1XLTC

Crystal structure of transhydrogenase [(domain i)2:domain iii] heterotrimer complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
RHMAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords NAD(P) transhydrogenase subunit alpha part 1
publication title Conformational Diversity in NAD(H) and Transhydrogenase Nicotinamide Nucleotide Binding Domains
pubmed doi rcsb
source organism Rhodospirillum rubrum
total genus 52
structure length 174
sequence length 174
chains with identical sequence F, I
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2004-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1xltC00
5EJ6A 2NXWA 5MFPA 2EZ9A 4GG1A 1J8FA 4UUBA 4K9NA 3FZNA 5D7NA 1PTJC 2A1TR 2PANA 5EJ5A 4QELA 3IAFA 3GLTA 5EJAA 4FVTA 4Q9DA 2H59A 3U31A 1PNQA 2OD7A 1MA3A 1U2GC 2UZ1A 3ZGVA 1PVDA 5K6RA 2B4YA 1U31A 1OVMA 4D5GA 4COKA 4X3PA 4GP9A 4ZZIA 5MF6A 5BWOA 5FEMA 2W93A 5DEIA 5BWLA 4K9MA 2EZUA 1DJLA 2FSVC 1UPBA 2H2IA 5EJ9A 1U28C 3U3DA 4JSRA 4KGDA 4Y6LA 1POWA 4JUBA 2OO5C 4KPUA 4F4UA 2Q5JA 1YNOA 2VBIA 2C31A 5EJMA 4FZ3A 4RMJA 4V1CB 2JI6A 4MPJA 4BVGA 2VBFA 2H4HA 4J16C 3ZGOA 2PGNA 4MQ5A 1E3TA 4RJIA 1U2DC 3FLMA 1V5FA 2VBGA 2FR8C 5MFZA 5DGTA 3CLUD 2H2HA 1N0HA 3EYAA 4F56A 1Q17A 4FEEA 2VK8A 4JUCA 1OZFA 5EJ4A 2EZTA 2VJYA 3D81A 4L2IA 4RMHA 2PGOA 3EY9A 1SZCA 4RJKA 4BV3A 1MCZA 4GPEA 2IHTA 1YC2A 2VK4A 3E9YA 3IAEA 2H2GA 2EZ8A 2WVAA 1M2HA 2FWNA 1YC5A 4BVFA 4I5IA 4UTNA 1M2NA 1EFVA 4JU9A 2Q29A 2OD9A 4ZP1A 1BFDA 1HZZC 5DGDA 1POXA 3PKIA 4BN4A 4HDAA 1PYDA 2JI7A 1YTLA 2BRUC 1NM5C 1ICIA 1M2JA 5IMSA 1V5EA 1Q6ZA 1S5PA 4JUDX 2Q28A 3D7KA 2OORC 1T9CA 4IF6A 2FRDC 2VK1A 3OE1A 4K9PA 1O97D 1T9DA 1YHZA 4JT8A 4UTRA 2AG1A 1UPAA 4V1CA 3HWX1 4G1CA 4RMIA 3PDHA 5EJ7A 5AHKA 4UTVA 4QPZA 3F6BX 2AG0A 2QQGA 2DJIA 1YI1A 4R8MA 5BWNA 1Q14A 4MZXA 4JD5A 1PNOA 1PT9A 2X7JA 1UPCA 4K9LA 4BVEA 4IAOA 3EA4A 1JSCA 1XLTC 4KXQA 4D5EA 3GLRA 4O8ZA 4Y6QA 4HD8A 1PO7A 3RIGA 4UTZA 4GM0A 4K9KA 1Q1AA 5MGNA 2EZ4A 3JR3A 2HJHA 5EJ8A 2JI8A 4MPPA 2WVHA 3CLTD 2Q5QA 1ZPDA 4C7BA 2JI9A 4IG9A 5K2OA 4UUAA 1D4OA 4JUFA 4TWIA 2IHUA 3F6EX 3JWPA 3CLSD 2OD2A 4GM4A 2Q27A 3D4BA 4JT9A 2H2DA 3LQ1A 1Z8NA 5FYQA 2IHVA 1Y9DA 2QQFA 2H2FA 3K35A 4FEGA 4K9QA 2UZ1B 2Q5OA 2WVGA 3CLRD 1T9AA 4C78A 1V5GA 3PKJA 4UU8A 1T9BA 4UTXA 4Y6OA 1YBHA 4K9OA 3CF4G 1YI0A 4V1CI 4JU8A 3HWWA 3GLUA 2H4FA 4BN5A 4BVHA 2FN3A 4BV2A 2JIBA 4L3OA 4JUAA 4X3OA 1PI3A 3FSJX 4BVBA 4BUZA 1M2KA 3ZG6A 2A1UA 2NYRA 4J1TC 4UU7A 1OZHA 2Q5LA 4TWJA 4RJJA 2H4JA 1SZDA 2V3WA 1YHYA 4QQ8A 4GM1A 5K3SA 1OZGA 1QPBA 1EFPA 5K6TA 3GLSA 2JLCA 4MPRA 3RIYA 1O96B 1S7GA 2JLAA 4RMGA 1M2GA
chains in the Genus database with same CATH superfamily
1CDDA 1FLDA 2R86A 5ICFA 3R3JA 3F8TA 2XT0A 4TXHA 4A26A 3GQBA 3KEQA 1GHTA 2XVAA 4RFSB 2NACA 1KDRA 3BXXA 4XIIA 3VYVA 4DSNA 2B98A 2FF7A 3LP8A 2XA9A 4HX2A 2H4YA 2VK2A 4RK6A 3TZLA 1ZHOA 1MD9A 1TFUA 3LOQA 2E82A 4XX1A 4BLVA 2HJSA 3RRNA 1YE5A 1UMDB 1Y1QA 3CH5A 1PBTA 4N5MA 3C3AA 5ER6A 5CLLA 3AW8A 3ZWAA 4BP8A 4D0LB 4YHHB 3K4HA 1XCJA 5HP4A 4PHFA 3R3UA 3JQPA 4QXRA 3B5EA 5CLFA 5AW1A 2V0CA 3CWCA 3LVRE 3H9CA 1DIAA 2FPXA 4CV0A 2OPBA 5JOQA 3K0EA 5CNIA 5AM1A 3QIAA 4ENTA 1QGZA 4JLKA 1JHMA 3ILHA 4BP1A 1RCTE 2XF8A 3UB3A 3L92A 3Q8XB 5KYUA 1UBLS 2OM6A 1CY7A 3SBXA 3V4VB 1QIFA 3BQNB 1YDEA 1QJCA 2D4HA 2LXNA 1J22A 3LGXA 3RAJA 3OWHA 1EM6A 1JEOA 3SF8A 2QPOA 1CR1A 5EOVA 3C3YA 1KEZA 4IRMA 2PBZA 2PJDA 2VZ8A 1OGYA 3D6FA 3WLJA 2UYYA 1MKYA 1AM4D 2PM8A 1N32B 4FNAA 1PVDA 1MDFA 1S96A 1ZK2A 1NVDA 1SBQA 3FN4A 4ZK6A 5B1EA 3SZ3A 1TFRA 2WOOA 1P61B 1Q1BA 4UKDA 2JA1A 3M6UA 4FS8A 3RYCA 5JDCC 2RBKA 1REQB 4FXPA 2C8KA 4HZUB 1BFKA 1TQDA 4D5GA 5L53A 4ZZIA 1OBOA 2H51A 2DFTA 2QNIA 4GP9A 4ERNA 3IBYA 4FZRA 3U49A 4WGGA 5G02A 4UZEA 2W6QA 4N4AA 3RWBA 2R2GA 4G1BA 4UBKA 1W6UA 3QE2A 3FM9A 2HK7A 1AURA 2GKSA 3X3HA 3BXOA 3UT5B 5LNK6 1MP0A 2W2NA 4PCVA 4CDGA 4OXQA 4RETA 5C35A 2VHTA 3DS8A 2O52A 4P4SA 3RT7A 1B8UA 1Z0AA 5H70A 1XHFA 5DM0A 2C2BA 1ONPA 3PFIA 2ZOSA 3ZE2B 3G0DA 4RPLA 1V8ZA 3RTEA 2ZI5A 4DLBA 3T1HB 3R7BA 1YRBA 3NEJA 2J7PD 3ESDA 3ZWKA 1PZMA 3PJRA 1F4LA 1XPRA 1I13A 4Q4CA 2O19A 3QG5A 2NVOA 5JNLA 3M2TA 3QUAA 3RUDA 4UHHA 2A30A 4H1UA 4H9GA 2QM7A 4RK7A 4KO8A 4LHVA 2ZYGA 2CE2X 5LQKA 5LD2C 1B23P 1GPLA 2WYVA 1L5HB 4GC5A 5E1MA 4KQ2A 5ALLA 2FG5A 3K8QA 4G5YA 4URYR 1M2VB 2XYGA 3H3FA 1ZS9A 2HU8A 5HMLA 2Q8NA 3HCNA 1MQAA 4NK4A 3RLIA 2PEYA 1XPJA 4KPUA 2PZMA 2WWIA 2CFIA 1MZVA 4GRAA 1T6BY 1S2DA 3OQHA 5KYYB 2CNWA 4IQ4A 2QTBA 2XRZA 4C08A 4DRYA 3NHSA 2Y05A 3IOMA 3R9IA 3UQYS 4BEJA 4QRHA 1RQ7A 4D9HA 4BX8A 2C5BA 1N9KA 1QCCA 5LMCA 2YJZA 2G8NA 5T57A 5I48A 2JLBA 1WDLA 2I9PA 3GEDA 1QZTA 3PDCA 4TN1A 1BOFA 1D2CA 3WY9A 3Q1KA 1T2CA 1JN0A 2O7SA 2JFZA 5A03A 1QC5B 2ZSHA 4EHKA 4DR1B 3I9NA 3C8UA 3AB8A 1YDGA 1MBZA 4W5RA 2CD9A 2FX3A 4MAMA 1B3BA 4UXJA 5IDWA 4JC4A 4D4LA 1T25A 4S2UA 4OHOA 3K9GA 5C1BA 4RNDB 3JQQA 3KT6A 4BTLA 4MZDA 2ZVDA 2DC1A 1Q5PA 4YRAA 5SZKB 2P9TA 4FPXA 3E9MA 4AJPA 1QHFA 1FYFA 1KAHA 5DGTA 5AICA 2Q9UA 3CLUD 4OP3A 1AQUA 5BWCA 5DEOA 1RW4A 3EK2A 4RTQA 3AM4A 1LY1A 2QVCA 4UDYX 3LC1O 5AOAA 4Q66C 3LTNC 3WKBA 3ZOKA 2HOQA 3CLVA 5IFLA 1FFSA 5DH9A 5LR6A 5FH9A 3PXXA 4Z4CA 3OJCA 3INRA 4DLUA 2OCIA 5DT2A 5TS3A 4IDHA 1CK4A 4W8GA 3SHFA 5LUAA 1LK0A 1PZEA 1ZIOA 1EQ2A 1GV0A 5D3QA 3AF4A 4BFYA 4D9NA 4OGFA 3PUIA 4JODA 1COZA 3OD5A 1Y8RA 2X8AA 2N75A 4GEKA 4B3MB 3LHSA 3OT1B 2OK7A 3FTDA 3L7MA 3ZV5A 3TFOA 3GGGA 3NM5A 1GP2A 3QWFA 2QNRA 3EY9A 3CT4A 1H94A 1NV8A 2DETA 3VQTA 3HC7A 4MGZR 2JHFA 2CHEA 3KO8A 1DRJA 1MCZA 2NO7A 3NHAA 3QMVA 1XRMA 2C9MA 2BGTA 4H08A 3TH5A 5BV8A 2X5KO 3TOZA 3DVAA 4YA6A 3B2EA 2VK4A 4IXWA 1NMSA 1VDMA 4A8TA 5BUZA 3U62A 3KSDO 2B9VA 1N7HA 2P9FA 4IVNA 1AKYA 2CJPA 1DC3A 2E5WA 3PRJA 1BW9B 3MWEB 4HEHA 4JAVC 4QFBA 3TW8B 4AY2A 4XWTA 2WI8A 3MT7A 1VHDA 1A5BB 2A5DA 3AR8A 4L9SA 1OBVA 2H85A 1OY1A 2L19A 3PDIB 4HR7A 2REOA 4N7BA 5CTJA 1C1HA 2CMHA 4W4TA 3DOCA 3WLTA 1GNRA 2ZUEA 3G02A 1P5FA 1CE8A 2O0LA 3JQAA 4D8YA 2ZBFA 5LZ9A 5C8DA 3GL9A 3GWZA 4BO7A 3VZSA 3MG9A 3B78A 1RPZA 1OLSB 2WU0A 3ASVA 1ORVA 4ZEWA 5FWDA 5CCDA 2ZRDA 4XTRA 3T9DA 3I2HA 3MJRA 4YGYA 3T3MB 1Y8AA 1UDWA 4GC9A 1Q57A 1LDGA 3HADA 4F1WA 4JC5A 4WKNA 3W3AH 1Y42X 3R44A 4KH1A 2VTBA 3DB2A 4P7BA 4Q9KA 1K7YA 2CD7A 3T15A 1LSOA 3D8NA 2I5PO 3C4JA 5FV4A 2PTHA 3CE9A 5A2QA 2IHNA 1J99A 1S2OA 2C2KA 1OASA 1UWCA 1A50B 1I1HA 1NTOA 2YV3A 1V8DA 1Z6QA 3VFDA 4B9AA 1A8QA 4L74A 1MOSA 2PL9A 4Q4JB 5HXAA 3DOIA 1JKJA 1H0KA 721PA 2C8VA 2D1TA 3ECAA 5G0UA 1GO2A 1UXOA 1JBKA 1DEHA 3R9KA 1GSOA 1WDKA 2ZE5A 1FX1A 4X1YA 1AA6A 3R3XA 2QL6A 3T7AA 1H1TA 5KNBD 5FOQA 4JP3A 4OX9Y 4QJ5A 4YRPA 1JVNA 1Q6ZA 1E9VA 1UMCB 2ZTLA 2FLKA 5BN5B 1SB9A 4B87A 1UFOA 3TNYA 3L2OB 2HHAA 3LPDA 1EVLA 1ZD9A 3H11A 3MZ0A 4L85A 4AD8A 4BUCA 4DJEC 5AM2A 2WT9A 5LQAA 1EMDA 2IWRA 4EJ0A 2RGBA 3JATA 2P1RA 2P67A 3ZV3A 2QLFA 3GWGA 4C1NA 2VOEA 2WF7A 3AUJB 5E8RA 4F21A 2AG5A 4EO7A 1BDHA 3IP3A 1RHQA 3Q6NA 4ANFA 3N6VA 1GG8A 3IB3A 1AS2A 4RA9B 4DDKA 4OLAA 1T9DA 3CUSA 4MQ4A 1EA7A 2O6HA 5T4EA 2QZ4A 3ZXXA 5GTDA 2V45A 3C5WP 3DEYX 3LO5A 4NZYA 4P22A 4K28A 3RC7A 4UTRA 5BRNA 2GTPA 4QUIA 4CTOA 4F5YA 3EDYA 4MHOA 4N7MA 1OTYA 3DWEX 4TM8A 5B1IA 3WKCA 2R7KA 2W0SA 4DMHA 4OK6A 2CHQA 1CUGA 1ETUA 2RARA 3TIXB 1MOZA 1ULBA 2J3HA 1CZOA 2O48X 3BWEA 2BGMA 4C04A 3O2JA 3KKMA 4FR2A 2K87A 4FDTA 1YMQA 4ZVPA 1SWVA 2X0NA 1CR6A 2NXNA 3W9BA 4CMEA 1RXWA 5BXYA 5ED4A 3ZIUA 3LA6A 2XGSA 1K7FB 2Q3LA 3GAFA 5JAUA 1KY2A 1U5CA 2MOKA 4DNQA 1H6DA 1U3UA 1ZL0A 4XUEA 4Z53A 1D6JA 1M1NB 2DAPA 3EVBA 3MHPA 5SZIA 1XDSA 1XL0A 3JQ8B 3UJ7A 5BWNA 5JEDA 2IDMA 1Q11A 2VCYA 3Q2IA 4B85A 2P9JA 3REGA 3HU1A 3VTZA 2BUBA 2JPDA 3VH4A 3R3ZA 2D8MA 1QHSA 3AKZA 1HDOA 5FOWA 4NMXB 4K9LA 4YV7A 4FCCA 1E2NA 1KYQA 2WSSD 4RLFA 3TQTA 1BO6A 2JFQA 1CU1A 1F8UA 2OGSA 3IEXA 3LP5A 3BF8A 1N33B 3FD8A 5AUQA 2FN9A 2LE0A 3GNTA 1GQRA 1IULA 4NZOA 4PPYA 1BAPA 1YS2X 4QBKA 5E2BA 3RPEA 1DOHA 1TPZA 2I7CA 2I7VA 2YS6A 4Q1CA 2V5AA 3O7MA 2FSPA 4UAUA 2Z3ZA 4AJEA 4D45A 4NXMB 2D5IA 1J21A 5KOJA 1XSEA 1AQNA 2JCVA 4GZLA 4LE0A 1BJRE 3M83A 5HG0A 2C2WA 3NOOA 3ZE0B 3LJKA 1GKUB 4MUFA 3HU5A 1T1RA 3P96A 4X44A 4JJ7A 3PC6A 4L0CA 5IT5A 2VSNA 4PGHA 1IMOA 1CT9A 3IUMA 3JQGB 5FUMA 5DTMA 3P27A 1NVTA 3VZBA 4GO1A 5ICGA 3EDMA 4AY4A 1MVNA 1OAAA 2OAEA 4RK5A 2C7PA 2A5YB 3IERA 4IG9A 5GZ1A 3UEOA 1M34A 2P62A 1E18A 3AL0C 4FLFA 4TWIA 5F73A 3ZLTA 3OPMA 1HE2A 3PDJA 3UFXB 3NXKA 5HQJA 4ZD6A 3C3XA 2VSFA 2IU3A 3EIXA 3TUIC 1UXKA 3EEYA 5EWLB 1G64A 3ADKA 1UK6A 1NBEA 3L93A 2E5FA 4NS1A 4YJ2B 5DBHX 3QLEA 4FYPA 1ZVQA 4GM4A 1W2HA 1E9DA 2Q27A 3UMYA 2GZHA 3BIXA 2H2DA 1VHQA 3K0FB 2XRYA 4NOMA 4DDHA 4G1EB 3QXXA 3VOSA 3L04A 2H0RA 3T95A 4EY4A 2AK3A 1IONA 1E8MA 4ZEXA 2C4NA 3O82A 5FTJA 2OTCA 1J2YA 1Y3AA 3O7WA 1Y9DA 1BROA 4R7TA 2JD2A 3EEQA 4UHBA 1H2XA 3THRA 4ZZ1A 2BEUA 4AKTA 2AYXA 2OFXA 3RASA 3TLZA 4XGQA 1OB2A 3BXHA 4Q37A 2V7XA 1IDN1 1XAGA 1XU9A 2RCYA 1P4JA 2A67A 3F96A 1L7QA 1E2LA 5E0OA 4MIKA 2C95A 3DM9B 4EYSA 3DEKA 4JEUA 2VYND 1MJFA 2O2SA 3JD4A 1JH9A 1MEEA 1RAAA 5I9NA 4ECAA 1PEDA 1XKLA 2PZEA 1U99A 2O1XA 1Z12A 2WG2A 1D7OA 1C30A 4KREA 1TDJA 2WKPA 4LXTA 1V5GA 3IEVA 1F14A 1Q84A 2JLQA 2PKCA 3FGNA 3L6EA 4E5SA 3A9SA 2WP0A 3R0JA 4V24A 3A2LA 2ACWA 2ZTHA 3F0TA 4Z0PA 3ZVKA 1JFSA 6CHYA 2XE8A 2I76A 3JQEA 5BMVB 4OMUA 1J1IA 3I2IA 2AR7A 4HNGA 1Z63A 1L4HA 4RMNA 4EG0A 4H1VA 4FE7A 1C3XA 3PXBA 3RCBA 1YL7A 2V03A 1ZVKA 1XVIA 1NUAA 2G06A 5ADHA 2W2VA 1QO0A 4JN6B 3KLOA 2RK6A 1XA4A 2W5UA 3OPVA 2L17A 4HQFA 5CH3A 5H9VA 3ZNNA 4QT0A 4A5OA 2PH7A 3ECSA 1T0HB 4FR0A 2FZVA 4BQSA 2IHBA 1VXRA 4FNMA 1OKKA 4UQPA 4L75A 1VJCA 4IDBA 3RANA 2QRQA 4MRMA 5AKEA 4NATA 3LV8A 4EGCB 3MWFA 3EXHC 3L7AA 2GZ1A 3ZNPA 5BR7A 1GLNA 1NN5A 5JTUA 1BEUB 1XV5A 4X5OA 3DWFA 3JWHA 4GGOA 1PE0A 3FHLA 2ZXUA 5KMGB 3GPDG 3PIDA 4JI2B 1FTYA 3FWKA 2PTGA 4JLJA 3D5QA 1ZH0A 3MD0A 3U4MA 2WWWA 1NZFA 1QH8A 1RZ3A 1YRQA 2BDEA 4BYGA 3EPJA 2ZJ2A 1J9EA 3ANTA 3BZUA 4HGNA 4PNHA 4YUAA 3S2ZA 4R2XA 3OJFA 3HCAA 4FFRA 1JR3D 2CFCA 3VR2A 3SQLA 4WOKA 2AUTA 2W6ZA 5IAOA 5KWJA 2ZIWB 3PQ2A 3UWMA 4OCZA 4MV5A 3G2JA 1QYRA 2P6MA 3ES9A 4IFBA 4J3FA 4WNAA 1O6BA 2HXYA 1W9MA 1K7SN 1C3VA 3AILA 2I3DA 3CA8A 2G4LA 3DKKA 3VNQA 1DBRA 5B4UA 5BT8A 1NATA 5LXTB 2FPGA 2DX7A 5EI5A 5IJ0B 2V4ZA 3MBOA 3O9VA 4MARA 3HM9A 4CW7A 1DIOB 3KR9A 5FBVB 3ADBA 2WIKA 4A36A 1SZDA 3HCEA 1VPTA 2GVNA 1A9TA 2C59A 2V3WA 1E0JA 3S8EA 2SHKA 5B53A 3ZWNA 3IL2A 1W0KA 4XZ3A 1GZVA 1GZHB 3KQUA 1ZSNA 4FKBA 5JNSA 3GJ4A 3T1NA 3F3KA 2Z2ZA 4G5OA 1ZBDA 2CBZA 2V7QD 4GI5A 4JA2A 2D54A 2XF2A 3GVHA 2F1IA 5L8VA 3VR3D 2QS9A 1U8YA 1OZAA 3KWLA 3IV9A 4LHEA 4NCKA 1UBKS 5C7YA 1HMPA 4HTFB 4BIIA 4YFVA 2DWUA 3GT4A 3W6PA 3L7JA 4LRUA 1H0HA 3PT9A 4TMVA 1AKNA 2MT9A 2GXSA 4ZOLF 4L2IB 4Q3CA 3T7TA 2X5NA 2HK6A 3DMDA 3E5MA 1ADFA 1J0BA 4L6IA 1OIVA 3D8SA 1V8FA 1M2OB 4M60A 3TL6A 1WNTA 4HGRA 3REOA 2ZT8A 2AVDA 1PYOA 4FYWA 3DV0B 1L4KA 3H75A 3ZLJA 4OB8A 3SDZA 2JH8A 3VKGA 2IIQA 2VHQA 1KEEB 1KMCA 2V9PA 4KQIA 3AUXA 2BFWA 2J46A 3PDUA 5KHLB 1PFQA 5LIRA 1ZESA 3UATA 4G0YA 4FQ5A 4M46A 4QNNA 1OOEA 5LQSA 1ZNWA 4Q7JB 1VSVA 2NU9A 3UJ9A 1HQYE 3HVHA 1VA4A 2G07A 3B20A 1ZIPA 2LV8A 1I2AA 1E79A 2PHZA 4DB2A 4OMFG 3RV4A 2AYZA 1F3OA 4L4XA 4CCAA 3IGFA 1DAMA 2QT0A 2FG7C 4TZ0A 1S3SA 2W6MA 3I8OA 3TIIA 3BDIA 4Y2SA 2GFIA 4N0QA 3ZZ0A 5F2NA 2RHRA 1DKMA 1RBZA 1JG7A 4HXGA 1E2MA 1LX7A 3MTAA 4BWVA 2ZBEA 1FFEA 1LF0A 4JLOA 2I62A 4B35A 3A6PC 1RQGA 1Y5LA 3T1YB 2O8CB 1FB5A 2B6NA 5JISA 2B4YA 3G0HA 4INZA 4QXQA 3S2EA 4CQMA 2GR9A 4JLBA 4XUDA 2ZYDA 2Q1UA 3E81A 4IS3A 2OXTA 3O3NB 2WFAA 1VLMA 1F4VA 3KLPX 4EYKA 3NR2A 3LT2A 4ZMRA 3BE6A 3V3KA 4I3FA 1GXSA 3MWJA 3I62A 1KI6B 1IZ0A 1KI1A 3L77A 1BOOA 4FXOA 5BWLA 1F51E 2NLOA 3SZUA 5SZJA 2ZJ7A 3GXBA 3NBUA 4Q16A 3C2QA 4KXLA 3ZEIA 3LNCA 1UBFA 3QH4A 5C7LO 2EBWA 2GBPA 3A1TA 4FIDA 3ETNA 2R68A 4XWYA 4B4OA 4EKDA 2JGJA 4DJ5X 4YRBA 3H0CA 5A9RA 1L9XA 1VKOA 3D64A 1E0AA 2CN1A 2D1YA 3ABZA 4MV9A 3UWDA 3UT0A 5KTSA 5K4HA 4JVNA 4PRYA 5AVRA 5TVKA 4E22A 5G3ZA 4PRKA 4DSTA 1U28C 2OZLB 2J0VA 5IT0A 1ULTA 2IL1A 1E1QD 1EP2B 1SC4A 1NUUA 4B3IA 2GBGA 4KGZA 3L1JA 1V4NA 2JZOA 1CJMA 4Z9BA 4RTNA 3CJRA 1PR5A 1WPXA 4GW3A 3REQB 3LU1A 4CMIA 4EYOA 3D43A 2VAWA 3BBPA 5BRAA 1ZU4A 2BMFA 5IN4A 4DLVA 1BKDR 1GDTA 3OLXA 1G5QA 4UXHA 4AM8A 1Z2PX 4TMKA 4LVUA 3HSYA 4QOSA 4XYEA 2C31A 2GOYA 3MERA 5E1DA 4OQXA 4F1KA 2AOXA 2W2KA 1P74A 3OWOA 1WPGA 2GHRA 2AJLI 5EPUA 4CLEA 2HQRA 1A8UA 1NMXA 2Q5EA 4QUGA 4X24A 5DI9A 2CLOB 1CCWA 1WHTA 3LRXA 4L4RA 4ONEA 4ETMA 1ZLYA 1XD2B 2CYBA 3DMYA 3HFRA 3W5VA 2X8JA 4DE5A 3ROEA 4DR5B 4IVRA 2QXTA 1WCYA 2AJ8A 2O2GA 2PO7A 2QTTA 1COWA 1ENZA 2MR6A 3I1FA 4PBRA 4WD3A 4NYIQ 1TYCA 3UC9A 1V47A 1DV1A 2O7RA 5T64A 5EP2A 1W1UA 5LN1A 3PQ8A 3N75A 2P6OA 1OTXA 2VUTA 4YRGA 3W78A 1K5PA 3LNTA 4DEYA 5K09A 3LKBA 2PUFA 1NHGA 5B3JA 1UBGA 2J07A 3KOXA 1JAHA 4NEHB 2FR8C 4OU4A 2WMYA 4U7TB 3T12A 4G0WA 3R3HA 1W5EA 1KZ7B 4X41A 1HRDA 3ZNQA 4C20A 5JBNA 2I7DA 3ORHA 3WJ1A 1A2BA 1PS8A 1TJ4A 1GSIA 3KOWA 1U3CA 4XI9A 2CLHB 5SV2A 4QEZA 5EXXA 4EJMA 5FPYA 4OL9A 5CFPA 5ITVA 3KZXA 2H06A 4DV0B 1L4LA 3O93A 3SQMA 1N6RA 1AXGA 3IX7A 2AB0A 1O96A 4QHYA 4PGAA 2I2CA 2W4IA 3N05A 5DCYA 3C3BA 2EAUA 3TI9A 1Q0ZA 3HB1A 4UAGA 3RTDA 3SX0A 4JJEA 1PR2A 4ZGWA 1GDHA 4BL5A 1U8CB 2PD3A 3PE6A 1SXJD 1C4KA 1T35A 2OK8A 4F11A 4FWTA 1RQLA 3QLUC 3W1WA 2F6RA 2CDBA 3FWZA 1MAVA 2I6XA 4TLEA 3HYCA 4LJ5A 3ZCTA 2G0TA 2D7DA 4O4LB 4ZOBA 2VPWA 1SXJE 3GDGA 3PPVA 1F5SA 2WA1A 1E59A 4OOFA 1UKCA 1P1IA 3CG0A 3ROXA 5CCBA 4RV4A 3AY3A 3LC2O 1XQXA 4FE3A 2J8ZA 3SJUA 5CEEA 5FLEX 4II2A 3QHPA 2VJNA 4NS4A 5IC5A 1TCBA 3IIIA 4JFAA 3WGIA 2VATA 1KKUA 1ZD5A 1P3DA 3JTEA 4RORA 4YASA 3T9CA 1HZJA 4BE9A 5CB4B 5KWSA 3HWRA 3R9XB 2GGSA 3DCJA 3E27A 3B6JA 5EIBD 1EGAA 3BFJA 4GMDA 3X1WA 5GJVC 1E58A 3H1TA 1CC1S 1K3TA 1U0NA 2IYAA 4QM6A 3IUQA 4RESA 1NL3A 3ZW9A 5BV0A 1DMSA 3S7ZA 4HY3A 5IYZA 1OGJA 1EFVA 5EG5A 5REQA 1P45A 2N9UA 3OA0A 4NLLA 5LD2B 1N25A 2I7XA 3E5RA 3RSCA 1X13A 1UQRA 4FONA 4P3YA 1OPXA 4BQPA 2JGLA 3CUKA 2QW8A 2ZB3A 3AEZA 3PTLA 3B89A 3R8XA 1YBVA 2WE7A 1KYYA 3JZFA 4Q9JA 5DGDA 5FI0B 3ZBPA 4C1BA 1NQVA 5JS8A 4DV3B 3F98A 3PFBA 3BB1A 3LD9A 1WUIS 1L7EA 3ROGA 2ZBPA 4BN4A 1EUZA 2JHGA 1AN9A 2PGDA 3IOEA 3WK4A 2P7IA 2FXVA 3WJAA 9LDBA 1P7WA 4JY7A 5LP6C 2F00A 2HMVA 4DQ0A 2JIMA 3AVVA 2D0OB 1OFHA 2GPWA 2UVDA 3F90A 3AR2A 3TX2A 4LBZA 4NJEB 2M32A 5AR1A 3SR0A 2QMYA 2YTZA 3PFFA 1CIPA 2COEA 2QGZA 2ST1A 4UCQA 4DSUA 3GJTA 2PIDA 1CEEA 1YAJA 2ZB4A 5AUPB 4WVLA 5K0GA 3DT6A 4R9RA 3GMSA 3HEBA 3SEQA 1NM5C 1IBRA 2AKAB 2GEDA 2P30A 4XFJA 1R6TA 4PBSA 5DE3A 4Q3AA 3WL3A 3IBSA 1I4OA 3SSOA 1GRCA 1HV8A 1P4SA 1U9YA 4MJ7A 2QTRA 4RPIA 1Q0HA 2C2HA 4FMCB 1RM5A 2XZLA 2J5QA 2H1HA 3UK6A 1KE1A 4IEIA 4MV0A 1G5TA 4IIVA 4OKSA 2ZSJA 3AHGA 1RU3A 5EVCA 1QRSA 1N9GB 3V46A 5DM2A 2D2VA 3S5JA 2ZYVX 2IX3A 1DJPA 3M34A 3GAAA 2QD2A 3B1VA 2FRDC 3MEQA 4LJ6A 2AWNA 5D87A 3VHQA 3ZYZA 3HUTA 4CGZA 2PY6A 1XZKA 1FNMA 2I2WA 3QVJA 2AJBA 4W9RA 5FJJA 3K2EA 3C14C 4KE6A 3IQWA 3UHJA 3IS3A 1G63A 3AUAA 1D6SA 4BO9A 4QBHA 5CG2A 4UFNA 5LZ4A 1G0OA 3M6FA 1O6GA 1DWQA 3IUSA 4F86A 1IC6A 2O7NA 2YHAA 2HF2A 3ZKWB 5DNEA 5KYNA 1L3IA 4LCJA 3UV7A 2YY6A 4GI3A 4D0RA 5BNIA 2BEWA 3G49A 5LL6P 4XSHA 1TGYA 2ZCUA 3G68A 1V35A 4KP7A 1ZUHA 1D2GA 1PTJA 1VKHA 3PT5A 4I6JA 5BN1A 2AG0A 1MDBA 1KVQA 3DO8A 1RC8A 3ANLA 3LL4A 4PHCA 2HUNA 4Y0NA 1XJ5A 2IBMA 1FL9A 1Q3TA 3A6LA 3SSAA 3QKSB 3SOPA 2GHIA 3FR8A 3Q3VA 3NX4A 1A88A 1TJNA 3I9LA 3PUHA 3R6GA 1UDBA 3V8BA 3A1UA 1VKJA 5H3LA 4FKMA 3ROQA 3ON5A 3IJ5A 2QRMA 2X7XA 3H5IA 2RGWA 3IKLA 1XMPA 4MZXA 2JIZD 4RFLA 3T4UA 3WADA 2W58A 1QP7A 3ULKA 3FETA 2MU1A 4NBRA 5HBGA 2XADA 3UKJA 1UBCA 4C3UA 2WAYA 1ZITA 2Q5IA 3CZQA 4LEIA 3K1TA 3UBMA 3PV0A 2OHXA 2C5AA 3FZQA 4IAOA 2BUCA 3VNVA 3I0NA 1IVNA 3I3SR 3LDUA 1QE0A 4MW6A 1OFTA 1HYEA 1SZPA 5HA5A 1ZQ1A 2XOKD 2XGGA 3FPSA 1AUPA 1QPZA 2ORIA 1Y33E 4KEAA 4C2UA 4WBSA 2C2XA 3GRPA 5LC1A 3K8YA 2XT9A 2I1QA 2QI9F 4A1FA 3RAEC 3FZEA 1DLIA 3GFQA 1KZGB 5ETJA 2D2FA 1T9HA 3TRKA 4O2BA 2AR0A 3JR3A 4H1WA 3B1JA 4QDUA 4ZVSA 1IHOA 1OREA 4UM7A 3WO1A 3QVVA 4FFBA 2J0UB 2V1XA 1GPKA 3EZFA 3ONEA 1V1RA 3EFHA 3KJIA 2PBLA 1R0WA 4EFLA 4TS3A 2BMJA 3RSQA 1MG0A 1PR6A 2GYVA 5LA6A 3TNJA 2CVZA 2VLBA 4MLCA 3QPVA 4IMPA 2QJWA 1U8ZA 1G18A 4DA6A 3RD5A 3M5WA 1JEYA 3LA8A 1Z83A 1E2QA 4TWZA 1DFHA 3WZ2A 1AHPA 3NBMA 2PWYA 5K8UA 2VJPA 4EHAA 3N0TA 2W2LD 1ZIXA 5DP2A 4B3XA 3JWEA 3MELA 5FWXA 3WK7A 3QJ5A 3A3PA 3O90A 3WQBA 1E8DA 2KMLA 1SUFA 2Z4TA 1H8ED 1QHGA 2PUGA 1S89A 1ETHA 2FPWA 1CYEA 1PJCA 1GTRA 4RK1A 1RMYA 4C7JA 4Y6PA 4HH3C 2J3JA 4LJ9A 4Q21A 4CTMA 3S28A 1YQTA 4NNOA 4TS4A 3VHRA 1OJLA 3FUXA 3ZDFA 4YXWA 5FPHA 4BNDB 1OX5A 4JEMA 4HUQB 1RAGA 3ZTYA 4A8JC 1KJYA 5EMNA 5D6NA 4ZKEA 3PLRA 1SXPA 1GY8A 2JGDB 1HE1C 4NVRA 4Y3UA 4AMUA 4BCDA 4CL0A 1S0UA 2IHJA 3FGOA 4JLWA 4BGUA 2D1QA 1ODIA 3GBVA 1FS6A 1T1JA 2ZBVA 2IDZA 2O8FB 4BQFA 3ZY5A 2HPHA 2D1RA 4IHKA 2AN3A 3NT2A 3DT9A 2N3ZA 3O1HB 2ZITA 2D3WA 2P40A 2XQJA 3TZEA 4JIMA 2WE8A 5HTKA 5K2MA 4C6TB 2G88A 2FX5A 5B7NA 1ODSA 4YCMA 1FOEB 1Y4UA 2WJAA 3UPUA 4JCCA 3WA7A 5BVGA 1AQLA 2XMPA 4J0KA 5AOVA 3CEPB 3D3WB 4ZKDA 3HXPA 1LVGA 4XIJA 3T3GA 4C0SA 3O03A 4I3HA 4I46A 4GLLA 2ZWVA 5EHGA 4Z6KA 3DMPA 5EZ6B 4PSDA 2EWWA 4I9UA 4UZSA 5DXFA 5G0WA 4OHKA 2H4FA 2IPXA 1RFGE 3AX6A 4BVHA 2AFIB 2CWWA 5JCXA 4Y2PA 4PY2A 1BMDA 2F7SA 2YN4A 3GYBA 4UATA 1JPNA 5AKJA 2J3KA 3B9PA 4I4TB 3SM3A 1B26A 1VL1A 2UZIR 2ODNA 2F43B 2OT3B 4TVBA 3QI7A 1E99A 2IYRA 3RFUA 4F12A 4GRDA 3DXZA 2J0QA 5H4GA 1Z15A 4HH0A 2Z98A 4YYZA 4ZI7F 4BWYA 4B8ZA 1B3RA 1FXSA 1HYBA 3F3YA 4B7UA 3BJRA 3C3JA 1U3VA 5T3YA 4KRXA 3OOYA 2X0EA 5EKSA 3RFTA 2BEKA 5HF9A 3SYMA 3CPEA 3FPLA 1AZTA 5H83A 4AMZA 3LPAA 2AX4A 4JMLA 1XTRA 4C4OA 2ZAIA 1EXNA 5B12A 5B2EA 3ICOA 4IFIA 1RKUA 1XXHE 4EG4A 2BR3A 2H4ZA 1VRCA 3STHA 3ETLA 1H9AA 3F47A 2MYTA 3K32A 1Q50A 3PQFA 1P6UA 2G6BA 2ZUDA 3GLKA 5DYYA 1BX3A 1GVHA 1L4EA 4MWCA 4WZAB 1BHO1 1A97A 1XTPA 4REQA 5DKFA 2WU1A 1IPFA 4EMTA 3DDOA 1QU3A 2MSWA 1N5KA 5CDHA 1JIXA 3HKDA 2I4TA 1SU4A 3WYAA 2GA9A 4IZHA 4CFZA 1LI4A 3PC3A 3C85A 3QA3E 5K3FA 2AOUB 2DFKB 2BI8A 5G41A 3DAGA 3U26A 4MW9A 5CA0F 1V4BA 5IEBA 1II8B 1KFCB 2JGNA 2BOVA 3UIEA 3O74A 4RJLA 1OZ0A 1V11B 2VIIA 3JQDA 4IQ8A 4P6VF 4BAZA 1RKVA 3O8LA 4ERXA 4PTYA 2J9FA 3JVVA 3DNMA 3JAKA 4N6OA 1YRLA 2VF2A 3Q3JB 4INOA 3VVMA 3YASA 2NXWA 1Y9JA 1H2EA 1X1DA 4BNIA 4EX6A 1XRNA 1JHUA 1HLPA 3DFZA 3K1JA 1KOGA 1A5AB 1KR2A 3TQRA 3AVYA 2HEGA 2QOEA 5D7NA 4GZ6A 5K8LA 4IIYA 2BFPA 2FPPA 1I4DD 3O75A 3OBBA 4LDRA 4MAFA 4Q24A 2WJIA 4WKOA 5GOTA 1P60A 3UJHA 1RPNA 1PLKA 2DUWA 3EOAI 4HN4B 2MMGA 4DV4B 3X1JA 2ORYA 3IE2A 2EOAA 5L3SA 1W0JD 3X1KA 4YMHA 4JI5B 1M6VB 2PANA 4P7KA 3QF4B 1WB5A 4L08A 2W70A 5EJ5A 4D9JA 4ZYVA 3WB2A 4WLNA 1HFJA 1N3BA 4OX9B 1OR8A 3L0BA 1N2GA 1XZIA 2X3FA 3AR5A 1YL5A 1VPEA 2NU7A 2QUJA 4L27A 1M2WA 3GFVA 2OCYC 5FTWA 1NUQA 3DE7X 1RLJA 5JJLA 3T5CA 3LXXA 4HK4A 2E5LB 3K1AB 3Q4GA 2WHYA 2D5BA 3AV0B 3EXHB 1U7WA 2GDJA 2IEGA 2J3MA 3FOFC 2OD7A 2R8EA 1ZI9A 4K40A 4ALIA 5TMEA 1EFRA 1GAJA 3MPOA 4ZEOA 3ZVMA 3G7SA 3DMHA 4AKSA 4KYVA 2VHXA 1KHHA 1LBHA 4TQ9A 1LBEA 5K0ZA 3T0GA 4E15A 4MW4A 1VLJA 2E87A 4BNLA 3IUPA 4ZAWA 1BVUA 4H7FA 3AFOA 4DLLA 2YUIA 4RE5A 1RZRD 2VWPA 3PGVA 1U7PA 3TSWA 5J2TF 1PEKE 2CVHA 5AKHA 5IC4A 1DDGA 2H8KA 1U90A 1HFWA 4ND8A 4MWEA 2TMKA 3RJMA 3LDAA 3N2ZB 3D6UA 2NVUA 5U1PA 3VZQA 4BJHB 1PFWA 4YMVA 2JLUA 2FSVC 2MMCA 3G7NA 4NF2A 4X1IA 5E4JA 3FMVA 4LMPA 3MMSA 3L0OA 4OHXA 2BFEA 4WBXC 1IVSA 1IY0A 1GLGA 4TT8A 3DT8A 3GEGA 1JT2A 1U0HC 1G8SA 5DHAA 2ZJBA 5FQOA 2O0KA 2QRGA 4GS5A 4BNYA 1H85A 3AP3A 1VJ5A 5BP7A 1DV2A 1SOAA 2R1VB 3O4HA 5AJUA 2GILA 1K4MA 3FDZA 4C0AC 4FBLA 3CB4A 4URZR 3N2IA 5IF9A 1NXTA 3HDJA 3LY9A 3KKEA 3DLPX 1KJNA 4OHWA 5ISMA 4KN5A 1DUVG 3HJCA 3MJEA 5LQJA 1ZM4A 2BZSA 1VE1A 2IEIA 2OP1A 3I64A 2JIQA 3G5UA 3OPNA 3OUUA 4NFSA 4YPFA 3VTKA 4O6VA 4UAVA 1PJTA 2Q5JA 2VQDA 1YNOA 5L95A 1IXSB 1QR2A 4NBSA 4G37A 3C87A 3X44A 3INNA 1N92A 1EUCA 4AC9A 4DWWA 3BSSA 5LYJA 3AHDA 2ZRCA 2R8ZA 3THWA 4ALMA 1ZI8A 4E51A 1C9NA 1RKXA 1E9RA 5BSEA 5A6SB 1XAIA 3PQ3A 5C2JB 5AJYA 4R05A 1S01A 4QUBA 3L0DA 1JEQA 2DR0A 4OUKX 1E4EA 3SZRA 4K2HA 1U3WA 4ALJA 1XDUA 2CVOA 5JY6A 3NVKI 2PGNA 3LH5A 2PYZA 3ZZNA 4AROA 6ADHA 4BE7B 4RHFA 2RHJA 1ELOA 1XQVA 4HATA 4DPMA 5TNXA 3FXAA 3O73A 1AHNA 3LHFA 3X2EA 4KBGA 3D4PA 4EUSA 1OYYA 4W5NA 3Q5EA 1EE9A 1HM5A 1RWNA 1ZOLA 3EWSA 1D6NA 4YALA 2B69A 4MPTA 1BE0A 5AK3A 2C9DA 2QMOA 4DXHA 5ITWA 4M53A 2B8TA 4P1ZA 1YS7A 3F46A 5B7GA 1A4XA 1AIPA 4MV3A 3AU9A 3OTOB 4Z1MA 1ZA2A 5J43A 3DTTA 1EINA 2ZR0A 1TVKA 3I4FA 3II6X 3QRWA 3C1AA 2GPSA 1CB7A 2QLLA 1T3HA 3H9JA 2HZBA 4Z3KA 1PHRA 1F6WA 2MTBA 2PH5A 2BH9A 1SBNE 2NV0A 3FFXA 3JWGA 4H6VA 3ND7A 4OQLA 3WV5A 5BN3B 4P58A 1SQ0A 1IY2A 3AVOA 3NHUA 1HWYA 3OFNA 4L8YA 4AJKA 1AK2A 5COQA 2UXDB 1Z73A 3EOZA 5K03A 4HDKB 2B8WA 1KKMA 3WLEA 1S4QA 2E55A 4BATA 1CQIA 2ID9A 2FLWA 4ZTUB 1A5SB 2LW7A 4CKWB 2WP8J 5TT1A 2FHSA 3ZQJA 5CB6A 2YZNA 3RSSA 1CS0A 1YHNA 2P9GA 4UUMA 3WRXC 2I4RA 4EGAA 3EAGA 3C1UA 5E3HA 3ITDA 4PF1A 2Y27A 4BNGA 4B8YA 1CNFA 4FOOA 2I54A 3MWYW 1TQ2A 2HBYA 3PEEA 4FI3F 1EE2A 1U7TA 1DWUA 3SE0A 1Z4LA 1QS0B 3VOBA 3BSFA 2GN9A 1A9RA 1VL2A 3OZRA 2NP7A 2B3TA 4P7GA 1PGJA 2VNAA 3IAS1 4I4NA 4A16A 4FU0A 4ETIA 4EZBA 4LZPA 3FGPA 3WJ2A 2LCFA 3BWVA 3OZFA 4S35A 4G5XA 4INPA 3GLFB 4D4MA 1E1RD 2HPVA 2Q41A 3GCWA 2JBWA 3L6DA 3KHKA 4DUPA 4YLYA 1TTHA 4IDPA 4YMUA 2ZCJA 1EFKA 3NM6B 4TSFD 4CQLB 1PFYA 4ZPJA 1UBMS 4M0KA 1G8HA 4YVFA 3QX9A 1E66A 3RVPA 1V26A 3CR7A 5F1PA 4BXOA 1Q12A 1X74A 4HNVA 2W7TA 3DGEC 4XPIB 3FNQA 1R7RA 3QU5A 4LDNA 1NA5A 4IXDA 4BFZA 5KYKA 4BJ1A 2HI0A 2TMGA 4MV4A 2AQ8A 2J0EA 3VR1A 4DLXA 1NN3A 1W76A 2Q62A 1D9XA 2EDAA 1JI3A 2WFLA 3EW9A 1U65A 1X7ZA 3N87A 1N8SA 1ITZA 1WVIA 1IEQA 2H63A 2YR0A 1KEVA 2A0FA 3BMOB 1I24A 2RAUA 4JVMA 4M8NE 4GBED 3L43A 4S05A 3AI1A 2ADFA 3K94A 2BBTA 4JQCA 4HDOB 3WL6A 1Y8QA 2GN1A 2H5JA 3ZW7A 3CJTA 5A7HA 1M2JA 1WP9A 1FJXA 3A3KA 3R7NA 2HRQA 3IQIX 1TZ2A 3CRVA 4C3OB 1GUFA 2CXSA 1KSJA 2P3OA 5JQWA 2GCOA 1LPNA 3TTWA 4POAA 4JR0A 2O0MA 3R6TA 1AHIA 3DMTA 3O8QB 3HJTA 4LQCA 4DHWA 2Q1YA 5JWHA 3EQ2A 1L5KA 3OZCA 2ON6A 3CVOA 3OLCX 1KAMA 2HM7A 1H2ZA 1E7RA 1U2EA 3AGQA 1Z4IA 3JVUA 1G16A 1RNLA 3A6DA 4GZMA 4R3WA 4DLKA 3EASA 4IF6A 1FFWA 2AXNA 1SXQA 2DPMA 2GX6A 3ABIA 1YR1A 3BL5A 3OQVA 1NVMB 1NFQA 3GJYA 1TYDE 3U81A 2JGEA 3U56A 3QFHA 5EAIA 5HM6A 2RSLA 3JPWA 2QPLA 2QZZA 2A94A 4X91A 4MUYA 5EZSA 2AG1A 3JALB 4BNMA 4P54A 4N5LA 3NYRA 4XGIA 1PV1A 4EKIA 1ZM2A 5GADl 4V1CA 2HMAA 2MCFA 4NU0A 1AGPA 2L2QA 2HSWA 2ZSIA 4FINA 5J5CA 3TB6A 1G3RA 3W5UA 4MQEB 4E07A 3FMOB 2HHLA 1SY7A 5KYXB 1NXOA 3IKJA 2JIOA 4D3YA 5TQJA 3P2IA 3S68A 2AFHB 5AUOB 5HQ3A 3UWOA 4OQFA 2PJUA 4EVSA 4G85A 2WM3A 2B7CA 4ARZA 2HNKA 1Y8CA 4EFNA 2WG0A 1LQUA 2H7YA 1JIQA 3LYLA 2R751 5DX8A 1C41A 3TTTA 4F2WA 5EN4A 1TI7A 2E18A 2FW7A 2ZT7A 4UNIA 1XRJA 2FKAA 2IHZA 2Z8ZA 2BZ1A 3DE6X 4MH0R 3UWKA 5BVHB 1GU1A 4IH4A 5CB8A 5JI2E 5M29A 4B3FX 2TSYB 3I83A 4H3KB 4I9FA 2JF0A 1Z08A 3KXLA 4R3NA 2C4MA 1C1DB 2EV9A 3U09A 4X1KB 1U4OA 1PT9A 1MHPA 3T7JA 3ZIAA 5FD8A 1PK8A 4MWBA 2JGKA 1HNXB 2NZUG 3I6ZA 5ALGA 2H0AA 5ABPA 3NKLA 4KNVA 3S55A 4C87A 4M1ZA 2HQOA 2WJPA 4MIOA 3ZHVA 4R81A 3ZCSA 1MJGA 3TLXA 1N3LA 2I2BA 1WBJB 3PGLA 4X6LA 4YJ3B 2FFRA 5DO9A 3TPFA 1D7AA 3CV3A 4NZ9A 8ADHA 2CZCA 3D9QX 2VSYA 4COOA 5C1OA 1PJ8A 4AS1A 2F3UA 1NVVR 3KVRA 3MIZA 3MINA 5JD6A 3MTBA 1E1DA 3AZOA 3DFUA 4I6GA 3HZHA 3NTVA 1U1FA 3DTVA 4J0QA 3L4KA 3FZYA 5KOJB 1TA0A 1EXDA 3B53X 4RCYA 3DDWA 5LP6B 3RT1A 1HT3A 3BOSA 3NBZC 3SHOA 4KJXA 1DEKA 1HC7A 3A3NA 1AF4A 3PFGA 1NAHA 5FWYB 5B2FA 3W5JA 1JR6A 1WL8A 2C7VA 1G66A 2CXXA 1SVKA 2WIFA 4RQUA 3IMFA 3K9HA 3GK3A 4FSXA 1FFHA 1YZGA 2GAIA 2FUG6 3C8ZA 3ENQA 5JCJA 4F9FA 4KE9A 2YFHA 2CLMB 4ICIA 1D4OA 2DTXA 2GYUA 3RODA 5I4CA 3RVMA 4FN4A 2RHMA 5KJCA 3IT3A 3GLIA 1NKVA 3V32A 1DRUA 2NWQA 3VDRA 3DA8A 4B2PA 4FBGA 5EIHA 1U6IA 3QMWA 5EJIA 4CMJA 4UBIA 4B33A 3QLJA 4M2LA 2C4TA 2R79A 4NAHA 2WAOA 2X1LA 4ZALA 3FWNA 1PQWA 3HB0A 4EL0A 4LK2A 4Q18A 2CDCA 1O95A 4P33A 1XB2A 2BBWA 4IX9A 5A7GA 2BFFA 1LLCA 2XE4A 1GPJA 2OO5A 4QQRA 2JLSA 4E1VA 5HZHA 1ZSVA 3BT7A 4F60A 1Z28A 1T3SA 4DIDA 1R12A 3VYWA 1IN7A 3JQBC 3OFKA 4RF4A 5KNBH 4P83A 1EHYA 2H2FA 5DK6A 1QORA 3SBDA 2WYWA 3BORA 3L7NA 3X2FA 1X7GA 1Y7TA 3KSZO 1PJZA 2HJ9A 4R7GA 1V5WA 3EBPA 4GU5A 4MVJP 2I3GA 1DJOA 3OM8A 3TOCA 1MO5A 2G76A 4RVNA 3LUDA 4DQXA 4DS3A 5C5EA 3DKVA 1A0OA 3JV7A 4DRZA 4ZMSA 2VSXA 2HC9A 3PC2A 3SU8A 3V7UA 1OXUA 3SMVA 1YIAA 2A4MA 3E18A 3EEFA 5E6SB 5C8XA 3SC3A 1M5RA 2J3LA 1UBRS 1KOJA 1L2TA 1X87A 1WMEA 1FQJA 1LNQA 3GPCA 5CA1F 6NULA 3H2GA 4UEOA 4KFSA 1U1CA 4CDMA 3THYA 1QKKA 3ISJA 1R5OA 2RH4A 3GJ6A 4FD2A 4TLMB 4UDXX 5BQPA 4M55A 4CODB 4EVIA 4Z7OB 3OM1A 3IHKA 1DG3A 3GRKA 3BMQB 3I72A 4ZOLA 4ZHQB 2DUJA 3HRKA 3FCEA 3FVRA 3G23A 4FQ7A 1RRGA 1LJUA 1G6Q1 1QQ6A 4V0QA 4EPXA 3KV1A 3PXDA 3V55A 2WYUA 2QA5A 3HCCA 1T1IA 5HHTA 3E6AA 2Q6OA 5P8WA 3WWDA 5FUWA 4EF6A 4ZYWA 4TL7A 1LPPA 4XYMA 5IHPA 1U9IC 1QH1B 2G1KA 3EDRA 3NFYA 1MX1A 3DUFA 2XGJA 1YS6A 1W4CA 1OBCA 2JAWA 4UVEA 4KXWA 2Z1NA 1V7ZA 2HMUA 4HZIA 4XIYA 3E1KA 4BUZA 1NDQA 3IPYA 2DPLA 4DLAA 1P2TA 3GLGB 2P9EA 2NZYA 1GN9A 1WM1A 2HNAA 2CFOA 1LBSA 4F9TA 4D26A 2A1UA 1IK6A 4RYLA 1K8ZB 4D4KA 4IHJA 1W0CA 3M89A 2A9OA 4O4HB 4EWLA 3FLAA 3PQ6A 1YI8A 3AM3A 3NCHA 4FGJA 3PQCA 5CLJA 5H0IA 5C5CA 3OZIA 1GL6A 2V6IA 4JEHA 1QZ3A 1CJUC 2Z5FA 5F21A 3LFTA 1SOVA 2OOKA 4URUR 2PSDA 4ON9A 2YJTD 2HU2A 1P1JA 4NCIA 3ACCA 4QATA 3N3BC 1C0PA 1Z18A 3HLYA 2MYUA 4FK8A 1BKSB 4GGPA 4Q9LA 4XDGA 2W2MA 4RD6A 1ECPA 1KXJA 4MMYB 1GAWA 2Y1FA 3EGEA 1VI5A 3GLSA 5BPHA 4IV8A 4AO8A 2XKJE 4LV8B 4XM1A 3S2YA 1V6CA 1Y3IA 1XZQA 1B41A 1NJ1A 3G2NA 4GOOD 4L5YA 2R7NA 2VRNA 5FCDA 3AQIA 4A8JB 5EUMA 2ZRNA 5EJ6A 4NESA 5A71A 2GASA 2VTVA 2WUGA 4GG1A 3EIFA 3TCXB 2FB9A 3SIRA 1EK1A 2BGIA 4LSGA 4E2FA 4E30A 4FGSA 3QKRB 1QAOA 2C9YA 3Q88A 4LDPA 4O2AB 4YRLA 4UUPA 1LC3A 1DXOA 2AN1A 4NSNA 4N65A 4OYYA 4YP6A 3WKAA 3QX3A 1I3LA 3ER8A 2XQGA 1O9BA 2PX4A 2J3EA 3GLHE 4GIBA 1GIAA 4HAWA 3TB4A 1D8TA 1Q0QA 2E4XA 3IPAA 3NJ4A 3HSKA 4O0MA 4UPVA 1JFFA 3JX9A 3OLYA 4PCUA 3K0CA 5KYTA 2C3OA 3OM9A 2BJVA 4JEIA 1SOUA 2HO4A 4I08A 4KX5A 3AHCA 4J0EA 4P32A 1FCJA 1EG2A 4HAIA 2XKAA 4I8IA 4RSMA 1M8JA 4TYWA 1DS6A 1Q7RA 4S24A 1ZJ4A 1K2WA 3ED1A 3VPFA 4WHMA 3TLGA 4QYIB 3QJYA 1YZQA 1NR5A 3V1KA 4G0VA 2C9CA 3D6JA 2B1QA 3LPMA 4EBBA 3GG2A 1V37A 1FDRA 5ESRA 2ZQYA 3N8NA 5BYBA 4KIUA 3K6KA 3IBGA 5AVKA 2XUOA 2QN2A 2GZAA 2KWIA 3TQHA 4RVDA 4L73A 4NCBA 3FHOA 3JU3A 5LQUA 3CYFA 3PNMA 3VBEA 3WTBA 1K27A 1RJFA 1Z2CA 4HNAA 4QRIA 5A9SA 2AMYA 5EMMA 3TSCA 5JSZA 4ZZ3A 5EZYF 2XZTA 1Z38A 4RSGA 4GDFA 3SEAA 3GRRA 3E9NA 4CIDA 1N7JA 3EXG2 1E9AA 3GG9A 3LQ4A 1PL0A 1J2UA 4X45A 1QQTA 5HIIA 2PZAA 4TYQA 1JLLA 5C52B 2VXYA 3P9XA 4QE3A 2ID8A 3EARA 2PUBA 3M6AA 2HPAA 1R6DA 4A2PA 5K3EA 1ZIYA 1Q19A 2BKAA 2ID7A 1UC8A 2Y1EA 5HS4A 1P75A 3NH6A 1RAIA 5BSUA 1XVTA 2CFTA 3ZI4A 3FH0A 4DCJA 4B6PA 1KFEB 4CL3A 3E7PA 5GIPE 2CLEB 2C4HA 3UJ6A 3BFXA 3SHVA 4BFTA 4XASA 1ORDA 5HZKA 2I3AA 1F0YA 2WYHA 3V7YA 1BH2A 1MVLA 2XMGA 4XR9A 5D5QA 4WACA 4JSRA 4DQVA 1NVUQ 5T7BA 5AI6A 2VF4X 3I04A 3DAOA 2C00A 4KN9S 5H16A 2CXQA 5K0BA 3HCFA 4JJAA 5BOSB 4MTCA 3AU8A 4PW0A 3AR4A 3L1KA 3SIWA 4DY6A 3S8YA 4MVJD 2PGIA 1SKQA 2P9CA 2WEKA 1R4AA 2XGMA 2YZGA 3AZQA 1N2SA 3M33A 1C0LA 4IJKA 4CM6A 5KWIA 1PG5A 1SCUB 3WGJA 2PSHA 5K01A 3VOTA 3AHEA 3CRW1 2VRWA 4J2OA 1Z35A 3QBJA 3WHIA 1Q91A 2GJ8A 3N2NA 4MVJE 4A2QA 4QZVA 4R84A 1CWUA 3W2FA 5K45A 1HTBA 4RVGA 4KQFA 3FKQA 3T7DA 2OB2A 2II6A 1DFIA 3NAGA 4B0PA 5BWBA 4R2LA 3SSNA 3DZJA 4IXMA 4O1MA 1MVOA 3BSWA 3QYAA 1LBIA 2G80A 2HNBA 3N59A 3ROTA 4DCMA 3QU7A 4D42A 1KEUA 1V1MB 3S1AA 3STYA 4Z4EA 2JVJA 2GSWA 2UYHA 3K9QO 5BVGB 3R5SA 4ISBA 1VKRA 3GZNA 4C6HA 3RGWS 3DMTC 4RHYA 3K7EA 3DP9A 4AP6A 3BTVA 2F64A 4JQOA 4BNHA 1ISHA 2XNCA 4KR2A 4G23A 4JHLA 4UTOA 4OK3A 5ES4B 4V3BA 1UAGA 2R4QA 3P4UA 4D8UA 3O4GA 5JLAA 2GZDA 3GNQA 1DC6A 4YTEA 4KIFA 4KL8S 1XQYA 2A57A 2J32A 4R1OA 4TLBA 3QVTA 1BYUA 1G5RA 1B6SA 1YR9A 3TZ6A 1DSSG 4JMPA 1J2TA 3FMFA 5BR1A 4G65A 5C31A 2OXCA 4GNRA 4D96A 3ABRB 3CX4A 3O5AA 1YSCA 1KC3A 1LRJA 1RR6A 2EGUA 4L7QA 1Q44A 3LSTA 4NPHA 3SS7X 3BIFA 3TCNA 4B17A 5KUTA 3HJRA 4II3A 3N6RA 4HB2A 3ZZUA 1U6JA 3D6HA 2IUUA 1JF8A 3V7WA 5DI3B 1O9HA 4BMZA 5J5VA 1R6XA 4RDHA 4RPJA 5GP1A 3BKWA 4ARVA 5MDHA 2UXCB 3TGLA 3SXUA 2IHTA 4YCJA 2EF0A 4ZQEA 1JW9B 1NJSA 1W19A 2GBCA 2I55A 3HN6A 4WZBB 3FW1A 1XNJA 1KJWA 3IAEA 2WNIA 3P0FA 1AGRA 4G0XA 4RSHA 1XCPA 1THMA 4ZYTA 4NBNA 4KE7A 2P6PA 3CZMA 3UWSA 2NZJA 3RHFA 1UQTA 2QVYX 4O1HA 1PTKA 1Y4DE 3FR7A 3VAZA 1Y4SA 5BR4A 3IIKA 4Q48A 1JSLA 1OC2A 1CX9B 1UK9A 3GOHA 3LWDA 4O1IA 4ESOA 3SN6A 2FPOA 1DWPA 5HKKD 4E11A 1IQPA 2RGEA 5IULC 3OEEA 1GTL1 2EW2A 4ZT5A 2Z6UA 2CCJA 4L28A 4UFPA 4NABA 3OFVA 1WW3A 4FMDB 4PLFA 4F06A 3SJZA 3AM1A 2PGLA 5IHXA 2YJGA 3OQJA 4MUHA 1Y63A 1TLFA 5BN3A 4ARCA 3I2GA 1OBFO 2RKWA 2YW2A 3AQ4A 4HADA 2FNAA 3BD8A 5ALYA 2FSHA 1ZK3A 4FHFA 2X8LA 3LUBA 2WWRA 3NG1A 3QOYA 3V8MA 3CR8A 1ZA1A 4DCUA 1KORA 3BC1A 2IH5A 2XA2A 2FWPA 5KHAA 3VYRB 1BD4A 2C4VA 3ETDA 4RGQA 5AM4A 1ZGZA 4QU9A 3A4TA 4EDHA 4HH4A 3ECCA 4MAAA 4P9NA 2E4AA 3L7CA 4FM9A 4N5IX 3RKRA 3KOUA 4FYYA 4J4TA 3UV3A 3I2FA 2VDJA 3HCBA 4JLVA 3AKYA 3GA0A 2LCQA 3DOJA 1L5RA 3PNPA 2Q2OA 1XGKA 4ZZ2A 1GQ2A 2P2NA 5TV2A 1EKXA 1MRNA 4HDSA 5CPFA 3VPGA 3FG9A 3FYDA 1FYWA 2ZIAA 4BVAA 2BM9A 4WZBE 3TLBA 2X19A 1ICIA 1UOOA 4YCLA 2HXSA 3OEWA 2WPNA 4DM7A 2AL7A 3IMCA 3LZDA 3NPAA 3U1TA 1ORHA 3HJAA 3B6EA 1DX6A 2RGYA 3HDYA 3NONA 1J1UA 3NDJA 5EHIA 4C4YA 1M7HA 1Z75A 1O9GA 3CZ5A 2YW9A 1QF6A 1ZNZA 2VZ9A 1P3JA 4Q1DA 1CY0A 4YUXA 4U8HA 1T10A 1F9EA 1VMAA 3DR5A 2COKA 4CKBA 4W5QA 4AUEA 2R00A 1QV6A 5ITZB 2DXIA 2QX6A 3WGLA 1S3IA 3GUHA 4I55F 1AT1A 3OE1A 3L6RA 4GOKA 3VI4B 2XXAB 4H7JA 1QG6A 5ADWA 1WP4A 2A5JA 3JW8A 1TUBA 3T5DA 2FZKA 3B85A 1CZNA 3TL2A 3V1LA 1JHVA 4ZRMA 1DMRA 2YRXA 1B6TA 5F2EA 2VI5A 1UPAA 2PYDA 1C29B 3CH6A 4C22A 5B1YA 2QX8A 1RM3A 2VJMA 3ZWXA 5CITA 1KO1A 1TAHA 3S2GA 1H65A 4M1SA 1W87A 3ELBA 5K51A 4UTVA 9MHTA 1T5OA 1YMUA 3IEPA 5H02A 3SZLA 1VRVA 2GI4A 4J75A 3DXYA 1JL3A 1L5SA 5AI0A 2ERYA 3BAZA 3N8GA 2TMDA 3KYCA 4EGSA 2TRSB 3P9PA 4OG2A 2VPXA 2DJIA 4PRZA 5D5HA 4ABYA 1OLUA 3EGIA 3ZCPA 4M21A 1GJRA 1JWLA 1E3LA 3KJHA 3W7VA 1OC4A 1G21A 4JQZA 4BO6A 1WXQA 3ZBTA 3EVEA 3P5SA 4M0MA 1DKUA 3X0DA 1IHPA 5AT1A 1N5DA 2H0QA 4P98A 4LXUA 2NUPA 1TEHA 2PKRA 1GGNA 4YDQA 3L82B 2QR3A 4G63A 2RHBA 3U7QA 3U44B 1WETA 1PQYA 1ZWKA 2XT6A 5B6PA 4HLUA 3ICQB 2JATA 1PP4A 2REBA 5D3MA 3TS1A 2QN9A 3UENA 1S2IA 3KKPA 3HXLA 2YJ6A 1S7CA 3H2SA 1C8LA 4CG1A 1NJGA 3FTQA 3TDNA 1KWGA 1Q0PA 4IDOA 2QZSA 3FI0A 3BD9A 1A95A 5AJWA 4C43A 4Q1FA 3I61A 2FGJA 5BORA 3AY7A 4QHTA 3GA7A 4F85A 3QVOA 4R68A 4UNQA 3WP1B 1DRWA 4IIFA 4H1TA 4W9NA 3BG5A 3W8FA 2O8BB 2YJNA 2EZ4A 3VO9A 3QU4A 5L3VA 4XM0A 3ZJ4A 4PBTA 2ZETA 1L5OA 3OZVA 4RY2A 4XKJA 3RB8A 4D4GA 4XD2A 5LLSA 2Q5QA 3DR3A 3N7AA 4FFNA 4GX2A 3UHPA 2QIPA 1G6HA 2OUKA 2QMQA 3BERA 3L4EA 4M1YA 5HE9A 3RYTC 4UUAA 4WZ6A 2BI7A 4R6XA 2OPHA 3ZDEA 2P3LA 4ND1A 4UPDA 4ZCQA 5HMMA 3F6EX 2MSCB 3DLAA 1BCSA 2EX1A 2I6FA 3DO5A 1NG1A 2C0PA 1Y0BA 3RAPR 4UEKA 4D0SA 1CTQA 1H2AS 1AKQA 3N7UA 2ARKA 4X8LA 3MXTA 4YV2A 2CYCA 5C1IA 4JWKA 1MA0A 2C58A 2FDXA 4B73A 4EHIA 2K2WA 3D0OA 1C50A 1IG0A 3LC0A 2WT8A 2KB0A 4LMRA 4QUJA 5A4FS 5KNCA 4YNBA 1BMFA 3L8DA 4GSKA 2VP0A 5AVUA 1M1YA 2MSKA 4NENA 2RGCA 3AGPA 2DCMA 3CWZA 4TPKA 1FFXA 1O87A 1TVMA 2WIAA 4CWAA 1P3Y1 5EPOA 4NWIA 5HCUA 5FT9A 4ZI7A 4UE6A 3HVKA 4C0QC 3Q7IA 2VJCA 1WTAA 3EAFA 1GV1A 2JC3A 1IRIA 5CT5A 5B37A 3PHJA 5FI3A 5EIAA 1DCMA 3RSLA 4RTOA 1U4NA 4K9QA 5AVXA 1LSUA 3EWIA 3EXFA 3MB5A 2Z57A 2VN8A 3R6LA 3CX6A 1VIAA 1JQDA 4PQEA 1DWOA 2P11A 3VR5H 3U5TA 3I2YX 4KWCA 3TBHA 3ZCRA 1HDZA 2H1OA 3BMCA 2PVCA 3RRBA 2AV6A 1X77A 4G84A 4MSUA 2NNWB 2ZU6A 4W63A 1P31A 4C78A 2JI4A 4L8FA 2WF5A 3IQFA 1EXWA 2X3UA 4GF5A 4YO8A 1H5QA 4UU8A 3CZAA 4BU0A 3B3JA 4EEKA 3OLZA 3ZR4B 3V4LA 3Q5GA 3DNPA 4G4SO 4MEAA 1N6HA 4FYHA 4CU5A 4K9OA 3VU8A 4DANA 1P6XA 2CNLA 2RGNA 2UV8A 4XYBA 1ZKDA 3PJGA 4FS3A 2J45A 2G83A 1K6MA 2DPGA 2NZ8A 2BGLA 3QV1A 5EWJA 4IMIB 5H3CA 4JP8A 2C84A 2GD0A 4MP3A 1TZMA 4IWNA 4CNBA 4DC9A 1E0KA 2OCDA 5JAIA 1WVMA 3WXBA 1EDDA 3KR1A 4KDCA 5JYDA 3AVUA 4I5FA 4MQBA 5FNVF 3ND8A 3UMMA 3KYIB 1KNQA 3ZUGA 4FE4A 1TQ6A 3CB2A 4FC6A 4ARSA 4HDMB 4B34A 2XQIA 2HBRA 3ER6A 5T4FA 2Y0CA 1SIUA 3OX3A 1KQFA 4O63O 4BN5A 2XOXA 4MCHA 4ZWNA 4PO1A 4HB0A 2CLSA 4RPHA 4I2VA 1VSTA 3L7OA 4CMHA 5J2UF 1IHXA 5BSGA 3NALA 3FNEA 4DQKA 4G4GA 5AXCA 2OCBA 3PRYA 3NUGA 2JIBA 1ADYA 1PN3A 4BMPB 4KAXA 3JYHA 3I9OA 1GGFA 1M54A 1UM8A 2VSQA 2NUTA 2FR1A 3KC2A 2BE9A 2WAXA 3QVMA 1DCTA 3L6BA 4YYEA 5AK6A 2HXGA 1IXYA 1SJ9A 5B6IA 1JPVA 2BTQB 5J47A 1D8AA 1GL9B 2YXDA 2XH8A 2NTVA 2ZT6A 3UG6A 3MT9A 2QAGC 1B00A 1E6MA 3ONNA 1QOPB 2YBEA 3OZWA 1T9GS 3GARA 2HMYB 4UU7A 2V9CA 1T8PA 1XZNA 2BN4A 2B2XA 1V0JA 1I5EA 2WD9A 1ZK0A 3A32A 3LVFO 2G5CA 4NU6A 4NV3A 3I52A 4Y2GA 4Y30A 2YXNA 5FRDA 4ZN6A 3W4KA 4TL9A 1K7XB 4A7PA 3IVXA 3HGQA 4XWGA 2MIIA 1J0EA 2VJAA 3CLUC 3O1IC 4B84A 3HKBA 2A9RA 5ENDA 1Z26A 2FX2A 5DHRA 1E3QA 3QSYA 2EJCA 2A0XA 1X1BA 1N0IA 5EP1A 3N8IA 2QN6A 3F9CA 4ARIA 3NIBA 3IQEA 1ST3A 4PZ0A 3RHSA 3UYKA 1SG9A 4OL0A 4LMAA 1ZGGA 1DC5A 3E8XA 3KEFA 1RWWA 4E0BA 2JLVA 5IJ9B 4ZVQA 1A71A 1RQRA 1KMMA 2VOJA 1WQ4A 1ZNXA 3K9CA 2YFKA 4PG8A 1NE7A 3TLJA 3E22B 4G25A 3JSXA 2OVFA 5JSUA 4MUMA 5J2TA 3GCDA 4X94A 2OEPA 3IMKA 3ESRA 3RSHA 4CEHB 4A0FA 3E0XA 2AE2A 4DIFA 2I6QA 2G09A 1Q7BA 2NXCA 4LXXA 2YFYA 5T8KC 1O3YA 2QJOA 1M2GA 3C3WA 4Q5IA 3GEHA 1W47A 2JFYA 5JYEA 2NU6A 4RTRA 1FDWA 3DBLB 2I66A 1JGTA 3G6KA 1XDWA 4YMIA 1QYCA 1WR8A 1YRAA 3CVJA 3FNFA 4GLFA 3TLAA 2RJ3A 4H27A 4ACAA 3RHTA 4E88A 4JX8A 5F7XA 3NP9A 1QH0A 3AL2A 2FPPB 3KKOA 4RIIA 4F3TA 5AHOA 4L5AA 2ZWAA 2BAGA 2UZ0A 4AVYA 1ZD4A 2ODEA 2PMCA 3M49A 4HGQA 3PX3A 3JYNA 1G7RA 5DOZA 5AHWA 2GJSA 1A76A 4YP5A 1OQAA 3L7DA 1UWVA 4LPKA 2HA3A 5TR9A 3VGPA 3WDSA 4EPTA 2O54A 1O89A 2AMVA 3H5RA 3O4FA 3QQ5A 4IGKA 3AIMA 2O2EA 2D0IA 1WMFA 1P7PA 4M1QA 4XVRA 2B2CA 3MQFA 3ZPXA 1X1TA 1FMFA 4O4IB 1C7JA 1EQUA 1MC8A 4QOIA 5T6MA 3KELA 3R0ZA 4HLNA 4BRUA 1I6MA 3KWMA 3AXSA 4EAQA 1UBSB 2XQKA 3TF5A 3K0SA 2PLAA 2PD6A 4JLPA 1OF1A 3ZXYA 5KTNA 1U8XX 1F0NA 2J6HA 4B48A 2XKKA 4V38A 4HVLA 1RWBA 1SXIA 1KJQA 2VDWA 1EUQA 2H7VA 3N2EA 1FFAA 5IDVA 4C4ZA 3DEJA 5F64A 1QE5A 2AMLA 3RYHA 4J0GA 1OWPA 3IJRA 1W88B 3ZS9A 4C7XA 1MHTA 1NULA 1OLOA 2HH9A 3L7YA 3D6AA 4PYKA 3VHXA 4ZT6A 1JKIA 3WOHA 3IESA 3CUYA 3MW8A 1XWWA 5EPEA 3W1VA 2G71A 2YIVX 4Y2RA 1RZUA 2GA8A 2JFXA 1GOTA 1JECA 4Y2UA 3LCCA 1ZCFA 1VPWA 1KKLA 2H2AA 3H9GA 2CXOA 4LZZA 1BHQ1 9ATCA 3M1LA 4LX0A 4OM7A 1GGKA 5JQGA 3VJKA 1A8HA 2P78A 1HFEL 1ZD3A 2QRNA 3Q9UA 4FGWA 4XJSA 4D9EA 3SF0A 2JG3A 3ML1A 5J4YA 1C1XB 1T2DA 2VO1A 3PR2B 4JGIA 4NNJA 2EQBA 4X1IB 4MUJA 2VH2A 3H0EA 3RIEA 4EJ2A 3B9BA 2WWGA 4I36A 2Q9CA 5NULA 4DYVA 3TGPA 5EJEA 2DKOA 3CVVA 5G3YA 3OPYB 2CZQA 1ZHFA 5A5GA 3EC1A 3CRZA 2WMDA 3WGQA 1Y5IA 5DBEX 4CPDA 4I3GA 4LRSB 4OQPA 1ULHA 3K53A 2DB3A 2BF7A 2XUJA 4P08A 1IVYA 1J1ZA 5DWDA 3RVOA 1R50A 5PNTA 2XNHA 1C80A 2O2DA 4AZ0A 4RADA 3A9RA 3DJFA 2NYAA 2B1JA 1C8KA 1G4HA 4J1NA 1PV4A 3PHBE 3T3IA 1SBZA 2HGZA 1NXVA 4JUBA 5EC8A 3NTXA 1P4RA 2W6ID 1G8JA 1NLUA 4P3OA 3OWXA 3GEMA 2AC7A 1DQRA 1KVUA 1J2RA 2D5LA 4X00A 2VBIA 4YJHB 5GMOA 1NT2A 3UJDA 4AJNA 1G3QA 1BRTA 2FW6A 2HT6A 3W5CA 1FJGB 4E46A 4DPKA 3ZJUA 1WUYA 5AJHA 3PVZA 4ZT4A 4QTZA 5KEIA 4FDUA 1C9EA 3COWA 3RRJA 4FQ8A 1T1SA 4LOAA 3DBOB 4O25A 4H7PA 3WAGA 1VM6A 1JE1A 2Q6IA 3D1JA 1P2VA 4JLDA 1A1SA 2QT1A 5KCMA 2PMFA 3H83A 1L5FA 4TQAA 1S8FA 3VJRA 2QUKA 4MVJF 1X14A 2FVYA 1FRQA 4NP6A 2RGRA 2EERA 4G2TA 3FNGA 1IJEA 2HDNB 2GXQA 4IJWA 2W48A 1K4YA 3OMWA 1RAHA 5L6LB 3TMKA 3ZGOA 1UOPA 3FPEA 3GH3A 1YBMA 3QEOA 5EEHA 1LCIA 1E3TA 1ZMOA 4I50A 4L3VA 4N0MA 3S7TA 4XDYA 1NMZA 2IYZA 1CR4A 1MG5A 2VBGA 3D4IA 3JD2A 1H23A 1IWBB 1U4SA 2JFOA 1HORA 4FWIB 4U2BA 1I6WA 3OP1A 3H5WA 5IUKC 3ZHRA 2P9QA 4YUYA 3R9XA 1KO8A 1C7RA 1TIPA 2QI9C 4PRLA 2IV2X 4DF3A 2DEUA 3LXRA 4KFUA 1BIFA 4F56A 2X8WA 5L45A 4QULA 5CH8A 4L9WA 3J7TA 3E58A 4E5PA 1ADBA 3PEUA 4X92A 4JUCA 1OZFA 5D5PA 4RTMA 1J39A 1U0GA 2GRJA 3KJGA 1BS2A 3GUVA 1GPH1 1RD4A 2IYPA 2AUNA 1NVEA 5AFSA 3HYRA 1Z5NA 2HA0A 4LG1A 4RMHA 1V96A 4X95A 4A0HA 1PG0A 2ZUSA 2EXXA 3T9FA 2P9ZA 4B6FA 3A6JA 2HWUA 2Q9BA 3SHWA 1PBNA 1T4BA 1SN7A 2XR1A 4K87A 4NNPA 2GESA 3VYUB 4AUNA 3AFNA 1P91A 1YUBA 3AETB 1VCOA 4UDNA 4PXYA 3PICA 4Q19A 3NDIA 2C5FA 3A1EA 2RG1A 1PDVA 1LV7A 3F6RA 3BAFA 3PB3A 4BWFB 2G0NA 3WS7A 5KO2A 3F2VA 4PLTA 4UC0A 4JYBA 1LD3A 1VGQA 5BPFA 4PONA 2W2TA 4Q1VA 1TYBE 3T3DA 3W8NA 2D7CA 2NM0A 4YPOA 5BNWA 3ZU3A 3WSWA 1KEKA 5JPCA 3H6GA 1BXGB 2JZNA 4NKRA 5FP0A 4UTNA 1NQUA 2JJ8A 5LCXA 4ZA2A 3ZY4A 3MXOA 4AY6A 5LQRA 4D6XA 4LYGA 1ADJA 4BO5A 3KE8A 3D3KA 3Q3GE 4B7AA 4CM8A 1YK1A 3KSUA 1ML4A 1XFDA 2EBFX 1Z7GA 3G2IA 4LXHA 3RJZA 3VR4H 2DFDA 3FBGA 5KDDA 1H9CA 2VYCA 3KKNA 2BZ0A 1WA5A 3ETJA 4HQ0A 4IIJA 4KQJA 1RHRA 2EKPA 5FFFA 4CBVA 3D6VA 1FBTA 2IY7A 4LF4B 2P6RA 2FPUA 2HA7A 2FJUA 4HNHA 4WKPA 1NYQA 2VHUA 1L1RA 2ZUBA 3GGDA 2D06A 5FAXA 1MR3F 5LJIA 3AVXA 5JAHA 3NGMA 2O3JA 4Z0HO 3W6OA 1FLVA 1ZZEA 3EIOA 3VKHA 1XI2A 1BTOA 1JG2A 1R4NB 4KQCA 4M9RA 3JVIA 4AS2A 2IEYA 2Z5LA 2A5FA 3QKUA 3W77A 2XWSA 5LDHA 2XHEA 3IP6A 5EGNA 1SKBA 3RTAA 1E7WA 4JOBA 1QO7A 4RELA 3GJXC 1NW8A 1YA6A 2EG5A 2QQEA 3UA3A 1KP2A 1XMXA 3N70A 3EXIA 2YWCA 5JS1A 1YQQA 1PR9A 2QRVA 5JQGB 2BFOA 3MOIA 4CEJB 2FRVA 3ISVA 3MJCA 4H7KA 4P4GA 5I7UA 3QENA 3RSZA 2FDCA 4FX5A 1BH6A 1K6JA 3OPQA 5FPSA 4O0LA 1TNDA 4QPDA 5DFAA 4E1AA 1QX4A 4AF6A 4K6MA 4QVGA 4XB6B 4F5ZA 4QFDA 1YVRA 4BX2A 1Z0UA 1Z82A 1ZINA 2WF6A 821PA 3KLMX 3A7DA 4RM3A 3U7FB 2HV9A 1IDOA 1M34E 1RWQA 1U5BB 1MNQA 4TROA 4WEQA 1R18A 4UTPA 4ZQFA 3DDZX 1M3SA 3LO8A 4ZT3A 1DTSA 2LWIA 2E37A 3B9RA 3DE5X 4FEYA 4PC7A 2J4CA 1FP4A 2EIHA 1ZM7A 4GUDA 2BKLA 3KT3A 4HX9A 5BYJA 4BTVA 4TTPA 4JBHA 1AV6A 4PZ9A 4RQAA 2V7PA 1YVDA 3JPYA 1M6YA 3O3MB 4G1CA 2PUDA 2NUAB 5KZMB 5L3ZA 5KVSA 1PW5A 1J0AA 3K09C 1M1UA 5D51S 2BT4A 3ADOA 3COSA 4L6AA 5F3DA 5T41A 2O8VA 5EKXA 5WRFA 1BXRB 2IQIA 5HUJA 1KYWA 1LC0A 2CDRA 4ZC1A 4M22A 3EY4A 3TVDA 1G8KA 4GKBA 1XALA 2YIMA 1RRMA 1I7NA 5DMXA 1CDOA 3RUPA 1IZZA 1U7DA 5L51A 1ACLA 1NVWQ 2N0SA 3Q3IA 4A73A 3M1AA 5C8ZA 2YZKA 4IJQA 5DNDA 4BO0A 1YZVA 3PLNA 4TVOA 4EZIA 1E2BA 3SYKA 2PS1A 4CJXA 3RJ9A 5HOEA 4BVJA 5EMKA 3P20A 4YWJA 3LE8A 4TXMA 1R0ZA 2JAHA 3F71A 1BG6A 3KKZA 3KQQA 4QTXA 4RF2A 1CQZA 3C7CB 1VJGA 2B8JA 2GNAA 1BEZA 1KA9H 1PX2A 4TWRA 1P2BA 1JLSA 2P68A 3KUDA 1ISSA 2DCUA 2JFFA 3GCZA 1J56A 1QO0D 1RLMA 3R5HA 1C3JA 3U39A 4BVEA 4F46A 4WJKB 5C8YF 2VNKA 3FVTA 3KOYA 1XLVA 2WM2A 1JXMA 2PMDA 2WHXA 1DZIA 2QLBA 4G8DA 1D1QA 1JTFA 4A03A 4D5EA 2O5EA 4B46A 4DBZA 3PHHA 3NZEA 3QA9A 3HEAA 4ENQA 2WKRA 3Q7SA 4PZEA 2BD0A 3LT5A 1VKZA 4HAUA 4M7WA 2QF7A 3WK8A 4AK9A 2OG1A 2VL7A 3K2BA 4K9DA 1RXEA 5I7AA 1OFGA 2FEAA 2ZDQA 4JOCA 2PNJA 4M0EA 4X9XA 10MHA 4EJ6A 5EJ8A 5F2OA 621PA 2CNBA 2K2QB 5CGZA 4RF5A 4UHCA 2NVWA 2NTEA 3U1VA 5JU6A 3DD1A 4TKVA 1GRVA 4EUEA 1QHHA 2QMZA 2F1HA 1BEEA 1X1EA 3G8AA 1LS6A 4PYIA 1CRPA 1SVWA 2FFJA 2Y67A 3GLIB 2V74B 2F3QA 1ZRSA 2EKDA 3TVYA 2DVMA 2P5UA 4MPDA 5FJIA 5FPTA 5H1YA 1DOZA 4Z4IA 2JEZA 3I23A 4BMSA 4FYIA 2ZYSA 3JWPA 3M5PA 1QFMA 3DM5A 4Z49A 2HBQA 1R3UA 221PA 2HREA 4FW8A 4RHUA 5KSOA 2JANA 5KTYA 1FU8A 1Z2AA 1FJHA 1VZ2A 1JMYA 3D6NB 2A7QA 2OD2A 3E3MA 1NT4A 3HUFA 3QYPA 4QYMA 3GOQA 3H4TA 2P75A 4WEOA 4EY5A 4MW7A 3U9LA 3PUYA 4QT4A 2JB9A 2PX3A 4KGXA 3H1GA 5HE8A 2IFTA 3HB7A 3ZN2A 1CUWA 3ZV6A 3B6ZA 3K4PA 5FYQA 4ER7A 5ICMA 2IV3A 3O2SB 2GN6A 3TM4A 3ZHUA 3PNLA 3WFJA 4E5UA 4EY3A 3A4YA 4WFIA 5DRYA 2PSSA 5J1TB 4V0NA 3EMBA 4EHDA 4JXXA 4L78A 2UUPA 1WG8A 1JEDA 1TAGA 3IBTA 3G2HA 3OPYI 4EABA 3K71B 4X7BA 1WNFA 5JPIA 2ODQA 3NMUF 3KIPA 2FWAA 4KB5A 2YVQA 3FWHA 3QOXA 2I2AA 3U16A 2RGUA 2JA2A 1NXWA 2QN8A 2YWXA 5JVDB 2WNSA 3MOSA 1DQSA 2ZREA 1DPFA 3P0EA 1TADA 3R41A 5DASA 3ICPA 1UBHS 2H57A 4BNFA 6YASA 5H9WA 1ES9A 3DMGA 1VHJA 3PKJA 4OYHA 1CJBA 3QY0A 4QDOA 3EA0A 1T4MA 1FNCA 4IO0A 5AVOA 3ZU2A 4B71A 4UTXA 1Q0SA 1LRLA 1VYTA 1UKYA 3HM2A 1ULZA 3IAAA 4IOMA 2EP8A 4BKUA 5FFNA 4D9KA 2MYPA 3VAAA 5CVUA 3VPBA 5AVYA 1GKLA 4B2LA 4DCNA 1V3VA 3WB0A 2O14A 4XCQA 1V1JA 4QLOA 4HNQA 3I9V1 1KU6A 2CNNA 2BM1A 3B6MA 1GITA 1V2HE 4E08A 1E1NA 3P2MA 1BRMA 2NQTA 1P29A 2YVAA 2C2YA 3OOWA 2ACKA 4XLLA 3O8CA 3LX4A 4DREA 5K0JA 4BX9A 4MROA 3UC5A 5CDYA 3F4LA 4B45A 3G1TA 3HWWA 1B74A 4DDWA 1N8NA 3HXTA 4ZOLB 5CD1A 1STOA 4NYJQ 3RTBA 4X3CA 3I6YA 2JEYA 4WESA 1X0VA 3KNZA 3IFSA 4ZCTA 4FUQA 2WHQA 3W5HA 1E79D 2GZRA 5L4LA 1VSQA 2FN3A 2I4IA 3LZ6A 4DWJA 4U00A 1RM0A 5DYTA 2YICA 2HFKA 3QVSA 3D8HA 4DTIA 2FQXA 1I7SB 5FA6A 2C0QA 4RD0A 1NOJA 2IOHA 4X3OA 2AF4C 2O2ZA 3CLHA 3MUFA 4JB3A 4C29A 4EF4A 2ZXFA 5H5JA 3V48A 3MIIA 5DLQC 3SXJA 4XQCA 1GPUA 2AHRA 1P81A 2H2WA 3BTUA 3UAZA 4AW9A 3P0IA 2GBLA 4BFWA 2OV8A 4CQMD 4ABTA 3RYIB 2FP4A 1Q16A 3KQTA 1WU8A 4AY5A 1CV2A 1MB3A 3I0MA 3Q7TA 1Z33A 2WJGA 4FNOA 2JGIA 2VP6A 1SH7A 5K3CA 1P2SA 5F3RA 4CKEA 5LZ5A 4QG7A 1XROA 3D3QA 4MWOA 3ZWVA 1DDIA 4BCBA 2ZUFA 2ZSFA 3Q7RA 1UC4B 2H7CA 1I10A 4PG6A 4LAFA 3DLIA 4BVLA 1EM8B 2MINB 4TL8A 3QWAA 2FP3A 3FSGA 4G1VA 3EWAA 4OBXA 2R25B 2AQKA 4KN6A 4KQHA 1F3LA 2SNIE 3ZDZB 2SKCA 5KQPA 4BUJA 4KYTA 2VT3A 5SY4A 8LDHA 3I34X 4ZOAA 5TE9A 4XJVA 2GM5A 3ZQ6A 2YBDA 4DOMA 3DAFA 4P3KA 5I6DA 5E1BA 4MPRA 5AKIA 3GVPA 1M6WA 1NSYA 2I34A 3RVRA 1ZZGA 3PUVA 5GONA 1R0RE 1DAIA 5CXUA 4AU1A 4BRZA 1XYGA 3NTRA 2R2AA 4KRYA 4LYAA 1C4XA 3NHKA 1Z2OX 1EK0A 1V41E 1XCBA 1Y6JA 1GPMA 2QQ0A 4GDMA 4R4JA 5L7WA 4MRPA 2P9YA 3IALA 4RH3A 4BFVA 2IHKA