3RROA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from vibrio cholerae
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
247
structure length
247
Chain Sequence
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
molecule keywords 3-ketoacyl-(acyl-carrier-protein) reductase
total genus 90
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3rroA00
3EVNA 1OC2A 5JDCC 2HK8A 4JBGA 4QEDA 4AJEA 3JQEA 5A03A 4C4OA 1F8FA 4YT8A 5EL0A 4J7CA 4LCJA 2EIHA 3EZLA 3W4IA 4CL8A 2VZ8A 1Y9AA 5L7WA 5B1YA 3DZGA 4BO4A 1U3UA 2AEFA 5FI5A 1LXCA 4A2CA 1UR5A 4WLOA 1VE9A 7MDHA 1PWZA 1W4ZA 1B3BA 4RZIA 1YL5A 1G1AA 2NNLD 1ENPA 3NGLA 3WYBA 4GQAA 4BMVA 1BG6A 4WGGA 4YAKA 4E30A 1LSSA 1DC3A 3PHHA 4R68A 3VZPA 2ZCVA 4R16A 1Z74A 2ET6A 3RUEA 4RDIA 4J4BA 1GDHA 3MJTA 1UXIA 1I01A 4BB5A 1E7SA 1U9JA 3E82A 3KSZO 1PZHA 3A14A 3WGGA 3LT1A 4II3A 1Y1PA 1NR7A 4ZRMA 1U7HA 2RIRA 2WE7A 3QHAA 3U09A 2J5QA 2X0RA 5JCJA 2BKAA 1N9GA 4D42A 3GGGA 3AM5A 2ZYDA 5A9SB 4DQVA 4CMKA 3TQHA 2DFDA 3R3JA 3A28A 3VZSA 3ASVA 3PFWO 4PIVA 1ZEJA 3I3OA 4BNHA 1GYQA 1PJBA 3KYBA 3I9NA 1WP4A 3TFOA 3L77A 2NWQA 2ZJ1A 3S2GA 2X58A 5A9TA 1YH3A 1T2FA 2Q49A 5G0SA 3PHJA 5T5QA 3A9WA 3GUYA 3U4CA 1C1XB 4PG6A 3NV9A 2Y1FA 2HRZA 4J4HA 4BNMA 1XR3A 4KMSA 3WYCA 3KB6A 1HYEA 5JMPA 4B4VA 1SCUA 2GN8A 4YT5A 5L53A 1M2WA 1PJCA 2JD1A 5C7IO 1N9GB 4RCVA 4IJKA 4JP2A 4KQWA 1A7KA 3VPFA 3NX4A 4U8GA 5JC1A 1ZKMA 4FN4A 4EUEA 1WAMA 2PH5A 2G0TA 3DFUA 1YVEI 4MVJP 3FNFA 2EKPA 3W4JA 5JSFA 2J3HA 1LUAA 2Y68A 4ZD6A 3UXYA 4UREA 4MVJD 2CDBA 2D59A 3R1IA 2PKRA 1EEHA 3IOYA 1VKOA 2VHYA 3B1FA 3GRPA 2OP1A 4OMUA 4WNCA 1I2BA 3GPDG 2X0NA 3HFGA 4BNWA 3U5TA 3PGXA 3RASA 5JO0A 2J3IA 4IIVA 1GL3A 4NK4A 5G4KA 3GQVA 2IODA 1X7DA 1B26A 4GX2A 2OOSA 2RBEA 4FJ1A 5L95A 4LRTB 3CH6A 3FTPA 4IUYA 1NQOA 3GG9A 2H63A 3ITKA 4XX0A 3PLNA 4E0BA 1B8UA 1LA2A 1U4SA 3CTMA 2PGDA 1N92A 4J0EA 3WS7A 1VC2A 2EEZA 2I65A 3AUSA 4WLUA 4EZBA 4E2ZA 3ROMA 3CIFA 3ZCXA 1GQYA 2NTNA 1TLTA 3GA0A 4E2XA 2O3TA 1E7WA 2P9CA 3ZV4A 4KUEA 1KC3A 3HB5X 3B1JA 4K28A 1DJQA 1BW9B 4CMCA 3DOOA 3OETA 3LVFO 3ZNPA 1ZXLA 4JIGA 3L9WA 4QO7A 2ZK7A 2HMUA 1GV0A 1X7HA 3PXXA 1X1TA 1P1FA 3GHYA 1QKIA 4IJVA 3A06A 3C1AA 1U3WA 3FD8A 3DMTA 1ZUD1 2AQHA 4DXHA 2X9NA 5C7LO 4BNGA 3ZWCA 1PJ2A 5DN9A 1V35A 2UUPA 4LSWA 4CM9A 2ZTUA 3GC6A 4NU5A 2JD2A 3FNHA 4Q3DA 4CV2A 4DC1A 2GRAA 1EVIA 3H9UA 4GX1A 4XYLA 2Y0DA 2CVOA 3V1UA 4Q3AA 4EEXA 5IZCC 4II2A 4MVJG 5BNFA 2GPTA 3H65A 2A94A 1NP3A 1QYVA 3I9MA 4F6CA 4D7AA 1IY8A 1KVSA 1I10A 1DAOA 1ENYA 3RIHA 3K6JA 4RVGA 2YJZA 9LDTA 1C0LA 5I8WA 5L4SA 2R2GA 2WJPA 5JC8A 2AG5A 3E48A 4JGBA 1LRLA 4DQXA 5TIIA 3TZKA 4GX5A 2B36A 3BIOA 1YB4A 3I5MA 4GAEA 2X23A 1R12A 1SEVA 2YY7A 1Y8RA 1YGYA 3ZNQA 1UJMA 4TRNA 2Q46A 3HDQA 1RYDA 2X4GA 5HS4A 4E31A 4ITUA 1NYTA 3I4FA 2BD0A 3DBRA 1Y9EA 1VL0A 1RM5A 2VWGA 3RUFA 2GZ3A 3L4SO 4M89A 4Y6RA 4NBRA 4TVBA 3ZGYA 2AEMA 2E4AA 1EUCA 1HT0A 5ILGA 1JKJA 5ENDA 3R3SA 5K0ZA 1Y8RB 3UF0A 2P5YA 4PG5A 2ZYGA 1HLDA 2EV9A 5G0WA 3V8BA 3ZU2A 2AQ8A 3BYZA 1ADGA 1PJSA 3Q3CA 3MJCA 4ZQFA 3AUUA 1RM3A 3RWBA 5I7FA 1SOVA 2J3JA 3DR3A 2C5AA 2SCUA 3E5RA 3GMSA 3PEFA 5TT1A 3E6AA 1HDYA 1H6AA 4P8RA 3UW3A 3M6IA 1Z7EA 2EG9A 3AOGA 4GH5A 4TRMA 1C3VA 4R9RA 3G1TA 4M87A 4M8SA 4DGSA 1NAHA 3D1LA 3BTVA 4FSHA 2CVZA 3D3EA 4PN3A 5HTOA 2DBQA 3SBOA 1YO6A 2AQKA 2WMDA 2V6FA 3GNQA 1I5RA 2BHLA 1GCOA 3F3SA 3OECA 4WLFA 1QMGA 1EQUA 1O89A 3IP1A 2D0IA 4PGFA 3U4HA 2YHIA 4M1QA 5AXBA 4TSKA 1KC1A 2J6IA 4UUPA 3E9MA 3WWYA 1HDOA 1ZEMA 5JO9A 3PIIA 3BAZA 2Y67A 3GN1A 2POQX 3ICPA 2VWPA 4RVSA 2NU6A 4J16A 2IXAA 1M75A 4JQCA 4YPOA 3ZW9A 3VH3A 3S55A 4DVJA 3HDYA 3T4EA 1E0DA 2X5OA 1M6WA 3CZMA 3TPCA 1XHLA 1TEHA 4NBUA 4TQGA 4CUJA 5GZ3A 2JFGA 4GL4A 3VDQA 3KRTA 3OH8A 4OH1A 4MINA 4GWGA 2X9VA 3PRJA 1YDEA 4XQCA 3AJRA 3C85A 1UP7A 3C7CB 5U4QA 1GADO 3L9XA 4F6LA 4OOEA 2VUTA 2PZLA 2V6GA 1JKIA 2JCYA 1QSGA 3MEQA 1GZ4A 3HE3A 4WLEA 4YVFA 4Q3BA 2XXBA 4FDAA 5CP8A 2AE1A 3QP9A 3OF2A 4KQXA 4MDHA 3ZI0A 4CV0A 1GCUA 4NI5A 2JFHA 3ZHYA 2EJVA 1S7CA 3DB2A 3PTZA 2PFGA 2YUTA 4FGSA 1PR9A 4IXWA 4OKNA 4OXKA 3F9IA 3UN1A 1ZVMA 3TZQA 1P3DA 3JQ9C 2HUNA 4MP8A 5U9CA 1GQ2A 3CZRA 4XR4A 3BTUA 5IN5A 2A35A 4IXTA 4K9DA 1SPXA 3ETGA 3H2SA 4PCVA 3QSGA 3ZDFA 5JFOA 1J4AA 1P33A 1HSZA 2OORA 1LDNA 4MKZA 5JCXA 1H9AA 4D41A 2OL4A 8ADHA 3E18A 1KOLA 3OQ1A 4B8ZA 1Z45A 3SLGA 4YCAA 1E5QA 3OQBA 1CWUA 3S2IA 3ZV3A 3PIDA 2IZ1A 1LJ8A 1CQJA 1YBAA 1NBOA 3ZW8A 2YHIB 5F1KA 1C0IA 1OZAA 2CDAA 2O7QA 4XIYA 3RU7A 4WEQA 1NHWA 2VOEA 4ONEA 1EBUA 3JCZA 5KVCA 2HJSA 2ZIZA 2JAHA 3H4VA 1NWCA 3P2OA 1BHSA 4XYGA 1TI7A 4Q3NA 3RCBA 4CR8A 3PQFA 2OUIA 3E03A 4ID9A 2E37A 2O3SA 5JE8A 3LU1A 3UOGA 4OQYA 4DLLA 3U4IA 1GU7A 3NUGA 2NU7A 5CPBA 1PQPA 6ADHA 4AJ1A 4KWHA 5I7VA 1WZEA 4AICA 5C3MA 2GO1A 4TROA 1R16A 4BNKA 4LSMA 3P19A 4YJFA 3ETDA 3GGPA 4TRRA 1HE2A 4YR9A 5K6AA 4IPTA 3FSRA 4YJHB 1PJ3A 5JAQA 4BGUA 1E1MA 3ANMA 2VHVA 3RC9A 1U3TA 3OJOA 4QTZA 4CM5A 5HRUA 3EK2A 3AFNA 5H83A 4BKUA 4JJGA 1EFLA 3ANLA 2G1UA 1I3LA 2PD4A 1NASA 4Y8VA 4INAA 4PZDA 1I2CA 3OP4A 3JQFC 1GUFA 4L8VA 1GV1A 2FZEA 3L6EA 3DHEA 5TC4A 5KCZA 3N7UA 3GVHA 1EDZA 3BHJA 1I32A 1RM4A 4YJGB 3WTCA 5I7SA 2EW2A 4CMIA 3VC7A 4D43A 4ZQHA 1QYXA 3M2PA 4NH4A 4R01A 3KEOA 4B4WA 4W7IA 4NMHA 2ZTVA 1EBFA 2BFAA 2P91A 3WJAA 2ZQYA 5MGBA 5IZ4A 1GEGA 2Q1TA 3DAGA 3ZWXA 1MUUA 5KVVA 3U49A 4K26A 5ER6A 5LCXA 4CMEA 3GZNB 5L3ZA 3JYQA 2FPPA 2C7VA 3OJEA 4UVDA 3IDSA 1A71A 1RYEA 4CMAA 3JYNA 1GZ6A 2Q1SA 4JX8A 2IEDA 3PJDA 3K9QO 1TT5A 1XU9A 1C1XA 1GPDG 3EVTA 1E1NA 1K0UA 5T57A 3ZWNA 1Q7GA 3HJAA 4IQ0A 1YE3A 1C1DB 3ZWAA 4B7XA 1KVTA 4M49A 4UUOA 4U7WA 3EAGA 3AFMA 4EW6A 4CODB 2FSSA 3JQGA 1SB8A 3DOJA 3PWSA 3F4BA 3PGJA 1E1KA 2XAAA 1HDZA 3OIGA 3RD5A 4NFSA 3I6QA 2QZ9A 2VOJA 4ALMA 1LDGA 1N1EA 1PTJA 4OQZA 2HMVA 2DU8A 3OJLA 4R4JA 3UCXA 4JBHA 5F1OA 3OHSX 4XR9A 1C0KA 3WJ7A 4B8WA 4YB8A 3AY3A 4YJHA 4RF5A 2OXIA 3K30A 1VPDA 2EP5A 3RKUA 3GHHA 2I76A 2IEBA 4EDFA 3CPSA 1VJ0A 2WTBA 4R5MA 2Q1WA 2FY8A 3UUWA 3ULKA 1Q0LA 5ITWA 3GZNA 4XDYA 5JDIC 2NM0A 5COBA 4R51A 3K96A 3ZWBA 1A27A 4ND1A 4TZTA 2O50A 4DYVA 5T6BA 1FDTA 4YYZA 3HG7A 4MIYA 2YHUA 1YL7A 1E3WB 4CMGA 4UEKA 5DULA 5DCYA 2B5VA 1JWAB 4I5GA 1A7AA 3BTSA 1TT5B 1L7DA 3EYWA 3INRA 5A5FA 2YV1A 1ARZA 3PJFA 5JDIA 3KO8A 3UVEA 2QZZA 2PZKA 3SXPA 1DHRA 2DVMA 1A4UA 1GFSA 4QT0A 5KTKA 1DRVA 2H6EA 2WD8A 1BXGB 4MKRA 3OSUA 3UFXA 1GQQA 3W8EA 5A4DA 4CQMA 4MVJE 2W2LA 5DBGA 1Y5RA 4NR0A 1L7EA 3L0DA 1YOVA 1PS0A 1QV7A 3PYMA 3TWOA 1B8VA 1DSSG 2VYVD 4EBFA 3JQAA 3FWZA 4BIIA 2PZMA 3GPIA 1QP8A 4D0RA 3WBFA 2QG4A 5KVSA 2J8ZA 3X2FA 3TOZA 1XYGA 4QO8A 3VVCA 4YA6A 1K3TA 3QW2A 1QXSA 4YTEA 4AJNA 5IG2A 4IY1A 4R9SA 4OXNA 1V3UA 4PVDA 4A03A 2Q1UA 2FR1A 1Z82A 3N74A 4E5YA 5JDCA 1W0CA 2DT5A 4QFDA 1FMCA 3RFTA 4LVCA 4BB6A 2GNAA 4ND4A 1ADBA 3GZ4A 5TS3A 4R1NA 1MLDA 4R69A 3U62A 3E8XA 1BDBA 4IMPA 1RPNA 1E6EA 4WLNA 4ND2A 3GDFA 4J2HA 1GEEA 4XJTA 3JD2A 5JW6A 4AJKA 1EQ2A 4KTVE 3SEFA 1H5QA 5IDXA 2PGLA 4CM3A 1BXGA 4Y6SA 4UVGA 2C7GA 3CUKA 3JD1A 4FOOA 4EYEA 4MJLA 1KY4A 2FSVA 1HKUA 1E77A 3IJPA 5TQVA 4NBVA 3W8FA 4CM6A 1SO8A 1MGOA 3LLVA 3WGHA 3RSHA 2NACA 4J7UA 5KJ6A 4Y98A 4DPLA 1G0NA 1GTMA 4BHTA 4CR6A 4TRJA 4DL9A 4ZHSA 3C24A 2VYVA 5KWEA 2QQ5A 1XGKA 4NJOA 3GNSA 2VZ0A 2YFHA 2P5UA 1HDXA 1U2GA 3UGKA 4PLFA 4DBZA 4K1LA 2DBRA 3PWKA 3NTQA 3RI3A 2G82A 1Y7TA 4JJFA 4XCVA 1R15A 1SNYA 2DBVO 3EY4A 1OAAA 2D3TA 4BO0A 1V8BA 1N7GA 4NNJA 3VVBA 1FDSA 3WGZA 1PJQA 4RQUA 3NAQA 4UULA 4BKQA 1A72A 3JQ8A 1AHIA 5BR7A 2DTEA 4UVEA 4YAEA 2EW8A 4IQ8A 4FOSA 1F8GA 3WWZA 2GDZA 1ZSVA 3GEGA 4UVIA 5FF9A 5TX7A 3AK4A 1E1LA 5CDGA 4OXYA 1JN0A 4IQGA 4JK3A 4P4NA 3DXFA 5TT0A 2PD3A 1PEDA 5JMWA 4M86A 4XGIA 4BV9A 4EGFA 3VPGA 3ADOA 2YQ5A 2E48A 4R3WA 1SOWA 4PRKA 2CD9A 2UYYA 3Q0EA 3PJGA 4MP3A 3A4VA 4HV4A 4DLAA 4XYMA 4J4TA 5HBRA 4YAIA 5JAIA 2PLAA 1V3TA 1YB5A 2PKQP 1EK6A 3D64A 1K6XA 1MA0A 1ZW1A 3ON5A 4XGNA 1H93A 3WMXA 3JYPA 3DWFA 1P77A 1EUZA 1PJTA 2AMFA 3PYXA 1DIGA 5AQ1A 1PL8A 4BQPA 3PK0A 2D8AA 5DCWA 1PGQA 1BWSA 1Q7BA 3GDOA 3GY0A 3I1JA 1UDAA 3V2UA 3C7DB 1CETA 2UDPA 4OYRA 3ZU3A 4D79A 1S6YA 4AJ2A 5IZCA 1PJLA 2PKQO 1W6UA 4QXMA 1I36A 1XU7A 1QYCA 1ISMA 1RJWA 2Y99A 4U0KA 4E13A 1JVBA 5A05A 4JROA 2Y66A 3BMCA 4IMRA 2X0JA 3TN7A 4DTIA 1NAIA 3WSWA 2O2YA 3VH1A 4E5NA 2B4QA 1J5PA 4MP6A 4IJUA 1HYHA 2IYOA 3KYDB 5AXAA 2GF2A 4I1IA 1V9LA 1X13A 3I6IA 1ADCA 2H9IA 3JQ7A 2D4AA 4L73A 1DHTA 4W9NA 3H3FA 3HADA 3GNTA 1ISJA 4IDAA 5BSGA 1H6BA 4U6SA 2XXJA 4HKTA 1HTBA 3VH2A 4DBVO 3H7AA 3PFFA 4LCEA 4LMPA 1A9YA 1U4OA 3WICA 1QR6A 1ZK4A 2O48X 3AOEA 4YACA 1FDUA 3GAFA 2NTVA 4K6CA 5COQA 3K2BA 2IE0A 3WGIA 4EI2A 3GOHA 3LSYA 1SMKA 3IIEA 3KV3O 4WKGA 5FWNA 2FHSA 2F00A 3KYDA 4I9NA 2PNFA 2DC1A 1PWXA 4N54A 2X1HA 5U1PA 1P9LA 5GMOA 4CMJA 5JBIA 1D7OA 4GSKA 4RVDA 1MC5A 3WGQA 1D8AA 4BMSA 4WK6A 1IOLA 1M67A 5L45A 4IDBA 1MB4A 4FR5A 3ROQA 2NV6A 4CM4B 3GG2A 1BXZA 1T4DA 1R0LA 3QWBA 2OMEA 4I9HA 4Q3EA 3CXRA 2ZTMA 2TMGA 2NU8A 3V2HA 4K6FA 1ZJZA 1GAEO 4CM7A 3K5PA 1V0JA 3WYEA 3Q11A 4JBIA 2I3GA 2PY6A 2PD6A 5CG1A 2H1SA 2C29D 1PZFA 3TL3A 1M66A 3O8QA 1LX6A 1HRDA 2VRCD 4IDGA 4DIOA 3TOXA 5JAMA 1ZK3A 5CPFA 4IGEA 1C14A 1U28A 4IJWA 4YRBA 4BGVA 5EINA 1PS9A 3STHA 1PX0A 3FTNA 2R00A 1JA9A 2R6JA 3DMTC 3QJ5A 2YDXA 1FK8A 1KVRA 2D5CA 1X7GA 3K31A 3V5NA 3QWAA 4YRDA 4L4SA 4KWIA 5TNXA 4ESOA 3I83A 3PQEA 4I9UA 4MO2A 4YJDA 2W98A 1KYQA 2GN9A 1YDWA 4ZQGA 4CM8B 2VUUA 3ZZNA 4NJMB 4XYEA 3ZN2A 4QSMA 3CKYA 3QA9A 3AY6A 3RUHA 1XLTA 1HXHA 2NU9A 3DZIA 2BI7A 4WOJA 2YDYA 4R54A 3GVXA 5C37A 3IUSA 5GZ1A 2JJYA 1ONPA 4OJNA 3B6ZA 4I08A 1YQXA 3ZU5A 2PH3A 3BMQB 1D4FA 1YL6A 1OI7A 4R3NA 2EXXA 3LT0A 3W1VA 4Z9XA 4RPLA 4TWRA 1E7MA 1QLJA 2EF1A 3OJ0A 4DYDA 4WJZA 4NFYA 5HA5A 3DHYA 4CLOA 3E9QA 4JXKA 4Y67A 5CDTA 1G6KA 3D7LA 1IHXA 1WXDA 1I33A 4LGVA 4MVJA 1MFPA 2NSDA 3DZJA 3FBTA 3H6KA 5I8ZA 1IULA 2ZATA 3WSVA 4FJ0A 3WGTA 4TKLA 4CV3A 4WASA 4RVUA 1K89A 5F5NA 4KOAA 3D4NA 2J5RA 2VRBA 3COSA 4OOFA 5THKA 3TNLA 2BFMA 3VPSA 4BNXA 4GLOA 1B16A 3S2EA 3O03A 3I52A 5G4LA 4YQZA 5DBIA 5AYVA 1F12A 1PZGA 1QV6A 2VZ9A 3QVXA 2NUAA 1J6UA 3JQAB 4C7JA 2YW9A 3GT0A 5DZSA 1B2LA 4DWVA 1YOVB 1NX6A 5BNIA 3WB9A 1FXSA 1PJ4A 1IHYA 1ZMTA 3VDRA 4HX5A 3RUCA 3HWRA 1ZO8A 3PI7A 4O5OA 5CEEA 1MV8A 2VYND 3AOEC 3GVPA 4YWJA 3D3WA 3NTRA 1NPDA 3AWDA 4H7PA 3H5RA 2X5KO 1SZJG 5L40A 3EUWA 8LDHA 4ND5A 4RLHA 3DEYX 2W2KB 1O6ZA 4XQGA 3N58A 2PA3A 4PLTA 1XA0A 3RQSA 1J49A 2VNAA 1BGVA 1B8PA 3BXXA 3G49A 2RCYA 4CR7A 4PZCA 3MWDB 5JNLA 1BXKA 4B3IA 1OOEA 3CMCO 2GD1O 3HUDA 3E1KA 1BVRA 4O0LA 3D3WB 1DRWA 4XRGA 5JY1A 4PLPA 3QIVA 4J9UE 1UXGA 6LDHA 3FHLA 4RPKA 1Y8QB 1ML3A 3QQPA 2EERA 1LRKA 3DOCA 5EJ2A 5TRTA 4IDEA 4RPJA 5BSHA 1KVUA 3PZBA 4M55A 3LYLA 4XIJA 1LC0A 4KUHA 5DOVA 1GUYA 3BZUA 3RU9A 1IL0A 2ZB8A 4Z0PA 4R41A 3PYLA 4ZGWA 1PR3A 1GZ3A 2I5PO 1LQTA 2VHZA 1P44A 1Z6ZA 1UZLA 2R00C 1HF3A 2QYSA 1HLPA 3QWIA 1P1HA 5GY7A 3KETA 3QRWA 3CINA 4W82A 3WNQA 1LDEA 1E3LA 4G81A 5B37A 3KLMX 4WCFB 3V1YA 1IZ0A 3WR5A 4BV8A 4ROSA 2NTJA 1F06A 2X7HA 2BRUA 3OIFA 4S3MA 2GUGA 3Q2IA 1I30A 3M1AA 2BF7A 1RKXA 3FN4A 2IXBA 1LDMA 3RUAA 2HK7A 2OHXA 4UVHA 4EJ6A 2E82A 1NVGA 5IDYA 3P2YA 4J1TA 3BMOA 1ADFA 1DOHA 3ETEA 3U3XA 4BO2A 1R4MB 4CM1A 1I8TA 3DBLB 4FB5A 2YQ4A 4PFJA 3ZU4A 3HB4X 2Q2WA 1UDCA 3AY7A 3DTTA 4UAGA 1RM0A 2P4HX 3ABIA 1R4MA 2EGGA 4KUGA 4E6PA 3NYWA 2DKNA 1R66A 5AOVA 4D3SA 2QYTA 1XG5A 4WECA 4MIOA 4EJ0A 4P4LA 5TLSA 1HE5A 1VRWA 1H0KA 5DOZA 2O3UA 1ZK1A 3OIDA 3IKVA 2IZZA 4OAQA 1G0OA 2DTXA 4DA9A 3IKTA 3MWEB 1E5LA 4ND3A 2DTDA 3G1UA 1TVEA 2CVQA 4HBGA 1X1EA 2O3JA 3KTDA 5EPOA 1WWKA 1CQIA 1NFRA 4M54A 3JD0A 4L76A 4P4GA 1YXMA 4FFLA 5BSEA 3DBHA 4RJTA 1UZMA 3DBLA 4CLEA 1BSVA 2W8ZA 4ZRNA 3P5SA 2BELA 3JTMA 2WDZA 2W4QA 3JQBA 3FR8A 3LQFA 1NFQA 1E7QA 1PL7A 1N8KA 4OKIA 3K8ZA 3GEDA 4CLOB 4E3ZA 1I24A 3QWHA 1E7RA 1NPTO 4FC7A 3U4DA 2CFCA 2EP7A 3VKVA 2BFPA 4PLZA 3H9JA 1R0SA 4OM8A 1YB1A 1GPJA 2HK9A 4LN1A 4YJGA 3SC6A 1U5AA 2VRCA 2GZ1A 4L4RA 3WMWA 4ALKA 3ROPA 4MOWA 4D3DA 2AHRA 5JY6A 4L74A 1B3RA 2W90A 1BRMA 1PGNA 3WX0A 4FS3A 3RJ5A 1K6JA 1CYDA 3RBVA 3C1OA 1LI4A 4PVCA 3QVTA 2FMUA 4NQZA 1DDOA 3IJRA 2NVUA 3OICA 2WD7B 4XGKA 2GGSA 1U3VA 2WM3A 2B4RO 4BO5A 3FBGA 2DPHA 3HNPA 4FBGA 2IDZA 3KYCB 5DP1A 5ICSA 2FPGA 4KDFA 5IFLA 5A5EA 1VM6A 1R4NA 1K2WA 4R1UA 1W8DA 3CSDA 4BS9A 1NHGA 1XWFA 3GVCA 3O38A 3SLKA 4AJLA 2D1YA 2OGUA 3FPLA 4W99A 3SC4A 3VTFA 1UH5A 4A26A 4BO9A 3BMOB 1O94A 2BGKA 4RV9A 4FJ2A 3ZWOA 5FEUA 2FP4A 4XQEA 4HXYA 1E3EA 1MX3A 3ANNA 3ZWVA 1H6DA 3QVSA 4FD3A 4PLCA 5C5IA 2CZCA 2GCGA 3AW9A 3QE3A 4Y6PA 1AXEA 4J1QA 3K73O 3ZNNA 3WNVA 1OFGA 4CPDA 2B35A 4PG7A 1WW8A 1MC4A 3RUDA 1Q7CA 4UEJA 4A27A 1B15A 1TXGA 1Y5MA 2CMDA 5TGDA 3BHMA 4LW8A 4PLYA 3INGA 4WCFC 4BO6A 5KOIA 4GKBA 2D2IA 1NQTA 1ZMOA 1Z7BA 3JQBC 1AUPA 2VHWA 2G5CA 1QG6A 5A06A 1ZFNA 3S8MA 4BO8A 4BOYA 1ZCJA 1DRUA 1MP0A 1ZK2A 2AXQA 1LDYA 3IAHA 5G0TA 4PLWA 5DT9A 5IJZA 1HZZA 4LVUA 3KUXA 2HLPA 4RF3A 3DZBA 4YJFB 1YONA 1WDLA 4XEHA 4LMRA 1O0SA 1XDWA 2OBYA 3GLQA 4L4XA 4J49A 2QX7A 3PDUA 1HSOA 5BNTA 4IDDA 4H3VA 2C54A 4NBTA 3DBHB 1JTVA 1P0FA 1FF9A 3PZRA 4R1SA 4Z9YA 1HZJA 3PLRA 2NADA 4BUCA 3HN2A 4GVLA 4LK3A 4A73A 1YJ8A 1WLYA 4N18A 4XZ3A 5KJEA 5H81A 4G5HA 1UXKA 4J9VA 3F47A 1BMDA 3EDMA 1CEQA 4TMFA 1V6AA 2WSBA 2Y93A 4E5MA 1GYRA 2BH9A 4A0SA 2Z95A 3H9EO 3RC7A 1PGJA 3UHAA 3JQ7B 3IS3A 3VH4A 1ISHA 4FGWA 3Q1LA 3QY9A 5A9RA 4CLXA 4F46A 4I5DA 3FWNA 2B69A 2NLOA 4Q39A 4CMHA 4B4OA 5CEFA 3WOHA 2DQ4A 5JAZA 1ZK0A 4YDRA 1NTOA 4J0FA 1ENZA 1PL6A 4XQ9A 4BL5A 1PQUA 1CRWG 2O4CA 3RJ9A 4QQRA 5G0VA 3H2ZA 5G2OA 1P1RA 2FRDA 3F1KA 3C8MA 4O63O 4BO7A 3DDNA 2PZJA 3AI2A 5CFZA 1O9BA 3H9GA 4OGWA 1JDJA 3O26A 2VTEA 3WQQA 1YBVA 2I9PA 4Z0HO 1LSUA 2Q4BA 4FFNA 5LDHA 4RZHA 3FRJA 1ZH8A 5K9ZA 4O6VA 1TB4A 1T1SA 4BNFA 3AM3A 3ICCA 3G17A 1EVZA 4JCOA 1N2SA 3WTBA 3LF2A 1DXYA 1WPQA 4BNZA 1H6CA 1WDKA 4IDCA 1H9BA 3GVIA 4FW8A 4BKPA 2FN7A 4B7UA 3LC7O 1K6IA 4EUHA 4AJOA 4BGEA 2QRLA 4BKRA 3ZHZA 1LSJA 4PRLA 4BO3A 2LDXA 4XD2A 3IUPA 5A3VA 2C5EA 5F5LA 4ZA2A 1LLQA 3I4CA 5A3JA 3MTGA 4CMBA 4KP7A 1ZBQA 2HSDA 3PHGA 1RWBA 2HKIA 2JHGA 4JJIA 7ADHA 3B20A 2P9EA 3RBZA 3S1LA 2RHRA 5B4UA 1DAPA 3RAJA 1KEUA 5A02A 4ALJA 4J1NA 3AI1A 1NQ5A 1KEVA 2BFOA 2P68A 1ORRA 1HDCA 2Y05A 4Z6KA 3I9LA 4H16A 1LLUA 1NVMB 2BI8A 3WLFA 3W6UA 4AFNA 3SVTA 3IC5A 4DPMA 2Q45A 2Y1CA 5L4NA 4BVAA 1ZSYA 3KSDO 1DPGA 3D4PA 1VJ1A 1ZIDA 3G79A 3S2FA 3GGOA 5JYEA 1ZJYA 4E12A 4BNVA 5L51A 4KTTE 4OO3A 3WGYA 3UCFA 2FOIA 1YWGO 1X0XA 1HDGO 1EZ4A 1U1IA 4D45A 3NJ8A 4UEOA 1CF2O 1SB9A 2B37A 4OSOA 4CQMB 1MG0A 5AVOA 1JU9A 2NVUB 3RKRA 1NQAO 2YFQA 4ALNA 1WMBA 3WIDA 1E92A 5DCUA 4HWKA 5L7TA 1HE3A 5JLAA 4IS2A 4CM9D 1X0VA 3RUIA 5FYDA 3B1KA 5GZ6A 4QUKA 4PLHA 1ONNA 1PSDA 2BGMA 2WYVA 3ENKA 4IGFA 3RROA 1E3WA 1QORA 2HRBA 5L7YA 2P4QA 5I9LA 2OP0A 4RVHA 1LLDA 1ENOA 1DC5A 1NM5A 2GYYA 1SBYA 2OFPA 3F4LA 4CQLA 3G3EA 4MIEA 1IB6A 5I7EA 4A10A 1CERA 3HZZA 3LF1A 1DLIA 1CJCA 1Z73A 3IQDB 2RHCA 1HETA 4CQLB 1HDRA 1WNTA 1XEAA 4BO1A 4GKVA 3DL2A 3TF5A 5ITVA 2C2XA 3H8VA 2Y1EA 2QIOA 4CM8A 3HDJA 4PZEA 3MJSA 3WLEA 4D0SA 4YXFA 3Q6IA 4FFOA 3NKLA 4QECA 5EN4A 1PIWA 3BTOA 1DJNA 1P1KA 5L4LA 3DQPA 2VHXA 2V7PA 1TA4A 4B3JA 1XQ6A 3BMQA 1LU9A 2VWQA 2BLLA 3NT5A 3ONDA 4FQ8A 1E7YA 4W4TA 1Y6JA 1E6WA 2CUKA 1LQUA 4CQMD 1TT7A 4OL9A 5ADHA 5CG2A 4RPGA 4IDFA 5THQA 4NDNE 3Q9NA 4W7HA 3WGOA 5TF4A 4L75A 3JQAD 4ZQEA 5FFFA 3JQ8B 1U8FO 1Q0HA 4A5OA 3DZHA 3D4OA 1K5HA 4YBZA 1JLLA 5KNLA 5IDQA 3LC1O 1QLHA 1QYWA 4DMMA 2JFFA 2X86A 2PR2A 4WPGA 1EDOA 3TZ6A 1O8CA 4EITA 2Q2VA 1UXHA 2IRWA 4EJMA 3PP8A 3V2GA 3ZWPA 4GPD1 2X0IA 9LDBA 4JNKA 1T2DA 3D0OA 2H5LA 3RFVA 1X14A 3JYOA 1GYPA 4O59O 3SX2A 3W6ZA 1JQBA 3VTZA 4U5QA 4AJHA 4GGOA 2EKQA 2ZB7A 4PG8A 1O95A 1WDMA 2C07A 3IL2A 4URFA 1PGPA 1ISIA 1ZSNA 2Z5LA 4OSPA 3C1TA 4HADA 4D3FA 4RGBA 4DIFA 1N1GA 1P1IA 4MVJH 1NR1A 1KVQA 3L07A 4AJ4A 3KVOA 3QV1A 5BT9A 2EHDA 3IMFA 1N5DA 2G76A 1GR0A 2JL1A 3ST7A 5AXCA 3SJ7A 2JD0A 3RC1A 4FIZA 3WQRA 1JAXA 4L9RA 3EGOA 3CE6A 4CV1A 3PVZA 1Y81A 3E5MA 5FI3A 5TJHA 3VHRA 3FR7A 2ZB3A 5JPIA 3OM9A 1IUKA 2Y0CA 5EMHA 1H2BA 1I0ZA 2CF5A 5TJ9A 2GSDA 4I8XA 3FI9A 4PLGA 2GN6A 4NG5A 1I2ZA 1KY5A 3JQCA 1UAGA 2WWRA 3EW7A 3LZ6A 1Q0QA 1ULUA 4XA8A 4AL4A 5CDUA 1T4BA 4HFNA 4IZIA 2Z1MA 2Q2QA 3LT2A 5ENVA 3ONFA 4PLVA 1WMAA 4ALLA 4EEZA 3KM0A 1I3KA 4AVYA 3BMNA 3O8QB 3EHEA 3I23A 3ONEA 3AU9A 1OBFO 3ZV6A 2W2KA 3M2TA 3ADPA 4QFCA 1FJHA 4ZICA 2IZ0A 1PGOA 2O3RA 1E3SA 5EQDA 1CIVA 4BQRA 4MKXA 1GY8A 1L1FA 3AU8A 2CF6A 3KEQA 3L6OO 4YRAA 4BNJA 4BNLA 2OBNA 2BMAA 2JCVA 2TMDA 3KHUA 1I3MA 4J3FA 3DAFA 4RPHA 4AJIA 4H15A 5KJCA 3ZHBA 4JLWA 1XELA 2YV2A 1T24A 4JN6B 5COAA 4DIBA 3DC2A 2HCTA 3X2EA 1AGNA 2B4TO 3EMKA 3B70A 4WCDA 2O4UX 5EERA 4ILKA 1BVUA 2EWMA 3HSKA 1P45A 1B7GO 4CUKA 1VL8A 4UUNA 5B12A 1HL3A 5IN4A 4O1MA 5IXYA 2I67A 3QWFA 4J91A 2WE8A 1CDOA 3U9LA 1MFZA 2A4KA 4F45A 1XKQA 1UXJA 4NK5A 3UCEA 5DNAA 2HMWA 4EUFA 1T2CA 1LEHA 1EK5A 3KZVA 4JP3A 4A7PA 1ID1A 1JW9B 4XB2A 1EE2A 1VL6A 1J0XO 3NJ4A 1BDMA 1Z75A 4B79A 2BGLA 2UUOA 3FPCA 2E6UX 3ORFA 1PQWA 3RBXA 2DPGA 4W9NC 4AG3A 5BSFA 4Z0TA 3OEWA 1ZZEA 1OC4A 1YJQA 1HYGA 3EZYA 3JQDA 3MOIA 4WUVA 5T67A 1LBEA 4HFMA 4MVJM 4NJMA 5F3RA 4DLBA 3GH3A 1V3VA 5TSDA 3KXDA 1NVTA 4BNYA 5ER9A 3PHLA 2OZPA 1A5ZA 3JYLA 1JAYA 2DBZA 2FPIA 3ENNA 2QRKA 2VWHA 1U7TA 1MG5A 2FZWA 1IE3A 2I66A 5HS6A 4N5LA 2DUWA 3RFXA 4DPKA 5CDSA 2EGHA 3PPIA 1VI2A 4ZJUA 4X54A 1DC4A 4OIMA 3H3JA 2A92A 4KDEA 4QX6A 1F17A 4BNUA 4CLRA 3DONA 1R0KA 3L6DA 4ZQBA 4DC0A 4BNIA 5T8KA 2HQ1A 2C2YA 2HO5A 3TZHA 1KS9A 3F5QA 4J90A 4XKJA 4XYBA 2OO5A 1H2HA 2GZ2A 3DBRB 2G17A 4J43A 1GUZA 3TL2A 5ES3A 2YZ7A 3OJFA 1C0PA 4CJXA 1VKNA 1EUDA 3D5QA 3T4XA 2D5AA 4NHEA 1T26A 2ZQZA 3ASUA 3TZCA 3MOGA 5A9SA 2Q99A 4YAJA 5T64A 4E2WA 2JCXA 4CL3A 1DFIA 5IXSA 4AJPA 4IM7A 5EESA 1YS4A 1XSEA 2DM6A 4HUJA 4RL6A 5A1TA 4Z3DA 1EVYA 3OBBA 4FPXA 3D5TA 1AXGA 4ZN6A 1SC6A 3DAPA 4W6ZA 4LRSB 4NIMA 2C20A 1IPFA 2O23A 4CLDA 4E32A 4MVJF 3WQSB 4D46A 4YT4A 3JQ9A 3TFQA 2P2SA 1LSOA 2V6BA 2NQTA 3GR6A 1XCBA 2ZYAA 1MXHA 2VT2A 1SAYA 2J3KA 1PS8A 4E5KA 2V6MA 3W8DA 3DHNA 4HNGA 1T2EA 2JHFA 2ZJ0A 3NEPX 1M6HA 3MTJA 4Z3KA 1E6UA 5AXDA 4CMEC 1VJTA 1UZNA 4Q9NA 3H5AA 3NT4A 2HU2A 3F1LA 2AEJA 4FFPA 2V65A 3G0OA 2GERA 2Y1GA 3NT2A 2IYPA 4NU6A 1PZEA 3L4BC 1R37A 1VSVA 1KEPA 3UICA 2P9GA 1XIVA 3LK7A 4HFRA 2AW5A 3FF4A 2EKLA 1QYDA 1U5CA 1T1RA 1AE1A 1ULSA 2B83A 4FFMA 4GMGA 4B3HA 2VYNA 1E3IA 3I9JA 1KETA 1HEUA 2VN8A 2AG8A 4MVJI 2UV8A 5DBFA 1D1TA 1IPEA 1GD1O 1KERA 2AA3A 3AUAA 2Y1DA 3V1TC 3VZQA 1YQDA 3OA0A 5A04A 3INTA 1I3NA 1HE4A 4D44A 1VSUA 4P22A 3TDKA 2O7SA 4WE3A 3KYCA 1EMDA 3FCOA 4IIUA 3ZNOA 3K92A 3BA1A 3I9KA 4G65A 2J5KA 2X22A 2NVBA 3QVOA 4IINA 2PGJA 3GAZA 1N7HA 1WZIA 1X15A 2O3QA 3PJEA 2LDBA 3O9ZA 3GUCA 3LT4A 5MDHA 4Z9FA 1R6DA 5KVQA 3LLSA 2YV3A 3VPXA 1KIFA 1XQ1A 2PK3A 3O4RA 3DFZA 3MJ4A 4GSLA 1Q2XA 3SJUA 3LDHA 4G2NA 1P0CA 3IP3A 4GX0A 3VZRA 4YT2A 3W4KA 5KJ1A 2WYWA 2XPCA 1NNUA 2A9FA 4Q3CA 5DDIP 4GVXA 1DEHA 4B7CA 3MJEA 5BQFA 4RF2A 3NTOA 5ILOA 2VTDA 2I6TA 3FNGA 3WDSA 1DFGA 1DB3A 3MJVA 3GFBA 5F1PA 5JXWA 1Y8QA 2JKVA 3KBOA 4XB1A 4BGIA 2QHXA 2HMSA 2Y1OA 2NVWA 4RDHA 2ZTLA 2Q3EA 2RH8A 5G4KB 3Q2KA 3NDJA 4RORA 4FCCA 4I5FA 4UUMA 4E5PA 4RQTA 3JSAA 1VLLA 2ILTA 4NFHA 3JQGB 3TSCA 1D1SA 5JS6A 2VNSA 3GF4A 5IAAA 1DIAA 3L4BA 5ICMA 1KEWA 1ISGA 1FDWA 1MXFA 5J23A 2WYUA 1DLJA 3DO5A 4U6QA 4WEOA 3RVDA 3JV7A 5EQFA 1F14A 5C7OO 2C0CA 1UP4A 4NZ9A 1ZXBA 2QRJA 4ALIA 3MCVA 4E33A 2X6TA 3NGXA 2QW8A 4R1TA 5B4VA 4B4UA 1DIBA 3A1NA 2C82A 3GDGA 1UAYA 1BTOA 3NDIA 5DP2A 3GFGA 3ZWYA 5CDYA 1U2DA 1T25A 3OFSA 2X5JO 4BMNA 2F1KA 5DF1A 5I9MA 3PQDA 2HMTA 4BKOA 4CM4A 3KSUA 1JWBB 1YQGA 2XOXA 4J7XA 5EIOA 2I99A 2UAGA 1AHHA 3CMMA 2RH4A 4HP8A 4R5HA 4DMLA 3VAZA 1F0YA 1NWHA 5JYDA 3RC2A 4E2YA 2ZKLA 3GMDA 1P74A 3WG9A 5IDWA 1D3AA 4GLLA 4E4YA 4RVFA 3AUTA 3TRIA 4DQUA 3ROKA 4GGPA 2JAPA 2NQ8A 3PHIA 2VCYA 1IZ9A 1JKFA 3K2EA 2E49A 1WVGA 2ZB4A 4N7RA 3HFSA 3DTYA 5F21A 4BNNA 4FC6A 4CUZA 2Y0EA 4IZHA 3DZFA 3KLPX 4RLSA 1KBZA 2CDCA 4GBJA 4XJSA 1E3JA 4XDZA 1FDVA 2HJRA 1QRRA 1P1JA 3JD4A 3OEYA 4GMFA 1A9ZA 3U0BA 2DFVA 2X9GA 5CEJA 3JQ6A 1B0AA 4I5EA 2CY0A 3WIEA 1YBMA 3QVWA 1M76A 1AN9A 3R6DA 3M1LA 3FNEA 1T2AA 4PG4A 4TKMA 1OMOA 4TVOA 4HNHA 4TZKA 1DIRA 3GK3A 4GWKA 3VOSA 3F5SA 3NDRA 5LC1A 4CLRB 4ZU3A 2HAEA 4YAGA 2GN4A 1A4IA 1ONOA 3WFJA 3ZHXA 4WLVA 1R4NB 1YRLA 3H5NA 4HFJA 3VPHA 3F6YA 2I3AA 1LLCA 1LDBA 4WOKA 1B14A 1EVJA 3CEAA 1EE9A 4DUPA 4BNTA 1C1DA 5CHEA 4AJJA 5B4TA 4CMIB 4E21A 4RF4A 4J1SA 4NBWA 3PDJA 2WD7A 1LTHR 2C59A 2EJWA 3HN7A 2CNBA 2CSUA 3P7MA 3GN2A 4J6FA 2GASA 3HQ4O 1DFHA 5G0UA 4IBOA 1LNQA 3ITDA 4L0QA 4U0JA 3GRKA 2WEKA 4NPCA 1DBVO 1W73A 3T7EA 3Q9UA 3HHPA 2HDHA 2W2LD 3BMCB 1LC3A 2B5WA 4KZPA 2FR0A 3ZWMA 3WBBA 1ISFA 4YEDA 3NRCA 3KOUA 4Y9DA 5H82A 2Q50A 5KJFA 3UH1A 2GLXA 5IF3A 5CAEA 4N5NA 3T7CA 1DO8A 1H94A 3R0IA 3GEMA 4N5MA 1DIHA 4XWYA 1P31A 4WNIA 2XF8A 1NPYA 2GR9A 3UKOA 2FWMX 2Q4EA 3LC2O 3C7AA 2PWZA 2RAFA 2O2SA 5K6AC 1EFKA 3EC7A 1UUFA 3HDHA 2X8LA 3OMLA 2DAPA 3TJRA 3DMYA 4DRYA 3F46A 2PTGA 3OQ6A 1O5IA 1U8XX 1ZNQO 2DUUA 1DC6A 3JQFA 3H9QA 4DREA 5HWSA 3BHIA 1Q1NA 1HWYA 5T8KC 4MPDA 4OHUA 2UVDA 5KIAA 2VUSA 3MZ0A 1UP6A 1LRJA 4FFRA 4C7KA 4J2OA 5KKAA 3VKUA 3UAGA 2B0JA 3ZWWA 3JD3A 3DZKA 3OA2A 1SEPA 2AQIA 4IS3A 2PV7A 1IYZA 4S1VA 1YKFA 3BMNB 1NXQA 4CLHA 1JVSA 3QLJA 4WCFA 5JCJD 2Z1NA 4LISA 1BW9A 2FR8A 4HY3A 2VQ3A 2YYYA 4ZVVA 1PU2A 4GI2A 4F3YA 2ZCUA 3WFIA 3WXBA 2VT3A 4YQYA 5HM8A 1NFFA 5L9AA 1UDBA 4XRRA 3AM4A 3PWZA 5KKCA 2AE2A 3I9OA 5I9NA 2DLDA 3DBVO 3E9NA 3ZH2A 3AI3A 4RO0A 3ZV5A 3C3XA 4P38A 5LDGA
chains in the Genus database with same CATH superfamily
1BA3A 3EXHC 1IM5A 1OC2A 4QEDA 4LZJA 5DX8A 1P0MA 2O20A 2O8NA 1ZJ5A 4KN6A 4TLAA 4Y2QA 3T99A 1NVDA 2H5JA 4WX2B 5DRTA 3TK1A 2Q6VA 1JUDA 2G9UA 2WU1A 4G0YA 4LCJA 2QVCA 1DDGA 3FYTA 2VZ8A 2MSLA 2UZAA 3J7AC 4ZYLA 3JVUA 4B32A 3DZGA 1NIPA 4R40A 5FI5A 2AN4A 4IHAA 3WRYA 2KW5A 1ZHOA 4DMGA 2XT9A 3ELYA 4CWAA 3FVTA 4Q03A 2ZE6A 4BUZA 2RH5A 4MUFA 3C6KA 4EH1A 1P2FA 5I4KA 3DJYA 1B3BA 4RZIA 2NNLD 1TVMA 3NGLA 1CS0B 1II9A 2W11A 5D3MA 2JI9A 2QVXX 4WGGA 4YAKA 2WSIA 1F3OA 1Z74A 2ET6A 1PSWA 6AT1A 4RDIA 1TF2A 1KA9H 2C95A 1MABA 4BB5A 2OQRA 2P4UA 2P4EA 3DMPA 3E82A 1PZHA 3KSZO 1WZ2A 4X91A 2QN9A 1Y1PA 3QY0A 4YDQA 1WXGA 3IELA 9GPBA 1NUSA 2WE7A 3W6OA 4W5QA 1FX1A 5BWCA 2J5QA 3NC1C 5JCJA 3R20A 2BKAA 2G71A 2QZPA 2GT1A 1LNSA 2HCJB 2RAVA 4D42A 3BXZA 3AM5A 5A9SB 2JAWA 4CMKA 1FXWF 3KOOA 3KXKA 2PX0A 1L4BA 1SG0A 2DFDA 3TQHA 3NC0C 4TWJA 3KHSA 4CI0B 3OQJA 4M83A 4QU8A 5LQUA 3QFFA 1GYQA 2CXSA 2X4DA 5EJ6A 2P5SA 3I9NA 3I01A 1WP4A 5K3CA 5IRCD 1VPLA 2FAXA 1UBKS 2YVUA 4EJSB 1AMOA 1RJFA 4F7WA 3PFBA 1RRCA 4Z99A 4O2BF 1UANA 3FGNA 3R0VA 3A9WA 4DUGA 3AMVA 3U4CA 2VBGA 2B34A 5JQGA 2Y1FA 3TRDA 2HRZA 2WM2A 4J4HA 1DG9A 3CA8A 2UUAB 3C5VA 1YAHA 3NAMA 1SCUA 3AEQA 3BWBA 1YRWA 2GN8A 2HLDA 1Q1ZA 3EVBA 3SJAA 3G0BA 1PJCA 1VLJA 2WU4A 3FVRA 1I4OA 1WBBA 1KY2A 2H7YA 2QI9C 4UM5A 3IEPA 3VPFA 2C58A 3BXOA 3NX4A 2BV3A 3IPCA 2I91A 2FEXA 1QO9A 4PC6A 2IPXA 2PH5A 5ALYA 3UY4A 1ZD4A 2G0TA 1YVEI 2ERCA 1YB2A 1PO7A 1EJ0A 4Q1CA 4QHSA 1DT5A 3OPVA 4AP9A 2E4XA 5FULA 1TCAA 2LNDA 1U28C 2FQ1A 2R2AA 2Y68A 4H3SA 4YRJA 1E58A 4UREA 3S27A 2L82A 3UXYA 3CVYA 2CDBA 3FRIA 4RA9B 3VGPA 1EEHA 1CNMA 2J9XB 3IOYA 3SZLA 3B1FA 3GRPA 2OP1A 4OMUA 2YC4C 4ZJZA 2IYTA 4FDUA 2ZRPA 4K9SA 1FTWA 1M0WA 3X1ZA 5KTOA 1Y33E 4IIVA 4YAUA 4UMDA 3OQIB 4NK4A 5G4KA 2XNKA 1BE1A 1X7DA 2JDIA 2JZCA 5JHHB 2RBEA 3ACBA 3NRJA 3DCNA 4FJ1A 2JH9A 4I4NA 4I50B 4ANFA 2LUOA 2YVAA 4LRTB 2BC9A 5D87A 2R25B 3CBQA 2BBWA 4BBPA 3BB1A 3H6GA 3EEBA 2C99A 2JZOA 3OBIA 4IUYA 3GG9A 5F3DA 1KI9A 2VF7A 3LNTA 4CKEB 4TQ9A 4TXJA 4E0BA 4WJKB 5LJIA 4QBHA 3FFTA 3HVRA 1FIUA 1U4SA 3QFTA 3B1VA 1DKMA 2GBGA 1VC2A 2EEZA 2I65A 3EC2A 3AR4A 3PNBA 3I42A 1BKDR 2GK3A 3QYFA 2O8VA 1EPUA 3CIFA 4QELA 3N75A 1GQYA 2CJWA 1U0FA 3DKKA 3FCCA 4X85A 4LF5B 3F74A 3ZWKA 4E2XA 2P9CA 2QUKA 3S5JA 4DWOA 1NF2A 3SBDA 1X8JA 2ZJ7A 3H86A 5M34A 3NBQA 1BW9B 2XQFA 4HTFA 4MYUA 3IEIA 3LVFO 1VHTA 3KJQA 4HRVA 4U3JB 3TLXA 3PFHA 5K01A 4OUKX 4ZYVA 1NQVA 1WCYA 4LXGA 4G8CA 2ZK7A 2BUBA 1K92A 4YXWD 4Y18A 1NZDA 1H4VB 1QR2A 3SYNA 2HSGA 1QKIA 1S0UA 3IOMA 4DEXA 2P65A 1CHNA 3A9VA 4IV0A 3FD8A 3URKA 2NPIA 3AV0B 2G0AA 4C29A 1SR8A 4DJJA 2GK4A 1ZUD1 2AQHA 4DXHA 4KHPB 4BO2A 4YRSA 1TOAA 4BNGA 1AKNA 2AFRA 5AHKA 2UUPA 2EU8A 4DC9A 3FOFC 2H4WA 2ZTUA 4Q3DA 1IHDA 3ICVA 2JLCA 3H9UA 5UKDA 3GFVA 2Y0DA 3NBKA 5E6SB 3N6XA 3V1UA 4D8VA 2HW8A 3EIWA 4Q3AA 5GJWC 3UMSA 2EFJA 1RPTA 4F38A 1X1AA 2GPTA 2WAYA 3H65A 3I73A 3T34A 3EBLA 3N6VA 1C7EA 3HDGA 1KVSA 5LXTB 1D2AA 1DAOA 2VJBA 4Q9IA 5IX8A 1DWUA 3M8KA 4UTNA 1N25A 2R2GA 1RNLA 4OI0A 1DX9A 4KK4A 3ZE7A 4KAFA 2M2IA 1NZFA 2D0PB 3D6HA 3L0CA 3RT1A 3P0FA 3N5KA 2B36A 2VDQB 4DE5A 1NXOA 4NYJR 3ZC3A 1G9SA 3GU3A 1DAHA 1KORA 2WK1A 3G23A 3I5MA 2VBFA 1AQIA 1A95A 3FCYA 3HU2A 2Y6VA 2AVDA 1NW7A 4QTTB 3FUUA 3T7RA 2IOHA 4LVNA 4JXXA 1IUOA 1OLSB 1UJMA 4GG1A 4YALA 1KJJA 4E03A 2IOFK 5G1PA 5FA5A 5LA6B 4E3WA 2R84A 2G1KA 2G6BA 2EP8A 3Q3HA 5DMHA 1RYDA 2DFKB 4MPPA 4E31A 1PT6A 2YXPX 1BS9A 3RJTA 3WJ1A 2RB4A 4AS1A 5JS8A 2F1OA 2N46A 2QLFA 4QBFA 2WNSA 3ZD9A 3IPYA 2GZ3A 4FYJA 4NBRA 4GYKA 4WZAB 3QE4A 1YUMA 2E4AA 5FLEX 1L1EA 1JDVA 1JKJA 3MJFA 1UJ6A 1XCLA 3I1YA 3OM1A 3KOXA 4ZEWA 2HGZA 5G0WA 3BYZA 4IH4A 5L3VA 3QVKA 3CX4A 2CWWA 4MJ7A 5CCBA 3AFGA 2VQSA 2QTMA 2QAGA 3UAOA 2WG1A 1E79A 3ZLBA 1G18A 2WVAA 2J5XA 2OXTA 3EXEB 2J3JA 3O84A 3DR3A 3E5RA 2SCUA 1Y6ZA 3GMSA 3CRVA 3FCEA 4QU0A 4YP7A 4P8RA 2I8CA 2HJGA 2RHDA 2NSHA 4AMZA 3BUSA 4PPYA 3EWIA 1SC1A 1QO0A 3FOWA 3KS9A 3KT6A 3FWHA 3I64A 1CY4A 3W5IA 1G9TA 4DGSA 1TQ2A 5B1EA 1ZU5A 2WYIA 3KB1A 3P71T 3D3EA 1KS2A 4AY3A 5LIPA 3UANA 1QIKA 2AQKA 2WMYA 2V6FA 1XD2B 1WMDA 3QJGA 3E22B 3KQHA 1GCOA 1ZM2A 4GXNA 3C6YA 4QQ8A 1Z38A 3SEAA 4WLFA 3IP1A 3BVPA 2D0IA 3U4HA 1RXWA 3WKAA 2XZOA 2LRHA 4M9XA 4DTCA 2IHVA 3WWYA 1XZBA 3L6CA 4KW7A 5JO9A 1POXA 3K15A 3NKVA 5J5CA 4RVSA 2EFYA 3ICPA 1I6LA 4LDAA 3QKWA 1SXQA 3KWLA 2EZ4A 2IXAA 2QG9A 1M75A 3NUQA 4RVCA 4YPOA 3SVLA 3A1VA 1N0IA 5AKZA 2BT4A 3VH3A 2VG8A 3Q7PA 3ZW9A 4DVJA 3DXXA 4ETMA 3TPCA 3PDWA 2CLMB 2JI4A 4KVFA 5LNK6 2UU9B 4ATNA 1U9IA 5GZ3A 1UIMA 4IVRA 1GNVA 2D5IA 3NHLA 3OH8A 1OXVA 1DX4A 1H65A 2WPDD 2ZBPA 4NENB 2XE6A 2G9ZA 2X9VA 3CJQA 3CNQS 1I3CA 4Y2JA 4F6RB 5EIWA 4XQCA 4KWCA 1T2VA 2FZLA 3L3BA 1SVIA 2WSMA 1X80B 2V7GA 4UNPA 3ZKAA 2M6RA 3KPJA 3LVQE 4LZPA 3KQLA 2PKEA 1B2RA 2PHZA 4JR0A 2V6GA 4OF4A 1JKIA 2XAUA 1DT3A 3L7KA 1U6JA 4OK6A 5DSZA 5AUQA 2HIMA 4LSZA 3W06A 1V1MB 2FFAA 5C52B 1QSGA 3MEQA 4NYIQ 3S2SA 3HE3A 1Z2DA 3BEDA 5FTNA 3C15C 3BN3A 2XXBA 4KQXA 3QP9A 2XZPA 1GCUA 4NI5A 3H1TA 2PX2A 5LQKA 2VBIA 2A0XA 5HOEA 4KODA 1SD2A 3DB2A 2A88A 4GLFA 2P3SA 2ZXUA 4DSUA 4ZEVA 2ZUFA 2ZAIA 1KPGA 4FGSA 4R9UC 4UFPA 4G86A 3SXUB 4N6GA 3TXAA 1SKYB 2HUNA 2XUGA 4MP8A 5JZMA 3ESYA 1KJQA 3FH0A 5AI8A 2YXDA 2RE8A 4QGBA 3DMNA 4YMSA 1II0A 4DIMA 4Z2AA 2HSEA 2A35A 2V8BA 2VSFA 3CE9A 1PD0A 4IXTA 1U7ZA 2FPIB 1NKSA 2FQYA 3FY4A 1V5IA 1X38A 4RE5A 1KI8A 2P6PA 1A8IA 1P33A 3DULA 3T7AA 4HLCA 2PL3A 4NZOA 4Q01A 4XVQA 2TMKA 5M29A 1G3IA 1LTQA 1QANA 3FLAA 4UNIA 1E5QA 1PK9A 5CVVA 5AMXA 1CWUA 2H52A 1R4AA 3ZHSA 3ZW8A 1YBAA 1NBOA 1WPXA 4R7ZA 2X14A 4Z4EA 1KU6A 2MWMA 3BB4A 2JKZA 1A77A 2CDAA 6GPBA 2O7QA 4XIYA 3L0PA 4ZIRB 1RZRD 4AYTA 5SZHB 2R1VA 4U6NA 1N57A 1GGVA 2VOEA 1XYYA 2IQ5A 2ZAGA 4ONEA 3BS4A 1SZDA 2Y2VA 3SP1A 3CUSA 1WM1A 4FOPA 2PXAA 2HJSA 2ZIZA 1A9OA 2HHAA 1E9FA 3GCDA 1QTRA 1N6OA 1YD7A 1BHSA 1QG2A 3A0UA 5BSRA 1J2RA 3T3EA 3EVGA 3D7RA 4JH0A 1ZXXA 4Q3NA 3EFEA 1P7PA 1BQEA 2ZG6A 3E03A 4ID9A 2YYAA 5TEVA 2VUIB 2WHPB 3AEZA 3L18A 1Z2EA 4J0GA 4A8JB 4AZVA 4DLLA 3W5CA 3O8OB 1U2DC 2NU7A 2CVHA 1ZM7A 5AWFC 3RV3A 2Q27A 3USCS 1UQRA 1R9NA 2C61A 1R16A 2Z2YA 4BNKA 2FZKA 2C88A 2KX7A 5F12A 3EZFA 5EP4A 4C7XA 2BIFA 3NALA 3L0SA 4DR5B 3OKAA 4EENA 3V4VB 4U7PB 4B5KA 2B25A 3ETDA 1E2BA 4DCTA 1HE2A 2ESRA 5K6AA 3OWOA 2XV1A 3AVOA 3SJZA 4BGUA 4CL0A 5AVVA 1E1MA 5HRUA 1U3TA 4MAMA 1TTTA 2D7CA 2C5BA 2JFUA 2XNHA 3O21A 1HOTA 4M0UA 3ZZMA 1KO8A 3ANLA 3KOZA 3N76A 2QP3A 2Z6QA 3EZXA 3TVTA 1W581 1KYZA 1YASA 2XY4A 2I1WA 1I2CA 4GYYA 2OQVA 3RTGA 1U0TA 3HCDA 3ENWA 2G1AA 4L8VA 4JUIA 4AX4A 8GPBA 3NEAA 3UPDA 3L6EA 3DHEA 2CDNA 2R87A 3GVHA 5KCZA 2GZAA 1KEZA 3BHJA 3CX7A 4FYWA 4MX8A 3ZZ0A 2PUBA 4UAUA 1I32A 2NTEA 3MGGA 2NPFA 3BBLA 1SUCA 2NNWB 3ORSA 3O8CA 2GJKA 3PE6A 4KREA 1GTRA 1JECA 4B4WA 3KEOA 3ZE1B 2DKFA 3RU2A 5LU8A 4OYYA 4CTNA 3TB6A 1EBFA 5IPFA 4RM3A 5KNCD 5IZ4A 3BE8A 5TDHA 3MT0A 3DAGA 2FMIA 2C3OA 1WHSA 1QHEA 1EYZA 4DA6A 4ECAA 1O94C 2P9YA 1CVIA 3KEGA 3KYIB 4YLEA 4IRXA 2QG6A 1WCIB 5EQTA 1V9CA 3PPYA 4M1TA 5FPYA 3WLPA 2WM8A 3H1EA 5E0OA 4HRXA 3ED1A 4OQQA 5ELLA 3JAWA 2PX5A 1GZ6A 4X6YA 1RLUA 3TZEA 3K9QO 2XVMA 1TT5A 1XU9A 3Q7EA 4YONB 4KXXA 4KPFC 1E1NA 3ILHA 4EG7A 5SYNA 1Z29A 2NSLA 5CA0F 2AK2A 5LQNA 1KVTA 4KQ6A 3ZZUA 1V37A 2D3WA 2XECA 3EAGA 4QLAA 2CNOA 1OQAA 1Q1AA 2FSSA 3CKKA 4CODB 5FV4A 1FVHA 3A25A 3ET4A 2VSYA 2O8BA 4FHGA 1KARA 2CJXA 1Z5NA 3PGJA 3E58A 5TQJA 1W1UA 3DDUA 2O9JA 4QEKA 4DF3A 2YVLA 3N05A 1GR1A 2EX1A 2H5IA 4JB3A 3SX0A 5T6MA 3I6QA 5AOCA 3TW6A 5BOSB 1LDGA 1ZLYA 4KYUA 3AR8A 4I6GA 5J47A 4BVFA 4OQZA 2H1IA 3QF7A 3QEOA 1O08A 1C0KA 3DLTA 4XR9A 2V9ZA 1OX5A 2XDQA 3F6BX 3VDXA 2GFQA 3AY3A 4OXRA 3A1UA 3TLMA 3WK4A 4WACA 2Z57A 3PR3A 4IG9A 3H8SA 2KYRA 1JPUA 1U8YA 1YGPA 1VJ0A 1P7ZA 1QH0A 1R88A 4I3HA 1QAOA 3A2LA 1SXJC 1ST3A 2CNNA 4US2R 1J21A 2FY8A 3KJIA 2REOA 3DBOB 4Q4HB 5BVGB 1DOZA 4I3FA 4YAFA 4CM9A 1Q0LA 1HE1C 3GZNA 3WL4A 4CKCB 4R51A 3CWCA 1VQ1A 4HGRA 1CQIB 3ZWBA 3NHKA 4B1FA 4L5CA 1FOEB 2MDTA 4DYVA 2C5HA 1FDTA 4YMLA 4LI3X 3EPPA 1NVFA 4MIYA 4YP5A 1TCUA 3P94A 3OE7A 2PG3A 3KJHA 3KP1A 2QX9A 4CMGA 4HYQA 3I37X 3IVCA 4PZPA 3ESDA 3T61A 3GEHA 2NAFA 3ZU6A 1UOQA 4I5GA 1N2XA 1GT91 1H2AS 4Q1FA 2IU0A 4ERNA 1L7DA 1VJ5A 2BBOA 4TTRA 1TVKA 3L84A 3W2FA 4MRVA 3VU3A 4UEWA 3R9IA 3I2KA 1ARZA 4H4DA 1GRVA 3IKJA 1NJ8A 5J4KA 1RAGA 2QZZA 5AW8A 2DVMA 1GFSA 4N4AA 4JVLA 1FRZA 5FL7A 4URHA 2CNWD 4K9RA 2H6EA 4PZUA 5E9JA 3OSUA 4G1FA 1Y6GA 3M6VA 4D99A 4HXGA 5J2TF 3VNRA 3W8EA 1UBCA 3GRCA 4MVJE 3IJ5A 5A4DA 3H0KA 3AERA 4HDAA 5F2NA 5E1DA 1L7EA 1ZCBA 4C2BA 1FX0B 1QHHA 1QV7A 1YOVA 1N0HA 2VYVD 4BEVA 2VPZA 4JOQA 3V8QA 1JEYB 3UHPA 5ITZB 2MR5A 3JQAA 1AK9A 4NU0A 4EG3A 1W49A 1QIDA 2LZ0A 3PBKA 1P9OA 1ESMA 3GPIA 4P2GA 1QP8A 2OCYC 3IT3A 1ZD5A 2W2NA 3SPXA 3MVEA 4Q12A 1H0SA 4URYR 3X2FA 2BFEB 2BP7A 4Q7MB 3H1AA 3TOZA 1WXWA 3VSEA 3ZNPA 3OT1A 3VVCA 1MPTA 2I2DA 1K3TA 4F71A 2JLZA 1ESZA 1MQSA 4ND7A 4AJNA 3KQVA 3DR5A 1V2GA 2PIAA 4OXNA 1QFYA 1KK2A 4PVDA 4UBNA 3N74A 1LK0A 1TKRA 2HFKA 1JA0A 3ZUGA 3KOWA 3GLFA 2GNAA 2UZ3A 1VSTA 2Z1DA 1Z35A 1UCFA 3GZ4A 1K8ZB 1R8XA 2AI3A 3IVXA 3LGAA 3Q5DA 4KXMA 3OLZA 3Q3GE 4MMZB 2O5RA 4WOCA 1Y3HA 1BDBA 3LGSA 1UZAA 4ZEOA 3IVAA 3GMTA 1KOGA 3V4RA 1W34A 1PR5A 5EXSA 3PF9A 4J2HA 4XJTA 1AV7A 2Q0XA 2JIOA 2Q6LA 5J2UA 4C7OA 3EBOA 2CK3D 5IDXA 3SEFA 1OA0A 1MJ5A 3EVDA 1G8AA 5JJLA 1XMIA 4F8JA 2B92A 2C7GA 4GP7A 5F35A 4E11A 3EG5A 1WPGA 4MA0A 4D80A 3PEVA 3K0CC 4MWGA 3CLUD 3D7SA 1JIUA 4M1YA 5FTLA 3GPBA 4NBVA 4YJ2B 4EEKA 3N8KA 4G4SO 1SCJA 3UYLA 3JWGA 1NJ1A 2ZT8A 1O0CA 1XP8A 3EH1A 2R6HA 2QMOA 4Y98A 4DPLA 5A0TA 4N65A 2H1HA 4OLFA 3F6CA 4JWTA 3FBWA 3L05A 4K2HA 1G66A 4LJAA 1A2QA 2VYVA 2IHZA 2WMNB 1T9KA 2QQ5A 3AXSA 1BROA 3EEYA 3QKTA 4IMIB 4LV8B 4YRRA 5KNDA 4OU5A 2P5UA 4HDQB 3UGKA 2ZE5A 2V7WA 4JL8A 3HVIA 3V7WA 3OTWA 3PWKA 3IA2A 3NTQA 3RI3A 2PM8A 4IYRA 1G7RA 3VR2A 4JU8A 5JANA 4FHEA 4WFJA 5BV0A 4AY2A 4INOA 4DY6A 3RT9A 4US0R 1HX7A 2DZDA 1Z6GA 4F5DA 3A1DA 2J08A 1SCUB 5FFMA 2WB2A 4WQMA 1N7GA 3HN6A 2ECKA 5EHIA 1TU3A 1DQSA 3IUYA 2MSDB 3WGZA 2W4MA 2ES4A 4OJMX 1PJQA 5AKXA 3TW8B 4WJLA 4HDSB 1UT5A 1AHIA 2QXUA 5B3AA 4UQPA 4UVEA 2QJTA 2CSXA 2ORED 2CHUA 1BHQ1 1IN7A 4UBOA 5AKIA 4ZXFA 2XODA 4JLUA 3AIIA 5FF9A 5TX7A 5B6JA 1EBBA 1ZY2A 5CDGA 2CNLA 1CT9A 1JN0A 3O9MA 4P4NA 5TT0A 2PD3A 1IQRA 1Z34A 4OHMA 2UXCB 2IZOA 4PO8A 3EXAA 4XGIA 1MJNA 3VPGA 2E48A 1ORHA 3A1FA 4I1SA 1SOWA 1PDVA 1IVSA 3HXPA 1SIUA 2I62A 2QUAA 3WLRA 4B6SA 1N4DA 1V26A 5CAEB 1J06A 4L4ZA 5IAOA 2K5UA 2PLFA 1UBUS 1TZBA 3MQFA 2PLAA 1ECLA 1Q11A 3HYCA 2FSPA 1WRBA 1JEEA 1MA0A 1ZW1A 4OXIA 3BBPA 3PD7A 2BY4A 3TBFA 1P77A 4R9NA 5CCXA 1DTEA 2W37A 2A9PA 2AMFA 2IDJA 5EKUA 1Z63A 4I1VA 5AQ1A 3E2PA 3RE1A 3TVDA 5EXTA 1JSLA 4LFCB 3H1PA 5EIAA 1PGQA 2Q1YA 1BWSA 4DMFA 4D79A 2ATVA 5KHAA 2IXFA 4OYRA 3ZU3A 1MZVA 4DM3A 4L8FA 1NBAA 1BFDA 5IZCA 1U63A 1YNOA 5K1ZA 2PKQO 4E51A 1W6UA 2JARA 1I36A 4PWZA 3VO9A 4XSGA 5DX1A 4A8PA 1QUFA 2H2AA 5A7HA 1MB2A 1Z17A 4IOJA 3OCVA 3QXHA 4Q21A 2XB2A 4LXTA 4DGQA 1PWEA 4DHEA 3P8ZA 2HXSA 2Y66A 4UW9A 3PICA 5AKKA 5LZ4A 4IMRA 3LXMA 2Y4OA 2Y1XA 3WSWA 2M32A 1STOA 1V4VA 5BN1A 1R6AA 4IVQA 1FQOA 4ZDWA 2NZJA 4FW9A 1HYHA 1FSGA 3STWA 1EX1A 2YIMA 5GONA 3WQHA 4JLPA 2P62A 2FOLA 4JUDX 3KKQA 2HXYA 2XD9A 4JP5A 3LUHA 2I4RA 1X13A 1DV2A 4QUAA 3O73A 3M3DA 4NKRA 4P5PA 4UZSA 4FYKA 3W3AA 3T5MA 3H3FA 2X7JA 3DUWA 1P2TA 2Q7XA 2R6FA 4BTLA 5L8VA 4PNEA 2J3DA 1EM8A 4GOLD 2ZBFA 3HRIA 3X1XA 4U6SA 2FPUA 2LKDA 3L7MA 1HTBA 4M21A 1PCXA 3THYB 3U4QA 4G5SA 5A4AA 4ZVNA 4HGYA 3EPHA 3LZDA 2PQ0A 4QATA 4GVPA 1P75A 1A9YA 1P4JA 2ZVPX 4KKVA 1OFUA 4REQB 2O48X 4YIKA 4EHHA 4K6CA 2P41A 2XKBA 4JZKA 3VYTB 3NVMB 2GDJA 4BP8A 5E2BA 3GOHA 1SMKA 3IIEA 3KV3O 3VC1A 5JSHA 3N53A 5AI4A 2BSQA 1T0HB 4G4IA 2ZRCA 3PNMA 4FMDB 3B9PA 2MSKA 3D59A 2DC1A 2ABWA 3O8LA 4HS9A 1R0ZA 4MW1A 2X1HA 3OFNA 4OQFA 1P9LA 3ANXA 4PBSA 4YLGA 3CNNA 5EPEA 4C2UA 1UFRA 1WVIA 1DWQA 1WLSA 4KLNA 2PUTA 1MC5A 4G5XA 1VG9B 1Y9ZA 1M67A 4LHYA 3IQZA 4IDBA 4CIDA 4FR5A 1IOZA 1IBRA 1EG2A 2C83A 2NV6A 3EFOA 4FHCA 4WY8A 3GG2A 3U1VA 3WZMA 4ZMBA 1JDNA 2FW1A 1QVZA 2J9RA 2M1ZA 3Q0IA 3ZXIA 2ZBGA 3DWGA 2H48A 3JPWA 3NAGA 5IC5A 2C57A 3KT3A 2GVNA 5DM4A 4K6FA 1ZVKA 3V2HA 3H5WA 1ZJZA 1GAEO 2A78A 4CM7A 1WB9A 2ILVA 1ZL2A 2Q5EA 3NIWA 5LDDC 1QVVA 3AF4A 2BM9A 2X0FA 2PY6A 2A5YB 5LQJA 1KY3A 3KAQA 1J97A 4EHJA 3D1JA 3G0GA 4K9KA 2COUA 5FTKA 1KMNA 1HRDA 2WTUA 2ZRKA 5JAMA 5F51A 1ZONA 2A5FA 1GGNA 3GJ0A 4XWWA 1U28A 4IJWA 4Q3KA 2PRJA 4YRBA 4BGVA 1CZUA 4QUIA 5EINA 4FINA 3OQOA 1MH1A 2ZBDA 1NMZA 1PX0A 3SIRA 4N40A 1JL3A 3QJ5A 3SY8A 1X7GA 3K31A 1PW7A 3V5NA 2HHLA 1ZH2A 1CZKA 1SXGA 4RSRA 3V6MA 4Z7JA 3EDCA 3WAJA 2FPGB 3GWZA 3KXIA 4YMVA 1NJ6A 4OI4A 4KAAA 1BX3A 4PYNA 4NAUA 4YASA 2ZSUA 3PQEA 4DV3B 2YVKA 3FG9A 2YFKA 2W98A 3OO1A 5ECDA 1IUPA 4DQDA 4F2DA 1KI6A 4IFBA 4JENA 2O8FB 4CM8B 1Y1LA 5JSZB 1RQ7A 5AW4A 4EJSC 3N8NA 3PXDA 3CKYA 4IIGA 5IAGA 1HXHA 1QFSA 2E55A 3NM5A 5BSVA 1F60A 5GZ1A 3PCRB 4ZOEA 3B6ZA 1U7PA 3L02A 5D5HA 2SBTA 2PH3A 3BMQB 4LDJA 2JFVA 2ORIA 3TEFA 3ZU5A 4FOTA 1IK6A 2CFOA 2JGIA 3WFZA 3MXTA 5E1BA 4XVUA 2F43B 4K9OA 4JT2A 3GRUA 3LT0A 3J80A 2C2OA 1RRGA 2QD1A 1RWVA 1W96A 3UO8B 5EYPA 3C7TA 1AO3A 4DYDA 3PCXA 2QUIA 3C3BA 3SCZA 3OQMA 5HA5A 3I1IA 4CLOA 2VJLA 3CF4G 3E9QA 2HRRA 1FTNA 3O90A 4Y67A 2ROQA 2Q2NA 3D7LA 1YR8A 4LGVA 1W75A 2W2MA 1PR4A 3BD8A 3DZJA 3H6KA 4YRTA 2ZATA 2H7VA 3HUTA 4HNSA 2HEGA 3PFKA 4TKLA 3WGTA 3TSWA 3AR2A 3ZOKA 2FLWA 4WASA 5BV2P 1K89A 3UWMA 5KYGA 4J07A 1BCSB 5B30A 5CX1A 1JMYA 3KVNA 4KOAA 2OILA 2WJIA 1OLOA 2EX4A 4BNXA 2GEBA 2VXBA 1NDUA 4FGZA 5DYNA 5H3CA 5HF5A 1XFAA 2DPYA 1O1YA 4JJZA 5HE8A 4YUAA 1OH8A 4NWIA 1Z0UA 1COZA 2AN5A 3WV4A 4B46A 3EOZA 1QO0D 1SD5A 5K3BA 2PUGA 4BFTA 2VZ9A 1Y3IA 1GZSA 1ZIXA 3QVXA 3CR3C 3AJ9A 3QNWA 3AJEA 4KVZA 3JQAB 4M36A 4ND6A 4P3KA 2YW9A 2Y0BA 3U9TA 1ABEA 3WWEA 2Q4OA 4DWVA 1FX0A 1NX6A 1XTKA 1YOVB 1FXSA 2HA7A 3BQ9A 2WKWA 4MDFA 2WU8A 2X5XA 3EWSA 2ZI5A 3HWRA 4MZDA 3CPEA 4KIGA 4B74A 4C0WA 4KPEC 3PI7A 2M6KA 1NOIA 3RS7A 3T54A 1L8LA 1MV8A 2FKAA 3AOEC 2VPYA 3SD7A 4PPQA 3FUTA 3ZH9B 4E1VA 1KZ4A 1ODFA 3PE3A 5CB4A 1U0SY 5B6PA 1FFEA 3DVAB 3LHFA 1G5TA 1T5OA 1Z0ZA 3MOIA 4H7PA 4HO1X 3D3JA 2G72A 4YFVA 2PN1A 2R9VA 1G3QA 4V0ME 5L40A 8LDHA 1H4TA 1SY7A 4RLHA 3DEYX 1O0BA 1W8IA 4Z4HA 4UQLA 4XQGA 3E7XA 3VYWA 4C78A 5KI6A 1NMXA 5ECYA 1W29A 1SU6A 1XA0A 2IYNA 1ATZA 3ZDEA 4LNAA 4C4YA 2P0EA 3AKDA 5DWVA 2OD9A 5KTNA 1BGVA 2PA0A 4EUNA 4K46A 1Z0IA 2TS1A 3BGIA 3IOEA 1WTAA 2FP4B 4ZDJA 2RCYA 4CR7A 1F2DA 2W2OA 3MWDB 4PZCA 5JNLA 1BXKA 2LW7A 621PA 1WQ1R 2QM3A 1QTIA 3E1KA 4U5XA 1PV1A 1RD4A 2QTLA 1SUWA 3DE6X 1XJ5A 4O0LA 4QDJA 4PNZA 1DRWA 4RD4A 4ARSA 1PG0A 2DUMA 3QIVA 5CLIA 5K0SA 4ZZ1A 2CMHA 2EFEB 5BN4B 1VLZA 3DTVA 1UXGA 1MAWA 4J9UE 1KHHA 5IBCA 1K86A 2B0CA 2BKXA 5D7BA 4D9CA 1ML3A 3AW8A 3DOCA 3MF4A 4MWZA 2PYDA 3RVKA 2D62A 1JQ3A 4MR9B 5C8ZA 4RPJA 5HK8A 5BSHA 4JHXA 2C7BA 2JA2A 4BVKA 5K8LA 1KVUA 1G98A 4HH1A 2ATEA 3MJRA 4M55A 1C7JA 3BWMA 3SYKA 4EMTA 4RSHA 2BTQB 2NZXA 4QQFA 1QQ7A 4XIJA 1GUYA 2P6MA 1WE2A 4P33A 3BJIC 2ZB8A 4Z0PA 2WAXA 4R41A 2H9YA 1YTUA 2G9RA 2IHBA 4Y7CA 3FWPA 4OM7A 4C7MA 5LZ9A 3VBCA 1LQTA 4LZOA 5BWLA 2VHZA 7REQA 2W6CX 3VGJA 3GFQA 1GQRA 4RD2A 4ASUD 3PD0A 1P1HA 1BDJA 2CBGA 4L9AA 3LYUA 4UBMA 5G02A 3CINA 5GY7A 4FQ7A 4HR7A 4W82A 1F2UA 3R7WB 3G9XA 3CEMA 2RGYA 4G81A 1J90A 1GPH1 1V6CA 3EDOA 4WCFB 2PMBA 1IZ0A 1C3XA 1LZLA 1TUBA 3R3VA 4WKPA 4DRXB 2CZGA 2BRUA 3OIFA 2V7EA 4DZZA 4LWOA 4NCNA 3G6WA 1T5LA 5A6SA 1APBA 3Q2IA 4OGLA 4Y1RA 3BSWA 2BF7A 3V46A 4F3TA 3EUEA 4G4GA 4GOKA 2HK7A 4MUBA 4UVHA 4D5GA 4URXR 3I9FA 4ZVUA 3M33A 3TRHA 3P2YA 3N0RA 4J1TA 3HZOA 4O4HB 3BICA 5IYZA 4CM1A 3DBLB 1A9XB 3DV9A 3UC5A 1D1PA 2C4NA 1C9EA 2PU7A 3HK2A 3NH9A 1B76A 1YZQA 3MBKA 2P4HX 1R4MA 1SCDA 2EGGA 4KUGA 1YS1X 1ELOA 1R9GA 5ABPA 5KX5F 1Z5ZA 4UHBA 4K6GA 1QOPB 4HB0A 4BBZA 2JRLA 4MIOA 5BUQA 5EHNA 4C4XA 5IBRA 2FZ4A 2I7DA 5AJHA 1HE5A 1EKXA 3QXXA 4UNNA 5DOZA 1ZK1A 5C9ZA 1IQ0A 1RVDA 3OIDA 2WI8A 2IZZA 4M1SA 2AL7A 3SVZA 3X3HA 1G0OA 4WBNF 1F6WA 1OXTA 2V5UA 3DFMA 2BDEA 4REOA 1E5LA 4ND3A 1N6IA 2DTDA 3GZJA 3HV0A 2DJIA 1QGYA 3KTDA 4GZ3A 5LP1A 2E5WA 1EH5A 3A2KA 1CQIA 3KFXA 1NFRA 1GKUB 2UZ1A 3JD0A 4XUDA 2AMVA 4P4GA 4FFLA 2BJVA 5BSEA 2DR3A 2C9OA 2XIQA 4CLEA 3IURA 1BSVA 1KSFX 4I4IA 3AM1A 2XYVA 4PYMA 3G2OA 4MGKR 2IEAA 3JTMA 3OTIA 2QM7A 1MW8X 4QJ3A 3G2PA 1PL7A 3OSZA 3K8ZA 1L4UA 2ZJ2A 4TXNA 3UB2A 3ZYZA 1NPTO 2WQ7A 2EP7A 2GK6A 1EE1A 3G8YA 3LPAA 2BFPA 3H9JA 3EEQA 3HGQA 1AG9A 1L4KA 4RTSA 3PXEA 3V7UA 2HK9A 3MG9A 3SC6A 2Z2ZA 1R9JA 4AQ7A 3FCUB 4UBJA 4LTMA 3WMWA 1T2NA 2B8TA 1BQ3A 4ZCLA 4F8YA 4MOWA 5HGJA 2R6AA 2AVNA 1I1QB 2OC9A 1B3RA 4IDQA 2OVFA 1RACA 3TTVA 2PS0A 4FS3A 2XB4A 4R8MA 1K6JA 4ACBA 2MU1A 1RHUA 5CVEA 1OFVA 3O2SB 1LI4A 1GG2A 2OG2A 2GAJA 3N2EA 4JL5A 1DDOA 4PAOA 3FNRA 2W42A 2XE7A 2UXBB 4XGKA 1R0WA 5TPZA 1OU0A 1U3VA 5AI5A 2WW8A 3FBGA 4QDKA 1WNFA 5HJ2A 4FBGA 3WLKX 5AM3A 3UJNA 2OGZA 3O4FA 4EUKA 4D96A 2LE0A 3ECCA 3KQQA 4Y9UA 1F4PA 2Y4NA 1NI5A 2Z3VA 2XADA 3EZ7A 4D8XA 3TMYA 4BS9A 5IULC 3A6LA 1MTZA 3QI2A 4WADA 5J40A 3WWPA 1NT2A 2D1YA 4G1CA 2W22A 5GOZA 4NULA 2O06A 4JJ4A 4A26A 2IEIA 2BGKA 3KALA 3G9TA 5KDLA 3ZQUA 4A91A 1I0LA 4DW8A 3ANNA 4KGVA 1JLKA 1UBFA 3QVSA 4R2IA 4TSFD 3HLYA 4IH1A 4PLCA 5K0GA 2BGNA 4QT4A 4TMKA 4TWBA 3ECAA 2Q3MA 4L07A 5BV1A 1VL1A 3MGAA 3V32A 4B31A 3JZDA 3HO6A 5IT5A 1Z4QA 4KV9A 1WW8A 3I8OA 3GYGA 1Q7CA 1T6ZA 4MYRA 1ZVQA 4UEJA 1QGZA 4ZO4A 3NUZA 3SR0A 3BHMA 2G08A 2A1UB 4NMLA 5FOXA 1C30A 1CUGA 2H08A 4DIEA 1QZUA 1KZ9A 5C31A 5A4MS 1NU8A 2GK7A 3I3SR 1I7NA 4YJKA 3TI7A 4YREA 4DT1B 4EO4A 3S8MA 2WUFA 1XKTA 2AXQA 1ZK2A 3QJYA 3TM4A 3ITNA 3U80A 3M4ZA 3ZK8A 2J6CA 3QK7A 4RHXA 5ILQA 3KQKA 3LUPA 2Z09A 1OE0A 4RF3A 5DNCA 1XWWA 1Z6PA 3INYA 1L5HB 3LFUA 2CHEA 1E1QA 1UWLA 2CDRA 4ICIA 4UZFA 4EI7A 1KZ6A 3IRUA 4OHKA 1ISPA 3BK7A 3TNYA 1WDLA 4XEHA 1VPEA 4FFWA 4E5PA 4QPJC 3QLUC 4L4XA 2W2TA 4L8WB 1YHYA 2G9NA 5TGZA 4RC9A 1HSOA 3VU9B 4IIJB 4DT1A 4ZO8A 2Q4DA 3IHWA 3M82A 4LDNA 3OX2A 1FFXB 4JNCA 4MPRA 4Z8XA 3RRBA 3IBSA 2QORA 2C54A 4NBTA 4NCJA 5DHAA 2F17A 4LRUA 4YMGA 1JTVA 4FYPA 1MJGM 1P0FA 4HI0E 3P9SA 4UUQA 5F7JA 3DV0B 3I30X 3PZRA 4IDNA 4EK9A 4QUDA 4HOYA 2C7RA 3I05A 3AESA 1JI0A 2NADA 3OESA 1J20A 4FHDA 4LDPA 1PV4A 1K8XB 5LKAA 4TT8A 2AS0A 5DM0A 5GIPE 1R1DA 1WLYA 2XYRA 3AEXA 3MQ4A 2AJBA 3DPIA 3QIAA 4CIBA 5JEDA 2BGTA 2C7QA 4MYHA 1O87A 5H81A 5GVSA 2BTEA 1F2VA 1E0KA 4FE7A 1USKA 3G0CA 5K0NA 1BMDA 5DB4A 3WGIA 1Z4PX 2GJAA 4TMFA 4OHXA 5NLLA 3O95A 3W8RA 4KXYA 4A0SA 4BUJA 3GAAA 5M04A 1KJZA 3JQ7B 3C1UA 1IZ7A 2LWIA 4GMXA 1KQ3A 1MU0A 3M81A 5FBZA 4FGWA 3Q1LA 3RO7A 4QRHA 3TAUA 5CFNA 5IM5A 1F7UA 2AFHB 2VJAA 3GJ7A 4ILEA 2VZLA 4BVHA 1U7OA 5FIUA 4I5DA 3WL5A 3ZTYA 4AO8A 2ZE7A 1R3UA 3R3HA 2Q5HA 5DWDA 4CIVA 5J4VA 2CHGA 4Q05A 3S2ZA 4B4OA 1IBLB 3WOHA 2ZQ5A 3F6EX 1NUUA 1HEYA 4QRDA 4ID3A 1EINA 1OUMA 5JAZA 4RELA 1FVOA 3VYVA 5I4CA 1A8QA 5A6SB 1W2GA 2CMFA 3ID6C 1PL6A 4NBLA 2BGJA 4PX9A 2PRSA 3EY9A 4XTCS 1PQUA 3KCNA 2G7MC 1R6UA 3DFIA 3W9BA 4BL5A 1JHRA 2BEKA 2H1CA 2JBAB 2OHFA 2HQSA 3GQBA 5G0VA 3H2ZA 4IFTA 2IP1A 4PYLA 4NH0A 5SYMA 4JD5A 4O63O 3THWA 3K2IA 3CV3A 1X3SA 3DDNA 2YMQA 2ZYTX 4NYMR 3SSNA 1SXJA 4DLRA 3DH0A 2OK7A 2VCHA 3MWYW 4K9PA 5CFZA 4Z3OA 3IVGA 2Y6UA 5CM9C 3N0WA 3O26A 4G5RA 5CK4A 4HPXB 4UOQA 4J0KA 4DANA 2ZSDA 4C04A 5A5DA 4H7FA 2WSSA 1YBVA 2F3SA 4WZBE 4BJHB 2MSEB 2OZLB 4BFCA 3HBAA 4RZHA 3FRJA 5CT4A 4QG3A 4WZAA 3SZRA 3CUYA 4DDVA 1LPSA 4BNFA 1KAQA 1TJ5A 4KO2S 3GFRA 4PS0A 1EVZA 4B7AA 2AMYA 2JFXA 4Q15A 3LX6A 2H1FA 1N2GA 1WPQA 1XCMA 1G21E 2ASEA 1QF9A