2LUOA

Nmr solution structure of apo-mptpa
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
164
structure length
164
Chain Sequence
GMSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQLGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Apo-structure of the Low Molecular Weight Protein-tyrosine Phosphatase A (MptpA) from Mycobacterium tuberculosis Allows for Better Target-specific Drug Development.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords LOW MOLECULAR WEIGHT PROTEIN-TYROSINE-PHOSPHATASE A
total genus 50
structure length 164
sequence length 164
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2luoA00
4KK3A 5CNIA 1YMVA 1DC7A 3SQNA 3NHZA 2V0NA 3A3KA 3CHYA 2FXIA 4G0ZA 4QYWA 1YTUA 1DBPA 1VKRA 5DGCA 4N76A 4EYGA 3KYJB 3CLKA 1USGA 3OLWA 5F64A 3NNSA 4HNQA 3C3KA 3JPWA 1YK0A 4EYOA 1FSPA 2ZWMA 5HQJA 1NXVA 3LFTA 1JLKA 2JBAA 1CHNA 3CG0A 3QLUA 1S8NA 1MVOA 3DGEC 3QLVC 3B2NA 5ED4A 3CZ5A 2FQXA 2NT3A 2OENG 2WMYA 2QW1A 3F7NA 4XASA 4EY3A 1URPA 2FN8A 2PL1A 5EWJA 4W5NA 5TPZD 1K68A 4IMIB 1Z18A 5BR1A 5HKOA 3K4HA 2GBPA 3HS3A 5BQ3A 3EGCA 4RS3A 3GWGA 2RJOA 4OLAA 5BRJA 4LDZA 3IPCA 4YV7A 3MF4A 3LUFA 1R8JA 3GRCA 5JNRA 5DCLA 3HUTA 1QMPA 4S04A 1JYEA 3TD9A 4MQFA 4ZJPA 1A2OA 2KYRA 1U8TA 1U04A 4JP1A 2MSLA 1EWKA 1M2FA 3GV0A 1DRJA 9ABPA 5IC5A 4MQEB 5JNWA 1OXBB 3QX9A 1NXTA 4XFKA 4HYEA 1E6MA 2H3HA 3QLTA 3M9XA 4G0MA 3TMYA 3CNBA 1SXGA 4KRFA 4L4UA 1YMUA 3HSYA 1MAVA 3LUGA 2CHEA 2L19A 3LKBA 2PAFA 4MPTA 3F6PA 4EVSA 4RY0A 2LUOA 2VUHB 2JCGA 1GCAA 3KS9A 4Z99A 4WT7A 3O1HB 1A04A 1MB3A 2VYCA 2E4ZA 3HZHA 1Z12A 1QPZA 4RXTA 1D1PA 3BREA 4LDAA 4MLDA 1TMYA 4NCBA 1FFSA 3IDOA 1C4WA 3KJXA 3LKVA 3HDVA 7ABPA 2NT4A 4OATA 5CNKA 3QLUC 3T8YA 1U2PA 5GQSA 3CZCA 2HQRA 4LE0A 3F6CA 4XLTA 3RVMA 4MR8B 5B3JA 3LUCA 4ETIA 3UKJA 4RK1A 4KK4A 3Q7SA 1P2FA 1BAPA 3QEMB 3OO0A 4EGSA 3HV2A 1JF8A 3QEKA 1ZHHA 2A9QA 1ZESA 2FMIA 2FEPA 3FFXA 4PEVA 4RY9A 2W42A 2YHAA 1KRWA 1DP4A 3EJWA 2GWRA 2O20A 5KC9A 3KKEA 4MS3B 1L5ZA 2MSWA 2FTKE 1QNLA 3EAFA 3GBVA 4Z4FA 2JVIA 1U0SY 2A9RA 3CRNA 4YGXB 4RU1A 3CFYA 3KSMA 2FEWB 1QKKA 3L49A 3I09A 2PMCA 3IP5A 1LJUA 1T34A 3LOPA 5CNJA 1JFVA 3RVNA 1J56A 2LP4Y 1P6QA 4RDCA 1QQAA 4L85A 2JB9A 4W5QA 3HJFA 1QP4A 4LE1A 2PLNA 2R25B 4O5AA 3H5TA 2PUGA 1K66A 1NY5A 3DZDA 1PUXA 3TX6A 4H3HB 1YIOA 1VLZA 2DRIA 4MYRA 4RKRA 5DTEA 4Z0NA 3CS3A 5TQ0A 1EFAA 1QO0D 2A9OA 3LTEA 4ZMRA 1GLGA 2M98A 3O21A 4RK6A 1Z26A 4RXMA 4IMJB 1W9HA 3G85A 4QYMA 3FMVA 3RVKA 2FSPA 4MR9A 1DC8A 2L17A 1AB5A 4N41A 2E4WA 4OBBA 5C5CA 4EUKA 3EDCA 5IX8A 1JBEA 4MS1B 5BRAA 4EVQA 3H5OA 3LUJA 3D02A 1QP7A 4IGAA 2IYNA 2NZVG 5FWYA 1NXOA 2IPMA 3RVLA 5FWXA 3RVPA 1TJYA 3NNDA 4MS4A 1Z2EA 5IUJC 2QSJA 1JYFA 1JFTA 4MRMA 2R47A 1L5YA 1SXIA 3IP6A 3H5WA 3GT7A 4MQFB 4D6XA 1DZ3A 5CNMA 5PNTA 1M5TA 2ID7A 3SM9A 4RZSA 3C6QA 5FBHA 3DGFC 4LRQA 3I5AA 3GL9A 4F06A 3GYBA 1AB6A 4TN5A 5IEJA 5KC8A 2PUDA 4F11A 3JPYA 4YLEA 4JB0A 2FQWA 5TQJA 3JVDA 1GUDA 5EWJB 4YRZA 1ZVVA 2A9PA 4KQ9A 4MS1A 4N0PA 5DKFA 5JNTA 2FVYA 3CTPA 2YHBA 3KCNA 2TMYA 1ABFA 4ETMA 1NXXA 3W9SA 3C3MA 4W5RA 5TPWB 1B00A 1LBHA 2FQYA 5EWLA 2M1ZA 5DLEA 5D2CA 1PEYA 3EQ2A 3H1FA 3HXMA 3SNKA 3H5IA 3I45A 3OMWA 2JBAB 3CKMA 3GBPA 4N0QA 2MYPA 1WETA 3HCWA 4MAAA 2RJNA 1RPJA 1NATA 3IP7A 4H3KB 3ILHA 3JTEA 2PUCA 3RVRA 4Q7EA 2WWVD 3ROTA 2BGGA 5JS1A 4Z4GA 4MLCA 3MYYA 5T3YA 3BBLA 4KREA 1D1QA 3RVQA 1LJLA 3RQIA 2WRZA 3GA5A 4RWEA 2MYTA 4CBVA 3O1JC 1SRRA 3CU5A 3Q9SA 4M88A 2QVCA 3Q7RA 1QQBA 1QP0A 2HJ9A 3EULA 5KQPA 4RY8A 2P4UA 1EWVA 4G0QA 4JOQA 3OLZA 1FFGA 3RVOA 4TLLB 3KHTA 1I3CA 4Z9AA 3N0WA 1KRXA 3HO1A 4Z4IA 3LUDA 3QEMA 1XHEA 5EWMB 4JB2A 4P1ZA 1W25A 2F8SA 2XDYA 3Q41A 1TVMA 4MR8A 2QZJA 3IP9A 1JH9A 3OLXA 1JL3A 4KQCA 3O74A 4P98A 3BRSA 3NNNA 2QXYA 1EWTA 1Z17A 2CWDA 4MR9B 4EYKA 1CEYA 5IEBA 4HNSA 4KFCA 4WXEA 1JX6A 4N03A 4QICA 1BDHA 2WB4A 4E7PA 3URMA 4KMRA 5JNSA 1DBQA 1ZDMA 4Z9BA 1NXPA 4D6YA 4GNRA 3N8IA 1E6LA 4IILA 3UUGA 4IRXA 2E4VA 1KMIY 1RXEA 3CG4A 5GOTA 2IPNA 3KLNA 3MQ4A 4MS4B 3MA0A 1HEYA 5IUKC 3T38A 5FWYB 2QVGA 1DBWA 4D74A 4NICA 4Q6WA 3E3MA 4TLMB 3A10A 1DCFA 2LIVA 1D2AA 2LBPA 4G97A 1DG9A 5IUNC 3LUAA 4JA2A 4NCAA 4RK7A 1PNTA 2JK1A 3SG0A 2CD7A 4YR7A 1APBA 3D8UA 2QU7A 4GPAA 4G0YA 2MYUA 5KWSA 3HUUA 1D5WA 3KYIB 4MR7B 3H5LA 2FN9A 3C97A 4YO7A 1UDRA 2B4AA 1C0EA 4MS3A 2ID9A 1XWWA 3O2SB 4B09A 1USKA 2E4XA 2L18A 3H6GA 3IPAA 4G86A 3OQMA 4DQDA 3HVRA 4F3TA 1CYEA 2QV0A 2IPLA 6ABPA 5CHYA 4OLBA 3KG2A 4UHJA 4XAQA 2E4YA 3O2JA 2IOYA 2VK2A 3QLVA 4Q6BA 4RXUA 4W5TA 1EHCA 1Z25A 2FMFA 4LX8A 1YK1A 3DLBA 2WY2D 3QELB 3N0RA 5C5EA 4DN6A 3MM4A 3OMXA 4KNYA 3OLYA 1Z2DA 2FW0A 1ISSA 1F4VA 4QPJC 2PJUA 4XARA 4HNRA 2MYNA 1P6UA 3NBMA 2X7XA 4PYRA 1ISRA 1U2QA 3LUHA 4O1HA 1NTRA 5HM6A 5T7BA 1Z15A 1JDPA 2RGYA 3H6HA 2VUIB 1RZRA 3FDFA 4PE5B 5TPWA 4YCSA 2FLKA 3FFTA 4FB4A 1ZY2A 3FFWA 1DCMA 4WUTA 3I42A 4DADA 5KQLA 5JNVA 1PNRA 2J48A 4WZZA 5HSGA 4KV7A 4MGEA 3A0RB 3OQNA 3OQOA 3SAJA 1XHFA 3RVSA 1ZN2A 4G0OA 1TLFA 2R4QA 4MQEA 5E3JA 1F51E 4G0XA 2PUBA 1RXIA 3H5VA 3HEBA 4G0PA 4S05A 1E6KA 2MSKA 5TQ2B 2E4UA 5KQMA 3DLHA 2WJAA 2FMHA 4RV5A 5I4CA 3H1GA 3NHMA 1QO0A 4FE4A 1ZH4A 3E61A 3K9CA 3M6MD 3N53A 2I6FA 5FWXB 2AYXA 4RK5A 5FBKA 3Q7TA 1Z13A 4FE7A 4PICA 3A0UA 4PZ0A 4OG2A 3H75A 4JAVC 4ZPJA 1H9CA 1BVHA 1DRKA 5IBQA 5EWMA 3EODA 3SY8A 4E7OA 4YS6A 1ZGGA 1JWLA 2GX6A 3L6UA 4Z4EA 1P8AA 4WXMA 1SD5A 2L2QA 2AYZA 2HPHA 3OM1A 3G1WA 3O1IC 2HSGA 5TQ2A 8ABPA 2QR3A 2IDMA 3MIZA 1JFSA 1MB0A 3QX8A 1MIHA 1ZITA 1ABEA 4XXHA 1RNLA 1DCKA 4OTZA 1D4ZA 2FMKA 5TQ0B 3HM9A 2H0AA 3M9WA 1PEAA 2FEKA 2HQBA 1LBIA 3BILA 1JDNA 1M5UA 4JASB 4WWHA 4F12A 3KLOA 2PUEA 1USIA 2CHFA 3QELA 1ZGZA 3LMKA 5IULC 4YP9A 1KGSA 3TB6A 1GUBA 1VPWA 1JHZA 2N9UA 3ILYA 1BDIA 2WJWA 1FFWA 2HQOA 2GKGA 4RSMA 4ZYLA 2FLWA 3C3WA 1RZRD 3VNBA 4EVRA 4RK0A 3N6VA 4ML3A 1YVUA 2PUFA 1VRVA 1YS7A 1PHRA 3S99A 4W5OA 4Z4HA 1SXHA 1OXKB 1ZH2A 2JVKA 4MR7A 4KVFA 3MMNA 3JS5A 1NXWA 5JNUA 3N0XA 3Q15C 3P9YA 1NXSA 5EWLB 3FGZA 3OLVA 5B3JC 4O1IA 4H60A 3OO1A 3TO5A 1M2EA 4IF4A 1DJMA 4TMYA 1BDJA 1BA2A 3RVJA 5ABPA 2R48A 3LUKA 3OM0A 4RK4A 3BRQA 4YWHA 4NQRA 3H1EA 3O2QB 2PL9A 4Y9TA 2JRLA 1A0OA 2B1JA 2FKAA 3R0JA 4EYQA 5TPZA 3T95A 3JY6A 1Z16A 4MRMB 4KPYA 1E2BA 4RKQA 1YS6A 4Z4CA 3DBIA 3F73A 1EAYA 1IIBA 5JS2A 4UHKA 3T6KA 2ZAYA 3KTOA 4N47A 2GI4A 3QK7A 2PE5A 1ZAYA 2RDMA 4ZMSA 3O75A 3VNAA 2F8TA 1FQWA 4ETNA 1GCGA 5KQGA 2NUBA 1LK0A 2PKXA 3HK2A 3ROFA 1TM2A 2JVJA 2Q5CA 3N75A 4KZKA 2NZUG 4LE2A 4NV3A 4F8JA 5TE9A 3JVIA 2IPAB 5KI6A 3UK0A 3HDGA 2LPMA 2OQRA 6CHYA 3RH0A 2P9HA 4LZLA 2PUAA 1Y1LA 3EQZA 2IKSA
chains in the Genus database with same CATH superfamily
4RZ2A 1GFZA 2PKEA 1FUKA 1ZXXA 1R3DA 3FJYA 1ZWKA 4L4YA 4MV5A 4ZCSA 3F71A 1GRNA 2BV3A 1RCTE 1Z35A 2GFQA 4KLZA 4M21A 4QVKA 1I2AA 3WQBA 4BVAA 5JYCA 5F9HA 2BKXA 1LDGA 4AZ3A 3FFBA 3DE7X 4Q82A 2I7DA 2D1SA 4AP6A 2DX7A 2I7XA 3HEMA 1V1MA 3HPRA 3LI2A 3NAMA 2V59A 4LIPD 4EYOA 1P1BA 2VPYA 4IIFA 4YJFA 1XFAA 4LFBB 3GP8A 5FPTA 5DJ5A 1UC8A 4LSMA 2JLZA 2W00A 5GIPE 2CVFA 2QLTA 2V74B 3ADOA 3I8XA 1NNLA 1MC4A 3UKDA 4WZAE 5KNLA 2GCOA 2IYOA 3P71T 1XMOB 4XUGB 2IH4A 3C6KA 2CEAA 1U9IC 3THXB 2YHSA 1NBIA 4FYMA 2GCIA 3IUPA 2QW1A 3F7NA 4J6EA 5GTDA 4R51A 5JARA 1M8JA 1URPA 2HGZA 2O0JA 2PL1A 4OQDA 5AW9A 1GAQA 4G1VA 3TFQA 3WO1A 2HB6A 1KWGA 4OI4A 1JEQA 3HA5A 2ZE5A 4F46A 5A4AA 1BWPA 1DWPA 4YRTA 3V4SA 2FSGA 1UKVY 1NM5A 4QUJA 1UMCA 4OX9Y 1DT5A 1H0HA 3H2IA 3Q0IA 2H8KA 3T5MA 3UUEA 4FOPA 4GDMA 8MHTA 5DCLA 4BBZA 3H1BA 1Y9EA 3DE3X 3ILSA 3UB3A 3BEDA 1U04A 4H16A 4F4FA 1PL8A 1M2FA 2Q2VA 3EY9A 3GV0A 3ODPA 2XWJI 1D2MA 3U3KA 4QOEA 5BOVA 4ZVLA 3IV9A 3NOQA 5K0CA 2NV6A 5ARDA 1VBNA 2BJWA 3LCCA 3JYPA 1ENPA 3OU6A 1ORIA 4L4XA 4F04A 1D0VA 4P0QB 1S8AA 1ZEMA 4J4BA 2EQAA 2IIQA 3IA7A 4EA6A 3P2OA 1GRCA 2BHRA 4CNBA 5I7SA 4ANFA 4G0UA 2BFCA 5JEEA 3WLLA 1PWYE 2WB2A 5ECDA 3MJSA 1E3JA 1Y3FE 5K0GA 4JB3A 2Z30A 2P4QA 1XK7A 4HWSA 1HT1E 3MCZA 4JNKA 3VNRA 1GKKA 3GGOA 2J3JA 1XN1A 4I9UA 4M7OA 5JC1A 1SOAA 2GVZC 3TEJA 1UZNA 3E9CA 3SR0A 1UAGA 4M9CA 3K9BA 1TUEA 1YJQA 4RW0A 5I7WA 1RI3A 3ZDYB 5GQSA 1M2VA 3VPSA 4HGNA 2HQRA 4X6UA 1EE1A 4LMRA 2I87A 5C8YA 2BVNA 4BGVA 1BHQ1 4DA4A 5IN4A 2G63A 3CSUA 3ACDA 3OWHA 4RL6A 1J8QA 1KI4A 1RKUA 1U3FA 1GVNB 3DVRX 4WJZA 4E88A 5BR7A 3OM8A 2V7QD 1SVLA 3GUHA 3HXPA 2A14A 3MTAA 1RLUA 2OD7A 2HOQA 2VSYA 3LLVA 3JQAD 5FA8A 3U80A 1OASA 3MWEA 4EGSA 4MYDA 4PQEA 4D97A 2QDXA 1JFFA 2YY6A 1O03A 3P96A 4RA6A 2WZQA 1MEOA 1XJCA 4HD8A 5DSTA 4KQ2A 3BK1A 4EZBA 4W6QA 3UANA 1CUAA 1M1ZA 1MVLA 3FM9A 5AP9A 3TDNA 2GXQA 2Q07A 4RVCA 3ER6A 2AA3A 4M87A 1HYBA 2HNBA 4I3GA 3OJOA 4QBIA 1JHVA 3GN2A 3WI7A 1L1EA 1VSQA 2TMGA 3RFUA 1E2IA 3TUJC 2BFFA 1U0GA 2B2NA 4G23A 4RIEA 1N2IA 1TRKA 2D1QA 2OYRA 4BBAA 3RAEC 1TKCA 2QM8A 1EGQA 3VHXB 2G5CA 1V5IA 2ZPTX 2ZRIA 4J75A 8LDHA 3KWFA 4AKSA 1QH8A 1ULAA 5JH7B 1HL7A 2OK7A 3FNEA 1R5OA 3KXLA 4K6MA 3IRUA 4GKKB 4BKUA 3QRWA 4RBNA 3W5JA 2V9PA 3P32A 3PEVA 4NY1A 3DFKA 3DFUA 1OWOA 4JT9A 2VJOA 4AD8A 2A9FA 2W98A 3IR6A 2WP8J 2Q4EA 4L8VA 2XGOA 5AW2A 4L16A 3FRIA 4FPXA 3TLJA 4LFAB 1OZAA 2XX3A 4RE5A 3EGXB 2XCSB 3TZ6A 3FOZA 1AVTA 1ESMA 2IXAA 2J6HA 1CRQA 2LGJA 3NAGA 5AI6A 3R7LA 2D8AA 2L17A 1K3FA 2OCXA 4S1NA 1QK5A 3NDRA 3NB0A 2FZCA 4II3A 4Q37A 2X0DA 3LLCA 1ZUNB 1HQYE 5ICMA 4WSOA 4Y1EA 2BF4A 2YW2A 1N4DA 5JZMA 4Z54A 1TKBA 2XVZA 4FYJA 1UBUS 3ZDEA 1B3RA 2AF4C 3IUEA 3O1LA 4HVCA 3AF2A 3IQIX 2ARKA 1GPWB 2AFIE 3IUQA 4G9BA 3RSGA 2XUIA 3GNQA 4J91A 1ZM9A 1JU4A 1YQ9A 2FFJA 2ZFUA 4LJ5A 3STVA 4ZOLF 5LMZA 3IVMA 2XD9A 4AQDA 3DOEA 1TJ5A 3FKJA 5DWDA 2F67A 4QDKA 4TRNA 5CNMA 1NW9B 4MIOA 2AOUA 3EPJA 5HILA 3DV0A 5EL0A 2EJBA 3B7WA 3A05A 1PJTA 2IS4A 4QPNA 1NOKA 5E3HA 2IEBA 2QN9A 2YW9A 5B53A 4QXRA 1E4OA 5JANA 2J7KA 5CDGA 5JAMA 3ADKA 3FYTA 2Y4NA 4G25A 1V96A 5EWJB 1UKYA 4YRZA 4HCJA 1UEIA 4RAQA 521PA 3KZMA 1Z4KA 2YHBA 2VWQA 1OV6A 1ABFA 4HXFB 3TQIA 5C18A 4EQZA 4RS4A 2CLLB 2QSZA 3LGSA 3R40A 2FQYA 2PGIA 3GT0A 1K89A 1GO2A 3ORHA 2QRQA 1FFEA 4HDRA 5BN3A 4IMRA 2R2AA 5BMOA 1PT7A 4XYEA 4PZUA 1K0UA 3IIJA 3OMWA 3ZDQA 3ZW9A 5E2AA 4EL0A 4KIFA 4C29A 2OESA 3U48A 3LBFA 1COWA 4KDRA 4HEA6 3WRWA 2R9VA 3IRVA 4IEEA 5FTWA 3U13A 2B9VA 5LQNA 3D8RA 3BDIA 4OV6B 2I54A 2ODAA 4WZBB 1IY1A 3FD8A 4FZJA 3RM3A 3FROA 2QZ4A 4HUTA 1T9AA 1NX9A 1Y48E 1T6XA 3CVOA 3G5UA 3DQQA 1AKNA 1J00A 2OHOA 2PPLA 4OLJA 3TLZA 1RI2A 4MVJH 3LNTA 3GD7A 4OLFA 2ENWA 1GG2A 4R1UA 3FSGA 2WI8A 3LV8A 3CH6A 1J6UA 4G01B 4PN7A 1VMDA 2IZZA 1WMSA 1XR3A 2NNWB 3OZBA 1FFGA 5FWNA 1E8MA 2BGTA 2VPQA 2ZE8A 4JN6B 3HDJA 5EJGA 5A5VA 3TI7A 4MWTA 2D54A 5KTKA 1ZHFA 2QX8A 3LOQA 4CQLB 2JI7A 1EJBA 3ROEA 4PYOA 3V8BA 5JQGB 4FNOA 3V3KA 1SU6A 4KX3A 1GU0A 2OC9A 5DNVA 1FDRA 3ZNOA 5JUWA 1T6ZA 3HKCB 5D7NA 3BWXA 2BGJA 2DJ5A 4CKZA 3PPWA 2G5GX 4YJDA 1CRWG 4OSPA 5B6JA 1LWNA 2WICA 3ZI7A 2IHTA 1LPAB 4PLVA 2C3OA 4MUAA 1TU0A 2JEZA 4ENQA 2WF6A 1K08A 3WLNA 3EF3A 4M8NE 4QYSA 5D1HA 4LZZA 3UHPA 2CLOB 2H4YA 3EZ2A 4IF6A 1ORRA 4JQYA 4QTTB 4C89A 5KHOC 4CG3A 5JAHA 4ZMBA 1IN1A 5ALHA 1DAOA 3W5HA 5EOVA 2R62A 1ECPA 4J4TA 2J67A 5DO9A 1VIVA 2CLCX 4HYQA 3T38A 4E0BA 5GZ3A 3PRHA 1D6NA 4QHTA 4TV8A 4Q6WA 3WHPA 3SOZA 3UNXA 1NURA 1JEOA 2A3NA 2F55A 5FUWA 2KHZA 5CB4A 3SJZA 2QZZA 1E6WA 1NSFA 4KO1S 2DCUA 1U8EA 2PWBA 5H3LA 3ZZMA 3VR2D 3KSBC 1ZI9A 1GDHA 3PNSA 4NBVA 4KTTE 1IZ0A 4K6FA 2RGBA 4G0YA 2UV8A 3L4JA 1MJHA 1EZ1A 3QYAA 1JUDA 2Q3JA 4RWZA 3TGWA 4YRGA 5I51A 1OPXA 1TJNA 4GU5A 3LQKA 4I2NA 2F3UA 1KOGA 2WUGA 2ZIZA 3UWSA 5BSTA 2GTHA 3OZDA 4YJFB 4YRIA 2UXCB 3IPAA 4L76A 1DXQA 2Z3WA 3EEQA 3N5CA 3IKTA 5AW3A 3HWRA 3JRXA 1KP3A 2QT9A 1L3IA 1MO2A 2WDPA 5J2TA 1IU9A 1ATIA 2H92A 1J2TA 5ECGC 2GN2A 3ZD7A 1K98A 1G9TA 4EX7A 1VG1A 4UTOA 4X0EA 1TEXA 1Z2DA 2O4UX 1UCFA 1QCZA 3CM0A 3A3NA 4MUKA 4UCQA 5K45A 2XAUA 1XAIA 3ZJ5A 4LWOA 2WT4A 2BFWA 3JQ6A 1CFZA 4GGPA 4HNRA 4KQEA 1YC2A 5IFKA 4H7PA 4C5AA 2X7XA 3ECSA 4MP3A 3A1DA 3PE4A 3H99A 1MTOA 3GT3A 3UJAA 4F92B 1D07A 1JXOA 4XWWA 1H1TA 1OFGA 2CL6X 3A1NA 3DD5A 3O4GA 3IEVA 2QRLA 2I2DA 5C0OE 3BXOA 3PQ4A 3R0ZA 4ZTBA 4P2GA 3T7TA 3VDMA 2OBYA 4Z1MD 1IMOA 1CU1A 4N7JA 2CFIA 2GK4A 2QTFA 1KEKA 1RZRA 4EM6A 1W2WB 1L1QA 1Z37A 1EGAA 2J31A 2XE4A 3BQ9A 3M6WA 3TIVA 3UO8B 4AG6A 4NOKA 1UINA 2CMFA 4MJ3A 1G8GA 4NEHB 1JHOA 5EY5B 4MQ4A 2QN3A 2BGRA 5CH5A 3L0IB 4D25A 3DLAA 1XZ8A 5HIMA 1O77A 4IIJF 2ZYHA 4YLGA 4F8EA 1N5RA 3GWZA 4EECA 2YWEA 1N8TA 4E21A 2ENUA 3RT1A 1QM5A 2P68A 1WABA 3R7BA 4B9AA 3D59A 1QIFA 4CIVA 3G89A 1KO8A 3L7JA 5H7XA 3B1VA 4ZHQA 3SZMA 4XGKA 1QRUA 2AD5A 4ZQHA 1E6KA 3W3AD 2C8VA 2E4UA 2GEUA 3SBOA 1U11A 4F7DA 2VJPA 4DV2B 2VUSA 5I4CA 1LGYA 3TNJA 1Y33E 2OKGA 2QAIA 4FE4A 1P0IA 4YPFA 4W82A 4X90A 3OSZA 4IQ0A 1A5BB 2Q5FA 3A7DA 4RK5A 3U1TA 4JR1A 3PHGA 4QT0A 3VPCA 4QDTA 1EFPB 4OIFA 1R64A 4FSHA 1F8XA 2VHTA 2XQGA 3JZIA 1RTTA 1VPEA 2GF2A 5ARCA 4MUEA 2OA0A 1IDOA 2AEJA 3RVDA 3WIUA 4G1EB 4E7OA 1DFGA 1K7CA 3L6UA 4NYMQ 4S1VA 2H2IA 3DOFA 3QPUA 4ZU1X 4HJXA 5DT2A 3WDSA 3ND6A 4JLDA 4FYYA 3WB0A 2GN4A 5IK2A 2P8SA 3ZV3A 1AJEA 3BWVA 1K92A 2CZGA 1HQKA 4XIGS 1R3UA 4Q02A 2I2XB 4XXHA 2Q4TA 1CCWA 5MFZA 3WK9A 1MBZA 4JJ6A 3WBBA 3NTUA 5CG1A 1N0UA 5K2MA 2DSNA 3RSOA 4B85A 1O4WA 4FHFA 5CT6A 1JZQA 5BYKA 5JJIA 1USIA 1VA5A 2R79A 3GY0A 3LFHA 3C5VA 5KOIA 5LMNB 3IE2A 1GUBA 1EK5A 4AL4A 3VHXA 2X8JA 4OKNA 5IT4A 2KLBA 1FFWA 1IEQA 4QYXA 4V03A 4FR2A 5B37A 1F3OA 1M8KA 3SZUA 2IQIA 3VNBA 4C01A 3VU1A 5AHOA 1MO6A 4QOSA 1GNRA 5C8DA 5K6RA 1WXXA 4RF3A 3BXGA 1LPNA 4QATA 4LX0A 4C3UA 4F96A 1B23P 1J22A 4CDNA 5JNUA 2ODNA 3B6KA 4Y6GB 1YJCA 3QU5A 3Q85A 3OE5A 1IZ9A 2YNMC 5HF8A 1DKMA 3H9JA 2HV9A 3NHPA 1DV1A 2H2WA 1A9XB 3DOJA 1NUPA 3CW9A 1SNYA 3BYZA 3DEHA 3NH6A 3RYIB 4FDTA 4A16A 2G7ZA 2Q1XA 3T7AA 4QASA 2DECA 3B8EA 3NUQA 2AZXA 1MJGM 4DV4B 2EZ9A 4UZSA 2M6SA 3HLKA 2UZIR 4COKA 1OIWA 2D1FA 1WSDA 1L7XA 3CW2A 4PG5A 1B1AA 4WW0A 3RKSA 5ITWA 1E6CA 3ZX4A 3OOWA 4M9UA 1NULA 2SBTA 4A73A 2R4UA 4D3YA 1EUYA 2QA5A 1IXZA 4Q1FA 1QRDA 4FMDB 2I2FA 2NO6A 2NN3C 1Q3KA 1ZS9A 7REQB 3CNOA 1N0WA 4QWMA 4EHFA 5JPCA 5JS2A 1LDNA 1N6LA 3BWCA 2IXBA 2OAGA 4UHKA 4ZAFA 1UDAA 2OBFA 2IW1A 2XKJE 1A9OA 2QN7A 5KTSA 1E20A 1E2EA 2IE0A 2JASA 3KOYA 4XB1A 1FEZA 3A25A 4QVGA 1V4NA 5D00A 4CR7A 3S2SA 3DCNA 4EKNB 2V54A 3PIDA 1UOPA 4CM4A 3KL2A 3C15C 1NVXQ 4WIAA 4L07A 1V8BA 1T29A 3V7FA 5J9FA 4JSYA 5SZJA 5CVDA 2NUBA 3NBKA 4GGOA 4IW3B 5C5IA 5C8VA 4MRNA 3H97A 1COWD 2O2SA 3CUVA 2FXVA 3EH2A 4YRPA 4ZO9A 5L95A 1CIPA 1DFIA 4FGZA 3K92A 2QX9A 1GPUA 4N5NA 5JDIC 2RGRA 4HP8A 5EXTA 3TH5A 1MZPA 4A0RA 4FFOA 4CUJA 1Z62A 3E9NA 5D3MB 4KK3A 4CDRA 5KX5F 2CVZA 2C1EA 2EGUA 2MSNA 3CVJA 3OCUA 3LVFO 2GHTA 3TZHA 3VTKA 3TYXA 4QYWA 2OE2A 1XEWX 4RH1A 3F4KA 4E6EA 3PZBA 3FAKA 4EATA 4TXMA 1T8WA 2XNKA 2EL9A 1QGYA 3DDCA 1QOPB 4HUQB 4HNQA 4HXGA 3ZDXB 2R87A 4YMWA 1IVYA 3VI4B 5AVVA 3AZPA 3ZW8A 4I0WB 1GU7A 3F5SA 1YQEA 1IBRA 4U6QA 3ZE8A 4LKOA 1S8NA 2XUJA 3WL7A 4YCBA 2A9KA 2DQ4A 3UENA 4DJJA 4BV9A 1ZIYA 1MG0A 4BVBA 1I51A 2OENG 4RSHA 2AMFA 1VQ1A 4TT3D 4CTNA 4A6DA 1XMVA 2VBIA 2FN8A 2GJKA 3IA2A 3PIIA 1KR2A 4MX8A 4KUHA 4RORA 2AG8A 3IVRA 2HCFA 4H0FA 4WTOA 3ZCXA 5HKOA 2HIGA 2XNHA 1Q14A 2GHQA 3BCHA 4O4LF 4ZZ1A 3JV7A 4RTJA 3KDAA 4DJTA 5BRJA 4XM0A 4Q01A 3MF4A 3BH7A 1GGFA 3M89A 1D9ZA 4P6VF 4YA6A 5EUBA 2O19A 1AKVA 1LB1B 1KFJB 3DE4X 4PYJA 4D7AA 1AQJA 1M2OB 5KQRA 2RHRA 4JJZA 1CRZA 1HKHA 3DR5A 3PQDA 3VX3A 4E2ZA 2EFHB 3D2BA 1AIPA 4YV2A 5JZSA 4E33A 4RVSA 4JCOA 1OXBB 1DX6A 4XFKA 2X7JA 3QJYA 4L5AA 1JFLA 1I13A 3TQTA 1JR4A 1E69A 2OVBA 2AR7A 5K0LA 4KHPB 2HA2A 2ZQYA 4LHZA 5D86A 1D8AA 1G5RA 1MB2A 3MRXA 1C9NA 2H7CA 3AC0A 2WLTA 3K0FA 4Y9SA 2NU9B 3PC4A 4GZLA 3TGPA 2XQFA 1Y4UA 3RREA 1U2RA 3F6PA 5J2UB 4N9QA 1QNFA 1U1FA 1QV6A 3PFCA 4NEQA 1H3NA 1TEHA 5FLEX 2R1TB 2ZIAA 4BMVA 2WIGA 1N5KA 1N0VC 3QH4A 3LK6A 2FNAA 4OQMA 3HZHA 3I64A 4Q3NA 4WOPA 5H02A 2VUUA 1NVWQ 4DDUA 3QEAZ 3LBYA 5CT4A 1M33A 3QWBA 4QTXA 1BHJA 4A0GA 4MARA 4WKPA 5A2GA 3Q2KA 2WSIA 1I5RA 2Z4RA 4GOOD 3R3HA 1Q57A 4W8HA 3ZY2A 1ZVKA 3CLVA 3IALA 3JQRA 4CKBA 5D7BA 3M6UA 4Y0NA 1RRMA 4NS1A 4U0JA 4PTZA 5BSWA 5J2TB 1SIUA 5IDQA 2L42A 3ONEA 4K6HA 2GQ0A 4M89A 4OUDA 5SYNA 5JQGA 3L4BA 2RHTA 4NS4A 3BEOA 4NZNA 4RY9A 2W42A 4CV1A 2R6R1 4L5YA 1NE2A 3E22A 5E9JA 1Z45A 5EZYF 1LZLA 4DVJA 1JIKA 2KB0A 2XXBA 3SIXA 4YBRA 5T64A 4C20A 3V8NA 3JR3A 1S3IA 3FJOA 1NTOA 4S1TA 1ZNXA 4KDEA 1NNEA 5TMEA 2OQIA 2ZROA 5BN5A 4C22A 1UAYA 1GGKA 1ZQ1A 2V9ZA 3OP1A 4PG7A 1ZCFA 3FTFA 3CMCO 4E2XA 3CN9A 1YH3A 3LCJA 1I1HA 1CEQA 2NYUA 1BQEA 3JVVA 1DIRA 1J56A 2NM0A 2PGOA 2Y0CA 1C9MA 1WNTA 2Z9BA 3L7KA 2PX3A 3R3VA 4ZV7A 4HAZA 4L85A 4EB8A 1P0FA 3EXFB 1OTHA 3H1TA 4XM1A 3EZXA 3WYCA 3DBLA 1PS0A 1TQ8A 1YACA 2IEIA 1TCAA 3ORQA 5A4KA 2JGNA 2YMMA 3IKJA 4DIEA 1SA0B 3I9FA 3KSDO 1VLZA 2VNHA 1Y9JA 3DVQX 3IAFA 3PQ2A 1KPGA 1EP3B 4Z6KA 5FL7A 1SHUX 2O2JA 1NW3A 2XHZA 2BEUA 4CE6A 2AR9A 3GVCA 1W9HA 1KK3A 2O2EA 4JLJA 2L82A 4YJ2B 3RC7A 4YYZA 1T4CA 4PY2A 4B3CA 1TB4A 4HDRB 4MKXA 4LV6A 4KXFB 3K0AB 4QDXA 4KWIA 1I4LD 2Y05A 4BMSA 5I48A 2PD4A 3KXPA 5C2JB 3BFJA 1NI4A 3EDCA 2JKYA 4BX0A 5CFQA 1P1FA 3CWCA 2XCTB 2APJA 4MJ7A 5DM1A 5F73A 3SFVA 4ENUA 2KWIA 5F2OA 5IJAA 3PLAE 1BE1A 1DAPA 1Z2NX 1CDOA 3OF3A 1P3Y1 4HJRA 4WNYA 4DREA 2VAPA 1ZOPA 5C4IA 2POQX 4F5EA 1U4OA 3AB3A 1M83A 1YRAA 2Q5JA 4M0DA 1OFHA 1CNMA 4Q12A 1YQQA 1JRLA 3DOIA 4JHXA 1M5TA 1U2TA 2XQVA 4HLNA 2I6SA 4KSYA 4ZAGA 3VOTA 5LKAA 1V5EA 3ZWVA 2W6IA 1POWA 1ZU4A 1VCMA 5KHAA 2NUAB 4LJ8A 4F21A 1P2BA 4XEHA 2OSVA 3EG9B 5IT0A 2XTAA 3AJ8A 2JIZA 4YLEA 1TD1A 1AQNA 2FQWA 2HMYB 1SBCA 2BAGA 4LBWA 4HWPA 1XKXA 1YCDA 3KCNA 2TMYA 4WZBA 5AO9A 1UFKA 3NWBA 1NXXA 1WTAA 4R69A 1MDFA 1HDEA 5JLAA 2VTBB 3L1HA 3ILVA 3NHRA 4OEHA 1KJWA 3THWA 3QBVA 3L0SA 4N82A 3F6SA 1Q7GA 2C94A 4PBTA 2CGEA 4XVUA 2QR2A 3F5DA 3EIOA 3EVFA 3A14A 4JP5A 1B6GA 3Q7QA 2JFPA 4JBHA 5B7NA 2E18A 5LDGA 3OCYA 4EDFA 5C81A 3WIDA 1QU3A 4BKRA 4Y2HA 1IRXA 1MJFA 2XVYA 3BF7A 4YAOA 4YJHB 1R5NA 4ZQGA 1P0CA 3GDHA 1DG1G 3EISA 2CLEB 2JJ2A 4JYCA 5HX7A 4JXXA 1L1FA 2Q3EA 2J0UA 1C3JA 4LY3A 1VJ1A 3NDJA 1WW2A 4MYHA 1T3SA 2ONZA 3JYLA 3INNA 4LZAA 1D1QA 3IDAA 1DAGA 5CLLA 1Q1QA 1HNZB 4I6EA 1R00A 2MYTA 1W36C 4RFSA 2GDZA 2VLIA 1IBMB 1R9MA 5TJ9A 1IIRA 4M88A 2P4EA 2IZ7A 3J80A 1N8SA 1U0FA 4LF8B 5DFAA 3V7UA 3EGEA 2BW0A 3IH5A 1BTOA 4KDFA 5KYGA 2VF2A 2WF9A 3BN3A 3H84A 3H2BA 4KQKA 4XWTA 3T1QA 4DCVA 2UXBB 1UIRA 1HUQA 1ZCZA 4K9DA 4B3DA 2VP4A 4YAUA 1U90A 2VDWB 3K0HA 3M6XA 1FVOA 4TXLA 1CEEA 3SHVA 1P1HA 2YIVX 2ZIEA 4JQSA 3RTDA 1YJBA 4K6KA 2XHEA 5DBOA 2PZ8A 4EG3A 1Z47A 3T94A 2RCYA 1YIDA 4H6WA 4MWOA 3PC2A 3BX1A 3WHLA 3THSA 2H1LA 5AKKA 2YXBA 1N6KA 3WK8A 2HMUA 4B6FA 4ZV4A 3GF4A 1CP2A 4DR4B 1ZJYA 3C4JA 1EWTA 4XPIB 5BVHA 3V7NA 3VV3A 2ATEA 2XMRA 1WUHS 3K2EA 1OTYA 4MVXA 2IT1A 4Z9BA 1P4HA 4C0QC 1GA1A 4QOFA 4V3BA 1EG2A 5A3RA 4JKOA 5I47A 4TZ6A 3C87A 1EVKA 1ZISA 4K46A 1QGZA 1Q0TA 4FSDA 1N2JA 4KFRA 4EPWA 4B73A 4ZT4A 4K86A 1YNOA 2JEYA 2Y1KA 3B6JA 2FWNA 3GP3A 3L7MA 2PTHA 3EVAA 3MGCA 4GLJA 4KO4S 4QFCA 4WCFC 3T61A 3TBKA 4GWLA 3UH1A 2IE8A 1J39A 3U26A 4FYHA 1KSFX 4BKMA 3GJ5A 4JA2A 1OWPA 4MGZR 3GAMA 1PNTA 1P5JA 5LZ2A 3RIMA 2PLAA 1KBOA 1Y5NA 2P9TA 5IYZA 4ALMA 3O90A 3HUDA 2XIJA 4R1PA 3WIEA 5KWJA 1QF9A 3E82A 3T1YB 5E9QA 4ZC1A 1I2MA 1WV1A 2AZMA 4MR7B 4TWRA 1ZVQA 1LJ8A 3A1CA 3LS2A 4LYAA 2B4AA 9GPBA 1I2BA 3V4FA 4C21A 4UOZA 4NP6A 2ZXUA 3H9CA 4WZAB 3SYNA 2C7PA 3ESDA 3TTVA 1E7YA 3UHJA 4F6RA 1SA0A 2O7SA 1W76A 3JQAB 3W5SA 3GPIA 2YBDA 1LD3A 3FCOA 4HEQA 1X0VA 3IB3A 1FQOA 2FMFA 2ID8A 3WLRA 3T3MB 3IPLA 3MUNA 2PX5A 4IRMA 1PZHA 2VPTA 3ZU4A 2WYVA 2MSCB 4REMA 1CLEA 2PJUA 4LDQA 2R8OA 1DPFA 4N65A 2Z83A 3HCCA 2PVSA 5HIAA 3I32A 4IDOA 3S27A 2AG5A 4NULA 2YIDA 1KKUA 4X61A 1EBUA 4FOOA 2ODQA 1ISRA 4HN4B 5FBVB 1FXWA 1BRTA 2XQKA 4ISCA 1HM5A 4WOKA 2J9RA 4L5JA 3WV4A 3BGDA 2D0DA 3FOAA 2G25A 1H2YA 5E6RA 1QOZA 4M0FA 4M60A 2O2HA 4WCVA 5EEGA 1Q6YA 1CJCA 2CLDX 1WIWA 4DZZA 3KOOA 2DQYA 1U5CA 3FFWA 3QFFA 5EIWA 1DOZA 2FWBA 1KEPA 2PH3A 3EXHA 5LA6F 3N2EA 3KTAB 3PWZA 3BC1A 1ZHOA 1CY7A 1HDOA 1T0UA 1LX7A 3TQCA 1G3MA 2PKCA 3MFQA 2FPLA 3FVRA 2OZLB 1G66A 3VR6D 3GU3A 3PTLA 1YZKA 2FOXA 1SK9A 5CGZA 4JI0B 1EDOA 2H0RA 5B5SA 2E1PA 4MUMA 1PV2A 3VISA 4C14A 5K3EA 4K0KB 4PNPA 3GFBA 1EB8A 1YCHA 2AE2A 2R65A 3A4TA 3S70A 4EX6A 2JH8A 2YNMA 1AHHA 5JYDA 1CRPA 4K05A 4U4AA 1ULZA 2XB6A 4O3FA 4UZEA 3UK6A 3WGMA 5TGDA 5AM3A 4EUNA 4IDNA 4FFNA 1Z13A 4ZT2A 2ZRAA 3QVGB 3TVDA 1RYHA 4R7TA 1EBBA 4D99A 4DDKA 3R09A 1JJIA 4PR3A 2PRZA 2H2DA 3E6AA 3FNGA 1Z82A 2A1UB 4W5JA 4AY2A 4L6IA 2W8ZA 3G2LA 5IMSA 1U63A 5G1PA 3QUBA 5H81A 2II6A 1YR8A 5DNAA 2O3JA 3UXYA 4NXNB 3KSAC 3NJ8A 3FDZB 5JLJA 3V6LA 2VF4X 5HIKA 1XRNA 1GKYA 3FNIA 3OM1A 3WYDA 2Z6UA 1WKBA 1H23A 2QR3A 3I12A 4F7WA 1NQVA 5ALZA 1JFSA 2EAUA 3CF2A 2COUA 3C1UA 1Y8RA 1R4ZA 5JXGA 3BMNB 1GL7A 1KETA 2OZLA 4O08A 3JRNA 2BM0A 1O6GA 2B1IA 2FEKA 2PKQP 2YVAA 3EA5A 3FLAA 3IAEA 4JR0A 4P7FA 4JLNA 1BS2A 3OETA 2FFQA 4KV9A 3SSNA 2ODBA 3T7EA 1ZGZA 1Q21A 3LMKA 4CQJA 3W5BA 4YP9A 3WKBA 5ESWA 4JL6A 1S2LA 3AF0A 2OYSA 4ZQIA 5ALEA 3C3WA 3ZCUA 1SPBS 2ZBFA 1YV9A 4I9FA 2IH5A 1YR3A 4EVRA 4OKSA 3A2LA 4RK0A 4G4JA 4AWXA 2VDOB 1EVEA 1YVUA 2HMAA 2P27A 3HDHA 2EJVA 3KM0A 4P83A 5H4HA 5I4KA 5JZVA 5LJIA 4FOSA 1B4DA 4L22A 1X7ZA 3U09A 3NHYA 1OI4A 3AIKA 1RAHA 4DMRA 2WD7A 2HMWA 3LQ1A 4GDFA 4Z9YA 2HMVA 2HLPA 3P9YA 5ENDA 2DERA 3CCFA 2AJ8A 3FI9A 4H60A 4LZNA 4G85A 1ZD1A 3U49A 2VJQA 3ELWA 2MR5A 1SUFA 1TDJA 2AS0A 4H2DA 821PA 1S96A 2WR8A 1PK8A 4B87A 1BDBA 4DXHA 4MV7A 1YASA 3K2IA 2FUNB 2X76A 1PFYA 1J0AA 3OIUA 3E5MA 4Q34A 3VMFA 5KBYA 1NW5A 1N9GB 2NXEA 4DLLA 3KQKA 2KPOA 3L77A 2RGEA 3QKTA 3QBDA 2RBKA 5ALIA 1ND5A 1B6RA 4OK6A 2J30A 1T36A 3LLMA 2B1JA 2EG9A 1OFVA 3CLUC 1TM3E 4G36A 1NA5A 1WCIA 3P26A 3TSAA 4EELA 4RTPA 1L7NA 4RESA 1QE0A 1QFMA 3SBEA 4L7VA 1NC1A 3AETA 1J33A 4FCWA 3C1AA 3G82C 3WXMA 4UM8B 4MKHA 1WMBA 3D81A 2OD2A 1A82A 2PZEA 4FHDA 4ENWA 2BFAA 3MT9A 4KPUA 4NC9A 3SX2A 1CUVA 2QNBA 3K8OE 4F71A 4DB2A 1XRSB 1TO6A 1SCBA 2VAXA 2OHHA 2JGDA 3AUJB 1T5LA 2FB9A 1IQRA 2R2GA 3RF7A 4AKEA 4ZMSA 3ZTWA 1QFYA 5HIIA 1CR1A 1I8TA 1XLUA 3ACBA 3D4IA 3K6KA 5J5CA 3VHQA 4MW2A 5CCEA 2HRZA 2PMBA 4LXUA 3WMRA 3FCEA 1RLOA 1Z73A 1OC4A 1WB4A 4PPYA 4XD7D 3OG9A 1I7QB 3HWSA 3PK0A 4P53A 1PJ8A 2GSWA 3FPCA 4F8JA 2NZXA 4LQCA 3UKOA 3N5KA 2VRCD 1B15A 1DXOA 1W4AA 3K8YA 4N9WA 2IS1A 2DPGA 1VI6A 1KVRA 1K6EA 1Q11A 3FVTA 1FQKA 3DP7A 3INYA 4LZLA 5AK0A 4MKIA 5IVDA 3LU1A 1JE1A 2VBFA 3T3IA 2IKSA 3LWDA 1RHUA 4MKFA 5KYNA 2H1IA 4E3ZA 2C4TA 4P7KA 3JAMA 3UMJA 2O0LA 4JLKA 2IUEA 2WG2A 4I1SA 2OB2A 1KFBB 3K1AA 1GYQA 3EDOA 2KLHA 2B6NA 2W22A 2POCA 3KR1A 4QEKA 1AKMA 1QK3A 4LNAA 4TYMA 3WV5A 4N76A 2O05A 2GASA 1DNPA 2O23A 2VG8A 4HO1X 4PYIA 3KJEA 3L0DA 4MRSA 1MOPA 1YI1A 2HWUA 3C2QA 2OQVA 2QD3A 4ZI3A 3OTWA 1CPYA 5G1OA 4CTJA 1YUMA 1JLKA 1HFEL 3O4VA 4D3DA 4HXYA 2ZR0A 3KQTA 5CBPB 4GIBA 5K0FA 3CEJA 3FSEA 5TY0A 2G4VA 2XMCA 3O7WA 2NT3A 1NVDA 1NIPA 2FY8A 4ZK6A 2QTLA 3VJMA 3EUFA 2QR5A 1OXSC 3JATB 3OUTA 4XASA 3X2SA 1NRIA 2K6GA 1K5HA 3FHCB 3MXOA 4RGVA 1KPIA 1O8BA 5TLSA 3DAHA 2ZJZA 4IXDA 1XNHA 3OTQA 1EVYA 4RS3A 4M86A 2CNWD 2QQFA 2NO7A 4JYPA 2FPWA 2WIKA 3R20A 2NVUB 3CO0S 2BI8A 2YOGA 3G7NA 3IBGA 3HJUA 3IIIA 3JQGA 3KQPA 1L4NA 4KACA 5EXEA 2VXBA 2ZAMA 4BCDA 2X0NA 1IATA 2WIBA 3CY6A 3SSOA 5KOJB 3TE6A 3TD9A 4MQFA 3UK1A 4OGLA 4BWFB 3ZV5A 3V1NA 3RRJA 4BX3A 3WA7A 4KGZA 1LDMA 3M8KA 4I1PA 4PZPA 2IYSA 3TZBA 2WTBA 1MABA 5EJIA 5CJPA 1DADA 4XB6B 3UJPA 5B57C 5EJ9A 3H2HA 1Z8HA 3MBKA 5EFOA 5ELLA 2O7VA 4TS4A 3BHNA 3P8ZA 2JLBA 4D0GA 2DETA 3UC9A 4KRFA 4JV5B 3OZXA 1NOIA 1OILA 1KZ7B 3AZQA 2C7GA 5AKEA 1JEAA 5T8KC 2NUAA 1EEXB 4TZTA 2OFFA 1RKXA 1S3SA 3E0XA 3GLKA 1ODCA 2CLKB 2OHGA 4WT7A 4QO8A 4J90A 1A04A 3X44A 4U2GA 1Z12A 1MTZA 2Y1DA 2BH2A 2EJCA 3EBLA 2GYYA 5F3RA 1L0BA 4L72A 1GZ3A 5IWCA 2HF9A 7ABPA 2BZ0A 2BONA 2COEA 4P81A 2OPHA 1MAUA 2DH5A 3COPA 2ATVA 2IITA 1XQ1A 4L8GA 5AJVB 2G40A 1CF4A 3WFJA 4XLTA 3LUCA 4WBXC 3PQ7A 3A1VA 3SEFA 5IVHA 3EDQA 3K2BA 1T9GR 1QDEA 3QEMB 4FS8A 1J8YF 2QKYA 4IKOA 4B17A 3Q9UA 4RA9B 1JF8A 3ZNNA 1DELA 1ZESA 2QZPA 3FFXA 4NG4A 3U56A 1XQVA 2ASEA 2IUSA 1BCSB 2GWRA 2A1TS 1LPMA 4BNLA 2W2KB 1QS0A 4TKMA 1QRAA 3GBVA 1LC3A 3H05A 3LCVB 3WJ1A 4BEBA 4YCCA 1XPOA 1FP4B 4JIMA 2WW8A 1H4QA 2CXNA 1BJTA 1KY5A 4V0ME 4LY9A 1GRVA 4ZWNA 3C8DA 5GPBA 3MRTA 2ZB4A 5TJHA 3DMTA 3FCSB 4Y6SA 2PA0A 3RYFA 3T3NA 2V7WA 3FUXA 4O8CA 2ZYRA 4UUNA 4E5VA 3LHKA 2NMVA 1GLNA 5DP2A 5JATA 3HJFA 2WUFA 5C7IO 4RIGA 1YU6A 4O5AA 1QVAA 4ZCRA 1QP4A 3QLEA 4YNBA 4LV5B 5HZMA 3IAHA 4YJKA 3KU4A 1E9FA 1P2GA 4ZARA 2OD9A 3WG9A 1HORA 1E3EA 3GUYA 2VZ8A 1GLVA 5JPDA 5EINA 1QUEA 1W75A 2DKFA 3O21A 4ER3A 2Q6OA 2QUIA 2ALJA 3GCGA 3QUAA 1DSSG 3QQ5A 4M55A 1KAOA 4HPWA 4BNWA 2Z5FA 4IEFB 1HEIA 3A1SA 2GEVA 2ADFA 3RS2A 3B6EA 3NAZA 4PYKA 2C0CA 5LP6C 2YWBA 4RFLA 4YLYA 3M1LA 1NR5A 3EWNA 3SSMA 1PFWA 3PPIA 2G9RA 5EN4A 2Z2JA 3BHJA 4AY4A 4DG8A 1PT6A 1NI4B 4YEDA 1BWRA 2F9LA 2IYNA 1J42A 3KTDA 4KLAA 1JQKA 2ZXFA 4AZTA 3IERA 1UUFA 3W4KA 2GZMA 3KKQA 5F1PA 2R47A 1SG0A 3X1JA 4AJLA 1GZ4A 2G71A 3X43A 1QH1A 3GRYA 4HMQA 2Q41A 4A27A 4LDNA 1IPFA 2VRCA 2QE7A 2D0PB 3VH3A 4LRWA 3MWYW 1TT7A 1N5DA 4G5OA 4HWTA 1HYQA 4EJFA 1ZVVA 4AYWA 5HQ3A 4MS1A 3QFHA 1WETA 4KBYA 2VXYA 2AB0A 1WMEA 2DTEA 4Q1BA 4R2JA 2A9JA 3VSBA 3TFOA 2ZUFA 3EVNA 3MS2A 1X0XA 4LPKA 3VOAA 1B00A 5EHQA 5JTTA 3KQHA 2QRVA 4DCSA 1WCXA 3IAS1 3LC2O 5D2CA 5GONF 2JAUA 3MS7A 1F14A 1QANA 4MDHA 1FDSA 2C83A 3S8MA 1VHJA 3BGVA 1IPEA 1G8JA 2MJLA 3G0DA 4HBZA 2Z4TA 2B5OA 4FC7A 4P38A 2GVNA 2BFOA 2D7DA 1Y8AA 2EX1A 4MOWA 3AVYA 5IH7A 4ZAXA 1OBOA 1HLGA 4FN5A 1CETA 4BP8A 2RJNA 4FC6A 1IYZA 1B73A 2AZDA 2HDOA 2SCUB 5H0IA 1VZ3A 4YVFA 4JZKA 4PGFA 2RBGA 3T15A 2P67A 5JZBA 4RC9A 2Q0HA 2VPPA 3EQ9A 1YDEA 4YTEA 5JS1A 2OP1A 1ZJ6A 4KREA 3OD5A 2RGCA 4FCCA 3B5IA 1LLUA 4MVJA 3GG9A 2FMUA 4CZ2A 4B3TB 3DVSX 1I3KA 2X2PA 4OXKA 1SRRA 2CE7A 2ZJ0A 4J03A 1P2UA 5EKTA 2A7QA 5IVKA 1CY0A 2P4UA 3CH5A 4LS3A 2FW6A 2OAEA 3UA4A 2LDBA 4JOQA 1JIQA 2P77A 3KD3A 4KBGA 1YZTA 4PAQA 5FD8A 4UPVA 3N0WA 4QGAA 3ZLTA 1Y5RA 4KAAA 5AK5A 4RD2A 3R8XA 4A1OA 4ENTA 4F97A 2Y67A 4CIYA 4Z4IA 5HCUA 4ES6A 1DJLA 1X8JA 3USCS 4XOUA 3VFDA 3B6IA 1GIAA 3IIKA 3KAJA 5BY2A 1EP1B 5CA0F 4OHKA 3I5YA 2AZ4A 4LJKA 4ARZA 1R4NA 1QVVA 1WUTA 2R68A 2OCAA 3ASYA 2WPDA 3OIVA 2FG5A 3KE8A 2B21A 3T7SA 2H48A 2BCEA 2ZRNA 3LY8A 4EKEA 4MSUA 1KF0A 2YWFA 2B69A 2IIPA 3FPSA 1P4RA 4XPZA 5CXSA 4N03A 3DAYA 4W6ZA 1WXWA 1UK8A 4KEAA 2VWGA 2BUAA 1M2OA 3EA4A 1QF7A 2O8BA 4GMFA 1UKAA 3VVLA 3ZGVA 2EBFX 1P72A 2PSFA 3ONNA 4C5CA 3K15A 2XI4A 1GQ2A 4ARAA 3BRWD 2VYVD 3BORA 4XVHA 1FSFA 3OU2A 2HHCA 4KKXB 1CJVC 3AJ9A 5FWYB 3R9IA 2PZFA 4PXSA 1OBFO 1IBSA 4I5FA 2AUNA 1V7CA 3K0EA 1TAHA 2FX3A 4PLZA 3CUKA 4G5QA 4AC9A 3VZQA 1X7HA 3FHOA 3QI2A 1XLTA 4X91A 3LUAA 4NPCA 1RC1A 3LYUA 4Q48A 3KK0A 4AICA 5IVIA 3A6LA 1K4MA 1X7YB 2GJ8A 2WTAA 3KBBA 2C4MA 3JYQA 4KWEA 4UAVA 4BQRA 2ZATA 4HGZA 4TXJA 1TYDE 2H5LA 2UUBB 4ALNA 1RXVA 4RVHA 4X93A 3N8GA 1C0IA 2W2LD 3CZAA 2GT1A 5E4FA 1N2CE 4D81A 3C97A 3M70A 3EGXA 3K9NA 2VZ0A 1Z08A 1X7DA 3CNEA 3H6GA 1U7PA 1UT8A 5TB5A 4XDGA 4YMUA 2J4FA 2Y8EA 5AD1A 1Y9ZA 3NIBA 3W9BA 2VJMA 4CMIA 4YECA 4JOSA 3KG2A 3PHLA 2IY7A 4OFZA 4U0KA 3D3WB 4XAQA 2GN9A 4NCKA 3N7UA 1F2TB 3G2MA 1YK1A 3FF4A 1Z0UA 1JR3A 1Y7LA 4K81B 2QRUA 3MXTA 3PYLA 3L1JA 1X9IA 4Z3OA 3STUA 3IMKA 1OHHD 2B82A 2CW5A 2XDQB 3AUAA 3JATA 4P4UA 5D3MA 1S7CA 3JZAA 1BRMA 2XTMA 3AEQA 3JQDA 4KQJA 1IY0A 5LD2C 1GZ7A 3BB1A 1NYTA 2FR8A 2W6ID 2ZSFA 4ZKEA 1N92A 4RZIA 2WD8A 2OGTA 4W8OA 7MHTA 3CR7A 3UYKA 2JIZD 4ND5A 2HCJB 1NJSA 4OPMA 4Q9JA 4NV0A 3R75A 4ZTZB 4GYKA 5JCOA 4R2XA 2WJPA 2I62A 1NUAA 1WZNA 4MYTA 4DA0A 3HBFA 4FNGA 2NZ2A 4FB4A 5JDIA 2XNDD 1ZY2A 4RTSA 1YOVB 2H5IA 3FNHA 3GARA 1OU4A 2OV1A 2CEKA 4OCZA 4XIIA 1PJ3A 4GP9A 2CMGA 1PS8A 1EB9A 1ZRHA 4RM2A 3SYKA 4D5EA 5JNVA 1UOOA 3NTQA 3C6BA 4C03A 1XZEA 2O57A 2PFGA 3GEGA 3HB1A 3V4OA 1QQ6A 3AKZA 1J8VA 1M2WA 4KXVA 5LMCA 1Y7TA 1PNQA 4Q00A 4YK7A 4YAEA 4H3SA 3U81A 4IH4A 4G5GA 1KE1A 2CKMA 5TQ2B 5KAPA 2WVJA 4RV5A 3HYTA 4M1OA 3VR4H 4RVUA 3E61A 3F96A 2J4DA 3AVOA 3OJWA 3TLBA 5CT8A 1E1DA 4FEYA 3V46A 1G5PA 3OM9A 4JBWA 5L3SA 3ZKWA 4C05A 1U80A 3A0UA 5AW4A 4K2AA 2ZI3A 4JAVC 1F4LA 2C31A 3T54A 3UJCA 1PSZA 4KI7A 1RWKA 4F3YA 5AUOB 3K70C 2X23A 2ZVJA 1KI8A 3CPSA 4C0XA 4E2WA 4PHCA 3PQ3A 4QQNA 1ZAKA 3HGTA 4R5MA 1O0CA 2BHSA 3PC3A 4KE7A 4RQTA 5DN9A 1IUOA 1RCFA 4U2EA 5DEIA 2SICE 4MQUA 2H52A 3O1IC 4KG7A 5DMXA 1H2HA 4TUYB 3OBBA 1OH5A 2RH5A 4R8LA 4R8KA 2ADOA 1DEHA 2P4HX 1OV4A 5A0VA 2FMKA 4FJ1A 4I9HA 2H0AA 1T8TA 2JD2A 3BRWA 3HI4A 3IMEA 4E03A 3ZDBA 1IK4A 2WAMA 3A31A 1O89A 1QK4A 2DLDA 5JS7A 3R7WA 4F12A 1E7QA 5BSMA 5IULC 2PLWA 3UV3A 4MVJP 3F49S 5ITZA 1SEPA 2JLYA 2HQOA 3EWSA 4YJ3A 3OTHA 1DBIA 1FFXB 1NQTA 4KWHA 1VXOA 2EBUA 3K5HA 3L4SO 2GCOB 3N6VA 4QA9A 2H57A 4R1SA 3LO8A 2OOKA 3KZOA 4KZPA 4OB8A 5KNDD 1XU9A 3HR7A 3VPBA 4EFLA 1COZA 2XYQA 3TRFA 4RGYA 4A8TA 3N07A 4ZO4A 1W0CA 3TLKA 3EGDA 5EFZA 2AHOA 2JJQA 2F59A 4HNVA 1BKSB 1QH0A 2JHCA 4AZ3B 2XV1A 1WU7A 5BN1A 3ICPA 2H59A 2AXPA 1JR3D 2JFWA 3O3OB 1OVGA 1ISMA 2PJDA 3RRFA 3L8MA 2BGIA 4FHEA 5IJ9B 2D06A 4H0CA 1ZJZA 4Y67A 3AF1A 5C4MA 2OHFA 3W1EA 5JFGA 4C2BA 4NQRA 1IWPB 4OI1A 1R10A 2OGWA 5TSDA 2ZAIA 3EGVA 2Q5HA 5LLTA 2H1SA 3D4BA 3L5KA 4WLUA 3BMNA 5CJJA 1PHPA 3ZVLA 2BDTA 3OFVA 2ZTHA 4NHOA 4F4CA 3AG6A 4ZZ0A 1HL3A 1UBJS 1XA3A 5EZYB 4BFLA 3JY6A 5DLPA 4XEUA 1A72A 4NKRA 4JYMA 3PWTA 5CVTA 1F9AA 2LCFA 1W1IA 3OT5A 3QV1A 5CVEA 5BV2P 1SHZA 4E4YA 3NCHA 4Z4CA 2HF2A 3EPRA 4U7TB 1AZTA 1KZYC 3EFHA 1G291 2PXXA 2FPPB 3FJ1A 3I6YA 4J2OA 4RF2A 1EE9A 1M1NB 2C2OA 3KTOA 4PCAA 2WAOA 3GLGB 2BGMA 3IKMB 1QHXA 3K72B 3NHAA 1MW8X 2DYKA 1DC5A 2V55B 4L95C 4P5DA 4ZAVA 1SU4A 3K0CC 4O2RA 2RSLA 4Q5IA 1LK7A 3RYTC 3O75A 1XLVA 2O7NA 2DUNA 2WWIA 3AY7A 3AGQA 4A0FA 2IX9A 4C7MA 5B4UA 4MV6A 2ZRPA 1B8NA 5KO2A 1M66A 4E1AA 1OZFA 3HVJA 4F1KA 4A8HA 4L8FA 1T91A 4I6GA 5FOVA 3FZNA 3PJFA 4W9NA 3TINA 3AFNA 1RWVA 2DZDA 5EP1A 2QF7A 5CDSA 1F1JA 4PNHA 3T3GA 4KPEC 1KR5A 4L15A 4P3KA 4PCVA 3TXXA 1OH7A 5H68A 1G6HA 4BLOA 2BELA 1US8B 4NESA 2LWIA 4Q9AA 3NKLA 2LR0A 2VJDA 3BMQB 2NP7A 2BH9A 4NWIA 1NF9A 1S02A 2WUEA 3LX4A 1V95A 1VKRA 4NV1A 3AVVA 1OGJA 4WERA 1XROA 3WMXA 5GAJA 1AGYA 4L75A 4L28A 5F64A 4Q7MB 4BN4A 3GX1A 5CDYA 4X65B 1M1YB 3G2HA 4HDCA 1UBEA 1SKYB 1WKVA 2IXTA 3TTSA 3R4CA 1WBJB 2I8CA 2WSYB 4X94A 3PHCA 1V5GA 2OCPA 2PO5A 3ETNA 3CG0A 2X4DA 2VPWA 4NOJA 4IWYA 3HFGA 1YDGA 3WJ7A 2IYVA 2A6PA 5BP7A 2PEYA 3HN2A 1QX4A 2JA2A 2HLHA 3GGSA 4KN5A 4DEYA 1B6TA 1LNZA 1TFUA 1Z4JA 5KVVA 2QYSA 3GELA 3OHPA 3TUZC 1U3WA 3RSQA 1MNAA 3D2AA 1XDWA 2FPIA 3IQWA 1FNMA 3MLBA 5C8ZA 5G3ZA 2WHEA 4OQYA 3HKEB 2JLCA 3EE6A 2V58A 1CZKA 1PX2A 1TCUA 2OCIA 2MDTA 3ELDA 3QBJA 3TJRA 3WNVA 1XXHA 4QREA 1PLJA 4JDPA 5K0NA 2PH1A 1U5BB 3E8SA 1QH9A 5AUNB 2YJGA 3DS8A 1TTPB 2Q5IA 4E09A 3LQQA 2B8JA 1KXZA 2GRJA 3BM5A 2F7SA 4KGDA 2JGLA 2Y1FA 3I52A 3LF2A 4OQNA 5EAIA 3AM3A 1QLHA 3ZGLA 1ISIA 1KI6A 4JODA 1NMSA 3RHSA 1HDGO 2GESA 4L0QA 1XCGB 5E4JA 4CNQA 4DLBA 4F85A 3U19A 1KJJA 4OI0A 1HTTA 3SR4A 4E5YA 5KWIA 1SXGA 4QQKA 1GSAA 1YMUA 1YS9A 4PPNA 5LQJA 1W6UA 2DUWA 1L1RA 2V8BA 2YIMA 1GGMA 3KHSA 2ZZNA 1BNCA 4EKDA 1O7JA 1ZR2A 1JZSA 2ZULA 3AFMA 1TVEA 4Z99A 3WOVA 5LP6B 1HNWB 3R0VA 2C07A 4HNTA 1QSGA 1XTBA 2RG1A 3CE9A 3HABA 2EYQA 4QG7A 1D1PA 1N6PA 1TQ4A 1P0PA 2RCNA 3DPIA 4HWGA 1FFSA 5B12A 4NCBA 3SIWA 1LLFA 1TCVA 1TQHA 2GEBA 2WM2A 3L7OA 3HZOA 1XQ6A 3LKVA 2QZ9A 5CNKA 3M2PA 3QLUC 5D01A 4CT0A 5CEEA 4OMUA 5A4MS 2QW0X 1A71A 1DAMA 4KAJA 1TIPA 1RWNA 1LVUA 4O4JB 3TR6A 4LE0A 2FWAA 4P3NA 3F6CA 4EKIA 4AZWA 5KQSA 5G4LA 4E5UA 4MUGA 1R6DA 3F97A 4XCXA 4XGNA 4INJA 4RK1A 1ZUNA 3RVBA 1RI1A 2EGHA 3OICA 3QSGA 4K2HA 4MCIA 4MLPA 1UZLA 1UF9A 4QYIB 3PWSA 3TLCA 1ZHHA 2GRUA 5DF1A 1M6EX 5TF4A 3RSZA 1Z3IX 2CMDA 1J0EA 3HVHA 2YHIA 2ZVDA 4IVQA 1HOXA 1WOMA 4Z4FA 4YGXB 4D3FA 5DNCA 4KN9S 2W2MA 3O8QA 4HUQA 1U6JA 2XB8A 2EFCB 1YJAA 1ZD3A 1FXWF 4CETA 1Y37A 2HI0A 4LGYA 3GJ0A 4RDCA 1Y6JA 5LM3A 2ISSD 5E2BA 4W5QA 4HWOA 2PUGA 2EF1A 3LLUA 5IP5A 2E5FA 1V3QE 2Z43A 3GH1A 3SBXA 1GG8A 4GM4A 4ZCIA 2G4CA 5KNCD 2ERYA 5TQ0A 1WRBA 4M53A 4MYRA 3B1XA 3BFVA 3D8NA 3HP7A 1DXHA 3HYNA 4TYNA 5G1NA 4ZVRA 1QB7A 3ZTTA 4JLPA 1NKVA 2HM7A 4MI3A 2D2EA 3ASZA 3OCCA 2RH9B 2HIMA 4RTNA 3N2YA 3LF1A 1CB7A 1ECGA 2QUBA 4W1PA 1JA1A 1YT5A 5BT8A 3KPVA 1ONBA 3GJQA 1Z6AA 2ZCUA 4PPQA 3F9IA 1SVOA 3PSAA 3NC4A 2WDZA 4EUKA 5L4LA 5LXTB 5KYWB 2A59A 3PXAA 4LHEA 5ALYA 1P9OA 1FNNA 2NU7B 3B5JA 2WG0A 2FOIA 5CVJA 1TJ4A 3FR7A 2VTKA 4EG0A 4J9UE 2F43A 1XTJA 4UZFA 2JZCA 3PCTA 4ACBA 2Z5VA 3IQHX 4CXMA 4GHWA 4DSAA 4JVSB 1KY3A 1NLFA 2X15A 1M3SA 3E5NA 3OH8A 4V0KA 3T3DA 4BVEA 4NYIQ 4Z7QB 4BKQA 1VE3A 3KOWA 1XYVA 2DUJA 4D8XA 4FDMA 4B8WA 3W2HA 1AOXA 5J5VA 1Z74A 4BGDA 2J3LA 2X0KA 1X8LA 1V4BA 2V8OA 2OBLA 3JD4A 3HSSA 1LQTA 1XMPA 3B7PA 5JBIA 4GX2A 1IC6A 1RMYA 3FA2A 4IDBA 4I4TB 2DFPA 1NPTO 2VCHA 3MWKA 3QPVA 4Y30A 3TVTA 3GYBA 4JUIA 3WYFA 4D26A 1T13A 2AZTA 4MV1A 4OSOA 5KCMA 1ZVJA 1U7ZA 2YY5A 4YBZA 5C9ZA 2CL5A 1LUAA 2V45A 3MTBA 2A9PA 1UDWA 3PYMA 4MUNA 4ND3A 1W4CA 5DKFA 4D4JA 4F86A 1A9XA 3RRYA 3BZWA 1RABA 4NONA 3AHGA 3W9SA 4IXNA 2XE6A 4RHFA 4P22A 1C7IA 2CV0A 4KR7A 3H1FA 4G0VA 3PCRB 4NE2A 1ICIA 1P45A 1Q83A 2HSZA 1VKNA 2WINI 1ZICA 4HDQB 2IPOA 4IS2A 5E4TA 5G4KA 2X0EA 4Y6QA 2V7TA 5F2NA 3FF1A 3I3OA 5J63A 1ZOSA 1P7ZA 1F7VA 4BMPB 4R6XA 3C4VA 3JTEA 4NVRA 3UWKA 4LYFA 3OZEA 2G0TA 4AUKA 4B33A 1C7JA 3H8WA 1SXJE 4Y1FA 2BGGA 4ZYUA 4IXMA 3UY4A 4F3CA 4INOA 3W2IA 1R66A 1RJFA 3LPDA 4MWBA 3ZN2A 2WNSA 4CVNA 2EEPA 1VL8A 4CBVA 1M0SA 1QIHA 2GZDA 3THXA 3RBXA 4Q3KA 3S1LA 2EKZA 3NHUA 2P79A 4QOJA 1DBRA 1YD7A 1CIVA 4PZEA 1DB3A 4JS0A 4AYXA 4RE6A 1UP7A 3OLZA 3LX5A 3J81A 5BQOA 2ONCA 3I5UA 1USWA 4EQ6A 4F93B 4G5SA 1Z34A 2P7HA 4YRQA 1V1MB 1EUDA 2XCRB 5F98A 3E3AA 3H4IA 4TV9F 2FZ4A 1X7YA 1EIWA 3DAGA 2HCRA 3MILA 1NBEA 2C4UA 2UYYA 1PO7A 1F48A 2IGBA 2WJZB 2ZTSA 4XFDA 4A03A 4CKBB 3KYCB 1UXJA 4N8EA 3RBZA 1E58A 2OZVA 2ZIWB 3UIEA 3WKAA 5LXTA 1JH9A 3REQB 2WV7A 2B4TO 1Y4ZA 2XD4A 1MW9X 5P8WA 2C84A 1EXMA 1YO6A 4LY6A 1SZPA 2FFAA 2X0FA 2AC2A 1HBJA 2WB4A 3QY0A 3PT5A 1N2XA 4BP1A 4PAWA 2DJIA 1O6ZA 1UXOA 3L07A 4J76A 2FAXA 4KGVA 5JCZA 2JS7A 5EESA 4X6YA 1RXEA 1XD2A 4IX1A 4Z2AA 4RYDA 3CVWA 3MBIA 5K20A 1U7OA 1CUYA 4PQRA 5EIAA 4AO7A 2I7VA 5BSHA 3K4PA 4Q7KA 1BMFD 3PPVA 2WBLC 3GLVA 1TJPB 3HR8A 3LT4A 3N8HA 4HEJA 4ARZB 1WZEA 2GNPA 3DNFA 4ZV9A 3WWPA 3AR4A 1EFVA 3D8TA 3TD2A 3AW9A 2FZWA 4G09A 1RQXA 2PX0A 3QE3A 3MT7A 3ZIAA 2QU7A 4DYVA 3HA7A 1GPNA 4TL6A 4JUDX 3OAAD 1MIOB 4PAOA 2IOHA 2GNAA 3WGGA 4MS3A 3ZNQA 1TKRA 1VL0A 4IJ6A 4DL9A 1JJFA 3WZMA 1U9YA 3H8VA 2JDID 3AL3A 2Q3BA 4XTRA 4X6XA 1A4XA 3J81k 1XCPA 1QHIA 5G40A 4BIMA 3SC2B 3U9SA 5A0TA 4O4HB 1EHCA 3BBPA 2C99A 2YWXA 4IJQA 5DIFA 3W34A 2HU7A 4M49A 1ATZA 3QELB 1UXKA 3V4VB 1MQ8B 1POXA 4UCXA 4QPJC 4DQVA 4HYYA 1GDDA 1ZUIA 3SU8A 4FHCA 1XI2A 1X15A 3HL4A 1P6UA 3VKGA 4CODB 4D0NA 1MO5A 3SC4A 1N33B 1OAOC 4M2LA 4N3BA 2HO4A 3KEGA 3KOZA 2CUTA 3M4ZA 1GUZA 2GYUA 1NTRA 4EENA 1LVHA 2M6LA 3H2YA 2AW3A 5TARA 3GJYA 3HXOA 5COBA 2AN4A 3MAAC 3MGKA 1RM0A 5ALQA 2YFKA 3KJNA 4UM5A 3GRZA 4MI9A 5CCBA 4MGIR 4CQMA 1OH6A 1GPBA 2W4IA 4K26A 3RU7A 1RS0A 3U7HB 1TUIA 2X86A 3E70C 2I7CA 2J09A 4EZIA 5IZCA 4WASA 3AERB 2DPYA 3DT8A 1YDHA 4JYAB 4B8ZA 3RVSA 3C7KA 3IBTA 4QXQA 2WHQA 3CR8A 3ETEA 5AI4A 3QMVA 4G0XA 4M8IA 1DZIA 2WHPA 1G0NA 2REQB 2OZEA 2UYQA 3OPMA 3AI7A 3OECA 5CM2Z 2W6PA 1QZXA 3NHMA 2M2IA 3NKFA 4M9ZA 3V4PB 1KIFA 1W5SA 1NJ2A 4EMSA 1L6IA 2GNOA 4Q4AA 5KYUB 2XLCA 2WSLA 3S4YA 2Y1EA 2BJVA 4OKIA 2CE2X 4YT2A 3ESZA 5AXDA 1Y1PA 2A0WA 3PUVA 5IM5A 4M1QA 4JI6B 2W90A 3GRAA 1HY3A 1ZMTA 3HKCA 5C3UA 2C77A 5IC6A 3HV0A 3AH8A 3DBOB 5AWFC 2VAWA 2QS9A 3G7UA 4RABA 4LXIA 4RTRA 2J1LA 1U7DA 3UB2A 4W99A 5L7TA 1RC8A 1Q44A 2QD1A 1Y0BA 2A3RA 4FZVA 2A4KA 2VWPA 5TQ2A 1C7FA 4N3GA 5A3JA 1FFAA 1RIIA 4RCYA 5CK5A 3DMTC 1T5IA 4X3OA 3UXMA 3A4YA 3STTA 4DG5A 2FJUA 3W3ZB 2PT7A 3SKVA 3HM9A 1MXHA 5IKPA 2VUTA 1CJKC 4QODA 2JJMA 3GMTA 5EE5B 1X8KA 4R4JA 1RBYA 4NBKA 1QUFA 2Q62A 4M0MA 2G80A 2P2SA 2SNIE 3ZLBA 4EG4A 3BMQA 3EXIB 4BNDA 4Z53A 1FZQA 1I0ZA 4O6VA 1NI5A 1B43A 2DUMA 1PW7A 3VU9B 5DYWA 4AJIA 5EZQA 1NFRA 1ZMOA 5H9VA 3G2JA 3JU3A 1C0PA 2V3VA 4W1RA 2FPMA 3QUQA 3K6SA 2VS1A 2NOAA 4C6TB 3TS1A 5A4FS 3TTWA 1EUCA 3SWWA 4W5OA 1MMFB 2G36A 3CPHA 3LQYA 2N42A 4KXLA 1CC1S 5BNFA 1JN0A 1JAYA 5AOCA 3Q15C 5K3SA 4ADSG 2XMGA 3K9HA 5K4AA 1OY1A 2IYPA 4OHUA 4TVBA 1TGVA 3BTVA 2FX5A 3OFSA 3Q7EA 1JMKC 4V0OA 3F6EX 2G17A 3S1AA 5IF9A 1FZTA 2IA5A 4DMHA 3QWHA 3ZVKA 4UNPA 1F60A 1O94C 4BLPA 3N3BC 3KZXA 3RROA 4D8WA 2MR6A 2YQZA 1DUIA 3AUUA 3H1EA 3CWQA 4HLQB 3SHQA 3UZUA 5DP1A 2WMOB 5CD9A 4X7MA 3BD6A 2IHBA 4XCVA 1HSOA 4KXUA 3EIWA 5TPZA 1TTHA 3OFKA 4JUCA 5SZKB 1YAHA 3ZK7A 2KMLA 1VBMA 3A6JA 1U31A 3F73A 3W77A 1L7OA 1NPYA 3PRJA 4BX8A 4F1WA 3KPUA 2O2YA 4ED9A 2PTGA 1L3BA 2XWSA 4RPHA 1P1IA 2Q4OA 3EVTA 5AM5A 5HFAA 2YJZA 3EZ6A 1DDOA 3N7TA 1J0BA 3QK7A 3R0IA 4XUCA 5CTJA 2GEJA 5AVJA 2HPZA 2XITA 1QHGA 1RQLA 3HRIA 3I04M 1CUWA 1U2GC 3IULA 3O4RA 1JWAB 4BB5A 4CMEC 5F5LA 2J9GA 2RBEA 1X6VA 1CRLA 5KYKA 3PC6A 3GAZA 5SZHB 2CFOA 2CNKA 2QQGA 5KNDH 3ROFA 1CKEA 1N2HA 5CYPA 3RG2A 3T7CA 3UM9A 3DDHA 2UDPA 1K8YB 2AI3A 4NYJR 4CL0A 3ILXA 4YRBA 1EZZA 4CIWA 3AFHA 2X1LA 3DHNA 2WHYA 4JC0A 5KI6A 1YB5A 4KC0A 4Z0TA 1VMEA 1JJBA 5K8IA 2PS0A 3Q98A 3DLCA 2GGSA 3U7EB 4MVYA 2ONKA 1DC7A 5ENVA 3A6GA 3FZGA 1VB5A 3WLQA 4P3XA 2RK6A 3QYPA 1ESZA 3D0KA 2R6AA 4MRVA 1XWIA 4A0HA 4LZOA 3RUHA 3CB4A 4HQRA 3AEUA 1F2DA 1H3FA 4R2IA 4DF3A 5LJLA 1CV2A 2M9MA 2NU6A 3BQMB 3PFWO 5ENZA 3W2FA 4YUWA 1O08A 4HI0E 4TUYA 2NVWA 4FGWA 1Z4OA 3UXHA 4CKCA 4HDOB 3QLUA 5BQFA 1M7GA 4TLCA 1QDLB 2GM5A 1MVOA 2RGNA 2V5AA 1U0NA 3ANSA 3O3NB 4UNSA 5CCXA 2ZIXB 1BVRA 2C2ZA 2YX1A 1IWBB 2BMEA 3GJTA 4IFIA 4IDQA 1Y1RA 2FW9A 1MR3F 1WQ1R 4LSZA 2ZETA 3VU9A 3W5UA 3ZHXA 4B2IA 1AUQA 4HC4A 1AXGA 5AVOA 3DKIA 4BNKA 5DSZA 1S1CA 2UYGA 5LIPA 3B3GA 3I6ZA 1K68A 4TTSA 3QYFA 4KKVA 1TT5A 1V41E 4UUOA 1KYXA 4WFJA 2O6LA 4EA8A 1GYPA 1UANA 2YINC 4RZUA 1M2JA 4WDRA 3ASVA 3LUFA 3GFTA 3GYGA 3GRCA 1G4UR 3NGLA 2VTVA 4ODIA 4TUYF 5CITA 5K0TA 4DVGA 1SVKA 3LFUA 1PWEA 3O94A 4L3OA 2D5CA 4KQ6A 4EUHA 3G8BA 1QU2A 5K8UA 1PBTA 1Q77A 1RQRA 2AVNA 1SXJC 4FGSA 4YAIA 3DV2A 3VO1A 4MK4A 1HZZA 1ZSVA 1X1EA 3FCCA 2Q7DA 2EP8A 3LZCA 5F77A 3C5HA 2OKCA 4X5OA 3F98A 4KH1A 1DEAA 3HSYA 1GG9A 1Q95A 1WM1A 4L4UA 4WECA 3H4MA 2XYPA 1INLA 4L0MA 2BRUA 4L4SA 1TM7E 1NE7A 2P3QA 2XMDA 5KYUA 2NTEA 5FTMA 5B1DA 2WYWA 3L3BA 1HMYA 1PSWA 1TW3A 2ZIFA 1G17A 3NBUA 3KS9A 4NR0A 4TPKA 2AFRA 3P0HA 1NXQA 4JEUA 2GK3A 2HC9A 2B6HA 5DEOA 2VYCA 1JG6A 4RXTA 2GXSA 2I6UA 3VUEA 3JCZA 5K0SA 3OEHA 1UM8A 4NCIA 5JG7A 5JVDF 1KDRA 3FOEC 4QUIA 3HXQA 4X41A 2XODA 5AYVA 5EVCA 4U39A 1P0QA 1U2PA 2GDJA 3ZWYA 3DWFA 1RHRA 2PD3A 3WYGA 2OT3B 3CZ9A 5B3JA 1RPZA 1KQ3A 1C9JA 2PZGA 2YASA 4ZVMA 3ZXUB 2JFHA 4LXXA 4RDXA 3MHTA 4H9GA 4GICA 1AM4D 3WOHA 2IW3A 2WUVA 4BJ6A 3IPRA 2XTJA 3BRCA 8ADHA 4LHYA 4B6EA 4GL2A 3NWEA 4KYVA 5GONA 3ROPA 2FZGA 4AY5A 2XW6A 1N32B 1PDVA 2O20A 3FG9A 1KJ9A 2MINA 2P5SA 2OY0A 3N2NA 4B2LA 1MD9A 1NAIA 1OFUA 4RIHA 3RTCA 1Z88A 2XRZA 2ZSUA 3DLPX 2R1ZA 3U0VA 3KSMA 2EHDA 3SHFA 2GD2A 2B8EA 1JZTA 2YVUA 4PYQA 1FB5A 4F3KA 5CFMA 4ZFNA 4E51A 3MJHA 3RKRA 4EUEA 1K2VN 2D0IA 3MD0A 4XVQA 1T15A 1Z2OX 5K7SA 2NXJA 4LOHA 2RG7A 1US8A 1W93A 1ECCA 5B2EA 4PLTA 1K66A 5BWLA 1HR0B 1E3MA 4ND4A 1B8VA 1JAIA 5DHAA 1EGMB 2HA7A 4BO5A 4I8IA 1H3EA 4FLFA 1NBOA 2W11A 2DRIA 3SXJA 4BMDA 2IV7A 3ENKA 1XU4A 1U28A 4PM4A 4JLAA 4TX1A 5COQA 1VPLA 4YQEA 3VSCA 4WKCA 1U0BB 5D87A 1CF9A 2C2HA 2HRDA 1I3LA 2BBSA 2AYYA 2P91A 2QXTA 1UBTS 2WKSA 2C4NA 3HMQA 1Z26A 4GFDA 4RXMA 2BTOA 3D7KA 5LBUA 2BI4A 5FFFA 4RMJA 2A5DA 3A1FA 3EARA 5EIHA 1CQIA 3GJRA 4LJ7A 3DL0A 1BG6A 4NCXA 3QM1A 3DUFB 3ROQA 1ZR4A 1EP2B 2PDAA 4HDMB 4KH0A 2VIIA 4PAGA 2VQFB 1ICEA 1SB9A 1SC9A 3ZOZA 4A0QA 3JSXA 4EKGA 1FRVA 4MMYB 5B64A 4MA5A 1V2HE 4ZHQF 1ECJA 3KAPA 2H7XA 3PA8A 4FX5A 2ZIVB 4X97A 1Z38A 3ZJYA 4B3HA 3GGGA 4BQNA 4MTLA 2ZK7A 3UVEA 2DG2A 2FPXA 1CQPA 2GK7A 4Y2TA 3DKPA 5DULA 1NLZA 3FSRA 4IIJA 1JYFA 3H4VA 1AA6A 3I9MA 1V3UA 1ZA1A 4KR3A 5EZYA 1KK0A 2ANBA 4LJRA 1MNQA 4NLLA 3UOGA 2DLCX 2ZANA 3F74A 3ZS8A 3EGWA 3W3AA 4LRQA 4ZA2A 5B6IA 2WJJA 2ZJOA 3I5AA 4KQFA 2G9QA 2Z09A 4Q9DA 3DJYA 4IIXA 5ESDA 3C3CA 3KQQA 1QV9A 4F11A 1OX5A 3N2KB 3P97A 1QYCA 3RWBA 4MUYA 4U8GA 5K0ZA 1QG4A 1GQFA 3D2CA 2HK7A 3ENVA 2QV7A 3K0BA 2P0AA 4IIGA 4U00A 2OMKA 4BLUA 1Q0RA 2FP4A 3BB3A 4B4KA 1CY1A 1X9HA 3C6YA 3M2TA 4ZAYA 4ND2A 2O5EA 2VTEA 3VTZA 4BNGA 2ZBQA 4TTIA 1DQZA 1L3CA 1H9AA 3EQ2A 3WGHA 1LLCA 4Y98A 1OLXB 2FW1A 2IP2A 4ZOAA 2DFVA 3GUCA 1W88B 4FEGA 4BP9A 2P9GA 4R98A 3WBJA 3UJ7A 2E49A 1MQ9A 4IWNA 4OLHA 2DR3A 3EZFA 1L4UA 1HSZA 1PJZA 1B0ZA 2IYFA 3ZHSA 1EUQA 3K70B 3HU2A 1L7BA 4PYMA 3QKSA 4R8VA 4IHJB 4IIVA 4JC5A 4BFYA 4BMCA 1NPDA 5JZ9A 1GSHA 3ADCA 5TGTA 3TRDA 1XX6A 5HRCA 4OA5A 5B1HA 3IEKA 3MWLA 4AM8A 5EJ7A 4IG9A 5JBNA 1IHUA 4BY9E 3QJGA 1VOTA 4KPGA 3VSEA 4PBRA 4ZP1A 4L0CA 3ZHTA 3AEZA 5FEUA 2WRZA 3U31A 4BO4A 4JJ7A 2CZCA 4EJSB 3PKJA 1N75A 4QAJA 4F6RB 3G8YA 2D1TA 3Q8WA 2C2XA 4HQLA 3OIDA 4R6WA 1F8GA 1XJWA 2AG0A 3D6MA 3G5MA 3M0EA 4DLSA 5JT1A 1XD9A 5K6AC 3NJRA 1WUYA 3G3EA 3DDZX 4HRXA 1AS0A 2VT7A 4ZJUA 2YZKA 5JO0A 1KRXA 2FR1A 1EFDN 2G07A 3PEYA 4MJXA 3MG9A 4E22A 3G9ZA 4V0NA 1KY2A 4MPDA 1KDPA 1MZVA 4QKQA 1GEEA 1PBNA 3AU8A 1XHEA 2YYYA 1UMKA 1QWOA 1WX1A 1TF2A 2A78A 3GGCA 1IOZA 3BMCB 4I50B 5DTJA 4ZU6X 5GMOA 1XVAA 3RS5A 3X0DA 4NJOA 4DSOA 3FGOA 1S3GA 4I46A 4FGKA 1PU2A 3OLXA 1NLYA 2CHGA 2DWCA 2WU3A 4KQCA