2LUOA

Nmr solution structure of apo-mptpa
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
164
structure length
164
Chain Sequence
b'GMSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQLGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LOW MOLECULAR WEIGHT PROTEIN-TYROSINE-PHOSPHATASE A
publication title The Apo-structure of the Low Molecular Weight Protein-tyrosine Phosphatase A (MptpA) from Mycobacterium tuberculosis Allows for Better Target-specific Drug Development.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 50
structure length 164
sequence length 164
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2luoA00
5IUKC 5JNTA 3TB6A 2R25B 1C0EA 5KC9A 1Z2EA 4KQCA 2QW1A 1QQAA 1U0SY 1JHZA 4MQEB 1TJYA 3KYIB 4KVFA 4OG2A 5KQMA 1JLKA 3O2SB 5KQLA 3DGEC 3SY8A 1MB3A 9ABPA 3RVRA 2PUCA 2PUEA 2A9OA 1CYEA 4IMJB 4RY8A 4NICA 2E4ZA 1W25A 1GLGA 3EULA 3O74A 4E7PA 2WJWA 3F7NA 4UHKA 3E3MA 4GPAA 3H5VA 5CHYA 4P98A 3CZCA 3D02A 2N9UA 2YHAA 1RZRD 4OBBA 4F11A 5JS1A 2PUDA 2AYZA 2GBPA 3MQ4A 2LBPA 4H3HB 4WT7A 1BA2A 3Q7SA 1Y1LA 8ABPA 4RY0A 1P2FA 1SXIA 1AB5A 3FFXA 3GL9A 4D6YA 3ROTA 3JVDA 3H6GA 3MA0A 7ABPA 3HVRA 1VLZA 1YS7A 4Z4FA 1YMUA 2B1JA 3SQNA 5TE9A 2FEPA 4KK3A 3N6VA 1QQBA 2JCGA 1M5TA 1U04A 3URMA 2OQRA 1MB0A 1ISRA 1QO0A 1GCAA 3HDVA 5GOTA 1CHNA 3CU5A 1BDJA 1K68A 1RXIA 1GUDA 1JYFA 2RGYA 2RJNA 4B09A 3A0UA 3H6HA 4LDZA 4RK4A 2X7XA 1ABFA 1FFGA 1K66A 2IOYA 5DCLA 4Z0NA 3W9SA 1Z15A 2A9PA 3KKEA 3R0JA 3A0RB 3KHTA 4N03A 2L17A 1QNLA 4WWHA 2VK2A 5TPZD 3DGFC 2GWRA 1DC7A 3SM9A 3UKJA 3OM0A 3VNBA 1OXBB 3F73A 1PEYA 2E4XA 3UK0A 4RS3A 2H0AA 1DRJA 3HV2A 3K4HA 4E7OA 5KC8A 4NV3A 4KMRA 3IDOA 5HKOA 1R8JA 1H9CA 4TLLB 5EWLA 1E6MA 4EYOA 3LUJA 2TMYA 1Z13A 1JWLA 4JASB 2WY2D 4PE5B 2IKSA 4WUTA 1D4ZA 2WMYA 1BAPA 1KGSA 1FQWA 4G0XA 3RH0A 3NHZA 3NNNA 4Z9AA 4FE7A 2XDYA 3OLZA 4NQRA 4EY3A 2JBAA 1KMIY 3C3MA 2ID7A 2JBAB 1QO0D 4S04A 1DRKA 2FEKA 3HEBA 4MQFB 1YK1A 1VRVA 3EAFA 3OM1A 3SG0A 3C3KA 1GCGA 2CHEA 2MYTA 5KQPA 5DLEA 5IUJC 2VUHB 2PUFA 3S99A 4G86A 3TMYA 4KFCA 3SNKA 3CTPA 5IC5A 2QXYA 1YK0A 2FVYA 2QVCA 4MLDA 3GBVA 4XASA 2AYXA 4CBVA 5EWJB 3KYJB 3E61A 4MRMA 2NT4A 4RXTA 4N47A 3ILYA 4PICA 4W5OA 2W42A 4RK7A 2WB4A 3JS5A 2IPNA 2NUBA 3LUCA 3N0XA 3RVKA 4YCSA 1NXVA 6CHYA 3O21A 2HQRA 4MYRA 1KRWA 3RVJA 4G0ZA 4D74A 2A9RA 3EDCA 1A0OA 2FMHA 3G1WA 3GT7A 3KJXA 3N0WA 2PJUA 2FMIA 3OQNA 1J56A 1NTRA 2P9HA 3T6KA 3N8IA 4O1HA 2LPMA 2M1ZA 1XHEA 5TQ0A 3HXMA 4QPJC 2PUBA 2E4YA 4GNRA 4MR7B 1QP4A 4IRXA 3LUAA 4G0MA 4RZSA 2I6FA 4MS4A 4DADA 4Z4IA 1E2BA 5I4CA 3OLYA 3M9XA 2R4QA 3P9YA 3CZ5A 4MR9A 5BR1A 4MR9B 1USIA 2FMKA 2IDMA 1SXHA 4O5AA 2JB9A 2E4VA 4YO7A 4RSMA 2HSGA 3CKMA 4MQEA 1M2EA 1ZESA 3CRNA 3LUDA 1MIHA 3QELB 4M88A 1NXOA 4EYKA 1NXPA 3UUGA 5CNKA 3LMKA 2JVIA 4ETNA 5IUNC 2WWVD 2GKGA 2MYPA 3QLUC 1F51E 3NHMA 3NNSA 4L85A 1Z26A 4H3KB 4JA2A 1ABEA 4YP9A 1LJLA 4RV5A 4N41A 3OMWA 2JVJA 2FTKE 1P6QA 3BILA 3MF4A 4G0QA 3BRQA 4ETIA 1PNTA 4O1IA 3RVLA 3EODA 4N76A 4FB4A 5DGCA 5FWXB 3CNBA 4MS1B 1D1PA 2WJAA 4YWHA 3RVNA 3LKVA 2IYNA 1ZGGA 1DZ3A 2V0NA 4YV7A 5T3YA 4JB2A 3T95A 4KRFA 4KK4A 5KWSA 3IP7A 1YVUA 4UHJA 4W5TA 3QK7A 3TD9A 1ISSA 4N0QA 4OLBA 3F6CA 4FE4A 2FLWA 3JTEA 3O1JC 4IILA 2CD7A 5JNUA 3FFTA 4OATA 3H5LA 2GI4A 4MAAA 2YHBA 2FQWA 3OLXA 4HNSA 2L19A 3VNAA 3Q41A 3CG0A 3JPWA 3RVOA 3K9CA 2HJ9A 3SAJA 4P1ZA 1KRXA 4JAVC 3A3KA 1P6UA 1NATA 1JDNA 4DN6A 2LP4Y 3ROFA 1TLFA 1XHFA 3TX6A 1FFSA 1I3CA 3OO0A 1URPA 1VPWA 4ZMSA 1HEYA 5E3JA 5TQJA 3T38A 5IEBA 1EAYA 3QX8A 3C3WA 4YS6A 4ZJPA 2QZJA 4PEVA 1MAVA 1U2QA 2PL1A 1LK0A 4KZKA 3LUKA 5F64A 5FBHA 4EVRA 3H1GA 5PNTA 3BBLA 1WETA 3O1IC 4Z9BA 3H75A 3H5WA 2JK1A 5DKFA 1DP4A 2CWDA 5GQSA 5JNVA 2R48A 3KS9A 3OQOA 1T34A 5FWYB 3FMVA 1DBPA 2PMCA 4MR8B 1XWWA 4F3TA 1YIOA 4TN5A 5HSGA 4MQFA 1UDRA 1ZITA 3L49A 1Z17A 4OTZA 3HUUA 5T7BA 1FFWA 1LBHA 3O2JA 1LBIA 3NBMA 5JNRA 5KQGA 1QPZA 3KLNA 4JP1A 3B2NA 3LOPA 4Z4HA 1PEAA 2HQBA 4Z4EA 1USGA 3HDGA 3M6MD 3Q15C 3GA5A 3DLHA 2PUAA 3H5OA 3OLWA 1AB6A 4IMIB 3RVQA 1NXWA 4KQ9A 4JB0A 1QP0A 4XARA 1NY5A 5EWJA 3QLUA 3HO1A 5TPWB 4EYGA 3QX9A 4MLCA 4TLMB 1L5ZA 2FSPA 4RXMA 5C5EA 2RDMA 3CS3A 2IPLA 1QMPA 2HPHA 2P4UA 3MMNA 1SXGA 2FQYA 1Z25A 4PYRA 1A04A 1TM2A 4HNRA 5C5CA 1ZH4A 1RPJA 3I09A 1GUBA 4EVSA 2PKXA 3DBIA 3DZDA 3QEMB 5JNWA 4LZLA 5BQ3A 1SRRA 2FXIA 4LDAA 1NXSA 1EWKA 4XAQA 2LIVA 4MR7A 5CNJA 3KSMA 3IP9A 1OXKB 3OLVA 4MPTA 1JDPA 4ZMRA 3LUFA 2NZVG 2VYCA 1DBWA 1BVHA 4Z4GA 4H60A 2R47A 1DCMA 3EQZA 3H1FA 1DBQA 4RK6A 5KI6A 2PUGA 3JPYA 3EGCA 4G0YA 5HM6A 1Z2DA 3Q7RA 3IP5A 4HNQA 4KV7A 2QV0A 3FDFA 4ZYLA 3GRCA 4NCBA 1TVMA 3QELA 1DCFA 1RZRA 4D6XA 1MVOA 5CNMA 2M98A 4Y9TA 1RNLA 2F8TA 3GBPA 3MM4A 3T8YA 1NXTA 2J48A 1B00A 5D2CA 3LUGA 1JFTA 2IPMA 2FKAA 4RKQA 2FN9A 3F6PA 1CEYA 1YMVA 3RVSA 2MYNA 1ZHHA 2QR3A 5DTEA 5IULC 5FWXA 4MS1A 4MGEA 1E6LA 2FQXA 3QEKA 3C97A 4KREA 1JX6A 3EQ2A 4N0PA 2CHFA 1JF8A 2L2QA 3JVIA 2QSJA 4QICA 3QLVC 2GX6A 4QYWA 3GYBA 3LFTA 4XXHA 4RK0A 2FN8A 2FMFA 5IBQA 3IPAA 4OLAA 3C6QA 3MYYA 4W5NA 2A9QA 2DRIA 4PZ0A 5EWMA 4EGSA 5EWMB 3BREA 5ABPA 4XFKA 2E4UA 1DCKA 4F8JA 4JOQA 3RVPA 4HYEA 4G97A 5TPZA 1Z18A 3JY6A 1W9HA 4WZZA 3I5AA 4MS3A 1YTUA 2L18A 4MS3B 4IGAA 4Z4CA 5HQJA 1JFSA 1SD5A 3HS3A 3FFWA 1PUXA 3EJWA 4Q6BA 3O1HB 4DQDA 1DC8A 1Z16A 2H3HA 1QP7A 5ED4A 1JFVA 1ZDMA 2NT3A 1PHRA 3CLKA 1EWTA 3KTOA 4EUKA 4YR7A 3BRSA 4ZPJA 3LKBA 4Z99A 3DLBA 5JS2A 3CHYA 2MSWA 3KLOA 4RWEA 2ID9A 2FLKA 3L6UA 3OQMA 2LUOA 4EVQA 1BDHA 4XLTA 3QLTA 2HQOA 2QU7A 3ILHA 3RQIA 1D1QA 2FEWB 4KPYA 4TMYA 4YRZA 2IPAB 2VUIB 3Q7TA 4LE2A 1M2FA 3HSYA 5FWYA 1F4VA 2WRZA 4RKRA 4RXUA 1P8AA 4MR8A 3HM9A 1U8TA 4LE0A 4L4UA 4W5RA 2PLNA 4RDCA 3HJFA 1ZN2A 3I45A 1JBEA 4NCAA 1E6KA 3N75A 2E4WA 3Q9SA 3KCNA 4G0OA 5JNSA 2RJOA 1C4WA 1EFAA 1ZGZA 1JL3A 1ZY2A 4RY9A 5FBKA 2PE5A 4WXMA 2MSKA 1NXXA 2JRLA 3D8UA 3HUTA 5CNIA 5EWLB 4F12A 1PNRA 2ZWMA 1EHCA 3N53A 5B3JA 4WXEA 2QVGA 4LRQA 2Q5CA 5BRAA 1JH9A 3N0RA 1S8NA 5TPWA 1LJUA 4IF4A 1DG9A 3G85A 3LUHA 1RXEA 3OO1A 4ETMA 5IX8A 2O20A 1U2PA 2JVKA 3I42A 1D2AA 1TMYA 3KG2A 3HCWA 2MYUA 4EYQA 4QYMA 3CG4A 2MSLA 4LE1A 1USKA 2PL9A 3LTEA 2FW0A 3QEMA 1EWVA 3CFYA 2B4AA 3QLVA 1APBA 4ML3A 4RK1A 2F8SA 1A2OA 1L5YA 2KYRA 3M9WA 1ZH2A 2ZAYA 4Q6WA 1Z12A 3RVMA 3IP6A 4MRMB 2NZUG 4S05A 1VKRA 3FGZA 3GWGA 3H1EA 4W5QA 1DJMA 4RU1A 1M5UA 1YS6A 4Q7EA 4LX8A 4YGXB 6ABPA 4F06A 5IEJA 1IIBA 2PAFA 4RK5A 1ZAYA 1BDIA 4KNYA 5BRJA 3O2QB 5B3JC 3A10A 3IPCA 2BGGA 1FSPA 3HK2A 3NNDA 3GV0A 5TQ0B 3OMXA 1QKKA 3H5IA 3HZHA 4G0PA 3H5TA 1ZVVA 1JYEA 4YLEA 5TQ2A 1D5WA 2OENG 3O75A 5TQ2B 3TO5A 3MIZA 4MS4B
chains in the Genus database with same CATH superfamily
1IHDA 3K70B 3WYNA 4ZZ1A 2JFUA 2AG0A 3GJ6A 1J2YA 4ROTA 4US0R 5LMCA 3K6KA 4TTIA 3A6JA 4AS1A 4YGYA 1U1GA 3UAWA 1TJYA 4MB0A 4MUJA 4GMHA 2GH1A 2JL1A 4CEIA 1O03A 1OH5A 2VRBA 1ULSA 2NADA 3O84A 3OIDA 3PUZA 1X1BA 1S1CA 2OGUA 4DV2B 1ETHA 3QF7A 1ITZA 1X80A 3K16A 4BP8A 3VX3A 5K0SA 4DWWA 3WBFA 4R71A 1NW4A 2HZBA 3FYCA 3QYJA 3NBXX 2EV9A 3CH5A 3TH5A 2D4AA 1ZM9A 2PZFA 5CHYA 3AIKA 4P98A 1E0AA 1WDLA 1KI7A 4MV5A 3S27A 5KU7A 1KVTA 2AKYA 3P2IA 5JAQA 4D9FA 1V8ZA 1ES9A 2GBPA 1N2CE 5C34B 3K9BA 3HKEB 5ECGC 2JLAA 2HTFA 2P6UA 2G82A 3FYUC 1SVWA 4HVAA 4BS9A 2BYTA 1T9AA 1WVMA 4J2OA 4KSCA 3IBCA 4P0QB 3E9NA 3EZFA 2J0EA 1ZEJA 3RS4A 3AF6A 3IP8A 1ZO8A 4TGLA 4LYFA 1V37A 4F7WA 1XZLA 4DNOA 4M38A 1E3QA 1RI3A 4CQLA 2VH5R 4GBJA 4CCSA 5CVTA 3VU0A 1NLMA 1FZQA 2NUTB 4E0BA 4ESEA 4A5SA 2HZ7A 1TM1E 3GROA 3H17A 1P1JA 3LUPA 3LUBA 1ISRA 2WWGA 4CCYB 4QEZA 5GOTA 3RM3A 1CHNA 3HNRA 1BDJA 1TQDA 5I8WA 1MO2A 1EVYA 1SKBA 1JP7A 1JAYA 4B09A 3CN7A 3NWJA 4V0SA 3NPAA 4FZ3A 4EW3A 3IEVA 1ECCA 1ZXXA 2B5WA 3WSTA 1CJVC 4KQGA 3QUTA 3H11A 3VYWA 2QVXX 1QV6A 3UJBA 4P4SA 1V3VA 3ROXA 3A9SA 4DLBA 2XTAA 1ZK1A 1R3UA 4GBGA 4IVPA 3UJ8A 2YZMA 4E88A 1SA0B 4F38A 2ST1A 3SDBA 5BV1A 3K9QO 3WYBA 1KEEA 5JSHA 3ZHCA 4HRXA 1OXBB 2C97A 4WLUA 4OUDA 4L02A 3RRJA 3F4LA 1DAFA 1FFAA 4PO1A 3HDJA 3FSGA 4A8PA 1JKXA 1T8PA 4MWBA 4E5NA 2XCRB 1FDWA 2ZJ2A 3C15C 4C0WA 4JYZA 3B1ZA 3GFOA 2YMQA 3HDHA 3S1SA 1U0EA 5DYGA 2ODQA 2WU8A 2B2CA 2Y66A 1OTXA 2QX6A 2RGUA 3FJ1A 5A9SB 1W1IA 1E0JA 1R8XA 3FNFA 5CXUA 3IO3A 3OJEA 3OLZA 1MBZA 4IF6A 4NPAA 4B71A 4EY7A 2PK3A 1YS2X 1EVLA 1DFIA 4BZWA 3RJMA 1JU4A 4LBWA 2GILA 3AINA 3SK0A 3V8VA 1LVHA 4IL5A 3OKPA 4P58A 4RLFA 3UV3A 5KQPA 3RTCA 5DNUA 1OT3A 2TYSB 2FEXA 3S99A 1QZUA 4FR0A 4S12A 5H4HA 3DCIA 4G01B 3X1WA 1M9NA 1Y3FE 4H18A 4DBVO 1BWQA 3I32A 1XLTA 3UGJA 4EKGA 2JAOA 1HTWA 3KL4A 1GNVA 3I73A 2AYXA 4IIBA 3HHPA 4MW4A 1ZJJA 2ZS8A 1SQFA 3AJDA 3ISJA 5T6BA 1D5CA 3HN6A 1NSFA 1JEQB 2P5YA 1Y3CE 3TTYA 1QMGA 2PMDA 1N75A 2RGWA 3FPBA 2BKUA 4YRGA 1OAOC 4IDOA 4M83A 2WJHA 4FCVA 4MVJA 5EPEA 3JWJA 2PIDA 4ACBA 5EKXA 2CLCX 2EFGA 2FMIA 3FYUA 2IW1A 3RSSA 4D9NA 4LF6B 3D0OA 2A5YB 3BMNA 3GAFA 2BC9A 2HDHA 2QORA 3QWBA 4QDJA 1MGPA 5KX5B 1DJOA 1R18A 1DKNA 1T3HA 5UKDA 4O4LF 3I39X 4G07A 1QB8A 3P32A 2XA2A 4XCVA 3R0XA 1P9RA 5DOVA 3V2UA 5BPHA 3DDCA 3LT4A 1E89A 4KWCA 5I4CA 2XF8A 4B2IA 2JFYA 4DNQA 1MXHA 3WNCA 2BGNA 4O4JB 1G4AE 4ZALA 4BVLA 4KXYA 5IC6A 1ZJ4A 1IDN1 1ZESA 1AKMA 1QCDA 2OAQ1 421PA 1E1LA 1ESCA 3WK9A 1OD6A 5K20A 3BQMB 2CLMB 3ITEA 4XQGA 1T4CB 2IUFA 1NXPA 5KWIA 1SHZA 4QYTA 1XEAA 3DOUA 3LMKA 1AF4A 3E5MA 3L5KA 5DASA 3LQFA 5EG5A 3N3BC 2VQ3A 1X1TA 1C1XB 2PR7A 3TNDA 4R8MA 5DYWA 2I2XB 1ABEA 1IOLA 2H4ZA 2Z04A 2FZWA 4TX1A 4PAWA 5E8RA 5F2KA 4A2WA 3ZE7A 5TVKA 4F04A 2FY8A 1IPHA 2VJQA 2XGMA 2IUEA 3BL6A 3GC6A 1DRWA 3GR6A 1M0WA 3CT6A 4LZZA 4MS1B 4O29A 4DCVA 2YUTA 4YWHA 3A2NA 2OGTA 1RBYA 4MV3A 5MN5A 2PJRA 2EFYA 2EKPA 4FOPA 2NXNA 1VE3A 4IHJF 3X1YA 2XB2A 1NFQA 4MITA 4GAEA 5FBVB 1O97D 1KAHA 1G2PA 1JNYA 2QL9A 2YIDA 3BXFA 3KD3A 3P2OA 4JYCA 1C0PA 4WJZA 4WNIA 5D7BA 1FDTA 1Z08A 3RASA 2GCEA 4C5BA 2ZTMA 1R6TA 3ZTTA 2FLWA 4PW0A 2Q8QA 2P75A 5EL0A 1PFYA 4TKLA 4EW2A 3J81A 3DQPA 1G3IA 3FFTA 1EI9A 4JC5A 3FOEC 1KYIA 1ZN7A 1BS2A 4CMCA 5BN3B 3QUAA 1VXRA 4PR3A 1V8PA 2FSSA 2PTHA 3BMXA 1P60A 2J0VA 2ZJ8A 3GT4A 4RTOA 3ZG6A 1I10A 4K9SA 1MJGA 2JIOA 1KRXA 1GN9A 3ET4A 5IJ9B 3RE1A 5U4QA 4WCFC 3DHWC 4AJKA 4I1SA 3KUUA 5DHFA 4WNAB 4CMAA 5CB4B 5DB4A 1AVTA 1H2ZA 1HEYA 1FNNA 1KYQA 2PMBA 1OFUX 4TL6A 2SCUB 4RQBA 5JH7A 4AY6A 2WIBA 1RPNA 3QOFA 4S2UA 4YS6A 3SE0A 4ZYVA 1YUMA 1OA0A 2QTWB 5ALOA 1LK0A 2XHEA 1ECFA 4P2GA 4M99A 3H1GA 3OI7A 1L9XA 2EP5A 1RQLA 1DV1A 2H9AA 3R5JA 2DBRA 5KTYA 2RHGB 2JK1A 4I4CA 5AJXA 1T5SA 2ZAMA 5DKFA 3VC7A 3DV0B 4CR6A 1R0XA 5A62A 2R48A 2AXQA 3H9EO 3UK1A 5H70A 4FX2A 3G2IA 4X1IB 1UJCA 2XWQA 4PVCA 5F21A 5GM2A 2P35A 4W7SA 5KYXA 3L8EA 4MR8B 3QG1A 4HQKA 4WBSA 5A04A 2PMKA 3L3BA 1RI4A 3I9V1 2VQ6A 3Q87B 2JATA 4A8HA 3CUKA 4IG9A 5LSAA 2DPLA 3IAEA 1BNCA 1RE0A 2E5LB 1GAXA 4L5AA 3R0VA 1LBIA 2IY8A 2B25A 1Y1SA 2YNMD 2C5FA 3LOPA 4QOHA 1NAHA 4JD5A 4NYIR 1EEHA 3B38A 2X4IA 5LBTA 2GBCA 1R4ZA 2G25A 3DUWA 2UYHA 3ELUA 1UXJA 1O1YA 5D85A 3D3KA 3WK5A 2GZRA 4RVOA 1P3Y1 3RR2A 4EKYA 5TS2A 1QDEA 2P2NA 4MLCA 3OQVA 2VJDA 2QJWA 2RDMA 1OSNA 3CSUA 3I64A 4FDAA 4D4JA 1KSGA 3IP1A 1ISGA 2P4UA 3MMNA 1SXGA 3AV3A 3GH1A 5DSZA 1PV2A 4TYWA 4QTYA 1BG6A 1Z63A 4II7A 4TTVA 1NUQA 4EB8A 2PSDA 2CMGA 4LZPA 3SZLA 1A9XB 1IBKB 4JOBA 3A1NA 3KBOA 4CYMA 4TXMA 2PKXA 5E4JA 1AMNA 2VDVE 1Y8QA 4AZSA 1XRSB 1Z4OA 4YUXA 5H83A 1AV6A 1K5PA 1Y6FA 1Q0ZA 4G1BA 1Z6XA 1W8IA 3RBZA 2FPIB 3SDSA 4EYSA 1JDPA 1K6EA 4R0MA 1DBWA 1C14A 4YRJA 3QNMA 1AUQA 3I0MA 1PJBA 4U39A 4A0SA 4Z4GA 1EFVB 1ATZA 3MT7A 3ZJYA 4BGVA 3HMKA 1JJFA 4FNOA 4C08A 2JLQA 1ZBDA 3FSJX 2WIKA 5CGZA 2JZNA 3TS1A 1EUCA 2BEUA 4HGZA 1L4HA 3CF4G 1DEKA 2O6HA 4L5IA 1DCFA 5G53C 1RZRA 3OEWA 3U39A 2I91A 3BE5A 5C18A 3DFKA 3ZN2A 4OSOA 2JRCA 3QQ5A 1QAQA 3URKA 1F8FA 4MIYA 3I8XA 2YJNA 5DBGA 3AB3A 3K0KA 5D2CA 3EGDA 5AKHA 2QRHA 4RKQA 4F4CA 5KEIA 1K7EB 2PNJA 1V8FA 4V1CI 3RYHA 3E23A 1U65A 2OG1A 4DMFA 1Q7GA 1H9AA 1Q3KA 1SUFA 4YMLA 4JI0B 5F9FA 1GFSA 1SRQA 1G6KA 4FLMA 1JG7A 1Y4DE 4Q9HA 2FW6A 2WIFA 2ZI9A 1CT9A 1D1TA 3FUCA 3GCWA 3QKIA 4TT3D 1KVQA 4Y2PA 3RSCA 4BMOB 4N0DA 4V03A 3RIEA 4BMSA 4K9QA 4QICA 1NJSA 1LTHR 1NJGA 2VDRB 3EC1A 1WXHA 3QLVC 1GQFA 1KMHB 1LX7A 2RIRA 5TJHA 1ST3A 1BOFA 1LLUA 1GDHA 2J45A 3SBDA 1GLVA 3G2MA 1RSZA 3OIWA 1P4GA 4J91A 5F1OA 6REQA 4HMQA 5AOAA 1U2ZA 4ZVPA 3MJCA 5CVEA 3D54D 5F7XA 2BF4A 4U8GA 2HRBA 1HURA 3TFOA 1Z9BA 4Y2UA 2QJRA 4HDSB 1LVGA 1RIFA 2HNBA 5EI5A 1F14A 2O52A 5DNCA 4MS3A 4G4GA 1XXLA 1SWWA 3PC8A 3FIJA 3PE3A 5HQJA 4E1AA 4V0MA 1E1KA 5KSPA 4Y2YA 4RA6B 3ABQB 2OO5A 2F4NA 2I22A 2Q2WA 4WBXC 2EC5A 2CVFA 2QUZA 4DQDA 5J63A 1V8DA 4D43A 3ERCA 4ZAGA 1QP7A 3TI7A 4MGKR 1E1NA 3OA2A 2NSLA 4ZOLA 2J9XB 2V3VA 1S4MA 3NXSA 1ESDA 4XQ9A 4C2BA 4EY6A 1VPDA 1TYBE 2F48A 3B82A 3H8WA 3N5KA 4H7JA 4I2NA 1Y98A 1H5UA 2QG4A 3GFGA 1C3LA 3VTKA 4BTVA 2VJMA 3PRKE 1OXUA 3NIBA 2IYFA 2WWIA 2ZRBA 3QLTA 5F1KA 2NPFA 3BD6A 2QTAA 3O9ZA 2YWRA 3AF2A 3F1LA 1L3CA 2WZBA 3GGGA 1NF2A 3PFKA 5CPBA 4XDYA 1ZSNA 4LBZA 1P1HA 2GCNA 3NWBA 3Q7TA 1HPLA 4MI1A 4QUJA 4U2EA 3WL3A 9ATCA 5EGSA 2NZWA 2UYCA 2IXAA 2WRZA 1NW7A 1P7WA 2EIXA 1IVNA 2Y1EA 3BORA 1JIKA 3PXBA 3NYWA 4U7HA 2YZGA 4RDCA 4ITVA 4EELA 4I3FA 4DQUA 1J5XA 2AL7A 1UKCA 2XODA 3IAFA 4GOMD 1YAHA 2WG2A 1USWA 3P52A 4HRAA 4YO8A 3DD1A 4ZANA 3HLTA 5LQJA 2AI2A 2Q27A 4C6RA 1G6HA 2RI1A 3L7JA 4HLQB 3CF6R 4G0OA 4Q4HB 2R7AA 3T3IA 1L4MA 2VJLA 1MENA 4LYJA 5DP2A 2NQ2C 4OF4A 5IH7A 1V48A 3R5SA 5I48A 1O6GA 5B7QA 5HRCA 1NXXA 3D3WB 4EHLA 2ZJOA 4Y6SA 4ZT6A 3I9FA 3TE6A 1K3FA 1ZUD1 5BSFA 2W6CX 4QAQA 1IXRC 3LLSA 1ZC3A 3QSGA 4OXQA 1R5JA 4BXOB 1F60A 3TLGA 4O4LB 1E1CB 1W87A 1F6WA 1H8ED 1WW2A 1I6LA 4XVCA 5FX2A 5K2OA 1EA5A 1WNTA 4A1FA 2A1UA 2BUCA 3ZWOA 4BC0A 4UAVA 4ASUA 5L3SB 3FBGA 3CG4A 5HJ5A 4BO3A 1YL6A 3AI7A 1KZHA 3L1JA 4UNIA 4IWXA 3EQ8A 1LSUA 4RMHA 2IH2A 3G9ZA 2PV0A 2EP8A 3QLVA 1U8UA 4XX1A 4DCMA 3OPXA 1GZDA 4WN9B 2KYRA 2HK6A 4FJ2A 1Z12A 2XUDA 4FR5A 4XYMA 4XZ3A 1HDXA 3LYHA 4UHHA 5ELMA 3UUFA 2NZUG 3MK31 4DGQA 5KWJA 1Z45A 2Q9CA 3ACCA 3QMVA 4F4FA 2ZPAA 5GM1A 4YMTA 2QTRA 2QE6A 4QNRA 4FNAA 1G17A 1YS6A 2QZPA 1QYWA 2X8AA 3I0NA 6ABPA 2GSWA 1X7XB 4LYGA 1FTQA 1JNXX 3KXIA 4OHXA 4LQCA 5DYNA 2PZLA 4DZRA 5B3JC 3NVMB 1RKVA 3PI7A 5BYJA 3F3YA 4KQ6A 2ZZKA 2ZVPX 3AW9A 4IHJB 4RHUA 4X97A 5HGXA 4DLZA 3Q8MA 2PUJA 3V48A 4TT8A 3OMXA 4IFIA 2C8VA 4R1MA 1BKYA 2IVFA 4ZD6A 4I4IA 5E6UB 3FYSA 2GFQA 2J6BA 3O7MA 5EMJA 3RS2A 4AJ2A 4B6GA 3O75A 3R4VA 3P9XA 5M04A 2H1RA 4J0KA 4ZARA 4MI6A 5DM60 2EZ9A 1B76A 2OBFA 3SOZA 1IVSA 2ET6A 1PQPA 4CLRB 4RVFA 1SZDA 1M66A 3IKVA 3SFVA 1IUNA 4QO7A 1IEQA 2AW3A 4HQLA 1QIEA 1B3RA 4GMKA 2RHDA 1L5NA 3L0BA 1TZBA 3DTVB 3P8ZA 5KOJB 2YBEA 2JFVA 3HXKA 1BFDA 2OD2A 4J7UA 1C3OA 1EVEA 1UM8A 2GKOA 4C5AA 5FH9A 2OV2A 2CE2X 1OZHA 5ITZB 4P4LA 1N2HA 3RAGA 1ADBA 5LQNA 4RV9A 3P9QA 3UXMA 2AGVA 1WEHA 1IH8A 4EL5A 4DYDA 1K27A 2C4HA 2O8VA 5AO9A 1KEWA 3UMFA 1BHQ1 4RMJA 3MQ4A 4UM7A 3TDMA 2WNHA 4WT7A 5BOVA 4R1SA 1BA2A 3OBIA 2WOOA 4RY0A 1P2FA 2OKGA 3R75A 3SXJA 1AB5A 3VZDA 1KQGA 3FTQA 3UXHA 5D6NA 4F1JA 3WB1A 3H6GA 1J9GA 2GRJA 1E2MA 1ZM2A 2LD4A 3OF2A 4L3OA 1J0BA 3HY4A 4XVQA 5CX1A 1G5PA 1BX3A 3N8HA 2R2AA 3GO4A 5DYIA 3S1AB 4LXQA 3FZNA 1YO6A 2M6SA 3EFOA 4EJ2A 1PR9A 3LE8A 4FJ1A 5J4YA 4UHFA 1OJLA 4LMRA 1LI4A 1OROA 2IXGA 1PW5A 2XITA 3L6DA 1LGYA 4H16A 3O8NA 5T4EA 4JLBA 2VT3A 2QJOA 4YQEA 2GPAA 4JITA 2X0FA 2NZ8A 3IQXA 2ZB7A 3CJTA 3I2FA 5DM70 2AFHE 3S40A 3RYIA 5IVDA 3ZWCA 1CUEA 1TPZA 1CF2O 4B85A 5MN4A 2FEOA 4MW9A 1OV6A 4NZZA 2GWRA 1DC7A 3DVAB 4YLGA 3WK6A 2W6ID 4DUPA 2B3DA 2NX2A 4HADA 1W36D 2IYUA 3UK0A 5LYYA 1PJQA 3KOZA 3LA8A 4RS3A 3M8KA 5KC8A 1R8JA 1V6AA 2X0EA 3W7BA 2Z5VA 3QHAA 5EHQA 5BW5A 1VFNA 1ZN8A 1LWNA 4ZQBA 2AOUB 3RNLA 2AC2A 4WACA 4PYNA 3SBOA 3IEXA 3ESYA 2WK1A 2H5JA 3AR8A 4MA4A 2WABA 1W52X 4IS2A 2WY2D 3ZCUA 2ZT8A 5L3QB 2AQ8A 1D2EA 1XAHA 2NUPA 4X54A 5IHXA 2ZDHA 5JTTA 3KT3A 2EDAA 1LZKA 3KZKA 3LXMA 1FIUA 5I8ZA 2QT0A 2WTXA 3EQ7A 1H0KA 1JG4A 1AQLA 2ANBA 1DRKA 4FU0A 2D0OB 3LWNA 4J49A 1UQTA 2SNIE 3M83A 1GAJA 4JEIA 1BHSA 3D3EA 4LOLA 3C6ZA 2IEGA 2HCFA 3I4CA 5DI9A 5DLEA 3DHYA 5E2AA 3R6TA 4RZHA 3EIWA 3IEIA 3TJZA 5JATA 3CX3A 3RBXA 4TV8A 4EGQA 1C0LA 4QJBA 1AS0A 3KALA 2QN6A 4MGZR 2RAFA 2FVYA 3VYVA 1NL3A 5AVQA 1H2FA 4EF5A 4FFNA 1E8DA 2LDBA 2O0MA 1O95C 4K7JA 3U7QB 3OOHA 2GERA 5G0TA 1NSTA 4P82A 2IYPA 3RAEC 1U0NA 3MUFA 2BFBB 3A26A 5CT5A 3CLSD 2IZ0A 3SSOA 1KH1A 1FSZA 3GPLA 1NLUA 4EA9A 2DECA 2Z56A 3F7MA 2B8NA 3Q12A 4NCHA 4XB1A 1VMAA 3MCZA 4MMZB 4PHHA 2DWPA 1OUMA 2Q5LA 3JAKA 1PGJA 2Z09A 3RTDA 1JR3D 3GZ4A 5HQ3A 1H66A 4KXWA 2ECPA 4CT5A 1Z5GA 3TMAA 4CDGA 1B4DA 2VL7A 5KTOA 1CZLA 4F45A 3EIEA 1C9KA 2ODBA 2P3QA 1CZUA 1HRDA 2E4YA 4GNRA 3PWTA 4UZFA 3LUAA 2ZI7A 4LDNA 1Y6RA 4RZSA 2HCJB 1ZD3A 5FWDA 3NHWA 2FMTA 2FPXA 3COZA 4QXAA 1I80A 1TYEB 4BN4A 1IQRA 5AKLA 4BV3A 4Z86A 4B5LA 2NLOA 2V5VA 1UOEA 2YV1A 2I2WA 5CB0A 1MQ9A 1PT8A 4EPWA 4E3ZA 1NP3A 1SEPA 2PG3A 1ZLYA 3JSAA 5F5XA 3DC7A 4J6EA 4BNFA 5L4NA 1B2LA 1QG4A 1E9AA 2Z95A 5JLAA 4EKIA 1C4KA 2BVNA 3CH7A 2C20A 3H1PA 2HF9A 3EXEA 2WWVD 3RYCA 1TYCA 5HCIA 3BXEA 1E77A 1I9GA 3LBFA 4MEJA 3GRAA 1FMCA 1T3GA 1H6CA 3DDZX 3AWDA 4ZI5A 3H4TA 4RV5A 2UDPA 3OEED 4EO9A 1FX1A 2CEKA 5BRAA 2ZWAA 1L0BA 1TVKA 1XQ1A 1T43A 4G0QA 5I7FA 4HK4A 1J1IA 2Q29A 2YJZA 4DLWA 3HC7A 3L4BA 1GCOA 1W5FA 4JMLA 2WJAA 4X64B 4UHEA 3ILVA 1BE8A 3OE7A 1U8XX 2MR5A 4FGZA 3ZVKA 5E0OA 1WD5A 2ZATA 2WJ3A 4FKBA 5J47A 1G7CA 3OQIB 3OQPA 1KEVA 3I4LA 3OZTA 2UZAA 2VJNA 1P91A 3VPHA 3RK1A 4W99A 3PFIA 1O4VA 3QK7A 3VR4D 5AWFC 4EECA 2GEKA 3NGMA 2RKWA 4RD2A 3GOQA 1SNYA 2IDZA 2B21A 1XCGB 2VEDA 3PU6A 5ALZA 4D8VA 3IMGA 3VHQA 3IDQA 2H1IA 4HAOA 1YQTA 2Q1TA 1VLMA 1U7OA 3IXLA 1PR3A 2QNIA 2ONKA 4ED9A 5M29A 4HB4A 4CGZA 4LW8A 2YHBA 4P3NA 4NF2A 3LFUA 1DHRA 4K2AA 3JPWA 5DHRA 3V8QA 2R6ZA 2CXSA 3K7EA 2QIPA 3SIXA 1PWEA 3DAPA 3R3YA 4DIUA 1L4EA 3RIYA 5BWMA 2JPDA 4EAQA 1QTNA 3C6YA 1NX9A 2ZXFA 1WHTA 2W0SA 4DYVA 1O95A 2O8FA 5K7SA 1FRZA 3GRPA 4CLEA 2JW5A 2FX3A 2JJ1A 5IANA 4DCOA 1X19A 5T5QA 4EY5A 5AIBA 1WZEA 1QFSA 2Z2XA 3LVQE 3OO0A 4M1MA 7AT1A 5IDYA 3GLFE 2QTFA 5FPYA 1M76A 4HQ0A 3QX8A 2JIRA 4DTIA 3LGXA 1OPRA 5L95A 1W4ZA 3LUKA 2PVCA 4EVRA 2FGKA 4YRAA 3CA8A 3RTBA 2YJ6A 2GZHA 3UNXA 4RHYA 4D3YA 4YCCA 3AETA 4P22A 2CKDA 4JJ7A 5JU6A 1XNQB 1ID8A 4BFYA 3HI6A 4CEHA 1DI0A 2GKSA 4Y9RA 1WXFA 4Z3KA 4CG3A 5BN4A 3P9PA 3LX6A 3PFGA 1VZ2A 4C6TB 5BNIA 4R8SA 1H69A 3F78A 2EFCB 4JLOA 1W19A 4KIFA 3VKWA 3GLHA 4FEYA 4CIVA 3IL2A 2H5LA 1OAKA 1BE0A 1MNQA 2ZRDA 1NUUA 4GECA 3H5NA 3G59A 5KVSA 3OF5A 3UWKA 4G4SO 1DQPA 1Q15A 2ZW9A 4PTZA 2I6QA 2MSNA 2WZCA 1KI9A 5EMNA 1PS8A 4B44A 4BUZA 1WWKA 4C3ZA 2H2WA 2IP1A 1WKBA 3AVTA 1PE0A 2P11A 3TEFA 4MI3A 4CGYA 2WILA 1KSJA 4BATA 2VG8A 3D7KA 3EISA 1SCUA 2UVPA 2XGGA 3K8OE 2KS6A 3RUPA 4ZJUA 4MYSA 1YQ9A 2ZAOA 3FSGD 4P84A 4KGZA 1HZJA 1C8VB 5AOCA 1P72A 3VO8A 4QQFA 1K08A 4IM7A 4RYLA 4UHBA 4A26A 4EJSA 1KJWA 1TCVA 2D00A 1DWQA 1PD0A 2CZQA 2PBZA 1HE4A 2HU8A 2Q07A 3FNRA 3NUGA 4FMDF 1K1EA 3IQZA 4L0MA 3I6MA 4ZZ3A 3ZY5A 3BWDD 1QDUA 1YNSA 2WHEA 3F9IA 1ACLA 4PYJA 2AG5A 4FFSA 1OI7A 1XEFA 3E3AA 1X0VA 2XOXA 4EHNA 3HY3A 3D7SA 5TEVA 2O3SA 1TECE 3HLKA 1GYQA 2H52A 2PGJA 1UMKA 3B1XA 2OBXA 1Y81A 4V0LA 4YAUA 3B5IA 3BFXA 1M0EA 1GP2A 4BNLA 3U4IA 1N0IA 1YB1A 1NBIA 1QVRA 2YIJA 1DL5A 2BGUA 4HQRA 1L5GB 3D59A 1BRMA 1XV5A 4N3BA 1REQA 1VA4A 3GRCA 4E6PA 4UMFA 5EMMA 3OTWA 5CNMA 2QT9A 3G9QA 1KO8A 2OXRA 5ALRA 3JYHA 3VR2D 1U8AA 3VQTA 1KO7A 3VU9B 2BDTA 3OVMA 5B3AA 1U28A 4NP6A 3KEGA 3IEMA 4GBMA 2C3PA 1QQ6A 2AOVA 2FN9A 4HF7A 4AP9A 1KTIA 4PTLA 2B1GA 2BTQB 2D5BA 3UPDA 1Q44A 4LWQA 4LHYA 1DPGA 3DYIA 4IIVA 4QO8A 2GNPA 2Q1SA 2H1WA 4R0NA 4XLLA 5G0WA 2AW5A 5GONF 2CXUA 3DE7X 5I9LA 1DKUA 1JX6A 4TYPA 2IWHA 1KO1A 3O0DA 5L40A 3WBKA 3IUBA 4R1UA 2RH8A 3UKDA 4JLDA 4DBLE 3MCUA 1YFZA 4CFSA 4ARAA 2Z0MA 5HPYB 1PR6A 3DV2A 2WE8A 3E8MA 3BDAA 3K0BA 5AVVA 5FLXA 2V1XA 1O96A 2FDRA 3DNMA 5AM5A 1GUZA 4ZC1A 4DANA 2ADMA 4TVKA 5C9ZA 3NBZC 3B1KA 1KI6B 1FXSA 1JSRA 2QR2A 3E9CA 3IMCA 4U9IS 2AD5A 3VPXA 5EWMB 4A27A 2ZVJA 5LD2C 2R6GA 1RM4A 2ZRIA 4CI0B 5BN5A 1E5TA 3VVLA 4QULA 1T4GA 4EFKA 1CQJB 1U2EA 4QOIA 4QM7A 5DNWA 5HKKA 3JQGA 3JQ8B 4QBKA 4LI0A 3H04A 4MWCA 2H3EA 4TTQA 5F73A 1TAHA 2VDPB 3UBMA 2ODTX 2XB6A 3AFNA 2FP4A 4LS3A 2VNJA 4JYPA 3K05A 4ENUA 1A7UA 3L0IB 2R97A 4EG5A 1LPSA 3LGSA 1PHRA 1WSDA 1EWTA 1WW3A 2QYTA 1SVOA 5BRNA 2ZB3A 4HY3A 2W2QA 4Y1RA 3BKWA 4HDNA 3L9XA 1ZONA 2X86A 1KJJA 3G9XA 2P0YA 1JKJB 2YRWA 3QFHA 3NANA 4JJIA 5ANRB 4QQRA 2GHQA 1W5TA 2IHYA 1S5PA 4G0NA 4MJXA 2ATVA 4URFA 3FMPB 3WLMA 1NW5A 3DWEX 1F2VA 2UYOA 3H9GA 3WO0A 2HT1A 1MEOA 3N2KA 1RQNA 2WU1A 5I9IA 4XB2A 2EARA 1U2GC 3BX1A 3L6RA 3PJDA 1WABA 5D5QA 2E85A 4RLSA 4BKOA 4FW8A 4NS1A 3ZD9A 2EFDB 3L92A 1LI5A 3K53A 4DA8A 3TL6A 1KS9A 2QJTA 2F1RA 5DCWA 1ZUNA 1J90A 2XTMA 4RSHA 2GASA 3RODA 3PFHA 3ZJVA 3OQ6A 2ZUTA 4ZT7A 5C5DA 2JHAA 1TX4B 4Y2SA 4OXNA 3REOA 3MSCA 2YZNA 3AOEC 3JD4A 4FFWA 3R7LA 5AP9A 3UG7A 3VR0A 2XMDA 4F5YA 5JNSA 1E3WB 4B2PA 3IVGA 5EINA 2FPPA 2ILTA 1C4WA 4E21A 1XD2A 1ZOOA 4ZO7A 3E22A 3R5FA 5SY6A 2ROQA 1N2XA 2AH5A 1JPNA 1PNRA 3HUTA 2GBLA 2ODPA 4KGVA 2L82A 5F2EA 2R3SA 2QVGA 3PCTA 4QBFA 1QH9A 1CU1A 2I6UA 1U0JA 2KHZA 3JYQA 1A9ZA 1UJMA 1DIBA 5JJ5A 3REQA 1ZD1A 3B6IA 4PXYA 2J0QA 3ANSA 1KVSA 4CM9D 4CMIA 3THWA 1UKYA 4QQNA 4EA6A 1MPTA 4RABA 1U2PA 3H86A 5IJ0A 5CJ2A 4U2FA 2A4KA 3W8NA 1QK3A 4X84A 1O7JA 1RCFA 2FX5A 2VHJA 4KAFA 1XZHA 4CMJA 1KTVA 1MAWA 1SUIA 2WNIA 4UJ3A 3WGVA 4CIBA 3U4GA 3AVWA 3GPCA 4BVGA 3TCKA 3A36A 1IN4A 3M6WA 2NNLD 3JQQA 2X6RA 4MVJE 5SY4A 1ILEA 1L5YA 2OV3A 2JFQA 3B1YA 1ZH2A 3GHHA 5KTMA 1MRZA 2G1KA 4I2VA 1G8JA 5FLKA 1VKRA 1P80A 3JVEA 3QOYA 4QU5A 2IU0A 3L8FA 4PNHA 5F4ZA 3TLZA 3M6VA 1OX4B 4GI5A 4LIPD 1ZK2A 1ZXBA 2MMGA 3VKFA 1JT2A 4M6WA 3ZOZA 4DABA 1ISHA 1TO2E 2EZ4A 2G4LA 2DY0A 3W0LB 4YRSA 1JN0A 1O6CA 2AF3C 4RHFA 1PN3A 3DXFA 4TV9F 5LXTF 3WL6A 3GRZA 3ZD7A 1C0KA 2F8LA 3T3DA 4GLJA 5A3QA 1B23P 1J1ZA 4DG5A 2OO7A 4ZVOA 1LTKA 2D0IA 3OH8A 3RC1A 1RHRA 3ICCA 3WSWA 2RHOA 3MCTA 1T9ZA 1I1HA 2O8DA 1OLXA 3PZRA 4KREA 4UEJA 5TQ2A 4X45A 5EHNA 2UU9B 3T9AA 1YR8A 4JI1B 1U8FO 2PANA 1YBMA 2IFTA 2R25B 4P7GA 4W63A 4MQ6A 3CRZA 4A0GA 1Z2EA 1WPRA 4BNDA 2F90A 1VJRA 1JE0A 3JD1A 2WA1A 3S2UA 3PNSA 1CUJA 2O4CA 3TTWA 1QU3A 2HU2A 2Q0XA 4MULA 4I5GA 4N3CA 4JI5B 3RS7A 2H1HA 4DLPA 3RVRA 2XEXA 1TM5E 2ZAGA 3KQLA 4GVPA 3PE4A 3IV9A 2JLUA 1SXPA 1T0BA 1WZNA 2M1XA 2XUJA 3T3MB 1E6EA 1C9JA 3KZOA 1GTZA 4E7PA 4G5GA 1UM9B 1NIPA 3CNEA 1AIPA 4NVRA 1XCLA 5AI6A 3RABA 3D8BA 2Z5GA 3LS2A 4GM0A 5CA1A 5J43A 3BOSA 3K2QA 4FGKA 4B0PA 4CKBA 5IS2A 4BFUA 4TZTA 1RZRD 4JU8A 1SVLA 2H1OA 1KFEB 2H92A 3WKBA 1EBUA 1P4JA 2DFKB 3CZRA 1DJLA 3ORQA 3TYXA 3PQFA 1XO1A 2XYHA 3JWPA 2I9PA 3ZNOA 1TC2A 3QIAA 2P9EA 4AMYA 1RAIA 2RG1A 3E2PA 5HDQA 3N0VA 2I4MA 3KQYA 3Q72A 4DFDA 2IOFK 2WAAA 2ZIGA 1PJSA 2B1JA 2QVYX 2HHAA 2ZROA 1ZGHA 5DN6A 2WSLA 5C8YA 4D46A 1FZTA 2QHXA 1UWLA 2QRVA 4HGYA 2CFCA 2RIPA 4ESOA 4QUIA 1M6EX 1OYOA 2OQRA 1IUOA 3TQFA 1YS4A 3WXBA 3GBSA 5ALLA 3CQ9A 4Z3DA 4Q93A 5BWLA 1GUDA 2RJNA 4LAFA 3C4JA 4OJKA 3IBTA 1CS0A 4MXDA 1QDLB 5BO5A 2KB0A 4IGFA 2JEYA 4MDYA 3WV5A 3ZZ1A 1ZMOA 5ALJA 4PLYA 4ALMA 1E32A 1GXSA 2IWRA 1RHJA 1LC0A 2OBYA 4NSNA 4JXXA 1RVDA 2B2NA 3PXDA 1IN6A 1PX2A 2Z1MA 3SSNA 3GLUA 4M0KA 3ZOKA 3J7AC 5CCEA 4MPRA 1UMCB 1YHNA 1KK1A 3SF8A 3O2NA 3OE1A 2X9VA 4LISA 1TUGA 2VC2B 4PYQA 2X5XA 3KJQA 3PQ7A 5KJFA 1BHO1 1HLGA 1WMEA 4FMDB 1QRDA 4X90A 1YZNA 2ZBFA 1R64A 1SELA 1XKTA 1ZL0A 1P2GA 4NAHA 4EYOA 3C14C 3H0CA 4WINA 4URHA 3WBBA 4JASB 3OETA 1J1UA 4A10A 1RC1A 1BAPA 4JDUA 1YR1A 1Y3HA 1F3LA 3N2ZB 4UAUA 1EFPA 1JG1A 2ORVA 3A04A 3AB8A 4G2NA 3GN2A 5FADA 4QVIA 4QZVA 4S04A 3ADDA 2ZYSA 2AN3A 3A37A 3MS4A 2HX1A 3TD6A 1HR0B 5K09A 3K3PA 4RCZA 1USUA 4UBLA 2C03A 3TM5A 1JKFA 2MYTA 4CU2A 4D0NA 4CKZA 5LQAA 1OX6A 2VUHB 2W6JA 2OSBA 3O93A 4MVJI 2QEQA 2VCYA 3FMOB 3FAKA 2PJZA 4R2KA 1SVIA 2OFPA 4DF3A 4JBXA 2IH4A 1DLIA 5ALDA 2QXYA 1IULA 5JZBA 1YK0A 2NSDA 2QVCA 3IUYA 3ND5A 4PZEA 1JAHA 3LQ4A 3ZU2A 8GPBA 2CNNA 2CCJA 4JLAA 4IXMA 1HETA 4ZYXA 4WOCA 3CNLA 3E61A 3NYIA 3MCWA 1THZA 3WJ7A 4PICA 5CEJA 1EDEA 2VNHA 3FGNA 3H16A 4TTAA 3L06A 4Q9KA 5HIAA 1E2DA 3WVNA 3FA2A 1GRVA 3QX7A 3PLAE 3N6XA 2IGBA 2XCUA 1POXA 3BDIA 2F64A 1HOXA 1STOA 3SQOA 1IMOA 1XN4A 3TIIA 3TN7A 1CZKA 2FSUA 3MELA 5GONB 1UP7A 3WS7A 3SHFA 5FUWA 1G1AA 2DU8A 2H06A 2QM8A 3I12A 3ZY4A 4D3XA 1HNNA 5CJJA 3PCRB 5HIIA 5IXSA 2LPMA 1C4XA 2BFFB 2QW0X 3L9WA 4M4SA 4TN1A 1BRTA 3ELDA 2XGJA 1VG0B 3EIFA 3PUXA 4NR0A 4IDGA 4BQQA 4TQUS 4COOA 2IIPA 4X60A 4ASUD 3K0EA 4KDRA 4L0DA 1WB6A 3K8QA 2ZSUA 4WCDA 1JAIA 4Z4QA 1GL9B 4XTCS 1AK9A 3L7AA 3P9YA 3UHFA 1FX0A 3BGWA 1N4DA 5KSOA 5ADVA 4BRZA 1UMDA 4YO7A 2PQ6A 4BX3A 1BVRA 3Q8XB 2P7IA 4X5OA 1CHDA 3EXHC 3ZZMA 1CUXA 2G04A 1IAVA 5COBA 4B45A 5BVGB 1Z56C 3M6AA 5JS8A 1C1YA 2XMGA 2WHXA 4YMSA 2ZYTX 3G7SA 3H19A 2MYPA 3MWEB 4IGKA 2VNIA 4L8GA 4UMVA 2RBEA 3WQRA 1ZI6A 3KKKA 1BIFA 1EJ6A 3MGBA 1Y1QA 2RC5A 1R6DA 1XTVA 2OTCA 3KQVA 3MGAA 4ER7A 4KV9A 1XFAA 4N3GA 2AG1A 3M1LA 2VHXA 3R7WB 3WWPA 5EQDA 2JI8A 1N9GA 3CLVA 4UD6A 2XVZA 3SEQA 2WQ6A 3EPPA 4DA9A 1UJ2A 2G06A 3N74A 4YACA 5ESRA 5IAKA 4B3HA 1K97A 2I2BA 3KTFA 3AL2A 3Q85A 2HR1A 2HK9A 3ODPA 4EPXA 5ETJA 3WLSA 1RYYA 3RO7A 5LDHA 2HBYA 5BNZA 1TQ2A 2QTTA 3C43A 4TLCA 2CL5A 4WDRA 5ALMA 3UB3A 4DJTA 2XCTB 2PSEA 4WKGA 3A2KA 2B5VA 4F5WA 4L9AA 4N0EA 1XOIA 3MWLA 2FG6C 4REQB 2IKQA 3QXSA 3UGQA 1P74A 2PH3A 1IN8A 5T67A 1JILA 5DHTA 2OXTA 4ZAFA 2WUEA 3OUUA 4OHOA 3SICE 5HJ7A 3CG0A 5HVNA 2PKCA 1DO0A 1K98A 2PCJA 1TMGE 4PC7A 3WV4A 4B31A 2R8YA 4D5EA 4MRVA 4OPMA 3IIKA 4PSCA 4Y8VA 4TUYF 5EGNA 1NATA 4M9ZA 2VH1A 4YJ3A 4AIRA 3PIIA 4D0GA 4DV3B 2JGIA 5EXEA 4BP3A 4BLRA 3WMEA 1HE1C 1NP6A 3U4QB 5JSKA 1FFSA 4ARSA 3FBTA 4E1BA 1JWBB 3FVQA 5HRUA 1URPA 3IQDB 4Q66C 1BWRA 2ZTVA 1PQ4A 1S3GA 1CB7A 1QBKC 2YX1A 3E9MA 1Z6ZA 1P3JA 4L2IA 4LA4A 5F33A 3VR4A 2YN4A 1TNDA 3BHMA 3SEZA 2R68A 2OHJA 3R1IA 2BZ0A 4ZV4A 4F1WA 1U80A 1UMBA 3JRNA 3R7FA 2I33A 3INNA 4FFMA 3H9JA 3PSAA 1GAEO 4R51A 3LCUA 2OB2A 3FF1A 2G1JA 4B33A 1DBPA 3AUAA 3HVJA 3T9FA 4NC9A 1GGHA 2CNBA 1U3CA 3H9CA 2WSIA 3M3HA 2R62A 3NT5A 3N70A 2AK2A 1II8A 3JX9A 4M89A 4KXMA 2IHTA 2EKQA 4PYLA 5AYVA 4LSWA 2R5NA 5I7RA 5JNRA 4XIFA 3DMHA 4IWNA 3G7NA 1XNGA 1QRAA 2I62A 3IQEA 3R0ZA 4YXWD 2V7GA 2FUEA 2XF2A 1USGA 2B1RA 4FT2A 1VE1A 2GLTA 4Z8YA 5EJ4A 5F52A 3EXHA 1DBIA 3G02A 4R98A 4TV9B 4Z1OA 4MWZA 5LXTB 1QWSA 3WR5A 2WB2A 3P9ZA 3WB2A 3OZGA 5LOVA 1DQZA 1Y6JA 3KUDA 3MWFA 4JLWA 4OYYA 1TU4A 3KBBA 5F1PA 3IMFA 3GG9A 3ZX4A 3STTA 3U61B 3HXPA 1ZD9A 1QRTA 5KJ1A 2O2YA 4W82A 3SQXA 1X8XA 2PGXA 3UCXA 2HY7A 3FH0A 3U80A 4PYRA 5D1HA 5FOTA 3WADA 1CFZA 3UMCA 3UB2A 3DP7A 1ZH4A 3PB3A 4MCJA 4AUKA 4BU0A 1DINA 1ENOA 1OFIA 3D1JA 4U9HS 1J0CA 2H85A 3I5UA 3KELA 2PGIA 2ZJ1A 4NENA 1KK0A 1EWKA 1OXMA 4EF6A 3ZCQA 5A1TA 2QM0A 4IDBA 4YCLA 5AKYA 1O8BA 4IYRA 5FJIA 4OK5A 1DNPA 4EEKA 4JQCA 1JLRA 1TL7C 3VMFA 4OHYA 1UODA 3EQZA 2GTHA 2O0JA 5BYBA 2X58A 4ES6A 5B6PA 2MSDB 5HS4A 3EZGA 3CH6A 2VXBA 5DW3A 2R66A 1BXGA 3K1AA 4XYGA 1X1SA 1TF2A 3AUTA 4X61A 4YK7A 1QHXA 3SFTA 2JI6A 2V03A 5IJXA 4ZVLA 5BVHA 4PWZA 1UXGA 2M98A 4UE3S 1AHNA 3KZVA 1L7QA 3BGOS 4G25A 3U62A 1I3MA 5LLSA 3S70A 1SHKA 4BQIA 4TL9A 3X1KA 4BN5A 4HXYA 1JFTA 3E1KA 3VISA 5JWHA 2RH5A 2CLFB 3IJ5A 3PQCA 2QX9A 5LQUA 3EWSA 4F85A 4NDAA 2Y3IA 1LV7A 4QRHA 3HI4A 1V5EA 4UNQA 2PR2A 3VH1A 3TKLA 1AURA 2HK7A 4H77A 4KE6A 4JI7B 2PSJA 2XNCA 3K0FA 4YP1A 3SS7X 1TI7A 3EA0A 4GPIB 4GPTA 4X7PA 1UKEA 3TQCA 3U1TA 1JZSA 3V4LA 3WOHA 3TECE 3AVYA 2FEMA 5CK4A 5K6AC 1U9ZA 2QVBA 2OYCA 2D4HA 1VIAA 4QYWA 2PS0A 3GP3A 2I6GA 2VDNB 4J0HA 4OB8A 2DGDA 1RHMA 3JZFA 4WJLA 1IOVA 4W5NA 4YTEA 1W4CA 4FWTA 4IZOA 2QRPA 3QXHA 4KNWA 4PZ0A 4XQ0A 4DPMA 3BREA 3U0BA 3LYAA 4WERA 2P7HA 2HNKA 3DE4X 2X3FA 3BGDA 3NBYC 3RVPA 2B7BA 2AX3A 4NCIA 2VPPA 4E94A 4ZCIA 1X1EA 4M1EA 4ZAWA 3S2IA 2IBMA 1UPUA 2PH7A 3I5AA 4UEKA 3SJBA 1QR2A 2BKEA 3U1VA 1Q0TA 3HS3A 2ZBUA 3BZWA 2RGDA 5B1SA 1XQVA 1Z4MA 1U4OA 3BEOA 1U7TA 1E9EA 2QLMA 2XZPA 4JY7A 4OFWA 2CCGA 4ABTA 3EF3A 1TM3E 2C2GA 3V3KA 4F2PA 1Z16A 1NMXA 3S2GA 4I3GA 1ZDMA 2PWZA 5GV7A 1BCRA 4BDTA 4E4TA 1A8UA 4GMGA 1Z22A 3ZCXA 2QPOA 1C7IA 4QXMA 1X8KA 3AIIA 3TKAA 1H0SA 2P0EA 4D0LB 2NXEA 1J33A 3ZK8A 3O94A 1Z7GA 2VYND 5LM3A 2QP9X 4IJ6A 1G63A 3KFXA 1LS1A 1WX1A 3D31A 5SZIA 1AH2A 5FA8A 5JXJA 3UMRA 2B4QA 1MZVA 1XLWA 1W1WA 5LZ7A 1Y9AA 1Z8NA 4G5HA 2YWBA 4OK6A 1QKIA 3K5IA 2FH5B 3C0KA 1M1YA 3M1IA 2ZRHA 4UMEA 1BVYF 4WBNF 1YUBA 1Z0UA 3R44A 3T5DA 3PUKA 1K6IA 1SB9A 3B9QA 4N18A 2OD7A 4ZT3A 4EUNA 3KR1A 3TSAA 3GFPA 3IHTA 1JIQA 1K7FB 4XSVA 2AHRA 4YRPA 2NTNA 3FN4A 4FDLA 4YP6A 3I45A 1N78A 4GEGA 4GLLA 5G3ZA 4AZVA 4P0PB 1OBFO 3IQIX 3EBPA 4RAQA 1M7GA 2O23A 3L07A 2RJOA 3E53A 1V26A 1CQIB 1QK5A 4JGGA 4MGYR 1V2HE 4YMIA 2VJYA 1NN3A 3KVOA 4J03A 2Q5QA 4RJJA 4F9TA 2YIMA 4WKCA 2GEDA 4LQ4A 4YJHB 5SYAA 1THGA 3LVRE 4N40A 3BXXA 4WJKB 1KI1A 1WUYA 3B78A 4V0QA 1DG9A 2WHPB 3UFBA 3F4KA 3ACDA 4EBBA 5L45A 3HBNA 5D3MA 3ISVA 1NDHA 1ADCA 2R8RA 3N87A 4IMPA 4OXIA 2WA2A 1LPMA 2W2PA 1J70A 3BKXA 2QT1A 4LJKA 3VXKA 5HZMA 2V9PA 3DMYA 3FCXA 2XCOA 4BE7B 5KSZA 4TL8A 4JX9A 3DTYA 1GNSA 1P31A 1ZH6A 2UZ1A 3QEMA 4MVWA 4KO8A 4NU6A 3MWJA 4Q7MB 3F5DA 3O6VA 5MDHA 2OXFA 1SQ6A 2F3RA 4NBTA 1QS0B 1CP3A 3EIOA 1YL7A 5A02A 4QOJA 2JGFA 3QYAA 2O3TA 4NV1A 4JI2B 1KEZA 3ROQA 3GWGA 2F1KA 3INYA 2H57A 3UOGA 5L8VA 2WJIA 4QC2A 4YRTA 1BZYA 4Q34A 5B53A 3VGPA 4CTNA 4D4HA 2C5AA 2JZOA 1N34B 2IHBA 4Q7EA 3UH0A 3ZE0B 2YOFA 2KPOA 2O0LA 4QD3A 1TGYA 5IAGA 2XLBA 1THTA 3L2OB 4AM8A 4F06A 3E5RA 4AN0A 1E7MA 4LTNA 3P9IA 3CIFA 1EIZA 3PL1A 4N5DA 3CT4A 4O33A 3GJXC 2KE5A 2VYQA 5BP7A 2OHVA 3TX2A 1ODIA 3B53X 1D6NA 2DQKA 1T8UA 4KO4S 4FKZA 4H7KA 1MO4A 4PG4A 1SCJA 3SKVA 5B7NA 1IU9A 2VXYA 1H2BA 3EDQA 4F9FA 4YV1A 2QVZX 1OA1A 4RJTA 1P19A 1XQXA 4RH3A 3D0KA 4M9QA 4AROA 1NG9A 3IELA 2A5DA 3MIIA 2CD9A 4JJKA 4LXXA 4PM4A 4UOQA 4TZKA 3U40A 5JQGF 2XMQA 2QUBA 1VKZA 1U0SY 2VN8A 3CLUD 2PYDA 2RK3A 4IHQA 4MQEB 1K63A 4ND3A 4QKQA 1N1MA 3Q6IA 2ODAA 3O2SB 4D4KA 1I01A 2E89A 1S9DA 1SXJA 2ACKA 3AILA 1XDSA 2BD0A 2I4TA 2RI6A 3D9QX 5AW1A 4M22A 3K73O 3KB6A 2H4HA 4TS3A 5I7WA 3ZVNA 3WIOA 2Q1UA 5DF1A 2BLNA 3OJWA 1L5KA 2XB4A 3ZH9B 1BYUA 2OD9A 4TUYB 4BE4A 3IE2A 4I4TF 2BFDA 3F7NA 5THQA 4JSTA 1IQPA 2RMKA 3FDIA 3IUJA 4BO8A 4BUCA 3EZNA 1B15A 3PICA 3L5OA 2V6MA 4OBBA 2XKKA 4HZUA 1PW7A 1WMSA 4KQKA 4R9UC 2OBBA 4RO0A 5EYPA 4BFTA 1VTKA 4P93A 5EJ7A 1NN1A 4HI0E 1Y1LA 1COWA 4M86A 4RUKA 1DAEA 3GL9A 5E1MA 2J85A 4XE5A 2VT6A 5CBPA 4XGQA 5AW9A 2YMPA 4CQMB 3P9NA 5BORA 3MA0A 1O5IA 3KOOA 1OIWA 3NI2A 5KYTA 1VLZA 4PHGA 2G1UA 2XYQA 1V25A 1RW4A 3EG9B 3MLAA 2GYUA 3VR6H 2DTXA 3W6NA 2FZKA 4YFYA 4DT1A 1FJHA 1RRKA 1YJ5A 5K0BA 1E9RA 2H4WA 4PTYA 2C1EA 1B8VA 1L7PA 1M5TA 2WHRA 3A4VA 4MICA 1KMQA 3K70C 2RBKA 3EZ2A 2H7VA 2MHCA 1GCAA 2VUSA 3JQ7A 1S7GA 3KJHA 3JQFC 1WBJB 3X1XA 1F0KA 3OTQA 1NR7A 4PBSA 1KH2A 3LYLA 2HA6A 3GGPA 4LC1A 3X3HA 5EZ6B 1JU9A 3MMSA 3LYUA 3VVMA 3T9CA 4M0UA 4RGYA 1F8GA 4GE3A 4N5IX 4DJDC 3BFKA 1JDJA 3HHEA 2YWDA 1T5TA 1J09A 1KIAA 3RUCA 3ZDRA 4URXR 3BF7A 4C4AA 4OQNA 2CUKA 4QTUB 4C88A 2Q7OE 1U5CA 2Q3CA 3AUJB 4XVRA 1Y8CA 1Y9DA 3R6LA 5C7IO 1D2CA 4H3SA 3SQWA 5K0ZA 4RF2A 3PRHA 5BPFA 1JU3A 1YI8A 3DBRB 2O1WA 1E9SA 4LJ9A 2G6TA 4YRFA 4PNZA 1CVRA 4RHCA 1EE2A 4CEJA 1OXTA 1D8TA 3A1TA 4NABA 2PGNA 4MROA 3AP2A 3ZK9A 1X3LA 4G0WA 1PVDA 5FWAA 1TM7E 3E9QA 4PXSA 3C85A 3IQHX 3BMQA 3DEFA 3SX0A 4G0XA 3SVTA 4LRXA 1W4BA 2Q5FA 2GHRA 2WAOA 2JBAA 4QGSA 5B7PA 3QVVA 3A6GA 2FOLA 4HQFA 5IU6A 1XPRA 1PJTA 2IYRA 2YWFA 4ZO9A 2G1PA 4KLZA 2Z6QA 4MQFB 2MOKA 3WL4A 4J76A 3V00A 2DUWA 4CQJA 2CHEA 3KHUA 3S3TA 3UJ9A 1IK6A 2G70A 3QE0A 3AEUA 4DSAA 1OWNA 4XDZA 4G5YA 1ISMA 4YAJA 1HFKA 2D13A 4EY4A 1FMTA 3V7NA 4RENA 2R1ZA 3K9NA 2EW8A 1Q2XA 3H7AA 1CUZA 1AMOA 4FGLA 1NSYA 4C2UA 3JQ9A 4MIEA 4B3DA 1MB9A 2ASVA 1XI2A 2Y1FA 1K88A 5BW8A 4O0MA 4OXXA 5B4VA 4S0ZA 4KIUA 1EHYA 4CF7A 2X42A 1ODKA 2W90A 2YCBA 3UWMA 1X2BA 2FW9A 3N0XA 8ADHA 1K4MA 4LXTA 1XZEA 1B93A 1Z7YA 1Q19A 2VPQA 5H02A 1DAOA 1DOHA 2J6IA 4MDFA 2WV9A 2PRJA 3C6XA 2CYAA 2ZOSA 1NMZA 1MO3A 2ZT5A 4M21A 2JANA 2XMBA 3G1WA 4R2LA 4Q01A 2I03A 3GPDG 2XLCA 4JA0A 4IVRA 1FXWF 5CVJA 3V4OA 3IHKA 4LQDA 4F3NA 3AL0C 1H2RS 1WXXA 1Y37A 2NU6A 5SZKB 4Y6RA 2Y0BA 2FVXA 4Q1DA 1VPLA 2OFWA 2XUIA 3N2EA 5F77A 4BFVA 4DPLA 5HOEA 3EHEA 2AYYA 3FOZA 1A76A 2ZXEA 1AKWA 3QV1A 4XUCA 3KVNA 4XUGB 4AIIA 1RPAA 1JLLA 1E60A 3QVSA 3W1EA 1M74A 1UBMS 4IXWA 1JALA 1MG5A 4IH1A 1USIA 1J00A 2OBMA 5KYWB 1UT8A 3JWGA 4HPXB 3S4YA 1Q0PA 3JQFA 2A86A 1SKQA 2R11A 4KLAA 2CVZA 4W7HA 4PLHA 3WIUA 4YALA 2XYRA 4BECA 3SZOA 1Z47A 1TK3A 4L08A 3UAXA 4HOYA 1ULZA 3C5WP 5FULA 3E05A 1IUKA 1YQDA 2IZ1A 3OTIA 4R9RA 5FFMA 3DO6A 3T52A 2DVMA 2ZE7A 3WMXA 5JNLA 4NDNE 1T29A 3H2ZA 5CLHA 1LC3A 1YKSA 3OMWA 2JVJA 2RGEA 5CLFA 4LRTB 1KJZA 1SHLA 3BRQA 3N2IA 4LZWA 4O1IA 3EODA 5IT9A 2G72A 1JQBA 4J1QA 1RLTA 1EK2A 3CNBA 4I5DA 1EFLA 1G8MA 3HJTA 3P0IA 2Z6VA 3DFFA 4KRXA 3RNOA 1UAAA 3LKVA 4FYVA 2OLEA 3MLEA 3QE4A 1IRXA 3NYRA 4LKRA 3ZV6A 1GPUA 5AMXA 5C8XA 2CSXA 2PD6A 3QMWA 1F2TB 5CLIA 3PVZA 1YVUA 2AFRA 4J3NA 3V2GA 5A5EA 1PAUA 4WBNB 4HJRA 2H11A 3FPCA 3M3PA 3TD9A 1FJ2A 2DYKA 5FV7A 2PQMA 1HO3A 4K2HA 3JTEA 3HZOA 2O2CA 3SC3A 3UJNA 2YQZA 2OV6A 4OHCA 2NUTA 1LLFA 3SJCA 1EGMB 3GT0A 3O83A 1KMNA 1NBMA 1VM6A 4JL8A 3T7SA 4BP9A 4CCYA 5ALEA 5KOHB 5BV7A 3A58B 1GPAA 1KRHA 4Q19A 4JSYA 1K9VF 5BYAA 5MFZA 1LJ8A 1ORIA 3OWHA 2LNDA 2PZAA 4QDKA 5DBEX 2XBLA 1KXJA 3SAJA 1QGOA 1E69A 4L4XA 3ESBA 4QVGA 1L2TA 2OCPA 3X0DA 3HPRA 1XYVA 3ZGZA 5K0LA 1QJ4A 1JEEA 1DADA 2IHZA 4Q00A 1XHFA 3H2IA 5DE3A 3FRHA 3ZHQA 3PGJA 5EJ2A 4ZK2A 2Q3HA 2X9NA 4QYIB 4AUEA 4C0SA 2O3UA 4EZBA 3THXB 2BEVA 3QIVA 3A1DA 3RC8A 3C3WA 2VAMA 3PHCA 1QGYA 1EX1A 2W2LA 5K1ZA 1YVPA 4YJFB 2SBTA 2EBUA 2OESA 4OQXA 5ILOA 5PNTA 3AW8A 3U56A 4O3FA 2CF6A 4PRZA 5EPOA 1XMOB 1ZCJA 2ZIFA 1T13A 3D6TB 3ETLA 3ND8A 4RPHA 4Y2QA 4Y98A 1T34A 4OQZA 4UU8A 5KVQA 4AKEA 1GZSA 5A9SA 4PG7A 3DYBA 1F4PA 2HCRA 3RRZA 1W85B 2Z3WA 1M2WA 1CY1A 5CEEA 1YRLA 5JARA 4F3TA 2AEMA 4WXHA 4OL9A 1KDPA 1S3FA 1F6DA 1XD8A 1SBQA 3D43A 1RLOA 2GSDA 2YHUA 3O8QA 3F9RA 1Y82A 3KLNA 2WKQA 3G6WA 1WM1A 3PUYA 7REQA 2FFQA 1ZKDA 1FFEA 3WGNA 2REBA 3DLHA 1SUBA 1FL9A 1L4YA 2PD3A 3HO6A 3ZXUB 3DVLA 2QNRA 3DMFA 1C3XA 5HJ2A 3CLHA 2MU1A 2P6PA 2Z4RA 4R1LA 4R3NA 2GBGA 3NBUA 1QGZA 3RVQA 4C0KA 1RWQA 1XDDA 2B36A 1EM8B 1RKXA 2ZRCA 3GJ0A 3HABA 4I8IA 5TMDA 3GARA 2NYVA 2QE7A 3L1UA 1F3OA 5C5EA 2O59A 3PE6A 1KDOA 1JEQA 2Y9MB 2B78A 1LRJA 4JK3A 4RIEA 3ZK7A 3CF0A 1TYDE 1IMJA 4BJ3A 1K6JA 1VYUA 3NV7A 3QFCA 1CSEE 2FQYA 4XR9A 1TUBB 3VR3D 1DQRA 1GADO 4C4TA 4C20A 4X8OA 2LVBA 5KYYB 3EEOA 1A04A 4P7BA 3K9FC 2Q1YA 2YXPX 5JQGB 1Y7HA 2OQIA 1R0LA 2P4HX 2C5SA 3S44A 2YWGA 5KX5A 3AR5A 2NOAA 4IIJF 2YRFA 5HJEA 2YBDA 1NXSA 3NDBB 2FZ5A 4O02B 4ZIRA 1BVHA 3BJEA 2A6PA 1WB5A 5FTMA 2ZRLA 3DJFA 4XWOA 1P7CA 4O2LA 2NYAA 2PUGA 1X15A 2QZ4A 3NH6A 1EE9A 1CPYA 1RACA 1UBRS 1MG0A 1DVRA 4I4TB 4IV5A 1SHUX 1Z2DA 4O4JA 1YRHA 2OLJA 1JSLA 1QGDA 3AY7A 5H80A 4Q7QA 8AT1A 3IJPA 2IIQA 1VKHA 3I76A 4NCBA 3E58A 4DZZA 4OV6B 1CNFA 4U2DA 5J4VA 5LMNB 1KDYA 5AM0A 1W59A 1JEDA 3A3YA 1T4CA 5FUYA 1QC5B 4LVNA 2PH1A 4MSUA 1Y1PA 1Q1NA 1RNLA 3ORSA 1NP7A 1BC5A 1E9BA 3MM4A 5E1OA 4OIMA 3MTDA 1PBTA 4Z1MA 3R7AA 3VRHA 4IV8A 1C1XA 4A36A 4X9XA 4AW9A 4MIKA 1IB0A 2O7NA 1VECA 3ETHA 1JVBA 3ORRA 4GE0A 3TIXB 4UPEA 4BVJA 5KKCA 2PH5A 4FMPA 5AR1A 1H2YA 4MPJA 3HJNA 5CT4A 1UR5A 2ZRPA 4MS1A 4ZVSA 1RQ7A 2GPTA 1O89A 4OI2A 5CAEA 4N0PA 3P27A 1WP9A 3GGJA 2IODA 4ODIA 5ALFA 3KE9A 1GRCA 3VYRB 1Z0AA 2PX0A 1KHHA 4MPDA 2HHCA 2JG3A 2M32A 3I1IA 4I1RA 3A31A 1CV2A 3HJGA 1LW6E 3LXUX 1VBFA 3DXZA 4DUGA 4L22A 10MHA 1XL1A 2DY1A 1CUVA 4CE6A 1E1RD 2VRCA 1DCKA 1P1BA 1PZXA 4G5RA 3TFWA 1ST2A 1HDCA 3TRIA 4DG9A 2OB1A 2X0KA 2WAXA 2Z3ZA 5BN3A 4GVLA 1NVBA 3TXAA 3ZLTA 3X1ZA 1RJFA 4CFYA 3GLSA 3Q5EA 4LXGA 4IGAA 2VF5X 3ZU3A 3RKRA 4H0NA 3BWCA 4M3NA 4XKJA 2AR0A 2DR3A 3UKOA 2BE7A 2Q9UA 2BHNA 3CW2A 5IF3A 5I7SA 4DPKA 2OUIA 4OA8A 1GILA 2NT3A 4BLSA 4D80A 2B8TA 4NE2A 1MR3F 1G1MA 4WNAA 2DETA 4PZAA 3F6EX 4F4DA 5KNCH 1Z0IA 5KHAA 4YMHA 2CL6X 1VE6A 5CB4A 2BMAA 2SCUA 1DRUA 4YA6A 1EWRA 3DAOA 3HFRA 4FDMA 4XLTA 2Y68A 2C98A 1V5WA 4AN4A 5JPIA 3DMDA 4UFNA 2COUA 2KQUA 1U1EA 3LCVB 3UM9A 1GV1A 2H18A 4FXPA 3ANXA 2XAAA 4GMXA 5ALIA 1QYRA 1JDUA 1UC5B 5KWEA 2JIPA 1T0IA 1TVCA 3ABSB 1UT6A 1CY0A 4TRJA 4X1IA 4XIYA 1QIMA 3BICA 4RXUA 3PTZA 4MR8A 5KKAA 2CXQA 3PJEA 5AXBA 5AI9A 4KAAA 4QTTB 3AR2A 4TKZA 1XDWA 1N0WA 3DVQX 3C3DA 3HBLA 3MT8A 1I14A 2HADA 5EJIA 2P5TB 4DC1A 3GN1A 3JQRA 2OWDA 1XAJA 1YS1X 3CSSA 1PSZA 3H6KA 5AJWA 3AUKA 4QWMA 3T9EA 1N5KA 2JA1A 2GEJA 2ZYDA 4AZ0B 2ETXA 3G82C 2H0RA 4KKXB 1G6Q1 1HK7A 2GPSA 5EFOA 3AYXB 3AEQB 4U0JA 1O4WA 1WKVA 2C2BA 2DT8A 3KU4A 3AXSA 3LKZA 4ZVNA 4EEZA 4EMSA 2ZR7A 3G85A 3T34A 3OO1A 3WRWA 4W5RA 3QPCA 3L04A 3H1BA 2ZPUA 3A6EA 2WEKA 4PGAA 1UINA 4YECA 5D86A 2DULA 1EZ1A 3RANA 4KX3A 3KQKA 1M1XB 2WPDA 4LVCA 1DIAA 1J2UA 1G42A 1ICEA 4H2DA 5I5EA 3EOZA 4ZVTA 2MSLA 3L4SO 5IYZF 1YACA 3AESB 2WF9A 4AG5A 4G1UC 1Y0BA 4DHWA 8OHMA 5JMTA 1Z62A 4KVZA 2XUQA 1D7AA 2QN1A 3U3MA 4RQAA 1APBA 4RK1A 3PIDA 4ZJZA 1U9IA 1Z4LA 4FWBA 2YJTD 3OZVA 2OPBA 2GD6A 3IP6A 5EMKA 1L1FA 3TW4A 5L4SA 5DTMA 3IALA 3UF0A 1EFVA 3EZ6A 1XMJA 4WOPA 5KNDD 1NMSA 1NUSA 3CKLA 2QLLA 4B32A 2YICA 1SH7A 1UPTA 1K89A 1HDZA 5SZHB 1D3AA 2AKAB 1X8LA 2CLHB 3WAGA 4LX8A 4S3MA 5HR5A 3HN2A 2X3UA 4K26A 1NONA 2KX7A 4XWAA 2ASEA 4LGCA 4O4IF 4CCWA 4XRGA 1Y8RB 3D7RA 2BGGA 3NTUA 4DKJA 1XIVA 4JVMA 1KYTA 2PEYA 4DSUA 1CVIA 4Y7DA 3JQAD 3CRQA 4UUQA 4XUEA 3O31A 4DARA 2MIIA 3I2IA 5JD5A 1ULAA 1J9ZA 4HO1X 5DNAA 3HB1A 3R2JA 4M0DA 3TB6A 2ZZNA 5LNK6 4QL3A 1ZSYA 2AXPA 3CZ9A 1BHJA 1RIIA 2PXCA 3E81A 2GDZA 1EFRD 1JLKA 1M1ZA 2NAFA 1DUSA 2QG9A 2FFBA 2RSLA 5FL7D 4D3FA 5I45A 1KMHA 1ABBA 1K6XA 2PS1A 4FBGA 5K3EA 5JYEA 3LXXA 3CCFA 4WXRA 2G07A 2ZANA 3DDSA 3HADA 1X70A 4RNDB 1OZAA 3HR8A 3EPLA 4TLDA 1XTRA 3CRRA 5EOVA 1E0DA 1QX3A 2JGKA 2P2DA 1P4RA 3IUMA 2UUOA 4L8WB 2DP4E 3RIXA 4HDSA 4X44A 3D7LA 5K5EA 3OCUA 3VTFA 1ZVJA 4HMPA 3L6BA 3PC4A 3UJ3X 3U16A 3IX7A 1YZQA 3NEAA 5GV8A 4D98A 1NRXA 2H7CA 4C14A 4U7WA 4UXHA 2CF5A 2EHDA 4TKUA 5FNVF 1FW8A 4HLDA 2X8JA 3H5RA 2A9JA 1PCXA 3E82A 4OGKA 1PR0A 1NE2A 1KXZA 3LNTA 1RJGA 2Z8YM 3N8DA 4A8TA 2DUJA 2IJGX 3QI7A 2WFLB 1XP5A 3I5YA 2FEPA 5DYTA 1X7DA 4LYEA 5KAPA 1ZIYA 2ZS7A 3UN1A 1CJTC 1MB0A 5GMOA 5B12A 5B4UA 2D1SA 3C7TA 4KQFA 2PU7A 4INZA 2B83A 4UKDA 4QBTA 3ACBA 1M1UA 3CU5A 3C1OA 4AO8A 4XDGA 2H4YA 3OTOB 3A8TA 3BGIA 4D9IA 1YZVA 1H22A 4NYJR 3AFOA 4BRUA 1WR8A 3C41J 1FYVA 3IEPA 1ESEA 1K66A 1H3FA 4G1CA 4M54A 3WMWA 3BD9A 2A9PA 1N8KA 3ICPA 3N7UA 4QDXA 2C5BA 5FOUA 5CA0F 1CTQA 4TKMA 3M81A 4YHBA 1E4VA 4UZSA 5LC1A 2D6FA 1SU7A 2BFEB 3COYA 4GX5A 1ZI8A 2IP4A 3ES9A 1PIWA 4RD0A 4AAYA 1TEZA 4UBMA 2VTKA 2ZS9A 3DQZA 4ZZIA 1PEYA 4GG1A 5KNLA 1NMYA 3BRWA 1E9DA 3FUVA 2HU5A 3CEPB 3II6X 4Q4HA 4E7OA 4BMXA 3GFSA 3W5SA 1NAIA 5J59A 3SX2A 4YUZA 3D3WA 1U8ZA 2NQ8A 4M7OA 2PKEA 1U7UA 5I7EA 4I50F 4B3TB 2TMYA 4ALNA 3P26A 1NYLA 2AXEA 3UG6A 2I3AA 3SQLA 2J3KA 5KTTA 3WP1B 4IIJB 1WZCA 3BCUA 3ICWA 4O4LA 1K7YA 1KMIY 1E1CA 3N28A 1AKEA 1J21A 1DKLA 3NASA 1CG6A 5IAOA 4OHVA 1ESMA 3OM1A 3EIUA 3CWCA 1ESZA 3EAFA 3GPBA 3VAAA 2NSJA 2WD7A 3WKEA 4JLUA 4EY8A 1YDHA 4D45A 1X7WB 1Z29A 2XQJA 1IYZA 4P2BA 5K3CA 3C4VA 4K6KA 4GVXA 4QDOA 3EAGA 4RELA 5CFOA 1XJQA 1GZ3A 2W48A 3NP9A 5IC5A 4Z2AA 2CLSA 1YHYA 1MJHA 3H5AA 3LF1A 3HKBA 3RW9A 3FMGA 1O94D 4DMCA 2UZ3A 3SS9X 1D03A 4XASA 5HCUA 2A30A 2X8WA 3FOFC 5EWJB 5FOWA 3WGKA 4AZ3B 1UUFA 3OU7A 5LZ5A 2BRUA 1DXQA 1VP3A 2WU3A 2FPRA 3CWQA 5DT2A 1R8YA 5EC8A 1UCFA 5BWOA 4H4CA 1GGFA 1LF0A 1BMTA 2UUCB 3GGCA 1X7XA 3DZ8A 5A0VA 1FB5A 1WV0A 1E64A 4F6LA 3R5HA 1P0IA 4C4PA 1B41A 1CY2A 1U1FA 2MR6A 4XWGA 3KKOA 2P5UA 2QVLA 3I6YA 4ZN6A 3C6BA 1PJRA 5HTOA 4X00A 3ZWPA 3C8MA 3HXTA 4IHJA 5CT9A 5F3WB 1XNRB 2M1ZA 3RUIA 5ISMA 4AMBA 1SQSA 2PQ2A 4HYTA 3HXMA 4B6PA 1RRMA 5KNBH 1JGTA 2KM1A 3IP3A 2V4ZA 1OF1A 4LOHA 3IURA 3S2ZA 4JKYA 2NU8A 2NPIA 1I3OA 1UAGA 1Y6GA 4YP0A 4U3JA 5EQJB 2NTYC 3M9XA 1I5RA 1IB6A 4AY4A 4DMUB 3EEQA 4ERNA 5L51A 1E7QA 1HNXB 1DV2A 4CLRA 1B0UA 2CBZA 2XNKA 1MTOA 2P4EA 4IIGA 1PSWA 1YE3A 5K3DA 3TE7A 1UJNA 3KYCB 1LUAA 3ZWWA 1QFMA 3KXKA 1R4NB 4YAIA 3DTVA 1ISJA 4BO0A 5KOJA 1OFGA 1MQAA 3PX3A 4KLRA 1NDQA 3FRIA 5HS6A 4C89A 3PKZA 1R27A 2WF6A 5F9MA 3STHA 1LK5A 3QLUC 3BB4A 2MJLA 2GFIA 4EG6A 4B3CA 2YWJA 2CLEB 2L42A 3HYTA 1GG8A 4JA2A 3S81A 4B3JA 4G0UA 4BTEA 3TINA 2AZ4A 3IJEB 3C39A 4RZ3A 4QPPA 1CX9B 2QW8A 3PBKA 1EK0A 1PNTA 3FKQA 4YIKA 4ZEWA 4B5KA 3QG5A 4K8OA 4F71A 1Y4SA 1GYPA 5L4LA 1MAHA 2NU7B 2O2IA 4AP5A 1IZ8A 4BMPB 4ZU1X 5KCMA 2O5CA 2WT8A 4JROA 2HD4A 2ZQYA 3HCCA 4IXDA 4OYRA 3TXXA 4ZQGA 1GTL1 2QUIA 3M6LA 4AJPA 4Q9LA 3L7OA 3ZEAA 3N86A 4EG4A 4IIHA 3L7DA 4JCOA 4UHJA 1EGQA 4W5TA 3A4IA 4C7OB 2C1ZA 3NLLA 3RC9A 4OLBA 4YY3B 1VKNA 4TWIA 1A9QA 3S1AA 3U49A 2WZQA 2WU4A 1ZPDA 3I1FA 5CDFA 2O0KA 3FNIA 2R7MA 3G8CA 3G1UA 3K8YA 4CM7A 5LL6P 1SXJD 3TJRA 4FCCA 3RHSA 3CPSA 3AGQA 2NZXA 3VPFA 5ADWA 3TVYA 1GA1A 1QF7A 2QSUA 4I5EA 5T8KC 3DBHB 2EF0A 4J2HA 3COPA 2V8BA 1PWHA 1QGED 3H8SA 5LDGA 3FUUA 4NIMA 4JAVC 4BO5A 3E70C 5IZCC 2YZ2A 3KKPA 2HQSA 4Q1CA 4ER3A 1XZQA 2QJFA 1FLVA 3CX6A 3DVAA 3M6FA 4EAAA 1E2GA 1R74A 3WLAA 5JYDA 4OFXA 5EERA 1RAEA 4ZMSA 1RQGA 1VRCA 2HUNA 1T8WA 2CVOA 3FIUA 5AHOA 1COWD 2YVKA 5KYNA 1EAYA 2ZJAA 3WGZA 3GI1A 2DSNA 2OFFA 3VZCA 1MAVA 4OL0A 1ZU5A 4KZKA 4DGSA 3GUYA 4HMOA 1BN7A 2AOUA 4Z9BA 4I1PA 3EN0A 5IYZB 4D82A 2XZOA 1IOZA 2O2HA 5GQSA 3V7UA 3A2LA 3B6JA 3QZUA 5AVWA</