1XLTC

Crystal structure of transhydrogenase [(domain i)2:domain iii] heterotrimer complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
RHMAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAD(P) transhydrogenase subunit alpha part 1
publication title Conformational Diversity in NAD(H) and Transhydrogenase Nicotinamide Nucleotide Binding Domains
pubmed doi rcsb
source organism Rhodospirillum rubrum
molecule tags Oxidoreductase
total genus 52
structure length 174
sequence length 174
chains with identical sequence F, I
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2004-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1xltC00
2VBFA 1YI1A 2VJYA 3HWWA 4BN5A 2IHVA 5EJ4A 3FLMA 4JD5A 1D4OA 3CLTD 2OD2A 3U3DA 4KPUA 4C78A 4JUBA 1V5EA 2VK4A 2JI8A 1NM5C 4V1CB 1M2KA 5DGTA 2H4FA 4F56A 5FYQA 3FZNA 4UU8A 5FEMA 5K6TA 1YTLA 5EJ9A 4RJJA 2H2IA 1T9CA 2WVHA 1Y9DA 3CLRD 1M2JA 4GPEA 2QQGA 2AG1A 2A1UA 1T9AA 1UPCA 5AHKA 4K9NA 4J16C 2H2HA 1YI0A 3GLRA 2EZ4A 4MPRA 2Q28A 1PT9A 2FSVC 1Z8NA 4G1CA 2V3WA 4GM1A 3D7KA 4L2IA 1BFDA 3ZGVA 3PKIA 4F4UA 1UPAA 4UTZA 4V1CI 3E9YA 4K9LA 4RJKA 2Q27A 1PVDA 2W93A 4Y6OA 5BWNA 3GLTA 4D5EA 1PI3A 3IAFA 5EJMA 1ZPDA 1YC5A 1YNOA 4KGDA 4BVFA 4R8MA 2EZ8A 4IAOA 3EYAA 2AG0A 4FZ3A 2WVAA 4Q9DA 2H2FA 1E3TA 1O97D 4UTXA 4KXQA 4RMJA 4HDAA 4BVEA 5EJAA 2Q5LA 2UZ1B 4TWIA 5K3SA 3EY9A 1DJLA 4RMGA 2VBGA 1T9BA 4RMIA 4MZXA 4FEGA 4BVHA 5MFZA 4BV3A 2OO5C 2FR8C 2OD7A 3OE1A 3PDHA 1O96B 1OZHA 3GLSA 4ZZIA 4UUAA 1PO7A 4JUFA 4GG1A 4UU7A 3EA4A 3LQ1A 1YHYA 5MF6A 1M2HA 4GM0A 1YBHA 3FSJX 4RJIA 4K9QA 5BWOA 1POWA 2PGOA 2H2GA 2EZTA 1Q14A 1Q1AA 1M2GA 2H4HA 2NXWA 1PYDA 3HWX1 5EJ8A 4QPZA 2PGNA 4X3OA 4HD8A 2VK8A 2JIBA 1V5GA 1XLTC 5K6RA 1POXA 4IF6A 2Q29A 4GM4A 5EJ6A 4QELA 2QQFA 1MA3A 2JI7A 1MCZA 3RIGA 1EFVA 1SZDA 2PANA 2JI9A 4JUCA 2IHUA 4ZP1A 2EZ9A 5DGDA 2OORC 4BVBA 2HJHA 1SZCA 4BVGA 1EFPA 4UTVA 4K9PA 4QQ8A 1QPBA 1OVMA 3D4BA 2C31A 2B4YA 4D5GA 2NYRA 4RMHA 2VBIA 5MFPA 4JT8A 3CLUD 4MPJA 4UTNA 3JR3A 1S5PA 2VK1A 4BN4A 5IMSA 3CLSD 3ZG6A 1OZGA 2Q5QA 1JSCA 4O8ZA 1Q6ZA 1YHZA 2IHTA 2OD9A 4L3OA 5BWLA 3K35A 2A1TR 4JUDX 3PKJA 4I5IA 1J8FA 3ZGOA 4J1TC 5DEIA 5EJ7A 5D7NA 1PNQA 2Q5OA 1U28C 2JI6A 4JSRA 4K9OA 2JLCA 4MPPA 4TWJA 1ICIA 1S7GA 2UZ1A 2X7JA 4X3PA 1UPBA 3IAEA 1M2NA 4FEEA 4JU9A 4COKA 4BUZA 4JT9A 5EJ5A 1PNOA 2Q5JA 3F6EX 3D81A 5MGNA 4V1CA 1HZZC 2H2DA 2BRUC 1U2GC 4GP9A 1YC2A 4IG9A 2FRDC 4UUBA 1N0HA 2H59A 2FN3A 4UTRA 3CF4G 4JUAA 2FWNA 2WVGA 1T9DA 4Y6LA 1U2DC 2H4JA 4BV2A 4K9MA 3GLUA 2EZUA 3JWPA 1V5FA 5K2OA 2DJIA 3U31A 4MQ5A 4JU8A 4Y6QA 4C7BA 4K9KA 1PTJC 4FVTA 1OZFA 3RIYA 1Q17A 1U31A 2JLAA 3F6BX
chains in the Genus database with same CATH superfamily
4HWKA 3HPRA 3IVXA 3AVWA 1GSIA 1O6CA 3INGA 4XCXA 2VG8A 4X60A 5I9NA 1GPH1 1YL7A 2A8YA 4HATA 4I55F 4MVXA 2C96A 2PJDA 3D31A 1Q19A 1Y5NA 4TTAA 4X8HA 5JWRA 1XO1A 1E9VA 1UBUS 3I12A 1DKPA 1WXDA 3GA5A 3GRYA 4QAQA 3WJ2A 1CR0A 2RAVA 3MTIA 3QKRA 4O4HB 5DE3A 2A2ZA 3Q0EA 3T9BA 3UJHA 1VKNA 5JC1A 4BEBA 4PIPA 1UBMS 2YHIA 5AUOB 4UPDA 2DEUA 2ZFUA 1YJQA 3TOCA 3R20A 2IF2A 1G0OA 4V1CB 1BXKA 1Z5OA 3HFRA 3WIBA 1ULTA 3BJZA 5K3FB 2J0SA 3F7MA 4DSUA 1U1FA 2HSZA 2YC4C 1NWHA 2XCQA 3L0YA 4KDCA 4UBOA 1XCMA 5IAJA 1NQOA 2ASEA 1JZQA 2ID9A 3R9KA 1TCVA 1GDHA 2ONYA 2WHRA 2EWVA 3GQVA 5EIOA 3PDIB 3O31A 3QX9A 1X70A 3GT4A 4NNPA 5FEMA 5DF1A 4N6GA 1H85A 5LJLA 3VR3D 4JCCA 5K6TA 5JSFA 3GXBA 5FOSA 1WCIA 1NGSA 2DMRA 2OVBA 3DUWA 1FFHA 1RJEA 1YT5A 2JAQA 1TAHA 1FRZA 2YVQA 3E4CA 3GJYA 3K9QO 2QMOA 1XQYA 3IOMA 1I1HA 2W2QA 3K0AA 3CVJA 5J4KA 4MR7A 3L6UA 4OAQA 4WGGA 5K3BA 3QFRA 5TPWB 5I45A 2FFHA 5L7YA 5DNYB 3IDAA 2XPCA 3E7FA 4HDKA 4NHOA 1C0LA 1B3BA 2PAFA 3VXKA 5DVZA 3ONDA 4E22A 2EF1A 4FNAA 3F4LA 4NL4H 3K70D 4F3CA 1XDDA 3G8YA 4IWYA 4DBZA 1KYVA 4EJSA 5BV7A 1UCFA 4EKDA 1MDFA 4O08A 2ZM6B 4YAWA 4RHEA 1PFYA 4XQ0A 3T7SA 4YP5A 3U3ZA 3U62A 4DGSA 2OXEA 1OLUA 2OFOA 2WZCA 3DCNA 2H7YA 2ISSD 3LDUA 4JBXA 3G8BA 4R01A 1E7RA 4JP3A 4IMRA 4OHMA 4J07A 3G6KA 5ANRB 4COOA 5C7IO 4MPRA 3RVKA 1DQPA 5ALOA 3RV3A 1KZ4A 4XB1A 2ZTVA 3W3AH 2GLXA 3NWJA 4PNPA 4TKUB 1PS0A 4ENUA 1PX2A 2V6JA 1U7WA 3GMSA 4LDRA 2ZWPA 2R8OA 2XYRA 2PEZA 4UZFA 1LSOA 3ZWOA 2NXEA 4C4AA 3EVNA 4E2ZA 5JSZB 3AUTA 1YNSA 4GH5A 4DA0A 1USVA 2XZOA 3PGVA 2DLCX 1B1CA 2XW6A 3QX7A 4GOJA 3V8NA 2AS0A 2OP1A 3IEUA 1K66A 1T43A 1KMHA 4K9LA 5F7JA 1ID8A 2ZB4A 1R0WA 1ZZEA 2DBRA 3M9WA 5B7GA 3R75A 4D2IA 3R7BA 1CEEA 2M32A 2FMXA 4PLWA 2BY4A 3WJ7A 2B8JA 5IF3A 2XCIA 3LUGA 4M0UA 1FW8A 3SHTA 4K1LA 1AY0A 2NWQA 4W8GA 1N36B 1YC5A 3EARA 4IV0A 4ZVTA 3PXAA 4R6WA 1KJYA 1TMKA 3WWZA 1NY6A 3BXXA 3QLVC 3WMEA 3EXG1 3C3KA 2IXDA 3CXRA 3HBLA 2PU5A 1N2SA 2GF9A 1CJCA 3IX7A 5CDHA 2VF8A 2AJCA 2E4XA 3E3OA 2WHYA 4CDRA 1OIVA 3EYAA 2AG0A 4HQNA 4OQEA 2PU7A 4X92A 2FX5A 4DIFA 1R12A 1UWVA 1M6EX 2H2FA 1YR9A 2W6MA 2X4IA 4INJA 1F8FA 4RPGA 1ZGAA 4HAOA 3QOYA 4BECA 2JLYA 2ZWOA 3LNCA 3B13B 2FETA 1KR2A 4JT4A 1UMDA 3HKCB 4D9IA 4MVJF 3NH6A 5HXAA 2GN6A 3KIPA 3TLKA 1EGAA 2ZBRA 3IR5A 4NSNA 1B76A 2HLNA 3DZJA 4RFVA 4U7FA 2Z09A 2I6TA 3TPZA 3H75A 3AM4A 3ETEA 9ABPA 1UJBA 3Q3GE 1SQGA 2GF0A 1ODKA 4GEGA 3ON5A 4NVRA 5HIJA 4RSGA 5FTKA 1BCRB 2E5WA 1HY3A 2R5NA 1TU4A 4NYMQ 4HWTA 4H7PA 3VO1A 4E2FA 4NMWA 3JYNA 4BU1A 3JQAB 1E6EA 4RMGA 1C4XA 4DV4B 3U4CA 1JSZA 3HTXA 1G3IA 4M60A 3H9GA 4WPGA 4BB5A 1GYQA 4OATA 2CJXA 4I8XA 5D84A 4F85A 5IH7A 3Q3HA 2WF5A 3N2IA 3OPXA 5LU9A 5CYFA 5FD8A 3EGCA 5IFLA 2HGSA 1X7XB 1RI2A 2PMFA 1GTRA 2OGWA 1TKRA 2GYVA 1UEIA 3MWDA 2TSYB 4K6FA 4A92A 4TVBA 3ZCTA 3LCVB 1YUBA 2HJGA 2OCBA 3WKEA 5HPYB 2FP4A 4E1AA 3FBTA 3TX2A 4QUIA 4Q9HA 1S3IA 4HNAA 4M22A 1E61A 1Y6ZA 3GNTA 4ZZIA 5B1HA 3VVBA 3VM6A 1PO7A 4LCBA 1X1EA 4X54A 2TRSB 3SC2A 3P9PA 2W2KB 1G16A 3GCGA 2MYTA 3R3SA 4O2LA 5EIEA 1RPAA 4MITA 1VIMA 3Q3EA 5LQDA 2NUAA 3EXAA 2PL3A 2L82A 4PNHA 4V0QA 3M7IA 4XCQA 1MNAA 1XAJA 4TXLA 3GLGE 1D0VA 2P6OA 3L8HA 1BTOA 2C4KA 1TU3A 2R751 3TNLA 5CBPB 5EXTA 5G0UA 4KHZA 5ILGA 2JH3A 2BSXA 3N7UA 3RFTA 1IDN1 1RE1A 5BN5B 1WXXA 3SHOA 3V97A 3EH2A 1OXKB 4ITRC 4URXR 2BEUB 3RAGA 4BMDA 1JHDA 2X58A 3WX0A 4JLUA 3VFDA 4C88A 5KMGB 4MDFA 3S99A 1M6HA 5FB3A 1NPTO 3NVMB 4LY6A 4HYQA 1C4KA 1LPPA 2HMTA 2YDYA 4OI2A 3ZOKA 2D1TA 4IXWA 3PGMA 4KNWA 3IDZA 2WINI 3THYA 5FNVA 2AZMA 1Z8DA 2BMFA 1Q11A 1NVBA 3SR4A 4W82A 3Q40A 1CZLA 1IUKA 4ZU1X 3RRBA 4L7VA 4PX3A 1AN0A 1JHYA 1CUBA 2ZITA 3OO1A 4HD8A 4TT3A 4ZAZA 3HXMA 3E70C 3HXKA 1H6BA 1QOZA 1I4OA 2V7QA 3WIEA 2PVPA 4NIMA 4JOCA 1POXA 3BWXA 1PD1A 4GYWA 5JDCA 1O5OA 2BPOA 4QU5A 1T1RA 4XGQA 1EXMA 2O8NA 2O2ZA 3AR5A 3MWKA 4WLNA 1IBCA 3SSMA 1M2VA 4ZI7F 5KKCA 3KAQA 1O5TA 3F90A 1TU0A 1A27A 5A3RA 2IGBA 2ZJOA 4PZDA 3ABSB 3OA2A 3RS5A 1LFDB 2VRCA 1Y6RA 1JAZA 3SF8A 2ZPUA 1NG9A 3D4IA 1LI5A 1ZCAA 3I9KA 4F1WA 4RHCA 4AC9A 2CVQA 3CR3C 4G07A 2Z8ZA 3QVUA 1Q22A 2DCUA 3HN7A 4TMWA 1JPVA 2DY1A 3SDZA 4XRGA 5KWEA 1PSWA 2DQSA 2IK8A 4DDKA 4YRAA 1APBA 2ZI3A 5FFMA 3VUFA 3LK6A 2GBCA 1E59A 2NT4A 1WW3A 4JI1B 4PF1A 4XA8A 1Z26A 2ECOA 1YZQA 3A6HA 3LQ4A 1NTOA 4M3NA 4F06A 4MUAA 1T3LA 1S9HA 5BRJA 4KTTE 4J7UA 3FJOA 4UXIA 4CKXA 3K2IA 3RHZA 4NBKA 2CDCA 2D2FA 3EUEA 3N8HA 4R2HA 3ZIDA 1EGVB 2WEKA 2C82A 4DUGA 4P08A 4BLUA 1IONA 2D4AA 1I2AA 1UMCB 3OZAA 4KXMA 4NATA 5FI5A 3ELYA 5IKOA 3T3MB 4DIBA 4EQ6B 1BEZA 5HKLA 2I4MA 4XGNA 4ES6A 3IP9A 4DR6B 1UC4B 3AMVA 5JD3A 3WP0A 2HFKA 1FUYB 2NP6A 4XGKA 4AS2A 5FH9A 4KOEC 4H6XA 5A0VA 3E7WA 3O75A 5G3ZA 5A71A 2ID8A 1N1EA 1NXVA 2YXNA 5JNVA 1EQAA 2D1YA 3HCOA 4NR0A 4S12A 1A4IA 3ZEIA 4CE6A 1QJ4A 4HQFA 5D1HA 3G2NA 3TI9A 3U80A 3NGXA 2JD0A 2ZRCA 3FFTA 3HKBA 3LTEA 4PFSA 5KQSA 4KAFA 4G0QA 1MG0A 4LOIA 4ETMA 5A4AA 1DP4A 1QCZA 2ZUEA 1MJNA 2B8TA 3TM5A 4PY2A 3S5JA 3ZXUB 2M6SA 1IPHA 1E4YA 5GV8A 4IHJB 1U4NA 3ZJ5A 4CLHA 1WULS 2IZZA 3I9V1 1NPDA 5DK6A 2HCTA 3CQ9A 2VHEA 1ZXBA 2WJ3A 3RNOA 4TLCA 1J1IA 3NRBA 5TMPA 2CJPA 1QU3A 2Y2UA 2J3QA 3K6SB 5I9IA 4D4IA 2EJCA 2ZRHA 3S81A 1VCOA 5CFLA 2HHCA 3FYUA 2ZR0A 2O8FB 5KEIA 2X8JB 3B8HA 3FI0A 4LF6B 4YP0A 4AWXA 3F6SA 3T9FA 3KJZA 5J43A 2QSUA 3FJYA 2YHUA 5CVEA 5ALVA 5KX5B 1HXHA 1Z0KA 1TDJA 2ZAGA 4X1YA 3ZD8A 4YRBA 1JW9B 4PLZA 3I76A 2YX1A 1KWKA 3DTVB 1KP3A 1DCMA 2B3DA 2CLDX 1Q6ZA 2MINB 3CNNA 4ZVNA 3T3PB 1TYCA 3O9VA 1ZONA 3VO8A 1CDEA 2I6SA 2QD2A 3HU1A 1YBFA 4HC4A 2JC3A 2VDVE 1O6ZA 4L3OA 3FNEA 2IYAA 2G7ZA 2YMQA 3M3HA 3A6GA 4MVJI 1B1AA 2YIVX 4CM5A 1Q0RA 3BHIA 3AF1A 3ESCA 3RUDA 2JAUA 2DF8A 1H2FA 2I03A 2PH1A 2WRZA 3I9V6 3PJDA 1REQA 4O3FA 1G2QA 4QU8A 1QGUB 3CX4A 2QR2A 2RAUA 4PXYA 3UK7A 5JNWA 1HDZA 3GT7A 2M6LA 2Z9BA 1U2ZA 4JUDX 4I5IA 5JFOA 3GHYA 2RHRA 1G5TA 1J8FA 4YP6A 4Z49A 4BZXA 4EENA 4CETA 3C15C 1H94A 1NRJB 3U4AA 3NDBB 4MVJE 1SZJG 1Z22A 1MB4A 2KI5A 2QI9C 2PX5A 4JUIA 4OHPA 4XIJA 3RUHA 5ICGA 1AGPA 3JVIA 3W5AA 3VZBA 1JYFA 4LV5B 4J91A 3VR2D 4BGDA 3AXSA 4YN3A 2WF8A 1OWMA 1F2UB 4XTCS 4I4TA 3MUNA 1M0WA 1K9VF 2GZMA 4EHAA 3SM9A 1W29A 1YE5A 1DIAA 1JHVA 2BKVA 1JEYA 3DGFC 5TARA 3LLCA 4MP6A 5DBIA 5FHQA 2HCBA 1HK7A 3F3YA 4FGLA 4NJEB 4PTZA 3MRSA 1E58A 621PA 2FAXA 2B0JA 1TA9A 3DOJA 3EK2A 4YMSA 2BKEA 1JL3A 4C1NA 1AT1A 1W2HA 5HILA 4KKVA 2I67A 4R31A 5DP2A 2HK8A 3VR4D 1N9KA 4YRSA 5B2FA 1FIUA 2FZLA 4HXEB 2PZFA 1GUYA 5ICMA 1B0ZA 1O7JA 1U0RA 4CMIB 3USCS 2FDRA 2R62A 2LNDA 3RUPA 4L0MA 4LYGA 3B1VA 3K5HA 4CIWA 1KMMA 4ZODA 1L7XA 1THZA 2QY9A 2X6QA 3EQ9A 3I30X 5DNDA 2GKSA 4R16A 2FR0A 1EX1A 1NAIA 1VP9A 3IQXA 2Y67A 3V2IA 1DIBA 2KX7A 1V16A 1YU6A 1TA0A 5TNXA 1BDIA 2XWSA 2ZYDA 1YFLA 1G59A 3D3WA 3FE2A 3IT3A 4RS3A 1T24A 1XEWY 2A0FA 2CGEA 1LDGA 2H2DA 2WFAA 3RTGA 2AFRA 2QTVA 4F6LA 1C3LA 1U2GC 4G4IA 5IEBA 2G63A 5IAGA 1RHQA 1GUDA 2VYVA 3CE6A 3LXRA 4LVOA 4RQTA 5EP3A 1UZMA 3FUTA 2FXVA 5E6SA 1LDEA 1M83A 5IG2A 4G8CA 4Y2XA 5K4HA 3BIJA 4KAXA 4JUAA 1T1IA 4M9ZA 4YRLA 3L7KA 4GI7A 3JATB 1YVRA 1T9DA 3OQJA 3DEHA 2YWGA 3D6AA 2F3TA 2ZIUB 1FS5A 3WAJA 1A7JA 2P6UA 4FE4A 1RJWA 3GLUA 4IDCA 4AF6A 3PGKA 1GGKA 1D1SA 1BGXT 1U9ZA 1G6KA 3ZNQA 4DREA 2VT6A 5TF0A 3PWTA 1US8A 1GGHA 1O03A 3R3HA 4IQ0A 1WY7A 4DJ5X 4EYKA 5H82A 3M6UA 3WL8A 4CKWB 1WMSA 4MYTA 1GG9A 2QZSA 4RK5A 2VZ9A 5A5FA 1U2QA 2HA7A 1EA7A 2FQ1A 4EYQA 4P7FA 2PH3A 4K9KA 2QPAA 3GEBA 2KQUA 1VP3A 2RH9B 2N1BA 2ZIVB 4DCVA 4OHUA 1ZLYA 4NFSA 1CP3A 4ZO4A 5F9MA 4TLAA 4XR4A 2DAPA 3FCYA 3K2QA 4JLAA 1UBEA 1V4NA 3F47A 3CBGA 4YH1A 5T57A 5GADl 2CFCA 3F6BX 1T0PA 2QVBA 4QPPA 4EPRA 2D5BA 2AEFA 3ORHA 1KJWA 3BMQA 1F9AA 3G0IA 2VJYA 4S24A 3QY0A 3F74A 4L9RA 2BP7A 4KFCA 3ZI0A 1L4EA 2P9YA 2Z4TA 4OMCA 3OIFA 2ZBVA 1YRWA 5GMOA 2GPAA 4GBMA 3X1XA 4F84A 2PRSA 3DLPX 2P4SA 3DH0A 1ORHA 2WMDA 1L6RA 3BORA 2X0IA 4JLMA 3AWIA 1G5PA 4BP8A 3RASA 4Z7JA 1R4NA 3SVTA 1XCJA 5IASA 4Q1AA 4WFIA 2I0FA 5EQDA 3R0QA 3UWMA 4ADSG 1PV1A 3AR8A 3BC1A 4TMFA 4HDNA 2P8JA 4B79A 5H80A 1FJGB 1X9GA 1XKTA 3OFJA 1NM5C 2QM3A 3LPMA 4HEHA 4KE6A 2JFOA 1CY0A 3R6TA 1QE0A 2AD1A 1X94A 2NZUG 3OQHA 4GR9A 3INRA 1UFRA 3CWCA 2IHZA 1UFOA 4YJ2F 1Q1NA 1R27A 1N2CB 4MYSA 4OXIA 4YAOA 4IFEA 5AXBA 3C97A 4NE9A 4B6FA 5KSOA 1QTIA 4HAXA 3TRDA 2GAOA 4YXFA 1BHSA 2O2DA 4EELA 5B3KA 3GJTA 2ZBQA 3MGAA 3WK8A 4B85A 3DWEX 4RIEA 2D7DA 1J2UA 2CHGA 3L1VA 1XCOA 4KV7A 3NTRA 2L2QA 3B7GA 5JASA 2QROA 4ZMSA 3LCJA 2UXBB 4ZGGA 1C8LA 3VYRB 2R7KA 1Y6JA 3BKWA 1T9CA 4Q1BA 2FW8A 4YA6A 1DKLA 1SBHA 2RHCA 3CLRD 3GDWA 1M2JA 5CH5A 2RHTA 4YUAA 4BO0A 3UMRA 1EI9A 2PZJA 3QVLA 5IKPA 1QTQA 3U0VA 3QFTA 3NBAA 2NVUB 2FX2A 1G21B 3KZMA 2VN8A 3P2EA 4DFDA 2XD9A 1Y4DE 3MUEA 2X8WA 3HSKA 1DUVG 3NJRA 3NTOA 3IMFA 4ILEA 3RBVA 2CSXA 1VIYA 2I4TA 1Y4UA 1XWIA 2FUEA 3K53A 4D45A 2HD4A 5A06A 4KYUA 4CLOA 5FA5A 4P31A 4PCLA 1WAMA 3NM4A 4FFSA 3PUHA 1XN1A 2AFIE 2FEXA 3RSZA 2ANCA 2VFAA 1A77A 2KB0A 1EVIA 5HF5A 3AG5A 3F3MA 4CL2A 1BD4A 4I50B 4FD2A 2Z5VA 4MWGA 2PXHA 3RC7A 3RSOA 5DM0A 2AK2A 3PKZA 4C7MA 3GROA 2Q1TA 3A1FA 2SCUB 3IMGA 1TVEA 1BFDA 3ITKA 4GOXA 2H1RA 3U3KA 1GR1A 2F1RA 2VAPA 2B37A 2XXAB 4O4LF 5JD6A 1HNXB 2QNRA 1M10A 2Z3VA 4Z53A 5J47A 3VI4B 1H2ZA 3UQZA 4N76A 4IKEA 4UEWA 5BV1A 3QJYA 2N46A 4BFXA 3TOSA 4HXYA 1JQAA 1UDWA 3UOWA 2XB4A 3T7AA 2HA4A 2D5AA 1R9MA 1FS6A 1KDTA 1SOVA 3Q7SA 2W43A 5DNVA 2G1UA 4FDVA 5ABPA 2REBA 1T5DX 2O1XA 2WWXA 1TT5B 2HA2A 2RGUA 3DZCA 4H60A 5BR8B 3HA2A 3JQ8A 4ZGBA 4IO1A 1TFRA 3NBMA 1HYEA 3IXMA 4P1ZA 2BONA 1CVLA 5AP9A 2UZAA 3QP9A 4QLOA 2ZSJA 4AZVA 2GM9A 3KT8A 3G49A 2O50A 1P2TA 3MC1A 2FEKA 1IG0A 2GM3A 4X3CA 5J23A 4KSCA 3KYDB 5DHTA 5JEDA 5JBIA 3K8OE 4MUGA 1PU2A 4W5JA 4ZKEA 1E66A 4ZYWA 1QX3A 3D6HA 1CW2B 1YMVA 1Z28A 1F1JA 1QHHB 1QWOA 2QRGA 1XZJA 4RU1A 1KE2A 2V6MA 4EIWA 3PQCA 4U2GA 1X1QA 2DX7A 1AO3A 1BS2A 1COWD 2P6MA 2O5VA 3C85A 3NDJA 3LPDA 4RPLA 5HJEA 2QZ4A 3OVMA 4U6SA 1KDZA 1BDJA 3Q3IA 1VG1A 4BJ3A 3DV2A 3O4FA 5DW3A 5LD2C 5AW7A 3C6ZA 2FE4A 4HNUA 5JS1A 1IBSA 4RMJA 3GJ5A 3W3ZB 2WJPA 4IDBA 2B5OA 3AL2A 3PWZA 4UQLA 3O8DA 4YT8A 2NZWA 1SA0B 2WJVA 3ZQ6A 3JVDA 3OTWA 4YUZA 2CC2A 5LLSA 5LB4A 3ULKA 2UKDA 3ISVA 4G37A 1SIBE 3UFBA 2Z6AA 4P38A 3EYWA 2BIFA 5E2IA 2WU1A 4TWIA 1SVWA 2V9ZA 3VYWA 3S8YA 2I3BA 5KU7A 1AZLA 4QBKA 2F43A 2O9JA 4GRIA 1XA0A 2X9LA 5IXYA 4NONA 1OCEA 3TLZA 4B4UA 2YQ4A 1VMEA 1WF6A 3C5WP 2B61A 3BUSA 1T5HX 1X92A 2JLUA 1CCWA 1XVVA 2CK3A 4I99A 4DLNA 1C8VB 3FMVA 3FYDA 1QYWA 5T5QA 1WSAA 2VT2A 4OM8A 1H4TA 4O4JA 4WLEA 4DQVA 1ZI6A 1DX6A 2GUWA 2WUWE 2OO5C 2ZE5A 5G40A 3WNZA 1SBYA 1BWRA 3A1SA 1XV5A 4Y9TA 4RCYA 4Q02A 5K51A 2QG9A 1U8TA 3CS3A 5DT2A 2DWUA 3BL6A 3SQDA 4JC5A 2RBKA 2SKCA 1GCOA 4K03A 1FW6A 2E1RA 2J6CA 2YY7A 2ZJFA 1TQ4A 5J2UB 1JBEA 5EESA 4X44A 1CR4A 3VPAA 2XJ9A 4BVKA 4OJMX 1U0BB 1GPAA 2WVJA 3GI1A 5BMVF 4FS8A 3I1IA 4C14A 1GXSB 3AYXB 3UJNA 4GM0A 5F4ZA 4ISBA 1GIAA 1YJAA 1QC5A 1U81A 1W6UA 4KPGA 1KVRA 2BHNA 4BL5A 3DYVA 2HSJA 2CKMA 3A1DA 3MILA 5TRTA 2JGKA 4JVLA 2I55A 3FSJX 1X77A 1U8XX 1ACJA 1NV8A 1WXFA 4NBVA 4RY2A 5TQJA 1LX7A 1QBGA 2QN9A 5CD1A 4HGNA 5B6IA 2J3HA 2B7BA 3O7WA 4CLEA 1A7AA 3UENA 2XTNA 5DM60 1E2UA 4QTZA 4QFMA 4ZI5A 3REOA 4MI6A 3T5GA 1N8TA 5BQPA 4PGMA 4P4NA 2NPOA 1XTPA 1ISMA 3DR5A 3VYSB 2BGNA 3QIVA 1PYDA 2AFHB 5EIBD 4L75A 5SZHB 4EB6B 4ZK2A 3EA5A 1PAUA 1ISSA 2NAFA 4UEKA 2D1QA 2W2OA 3W7VA 1WMDA 1S0UA 1X3LA 5T67A 3R7DA 1OH7A 4E08A 1N25A 4Y7CA 2QGFA 2VOJA 3PB3A 2QL7A 3DM5A 3ABIA 3FPGA 3U3RA 1Y34E 4JS0A 1Y33E 3RQIA 3QVKA 4M87A 5B7NA 2VH2A 3DLTA 1VYTA 1XLVA 4JBLA 4WXHA 4BC0A 4I1OA 2YN4A 3OD5A 5CFNA 1KS2A 1SVLA 5TMEA 1P45A 4QFCA 1QKJA 1X1BA 3X2FA 1FUUA 2IH5A 4GMXA 1K1EA 5AICA 2I7TA 1UJ2A 2YV5A 3R3WA 4MUFA 3E9DA 3K31A 2XNJA 1DKUA 2WKPA 3JAKB 1O89A 1UP6A 5BW6B 5LP6A 1A9PA 1GZHB 3D6UA 3DNMA 4OK3A 5HS4A 5IJ0A 3DWFA 2LIVA 3DVLA 1X42A 1PGJA 2GPNA 1RXSA 1L1QA 4A8JA 2J0QA 3H5WA 2YS6A 3IIMA 1KH3A 1I3MA 1QMPA 1NPYA 4MIYA 2XMSA 5G2OA 1ZOIA 3PQDA 1QF9A 2P6RA 1SKUA 3DD5A 1S89A 3SC3A 4H15A 1QDLB 2GZ2A 4RKRA 3WTCA 4QZVA 4K3VA 4LRSB 3N0XA 4YLEA 2X2OA 1IUPA 3W9YA 5AHOA 3TZBA 1GUAA 1GPUA 1MTOA 2B0CA 4LBWA 4TMVA 5F2NA 1DIOB 2Q6LA 2GILA 3IO3A 1WETA 1YVEI 1ML3A 4DPKA 3HO6A 2DR3A 3WLJA 3ROTA 4L08A 1ISPA 2FA9A 1Y80A 2H1OA 3CZ4A 5ILQA 1YV9A 3VOAA 2WIKA 1OPXA 1G18A 4U2FA 4WV3A 4KIJA 4ZAVA 3PJEA 5AT1A 1F0NA 3T9AA 1G20E 2GN9A 2W8BA 2ZUUA 3NEPX 2Z4RA 3SYTA 1RT9A 3W1EA 1PBNA 1YS2X 1ADFA 1NQVA 2R4TA 1NQXA 3DAOA 3GWZA 3BRQA 1OOEA 4KV9A 4AYXA 1D5WA 3BA6A 3JQBA 3QMWA 3QHAA 4E32A 5KC8A 1ZH0A 2X2FA 4NNOA 3SMVA 3RHTA 3TLAA 3AIOA 3DEJA 3MOSA 2R3SA 1PUIA 1X9IA 2H5JA 3NPMA 3EIEA 2GN1A 2PKXA 1Z34A 4KOAA 4LC1A 1Z7BA 2R00C 2FSPA 3I1FA 4QXQA 2ZT5A 3GGPA 1UINA 4NYJR 3ZD9A 1BAPA 2OC9A 2I33A 3C6QA 3GRRA 3G2OA 3L0IB 1Z38A 4CV3A 1TLFA 2C31A 1UJCA 4HY3A 3H8SA 5K4AA 3TH5A 3U7RA 1G8JA 1EQUA 3QKWA 5CEJA 2WJYA 5JJ5A 3QLTA 2BELA 1RKBA 3GEIA 3PPIA 4HGYA 2E37A 4XH9B 2O7SA 3R6DA 3HN6A 1EE1A 1PLKA 3OX1A 5T6MA 2QRJA 2HA0A 1O87A 1F0PA 2VK1A 4N7BA 4DUZB 5JNTA 3UAXA 4N0EA 4JJZA 3A1WA 4HQKA 1ZSNA 3NANA 2DVMA 3QX8A 5ADUS 4L27A 4RTOA 1MAVA 4GKBA 2V0NA 1DL5A 3S6JA 5KNDD 2HNBA 3JRWA 4LECA 2VWQA 2ZETA 1VSTA 4BZZA 4MS3B 5FI3A 2G7MC 2KWIA 5K0TA 1EE9A 3A4NA 3HBJA 3PTAA 3K16A 3MJCA 3MLEA 2P2NA 4KR0A 1NBMD 2GI4A 3WDMA 5A62A 4RFLA 3PJGA 2DHQA 1QVVA 5HF8A 4XPZA 1Y3BE 1M7GA 2QYTA 3Q7QA 3MXTA 1HDCA 5CVVA 1W85A 5CA1B 3HACA 3TL3A 4ER5A 2XQVA 4RWZA 5I4CA 1Q77A 2ZS7A 3P96A 5KJFA 2PL5A 2WZBA 2ZANA 3A1TA 2HRBA 3JASA 3H9CA 3OSUA 4M54A 1FTGA 3SGLA 4PLCA 1JN0A 4MARA 2AG8A 1L4NA 1IOZA 2A1TR 4OJTA 4DIOA 3F1KA 1KERA 3EQ8A 1E64A 4IIHA 3UAGA 3CGGA 4A4DA 4WLFA 3DZDA 4AMBA 5JYCA 1EU1A 1HYBA 5D7NA 3C74A 4DMGA 2Y4NA 1CJMA 5JAUA 1X6VA 4ARBA 1FFDA 5AOCA 5TGTA 2PD3A 3Q5GA 2CHFA 4BIMA 3TR6A 3FTNA 5AI8A 4CVNA 1ZH2A 3OCUA 2XEXA 4B3FX 2ZM5A 2XE7A 3I6BA 4PXSA 1FFWA 4AB1A 1TQHA 2G4LA 3D1VA 1KBOA 3EQ2A 3AERA 4KVFA 3ZCUA 3OPYA 1ZM4A 4MIKA 2R8BA 1WMBA 3C3AA 5A0TA 4JBGA 4NZNA 3ZCRA 4G0MA 4O4IA 1Z7EA 2IQ5A 4WXRA 3FAZA 3PI6A 4CT5A 1ZGCA 3QWBA 2X0FA 2VTBB 2ZIWB 3WWOA 4DA8A 1I7SB 4OGGA 1UPBA 4G86A 5BR1A 1WTAA 3KKOA 5A05A 3PC2A 2NVWA 2J0EA 1PKXA 1T3GA 1G5FA 2WTMA 4ND8A 3AKYA 1XNJA 2C2MA 2EW1A 3EXHC 2G9VA 3N6XA 3TUIC 3B3QA 2VNKA 2GTHA 4TYMA 4DXHA 4QVIA 1R6UA 3KQMA 3SFVA 1GO2A 1VMDA 1USIA 1XWFA 2RHLA 3IILA 3MBIA 4R2XA 1P1KA 4GW3A 2AR7A 4R51A 3J80A 3ZD6A 4POOA 1QHXA 2Q5JA 4R9SA 4MVCA 4TZTA 2XWJI 2E4YA 2GNPA 2YWHA 1B41A 3H4TA 3IEKA 3IQDB 1LJLA 3M3PA 2FR8A 4DQXA 3GNSA 1JG2A 4A0SA 4XD2A 4HFJA 4TV9F 1KK0A 1YIAA 1B23P 4F6RB 2O2GA 4RY9A 2YWXA 3UWOA 1ZJ6A 2X4LA 4WAUA 4NMXB 5ALNA 3OUUA 5CVTA 4AKIA 1I4EB 1KARA 3AYZB 4PPFA 1VPWA 4OH7A 5LB2A 4BQSA 4BB6A 4F3KA 5IULC 3VHLB 2H07A 4OMDA 1D0IA 2B5WA 1DZ3A 3T61A 2IIPA 4AG3A 5IAAA 4P81A 2P67A 3L5OA 2HT6A 4LHEA 3M5PA 5F7XA 5JQGA 4WBNA 2NPFA 2JBAB 5DNEA 5KB3A 2J3EA 1OJLA 2D7JA 3MT7A 4TSRA 4FT2A 2WPNA 5ALEA 1BMTA 5EZQA 1XVLA 2QV0A 5BN4B 1N92A 1G20A 1RBMA 3MJHA 1YDMA 1DIHA 2WWIA 3ADKA 2NXNA 3AM3A 3N9IA 4IDFA 4US0R 1ZMTA 4BUCA 1CEYA 2YQZA 2YNMD 3QVMA 2RBGA 3IEPA 4XJXA 4HLNA 1N4DA 5JCJA 3L4JA 4TRMA 1XAGA 3BB4A 2D4HA 2G8LA 2WWGA 3DCYA 4LIPD 2FK8A 4DA7A 5K8CA 3O4GA 3A10A 3Q72A 1IXRC 3ESAA 1Z33A 2YY6A 3OAAD 1Y1QA 2Q4RA 2RHWA 3TNYA 1FOEB 2YFYA 4BEJA 1BGVA 2BHRA 1BG6A 2RGDA 4WY5A 3S2GA 2WE8A 1M2FA 2QEQA 3CW9A 3A4VA 3JD2A 1KI1A 2VCEA 3EIQA 3SHQA 4REQB 3ASUA 1ESDA 4M1KA 2I91A 3RKSA 3V80A 5BSVA 2HWYA 4KO1S 4QUHA 5KVVA 4BGUA 4D3ZA 4L0DA 1Q0SA 4AN1A 3MRVA 3WLOA 4RLHA 4N6OA 3EC2A 3AETB 3IDFA 2JLAA 3CMMA 4QQNA 3N8IA 3WQQA 2CL6X 4WCVA 1GA1A 4Q4JA 4YDSA 3BH0A 2C7OA 1ZNQO 1QGOA 2GB4A 3CNHA 4EHBA 3H2ZA 3ER8A 1H4SA 2HGZA 1IIBA 2XY4A 1B6TA 1QE5A 2WDPA 3MJ4A 3FLMA 3GRUA 4PBTA 4BLPA 4OLAA 1UJMA 4UPVA 3KP1A 3FF1A 1M5TA 1VTKA 3ET5A 4YJGA 1ZOSA 3IDSA 5JY1A 4UM8B 4DHEA 3CISA 2X23A 4PE5B 1WKVA 2LXNA 3AJ8A 3FGNA 3PE4A 2AXNA 1V0JA 4P7GA 5JZBA 5K0BA 3UBTA 4KREA 4RXTA 5HKAA 3FIJA 1YZYA 2O48X 2JVKA 2VK4A 4P4SA 3UV7A 2ZE8A 2Z8YM 3KTFA 4YQFA 3HU5A 4PAWA 4B83A 4JI0B 2PJRA 2ZBEA 1KAGA 2W2MA 3HKEB 4QJBA 5H9WA 2JKZA 4BO9A 1N6NA 4MAFA 1D4ZA 4PX5A 2BFEA 3BL5A 1I3KA 1M76A 4M7PA 4XPIA 1G19A 1HFWA 2QM0A 4E12A 2B6NA 3F5MA 3ZU2A 1CRLA 4PRKA 3QE0A 1VIVA 5IXSA 3PBKA 4OFBA 4P7KA 1QX4A 2VAWA 3CUKA 3TE6A 4BE4A 1OAOA 2HWKA 1J8YF 4UU8A 4I2NA 3SLRA 4M7OA 2FEOA 3PXGA 3VTFA 3BZBA 3QIAA 4L73A 3W8NA 4KQMA 1ESZA 3VZCA 3NWBA 4QUJA 4KX3A 5ECYA 1G2PA 4H1UA 1WNTA 4LSWA 3DE2X 1O95A 4RTKA 1CZRA 7ADHA 5TIIA 3A2MA 4QYSA 2XUJA 1U7XA 1V6AA 3BJEA 5DIZA 4CKBB 4PZLA 1LRKA 3JRXA 3LMKA 2IV3A 2ABWA 3IH5A 3QH4A 4GZ5A 3ZHQA 1RHRA 1M1YB 1N2GA 1IEQA 3FOAA 3ZZMA 3MMNA 4TSFA 4XX0B 2V96A 3FLBA 3FMGA 1DXYA 2BEWA 3RAJA 4ER3A 3VPXA 1JQKA 2WA2A 3QKSA 3B38A 5KYGA 4DG5A 5EIWA 1LQ2A 3EQ6A 3TUZC 1VC2A 4FILA 4D44A 2BMVA 2IEDA 5LXTF 2Q3DA 1H0SA 3NU1A 4WZZA 4ANFA 4CU2A 1JHXA 2C9BA 4S1TA 5T4BA 3WSTA 1I33A 1TUEA 4LTDA 4ZDJA 1CS0A 5DI3A 4YLGA 5BWBA 4JJEA 1Z8NA 5T41A 3KQSA 2P68A 4GX1A 3EBPA 2CVPA 4JYZA 3BTSA 1OYWA 1M2OB 1U02A 2JLQA 2QD4A 3D7KA 3O3NB 3U7JA 5K3DA 2QZPA 1C7RA 1GEEA 1IK6A 4O25A 1AMNA 1A9YA 4Y0VA 2GJSA 3ZHVA 2VP0A 2OGUA 3NTXA 4V1CI 5LCXA 4ENPA 2PJZA 4MW1A 3QNMA 4ENRA 2G1JA 1YZVA 3GZJA 3LNTA 3BWVA 1Q83A 4DRZA 2QT1A 4D3DA 3WB2A 3SX0A 1D2CA 1UADA 3CKMA 1V8ZA 3JD4A 1DE0A 4RZXA 2WFMA 3F8TA 5TEVA 1XT6A 3MJEA 3OO0A 3KDPA 5CK4A 4AMGA 2C94A 2LW7A 4LI3X 3HVJA 1XZMA 2OQRA 3QA3E 3KJGA 3EWAA 3T1QA 3PQ3A 1JIUA 1GNLA 4N82A 1BXGB 4RVDA 1OZ0A 3ZIAD 4Z51A 1V5IA 3FVQA 3VSDA 2ORIA 5LOVA 4GXRA 2REQB 4BNIA 3RODA 2CCGA 4J6EA 4YO8A 5CLLA 1EWVA 1FP4B 2B21A 2BFWA 1C7IA 2PMDA 4BUJA 1RYHA 1USKA 1X7ZA 5J2TB 2AJ8A 3QEOA 3IIEA 2CLOB 4QXRA 5DHPA 4QBHA 4D8TA 4D0NA 5LQMA 1DG1G 3B6KA 2FH5B 2O7NA 1E99A 2GSDA 3WGYA 1YCGA 5DI9A 1UBHS 1Q0ZA 2X77A 1ZXXA 4IM7A 2DFNA 1Q0TA 1P17A 1V9CA 2QB5A 3YASA 4AO7A 3T0FA 1G8SA 4DANA 1BW9B 1NI4A 2ZKLA 5AI6A 1OXXK 3G17A 3LZ6A 1LRJA 1MB2A 1RWMA 2XUQA 2SKDA 3DULA 1F5NA 1XZIA 4IJMA 4OXQA 1KPGA 4MYHA 3JQ7A 4HWRA 1RJGA 4ND6A 2NSLA 3EVDA 4QOSA 4C6HA 3A6LA 3HA3A 4N0MA 4AJ1A 1FU4A 2B1IA 2OYRA 2C9DA 3D3JA 5L6LB 5CDTA 3NW9A 4Z9AA 3V9AA 1DBPA 2ZDQA 2GZ3A 3DAFA 4L15A 5K0EA 1N6KA 3C41J 3O4JA 4CLRB 1FA9A 1SCQA 1GL3A 3ONVA 2KS6A 2FRVA 3Q3JB 4H7JA 3E84A 1CNEA 1SKQA 3TBHA 1JIIA 1EA5A 4GF5A 2CHVA 1YWGO 2J0VA 3AVTA 3TTXA 1GQSA 1J42A 3FN4A 3HB7A 5M3BA 4IHJF 3MIIA 3L4EA 3BWMA 1E2IA 1IE3A 1XTJA 3UW3A 4WFKA 3V2GA 2XA2A 2R8XA 1DRJA 3MLBA 4IQ4A 3QBDA 3I4CA 3ZQJA 4V38A 4L22A 4RK4A 4AO6A 1VKZA 2VHYA 4YONB 4BMNA 4D4KA 5ICCA 3TLGB 3VZQA 1O96B 2O3SA 3CLRC 5CVCA 1TPYA 3LKBA 1OR8A 1K3TA 4PIVA 3CUEF 1QSGA 3DFFA 4MUBA 5IEJA 1AMUA 2FPXA 4YXWD 4YP1A 3ZWYA 3EA4A 2INGX 1XZFA 5DXJA 4BWVA 1E3DA 1FUIA 1AKMA 2X41A 1UDXA 5MF6A 4P34A 3ACDA 2QD1A 4TGLA 1A8QA 3H2BA 3PC3A 4G25A 4G41A 5HF6A 2R1VB 1P1CA 4N3NA 2WKRA 1PGPA 3TE7A 3C0KA 3C14C 1GYRA 3LHFA 4JITA 4LA4A 3UT0A 3T94A 4K7JA 3W7BA 3Q2KA 3NCHA 3OP1A 3AJAA 4O5OA 4MVJH 2G5GX 1Q7GA 3PRKE 3MCAA 2O6HA 1C3VA 4LZZA 4UFPA 3QYJA 1BH6A 2ZRBA 4KRGA 1NASA 4KGXA 1MABA 3RBXA 4W1RA 3CNEA 3UHJA 1BVUA 3MCTA 2O0HA 3VR6D 1I7NA 3KELA 1E9CA 1G1MA 1VE6A 2DQYA 2ZYHA 3G89A 4Z4EA 3WLMA 1QNLA 2WT4A 1CQXA 1K4YA 2WMYA 4BO5A 5EE0A 4IJWA 2BE9A 1E62A 5CLGA 3PHLA 5DWDA 4MLCA 2J1LA 1OROA 1FZTA 3ACCA 5AVKA 1MIOB 2XCTB 4FYPA 1IDOA 3B3GA 4H4EA 3C6XA 3PNMA 2IWHA 5JNLA 1B8UA 4OKSA 3R0XA 3R7LA 3PX2A 4ZEXA 3RANA 4I1VA 4X7PA 4B8WA 2TMKA 3LHDA 2Y6VA 3I6YA 3V34A 1GQQA 1L5NA 1HDYA 2XUPA 4HYEA 1HEUA 2F8MA 2GS9A 3GZNB 4O4HA 4DDUA 3TWOA 4N0DA 1EVJA 3UMGA 3GVHA 1B6RA 4W7SA 3CX6A 4IOLA 4DUYB 2I4OA 4AIRA 1QS0A 1DLJA 1HRDA 3VC7A 4LJ9A 4B40A 1HG1A 3HV2A 4FGWA 3AF2A 2WMOB 4J0KA 4RA9A 2I1QA 2GO7A 3FCCA 3QSGA 2CVFA 4PM4A 3RSGA 3VZDA 1HX7A 5K3FA 4E13A 2OXRA 5M5BA 1SZDA 3WRYA 4ZO6A 2ZREA 3USES 4K26A 1MW9X 2YL2A 1M2WA 1C50A 4E5MA 1T8PA 5JVDF 2DFTA 2BFBB 2PANA 2XA1A 2JI9A 2X42A 3PDIA 4B09A 4MRPA 3DE5X 1LKZA 2GA8A 3GLIB 3HB5X 2C7BA 1PCXA 4F5ZA 2P77A 5D87A 3LBHA 5GP1A 1RCTE 4YS6A 4BX3A 3LHSA 3G5MA 3KYIB 1RLOA 3R5HA 1HI9A 3H5OA 5D86A 4KNVA 1XWWA 1W9MA 1Z0IA 1ILEA 3IC5A 4TMKA 4D3FA 4L85A 3GDFA 4Z8YA 4DLTA 2AR9A 3CVXA 5DTIA 5C4GB 1E1RA 3FMIA 2ENWA 4IS2A 3RC8A 2ADMA 4Y30A 2X6TA 2HWXA 4JKIA 3FNGA 3AUXA 3KO8A 3IKJA 3H9UA 5JZ9A 1CY2A 3QLUC 2I8LA 3O8QA 1BXZA 5LU8A 1ZVQA 2OR3A 1PRYA 4Y2TA 5JSKA 1JR6A 4BC1A 3EDYA 2GJ4A 2JFXA 4HEQA 4D5GA 2DQZA 2E5LB 4DPLA 1AV6A 4ZV9A 5CFZA 2OAGA 1IY9A 1CQJA 3Q6NA 1N7HA 1NBWB 1JPUA 3R7SA 2CFOA 3PJRA 1XTZA 2PH5A 3BGOS 3QEMB 4KPFC 3T3IA 3QVWA 1Q74A 1JG6A 4H16A 2GHTA 3NO4A 3ROKA 2E1PA 2ZI5A 5HJ2A 3SC6A 5CT4A 2GN2A 1DJMA 1YRHA 5C4IA 1E6UA 4G8JA 5JSZA 2GD1O 4LF5B 4AZTA 3T3OA 1H2YA 1KEEB 1T2AA 2XUZA 3N8KA 2JAWA 1ZG3A 3PC4A 2UYHA 1NJ8A 5I7FA 1YA6A 2RGBA 5G0SA 5TLSA 3S2ZA 2EJUA 2YN0A 2OFWA 1SZPA 3BAZA 1R2QA 4U3JB 2ZULA 2JCYA 4KR3A 5IX8A 4FXPA 3OCCA 1PK7A 2GXSA 2YXDA 3GLHA 2QSYA 3O1HB 4MUJA 2QSZA 3UK1A 3V4FA 1BROA 1IMOA 4TV8B 5EPUA 3ND8A 2IZ7A 2OD9A 2VQ3A 4H7IA 5JSYA 2P2YA 4V3BA 2EV9A 4XSGA 3U13A 1I80A 1SFRA 5KOJA 3BT7A 3W0LB 2GEFA 2AN3A 2ZSKA 3FLEA 4BWYA 4MTCA 4NX2A 1LY1A 3DLHA 4DCMA 4URUR 1J2RA 1ZL0A 5ALIA 2O3UA 1S2IA 4KXWA 4U7HA 5LA6A 4EPTA 1NZFA 2HNKA 5HDBB 3KOXA 4ZYZA 3N86A 6CHYA 5BN3A 4HSEA 1OI7A 3FUXA 1L4BA 4C21A 4LMBA 2PRIA 2X1VA 3K1ZA 2AZXA 1MN6A 1PNQA 3JQCA 3NNDA 1L7BA 2Z04A 3GB9A 4V0KA 2GFHA 5EI5A 2KLHA 4FSXA 2IYZA 5FPQA 4D80A 4C3ZA 3BILA 3HGMA 5REQA 3ZJVA 3EW9A 3HKCA 3P2MA 3UTDA 1RBQA 1ZMXA 2AX3A 2VZLA 2JNWA 3TNJA 1PJAA 5BXYA 4KWCA 4RFSB 1KL7A 4YO7A 3LFUA 5A9TA 2IXGA 4C5CA 4G2NA 1QIKA 3QUAA 4L95C 4AKHA 2ZS8A 3GUCA 4BRZA 3ZJYA 4X20B 1N2ZA 5GJVC 2XUKA 3R7FA 3BWDD 1BA2A 3UBMA 4L8VA 3GEDA 1WIWA 3Q7PA 5A1TA 4ETIA 4ZAXA 4RDCA 3I45A 1GLNA 3O2QB 2VZ0A 2X0DA 1DQRA 3L6RA 2QUIA 2F3PA 1IM8A 3JU3A 1QIGA 3KZKA 3LUKA 4JX8A 1W5TA 5DM70 2CB0A 4LDPA 3KKNA 2ZU6A 1DDOA 3I1JA 1FDRA 3KQTA 4JQZA 4WLOA 1OWPA 2J9FB 4ER0A 4EHHA 3ONEA 2AUTA 3E5RA 3K9LA 4N18A 4RC9A 1VZ2A 3BB1A 4XJTA 3F97A 4NZ9A 4ZCQA 4H35A 1X7XA 5L3RA 2OL4A 2SICE 1NBHA 4GSYA 4Q3OA 1KU0A 2VRWA 4JEIA 3MSCA 2XF8A 3D8TA 2PO5A 2GPJA 3RVBA 1S2LA 1ENOA 1PT5A 2BUBA 1XP5A 5EUMA 2QRVA 2ZQZA 3GK3A 1MGOA 4L8LA 4P33A 1Z6YA 3SYRA 2ZUVA 4I50F 4ZI2A 5CB0A 2P62A 2QN1A 3FPCA 2VXCA 3PDWA 4KI7A 2CXRA 4BGEA 2V0GA 3EMDA 4Q0MA 1SB9A 1SJ9A 3IAHA 4IQGA 3T99A 1VGRA 1C0PA 2VJPA 1P0CA 1P1RA 4KDEA 2RE8A 1CKEA 4FYIA 3FNIA 3CF4G 4QHYA 4ZXFA 2DXIA 4MQEB 3O8BA 3QQPA 4FOPA 4GR4A 4OYRA 2N0SA 3DBIA 4Q1VA 3DMFA 4PO1A 3RSHA 4L5IA 1XNGA 1T4BA 2FQQA 5JAHA 3ZW9A 1WZNA 4JEMA 4PQGA 3R7AA 3MHPA 1EJBA 2Z2KA 4B74A 4MVJM 2WHPA 3H2GA 3QNUA 5KMGA 1OY1A 5FUYA 5F33A 1MD9A 1QE3A 3IAUA 5EFZA 2XQJA 2DPMA 2DUJA 2EYQA 3HYSA 2ETXA 2VHVA 3RS8A 3VVMA 4GRAA 4OAPA 2I4LA 3H9JA 3K8QA 1T9GR 3SYLA 5I6DA 2XUGA 1MJHA 1EM8B 2B36A 1C1XB 4Y6QA 3UWSA 1NQTA 1JDUA 1E2QA 4JELA 4LYEA 5CH8A 4ZQIA 4LHWA 1WSWA 1ZR2A 3AR6A 3AH8A 1A71A 3E15A 2WKSA 5I5GA 1E1QA 3G7NA 3OTQA 4XVQA 1UANA 1CV2A 2WQ6A 4EMUA 5KTKA 3AHDA 1SBCA 1AC5A 2XVYA 1T4GA 1JR2A 5FI1B 1GPNA 4M6WA 4NP6A 1RYBA 1LWNA 2XT9A 2Y8EA 3HXTA 4U2EA 1OU4A 4PYJA 1WZCA 3TB4A 3IPXA 2H3HA 1WZEA 2ZUFA 4UVIA 1KETA 1WBJB 3EG9B 1PSDA 3T5AA 3DZIA 4UNPA 3AUKA 1GV0A 1QRRA 1AKRA 4DMUB 4DV0B 3H87A 2Q2WA 3TZEA 3COZA 4TX1A 2PWYA 1DIRA 3WGKA 4YWJA 4PV7A 5ESRA 1JDSA 1HT1E 1JKJB 4LCJA 4MQLA 3VRHA 4CIYA 3BGDA 4IDAA 4E03A 1BO6A 4OY3A 2H4YA 1AKUA 4QOJA 4MEBA 4X64B 1D3AA 2CMDA 1EUCB 2I3GA 3ENNA 1LRLA 4M89A 4YJKA 5K8TA 1NF2A 3LUPA 1V35A 4MR8A 2O1SA 2BFPA 4I81A 3IIJA 3QEAZ 2Q41A 4L3WA 3HM9A 1M6NA 1PX0A 2JIOA 5EHIA 1EZ4A 2GFQA 2YN2A 4HB3A 4X1KA 4DIMA 1MZPA 1HFEL 3BMCB 1DRKA 2HQBA 4IX9A 4UVDA 3QMPA 2H4WA 1NURA 3W6OA 3RROA 3VO9A 3PPWA 4LNUB 3WQHA 1W5SA 4JA2A 5HP4A 1M66A 3TZLA 2YJ3A 2EERA 4ONEA 2CFRA 3T1NA 2ZSBA 3CBQA 2HU5A 4OOFA 2OPBA 1R5OA 2ZRKA 4UE6A 1L5SA 3AM5A 1BHJA 2R7LA 1SD2A 3KHTA 4GKKB 4OQ4A 1UMCA 3PWSA 4AECA 3WXMA 5LMCA 2B9EA 4N7RA 4JIGA 2VYNA 1NLYA 1CY7A 2EKPA 3MJDA 3PTZA 3GBPA 4RJLA 4EQ6A 4H59A 4DLPA 1EHIA 1M8FA 4CYMA 4EGSA 3MOIA 1P0MA 3GIWA 1L6IA 2CE2X 4F5EA 1PJLA 2D0IA 5J2UF 3TJZA 3D4PA 2ADOA 2FVYA 9LDBA 4W5OA 1ZUNB 1OFVA 2W00A 1MU0A 4YRFA 2XE8A 4ZOLB 2REOA 1QNFA 4LE2A 2QTGA 4FI3F 1K4KA 1H9AA 5E6UA 4L4UA 1SOWA 2PVSA 1Q7CA 4KK4A 4BNHA 1CZKA 1HTTA 2WM2A 1JDVA 1ZGBA 2XUFA 3LHIA 4JYPA 4W1PA 1HDRA 4G0VA 1BNCA 2ZZNA 3B7PA 1DEAA 3B1FA 2HADA 1NY5A 2BFAA 2JGDA 2HK6A 2ZBUA 1BA3A 1BHQ1 3KFVA 4OJKA 5H02A 5IVIA 1NNSA 3VTAA 4DV3B 2ZDHA 3QUQA 1KSFX 3VR5A 2ETVA 1IJKA 4P3NA 3R09A 2FK7A 4A0QA 4MS4A 2H7XA 1PZXA 1VB3A 4U6QA 1IXZA 3FTEA 1I7PA 1M74A 1QUEA 2C8JA 2JL1A 2WB4A 2WD7B 3AUYA 3EAGA 3O5AA 3EFOB 1GILA 1I6KA 2LE0A 4UBJA 3PUKA 3AWDA 2NQ2C 3KM0A 5JMTA 4E7OA 4FE3A 2Q28A 5I4BA 5IDYA 5GVSA 1FYWA 1W1IA 3EUFA 1II9A 1SWVA 2JAPA 1DFIA 2P2SA 1RAHA 3NNSA 4RK0A 4FGSA 1HDIA 3KAJA 4YMLA 5A5GA 5KX5A 2J6IA 4UM9D 3V4PB 1RRMA 3P19A 1IBMB 1YS7A 2MSEB 2VWHA 2Y1KA 4QUGA 5JG7A 3B51X 2YNMC 4B82A 1QHSA 2MYUA 1Z4KA 1ZC3A 4R4JA 1FFCA 3K5IA 4QGBA 4MQMA 5FPYA 1YB2A 1G5QA 1D03A 2BKLA 1AQ6A 4JYCA 2BKUA 3DDUA 4UM7A 5DDIP 3C7KA 3JTMA 4B6PA 2QRKA 2W7TA 3NBFA 2OCLA 4XVRA 1ZGGA 3NBYC 3OFSA 3MBOA 2JGAA 1DB3A 1FQJA 3MT8A 4A82A 3WKBA 4GI2A 1M3SA 1Q16A 1PVDA 2V03A 3E2PA 4MA0A 4C22A 4MW9A 4XYBA 1BYUA 1TI7A 4Y6OA 2NSJA 1W4CA 4D5EA 1KORA 1KGDA 3B60A 4I4CA 1Z2OX 5KHOC 4WXPA 3VH4A 1XEWX 5JIBA 1FK8A 1LU9A 2YINC 3I9JA 3K4QA 3KXLA 4HEJA 1N2CE 4F92B 4KZKA 3ETLA 4JJ6A 5D51S 3UOAB 1PDWA 2BMAA 1QTNA 3MJTA 3OU6A 5KYVA 5CNKA 1R3UA 4KR6A 3KBOA 5BSUA 2EZ8A 8ATCA 1HQDA 2O2SA 1JDBC 4KNYA 3KWJA 3FDZB 1XRLA 4XVUA 1TAGA 1KYIA 4A0HA 1N0VC 2AFVA 2XTJA 4YNBA 2CFIA 1KMNA 4DABA 4Y1RB 4INZA 2OXFA 2P2DA 3OJEA 3W8RA 1RU3A 4IDOA 1N3LA 1G8AA 1TW3A 3OWOA 2JG3A 3OEED 4RZSA 4IIUA 1S9DA 5CBKA 3AUFA 4JJKA 1F4LA 1JALA 3B5EA 4HDAA 1HNWB 4HN2A 4WECA 1M8PA 5DZSA 3TRIA 3AB7A 4FX5A 4U2DA 3WAKA 1XMSA 1G21E 3QUTA 1QF7A 5AKEA 3RS2A 2NG1A 1X1AA 4WD3A 2EQAA 1Q84A 5C5CA 2VQFB 1TM2A 4NCBA 4I8IA 4MLZA 1L5GB 2O6LA 1MOZA 1YQUA 3BIXA 2VSNA 2CWWA 3LG2A 4KFRA 3AI2A 2OESA 4LXTA 4EJSC 5KWIA 2NU6B 1RFLA 5LQRA 3DGEC 2CNWD 3QHPA 4GICA 4JYMA 3JCZA 4WCFB 1WPRA 2GDJA 5KKAA 1CUFA 3AEYA 4OXRA 3UK0A 5FJJA 3SIRA 2A35A 5FAKA 4D99A 3ZWXA 4JZKA 3W4IA 4C5AA 2WJHA 3VHXA 3U44B 1AGXA 4U7JA 1SOUA 2G28A 2NU9B 3WLNA 5K6AC 3W3AD 1DWQA 4FEGA 4LJSA 4KRFA 2I7VA 4DQLA 5EGNA 4BV3A 3LPLA 3EAQA 4DG8A 3P20A 2BRUA 1D6MA 1G55A 3HL0A 3PQ7A 1JHOA 1I2ZA 3G7SA 1EFHA 4NAUA 4PCAA 3WWYA 2DZDA 2MTBA 2V1UA 1SK8A 2CXOA 3AKCA 1MKYA 3RCBA 4I0WB 3IUBA 4B3RB 2D2IA 3Q0IA 4IHQA 2FHSA 2OCPA 3PV0A 3DOUA 2QU8A 2A7QA 3LQ1A 4F4JA 3NQ41 3BJMA 1CJTC 5C32A 3MTQA 1F20A 4JOBA 1LNQA 1WXWA 1JSLA 4UAVA 1IEXA 1U2RA 3GFGA 4FXOA 1HT3A 5AVTA 1OF1A 2H92A 4BASA 2I2DA 1GLVA 2HHAA 1TJ4A 2ZYGA 2YJ4A 3I09A 3TZ6A 3QV2A 3UCEA 5CA1F 2PGOA 1VL5A 3LUJA 2BTQB 2X8BA 3MYRA 4MGKR 2EHDA 1V8FA 4G63A 4R2KA 3E0XA 4C2BA 1TO6A 2ODWA 2R5WA 3P0IA 5HMLA 4D6PA 2NXWA 2OCGA 2X1MA 5B12A 1X1TA 1EBFA 1WD7A 3NR2A 4EVQA 2PT7A 3WBKA 2IIBA 1ZK1A 2FW9A 1D8TA 1NJSA 4OF4A 3M82A 1VRVA 2W70A 3WK5A 4U2KA 5CU7A 4D7AA 3F96A 3TIIA 2HSEA 5DNWA 5E9AA 3WL6A 2AW5A 1XLTC 2WIDA 1T35A 2CDRA 4AL4A 3GRAA 2QI9F 4F2DA 4E70A 2YCBA 3ZHYA 2A86A 1C30A 2WUFA 4IP0A 4O33A 4UEJA 5SICE 4MMZB 1V1RA 3N76A 3PF8A 4XOIA 4UCFA 1NJ5A 4UBKA 2HMVA 3DNPA 1MNQA 4US2R 1KEZA 2R6FA 3QK7A 4HB2A 3WGGA 5E3HA 1LQUA 2BGJA 1UPUA 4ZK6A 2Z56A 3KNZA 4M1YA 1CVIA 3LF1A 1G8KA 2HJSA 1OUMA 3G79A 1MCZA 4XYEA 2O8CA 1YFKA 2G9UA 4WJLA 1V11B 1VQ1A 1F06A 3G5LA 4GHWA 2Y0EA 2PWAA 4KUEA 4XLZA 4XEUA 3WNVA 4Y9RA 4MULA 1G60A 1EZZA 3RG8A 4EZIA 5DGHA 2GKOA 3OHPA 5JROA 2BGMA 3UY4A 2VSOA 1CERA 1Y5IA 4A26A 3WLLA 1S3FA 3IDOA 4QFDA 3WA6A 1QAOA 2DPGA 5F23A 5AW5A 2FEMA 4JB0A 2NLOA 4AJHA 1Q7TA 2AZ4A 2Y0PA 3DHVA 3VNQA 2NSDA 4YV1A 1GSHA 1N2CA 2GO1A 4IJVA 4JNCA 4Y2RA 3S1SA 2VYFA 3KD3A 4PXAA 1OA1A 2O2EA 4UNRA 3WNCA 3NONA 1CUSA 3IUPA 4OQFA 4B47A 3OF2A 3JQRA 2IQIA 2AG5A 1EFAA 1ADJA 1ISFA 3LIPA 1G3MA 4DT1B 3WTBA 4PYKA 1H05A 1S2NA 2P75A 2I4IA 2PO7A 3WRWA 4RDHA 3WQSB 5FF9A 2IY8A 3EJ6A 3QEKA 3E48A 2Q0XA 2XAUA 5L95A 4E46A 3T1TA 4EMTA 3EXFA 3DEIA 3EVFA 4IIBA 2EZ9A 1Y3IA 1EG7A 1GZSA 1CZNA 4RKWA 1D04A 1G6Q1 4FN4A 1HM5A 3DBLB 1ZWLA 3B89A 3EXIB 4GT1A 4OBEA 4RQAA 3TIVA 3V7NA 2UUAB 4BPBA 2Z30A 2O8DA 1WXHA 4BVGA 1EFPA 5KTPA 2QIOA 4H31A 4I1YA 1T0BA 5LQSA 2R6AA 2Q4TA 2FVXA 2WF6A 1ZDMA 2CLKB 3PLRA 4PTYA 3WE7A 1HE2A 2ISCA 2EGUA 3LF2A 4BDSA 5FT9A 2GQ0A 1OTXA 1QPBA 3L7IA 1SUPA 2AFHE 3JY6A 4OA5A 1T3SA 1RIFA 3SZLA 3W2GA 2GBIA 3C3BA 4FWIB 4IEFB 2B4YA 5F7ZA 3HKDB 1OBFO 3ZV7A 1KOLA 1LBIA 4ZTZB 3FNBA 4GNRA 4M9SA 5FR1A 4N65A 5LZ2A 5AJXA 1JWLA 1DFHA 1S5PA 2YZ2A 4XFDA 5K5EA 5LDDC 2EP5A 2F3QA 1KO8A 4RO0A 2VHZA 4AZSA 4WNAA 4E4RA 2IPMA 2XZTA 3BE8A 1SHLA 1NFRA 1WXGA 1W8DA 3NBUA 1QFSA 3PU6A 1ARZA 1NQ5A 4FCCA 4LK2A 5J5AA 1WB6A 4BX8A 2XXAA 1SUBA 3VTZA 2CYCA 4I6EA 4A73A 1OFUX 3PGA1 1RAAA 3AKZA 3CNBA 1RYDA 4DCNA 2PR2A 1PQWA 4CT0A 5A3QA 2HDHA 3TCNA 5AQEA 4TVKA 1O4WA 4QICA 3E58A 1FX0B 2IE8A 3MPOA 5K8JB 1TT5A 3UT6A 4BBJA 4S1NA 4LZWA 4ZVMA 1B00A 4XDYA 1MOPA 1P80A 2X7HA 3ZU4A 3LX4A 4UUPA 4X85A 4YCSA 4EA7A 5JCOC 1KHTA 3IPCA 1IJFA 1PFVA 2DSNA 2QZ9A 3CUTA 3B7WA 1QHEA 3SP1A 5DEOA 1YB7A 3SEZA 4P5DA 1B7GO 1L5ZA 1UK7A 3HZOA 3LYLA 3MCUA 4FYXA 3WGUA 4CODB 1H2WA 3BGWA 2UXCB 1JV2B 1QHHA 1XXHB 2HXYA 3ZGOA 2KE5A 3GJZA 4OHFA 2Z5GA 3QU5A 4EHJA 2YRWA 4BNFA 5AIBA 4FYKA 4U7TB 4LE1A 1E1NA 1G5IA 2PQ6A 4FHFA 4HN9A 1MOQA 4ZARA 1LDBA 3TSZA 1IUOA 3HNOA 3PQ6A 3R7WA 4URZR 4EL5A 1XQXA 2W6QA 4R2JA 5BQFA 2X8LA 4QQRA 3H7AA 2J6BA 1V8DA 4EMBA 2JLCA 2IEBA 2JIDA 1KBQA 1DAHA 1T13A 4OQMA 1E69A 5BP7A 1SXHA 1JDZA 2Z2IA 4FMDB 4PZUA 1OLXB 2W4IA 4HNGA 4QUEA 5EIAA 3E23A 3RVSA 2B8WA 5K3CA 3MWJA 3PFNA 4IGIA 4G67A 4IXTA 5FFNA 1FLNA 1Q0HA 3UM9A 1P9LA 2JFQA 2APJA 2C61A 3IAEA 1XPJA 3SJCA 5KKNB 3L7JA 4BRSA 3PNOA 1D1PA 1JKMA 4D41A 4Q3BA 1L1RA 4JLWA 3R5KA 5KUTA 3DDSA 4WA8A 1XA4A 2GPBA 2OAP1 1ZA2A 4R69A 1CUCA 1WLSA 1MBZA 1HZJA 1KEPA 1V47A 2CNNA 3GFOA 5J9FA 5MGNA 2PS0A 4A6XA 4DHWA 4ZYXA 2R4UA 1MHTA 1U0HC 4PYRA 5AVWA 1TF5A 4GOMD 2I1VB 2Q2NA 3ONNA 3MXOA 3M5WA 5EMNA 2EX0A 5JAZA 1UT8A 3ANSA 3G2QA 4P86A 3E1SA 4UEQA 1KDOA 2X4GA 3OQIB 4KVZA 5BSMA 4MCAA 4CQMB 1RPZA 3EG5A 4GP9A 3AP3A 2IV2X 3ZVKA 1J70A 4GX0A 4H77A 3LO8A 1EUQA 4F5YA 1YC2A 2ZGVA 3CH4B 1QZXA 3O82A 4HQLA 4MRVA 5C51B 1GXSA 1Z39A 2VQ6A 1JEOA 1OXVA 1SC4A 2J7PA 4G23A 4GX2A 4BQQA 1QK3A 5FCDA 3ONFA 2BGRA 4Y6PA 5LVAA 3FBGA 4HLCA 4PG6A 1JFFA 3N6VA 1GHTA 1R50A 1A5AB 3FUVA 4HTFA 4Z9BA 4M7WA 4RJTA 5KNCD 1R6AA 3L1IA 2H4JA 2F8TA 1G2IA 3I8SA 3L92A 4I66A 4KODA 4W9MC 1I14A 2OK7A 5CW1A 1RQNA 1QR6A 1AXGA 4HXGA 1UEXC 2QRUA 3AR4A 3KOZA 4O1IA 4AJIA 2PGAA 3HBMA 2PG3A 1A72A 4EB6A 1D6SA 1G41A 3T3EA 2O4CA 2YCLA 3ICWA 1LBSA 3CH6A 4MRMB 4M8KA 4DNXA 4INAA 3GPIA 1YZNA 4YAFA 4RV9A 2AC2A 2EWMA 1YBMA 5H7XA 2WUGA 2CUTA 4FHGA 3RUIA 3K0CC 5J2TF 2CLLB 3IA7A 4F12A 2IH2A 3IUYA 3HJFA 1OZFA 1QOPB 4TT8A 2VWPA 3G5UA 3LZDA 4J43A 5GQSA 4CIAA 1U8FO 5KQMA 2A0YA 4AY6A 3SQNA 1S02A 5KIAA 3HA5A 4L9WA 1H22A 1JWBB 1LVUA 4Q39A 1U31A 3H1EA 1TIPA 2AI2A 4CEJB 5TXGA 3CRMA 1NW3A 3EW7A 1LF5A 3Q7IA 4EJ6A 3IVGA 1GVHA 1THGA 3A58B 3CMCO 1JB1A 1GADO 1W2WB 4Q5IA 2MR5A 5AI9A 3U9SA 4DNOA 3NBZC 2YIDA 2EW8A 4QULA 1P7YA 1Q1EA 3HBAA 4JD5A 4I9HA 5LDGA 4C2UA 2A9QA 3K8YA 1VLJA 2E2WA 1BU5A 4KAAA 4TQGA 2FPIB 1LPBB 4P83A 1Y3FE 4LXGA 1QIIA 1XAHA 2HBZA 4G3XA 2XMCA 2ZWIA 4Y6GB 4AJOA 1ZRNA 4DQDA 2HJRA 3KJQA 1E9BA 4O63O 3VTKA 1H8EA 3OZEA 1V26A 3I5AA 1I4LD 2A5GA 2YHBA 3D7NA 1NR7A 4MK4A 5BVGA 2ZYTX 2UZ4A 5HK8A 4F3RA 4L8YA 1R16A 5EN4A 4LGCA 4TTPA 3OCWA 3R8CA 4DA6A 1UOEA 3CJQA 4FFMA 1M2KA 4B6QA 3D54D 1P5HA 3D4LA 1E5VA 2MWMA 1ZEMA 2NV0A 1F7VA 2XWPA 2PKQO 3EBOA 2Z95A 1R37A 4P82A 5AKKA 4C03A 4PICA 2GTPA 1TNDA 3PHBE 5ALRA 5HTOA 4TS4A 1BE0A 3OH8A 4C0AC 4IVNA 3FOEC 4DA9A 2XCSB 3DEKA 4NOJA 4S1OA 4BFUA 2LPMA 3VV3A 2WUDA 4HZUA 2RJOA 1O3YA 4DDTA 3IKMB 1R5JA 1XRSB 2RB5A 2DHCA 3WSWA 1P9OA 1XELA 1WG8A 221PA 1NZDA 1MC4A 2P7IA 2V55B 3UPDA 4C0HA 3PDJA 1LD3A 4OU5A 1U8UA 2DULA 3E53A 4N8EA 3TW8A 1WXIA 4BHTA 3LY5A 4RZIA 2F4VB 1DLIA 2FGJA 3PC7A 4KP7A 3FR8A 4WBXC 3LQRA 2EG9A 5U4QA 1EHYA 1XDGA 5E7QA 2WA1A 2H9AA 1GZ5A 2JIRA 4ZT3A 4FHEA 5LZ7A 3TEFA 3PG5A 4NE2A 3UJ7A 5C5EA 1WEHA 2YWFA 5D3MB 4C30A 1SHZA 4Y2QA 4ZOBA 4UQPA 4EB0A 3GH3A 4RHTA 5AK3A 4EY4A 2HPVA 3DJFA 1D2GA 3KR0A 5HBRA 3S8MA 1OTHA 2EZ4A 3G1UA 1ILWA 1ONNA 3QEJA 3WGTA 3M6VA 3DC7A 3ZH2A 1UJ6A 4Q47A 1VE3A 1SQ0A 2QMUA 5HDQA 1X19A 2FSVC 3LC1O 2R60A 3NIWA 2NU8B 4ZCTA 3U4GA 3C3JA 2ZR7A 2V3WA 2YBEA 3SZRA 3WGIA 4EF5A 1DKRA 5L3SB 1TMOA 2RGNC 2XOXA 1Q15A 4MS3A 1UXKA 4DCPA 2IU3A 2OGZA 2XV1A 4F4UA 4PN7A 4UZSA 2WT9A 3FW1A 5IS2A 1T3ZA 1DUSA 1B16A 3E6AA 3OFND 4QTXA 1FE8A 1SCBA 3H5AA 4Q7MB 3TTWA 1X8XA 1Z47A 1LLUA 2W11A 3ND9A 3QA9A 4TL9A 3CUWA 4Z0NA 5C31A 2YKGA 2Q6IA 2ZUWA 4HUQA 4AMYA 4DSNA 5F5LA 4D4LA 3DB2A 5JFTA 4IV8A 1NXWA 2OBXA 3NVAA 3QKRB 3DP9A 4ZAYA 5DB4A 2RK6A 1AMOA 3EXEB 5FL7A 1DJQA 5KINB 4YY3B 4MHOA 2JFHA 4G5SA 2FMHA 2YHIB 3IAFA 3K0FB 3VBEA 1JH9A 2IHNA 1OFGA 4MI1A 3ZU6A 5TQ0B 3G13A 5DT9A 1RHMA 2ATEA 4P58A 4Y98A 1PG5A 1TD1A 1HDOA 4LZOA 1I2CA 4ZVSA 4W63A 4RH1A 4CDGA 1DHRA 4IO0A 1E79D 1KKLA 1MC1A 5IANA 1C7ZA 4OMFG 3VX3A 3RVRA 1XZBA 2JD2A 4CFSA 4M7RA 2FCRA 1EX6A 2RGYA 1EINA 3AIKA 4C87A 1JLHA 4GZLA 2HF8A 2PAAA 4LISA 4YT4A 1PJBA 1VA4A 2OKCA 2YJ6A 4B7ZA 1HLPA 1NE7A 2OENG 2WVAA 1K0FA 1LZKA 2FG6C 2O4UX 2Y9MB 4OI4A 4UNIA 4EUHA 2WFZA 5EQFA 1TZJA 1OXUA 5KO2A 1KO1A 2BM8A 4HKTA 5IC6A 4UFNA 3ZZUA 4UTXA 4B9AA 4JFAA 1NX6A 2CV2A 1R6VA 1WCIB 2AWOA 3ELDA 2G4CA 1JEDA 5B2EA 4KXQA 2EVWX 3UAZA 4K6MA 5TR9A 2C1ZA 3BMNA 2V54A 2RCYA 2OFPA 3K0AB 4G0OA 4MR7B 2MDTA 3I73A 3AHIA 3OOWA 1DEOA 2AOTA 3MTDA 4OUKX 2CUZA 4UUNA 1M1YE 1JKIA 3K1JA 4PG5A 5AXAA 5EJAA 2O2HA 3D64A 3ESBA 4BVLA 2VLBA 1S4QA 2FW1A 3B1WA 1KI2A 2AT1A 3IP7A 3NXSA 2PH7A 2VDKB 2QL6A 5HM8A 3EY9A 3GMIA 3RSCA 3K73O 4EJSB 1N9ZA 5JCOA 4DMMA 1U04A 3EE6A 3MT9A 4MS1B 3GFSA 4YFYA 2CKDA 4KMMA 4QT0A 4C3VA 1UH5A 4DY6A 1EIWA 1OLUB 2RH8A 3UWDA 5JD5A 1GDTA 2HIAA 3W5VA 1YQ9A 4NV3A 3MNFA 4PRZA 3ZH9B 1IBRA 4F6RA 1Y7LA 4JVNA 5F12A 3H4MA 1RP1A 4K6HA 4J0IA 2JFZA 2HU8A 4LRUA 1PL7A 2W2PA 2R96A 3IMCA 1G8YA 1U2GA 2I6QA 3C7DB 4FLMA 4RA6B 3FSRA 3QLEA 4DIKA 3NP9A 2PT5A 3EVZA 2IBTA 1ZMBA 2X14A 4RZ2A 5E2BA 4GD3Q 1UXJA 1L4MA 2FDXA 1LS6A 2JBAA 4JXKA 4LVUA 3ESYA 4IIYA 3NHWA 4GG1A 4E2XA 4E4TA 5CCXA 2V7TA 3JQQA 3LL4A 3MMXA 3JD1A 4PSUA 1FBTA 5JRJA 5LYJB 1WPXA 4PG4A 1P3DA 3Q1LA 1AKEA 3D6MA 5CTAA 2WB2A 3ZK7A 4G1BA 1I01A 3MWEB 1KMHB 1MEEA 3EDRA 3BFJA 1WJGA 3W1WA 1G9SA 4L5YA 1K8QA 4GLLA 3ILYA 3H8WA 1JHAA 3DBHA 2PYZA 3U26A 4TV8F 1KEUA 4WKNA 4BNNA 3F49S 4IICA 3H11A 1WVMA 4Y9DA 4GE0A 1AKWA 5BWOA 5KTOA 3EPLA 4ITVA 4OBXA 3HCEA 4BXOB 3ZV4A 2Y77A 1TADA 4CMEC 1AS0A 4KHPB 4JP2A 1JXQA 3I8XA 4FFBB 4W9RA 1KU6A 2H4HA 4AP9A 2ZJ6A 1ISHA 1E2BA 4IX1A 3H1AA 4JC0A 4OB6A 4R1PA 5D3KA 1NV9A 2CNOA 1GTL1 1I6WA 4FCVA 4PSAA 3QMVA 5EJGA 3VUEA 2YYAA 3ZGNA 5BURA 1IVSA 4X3OA 5HNKA 1EPUA 4U8HA 4CDNA 4PZPA 2JIBA 4K88A 5TGZA 3ZDAA 4AG5A 4QU9A 2X5JO 1Q20A 3QFSA 4FZJA 5FUWA 4U9UA 3AETA 2KJQA 3ED5A 1AA6A 1UMDB 2QP4A 4M0PA 3KC2A 4I1IA 4UDXX 3NAQA 5T8KA 4WGFA 4C0SA 2Q29A 1NA5A 4IIDA 1UXOA 1NU8A 3QYFA 4NOMA 1G8MA 3Q5EA 2VJMB 2VQDA 4TS1A 2FMTA 3A2LA 4MV6A 4R7GA 4F2HA 1KRHA 5CFPA 3QXJA 4OK6A 1PD0A 1QKIA 1NOIA 3AKEA 3ZE1B 5FXMA 2IDMA 4NS4A 2H3EA 4RIIA 2YXEA 1FC0A 4ZVOA 3ZBUA 1J9GA 1NKTA 1YH3A 3P9RA 1GCIA 2ARKA 2IW1A 1K8ZB 2RFLA 1KSGA 4D9KA 5HQ3A 1ADGA 4QNMA 1QP4A 2OE2A 2VXBA 1SCIA 2ZYSA 3JALA 3PNBA 2NXJA 5B30A 1SXQA 1E1RD 1H5NA 1S96A 2XIQA 1ORTA 3L8EA 4GUDA 5ED0A 3HKEA 4S2UA 1OFTA 1AHHA 1SN7A 5JJKA 2Q6TA 2BCEA 1NM5A 4YDRA 2FG7C 4AVYA 3RTDA 2HT1A 1WQ3A 5ALSA 1KH1A 2DHEA 3EZGA 2ZYVX 2A1IA 3RHFA 3ELBA 4WKGA 4ZYYA 2I66A 3S2IA 1A2BA 3MWDB 2LRHA 4R8VA 3R4CA 1BE1A 2EP8A 3Q15C 4IKPA 4RD3A 2QENA 1QP7A 4JY7A 3FVTA 1WVGA 4UQOA 4FD3A 3GVPA 4DNPA 1EWQA 5HM6A 3DO8A 1ISJA 4XI9A 3H0CA 2X40A 4L9SA 4W8OA 3CX3A 3FVRA 2B1JA 4H0NA 3SM3A 4NFYA 3A0RB 3OKAA 3NYRA 2IP1A 4FMCF 2JH8A 3I5XA 1W0JD 2AI3A 1OA0A 5IXJA 2NUAB 4B3SB 1BOFA 5BWMA 1Z16A 2ILVA 2ZRNA 3ANYB 4JP8A 4X61A 5J1TB 1T2CA 1XHFA 2G8NA 1VPTA 1P2SA 1N2BA 1Z5WA 5ALUA 2OHHA 1PF7E 5FV4A 2KMLA 3UO8B 4WH0A 3BCHA 1Z4NA 3ORSA 4UTVA 2QUKA 4OLJA 4F4IA 5AM2A 1EAMA 4O5AA 4DYHA 2JBHA 5HKKD 3LAWA 1VJ0A 4OPMA 2AMLA 1AUVA 1LTHR 3DTTA 2JDIA 3EFEA 3DG9A 3RSSA 1W73A 3D2CA 2MSCB 4X5OA 1NDUA 1L5LA 3IP8A 3ZW8A 1X7GA 4RABA 1FRQA 1WM1A 5FNVB 4RPCA 4AWBA 1ENZA 2Q50A 4RMHA 4BFWA 4F9EA 1TM5E 2HFJA 2JZOA 3PTLA 2M1ZA 3VKUA 3WICA 1EM6A 2BGKA 1VLVA 2AMYA 3DFKA 4YV2A 3MT0A 2C8KA 3F4KA 3ZKWB 2FMUA 2VHCA 2R87A 1XMQB 1N1MA 2EBFX 1UXGA 5G0TA 3ZLVA 2J5XA 1H4VB 1UOOA 4PZZA 2IS6A 3A7EA 4JJ7A 4NEHB 4G4GA 3B52X 3W8EA 1ORRA 1UJ5A 3N0TA 4A6EA 2ACKA 3JVUA 1ZCJA 3OLXA 1H0KA 4LYYA 3RBZA 1M2VB 4UULA 4GBJA 2GWHA 3TW4A 1NUUA 2D54A 3WGQA 1CQPA 4EARA 4ZCMA 5AVQA 3AY6A 3ZWCA 3T9DA 2PJUA 1T8SA 1YONA 4DLWA 3SF8B 3UT5A 3ZVLA 3BD9A 1G17A 2DWOA 1NMYA 3A6FA 5LLDA 2P9TA 4TTJA 4TUYA 3RH0A 3C8DA 3ZVMA 3UK2A 5A7FA 1YHZA 2FSGA 2IHTA 4WXMA 4EG5A 1B0PA 1XTBA 2WQZA 1NXOA 2Q6OA 1T36B 4PYOA 1BXGA 3TMAA 5H4GA 2JEZA 1AH2A 3A9VA 3SQLA 1TK2A 4Z3KA 5ALXA 4P3YA 3RYFA 5D8DA 3SCZA 3ZUGA 4QSHA 4L4ZA 1V41E 2J31A 3FD8A 1F48A 3IMKA 3GLIE 4HNSA 4KQEA 3JQDA 1Y3CE 3GRFA 2E85A 4WXEA 3CEHA 3Q7EA 1VSVA 5DLEA 2H5LA 2DJ5A 3R5SA 4TQAA 2DFPA 4GS5A 4PLGA 1N5LA 3ZE9A 3DLCA 1JR3D 1DTWB 2VXOA 2YWBA 2WJJA 3F6YA 3H5RA 1KI9A 3LT0A 1QYVA 1KZ7B 3GT0A 3RU2A 5DMXA 1U9IC 1FXWF 1U6IA 2LCQA 3TRHA 1A0OA 4EF6A 1DJOA 5ECGC 2PX3A 2IS2A 1L3BA 3RJMA 3RVJA 3RRFA 2PN1A 2ZRJA 2GCOA 2P4EA 5G02A 4MWSA 4V0RA 3KZNA 3WGLA 4CIDA 4C4SA 4YT2A 3SZOA 1ICIA 2A1TS 1HRKA 4CF4A 1V7PC 4QGHA 2XOEA 4UDYX 1G7TA 4NPCA 4ZOLF 1Z18A 4X8OA 4XARA 1A8UA 3QWHA 4CHGA 5JYBA 1F9EA 1FPQA 1P77A 2SECE 4PO8A 4IUDS 1QB7A 1Z4IA 2G80A 5DWQA 3ZXSA 3LRXA 1R0XA 4XUCA 4O3MA 4HDRA 4Z0HO 1KAEA 4DL9A 2UUCB 1FP1D 1GQOA 4QT4A 3PEEA 1ZX1A 4I4NA 1VFNA 4JT9A 3LRTA 4P93A 2P5UA 2R44A 3PS9A 4IL5A 3HJCA 4N8DA 5BUCA 2Q2QA 3FH0A 3HNRA 2OCDA 3FHCB 4LN1A 4RLSA 1WP4A 4YRTA 1C1DA 2GASA 2PWZA 3F6EX 3IVRA 3LY8A 4FOTA 4XR9A 3PYLA 5MGBA 3VR3A 3X2SA 4AJNA 1YK0A 3N8DA 1FRNA 2FZCA 2HK7A 1K7FB 2D8AA 4KUHA 3KDAA 4B2YA 3OCZA 3PFIA 2ZIZA 1NBAA 4LGMA 3TLGA 3H3XA 2C2YA 4JN6B 1U7ZA 3IESA 1SC9A 5JHHB 5T64A 1GAEO 3GBSA 3R3JA 4XSHA 5JXGA 1KYQA 3AVOA 2FFAA 2GAIA 2QPLA 3P9YA 2QE6A 4HWPA 3OIGA 5FTJA 1H5QA 3OSZA 4YCCA 2BI7A 5GIPE 3RVQA 2NZXA 4NBRA 4CRWB 1YQWA 1K89A 4X1YB 1JJFA 5HMMA 3TD2A 2FN3A 3UA4A 1IFXA 5JXJA 5I7WA 4M46A 4DW8A 1QUFA 3O83A 3PCRB 2CBZA 3X1DA 4DY4A 2PRYA 2ZBPA 2CEAA 2IEIA 3MEQA 1RRKA 3UMJA 2R8RA 4RYLA 1T10A 5BPFA 3GRZA 3AZQA 5HHTA 2ODTX 3U60B 2W5UA 1DTEA 1XDZA 3KL2A 4HAIA 5A3SA 3WGVA 1UC9A 1ZHFA 2D5LA 3EUWA 3N2NA 3G85A 2Q5EA 6GPBA 3PNPA 4PAMA 3KFXA 2AC4A 4FTWA 4N7JA 2O8EB 1R9GA 2Y05A 2VJQA 1REQB 2Y0DA 3UJ9A 1EP3B 2H57A 1N8KA 1DADA