA 5LKRA 4NJMA 4DIDA 1BDJA 1RT9A 4RGBA 3VR2D 4MGZR 4HMQA 2QTNA 4RPGA 1U6KA 3B1FA 3BSYA 3NHFA 3PUKA 3CBQA 3D6UA 4H35A 1GFSA 4ZIRB 4PR0A 2J3MA 5AVQA 4IKPA 1LVUA 3C4QA 4ZU1X 1XRQA 1Z6ZA 1WKBA 4WLNA 3O6VA 1KKLA 3R7SA 1L6RA 2RIPA 1N5JA 4BFWA 3ZH2A 3DCJA 4DA0A 2HF9A 1EDEA 5MFZA 1U0OC 4GMGA 1M6EX 5HVNA 4AY3A 4BNJA 1TMGE 3PXXA 3W06A 2DSTA 3K8ZA 4D4KA 1Y9JA 3H9UA 3OCVA 5C4GB 5FDFA 2IZOA 2R5NA 4N76A 2QPAA 4ARIA 4KDRA 4G8DA 2ANBA 5FNVA 1HE1C 1IQPA 2BEWB 1JIIA 4NJEB 4PHGA 5LU8A 5K0ZA 4OU4A 5H68A 4R5MA 1QWOA 2AFHA 1PAUA 2D3WA 2DFPA 3CCBA 3RU9A 1YZGA 2W4QA 4KACA 3KP1A 3OD1A 4G0NA 5K0JA 4BNUA 5K3SA 3KZKA 3NVAA 4ECEA 4RKRA 3WYGA 5EGSA 3WRYA 4LNAA 3KPWA 4C6RA 2FG6C 4HDKB 3KCQA 3O0TA 5I9IA 3G3EA 2GBLC 3NIGB 1FX0A 2ACEA 1JYSA 3A1DA 2PUJA 3HN7A 4NYMR 5BV0A 2A9KA 2CNKA 2IW1A 4NONA 3U7EB 4GM4A 5A0TA 4BDSA 5JNSA 4LYAA 4OKSA 4ONEA 3TMAA 2IHTA 4TXNA 3PA8A 2VA8A 3DMTA 4LUCA 3W5AA 4I99A 2P2GA 4QNRA 1TJ3A 1K2WA 2AD1A 1G3UA 4O8ZA 4WQMA 4L8YA 3H1BA 4WECA 5DJ5A 6Q21A 5JCOC 3DMGA 2NYVA 3IO5A 4QYWA 3PENA 1YQQA 2O3JA 4KRGA 3RVPA 1IB0A 2ECQA 1NMQA 2IDMA 2Z3VA 4DFDA 4L4UA 1BIFA 4CCYB 4TKLA 4F38A 2BM1A 3J7AC 4D5EA 2Q46A 4RXMA 1R16A 1RLOA 4GQIA 5CA0A 4OK5A 1EQAA 4R9SA 1Z0FA 1JEYA 1JA1A 1M2FA 3SYRA 4UE6A 1OXVA 3E22A 1I24A 2FN9A 2XQIA 4LY6A 3VC1A 4F84A 4KITB 3ERCA 4HAIA 2OP0A 4ZOQI 2HMSA 3ASYA 1D2MA 4TLCA 1R0XA 1E1KA 3WLKX 1ENYA 1ZM7A 2MYTA 1E5XA 1RI5A 1SA0A 2NZ8A 2WFAA 4OA5A 4OVKA 5TPWA 5CDTA 3WTCA 1JWBB 1FFEA 1HLFA 4QARA 2YYAA 3U9LA 4BVJA 3WA7A 4YV0A 4NR0A 1T2CA 1IM8A 1HDGO 1O58A 1GCOA 4AYXA 2QZSA 4ICIA 2M6RA 4MI1A 4PHHA 5GPBA 1KOGA 3QEKA 4HMPA 1V1JA 1UZAA 3FCYA 3D8RA 2WIJA 3DPIA 3ZWMA 4DLNA 4ZIRA 5EIBC 1UBKS 2WP0A 1PT7A 4Q1FA 2LZ0A 3LG2A 2PXCA 4WDQA 2ZSHA 4C01A 3O47A 4P86A 1R6VA 5K0BA 1DL5A 5GZ6A 1SUEA 2OGTA 2GD0A 3PHGA 3RNOA 3SWWA 4Q3OA 1G5HA 5GM1A 2JW5A 4DNOA 3O4VA 5EJ9A 4IRMA 1SM4A 1VCMA 2NVWA 3PIRA 4M49A 4EG5A 5IJ0A 4YAWA 1KK0A 5KCMA 5JSUA 2AOXA 3ZE1B 3NCHA 1FPQA 3EFEA 3K96A 4Y0NA 1X38A 3TNFA 4YQFA 2WWWA 4POOA 2IPAB 2VPZA 2YHIB 2X5XA 1NUUA 1GQRA 5ALKA 5A04A 5F4ZA 2F3RA 2R6CA 1N78A 4AJJA 3GLIA 3Q3HA 4B33A 5IM4F 1QK3A 3NHMA 4WW0A 3N7AA 4L4XA 4O2LA 2GF9A 3EJWA 3QEJA 3E5NA 3FSJX 1JLLA 1Y6FA 2B8EA 2RH9B 5K3DA 1F7VA 4MULA 3QV2A 1TKRA 3E5HA 4WLOA 9LDBA 1D7OA 1PHRA 3E3NA 1X7GA 1YK1A 3X1YA 4BS9A 1UJ5A 1IU9A 3SQDA 1CT9A 3HA2A 4J0KA 3BMCA 5FA6A 3TSYA 3W5UA 4EZIA 5IDXA 3UKJA 4Z0TA 5L8VA 2FW7A 2IYQA 2AV6A 5I7FA 3ROEA 1WU7A 2BSXA 1TLTA 1JJVA 2JKYA 1VC2A 2YV5A 1JILA 1P73A 5J63A 2C94A 2P5SA 2YZ7A 1GKUB 3NRBA 4HN9A 3RUEA 4ILEA 5IJ9B 2ZT8A 5AFSA 4R7TA 4AO8A 1BGWA 1OX5A 1PK7A 2BL4A 4DMCA 3QMVA 2ZBGA 4HNQA 1R27A 5IKEA 1PS0A 1AF4A 3K09C 4G4JA 2NPIA 1UZUA 1FP6A 1OSNA 4M99A 3RBAA 8GPBA 2AYZA 1ZL2A 4ZVNA 2JGLA 1T1EA 1T9KA 2BKXA 4IGFA 4IDPA 4PNPA 3A7DA 3K53A 5ALRA 4PYIA 3VNRA 4LF7B 2AJDA 3VPGA 3I1YA 1CUXA 5FOVA 2XBLA 1QANA 2YWGA 2JJ8A 4FFLA 1WEHA 3QLUC 5AVYA 4IIUA 2HCFA 1IHPA 4ZO4A 4QXMA 3RHTA 4TS4A 2K2WA 3W6ZA 3W4KA 3I0ZA 4ARUA 4UTNA 3DC2A 3DVAA 1T9AA 1TYCA 1E4EB 2UAGA 5LQSA 3SR4A 3I37X 1XEWY 4X91A 4B7ZA 1U2RA 1TF5A 1S89A 4OXIA 2FWAA 4EHLA 3WNQA 3GAMA 4R7GA 2QJOA 3TXXA 3CM0A 1TUEA 3RVQA 4YP9A 3ZHYA 2EG5A 1PFVA 2BOVA 1EFLA 3FPHA 1OI7A 2UZ0A 5CW1A 2W2KA 4YK7A 2C7OA 5FUVA 1QOZA 4K6FA 3NV9A 2BWJA 1HSOA 4BQOA 4UPEA 5ADVA 4MZXA 2V5UA 1PTJC 2QAJA 5LWQA 1QAQA 1P61B 3N3AC 1FU8A 2VYCA 4J1NA 1J7JA 6ABPA 5GV8A 5BQ3A 1XEXA 1U90A 1IXRC 1M34A 1PR5A 3FVRA 1IXKA 4P4SA 4TTVA 1W1UA 2DKOA 2BMFA 1U0JA 1CZKA 4ZJPA 4BQQA 2F7SA 2LKDA 4XUCA 4EFNA 4PCUA 4QXRA 2HMWA 3GWGA 4PHCA 5GTDA 1P4HA 3HA7A 4TL7A 5J2UB 5JXJA 3CXRA 2JD1A 3JQAA 3X1WA 3H5AA 3BEOA 2O1SA 1KK2A 2PWZA 5IDWA 4DOMA 3OX4A 2JHPA 2WOJA 1GQ2A 4RJTA 5JYBA 1JB1A 1YI0A 3T7RA 2BDTA 1T4MA 5LMCA 4ZODA 4KYIB 4R69A 3VH3A 4ZYYA 2B1QA 1FW6A 3DBHA 2WKPA 1R9MA 1QFMA 2XVZA 2BFFA 3A05A 2JLRA 2P2SA 1A5AB 3ZOZA 3CSDA 4KAJA 1N9ZA 5DBGA 2A5JA 1JSRA 3NM5A 1S9DA 3KDPA 3EEIA 2M1ZA 2PSSA 3I6QA 5CFOA 3I5XA 1AKUA 5EAIA 1M6HA 2HWUA 1JHXA 3KYBA 1CYEA 3GB9A 1DDIA 2FCAA 4O08A 1RAIA 5F7JA 5IAJA 3U0BA 1KXJA 1Z16A 1ZD1A 4RHXA 4F97A 1GCGA 3WLTA 3AJEA 4DV1B 5B1IA 4S2EA 5F51A 1JTEA 4II7A 4RSHA 4Z1OA 2QLBA 5LPNA 3B8HA 4KGZA 2F1OA 2Z6QA 4G8JA 5T64A 4BNNA 3D02A 5IUKC 3AFMA 3JQQA 4OFBA 1VGVA 4JS0A 3UA3A 4AJNA 2H4YA 1VKJA 1Z0UA 1P1CA 3PITA 1YJBA 3P9QA 4W9RA 3C87A 4O25A 4ESEA 4EVIA 5AW6A 4R2HA 4DLAA 4JDPA 5IW8A 4XIYA 1Y7HA 2I34A 4I46A 1E92A 4CKCA 4DIKA 1BCRA 4HPWA 5CA1F 2HFKA 5KQLA 4QUBA 2QLTA 3L8MA 3P2MA 1ECFA 3ENKA 1TYBE 1UF9A 2O7NA 1MPXA 4LZZA 3W3AH 4XJVA 2I71A 1E20A 3D54D 2N9UA 3ORHA 4DA7A 1EEXB 1JKJB 4XGIA 3OZBA 1IN7A 3BSFA 2ZI4A 1EFAA 3IE2A 3WYDA 1V1RB 1SCUB 3QKRA 1HDCA 3CLVA 3GLHE 5I45A 5J5CA 3NYWA 2Y4OA 3EXG2 4PZDA 2IXDA 4ZVQA 5A4KA 2O9JA 1YR8A 3JQGA 4G65A 5TE9A 3TLMA 3PZBA 2JJ1D 4FMDB 3DWIA 3FPKA 3N58A 3QF7A 4X44A 2VDUE 4UNIA 4D8UA 1O96B 2B4YA 1CRLA 4RK7A 2COEA 3O1HB 3FH0A 4GX1A 1JB9A 2QOEA 4NZMA 1PHPA 2O6HA 1JQEA 2XGMA 2C7BA 1FPMA 2EKBA 1I7DA 5EPOA 4CG0A 2YXDA 2OM2A 3EWIA 3LC2O 2I4TA 3PI7A 2JGIA 1SQSA 5AT1A 1MC5A 5TMBA 3TEFA 1NR1A 2VJMA 2E18A 4FQ5A 3ZHBA 5LJLA 2W90A 4Q82A 4AI6A 5EKXA 2I7DA 4CMJA 1RXIA 5CVTA 2YYZA 2P9YA 4U2GA 5CMLA 3VC7A 4AKGA 2CHGA 3EMVA 4M38A 1D5CA 1M33A 1SJ9A 1YH3A 1FDOA 1ZG3A 1DC3A 1UK9A 3H2GA 3L6UA 3RRJA 4MMZB 2G9NA 4F85A 4A8PA 3S7TA 3GMIA 2M32A 5LBUA 1MKYA 3UMCA 4Y9SA 1K3TA 3STTA 5CUQA 2WWYA 2EFCB 5KAMA 5AVOA 1GADO 4YAOA 1BW9B 4DSOA 1HDEA 1K06A 3B2NA 1QGYA 2CLFB 1DJQA 4YJ2B 2WHEA 1YGPA 1I51A 2PRZA 4BNGA 1IQ0A 1C3XA 1FZQA 1HORA 1L1EA 1XRLA 3GGPA 5DNUA 3OCUA 1CR6A 8MHTA 3C3XA 1AKEA 1FQOA 2VK8A 3UT5A 2FFBA 2ECPA 4P2BA 2XUQA 1F0YA 1WXQA 3Q85A 3H87A 1Z0AA 5DT9A 3PNVA 3BICA 3ZK8A 5C1BA 2A5YB 4I1RA 3HU1A 3U6KA 4FU0A 4M8IA 4YXWD 3DL7A 2HYIC 3PT9A 1P9OA 4N7BA 2JH8A 3IIMA 2UVPA 3QW4B 2ASVA 1FSFA 2QMYA 3CZQA 3DOHA 1MJ5A 5LQJA 1QGUB 1F3LA 3WBBA 3BF8A 5E9JA 3KU1A 5AOCA 2A4KA 1T5SA 1N6LA 1Z3IX 3A6GA 2ESRA 2ZTMA 1BXRA 4NCHA 1GQYA 4GSLA 1VSUA 1MQAA 1YNOA 1ESNA 5F2NA 3LQYA 1IPEA 1YV9A 5TC4A 3T3NA 4KLNA 2Q8PA 1IY1A 2IYWA 2JD2A 1QVZA 4UDNA 3ZC3A 4B3JA 3HJFA 5LWHA 4ZAWA 3T1TA 3KXPA 1PQ4A 4I08A 4CVNA 5CFQA 2RGCA 5C80A 5DX0A 3NC0C 3OICA 1JKXA 5ALNA 5TQVA 5KOHA 3TLAA 4N4AA 4EA6A 3D3QA 4IY1A 2HPAA 2B94A 2VJNA 2X6RA 4I5GA 4BVBA 4GRDA 4MRVA 4CI0B 3DAPA 1TC2A 4DLYA 3FIUA 5BOVA 2D5BA 4JUAA 1D07A 1EDZA 2CJXA 3ZV7A 2RHCA 3VVBA 2ACWA 4BQIA 4RVHA 4EJFA 4EMUA 2FJ0A 1SVOA 3JZIA 4TV8F 1Q0UA 1KE1A 2VJAA 2WTUA 2V3WA 1I7SB 1LS6A 3TBFA 3FWPA 2J07A 1IMJA 4YN3A 4GYKA 4IEIA 3HCBA 5AKGA 4W5QA 4J94A 4JY7A 4WL0A 4A8HA 4JLOA 2PZFA 2ZANA 2ZDHA 1QH1B 2ODQA 5DI9A 4HGRA 2VI5A 1URPA 3L18A 1FFHA 1GNPA 3IAHA 4HLCA 3OLCX 4M1OA 4RK0A 4Z9XA 5T4EA 4BEVA 1UBFA 1XLTC 1T4GA 5IAGA 2M6LA 1QOQB 1K2VN 3AL2A 4FCVA 5G4LA 1J07A 1WZUA 2ZS7A 4PFSA 4PHFA 3ZDRA 3A4YA 2GI4A 3MN1A 4HQRA 5D5HA 5JANA 4P36A 1M0TA 1EWQA 3U4AA 4DPLA 4A0GA 4I6EA 1U2TA 3KJHA 3MJCA 4EPTA 1IOVA 2YBEA 1U65A 4QGHA 4R71A 2FN7A 2YNMD 4QQNA 5ER6A 1CUUA 1KI6B 4CGYA 2VDWB 1STOA 3PCXA 3KKKA 2MTBA 4CKBB 1J2UA 4D46A 1BMFA 3ABOB 5HM6A 2AJBA 3F78A 1NF9A 3Q3CA 1XT6A 5E1BA 4AP5A 5EWMB 1IY0A 3SHTA 3SNHA 1I10A 1Q50A 3AESA 1RXYA 3ZVKA 1XMQB 2BE9A 1RWOA 2RDMA 2WG2A 5ITZA 1TT7A 5ADHA 5JVDF 1AN9A 1GZDA 4FFWA 2OFWA 3D3WA 3PC6A 4IUYA 5GGXA 4ES6A 1EQUA 3GLTA 1WAMA 3PHBE 3QUAA 1RYYA 4RTKA 4A36A 3PE3A 1XQ6A 1L5QA 3W1WA 3FYUC 1ZSVA 4G0ZA 3DYVA 2JFXA 1V4VA 2AG0A 3DDZX 4WJZA 1FSSA 3GCGA 5GONB 5EJAA 3G2NA 3AEQA 2J87A 2UZ3A 5CT9A 3FPGA 1LTHR 3R23A 5BN5B 2Y0BA 1GITA 3WK7A 5CDUA 3N75A 3GJ5A 5M5BA 2A59A 3QBJA 1Z0JA 4MZDA 5EJ6A 1FFXB 4GPIB 4XIJA 2QD5A 2Y1GA 1CF9A 2C5AA 3HGMA 4D8YA 2R4TA 3AINA 5JAPA 2DR2A 2V0CA 3EZFA 3GOQA 4UBOA 4M87A 5JNWA 4E22A 2Z9BA 3D43A 5I8WA 1J8VA 2ZITA 1W19A 3FNIA 4UAJA 2RHMA 4PU0A 3A37A 3TS1A 2JJMA 2EDCA 4BMXA 4AYWA 3KFVA 1D6NA 1XJQA 3TZQA 4FDTA 2W00A 5SICE 1IBLB 4PX2A 1CZUA 2BTQA 1I7LA 4MVJE 5B3JC 1YAJA 3O8DA 1WBJB 3KDSE 4AMZA 4DQXA 1DKNA 4MJLA 3KR2A 3PDCA 2QK4A 2VK1A 1PNTA 3T5PA 4OX9Y 3DD1A 2HPZA 2X4DA 1YDWA 3DHYA 3EAQA 4KPGA 3LP5A 3G5UA 4KCGA 2C9BA 1Q1ZA 2X8JB 1VLZA 4RZSA 4BNZA 3CGGA 1CR4A 4YAIA 1WDKA 1OLUA 1NONA 1U8EA 1UKEA 2H51A 3I12A 4YROA 2IZ6A 1L7OA 4CM3A 2PJRA 5JS7A 1KEEA 2JG3A 4K8RB 2ZZKA 3G1WA 3T1NA 3T1OA 4HFNA 1FS4A 4K6CA 4KQ1A 1LI7A 4OI2A 2ZBUA 3V55A 5KSZA 3K0SA 2X0EA 2DX7A 2VXYA 3HI6A 4OK6A 3H4VA 3KTFA 4OXKA 4MI3A 4BNHA 2OAP1 1T29A 2EQ5A 2C3PA 1S2LA 2P3SA 3CZPA 3A3OA 4PLFA 4F86A 1TKAA 1O0CA 1K7EB 1ZVVA 1H3EA 1AXRA 4WXRA 2R8RA 2FZKA 4XTRA 3JAMA 3R3JA 1JDNA 3C6YA 4ZT2A 3ZUGA 3MTIA 1HL7A 2AG8A 1XZPA 2WR8A 2IY9A 2R5WA 4PTZA 2FLVA 5KVQA 5HR5A 2LCIA 2PEZA 3SDZA 3UH0A 3VJMA 5I7SA 2J3IA 1DRKA 4E4YA 2ZSFA 4O4IF 2GYWA 5L7TA 5SYNA 1E79D 1TD9A 2NUAA 4ENQA 1U0BB 4NCBA 4JH0A 4FN5A 4NABA 2VUIB 4LVCA 3VVLA 2ZJBA 2Z9DA 4D9MA 2MIIA 2XUPA 1FVHA 5DASA 3JAWB 3CF0A 4Z5XA 3DOFA 4G0UA 4WY5A 2QV7A 3K05A 4IW3B 2C4WA 1MB4A 4X5OA 3WIUA 2P2ZA 1V5FA 2Y0PA 2X0DA 4GC9A 2DTEA 1TAQA 2RHRA 3ICCA 5HA5A 3HKBA 1JU4A 1UMBB 4UEJA 3AEYA 1ZA1A 3EGXA 1FC0A 2HU2A 4CL8A 4DDTA 2RK3A 2FSVC 2QE6A 3IIIA 4MRMB 3M4XA 4F3YA 1FUEA 1N5RA 1A7JA 1IH8A 2PKYX 6LDHA 3T4UA 3QE9Y 2AIRA 3VZDA 4QBFA 3WC4A 2IFTA 3FOZA 4DCJA 4C4OA 1DSSG 3DV9A 1KNXA 1N7IA 3OIFA 3QENA 4DTCA 4RIGA 2ZKLA 2BZSA 2RGEA 3NBZC 5AUPB 5JDCA 4KBYA 1O6FA 2G0AA 2QTZA 2E5LB 2C58A 3HB1A 3IDFA 3DV0B 3ILVA 1KI9A 1VFNA 2C2HA 3PKZA 4MPJA 3E84A 2QRPA 2QU8A 3LH5A 3MOSA 1L5VA 3PGVA 2W2VA 2XCTB 3RSHA 4XCXA 3S2SA 1AF7A 1Z34A 4W1RA 3O95A 1SPXA 1W0KA 1NVUQ 1DU4A 3G02A 3FJOA 4RL6A 4BBJA 5MGBA 2QP4A 3IKLA 4XIFA 4AG6A 5D5QA 1C0IA 4JFRA 4LGCA 3ZKAA 4ENSA 4JR0A 4LV6A 1QC5B 4C1NA 1G2QA 1RPNA 2BFDA 2WLTA 4UHKA 2Q27A 4NNPA 5IHXA 1NUTA 1Z07A 4E2YA 1PT6A 5LP6B 1IZ8A 1A5TA 4BN4A 2NZJA 1XZIA 3Q0EA 3VZBA 3HPRA 1JBQA 4Y3UA 5MF6A 4YC7A 1V11B 3IP9A 3PJEA 1HPLA 5CBKA 3H11A 4IHQA 2B83A 4YCJA 3WGIA 4TN5A 2ENWA 4D9JA 3CR8A 1XALA 3QNWA 1YOVA 4WOPA 1S8FA 1UJ6A 3CURA 4YIKA 2C2OA 4JI1B 1Z28A 1HQYE 4BKPA 4C21A 3FX2A 1U28C 3FDXA 2EHDA 1ZNYA 3B3FA 3MTAA 3IHLA 4M1YA 5FBVB 4TV9A 3N2LA 3B20A 2NP7A 3LUAA 3N0RA 4HLQB 2QBYB 4U7GA 3I5MA 3KTDA 1E1RD 1MB2A 2I4MA 2O1XA 1OIWA 2OBMA 5TS3A 5C8ZA 5CB8A 5DNWA 5JPCA 1P91A 3S8YA 3GEGA 3G2IA 1X7WB 2W2NA 3G8DA 3ONEA 4GBMA 4L7QA 5JIBA 3BX1A 1WD5A 5DTJA 3NHBA 1ZXXA 2CXTA 2JNWA 1I4LD 2VR1A 4WNCA 1UP6A 4OAPA 2GBGA 4Y2GA 1IQRA 3DTTA 4IZIA 5BR1A 4Y9DA 1JFTA 2VAMA 4C7BA 2PUVA 5BMVF 2HIMA 4CFZA 4DCSA 1JTVA 2O8DA 4GYJA 4URYR 1RMTA 2JFFA 5AMXA 4I50F 4J7AA 1DINA 3URKA 1NNSA 2CDRA 5F4BA 2PTGA 2ZRAA 4QU0A 5EJ4A 2I3BA 1PFQA 2QTAA 3GBSA 3KZXA 2GAAA 2NU8A 3T8YA 4BATA 3IEVA 4CQMD 4BMVA 1P2VA 2OMKA 4DLSA 2IU4A 2Q3DA 2C54A 1KMIY 5CVJA 4GBJA 5DHUA 4RCVA 2ZBVA 1NLFA 4PSCA 5CXQA 5A62A 2XGJA 1IVYA 1XPJA 1UWCA 5KYVA 4RVNA 2FSFA 1DBIA 2PPVA 1S5PA 1M6VB 3SX4A 5JRZA 1NUSA 4G89A 3W8RA 2QTRA 5L45A 2CV0A 5KYTA 3JQBA 3WRWA 5CDSA 3TRFA 4QPCA 1F12A 4M1TA 1GKYA 1CQZA 2VLIA 1SCQA 4LXHA 1EM8B 1AURA 1FDWA 3WLAA 4AJ1A 4WMLA 3HPQA 1EWTA 3TMKA 5BVGB 1GUFA 5REQB 4DRYA 3CE6A 3QSGA 3GUHA 3PVCA 1ORWA 1XCPA 1EZ1A 2VSOA 3G9ZA 1EVYA 3O26A 3OF3A 5FJJA 4CMEC 1P6XA 4PYNA 4DNXA 5JPDA 2ID7A 5BN3A 1Z2NX 3HCCA 1JEQA 3O4HA 1JVSA 2WI8A 3Q7EA 4X95A 5BR4A 1JSCA 2YVAA 1IRXA 1FRNA 4HTAA 1DWOA 1M8PA 4BIIA 2KQUA 3ROXA 1C7RA 2CWWA 4LHSA 3LBHA 4X6LA 1E3IA 3NLLA 2AOVA 2HRQA 1JAZA 2G1KA 2H16A 2MHCA 1R0KA 2BFMA 4H27A 4BRSA 4AWXA 4F11A 4MR8A 1JV2B 2APJA 4H2DA 4RUKA 5CT5A 3E2PA 5FFMA 4PNZA 3SZRA 1ADBA 1W25A 3KUXA 4R6XA 1F2UB 2GEDA 2R79A 2X6QA 3G0HA 1YDGA 1E3WB 4Q3KA 1NE2A 2Q6OA 4Q05A 3LS2A 4YFVA 3OU6A 1J0AA 1DBPA 1A9TA 2H00A 1Z38A 2H3EA 3NUGA 3JQRA 4RLFA 1FQJA 2WSSA 2B1RA 1AS2A 1OTXA 5JSYA 3VO2A 4M0DA 3R3ZA 3C7CB 3PJDA 5H81A 3V4FA 9MHTA 1N7JA 1FFDA 3F46A 4LWQA 3UB2A 1E1QD 2VL7A 1Z26A 3ZV6A 4IFTA 2RCYA 3MUEA 1H0SA 2ZJ5A 2PX6A 4TRRA 4DM4A 4R8LA 1KYQA 1XHLA 1JWLA 2CMKA 4F04A 4EUNA 5CAEB 1P80A 1BGXT 1T2DA 3I8SA 4IXWA 3ICWA 4Z3KA 3R7FA 1BXKA 1XI2A 3QMWA 1VI2A 4DSUA 1K6MA 3NC1C 5JY1A 1CTQA 1NVDA 4P9NA 2P2NA 1C7QA 3RVMA 5FWXB 4FIZA 1V8FA 1N92A 3KG2A 1C3OB 2VJBA 1S01A 2G3YA 3OZUA 4YMWA 5A9SA 1LSJA 5DCUA 1JMKC 3O4FA 3N39C 4QBGB 4RD6A 2P6UA 3VHQA 5DPMA 1UM9A 3E9MA 3IAXA 2R97A 3GP5A 3Q3JB 4V0KA 4YMIA 1NMSA 4BGVA 3P5BA 4C7OB 1V7PC 1Z5ZA 4R68A 4MDEA 3NHYA 3WYBA 3K6RA 2FPSA 1ODJA 1II9A 7AT1A 1CY1A 5F9MA 1DX4A 1G20B 1WV1A 2D00A 3ZU3A 3WGMA 1Z4IA 3KBBA 1PTKA 4OREX 5KTOA 1SBQA 1VL0A 3K2EA 5IDYA 1M8KA 1Y7IA 4WXHA 1JEOA 2IE0A 5D2CA 3R8FA 4GYWA 3PHJA 2OSBA 1AUVA 2OO5C 4LDAA 4WKBA 3COWA 3OEED 1BA2A 2P41A 3GP3A 3OQ6A 4MWTA 4YCDA 4NF2A 4BU1A 4G97A 2I1QA 3M6UA 4ZOCA 1RAFA 1I5EA 2H0AA 4NRDA 1MEOA 4ECAA 1U0GA 5K8CA 3ROQA 2BFOA 3ZKWA 5C5CA 1XTKA 1QNFA 2F9MA 2V7BA 3MT7A 4LJRA 1LFAA 2YZMA 2C61A 2C8JA 1PL6A 3ANSA 4KHPB 5KTSA 2BHLA 1DXOA 4ZVRA 3L4KA 2BFWA 3V1NA 3IOCA 4I1VA 1SK9A 5D3MA 5FUWA 1XAJA 1AGRA 1Y5MA 2X5JO 5FWYA 5CITA 2EF0A 1LX7A 2VSFA 4OOFA 5DO9A 3DW1X 4P82A 4CKWB 5T57A 4F1JA 2FP4B 1L4EA 2ZWAA 2I9KA 3CRMA 3IT1A 1G5FA 4UAUA 4B6FA 3NT4A 2J1LA 1Z4KA 5A5DA 3CLUC 3G8BA 4HB3A 1UFQA 3T4PA 2I6SA 1R88A 2P9QA 4FPXA 1VE7A 1PJTA 2DC1A 1OXUA 6CHYA 2X0NA 4HVTA 1OY1A 4QE3A 1CY0A 1I7PA 4X24A 5HKBA 1AQJA 1IHOA 4FBLA 3ZY3A 2VK2A 1M2JA 3HBLA 5F7XA 1RIFA 1G4UR 2Q1TA 4LFBB 3H7IA 5AVRA 2AZTA 2IZ5A 2V96A 4GMKA 1QUFA 4R1NA 2FW8A 5GGYA 3AY7A 1AB6A 4II3A 1Y81A 4REQA 3STXA 2M1XA 3V8MA 2QPTA 2IUTA 2NXWA 3WYNA 4CDRA 3RC2A 1EZZA 2YIDA 1TM7E 3E53A 4YJHB 1QO0D 4FC7A 4OQNA 5ES3A 4NI5A 3A1NA 1RLIA 2O20A 5E4FA 1MORA 4YRSA 4URZR 2JAPA 1G64A 2ZIEA 4NENB 2EGGA 5CDGA 1PDWA 1Y3HA 5JPIA 3UMVA 4CLRB 1RM0A 3SFVA 2O1EA 1KMCA 2W42A 2C59A 1PR1A 2J0UA 2CDCA 1KVQA 2P27A 1APBA 1DT5A 1C4WA 1G63A 3CLKA 3QEOA 3UMFA 5IP5A 1Q44A 3UAWA 3V8NA 2OC9A 1W8IA 1BE6A 3FOBA 1J70A 3LZCA 1BQ3A 1RQGA 3USZA 3RRFA 1F51E 1IK6A 1QIHA 2YV1A 3KUCA 4LI0A 4ND7A 1KZHA 3ZWNA 3KC2A 4EY6A 1HYBA 3VC2A 3RH0A 1KTVA 1RYDA 3QE3A 2VHWA 2VNAA 5A4FS 1NKSA 2P7IA 4H15A 4MUXA 5C3UA 3ZQKA 2FEWB 5ALLA 2RHJA 4WAUA 4BPBA 1W0JA 3ETEA 4F12A 5ECGC 1KSJA 3I6IA 4IJMA 1Z68A 1QCCA 3UAVA 3THOA 1OYWA 2WU3A 3NDPA 1MAAA 5A02A 1JPUA 3B8EA 1SKUA 4KYTA 4TXMA 2FVYA 4Z1MD 2GK6A 3TTSA 4G1UC 3V80A 3U44A 4Y6LA 3NZEA 3RARA 1QFYA 1VLJA 2QRUA 3LRXA 2L69A 4YUVA 3P4UA 1U04A 2YS7A 2WWHA 2R7MA 1CP3A 3QVGB 1PZEA 5DNCA 2X7XA 2HM7A 3KLPX 3P20A 3Q3IA 3GLQA 4FQ8A 3H8SA 1Q92A 3STUA 1IM2A 3DYIA 4MUHA 4JBXA 1C8BA 4EHDA 3H1FA 5MHTA 4YDRA 1E2EA 4NKRA 3V7NA 2XWJI 4MUIA 2PMWB 4KTVE 4UPDA 1DEXA 1GPWB 2MYUA 3I3OA 1TU0A 5DMXA 4ZFNA 3NV7A 2C92A 3ZJVA 4G85A 3EYWA 5DGTA 3SQMA 1CQIB 4F5ZA 3WA6A 4QJ5A 3IXLA 2VTDA 1JJBA 3NTVA 4BFUA 5KYXA 3HJNA 4ALIA 1C3VA 4JCCA 4M6WA 1NF2A 4YQYA 4N7JA 4O3MA 4IJQA 4LFCB 1CETA 4FFVA 4A7PA 5IDQA 3L7YA 1Y8AA 4NCXA 5C9ZA 4H7JA 5MFPA 4LDJA 4B43A 3NVKI 2QHXA 2E37A 5P8WA 2Q4RA 3TAHA 2KS6A 5F3DA 4EHAA 3EK2A 4EYQA 3D0KA 2C4MA 2Q4EA 4JVNA 1PFYA 2HMVA 5AESA 1K8QA 2AS0A 4W7IA 4BASA 1PJSA 2Q5JA 3DWGA 3Q98A 4URVR 3NWPA 1XZ8A 4GOMD 4I8IA 2DUNA 1UMDB 3UJPA 2H1HA 2XQGA 3LOUA 2R84A 4RLQA 4X1KB 5HCIA 4OOEA 4RADA 5KJEA 3UEOA 1FNCA 2VCEA 4R0VA 2OCIA 4QAJA 4CF4A 2C5LA 3MWGA 3G1TA 4DDMA 3ISJA 2D2EA 3G0OA 4ZZ3A 2XB2A 1ZBDA 5DP2A 5CDFE 3VU1A 3BHNA 4UREA 3S2YA 5ENZA 2W43A 4PSVA 1N6IA 1P4AA 2RH5A 1R0ZA 1S3SA 4AMVA 5I5EA 3G0BA 2QYOA 2A0YA 2ZE6A 4RY9A 3NPMA 2YXPX 2ZJAA 4Q02A 4UEWA 1O03A 3CLTD 2GSWA 1U8AA 3WNCA 2NO9A 2QN3A 2VYND 1TVEA 3HWWA 1M2WA 1LRJA 1QVVA 3S5UA 3VR3A 3Q5GA 1D8TA 2H07A 1L7XA 2Z8YM 2CUNA 4NV1A 3QFFA 421PA 5JMPA 1W2WB 2Y92A 1ZK0A 4RABA 5ALXA 2OFOA 3ZHOA 5FBWB 1C8LA 3UOWA 4ZEMA 1GCIA 3ZU6A 2BFEA 2FOIA 1WXIA 4C0BA 3I5YA 2BYTA 3AFIA 2H0QA 2FEAA 1K63A 3RUHA 1SBZA 1F8GA 3KCNA 3DBOB 3S2GA 1E9VA 3RGWS 5COQA 3ZDXB 3R1IA 1GD1O 4K8OA 4YIHA 1VTKA 4CF5A 3ASZA 2GHRA 4Z2AA 4DLWA 3C1UA 1DJOA 2A1IA 4QYSA 3G0DA 4BV8A 3NEYA 4TXLA 3VR5H 5B4TA 4XDHA 4S04A 2UU9B 3A0RB 3AU9A 2R5FA 3H7AA 3G0CA 3I6BA 4M9CA 5A7HA 2MSWA 3UJAA 3FM9A 3ZCUA 4F1KA 1G16A 5KTRA 5B7QA 2C7PA 1P9LA 1DKMA 3HJGA 1MQ8B 3K2BA 1L4LA 3UWOA 1MJFA 1AKVA 2Z8XA 3OIYA 5CB4F 4DKJA 1UK8A 1OX6A 2JBAA 4Y2QA 3ZHQA 4AF8A 3NYQA 5IJWA 2N46A 3O1LA 1J9GA 1RQ7A 3Q5EA 4OBEA 4PGAA 3ICVA 3GHHA 3NXSA 4R2XA 4TSFD 3AZPA 3URMA 2YQ5A 2V65A 2SNIE 4OQ4A 1HNWB 5T6MA 3B3JA 2ZM5A 2GEBA 3CR3C 4LY0A 3RUCA 4AC9A 3OIGA 4M22A 2WF7A 4W5NA 2IYAA 2XX3A 1BMDA 3OQIB 2PR7A 1ISHA 3BH7A 4JT2A 4I9FA 1TF7A 1NURA 4LV8B 3AL0C 1NF8A 3O8QA 4OMUA 3BM5A 4LOKA 3VNAA 3ZNPA 4D41A 1X2BA 2PEYA 4ARBA 2OCDA 3IV7A 3SXUB 1J97A 1II8A 5EJGA 3FTPA 5CFZA 4GO1A 3IMKA 3KRTA 2VBFA 3JWIA 3OPYB 4V03A 4G5XA 5DBEX 3BD6A 3N07A 4ZALA 3KTAB 4FDAA 4HDRB 4Y2YA 3QVSA 4QT4A 3IELA 1OH6A 2ZCVA 3WTBA 3HP1A 5EXSA 3IL2A 1QGAA 2IUSA 2Z09A 3EEFA 4PLVA 4WBXC 3R7AA 3CF6R 1NVMB 4J2TA 3B9RA 3HJBA 1WW2A 2HK7A 4I1SA 3I4LA 4X1YB 2C95A 4GAEA 3TL3A 4A5OA 1NUHA 3BXZA 1CK4A 3UAGA 4FFOA 4C0QC 1XMXA 1X1RA 3H13A 3VNVA 1COZA 4M0KA 4MAAA 4QREA 2Y9MB 1Q22A 1QTRA 2GPYA 4JJAA 5JYEA 1ZHFA 3EVBA 2Y4NA 2NZVG 5JSHA 1P0IA 4HAZA 1MGOA 1IWOA 1NXTA 3OVMA 1Y3IA 1ZGAA 3DKVA 3GELA 3V8RA 3PEYA 3HEAA 4DG5A 1QH8A 3Q8XB 5EA2A 3RSQA 4NYMQ 5CG2A 2BBWA 1M72A 4M7PA 1TIBA 5KVVA 3BF7A 3FGOA 1M7BA 2ZR8A 1U1FA 4CETA 4MWOA 3OBIA 5ILGA 1HFWA 2FI1A 2J7KA 1G7SA 1HGXA 3R6WA 5F5LA 2WUVA 5A4JA 4TZ6A 4IFBA 3A1FA 1H2YA 1I13A 5K8IA 4ZJUA 2ZP1A 1W76A 3EVGA 3R4CA 1GUDA 3KEGA 1ZAYA 2JI6A 1HNXB 3L8FA 4XIIA 3PEFA 2COKA 4J4BA 1W48A 4TLEA 3GZTB 2OCAA 1OD6A 3W9SA 3K1YA 1V45E 4FGJA 3EXFB 3WKEA 4QYMA 1KJQA 4DWWA 3VNBA 1C80A 2QL6A 1IYZA 4KAXA 1LLQA 2Q9AA 5ALWA 3LFTA 4COOA 2QX9A 1BC5A 1SXJD 3FXAA 4B2PA 4PYRA 3MWEB 4GUDA 3VPSA 1GPDG 3L1UA 5DNAA 3MFYA 1CVIA 3ENWA 5K9ZA 4FCWA 1W87A 4UASA 4I1UA 1U5BA 1XUOA 3ZWCA 2C1XA 1GRNA 3LA8A 3BTVA 3N2KA 3GLHB 5L6MB 4DRZA 3Q7RA 3ZJYA 3U3MA 1EJ2A 4LSGA 1IEWA 2REQB 2C03A 5AK6A 3B6ZA 1E0AA 1CJMA 3ILXA 1ZY2A 3S40A 3TIGA 3TQQA 2FX5A 4BE7B 1IN4A 5CJJA 4DMKA 2PKEA 4KN6A 2HJGA 3NIWA 4GX2A 3FNHA 4BY9E 1B0ZA 3PQ2A 1JR4A 1RCFA 5EIHA 1Z18A 1OI4A 1F9EA 1MO6A 2IODA 3AHJA 1ISIA 4LISA 3A4VA 3FYCA 3T9EA 4ZHQF 4EKEA 4D79A 1FNSA 2Q9BA 1FVXA 1MXHA 1ZESA 4TM8A 1T9GS 2GHQA 3D5TA 4O29A 5DTQA 3V6LA 2HRDA 3TWOA 1SUWA 1ZICA 2PZJA 1F2VA 1CZNA 1IUKA 1U2EA 2A9JA 1RQLA 2CHEA 2FUG1 2FJPA 2A9VA 4KIUA 5L7YA 5B1EA 3KQNA 3L1HA 1C1XA 1J8DA 1JXQA 3BL6A 2B8JA 4HNGA 1W35A 1HZZC 3GLSA 4OXRA 1KC3A 3M3PA 4FYPA 1BJTA 2HC9A 2IXFA 2JJ2D 2WE7A 4GWGA 4WCFA 2PL1A 3MSCA 3MMPA 1ZNZA 1CFZA 1U80A 4KEAA 4NICA 4X8MA 5EY5B 4GWKA 3LP8A 4D8WA 3BMQB 4DR2B 4ABYA 3TB6A 3TSCA 1VG9B 3QVKA 4J4TA 3DE1X 3LX4A 3ZWAA 1SULA 3CB2A 3PR2B 4ISBA 4URHA 5DV9A 3ZWWA 2WMYA 4UXHA 5LB4A 3GAZA 5L95A 4HUQB 4RACA 2CCJA 4MRAA 3D2BA 2GCIA 5FPSA 3NFYA 4F6LA 1WCV1 3QE2A 5JQGB 1T36A 4XX1A 2R00A 3O73A 2FU5C 2HCRA 2ZK7A 5BOSA 5HPYB 4OLAA 2PQ6A 3MRVA 4PFKA 4BVEA 3IDQA 2SCUA 1UK6A 3VYTB 5CCBA 2XGSA 3DHWC 2AL7A 1KH3A 1M3SA 4GVPA 1UBRS 1VECA 1M66A 4Q15A 1ZI9A 5E6RB 4W5TA 4K6MA 1J1ZA 4NAUA 4JN6B 3FFAA 4P7BA 2WHPA 4D45A 4HDQB 1PF7E 4KYUA 1AK9A 3KJFA 1D2CA 1T5BA 4MS1B 5B57C 3ZYZA 3OFND 1EE2A 3ZWYA 3FSGD 3K1TA 2QAGA 2J7PA 1ZC3A 2FW9A 4C3VA 1QUEA 3X1ZA 1WMAA 4QGFA 4EAQA 3L1VA 3LX5A 1UKVY 5I4BA 1Q2UA 3HP4A 4LE2A 1W59A 4DQLA 2XPCA 5KWSA 3GMDA 1Z45A 4IXDA 5TLSA 1OHHD 2Z0MA 4YT8A 1WB6A 1N5MA 1TTQB 3L8ZA 3NNSA 3OKAA 3ZY5A 2YV3A 5IYZB 1P9RA 3L7JA 4J7UA 3AG5A 3IHWA 3JALA 5DU2A 1Z3CA 4IVQA 3CF4G 5IC6A 3W79A 4D43A 4RTQA 1UWKA 2I1WA 3ZK9A 4I4IA 4K3UA 4P83A 4UBLA 4E2FA 3H3XA 2O3RA 1BU5A 3ESYA 2ODWA 4J2OA 1QQ6A 3D6HA 1N2OA 4LQLA 2PXAA 4O2AF 1EUDB 1ZLXA 2FDRA 3P2EA 3Q9NA 3I1FA 4RK4A 3HZRA 4ZYWA 2O14A 4HEHA 2AVNA 1O95A 1XVTA 2H4HA 4G07A 4TQAA 5BP7A 2EJUA 3O2SB 5K7SA 2GCOA 5C0OE 2V6BA 2ATIA 3JYPA 2HXGA 1ISRA 3H6GA 4RFLA 3HM9A 2DBZA 5C4MA 2FV8A 1YR9A 4GFDA 2GDJA 1EWRA 1GQSA 2GN6A 1IZ7A 1HURA 2QMEA 4MQFA 6REQB 1ZM2A 2WHQA 1NXWA 1XTBA 4XGQA 1YB1A 4EW1A 1BRMA 3P97A 3FYSA 5DN6D 2Q3HA 3N86A 2PSJA 3AR6A 4CFSA 3L8YA 3IP8A 1GLGA 5BYAA 1WXHA 3CNHA 2WUWE 1JHQA 3T0GA 3LMKA 2H5IA 2BY4A 3FKSA 5KYUA 3AKZA 1HQDA 5EMNA 1QFJA 1FUIA 2AOWA 3CWQA 1BWPA 3GQVA 1X7XA 3GRPA 3P9ZA 3E8XA 1POWA 2HFJA 5JTTA 1PBNA 2P4EA 4WCDA 1SIOA 3SKXA 4CM9D 3JYOA 4L7VA 1L5HB 3IE0A 2J9GA 1KYIA 3TDKA 3ZZ0A 2XH8A 2ACVA 2PA3A 3GRZA 4AIRA 1KFJB 1YCDA 2AOTA 1HNNA 1GILA 2P9HA 5DM70 1WTCA 1C1HA 1BYUA 4FGSA 4HSEA 2CK3D 1YE8A 2IF0A 4MWZA 3IDAA 1QJ4A 4JVSB 3ETGA 4ZMSA 2NU6A 3IT0A 4LZWA 1CS0B 1MX1A 4KMOA 1CUEA 1XTZA 1XZAA 2K2QB 1ZH4A 2XTNA 3QPAA 5IUNC 3BWYA 1ESZA 4ITRC 3AF2A 3MINA 3VAYA 1M6YA 4I8XA 5KJ6A 5AVJA 3F3YA 1G5QA 4DYDA 3WE7A 1FBNA 2MR5A 1VJTA 2RC6A 1MJGA 5B6JA 2UUCB 3LX8A 3HVIA 3KQHA 3GPCA 3BFPA 2SKDA 4D8VA 2G9QA 1U9YA 4OQLA 4ZOEA 5AQ1A 1UBSB 4YRDA 5KSOA 3GYBA 4XJSA 3E4DA 4KK3A 1Z2EA 5AM2A 3WK5A 4S0XA 1WMFA 2OQRA 4I5IA 2BZGA 1ICIA 5GIPE 1JIVA 1V71A 3FLMA 3H05A 3W4JA 2PTHA 3PYLA 5AVVA 2CT8A 1Z7YA 4ND8A 1XZMA 1XZQA 1T1IA 2OZEA 4R9VA 4UFPA 3IULA 2WWFA 1REQA 2OGSA 4OATA 2ST1A 4LI3X 5AW9A 4DA4A 4HR7A 2VFAA 4G8BA 4ZICA 2J5KA 4J8PA 4F7WA 1OX4B 1HK7A 2O07A 3DOOA 4H6WA 5EZ5A 3U4QB 3C3CA 2IY8A 2ZU6A 4DTIA 1OAOC 3I9JA 1X3LA 4HLDA 4AJIA 5BWOA 2UVDA 4MQUA 2BFPA 4D4MA 3DDNA 1BS2A 1DHRA 3W3ZB 1LQTA 5C8YA 2JLYA 1O8CA 4P7KA 4WA7A 1HLGA 1XAHA 3N2NA 3NKVA 4GKVA 1ZDMA 2YXNA 3SEQA 3VPFA 4V0MA 4CTJA 2YV2A 5C5EA 1WTAA 1NBME 1Z2AA 3M4YA 2QT0A 3NS7A 3RWOA 3ZXIA 3IP1A 4XDYA 1H4TA 1HMYA 1E1CA 3UPDA 3DBLA 3Q12A 4Q12A 2UKDA 1KAQA 2Y1DA 1YE5A 2OV3A 4MCJA 2A35A 5CTJA 2X19A 1YAHA 2WM3A 3KJZA 5IZCA 3QKSA 5CW2A 1RI2A 1H85A 1U2QA 2POCA 3V7UA 1QIGA 3T61A 2RB5A 2D6FA 4LXIA 1NLMA 2DBQA 3RTEA 3WQSB 3FKJA 4KXWA 1W5AA 3VJLA 5BSFA 5JAZA 1ZPDA 4DJDC 4R1LA 3O3CA 4KE7A 4MDHA 4BAZA 1P5RA 4DHWA 5JATA 3UXYA 4YCBA 3KQKA 4KREA 3TSWA 4W5RA 3IAM1 1U7ZA 3H5IA 1QNLA 1GG5A 2Z83A 5J9FA 4QVIA 1IWPB 4CR7A 1XSEA 1SZCA 2I3GA 4D1YA 2DB3A 4LMRA 4DLLA 4JX8A 2ZVPX 2G1PA 1DELA 1TKCA 1H6BA 4N8DA 4BRZA 3ZWPA 4AJ9A 2NYUA 3COPA 4GLJA 1RAEA 3HV0A 4LZNA 3OSUA 4MAFA 2QQFA 2C2BA 2VZEA 4E5NA 4ZYVA 5H8WA 1POXA 3GT7A 5IAAA 1OH8A 4XLTA 1FDIA 4Q9KA 3OMLA 5FOXA 1BKSB 1N6RA 1RHMA 1T0IA 3BB3A