3HNRA

Crystal structure of a probable methyltransferase bt9727_4108 from bacillus thuringiensis subsp. northeast structural genomics consortium target id bur219
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
193
structure length
193
Chain Sequence
DIQYKEVFAHYEDILEDVVNKSFGNVLEFGVGTGNLTNKLLLAGRTVYGIEPSREMRMIAKEKLPKEFSITEGDFLSFEVPTSIDTIVSTYAFHHLTDDEKNVAIAKYSQLLNKGGKIVFADTIFADQDAYDKTVEAAKQRGFHQLANDLQTEYYTRIPVMQTIFENNGFHVTFTRLNHFVWVMEATKQLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a probable methyltransferase BT9727_4108 from Bacillus thuringiensis subsp. Northeast Structural Genomics Consortium target id BuR219
rcsb
source organism Bacillus thuringiensis serovar konkukian
molecule tags Transferase
molecule keywords probable methyltransferase BT9727_4108
total genus 68
structure length 193
sequence length 193
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hnrA00
5DM4A 5EC8A 3KR9A 3UBTA 3BZBA 3O31A 3R0QA 4IV0A 3UJDA 1DL5A 3DXXA 3G5TA 5GWXA 2B78A 3FTEA 3EEOA 5ICCA 3NWBA 2Z6UA 3P9KA 4FSXA 5K09A 2PT9A 3LSTA 3NDJA 3PB3A 1NBHA 4R6XA 3KKZA 2CL5A 3PX3A 2I62A 2YR0A 2ZZNA 3LECA 3BGIA 3NVMB 4GOLD 1QAOA 2UYQA 4R05A 1RI5A 3U81A 3NJRA 2AZTA 4RTMA 4YUVA 1Q0SA 3Q7EA 2VDWA 3CC8A 4XUEA 4YV2A 2PWPA 4PIMA 5C9ZA 1G38A 3A7EA 2PT6A 5EMMA 4ATNA 4M7RA 3MERA 2P35A 1PRYA 1TPYA 4FT2A 2VDUE 1BKYA 1L3CA 2E5WA 2ZBPA 1QZZA 5EGSA 1KPIA 3RIEA 3GXOA 3LCCA 2P40A 3M70A 2A14A 1KYWA 5LSAA 5CIYA 3VC1A 1BOOA 1KR5A 5D1HA 1JG2A 4PNEA 4RTKA 3CKKA 2FK7A 1YB2A 3AY0A 2YUIA 3EVAA 4CTJA 4PYIA 2VDVE 4M38A 3R6TA 1ZQ9A 2IH4A 1B42A 3I5UA 2XVAA 3FZGA 4KW7A 3KPJA 1T43A 2O07A 2HR1A 1KP9A 5DTMA 4PYMA 5E9JA 3DTNA 3TM4A 2AN3A 3KHKA 5K0NA 1BC5A 2PWYA 1X1DA 4HGYA 4OBWA 4RYLA 3SGLA 3THSA 2R3SA 4M36A 4C4AA 4XCXA 5FADA 5BP7A 1ZGJA 4K6MA 2OKCA 3BGVA 4RSRA 5KVAA 3O7WA 3UFBA 4MHTA 4E31A 1RJDA 2I7CA 3OE4A 1R00A 4C05A 1L3IA 5DM1A 5E1MA 5DSXA 4EQZA 4BP1A 5U4XA 2AN4A 3KR1A 3EVCA 1P1BA 3UJCA 3G8BA 3KPUA 3TKYA 5JUWA 3GNLA 1SQFA 5KQSA 1HNNA 2GS9A 1N7JA 3LGAA 5DM0A 5DX8A 3PLAE 4WVLA 1L1EA 2PSSA 2QY6A 2ZLBA 2P3QA 4QPPA 3UJ7A 3EVDA 2EG5A 3VSEA 3B3JA 3T7TA 3LDFA 3EEYA 3GIWA 4U7PB 3DXYA 5HIJA 5IH3A 3QV2A 4QQKA 5JR3A 3P8ZA 2HWKA 2F8LA 4MWZA 4KDCA 4IKPA 5KYGA 2K4MA 1SUIA 4E2XA 1EAMA 5DRYA 3EPPA 1O9GA 4QTUB 2IBSA 1XVAA 4RWZA 1TW3A 3FYCA 7MHTA 2PKWA 3HNRA 2EFJA 3LCVB 5CVJA 2O06A 2WA1A 2QM3A 1NV9A 4JXJA 4C06A 2FYTA 5EEHA 5HILA 3QOXA 4GOMD 2WA2A 3GRZA 1FP2A 1XDZA 4QQNA 3CGGA 4MTLA 3I53A 2ZZMA 1YFJA 1AF7A 4AZSA 2QE6A 3EGVA 1Y8CA 3ID6C 3X0DA 3OFKA 5ICEA 1XJ5A 4MQ4A 1R74A 1IM8A 1WG8A 1F38A 5DXJA 3TQSA 2FCAA 4FS8A 5T6BA 5DXAA 1RI4A 5E8RA 3BWBA 3VYWA 1R6AA 2PX8A 4QDKA 3GWZA 1R8XA 3GRYA 3LL7A 1JQEA 4LECA 3R24A 3BGDA 1N7IA 5K0EA 1NE2A 4ER5A 2HMYB 4ER0A 4RTJA 5P8WA 1NW6A 5GOZA 3G2MA 1EQAA 3OZRA 1NT2A 2EX4A 2H11A 2NXJA 5K05A 5DM2A 3HCCA 3G2OA 4F84A 2ZCJA 3BUSA 5BXYA 3UJ8A 1IY9A 1YF3A 1G6Q1 1RI2A 4CXMA 1VP9A 1X1CA 1ZGAA 10MHA 3MAGA 5FQNA 5HFJA 2EJTA 1KIAA 2ZIFA 5GP1A 2OXTA 1KHHA 1ZHFA 2B9EA 4F85A 2GB4A 3TRKA 2C7PA 3E05A 1HMYA 4KWCA 1MHTA 2NNWB 3B3GA 3UWPA 4R6WA 3FPFA 4LWPA 4PIPA 2FK8A 4EKIA 2DULA 5FCDA 4YMHA 1FP1D 2O57A 4PINA 3HCEA 4X61A 4BLUA 3PVCA 2Y1XA 4R8RA 5FHQA 2OPBA 3SSOA 2P8JA 5HZMA 4E2WA 4ER6A 3ER8A 3DLCA 3EVGA 1EJ6A 4YV1A 5EKXA 4EK9A 3FTFA 3V97A 3OU7A 1D2CA 4R8SA 2IFTA 3BKWA 3M4XA 1P1CA 4HH4A 3CJRA 4HRAA 1JTFA 4AUKA 1I1NA 1PJZA 2ZSUA 2PX2A 4H0NA 3P71T 2FPOA 2EJUA 5CCXA 3LX6A 5LQJA 3NVKI 2JHAA 4PYNA 3PS9A 3CVOA 2KW5A 1NV8A 2PX5A 3I58A 3OU2A 3B5IA 3M6WA 1NKVA 2GAFA 1JR4A 8MHTA 1FBNA 2H00A 4RTOA 2OBFA 5HEKA 4ER3A 5EOVA 4PYJA 4ZTBA 4DKJA 3C3YA 5GIPE 3ELYA 4P58A 1WY7A 3EVBA 4GOND 2CKDA 1JG1A 3C3PA 3KQOA 5E9QA 1AQIA 1JG3A 3GCZA 4DMGA 3HA7A 2N47A 1I9GA 3A25A 1UFKA 3UA4A 3LKZA 4X60A 4V0QA 2BR3A 3P97A 1KXZA 3GRUA 3TR6A 3MGGA 3P9IA 3HP7A 3I64A 4G56A 3JWJA 4KDRA 1JQ3A 1XXLA 1I4WA 2O05A 4E2ZA 2XBMA 3HCDA 3KQQA 2BH2A 1JSXA 1DUSA 1QAMA 1XCJA 5EMKA 4GOOD 3DUWA 2HNKA 1VQ1A 3NTVA 2QRVB 2ZVJA 1YZ3A 3M6VA 1P91A 2VS1A 4RVFA 5DTQA 4GUAA 5FA8A 2ZIGA 3UZUA 2OO3A 2ZBQA 4EKGA 4RTQA 1BHJA 5K03A 4UOEA 1UWVA 3IEIA 5EQJB 4CKEA 2P1DA 4YV0A 4YUZA 1D2GA 5B1SA 2H1RA 3MCZA 4A6EA 3DMGA 4U7TB 4PYKA 2BM9A 3IV6A 1YFLA 5ICFA 3GRRA 2IIPA 5CVUA 3FUVA 4E70A 5FULA 4RTRA 3VC2A 2G72A 2NP6A 2P41A 5EZSA 2BZGA 4IWNA 3AJDA 1VLMA 3MB5A 4KIGA 3TMAA 1VPTA 4DCMA 2VZ9A 3UJAA 4OQDA 3A26A 3E8SA 1KPGA 5KQRA 4PGHA 2P7IA 5MHTA 1WS6A 4E32A 3E23A 2AOUA 5DRTA 4CWAA 1L3BA 2G71A 1NW7A 1ORHA 5F2OA 3T7RA 1SQGA 4YUYA 1YUBA 4DA4A 1JQDA 3EGEA 3I9FA 5E1BA 2ZZKA 3JWHA 2UYCA 3DR5A 1V39A 1KYZA 3DP7A 1G8AA 3HCAA 3G89A 2ORED 2IP2A 5EEGA 2O0LA 3SSMA 2IH5A 2G8NA 5E9WA 3LBYA 5DTRA 2AN5A 4E2YA 1RJGA 5EG5A 4QTTB 2OY0A 3ANXA 4BP3A 3KQWA 5M5BA 3LPMA 4HTFB 4LWOA 4YMGA 2CMGA 3EGIA 2GA9A 4V0RA 4QDJA 5ICGA 4RV9A 2PBFA 3G7UA 5FTWA 3KPWA 4PYOA 5FHRA 3K6RA 3CJTA 1ZG3A 4BY9E 4PCAA 4CKBA 2PJDA 1IXKA 4X1OA 5K8VA 3C6MA 3UJ6A 4RTNA 1SUSA 3P2EA 2C7QA 3P2KA 2R6ZA 3HCBA 4P7GA 4PONA 4RVGA 1OR8A 3T0IA 1X1BA 4RTPA 3KU1A 3KQSA 2NXEA 2QYOA 2C7OA 5EHGA 4RTSA 3THRA 3EVZA 1SG9A 2PX4A 4C04A 2PY6A 3OZTA 3GGDA 4FSDA 5EIFA 5C0OE 5E8JA 1VIDA 1QYRA 3LCUA 4EVIA 4KIFA 4QVGA 5C1IA 1KPHA 2VP3A 3DXZA 3OFJA 3C0KA 4HSGA 4WXHA 2Q41A 4P7KA 4X41A 5K0LA 3A27A 1MJFA 5K0CA 1XDSA 3M33A 4GBED 1RI1A 3TKAA 2AS0A 4GEKA 5F2KA 4O29A 1NW8A 3AWIA 3LHDA 5DX0A 3FPHA 4HGZA 4RVDA 3WSTA 3DOUA 3O4FA 4FGZA 2ADMA 4X63A 2ZFUA 2ZIEA 1RJFA 3E7PA 2FRXA 2CWWA 3CCFA 3HVHA 5CUQA 5E1OA 1EG2A 1ORIA 3BWMA 1VE3A 2AOTB 3AXTA 3FUUA 3NWEA 3B7PA 2UZ4A 1EIZA 4RTLA 4CKCA 5G02A 1SKMA 2ZULA 4C08A 3SMQA 2NP7A 1INLA 3BWCA 3FUXA 2JJQA 2Y1WA 3ORHA 3MHTA 4OQEA 3DH0A 2ESRA 2PXCA 3P2IA 4KRGA 2OZVA 3KQVA 2GPYA 1TW2A 5LQRA 3PTAA 1VP3A 3S68A 1M0EA 3KQTA 4PCLA 4KVZA 4BLWA 1Z3CA 3BXOA 3KPVA 3L8DA 2IBTA 1XCLA 1R18A 2GLUA 4AX8A 4L7VA 3BWYA 2XYQA 1FJXA 5FA5A 3NDIA 3T7SA 3LDGA 4PYQA 3SXJA 3P9CA 4QVKA 4OX9Y 4RVHA 5EVJA 1NW3A 3PFHA 5H02A 2XYRA 2C7RA 5K01A 2XVMA 1NW5A 2ZW9A 3FRIA 2B25A 2B3TA 2ZWVA 1L9KA 4Z2YA 2JHPA 5EZQA 3REOA 3GU3A 3OZSA 4B17A 1EJ0A 2GH1A 3RODA 3HVJA 5DLYA 2B2CA 1P39A 2AOVA 3FYDA 5EPEA 3MQ2A 4E33A 3TOSA 4DCGA 3G8AA 1F3LA 3DMHA 2JH8A 3G5LA 3OU6A 3A7DA 2XYVA 2ONYA 4IV8A 5LR6A 2BR5A 4E30A 5T67A 3GJYA 3EMDA 2YXDA 2IDJA 5E1DA 4DQ0A 5T64A 3SM3A 3NW9A 4GQBA 3SR4A 1NBIA 2BM8A 4OA8A 5BW4A 3BT7A 1M6EX 5DSTA 2AOTA 5EMJA 3IHTA 3OCJA 5HIKA 3DULA 2YVLA 5DT2A 2PGXA 2DPMA 5DX1A 3PFGA 3HVIA 2NXCA 3H2BA 3TLJA 3FUWA 3SSNA 4A6DA 4C07A 3ERCA 4Y30A 4FZVA 3UJBA 1M6YA 2YTZA 2ZBRA 3HCFA 4HG2A 4P7JA 5CVDA 3C6KA 5FWDA 2JG3A 2PXXA 2V74B 3FPGA 3HM2A 4LG1A 5FUBA 3TFWA 4POOA 3FTCA 4BLVA 2PVCA 2WK1A 3FPEA 4DF3A 2G70A 4GC5A 3IYLW 4RX1A 5FQOA 2YXLA 3V8VA 5F2NA 2PXAA 5EIWA 5EMLA 5HIIA 2IH2A 3R3HA 2PV0A 4DM3A 3ME5A 3Q87B 3JWGA 4GF5A 3GDHA 1JTEA 3GRVA 4AZTA 2AOWA 5IKMA 3D2LA 3HVKA 5ERGB 3CJQA 4XUDA 3HTXA 2JH9A 4HC4A 2QRVA 2UYOA 3FUTA 3RW9A 2ZTHA 3FPJA 1XDUA 4ISCA 2CMHA 1DCTA 1ZKDA 2ZWAA 3KQPA 3KPYA 1FPQA 2ONZA 5GM1A 2I9KA 5GINE 3ELUA 3HA5A 2NXNA 2G1PA 3PT9A 3R9XB 1JSZA 2BR4A 2OB2A 4OA5A 4C03A 3KR0A 1AQJA 1WXWA 2YX1A 3SX0A 2JHCA 5CCBA 2LD4A 3F4KA 3G2QA 2AR0A 1RI3A 3KR2A 4F86A 1WZNA 3QOWA 2YQZA 5LQUA 4HTFA 1Q0TA 4M37A 3AXSA 4PWYA 5GM2A 5BW5A 2ERCA 3UA3A 4XUCA 1X1AA 1XTPA 2HV9A 1RJEA 2IGTA 3HA3A 3P9NA 2OYRA 1D2HA 3EMBA 3G88A 5EHIA 3TPZA 3K0BA 4ER7A 5D1NA 3B3FA 5LQNA 1X19A 5CD1A 4DZRA 4FR0A 4FP9A 3M6UA 4GC9A 4AZVA 3ER9A 4QPNA 4YUXA 5K0GA 3MCTA 4FT4A 1VBFA 1N2XA 4PYLA 3FRHA 5E2AA 1SVUA 2P7HA 3FTDA 4P7FA 9MHTA 2AVDA 2I6GA 5CM2Z 2P3LA 1UIRA 5DWQA 5K0BA 5LQCA 1H1DA 5GIOE 4MIKA 5LQAA 3B89A 3JWIA 1VL5A 4Y2HA 5KS2A 1JG4A 2AVNA 4OBXA 4YUWA 3TM5A 3OE5A 3HEMA 2V7EA 3SVZA 2UYHA 3ELDA 3DMFA 3PX2A 3MTEA 3EVEA 3A4TA 1AV6A 2HTEA 2NYUA 5EKUA 3GO4A 5HOQA 3G2PA 3UJ9A 2IDKA 3LKDA 3EVFA 1O9HA 1U2ZA 2OB1A 3M6XA 3MTIA 5DPMA 5K0FA 2Z6QA 5K0JA 1G8SA 2AOUB 2FHPA 1QANA 3CBGA 3ELWA 3KQMA 4NECA 5CVEA 4AZWA 5LQKA 1O54A 2P3OA 3LBFA 4PGGA 5CVVA 3NMUF 5HIMA 4CTKA 3KQYA 1WXXA 1G60A 2YXEA 2IPXA 1QAQA 2Z6AA 4EMSA 2AOXA 3LDUA 2PLWA 1YZHA 3DLIA 1G55A 1R8YA 3BKXA 5E2BA 3OPNA 5FWAA
chains in the Genus database with same CATH superfamily
1SUBA 2A6PA 2JD2A 3KVOA 4EPTA 1K8XB 4OQ4A 3GLFB 3S70A 2B78A 2QQ0A 4LK3A 1WXHA 2I7DA 2Y0DA 5C1OA 3KB1A 4HJXA 1T1EA 2GPNA 1TJPB 4IQGA 4D4KA 4AJ9A 3NDJA 4M1TA 1TE2A 1Q0HA 3PX3A 4RKEA 2I62A 13PKA 1ORDA 5FFFA 1U0HC 1O77A 1E3JA 1P0PA 4MRNA 4BS9A 1KNXA 1L4HA 1W9MA 3R3ZA 4PBTA 1RI5A 2G88A 1BCRA 4UBNA 3LHFA 2AZTA 4MINA 2Q2NA 4WK4B 2O52A 2X0FA 3AF3A 2C96A 4JX9A 3SX2A 1QS0A 2OV4A 4M1MA 1Z5NA 3WHLA 4RTMA 1AZTA 1EP3B 4GBGA 1YI1A 5F3DA 1QK4A 4IDPA 3NHKA 1TAHA 1Y9EA 3I9V6 2WHXA 4JUCA 1M8GA 4Q3CA 4QTZA 4ZRMA 2R85A 4Y1RA 4TZ0A 2HDWA 3L6RA 3R6WA 4QJ3A 3OZXA 1KRXA 1GEEA 4YR9A 5LSAA 2D1RA 3Q9NA 3HRIA 1RRFA 1JHMA 1RFGE 2FAXA 2W90A 4CL3A 2FUG6 2AA3A 3WA6A 1FPMA 1B1AA 3W5SA 1UJ6A 2XRFA 5FFMA 3ASZA 1RWOA 3GGPA 3RUEA 3VTZA 1JR2A 1THZA 4FKZA 2F3UA 3PKIA 1XVTA 1ZQ9A 5IAAA 3NUZA 1B6SA 3JQAD 4Q24A 5IJ9A 4MB6A 3KYCA 4KW7A 1NQOA 4EB8A 1E5XA 3HFGA 2HR1A 2XCOA 4HDRB 3SFVA 4WNAA 2QUBA 5CJJA 1TO1E 5F76A 3TGPA 3FPBA 2X9QA 2B7LA 3KHKA 2NPOA 4I5DA 4QBTA 1BE0A 3RC9A 1I3OA 3OG9A 2YCBA 4U02A 4DCJA 5FADA 2WSIA 4E5YA 2PBRA 2ZEJA 5TPWA 1FNBA 5B3JC 3FGOA 2CJXA 2VDOB 3C7CB 5CFRA 3NV9A 4B71A 1AU9A 4GMFA 2HWWA 5U4XA 5TY0A 4MVJI 4UAUA 2DY1A 4AP9A 1JH8A 4XTRA 3I2HA 4BE7B 2FMHA 1HNNA 2GS9A 2BH9A 1GA1A 1RLMA 3DMYA 4QL3A 4Q4AB 2QY6A 2ZLBA 1XTRA 4BGIA 3NBXX 4QPPA 2DKFA 2BMFA 5HJ2A 1WQ4A 3EVDA 2HJVA 1XD2B 1TDJA 1OXXK 5GZ3A 1THMA 2O0KA 2QSJA 3HR8A 4Q93A 3DE2X 4OQXA 3F7NA 5DASA 3T7TA 1PNVA 4N41A 5BYAA 5IS2A 2P5UA 4IY1A 3A4VA 4GI7A 2R8EA 3P8ZA 1WLSA 2HWKA 4K8OA 2VHTA 4KDCA 4BEBA 4DCSA 5JFTA 3NAGA 2YNMD 3PKZA 4KP7A 4TL6A 4BFTA 2V7PA 2B4YA 5DCUA 1B4DA 3WTBA 4LJ4A 1TPZA 2NNLD 5EAIA 5I7FA 3AUXA 5HE9A 3RS7A 4HEJA 3ZY3A 4BFUA 4KXLA 1W36C 4Q3KA 2PKWA 1JAXA 4KMRA 5G4KB 1F4VA 4MUYA 4OMDA 4QBHA 4Z9AA 1XMOB 2GO1A 1PGJA 1R0ZA 4E7OA 3NJ4A 3BCRA 1YDFA 4AN4A 4RLFA 2NWQA 3C5VA 1KJZA 1KZ7B 2IVZA 4TTSA 4YFYA 5CT4A 1MH9A 2JHFA 3DVSX 4C4ZA 5J4VA 1SCAA 3RS3A 4E3WA 2QRJA 1F38A 5BNZA 3AUYA 4A1OA 3ZE0B 2WF9A 4AJPA 4X66B 4QPDA 2C00A 1T6XA 2V7UA 1I6LA 5F4ZA 4LV5B 4H35A 4AJNA 1PJBA 2ZVPX 3H5TA 4Q6WA 1RAGA 3R24A 3BGDA 6REQA 1M0TA 3QVUA 2QTFA 1ZWLA 3OQPA 3A1TA 4FSHA 4OP2A 1AQ6A 4TS4A 1R4AA 2EEPA 2VRCD 1G4HA 4YCDA 5K05A 1MH1A 3W7VA 5DM2A 3KLOA 4EJSA 1NYQA 1CUWA 2PX3A 3EC1A 1LBTA 5BXYA 1C80A 5IVKA 3T9CA 2DPHA 1U7UA 2IQIA 3WGTA 4M1ZA 3HEAA 4R8VA 3LDHA 1C1HA 1KMQA 9GPBA 3TD6A 2B9EA 3T9DA 3QJYA 5JNSA 1SRQA 1KSJA 1LC0A 1DKPA 3GVHA 2NVBA 3QMMA 4P3YA 3FMFA 3WGHA 4XD7D 4DPLA 1VJDA 2DULA 2WPDA 1UT8A 4JEHA 4EO4A 4BLUA 3ICOA 3QYFA 1V47A 1Y7LA 1N2OA 1TJNA 4JP1A 4AG5A 1MF7A 1E8NA 1Z0FA 3KYDA 5PGMA 2ZRHA 2W2NA 1EH5A 2DR0A 1Y4SA 2IK8A 2OCXA 3F4BA 3R3XA 1TYDE 4YRFA 5ES4B 2CNLA 3SJ7A 2C9DA 4B85A 2HA3A 3GDWA 2OHFA 2QQFA 3PI7A 5DNYB 4K9RA 2FPWA 2XECA 4MA0A 1PT7A 3CVOA 3R3VA 4RKFA 1V96A 1NV8A 4MCIA 4URUR 4B8ZA 3OU2A 1T2NA 4PTYA 3M6WA 3L1KA 2CXOA 2HH9A 3D5TA 4R1QA 4AWBA 4EGQA 8MHTA 2JIMA 4MI1A 1QIKA 2NG1A 1VE7A 4REOA 4ZVUA 3LUJA 4L78A 4ER3A 1NX9A 3INTA 1VCHA 3L2OB 4EFKA 3BE8A 3C3YA 4TWRA 3WK5A 3RJZA 5IVPA 3MFYA 4WN9A 3TGLA 2HHJA 3IT3A 5D6OA 3EULA 5EXEA 3SZUA 1UL1X 3VSBA 3WGIA 3KQOA 2IWRA 4EATA 2G9ZA 3LUGA 3RVPA 4DMGA 3O4JA 2ATVA 3E9MA 1ZA2A 4X60A 3P97A 2VUSA 3L0ZA 3GRUA 4H7KA 5BV2P 5JRZA 2WT8A 2QW0X 1E63A 4AZ0A 4U2GA 4B75A 2CVFA 1JDPA 2PFGA 3HKCA 4MGYR 4LJRA 1E3IA 4J9UE 3K9QO 4M0LA 4C3VA 4E21A 1J22A 3NM5A 4HB0A 3NP7A 1FFGA 4GOOD 2A4KA 2IYOA 3FSGA 3FVVA 4KJXA 4QRDA 1G59A 1JDBB 2VS1A 1SUEA 3MRVA 4TZ6A 1L4KA 1CIPA 2X0RA 3RVMA 4A27A 3ZCTA 4MS1B 1LWNA 3GEGA 4GDFA 4CEJA 3MRXA 3DNFA 3IEIA 3VHRA 3ZW8A 3I61A 2ERYA 1DO0A 1TJ5A 5EMNA 2NMVA 2BSXA 2QG9A 3G9ZA 3PNPA 4LX0A 4U7TB 2BFBA 3ZNQA 4QXPA 3PE4A 2KWIA 4E70A 2VA8A 3LVBA 4J43A 2H85A 1GNLA 4JS0A 2PJZA 4G81A 1QQ5A 1UDRA 3IMEA 4M98A 3VAZA 4RDIA 1NXPA 1E2LA 2V1XA 5LZ8A 2O8BA 2IYXA 4HK4A 2OCPA 4EENA 3RR2A 3FFXA 3JASB 5J4LA 1KPGA 5KWEA 1R0SA 3MBIA 4ND1A 3UEOA 5ALUA 4HJRA 5DRTA 1L4YA 2ZP1A 3A8TA 1GLGA 3K8QA 1NW7A 2RGBA 4B7UA 4TKLA 1YIOA 4QBIA 4Y0AA 3FSRA 5A4MS 1U8TA 4L8WB 3K0FA 3PC7A 3CF0A 2AZXA 3BXZA 4XA8A 3F6EX 4YGYA 1SD1A 4DTCA 3T8YA 2HIGA 5ETJA 4XD7A 2ZCUA 4BWYA 2H2WA 1W7AA 1M2VB 1FW8A 2QTMA 1XXHB 5A6SB 4RJIA 3VMMA 2Z4RA 3ND6A 4BU1A 3TF5A 3J7AC 4LVOA 1BX3A 4HTFB 4DNQA 3U3KA 5LXTA 3PHHA 3O91A 3UY4A 3JQGB 4F6LA 3AR3A 2LCIA 4GIBA 4UVHA 4BIMA 4NEGA 3K9BA 4A2PA 1MKYA 1E61A 2PEYA 3OQ1A 5K5EA 4KFUA 4QATA 1U2DA 2CCJA 2VHXA 3FCEA 3PFCA 3PNBA 3EN0A 3S28A 2Z2KA 5BN5B 3GT3A 4DYHA 4XM1A 2I4TA 2Y3IA 3LSYA 2GZHA 1VIYA 1X1BA 5CNJA 2QTAA 5G3YA 3ZD9A 2C7OA 1WXIA 3TINA 2GEDA 3G5AA 2OVFA 5JW6A 1ABBA 1EK5A 2WM8A 3ZX5A 2PY6A 4R41A 3GGDA 3NWJA 1PKEA 5EJIA 8ADHA 3AHEA 3KU4A 3ESBA 2ACVA 4KQFA 1JXOA 4LXTA 3TD2A 3P9SA 4EYEA 2EKBA 4TV8F 3K8ZA 1EDDA 4OXXA 4KO2S 4UXJA 1ZICA 4Y7CA 1SD2A 4EY5A 2QRHA 4BIIA 3SBXA 1G2QA 2JL1A 1E5VA 1I2DA 1UJBA 2AS0A 2JHGA 3WO1A 3T3HA 2JDIA 1NW8A 2QY9A 1GZ4A 3C7DB 1LNZA 3FPHA 2J07A 4PLFA 1MAVA 3L6UA 4EPRA 2PNJA 2PVSA 5BWOA 2QMUA 4BPRA 1VHLA 1MC5A 4XOUA 4QPZA 5DJ5A 1Y8QA 2AOTB 2W48A 1F20A 3MRSA 5ARCA 1OD6A 1AKQA 1EIZA 1FTNA 3V7UA 3AONB 1Z5PA 2VCHA 2XB9A 3TLXA 4UM7A 3WJ2A 2F55A 3FHTA 4NCJA 3RI3A 5CEJA 3PHCA 4FFVA 1M1YA 2W2OA 3P9RA 4QXMA 1JEYB 1SCQA 2YFKA 2QTZA 2XUAA 1PQYA 3W5AA 3BJEA 4HNTA 2FUCA 3AJ9A 1F48A 2WYOA 2IBTA 1DDOA 2YWEA 4XYEA 4HYEA 1B2LA 4E2FA 1IY2A 2O23A 1G8PA 2AZMA 4PYQA 2RH8A 2JLRA 4M1WA 5FLEX 3L1HA 4D3SA 5JH7A 1BS1A 1CJVC 3QY9A 1Z8FA 4L4ZA 3SD7A 2AC2A 1QQBA 1BDMA 1SKQA 1WMBA 2G40A 1T35A 2EAUA 1RRMA 4PZ9A 4B0PA 4FD2A 2H57A 2N0SA 4P4UA 2RHBA 3NRJA 3I9OA 2ECFA 1MC4A 1SHZA 2VPXA 3I2JA 2JD0A 3E9CA 4ENQA 2C8LA 2X0JA 3ZIAD 4I9NA 4KWEA 4MWTA 5LYJF 1DV1A 4INAA 4HAZA 4MVJM 1EA7A 4FDUA 1Q83A 2J87A 3CW8X 5G3ZA 3NUQA 1L5HB 4TYYA 5DGDA 1IDOA 5E1DA 5LU9A 1NP6A 4EZIA 1CQJB 1XKLA 4ERNA 1KMIY 1XZAA 2FFBA 5AXAA 4MYUA 3LRPA 1JQJC 4TUYB 1VLZA 4P80A 3O75A 3AKZA 3HVIA 2Y4OA 3TLJA 1XLUA 1XJQA 3NS7A 3RFUA 1SKAA 3GJXC 5CLIA 3ZGNA 4DQKA 4F2WA 3U6KA 1WDMA 1YQUA 2G0NA 1T5LA 1C4KA 4OVKA 4HG2A 3PNSA 3WWYA 3DLTA 2PQMA 4B2LA 1Y3CE 3Q8KA 1V45E 2L69A 2Q5OA 1OVGA 1L4LA 1NLZA 1XG5A 4GDMA 4H6VA 3QPAA 2J3JA 5EYPB 3QX9A 3U7QB 4BX9A 4DF3A 1KEWA 2WI8A 2LWIA 3K2BA 5KKAA 4EKDA 3K20A 3DEFA 2PQ6A 1WPXA 3PIDA 4QPJC 3IALA 3OIWA 2GZMA 5JQGA 3E5NA 3OC0A 5EXDA 1AA6A 3RVQA 5IZCC 3K94A 2DKOA 1UPBA 2Q0SA 4IYJA 3QUCA 2MMGA 3WGKA 2EIXA 4G8JA 4I1UA 4MV3A 4N5MA 4OMUA 5DKFA 4DMHA 3THYB 3RJTA 5KDOA 3X1DA 4OM7A 1KKLA 1SCDA 1XDUA 2P68A 3HLTA 3KYDB 3WJAA 4YCAA 4XX1A 4QBKA 1DKUA 1Y1TA 2OHVA 1RWMA 4BPBA 4JYZA 4Q9LA 3OJCA 3ZR4B 3JQPA 1IEXA 4PXYA 3STHA 2I9KA 1HT0A 3TJRA 1YHZA 1N3IA 1C4WA 1ONBA 3ELUA 3HA5A 4WZBA 4CLDA 3WKDA 4UNQA 1K5PA 1DELA 4GP9A 4CKWA 3OCWA 3IIJA 4RUKA 5F73A 1H0KA 4D9BA 1SRRA 3H05A 4RKYA 1QHEA 3AERB 4H0FA 3HJGA 1E1KA 2AR0A 1Z4OA 4D5GA 5ITZA 2CHQA 2CZCA 1XL1A 3JALB 3QE3A 4N0PA 1B93A 3L0SA 3OX3A 5FAXA 3ZY5A 3ZS9A 1IEVA 3DOJA 1EM8B 1ZSYA 2WFLB 3HJNA 2I54A 3SHFA 4XUCA 1EUZA 3PHLA 1RJEA 4GSLA 1P61B 4RK0A 2EATA 2ZRPA 2J3MA 5B36A 3VR0A 1CEXA 1F0YA 1PFYA 3B1VA 5JBNA 4UTVA 4NLLA 4NX2A 2O7RA 1N32B 5SV2A 3A6DA 4MQEA 3SQMA 4B3SB 1X0XA 4LV6A 1NNLA 3RO7A 8ABPA 2QTVB 5LMUB 4ZQFA 2NT3A 4AKEA 5B7QA 2QF7A 3NWPA 3NBUA 4UOZA 2EDCA 6CHYA 5HKBA 4TN1A 3LCRA 4FMPA 1DT3A 1TK9A 2Q5QA 3VTAA 1ZJWA 2I6GA 4AP5A 5FBKA 3OAAD 4OP1A 4BU0A 3PDHA 1ISPA 2VNKA 4W9RA 1BQEA 2DT5A 4UNIA 5F7JA 3WMGA 2G5TA 1QH8B 3L8FA 3PEVA 2JLBA 3AM4A 2A0YA 3AIOA 1U8XX 3ECAA 3UMVA 2XQJA 3AL3A 2WSSD 4D0SA 3KB2A 1H85A 3RYFB 4OYHA 4RF4A 2ENWA 3H1GA 3Q40A 2X2OA 2I2BA 4CN9A 2W9XA 3C1TA 4DEVA 5L51A 2I4MA 4F9FA 1F9AA 3W6PA 3IQWA 1U90A 2OESA 3MOIA 1KHTA 3CVXA 3AZOA 4U6NA 2AMYA 1JHXA 1U2ZA 3I9KA 4WXYB 3TQHA 4C7XA 4DDWA 2P2CA 3QPDA 2IHUA 3VZBA 1C8KA 3G0IA 4CN8A 3GJRA 5CA1F 1A4XA 2OAEA 2VJLA 5AHRA 5IUNC 1AUVA 4LGCA 1M76A 3PDIA 3UWSA 3NMUF 3ENNA 1HG0A 1ZOPA 4PSDA 2YXEA 2BJWA 2HB6A 4KIUA 2AXEA 4F2GA 5DDIP 3WGMA 2DTEA 4IDNA 1U3GA 2C4MA 1TLLA 2IHJA 3LDUA 4KUGA 3VI3B 3ZH2A 4EEKA 3BXXA 2ATIA 4C0WA 2DPLA 5JYDA 1BA2A 3OPNA 2CDCA 4EUEA 4V3BA 3JPWA 3CH4B 1YE3A 3NTQA 4Y18A 1JIUA 3S29A 2H2FA 3DKVA 2PT7A 4OU5A 1G4UR 4DIBA 3ZWNA 3FFWA 2QAJA 3FD8A 3MWKA 3KOMA 1HORA 3FDXA 2LVBA 3LWZA 1YCFA 1H2AS 2V7WA 2W2PA 5AQ1A 1A7UA 1KAEA 3W6ZA 5ABPA 2ZJ0A 4KVAA 4RZHA 3G0HA 3TDNA 1QV6A 4IIVA 3L7BA 4UUPA 4NG5A 5HM8A 3KJNA 4ZO6A 1J70A 1GRNA 2VDWA 5A4IS 1SBCA 3MTQA 4JU8A 4YV2A 3UG7A 2XA9A 3ZQ6A 5BSKA 5ILOA 1YU6A 1IBLB 2NYVA 1QE3A 4GXQA 4M7RA 4R51A 1B00A 4EEXA 3ZUGA 2P35A 3UMGA 2ZBPA 1X1QA 1D9ZA 3VRHA 4EQ6A 4W5NA 1UXKA 4LKRA 1R6VA 2DM6A 3RIEA 5ALPA 1LFDB 3GXOA 4EZBA 3E53A 1NUSA 3IAHA 2BEUA 1N1EA 2XMCA 3V8EA 5KX5A 1XKQA 4EW1A 3RQIA 4ALNA 3MLAA 2FK7A 2ID8A 3IAEA 5C18A 5DHQA 5JC1A 1UKBA 2C8KA 3ENKA 2BEJA 2YYAA 1B14A 2WHRA 3KAQA 3MWJA 4C7OB 2VDVE 3B2EA 4BUCA 2ZOSA 4FDTA 4ND8A 1SXJB 2E4YA 1H6DA 4UZSA 1T10A 3OA0A 3LOPA 2C95A 2ZAMA 3IOYA 5DGIA 3ZTTA 1I7LA 1E4YA 3F1LA 3MWDB 4JC5A 4NH4A 3OIVA 4EDFA 2XADA 2EBUA 3QPCA 5A05A 1VMDA 3EZ6A 1UANA 5TT0A 2WMYA 1DMSA 1JMYA 1QH9A 2E4WA 1HL3A 1MQ8B 1HDEA 4ZGWA 2QIOA 1RXCA 5FWYA 1ZD4A 2RI1A 1NOJA 1JKXA 4K6MA 4M0UA 3GLGE 3B6KA 2IEBA 1OBOA 3D6VA 3GMDA 3K9HA 3OLQA 4GYWA 2QVZX 4MRMA 1E18A 4DLVA 4U2BA 2GJKA 2J3QA 5DM1A 4FDLA 4KRFA 4YPVA 2V6FA 5KQGA 3KR1A 5LZ5A 2W70A 4IDFA 4H0CA 5ESXA 1JV2B 1Z6ZA 4LOLA 3OOEA 4NOKA 3Q15C 2FX5A 2UKDA 2GCEA 2P3QA 4A0RA 2AMVA 1FYXA 4ZC1A 3MWFA 4O25A 1VDMA 4WKNA 5B1IA 3T9AA 3EEYA 3MGKA 5LB4A 5BN3B 4OATA 5TRTA 3G2IA 2QBYA 3GHYA 2RGWA 4P34A 5HCUA 3SFTA 1V7PC 3IPYA 1ZI6A 5CT5A 4E2XA 2PUTA 1NR7A 1ECPA 2D1SA 2P11A 5FV4A 4G2TA 1CY0A 5JAIA 2IBSA 1IOZA 2V7XA 3DL0A 3HHEA 3Q8XB 7MHTA 2B0JA 3QFRA 1ZY2A 2QM3A 4BE9A 1A2KC 2Z58A 3EVNA 2Z8YA 5AIBA 3QUQA 1L4FA 1SCKA 1A97A 2GEVA 1Q77A 1MORA 2NUAA 3H2HA 1POWA 4HX5A 4RH1A 4ZCIA 3T3OA 2C29D 1TA0A 2HMAA 2JIQA 3MA0A 4AZSA 3FKSD 5FV7A 3OO1A 3MD9A 4ND3A 5BWBA 1K4YA 1O0CA 1JDVA 1JHPA 2C8VA 3PXUA 1X92A 5DXJA 1D1PA 2YWFA 3UMJA 3WB0A 3ZNOA 2FR1A 5AVKA 4Q4JB 2ZDHA 4W6ZA 3CIFA 5EZ6B 4CLEA 4J76A 3PC8A 4QDKA 5G0WA 1KETA 1T25A 2RHTA 1PR9A 2ZB4A 5GGYA 4EZEA 5I7VA 3JYOA 4CQMB 2QM8A 4ER0A 4JLDA 3RHFA 1NW6A 3RIYA 4NNOA 2YJ6A 4D0NA 3H5OA 3G2MA 4R31A 3LTEA 3IBTA 5LP6A 4MH0R 3WFIA 3GP8A 2P65A 4XLZA 2G5PA 4F96A 1SFRA 3JD1A 4KI7A 4RCYA 2A94A 2E49A 3BDAA 5KOHB 3KLMX 2X15A 3NALA 2L42A 4RADA 1ZGAA 4JB3A 2PU7A 1QX3A 3MLEA 2QORA 1NGSA 1SCUA 3IESA 2O8FB 1BZYA 3TCNA 1A69A 2C5LA 2JGNA 4J1QA 1MHTA 2OHOA 2DR3A 2XVXA 3UV3A 2WTEA 3ZLBA 5AD1A 3DKPA 1W0KD 1VIVA 4I9UA 3KKKA 5JS1A 3LI2A 4U7WA 3SP1A 4CM9D 2P4UA 5TMEA 4E1VA 2AW5A 3ER8A 4YV1A 2UVQA 4IKEA 2CLIB 3G8YA 3JZAA 1BXKA 1I5EA 2BW0A 2P27A 4QGGA 5IT9A 2IZ5A 2B4AA 3FPKA 1U6JA 2RE8A 3CO5A 1I30A 3NPAA 4HH3C 1MC8A 2A0WA 3KUUA 3I76A 3R3JA 4W1QA 5EGNA 2EZUA 2LNDA 5FUVA 2ISQA 3AHGA 4IXNA 3IHLA 4O4HB 4B31A 1M8JA 1AKUA 2QU8A 3D54D 3VBEA 1I4DD 1NKVA 4G65A 4L8GA 3U5TA 1COZA 4G9EA 3U1VA 3RFCA 3VGJA 4ARUA 3LYUA 1RIIA 1SVOA 2WF7A 4DSTA 1IMJA 1W19A 2IIQA 4S05A 5J4HA 2EC5A 3AR5A 1Z29A 1JG1A 3WZMA 5CLGA 3IEXA 3LYAA 1TJ3A 4IRXA 1T2CA 1UOEA 1V25A 1DEHA 3KWJA 3ROMA 1L2TA 1TQDA 1MX5A 1FU4A 3HP7A 3OX4A 2A57A 1KAGA 4MVCA 2XUIA 3K0AA 1XMQB 1KARA 3KWLA 2HX1A 2F62A 4NQRA 2D2XA 3R3UA 5E2IA 3TEFA 4LMRA 4H1WA 1F2VA 2B2XA 3B1WA 1KEKA 3CHYA 2REQA 2VF7A 5J9FA 5BSFA 4MGHA 5FWNA 4DLLA 3MTBA 2OCKA 5F51A 2I3GA 4TT3A 4B2PA 2XCRB 2RB5A 4IJ5A 5TEVA 1F17A 2RGEA 4LGYA 2F1IA 1QP8A 1ST2A 2BAGA 2AFIA 2ZBEA 3DE5X 1XMJA 3HGQA 1CY2A 1YZLA 4HEHA 4MVJG 5JASA 2UUCB 5KC8A 4FCWA 2PH3A 2P2NA 1HT2E 1YZNA 1UWVA 4OHOA 2AMFA 3BFPA 3RF7A 4G5XA 3N2YA 3ZHYA 3TB6A 2PS0A 4CRWB 2P9ZA 4HMOA 4R3NA 1T0PA 4O0MA 1L0BA 3CVYA 1J9EA 1G8JA 4B33A 5IPFA 5ALYA 3JAWA 3UHAA 1NU6A 1FLVA 4HMQA 3BIFA 3N70A 2XKJE 5C35A 3A6JA 1RSZA 1HTBA 2BGLA 3H75A 3TTSA 1SQSA 3PGMA 5B7GA 1T8YA 1C8LA 1EHIA 3DONA 3FPSA 4JYBA 5MHTA 4L15A 1Q7RA 4TKUB 1IH8A 4MJ3A 3QHQA 3GEEA 1JQDA 2DVMA 3WK4A 2ZZKA 3AF5A 1WBJB 3UF0A 3UQZA 2UYCA 5T6MA 1MT0A 3MJEA 4GNKA 4HQ6A 3SBDA 3ZKAA 3L4KA 3RRYA 4AUEA 4BKOA 4H31A 1D1QA 1EFKA 2R79A 1DEOA 3ZCRA 2IPAB 5HZKA 1MCZA 4GR5A 4D43A 4E2YA 1LX6A 3D4OA 2NQ8A 3DBLB 4ZPJA 1W9HA 2A4MA 1LKZA 2HZBA 3EZ2A 2Z1NA 3TSCA 3F9IA 4Z6KA 1TUGA 5FTWA 1N25A 4JGIA 5KNBA 2VBIA 2EERA 4YWHA 3UJDA 3I4FA 2P2GA 1SVLA 3B20A 3E22A 3GFSA 3P2EA 2GJAA 4BFVA 2DWUA 2WU0A 1KP2A 4IDBA 4M21A 5TXGA 1T0JB 5SZHB 1SVNA 1QS0B 1PEKE 4BXOA 1KJQA 5AUOB 1Q6ZA 3RYHB 4KMOA 1PQPA 4YRKA 3CEHA 3OZTA 3ECCA 5F1PA 3DZBA 3I5YA 1J6UA 1QHHB 3HJTA 3SZ3A 1QYRA 5UKDA 4AO6A 4EVIA 1JT2A 4KIFA 1VIAA 3BERA 2WD8A 5C8YA 3ABRB 3MNFA 3EARA 1E3LA 4PWZA 5HX7A 2ODAA 1RP7A 4A1FA 4B9AA 2WRZA 1QORA 4NBSA 3DZCA 4P4SB 1XHFA 2C61A 3JW8A 3F8TA 4DIEA 1C1XB 2CLOB 4ZHQA 3L18A 3NKLA 1HNZB 5BQPA 1XEAA 4O29A 4XYGA 4G0PA 1QKIA 1CYEA 3RTGA 2EU8A 2XGGA 1IOLA 1VJRA 2Q3MA 3MLBA 4Y9RA 2AFIE 3EDYA 4YRTA 1B8NA 3ZH9B 4DA7A 4XXHA 3IUYA 3CZ5A 2Y4NA 2TECE 1N0HA 3OEHD 3G1TA 1L7EA 2KMLA 4PFKA 3RAEC 4RTLA 3DQPA 3KBOA 5GVSA 4DVJA 1KMNA 3ZZMA 4S2EA 1QTIA 3M34A 2NZXA 4Q9IA 1A9PA 2UZ1B 4R40A 4LSZA 3AUSA 1Y3FE 3IIKA 4L50A 5IP5A 5HA5A 3ZGYA 2RC6A 2EFYA 2XUDA 2YMMA 4GSYA 3K73O 5IJ0A 2OBNA 5JANA 1I33A 3K53A 1XT6A 4YAFA 5F5NA 2J3DA 4BLWA 4CKEB 2AC7A 1XQYA 5I9NA 1VE5A 4I6EA 2VPZA 5FLYA 4XB1A 4LYFA 2I4OA 1T8WA 3SXJA 2WJ6A 1P80A 4G5HA 1XK7A 3HMQA 5DIFA 1E69A 3ZI4A 5C3MA 3REQA 3REOA 1CCWA 2B25A 2ZVQX 1G7SA 3C3XA 2XUKA 5EZQA 4HNRA 1Y7HA 4YAWA 2B2CA 5BVHB 4QZVA 2PM8A 4MB0A 1UDXA 3H8VA 2E18A 4LDRA 3UCFA 4RFLA 4F93B 4JJ6A 4K26A 3B1YA 1X2BA 1TNDA 3JZIA 1MB0A 1G9SA 3HVUA 2I3AA 4HS9A 4TT8A 1GL3A 3I73A 4KYVA 4A0GA 4CCYA 4D9CA 2PZJA 2PZKA 3TNJA 3Q8LA 1M6EX 3Q9LA 2WW8A 1JQBA 4OMFG 4WY2A 2IE0A 5HQJA 3VZSA 1IPHA 2JFXA 2JVIA 5CCEA 3BRWD 5CB0A 1VI5A 2D1QA 5DZSA 4PPGA 1A9SA 5HDBB 5I3CA 3L8YA 1VKNA 4QG7A 3S81A 3LBAA 1X0VA 1QFMA 1J8DA 3ZY2A 4LG1A 1Y8RA 4M9RA 4BWFB 2WZBA 3U4QB 2EV9A 3PEYA 4OFXA 2DQSA 1H42A 2WJWA 3F74A 4L0QA 4C0JA 1S3IA 5AM4A 3GGOA 1H6AA 3SLKA 4MNTA 4UUAA 2JASA 2RGNC 3JWGA 2PKQP 3M1LA 2EYQA 4YRPA 1UUFA 5IKMA 4HOYA 5F4BA 4CMIB 1T2FA 3HTXA 2AUTA 2VJPA 4COKA 3O84A 4BO0A 1BWQA 1IN5A 4QGHA 4ZJPA 1OBFO 3FUTA 4C1NA 1DC6A 4AWAA 3KE9A 2FZEA 2O0MA 1ZKDA 4NAVA 4FQ7A 1V5GA 2VHEA 4MSUA 1XZ8A 3JRNA 1YJ5A 4PZUA 1XLTA 4ZU1X 4CEIB 4OIFA 1PNOA 1VMIA 1EP2B 5DIZA 2HF2A 2Q5JA 2R62A 3LPDA 3CX3A 4KHPB 2J0UB 3R74A 2OO5C 1MEJA 3GJ5A 4OB6A 2ASVA 1MABB 5FI5A 3VJMA 4UQLA 1HE5A 1R27A 2GSDA 4BAZA 3UJ3X 3K0CC 1DIAA 4RULA 2OYSA 1Q22A 4IYRA 3DMTC 4B3RB 3SBOA 2OQVA 2DJIA 4QPCA 2G7MC 3DZFA 3HBFA 4V2IA 5AJHA 5B3LA 4BUJA 1XTPA 4Z49A 4EB3A 1LK5A 3VYUB 2Q3HA 2VJDA 5KYNA 2DFDA 2YHUA 4AFNA 1EEXB 1X19A 5EJ5A 5CD1A 1XC7A 3GAMA 4FR0A 4DZRA 5ESWA 3M6UA 2BFDA 4JQCA 5FPTA 1NURA 2IYZA 4LQDA 4R7TA 3EUWA 3SEFA 1H2RS 1Q0LA 3T54A 3TZCA 1N3YA 1Q1BA 1E5TA 4KR3A 4IQ4A 4D74A 1H6CA 1AUPA 1NF2A 2AVDA 2GZ3A 2IPNA 3DDWA 3I04M 3FLMA 1A9XB 2GRUA 4I9FA 1NXWA 1WAMA 5FTKA 1YTUA 1DT5A 1GGHA 1DADA 5FI0B 1ZESA 1C1YA 2YINC 4BO8A 3HJRA 3H5RA 4LTDA 521PA 5A5FA 3MWYW 2HYDA 2IYUA 3CZCA 5ULLA 4B3JA 4UPEA 1JUDA 3HYTA 3OZBA 4PLTA 2QTHA 3T15A 4FOOA 4KIWA 1KH1A 1CUCA 1DJMA 4BNNA 3EXFA 2GASA 1HFEL 3OE5A 2B9VA 3C8UA 4WZAA 5GONB 5KQMA 1GTZA 5JMPA 1OBVA 5AMXA 4EFNA 1E0JA 4W5QA 1NJ8A 2DECA 2YICA 4B3BA 2BI4A 4N7MA 1A2OA 1ZI8A 4BNFA 2FSUA 2X19A 3EZLA 3UHFA 1VPDA 3TZBA 4QOGA 5FTNA 4IVNA 3ELWA 1WCXA 2CD7A 2NTVA 1O54A 3EQ6A 2OBYA 1L5LA 4CTKA 3I6MA 4UCWA 3AMVA 5E3IA 1WXXA 3C85A 2E1PA 3D6MA 4FJ1A 5EERA 3ROPA 5BN5A 1ENZA 3CEAA 3H9QA 3EAQA 4R5HA 2I6SA 1KDPA 3EA5A 2GN8A 4F12A 1SG6A 3KTAA 4LF5B 1YZHA 2EBFX 4G07A 3AHJA 4BVKA 1J99A 2CV1A 3TMYA 2Q6IA 1N4DA 5AKZA 1XEWY 1OI4A 4GWKA 2F1KA 3CISA 2XI4A 5AJXA 5TSDA 5JARA 2JC3A 1KC3A 2F17A 4W5RA 4E46A 2ZSFA 3D3KA 3HB4X 3S1SA 3W8EA 1X7XB 1Z4NA 1JHQA 1L4BA 3DF9A 1O5TA 3RSZA 4AO7A 1KVRA 5E0OA 1NBHA 3IQEA 1M1YE 2A5JA 2B61A 2OQIA 3W2HA 4F3NA 2BHTA 4P0QB 2UYQA 1XLVA 1M0SA 3PPIA 3T61A 3WSWA 5C8YB 2YKGA 1ZCFA 1IN6A 5DN6A 2QUKA 3LLSA 4NWIA 4OJYA 4RY2A 1S3GA 1X1RA 4UNPA 5EMMA 2HU2A 1MPTA 1PFQA 1NBMD 1XDWA 3W7BA 3F90A 1CUZA 1TPYA 1V3TA 2P9JA 2Q2VA 2VJOA 4WFQA 1P0QA 4AS3A 2JEYA 3G85A 4KNVA 3GLSA 4H59A 1KQNA 1GFWA 1E7YA 3TR0A 1OXMA 2ZB8A 1E3DA 4FB5A 4MRSA 3RVNA 2BC9A 3WNBA 3U61B 2RK6A 4PGMA 3G0DA 2PLNA 2PUVA 4GRIA 3E22B 3GBPA 2VHYA 3K09C 5TT1A 3RARA 3UK0A 3VNRA 5C52B 2FUNB 3GDOA 3LF2A 4JK3A 1ZAYA 1Q3TA 2HJWA 3CKLA 3V8RA 2HRCA 1PG0A 4D1YA 4LRTB 1G5HA 4Y2QA 1T43A 4WNIA 5JIBA 3U4GA 1KP9A 2EF1A 4MLDA 2JCBA 4PYMA 4HQRA 3MWGA 3OAAA 2QU7A 2FI1A 3SKYA 1GN9A 1T2VA 1JDSA 1DBPA 4FLEA 4HNQA 4CM8A 3SGLA 4RYLA 4HYYA 4C4AA 1CZHA 4URYR 4HDSA 5HVNA 5DV9A 2XSZD 2F59A 1XA0A 3BRCA 4E31A 5HUJA 3OZGA 3EF1A 4YX9A 3UOAB 5KTPA 3KUXA 2IS4A 1RNLA 1SXGA 1YZTA 3A4LA 1VBKA 4ZARA 4CDMA 4R1MA 3WVNA 1UBGA 3AEKB 4LYEA 3KT0A 2KI5A 2PA0A 2AW3A 1ZL0A 3QLVC 1B26A 2V6BA 2E7ZA 1T24A 5I7EA 3RRFA 1SQFA 4WOPA 4ZPXA 1N7JA 1R37A 3BORA 1AZSC 2F3RA 1OQAA 1A9YA 1SXIA 4BCBA 2YV3A 3LK6A 1IK6A 3NOOA 5KAPA 3B3JA 1BYIA 3O4RA 5A3JA 3GIWA 5IH3A 4N82A 2Q7OE 5J1SB 5IAEA 2IOQA 1PEAA 4IR7A 1QB8A 1U1EA 2DTXA 1JLRA 1J8VA 1EYZA 2OGTA 4ZP1A 5DNVA 3H42B 4Y9SA 4E4RA 4QTUB 2FFRA 4QBGB 4X65B 2XX3A 4Q9NA 3C3EA 3FTQA 2EFJA 5JE8A 5FUQA 4B73A 4CHTA 3ND9A 1DFGA 2O8FA 2VTBA 2AJTA 2ODNA 1R3DA 4S12A 4BMVA 1QQ7A 2IXTA 3L7MA 1SOWA 1ADBA 1T2DA 1WKCA 4CUKA 3CF4A 4EITA 4L72A 4EG5A 3F67A 3TOVA 4CG1A 2NGRA 1Z45A 2D3TA 5CH5A 3DUFA 3NAMA 4MKFA 1MVOA 4JEUA 5LB2A 3VR2D 1SIOA 1N78A 1P45A 5JYBA 2FCAA 2Z8XA 1YOVB 1ZHOA 4B34A 5TQJA 2RAPA 3ODGA 4IOJA 4NZ9A 2PTHA 4R5MA 4BZQA 5HHTA 3RYCA 1ZU4A 2N1MA 5AVZA 2J32A 2PL3A 4JENA 3IKTA 1GN8A 3EPRA 1TCBA 4B3XA 2I4LA 1I9CA 1MQAA 4I1YA 3U13A 3VNQA 3LP5A 4B47A 4EGCB 5K6AA 2P6UA 1QLWA 4DJFC 4DDHA 4ZJUA 1RLOA 5KOYA 4RIFA 2OBMA 4U8GA 4K87A 3W5CA 2XXJA 3NDRA 4JUIA 1IWOA 2PUDA 2CB0A 4O4HA 2CFTA 2RHJA 2NTEA 1SWVA 1H2YA 2QR3A 4BWGA 1N5IA 5T8KA 3GZJA 1GPAA 5L4LA 1PJQA 4LC1A 4OI1A 3B12A 4URWR 1HQYE 2FPPA 2ST1A 1V1JA 1I01A 4PV7A 1A76A 1LDGA 4GZLA 1QRSA 5FCDA 4FYVA 5I5GA 1N0VC 1I32A 2JAQA 3QELB 4DYDA 3WYGA 4CLHA 4RVNA 4RNCA 2ZM6B 1AC5A 3MINA 4R8RA 4EECA 5JSHA 5K0TA 2MSCB 4H15A 4K1XA 1E2NA 4JODA 2V6IA 4MAAA 1EJ6A 1JR3D 2ID7A 4NDNE 4QYMA 2DR2A 2DQ4A 4GOJA 4EW6A 1OB2A 3OZAA 1A96A 2P0YA 2YN2A 4C5AA 3OX1A 3EXHC 3TSOA 4A10A 1SUWA 4CTOA 3BDVA 2WAMA 3E0QA 3Q72A 3LX6A 1FFHA 2M98A 5CCXA 4HDSB 2FW0A 4JLMA 4V03A 4K0RA 1TGYA 2KW5A 4JI8B 5ENVA 5ER9A 4ZIRB 3PTZA 1AG9A 4MW2A 3TYXA 1Z38A 1P1IA 4YJFA 2HZ7A 5AVYA 1GCUA 5BUSA 4JHXA 4GLFA 4L08A 1M54A 5BWMA 4XCQA 5KOJB 4M9ZA 2B21A 4HI0E 2ALJA 2HU5A 4BFLA 4J7UA 4ND8B 3RSCA 2NZYA 4OLAA 4MKIA 4NPHA 4YP9A 5SZIA 4Z9FA 3TLAA 4HRVA 3C3BA 4IDCA 4BBAA 1D4OA 4FUQA 1NN5A 2VQ3A 4Q7JB 5IKXA 1D2EA 4X3CA 3L7KA 2XUFA 4QOFA 3SEQA 1RPZA 1O8BA 3OURA 4O4LF 1CR1A 1S89A 1L5GB 2BH2A 3DDHA 4Q48A 2HF8A 2GBPA 5BVHA 4EB6B 4E5NA 5CDSA 3IAAA 1N2HA 2XTAA 3IDOA 1ECBA 2ZUVA 1Z8DA 4F8YA 2OPHA 4K46A 4AJ4A 3I5XA 1UBSB 2XGJA 1SHJA 3ZS8A 1P91A 5FH9A 2DQYA 3AI7A 3T35A 1C2TA 3AC0A 1Q50A 4NBTA 3ZVKA 4AD8A 1Z62A 3FF4A 1HDIA 1E1DA 1REQA 2QJRA 1KE2A 5B1SA 5ALLA 4CKEA 3FA2A 3NH6A 1M2OA 2JJ2D 5BY2A 4LFBB 2V97A 3GP5A 4Z9BA 2A33A 2Z9BA 4FWBA 4LJKA 2NP6A 1E1CB 1EB9A 1XZPA 3BFXA 4YUAA 1VYTA 4R9RA 5ES3A 4Z8YA 3RIGA 4DLPA 4IIJB 3IDSA 3WBFA 1NQ5A 1Y33E 1CZLA 3AR6A 5GV7A 5JOQA 1SAYA 1WS6A 3UKJA 3UK6A 4DCTA 1F4PA 4YR7A 3Q9UA 1YL7A 2Y1OA 4YQYA 1N7HA 3L01A 3HCWA 3GCXA 4MI3A 4X1KA 4N3CA 3CW9A 4M6WB 2CYBA 1XZKA 1V39A 3KQHA 5J2UB 4AG3A 1Y3IA 3TL2A 3IEKA 1VSTA 1YDGA 1J9ZA 1PJSA 2ZTVA 4MRAA 4EF4A 1MT3A 5NULA 3IBFA 3RFFA 1EUQA 3FLBA 1GZ5A 1YACA 1EXNA 2NQ2C 4MS3A 1PVDA 1SU4A 4NFHA 2GGSA 3HMKA 4Q7KA 5LC1A 1YUNA 5M5BA 3MK31 5CX1A 1PQ4A 1M7GA 4X3PA 4ENPA 3KVVA 4IH1A 2D13A 4PYOA 3NTUA 2PMCA 4KN8A 1XRQA 3E9QA 3OTOB 1SN7A 1V1RA 1LX7A 1OV6A 2C5BA 1NWHA 2PJDA 4UXIA 3UKOA 3WC4A 1LD3A 1JPUA 2H48A 1O94A 4ACBA 3GWGA 1GSIA 2ZYGA 4DC9A 1M2FA 3H65A 4P7GA 4CYMA 4RF5A 2P2DA 3ANMA 3NOXA 5JV5A 1IXSB 4X93A 5HZHA 2CLFB 3G2NA 2PX4A 5A7GA 3CUUA 1A4IA 3BGSA 2DQKA 4EYOA 3U40A 4YJGB 2FMTA 1QH0A 4B7ZA 1ZO8A 1GA6A 2H29A 3TW0A 5TPZA 1AQYA 1EWTA 4K9LA 3O8QB 2VPQA 1AVTA 2C2KA 1GTRA 1OHHA 4QBFA 1FRZA 2I6UA 3LO8A 4OB7A 1SBIA 4GPBA 5D85A 1T1RA 1NULA 1FTGA 1RCTE 2WJGA 3IDQA 2HK9A 3GLFA 4HKTA 4KWHA 1ORVA 2G25A 1WCYA 4RHXA 4BKMA 3QXXA 5KUTA 4DIOA 5I8PA 3JWEA 4IIGA 3DEZA 4WUTA 1AGYA 4W7SA 3KSUA 4Z0HO 2QDXA 2WWIA 3QFFA 3CUVA 1VZ2A 1VE3A 2GKGA 4P3NA 1AX9A 3V2UA 3KQKA 2NSYA 4W4TA 4DJEC 2OCYC 4Y6SA 5AO9A 2H16A 2M32A 1YR3A 2IT1A 4RPCA 3SOZA 4DCOA 1O94D 1NPDA 1INLA 2CD9A 1HLFA 3AETB 3D6NB 4N3NA 4YLEA 3MHTA 2XHEA 1HDYA 2LIPA 1TZMA 1C9YA 2ZI7A 3A3YA 3C5HA 3IJEB 4KX3A 4ZOCA 2JI4A 2PXCA 3D6TB 4LDZA 2VK2A 4O4HF 3NVAA 1OTXA 1WKVA 2X41A 2FPGA 4Q1BA 3S68A 5JAZA 2XEDA 4KVZA 4A16A 4XLTA 2AG0A 4WXPA 1ODJA 4MGIR 1JH9A 4JI4B 1JP7A 3D3EA 2ECQA 2VYCA 3AG6A 4ZYVA 3LDGA 1IRIA 1RRGA 2IYYA 2ZJBA 3IEVA 3USCS 1R64A 4D42A 4D8XA 1GG5A 1GARA 4CDRA 1AURA 4KQGA 4DA8A 1P1RA 2JIZD 1S96A 2HRRA 3TKLA 4TROA 2GH1A 2GJ9A 3CUEF 3CXRA 2W37A 1KO5A 3RIXA 2OV6A 1T5IA 4RNDB 5AUNB 4BX8A 1T6YA 5K8IA 1XA4A 1AD2A 1LJUA 5DSZA 3O83A 4ARBA 4K9DA 1JHUA 4IXTA 3D6JA 4LHVA 2PMDA 1UK8A 1NLMA 5C5EA 1PWZA 1EBBA 3NGMA 4Q9DA 4XLLA 4ON9A 4ZAGA 3UAVA 1NX6A 5TS3A 4FEEA 4J9VA 1ES9A 1T1IA 3E2IA 3KDSE 4JITA 3SLRA 3WXMA 4C6HA 1RWWA 3KK0A 1PR3A 4EY4A 2RGGA 2RC5A 2A7XA 4I3HA 2SKEA 2ZR7A 2Q1XA 3ET4A 3IAXA 1DC5A 1PR2A 3MWEA 1QHYA 4A6DA 3CB4A 3O8CA 1EGMB 3JYHA 5J40A 4UTPA 5D5PA 1PR0A 5HJ5A 3N76A 4B45A 2P1ZA 4GMKA 4DJDC 2VQFB 3AVVA 1A71A 2C78A 2WR8A 5FWDA 1JYSA 1VJ0A 2BELA 1P2GA 1FDRA 3IQHX 4KWIA 2F00A 3TFWA 3FTCA 4WASA 4RIGA 3ZXSA 3ROTA 4Y98A 1V11B 1PX2A 1TQ8A 5BYKA 5ICSA 3IR7A 1K2VN 4NBNA 3K9WA 2CHEA 2XUPA 1B41A 2RJOA 4DZTA 2C1ZA 4JI6B 1EWRA 1K5HA 3LC7O 3EIUA 2DOKA 2BBOA 2IYLD 4GPAA 3X1ZA 2W8ZA 3CJQA 4ILEA 3HZZA 4RS4A 2Z1DA 5CXUA 3DOCA 3HYNA 3FPJA 3LW7A 2D5LA 4I66A 4I8DA 3U7EB 1ZW1A 4KGXA 3D59A 4R2WA 1E98A 5A3QA 4HWSA 1ZJ4A 4FPXA 4UOQA 2ONZA 3CZQA 5GINE 4KK3A 1K7YA 1M5TA 4Q82A 3BTUA 3MPOA 4I14A 3STTA 1H2EA 2G1PA 1V71A 2E4ZA 1JSZA 1NBOA 1VLLA 3JVDA 5FUYA 2WM9B 1HQCA 3RAGA 1GPJA 3QKWA 1HTWA 2JW5A 3KXLA 1AQJA 2MINA 1T9HA 1D7OA 2ZRQA 1LZLA 5FPQA 1V43A 4JH0A 2HIHA 1PIWA 2AXPA 3AW9A 3WFZA 4ZOBA 5K8UA 2DE0X 3JQBC 1VKOA 2IEIA 3CR3C 3STYA 3V7WA 1VKZA 4JBYA 3AQIA 4R2JA 2FPXA 1LQTA 2UZ0A 3PHGA 3DZDA 3KG2A 3TCXB 3VOAA 2OC4A 1UAYA 3FHJA 5AYVA 3WNDA 3JARB 2GN2A 3TPZA 1Q3HA 1VFPA 1B0ZA 3IPRA 1ZIPA 3B70A 1UXOA 4NJMA 4TV9F 1NASA 2YN4A 3W5UA 2R7NA 1XAHA 2BKEA 4JLKA 3NBKA 3HCPA 4FT4A 2ZYTX 1J23A 3M6MD 4N4AA 4EQ6B 2QN2A 1P7CA 7AT1A 1S8FA 3DMDA 3FWHA 1F7UA 5LIRA 3QBEA 2JPDA 2D4AA 3VX4A 3V1UA 2FE4A 3OTWA 2AZ4A 1QNLA 1R5BA 5CIQA 4YQZA 4J0CA 1G19A 2GESA 4P3XA 3R0VA 3NC1C 3WLHA 1K7EB 4Y2HA 1L5FA 4H7HA 4TVOA 2DEUA 3IPCA 3NX4A 5ALJA 1I3LA 4NMXB 4L8LA 1M2OB 3N59A 4UDOA 5LDGA 3GVXA 1Z39A 1X9IA 3BL5A 2VCEA 1XZQA 3DBHA 1QU3A 4N18A 1Z9BA 3DFZA 2O3QA 4HAUA 4BO2A 1F06A 2Q1TA 2IEDA 3RYFA 2SECE 5HM6A 3I28A 4M6WA 4PVCA 2VWHA 1FYDA 5HQ3A 4WZZA 3LVQE 3CEMA 3QLVA 1URPA 1L4EA 4PRYA 1L4MA 1T5TA 1IHXA 2V9PA 4LOHA 3CBGA 3CUTA 3TDMA 4QU9A 2Q9UA 4HF7A 4BZWA 2BSQA 4MDEA 2MSNA 2ILVA 2NT4A 3ETGA 1XCGB 5HS4A 1G60A 2M2IA 1N2BA 2QLMA 3M89A 3WLKX 2C2YA 2G09A 2W43A 2XB4A 3EUAA 1IIBA 3KKLA 4ZZ1A 2OMKA 2B94A 3IIIA 4D5EA 4R0NA 5DOVA 5FNVF 2C5SA 1BA3A 5AVQA 2GVZC 5EC8A 1N6OA 3BZBA 3O31A 5EJ9A 3G5TA 8OHMA 2A88A 2VEOA 4JR1A 2IELA 2ZSJA 1II8B 4ETMA 1KI6A 2DHRA 4X95A 4UM9B 2JFBA 4ENUA 3UFXB 1EP9A 4EL5A 3SX4A 1SXPA 4PX9A 3LECA 3USZA 4YJGA 3VSDA 1S2OA 4YMTA 5IX8A 4KXXA 1K0FA 2A0KA 4J49A 5KYVA 4DPKA 3Q7RA 1OPXA 1B8VA 4G0XA 4MV0A 2WWYA 5K9ZA 1EVEA 1M6NA 3P2YA 4ZEVA 1IJBA 1CR4A 2JGMA 2J45A 2GKOA 3IH5A 4X20A 3TVYA 3K70C 1NRJB 5KJEA 1P8AA 3VO2A 4BRUA 1U7WA 2WWTA 4PANA 2G63A 2P40A 3I34X 3RS2A 1AMOA 1I13A 3OHPA 1JWLA 5ALIA 2C2BA 2OD2A 4LI0A 1BOOA 4HQLA 4D80A 2BEWA 1EE2A 3AVWA 1L7NA 4UCXA 3CKKA 4GLLA 1HFWA 3M3DA 4Z4FA 4IJWA 3SMVA 2QA5A 1DRJA 4IUYA 4TSRA 3WLOA 4WESB 2HFKA 3JQRA 4H60A 4ZMBA 3NKFA 4BLOA 4TRNA 3ZWKA 1CNEA 1HX7A 3AU8A 4TXJA 3KPJA 1YD7A 4TMXA 4Z99A 5KYKA 3Q5GA 4HDQB 4F1WA 1GNPA 3F7MA 2JBAA 4ALMA 4RO0A 3KAJA 3U7GA 4X6XA 2A35A 3KJQA 4IJVA 4LRXA 4P4TA 2OK7A 4M53A 2PPVA 4XI9A 1Y8AA 3PUYA 5I7AA 3WLNA 3N2GB 5J58A 5BP7A 2D1TA 3ZLJA 2IPMA 4KDFA 2CUKA 4M60A 5CD9A 1DLIA 1P2BA 4LYAA 1N6KA 3OE4A 4J91A 3QBJA 4MR9A 4HRXA 4XJTA 1L1QA 3CCCA 3P9PA 3LX8A 4NR0A 3UJCA 5A4AA 4LXXA 1XE3A 1OZGA 3X1JA 1Y5LA 3MYRA 2EBHX 3QVOA 5AM0A 3WLPA 4BQOA 3A28A 4YRIA 4P3OA 2EFEB 1BN6A 4G5SA 3HSYA 4WVLA 4XVCA 1BDIA 2L82A 3ENZA 1C3VA 1M72A 3FPCA 2NACA 3IUSA 4KQHA 4RA9B 5JYCA 2G6TA 2PQ0A 4QC2A 1GG2A 1TI7A 1KMMA 1JFTA 1PN3A 4GYKA 4MVWA 4YAKA 1SK9A 1ZRHA 2PZFA 3G02A 2IA5A 2C42A 2W6MA 2RG1A 3FCCA 5BN4A 3JZDA 4NULA 1YNSA 2F8LA 2NU8B 3K1TA 1E1LA 3I2FA 3PKJA 4CEJB 1RD4A 1R4NB 1SHTX 2FN9A 4BB9A 1BD4A 1N3BA 3UW3A 4NCBA 2GARA 1XOIA 2JZNA 3DEHA 2ES4A 2QNBA 3DOFA 3RTAA 1BH6A 4YCSA 1PS9A 5FL3A 1COWA 3IAS6 4JXJA 4PZPA 2CYAA 3AIIA 1ELOA 2V5AA 4RD2A 5EIEA 1G20B 1O89A 1XRPA 2Q49A 1SPXA 4QQNA 3CGGA 3R8CA 1AF7A 2LKDA 2X86A 4HAIA 2ARKA 3EGVA 4BE4A 3JQFA 4JYMA 2J46A 4ESVA 3UUFA 3M6FA 1LS6A 3RAJA 3EQ9A 4JUDX 1IM8A 1CJKC 5B1EA 1SXHA 1Z13A 3JZFA 1ZUNB 1RACA 3K9NA 1SC9A 1HYQA 1RPTA 5DFAA 1CQXA 1SM4A 1DO8A 1G64A 4LECA 2JCXA 5LL6P 2ZS8A 2ETXA 2FDRA 1UJCA 3MB8A 4MUNA 4NENA 4U3JA 3RVSA 1EVJA 3ETHA 3OZRA 5U9CA 1PHPA 2Q3DA 2Z30A 4K9QA 4G0NA 3J81A 2RGYA 3NU1A 4K1LA 4A0QA 3KSMA 4BN4A 2A30A 1RI2A 3MMPA 5AUQA 3UV7A 4BKPA 3L02A 2WFMA 4MDYA 1ZS9A 1COWD 1XNJA 1X74A 1Y7IA 5FQNA 5HFJA 2OXTA 2E5FA 1L5OA 1K86A 3UUGA 1FC0A 5ITVA 1E58A 1L8LA 1PR1A 4K9PA 5TQ2B 1MEOA 2CUZA 2I6TA 1AK9A 4MUXA 1JKIA 2FK8A 3DBOB 3BA1A 1CY7A 3NDPA 4X61A 5FUWA 5K8TA 2FF7A 1W581 2VHCA 3PEFA 1CUSA 1JWAB 4RSHA 4DIFA 4XQ9A 3CEPB 5B30A 2BFOA 3N2GA 4Q3OA 3GLGB 4BVBA 3I1IA 3LZDA 4HH4A 3IVXA 4EP1A 1P1CA 3L8GA 4HRAA 4N6GA 4HAWA 4HVLA 2WUFA 4G23A 1WZIA 3O8LA 3L49A 3RUDA 1ZNYA 1GUZA 4M0KA 3T9BA 4F8EA 1VHDA 1XB2A 2RBEA 5E4FA 3WP1B 2GK3A 3EBPA 4EUSA 1CJBA 2MSDB 5LLSA 4GKJB 1ZEMA 2PUJA 2XB6A 2H6EA 3AKDA 5JDIC 2R6DA 3P5SA 3HKEA 4N12A 4NCIA 4ZEWA 2IPLA 2ORVA 2PSEA 4OHXA 4WQMA 2QD2A 5JAMA 1USUA 2EJBA 5GIPE 3A58B 3K4PA 1ZJ6A 2ZSBA 1IQPA 3Q3JB 4WK0B 4MP8A 2IXGA 1XKTA 4O33A 1JG3A 3QKIA 2C3YA 1I9GA 1V26A 4KUHA 3SHVA 4O8ZA 3HU5A 1E1CA 2AX3A 4O4IB 4A26A 3ETCA 2HPAA 2IYSA 4HDAA 4HGPA 4OQFA 1KK1A 2AJDA 1KYXA 1Q57A 2UUPA 2OCIA 1AQLA 4NBKA 2OR3A 1DUSA 1E2QA 5JEDA 2ZRCA 5MGNA 3CRW1 3KOYA 4YONB 2NV2B 4QREA 1WPQA 5HW0A 1C81A 1RFLA 3F97A 7REQA 3RV3A 1FXUA 3VXKA 1Q7GA 3CPEA 3L7JA 2P77A 3WL7A 3ZQUA 4TLBA 1UC5B 4C3OB 2AV6A 2JBWA 4Q1VA 2PLAA 4I8IA 4L95C 1XX6A 4P53A 5B53A 1SU6A 5FAKA 5ISMA 3A6PC 4R9NA 5L53A 4OXIA 1GNTA 3S40A 1KAOA 3GG2A 1TO6A 2DFTA 2QRKA 2QW1A 4PYKA 1L7AA 4DQXA 4WY8A 3GLHB 2G72A 4ZQBA 2OM2A 3MXTA 4I1SA 1OXKB 2D00A 2LV8A 1VLMA 2V54A 4UJ5A 4WCDA 1H22A 3HU2A 3K0CA 1H23A 2K5UA 5KNLA 4FFWA 1PGNA 5L8VA 3FNHA 1AE1A 3PEUA 1MW8X 1Z74A 4OO3A 4G1EB 3EXIA 4Z86A 2Y27A 5HKLA 4EG4A 2JZOA 4LVUA 3VC3A 4OHWA 1RWKA 5IF9A 5IM4F 1O5IA 4PSVA 5C80A 1Z0KA 1FVFA 4OSOA 1F2UB 2Q3BA 2GQ0A 3ABSB 5B55A 3EODA 3QLUA 5G1NA 2CVPA 5ITWA 3FDZB 5I9BA 4M0PA 3L4JA 5ELLA 1JFLA 1K0UA 3G0CA 3IRVA 4N6NA 5BV1A 5BUZA 1AIPA 4RVOA 2BOVA 3QXGA 2O0LA 1QUFA 3AF4A 2FRDA 3LBYA 5FF9A 3SYMA 1AMNA 4QTTB 1ZL2A 1P29A 2G3YA 3G5UA 3BMXA 4BQNA 3RG8A 4CGYA 3BJIC 3KJXA 1GNQA 3HKBB 4MQUA 1SZPA 1W25A 4JKYA 2L2QA 2RKOA 2QTCA 4RV9A 4C0QC 4Y2VA 3SSAA 5CFLA 3FOZA 2W6IA 2P1RA 5CB6A 1DARA 4PAGA 1OI7A 2A9VA 2W6OA 5BSVA 3DZKA 5IXYA 4F8JA 4U00A 3D4LA 4YIHA 4O5OA 5AKYA 2W6NA 4LZWA 1VPEA 2G17A 4TRRA 2B4TO 4CKBB 2FKAA 4YMSA 5JZVA 2FUG1 3LH5A 1E4EA 1K6MA 1UWLA 1WP4A 3EVZA 5BPFA 3K70D 5K4AA 4Y1FA 3K0SA 5JNTA 4QUJA 3EFOB 1O6ZA 2G1KA 3BS4A 4R84A 2J3LA 3ZZNA 4GXRA 3Q6MA 3CVUA 2QAGC 1UQTA 3JARA 3A2LA 4UW9A 2O7SA 1Y8ZA 4X00A 3R7LA 1PSWA 2R8YA 4MZDA 1FDVA 2CNOA 3QOFA 2D5CA 2KS6A 1GXSB 2VRBA 3HBAA 1RHKA 2VXOA 2W71A 3QKTA 1JHOA 3AWIA 1AO3A 2ZWIA 3QHAA 3V6MA 3WOVA 5G1OA 4MYCA 1PR4A 2PK3A 2HPZA 1WPGA 5IYZF 1VC2A 3QUBA 4IG9A 4WWHA 5CUQA 3SN6A 2B35A 2CWDA 3PJFA 1PFKA 3JVIA 2FVYA 1K8YB 5FOWA 1RYDA 5HBRA 5GONF 3NWEA 4DT1A 5ITZB 1I7QB 1CRQA 4IMPA 4JFAA 4M22A 2NX2A 3DQQA 1S2LA 4UFOA 4CMHA 4NJEB 3G59A 4JLUA 2QNIA 3PL1A 1MMFB 3STVA 2VT2A 1ZBDA 3LWBA 4NK4A 4WKOA 5I8ZA 2OORA 2FUEA 1VYUA 4DABA 3F0TA 2GN9A 1E3TA 1TYEB 4FWIB 4AJ2A 1SBQA 1Z5GA 4YCJA 3U3DA 5AQEA 2NUPB 3CVWA 3QSYA 1GQOA 2P69A 4MULA 3KPVA 3PF9A 4IXMA 4JP3A 3WV5A 1L5YA 2Y9MB 1GAEO 2LUOA 3GD5A 1VRCA 2HSJA 4CQJA 4EPXA 1NLYA 2GNAA 4YJ2F 3WIOA 1P75A 1FB5A 2A3RA 3ZGVA 5EJ4A 2YZMA 3B7WA 3HVJA 5GV8A 2VUUA 4Q7LA 2VPWA 2E6KA 4B76A 1HOXA 2WTXA 2JJMA 3P4XA 3SHQA 3BX1A 2BT4A 3U09A 1QH1B 2GVNA 3LKVA 3QEMB 4NE7A 5EP1A 5JMOA 1H9CA 4ZI3A 3OU6A 5TC4A 4YROA 5EYPA 3JTMA 1I0LA 2JLQA 4GECA 4EPYA 3U44A 5DMHA 5T67A 1XNRB 3AUUA 3UB2A 2P6PA 4Y1EA 3WLLA 2JARA 1UEIA 3HP1A 5EUQB 5TMDA 3FMGA 4IXDA 4D8WA 4DQ0A 3RWMB 1JXQA 1YRHA 2O6HA 3WLIA 2EWWA 2AEMA 1NYLA 4U0KA 4CM3A 1UT5A 5EQTA 3G68A 3I09A 5EP4A 2AFHE 1IONA 3SQNA 3BAFA 1OGJA 2ZYUX 2IYFA 4C07A 3T6KA 3IVAA 2J67A 2E6UX 2OQ2A 3EHDA 2GK7A 3BHIA 2PMEA 4RQUA 3KBBA 3EQZA 1HUQA 1O6GA 1Z6PA 2VHJA 4N5HX 3BFJA 3FPEA 2P5YA 5EZYF 2QYTA 3ORQA 2QXYA 3GEPA 2CHFA 2O7VA 5C5IA 4DV4B 2C4VA 3G49A 4ZXFA 3EGWA 1UBHS 1WNTA 2WP8J 1DTEA 2G80A 3TX2A 4A03A 2FGKA 3EQ8A 3Q87B 4GUDA 2CEKA 4UU1A 1EIWA 3CVJA 5TGDA 1KI4A 3T99A 5CCDA 2XMGA 4E4YA 1LXCA 2XTMA 4NS1A 3HWRA 5BSEA 3VNVA 1X9HA 3C8DA 3ETEA 4I1OA 4WW0A 4XDYA 4JYAB 4UEWA 5KHOC 2FN3A 4TS1A 3V4ZA 1ACJA 4GRAA 3K30A 1UEXC 2ZWAA 3CUKA 5IM5A 4NP6A 2H4JA 1TQ6A 2MSEB 1KBZA 4NFLA 3D4BA 1LJ8A 3F6PA 4G1UC 5BQXA 2II6A 3TLCA 2GBFA 4D3ZA 1E2GA 1JG7A 1Z22A 3PVSA 1E9RA 3QKSA 4H1HA 3DMTA 5CPFA 1V2HE 3F4KA 2C3OA 3N05A 4G86A 1X7XA 1OX4B 2WTNA 4OSEA 1Y8RB 1FX1A 2DAPA 2A58A 4ZHQB 3KYCB 4FNMA 5ERYA 1Q0UA 1OI3A 2JAOA 2YWJA 4IDOA 3A6KA 3FXAA 3PRKE 4PWYA 5JD3A 3UB3A 1PDVA 1OLOA 1LDBA 2UVPA 1MB2A 1U81A 1XQ9A 4R1PA 1F2UA 2WWXA 1Z4LA 4X64B 4F3KA 4KIJA 4MJXA 3DPIA 2AJBA 2W2LD 3H2IA 5ER6A 2QP9X 2WSLA 3I6YA 4CLRB 3AM3A 1W5FA 2RI0A 3Q98A 4WTOA 4NY1A 2ZJFA 3W4JA 1QVWA 1TF7A 1V9SA 5MN6A 1B1CA 1G17A 1SR8A 3FZYA 3EFHA 1WQ3A 2WUDA 2AYZA 2B7CA 3C7KA 2JGDB 4O2LA 1O97D 1M6HA 3D64A 4FCCA 3R7BA 721PA 2JFWA 5CM2Z 4F4JA 2FRVA 2VDMB 7ABPA 5DULA 5BOSA 2YWCA 3BE6A 5K6RA 2XDWA 3JVUA 1OA0A 2GTHA 4NSNA 2MCFA 1GHTA 2E1RA 4MLZA 1N5LA 3H2ZA 1S01A 2W6QA 3P0RA 2PXHA 2V45A 4MYTA 4L2IB 1F8FA 3WMRA 2PMKA 2BE7A 2G4LA 4A8JA 3ZV4A 4I4IA 4Q03A 5JZSA 4JT8A 4F38A 1WDKA 4CNBA 4LI3X 3OZ7A 1E6LA 2A1UB 4L2IA 2RI6A 1QHFA 1RLTA 3EVFA 1OH7A 4TMWA 1QKKA 3ADCA 4MR7A 2XQIA 3FOEC 1YIDA 1K06A 1Q21A 1Z28A 2Z5FA 4XR9A 4JJAA 1WIWA 3ZWDA 5LQKA 2UUAB 2HW8A 3EASA 5HIMA 4GZ6A 4UEOA 3TDKA 2YFYA 1F5SA 3H16A 5C3UA 4D57A 5TR9A 1BMFA 1RWNA 1VECA 1GZ6A 4NU5A 5A5DA 4Q4CA 3RS9A 1UINA 2EJWA 2YFQA 3WYBA 1ZLYA 3QFHA 2HF7A 3NONA 4CM1A 4HWOA 3PC2A 5DNCA 5E2BA 1BXGB 3DB2A 5AI4A 3UBTA 2B1IA 3ORYA 4RXMA 4IV0A 1H93A 4P32A 1DL5A 2YWGA 4XDHA 3K8OE 4E5UA 1XR3A 1V4VA 4JA2A 3WYCA 5KNDH 2QGNA 4CGZA 3ZIAA 1O95C 1ZBQA 3HFSA 5H4HA 4A4DA 5IULC 1KQFA 2X6TA 1KQPA 4MMYB 1JVSA 3FKSA 3O9VA 4ALIA 4XM0A 3LSTA 1W2HA 4WH0A 4BTEA 1ZUD1 4F4IA 4M9CA 1QO9A 3ZDEA 1UDWA 3C6YA 4ZT4A 5A2QA 2ZZNA 3GA5A 3U7RA 5JAOA 1Z56C 4IUCS 3ILVA 2JA1A 1TU0A 1FUYB 1GPYA 3L7IA 3O82A 3I0MA 2FPLA 4QT0A 4RMNA 4HUTA 1E6KA 1GA4A 2YNMC 4ATNA 3V9PA 3G5MA 5HF5A 4D9KA 2YY7A 4L6AA 2EKLA 2VDUE 4M87A 4ML3A 5FNZA 2VHUA 3A9WA 1OFIA 5I4CA 3I1YA 4OIMA 4H77A 2V98A 4N9QA 4QJIA 3WKCA 4NZOA 4EHBA 3VC1A 5LQDA 5ALRA 1X42A 1XDBA 3AY0A 3TVDA 4FFRA 2GBIA 1K1EA 1SUDA 1B0AA 2EZ9A 2RH5A 1L8OA 3EH2A 4J7AA 2FWMX 1LBEA 2WU1A 1I6WA 3AWDA 5AWFC 3SJUA 3T7IA 4JBGA 5TQ0A 4TWIA 3WLJA 1VLVA 2ZUEA 4TMVA 2WG2A 3W05A 2D59A 2PFKA 2PD6A 2O07A 2PR2A 2ZBDA 1DBQA 1SQ0A 4H08A 5CLLA 4KPFC 3TNDA 1QYIA 4EMBA 1E3QA 1E99A 1K4MA 3TM4A 1GKYA 1HO3A 3H1AA 4QOHA 4ERXA 5KYWA 2R25B 3CGWA 2FZ5A 1NFFA 2IHZA 3KOWA 4FFPA 2DHEA 2V5VA 4M36A 3X44A 2NPFA 2WQ7A 1GXSA 2QK4A 5KVAA 4BZXA 2XZPA 5ALZA 1K92A 1N2GA 3I5AA 4CIXA 5CMLA 4Z4EA 3V1LA 1SBNE 1XZDA 5G1PA 3MXOA 2AN4A 2VP4A 1QGZA 3ONWA 1DZ3A 2XVZA 1HR0B 1Q3KA 2N3ZA 2RHOA 4EOGA 1T8TA 3GHHA 5CBKA 4EHHA 4YAOA 1QRDA 1U1CA 3GVCA 4MUHA 4F04A 2HUNA 2QN6A 4UM5A 2QX6A 4HLDA 2V7BA 3ND5A 5LQSA 5DMXA 2FTKE 1LPMA 4AJ1A 2I2AA 4B3FX 3I3SR 3U44B 3F2VA 1A4UA 3H04A 3PJRA 5IVDA 3GJQA 1VJTA 4JSRA 1O94C 1YKGA 2HQSA 4QSMA 3EFBA 4XE5A 5HIJA 1VRVA 1PLKA 1MJNA 2VG8A 4G5GA 4ZOAA 3T5CA 4XRGA 1KJNA 1QPGA 4ZYUA 2AG8A 4JJZA 3PNYA 4TZKA 3T34A 5F1KA 6AT1A 4CL8A 2B7BA 1IYZA 3AHIA 3NG1A 1E4VA 4YDRA 3ZCPA 2NZVG 1EXWA 1HTTA 3INYA 1ZAKA 4IX1A 3DVQX 1NV9A 1P5FA 1QG2A 2C2OA 3DLAA 4M0EA 4NCAA 3LWNA 3GF4A 1OYOA 1PG5A 3DDOA 1Z7YA 5EJFA 1R50A 1AB6A 4GGOA 3MN1A 4LDQA 4BEWA 2ZIXB 2PUFA 1XQ6A 3X0DA 2OECA 1BKSB 4MRPA 4JASB 2IUUA 1W4BA 4XGQA 3N0VA 3HBLA 2NUAB 1RR6A 1EUYA 3LTNC 3I2YX 3AJAA 1J20A 5CJ2A 3ZCVA 5E8RA 4MIEA 4PC2A 2WQZA 3DDZX 3DVRX 1VCNA 4FTWA 4OAQA 1DIRA 3U4DA 2IPOA 4KMSA 2AIRA 4JSYA 4OHVA 1QKJA 4ER5A 3T1OA 1T9AA 4JWTA 4IIUA 1Z08A 2ODPA 4JELA 2ZT8A 1VTKA 2GR9A 2H52A 2HK6A 2OUKA 3R6LA 3MGAA 3HCCA 4UHBA 1Q95A 3W34A 1SGWA 4LBZA 4O4LB 1W46A 3WB9A 1R4NA 5AKHA 3W9BA 1DRVA 4JUBA 4EBFA 3A6HA 1PG2A 1ODTC 2C58A 4BFWA 1RHRA 4K2HA 4UVEA 2JK1A 4PSCA 4OHCA 5ERXA 3B3GA 3LO5A 4JUFA 4R6WA 5JD4A 1EMDA 3ETDA 3WL6A 1F8UA 1FQJA 1TAGA 1WTAA 4FNGA 3UWKA 2O57A 4URFA 4YMHA 2E4AA 2GTIA