2LUOA

Nmr solution structure of apo-mptpa
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
164
structure length
164
Chain Sequence
GMSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQLGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Apo-structure of the Low Molecular Weight Protein-tyrosine Phosphatase A (MptpA) from Mycobacterium tuberculosis Allows for Better Target-specific Drug Development.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords LOW MOLECULAR WEIGHT PROTEIN-TYROSINE-PHOSPHATASE A
total genus 50
structure length 164
sequence length 164
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2luoA00
1ABFA 1A04A 1JFVA 4LX8A 3CG0A 3C6QA 3OLVA 4TMYA 4GNRA 2F8TA 2FEKA 3H5LA 2L19A 1IIBA 4F8JA 4D6XA 2IPMA 3HS3A 4L4UA 1D1PA 4RXMA 3RVMA 5ABPA 3ROFA 4G0ZA 4S05A 1E6LA 2VK2A 5KQMA 5JNSA 1GUDA 4ML3A 5EWJA 4RU1A 3M9WA 4DADA 1SXGA 3FMVA 4NQRA 4TN5A 3A3KA 3CHYA 4XXHA 3GRCA 1XWWA 3RVQA 4YLEA 1TJYA 2CD7A 4G86A 1C0EA 3G1WA 3HK2A 4MS4B 4P98A 4QYWA 3W9SA 4XAQA 4JOQA 3O2JA 5EWLB 3HJFA 3I09A 3LUKA 1D4ZA 1MIHA 5IBQA 1D1QA 3KS9A 3RVNA 1YIOA 3Q7RA 4LDZA 1JFSA 5TPZA 3H5OA 4XLTA 4H3KB 3CU5A 2QSJA 4GPAA 4G0YA 3QEKA 3FFXA 2OENG 3S99A 2LUOA 3MA0A 1MVOA 4UHJA 4WWHA 1NXVA 4RXUA 4EYOA 1S8NA 2LPMA 2XDYA 3SNKA 3NNSA 3RVOA 5CHYA 2HSGA 3LUGA 1KMIY 1NXSA 5TPWA 3TB6A 4NICA 4JAVC 2ID7A 5DGCA 2HPHA 3N0XA 3RH0A 4RKQA 1XHEA 2JRLA 2QZJA 3QLUC 4EY3A 2GWRA 4EVQA 3OQMA 3BRQA 3G85A 1NATA 5HQJA 4ETNA 4N76A 3E3MA 3OO0A 2MYTA 1KRWA 2H3HA 1W25A 2RDMA 1DCMA 3EQZA 3HDGA 2WJWA 4YCSA 2PL1A 5IX8A 1P6QA 3HVRA 1A0OA 3KYIB 4MPTA 5IC5A 4CBVA 1VPWA 3URMA 4MRMB 3CG4A 4ZPJA 4N0QA 3QLTA 3JPWA 3GBVA 1K66A 3CLKA 4IILA 4QICA 2FN8A 1YMUA 5E3JA 2BGGA 4B09A 4WXMA 4Z4GA 3LFTA 2PMCA 1DC8A 3IP7A 3CFYA 3ILYA 3OM1A 3QX9A 5JNTA 3MQ4A 5C5CA 5HKOA 3ROTA 4PICA 4KREA 3C97A 1L5ZA 4RKRA 3O2QB 3M6MD 3KLNA 2I6FA 1M5UA 2PUCA 2YHAA 4OLBA 1B00A 2H0AA 1YK0A 3DLBA 1EFAA 3N75A 1QO0A 3HDVA 5KI6A 4TLMB 1GLGA 1PEYA 2X7XA 5EWLA 4PEVA 1Z18A 4Z99A 2LP4Y 2L17A 1LBHA 3FDFA 4RY0A 2NT4A 1LJLA 2E4ZA 3N0WA 3KKEA 2L18A 3LOPA 4IF4A 3O75A 1E6KA 1TM2A 2A9RA 3KYJB 1LK0A 4EVRA 1H9CA 2ID9A 1USKA 2FLKA 4HNQA 5IEJA 3OQNA 2PUBA 3RVJA 2A9QA 5KQPA 2PAFA 3H75A 5TQ0A 1HEYA 3O74A 1ZDMA 3LUCA 2MYPA 3HO1A 3GL9A 2FVYA 4WZZA 1TMYA 1BDHA 4N47A 8ABPA 3HUTA 5KQLA 1Z17A 3D02A 1P6UA 2ZWMA 2VUHB 5BRAA 1ABEA 3GWGA 3OM0A 1FQWA 3NNNA 1FFWA 3LUDA 3Q9SA 4MR9A 3CTPA 3LUAA 4Z0NA 5DCLA 1RXEA 4RWEA 1EAYA 3M9XA 2ZAYA 1EWKA 3NHZA 1M2FA 1J56A 4W5QA 3KCNA 3T8YA 3I45A 3CRNA 4JA2A 5DLEA 2E4YA 4MR9B 3TMYA 2PE5A 2WWVD 3H5TA 4Y9TA 3BILA 2WJAA 3KSMA 3O21A 3EULA 5TQJA 2Q5CA 2FMKA 3KTOA 4QYMA 1ZGZA 4IMIB 2IOYA 4RK6A 2FN9A 3SM9A 4Z4IA 2FQXA 2N9UA 4Q6BA 4N41A 3OLYA 3O1HB 4MQFB 4OATA 4PE5B 4QPJC 1YS7A 1SD5A 5GOTA 3DZDA 3EGCA 4FB4A 4S04A 2R4QA 3FFWA 3QK7A 2IYNA 4D6YA 3QLVC 3IP9A 1UDRA 1JDNA 1C4WA 1RZRA 3C3KA 5TE9A 1JYEA 3N53A 2FEWB 2B4AA 3GT7A 1RPJA 4RS3A 4RDCA 2HQRA 1VLZA 4RY8A 3EQ2A 3RVPA 3VNBA 2PUFA 5I4CA 5CNIA 4OTZA 1MAVA 2L2QA 3C3WA 2FSPA 3N8IA 4IRXA 2PUEA 1BAPA 4EYQA 3OMXA 5F64A 5B3JA 2OQRA 2NUBA 2B1JA 2MSWA 1JWLA 5PNTA 2R47A 1TVMA 5IUJC 3RVKA 2PL9A 3JPYA 1QP0A 3GYBA 5KQGA 1ZVVA 1F4VA 2HJ9A 1Z13A 2NZVG 1BVHA 4Z4EA 1M5TA 2E4WA 3DBIA 4MLCA 4KK4A 4ZMRA 4F3TA 1GCGA 3BRSA 5D2CA 7ABPA 2GI4A 4ZJPA 3D8UA 2MSKA 4G0OA 1JX6A 2JK1A 4LZLA 4Z9BA 3L49A 3KLOA 4RZSA 5HM6A 4WUTA 4KQ9A 3B2NA 4MLDA 5JS2A 2JVKA 1LJUA 3Q15C 1FFSA 5FWXB 1USGA 5FWYA 1NTRA 1DBPA 3T6KA 3T38A 3CS3A 4DQDA 3I42A 1I3CA 4D74A 4YR7A 1QQAA 3CZCA 5GQSA 2A9PA 1GUBA 2FMFA 1DP4A 5JNWA 2QR3A 1RXIA 1NXOA 3A0RB 1PHRA 4MQEA 5FWYB 1TLFA 1OXKB 5DTEA 5C5EA 1JF8A 5KC9A 4EYGA 2PUAA 3CKMA 3LTEA 3SG0A 3Q41A 1USIA 5TPWB 1Z2DA 3F6CA 1A2OA 2JBAA 1DCKA 3LMKA 2P4UA 1DC7A 3TX6A 4KMRA 3CNBA 3TO5A 3H1FA 4E7PA 4TLLB 1GCAA 2MYUA 5JNRA 2GKGA 2JBAB 1QO0D 1YTUA 5CNKA 1QMPA 3HUUA 4ETIA 2FEPA 4YV7A 4EUKA 4RY9A 4JASB 3NHMA 1YMVA 1KGSA 4YWHA 2CWDA 1SXHA 3QLUA 4WT7A 5FBHA 5T3YA 1JYFA 4ZMSA 1RZRD 4IMJB 1E2BA 1DBQA 1CHNA 2QVCA 3LKVA 4MR7A 2FW0A 3EAFA 5EWJB 2O20A 2AYZA 3R0JA 3H5VA 5IUKC 1ISRA 2GBPA 1VKRA 3O1IC 1YVUA 4RSMA 1Z2EA 2JVJA 1ZESA 4KNYA 4NCAA 4KZKA 4MR7B 1AB6A 2YHBA 1ZN2A 3QELB 3OQOA 4ZYLA 1DG9A 1ZH2A 1RNLA 2CHFA 1EHCA 3KG2A 2JVIA 1ISSA 1WETA 2PUGA 4YRZA 4XASA 4XFKA 4RK7A 1NY5A 5IULC 3H6GA 4F11A 4MAAA 4G0PA 1QP4A 3JVDA 1D2AA 1T34A 1Z26A 2VYCA 2E4UA 5TPZD 5BQ3A 4KV7A 2QU7A 1SRRA 2FLWA 2A9OA 3IDOA 2AYXA 3NNDA 3UUGA 3Q7SA 3EODA 2FMHA 3H1GA 1JH9A 2PJUA 3F7NA 4RK5A 3L6UA 4M88A 4MR8B 2IDMA 5BRJA 1JDPA 4MS1B 4Q7EA 4RV5A 2IPNA 3H1EA 4ETMA 3RVLA 4PZ0A 2FQWA 2IPAB 2V0NA 3MMNA 2FXIA 1BA2A 3MM4A 1ZGGA 3QEMA 4KPYA 2WRZA 1AB5A 4MS3B 3EDCA 4P1ZA 5TQ0B 5DKFA 1Z12A 3UKJA 1K68A 2HQOA 3OO1A 4MQEB 4MS1A 1BDJA 2IPLA 2WY2D 1QQBA 4Z4HA 1R8JA 1LBIA 3K9CA 4UHKA 3DGEC 3RQIA 1D5WA 3QEMB 3KJXA 3C3MA 3IP5A 3CZ5A 3N0RA 4KVFA 4MS3A 4XARA 5CNJA 2CHEA 2R25B 3F73A 2J48A 5ED4A 1EWVA 3TD9A 1PEAA 1DRKA 2MYNA 4HYEA 3LUFA 3I5AA 3OLZA 4LE1A 1NXTA 4MRMA 4KRFA 1MB3A 1SXIA 4RK0A 3JTEA 2PKXA 4HNRA 3HSYA 5TQ2B 1JFTA 3HV2A 5KC8A 4L85A 1M2EA 2QW1A 3GA5A 2M1ZA 4JP1A 4H60A 4OG2A 4MGEA 4G0XA 2QV0A 1VRVA 2JB9A 4KFCA 4LE2A 4RK1A 1MB0A 5TQ2A 1APBA 3FGZA 2QXYA 2PUDA 4YS6A 1FSPA 3OLXA 5FWXA 4MS4A 4NV3A 4H3HB 1QNLA 3HZHA 6CHYA 1Y1LA 2WMYA 4G0QA 1PNRA 2FQYA 2FKAA 3F6PA 1L5YA 1OXBB 3DGFC 1KRXA 2NT3A 3P9YA 1FFGA 4G0MA 4Z4CA 4EGSA 4N0PA 1P2FA 4WXEA 3EJWA 3SQNA 1JHZA 2NZUG 2TMYA 1P8AA 2RJNA 3GV0A 3MIZA 2VUIB 1NXXA 1DRJA 5BR1A 1JLKA 3LUHA 4YGXB 1PUXA 3K4HA 1DCFA 1PNTA 4KK3A 1NXWA 4IGAA 1Z15A 3HCWA 4OLAA 2E4XA 1U2PA 1XHFA 4RXTA 2RGYA 3QLVA 4YO7A 1DBWA 1ZY2A 4MYRA 1E6MA 4JB2A 4PYRA 3MF4A 1Z25A 3IPAA 4LDAA 5FBKA 3O1JC 1W9HA 1URPA 2FTKE 3JY6A 4Z9AA 4W5TA 4YP9A 1CEYA 1U0SY 1F51E 1ZH4A 1U04A 3IP6A 2GX6A 3RVSA 4DN6A 2DRIA 4EYKA 2MSLA 2P9HA 1BDIA 2F8SA 3ILHA 2R48A 4O1IA 3O2SB 5B3JC 4LE0A 5EWMB 3N6VA 4N03A 3HXMA 1CYEA 3HM9A 4LRQA 5CNMA 3JVIA 3KHTA 3QELA 5JNUA 3LUJA 4W5NA 1DJMA 3MYYA 6ABPA 2W42A 1ZAYA 5IEBA 4OBBA 3H6HA 2WB4A 2LBPA 5EWMA 3RVRA 4F06A 3FFTA 4FE7A 2E4VA 3QX8A 4W5RA 3OLWA 1EWTA 3T95A 2RJOA 3JS5A 3SAJA 9ABPA 4O5AA 3IPCA 4EVSA 3A10A 2KYRA 4Q6WA 3H5WA 5IUNC 4E7OA 4W5OA 1QKKA 1ZITA 5HSGA 3E61A 1DZ3A 2HQBA 4MQFA 4F12A 3OMWA 5KWSA 3HEBA 5JS1A 3BREA 4MR8A 5T7BA 4RK4A 1ZHHA 3VNAA 5JNVA 1U2QA 1YK1A 3H5IA 1U8TA 1YS6A 3DLHA 4NCBA 1Z16A 4O1HA 4Z4FA 4HNSA 4JB0A 2FMIA 3Q7TA 2QVGA 3GBPA 3NBMA 4G97A 4FE4A 3SY8A 1QPZA 1NXPA 2PLNA 1JL3A 2IKSA 3UK0A 3A0UA 3LKBA 1JBEA 4KQCA 1QP7A 2JCGA 2LIVA 3BBLA 2M98A
chains in the Genus database with same CATH superfamily
1H0KA 4DRXB 2GPSA 2YJZA 3DHNA 1EHIA 5AI6A 4DMMA 3NTOA 4EMUA 2M6LA 4JZKA 3FA2A 2NACA 4ZJUA 4RIHA 3TTWA 3DW3X 5FX2A 4NMXB 4DLPA 4RXMA 1H1TA 3NS7A 2BM1A 3DPSA 3QH4A 1JU9A 2FFQA 2NADA 3DLCA 3V1NA 1QG2A 2JLUA 3T35A 4M0KA 2X3YA 5AR1A 1GGJA 1I2ZA 3AP1A 5BOVA 3UM9A 5I9NA 1Z3IX 1IMJA 2ZITA 5KREA 4JKOA 2EW1A 1H66A 2PQ6A 4J4TA 3WBKA 4AN1A 1KQFA 3ZDAA 4MEJA 4QOIA 3HCAA 3RYHA 1C3EA 1PFWA 2EOAA 3KKZA 1PX0A 3HA2A 1KOGA 1RAIA 2ZIZA 2UVPA 3BB1A 3JQ9C 4P3KA 2O23A 2V9CA 5EWLB 4BLVA 3I09A 1LV7A 4MGYR 2TMKA 2J6IA 3R3HA 3F74A 4WZBB 3ZHOA 4A26A 721PA 4INPA 1HSZA 3I6ZA 1OFUA 5IBQA 4DXAA 1U9JA 4LDZA 5IAJA 1N1EA 3UOAB 1AMNA 3E0XA 4YR9A 1JAHA 3F5SA 5JH7F 1J8DA 2FPWA 3DDCA 5FAXA 1U8UA 4OHRA 4AZ3A 4DFDA 1BHJA 2BCJQ 3WWCA 4JOCA 2OHOA 4AMYA 3WGVA 4Z0PA 2OCKA 1NXVA 5E4YA 5TX7A 4OMUA 1XA4A 3T1QA 4BNJA 2CJWA 4HWTA 4YUAA 4R1TA 5D5QA 1PE0A 4DY6A 1H8EA 1TJPB 3DXFA 2GBLA 3W7AA 3LUGA 3F6SA 4A92A 2IBTA 2ZLBA 1M2OB 4UNPA 3RREA 3AF1A 4AZ0A 2LKDA 2KBFA 2QK4A 4FX2A 4S0ZA 4XJXA 2A7QA 3K1ZA 1QFSA 4OSPA 3ZCRA 5TJHA 2JANA 1Z6PA 3QF4B 2YZ7A 3ZHTA 1Y5LA 3WLMA 4RKQA 1FFBA 2QRJA 3AFMA 4A0RA 5BQFA 4HG2A 4ZFNA 1WABA 1BXRA 2ZQZA 5FI0B 1DJLA 4UU7A 4GX5A 1W96A 2UUOA 3BB4A 3UWMA 3C14C 4HNUA 3GXBA 2DBZA 2DQYA 2RC5A 1YZFA 3NALA 4CXMA 2JZCA 2J4DA 2VPYA 3DEZA 1P6QA 4GGOA 4LDRA 3UJCA 1X7DA 1P3DA 3Q3VA 2QG6A 2HJSA 4DREA 2PVPA 4PS1A 4WKPA 1UBCA 2NQ8A 3KP1A 3H8JA 3I8SA 4QUAA 5JXJA 1ONPA 3JQBA 4I8XA 3GMDA 1VSVA 5D00A 1N2HA 1VG0B 2WTBA 3CLKA 2BFBB 1I1QB 1W4BA 3FRHA 4B09A 1XHLA 4E08A 1NN5A 2PMCA 1EEHA 4UBKA 1NVKA 3AY0A 4EM6A 1N9GA 3I6QA 1UAGA 1XYYA 4XB6B 3EIWA 2A9FA 2EFHB 1NQWA 4JELA 3O0TA 2C9BA 1FDWA 2ODEA 3E4DA 4FIDA 2C8JA 4QAJA 2BPOA 3B89A 3WNQA 2RHDA 5BQ5A 4TV9A 2I66A 2QRGA 3WB1A 5IZCC 5IJWA 3LCVB 1KYIA 3D6VA 1AUPA 3UXEA 1B00A 2P6RA 2HF7A 1T91A 2VWGA 4WOJA 3WP0A 2NIPA 1Q20A 2Q46A 1JR4A 2O48X 1W0CA 1FMTA 1UQRA 1A82A 5FA8A 4X44A 4LQLA 1ESZA 3LPLA 5FTKA 3JCZA 1K2WA 5I8WA 2XVXA 2F00A 4JV5B 1VJ5A 2Z8XA 1F20A 1N2CE 2YDYA 4M0UA 3WNCA 2BRUA 2PD3A 3FDJA 4N3AA 1MC4A 1QH1B 2RB5A 4H2DA 2TRSB 3WE7A 1TEVA 5DK6A 3FCUB 1GRQA 5ALOA 3O75A 4NX2A 4B6GA 2GZ2A 1INLA 3EBLA 4L6CA 2FQQA 3K9BA 2HK7A 2HSJA 1VCOA 4A2WA 4H77A 2V7BA 2R97A 1K0UA 1EE9A 1VXOA 1S4QA 1CTQA 4H17A 1MXHA 5IAOA 5CCDA 3SK0A 1UXKA 1IEXA 2JCXA 3NCHA 1SCDA 2OUIA 1AKEA 1UWLA 2WJZB 4WZBE 1Y4UA 4W8HA 4X61A 3DE4X 1U80A 4N40A 4ZO9A 3A1EA 4Q3NA 4HZUB 1KARA 2OV4A 5DDIP 1HDOA 2C20A 4XB2A 5ALWA 4URYR 2FSVC 4D42A 4EUEA 2WILA 1M6NA 4QQ8A 3NHWA 3LDUA 1QONA 4ARZB 3CBGA 1M75A 1U90A 3RAPR 3TIIA 3X2SA 4PX5A 3TGPA 3AK4A 5KINB 5ALLA 1QIIA 2QTLA 1J97A 1JFRA 3BIWA 5KJFA 1FU8A 3U56A 3V8EA 4XIGS 3STUA 3SVZA 1QO7A 2AJBA 1IXSB 2VTVA 3JWPA 4GC9A 2JHAA 1P1FA 4K7JA 1L7DA 3NEJA 3KOXA 3GLFB 3W3AH 3O38A 5GJCA 3DAHA 4FZVA 4PSVA 4O4JA 3QVGA 4Y1RB 1SBYA 5LUAA 3DM9B 3L41A 4YXWA 3T7TA 4F46A 2E4YA 4MR9B 4PW0A 5K0LA 4ONEA 1P45A 3NVAA 4UEKA 4UMFA 2ONZA 2WDPA 5EE0A 2C29D 5AVYA 5IVHA 4HN9A 3FW1A 2A1UB 4JI6B 1U1CA 4HMPA 5CW1A 1J0BA 5D1HA 2AN1A 2BFAA 1U7ZA 1WZUA 2GTPA 3F49S 4FVTA 3SHWA 3TX2A 3CRRA 4LDQA 1JQDA 1XWFA 4MKGA 4EHBA 3NVDA 4LJ8A 1Z74A 2YH2A 3K9WA 4JK3A 1W36D 1DO0A 4NCKA 1F2UB 2ADMA 1GZ7A 2J08A 2J9FB 2B4TO 1QQ6A 1Q22A 3FDZB 1SHZA 3GLHB 4NE2A 3TSAA 4JP3A 3B3JA 1Y3BE 4FK8A 2G0NA 1P9WA 1YC5A 2ZWAA 1L7BA 4URXR 3BGOS 1KPIA 2CB9A 2AH5A 3FR8A 2H48A 4YJGB 3W6OA 2NUTA 2C7GA 4NR0A 5A5GA 2B1IA 4QZVA 4X65B 3UYKA 3R8XA 1BAPA 4NBVA 2VRCA 4YC7A 5CEFA 3IIKA 4DA6A 5B3JA 4B76A 2Q2QA 2OQRA 5L53A 1GIAA 1RABA 2F3TA 3K30A 4KV9A 3STTA 4ARIA 4UE3S 4DNFA 2YMMA 5HUJA 4X97A 3GYBA 1HM5A 2YBDA 4YWJA 5IMBA 3UMSA 2DHEA 2EFCB 2BFEB 1ULHA 2X8BA 3IX7A 4WJLA 4C2AA 3EA0A 3HVIA 1JHMA 3F8WA 4DWVA 4QATA 1P2GA 3M81A 3RC3A 1XXLA 4TYWA 4MLCA 1IK4A 4XYEA 5JSZB 4D3YA 5I4KA 2W6ZA 7ABPA 1GDHA 2G0TA 1WD7A 5HJEA 4J0CA 3WSWA 1UFOA 1XTJA 4H0FA 3VTKA 1WE2A 3OHMA 2XWJI 1RLTA 2MMCA 3QPDA 3KK0A 1E62A 2P0AA 1UKVY 4R7ZA 1JQJC 1S6YA 1UFKA 2EP8A 2O3SA 2ZJ7A 2C2WA 2QP4A 4A4DA 2WSSD 2FMUA 4DIKA 4OKNA 2GPBA 3Q7QA 5H7XA 5CW2A 2WUEA 3T6KA 1SOMA 5CVTA 4L78A 4XCXA 4KPFC 4ZT7A 3E9EA 4TGLA 3E23A 3ZLJA 1CZKA 1G8MA 1I8TA 2HTEA 3K7EA 3KVOA 1S96A 1LNZA 1PR6A 2R7AA 3SLRA 2O8FA 4O02B 3B1FA 5HIIA 4NV1A 1TAGA 4DC1A 5G40A 3FOWA 3PU6A 4DNQA 1NA5A 2XZOA 4S1WA 4S1PA 1Y8ZA 2DFKB 4HO1X 3ZKWB 1U6IA 1RHQA 1TLFA 4KH0A 3PXGA 2PRZA 2AJ8A 3HB0A 3MUOA 4Q02A 5DBIA 4B6JA 4EYGA 5HJ5A 5KJ1A 1IY9A 3D6AA 1USIA 2KI5A 4OM7A 3KTFA 1Y8QA 3OFKA 1ZICA 4S2EA 1L9KA 2POCA 3FNBA 3TX6A 3ZJVA 2WAYA 5TXGA 4BP9A 4PAGA 3GUYA 2AG0A 3AVQA 3QOXA 1JFFA 3UXYA 2XB6A 2Q3JA 4B82A 1XG5A 4IH4A 1FU7A 2VQDA 7REQB 5FWDA 3WOHA 1OGYA 1Z4MA 4CQMD 4YV7A 3GFOA 3ET4A 3OZXA 4KWIA 4XUGB 2ZZNA 3KT0A 3KWFA 1SKYB 2J5KA 2YN4A 4P54A 3S6JA 4FKBA 5DOVA 1GRRA 1PI3A 1AY0A 2ODAA 4U2KA 1TKRA 4I1RA 4HXFB 2IV3A 3QRWA 3VSCA 2BGIA 4YFVA 3PHGA 1QAMA 4D9GA 1LK5A 3OFVA 5EMHA 1RRMA 2ZRNA 3DDOA 3OQ1A 3A1VA 1XAJA 1OFTA 1N2XA 1XZIA 3BS4A 4C4XA 4C7KA 1VP9A 3CNQS 2XRYA 3LD9A 3UA3A 2RH8A 3DTVA 5HIMA 5REQB 5ITZB 1X0VA 1GA1A 2AFIB 3JWEA 3LQRA 4MICA 3RUCA 4D5EA 5JIBA 3KR0A 3OC6A 4QUGA 4AF8A 1VLHA 3GZNB 3U9LA 1RRVA 2X1MA 3DE0X 4IIJA 1SQGA 1YR9A 1U1GA 4YRTA 4S0XA 3EGDA 2FDRA 1TLLA 4MPJA 1CY2A 1NURA 4YH1A 3P4YA 4TRMA 2C88A 4G9EA 2DBVO 4GPIB 5EVJA 3IVRA 3U7FB 2ID4A 3PHIA 4UZSA 4G0VA 1X8JA 1NT2A 5KBYA 1SRRA 2CMFA 3M1IA 2GTIA 3Q7SA 4N5LA 1UBTS 4YJHA 4ITUA 5JT1A 5AXCA 2CLEB 4IDDA 1NPYA 3C1UA 1ODLA 3RU9A 1Q6YA 1TT5B 2R5WA 1RPAA 2B0JA 3IQZA 5EEGA 1QZXA 1T9GS 2ZDGA 3PRKE 3SC2A 3F78A 4YAFA 3R7AA 3RVLA 3WIBA 1N32B 1F8FA 1L4MA 2ENWA 2ZM5A 3DE5X 5AUQA 3S0JA 1VE6A 2XPCA 3FJ1A 5TQ0B 3P9IA 4AO7A 1Z12A 4DJDC 4UMDA 1XJQA 5E6RA 2ZIVB 1BDJA 4IDEA 1R8SA 1VL8A 2PWYA 2YNMC 3I0NA 1QDLB 3IAS6 4NU5A 4WADA 3S27A 3QITA 5CUQA 4Q3EA 3R8CA 3AGQA 1UMKA 2EYQA 4MW9A 4ATNA 5IF3A 5EC8A 4YQZA 2RIPA 1IJEA 2DECA 4E3ZA 3O26A 3ZN2A 5ED4A 3T9BA 1XDWA 1JG1A 4MQLA 1ECPA 1QOPB 2X5NA 2JJ2A 2WSMA 3E1GA 1A8IA 1SQ6A 3DCNA 4FGZA 4BECA 5LQSA 3V9PA 4HTAA 2QTVB 4OPMA 4DCTA 4ZYTA 3GMIA 3SQDA 5A0FA 3ZY3A 1VRVA 3WLIA 2JFZA 2AG1A 3RAFC 3V8MA 3IIMA 1G8AA 4PXYA 2NXWA 1DFGA 4YMSA 3NDBB 1E2GA 4EO9A 3QVKA 4D92A 2CLOB 4FWIB 5HUHA 3E03A 1EVQA 3FSRA 2X40A 1VB3A 3JD0A 1S1CA 4J0DA 2AZ4A 3WNDA 4AP5A 1LFAA 1AS2A 2GF9A 3TK1A 4BTLA 5LP6A 1GDTA 1CIVA 4Q5IA 4GEKA 1Y9DA 1GN8A 1DKLA 2LR0A 2VQ6A 3EASA 1YVEI 1I3OA 1L5YA 2QT1A 2G82A 5MGNA 3RBXA 1PJ4A 4Q4AA 4ALIA 4KMOA 2NT3A 3K32A 4OL9A 3FNIA 1MTOA 3KUKA 1KAMA 1DKNA 1GR1A 4EPXA 2Y2VA 4XH9B 5K09A 4O6VA 1CG6A 3Q7IA 1S5PA 2R3SA 5M34A 1E6CA 2A5YB 3CX6A 3EZ2A 3HG7A 4WTOA 2Z0MA 4YMTA 4JBHA 1LC3A 1J0CA 2ZFUA 1PVVA 1MO5A 3H84A 2DTEA 1BMFA 1U3GA 2H00A 4OLHA 1F6DA 4PM4A 5IXSA 1KH2A 1NNSA 3DNPA 2A14A 2QAIA 3KX2A 4LN1A 1E1KA 4D8TA 5D5HA 2R1VB 3HSSA 3CVUA 1CY4A 2W6NA 2VZ9A 3OFND 4P4TA 2IF2A 3K4HA 3H16A 3N3AC 5FV7A 2PFKA 3WO0A 3JWGA 4IGAA 5A03A 1W0JA 4P81A 2MT9A 3OECA 2VAPA 5HF8A 3R76A 1DBWA 3ONWA 3CT4A 1Q50A 3DZGA 1FL9A 3FTQA 3I37X 4WHMA 3RUPA 1KXJA 1C0KA 4LDAA 4GOND 1Q19A 1M54A 3QEJA 4GQBA 2FTKE 4PC1A 1C7FA 5DYYA 4FINA 2HFKA 1KAHA 1ZH4A 4MRRA 4UXHA 3VGPA 5DYTA 2ZIWB 2PJRA 4L5CA 1JQAA 3NM5A 4EH1A 3T15A 2AR9A 3LO8A 3EUWA 5ADWA 2A94A 3R7FA 2QJTA 2A5DA 2FKNA 3QP9A 1HYQA 1XZMA 2Q0XA 4RETA 1Q15A 2FSFA 3HY6A 4W7SA 3GFPA 3SLKA 4JIGA 4TLBA 2NUAA 1BWQA 3K35A 4YQYA 1JJ7A 3IP1A 4GOOD 4H18A 3EXHA 2HV8A 1ZGJA 1OH7A 4U6QA 2WB4A 1CZNA 2I03A 2MSDB 1P2VA 1PR4A 2J8ZA 3B1WA 3FFTA 3HVUA 4HK4A 4MA5A 3BGWA 4R2LA 3SQWA 1HOTA 1XDGA 2Z2ZA 2HNBA 4LHYA 4O5AA 1BHSA 1PTJA 3DOUA 1X92A 4I7EA 4JSRA 2PLWA 5EJ4A 2CL7X 1PN3A 5BSTA 3W4JA 3E61A 3IOCA 3JWIA 1EX1A 3WICA 3V34A 4MV4A 3WJ7A 3UPTA 1I94B 1K6JA 1Q0TA 3SYRA 3BA6A 5GJBA 2G6BA 3U4IA 2DKFA 5I9TA 2JHFA 5DISB 1KIMA 3PD1A 3EQ6A 1AJEA 1CS0A 1NLUA 3BERA 3DZFA 4KXNA 4E32A 1AHIA 3WLKX 3U37A 2D0IA 4LW8A 4FI3F 1GYPA 4KLCA 3GEIA 4GF5A 1ZLYA 4GLJA 2Z2IA 4OHMA 4X3CA 5ELMA 3T3GA 4GX0A 4JVMA 4OFXA 5FEMA 3BE8A 3AGPA 2VP5A 3VSAA 1XVAA 2QORA 3QXHA 1QQAA 1WW3A 4L8LA 4PLGA 1P4JA 4LX8A 1R15A 1I36A 3C6QA 2WMDA 5B7GA 2GUWA 1T3SA 4NNJA 2C7OA 2X2FA 3T4EA 1Q7TA 2FEKA 4B7AA 3C1AA 4IPTA 5KPJA 4AZVA 1GNLA 2ZCJA 4BTEA 4D6XA 1D1PA 1JA9A 5L7WA 3DEIA 4G0ZA 3FVWA 3BFVA 3HHEA 4I5FA 4K9KA 3U1VA 2VHYA 3LKDA 3QY0A 2VCEA 1V71A 1GYQA 3KELA 3ONNA 2XUAA 3HXLA 3UB4A 4EGAA 1MTZA 2B2CA 3C7AA 3GZTB 1FBNA 2R8RA 1P0MA 3IHWA 4JT8A 2PX8A 1RKXA 4HWPA 3A3KA 4FGJA 3DYIA 4U00A 1TPZA 3GRCA 4RVOA 2VJKA 4HDOB 1YONA 2VJYA 3TOVA 3S55A 3L6OO 4LRSB 1L8OA 3G1WA 4CM4B 3X2FA 1SHUX 2ZIXB 2XT6A 1TVKA 2QMQA 1KETA 3Q9NA 3T7SA 4XD7D 3VH3A 4YRLA 1I4DD 3S2SA 4CT4B 1IFXA 4LRXA 5AUNB 3BJZA 3U61B 2FN4A 1I4LD 4CKZA 1ORTA 1UDBA 1QX4A 2FRDA 1ZUWA 2IIVA 4OVKA 4KO4S 1ZK4A 2OV2A 3CVJA 3STYA 3ZPXA 1EZ4A 2QGZA 4U2DA 4E2XA 4XSHA 4ND4A 1JXMA 4LIPD 4PANA 1RXSA 5JDIC 4EEXA 1QTIA 2AV6A 4MIYA 4QQNA 1HFEL 2QI9C 4EYOA 2N42A 4QQKA 1XU7A 3DPIA 4PHHA 3EBPA 4P0QB 4DCVA 3A4MA 3JZDA 4Y9DA 4MWBA 3PDIB 5CHYA 2VYVD 4CM3A 3UICA 2X0JA 3G0HA 3HP1A 4JN6B 3FTPA 1BIFA 3B53X 1M6YA 1MZVA 4JQSA 4R8RA 3E48A 4M9CA 1W35A 1P81A 2FFAA 2P9CA 2MSEB 3BKWA 4I66A 3JQFC 4WZAA 5DGCA 3ETJA 3VAYA 1K75A 1Z6YA 1ZNZA 3A4LA 3P0IA 5JSHA 2VTBA 1YB2A 1TL7C 1P8JA 1EFKA 1FFEA 3RUHA 2GF2A 2CEAA 3L7KA 3BCUA 4FN4A 4I5EA 4D4HA 4TUYB 4DRYA 3A1CA 4DV0B 1BE8A 3W6ZA 4BXOB 3W5IA 4MCIA 4IUCS 3SXJA 2BEWA 2YIMA 3ED1A 1P2SA 5JQGF 2XNJA 4X1KB 1AKWA 2I8AA 3KB2A 3HN7A 1GU7A 1PAUA 2G7ZA 2RK4A 3CX7A 4FYMA 3RKSA 5LQUA 3KYIB 5CB4B 2QLTA 1M2KA 3CG4A 2GYVA 1MDBA 3PJFA 5EE9A 4BKUA 1EJBA 1MEEA 4O0MA 4RTNA 1CSEE 1G60A 2WPDD 5BVGA 4LZOA 2I7CA 4I1OA 4C01A 4CF7A 4NCNA 4QICA 5BSMA 1X2EA 2DBRA 3FMIA 4COKA 3WNBA 3M1LA 4CKEB 4EFLA 4W5QA 2IS1A 1FC0A 2BLNA 3QX9A 3FGOA 1GNSA 3FSGA 4BCCA 3LUBA 1G20A 2DHCA 1Y4SA 1H2BA 3C97A 4MP3A 4IGKA 1DV2A 2VP0A 4LHSA 4PSAA 3M6MD 5J5AA 3AOGA 4ZVOA 2I6FA 4QOSA 2HM7A 2XKAA 3E35A 3MCUA 4OLBA 4PGFA 4QOEA 1VE1A 3NT2A 4LAFA 2G70A 1AKUA 4G9GA 4BGIA 1FVHA 2QWXA 2GZHA 3OAAA 1BQEA 3OIVA 1HYBA 3T7RA 4C14A 3WO1A 5F5XA 1AZTA 5EWLA 3DWEX 3VAZA 2LP4Y 1OWPA 2CEKA 1XD2A 2XE4A 3ET5A 3FDFA 4XB1A 1ST2A 1IHDA 4TS3A 4XOIA 5DHRA 3L4KA 3C1TA 1PSWA 1JKXA 4RHUA 4C0QC 5H1YA 4G5QA 2GBFA 3VZCA 1YZQA 1DAPA 2L18A 3LOPA 1QGAA 4GICA 4RV4A 3CH5A 1O96A 2A9RA 1F3LA 3D5TA 4C29A 4FCWA 1P1BA 5BXYA 1ZFNA 2W48A 2POQX 4II2A 3R7WB 3OQNA 1AF4A 2XADA 3H87A 4KB5A 2X15A 2PAFA 2ZSJA 1DXHA 4M21A 3FY4A 4PLCA 4MQMA 4QJ4A 3T7IA 1EBUA 1XVUA 4EPWA 2D8AA 3E2PA 2QGFA 1HLPA 2MOKA 4RIFA 1GL7A 3DF9A 2FVYA 5CH8A 4Z3DA 3TLZA 2WUFA 1C41A 1A8PA 2FPRA 3NAQA 1UKEA 1UK8A 3Q8WA 4LVCA 4FHCA 1UOEA 4MJ7A 5KOJA 4M9RA 4BNMA 2PK3A 2QSZA 5ALDA 1HR0B 1K6XA 2AK3A 1I7NA 2WSSA 5C2JB 2Y0CA 4REQB 3RFCA 5L40A 3IESA 4K6HA 1F8UA 1BXRB 4MROA 5FPPA 2E55A 4ZCRA 5BT8A 2C2YA 3B6JA 5DHTA 3LUDA 2GN2A 13PKA 1C7JA 2RGWA 1HBJA 1R5OA 2GARA 1Q0PA 4XYMA 1MQSA 4A2PA 1XTUA 4M1KA 1EXMA 4BNVA 1MJFA 2VPPA 2J0SA 4P32A 2X2PA 4H08A 1E5LA 1EWKA 3AEUA 5AOVA 2HHJA 4MKIA 2ZJ1A 4QULA 3VTZA 3Q5GA 4BMOB 3PXEA 2CDNA 2DPGA 1M2NA 2WYUA 4M1MA 2I6TA 4UARA 1ZBQA 5EMMA 4OIFA 3A8TA 3S1AA 1B8VA 2B36A 4Y67A 1B41A 2IU6A 3WWZA 2O2SA 4MJLA 5TQJA 10MHA 1NUSA 3P96A 4IV8A 1VE5A 1LDMA 1NVBA 2QE6A 1P7WA 5K8LA 2FN9A 3PYLA 5KX5F 1WNTA 3FF1A 1FTQA 1OJLA 2PPLA 4IHKA 3AT1A 3DZHA 2C31A 2WJVA 3P9QA 1U7PA 1T1GA 5AVZA 1RYBA 4B0PA 3AP2A 5FEUA 4YRGA 2R4QA 1WY7A 4KFRA 4DLKA 2PU5A 4OGGA 4M7RA 3L92A 4WKCA 5KYUA 3T7AA 4NZPA 3ZYCA 3IMEA 3DP9A 4ER7A 5JJKA 4AW9A 4L7QA 4COOA 3V55A 3N53A 4Q7KA 4RVNA 2WHPB 2B4AA 2ZJ6A 4EBBA 2C3PA 4LXGA 3DEHA 5EIXA 3A4TA 4MVJE 2ZR9A 1QBGA 1V3VA 4L4YA 4UJ3A 4ZT4A 1NFFA 3SKYA 3ZD8A 4D9HA 1F8YA 1QG4A 2R7LA 2W22A 3C3WA 3IODA 4GKAA 5AW2A 1E63A 2MTBA 1IXKA 3PDWA 5E8RA 1IBMB 4R0VA 1P6XA 1EA5A 2IEBA 4Z7JA 4H31A 4YP1A 1IQRA 4WLVA 4QLBA 1PF7E 3Q0EA 1QH8B 1CY6A 4FT2A 5FUWA 5L4SA 1PLJA 1LQUA 2VBCA 4PLPA 2WNIA 3NT5A 4KIJA 3WXBA 1BZYA 1DT5A 1F4VA 4I9UA 4QNMA 4TMFA 5CX1B 4RESA 1D5CA 5EZYB 5H80A 2ORIA 2P91A 2Y1GA 4E1AA 5C8YF 2OYRA 1JEOA 1SCJA 1UFRA 2CFTA 2YINC 3KKMA 2P7IA 1AO3A 3M6VA 4GGPA 2F1JA 1T6ZA 4ZP1A 4AJJA 1D6JA 5BWBA 2JL1A 1JNYA 5D5PA 3TSCA 3KFVA 4YAGA 5IM4A 3BRSA 5D2CA 1KZ4A 2JIMA 3ZWMA 2QXTA 3UPUA 2EFYA 5ILGA 3FLMA 4G0OA 4HDNA 2XRMA 5JVDA 3T3OA 3U39A 1YB5A 4ZOCA 5E7JA 1KYXA 4NZNA 4R16A 1KI4A 3I72A 3GGJA 3NDRA 2OGWA 2YHIA 4FYHA 4PGAA 5AM0A 3B78A 3MPUA 3T1VA 3QNUA 2CCKA 2JD0A 2FWMX 4OP3A 4H0CA 1S2OA 2ZATA 1QWSA 5FWYA 4KPEC 5DHSA 5CFLA 1BC5A 3R5TA 5KTTA 2W4QA 4YRNA 2R86A 1XP8A 1Y5MA 5TMPA 1W87A 4J91A 4U7PB 5AJHA 3ST7A 5P8WA 1Y3DE 2X22A 3FPHA 4ZIRB 3M83A 2A9PA 2D2XA 3WJ1A 1PDWA 2C4NA 2NO1A 1OT5A 2J3KA 3A0RB 1IN6A 3HL4A 4JJEA 4NFLA 4IIJF 2AFHA 3KKNA 4IOLA 4QELA 4L27A 4L8VA 3JQ6A 2ZUWA 1DPFA 4YV1A 4O1HA 1BEEA 5A5VA 5C8YB 1IUOA 1Y3FE 4BIMA 4OB6A 3DTNA 3OIYA 2CJFA 1J33A 4LJ4A 4BO8A 2RIRA 3BTVA 2H08A 4HT3B 3QJGA 1EFDN 4J3JA 3NYWA 4BVLA 5BW4A 1MR3F 2Q2NA 4A8JA 1Z6TA 1OIXA 1EUDB 1E2NA 1WIWA 3PI7A 3O92A 4CTJA 4YDHB 1UDWA 4PPFA 1NONA 5IXJA 5JNRA 3ABOB 2GKGA 2ILTA 3PG5A 4A0GA 1T2VA 1YTUA 4YJKA 3GZ4A 5SY6A 4DTIA 3IR7A 4NVRA 3DB1A 2OTCA 3EVNA 2FSUA 2GN0A 3SWWA 4K9NA 2XCRB 2I99A 1OBCA 3K2QA 2CLLB 4TL9A 2IODA 2GETA 1EB9A 2VDVE 4AECA 1V9LA 2VHCA 5T3YA 1NPDA 2H1FA 4S12A 4YDSA 1IOWA 2OQVA 3SZRA 4BMZA 1DBQA 2GZAA 2B4YA 2B2XA 2HRBA 2BJVA 5ALSA 3G8CA 2JATA 5CDTA 5DEIA 3JR7A 1UT6A 1YQ9A 1H6AA 1SPXA 4NYJR 3VUFA 4DDVA 2ZKLA 1EQAA 1OA1A 1MABB 3C8HA 3N8DA 3K5WA 4DXHA 1PBNA 4ZWNA 3PKJA 4YO8A 5HZGA 1FX0B 1VGQA 1C8KA 2A1UA 2ZUUA 4OHKA 3CN9A 4Q1FA 2EFJA 1O95D 2CVPA 1DSSG 2NYAA 3EOBI 2PH5A 3HKDA 4HB2A 2JH8A 4C6TB 1FEZA 1J2JA 1NY5A 2QRNA 3B70A 3OPXA 4IY1A 2YRXA 1R5JA 2ZDHA 1ZGBA 3OTWA 1OV6A 5A5DA 1MORA 1SC3A 3B8EA 3STWA 3NJ4A 1USWA 2XSZA 4D56A 2W8BA 2XMQA 2A9OA 4KH1A 1ADCA 1P62B 5H8WA 3H4IA 5LKRA 1JJIA 2C7VA 3DXZA 3U9TA 3UMJA 4DQLA 2PJUA 2FSSA 1WXWA 1ESEA 1AQLA 1L5GB 3F7NA 4RK5A 5B2FA 3FWKA 2ZTUA 3L6RA 3MLAA 1JECA 2W0SA 4GR5A 1R7RA 2CC2A 2DPXA 4MS1B 5GZ6A 4JNCA 5ILQA 4A0SA 2O05A 4QYXA 1KYYA 3U9SA 2FZVA 3LHKA 2W8ZA 4PLTA 4HI0E 1Q6ZA 4HEQA 4R6XA 1TQ6A 5CIWA 2WRZA 2QEQA 4ANFA 3C6BA 3CRVA 3II6X 3UK7A 1W4CA 5DO9A 3SNHA 1L9XA 2FWIA 2BZ1A 3ZK8A 3K4PA 3CLHA 3OA0A 2QN2A 3CLSC 1DOHA 3AW9A 4HGOA 1HZJA 1NVFA 1AZWA 2H63A 2P78A 1Y82A 1Z0FA 1M76A 2ZOSA 3KT6A 1JSRA 2RGBA 5K2OA 2GR9A 3OPYB 5E95A 1KVSA 1RAGA 4PZAA 1DAIA 1G63A 4C7OB 1X80A 3A32A 3WHKA 4A1OA 4EG8A 4BFZA 1R6BX 2HB6A 2O14A 2BDUA 1JMVA 3PWSA 2IUSA 4M53A 3EEQA 1VC2A 3ZEIA 3DOCA 4FZ5A 4OM8A 5H02A 4B3FX 1ZGHA 4CNBA 4G5SA 4BO0A 2X14A 4XR4A 1GLNA 2J6HA 1IUPA 3NB0A 4OD0A 3LGAA 4ZARA 5IC6A 1OROA 4EW2A 4YIHA 3ACBA 4MS4A 4UNIA 5ES4B 3PQ2A 4BKMA 4Y1FA 4JZYA 4FLFA 1QNLA 3LDFA 1JILA 1QP8A 1W85B 2R2AA 4IUDS 4QHTA 1KEKA 3FOZA 2V74B 3SF8A 3BORA 1U4NA 3T9AA 1KRXA 1F6WA 2HHCA 3LCRA 1TD9A 3VHXB 1J2UA 3DHYA 1UBSB 2I6SA 1ZGAA 3RBZA 1GQOA 2C77A 3CPHA 4B33A 4DAEA 1CRWG 4ZO7A 1WKBA 1WQ3A 3GP3A 4TL7A 2ZT8A 3VDQA 5I7UA 1EIWA 2OMEA 2JFNA 2QL7A 3PFWO 2OCXA 1T3HA 1PWHA 2GN6A 3WLSA 2GVDC 5CAEA 4DMRA 4DPKA 1ZINA 4NFYA 3LUHA 1ZUHA 3MSXA 1K06A 4LV6A 4FFMA 4Y2UA 5JVDF 1XQXA 3VDNB 1DCFA 2D2FA 2FR0A 1NKSA 3ZCPA 1E9BA 1OPRA 4EWLA 2V96A 2WC1A 1CY0A 1JHUA 2FE1A 3CUVA 5C8VA 2WYHA 3VV2A 4WY8A 4M87A 1LDYA 3GMTA 4JB2A 2IL1A 3HFJA 2OBYA 3OVMA 1KI1A 4QU9A 4DSUA 4N5IX 1QX3A 2CSUA 1SBZA 4NJMA 4DNPA 4F5WA 4WI1A 2I3GA 4QVGA 4EB6A 4DN6A 2C2XA 4OBWA 3WBBA 3NTQA 1L4NA 2FZ5A 3TB4A 4A0HA 5A5EA 2IU0A 5LP1A 3OX2A 2R60A 1F1JA 1C9JA 2PS1A 5JNUA 3ZHZA 1WXXA 3QYAA 2EZ9A 5CM2Z 1NDQA 3IP8A 3EYAA 5IEBA 1OT3A 4R69A 1F2TB 4D5GA 4R2JA 4U0JA 1QZTA 4JBWA 3LXMA 3QX8A 3MUEA 1AURA 3HPRA 3OLWA 1HX7A 1P39A 2PNJA 3OZDA 4OXKA 3WLJA 1O0SA 3GRFA 3R1IA 4KEAA 2YXLA 3ZYZA 4J0KA 4IWYA 3H9EO 5JXHA 4MULA 4F12A 2BP7A 5FA6A 5HCUA 2ANBA 3KKOA 5IARA 3ABIA 4D02A 2Q4RA 4FOTA 1AKNA 4UBIA 3TXXA 2NPFA 3BDAA 2WE8A 3EXEB 2WD7A 1AD2A 2NTYC 4LCBA 5C31A 1T5HX 1TM5E 4CM7A 4YECA 3SHOA 4M0CA 4NENB 4L5JA 2ADOA 1RE1A 1UODA 2PV0A 3LQQA 4NYIR 2C4KA 3FCXA 4CLDA 4R68A 1V3UA 4IJ5A 1UJ2A 4DG5A 4EO4A 1GGVA 4LZZA 3HJAA 3KQVA 4WCDA 1RWOA 3HE3A 5FULA 2JIDA 4WNCA 3LKBA 4FYKA 5EKXA 3TTVA 3AESB 1QP7A 1KH3A 2IIQA 5EI5A 3DYBA 1A9QA 4AJEA 1QIDA 3UC5A 1Q3HA 4DGQA 1N3YA 4D9JA 2ZRMA 3RBAA 3VU9A 4PO8A 3EGXB 2OM2A 1RRFA 2IPMA 3RVMA 1DRWA 3R9KA 2ONKA 1Z36A 4OP1A 4TWBA 1LBQA 5FI3A 2CBGA 2B21A 3OP1A 2VR1A 4PYQA 2HMWA 4LBVA 1L4GA 2WYWA 3MTGA 2GCIA 5AKIA 1E4EA 4G07A 4BFCA 1MX5A 1RIFA 3EW9A 4TN5A 4WZBA 4IKOA 4FIZA 4FYJA 3OZIA 3PUIA 3HVKA 2P7HA 1QPBA 1TJYA 1THZA 1ADJA 5ECWA 2ZE6A 3CJTA 1YE5A 1E7WA 3MGKA 4YPFA 2IZOA 2XT0A 3NUZA 1M34E 1RBQA 3OKCA 5DNCA 3LUKA 1D4ZA 3TR5A 2P68A 2V9ZA 1WM1A 4LC0A 4LV5B 1UIRA 4RZUA 3AB8A 4QJIA 1MFZA 1D1QA 1HG0A 1T0UA 2VDJA 4KVZA 3RVNA 2Z2YA 1M7HA 1CRZA 1FJHA 3JALB 3LDHA 4EEKA 2I2XB 2QSJA 2H1RA 3FTNA 1QAOA 2EKQA 5ER6A 4MDEA 1U8FO 3EUAA 1OYWA 1IATA 1SCBA 5HWSA 4XA8A 4HRXA 4ZVKA 4WWHA 2P0YA 1BKYA 5FFFA 2QZZA 4I36A 4B5LA 4IBOA 1N2ZA 1OW3B 1E5XA 1VMEA 4LWOA 4QFDA 5HNKA 2DGDA 4N54A 3HFSA 3NHBA 2P2CA 3BWVA 4BO2A 1GEEA 1NXSA 4PR3A 4CDMA 5C32A 3CX8A 2WEKA 2ZYUX 2GQ0A 1D8AA 1L4YA 4I3FA 4OCZA 2ZUFA 4CM1A 2CNKA 2NNWB 4WKGA 5GM1A 3C3BA 5DGXA 3K9QO 1SVOA 5IYZF 2OYSA 1QLHA 3P1JA 4E46A 1IXZA 1RZVA 3BRQA 2NU8B 3KLMX 5B57C 3L7LA 1EM6A 5JD4A 1NVAA 3EDYA 1N8KA 4LHXA 1DCMA 1JDZA 4PX9A 1C4OA 1YVDA 2W6CX 2C78A 2VDPB 2P9TA 3ORSA 3OPMA 1MD9A 1YS9A 2A5JA 3NBQA 1G5IA 2UAGA 4XWGA 3A9VA 4WFKA 1J8FA 3FWNA 2LKCA 4B4WA 3CGWA 1FZQA 5HQ3A 1TAHA 1YE3A 4YMHA 5IRCD 2IYSA 5EP4A 4CMCA 2EQAA 2QG9A 1N5DA 4M8IA 3M0EA 2QMUA 3TW0A 4Y2GA 1AIPA 5IJ0B 5KSZA 4OGLA 3GROA 4YONB 3R7NA 1SG0A 1T9ZA 1S8AA 2O2CA 3EN0A 3DFFA 2D2IA 1PQ4A 1TAUA 2O0LA 4NU8X 2IYWA 2BBWA 1N25A 1CR2A 1AC5A 3PEWA 1OFUX 4CR7A 1LD3A 5HX7A 4IXTA 1D7OA 2CXHA 4RKRA 1U31A 2R1UA 4B6EA 3D64A 3LNTA 4UAGA 1JEQB 1W85A 2OVFA 4ZA2A 3TQFA 5ALZA 2RGDA 3E70C 3H3XA 1EFAA 2Z08A 4CCAA 2QBYB 5EXSA 2QA5A 4AG3A 3ROXA 2H7VA 3GLTA 1NBME 5FFMA 1QYVA 2EXXA 2QRVB 4EA8A 1SUFA 2J3DA 1JQ5A 4IIEA 5C53B 1SKMA 2IA5A 5CT4A 4YJHB 2HWYA 3CINA 3D6JA 4RD6A 2JLXA 4DOMA 4IXDA 1T6NA 5D86A 2FH5B 4UTVA 3ABRB 1RTTA 3LCCA 4CCYA 1F0NA 1P7VA 1K63A 1DKQA 3G2JA 2ODPA 3UFXB 2N1MA 3AHIA 1US8B 4KQGA 4WOKA 5CYGA 4JI8B 1LK0A 3HB4X 2DQSA 2GESA 4GP7A 2X0IA 4HOYA 1WU7A 4B32A 1YUBA 1O7JA 3H97A 5FUQA 2A9QA 1L5MA 3PQFA 3KUDA 4ID9A 3UWKA 3LUCA 4M9XA 1NBAA 2GERA 2MYPA 4ZRDA 1Q7RA 5TNXA 3ROPA 4UOZA 4Z2AA 2ATVA 1JTVA 1O03A 3NTXA 2ZRKA 1Q0RA 4P08A 3G5TA 3SBEA 1QFMA 2B9VA 3KSDO 4QBFA 5FOUA 2HIGA 3H4MA 4HDNB 5JVDB 3VHRA 3ZDRA 4CZ2A 3DYVA 2IUFA 2V8BA 1LLCA 1M2HA 1IPEA 1DAFA 3G2NA 1B26A 1YCHA 4HTFA 4R81A 5B6PA 2M6SA 3OBIA 3NHJA 4IIFA 4JU9A 4EY4A 2HWXA 3BUSA 5AW3A 2ZUEA 1OI7A 3TQRA 1I3NA 3NLLA 3CTPA 2FRVA 2VP2A 1A1SA 4QLAA 1GGEA 4CDGA 1K08A 1U7DA 3FNQA 2OOSA 1G4AE 4C4TA 4Q4CA 1QTQA 1X9HA 1H6BA 4FQ7A 2ZAYA 1XQ1A 3HA3A 4IZHA 2YZKA 1OAAA 4RA6B 3VYWA 2PZEA 3BTSA 3CEPB 1D1TA 2X2OA 3FFBA 4NBNA 5CIQA 2PE5A 4Y9TA 2XWBF 1C30A 1P2UA 3OFJA 1OMOA 2X6RA 2B8WA 3GJZA 1G7SA 4G4GA 4LNUB 5LD2B 2AEFA 1MAAA 5K20A 4F2GA 2G04A 3QFFA 4LZAA 4WXPA 1EBBA 1SO8A 2PS0A 2I4OA 4LJLA 2FOIA 3U40A 4OXRA 2PGLA 5FB3A 3UIEA 2FZ4A 2F8MA 2VH1A 4S04A 5IH3A 2XUGA 3PNKA 4QJBA 2VP9A 3OE4A 4BFLA 4EJ6A 3TZEA 4LVOA 4RH0A 3IP9A 3AFHA 4TSFA 3H3JA 1JDJA 1V45E 1YOBA 4U8HA 2QLJA 1QJCA 4BKQA 3IEVA 1CY7A 5E6UB 2AOVA 3C5VA 3H42B 4RVDA 2QJFA 3NAMA 3F0TA 2CMHA 4XFDA 5I4BA 3JTMA 4JQCA 5LZ2A 5JFGA 1IY0A 3FBWA 3PGXA 4X8OA 3U0BA 1MC8A 4OTZA 4UTNA 3DFMA 1PKXA 2BR3A 2OAP1 1ZM9A 2Z1NA 3VJMA 5BOSB 3WGTA 4CL0A 1Z7GA 2ATCA 1UINA 1Y7TA 3EQ9A 1RKUA 4EHAA 5I9LA 4DY4A 4WBNA 4XIFA 1Z0AA 1SVNA 2AFVA 3P2YA 4W63A 4FDLA 4E88A 3MOSA 3QPWA 4XZ3A 1QQTA 1X39A 4LYGA 2X5OA 5KHOC 3RI3A 3LBNA 2GKSA 2ZRAA 3D6TB 3JARA 3ZIAD 2DULA 4P82A 1NIPA 4MMYB 2FR8C 2WFMA 2GN1A 4AQYB 5EUMA 3F9CA 1N5MA 2VSOA 3R7SA 3VUEA 3GVHA 1J2YA 3R3VA 1H9CA 2WUGA 4B8ZA 4DYHA 2WPNA 3E9RA 1BGVA 4LK2A 4M22A 2COKA 1ML3A 4WESA 1BD4A 1YI1A 2HNAA 5AQ1A 5F77A 1VMIA 3AKYA 5F2NA 5KYKA 3NDJA 4FCCA 4ND8A 1ECGA 2Q5IA 2WFZA 4QO8A 3USCS 4EBFA 2OGZA 4M0LA 1IHXA 1XRPA 4LKRA 4RUKA 3O83A 3LQ4A 4OJYA 2VNHA 5K8TA 1HETA 1Y5RA 2HLNA 4HL6A 3GP5A 4QT4A 1I3CA 1HFJA 2AHOA 4HAIA 5KCMA 1XRMA 3MXOA 4HB0A 4OGWA 1SVIA 5F21A 5G4KB 3WLTA 4H7DA 5JRDS 2ZIUB 3MWDA 3N39C 1AS0A 1SXJD 4MQEA 1OXKB 1DIRA 4PTYA 5FJIA 2I80A 1QYXA 1ZVQA 2AKAB 3LTEA 3PZRA 5C8DA 3PIIA 1Z2DA 1A2OA 3CUEF 1NRXA 4TKZA 3ZE0B 3W04A 4Q3AA 3Q7PA 2YXDA 3MWJA 3HKBB 2XZLA 1JMKC 3K6SB 4DW8A 3G0DA 4RTSA 1KKUA 1B1CA 3MTDA 1ZH6A 2G77B 4FFLA 3H04A 4QFCA 4AN0A 2BGMA 1J5XA 1LDBA 4NZ9A 1BWPA 4EDFA 2VFAA 3U44A 3H9GA 4ETIA 3COJA 2BBTA 1A4XA 4C4OA 1ILEA 5EIFA 2V3VA 3GH3A 5KU1A 3PD0A 4KR6A 3JWHA 2F43B 1A5ZA 3B9PA 4L72A 1TZ2A 1ZJWA 5B30A 2ZT7A 5GGYA 2G09A 3FX2A 4AXXA 3OE7A 4PZEA 1C9EA 4OQPA 5JS6A 1PJ3A 3NBXX 1E2BA 4MR7A 4M4SA 1E1DA 2EW8A 3CKLA 5CG2A 3PUZA 4RYDA 4C7JA 1N5JA 1L4HA 1Z5WA 4IHJF 1DKUA 1FLAA 2QLBA 4B9EA 4CMKA 4F71A 4IDPA 5FUMA 2JLYA 1PJRA 1P5HA 3F3YA 2YVQA 4MWZA 4RQAA 1KWKA 3T9FA 4HQLA 4W1QA 4JXXA 3OQOA 2PSDA 5E2AA 1IRXA 4YUWA 3PNVA 1RNLA 4MIKA 4NIMA 3OFNA 4ZN6A 1DDIA 2BUBA 4L8FA 4LZNA 4F11A 2H4HA 3ZE8A 1V5IA 4Q1CA 1L3CA 4AO8A 1QP4A 3FOEC 4FU0A 3E82A 1QVVA 4HNAA 2B69A 5CLLA 2Q0HA 3D81A 3HXKA 3UUFA 5BSWA 2QU8A 3IE0A 4RZ3A 2A92A 3TFQA 3W5UA 2I34A 3MOIA 1EP9A 1ATIA 3GDHA 4Z9FA 3I2IA 1H4VB 1YJAA 1IZ8A 1XP5A 1Z8DA 4WAUA 4JI3B 4ZK2A 4J9UE 3QBJA 4RV5A 3QYPA 4JY7A 3VISA 1J9ZA 1L1FA 4PZ0A 2FJUA 2BGJA 2IYZA 2LRHA 4KXXA 4NENA 3K05A 4YA6A 3Q2OA 1OZFA 4NU0A 4ZT5A 3RARA 4A9AA 2VDWB 2YZGA 2W0MA 4ZVTA 3O3NB 4ZVNA 3RB8A 1K68A 3NOVA 3CF0A 4AZSA 4F9FA 3G68A 1JR3D 3GPBA 2IRWA 3MUNA 1NNEA 2AG5A 2Q5HA 1QQBA 1R8JA 1AUQA 3AVOA 3OCCA 4V24A 4F1KA 2VAMA 2YC2C 9ATCA 1BS1A 3QEMB 3BMOA 4DHWA 3NQ41 4XEUA 4DZRA 1G3IA 1Q14A 2EKBA 3EIHA 3T9DA 1XMOB 5JFTA 5KVAA 1ZRHA 2Y1KA 3WWPA 1O9BA 3EVAA 4LE1A 4D8WA 4CI0B 5H70A 4DV1B 3DV0A 2G40A 4UOQA 4EHFA 5K4AA 4FFNA 4UCXA 5K8VA 2UYCA 2BF4A 4GG1A 4QAQA 1FYXA 4JQYA 5AJXA 1GU1A 1FUYB 4MUKA 2P2SA 2QX7A 4MGEA 4MW0A 5I7FA 2O5VA 1JDTA 2X41A 5DLQC 4LE2A 2QQGA 3DXXA 1ECJA 1SUDA 5EQFA 5JW6A 2QXYA 3ND9A 3BXPA 3BEDA 1YBVA 5EJGA 3ROQA 3W7BA 2XGOA 4ZAXA 2AIRA 1PT9A 2COEA 2QTVA 3WV5A 2YY5A 4EW6A 3K0SA 3JSAA 2XWQA 4H6VA 3E5MA 1Y1LA 4O1MA 4U6SA 4UCWA 3KYCB 3F6PA 5BRAA 3UN1A 3DGFC 4ZO6A 3IQIX 3R8FA 2Z1DA 3TLYA 4EECA 1A97A 4HGZA 5BN3B 2HWWA 4LY9A 2IZ7A 3A3NA 1HNXB 1HMYA 4WXEA 4W8GA 4ZHQF 1HT0A 4MYHA 2CXTA 4EOGA 4AKSA 4WPGA 2QYHA 2IHKA 1TCVA 4FWBA 4EAQA 1XXHE 1MOSA 2O2JA 1M2OA 3E2IA 3DL2A 3A9TA 3PUWA 3TVDA 1TUIA 1PUXA 2ATIA 4C2TA 3GUVA 4LMRA 1ONOA 2CL0X 1NXWA 4JBLA 3I9NA 2NGRA 2PEZA 2WHRA 2Q7XA 3RIHA 4OLAA 3D7RA 1U2PA 1XHFA 3QLVA 2Y1DA 4MYRA 5AESA 1OXXK 1M1ZA 3B6MA 3PP8A 2WLTA 1QYDA 2O7RA 3EE6A 1C7IA 2ZAGA 5KKNB 1M6VB 2H0QA 1F51E 4I4TF 2H8GA 3AJEA 3M5DA 3MW8A 1CDZA 1QHGA 2OZEA 3E2MA 3OQIB 5SZKB 4AKHA 2WYVA 2WVAA 4J0IA 4HLNA 4G01B 3BM5A 2J3JA 1MABA 2DBQA 2ZVPX 3HM9A 4H15A 3TH5A 4YNBA 1DARA 1RWKA 3B38A 3JVIA 4WX2B 4ZAZA 2W93A 1PGQA 1PU2A 3I6YA 1DJMA 1OLXB 1U28C 2NZWA 4P80A 3WC4A 2XUHA 1GSHA 1M0WA 2OP1A 4OBBA 4A8TA 3H6HA 1OH5A 2CJWB 1VI2A 4EVIA 2R65A 3LG2A 4FE7A 3H19A 4GR4A 3J7AC 1HDRA 4W5WA 4OMCA 4AJIA 2HPZA 2O8EB 4QSHA 3A10A 3R40A 4Q6WA 2RHRA 3UF0A 4BMPB 2AI1A 2QY6A 3IQXA 4BWYA 5K0JA 1FMJA 1QKKA 4KW7A 1D6SA 3DE6X 2IHVA 3R6DA 3BD8A 4IDBA 1H5UA 4PYKA 1KYZA 3VV3A 3P0FA 5G4KA 3FMOB 4YTEA 3UWSA 2VIIA 5JPDA 4KYVA 4FFBA 1G20E 5JISA 4OHXA 4YDQA 4BLQA 3PX7A 4E3WA 1BXZA 3KQOA 4URWR 3SHVA 4M7WA 1YS6A 3GGDA 3DLHA 1VQ1A 2IX9A 1BJKA 3RT9A 3FDIA 3AERA 1N57A 5ICGA 1AK1A 1ISJA 3NBUA 4JWTA 3PGMA 4FE4A 1H2XA 1POXA 3IXMA 4ZJZA 5IM4F 3W4IA 2P62A 3OJCA 3MGBA 4YP6A 3IBFA 2AUNA 3OCVA 4KGDA 4OP2A 4RIEA 1JA1A 1VKJA 3H11B 4FCVA 2DMRA 4U5XA 1R16A 3AJRA 3BBLA 3NWPA 4Y6RA 3SJZA 1XWIA 1JKJA 2XE6A 6ADHA 2Q1WA 3RTGA 3B1KA 4ENRA 3WP1B 1DAOA 1C9YA 3L82B 4RD3A 4F5DA 1LVGA 1V11A 3V1UA 3SSAA 1TKBA 2GO7A 1ANKA 1RYFA 5GV8A 1E1YA 2Q2WA 3DEAA 4MQBA 1TTQB 2OHHA 3IJRA 5GWXA 5K3CA 5HXAA 2OKGA 2B25A 1I0ZA 4DSAA 1XPUA 1N0HA 3CYFA 3L7NA 5DGTA 3EF3A 4URUR 4C9BA 2AEJA 1EFRD 4NYMR 4P2BA 5JR3A 5LLSA 2HA4A 3HVHA 3W8FA 1KAQA 1B6RA 3LYLA 3TS1A 1B3RA 3D8RA 1O54A 2I9PA 3D3WB 4PG4A 1M33A 4F0JA 1X7ZB 1GAWA 3HXQA 2WUVA 8MHTA 2Y93A 1D09A 3RU7A 3CN7A 1X7HA 1E2JA 1WBDA 1Z2NX 5HMLA 3G5UA 1KDOA 1BCRB 5L7YA 3TFWA 2RMKA 1T8SA 1N7JA 1W1UA 3TEJA 4U2FA 1WSDA 2GN4A 3P9ZA 4UM9D 4UDXX 1KEPA 3GT4A 3OLCX 2H2AA 1NW7A 2Q99A 1YQEA 2ZJ3A 2XCIA 3ESQA 2C2KA 2PX4A 2ZREA 3TNLA 3W1VA 2CJYA 1J2EA 4P35A 2E6KA 2WU0A 5DZSA 2GYWA 1C8VB 1DAGA 1ESCA 5M3BA 1NKVA 3NFRA 4NPCA 1MF7A 1W19A 2X8WA 5FWNA 3MXTA 3IE1A 3B5JA 2ZPAA 1Y6FA 2FA9A 1HG1A 1V8OA 2CUKA 3R3ZA 1J20A 4DCUA 3A6LA 3AV3A 3DE2X 5AVKA 3QMMA 1CJVC 2Q50A 5ELLA 1RYMA 4N76A 4ETNA 3F5DA 3BSFA 4JKYA 5I4IA 3DL7A 1XMJA 2FQ1A 1TW3A 1X6VA 4UHBA 1IONA 2WJWA 4BN5A 1PEDA 1JG6A 1PJBA 2BISA 2PL1A 3M9LA 1GT6A 5KAPA 3MWYW 3RIMA 3U7IA 3NTLA 4A6XA 4EI9A 1L5FA 4CMIA 3NV7A 1H8HD 1YFKA 1NXQA 5FO1A 5GZ1A 4FBMA 3LSTA 4TUYA 5HEKA 5K5EA 1YZLA 2P79A 3LIIA 4I6EA 3U6BA 5FL3A 4XSVA 1DXQA 3GBVA 1AMOA 1FQJA 1L1QA 4QG3A 2E48A 2FN8A 1YL5A 2BGGA 3BXFA 1T5OA 2X1LA 4LRUA 2YZNA 1JAIA 4YCLA 1GHTA 4FE3A 3FYDA 2E1PA 4C4YA 2AOTA 4Z8YA 4Y6PA 3VPDA 1BQ3A 5B1YA 4JEUA 1AN9A 1QOQB 1X7YA 2FP3A 1NE2A 4CQNA 2PMDA 1PJAA 4HMOA 1QFXA 4J03A 2CY0A 2I0FA 2IHTA 4YLGA 3THOA 3KXPA 3WMRA 4QRHA 4RJJA 1MPTA 1AA6A 1QO0A 3AV0B 2XX3A 3JQAB 3UAOA 2PV7A 1HYHA 1PEKE 4BNWA 2BCEA 1FXUA 2QP9X 1PEYA 4MVYA 3TVTA 4JMLA 2CV1A 1ACLA 1J25A 2CKDA 2ZJ0A 3P0JA 1SG9A 3A2LA 3KQUA 1V1JA 3Q5EA 4I2VA 5F2KA 1Z4KA 1GL9B 5ICSA 2X8LA 2PXAA 5CCBA 2CUTA 5CM9C 4LQDA 3MK31 2P9ZA 4RKEA 3PE3A 1TM2A 2PX3A 2ZE5A 1SA0B 3FHTA 1UOOA 3R0IA 3DFUA 4CG1A 4KPUA 1Y48E 2P9FA 2QTHA 2DCUA 5KQPA 1ZVJA 3KAQA 3EGVA 4N6OA 2X0FA 1DWQA 1LLDA 1V35A 2FJPA 1UT8A 5F51A 2GKOA 4K6OA 5IZ4A 2QUHA 4UKDA 1A9TA 1UBFA 4PC2A 1VE3A 1KI7A 5D1NA 3WRYA 5DI3A 4LGCA 1RD4A 3K0AA 2OSVA 1OCEA 5F35A 4H7PA 1EAMA 3FKJA 4BJHB 3OUZA 5JLAA 3ZWNA 2PCLA 3F97A 3NBYC 3D9QX 3ESBA 1FP1D 1Z17A 3IVXA 2ZRJA 3H9UA 3GWGA 1G2QA 1N2CB 5BMVA 1B42A 1FQWA 1M1YE 5DI3B 1A8QA 3IEKA 4MW4A 5JEEA 4HX5A 1Z4OA 1T4DA 3FCSB 3C85A 5GJVC 3VR6D 2R79A 4NK5A 4B74A 1KPGA 1V1MB 4G36A 3DZCA 3P19A 2HL6A 3ETCA 3HA5A 5E7QA 3TMAA 3IC5A 3ILSA 2HFJA 5KJ6A 4C2UA 2AFRA 4CEJB 2B34A 3OQPA 3KSMA 3I9FA 4D4KA 1Q1QA 2VPWA 5ICMA 4A2CA 2JW5A 3P0EA 3P4XA 3LFUA 1ZUD1 3KRTA 5H82A 4A0FA 1SFRA 4PBTA 3BMNB 1ZA2A 3EXFB 1ZMRA 3DDNA 1EG7A 1NN3A 1VRCA 3KHSA 3R3XA 4MQFB 2WIAA 3I52A 4E11A 5JC8A 4WKOA 3GOHA 5C4MA 2NAPA 2COUA 3DTYA 2J32A 3I64A 5COAA 5DP1A 2RBEA 3LY8A 1Z2PX 3INNA 4RF5A 3PB3A 3EEOA 3C3KA 1K3UB 5ALTA 2GAIA 3SIXA 1DJQA 2CFOA 4IUYA 1PW5A 4ZCIA 1ZO8A 2BFDB 2H9IA 3Q2KA 5EFZA 1R50A 3CR3C 1RAHA 3KAKA 5I4CA 2C4TA 4JBNA 4M9SA 2M2IA 4RMGA 3SF0A 1OOEA 5K3OA 3M82A 1COWD 2BEUA 1N6RA 1YU6A 5K4GA 2YIDA 3AUFA 4ES6A 4FFDA 3MMPA 3I4CA 3AJDA 2ZRIA 5L8VA 4ARUA 5JJBA 1O0BA 3PEUA 1ETHA 3PEYA 2J3HA 2JFOA 4Y0NA 3F1LA 3T5DA 3H9CA 2YOHA 3HVJA 4ZQFA 4X9XA 1L5KA 1LI5A 3HWRA 5TV2A 4C4ZA 5B12A 4QUBA 2WJJA 1K27A 5JO9A 2ZB3A 3DBIA 4ZCQA 4HATA 2IHNA 1E7QA 5CR9A 4CN8A 4DBZA 4HP8A 5J2UF 4W1RA 2MHCA 2Y99A 4ZJPA 1D6MA 3TOSA 3AL2A 1QCDA 3L7JA 3TZCA 1HH4A 4HNVA 1HORA 3AR9A 1YOVA 3WJAA 1ZJ5A 4BKRA 3W5BA 2BFWA 4W4TA 5C80A 1D6NA 2WINI 3FOFC 4KQ9A 1PK8A 4AURA 3NH9A 4NYIQ 5ITSA 2YV5A 4UVGA 1YACA 5ELXA 1MH9A 5KNDA 5KKAA 3PEFA 1JUDA 5AW7A 2GEJA 1BYUA 2GN8A 2W2KB 4YR7A 3M5PA 4TKLA 3CZCA 2JHGA 3UAYA 2AKEA 1LC0A 2FMFA 2EFEB 1ZMOA 2R5FA 3EFBA 5FWYB 1QFJA 4JFAA 3R0VA 4NARA 4BLRA 4C05A 3AR3A 3N2KB 1T5SA 3SG0A 1KJZA 3HJUA 4EI7A 3AR4A 3OURA 4UFNA 3TWOA 1K8XB 1OZAA 2JBAA 5ADVA 4B83A 3EXIA 3U0VA 3WK5A 1S3SA 5CVEA 5D01A 3TNYA 4TT3D 2IX3A 3A25A 3U7QB 3OEHA 3ORFA 3H1FA 4OQYA 5CIYA 3LQ2A 1CUYA 1K7FB 1R64A 2W5UA 1SUSA 3DL0A 2JBAB 1E69A 3AR2A 4ER0A 3I5YA 3ELUA 2YR0A 2I6GA 3KJHA 3KM0A 1SQSA 2V5UA 3TW8A 1BEUB 1DO8A 3E84A 2Z9DA 3R5KA 2JLBA 4FMPA 2WIDA 2BFFA 3EFOA 3ZHYA 1H3NA 3ANYB 5K0BA 2OB1A 4D81A 4R7TA 5I7AA 2CWDA 1L5LA 5KOYA 2PM8A 4J29A 1VPDA 5KYWA 1D4FA 4LS3A 3HXOA 1OUMA 3M1AA 3A4IA 4DCNA 5DU2A 5IUKC 2GBPA 3F6BX 1KORA 4I14A 5LNK6 1M6HA 2ZSFA 5LQAA 4KR3A 1KYTA 3RUDA 4ROTA 1XRJA 1Z2EA 3QU9A 5CVUA 4C0JA 3UAGA 4DVJA 2EKZA 2EKPA 5D3MA 3KKPA 3BDIA 3PDJA 4KKXB 3QELB 5LLDA 1M83A 3BK7A 5TQVA 3BWXA 3WLQA 3B6ZA 2JVIA 2PBRA 3QTTA 4AMUA 1U0EA 1YRQA 5IANA 2AXEA 3OZBA 1S8OA 2W6OA 4C7VA 5AW1A 1PR0A 1ZUIA 3H6GA 3FUWA 4RVFA 4WERA 5H81A 2IOQA 5TJ9A 4P5PA 3PZBA 4JBGA 4A5SA 4LF4B 1Q11A 2NU6B 1MO3A 4KV7A 3HNRA 1N2SA 5EHZA 2X6TA 1UMCA 3EZFA 3EODA 4DWOA 3S2IA 4I55F 4BGEA 5KVSA 3L6UA 3IBYA 1KZ1A 2X13A 2RGAA 5JO0A 4C3VA 3DZBA 1RKQA 1JB1A 3LP8A 1CKEA 5BR8B 3GLSA 2FETA 2WKRA 3UB3A 4DKJA 5FLEX 2OFOA 3BKXA 4RJTA 2JRCA 2IXFA 1D1SA 1Z0ZA 2ZRHA 3KZKA 3MGGA 1GY8A 5F3DA 3UFBA 2Z58A 1G2PA 1G8GA 421PA 2FEMA 2Z3ZA 4Y9SA 3REQB 2D1FA 1LVHA 3HY4A 5HKKD 3PYXA 1M66A 4PAOA 1SQ5A 3VR3D 2GASA 1LBIA 3K9CA 1VIYA 2CK3A 1IDN1 2WICA 2Y05A 3CPEA 3RAGA 1CHDA 3SIRA 3WYDA 3RO7A 1LDEA 3IP5A 4MS3A 5B2EA 2CZGA 1AQUA 4G4SP 1E79D 4K6CA 1PT5A 2JJQA 1WQ1R 3E7WA 2XKBA 1MB3A 4P3YA 3Q6MA 4ZQEA 3QUBA 1VL6A 2EQBA 2A0YA 3RF7A 1ODKA 3AEZA 4KQIA 1M2EA 2WF9A 4HXGA 4UQOA 3QU2A 4QOJA 3WGHA 5G4LA 2QUBA 4DDHA 4F1WA 2DP4E 4DUPA 5LL6P 1XXHB 2ACWA 1X8LA 5JG7A 5GONF 4OQXA 3IAFA 1ZN9A 3LHSA 4QARA 5TT1A 1FSPA 3I9JA 4DVGA 5JYEA 4IG9A 1Z0SA 3D8NA 3JASB 1PWXA 3JSXA 4MKRA 4CNQA 1M34B 3IEUA 2HF9A 3ANNA 5EHGA 1T9KA 2EGGA 2TS1A 1TRKA 2YNMA 3NPAA 1YC2A 3HQ4O 4LECA 4NESA 2OXIA 2HI0A 3N74A 4JJIA 1WWKA 4Z53A 4D25A 3SZGA 5A7FA 3ADDA 4KLNA 4Q01A 2JEZA 2RHWA 4KIGA 1T1SA 3EGEA 2XDWA 4HJXA 4OUKX 2HAEA 3EMVA 5AKJA 1ZKDA 1B8NA 3INYA 3SQNA 4IEFB 1KERA 2VDKB 3SF8B 1JKJB 1CPYA 2NN3C 4HSEA 4NLLA 1N6LA 4LRWA 1EP3B 3OTQA 1MQ9A 3ZE7A 3HKBA 1CRLA 3R20A 2AZDA 2ERCA 3NKLA 4EA7A 3UUWA 5BR1A 2X8JA 4TZ0A 2G9QA 5JS8A 2IOFA 3DQPA 1ORRA 1JHXA 3DO5A 2E2WA 3R77A 3TOZA 2HHHB 4GRIA 1COZA 4I08A 3I01A 1SUAA 3IBCA 1ZG3A 2XUKA 3W8NA 5DVZA 3U1TA 5BP7A 2XDAA 4FEEA 1NASA 2IOHA 2YV2A 3FD8A 1OWNA 3A6JA 4IZIA 4DLNA 1V95A 1OF1A 3K94A 4LI3X 4Q9NA 2ZIAA 1JXQA 3GFRA 1Z6GA 1QTRA 4ARCA 1JJAA 1U0SY 4B17A 3KOUA 3CVOA 4X1KA 5F73A 3U7RA 1KI3A 3P32A 3T9EA 2DRIA 4C4AA 3SE0A 3BBPA 1LEHA 3R44A 1LZLA 4LOJA 4O1IA 4XLZA 3ZVRA 2XGMA 3H0CA 5REQA 2JI7A 3BRWA 5KIAA 5F4ZA 2YN0A 5LYYA 5E3IA 2JARA 2NZXA 2EZ4A 5JALA 3MTBA 3BPSA 4FX5A 1K0FA 1OFHA 3VU8A 2DH6A 5GPBA 5DM60 5LD2C 2FPGB 3VNSA 4EHJA 2P4HX 3L7BA 1H4QA 4I0WB 3DZKA 2G8NA 4L16A 1EWTA 1WO8A 3ZCQA 2FLVA 1BGWA 3CLVA 4D82A 4MVWA 4F8EA 1T5LA 3E5NA 2IEDA 4RZIA 4CEIA 3ID6C 2ID8A 1U0GA 4WN9B 5EKDA 1U3VA 2Q1YA 3DOJA 4NPHA 3NH6A 4B34A 2RGXA 4L95C 4QQFA 2XMBA 5FORA 2B7BA 1E2FA 5FJJA 3SN6A 4ZGGA 4LF6B 4ZYZA 4BMNA 3IAS1 4X24A 3G0GA 2H7YA 1W5EA 1QGZA 2B94A 3USES 3E9YA 4ZODA 1E89A 1IEVA 1GFWA 2V5AA 4EI2A 2EHJA 4HEA6 2OCDA 5SYNA 2HCRA 1M8PA 2MJLA 2QAGB 3GBPA 4GHWA 5DBOA 1TVCA 2X42A 1EUDA 1M73E 2J9XB 3DBVO 3RLFA 5CDUA 3URKA 5EY5B 3ZWVA 1JVSA 3V4ZA 2QRQA 5KYXB 5EJ9A 4J3NA 4HPWA 4BZWA 1A04A 3GG2A 4KR9A 4TMYA 2LCQA 1GDDA 4CQMA 2YOGA 4JMPA 1RQXA 1KEVA 1TMGE 1PTJC 4NK4A 3WGGA 3R74A 1RC0A 1Z5ZA 4L4UA 3F46A 4OUDA 4BX9A 5I7SA 1DFIA 3ZJTA 1ZBDA 4XQEA 3S70A 4N3CA 1Z07A 1J07A 5ALPA 4BWFB 3USZA 1EDZA 5EXEA 4KDEA 2QN6A 4Q9IA 1NR7A 2FNAA 4ZDJA 5K45A 3FMVA 3TXAA 2ZRLA 2ZAMA 1E2DA 1AZLA 2GPYA 2VNAA 2X0RA 1M9NA 3EPRA 2EP7A 1L7XA 4ZYXA 3EVGA 3IAUA 5CMLA 4KWTA 4DIDA 2I6XA 2BM9A 1UF9A 1DAHA 4ERNA 1XZLA 3L6BA 1Y8RB 1J9GA 3LZ6A 5FBZA 2NP7A 3GRRA 2D8MA 4TZKA 1JR6A 2NQ2C 3WIOA 2V0CA 3S81A 3AEUB 2AD1A 4UHDA 4L6AA 5F98A 1CQPA 5KYGA 3LSYA 4IJ6A 4L3OA 3OLQA 4XGKA 3Q7RA 4JS0A 1OU4A 2QV7A 3AO0B 4ZEMA 2HUNA 2WA1A 4FCTA 3ZDXB 1XNRB 3FFAA 3PWZA 4G0YA 4JYPA 2EQ5A 1C4KA 2WTAA 3O7MA 4I50B 5IM5A 4CDRA 4ZZ1A 1T0JB 3MA0A 2B1QA 2AUTA 1T0IA 2JDID 1ZVKA 2VTKA 2WZDA 2FK8A 2LPMA 3A6EA 1JLSA 3B7GA 4KSCA 1ZL0A 3RK4A 4P34A 1Y9ZA 4M7OA 2DWPA 3KT8A 4W6QA 1DRVA 2WHXA 3EQ8A 2QE7D 2R66A 5CITA 5TPWA 4XLLA 4H59A 4OQMA 2JFGA 2YXBA 3HNOA 1Y8QB 5DTIA 2YOFA 5ITVA 1JSXA 1CK4A 4OAQA 3V7FA 3ZU2A 1BOFA 1FRQA 5CB6A 3E22B 3DFIA 1UJBA 2H4JA 4BVHA 1YDGA 3UAZA 1J4AA 2ZSHA 4BU1A 1KNQA 1QKIA 1XFDA 1O89A 2E5WA 3AERB 5CDHA 3VX3A 4CMJA 1U2ZA 2NZYA 3AUSA 2FRDC 5AVOA 2HMAA 1MJNA 2PSFA 2C4UA 4XGRA 3HVRA 2MU1A 2K6GA 3FE2A 4HWKA 4QFMA 5E9QA 1L7VC 3LT5A 6Q21A 1H94A 1RMYA 3UGQA 5CX1A 2YIJA 2XKJE 4LGMA 1N6HA 5CA0A 3M4XA 4EELA 4GOKA 3VVLA 2K2QB 1GA4A 4DSNA 3ABSB 2OG1A 1V8BA 3X44A 5F23A 5IS2A 1T6XA 5DGDA 1JW9B 3U62A 3DTVB 5ITZA 3EWNA 2Q9CA 2W6JA 3OM1A 5IZCA 1JVBA 1WU8A 2OECA 2IV7A 4UUBA 5ED0A 5E8JA 5IJ0A 1D4OA 3A6DA 2OC9A 4EKGA 3LK6A 2Q5LA 5KYNA 4GO1A 1KZHA 2PUCA 2IOFK 1XZAA 2ZU0C 3I6BA 2H0AA 4FFRA 3CY6A 4F91B 3SX0A 3R6GA 3KOOA 2P90A 4WGFA 1U98A 2ZXUA 4HC4A 1ZP6A 3BSYA 4YCAA 2X7XA 5EMLA 1YFJA 2K2WA 2QTFA 4BVKA 3AUTA 2C5FA 2ICAA 5JAQA 2I91A 3MMZA 2XCOA 1A96A 2E3JA 3AY7A 4B2IA 3MJVA 2PH1A 4J16A 2GCGA 2XD4A 2FCAA 5EPOA 3VXKA 4HH0A 1B14A 1EVZA 1DEOA 1DOAA 2G1UA 2G6TA 2X8JB 5EIWA 5HS4A 2R2GA 1ZU4A 3KJGA 2H18A 2JCYA 2XMRA 4KO1S 4RX1A 3O2NA 1HEYA 3QU7A 2WWGA 4TTSA 3PCXA 4WY5A 3WFJA 2B78A 3B52X 2BL4A 3HV0A 3NRJA 2VHEA 3F4KA 1R4MA 4KI7A 2FSVA 2MWMA 2ZUCA 3EPLA 2AMLA 5CGZA 1YR2A 4NMWA 5DLYA 1B93A 4RQTA 1D4AA 2JFUA 4N47A 2FN3A 4BNTA 4QOHA 5IVPA 5IDWA 2QZPA 2J07A 3L46A 2ZWMA 3WGZA 2OR3A 4BGVA 4WVLA 2CLFB 2ECQA 1C50A 3B8HA 1NAIA 1Y6QA 3FPFA 4MR9A 5ITWA 3CSDA 1BX0A 1IPHA 2BEWB 5A04A 5DCLA 3HJNA 5K3FA 1L4EA 3KVRA 6REQA 5JUWA 1H2YA 2XHEA 3GRAA 4ZHQA 2QMOA 2YHUA 1PTKA 2B8TA 4RJLA 1I9GA 5ALXA 1UMDA 3O4FA 4M36A 2NO0A 4QVKA 5EOVA 3CKYA 2H1CA 3GEPA 3I5MA 4LGVA 4ESHA 2PVSA 4QRDA 3U3MA 4DA0A 2K7FA 5G2OA 2J87A 3HBLA 2VYFA 1TFUA 1ZD3A 1GADO 2FMKA 2ODWA 2V3WA 2VDUE 4ENWA 4F7WA 1ZNWA 4RK6A 5JOQA 5LQCA 1IBKB 4H6WA 4IJKA 1P1JA 1FJXA 3TQOA 2ZPTX 4B79A 4OATA 4IO1A 4FB4A 2JAWA 4OQZA 1ZOIA 1CYDA 4XVHA 5K2MA 3GHHA 3CVYA 2ZE7A 3ENVA 1E4YA 3QLVC 3T7DA 1KVRA 1UDRA 2YQZA 1HUQA 1GEGA 3LY7A 3AEQB 1C3JA 1TK9A 4POOA 4QHSA 3LC1O 5BOSA 5JYDA 2J4CA 2FEWB 2V6FA 1R9MA 3E1KA 1N4AA 4BNXA 3BXZA 2RONA 3NETA 4RDCA 1WUTA 1R3UA 4GOJA 1OZHA 1HOXA 2JZOA 3C3YA 4V0SA 3WBJA 3ZZNA 3OE1A 2GWHA 3MWFA 3RU3A 1RBYA 1QANA 4BVJA 5B64A 5LBTA 3Q3JB 3N1UA 3PHLA 5CK4A 5BMOA 3VYTB 2CZCA 1X1QA 4GX2A 5EMJA 1BVYF 4WKBA 5J40A 2G7MC 4RPGA 4K9RA 1QRDA 1N2GA 5J5VA 1SPBS 3NR2A 1QBKC 1OAKA 1FSFA 2YRFA 4KLRA 4B3RB 2PGJA 5EL0A 2XECA 4ZQIA 3S8YA 2GCOB 3O8RA 3NBAA 1Z13A 3SQMA 1BSVA 4E09A 1CQIB 4YAWA 4QXPA 4X3OA 4Y2SA 1SXQA 3MERA 4BNLA 1E4EB 2WM3A 4HH3C 4EG6A 4OL0A 3UMMA 2H07A 1ZKMA 1Q7BA 2ZRDA 2W98A 4Q3KA 5DHQA 4BVGA 1IBCA 4W6ZA 2R0QC 2IVZA 5E1BA 1I2DA 1XRQA 3E9NA 1U8YA 4BPRA 1AT1A 4RVCA 3UO8B 2QNRA 2BTQB 4BVAA 1PNQA 4M1YA 2DU8A 1Q1GA 1LNQA 4XDHA 3U19A 2VDLB 4YROA 1X3SA 1GG8A 1PHPA