1XLTC

Crystal structure of transhydrogenase [(domain i)2:domain iii] heterotrimer complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
b'RHMAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAD(P) transhydrogenase subunit alpha part 1
publication title Conformational Diversity in NAD(H) and Transhydrogenase Nicotinamide Nucleotide Binding Domains
pubmed doi rcsb
source organism Rhodospirillum rubrum
molecule tags Oxidoreductase
total genus 52
structure length 174
sequence length 174
chains with identical sequence F, I
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2004-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1xltC00
3D7KA 4BV2A 2FSVC 5K3SA 4FVTA 1NM5C 3ZG6A 2UZ1A 2FWNA 5MFPA 1V5EA 2H2DA 4BVFA 4QPZA 4BUZA 5K6TA 4UU8A 1EFPA 2X7JA 2OD7A 4JUAA 3E9YA 4MPPA 5D7NA 5MGNA 2VBIA 5K2OA 3HWWA 1Z8NA 2Q5LA 2VK4A 3PKIA 4R8MA 2AG1A 5EJ8A 4GPEA 1YBHA 2Q28A 5AHKA 1PT9A 3JWPA 1UPAA 1YHYA 2QQGA 1V5GA 4UU7A 2OORC 1D4OA 1MCZA 4Y6LA 4JUFA 3IAEA 4JUBA 4JUDX 4JU9A 3HWX1 4QQ8A 1BFDA 5EJ6A 1U2DC 1HZZC 2VBFA 4RMJA 1YHZA 1ICIA 4JU8A 5IMSA 1EFVA 2UZ1B 2H4JA 4IAOA 1M2HA 5MFZA 1U2GC 1SZDA 2WVGA 4GM0A 2A1TR 2HJHA 2EZUA 4MZXA 3RIGA 2OO5C 4BVHA 4FEGA 5FYQA 2JI6A 4JSRA 3RIYA 4RJIA 4TWJA 1SZCA 4RJJA 3EA4A 2IHVA 4X3PA 4RMIA 3LQ1A 2B4YA 1OZGA 1DJLA 5BWLA 1XLTC 4K9LA 3GLSA 4O8ZA 1Y9DA 2PANA 4G1CA 4FZ3A 3PDHA 2FN3A 1T9DA 1Q17A 4RMGA 1Q1AA 4UTRA 1T9AA 3EYAA 4L3OA 4ZP1A 2V3WA 4J16C 4K9MA 1UPBA 3FZNA 3CLRD 1N0HA 4BV3A 4Y6OA 1YC5A 2EZ9A 5BWNA 3D81A 4MPJA 4COKA 1U31A 4RJKA 2H2IA 2EZ8A 4BVEA 2FR8C 2H59A 2VK8A 1PTJC 2WVHA 2JLAA 2W93A 4UUBA 4X3OA 4KGDA 4Q9DA 5K6RA 3K35A 4V1CA 1J8FA 4GP9A 2EZ4A 4UTXA 2Q5JA 2H4FA 2BRUC 2Q29A 1PYDA 2H2FA 4K9NA 3OE1A 3F6BX 2NYRA 2DJIA 2JI8A 5EJ7A 2JIBA 2H2HA 2C31A 2IHUA 4C78A 4UTZA 3GLTA 4K9QA 4GM1A 4TWIA 4D5GA 1OZHA 2JLCA 4F4UA 1POWA 4Y6QA 1M2NA 5MF6A 2OD9A 4I5IA 4FEEA 2Q5QA 2VBGA 1ZPDA 4HD8A 2Q5OA 4BVGA 3F6EX 1Q14A 5FEMA 5EJ5A 4BN4A 2OD2A 3GLRA 4JUCA 1YC2A 4C7BA 2PGNA 1O96B 1YI1A 3IAFA 4V1CB 1T9CA 4UTNA 2VK1A 4F56A 1E3TA 2Q27A 1OVMA 4L2IA 5EJ4A 5EJAA 4J1TC 5EJMA 5EJ9A 1QPBA 1T9BA 4QELA 4KXQA 3GLUA 4ZZIA 1OZFA 1YI0A 2H4HA 2IHTA 4K9OA 4K9KA 1PO7A 4IG9A 2JI7A 2AG0A 2FRDC 1YTLA 1UPCA 3FLMA 4V1CI 5DGDA 4JT9A 1M2JA 4BVBA 4GG1A 2EZTA 1V5FA 2H2GA 4IF6A 3U31A 4MQ5A 1PNQA 3ZGOA 1YNOA 1JSCA 2PGOA 4BN5A 2NXWA 3CF4G 3FSJX 4MPRA 3CLUD 4UTVA 1S7GA 1PVDA 3EY9A 4JD5A 1M2GA 1PI3A 4JT8A 3CLSD 2JI9A 2QQFA 5BWOA 4KPUA 3U3DA 4K9PA 2VJYA 4HDAA 3CLTD 1MA3A 3JR3A 1PNOA 4RMHA 3PKJA 4GM4A 5DGTA 3ZGVA 2A1UA 1S5PA 4UUAA 1O97D 3D4BA 5DEIA 4D5EA 2WVAA 1Q6ZA 1POXA 1U28C 1M2KA
chains in the Genus database with same CATH superfamily
1WS6A 5LD2C 2IYFA 1PT7A 3V4ZA 3BD8A 3D7KA 3GGJA 1JJVA 1Q7RA 2BIFA 3I23A 4GDMA 3A31A 5AHXA 1JZQA 5T41A 1Z25A 1ZISA 2FSVC 2I4OA 2OB2A 1RXEA 3GVPA 3LQRA 4FMDB 4RK1A 1C9KA 2FPMA 2XSZA 1UQTA 4GLFA 4DLXA 4QXOA 1U9YA 1XR3A 1WSDA 2P77A 4GBGA 3QELB 5IP5A 2IEDA 1U1EA 2HGZA 4GQBA 1RAIA 5TRTA 3U4MA 3ZS9A 3AEZA 4KE9A 2EEPA 2IYXA 1BVHA 2IU3A 4D8UA 1CX9B 4O3FA 1L7OA 1UUFA 1Z3IX 1V5EA 3EDYA 3RUCA 3SDBA 4YAUA 3JQAA 4E5SA 4I9GA 1N7IA 4QPZA 1WB4A 1UC8A 4QUBA 1N2HA 4HB0A 3T3HA 2RGDA 1SKAA 4DJAA 1TTTA 2AX4A 1YQDA 1U7UA 5F4ZA 1SVNA 1KDYA 1E79D 1RKXA 1XMJA 2W2KA 5EIWA 5DGHA 2PRYA 3RREA 1WX1A 2ZBGA 1G2OA 3TYXA 4UBJA 3LXMA 4DPLA 1ZESA 1E6UA 2P6UA 4QBKA 1X7GA 1TRKA 1JLLA 3R4VA 1U0BB 1FC0A 3F5SA 1JSXA 3C1OA 1NW5A 4O4LB 3TGWA 1MRNA 4P35A 2QTHA 3UHPA 2JFQA 4Q12A 5IG2A 1EFRD 2CL0X 3A1SA 3AF4A 4F1JA 3CRZA 3O47A 2YN4A 1W9MA 3JAKB 1CR2A 4FFMA 2O8CA 4II7A 5FTLA 1UJ6A 1VI5A 3JWIA 3N8HA 1N2BA 2BFBA 3TZCA 3DONA 3H9JA 2QVGA 1SXJB 4H1VA 1T1SA 4KO1S 2ZB2A 3I5AA 3I9LA 4G56A 4GPEA 4LTDA 4R54A 3CZ5A 1U3CA 1VJDA 5IBCA 3LJKA 3AFMA 3H1EA 5HUHA 5BR8B 2PZJA 2XAAA 2VPWA 4LF8B 1GGNA 4PGFA 2P6RA 3RF7A 4WKOA 2OY0A 3HLKA 2DQSA 3WNVA 1N6HA 4FGLA 3OVMA 4BDTA 4B3RB 1ZA1A 4YWJA 2E4YA 1JIIA 4XB1A 1WNTA 1KMCA 2XMCA 5BW8A 1YJ5A 1C4KA 4XQEA 1TXGA 3CB4A 1DAHA 1Q21A 3ZKWB 1FYEA 1H8ED 1VL8A 1WXWA 2HK6A 5BSFA 2CLLB 1X42A 4IMIB 4FMPA 2PSFA 4RVGA 4WCFA 3UV7A 4TVKA 5I9NA 1F20A 1NNEA 4O63O 5BSTA 3RANA 1ZGAA 1RKQA 2NTEA 4PF1A 4U7JA 4TZTA 4BP1A 4CG2A 4JYZA 3IAEA 1U28A 1ESCA 1OLSA 3V3TA 4K3UA 3GMTA 3C3AA 3G2NA 1CY4A 1D2RA 3EC7A 4IGFA 1W5FA 3HU1A 3RSFA 3SFVA 5CT4A 3ONEA 3HWX1 2FSVA 1ZGJA 1QDEA 4LFCB 3U7FB 1YUBA 3EF1A 3QSGA 4RMJA 2CWWA 4BNLA 2AC7A 5BRJA 3TE7A 2HKIA 3LNCA 3PNVA 2PAFA 2QM8A 2FEPA 3KSDO 4GF5A 3FNEA 1NU8A 5ITZA 2WKSA 1L5GB 4ZIRB 1HNZB 3EUFA 3WE7A 3PITA 1ACJA 5K3DA 4C22A 2QW1A 2EOAA 5TIIA 1OFHA 4H16A 2AW3A 4JB2A 4KQGA 3DH0A 4P33A 2WU3A 1HYQA 1K2VN 1NMEA 2H4JA 3IALA 4J1SA 3KWFA 2DM6A 2FPXA 3LUJA 4JBIA 5TMPA 1TZJA 3ISTA 3MUOA 4QT0A 4QUKA 5DHRA 3BFKA 2P9QA 1KE2A 2EJTA 2DUNA 2YICA 3W3ZB 2XRFA 3BGDA 1RFLA 2VUUA 3EH1A 3D6MA 2PV0A 1B8UA 1TT5A 4C7OA 1SU4A 4C0WA 1NIPA 1CUAA 5I8PA 2BZGA 1QIGA 5K0NA 3AEKB 3KM0A 2BCEA 5K09A 1EGVB 4RTPA 3OOEA 3NDPA 2D0PB 5CM2Z 1UKZA 4AUEA 2VT6A 2NZWA 4LVCA 1O6GA 2M98A 5IT4A 2WZQA 3EEFA 2ZM5A 5FI3A 1L5YA 1DJMA 2KLBA 2I76A 5AK4A 5HUJA 1G19A 2CXRA 2NUTA 5FBKA 3ZBUA 2JLWA 4BLRA 4QDZA 3WDKA 5DWQA 4CL2A 1JV2B 1UBMS 4HFJA 3GW8A 4UHEA 1NURA 5CHEA 4AJKA 1U4OA 3CMMA 3LYUA 4HSGA 1PR0A 4RD4A 4D6PA 2MYNA 3KYDA 1P60A 2GNOA 3FSGA 3SZMA 3UFXB 4A6PA 2G3YA 4HI0E 4EHKA 5BN4A 1ZJ6A 4X6UA 1EA7A 2OV2A 1T0BA 4Q9JA 1LDEA 2JIZA 4KQJA 4CEHA 4CKBA 4A2QA 4EGSA 1LJ8A 4F2HA 3RFUA 5H9WA 1OBCA 3GJZA 3K9WA 3Q3JB 1L5NA 2VT7A 3WAGA 3KZVA 1Z3CA 4HS9A 2SECE 4HDSA 1D2MA 1NLUA 1RBMA 4B3IA 4FSHA 1C2TA 5LZ2A 4ZMSA 2QKYA 4YCDA 2VNJA 2I6TA 3A6PC 5AVZA 3IUBA 4PSAA 4N48A 2PUEA 1CF9A 3LP8A 2X9NA 4F91B 4G5SA 4NECA 3Q7QA 4QOSA 5JI2E 2OM6A 3Q3HA 6ABPA 3UQYS 3QITA 1FYWA 3X2EA 1E2FA 2XGJA 4ABTA 1ACLA 2X22A 4I55F 2NT3A 3PC3A 2IL1A 1NGSA 1NDUA 3HCFA 4F8EA 2YFHA 2PUJA 1ULTA 3FPHA 3AQ4A 2VAXA 2LUOA 5EZYF 2PFGA 4QT4A 2QMEA 1DEOA 5E9WA 3JVUA 5TR9A 5A0TA 3ZWVA 1M2EA 2RKOA 3JVVA 2EARA 2P5UA 4IZOA 4QUDA 5A0VA 4V0MA 2O0HA 4DMMA 3K32A 3NEAA 1Y9EA 2KLHA 3ZIAA 4EPWA 1XWIA 1NI5A 4PFJA 1WSAA 1D09A 4RWEA 2AJLI 4UUNA 1FUYB 2QRGA 1JHYA 2X8LA 3N2GB 5L7YA 3HFGA 5K0BA 2HFJA 1QR2A 2GK3A 4RZUA 3IE2A 4TTSA 1QRTA 5DNCA 2V7QD 2WQ6A 3JPWA 2YRWA 3LQYA 4CG0A 1YVPA 1V35A 1Z7WA 2C2ZA 1L1QA 4HAOA 4TSKA 3HV0A 2I6XA 2W93A 3GEEA 3GOQA 5JHGB 2YINC 5BYAA 3HR8A 4FXPA 3U7IA 4BVLA 5ADUS 2XYPA 4ZMRA 4XB2A 2FJPA 1VE9A 3T0IA 2DF8A 1YH3A 2Y1WA 5AKLA 2VRNA 4AKEA 1U8CB 3GLGB 2Z5LA 4FMCF 4RPIA 5CLGA 5C8XA 1M83A 2XNJA 2OZEA 4KQ1A 2X0NA 2N0SA 4GNRA 4UUPA 2CLCX 2M9MA 3RUPA 1XQXA 3JW8A 2P6PA 3R7DA 2VPIA 5HRUA 2J3EA 4GPZA 4H6XA 1LF5A 3SSNA 2BI4A 4W63A 4RD2A 3DLPX 2R00C 1KJNA 2ALJA 1WQ4A 1XT6A 4RD3A 4WMLA 4DSNA 4TX1A 1LTQA 2IYUA 2TS1A 3PUJA 4EVRA 1CNMA 1J7JA 2RJ3A 1SVIA 2YOHA 3FVRA 2MSDB 5DE3A 2J67A 3Q15C 2PRJA 3DBRB 4URHA 3H16A 1Y3HA 1R3DA 1L7VC 4UCQA 2PSEA 3AF0A 1MVLA 2OBNA 3K73O 1Y37A 2NO5A 1J21A 2WAXA 2C5AA 4H0FA 4AZ3B 1IMOA 4DMHA 2ZP1A 2UXDB 1AH2A 2VZEA 1G5PA 2YJ6A 3CG0A 4AP9A 1M1UA 1J1UA 1EJBA 4G07A 1IXZA 2PXCA 4NS4A 4Z3DA 3RJZA 4FW8A 1LSJA 1OPRA 5E1MA 2C9CA 1G3QA 2GN8A 3ZDCA 3NIGB 1ZRSA 1QOZA 3O93A 4RXTA 3KD2A 1JAHA 2Y05A 2H2HA 4TLDA 1X7YA 4UDYX 5FCDA 3FGPA 3WHPA 1FSZA 5IS2A 1PSDA 3PHJA 3IAHA 4RZ2A 4H0NA 5T6MA 4DCPA 5LQCA 3IQWA 4LC0A 5CDTA 1KFCB 1EEXB 2XCQA 2ORWA 3EF0A 5ECDA 1PV2A 3U61B 4V3CA 2BFCA 4C3UA 1N0UA 2AE2A 4JS0A 3O92A 2BEVA 4PAQA 2IP1A 2ZJ3A 2QM3A 5DMHA 5EMLA 1ZGGA 1IQ0A 2HADA 4Q3OA 2QAIA 4I5IA 1R8SA 3AU9A 3QMWA 3S1LA 1XP8A 5JNTA 2JGAA 3NRBA 3QHPA 4KUHA 4UNIA 5THKA 1HGXA 4ARSA 3PIDA 3TX6A 4OGKA 5HIKA 1T3ZA 1ZPDA 5TT0A 4NH4A 4CHTA 1YU6A 3GDFA 4YAEA 4AJHA 2CB0A 4L85A 1FRVA 4R7TA 2Z2ZA 3NWEA 4E03A 4OX9B 4J9VA 1JZSA 4UAUA 2D4AA 1JG6A 4BEJA 1E18A 2PKYX 3Q0IA 4X91A 3TTYA 4BKPA 1UKCA 2PH7A 6YASA 1X7WB 3BKXA 4UD2A 3BUSA 4JQZA 5I9MA 2FFBA 5EJ5A 4S1TA 4UZSA 1VPLA 2PT7A 3N2EA 4YCCA 4OKSA 3ZUGA 3JAMA 1KDVA 2VZ0A 5SZHB 3N74A 4YBRA 3ZZ0A 4HV4A 4QXQA 1AS0A 3HYTA 3GA0A 3IHWA 3T5DA 4BDSA 2Q41A 3VKHA 2ORIA 4J43A 4JLUA 5CXQA 2ONZA 2PX5A 4TYNA 3VNUA 5IMBA 3GBSA 4JP2A 4LMPA 1ECCA 2QMQA 3NHZA 5D3MA 3T7CA 2R97A 3OO1A 2J9GA 3CUEF 2I3BA 2W6JA 2ZTLA 1E2GA 4FWIB 3TJMA 2M32A 2WIGA 4GOXA 3E48A 3ICVA 3AUUA 1M5RA 3DNMA 2R00A 4R5HA 3SHVA 5BSHA 3BXEA 4E1BA 4Z1OA 2QTWB 1T24A 4DCSA 1O95D 2O5RA 1QVRA 3LHDA 1CTQA 1RLTA 4NVRA 1XA3A 1ZR2A 1PFGA 3QKWA 1G291 2HK8A 5DV9A 1VIDA 2RIRA 3KSUA 2IP2A 4RDXA 1GU7A 1QIEA 4POOA 3GGDA 4B09A 1QOPB 1S2IA 3H5VA 1WCIB 3ZGNA 1UXGA 1YL6A 3SEAA 1YI0A 3ZHVA 4URYR 5ALMA 1OXTA 2O2ZA 4JLMA 4UUQA 3U5ZB 3PFGA 2I7DA 3WKCA 4CM9A 1T8PA 3DE3X 2GN0A 4PAWA 1UJBA 4ZVMA 1JT9A 3SKXA 3DJYA 3SE0A 4OBWA 3VVBA 4CDNA 1F7UA 1FP1D 1M2OA 3A10A 3LBYA 2VUSA 2C04A 4WNCA 4JXXA 2AG0A 3DL4A 4TKVB 5KZMB 5D5HA 2FN4A 2HCTA 4IGAA 4DCJA 4BZXA 5LPNA 4KTTE 3M4JA 1RXVA 1IZ8A 1UFQA 2FFAA 5J23A 1N3YA 2PWZA 4KBYA 4QQRA 3OJXA 3T61A 3CONA 2QPTA 3COZA 4HYTA 1PZHA 1V1RB 1I13A 2PUHA 5SYAA 3V1KA 1DUIA 1VE5A 2RGWA 5EVJA 3VBEA 1C3JA 1Y7PA 1FX1A 4ZPXA 3NGLA 4FX2A 4YK7A 4HATA 4LMRA 1KOGA 3N2KA 3GARA 2BGLA 3QE4A 2RBGA 5DHTA 2QEQA 3RU7A 2DR3A 2NX2A 4TN1A 2ZIGA 1ZJ4A 4LZLA 4ZYUA 4EWLA 4HAUA 4KFRA 2G76A 3W2HA 3AHFA 5JCJD 2R1VB 2C2GA 4LXGA 2Q2VA 2O5VA 5AI6A 1LDGA 3BGIA 2ATXA 4P80A 3VTZA 1LA2A 3FUUA 4ZVVA 3CXUA 3G5LA 2FFHA 4LV6A 3R20A 4ZZ1A 3TKAA 3IQHX 4UD6A 1ZN9A 1NLMA 3VNQA 2GZHA 1MOSA 3PX3A 3OMXA 3UUGA 2BCJQ 1Q0HA 1F2UB 1BZYA 3JWJA 4Q9AA 4HBGA 3CLSD 4B6JA 5DRYA 1VJ5A 1WV0A 2RC5A 2VDJA 3VVMA 1CJMA 4D99A 1L4EA 4MVJP 1V8FA 3I5XA 4FNAA 1FMCA 2B6HA 4LV5B 3H2ZA 5REQA 3USCS 3ABIA 3HJNA 3W3AH 1K7FB 1EE9A 1JDTA 1AMUA 1OPXA 2QD5A 2H1WA 1KYYA 4RCVA 4RXMA 1FBTA 4FBGA 1JWLA 4K7JA 4FUQA 3E53A 2OFWA 3M4YA 5P21A 4GT1A 2P4UA 4JHLA 4KXVA 5K6AC 1NVVQ 1FS5A 1ZICA 4A16A 4O5AA 1K7YA 2NV2B 3ASUA 3DVQX 2IVZA 1D0VA 3H1AA 4V0QA 1KJIA 1KZ6A 2EW1A 1N5DA 2YN2A 1MENA 3B9BA 3DOOA 2EFEB 3RVNA 4HX5A 5IKPA 3WI7A 1YCFA 2Y92A 4PYOA 3RVPA 2DUWA 3IDSA 4UDXX 3U9LA 3BMQB 3DW1X 4PRLA 1IUKA 1E6EA 2BFEA 1LC0A 2G72A 3CZPA 2BN4A 1AF7A 4M7RA 5H7XA 1OXXK 2D8AA 1ECBA 3PHHA 2O0KA 4F93B 4XYEA 5IFKA 2ECPA 1T8RA 2P9GA 3FR8A 4XGIA 3MCVA 1F8XA 1H4VB 4HG2A 4LYYA 2IE0A 3NOQA 4UVGA 4B87A 4B75A 4BV9A 1GTSA 4YJ3B 1FVHA 3IQZA 2HRZA 3FOEC 2W0SA 1Z68A 1WSWA 2EF1A 3MYRA 4JITA 1QTQA 1XU7A 4MR8A 3U4QB 5I51A 3WICA 2K2WA 2AHRA 4JCCA 1EDEA 3PWKA 2CUTA 4GFDA 1TX4B 2DUMA 3HPQA 4AT1A 2XUKA 1WG8A 3AEXA 3BFVA 1JILA 3PFCA 4LY0A 1N34B 3PX7A 1NJ6A 2XQFA 2WUFA 1XTKA 3X1YA 3D3KA 4RIEA 2EHJA 2CN1A 1W5AA 3ECCA 1X80A 4RV9A 4E6PA 4IGEA 4QUIA 7ADHA 3VGJA 1XDBA 5CBPB 2Z8YM 3OQ1A 2DBQA 1IBLB 2DT8A 3A36A 4YJFB 3T7TA 2WIBA 5DWDA 2FQXA 1PTKA 1TCVA 4EF4A 3CUUA 5B1HA 4DRYA 4CLEA 1FJXA 3A9CA 4JJ8A 1C7IA 3NTLA 1U63A 4Q4JA 2VPQA 5GJWC 3T1NA 4YRLA 4O2AB 3UMFA 3V4FA 1EIWA 3TI9A 4EQ6A 3PDCA 1E2DA 4YPOA 3IUPA 1N33B 2OCDA 1T1GA 3IUQA 4D56A 3OH8A 4D8WA 3PE3A 2AV6A 3MWDA 4ZI5A 2VRCD 1Z63A 4AMUA 5A3RA 3U44A 2QX8A 3UXHA 4DR3B 3EISA 3VNVA 1RFGE 3IO5A 3RTBA 4BKQA 4BNYA 1A5ZA 1RYEA 1JHAA 2XWPA 3E9YA 3FTFA 1G7RA 2H57A 1LWNA 2HMUA 2JFPA 1MVOA 3RWOA 3ZXSA 5GJBA 3LT5A 2VJOA 2E6UX 2H0AA 2HSJA 3OPYB 1WMDA 3I5MA 3ZHSA 1P2TA 3B7WA 2KYRA 5FNZA 3BYZA 1QK3A 4IM7A 3WYAA 4DHEA 1XMSA 4DJ5X 1IJKA 4C5BA 1PJTA 1Y98A 2CNNA 1ZUWA 1G6HA 2GI4A 4MVJD 1LPSA 1B8OA 2QVZX 5C8YA 3HWRA 2PJRA 4NYJQ 1M8KA 2CXOA 2QDKA 4CKCB 5AVVA 5HTOA 2H0QA 1QO0A 1KY5A 4G5FA 1MC8A 2WB4A 1W1UA 3M6MD 4B4KA 4EF5A 5K6AA 1V5GA 2R84A 1IOWA 5GWXA 1PEDA 2XGMA 4TGLA 2CXXA 2VPYA 1L5ZA 2PYDA 2Y1LA 1V43A 4WECA 3ZWDA 4DIFA 1A76A 3S7TA 1QNLA 3ZNOA 4KSCA 3KEGA 3QG5A 4DMLA 2C3PA 1BKSB 1TM3E 2QRHA 3GRYA 3NOXA 2GJAA 5LBIA 1YU9A 2YVKA 1NASA 3SEZA 5DN6D 4CNQA 3GCZA 4ZFNA 4EM6A 3T4UA 2COKA 2BVNA 3A1TA 1M2VA 3H5TA 5BR4A 3CCCA 2HJ9A 3W8RA 1AHIA 4RS3A 2XOKD 2GPNA 1PQUA 3OKFA 2RI1A 2GZSA 1JWAB 1Z4JA 2JJMA 5D2CA 3SNHA 4DC9A 5BQXA 1AUPA 5KOYA 2D1YA 3O8NA 3CUSA 4CMEC 3UW3A 5L40A 2CJWA 4CCWA 4ODIA 5HYVA 4I5EA 2W6OA 4LF4B 3G2OA 3H4TA 2VBFA 3M4XA 2FQQA 3GLHE 1AKVA 1GRVA 3KYCA 2Z2YA 3I1YA 5CHYA 3SDSA 1LBTA 1Z39A 1R9JA 2QXUA 1T35A 1JFSA 2Q4EA 4LOIA 4N6OA 3D3QA 2YH2A 3K53A 3H2GA 2J4DA 4LI3X 1G42A 1EA5A 3VMMA 4BKUA 3TM4A 5DNYB 3RYIA 4P3PA 5JZVA 2BFNA 3DZBA 4BNZA 4B6SA 4Q0MA 3GH1A 3WGTA 3VYTB 4LECA 3VDRA 1W76A 1YGPA 1C7ZA 3BHNA 1E3EA 5TF0A 1HY3A 1QH0A 3B8HA 4Z9YA 4Q3EA 3TSWA 4D80A 3KJHA 3ZDZB 4L0CA 1JYEA 5MFZA 1II0A 4LZPA 2I5PO 2WILA 2HPHA 3C5HA 2PH5A 2EL9A 4X1YA 3WHIA 4X65B 3BRQA 4PZZA 1XCLA 1V26A 2JLZA 3AL0C 4QASA 1JH9A 3PNOA 2EZUA 4MZXA 5IAKA 4ASUD 4LJRA 1KBQA 4KAAA 4QA9A 1DRJA 4TVSA 2ZUVA 3GLQA 4ZYVA 4F3YA 4MO2A 1VB5A 3L18A 3EZYA 5B6JA 5I7SA 1AVTA 3OTQA 1KOJA 5KUTA 1IHOA 2RKBA 3INNA 3JRNA 2WIDA 7REQB 1EWQA 4L8GA 2BBTA 1UXHA 4LZNA 2G0AA 2O23A 3BAFA 3MGKA 2WU8A 3MT9A 4ZAFA 4DBLC 5LWQA 4P93A 2IH4A 3ITNA 1W36B 5BWLA 1GT91 1KAOA 1P77A 1AKTA 2QRZA 4FGUA 3VSDA 4AECA 5CEJA 1Z08A 1J06A 1IAQA 2QENA 3S3TA 3VBCA 1VLMA 2YASA 1FRNA 3QEJA 1E94E 1Y9DA 4WY5A 5GOZA 1WTCA 4I4TA 4KIUA 4ILKA 1L1EA 1ZD3A 1HDOA 4FZ3A 4H7PA 5DCUA 3WS7A 2NO4A 4IHQA 4TL6A 5T8KC 3GEBA 2X3FA 2RK4A 1R0WA 5KAMA 4P84A 4PO8A 4L4RA 1NZFA 221PA 2QV7A 4LMAA 5ICSA 3H86A 1XDUA 3N6RA 3STVA 4YT8A 2FN3A 2P3LA 1RU3A 3ANYB 3L0CA 1MOQA 5TQ2B 3X1DA 3QLVC 2AXQA 3Q10A 2RAPA 1K4YA 2AOTB 3IIEA 4LXXA 4XJTA 1HQCA 4BP9A 3QMPA 1OXUA 3OJ0A 5F1OA 3THRA 3OURA 1ULSA 2ORED 1H5NA 3AJ8A 4MUYA 2ZE8A 1F9EA 3VR3A 2CJFA 2FUKA 3GZNA 3UY4A 2JRLA 4BRSA 2XYHA 1WKCA 3PEEA 2G1JA 3T38A 4M87A 4PHTA 3WL4A 4HX9A 2WNIA 4RKEA 4YV7A 3G9XA 1IZ0A 1JQLB 4FLMA 4EL5A 5JATA 3KALA 5BSEA 2B30A 1ZOLA 2SCUB 3IMKA 1JG7A 3U4HA 1MIOB 1Z6PA 3SN6A 1V1JA 2OG1A 2D3WA 2FSFA 4MW0A 2JHAA 1XELA 4P58A 3TNFA 5UKDA 2ZB7A 2LTAA 1BVUA 1S8AA 4LHWA 1BHO1 2XMRA 5BOSB 2H9YA 2V98A 2H59A 4GGOA 4K0KB 5DWVA 3HCNA 5HKLA 1WXHA 1T2AA 1CR1A 1PZNA 4PLFA 3O2QB 5JAUA 2XCLA 4LVOA 1ZFNA 4K3VA 2REXB 4EG7A 1CJTC 3B13B 2HRDA 3FPBA 2FP4B 4KPYA 2PYIA 3QKSB 1LPNA 4P5EA 1U2SA 2BMDA 1FNCA 4QGAA 4X71A 3SX0A 3O8BA 3KK0A 3VVLA 1B23P 4XDHA 4M7PA 1X7DA 4U2KA 5JYEA 2F6RA 4GP9A 1EVIA 4HJRA 1A9TA 3SQMA 3NDBB 1P17A 3QPDA 4JZYA 4W9NC 1N3LA 4CN8A 1T2VA 1Z0DA 3NHWA 3D8NA 4G1VA 4B80A 3VI3B 3C41J 3ANMA 3ZDFA 5C2JB 1MZVA 4P4SB 1JDBC 3I42A 3SLGA 3W5VA 2YFQA 3DAPA 2XI4A 4UFNA 2VK2A 4DWVA 3GRAA 1EE2A 5IBQA 4NOLA 4DLAA 3P45A 1PV1A 4BAUA 1SUSA 3UH0A 3A1WA 4RPGA 4UZFA 3UXYA 2QTBA 4IDOA 1K3FA 4IXTA 1XA4A 3C2QA 2ISQA 2X3YA 1FX0B 1N6IA 5B7QA 3RYFA 5CB0A 5T8KA 3MRTA 3AOEC 2IK8A 1AB5A 3HGMA 3NUZA 4Y2PA 3S1AA 1Q7BA 2NYRA 4UEQA 3QTTA 4L16A 2BR4A 1IK4A 1EVKA 4PYQA 1E2MA 1TKCA 5TY0A 4Q3BA 3EGIA 3QLVA 3AHGA 2DP4E 4BRZA 2FUCA 1TL7C 3WDLA 4ZJPA 5AM0A 1QB8A 3KDAA 5E3IA 2C31A 1Q19A 2IHUA 2W22A 3WGUA 3RBZA 5H83A 1K5HA 3R09A 4UEOA 1YS4A 3KU1A 1XO1A 5KJEA 5E2IA 1CPYA 4RF4A 3GLTA 2IHJA 4GEKA 4MUXA 1NJ1A 2XBLA 4B46A 1HDIA 4QEKA 1NR1A 3K30A 3A9TA 1G4HA 2WINI 3M1IA 2AR7A 3Q1LA 2CSUA 2Q9CA 3ZWNA 4MWBA 2BH2A 4UM9D 3WLNA 3ICWA 3VR6H 4Y6QA 2XLBA 3UJBA 3COWA 1MNAA 4W6QA 3FMOB 4C06A 1P39A 1A1VA 1I4OA 1YL5A 4NFYA 5AW1A 1M3SA 1RQPA 2R4TA 2Y4OA 2AZ4A 4FONA 1ISGA 2NVWA 4JLVA 4J03A 5KB3A 3NASA 4H6VA 2CJXA 5B4UA 1C3OB 3K0FB 1Y1TA 2PA0A 4IRUB 1RAHA 1U0TA 4RA6B 4TWBA 5AP9A 3F5DA 1T1IA 3HCAA 5DVZA 3F6EX 4OHYA 3P27A 1DC8A 3NUGA 3L82B 4Q4HA 4MWEA 4TWRA 1E9FA 1VKOA 2C83A 3NX4A 4PWZA 4LXIA 4C4TA 2O8DB 4ED9A 3GPDG 3ZXYA 4C4AA 4WLFA 4FT2A 5B6IA 5H5JA 1GZ3A 1II8A 3RUAA 2X40A 3WK4A 4G1EB 4W9NA 3KQUA 5IUNC 2R66A 4JBHA 2JW5A 3OOWA 3L7AA 2VK1A 3EXIA 5LDGA 4ZCQA 3RBAA 3B2NA 1PE0A 4DQKA 2E1PA 2Q9UA 1Y6JA 3KKNA 3BSSA 1DIAA 3ELWA 3C8DA 4FFDA 4LWQA 3PNMA 1JHQA 3FPSA 1KJ8A 4I2VA 2R5NA 4CM5A 1FVFA 4DCOA 1AGNA 2GBCA 5HS6A 4D8VA 4Z1MA 2QTNA 3MGGA 4HLUC 5EJ9A 3UWDA 1MX5A 2ZUCA 3AR7A 1XAGA 3DZJA 1EUCA 1U9IC 1ZSYA 1H4SA 2Z8XA 1BRMA 1XRSB 5B2FA 3U3MA 1U02A 2YV4A 1QQTA 2DULA 2NWQA 3AOEA 4INAA 1QV9A 3COPA 4WY2A 4EB0A 4BGEA 2DYKA 5IH7A 3QWAA 3IFSA 2I4NA 4OQLA 2E2WA 2ILVA 2P5YA 4KDFA 1J07A 1AQIA 4YP9A 4ABYA 3IUYA 4IP0A 2ZI3A 3O0DA 1K5GA 4I4TF 3ZWOA 1PCXA 4AQYB 1JHZA 4GL2A 4IG9A 1LB1B 3AHEA 3REGA 1J4AA 4D0GA 2J5KA 5C32A 4QGBA 2QD2A 4EF6A 3TQFA 3QELA 3GJQA 2OV8A 3FN4A 1P75A 3MZ0A 1ZSVA 4JT9A 2WRZA 3LY8A 1FUEA 1C7RA 3PXGA 5K8CA 1N1GA 1EWTA 1P4JA 4RVSA 4UREA 4X44A 3OM8A 2PGLA 1M8JA 3M6AA 4BO7A 1TOAA 5CVEA 5A4MS 3C8UA 5GP1A 3MHPA 4X41A 3Q1KA 1YIOA 4NFLA 3D6UA 4MGKR 1PJQA 3HR7A 1O94C 1WHTB 2P4HX 4V39A 3UVEA 7AT1A 4IZHA 1KYVA 3IQFA 4J75A 5EHQA 4EEZA 5JSFA 3TFOA 4CCAA 3F3KA 5B1IA 1ZMOA 4DKXA 1SCAA 1EZ4A 3A27A 1K3UB 4OA5A 2IVFA 3JQBC 4MPRA 1CCWA 3CLUD 3ONWA 4U2DA 3OG9A 2CEKA 2NO1A 1ADJA 4NI5A 1SD1A 1F6DA 2UZIR 3V1UA 2Y0PA 4O4LA 1GVHA 5K0GA 2ZAGA 2QZPA 5JYBA 1VCNA 3VR5H 1PVDA 3KG2A 3H6GA 3DTYA 4F60A 1ZRHA 4OHXA 2QX7A 4AULA 4WUVA 2N47A 3SI7A 2F9FA 1YWGO 2E82A 2OCKA 1XWWA 2V4UA 2GERA 4O1MA 4ZAGA 5B58T 1Q7CA 5ENVA 1WCWA 2F3UA 1N32B 2P1DA 2JI9A 2B82A 1GQYA 3FFTA 1FRQA 4DOMA 2AMYA 1XAHA 3N5CA 1DAMA 2QW8A 1CUJA 1YE3A 3IBCA 1WMFA 4YRQA 5JXHA 3LOPA 1KZHA 3T5GA 4YAGA 5LZ8A 3JQGB 1XALA 2ZRDA 2H92A 1VKJA 3C6MA 4I9UA 3GJ7A 4M1TA 1FSGA 3IRVA 2BEWB 4Q3CA 3UUFA 3VR4H 2PU7A 2WY2D 3V4SA 1ZD8A 4EKYA 3MM4A 4DEYA 2FU5C 4ZTZB 4HLUA 3PKZA 1T5BA 1PU2A 2A1UA 2ZRHA 3ZKWA 2X4DA 1R8XA 3MXTA 1S02A 4QOJA 4AKSA 1I0IA 1U9IA 1DG3A 4U0KA 3GY0A 2VVTA 3NIBA 4FD2A 3CYFA 3W5SA 1MJGA 1KSHA 1CJCA 3O6VA 4L8FA 2GWRA 4IINA 4WX2B 3ZQ4A 3BCRA 2GEVA 1B74A 2I87A 1TB4A 3I32A 3GL9A 2IITA 2ZIFA 3U4CA 1J99A 2FE1A 4PVDA 2YVAA 4B6GA 2ZR9A 2ZUEA 2NTYC 3H99A 2H11A 3F8SA 4H7EA 2I65A 1USKA 1XTZA 2E37A 3C3BA 4II2A 4ND4A 4E94A 1ETUA 3QH4A 1ZAYA 4HQKA 1SG0A 3UV6A 2ZCUA 3M4NA 2TMKA 2O2IA 4Q15A 1XVIA 3TUIC 4ZODA 3K09A 2QVLA 2YQ5A 3EXG2 1NE2A 4ZIRA 2Q07A 4ISBA 3M89A 3NHSA 5DNVA 3SSOA 1PJCA 4RVNA 5FBLB 3R5TA 4GBJA 1FTGA 3ASZA 3RU2A 1VPEA 1O94A 5CLJA 4R0VA 4U6SA 5FOSA 2J9FB 2B98A 3WHKA 1F0PA 4F72A 3LWBA 3OJCA 1WUJS 1REQB 1TIBA 3OP4A 4YDRA 2QX4A 1U9ZA 2JGIA 1MT3A 1NVVR 4FPXA 4JN6B 1M8FA 1JSRA 2XXBA 4JOBA 3D4NA 3OMLA 4JL8A 4U2CA 4N40A 1H2EA 1Y1PA 2WP0A 1OW3B 3CR7A 3JQBA 3LX6A 1OX5A 4D8YA 2EV9A 2B1QA 2AW5A 4DV5B 4N76A 5IVKA 1XF1A 2XHZA 5FV7A 2YR0A 2J5QA 4MAMA 1GO2A 4ZCSA 3LD9A 3NCHA 4DABA 4CQMD 4GOJA 2PX8A 1H6AA 1C14A 3DHVA 3ND6A 3V42A 2H7CA 2I80A 3DCNA 2FPGB 5F35A 5JEDA 3QX3A 3THWB 1LU9A 1UP6A 3F98A 1RACA 4OOFA 4UTOA 4D81A 5ETJA 4DS3A 5I7HA 2WFLB 1AO3A 2QA5A 2BTOA 4RMNA 5BUCA 2UYHA 4HMOA 5IASA 1COWD 5DP1A 3EH2A 3AY7A 4R8MA 3LO8A 3LDHA 4BE7B 4US0R 1R74A 2FDRA 4M54A 3HXOA 2G67A 3B1XA 1PZFA 3BK7A 5EJIA 3U7HB 2IXEA 1BD4A 4FHFA 4R1MA 5INTA 3H97A 1ZW1A 1DKRA 1PGQA 2J3HA 3EWNA 2PX6A 1PT9A 3NLLA 3R0QA 1UEIA 1U1DA 4UUMA 4CG3A 3OOSA 4P7FA 1VDMA 2ZDGA 4J29A 5F3DA 3STYA 2JLQA 4O08A 4MA0A 1CJUC 1BKDR 1TU0A 1IAVA 5C4MA 1L8LA 4NC9A 2YZGA 3UBTA 2W42A 3DULA 3OT4A 5IDVA 3PE6A 2M6RA 2ZWOA 2C20A 2GKSA 2VHZA 3L7CA 4HVTA 4RAQA 5IVIA 5B30A 2HMAA 1Y3DE 3MMPA 1CLEA 1ZDMA 3ECAA 3R6DA 3NJ4A 4HDOB 4IQ8A 4N5NA 3LRTA 1VYVA 3GVIA 3H3FA 3IKMB 3I5YA 1T5SA 1OX6A 1V9SA 1N5OX 4XM1A 2IF2A 2JI4A 1TZBA 3GJ6A 3WBJA 4A82A 4YHHB 2YWJA 4RE5A 1ZHHA 2ATVA 3K9NA 4TYMA 2PK3A 1JLMA 2VHUA 1RVV1 4JUDX 1QHIA 4Y2QA 3ZZMA 1FBNA 4CLHA 4ENPA 1QYIA 2EXXA 3D6VA 4RZHA 2RD2A 4RAOA 3W7AA 1FU4A 2IZOA 1HQKA 2RKWA 3O4HA 5HF6A 3ROTA 1YHZA 2ECFA 2FFJA 4FMDF 3P9QA 3WK8A 4WXYB 2YVQA 1NRJB 3WFZA 1B2RA 1ZI8A 3N2NA 2V4ZA 3AP1A 5EIFA 1J49A 4Y2XA 2EATA 1R50A 1UBFA 1PF7E 2VCYA 1IZYA 3N2GA 4NYJR 1NMQA 3K6RA 4TXLA 2WYVA 4YGXB 5H68A 1SFRA 3KJEA 4LE0A 3DKVA 2Q1UA 1PJ2A 2CDNA 4G4SO 3RSCA 2EWWA 2GBPA 1GAEO 4U3JB 2EBHX 4GYYA 4M8LA 4EUKA 4PLPA 5M5BA 2GD0A 4IAOA 1QGOA 4GUAA 4BXOB 1E1LA 3HP4A 2NUPB 4FR5A 5IVPA 1E0DA 1ZIDA 1U2GC 4FEAA 2CHFA 1YVEI 1UK8A 2WVGA 3H2HA 4PLCA 1RZVA 3U4IA 3CXRA 1M7HA 3JPYA 2AK3A 3NOOA 1U1GA 2GEKA 2BMAA 2XAUA 1SVUA 3A3KA 2WDZA 3LT0A 4PICA 4FGWA 4W8GA 3OICA 4V0RA 4KHPB 3SHTA 4LE1A 2N1MA 2B78A 2Y66A 1Z2AA 2XKAA 2C2XA 3VAAA 4FEGA 4I50A 4JC0A 3O91A 2C2MA 2XQKA 4O4LF 2AN1A 4PC2A 1OREA 3V9AA 3W8DA 1CQPA 2YYSA 3VHQA 3BE6A 1CT9A 1DARA 3QX7A 2B37A 1X7HA 1AS2A 4RJJA 3KJIA 4CLOB 3NOVA 4R51A 1QJCA 1A2OA 3U16A 2YV3A 5DP2A 5D01A 3IS3A 2IHVA 4U7PB 4R84A 5JWOA 3NBFA 3L6CA 4K40A 1G8AA 1XRJA 3LBHA 4MWGA 3DBRA 1FSPA 3NKLA 2JAWA 1YE5A 5H4GA 1Q7GA 3HGTA 1OCEA 1LQ2A 5F77A 4NLLA 5FBVB 2D5BA 1FDVA 2P7IA 4FWTA 4LX8A 4FYVA 4AZ3A 4WDRA 4D0NA 1GL9B 3WVNA 1B1CA 5B55A 1WZNA 2J0UB 2QR2A 1I32A 1QWOA 2C84A 1SQFA 2OAEA 5AI5A 1QAQA 4HXYA 3EGXA 1NSTA 3L0BA 4BTLA 3HYSA 4JVSB 4YCAA 1HT2E 3W79A 2RH9B 3BMNB 3R5HA 1CVIA 3TW4A 3VNBA 1E1RD 1DV2A 2LWIA 3MXOA 4J7AA 1HSZA 2R1TB 5A02A 3VKVA 1J2YA 1U8TA 3R7LA 4DCNA 3GYGA 2CXTA 4QSMA 3L6RA 4DF3A 4NBWA 3OM0A 1NQTA 2E48A 4UQPA 4BFSA 1IN8A 3B2EA 3SJAA 3FGNA 3FY4A 1NVBA 1CDEA 3EHDA 4IW3B 4L5JA 4RDIA 2JGDA 4DV1B 5LA6B 3WGOA 1JIJA 2WJAA 1XF9A 1XTIA 1FY2A 2PU5A 3O3OB 4ZP1A 4RZIA 3EIXA 4JENA 5HFAA 3P5SA 4PYNA 2ZTSA 3PRJA 3PUIA 4B1FA 1V7PC 4LZOA 2GFQA 1CQIB 1IWOA 1RRGA 3RIHA 1GITA 3G8BA 3KPVA 4BC0A 3Q2IA 5BWNA 1QCCA 3P0HA 5J63A 5B36A 1IZ7A 8MHTA 4KO3S 2D2XA 3PPVA 2HMWA 2I3DA 3EUAA 5CM8B 1FCJA 1GG2A 1HDYA 1NY5A 4HAZA 4M53A 1J0CA 1CUHA 2HN9A 4OK5A 4FFNA 1PFVA 4GZ3A 1MBZA 5ITWA 2CLEB 1V3UA 2HREA 4PQYA 3C98A 1X7WA 1V8DA 2XGGA 1RW4A 3PDWA 4F2PA 3UGQA 1Y8CA 2WT8A 4IKOA 4JDUA 2HLDD 4BMZA 1U2GA 1NVWQ 3OCVA 4UVEA 1H42A 2ZSAA 4EGFA 2NAFA 4C7XA 1ZHFA 1H3FA 4M98A 3CG4A 3E9CA 4TUYB 3LMKA 3GDHA 5K6RA 1E7YA 3LFTA 1KBZA 3NDIA 3LCRA 4ICIA 4MJXA 4D6YA 4ZMBA 3G5TA 3B9PA 5AOAA 3PHCA 4ER6A 3R0JA 3SBEA 1BO6A 3CRQA 4UTXA 2VWHA 4URVR 2I3AA 5EIXA 1L7BA 3CE6A 1OBHA 3I39X 1NJSA 2IUSA 1G64A 2B5OA 5IWAB 3ZHUA 4RV5A 5HXAA 3DYBA 3DTVB 1FNDA 3UHJA 4PG8A 4GPBA 2WMYA 2H85A 3K96A 1EGMB 4LSZA 4MQFB 4NONA 3IMEA 4NBUA 2IOHA 3JD0A 4X60A 2NG1A 2X0EA 1Y4AE 5LDDC 4A73A 1WCIA 4XSVA 2ZZNA 2ZRJA 3C3XA 3V34A 1H2FA 1F6WA 3F97A 1UZUA 1X7XB 2XF8A 1LZLA 4D0LB 4TZ6A 1G60A 2A7XA 4K6KA 4A26A 2R8BA 3ZYZA 3TQTA 1JDSA 2ORVA 5KYXA 3QHAA 3BD7A 3EBPA 2PLRA 3D5QA 4KQ6A 4TKVA 3K4HA 5IRCD 3Q3CA 5C51B 3SZ3A 2IEBA 4KYTA 1NR5A 5FPQA 4V38A 3G7SA 5L9AA 2OGWA 3E8MA 4K26A 3WFIA 2C97A 2QIOA 3GA5A 3PTZA 2A5FA 2FF7A 3FDXA 5H0IA 2BGUA 3PWTA 3SJUA 3WX0A 4OGLA 1ONPA 4HXGA 4NS1A 4RVFA 4BMNA 4DCCA 1L4NA 2FOLA 3JVIA 4K9QA 3ZWPA 3PQ4A 2WUVA 3QX9A 2GBLC 1WCXA 2HSEA 4YC7A 2NNWB 1XHFA 1WABA 3QPBA 1OZHA 1H2BA 1HA3A 5PNTA 3R0VA 4CMHA 1GU1A 3OQVA 4OYLA 4W9RA 4EATA 1Q74A 4BWVA 1QF7A 1YCGA 3BMCB 1KO5A 4HNQA 4L27A 4NBRA 1BDHA 4Z7NB 4Y2VA 1V41E 5E4JA 1G41A 5H16A 4YRDA 2IV3A 2HF2A 2R1VA 1QVZA 2H07A 1US8B 3ABZA 2MMCA 4X90A 1Q44A 2UUOA 2Z1MA 1BXKA 2W2TA 3HMQA 3TINA 1OYYA 3O8QA 4FCCA 2ZANA 2AF4C 4LZJA 1XJCA 5ESWA 4TTAA 1QYRA 3IYLW 5CNMA 5T57A 5HM6A 1PEKE 1WXGA 3SEQA 3WO1A 1FSSA 3KQLA 3PCTA 4KLAA 3IO3A 3VKWA 1G7TA 3WJAA 4R1OA 3MB5A 5JROA 3QEBZ 2CCJA 2EX0A 3OQNA 1BOOA 4MB6A 3NH9A 4R2MA 4NX2A 2AJDA 3A4VA 2HTFA 2ZVDA 2XSZD 3CHYA 4GE0A 4JR0A 2M1ZA 1P3JA 4BX2A 2RFLA 2G40A 2V5VA 1TA4A 4YQEA 2WWXA 3A1EA 5FO1A 2ZE6A 1T9CA 3AVXA 3QVJA 1DCTA 4G5RA 4PV7A 3TGPA 4OXYA 1E3TA 4JI5B 1JRLA 3SHQA 3RS9A 1W0KA 2FN8A 3JQAD 4L95C 4B7CA 4D0RA 3DEIA 5IT5A 1UINA 3M6FA 1YQUA 3REFA 3EFEA 5EJ4A 2OC9A 3VM6A 4QBGB 4MIYA 4KQFA 2V0CA 4BU0A 2QUHA 1DCMA 2G82A 1NKSA 3TOZA 3RS7A 1HNXB 4LOKA 2IEIA 2GLUA 1O9BA 3VFDA 4OP3A 4GI1A 2QLMA 1TDJA 3HVHA 4FU0A 1XB2A 5BW6B 3WTCA 1JLKA 1OFUX 3F3YA 4YJ3A 2H4HA 4UXIA 2W0MA 2ZRPA 3DAFA 2QRQA 3M6VA 2NUAA 5F9HA 3QFSA 3ONNA 3V4RA 3DXFA 2WSIA 3U4QA 4FT4A 1YB6A 1VJGA 1NX9A 2JD0A 3B82A 2IUEA 2OBBA 4PCUA 5CB6A 3O0TA 4YRTA 2JI7A 4UPEA 3DBLB 4BLVA 5F76A 2Z4RA 4PCLA 5FIUA 4B9EA 1YTLA 4CM6A 3V5NA 4HGNA 4EVQA 3A9WA 4V0OA 3S68A 4E5NA 2ZYVX 2GBLA 2COEA 2IFTA 4R5MA 5CJ2A 4EG0A 1R6UA 2VYNA 4WZ6A 1Z4LA 3X2SA 5CBPA 2D1SA 1DIRA 4YJFA 3U3XA 4RJTA 4N82A 4IF6A 1QFZA 2X5KO 2VCHA 5JG7A 4MLZA 3UH1A 1V96A 3M1YA 4PLYA 1VSBA 2UUAB 2DFPA 2EP7A 5BSKA 4IEEA 1LBIA 3CV3A 1KOLA 4RUKA 2WJGA 2WD7B 1MJHA 1KYQA 4YP1A 4M88A 1PNTA 3B6IA 1L5RA 3V3KA 3VGPA 4P36A 1IM8A 1B3RA 3CF4G 5EAIA 1PWHA 4U9HS 5TPZD 1XTBA 3V80A 2IS6A 3PA8A 1I24A 5DW0A 4DDTA 3MCAA 1QZ3A 4J2TA 1GZ7A 3RG2A 2VAPA 2Q1YA 3JYHA 1H2XA 1QHXA 5CJJA 2HT1A 1BYIA 1M2GA 3K5IA 2BE7A 3OPYA 5BYBA 2ADMA 1ZA2A 4KU4A 3GH3A 3P0EA 1Z0IA 1DMSA 3EJ6A 1T43A 1X0XA 1NSFA 2DHRA 1SO8A 1DWPA 1XHEA 2XW6A 2QQFA 4D9FA 4F9TA 4X45A 5A4KA 1YZNA 4MRPA 4MUFA 5BQ5A 1A72A 2BM0A 1CRQA 2Q0HA 5ITSA 4ZO4A 2ACKA 3VSBA 3V8VA 4CKCA 4KR3A 1AC5A 4RACA 1W36C 2J6BA 4QU0A 3TLEA 3F4KA 3JR3A 5ALVA 2VDWB 4BX3A 1PNOA 2Q3BA 3CF4A 1XTSA 4ZCLA 4PC6A 4G5OA 4URZR 1XEFA 4ENQA 3TF5A 1WM1A 1C8KA 3U40A 5A5DA 4BNJA 2OM2A 3LDAA 1Z83A 4MDFA 2H18A 5CVCA 4DMUB 3SBXA 1FU8A 3DO8A 1LRLA 3F5MA 3O4VA 4BGIA 3K6SB 3IAXA 4CKXA 4I1IA 2FN7A 1W5BA 2C99A 3ILHA 2RHRA 2OKGA 4L15A 5H82A 3RVRA 3I73A 3PUHA 1PFQA 5FOWA 4A8PA 2BJHA 5IJ0A 3OJFA 1YVDA 1LV8A 16PKA 1JG3A 1UIRA 3DMTA 5IXYA 1FTWA 3AL2A 2WVAA 3TH5A 3D31A 5C5CA 4EYEA 4PSCA 1BCRA 3NAZA 3LY7A 2HJGA 5JD4A 1KH3A 1U2EA 1LSUA 3BF7A 4Q9NA 2AC2A 5TMDA 1H93A 1MQ8B 2J8ZA 1U7HA 1H22A 5KNDA 2Y1EA 1WCV1 3OJWA 4DJEC 4ZCPA 2YIMA 2Z9BA 5CFRA 2EW2A 3OCUA 4BQNA 4X84A 3H2KA 2QUBA 3OTIA 1WMBA 4KC0A 4DA0A 1Q0LA 2BZ0A 1S0UA 2ZTVA 4XUDA 3P9ZA 1JDZA 4JVOA 4L57A 2QVXX 5EQFA 1V8OA 3T7AA 2HRCA 1Y6GA 5FHRA 1Q15A 3NPAA 1OTYA 2A9QA 1Z5GA 1TPZA 1JEYB 2AXPA 3QXCA 4BEWA 4R4JA 3CEMA 4XI9A 4EMUA 1P2GA 3ZG6A 4CBVA 4F9FA 4JXJA 4MB0A 1U5BB 5EMJA 4PGGA 1VBFA 2JIZD 3E58A 1ZJWA 3IOYA 1ZVJA 2XZLA 3GEHA 3VZPA 4AY4A 2WM8A 2HU5A 1XE3A 4UAGA 9ATCA 2O0JA 3TLYA 2FZKA 2L19A 3IP6A 2FEKA 1FXWA 4OHRA 3DR5A 2C58A 1CP3A 2IZZA 1ZNZA 1FVOA 3K8ZA 1UBHS 5C81A 4N3BA 3ESAA 2WNSA 4C0SA 1W4AA 4JBNA 5IZ4A 2FG6C 3QSYA 2WTEA 1UWCA 2JFOA 4BO5A 2Q9BA 3IVMA 3AESA 3QUSA 4AWBA 8ABPA 2IY7A 2OCPA 2DB3A 4TTPA 1JJBA 1GL3A 2FMFA 5DLDA 4MAFA 1OBOA 3H5NA 1VMKA 2C9ZA 2QE7A 3A70A 2NN3C 2GJSA 3OZGA 4C6SA 4EL0A 2IE8A 1GIAA 3MRVA 5BYJA 4PNEA 1D0SA 4HDCA 1I1OA 5JNWA 1K5DA 1SZJG 3I4CA 1L5QA 4B43A 4ITUA 3V4LA 1JIUA 3COYA 7REQA 5K2OA 2GA8A 4YJHB 3WGHA 5DTMA 4A0HA 4TYYA 2OCXA 1YA6A 2GAFA 2V7VA 1E3MA 1NP7A 3T9FA 2X7XA 1NF9A 1JFFA 3FOBA 3QV1A 2HNAA 2MTBA 3BQNB 1XD2B 4BMSA 4KOAA 4QDTA 2ODTX 2WEKA 1G7SA 3ILSA 5CAEB 4HLDA 3KBBA 4OKIA 4BHTA 1FTYA 1EAMA 4YMUA 2C98A 3M5WA 3ZIAD 1YS9A 5ALNA 4YMVA 2TYSB 3Q88A 2ZAOA 3ZYCA 1YUNA 2FZVA 4XVQA 2F1HA 4UU7A 1B93A 4RDHA 4TROA 4FYIA 4L74A 2FR1A 3ZU3A 1PR6A 2HHCA 2J9YB 3A9UA 4X8OA 3WLAA 5KQMA 3H2YA 1H0RA 1Z12A 1ZZGA 3E9MA 4Q3DA 3G17A 4YUYA 3IHKA 1X87A 1OWOA 2NP7A 4KQWA 1PR9A 4G37A 4GC5A 5CX1B 2R6CA 5JNRA 4UBNA 1QS0A 1A7UA 2AOTA 4K6CA 2CLOB 3EHEA 1NVDA 2W2MA 3VAZA 8GPBA 4CQNA 3GJYA 1WD7A 4PHFA 3PD0A 2G5GX 2GXQA 2HPZA 4GI7A 1NW6A 4YCLA 2AT1A 3F47A 2A5YB 4RETA 4MKFA 3T0FA 4YCMA 3I5UA 1E9CA 3SZUA 4IHJB 4IXNA 1HXHA 1YR2A 4QJBA 4YJ3F 3NVDA 1R6DA 5FP0A 4KR6A 5DMXA 4J0JA 1PS8A 2SCUA 5BQOA 5TJHA 3RSHA 3VH1A 1FQWA 5B6PA 1MIOA 4IH1A 3A6KA 1CW2B 2Z43A 3FX2A 4LBYA 4TTQA 5AKYA 1G5FA 3GGPA 4OQEA 5AYVA 1VTKA 2G80A 2IZ7A 5JCOC 3L8EA 5C3UA 3ICEA 3I3SR 5CVJA 5GV8A 4HFMA 4I66A 3OTGA 4GLOA 4EHAA 1V16B 2H5JA 3CSDA 4Q01A 3RTAA 3PC2A 3PE4A 4Y1GA 1OAKA 4KN5A 2DR2A 4O1HA 5KSPA 5I7WA 3QVWA 1JB9A 2CXUA 1KARA 2NGRA 3M3DA 3T7IA 1D3AA 5GVRA 4KWTA 2I4IA 1UJCA 1I7DA 3A2KA 4PNZA 1ZKMA 5LZ5A 4C4RA 3AFHA 3DYVA 2H1FA 5B2EA 3A2LA 4P34A 1D5CA 2FP4A 3LAWA 4DB4A 1ISSA 3CN7A 3FPKA 3UB4A 2H7VA 3C7CB 3RVQA 5C1OA 3KSBC 2OUIA 2VF4X 3QP9A 3ELBA 4HGZA 4RK5A 4XA8A 4YN3A 5D5PA 1UFRA 4LYJA 2G9QA 4O2AF 1I3OA 1X3SA 5L3VA 1W4BA 1FL9A 4HAVA 2ZKLA 1V6SA 3WMRA 3B12A 3LZ6A 5K8VA 2K4MA 4R83A 4EA9A 1B15A 3CR3C 3QRWA 1V4BA 1ZU4A 3CJRA 4IJ5A 4ZT3A 1EG7A 3SOZA 1NI3A 4ZXFA 5I7VA 2Y93A 5JPDA 1W4ZA 4KR0A 3U6KA 1A5BB 3AU8A 2B69A 4P4SA 5K3FA 3EIWA 4ZKEA 4N47A 1W96A 4CIAA 1HNNA 3VZDA 4IOKA 4UHHA 4UEJA 2OE2A 4MOWA 4NBTA 3GFRA 1GGJA 1EEHA 1DEAA 1J56A 2GK6A 1I7PA 4ALMA 1VIMA 3MTDA 1YZQA 3AUTA 3EXFB 4TMTA 3W4IA 3H8VA 3NT4A 4RMIA 4M6WB 2WWTA 5D3QA 5ELLA 3IPYA 4OHFA 3ICOA 1EP2B 1QYCA 4DUGA 1U81A 4Z4HA 3NWPA 5CGQB 5G4KB 3ETJA 4M9RA 3OQIB 5F5XA 1JX6A 2WYIA 2NZXA 1VGRA 3QOXA 1J22A 2GESA 4QHYA 1T26A 1AE1A 3AX6A 4TLBA 3RI3A 2EFHB 3TRJA 4GEGA 2HRRA 1WIWA 2B5WA 1GCOA 1PUJA 2QN7A 1NMZA 3GELA 1E62A 2ZSBA 3IQGX 4EFDA 2BI8A 1SOAA 1EP9A 2XA1A 3P0IA 1O08A 4X85A 3WQRA 3M6IA 3P9IA 3LIPA 2ZM6B 5F9FA 3FYTA 1IJFA 2FGJA 4CM3A 4YUWA 3TD2A 1JKIA 1V9CA 1V71A 1TJPB 1NNLA 1L9XA 4H7JA 1A27A 1OGIA 3DE0X 4NFSA 5BQ3A 2I3ZA 3TBHA 3ETDA 2W6JD 3T9CA 3TLXA 4S2UA 1HDZA 1A9YA 1M34E 3O9VA 5AW6A 1BS1A 3T95A 2NSYA 4RD1A 2EERA 4CIWA 2CV2A 1GNTA 3PFIA 3K16A 5IKOA 4H1WA 3UOAB 1PFKA 4IX1A 3HXKA 3IR5A 5JCOA 4ARVA 4E5VA 5D3ZA 1WV1A 2HDHA 3OU7A 4H27A 3ZK7A 4D4IA 2QY6A 4Y6GB 5L51A 2VDNB 2AJCA 5DM0A 3N0RA 3IEMA 4J3JA 5DGIA 1EXDA 3D81A 3N8GA 3NXSA 4JKOA 2XUFA 4LQDA 4U00A 5I4CA 2IH5A 1S4QA 2A35A 1C3OA 1N2IA 2BHNA 1U31A 2ZK7A 2ZUUA 3AHHA 3BXZA 4GRDA 4MGIR 5SY9A 4RA6A 2DX7A 3RODA 4ZD6A 1KEKA 3S8EA 5J4LA 3VPAA 3BXFA 1VDZA 1VFPA 2AE1A 3VH4A 4DE5A 3WMGA 4F38A 1Z38A 2VAWA 4BFYA 2AZDA 2OGUA 1U99A 3EQ7A 3T15A 3E7WA 4DJJA 4LHSA 5TNXA 2O8DA 4RIFA 2WVHA 4Y0AA 4TMFA 1JSZA 3C3MA 3KO8A 4R1QA 3S29A 3T7JA 4WN9A 2HB6A 1N7GA 3IH5A 4LJ4A 4OFBA 3UJDA 5AXBA 2QX9A 4EMSA 1EVQA 2HA6A 1RHUA 1CVRA 1SK9A 2IUUA 3A6FA 2FW9A 2LKCA 1YRYE 1FXWF 3ORQA 4MVJE 4PPFA 4JVMA 4LWOA 5CMLA 2AKEA 3GT4A 3WLOA 5DBFA 5J4VA 4F3KA 5EFZA 3FLAA 3UJHA 5IF3A 1SCIA 3HU5A 3PC7A 4E09A 3WLSA 5DTIA 4B45A 3HDHA 1W75A 3DKPA 3EWAA 1KQNA 3I8OA 1DQYA 3KB2A 3ZV4A 3D7MA 3TR5A 1SG6A 1XDSA 1IEWA 5G0SA 3KJZA 1DAFA 1G3UA 3I53A 4BMXA 1L8OA 5BVGB 4DMFA 1HYEA 5KTTA 1QMPA 4JAVC 1PK7A 1V4NA 3IAS1 2XA2A 3R0IA 2DUUA 1WMSA 5HRAA 3C1AA 3ULKA 3ZQKA 5PGMA 4HQNA 5JY6A 1FUKA 3UWKA 1U1IA 1WW8A 4HNUA 4QOHA 1KDPA 3Q6IA 2PHZA 2R1ZA 3FDJA 3L4EA 2XJ4A 2H8GA 4INJA 3HNPA 1UMKA 2VUTA 3GA7A 4KB5A 1NZDA 1PK9A 2COUA 4RANA 4YR9A 3DDNA 3FGOA 4HDQB 4HNHA 3WRWA 1Q2XA 4IO0A 1LBEA 1DWUA 3AB3A 1NJFA 2YXLA 5JAMA 3LPLA 3VC2A 1KY2A 4G89A 4ZK2A 3WYFA 3U0BA 2CYAA 3SKYA 1CUIA 1I3MA 3UGJA 2J0SA 1T9HA 4I1PA 1K0UA 1ZVMA 3S4YA 1UPTA 4XWGA 5IAJA 4MUJA 3C8ZA 4W4TA 2JDIA 2AQIA 3OHMA 1UP4A 4ZT5A 1OGYA 1IBMB 5IPFA 2VDMB 3DC2A 1KBOA 1WHTA 2JLCA 3LA8A 4CQJA 1M76A 2B9VA 4GLLA 3AFNA 3ISJA 3ZE6A 4EY5A 3EE6A 2AXEA 2F62A 4MLCA 5JS1A 5IJAA 1G6OA 5F5LA 3CVYA 5SZJA 2XTJA 5KSWB 2W4MA 1VC2A 4IDCA 1K4MA 1V48A 4PS1A 2IS1A 3Q7IA 2Q5QA 4BNTA 2NMVA 3HXTA 5IDYA 3ANLA 3M49A 1VL2A 3UK6A 4CE6A 2IYNA 1GZ6A 1HDEA 4YRJA 3JQDA 4HD8A 4KZPA 1Z33A 4OGFA 4Y0VA 4ER3A 1ODTC 3URKA 1X1RA 1WHSB 1N6NA 5GM2A 2DQ4A 3HGQA 1FXSA 1QK4A 4L08A 2V55B 1CB7A 1J0AA 2XODA 4HDMA 3VISA 4F21A 5B7NA 3ZDEA 2AFIB 2ZITA 3GBVA 1PG5A 5JRZA 4EAAA 3V55A 2AEFA 4Y9UA 3F5QA 3PDUA 2B8NA 3L7DA 1MH1A 4RCZA 5DNDA 4JIMA 1S8NA 5F7XA 4IJKA 1HLFA 3JQGA 3TECE 1BJRE 1GPYA 1SVWA 1AK9A 1VLJA 2E4ZA 1UDBA 1ZM3A 3K72B 1R15A 4QJIA 1E6CA 3LQ4A 1QZUA 1JH8A 4M0LA 3GN2A 5SZIA 2OYCA 2BEWA 3KCQA 4TTRA 3UKOA 4ER0A 1W5SA 1I14A 2DPLA 2RIPA 5HBRA 2DHQA 1JU9A 4DJFC 2QJWA 2V6BA 2BM1A 4IV5A 4GSKA 1EGAA 4C0BA 1CB0A 2BL4A 4AO7A 5DTJA 2W71A 3S44A 3DKIA 3G13A 5A2QA 4OCZA 5JBQA 5F12A 1GPBA 3P9YA 3PWZA 1SXIA 4IIJA 1XMVA 3C39A 5EINA 4R9UC 4N01A 1SKUA 2R8OA 4OIMA 4INPA 3X1XA 4F85A 4P3NA 3EDOA 3B5JA 4B5LA 4WJLA 3RKRA 3SC4A 5I9IA 1YBVA 3NATA 4ERXA 2ZSDA 5CVTA 2QL6A 2V8OA 3MWYW 1SQ0A 3HB5X 3ROZA 2QRUA 3QFHA 1RC1A 2RAVA 3V48A 3BH0A 2AQ8A 1LK0A 1DUSA 1XJQA 3BJRA 1GRNA 5DHUA 4H4EA 4AXXA 4CFZA 2ZUDA 1DP4A 3EEBA 2H29A 3PSAA 4B40A 1P5FA 1G21E 4UEKA 1DDOA 1S2DA 2Y1CA 1X9HA 1Y8RA 4ZHQB 4HNGA 5JS6A 1MC5A 1NMXA 2HJWA 2PFSA 2XMQA 1I33A 1NUHA 4IWNA 3L79A 4K28A 5KDDA 1RPTA 4KO8A 1IXYA 3A9SA 4QGHA 1N6KA 3FLMA 2L2QA 5CFZA 3RV4A 2C9YA 4G25A 1FFHA 3ZC3A 2X4GA 3NBYC 4K46A 2JRCA 6REQA 3VYVA 4CZ2A 1TD9A 4NZOA 3QVOA 3U7EB 4JIGA 6ADHA 1KVQA 1QO0D 2AFIE 2J9FA 4FINA 4RPCA 2C00A 2QQ0A 1K66A 3IXQA 4FCWA 1GUYA 2HI0A 1DXQA 3A04A 4KXXA 4O3MA 1REQA 2CHQA 1Z74A 3NHJA 3VO8A 1YRHA 1FNNA 3IP7A 4GAEA 5IN5A 4U2GA 1MB4A 3EZ7A 3FWZA 3ROQA 4QYWA 3W7VA 4DXHA 3H11B 3Q3VA 3R5KA 4QUJA 1W46A 3MHTA 2HPVA 3RROA 3DMYA 3MTQA 5AIBA 1FVXA 4G0NA 3A3YA 3TLAA 4D02A 5LQNA 5BQFA 3ZDBA 4LW8A 4QGFA 2AJ8A 4G2TA 4J91A 2OHJA 1SVLA 2RSLA 4KO2S 4CQLB 5KQRA 1JYFA 1U7WA 1RC0A 4ZO6A 3GRKA 3OZ7A 1MQSA 1RBQA 3K4PA 3UK0A 2FPGA 2ONCA 4E4RA 3FVQA 3WV5A 4KNVA 4N3NA 5JSZB 1R5JA 5I8ZA 5KJ6A 1XK7A 4E33A 1CUDA 1GCGA 4IUBS 5I8WA 4Q1CA 2Y71A 2QMUA 1JAZA 4TM7A 1ULZA 1I8TA 2XTZA 3C3YA 3U80A 5HJEA 2YCBA 3UPUA 1LFDB 4XCQA 3P2IA 5IJ9B 4KMRA 3P5BA 2EGUA 1UZLA 1HLPA 1ULHA 4J2HA 3QVSA 2P9HA 5EUMA 1J33A 4S04A 3HABA 1Y42X 1RXWA 4KVGA 1DOZA 2IKSA 2BHSA 3D64A 3G5UA 4OFWA 3A28A 4XM0A 4YLYA 3HNOA 1RM3A 3L0ZA 3L6DA 4YB8A 3IJEB 4Q00A 2X15A 2MSCB 4CT0A 4EPTA 4NZPA 2O2JA 1PD1A 1Z6AA 2FGKA 2BHLA 4NNJA 1GKIA 1P33A 4MV3A 1XCMA 3R3YA 3LS2A 3FETA 4L76A 4UUAA 4AJNA 3D4BA 4YDHB 2OAGA 3VDXA 4KDCA 1SUIA 4KN9S 2NXNA 1GOTA 4OGWA 3UEOA 5BSVA 5HZGA 1KETA 3I76A 2GHQA 4Q1VA 4ZU1X 4PXYA 1IBSA 4B7XA 4AYWA 2YW2A 2NSLA 1BHJA 2V9CA 3FFXA 4XOUA 2OENG 5G0VA 2GFIA 1OY1A 2VBCA 4L6AA 3SWWA 1RCUA 2IGTA 3GPBA 1HFWA 4TVBA 1L4UA 4PG6A 3ASVA 2VF8A 1A5AB 1IK6A 3EW9A 2J3LA 3STXA 4BO3A 3ABQB 3AKZA 3OX2A 1HE5A 3O1HB 3KIPA 3DWIA 1XLUA 4IF4A 4WERA 4AFNA 5K0JA 5KS2A 1UOEA 4KV7A 3T3EA 3GFBA 1W0JA 1HTBA 3HBLA 2FPWA 1E92A 4ZVOA 1SG9A 1JE0A 6GPBA 1DTWB 3RJ5A 1QH1A 3QOYA 1KO4A 4B31A 3DGFC 1XNQB 2HNKA 1OFUA 3QUAA 5CBKA 3RTGA 1IXRC 2XQVA 3TRHA 2Q99A 4F12A 4GMKA 2D1RA 5CB4B 4Q9KA 4DT1A 4EJ2A 1UCFA 3EFOA 3T3OA 3I09A 5LU8A 5CIYA 4JP8A 1W48A 5EIHA 4YRAA 3H2JA 2W6ZA 4BXOA 2GF2A 2NUPA 4P4LA 3BCHA 3KXPA 1V7CA 2JD1A 5EQTA 4DKJA 3DLIA 3UCEA 2XBUA 4ADSG 1CF2O 2Q3HA 3A2NA 4JNKA 2GCPA 1J5PA 1D8AA 1IHDA 1SUAA 1Z07A 2O50A 3FPGA 3QLUC 4OF4A 4D9NA 2I03A 3VJLA 4O6VA 5AI0A 4JA2A 2RHLA 4NK5A 2YV2A 1OF1A 2C4UA 2WSMA 1QZZA 3MJHA 3NBXX 3WGJA 3B1WA 4Z54A 4M1MA 1P2DA 3VR3D 4CLRA 1CBUA 5K0LA 3SR0A 3SVZA 4C6TA 1R6AA 1FRZA 4RULA 3LECA 1ZJZA 1PSWA 2AKYA 1EFRA 3DTNA 4H1HA 4DNXA 3VPGA 3SQXA 3U3KA 4OX9Y 3NKFA 1EK2A 3BDIA 1EPUA 1VSVA 4EHFA 3W2FA 1AKWA 3GFQA 2AB0A 1K6EA 3U7JA 1DPGA 2O57A 4RHUA 4FZ5A 4TM8A 5EP1A 3WO0A 5JNLA 2G4VA 1ESNA 2SKCA 2J59A 3F6YA 5ADWA 2ZYTX 3BL6A 1CEQA 1EUZA 2V7TA 2YV5A 3NIFB 3NEJA 4FYXA 4BUJA 4DTCA 4MINA 4X92A 5FTWA 2R4QA 3JYLA 3O8DA 4AJ4A 2JGFA 3GJ0A 1THTA 4IIUA 2PT9A 4MS4B 4QEDA 5JY1A 2JATA 2Q1XA 3CA8A 4M0DA 2BTQB 2QJRA 1AY0A 1RJWA 3EIOA 1A7KA 5C0OE 1QHEA 2AN5A 3RRJA 4XIFA 2ATCA 2R1TA 4FIDA 3OZTA 5JI3E 4BQSA 1YFKA 5EUQB 3T52A 2O3TA 4IIJF 1KFKB 1LVHA 4KXWA 3ETHA 3GLKA 2XUJA 3TJZA 5HTKA 4WT7A 2A0WA 1UP7A 1M10A 5EGNA 4JP5A 3JWHA 3PQEA 5LA6A 3GCWA 1Y4ZA 3OPYI 2HSZA 2BKLA 1KYXA 2DFDA 4MW2A 4ONEA 5A03A 1BD3A 1F48A 5JPCA 2PKEA 1RAFA 4MARA 1BFDA 1TZKA 3GWZA 2WPDA 4X8HA 3JD1A 2GAIA 4RZXA 1VMDA 1OLXB 1PN3A 2YXEA 4NV0A 4R6WA 4GP7A 5ALTA 4ARIA 3GJ4A 3MBKA 2PT6A 2ZRCA 3CLVA 1NONA 5F4BA 3AHIA 3E61A 3F74A 4FLFA 4KX3A 5EIAA 4MW9A 1E3WB 4EB8A 5JFGA 1BVRA 1VZ3A 3IPLA 3TQSA 1RMYA 4HH0A 2XCTB 4RGVA 3R6TA 2ECKA 4BLTA 4EAQA 4MR9B 2JLRA 5DXFA 4RCYA 1GNRA 1TMGE 3Q85A 1XNRB 1QHGA 1Z5OA 5IW8A 3UCXA 3L5KA 1OOEA 4M9CA 4HNTA 1Y5LA 3W5IA 2IU6A 3K2IA 4P3OA 1NW3A 1M2HA 4B4UA 4QBFA 3QLUA 3A0RB 4L2IB 1V3QE 3QEKA 4TUYA 4DDUA 1RI4A 4POAA 5ERGB 4YRSA 4Q3AA 5LQKA 3HSYA 1NATA 1G5RA 5L4NA 4LXHA 3TUJC 2RHCA 1DT3A 2H5IA 4UCWA 4OM8A 1KYWA 2BT4A 2EEZA 3F46A 1NUSA 2ZWAA 3KOUA 1TPYA 1EFPB 2DJ5A 2ECQA 3BMXA 1QTRA 2BFPA 3Q6NA 2NXEA 4NK4A 5KHAA 3VOTA 4DLLA 1P1JA 2C3UA 2JI6A 4BLPA 3KDSE 2RBKA 2F00A 2W8BB 3GT3A 4TWJA 4MS3B 3X2FA 4QHTA 3KE9A 1GADO 3GMSA 2APJA 3FLBA 2VSQA 1O77A 3WNBA 1J0DA 1DIHA 1B8VA 2ZBRA 2H9AA 1ZX1A 3EA4A 3MAGA 4RF2A 4YO7A 5DOVA 3U4GA 1XXLA 3OIDA 4P53A 4D9BA 1R4MB 1HPLA 1K86A 3KV3O 3MJSA 1CY6A 3EA0A 3OLXA 4Z7JA 1WKBA 1DJLA 3H7IA 3ELUA 3MMSA 5IARA 5GIOE 4RDCA 3PC6A 4PZAA 3L04A 1QONA 3FNGA 1BGXT 2H52A 4K9LA 4AS2A 2FW8A 4BCBA 5BNWA 3E27A 3VPBA 2A30A 1P19A 3FTPA 1ZMRA 4G0OA 2JGLA 2B9EA 2AFRA 5AM1A 5D6OA 4QYIB 1P9RA 4AKIA 2C54A 3K8QA 3EXHB 2OPHA 3TSCA 1L7QA 2JHFA 3F7NA 2GPBA 1SCQA 3ILXA 3ZWYA 4IMPA 2X8WA 3E15A 4YAKA 3W5DA 4ND1A 3L07A 4IJ6A 5BQPA 3TXXA 3U56A 1DX4A 4AZVA 2ZBFA 1T9DA 3MILA 1SN7A 1GTG1 4FW9A 1I2BA 3E2PA 3SP1A 1QDLB 1GRQA 2VF2A 4RMGA 1X1TA 4FCVA 4NBVA 1TTPB 1E1QA 1ENYA 3WLPA 3IT2A 5K4HA 1ML4A 4QTZA 4DY4A 1URPA 1Q1AA 1EHYA 2WAAA 4LSWA 3RARA 2AZTA 4LGVA 4NWIA 2YWHA 4GP6A 1USIA 4G0UA 4KBGA 1NKVA 3BMCA 1ZMXA 3B60A 2V3WA 3EQ6A 3GQBA 4RW0A 3FHOA 3QUCA 4Z0HO 2GVZC 5HF9A 1QP7A 1EZ1A 3DF7A 4Z1MD 1CSEE 1E0KA 721PA 4ESEA 3U0VA 3BGSA 3AVUA 1N4DA 2AVDA 3N05A 1S6YA 4BQOA 3KR9A 2AWNA 1W1WA 1NTOA 1W88B 5ALXA 2H6EA 3PC4A 1K8RA 4BNDB 1EFVB 1ANKA 1SUWA 1VLZA 2Z98A 2EIHA 1KVSA 5DNUA 4Z6KA 3CIFA 3N8DA 3WIVA 1ZH0A 1JMYA 1X1CA 1NDQA 1JF8A 2WWRA 1JTVA 1ZM4A 2Q0QA 1IPFA 2JBAB 3P0JA 3BVPA 1JBEA 2K87A 4QPJC 1NN3A 3T3GA 3NBKA 4XDGA 3K5WA 2A57A 4HYQA 1Y6RA 3TRFA 1BN7A 4U5QA 4MJ3A 2HUPA 1P7PA 1SU8A 5K4GA 1E58A 1DAPA 1AHHA 1N2CB 3IVXA 3F6CA 5B1SA 1NN1A 2DE0X 3PGKA 4C4ZA 3U7QB 3W5CA 1U6KA 3V2GA 2QTLA 2ZIUB 4YMSA 3KYJB 3WMWA 4CKZA 5J4HA 2VPZA 2DH5A 2VDPB 5A3JA 1ZUD1 5HGXA 4DCTA 1MPXA 2GXAA 1YI8A 1YAJA 2XNDA 3WGKA 2LR0A 5DNAA 2J4FA 4MLPA 1KS9A 1FUUA 1W85A 3U1VA 5J43A 4WXPA 1KAHA 3QEMA 1ZI6A 1PHPA 4AJIA 1N25A 2VH5R 5LXTB 2XOEA 2YY7A 2W83A 4LOHA 3R9IA 2PS0A 2GHRA 3KQMA 1Z6XA 5BT9A 4H7FA 2MJLA 2JVKA 3A6GA 2PKCA 1DO8A 2VDRB 3K4QA 2XE4A 4HPJB 4AURA 5U4XA 4EB6A 5KNBA 3S81A 3U6BA 4BO4A 1BQEA 2ENWA 2DHCA 5FLYA 4BJ3A 1N36B 4XEHA 2JJ8A 3CGWA 4DQUA 1Z0SA 2VPPA 3OTOB 3PWSA 4N8EA 2HK7A 3FIUA 4OB8A 3BULA 5FBRB 1EE1A 2JFFA 5KJFA 4U8GA 5CFLA 3RSQA 1B26A 3JY6A 4N0QA 1D2AA 4UU1A 4LDAA 3DBLA 3UGKA 1Q1EA 1UPFA 1ZIPA 2CXQA 2X2OA 2GPYA 4P38A 2V0NA 4ZAVA 1CR6A 1OT5A 1G8HA 3GRVA 4NZ9A 1Q3KA 1WEKA 2VR1A 4LSGA 4UE2A 4Q9IA 5EJ7A 4PPYA 1FFXA 3KU4A 4ITVA 2C2KA 1A8QA 2CXNA 2O2GA 3D4OA 1PS9A 1N57A 1PZXA 2RHJA 4ZCRA 2BH9A 2I34A 1E2PA 3AY6A 4QG7A 4DV7B 4X0EA 1YZHA 5CM9C 4ZAZA 3TR6A 2B2XA 2XE7A 1PL7A 3G68A 4BFLA 3GEPA 5CA0B 5CD9A 1UL1X 3AWIA 3DXYA 4ARAA 3WLIA 4EKDA 3UMVA 4BNFA 4G24A 5LA6F 4YYZA 1PQYA 2XH8A 1JDJA 1V25A 1O4WA 1RHMA 2DSTA 121PA 4DZRA 3WGZA 4RO0A 4X8MA 5K5EA 2WD7A 3LW8A 5KNLA 2DWPA 1JR2A 4TL7A 2OHOA 4MS1A 4WNAB 1Y5MA 5D1HA 4D9EA 3DW3X 2VTDA 8LDHA 4ENUA 2RGNC 5EMKA 2O8FB 2WIAA 3PF9A 4B2YA 2IA5A 4EI9A 1HSOA 5J5CA 3SNKA 1N5RA 2ZXFA 4IIFA 5HDQA 4BTEA 3AEQB 3BGWA 2NU9A 3IP8A 4J0EA 1UKBA 1DRVA 2R25B 2PUBA 1JVNA 3SFTA 1ZNQO 3TIXB 1MP0A 1AXEA 5FEMA 4YT5A 2H54A 4RZQA 1GSHA 2Z08A 4UDOA 1MO4A 4WDQA 1ILWA 3PFFA 3IX7A 2B34A 3UJ8A 3HC7A 3NORA 4I8XA 1NOKA 4EI8A 4OB7A 3GEMA 3BGOS 3C70A 4F2WA 1YI1A 4TUYF 2R2GA 4CKYA 1D6MA 4W5QA 3V9PA 3W9UA 2AUMA 3KRTA 5TV2A 2IZ6A 1AJEA 1ND6A 1YOVB 2GRUA 3R3ZA 3ZGLA 4L0MA 1ZN8A 2QX6A 1O94D 5GY7A 5A5GA 5CT9A 3RC7A 1PRYA 4GKKB 1EFDN 4HXEB 2DTXA 2Z09A 4RKQA 2QROA 1S8OA 1PT8A 2V59A 1TKBA 3OA2A 4FE7A 4JLWA 1RWQA 3HCEA 4OLHA 3K6SA 2QRPA 4J4TA 4DDVA 5J5AA 1TCUA 2B1RA 3IT3A 1AQNA 1JR3A 2PT5A 4RM2A 8ADHA 1ZI9A 5DTQA 3ROGA 4B3CA 1LEHA 3BWXA 4YV2A 1RQ2A 4YROA 3NHKA 4LJ5A 3TSYA 4W5TA 1GSOA 4MVXA 4JC4A 1R0LA 3LTNC 3GLUA 1N1MA 5LOVB 5TB5A 4FNOA 4AO6A 4EX6A 1CRPA 2H48A 2ERYA 4KXFB 1QHSA 2YS7A 4PX9A 2ZREA 3CBQA 3C3JA 3HYNA 3I72A 1QIFA 3O5AA 4U2EA 2KX7A 2VL7A 4AMVA 4QJ4A 1IY0A 3ANTA 2G1AA 2FZGA 4COOA 3E23A 4K0RA 4O2BA 1BXGB 2GS9A 1MTZA 4A15A 1L4LA 1KORA 1YQTA 2R60A 3FFBA 2ZIWB 3TTSA 1J2EA 2BZSA 1MRZA 4J0CA 3F4BA 5DGDA 4CUJA 3C14C 1JEYA 4IIGA 5JTTA 4E7OA 4NV1A 2ZT6A 3NTVA 5G1NA 4TOIA 3RDPA 1MGPA 4R1PA 4GYKA 1WZUA 1MO3A 1U5BA 1U8AA 3QU7A 4I4NA 4YJ2A 3OKPA 3KELA 3NC0C 2PQ0A 1KI6B 5AUOB 1E9SA 3TZHA 3RFVA 5JMWA 3KXKA 1T4DA 3K9CA 2F59A 2RGNA 4K6GA 4IHAA 2YMLA 4RQAA 5CK4A 2VSFA 2ZROA 3ZZTA 1ZL0A 1VHQA 4RS4A 2VP0A 3AYZB 4OHZA 1QR6A 4WY8A 3VZQA 2BFDB 2ZRMA 2YJZA 5C5IA 2QT9A 4H7DA 3S5UA 3I4LA 1Z4PX 1ZK3A 2O2XA 4G1FA 1A98A 3ESZA 4NU8X 1EB8A 3KTAA 2WG2A 1MX9A 1P8JA 3MN1A 4CU2A 4BJHB 2WF6A 3HN2A 4B7ZA 4YJHA 3L8ZA 2ZVQX 2ZQ5A 3ZHRA 1QIJA 3C7KA 4C5AA 3O4JA 5HS4A 1PLLA 5JH7B 3BQMB 4IIXA 5JCZA 2X0JA 2CZQA 4GOOD 2XVAA 5FO0A 4UQOA 1V4VA 1XD2A 4QSHA 1XIVA 5D1NA 1MH9A 3EF3A 1U8EA 3GP5A 5EC8A 4KPUA 1HR0B 2ZIVB 3RYCA 2ENUA 5CAEA 3C43A 3RE1A 2J0EA 3Q2OA 3J80A 5KU1A 1XVTA 4JJGA 3MPUA 3VR2D 4ERNA 3CLTD 3DV0B 5EUBA 1NR7A 2C29D 3BC1A 1OUMA 2O3SA 2QN6A 3E0QA 3LGXA 3O1JC 3OEYA 5FWXA 1RIFA 3UHAA 4YUZA 5BVHB 2ZPTX 3B2QA 3HK2A 5GZ1A 3ADCA 1KI9A 3TD9A 2CCGA 1YIDA 1KZYC 1PG2A 3FPEA 3VJMA 4TXMA 3ZWMA 3FKSD 4Z4IA 3L49A 3UAXA 3UC9A 4C4YA 1S5PA 1JQKA 1MQ9A 1E2BA 3ZLJA 4QC2A 4KMMA 4KPEC 3R76A 2MMGA 3PR1A 5FEUA 5HG0A 2HAEA 1DBIA 1CETA 2FEAA 2QQEA 4QLOA 2B21A 4DLTA 1E1CB 4IUYA 1N3IA 1SKYB 3KVOA 3PGMA 5B3JC 5HJ5A 2X9LA 5C1PA 1O5OA 4IHJA 3HI6A 3G9ZA 4ZI7A 1KP2A 5HOEA 2YX1A 2FWRA 3HBMA 2ZBVA 1HH4A 3BFPA 5C35A 3F8TA 3WMFA 4CUZA 2ZTHA 4ZVRA 3KYIB 1UDXA 1HOXA 3H0EA 1R5BA 5HEKA 4D4GA 1DI0A 3HSSA 1W94A 1KKMA 3O7WA 1NBIA 1S4MA 3CE9A 3GXBA 1Y1LA 4PANA 1K97A 1T4BA 3DHWC 5T4EA 1V16A 3EG5A 3BB3A 3MJFA 5JLJA 3P97A 1N8KA 4CGZA 4F5DA 3MLAA 4FGSA 2PO7A 3WKDA 3WRXC 4RORA 4UHBA 3BICA 5JECA 4X7RA 4HQ0A 1WOYA 5JNUA 1TK3A 4N4AA 4ZQIA 4AMYA 1RXUA 5BY2A 3QFFA 5H8WA 3HY4A 1M34A 1EDOA 3IIKA 3ONDA 5EWLA 1U7ZA 1QGDA 1JQJC 1W25A 4JX9A 4NNOA 4MVJG 1TQ6A 5C1BA 1OV6A 3CIOA 5TGZA 1F51E 4KH1A 4PC7A 4DNOA 1RRPA 3T9BA 1PFWA 3COVA 4UTPA 1G1AA 3RHFA 1AK2A 3NRJA 4KO4S 2P91A 2HBRA 1NQWA 2OBFA 2PWAA 1EFCA 1XCGB 3GAAA 3OZIA 3Q40A 4H4CA 1IM5A 4KSBA 5FL7A 3OLQA 4NRDA 2ES4A 2VRCA 4E11A 3NBMA 3O8CA 3BWYA 4C7JA 5H3LA 4FNMA 4D8TA 3OFND 1AKMA 4GX1A 1BE6A 1IBRA 4GWLA 2LDXA 3C97A 2YVLA 1GYRA 4MPPA 2UUCB 2VBIA