3HNRA

Crystal structure of a probable methyltransferase bt9727_4108 from bacillus thuringiensis subsp. northeast structural genomics consortium target id bur219
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
193
structure length
193
Chain Sequence
DIQYKEVFAHYEDILEDVVNKSFGNVLEFGVGTGNLTNKLLLAGRTVYGIEPSREMRMIAKEKLPKEFSITEGDFLSFEVPTSIDTIVSTYAFHHLTDDEKNVAIAKYSQLLNKGGKIVFADTIFADQDAYDKTVEAAKQRGFHQLANDLQTEYYTRIPVMQTIFENNGFHVTFTRLNHFVWVMEATKQLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a probable methyltransferase BT9727_4108 from Bacillus thuringiensis subsp. Northeast Structural Genomics Consortium target id BuR219
rcsb
source organism Bacillus thuringiensis serovar konkukian
molecule tags Transferase
molecule keywords probable methyltransferase BT9727_4108
total genus 68
structure length 193
sequence length 193
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hnrA00
3EVDA 4X1OA 3SR4A 4C08A 4HGZA 1RI1A 5FUBA 1UFKA 1JQEA 2QE6A 1ZQ9A 2JG3A 1VL5A 2G8NA 1JTEA 2YUIA 5K0NA 1Z3CA 4GBED 2ZCJA 2K4MA 5K01A 1BC5A 3FYDA 1R00A 2EX4A 3AXTA 3EVBA 3X0DA 1PRYA 2C7PA 4C04A 3GRYA 3UJDA 2P41A 3UWPA 2JH9A 3FUVA 4R6WA 1N7IA 4RVGA 1QAOA 4POOA 1NV8A 1WY7A 4Y30A 2PX5A 4IWNA 3KR9A 2NNWB 4QDKA 5EIFA 5FA5A 3M70A 5DSXA 5E2BA 5FHRA 4DQ0A 3OPNA 3LBFA 3KQWA 5JUWA 4PWYA 3VYWA 3ER9A 4RTKA 2GLUA 2ZBQA 4GF5A 2JH8A 1L3BA 4PINA 3CJRA 3P71T 3CVOA 2AVDA 3KQTA 3TM4A 2EFJA 5H02A 4PONA 4MTLA 2C7QA 3GIWA 2HMYB 1YUBA 3SSOA 4YMGA 2IDJA 4ISCA 3OE5A 1AQIA 3NDIA 5CVEA 5FWDA 5K0BA 3R24A 1V39A 3BKWA 2NYUA 3B3JA 1KIAA 3OZRA 4PGGA 1BOOA 5T6BA 3UJAA 2YVLA 1DL5A 2UYOA 1M0EA 5BP7A 4ER6A 4BLWA 4E2ZA 3I5UA 3R3HA 3HM2A 1AV6A 3EVAA 1WXXA 2B9EA 3P9CA 3UBTA 3OU6A 1X1BA 2ZIEA 3LCVB 3LHDA 4ZTBA 4RV9A 4DCGA 5E2AA 5DX8A 5LQKA 5KVAA 3LCCA 4PYIA 3FTEA 2NP6A 4M7RA 4PCAA 3GO4A 1XJ5A 3E8SA 2G1PA 2UYHA 5C0OE 3LDUA 2CMGA 1RI4A 3HEMA 3BKXA 1VLMA 2HR1A 5DM2A 3LDGA 3EEOA 3MHTA 4GOMD 4RTPA 3A25A 3JWHA 3PT9A 2IBSA 4HSGA 4PIPA 1VP3A 2ZBPA 5JR3A 1RI3A 4RTMA 5EMKA 1G38A 3GRRA 4R8SA 4RYLA 1KP9A 3LBYA 2Y1WA 1EQAA 3V8VA 1WS6A 5EHIA 2NXNA 1G8AA 5DPMA 3GDHA 4R6XA 5FULA 1QYRA 1ZGJA 3DR5A 3OFJA 4GQBA 3KHKA 4M38A 3NVMB 4ER7A 4DMGA 4RX1A 2XVAA 1X1CA 4XUCA 3ID6C 3U81A 4LECA 4RTNA 1NW7A 1HNNA 3MERA 3P2KA 3GGDA 1SG9A 5EKUA 1I9GA 5EZQA 1UWVA 2Z6QA 1JSXA 5CVUA 5K0EA 1ZG3A 3DUWA 3TKYA 1Y8CA 5FTWA 5GM2A 2V7EA 1FP2A 4CTKA 4P7GA 4F84A 3B3FA 1X19A 3EGVA 2EJTA 3SXJA 2ZLBA 1NBIA 5DSTA 1QAQA 2F8LA 2YXDA 1YB2A 3HA7A 2XYVA 4V0QA 3SX0A 5FA8A 1JG4A 5HIMA 3V97A 5ICGA 1EJ6A 2C7RA 3MTEA 2P7HA 4FZVA 3BUSA 4OX9Y 3M4XA 2IH2A 3A4TA 3ERCA 2E5WA 2H11A 4RTQA 2ADMA 1EIZA 3EVFA 4E2YA 5CVJA 3T7TA 3UJ7A 2AS0A 2H1RA 2R6ZA 3KQQA 4BP3A 3AY0A 3R0QA 2I62A 5EEHA 4FT2A 4LWPA 1VIDA 2OB1A 4EQZA 2HNKA 4OBWA 3SSMA 3ANXA 4OQDA 3BWMA 2XBMA 2P8JA 4WXHA 4CKCA 1VQ1A 4EKGA 3CGGA 5K0LA 2C7OA 1RJFA 5BW5A 3G89A 3MB5A 3P9IA 2JHPA 3BGIA 1D2CA 5EG5A 2ONZA 4QQKA 3K6RA 4CXMA 3UFBA 4PCLA 2OXTA 1G6Q1 3OFKA 2JHCA 3HVKA 3JWGA 3S68A 1NV9A 3O7WA 5FHQA 3FPFA 1XTPA 4C03A 2GS9A 3LGAA 4JXJA 5EVJA 1NW6A 2ZFUA 3ELWA 3FUXA 3DLIA 3CC8A 3P9NA 2P35A 4DKJA 1FJXA 9MHTA 1R18A 3P2EA 4K6MA 3NJRA 1X1DA 4QPPA 1RJDA 5T64A 3M6VA 2B3TA 2LD4A 5GM1A 1KYWA 3M33A 4PYOA 3P2IA 4AZSA 2ZULA 2OB2A 1YFJA 3GRUA 1TW3A 2YR0A 5EMMA 5DWQA 3HCEA 4AUKA 2ZWVA 1BHJA 1ZKDA 3EMDA 3ELYA 4X61A 2ERCA 3FTDA 2BZGA 2PX8A 4FP9A 3KPJA 1INLA 4MQ4A 2WK1A 3G5TA 4GOLD 4E33A 2PX2A 2O0LA 2PXCA 1G55A 3T0IA 4YUWA 2ZZNA 3UJ6A 2BM8A 2IFTA 5EEGA 3QV2A 1XCJA 3JWIA 4C07A 1KHHA 2YXEA 3LKZA 4DF3A 5LSAA 3K0BA 4RTOA 2PGXA 1AQJA 2R3SA 3B5IA 2PT9A 2O57A 3KKZA 3R6TA 3DP7A 4PIMA 1JTFA 4E32A 4P7JA 4E31A 4YMHA 5K03A 4L7VA 3OZSA 5GWXA 1VP9A 3DLCA 1YZ3A 3KQPA 3BT7A 4HH4A 2I6GA 5CM2Z 1JSZA 1VPTA 1OR8A 4AZVA 4YV0A 3I58A 2OY0A 3C6KA 3T7SA 1WXWA 3TKAA 3RW9A 1MHTA 1RJGA 2AOXA 3IV6A 3LDFA 3QOWA 5GP1A 3BXOA 2Q41A 3LECA 4YUYA 3GRZA 1EG2A 3GXOA 5E9WA 2VS1A 2VDUE 2ZW9A 3DULA 3KPVA 1JR4A 5B1SA 2OYRA 3PFHA 2AOUB 4GUAA 3WSTA 4PNEA 5FQOA 4X60A 1L1EA 3EVEA 3THSA 3BGVA 3F4KA 1ORIA 1JG2A 1QAMA 3UA3A 3NVKI 3GU3A 4CKEA 4KRGA 3FTCA 2EJUA 2GAFA 4OBXA 1SUSA 1D2GA 3KPWA 3BWBA 3BWCA 3HCCA 2ZWAA 3TOSA 5F2KA 2KW5A 2YTZA 1P91A 3PS9A 4PYLA 5E8RA 5U4XA 3PFGA 1FP1D 4KW7A 4E30A 1XCLA 3KPUA 3AXSA 3HCAA 3O4FA 3HVHA 5FQNA 3TFWA 3FYCA 4HTFA 5DRTA 4RTJA 3VC2A 2GA9A 3G88A 3M6UA 3DMHA 1L9KA 3HP7A 4KWCA 4YUXA 2PVCA 3HA5A 5KS2A 3C0KA 2P7IA 1XDSA 2EG5A 3CCFA 1NE2A 1B42A 1L3CA 5DTMA 5HFJA 1DCTA 1TPYA 1XVAA 5LQNA 1O9GA 5DX0A 3FRHA 2ZIGA 4EMSA 4BY9E 2GH1A 2HTEA 3GRVA 3GWZA 4RSRA 3KQVA 4EVIA 4IV0A 4YV1A 3B89A 2ZSUA 3DTNA 3EGIA 4BLUA 3QOXA 5BXYA 3ORHA 2AN3A 3FUWA 5LQJA 5GINE 1N2XA 2FK8A 3BGDA 3P9KA 3E05A 4P7FA 5DRYA 3FPJA 4QVKA 4XUEA 5FWAA 5F2OA 1VE3A 2BR5A 3I9FA 3KR0A 4CKBA 5KQRA 1P1CA 4YV2A 5K0GA 3NWEA 4OA5A 5GIOE 4KIFA 1VBFA 5HIKA 1R8YA 4LG1A 2IBTA 1UIRA 1WG8A 2VP3A 3L8DA 3IHTA 3PB3A 4PYMA 4QQNA 2OBFA 4U7TB 4B17A 5C9ZA 4QDJA 5E1MA 2FYTA 4DA4A 5MHTA 3G8BA 4OA8A 3O31A 5K8VA 1ZGAA 2PWPA 4IV8A 2PXXA 3NWBA 2AOTB 2NXJA 5ICFA 2AOVA 2PX4A 3LL7A 3Q7EA 1NW3A 3SGLA 1SQGA 4HG2A 4GOOD 5D1NA 3FPGA 5DXAA 3DXZA 1I1NA 1I4WA 2NXCA 2WA2A 4FSDA 3A27A 4MIKA 3KR1A 4ATNA 3DMGA 1JQ3A 1KPGA 4A6DA 2QRVA 2VDWA 2P3LA 2BR3A 3G2PA 1QZZA 3LCUA 5CCXA 5DXJA 4DCMA 3PTAA 4QPNA 2AN4A 3CJTA 3RIEA 5P8WA 4C06A 5DLYA 5EGSA 1IXKA 1RI5A 3SM3A 5DT2A 2ESRA 3M6XA 2AOUA 2IIPA 3CBGA 5ERGB 2HWKA 3MAGA 3MTIA 5HILA 2ZBRA 3PVCA 2IDKA 2YXLA 4EK9A 1ORHA 2AN5A 3TRKA 4C05A 4DM3A 2IGTA 1XDUA 4ER0A 3IEIA 5HZMA 3P8ZA 3C3YA 2B78A 5EQJB 5K0CA 5LQRA 3FUTA 3OCJA 3LKDA 3ME5A 2DPMA 3KQYA 4U7PB 2AOWA 3TR6A 2ZTHA 5LR6A 3C3PA 1P1BA 2AVNA 2OPBA 3G5LA 3DH0A 4P58A 3MGGA 4AX8A 4RTSA 2V74B 4FT4A 4F86A 1R74A 3EMBA 3HVJA 3EPPA 2GB4A 3FPEA 5CCBA 3UA4A 2OKCA 4E2XA 2CWWA 1SKMA 3MCZA 2B25A 3OE4A 4YUZA 1KYZA 5EOVA 3AJDA 5CVDA 5E1BA 5EMJA 5GOZA 5EMLA 4GOND 1FBNA 2FHPA 4P7KA 2GPYA 1D2HA 3JWJA 5K0JA 3ELDA 4PYNA 1Q0TA 4Y2HA 3TQSA 3VSEA 5KYGA 1R6AA 5IH3A 5HIIA 5K09A 1XDZA 2HV9A 3E7PA 3HCFA 3KQOA 4V0RA 5EIWA 1O54A 2XYRA 3GJYA 4IKPA 2G70A 4PYKA 4Z2YA 4AZTA 1FPQA 3BWYA 4CTJA 1YF3A 3PLAE 2Z6UA 2CMHA 2P3OA 4QTUB 5DM1A 3GCZA 2VZ9A 3EVZA 3HCDA 5E1DA 3FRIA 1N7JA 5EPEA 5K0FA 1KPHA 3G7UA 2PKWA 5K05A 3OZTA 3HCBA 2VDVE 4FSXA 3NMUF 3GNLA 2Z6AA 4FGZA 3NTVA 2P3QA 1Q0SA 3CKKA 2PXAA 1KXZA 1T43A 2UYQA 2A14A 3BZBA 3G2QA 4R05A 2PWYA 4RTLA 4QVGA 1YZHA 2IH4A 3EGEA 1ZHFA 4AZWA 10MHA 3C6MA 3M6WA 4HRAA 1MJFA 2ZIFA 1PJZA 2ONYA 3REOA 2AZTA 1KPIA 3A7EA 4RTRA 3G2MA 2AOTA 1NW5A 2O06A 3DXYA 2AR0A 4H0NA 4PYJA 3TMAA 5EC8A 3UJCA 4BP1A 3DOUA 1NBHA 1RJEA 3G2OA 3P97A 3THRA 2QYOA 3IYLW 1L3IA 1EJ0A 3VC1A 2O07A 3PX3A 3NW9A 5DM4A 5IKMA 5GIPE 2BH2A 5C1IA 4UOEA 1O9HA 2ORED 3FUUA 4E70A 5BW4A 4BLVA 2BM9A 1P39A 3KQSA 1JG3A 4GC9A 3G8AA 2Y1XA 3OU7A 4RVDA 5T67A 4DZRA 5F2NA 3FTFA 3LX6A 1TW2A 3TLJA 2PV0A 4G56A 4QTTB 1IM8A 4WVLA 1BKYA 2N47A 4RVHA 5E9JA 1IY9A 2JHAA 3HTXA 3SVZA 2PSSA 2ZVJA 1H1DA 3HVIA 1KR5A 1WZNA 1NW8A 2PY6A 3KU1A 4KVZA 4M37A 3EEYA 5D1HA 2DULA 4PGHA 3UJBA 4E2WA 5HIJA 3Q87B 2ZZKA 4FS8A 4RWZA 1XXLA 1JQDA 3B7PA 2G72A 3LSTA 4HGYA 5EKXA 8MHTA 1G60A 5LQAA 5LQCA 3B3GA 4R8RA 5M5BA 1JG1A 3KR2A 3FPHA 4NECA 5EHGA 1HMYA 3PX2A 4CWAA 1M6EX 3HA3A 4HC4A 4HTFB 5FCDA 4MHTA 5EZSA 1F3LA 2G71A 3DMFA 2FPOA 1DUSA 3I64A 4RVFA 1NKVA 1AF7A 4ER5A 1G8SA 5DM0A 2YQZA 3AWIA 2NXEA 3ELUA 2UZ4A 3RODA 2IP2A 3TM5A 3UJ8A 2PLWA 4F85A 1EAMA 4KDCA 4FR0A 4OQEA 3D2LA 2QY6A 4XCXA 2YX1A 4XUDA 5DTRA 2PJDA 1SQFA 3HNRA 5G02A 4KDRA 2BR4A 5CUQA 4ER3A 5HOQA 2P40A 1RI2A 1QANA 3LPMA 3UZUA 1R8XA 3I53A 2H00A 2XVMA 2NP7A 3EVCA 4X63A 5E9QA 3T7RA 1U2ZA 3DXXA 3H2BA 3R9XB 3ER8A 1M6YA 4GC5A 5CIYA 2ZZMA 2PT6A 5DTQA 5CD1A 2I7CA 3FZGA 2CL5A 4O29A 7MHTA 4EKIA 2QRVB 4C4AA 5ICEA 2P1DA 2IPXA 5DX1A 1YFLA 1SUIA 2OO3A 3NDJA 3KPYA 2FRXA 4MWZA 2FCAA 3E23A 5CVVA 3SMQA 3OU2A 4X41A 1NT2A 5FADA 2QM3A 2O05A 3SSNA 3TPZA 5E8JA 4GEKA 3KQMA 2CKDA 4PYQA 2OZVA 3MQ2A 1X1AA 3MCTA 3A7DA 2FK7A 3CJQA 4KIGA 5E1OA 5HEKA 2UYCA 2I9KA 3UJ9A 2B2CA 4LWOA 1F38A 1SVUA 2JJQA 2XYQA 4M36A 5LQUA 2IH5A 2PBFA 4A6EA 4YUVA 5ICCA 3EVGA 5KQSA 2WA1A 3A26A
chains in the Genus database with same CATH superfamily
4B3TB 2YXBA 3IPYA 5DTEA 2NO5A 2QGNA 1R9NA 3CIFA 2CNWA 3EQ6A 3N9IA 4GZLA 5LP6C 1MT0A 4TXLA 1RRVA 1VXOA 2E4AA 3QXJA 4G9EA 5TMPA 1DC7A 4K9MA 4CIYA 4IJWA 5BUZA 1Q0LA 2G40A 4LXTA 2C7PA 1UEIA 1W581 2ZWPA 4NIMA 2FUKA 3DYIA 3F2IA 1EHIA 3OTHA 1F8YA 2F3TA 1SCBA 1X7HA 4CCAA 3AF6A 1QAOA 1ST3A 1NMZA 3VZBA 2ZUDA 5FA5A 1ZK1A 2YZ2A 3COZA 3O6VA 3DJYA 4LJRA 4KOEC 5JCOC 4PZPA 5IKXA 2GYVA 1PR2A 3OHMA 4NWIA 4JAVC 1SB9A 3O8QA 4HPJB 4D8XA 4DNXA 3FNEA 4X1YB 2D3WA 2BFBB 5IDVA 5J5AA 2J3KA 3A4YA 4DCOA 3T1HB 1ORDA 4DR6B 1R5BA 2EFJA 3L7YA 3FOWA 2IDJA 2CFIA 5JZMA 4ISCA 2ANBA 2JLUA 3HI4A 2X4IA 4LVCA 3QX9A 1RAEA 2Q99A 4P2BA 2PSEA 4OP2A 1GG2A 3CZPA 3LY5A 1N2OA 1Y3BE 2H1LA 2PYIA 3B3JA 1QUFA 3RVNA 5EJ9A 1BOOA 2C4WA 1UPTA 5CW2A 1CVRA 3E3LA 1ZGHA 1VLVA 5B1YA 4OHCA 4NBNA 1V9SA 3OX2A 2R7MA 4R68A 1B6SA 1FE8A 5LZ9A 3K5IA 3V2UA 4C7KA 6ABPA 3FHTA 2ILVA 3W4IA 2PKCA 4DEVA 4J1NA 4BC0A 5LQKA 2YW9A 3NCTA 3H1AA 5FBHA 2J31A 3SWWA 5EKTA 4UM5A 4ZMBA 2I4IA 5ARCA 1NMQA 4Z1OA 1J8DA 3HWX1 3MWEB 5TE9A 5EXSA 1JKJA 2QD3A 4FU0A 4S1OA 3HEMA 3K9HA 2RH4A 4LHWA 5FO1A 1MB9A 4JCOA 4DCVA 4WUVA 2WMNB 5JJ5A 2H63A 1UKBA 3E82A 1RI3A 3ESAA 3MPOA 1C3OA 2VDWB 4MW9A 4E13A 3MWDB 1Z6QA 4HNQA 4R8SA 1HM5A 4J16A 4OHMA 4RYLA 4BZWA 1RZRD 1B7GO 1RYDA 4JT2A 3TUIC 4MTCA 1R3UA 2EX0A 2QKYA 4WKGA 1W19A 3DR5A 3F97A 3VGJA 2ORWA 5BW8A 5JQGA 3NVMB 1XZHA 5DO9A 3RSZA 5LOVF 5D5HA 3U81A 3HKBA 2IHTA 1Z34A 5LWHA 3Q6IA 1GU1A 4KN8A 2JC3A 1WUYA 3MW8A 4WY8A 5IHXA 5K0SA 1R0YA 3CKLA 3INTA 1TVCA 1X0XA 4ZEWA 3URMA 3MEQA 1FFWA 4WFIA 5FWXA 3WWEA 5JD6A 3PD7A 2Q1SA 4PQEA 3QH4A 3IVRA 4ZOLA 2QSJA 1N8SA 4PN7A 5I7UA 1Z25A 1ZI9A 2GEFA 3FIUA 1HY3A 4PTLA 1DDGA 4QJIA 3EIEA 1M5UA 1QMGA 1WQ1R 3TZBA 1SB8A 1C3JA 1K3UB 3GEDA 4GYWA 1WKBA 4FZVA 4IHQA 4QFDA 4QQRA 3M4XA 2NW6A 3FJOA 5A9SB 1E9FA 2BLNA 2B34A 1ICIA 2VQ6A 4MQMA 4WA8A 1B15A 1BXGB 1EVZA 2B4QA 1LPBB 1LJ8A 1YL6A 2XSZD 3OX3A 4AIIA 4BP3A 2XODA 3Q6MA 1TQDA 2QQEA 3A3OA 1OYVA 3G2IA 3PP8A 3KD2A 3QENA 3BRQA 4D3SA 4A0QA 4EQZA 2BMFA 1AS0A 1DKNA 2UKDA 2POQX 3COSA 3WGZA 5BXYA 4D0SA 4ZDIA 2OM2A 4UU8A 1Z8HA 5HW0A 1N1MA 3U80A 1DRKA 2TMYA 4XDZA 1RJFA 2IYVA 5DCLA 3EIFA 4MIYA 3NXSA 2G5PA 1OOEA 2VJYA 1C0KA 1TO6A 2VYQA 1IG3A 1T1EA 3AIMA 1F4VA 4GI1A 5NLLA 5CDGA 4ZYUA 621PA 4F91B 1D4AA 5A05A 4LHVA 2HBQA 4BMYA 2OXTA 3M3DA 1SKYE 2PS9A 3B60A 2X13A 3KXKA 1PL7A 3N07A 3SEFA 1JKJB 4BO6A 5JZVA 4LY6A 1LD3A 3GCDA 3SBOA 1YE5A 5BMOA 2EAUA 4QYXA 4GOKA 1UT6A 2Y99A 2PZJA 3EAGA 9MHTA 1ZJJA 5BN4B 5TT1A 2QZJA 2VF8A 1LGYA 4BFVA 1GUFA 1N2JA 1T9ZA 3BJEA 3THYB 3PFFA 4QELA 3P52A 1GGFA 1D1SA 1W59A 3HHPA 1OZ0A 4MUMA 3OJFA 1HKUA 1I0LA 4MRPA 3ZEIA 5EMMA 5L7TA 1IQ0A 4NFLA 4EHBA 1ZKDA 4UHBA 4YK7A 1Y48E 2FG7C 3LX8A 1JSRA 1RWMA 1L0BA 1T1IA 1YB6A 3MAJA 3W6UA 1U1GA 1NIJA 5I7WA 3Q41A 2PU7A 1PTJC 3WB2A 2QP3A 3T0IA 1X7YB 5EHNA 5AKHA 2J3EA 3IPXA 4YAJA 2Z2KA 2YBDA 3OMXA 4DF3A 1QGDA 3EVTA 1RC0A 1Q2UA 2VHXA 2ZIXA 5F4ZA 5TQ2B 4I0WB 4CL3A 5ITVA 2QMYA 5TLSA 1TK2A 1UDXA 4DIBA 3GL9A 4EMTA 2D0OB 1CUAA 2C2HA 3S70A 5K4AA 1G59A 1NOJA 3BWVA 2AMVA 4Y2GA 2ISSD 3FZNA 4BFXA 2WB2A 2CGEA 1BWSA 3M4JA 3ANTA 4B3CA 1ZGZA 2GCPA 4LY3A 3F8TA 3FRJA 3CZAA 1G1AA 1VA4A 4K2HA 4U2CA 1Q3HA 1DQRA 2QUKA 3C16C 3KZ1E 4AAYA 1L1QA 1OILA 3JAWA 2NYVA 4B0PA 3QKIA 1AUQA 1LH0A 5IVHA 2WJ6A 3IIIA 4NC9A 3UGTA 4E94A 4FJ1A 5HGJA 4DWOA 4ZN6A 1OFHA 1OX4B 3GUHA 3WNZA 1ORIA 2RGXA 3IIEA 3L4BC 2BDUA 4KQ1A 1VSVA 1Y7IA 2FLKA 2PZLA 4X6UA 1CEYA 3D3WA 4RPIA 5AOAA 4NE9A 3SMVA 1GXSB 1SVWA 3TMKA 2XMQA 4GRDA 4DIOA 2WYHA 3FVVA 2ZUFA 1UR5A 2B5VA 2I8LA 2Z57A 3EZFA 4OHUA 4NNJA 3AXSA 3HCAA 3S8MA 4ETMA 1E3MA 2VHCA 5ILGA 3QI2A 4PYRA 4YLEA 1JHYA 3W2EA 1K5PA 1C9EA 2I71A 3AX6A 4WX2B 4ZYLA 4RQBA 3UHPA 2EU8A 5L4SA 1QU2A 1EK5A 1Q7RA 2FSFA 2ZRHA 3HJRA 4DANA 3M7IA 4HCJA 5DWVA 4JSYA 3LAWA 5UKDA 3K4PA 1UWCA 4FEAA 4TQAA 4TYQA 1FRQA 3EJ6A 3GA7A 5B6JA 1O8CA 3GRVA 1U28C 4HMPA 3IXQA 1XMIA 2REXB 2VDLB 4G25A 1J42A 1O95D 1OY1A 1PEAA 2W58A 3MGBA 4Y2RA 2FNAA 2GKOA 5ER9A 2FMTA 1MX1A 3W2TA 1RBMA 1LDNA 4ZK6A 2Q7DA 2JAXA 1L5WA 2BKUA 4RENA 1X92A 4LZLA 4GLJA 1IJKA 1Q0RA 3L7CA 2WY2D 1K6XA 3AF5A 4NABA 4TMTA 2XQIA 3X1JA 4EHIA 1BWQA 1OXTA 2XDYA 5BMVF 4BHTA 1C1XB 9LDTA 4EQ6B 1QV9A 3AYZB 4I6EA 3UPTA 1KH1A 5F9FA 5CH8A 1OWMA 1XL0A 3OOEA 3FOCA 1TMKA 4ZT6A 4P0PB 4HXGA 4LQCA 1M3SA 3QOFA 3QVWA 1GTMA 4AUNA 2PWPA 3RFXA 2JJ2A 2WSSA 4P5EA 4FMCB 1WZUA 1XT6A 2HB6A 4HQOA 3GLIA 3H2HA 3P26A 2XF8A 5C81A 4UHJA 5I51A 1ID8A 1WIWA 4A8JA 5KO2A 1W2HA 4G5XA 1BGWA 2I2WA 3U49A 3VZQA 1RIIA 1X38A 2C1EA 3UWDA 3FFXA 3WZLA 1YRQA 3I9V1 3IUPA 4D96A 3SAJA 3A27A 4DCSA 4NMHA 3UV3A 1CRPA 4EY8A 1JFVA 2ID7A 5E6RB 3E35A 5AVSA 3L02A 3IFSA 4D6PA 2ZANA 5IG2A 4GDFA 3IQDB 4Y2PA 1VG8A 4YQZA 3ZDDA 3LQKA 3JASB 4U8HA 3VTFA 1TCBA 1YVPA 3P0JA 4QOGA 3PYMA 2PG3A 3DT9A 3IO3A 4HEQA 1H3EA 1ZMTA 4TZ0A 4JLAA 4BUCA 1UFVA 3SEQA 4TWRA 5HEKA 3GR6A 3R5SA 2HEIA 1E0JA 4FGWA 1KS9A 4B0OA 2E4VA 3F5DA 5CBPB 2B6NA 4IGFA 4IIVA 3NBYC 3JZFA 3R3VA 4KIUA 3RUAA 3IE0A 1XQXA 4O4IF 1I5RA 4G86A 2AOWA 2Q9AA 2UDPA 1HFWA 4MWTA 3PU6A 4R1OA 4AX8A 2ZI4A 1UODA 1NP7A 2E3JA 4IJVA 3RAFC 1VKOA 3H6HA 2RCYA 5BN3A 3MINB 1SAYA 4HWSA 1NN3A 3IDAA 1MRZA 3QX7A 4JYZA 2N0SA 4E5DA 1SKMA 1O58A 3BD8A 2B5OA 1UK6A 4BO0A 1JBEA 4YGYA 2Z8YM 3FOAA 1CUHA 5IKOA 1C5KA 2WIBA 2DP4E 2XY4A 5ALKA 1YS2X 4B76A 3ELDA 2P6RA 5KYUB 3M83A 1ONNA 2A1IA 5JIBA 2QPOA 4Y6SA 3DDCA 2QMQA 4NU6A 3S4YA 5IZCC 1XTRA 2ZDGA 3GRCA 4F1KA 1TCVA 2G70A 2WSBA 3TNFA 4BC1A 1YQTA 4GI5A 4HWPA 1EVJA 4URUR 1L5HA 1NT4A 2ODTX 3SZRA 1ZUNB 1F51E 3N3AC 1DQNA 2VT6A 3NG1A 1KARA 1AZSC 1O97D 2DCUA 3TX6A 4I8DA 5DU2A 3T5MA 2D2VA 4CKBB 2SCUA 1G5IA 3DO5A 2YJ5A 3T6KA 1HI9A 2R8ZA 2XHZA 4LJYA 5DIZA 2UUBB 4BX3A 1F3OA 3OZTA 5HXAA 3USES 3O2SB 2JAHA 3BE8A 3C5VA 4GMFA 4FGZA 1QIHA 1VHDA 5K1ZA 4BNTA 4EKGA 4JLKA 4JVMA 3B20A 5BRAA 1RKVA 2XUKA 4QVGA 3OPYA 2I1VB 4URFA 2VSFA 3K96A 4HD8A 1E9EA 5HOEA 1TRHA 1OGJA 3ECSA 1Y3DE 2REQA 2WJJA 3KV1A 4HQLA 1TF5A 3K0AA 4KXUA 4WNAB 4KO8A 3N0WA 1MAAA 2H7XA 5EWMB 4MV4A 1SC4A 1E79D 3ESQA 4LIPD 1AZLA 1T9AA 3QPBA 3TNDA 2R79A 1XX6A 1T29A 2G4LA 2ZYTX 3EODA 2OYSA 2BELA 4DQXA 3F8SA 2X0DA 1K4YA 1ND6A 4EI7A 3W2HA 5FEMA 3NATA 5KC9A 3QBEA 1Q3KA 1S2IA 4PICA 4KN9S 1Y6RA 5IDWA 2DFDA 1G3IA 1ZL2A 3G5MA 2ECPA 2VYFA 2A86A 4H0FA 5HZHA 2PA0A 4F11A 3Q3VA 5H9VA 1YA4A 2HDOA 4OK6A 2RI6A 3ZDXB 3W2IA 3KYCA 1ML4A 3WV5A 3KTAB 2DFLA 4OOEA 3FUUA 2QW1A 2WSMA 3V8NA 4UTRA 3ST7A 1BFKA 1UK8A 2BM9A 3PIDA 4L6AA 4DVGA 1V3UA 1E58A 4C0KA 3QTTA 3VHRA 2BI7A 4E46A 4G56A 4KKVA 1BKYA 1H42A 4RVHA 2JAWA 5KOHA 2A1TS 3SVZA 3VHQA 4QODA 1A8HA 4L57A 4NRDA 3Q8WA 4TL9A 3UM9A 2IOFK 1OHHA 2YN2A 2G82A 1OYWA 1GPDG 2C04A 2QORA 3BEDA 3NI2A 4UNNA 2CLDX 3EN0A 3UQYS 3OTWA 4JJEA 3QYJA 3OC0A 1T4GA 1JDBC 1QNLA 5BRNA 5DGTA 2X2FA 4XIJA 1NF3A 2C29D 2HQRA 1GSIA 1CQJB 5B6PA 5KQGA 1P4SA 3M0EA 2EQBA 2ZJBA 1OFGA 1UINA 4NMWA 1XL1A 4NOKA 4TMXA 2G71A 3AO0B 2XWPA 3F7TA 3ZZ1A 1DARA 2FPOA 2JLQA 2QHXA 3N86A 1H6DA 1ZNWA 1TK9A 1XLTC 3NDRA 3NNDA 3OJXA 4JSTA 3T5CA 1Z8DA 4EYQA 5JYCA 5ESRA 2FEAA 2Z8ZA 1UBJS 3AF0A 3TM5A 4CM9A 2HZ7A 4QG3A 3M1IA 4F3TA 5HQ3A 1T5SA 2Q4OA 2JI6A 2O2SA 1MAUA 4XCXA 5IKEA 2XWJI 4XUDA 3IOMA 3PUIA 1MDBA 4CV1A 2JB9A 1XMJA 4B3HA 3DO6A 2M32A 2VZLA 5K2MA 4H27A 1X7DA 4XOIA 1IXYA 3K32A 4GAEA 3CX4A 4NICA 2HA0A 2XEDA 4M46A 4M9UA 3S2IA 5E9QA 2XE6A 5AMXA 1MJHA 3W6OA 1MB0A 1ULAA 2BFDA 4RY0A 4U39A 2XNKA 2LE0A 2YY7A 4LYEA 1Q7TA 2CMKA 4LKRA 5IT9A 1VHQA 3FNGA 2ZTSA 5EHXA 1JR3A 2ZRFA 3WJAA 4C4AA 3AVVA 2P68A 1GPKA 1UMCA 5HCNA 1JF8A 4LDQA 5BR8B 1FLDA 1M2FA 1ZFNA 1HO3A 2VFAA 2J0UB 1IBCA 2YIVX 4FPXA 4F96A 4AY2A 1X42A 5CNJA 4QIHA 1GNVA 2QTRA 4GEKA 4II7A 3SIWA 3V1TC 3X1XA 1RW4A 3CR7A 1U28A 2XYHA 3OM8A 1XN4A 3EA0A 3TCXB 3WOVA 3MJVA 3OX4A 2ECFA 2IEBA 1QFZA 2YFYA 4UUPA 3SYKA 4Q3DA 4TQGA 5L6LB 2NMVA 4UM8B 1KBQA 2GO1A 5ELLA 3I6IA 2ZAOA 3MUNA 3OFND 3IOCA 3DTNA 4EJ0A 2W2LD 2E18A 3L7BA 5EUBA 5HMMA 4BO1A 1QVZA 1JEEA 1A7UA 2EFDB 2JIQA 1MIOA 5FF9A 5JSHA 5J2TB 5CTAA 1VL5A 4X8MA 5K0NA 1LQ2A 3CF6R 3EW7A 2HHHB 3MYYA 1RXWA 3PHHA 1R00A 1P77A 1J1IA 3JQ7B 3NDPA 5C1OA 3GFVA 5HJEA 5LZ4A 4OGGA 4ZAWA 1DFHA 4L5JA 3DYBA 3T3PB 3GRYA 3O1JC 2JJ2D 2WSSD 2X8BA 3FYUC 4GUDA 3UJDA 3UKDA 4JYAB 1ZN2A 5D3ZA 4IQFA 2PIAA 5JV5A 1ZVMA 2GPAA 1P6QA 3ZBUA 3O8RA 3SC2A 2VHUA 4Y1GA 4IWNA 3IBCA 4C0LA 3WMRA 3KALA 4M83A 5AUNB 5ISMA 1EE2A 1KOFA 2QN9A 3RLIA 4QT4A 1E1DA 1AGPA 1NI5A 4EITA 5CA1F 1A0OA 3WHIA 1EU1A 1P7YA 2H3HA 5EVCA 4AY4A 4BNUA 4B3MB 2X6QA 4I1SA 3GUUA 5K6TA 3UCXA 2PL9A 2R47A 1Y98A 2Q3FA 1R8SA 4RMHA 2YWJA 3GIWA 5D87A 3TLEA 2WZDA 3OE5A 2IZ5A 1UBHS 2OSVA 1H65A 2XJ4A 4U63A 821PA 1O8BA 2FSSA 4D3DA 2CHVA 5HTOA 2NV2B 2VNSA 4IXTA 2DJIA 1DEXA 5KSZA 3G68A 3F2VA 4JU8A 4PGGA 4ZVLA 1T0BA 2DHRA 3GP5A 4YH1A 2Q3BA 4DADA 3AVWA 3AG5A 2I6FA 3ZHYA 2NUTB 4BTVA 2YRWA 3KZCA 3JATA 5JSKA 3VPBA 4EZIA 3IEVA 4U7JA 2HSZA 1NQWA 2QQFA 3UXMA 1N0IA 4DSUA 3TO5A 3LCVB 4TXJA 1LQTA 1MRNA 3JQGB 4GSLA 5A3QA 2PAFA 1O2DA 5E2AA 1NVFA 3CLTD 4OUDB 1W8DA 3TAXA 1J2TA 3OURA 1TYAE 3WQQA 3A0RB 2VF7A 4R3WA 1BE0A 1SUFA 1ULTA 2AKAB 3WOHA 3BZWA 1Z5PA 3M9WA 1YMVA 4ETWA 2CLKB 3C3DA 3LDGA 4MV0A 2HL6A 4KDFA 3EXHC 5JZ9A 1XTSA 1PNTA 3FNHA 1YGPA 1UL1X 4PIPA 1XOIA 2XUOA 1GYQA 3PPWA 4TRMA 1AHPA 5BUQA 4BVKA 2WWHA 4HWTA 2VWHA 3HKBB 4RJLA 1IQRA 5KNBA 1V16A 3K73O 2AWNA 3ZIUA 5KSWB 1XZCA 2ZJ2A 3C74A 3O90A 2PSFA 4UVGA 1P8AA 3TWOA 2CK3D 3C7AA 3HU5A 1U0NA 3G0HA 3ID6C 2J3IA 1YZLA 3QUSA 3SLKA 5IT4A 1SNYA 3V33A 2DF8A 4GBJA 4OXNA 1QLJA 1N6RA 3SI7A 3R7BA 4AJNA 3RV3A 5HQTA 4B40A 1JR3E 3U37A 1NVTA 1YCGA 3I92A 4IDCA 1DS6A 3ZW8A 2JDIA 4OFWA 4R1PA 3BREA 3N8NA 3PFCA 5E7JA 1GAEO 3MS7A 1FSFA 5JMWA 3OI7A 4OMFG 1JIUA 2XWBF 3MXOA 2TMGA 3ORRA 4H3SA 1YS4A 2XBLA 2P11A 3G9UA 5CFMA 4M1OA 1BVYF 3LBIA 2QVLA 3GGJA 4RY2A 4R9UC 3EXIA 3A4TA 2GEDA 4BTEA 5A6SA 2GZSA 4E6PA 5JXGA 1LRLA 3KDPA 2W2KB 2A30A 5THXA 1KDZA 1D2AA 5G1PA 4ARZB 1QIDA 3PQ5A 3X1WA 4A2PA 2BFMA 4KQCA 3ASVA 3LCRA 3DFKA 3CO0S 3PNBA 2AK2A 4I1RA 4XAQA 3SSMA 3VOTA 3ZQJA 4MB2A 2X7XA 1AKMA 1LLQA 1X39A 3BWMA 4O4LB 1CERA 3K0SA 1JA0A 3PPVA 1Y9DA 1Z7EA 3HA2A 4YR9A 3PV0A 2EZTA 5JSYA 1NYTA 3UOWA 5BW5A 3E2IA 3QBVA 3S2YA 3OEWA 3AUAA 2XMCA 3FDIA 4B2LA 1N0UA 5ALTA 1P4HA 3DKPA 3EZ9A 4CXMA 1UP6A 4R1LA 5ECGC 4L8YA 4TS1A 3TIGA 1G6Q1 1B8PA 1RQRA 2JK0A 2JHCA 3KYDA 3DAYA 4QTZA 2WVGA 5LYYA 1DPGA 4D4KA 2ZFUA 4KACA 1ZJ4A 4L0MA 5CR9A 2EWWA 3RS9A 1SD2A 121PA 4YAKA 3AEQB 4GNKA 3TRDA 1KFCB 3V4LA 2IC5A 3GFSA 2Q2VA 2MSEB 1GRVA 2Z09A 1NPDA 3I28A 3NB0A 4TLAA 2YJNA 1P5HA 4TLDA 4Q7JB 1TEHA 2R1TA 3G7SA 4KRFA 4P54A 2ZWVA 4WQMA 1AKEA 4JBXA 1SZCA 1AN0A 4FP9A 4DE5A 1Z07A 1PEDA 2Y66A 4C2BA 4GOLD 4OGWA 5JQGB 1QRTA 2ZZNA 1G55A 4C5CA 4YWJA 1W34A 3FZQA 2A5FA 3NT2A 1KAGA 2MIIA 2PZKA 2G7MC 1G9TA 2HBYA 3D8NA 3LG2A 4JT4A 3RBZA 3LWNA 5DLDA 3OTOB 3PA6A 4KBFA 5HK8A 3PXDA 2A9JA 1WOMA 4II3A 1N2SA 2QRLA 5LZ2A 3R74A 3AHCA 4GNRA 1WZEA 1RABA 2CFTA 1VP9A 2PRSA 3PG5A 4JOQA 1LPNA 4HH4A 5AP9A 4FD3A 5GV7A 5TMBA 1VL8A 3L5KA 3ZYZA 5AVXA 5WRFA 1JR3D 1NKTA 2GO7A 1QUEA 3T7SA 3AVQA 5HK9A 3L46A 4J0EA 3H8VA 1G5PA 1K2VN 1KSHA 4YUYA 3ZWCA 1QJ4A 2W0SA 1CP2A 1TZ2A 3DULA 2ZE8A 2RSLA 3RT7A 3D5EA 3JQ6A 2AOUB 4HP8A 4M1SA 5TB5A 1EB9A 2KQUA 2YY6A 4I36A 1CZOA 1K7YA 1BQ3A 4B6JA 3ZVKA 4HGRA 1GQQA 3USCS 3OIUA 3ANNA 1QHIA 3G2LA 1HOXA 3MS4A 3Q7RA 3BWBA 2F1IA 5B4VA 5F2KA 1SCAA 5K6AC 4YP7A 3FFTA 3VSCA 1NBMA 4EHHA 3U1TA 3BQ9A 2NX2A 4EA7A 2RJOA 2JJ1A 2AGVA 1OV4A 1ZAYA 4ZT3A 1L4UA 2XI4A 4RTJA 1CFZA 3VO2A 4JBHA 1J0BA 5E6UA 4F4UA 3T35A 2XCOA 5KOIA 1ZNZA 1G8GA 3F6EX 5KS2A 1RLMA 1M0WA 3QWIA 1UBMS 3TL6A 4HLCA 5B4UA 2QN2A 4RH1A 3PEEA 1B23P 3T54A 2Y4NA 3WLEA 4EA8A 1F2UA 5EMNA 4CCSA 4PLVA 2E48A 3SZLA 4KQGA 3DBHA 3FRHA 4UQPA 4UULA 2GZAA 3UC9A 1ZCFA 5E6SB 2V7TA 4LYFA 4CEIB 1IDOA 1P6XA 1JAYA 3A1EA 5ES3A 4EVIA 1HEIA 2OCGA 2BMDA 2Y27A 3CUTA 3GOQA 3R7NA 4DUGD 5IN5A 3FCEA 2HJSA 1H69A 2ATIA 3ZI7A 1XAJA 5D3KA 2ABWA 1U7ZA 2PKQO 4HNSA 2IU6A 4RPGA 2DSTA 4Q9LA 4YAIA 5JI2E 1U5BB 1ZJ5A 4LS3A 5HKAA 1K7EB 2FPPA 3FPJA 1GR0A 5B2ZA 3T9EA 1ORTA 1I3KA 2UYGA 2OV6A 1G5RA 2R2GA 4A0FA 2YV1A 2AEJA 4QJ4A 3SJUA 1GTG1 4DPLA 2GZ3A 2R6CA 4LG1A 1H6BA 1CS0A 1VG0B 4OLFA 4LDZA 4M8NE 2BZ1A 4N7BA 4PYMA 5F21A 3TW4A 5E1MA 4Y6OA 2WWRA 2CSXA 1P2FA 3PNVA 3BDVA 3KV3O 3FI0A 4IV8A 3ZVMA 2IEGA 5EJ8A 1EP9A 2RKOA 1NE7A 3L18A 4CL0A 2NXJA 1Q1ZA 3IQIX 4RETA 5AI0A 2O5RA 3OKFA 1GEEA 1L7RA 2SKDA 4YACA 1ZYUA 4POAA 2C4UA 2OWEA 2SKCA 3L82B 3CE9A 4DJTA 1V5EA 2A7QA 3ZTTA 4HAIA 4F5ZA 1IEVA 5KUTA 5HKBA 1VDMA 3CCBA 1A88A 1XAGA 3ZLUA 1NULA 3LCUA 5JMPA 2EWMA 2EFGA 4URHA 3BHJA 4HZGA 1ISSA 1PWYE 2OHVA 1Y1LA 2XD4A 3E8XA 3IGFA 1OASA 2KS6A 4B73A 1C9MA 4R40A 4ZU6X 1DJPA 3PNYA 4C43A 3GEPA 5HILA 4F2HA 1FCJA 1SR8A 2ATCA 2IDKA 4YRKA 4A4DA 2HKIA 4MKXA 4ZYVA 5JFGA 2IF2A 3PNKA 2J9RA 5CD9A 1RVV1 2QG6A 1OIVA 1KU6A 1RSZA 1ZIDA 1LK7A 2NM0A 2NUPB 2CZGA 4P3PA 3AERB 1REQB 4DA9A 1FMJA 2G09A 4KUEA 2V74B 4DCUA 1ONSA 2YWDA 3EMBA 3E3NA 3U7JA 3OZEA 2PUVA 3IVCA 3UT5B 4HZIA 2G9NA 1KI4A 1N6IA 3E58A 5LBTA 4BFCA 2E5FA 3KJFA 5FBZA 5C1BA 1YGYA 3NHYA 3TSCA 2B82A 3FR7A 1ECPA 2LDXA 5ER6A 2DTEA 2PVPA 3ND5A 4KIJA 4LY0A 4EY7A 3AVXA 4IFIA 2GPSA 4LK2A 3ER6A 1ADJA 4J0CA 2HLHA 5EPOA 1I8TA 2OD7A 3KHSA 2GBFA 2IU4A 3GB9A 3HCFA 4Y67A 1KRXA 5CNIA 2L2QA 5K99A 1G21B 4RHXA 3IJ5A 1NYRA 5AVQA 1SY7A 3I5XA 3T3IA 2Q0HA 1QIFA 2NADA 3TQHA 2I33A 4WNIA 1GZ3A 1MU0A 3PLAE 1HDYA 1C14A 3UVEA 1YZKA 4EP1A 5DM1A 1Y8QB 2IELA 1USIA 3HCDA 3ND8A 5B3JA 2PQ6A 3GAFA 1QG0A 3QW2A 2VK1A 2XCLA 3H86A 5GQSA 2P9HA 2Z5GA 4EIWA 1U2GA 2ZXFA 2O2HA 1TA9A 5DN9A 2WVAA 3OBIA 2BW0A 2D7JA 5B1HA 4DMMA 1TT5A 3HLKA 3KK0A 4EJFA 3AEKB 4NZZA 1R6UA 1T43A 3QFFA 1W6UA 3DMNA 1T2CA 1F8FA 5BSKA 1UP7A 1A4UA 2X8JA 3E70C 3FX2A 1DVRA 1OLOA 2I76A 1NR7A 2NSHA 3CF2A 4MUGA 3DMTC 3JWPA 5COBA 3BE4A 3RG8A 4B4WA 3AUJB 3YASA 3LLUA 3DV0B 3WLPA 5B12A 1Y4AE 2ZK7A 3ONEA 2BJHA 3G2NA 1R10A 4PM4A 3U2QA 1TECE 1ESEA 1XG5A 1AXRA 5SZKB 3RU2A 1YI8A 1E2QA 1KORA 2WAOA 5EYPA 1ADFA 1HWYA 1K63A 2V7WA 3PDIB 4OP3A 3W8EA 3ROQA 5D01A 2WW8A 1LZLA 3PEWA 5JT1A 1JPJA 4XWOA 3BMQA 4IFEA 4GPD1 4KXYA 1JXAA 4LYJA 2QR2A 3JARB 3THRA 1V26A 2QYOA 3IDFA 2ID4A 1HDIA 3IYLW 4KV9A 1GPLA 3NKVA 4DSOA 1MA0A 3I4CA 2Q4RA 1ULBA 5C52B 2OVBA 1XRRA 5DM4A 3RYCB 2LKDA 2HHCA 3NR2A 3WGNA 4OV6B 5C4MA 3ITNA 2QE7A 2QJFA 2WPNA 2A35A 3DTYA 4O8ZA 3RRJA 4E70A 1Y9AA 2WJIA 3KQSA 4EECA 2PWBA 3PEFA 5DYYA 1DSSG 3W5UA 3LRPA 2IKQA 4OI2A 4P8RA 1A8QA 2HMWA 2PS0A 4CNBA 4ZI7B 3DD1A 1XN1A 3VO9A 2YV5A 2V7VA 2FX3A 3HVIA 2NVOA 2DQKA 1C4XA 2WWXA 1TCUA 2B4KA 3IXMA 1CPYA 3OUTA 2BFFA 1DWUA 1WXIA 3Q3JB 2CXRA 2ORVA 4FFNA 2JIZA 3B7PA 4MR8B 3F98A 1T3HA 2PTHA 1KOGA 1E2DA 4QNNA 3RYIB 4L16A 3DAHA 1NXOA 5JAZA 2XGGA 4TMWA 3VXKA 3ICEA 1FDOA 3ILVA 4FC7A 2XADA 2XT0A 3KQKA 1JQKA 5A4DA 2BFBA 2OV1A 4RS4A 4EG8A 1KYXA 4R8MA 4JFRA 4XD7D 4ZAFA 5JCOA 4GP7A 3V8MA 4A2CA 2GHRA 1JFFB 3NHWA 1M8JA 2CB0A 2XXAB 1DZIA 2UZ4A 3K0FB 1S96A 4LNAA 1OFUX 3IUQA 4RVCA 3S40A 1I7QB 2GBPA 1RZ3A 5DNDA 2B0CA 2YX1A 3C5WP 2PJDA 4K40A 4MYHA 3SX2A 5M29A 2B8WA 4K9PA 4N0PA 1MRSA 1X3SA 4RHYA 1T5IA 3E7WA 5DOVA 3RYFA 3BMNB 2YH2A 2H00A 3BZUA 3ZZNA 3NXKA 1PJCA 2DQZA 1FW6A 2GA8A 4BU0A 5KYWB 1EFVB 2XZOA 1V47A 4GC5A 4S3MA 4YXWD 2WQ7A 1MW8X 2XGSA 2I7CA 1E9BA 2AHOA 3VI4B 4ERNA 4GS5A 7MHTA 4BLQA 3DKVA 2AFIA 4FFBB 4QO8A 2XOXA 4WL0A 1ZGBA 5D84A 2EP7A 3G13A 3RYTC 3WMXA 4B84A 4BWYA 1CUUA 3N2ZB 4Q37A 3EPHA 3KPYA 1I2AA 1QOQB 3KTFA 3O0DA 1I4EB 3K4HA 1WXHA 2ZJOA 4MV7A 3KVRA 1HRKA 4PYQA 3MQ2A 1X1AA 1TCCA 3ROEA 3TFOA 4LXHA 1K8ZB 4JBIA 3OQOA 2RD2A 2IYEA 5G0UA 4K6OA 5LQUA 4F4FA 4TQUS 3EYWA 1U7UA 3UT0A 4G4IA 4ZHQB 4W5TA 3O21A 2B8TA 4CL8A 1A77A 1Q1AA 2BONA 4PBTA 3P4XA 1OBVA 3DOIA 3GA0A 1OVMA 2FQQA 5FPTA 1W5SA 5KJFA 1D2MA 1XEXA 2HV8A 4L2IB 4UXIA 1ZH8A 2JG3A 1U63A 4LMRA 3O8DA 1A9PA 1NQOA 4DV3B 4EPRA 2R1TB 2H48A 5K01A 2IIQA 4LZAA 4TVKA 5BWOA 1RFGE 2F1OA 3EIUA 3QWHA 5CX4A 4G5YA 4HO1X 2C61A 2JHFA 2OORA 4HX2A 2Q3MA 4C04A 4YRAA 4B35A 4S35A 3MMNA 1T3SA 1T6ZA 4YN3A 1XEAA 3OT1A 2XITA 2GVZC 4B2PA 4DHWA 3VPAA 5KTPA 5J1SB 5J2TA 4ALJA 1NFRA 1Z37A 3LHKA 3GZNB 5HX7A 5LL6P 1VJGA 1RLUA 3IR6A 4FFWA 3F1KA 3VYWA 1HFJA 3S2SA 2WP0A 3FM9A 3IIKA 2ODAA 4ND6A 5EA2A 5G41A 4HL6A 1GARA 2JKVA 1OV6A 3SSOA 5JFTA 1PSDA 2YS6A 1M67A 3DE0X 5JU6A 4P3YA 4A27A 1P5RA 4DIUA 2IOQA 2REQB 4XX0B 1DEAA 1TUBA 2JVIA 3FGZA 1JXOA 1QMPA 4NAUA 3FUCA 1S6YA 1XZJA 4DDVA 5HE8A 1K5HA 4Z4FA 3H4VA 2PGIA 1YU6A 3NQ41 5F5XA 3VJMA 1LX6A 2A1UA 3LUFA 3U3ZA 1BCRA 4Q9AA 5JD3A 4CG1A 4DLBA 1KP3A 5DX8A 4DC9A 5J2UA 3FXAA 5BWCA 1NUSA 4EFNA 2VT2A 3I2JA 5BSFA 4AIRA 1VBNA 2P4EA 4FCCA 4QICA 4V2UA 5IDXA 5KYVA 4PV7A 4HQ6A 2IQ5A 2HR1A 1PWEA 2WUFA 3ACCA 2DBQA 1KWGA 4CGZA 3REQB 2IBSA 1QCDA 5EJFA 4HSGA 4TKVB 4TTRA 5KTNA 1FUUA 1XA3A 3QKRB 4MEJA 5MN4A 2VTBA 2PWAA 3DD5A 4L8LA 4M0DA 1S2OA 4YYZA 3CNHA 4KKXB 4CLEA 1K68A 3VKHA 3ANLA 4YHBA 3ZXUB 2B1IA 3RIGA 5ALZA 3CIOA 4JJKA 5C8YF 4RX1A 2XVAA 5DTIA 4CT0A 3Q3EA 1DWQA 1U0HC 2BEWB 2I5PO 3VTAA 4RTNA 2Q2QA 1DQSA 1YVUA 5ALHA 1V1RB 1DCKA 3ONVA 4RM2A 3WBKA 5I7OA 4UFOA 4ZJYA 5CVUA 3HBMA 2P78A 3K30A 3EB9A 3JQAB 1C81A 1R0RE 4GL2A 3FMFA 3DUWA 4KZPA 1NXQA 3HMQA 5GM2A 1O95C 4H4EA 1EQUA 2IXDA 1OD6A 3BL8A 5IAOA 3EPLA 1X19A 1GJRA 1EGMB 1NBIA 2BI8A 3AKDA 1X8KA 4BGUA 2CVPA 4F3CA 4TTIA 2M6KA 2ZG6A 2W6ID 1XQVA 3K92A 3QXHA 4K5QA 1H0KA 2XNSA 1HE8B 3C4JA 5L3SA 3VJRA 2EP8A 3BH7A 2B83A 2JIMA 5L9AA 1Z56C 2EDCA 3BK2A 4G1FA 3HBFA 3IKTA 4DR7B 1LWNA 3OO1A 4HB0A 3WXMA 1IRIA 2R6ZA 2PUTA 1K0UA 2FN7A 4IDNA 4CIXA 5B1DA 4XJTA 2QNIA 5GJWC 3BERA 4HEA6 4LWPA 4Z9FA 2YC2C 5JJKA 4R2IA 4LJSA 2XGJA 2ERXA 3WL7A 2QLNA 1VQ1A 2CV0A 2QX8A 3I6QA 3K0AB 3LA8A 4CDGA 4DLTA 3LWBA 1SBYA 3LPAA 3K2BA 3OKAA 1M6WA 2ANCA 2BBWA 3PFNA 5L3VA 2HA4A 2H5LA 2MSCB 4LSZA 4BVEA 4BE7B 1MB2A 1RWPA 5CCEA 1NVXQ 4Q7LA 3C98A 4BNJA 5KDOA 1D5WA 1YR6A 4KODA 1JHMA 4QOEA 2PJRA 1YJ5A 4JQSA 5JI3E 5JXHA 4L9SA 3WYAA 1YKGA 4I1UA 5ITSA 3NAQA 2ZIVB 4AMGA 4BX2A 3IESA 5HS6A 1VJ0A 4EM6A 1MOPA 1UBNA 4WVFA 4E21A 4F12A 5B4TA 1FJXA 4HEHA 4GBMA 5TPWA 4TSRA 4HX9A 2AFVA 4BRUA 1ZH4A 2FTKE 4LGVA 1UKVY 4AZSA 4D9BA 4RC9A 4D8WA 3U44B 1XSEA 3PE6A 2HDNB 2VXCA 2YR0A 4GI3A 3LFHA 1G8JA 4QBHA 4RK1A 5AW9A 2NV0A 4LJAA 5AXDA 2MU1A 4G0QA 5KJEA 4H1TA 3O8OA 1E1NA 2B35A 3PQ3A 1S3FA 3Q0IA 1AQUA 4ODIA 1QDLB 3UWSA 3GARA 1W76A 3U7GA 1SEPA 4DXDA 1JIIA 4RHEA 5ENZA 3TTTA 5CVTA 1JRLA 1VKHA 1PGOA 2WKSA 4NZMA 3VI3B 4FYYA 5M3BA 1AQJA 5DV9A 3AJ9A 1GAQA 3T5AA 4JJ4A 3KOOA 1IQUA 1KQPA 2YHUA 4PS1A 1KDYA 3RTBA 3PEVA 3DLCA 4CU2A 3TI9A 2HREA 2ZE6A 1CDOA 4ZVUA 3GZNA 1LBQA 3WRXA 4ALNA 4Q47A 2J6BA 4XJSA 2XMPA 1K0FA 5ALUA 2Y9PB 1GTVA 1NDUA 4EO4A 1E1RA 3KZKA 5HRCA 2FPSA 2IP1A 2WYOA 2FPMA 3BXOA 3BIFA 3KT0A 3WMFA 3S44A 1W46A 5CB0A 4KXNA 4MWGA 3MLEA 4ESHA 3BK7A 1XRLA 2O7VA 3K9BA 4IQGA 1L1EA 1Z8FA 5AOBA 1KY3A 3THSA 3OO0A 4AMVA 3F4KA 1FFDA 4UNIA 2K2WA 4WOBA 1M5TA 1OLUA 4IGEA 2GAFA 1NAIA 2GCGA 3LHSA 3TIXB 2QTLA 4BB6A 4B82A 4BFZA 1KGDA 2KW5A 1PR4A 1P91A 4PYLA 2DHEA 1WCYA 2PUEA 1Z2CA 4MRSA 2Z43A 1M74A 4FWBA 1NFQA 3KLMX 3H04A 3HV0A 2VQEB 1M76A 1ZM2A 1KEEB 4HTFA 4X92A 4F0JA 2F59A 2GA9A 3M6UA 2J5BA 1WZIA 4N4AA 4AN0A 1T15A 4AL4A 4BNYA 1RXSA 2ZDQA 4K7JA 1E5TA 1AB6A 1B3RA 3DFIA 3VSBA 4D5GA 3PGLA 1XE3A 3LIPA 2P7IA 4HYQA 4JQCA 4KK4A 2XXJA 4I4LA 4F8YA 4K1XA 2A6PA 4BAZA 4OM7A 2VK2A 4O33A 1PYDA 2F62A 3WBFA 1FXWA 3P9SA 3WAJA 3QOYA 3H0KA 4LOLA 4BY9E 3U56A 4ZK2A 1XNRB 5IAEA 3SZ3A 2PLNA 3QVLA 3TE6A 3HYNA 3RS8A 1X14A 1U2PA 1MMFB 1A5ZA 4DLLA 3JTEA 2ES4A 4Z1MD 5FOSA 4NTZA 2FR0A 3BB3A 4AZ0A 5J4KA 3RUHA 5LQJA 3I2HA 3MMZA 1S3GA 3A4LA 3IJEB 3P9KA 4CM8B 3RE1A 4ECAA 4YMLA 1C7ZA 1W93A 2CD9A 1VRCA 2YHAA 3KR0A 5D5QA 5FTNA 4YV2A 3HVRA 5JMOA 1TRKA 2QLFA 4BEBA 1VGQA 2Y4OA 1ESCA 3CNBA 5A4AA 3H4MA 1KMHA 3QVOA 2EL7A 1ZISA 2VHTA 2Q1WA 4IAOA 4YCBA 4ARIA 3G8BA 4XYGA 2FZ4A 3DZFA 3PRHA 2Z04A 4YP9A 4EFMA 4F7DA 4ZEOA 1JA1A 5LNK1 5FH9A 3DNMA 3RARA 1FTNA 1CE8B 4NXMB 3S1AA 2FZGA 1IUKA 3LDHA 2AOVA 4BE4A 1M34A 3GHYA 2E2WA 2C07A 2HPAA 4ZIRB 4GOOD 5D1NA 1R5JA 3STUA 1OXSC 1Z0SA 4FSDA 2A3RA 3QKSA 2QXTA 1E1YA 5LZ7A 1IN6A 1QONA 2PPVA 4A6DA 2CV1A 1TYEB 5C4GB 1BFUA 3S99A 1C80A 1MLDA 2GD0A 4DCMA 1CK4A 1QYVA 1ZIXA 1C30B 1YTUA 1DIRA 1JDVA 4RAOA 2P5YA 1R5NA 3RAJA 3NHFA 5JALA 2IIPA 1QNFA 4N3NA 4PZEA 1P3Y1 4X44A 4FKZA 1WKCA 3I32A 1Y8ZA 2ZB3A 1DKQA 1XU9A 4D4MA 2OUKA 4NZYA 1B73A 1IN5A 1QHFA 4MW6A 1JU3A 3FPSA 1AK2A 2EJWA 3TEFA 1QS0B 3MLBA 3RSGA 3HKEA 5K0CA 3QXXA 3GLGE 3K8ZA 5ALRA 3OCJA 1RQ7A 3LKDA 4PC1A 1E6CA 5AHWA 2ZSEA 2QIOA 1XRPA 4U7PB 2ACKA 2OXEA 3FKJA 4KFSA 1T25A 1JHUA 2A67A 2C5GA 3G5LA 4O4HF 3PC7A 4P58A 5LQDA 4DB4A 3VPSA 2EQ5A 2Q4DA 1QBKC 5IJWA 1JEYA 4S2UA 3L7OA 3WFIA 1L7PA 4PO9A 1IAVA 5BOSB 3NYQA 5DNEA 3I61A 3LYHA 4YUZA 3MWFA 4KQJA 4MW0A 1WMFA 4EW6A 1NU6A 3QIAA 3A4NA 4JC4A 5JLAA 1HSOA 2H17A 5SV2A 1C1DA 3D2AA 3H5LA 3ONDA 5AQ1A 1THGA 3TQSA 5IC4A 4YJ3F 3P32A 4X6XA 4PO3X 1L8XA 3KVOA 1PL0A 5FNZA 3UT6A 3IUEA 3SEZA 3UHFA 1D2NA 3H0CA 1SWVA 1X0VA 4D02A 1E4OA 2VJKA 4ARSA 4G24A 1YF3A 3NVAA 3UUWA 1LDEA 4E14A 2P3OA 1Y5RA 2MJLA 5CPFA 2F8TA 2CE2X 2E4ZA 4MVJM 4PSAA 5I48A 4MHSA 4ITUA 1SUCA 3ZZTA 1NNEA 2X58A 1MGOA 1F60A 2OYCA 1CIVA 1F12A 1YBHA 3OPVA 4QAQA 2OXIA 2Z6AA 3SZOA 3HR7A 1EBFA 1O9BA 3REGA 3CKKA 4UMDA 1KDPA 4Q6WA 2JATA 3V34A 2IHYA 1ZNXA 2DWOA 4MRNA 3PFBA 1A96A 3DDNA 3OEYA 4DL9A 4ARAA 3KBOA 1JB9A 1HE3A 4JSRA 4GSYA 4P6VF 3ZCRA 2VKTA 3C6MA 4FZ3A 3UK2A 2ET6A 3HY4A 1NHWA 1FQJA 1K4MA 3F49S 1JEDA 5B3AA 3AV3A 3STYA 3E9MA 4R7ZA 1NVMB 2AR0A 4FX5A 3SJ7A 1NATA 2H29A 4ZP1A 4DPMA 4QBGB 3O94A 3TBHA 1T8RA 3JVUA 3FWZA 4J49A 4MGHA 4LPSA 1AV7A 4UVDA 3GV0A 4ZDJA 6REQB 5LIRA 4RZUA 4KX3A 5C80A 4Q4CA 2O8EA 1U9IC 4KGZA 5EQTA 2AE1A 2OD9A 4E3WA 3WGIA 3AOGA 1P39A 4UDOA 6YASA 2E4UA 1NJ5A 4TUYB 3QRWA 4A5OA 3EXEA 3FYTA 3K0KA 2XBUA 3DOCA 5CXQA 4U6SA 2CXHA 4B87A 3EZ7A 3LQYA 2W6MA 1EINA 3PTLA 4OAOA 4XD2A 4WADA 3WY9A 4UBMA 3ZBTA 3KLOA 1EJBA 3JX9A 4D45A 1HEUA 3QE3A 3F3SA 3HUFA 3QEJA 3EFBA 4XYLA 1NSTA 3HCWA 5HQ3B 3F6CA 1ZZEA 2PIDA 3T5TA 3WNDA 4IOJA 1SIOA 1A76A 1GITA 1ZA1A 4XIFA 1POXA 4PHGA 5KVVA 5F7OA 1MD9A 1MXHA 1D1TA 1OCEA 5FPKA 2FSVC 1M6EX 1EUQA 4A2QA 3VAZA 3PC4A 1EHYA 3L7KA 3QU2A 4CLRB 2G1AA 4QJBA 4UBOA 4CMJA 5HS4A 1PLKA 3I64A 4G5HA 1HT3A 1SBIA 1D6SA 2P1ZA 3OIDA 2AQ8A 3CO5A 3AHIA 1DG1G 2TRSB 7ABPA 1N1EA 2FUG6 4LXYA 1SBNE 1DAMA 1QFYA 3L4BA 1GAWA 2BGKA 4FR0A 3A10A 1QGED 2Q5HA 5G02A 2TSYB 1UKCA 1RI2A 3GCGA 4AMUA 3NP7A 2JLWA 4WLOA 3EVCA 3Q7TA 3VKFA 1DLIA 4BJ1A 3FYSA 3H2BA 3OD1A 1NVGA 3IAS1 3WLKX 1VRVA 3UKJA 3IKVA 3DE4X 1J97A 5CYOA 1OBCA 5ALLA 1GPYA 2BUBA 2WPDA 3N0RA 5DZSA 3JAKA 3IS3A 1KQNA 2CV2A 2HUPA 4BLRA 4ZQIA 1OFTA 2VT3A 4GR9A 3H4IA 4X9XA 2O05A 4MI6A 5AIAA 1N6LA 3G8YA 2FK7A 3I2GA 5E1OA 4FHCA 3RFUA 4R0VA 1EI9A 4TXNA 4CR7A 1WUIS 2F67A 1S3SA 1H2BA 2FW8A 3JYQA 3IL2A 2J4CA 3UGKA 4OFXA 5JG7A 2PBFA 4EARA 4IMRA 3ZWYA 2RHOA 3PGMA 5GPBA 3A26A 3HFSA 4HAXA 4WBNB 4YCSA 1AMUA 2Q07A 2HMSA 1RI1A 4KU4A 1HL7A 2BGMA 2B98A 2O2ZA 2ZRMA 3PSHA 4YP6A 3RKSA 2IGBA 4ZQBA 3BCSA 4ZMRA 2QE6A 4CFSA 1C9YA 1TNDA 2B7CA 1JTEA 4MKFA 3EARA 4TMFA 4P36A 3KB6A 2D1RA 1BU5A 2JGRA 4XDGA 1J06A 1YCFA 3GLQA 5ELXA 3EGCA 2XMGA 1L7OA 3KOMA 5GY7A 3VZDA 4IH9A 3ECAA 2RJ3A 2JH9A 3FUVA 1A5SB 4A6XA 4YXFA 3IT0A 4YJHB 5EJIA 1RQXA 4AJ1A 1XLWA 1NONA 5CM9C 1SPXA 2NNWB 3RC3A 5IT5A 2X5XA 2XA2A 2CDCA 5FHRA 1L5HB 3CLTC 5BY2A 3LU1A 1Q0UA 1QRDA 3BFKA 2H1FA 5LMUB 3WGQA 2WLSA 4H17A 1NXSA 4CEJA 2WF5A 2CBZA 2HRQA 1L4BA 1RZUA 2JFWA 2KI5A 3EA5A 5FB3A 3TXAA 3J81A 1XTKA 1PL8A 4TV8B 5H02A 1UBSB 3KJNA 3LPLA 1YUBA 1GCUA 1M1NA 3OLXA 5H5JA 4YMGA 2DH6A 1RAFA 2D0PB 2RGNC 5JWRA 2VP4A 5FWDA 5GZ6A 1UZMA 1Z0DA 4G36A 2XTZA 2DHQA 3A32A 3ZWNA 5CLJA 1R6XA 5DWDA 3VNBA 1E0KA 3OOSA 1IN8A 2OG1A 3BAZA 2FGJA 4ZC8A 2L42A 2DWPA 3ND7A 3I9JA 3R3HA 1OIXA 3EVAA 3GVXA 1Y6FA 5J3JA 1TM7E 1IATA 4Q7MB 4ZYXA 1KRHA 2PMBA 3H0EA 1ISFA 2OFWA 3AEQA 5IJ0A 1DHRA 3R5HA 3HKEB 2WAYA 1ENPA 4R0MA 1Z4OA 3MJDA 4UKDA 1R4NA 2I87A 1UKZA 2N46A 1M8PA 3LP6A 1ZSVA 2FVXA 1MEEA 4PPFA 5CYGA 4OKIA 1JLLA 2G1PA 2CXQA 3DAPA 4P7BA 5AKJA 1Z2NX 2A9VA 4W7SA 4PHTA 3HGMA 3PDWA 4V3CA 3TD2A 3WWOA 2QR5A 5LLDA 3VPDA 1E2HA 4E22A 2XA9A 2H1OA 1UZLA 3AFHA 3FDFA 4QYWA 3CMMA 4MULA 1Q1QA 5L4NA 2VRCA 1V1RA 1VP3A 2IE8A 2W2VA 1N0HA 2R7KA 3I4FA 3I5AA 1Q0QA 2X0KA 1C3VA 2BFEA 3OZUA 4FGKA 1G38A 3K9FC 3HDHA 2HT6A 1QP4A 3LBYA 3G2JA 1E6WA 2VOJA 5AQEA 4BV9A 1LV8A 3A28A 1E9DA 2AT1A 2AD5A 4MJ7A 3VVMA 1WTAA 3D1JA 3KBBA 5HIAA 1BSVA 2G17A 1EFPA 4F56A 3F6RA 1CQWA 1CEXA 2GBLA 1X1CA 2IT1A 1GUBA 3C1OA 4G0PA 4CLHA 5JZBA 1K27A 2PD6A 1GRCA 2DYKA 3GGDA 5EKUA 2AFHE 3D43A 1IHPA 2CXUA 1UZUA 4J1SA 1CUIA 1O3YA 2MINB 3WP0A 4TUYF 3MJTA 2YMPA 4UATA 4C4PA 1ADGA 4EKYA 4DZTA 2PUAA 2VP5A 3HL0A 5C3MA 2QRGA 2DXIA 4HJXA 2O0MA 4ZCPA 4KWEA 4B7CA 3SXJA 1O1YA 2X9GA 1XLVA 4LKOA 2OV4A 1QF6A 1HTBA 2HWXA 5FUXA 2YXDA 3CVXA 3AHDA 3VH2A 3WZ2A 1KMIY 3M3PA 1RWKA 3CEMA 2E37A 4I1VA 5TS2A 1VZ3A 1YFZA 3VYRB 4ENPA 5CG2A 1B8VA 2R00C 3H6KA 2HGSA 2R8OA 4YP0A 4EUHA 2JGJA 2GWHA 2AS0A 1PO7A 4HAYA 2C1ZA 3UBMA 4BQFA 3I05A 1RPNA 1F1JA 4W1SA 4A0RA 4AUEA 4O1MA 2HT1A 2W48A 4GQIA 2EARA 1Q1EA 2IXEA 1BMFD 1DG9A 1HH4A 1LLFA 2NTVA 3B8EA 4WXHA 4QZVA 4MR9A 1T3ZA 1XZIA 2JKYA 5AOVA 2C7OA 1U9YA 3EHEA 4V2IA 5CU7A 2C4HA 4S04A 3HXOA 2FPUA 1D2CA 4MGEA 2ONZA 4B2YA 4N7RA 1OQAA 3BXGA 4O1HA 1VCNA 2PLAA 3NHKA 3ZV5A 4YEDA 4I1YA 4RZXA 3TUZC 3TYXA 3WA7A 5DNYB 4JUCA 1HDOA 5HVNA 5KNDA 1HYBA 4TWZA 2PGAA 2QM0A 4X97A 4PC3A 2FG6C 2ZJYA 2GK3A 1A9YA 3LPCA 3WGTA 1AGRA 4MA5A 2GS9A 2OGTA 1Y42X 4ZVNA 4UM9B 2NU6A 3DLIA 2RBGA 4WN9A 1KC3A 2HA5A 4QPPA 1A2OA 1RRFA 1U5BA 4GM0A 2R44A 2WQZA 4OFBA 4BYMA 1N6OA 4XB2A 3RVOA 3E9RA 3M33A 3QEMA 3T4UA 4WE3A 1TEXA 1YFJA 5B36A 2RAFA 3JD3A 2DSNA 5EE9A 5EP1A 3ZY5A 2VTDA 4FX2A 2HLPA 3ZE7A 2IYYA 3GLTA 3JWEA 4A6PA 3AMVA 3KDSE 1PJ2A 2EGHA 4NONA 3EBPA 3F46A 3OJOA 4MW4A 3VOBA 3VDXA 1LI7A 3TJMA 3OZBA 3QVMA 2PXCA 5AK3A 1EB8A 1H94A 2BM8A 1EGQA 5DE3A 2H2DA 3BG5A 3JWIA 4ZIRA 4CLRA 1VMDA 4PSUA 4DV6B 1IJEA 1UANA 1ODKA 2OP1A 1KZ9A 1URPA 1EX7A 4MO9A 4ZOBA 1JTFA 4D4LA 2Y0CA 2WAXA 3IPCA 2L0XA 4ZRMA 4BBPA 2FSPA 4OPMA 3EGWA 3ONWA 2EFYA 1JSZA 2HXSA 1HLGA 1OR8A 2ID8A 5F77A 1U3VA 1EVEA 2E49A 1I9CA 2F2TA 4J4BA 3V2HA 1LZKA 1N75A 2RC6A 4WZ6A 1GG8A 3B1YA 3QOWA 4FWTA 3MAAC 2AIRA 5EXPA 4BLTA 5KYWA 1Q0ZA 2H2IA 2C2KA 1NVEA 4W6QA 3TLBA 1DWPA 3ITDA 2EBHX 1TAHA 4OF4A 1YJBA 2PQ0A 4U00A 3QEOA 4WD3A 3RYFB 4ABTA 2Q3HA 1G7SA 1SUWA 1C2YA 1TM5E 3GQBB 3LK6A 2WIAA 1S2GA 1NR1A 3AZQA 4KRGA 4Z0HO 1AHIA 2PD3A 1KO1A 2X22A 3D59A 4ZANA 3G5UA 3HY3A 1DJOA 3FSGA 4FHEA 4CT4B 4M9ZA 3JD4A 4DSNA 5JDIA 3UJNA 2XXBA 4D46A 4QUJA 2P5SA 2X3YA 4OH7A 3RBAA 1W25A 3R76A 1NC1A 1SOWA 3D9QX 4GX1A 2AF4C 3G88A 2DRIA 4FBMA 4HYTA 4RF3A 1XQ1A 1S3IA 3D3JA 3LQ4A 2FQYA 2P8SA 5K51A 3BDIA 3TPCA 2QTFA 4B31A 3IRVA 4FC6A 3B2QA 4ZVOA 4CI0B 3TRIA 2OGUA 1W87A 4I55A 3PWSA 4YCLA 4E03A 3K70B 2JPDA 1V71A 3B1XA 1WPGA 4R9RA 3W5SA 3GZ4A 3N59A 4CM3A 1C8LA 5BMVA 2PX0A 2LCIA 4COOA 2PUGA 1MT3A 4P3OA 5L6MB 2WHRA 2PRZA 4HADA 4Q16A 4Q4HA 4YO7A 1JALA 4JLVA 1J0DA 4YV1A 5A03A 3GLFB 2PNFA 1L5MA 2FWPA 2YJGA 3ECCA 4IBOA 3ETJA 5T41A 3W0LB 5ABPA 3ORHA 4FGLA 3RVPA 1XNGA 4HB2A 4ZALA 5JO9A 4P7FA 4BTLA 5L4LA 1U3UA 2DKOA 1E1QD 2ZJZA 4FNGA 1BAPA 2FFQA 5INTA 3KE8A 4CKBA 5GIOE 2VF2A 3MT9A 3IAM6 4LXUA 2IHUA 1RWWA 1HC7A 4IH1A 3LS2A 3KS9A 2VP3A 3OJLA 4BMDA 5I9LA 4RLQA 3ZXSA 1GPNA 2ODWA 2F3RA 2NXWA 3ESXA 4ZC1A 2ZBGA 4B4UA 1GOTA 1FLNA 3BFXA 5JBIA 2OCXA 2IIVA 3PFIA 4OA8A 3ADOA 4LBVA 4DV5B 5ARBA 1FB5A 5BV2P 4XIGS 2FETA 5EZYB 2WTAA 3K0HA 3DHNA 1EVKA 2JJMA 3D8RA 1E5XA 2XMDA 2VWQA 2Z58A 2CLHB 2XRMA 2FZKA 2JHGA 2PGLA 3DOOA 1W29A 4HAUA 5EJMA 4BO3A 2E9SA 2RAPA 4ZAZA 1D8AA 2Q6KA 9LDBA 3GXBA 5M04A 5CH3A 1IWBB 1VL2A 2WFAA 4QOFA 3DVLA 4AJIA 2SHKA 1MO2A 4J43A 4RKYA 2QRVA 3I2KA 2VDWA 2XKJE 1H0SA 2ZB8A 4EW1A 1TJ3A 4RACA 4I99A 3DXFA 4OXYA 3GQBA 5JE8A 1EFVA 1E1MA 4P1ZA 3NBZC 1OXBB 3OP4A 3CX3A 1OBOA 4C22A 4ENUA 2AOUA 2AUMA 4FIDA 4MDFA 1QBGA 1J90A 2Y1KA 4DIKA 3AESB 4FVTA 5I47A 3CNEA 3OLCX 4R5MA 4LYGA 1T0PA 2CNKA 1QVVA 1Z0AA 2NG1A 2VCHA 3MRSA 5AJYA 3TOXA 4CLOB 3AFNA 3N0XA 1XDUA 5GADl 2O8EB 1Y7PA 4YRJA 3QYAA 4MKGA 2B78A 2O2JA 1WABA 1DUIA 2R0QC 3PYLA 2BEJA 2O8NA 1HG1A 2FEKA 3LIIA 4AWAA 3FPKA 5KDLA 1O97C 1MQ8B 4MVJD 1VRWA 2P30A 1NUHA 5CDYA 4ESEA 2H54A 5FV4A 1VJ1A 4O0LA 1THMA 4OEHA 1D3AA 4WINA 1POWA 4RD6A 2PFKA 2MSDB 1JL3A 1FRNA 2J6IA 3ZW9A 4EEXA 1MABB 1NIPA 5FI5A 5FJIA 1J56A 1E64A 5EJ4A 5IM4A 1PN3A 4WESA 3PJRA 1E7QA 3D02A 4WK2B 4WZAB 1W1IA 3ISJA 4M22A 5T6MA 2ZUSA 1RQLA 2C7BA 4L8GA 3L0DA 1T8YA 1YQEA 2GNAA 2NQ2C 3TLXA 1YULA 1THZA 4D9CA 3EQ8A 5JJIA 3D3NA 4KQ2A 2EW2A 1A9XA 1XTTA 1IIRA 5TXGA 3E7PA 3K1AA 1N32B 2C2YA 1O54A 1D07A 1MEOA 3KOWA 1CEQA 1NVAA 2IYTA 4X90A 3OZIA 4LOIA 1KDVA 1GGNA 2DECA 3STXA 5JASA 2OE2A 4BO7A 4KHZA 3CZ9A 3P0EA 4QTUB 4CV2A 1K06A 3TPFA 1HQKA 3B9RA 3FWHA 1E20A 3F73A 3L9WA 5K05A 1BHSA 3KWLA 1PR9A 2GJAA 3SM9A 1ZD8A 2AXEA 3ASUA 3OQIA 4B7UA 2NPIA 4G41A 4K0KB 1SKQA 2JCXA 4U5QA 4UD6A 3WQBA 2A5LA 3NYIA 4K9SA 4Q7KA 1HT1E 2UVQA 4BKQA 4E4TA 4QA9A 3ORQA 3OLWA 4AZWA 2AMYA 4RQUA 3PEUA 2ST1A 3W5HA 1RKXA 5JD4A 1UOOA 3A4VA 1ZW6A 2VUUA 1MAWA 5ENVA 4X3CA 1RQNA 3STVA 4Y1EA 3DWEX 1WULS 4GMHA 1WRBA 5F35A 4GSKA 4QT0A 2D2EA 1CZUA 1ZESA 1IBKB 4PYJA 1VIAA 2H9YA 4WDQA 2QBYB 3E5NA 4UW9A 1Y7HA 1KVSA 1X77A 1JMVA 1QX4A 13PKA 3I3OA 4ILEA 3RQIA 3HFRA 1SU8A 2O7NA 1XVLA 3OF2A 2YYAA 5ALWA 3BXXA 3NEJA 3P9ZA 5FFMA 3V1MA 4CFYA 4XJVA 3BD7A 4XQCA 1AKRA 4W9NC 2FQWA 1DT5A 1LJUA 4RIEA 3ZZUA 5BQ3A 1NJ8A 2ZM5A 4US0R 7REQB 1KSFX 1ENYA 2VOEA 1JG3A 2V96A 3G8AA 4BNFA 4M0UA 4TMYA 8LDHA 5LOVA 2W98A 4Q3KA 2IOFA 5K6RA 3NPMA 1S8AA 3V7UA 4CMGA 2JFVA 4V39A 4IXNA 2H3EA 3U7RA 2HF9A 3PC8C 3WLLA 5EE0A 3NASA 1Z6TA 4L76A 2XTAA 1U2RA 3A14A 3MCAA 3N74A 2XKAA 5BNFA 5JS8A 2YJ6A 3ZLTA 4RWZA 8MHTA 1YSCA 2G72A 5IANA 1FVXA 3K6SA 4EKDA 1JFFA 3GLRA 1EXWA 1MENA 3OF5A 3I6BA 1LLDA 1BW9A 1Q14A 4YRTA 1HG0A 3GJXC 1C9KA 1JDNA 1X86B 4JLMA 2CVOA 5T4BA 4G5QA 4CQLB 4R71A 2NT4A 4HWRA 4MGIR 5I5EA 2GXAA 2BJWA 3GMIA 3QA9A 4ZU3A 1E1CB 5EZSA 1Y3AA 3NHJA 5AESA 2YINC 4RVFA 3SLRA 1OJLA 2NNLD 2O6LA 2QPTA 1EFDN 1VJRA 3WGJA 4TLLB 5CK4A 1J8MF 2QEQA 4Y0AA 1U2QA 3EXFA 4J8PA 2VTEA 3QUCA 4KDCA 3RWBA 4ASUD 5DTRA 2RH8A 4BRWA 4E08A 1NURA 2LW7A 3FSGD 2A2ZA 2J9GA 1GD1O 2WJPA 4QYIA 2BUAA 2OV3A 3RRBA 3U0BA 4YALA 5FUWA 5A2QA 3CKMA 1JQLB 3JQGA 4D98A 1NRJB 1OFVA 2R65A 1U2ZA 2WC1A 3SX4A 3EE6A 3REFA 2ZZMA 2Q7OE 1K66A 1NU8A 3OCCA 2CL5A 4HLUC 2I3ZA 4OB6A 4I19A 3FHCB 1SOUA 1AQLA 1GUYA 1XFAA 1ZVJA 4M0KA 1AZTA 4U0KA 2H1HA 2O7SA 1B2RA 2P1DA 3AH8A 5CLQA 1ZK0A 4N0DA 1FXUA 3FJ1A 4BZZA 2BM1A 4FN4A 4G97A 1GTJ1 2GWRA 3QUAA 3B53X 4FTWA 2O2XA 2JFUA 5EN4A 2W2PA 4C29A 4BV8A 4WXMA 4QECA 1Z6XA 4X64B 4BEWA 3DWGA 4NJMA 2VRWA 4KPGA 2JDID 3F74A 2CVZA 3I9KA 4Q4JA 2BMJA 2IZ1A 3KQNA 3NPAA 1B1CA 1SVUA 4RFSB 4UE2A 2OBMA 4WCFC 5TC4A 1KZGB 2YVUA 2WD9A 4IIJF 4C7MA 721PA 2H8KA 3U6BA 2QK4A 2WQ6A 1EP2B 1X3LA 4UQOA 5HJ5A 2C83A 2QTCA 4K87A 1FYXA 3HR4A 4MYSA 5EJAA 5LCXA 1KMNA 3VR2D 1L8LA 4AXBA 1Z4NA 4JQZA 3WGMA 4EBFA 4FB4A 3OVMA 4HDNA 2G8NA 1IJFA 3A1SA 5LP6F 1EXDA 2R6AA 2X8WA 3GPIA 4DR4B 3OT4A 1J39A 2ZJ7A 5LNK6 1HA3A 2JZNA 1KJNA 1E5DA 1DAPA 2CNLA 2NU8A 3WGVA 4EF5A 1HFKA 3R1IA 1B6GA 1JI0A 1M2KA 2CVHA 1IWOA 3G6KA 4KNVA 1RWQA 1DWOA 1J8YF 5ALSA 4DA7A 3KSUA 3KUKA 1D9XA 1R4ZA 1XUOA 3NKFA 4J0QA 1N7IA 4K88A 3TBKA 1H6AA 3ASYA 1MO6A 5JSQA 4YNBA 4V0ME 2A4MA 2JFXA 3M70A 1I36A 1NFFA 2XAUA 1J1ZA 3OLVA 3KQWA 4QUAA 5DSXA 4PWYA 3LQ2A 4OOFA 2BIFA 3VR3A 4EGSA 4IGKA 1WUHS 2CHQA 1KI1A 3BH0A 4N54A 3VC7A 8OHMA 2BTEA 3K1AB 4GF5A 2IY7A 2L69A 4JT8A 2GN9A 1DOZA 4TMVA 2Q5OA 2IXTA 3V00A 3ZQ6A 2ZB4A 1H4SA 4UVIA 1PFKA 3SICE 2ZYWX 3KOYA 4XWAA 4TXMA 3ZJUA 3OCWA 2MCFA 3NDIA 5CVEA 4G81A 1KH3A 2X9VA 4C0AC 4P4NA 1U11A 3HXTA 3K9LA 4LC1A 3RTGA 1V7ZA 3O4IA 1UXOA 2J0QA 1ORVA 1GPJA 2NACA 2UYOA 1M0EA 3BQMB 4HK4A 2Q28A 1KI2A 5CIQA 4LX8A 1UC8A 4TKMA 2B9EA 1PWZA 2IZZA 4GWGA 5IX8A 3RC8A 2O9JA 2PCJA 3GUVA 1JIKA 4M1MA 4RV9A 1KRWA 4O2RA 1LSSA 1QVAA 3H17A 3IUBA 5BN4A 5KVAA 2I6UA 1KYQA 2P9FA 3NHPA 4PVDA 2V4UA 3K1ZA 4XWKA 4D9FA 5FWYA 2PR2A 5AJVB 4ZYTA 5GVRA 1XRJA 3NAMA 4KAFA 3GRKA 4XGKA 3TG8A 2DUUA 3N8DA 2OBXA 4R7GA 4I9HA 2MOKA 4MV1A 2TMDA 1UMDA 1DADA 2MR6A 3A6KA 3AR3A 1XMVA 1MH9A 1H5QA 2CL6X 2MSWA 4JLUA 1QO9A 3AM3A 4OQLA 3GI1A 1JFSA 3GRRA 3FSRA 1N4AA 1J9ZA 3K09A 4CF5A 3V2IA 2D2XA 2HHLA 5KYNA 5C35A 3MNFA 5DPMA 3N6VA 4Q15A 2C9DA 2WYUA 2A0KA 3D7NA 3F7NA 4WMLA 3D8TA 3ZS8A 4BB0A 2ZPTX 5KVQA 2HMTA 1U0LA 2J5XA 4RV5A 3MERA 4R9VA 3SYLA 1AS3A 1DV2A 3N8KA 1Z4MA 5DXFA 4R83A 1A97A 4YT2A 2F3PA 1MG5A 3K8QA 1TO1E 5JAPA 1U7DA 2P6NA 2H2WA 2BDTA 3B3QA 4DG8A 5KWSA 2HRBA 2BSAA 4CTKA 3HYTA 3IAUA 3S28A 4DQDA 3HFGA 5CT9A 5HR5A 1X7WB 1WSBA 5IYZF 1KVQA 1L4HA 3D6HA 3LZ6A 4M9RA 3T3MB 4Z9YA 4RKWA 1MTOA 5BVGA 1I33A 3MTGA 1GNRA 3GJ5A 3WRWA 1YZGA 2XLCA 2RGNA 4OX9Y 3BUSA 2QPLA 4PPQA 3L7AA 1B6RA 4HZUA 2B8JA 3INNA 4IHJA 4E2YA 3L6RA 3KQQA 1QDUA 5FKJA 2DQYA 3IP7A 2XECA 4D6XA 5IMSA 2V6MA 4Z53A 1CR2A 2CYBA 2XKBA 4OBWA 3NFRA 3H3XA 1IE3A 4XR4A 3T3DA 3AJEA 3AR7A 3BS4A 3NTLA 4QYSA 4CKCA 1D8TA 5EIBD 5BYAA 4IIUA 1NLUA 2HSWA 1WHSB 4W9NA 2RH5A 3O93A 2QD4A 1CVLA 3R0JA 3R2JA 4R41A 5JH7F 2P2DA 3CFYA 1U98A 5KTRA 3NOQA 2WAAA 3CSSA 1NQTA 3F7OA 3IMCA 3NHLA 4DEYA 4JDPA 2NGRA 1C4KA 3OEEA 1E18A 5JHGB 2GASA 2J3DA 2FR1A 2NYRA 3UFBA 4D57A 3LA6A 4OQQA 3DFFA 1YNOA 4TQ9A 2PKYX 1Y4DE 1HQCA 1KK2A 3DPIA 2YWEA 3GEBA 1ENZA 4D0NA 2QX7A 3CN7A 2W71A 3ELBA 5JCZA