3RROA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from vibrio cholerae
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
247
structure length
247
Chain Sequence
b'SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-ketoacyl-(acyl-carrier-protein) reductase
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
total genus 90
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3rroA00
3JYQA 2AQHA 1R12A 4IJVA 3HDHA 3K73O 1C1XA 1LQTA 2HMTA 1N9GB 2IZ0A 1U4SA 4GLOA 4JIGA 1J5PA 3GY0A 3UF0A 2VQ3A 3CKYA 1OI7A 4IDFA 1K89A 4GWKA 1V35A 3EZYA 4MJLA 5B12A 4ITUA 1C14A 2DBZA 1MXHA 4DPKA 2DU8A 1C1XB 4I08A 2DUWA 5G0VA 1KVQA 3D3EA 3ANMA 4TROA 4WLVA 2P5UA 1N92A 4QXMA 2D8AA 3UUWA 3ZV3A 3UKOA 1VL8A 4CLXA 2C7VA 1VKNA 3BTVA 5LDHA 3PXXA 3ASUA 4RF5A 3FBTA 4II2A 5L7TA 2GO1A 4DIOA 3BAZA 3NJ8A 1GYQA 4GGOA 4L0QA 2YUTA 1KIFA 2OMEA 4YRDA 5TLSA 2H6EA 2Q4EA 3INRA 3JQBA 1GADO 1HE5A 1TT5A 4PLGA 3O8QB 1W4ZA 3JYOA 5KVQA 2JCVA 4YYZA 3EYWA 3GK3A 4GSLA 3CSDA 4MVJE 4NQZA 3PHJA 2VT3A 2IEDA 1WVGA 1GCOA 1F8GA 5L4NA 2GCGA 5BNIA 1VJTA 4NFYA 4IS2A 5GZ1A 2DTXA 4PLTA 4NNJA 1NWCA 4PCVA 1KEVA 1ISFA 4TQGA 3F9IA 3O9ZA 2FZEA 1C0IA 2BFPA 1R0SA 3KRTA 3ROKA 3K5PA 4L75A 1R6DA 4FB5A 3BTUA 5T8KA 2VHZA 5JFOA 4XGKA 5A3JA 2XF8A 3HN2A 1P3DA 1AXGA 3T4EA 3GR6A 3DXFA 1E7SA 5KVSA 2UV8A 2HK8A 3FNEA 2ILTA 3O4RA 1PZHA 3RBVA 5CDUA 4L76A 3WSWA 3SLKA 4Y6RA 3L9XA 4ND1A 4Z9YA 5KJ6A 1XYGA 2X0NA 4DRYA 3TPCA 3FRJA 1PWXA 3TQHA 3AOGA 3F47A 1P1IA 2VUTA 3AOEA 3FR7A 5G4KB 2P2SA 4BQPA 1D4FA 3LT4A 4J9UE 1HYGA 5COQA 1XSEA 1H9AA 4YQYA 3E1KA 1RPNA 1YDWA 3L6OO 4BNUA 1PJQA 1V9LA 1JKFA 2IZZA 3OETA 2B5WA 3QA9A 1V3TA 3D5QA 5CDYA 1H2BA 2FR8A 3C1OA 3RC2A 3GGGA 2J3IA 3KV3O 3OECA 3DWFA 5F5NA 3MJ4A 4CMBA 1H5QA 2PD4A 4A26A 4U5QA 4OXYA 2OP1A 1UDAA 2VT2A 1E5LA 3H5AA 2NACA 3X2FA 2Q1TA 1E6UA 4IXTA 3JQEA 2OGUA 1MUUA 3GMSA 1GEEA 3A4VA 5IAAA 2DLDA 3DZBA 2CDAA 2C5AA 1LRLA 4CL3A 3FWZA 3W8DA 1UR5A 4DL9A 4NU6A 2YV1A 1L1FA 4CLHA 5DBFA 4D42A 1KEUA 3TNLA 1NR7A 4GWGA 4ESOA 3ZHYA 2Q2VA 3D7LA 1LXCA 3Q3CA 2G17A 4FJ0A 5EPOA 4P22A 2J3KA 4EBFA 4M55A 1R15A 5CPFA 4BOYA 1E7YA 3LYLA 3RUEA 4B3IA 3NTQA 4N7RA 4BNWA 4RORA 4F3YA 2O7QA 3ROPA 3AU9A 4RPJA 4RZIA 1UDBA 2O3SA 4FFOA 5CP8A 2PH5A 3P2YA 2YFHA 4YAEA 3RSHA 4D0RA 2PKQP 1U7TA 5B4TA 5JS6A 2WYWA 3JV7A 4GVXA 4CPDA 2DBVO 1JA9A 3G49A 1LDNA 3QVOA 6ADHA 2XPCA 4MVJP 4LRSB 4HNGA 4ALMA 4HBGA 2AE1A 4QO7A 1UXGA 4GL4A 2DQ4A 3GH3A 2POQX 4YXFA 1Q2XA 4BO2A 3Q9NA 5EINA 3BMNA 3I9KA 4WNIA 2EF1A 3PFWO 3ZWVA 4J7XA 1P1KA 4WPGA 4TKMA 2VHVA 2WD8A 2NADA 2ZTVA 2BI7A 2J6IA 4J4HA 3PEFA 3BIOA 4UVHA 3E18A 3LF1A 2O4CA 4B8ZA 3KYBA 1EEHA 5G4LA 1AXEA 3ON5A 4L4XA 4OL9A 4ZQFA 4Z9FA 4CMAA 3ZV6A 4WOKA 4R3NA 3HQ4O 1GQ2A 4UAGA 2X5JO 3ZWXA 3E9MA 2VWGA 4D41A 3GDGA 3QIVA 5JY1A 1U3WA 3KVOA 4I1IA 4W6ZA 4BO9A 1H94A 4HNHA 1HWYA 3AI2A 4J1SA 3ADOA 3V2UA 2O50A 4TRNA 1C1DA 1M6WA 1NR1A 4NK5A 2TMGA 4YJGB 1RKXA 1GZ6A 1IB6A 1NPTO 2BH9A 2G82A 3L4SO 3RCBA 3RKUA 3WGIA 3U49A 2NU9A 1BHSA 5L45A 4HX5A 5IG2A 3C7DB 5JXWA 1A72A 2GF2A 1E6EA 3PQEA 1HDZA 2B5VA 2DFVA 3EUWA 4RL6A 3B1KA 1GCUA 2DTEA 4Z0HO 3D5TA 4IDEA 4EJ6A 1ZMOA 2RIRA 5IJZA 1LDMA 5HRUA 2V6GA 1C0KA 2C7GA 4TZKA 2JCXA 3ZZNA 2OL4A 4MVJH 2I67A 1F17A 3EAGA 1QYWA 4G65A 1EBUA 2VOJA 2FSVA 5BT9A 2IRWA 2OZPA 1XQ6A 1ML3A 3HJAA 4OMUA 1IOLA 3I6QA 4E13A 3ORFA 4HUJA 4BS9A 4PLYA 3VH2A 1PU2A 2W90A 3KYDB 4FCCA 4RQUA 1HYHA 1I2ZA 4I5FA 3TOZA 3ZV4A 1LLQA 2X0JA 4Q9NA 3UFXA 2PY6A 1H93A 1K6IA 3KTDA 3ZCXA 2ZK7A 1E3WB 1L7EA 2YQ4A 4FFRA 3M2TA 3DBLA 1TB4A 1U9JA 3K6JA 3VVBA 1E7WA 2B35A 2GZ3A 4ZQEA 1WMAA 3DMYA 1SEVA 1GU7A 1MV8A 1UUFA 3DBLB 4R9RA 2FHSA 4UVEA 2DFDA 2YDYA 4FFLA 4U0JA 4Y98A 5KKAA 3T4XA 1R4NA 3E48A 3GZNB 4BNHA 1FDWA 4KUHA 3EDMA 5B4VA 3BA1A 4WE3A 1I10A 4Y6SA 4CV0A 3LLSA 1JU9A 1LRKA 3KSZO 3L4BC 4BGIA 1ZEMA 2DBQA 3RI3A 4K9DA 2YY7A 5A04A 1ZK2A 1VL6A 4JJGA 5G0WA 2F1KA 3OJ0A 4OGWA 4EUFA 4ZGWA 1B8UA 2RAFA 1OMOA 1D1TA 3UN1A 3HDJA 2HUNA 2PGLA 3AY7A 5JDIC 1YOVA 3TWOA 2RH4A 1VRWA 2GERA 4AJ1A 5DOZA 5I9LA 3IKTA 4TMFA 1H6DA 4YJFA 4X54A 3CH6A 3PYLA 1Q0LA 2PZJA 3RROA 5JAMA 4IM7A 5JYEA 1X0XA 1X7HA 4ZN6A 4DC1A 4YJFB 2ZYDA 1BSVA 1G0NA 3WQSB 1U8XX 1HE2A 4JCOA 4FR5A 1F06A 5ILOA 1P44A 3GGOA 3GHHA 2GUGA 3OHSX 1GUYA 5DN9A 1EDOA 4XGIA 2AXQA 1WLYA 3FBGA 1EVYA 1U4OA 4PLCA 3DDNA 4K26A 2B4QA 4BKPA 3A9WA 4GKVA 4RQTA 2Y1DA 1HF3A 1Y9EA 4N54A 4YRAA 1LTHR 2Y68A 3CMMA 4RF4A 4HP8A 3FTNA 1G6KA 2O48X 4YJDA 5KTKA 5BQFA 4CQLB 4KTVE 1EK5A 1KY5A 1M76A 2AQ8A 4OQZA 4F45A 3ETGA 5IDXA 2PD3A 1W8DA 4CR6A 3JQ8A 1NVGA 3TFOA 5JAIA 5KJEA 3ST7A 1CDOA 4PIVA 3RFVA 4R51A 1A5ZA 4YT2A 3Q6IA 3R1IA 5G2OA 3H9QA 3QVXA 3DQPA 4WNCA 1T2AA 2NU8A 2LDXA 3OF2A 3K9QO 2EWMA 5T57A 2QQ5A 4P4NA 2DUUA 3NT2A 4ZHSA 1WAMA 4XRRA 1UXKA 4PZDA 2DAPA 3L77A 3OEYA 3KB6A 4BO6A 1I2BA 3HB5X 4EEXA 5THKA 3DO5A 2PZKA 2E82A 2EJWA 2CF6A 2LDBA 5C5IA 2DC1A 4N5LA 4NMHA 1CWUA 1YH3A 2G76A 4DLAA 3ZV5A 1PL8A 5U4QA 3IKVA 3LC1O 2JAHA 4EDFA 5A06A 4D44A 2WDZA 4YEDA 5DCWA 1DIBA 1Y7TA 3EGOA 1XU9A 3KM0A 3LT0A 3KYCA 4JK3A 1O89A 1B0AA 1EQUA 4WEOA 2G1UA 1CYDA 4RF3A 2GASA 3OBBA 5EESA 3V1TC 2QRLA 1RM3A 1GUFA 3KYCB 1JKJA 1YQGA 1I24A 3UHAA 4XRGA 1I3NA 1W6UA 1GPJA 4L74A 4E30A 4PG8A 4JP3A 4LK3A 3NT4A 4MKZA 2NTJA 4BMSA 1F14A 2GN9A 2HO5A 1LJ8A 2OOSA 1NXQA 1B8VA 3Q2KA 3A06A 1NQOA 5AOVA 2IXAA 3V2GA 4DUPA 5L7WA 4AJPA 3ADPA 1FDUA 1RYDA 3PWZA 5AXAA 3AOEC 5THQA 3MJSA 5JAQA 3ICPA 5JDCC 1R37A 3NRCA 2YQ5A 4OJNA 2NQTA 3ZWWA 2PK3A 1B2LA 3DBVO 1SO8A 3AM4A 3AW9A 3LT2A 1UAGA 3W8EA 3G3EA 1Y8RA 1QYDA 4BNZA 3CINA 2B83A 1FMCA 2B36A 3PJFA 1NPYA 1JVSA 3VZQA 3AM5A 5IDYA 2EKLA 2E49A 3GZ4A 1RM5A 1Y8QA 5F5LA 1RM4A 2PLAA 4DMLA 5CEFA 2JHFA 2DT5A 1CQIA 5JE8A 1I3KA 4BGEA 1Y8QB 4R01A 1U7HA 3LSYA 3QSGA 4URFA 3C8MA 3WWZA 1HDYA 1I8TA 2UUOA 3KSDO 3OJLA 4A03A 2VWHA 4BKUA 2W8ZA 4EEZA 1J0XO 2GSDA 1D7OA 5K6AC 5TGDA 2WE8A 2ZJ0A 1VSUA 4TKLA 1HRDA 4CM5A 3BMOA 1E3JA 4XCVA 3VZRA 1VJ0A 4E2WA 3DR3A 4Z3DA 4YAJA 1KEWA 1MG0A 1MFPA 3MJEA 1X1TA 3Q0EA 1CETA 1LDGA 1Z7EA 4R9SA 1DRUA 4O6VA 5A1TA 3PLRA 4AJ2A 2AW5A 5ITVA 3DBHA 5A5FA 1PZGA 4UEKA 1PZFA 5HBRA 1ONOA 1U5CA 5K0ZA 2C82A 3JQGA 3I6IA 5COAA 5DT9A 3EMKA 1KVUA 5IFLA 1V6AA 4WASA 2X9NA 1LA2A 4J0EA 3ZNNA 3OJEA 4DYVA 1LBEA 1U1IA 1J49A 1KEPA 3LC2O 4CM8B 1FXSA 3ZW9A 1GZ3A 2Z95A 1LSUA 4E12A 3DOCA 2X58A 5U9CA 4IQ8A 3JQ6A 4PLZA 1IY8A 2ZB8A 2Z1MA 2CVZA 3IUSA 5KIAA 5KWEA 3WS7A 1XDWA 1DLJA 4OQYA 3GGPA 4CMJA 1VE9A 2DM6A 1EUCA 4E5YA 1K5HA 5I9MA 1PL7A 2X5OA 3G1UA 3NX4A 3QVWA 4NH4A 4I5EA 4R4JA 1XG5A 4GQAA 4FC7A 1LSOA 3U62A 2VNSA 4BNVA 1FDTA 3GC6A 1H2HA 3GMDA 5BSHA 3Q9UA 3L0DA 1QYVA 3ZWCA 2YW9A 1ZK4A 4FIZA 3WTBA 3FSRA 4MKXA 4JBGA 1Q0HA 4TVOA 4OSPA 2VWPA 2X8LA 1VJ1A 3P2OA 2QZZA 1TA4A 4TZTA 3TZ6A 4QEDA 1U2DA 2GRAA 3JQDA 2EKQA 1ISHA 2QRJA 3VOSA 1PJTA 3KBOA 2D4AA 3H5RA 3QWAA 3JD2A 5BNTA 4GKBA 4AJHA 3ZNOA 3C85A 4OO3A 1WNTA 1W0CA 3V1YA 2V6MA 4NBWA 4NJMB 3N74A 3L4BA 3QW2A 3ETDA 4ALKA 3TZKA 2HMWA 3G17A 3AUAA 1E3LA 1QLHA 2QG4A 1DOHA 1EBFA 1SZJG 2DBRA 1MC5A 2PA3A 4CMIA 4ONEA 2X23A 1BXZA 3RC7A 3RU9A 3GPIA 4XYEA 3I1JA 4MINA 4D3DA 3DHYA 5COBA 5JDIA 1DC4A 3E82A 4XB2A 1X1EA 4IDBA 1ONNA 4CMIB 3AJRA 4BUCA 1SEPA 3EK2A 2VTEA 4OSOA 4CLDA 4DPMA 4WK6A 4KDFA 1AE1A 5L53A 3NTRA 5U1PA 3WGOA 2Y67A 2C2XA 2A9FA 1I0ZA 2Y1CA 3I52A 1HSZA 3LDHA 1ZSYA 4ND3A 5EL0A 1YJ8A 1PZEA 5F21A 5HTOA 4E33A 2ZCVA 2FPIA 3L6DA 3D4PA 1Y1PA 4Y9DA 2VTDA 1WZIA 3VDRA 3BZUA 4CM6A 5I7SA 1J6UA 5L9AA 4IJUA 2ZTMA 1WDLA 2FPGA 4CM9A 2CMDA 5JY6A 2HCTA 1ZSNA 3LZ6A 3ROQA 1PS8A 1GYPA 2PGJA 4GX1A 1B3RA 4RLHA 1J4AA 2EXXA 2H63A 3JQ9C 4OAQA 2RHRA 4HFJA 4Q3BA 4E2ZA 5AQ1A 3BHIA 2P5YA 2GD1O 3H9JA 4R1SA 1WMBA 3PWSA 1ADCA 1RJWA 5TT0A 3BHMA 4DC0A 2IDZA 2V6BA 1OZAA 2EERA 3E5MA 3JD4A 4WCDA 4AJLA 1A9YA 3WYCA 4NI5A 3O8QA 2J5RA 4YWJA 2EW8A 3R3SA 4IZIA 4ROSA 3TOXA 4BIIA 5A9TA 1HLDA 4YACA 4WUVA 1N1GA 1CF2O 1ZW1A 3PIIA 2P91A 3H3FA 3RUHA 3D0OA 4B79A 1ARZA 2XXBA 2C07A 4QUKA 5DBGA 3GAFA 4UVIA 1GR0A 3BHJA 3VDQA 1UZLA 1E7MA 3CPSA 3QY9A 2I76A 1T26A 4KQXA 5HS4A 2Y93A 3ZGYA 3JQ7A 4DLLA 2EV9A 3TN7A 4JJFA 2IE0A 1QR6A 4P4GA 3HN7A 3NTOA 1T2DA 1GV0A 1R4MB 2B4RO 1E7RA 3JQ7B 2RBEA 3MOIA 4WKGA 4E5NA 3C1AA 3PQDA 4B3JA 1EMDA 1V3VA 2X5KO 3CE6A 1HT0A 2WMDA 2IYOA 1ZUD1 2UYYA 4CR8A 1QSGA 4CQMB 1DPGA 1B3BA 3E6AA 3GUCA 5AXCA 2PR2A 5LDGA 5F1OA 1WW8A 1TLTA 1WDMA 3PP8A 3WQQA 2I3GA 5EN4A 2BKAA 4BNMA 3B20A 4KMSA 2EKPA 4JP2A 1NAIA 4AG3A 4NBUA 5CHEA 4XYLA 2ET6A 5KVCA 4GGPA 3JYNA 1LSJA 1XLTA 5G4KA 1MG5A 3QLJA 4G2NA 3AY3A 1NASA 4DMMA 3INTA 3CUKA 2QIOA 1X0VA 4J2HA 4CM9D 5JDCA 4FFMA 4LN1A 2WYVA 3LT1A 4E2XA 3IQDB 3GRKA 4IDGA 4D43A 3PQFA 1LLCA 2NVUB 5AXBA 2B4TO 2IYPA 3GPDG 1LC0A 3MWEB 4OKIA 2WSBA 1PJ3A 3WGGA 3UGKA 4UREA 4IJWA 4N18A 3EC7A 5DF1A 1ZK3A 1P77A 2FOIA 3A14A 3B1FA 5AYVA 3ONDA 3E5RA 4DLBA 4FS3A 3RASA 5IZ4A 1PJLA 4XYBA 4Z9XA 1R0LA 4NR0A 2A35A 3LQFA 3IUPA 3UH1A 1WWKA 3K2BA 3M2PA 1K0UA 3VH3A 3KUXA 4IGEA 1YL6A 4YQZA 1FDVA 1XR3A 1X7DA 2Y0EA 1GPDG 3GG2A 1C0LA 3ZHBA 4A10A 1BG6A 4A0SA 3OP4A 1IPEA 2RHCA 3SEFA 3ASVA 4PG5A 5GY7A 4FQ8A 3SXPA 1OC4A 4YBZA 2IXBA 4LCJA 5IN5A 1Y9AA 1U28A 3AUSA 5K6AA 2OUIA 3DEYX 4FOOA 3SX2A 1XEAA 3V1UA 3M1AA 3GNQA 4B7UA 3K96A 3HFGA 1GZ4A 4PFJA 1CIVA 1MA0A 2O3TA 2X1HA 4PVCA 4PG7A 4O0LA 4S3MA 2BFOA 4B3HA 4CQMD 2BHLA 3DONA 1JKIA 2PZLA 3VKVA 2WTBA 3PYMA 1EVIA 4E21A 1BMDA 1RYEA 3RUAA 2R6JA 1DC6A 4HFMA 2Y66A 2J5KA 2C59A 1PS9A 2C29D 3QV1A 4GI2A 4BNJA 4BGVA 4IDDA 1PJ4A 2AQIA 3RAJA 3ANNA 5EJ2A 4BO8A 1ZZEA 1PQWA 3EZLA 4YAKA 2XAAA 3VKUA 3ZNPA 5K9ZA 2ZB4A 4B7CA 3GFGA 2VWQA 1WXDA 3DBRA 1FF9A 4NFSA 4PLWA 5BSFA 1XHLA 3D1LA 2O3UA 3ETEA 1LX6A 3LU1A 1ADFA 3R3JA 4NU5A 3DBRB 3I83A 3TZCA 2V6FA 1DIGA 1Q7BA 1PEDA 5LCXA 3QE3A 4GAEA 4U8GA 4Y8VA 5JC1A 4R1NA 5F1KA 3F6YA 2W2KA 2X22A 4ALNA 1HLPA 3I9LA 1NYTA 2PWZA 5CDSA 2JHGA 4DVJA 3U09A 4D45A 2X9GA 2YZ7A 2J8ZA 4D0SA 2A92A 2W2KB 4LW8A 2FSSA 4C7KA 1U3TA 1SOVA 2H5LA 3H8VA 4YJGA 3RFTA 4MOWA 1N7GA 1NVMB 2WYUA 1LRJA 2EIHA 2V7PA 3HUDA 3QVTA 4JXKA 3F4LA 4KOAA 4XZ3A 1SC6A 4ZQGA 1A4UA 2JFFA 3E03A 5CG2A 3R6DA 4XGNA 4J90A 4CLOB 1U5AA 1E3EA 2D5AA 1HTBA 1A27A 4R1UA 3TDKA 4Q3EA 2CF5A 2AEJA 4BV8A 3FF4A 3LLVA 2Z5LA 2CVQA 3GUYA 1QRRA 4CMHA 3GEDA 4BNNA 1MC4A 4DA9A 3AFMA 5BSEA 3PWKA 3I4FA 7MDHA 3NKLA 1UP6A 2VRCA 2ZYGA 3ZWNA 2GN6A 4YT4A 4IZHA 1QMGA 2PKRA 1LUAA 4O63O 1LU9A 4WLOA 4PN3A 3D64A 3KLPX 4QFCA 1FK8A 4EJMA 4B4WA 3DZIA 3RBXA 3GN1A 2HDHA 2TMDA 2Y1EA 3D4OA 5TSDA 3KYDA 5TS3A 1Z73A 1H6CA 1PR9A 1VKOA 2C0CA 1T1SA 1UXIA 3FI9A 1P74A 2JFGA 3ONFA 3Q1LA 1XKQA 2CD9A 1E3IA 3DHNA 3JQAA 3TF5A 3CEAA 3JQFC 5FI3A 1UZNA 4IQGA 2PKQO 4H15A 1JAYA 3RBZA 1LC3A 3W4IA 4MP8A 1E3WA 3WSVA 3ZU4A 1SB9A 4GBJA 1ADBA 2GR9A 3JQAB 4FFNA 1YB5A 3PVZA 4J7UA 1PS0A 5JCJA 4BL5A 1I36A 3VH1A 1UP4A 3UW3A 1E6WA 4Y6PA 4IMRA 4MP3A 2SCUA 4GPD1 3NDJA 4RF2A 4H3VA 3GZNA 3P7MA 1MB4A 3GQVA 1X15A 5T5QA 1YB4A 1VPDA 5DCYA 2RH8A 3OIGA 3R0IA 2BFMA 4ALJA 4IDCA 1DRWA 4W7IA 4EZBA 2YHUA 1DC5A 4G5HA 1Z7BA 3WMXA 1HDCA 3EVTA 3JQ9A 4E4YA 1HXHA 4EW6A 3ICCA 5KOIA 2HJSA 2NM0A 4NDNE 1ZEJA 2WE7A 4WECA 3IC5A 2Y0DA 4WGGA 5JBIA 4RGBA 2Q46A 4CV3A 2D3TA 4WOJA 4QTZA 1DFGA 3RUFA 4OHUA 4UUMA 4LSMA 2QRKA 1NWHA 3PHLA 4ND5A 1EK6A 5DNAA 3WGZA 3AUUA 3U5TA 5JSFA 3I5MA 3OSUA 3HWRA 3UVEA 5B4UA 1V8BA 2VRCD 4EGFA 4RPGA 4B4UA 1N7HA 2VHYA 2OP0A 2H1SA 4RJTA 1H6BA 4IS3A 3B6ZA 5ENDA 1XWFA 2HK7A 1PGQA 5ER9A 4GX5A 4BKOA 4A27A 1EUDA 3GDFA 2Q50A 3GT0A 3OFSA 4OKNA 2PFGA 4ZQHA 5DP2A 2Y1OA 4YAGA 3BTOA 2VCYA 4NIMA 1Q1NA 1W73A 3HHPA 2I9PA 1HKUA 1E7QA 1IYZA 1B15A 3JQAD 4WLUA 4CQLA 5L95A 3GN2A 4O5OA 4UUNA 3DL2A 4D46A 4TRJA 4PGFA 2CSUA 1K2WA 3O38A 3U4DA 5JCJD 3TRIA 2BF7A 3RUDA 5C3MA 1YONA 3ZWYA 4FGWA 3HADA 1PIWA 3WLEA 3OIFA 4BO4A 4RV9A 4BNGA 2P9GA 5IZCC 4M8SA 4K6CA 2QX7A 2CUKA 3JSAA 4LMPA 1P45A 2AG5A 2QYSA 3DOJA 4JQCA 1T1RA 4ZJUA 2AA3A 4KUEA 2WWRA 3PTZA 4QFDA 5ER6A 2EHDA 1A71A 2JD1A 1UDCA 3WNQA 5FEUA 2FZWA 3DFZA 2YJZA 1YWGO 4PZCA 2QZ9A 1HZJA 4QSMA 2W98A 1JQBA 1QP8A 4W4TA 1E1NA 1OFGA 3IAHA 3UOGA 8LDHA 1ZMTA 3E9NA 3K8ZA 1JVBA 3OMLA 1OOEA 5GZ6A 4ILKA 3T7CA 4BKRA 2X7HA 1E1KA 3V8BA 1MP0A 1JN0A 1YJQA 3PFFA 1OC2A 3H4VA 3RFXA 4E5PA 5I9NA 2PD6A 3GNSA 3WWYA 1A7KA 4GX2A 4XIYA 4EYEA 2YYYA 4Q3AA 5A3VA 1GTMA 4K6FA 4ID9A 3I23A 1GD1O 4WLNA 3DMTC 1DXYA 1KY4A 5KVVA 4RPKA 1I3LA 4BNFA 1P0CA 3WR5A 5C7LO 3U4CA 1LQUA 3JYPA 3S2FA 1E3SA 4PLPA 4FJ1A 3FNGA 4BGUA 5B1YA 3O26A 3E9QA 6LDHA 2GN4A 1RWBA 3HG7A 1EE9A 4YRBA 1YVEI 3MTJA 4BKQA 1ZXBA 3V5NA 5EMHA 2WD7A 5IDWA 3C1TA 4ZICA 1AHHA 2X86A 1DIRA 3VTFA 5C7OO 5FWNA 3IP1A 4BQRA 5AVOA 4TVBA 4J16A 2WD7B 2C20A 2JD2A 5KKCA 1R0KA 1CERA 3OA2A 4IPTA 1ZJZA 3DB2A 4R1TA 5TJHA 4ZA2A 4LRTB 5I7EA 2NVWA 3S2IA 3HNPA 4RCVA 1B7GO 3PDJA 2GYYA 4J2OA 4IMPA 3PZBA 5G0SA 5CAEA 1LDYA 3U9LA 1YQDA 4C7JA 2ZJ1A 5TRTA 1YS4A 1BXKA 1I3MA 3PRJA 2XXJA 4WLFA 1ORRA 3WICA 4E5MA 3PJEA 4FD3A 2W2LD 1ISJA 2AEMA 3HDQA 4HY3A 2ZB3A 3W6UA 1QG6A 1U3VA 1NFRA 4HFRA 3JYLA 4Q3DA 2EP5A 2D2IA 2NSDA 3HE3A 3O03A 3X2EA 2B0JA 3EVNA 1E1LA 3H2ZA 4LVUA 5F3RA 2HMUA 4YTEA 4DPLA 1P9LA 1UXHA 2ZTUA 3ANLA 2QYTA 3OJFA 3PJDA 2DVMA 2Q45A 3CZMA 1DHTA 5HS6A 4TRRA 5C37A 2BLLA 2X4GA 1ENYA 3BMQB 4H16A 4YVFA 1QV7A 1YO6A 2VHWA 2PH3A 4PG4A 4YCAA 8ADHA 3K92A 4CM8A 2VZ9A 3WYBA 1PJBA 7ADHA 3NGLA 3WLFA 2P4HX 4IJKA 3KHUA 4CLRA 3PYXA 3WB9A 4FFPA 3WGHA 2QHXA 4DIFA 1EVZA 3GVPA 4XB1A 4PG6A 2A4KA 4XD2A 4OYRA 4CLRB 2GPTA 4I8XA 1ENZA 2HJRA 4MKRA 1JW9B 2W4QA 3H65A 2A94A 4FPXA 1U8FO 4D3SA 3C3XA 1VM6A 1IZ9A 4MO2A 3QWIA 5IXYA 1PL6A 2P4QA 3AWDA 4L4RA 1QYCA 4XQGA 4RVGA 3RWBA 4BO0A 3I9OA 1HL3A 1MGOA 1PTJA 2Q2QA 1Q7GA 1EZ4A 1DAOA 1ID1A 5KJCA 3Q2IA 2HK9A 4J9VA 3T7EA 3DAGA 4BV9A 4J6FA 3FR8A 2O23A 3JQFA 4XQCA 1KERA 3AUTA 4EUEA 3KLMX 5T6BA 4D3FA 3ZWPA 1IUKA 1P1HA 3PI7A 4MIOA 1XGKA 4ND4A 3D3WB 3MJTA 2UVDA 1M66A 5C7IO 3W8FA 3OICA 2PTGA 2ZCUA 1LLDA 1ZK1A 1NM5A 3ZU5A 4BO3A 3EY4A 3IS3A 1AGNA 3U0BA 1BVUA 4O1MA 4Q3CA 1H0KA 1P1RA 4L4SA 2J5QA 3GVCA 3RKRA 3RJ5A 3PDUA 3BMCA 4XYGA 4JROA 4PVDA 1EE2A 3SBOA 3NDIA 5DP1A 4KZPA 2X0RA 2VHXA 4GX0A 3BMCB 4II3A 4NJMA 4GH5A 5J23A 3WXBA 5JNLA 4IINA 3F5QA 3GHYA 1SB8A 2GZ1A 3MOGA 5HA5A 1UP7A 2IZ1A 1O9BA 5CDTA 3DZHA 2FR0A 4R69A 4BNYA 2Q1WA 4P8RA 2NU7A 4Z0PA 1GQYA 3F5SA 4GSKA 1QXSA 2C54A 3FNFA 4R54A 5A9SA 3GNTA 1JAXA 3GFBA 1UJMA 3WFJA 3DHEA 4LMRA 5A9SB 1M67A 1BVRA 4IY1A 5CDGA 1ZK0A 1LDBA 3MCVA 1E1MA 1NVTA 1PWZA 4IDAA 5I8ZA 3QVSA 1DJNA 4RO0A 4LSWA 4N5MA 4UULA 3GVIA 2HU2A 4QT0A 4OH1A 3G1TA 3GF4A 1AHIA 4J4TA 3WBFA 2CDBA 3B1JA 1U3UA 4YB8A 3QRWA 3UCEA 3WDSA 1PQUA 1KVTA 1NAHA 1O8CA 1KYQA 1ZNQO 4NK4A 5JC8A 2JKVA 3ZW8A 2PNFA 4RPLA 4FBGA 2XOXA 3ZU3A 1C0PA 2Q1SA 4R68A 5GMOA 2P9CA 4PLHA 3PK0A 1VLLA 3KSUA 4OXNA 2Z1NA 2VUSA 2NTVA 3MJCA 1BTOA 4WCFC 9LDBA 1E5QA 3HB4X 4BO7A 4DBZA 3SVTA 4NBRA 1PJSA 2GZ2A 1BRMA 3IMFA 3K31A 3ZI0A 1P0FA 1P1JA 3EHEA 1PSDA 1QYXA 1ZO8A 4PLFA 5IZCA 2FPPA 4HFNA 1CJCA 4E3ZA 1I30A 1OBFO 4WJZA 4DQXA 4CMCA 1IHXA 3AY6A 1NQAO 1D8AA 1HZZA 1B14A 3ENNA 3K2EA 3TZQA 3WJAA 4AICA 3MTGA 4L8VA 3Q11A 4W82A 4BNLA 3ZWOA 4WEQA 2ZYAA 3NYWA 3ZN2A 4PRKA 2BGKA 5IN4A 2GLXA 1R4MA 2GGSA 4ZRMA 2EW2A 1KETA 3I9NA 1MXFA 2UAGA 2P9EA 1Y5MA 1YL7A 4I9UA 3H5NA 1MX3A 4CQMA 1ONPA 1OAAA 1ENPA 2JJYA 1NQ5A 4JJIA 3RC9A 1DC3A 2E4AA 1NNUA 1SPXA 1TT5B 1EQ2A 5DOVA 2FR1A 1HDXA 2HQ1A 1O5IA 3IOYA 3F1LA 3TSCA 3DMTA 4M49A 5A02A 1T2FA 1TT7A 1E0DA 2Y05A 3S1LA 4DWVA 3VZSA 4OXKA 4XX0A 4CMEC 1TVEA 3LK7A 3WJ7A 4KQWA 3SJUA 5TF4A 1GUZA 4XQEA 2BFAA 2B69A 1LNQA 2NVUA 3WGYA 4AJNA 4ALLA 4LISA 3H7AA 1GV1A 5AXDA 4DXHA 1IE3A 4A2CA 3WBBA 3KO8A 1NTOA 1DDOA 2BGLA 4I9NA 1ZSVA 1M6HA 1QORA 1SOWA 3DZGA 4BNXA 3U4HA 1GAEO 1NPDA 4BHTA 2QW8A 1B26A 2O2SA 1I2CA 3JQCA 4J49A 4JBHA 3KETA 3DZJA 4PLVA 1XIVA 2C2YA 5H81A 4MVJA 2WEKA 1ISIA 2VRBA 3QP9A 1VL0A 4MVJI 4XDZA 1ADGA 4W7HA 4J43A 2YFQA 2O3RA 3WFIA 4TWRA 5I7FA 4YAIA 1GL3A 4ND2A 1EFKA 1YQXA 5JPIA 1DAPA 1EFLA 1GY8A 1ZJYA 3E8XA 2CVOA 1LSSA 5A5EA 3WIEA 2ZB7A 5CEEA 3F1KA 1Z45A 2BD0A 2VYVA 4YT5A 2PZMA 2Y99A 3LC7O 3UICA 4RVSA 4W9NA 3JD3A 1GQQA 4FDAA 1HE3A 5A9RA 2UDPA 3F46A 4FSHA 4MDHA 2AE2A 3HSKA 2VZ8A 5T64A 4UVGA 3AI1A 3GDOA 1WZEA 4MVJM 4XEHA 1KC1A 1YB1A 3H9GA 5ICMA 1DRVA 2I6TA 2I99A 4HWKA 3ZWBA 4I9HA 4XR9A 5IDQA 2FP4A 5DDIP 4QO8A 2HMSA 1B16A 1BWSA 3HDYA 4JBIA 1D1SA 4KWHA 5TC4A 3ITDA 2ZTLA 4D7AA 2NVBA 3RD5A 4DQVA 3RJ9A 1ULSA 3JCZA 2EG9A 3RIHA 5H82A 1A9ZA 4NG5A 4YT8A 4ALIA 3GEGA 5DBIA 1QLJA 4OIMA 5L40A 5ENVA 3N58A 2ZKLA 4YA6A 4ZU3A 4KP7A 4EI2A 4KDEA 1YBVA 4IGFA 3S2GA 1M2WA 4EJ0A 1EUZA 3G79A 4MVJG 5I8WA 5TX7A 3FTPA 1ISMA 1WP4A 3NJ4A 4BMVA 5JO0A 1PJ2A 2DKNA 3IL2A 3DAPA 1BDMA 2FWMX 1UAYA 3UAGA 4XQ9A 3JD1A 3WYEA 4AJKA 1LLUA 3V2HA 1P33A 1XELA 1LDEA 1AUPA 1G1AA 3ZH2A 5ES3A 3AK4A 1NHWA 2OORA 4MIYA 1KOLA 5L51A 5F1PA 4JGBA 4E6PA 3HFSA 1KBZA 1NQTA 2BGMA 3PGJA 2IODA 3PJGA 3VZPA 1SAYA 4MVJD 3BMNB 2Q1UA 1HE4A 3H3JA 3QHAA 3ZWMA 4CLOA 3OA0A 1VI2A 1Z74A 1UXJA 4CMKA 5TIIA 1BXGA 5L4SA 4G81A 1BW9A 1PGPA 4E5KA 2R2GA 1T2CA 1SMKA 3F4BA 4NPCA 1BXGB 3C24A 4YDRA 4DTIA 2VYVD 1BW9B 4RPHA 3CTMA 1HETA 3TJRA 2D5CA 5ICSA 4BNTA 4AJ4A 2DTDA 3FWNA 5HM8A 4FGSA 4J1TA 3RU7A 3GEMA 1BGVA 1ULUA 4IQ0A 4J91A 4FN4A 3RUCA 4RZHA 4AJOA 2OBYA 3STHA 1ZCJA 3W4KA 1LI4A 4DQUA 1K6XA 5BNFA 1C1DB 4J1NA 4KWIA 5JLAA 4ZD6A 3CZRA 4IXWA 3TZHA 4XYMA 3VPXA 1NFFA 3WTCA 3LF2A 3WNVA 4KUGA 2P68A 4UVDA 3QWBA 4OOFA 3VH4A 4E32A 4B7XA 4R5MA 4BO5A 4BMNA 2I5PO 5DULA 4XJSA 4E31A 3NUGA 4F6LA 2F00A 3ONEA 2HSDA 4MPDA 4BVAA 1T2EA 5FF9A 4LGVA 3NV9A 1GEGA 2X0IA 4DREA 1PX0A 1T4BA 3JD0A 3ULKA 3ZNQA 3NAQA 2O3QA 4E0BA 5FFFA 3GA0A 5JYDA 1ZH8A 2EEZA 4GMGA 3OH8A 1SNYA 3IIEA 2AEFA 1BDBA 3MJVA 2Q2WA 5ILGA 3H6KA 3EW7A 3ZWAA 4QECA 3DC2A 5JMPA 3IJRA 3RC1A 3I4CA 4I5GA 3HZZA 3DOOA 5CPBA 1UZMA 4A5OA 3GOHA 3ZHXA 4O59O 2E6UX 2HLPA 1Y6JA 3GLQA 3W1VA 1FDSA 1A7AA 2PGDA 2ZATA 4BNKA 2D59A 3C7CB 2PV7A 3PHHA 1SBYA 1YBMA 2NTNA 2NU6A 3GG9A 1YGYA 3WIDA 4WCFA 1KS9A 1ZBQA 2YHIA 1YKFA 4AJIA 4XWYA 4XA8A 1JWAB 3MWDB 1MLDA 4AFNA 4WCFB 5JMWA 2YHIB 3FHLA 4GLLA 1R4NB 3PZRA 4W99A 2DPGA 5EQDA 1PGJA 4J4BA 2R00C 1VC2A 2GNAA 2HRZA 4CR7A 1F8FA 3DTYA 3GVHA 4BNIA 4U7WA 1O6ZA 1SCUA 1YE3A 2E48A 2ZQYA 2CFCA 1HSOA 1NX6A 4L9RA 4L73A 4BB6A 2Y1FA 5A03A 2BELA 3WGTA 4M87A 3CMCO 4CV1A 3KEOA 4XIJA 4EITA 2UUPA 2I66A 1YOVB 2HRBA 2ZIZA 4NHEA 3VPHA 2VOEA 3FCOA 2AHRA 4AL4A 3VHRA 4OM8A 4BO1A 4J0FA 1X13A 5LC1A 5TNXA 5TQVA 3H9EO 4A7PA 1N2SA 3DFUA 1JTVA 1I33A 4BB5A 2OHXA 4CM1A 5CFZA 3ZHZA 3OQ6A 2NLOA 1ZIDA 4TRMA 5G0UA 2G0TA 1DJQA 1ZFNA 4K1LA 1NFQA 5JAZA 2DPHA 1VSVA 4CMEA 3DTTA 2NWQA 1KVRA 3PLNA 4QQRA 5HWSA 4R3WA 3RVDA 4EUHA 5DZSA 3VC7A 1T24A 4CJXA 1YRLA 5TJ9A 4J3FA 3VPGA 1V3UA 2W2LA 5EQFA 1Z75A 3INGA 4R41A 2C5EA 3H2SA 1K6JA 4JLWA 2V65A 3LVFO 2CY0A 3ITKA 3IJPA 4Q39A 1F0YA 4J1QA 3WGQA 1EDZA 3RQSA 3JQBC 1XCBA 4TSKA 4XKJA 2BRUA 3JQ8B 3AU8A 4RLSA 1PQPA 5FI5A 3VPFA 4ZVVA 2JL1A 1CEQA 4CM3A 2OO5A 3NEPX 1DFIA 1HDRA 4NBTA 4AVYA 2CDCA 3W6ZA 3PGXA 4CUJA 5A05A 4R16A 3COSA 4Z6KA 2J3JA 4INAA 1K3TA 1TEHA 3N7UA 1FJHA 4IBOA 4F46A 4IUYA 2Q49A 1Z6ZA 2NQ8A 3ABIA 2O3JA 1NBOA 1G0OA 3DAFA 4Z0TA 3FPLA 5FYDA 1I01A 3L07A 1DFHA 3I9JA 3AI3A 5L3ZA 5EERA 2FRDA 2B37A 1RM0A 5T8KC 1E77A 1N1EA 3UXYA 3FD8A 1IHYA 2ZQZA 4NZ9A 4XR4A 3JTMA 4FC6A 1DBVO 3WG9A 4B8WA 3ENKA 4CM4A 4U6QA 3TL2A 3QWFA 3W4JA 2E37A 2Q3EA 3B70A 3DZKA 5JO9A 4CM4B 2YDXA 5G0TA 1DB3A 1NHGA 3UCXA 3I9MA 1ENOA 3UCFA 2EJVA 4E2YA 2NNLD 3WMWA 1QV6A 4PRLA 4AJEA 4JN6B 2OXIA 1E92A 4P38A 3KZVA 1XQ1A 3PPIA 4YR9A 3GRPA 4Z3KA 1M75A 5BSGA 1D3AA 2NUAA 2X6TA 1NP3A 3SC4A 4LCEA 1DLIA 1KVSA 3P19A 1HDOA 5KJFA 1DIHA 3FPCA 4IIUA 1P31A 4LVCA 4P4LA 3K30A 4B4OA 4RDHA 5MGBA 1MFZA 3ROMA 4NJOA 2VN8A 3G0OA 1U2GA 2IEBA 1Y8RB 4W9NC 1O0SA 1L7DA 4I5DA 4UUPA 1A4IA 4PZEA 4XJTA 2JD0A 4H7PA 4RVUA 2EGGA 3A1NA 5TT1A 1X7GA 1KC3A 3KEQA 1P1FA 5ITWA 1WDKA 4RVFA 3P5SA 4IIVA 3TFQA 3OQ1A 2Y1GA 4XDYA 1JDJA 1N8KA 3NGXA 2AMFA 3F3SA 1PR3A 3BMQA 4OOEA 5T67A 4ZRNA 4GMFA 5GZ3A 4CODB 3FN4A 1I5RA 3DZFA 3PIDA 2JCYA 3OIDA 3M6IA 4A73A 4RVHA 5MDHA 1IPFA 1WPQA 3TL3A 1R16A 1IULA 3FNHA 3NT5A 4U6SA 1V0JA 4DYDA 3NDRA 4WLEA 3BTSA 1N5DA 3S55A 1S7CA 1XU7A 1GDHA 1AN9A 4RVDA 4Y67A 1F12A 4FJ2A 5L7YA 4B4VA 2WM3A 4FW8A 2O4UX 1H6AA 3AFNA 1CQJA 3S2EA 2CZCA 1X14A 3BMOB 4N5NA 3SLGA 2O7SA 3GAZA 5L4LA 1DEHA 1T25A 1ISGA 4HXYA 4DIBA 2X9VA 2BMAA 1LEHA 4UEJA 4J7CA 5JCXA 2RCYA 3D4NA 4CL8A 1HEUA 2D0IA 2O2YA 5B37A 3S8MA 5KJ1A 3L6EA 4KTTE 3CIFA 5DCUA 1PGNA 2I65A 3IDSA 3AM3A 1HDGO 3DBHB 2CNBA 2WJPA 4CMGA 3L9WA 3JQGB 2Q4BA 3MEQA 4HV4A 3C7AA 2AQKA 3D3WA 1Y81A 2J3HA 1DIAA 5KNLA 3KXDA 3OM9A 1QKIA 2VYNA 4M89A 1CRWG 4F6CA 4YJHA 2HMVA 1IL0A 3WX0A 2Q99A 1C3VA 4CV2A 3RUIA 1TI7A 4MIEA 3OQBA 4M86A 4JNKA 1Y5RA 5IF3A 5IXSA 4S1VA 1HYEA 1Z82A 2OBNA 4YJHB 1XA0A 2GN8A 5H83A 4CM7A 4M1QA 4NBVA 2FY8A 2JFHA 5A4DA 3WQRA 2G5CA 3CXRA 1DO8A 1GYRA 1PGOA 3OEWA 4Q3NA 2OFPA 3SC6A 5ADHA 1O94A 2AG8A 1DHRA 4JX8A 3H9UA 4DBVO 4CUZA 4GVLA 4UUOA 1T4DA 1YXMA 1EVJA 2GDZA 4MVJF 5EIOA 2EP7A 2VZ0A 1PJCA 2H9IA 3ZDFA 5I7VA 3BYZA 3ZU2A 4CUKA 5BR7A 4RDIA 3SJ7A 5CEJA 2EGHA 1R66A 4D79A 3I3OA 1YBAA 3QJ5A 1JWBB 5JW6A 1H9BA 3MZ0A 3PHGA 5CG1A 3VVCA 1Q7CA 4M54A 1IZ0A 4UEOA 1ZVMA 3A28A 2HAEA 1ZKMA 4NFHA 3KOUA 4HKTA 2FN7A 3WOHA 3VTZA 4FOSA 4YPOA 2D1YA 5KCZA 2JAPA 3IP3A 1DSSG 1O95A 4K28A 1YL5A 3BXXA 1B8PA 1S6YA 2R00A 4AJJA 2I3AA 4U0KA 2YV2A 3GVXA 4MP6A 2FMUA 2NV6A 9LDTA 4CLEA 1I32A 2VUUA 4HADA 1ZXLA 4QX6A 4R5HA 3QQPA 1UH5A 3U3XA 1YDEA 1GFSA 2YV3A 3VAZA 3OJOA 1JLLA 3QWHA 3M1LA 4C4OA 4DGSA 3VPSA 2HKIA 2BI8A 3PHIA 1TXGA 2VYND 2Y0CA 1Q0QA 2VNAA 1N9GA 3U4IA 4ZQBA
chains in the Genus database with same CATH superfamily
3QLEA 1VMAA 5C46F 2EP8A 5JALA 1QH9A 5FBLB 1PCXA 3ZD8A 4JIGA 3I9FA 4GLOA 2HMTA 4LJ7A 4YCJA 1IPHA 5CFNA 3GY0A 2VQ3A 3CKYA 1OI7A 1CJSA 3UENA 3K4QA 3IHTA 4FGUA 3WNCA 2QNBA 3ZHCA 5KNBA 4G5OA 4RMGA 3T5TA 4BTEA 4DPKA 4E88A 3QE2A 1C1XB 5G0VA 2DUWA 5LFAA 5JRJA 4GUDA 3TAUA 3D3EA 1XMSA 4G41A 3AHIA 4LYYA 4JVMA 4WLVA 1BMFA 1E0JA 1DXOA 1KA9H 1P29A 5BYKA 2CBZA 3GBPA 3V1KA 5BMVB 2D8AA 3WGMA 5JMOA 2OM2A 3KXLA 4HH0A 1ZN7A 1BS1A 1PUJA 2NXJA 5F4BA 5AESA 2NZ8A 2Z2YA 3D8UA 3ENZA 4Q82A 3L8MA 1XDGA 3UMBA 1KWKA 3AQ4A 3BTVA 2CHUA 4B87A 2AC4A 2DYKA 1CUWA 3K5WA 3IDFA 1V9CA 3KPWA 3JRWA 3MMXA 3T06B 1KI3A 3A36A 4RF5A 1G6HA 4II2A 1Y42X 3A6EA 3MIIA 4JP1A 3UHOA 1TMYA 5LZ4A 2GO1A 2C92A 1KK2A 4KE8A 3VI3B 4DSUA 1GYQA 2YUTA 3FB4A 2ZPTX 3INRA 1DWQA 4HPWA 3C6QA 3GGDA 4X63A 4EG4A 3F8WA 3MG9A 1W4ZA 1K75A 3VSCA 1P91A 3PBKA 4Z49A 1XVLA 1H2XA 4MVJE 2NT3A 5TMDA 7REQB 3PHJA 4YV0A 3DV9A 4KOEC 2IEDA 3DQQA 4DSNA 1L7XA 1JHRA 2GCGA 3DWGA 2H07A 1E96A 3JARB 3LKZA 2X15A 3R0JA 4MV3A 4X3OA 4CEJA 5JZVA 5IBQA 5GAJA 1COWD 1G41A 2TMYA 3W2EA 2O2HA 4HXEB 4B3GA 1NWCA 4LXUA 1JBQA 2Z4RA 3B89A 3EVZA 1NUQA 3F9IA 3GGSA 1ZR4A 3SSNA 3EODA 1SUSA 2FZEA 2GMWA 3IOEA 1S1MA 1J8QA 2BFPA 1R0SA 2FW0A 4P3YA 4X93A 3VSEA 3ROKA 5JH7A 3K5PA 3PGA1 4PHFA 4QWMA 2IUFA 3NS7A 3OWXA 4BLQA 4OATA 2QVXX 3UJ6A 2GKGA 1NMEA 2AMVA 1AK9A 3LPNA 1SHTX 4TZ6A 2EBHX 5I6DA 2HQSA 3OCYA 1DEOA 3B85A 3QVGA 4AX8A 3NW9A 2XF8A 1D0SA 3T4EA 3V42A 4XCXA 5HF8A 5KVSA 1FY2A 3IXMA 3RS4A 2UV8A 1E2FA 1Z2AA 3LVRE 5CIYA 4YHHB 4WVFA 4MHTA 4RHXA 4PSCA 4FE4A 3WSWA 3BDVA 1KKLA 1L5MA 2EWVA 2PRKA 4ND1A 4GXNA 3V8PA 10MHA 4FILA 1XYGA 4DRYA 2AOTB 5DFAA 5FPTA 2WJWA 3U7HB 4WW0A 3TPCA 1G19A 1PWXA 1VG1A 3AOGA 3SBEA 2A9JA 4EHDA 2DB3A 3OY2A 4QQKA 4LA4A 3OIYA 5G4KB 2DPYA 4Q21A 1EX6A 2B9VA 2JI8A 2P2SA 3SQNA 4BQPA 2IIBA 1USIA 1NV8A 2UYQA 3MMSA 3C3MA 3TK1A 5KTOA 1KTIA 1H9AA 1KL7A 2EKDA 3LY5A 1M1NB 1RPNA 4HXGA 4AZ0A 3QG5A 4E5VA 2HF7A 3NB0A 4DSAA 1AUXA 2I2DA 4RVNA 4CKBA 4LRQA 4BBPA 4C7OB 3QA9A 4QD3A 1V3TA 2ACKA 1H2BA 4PCAA 3H2BA 4X71A 3RC2A 2V9CA 3CN7A 1NOIA 1K4KA 5ES4B 1JHVA 4MGIR 3T3GA 1H5QA 4Q1AA 5ANRB 4A26A 4ADSG 4OXYA 2OP1A 1KI6A 3HO6A 2JA1A 1NW7A 2XCLA 4TWJA 3X2FA 3OPYA 4DIEA 4IXTA 3OPYI 2Q3LA 3JQEA 1GEEA 2G36A 1JR3E 4ODIA 3FMFA 3IMGA 4M1KA 2OG1A 2PRSA 3CX7A 2EZ4A 3KZMA 3L7MA 3MM4A 3PEVA 4HRXA 2VHQA 3L0PA 3FWZA 5ALDA 4CRWB 4TYNA 1JPJA 1UR5A 4BX0A 1FLNA 1SUWA 4CLHA 5DBFA 3Q10A 2F3QA 2R6DA 4L5JA 5HUQA 1KEUA 4LY6A 4EJSC 5F78A 3KJNA 4GWGA 1GNLA 1MRNA 3KR1A 4OGGA 1TM5E 1HEIA 2EKBA 4ESOA 2HJ9A 2G17A 1PR5A 4KXLA 3WBKA 3OP1A 5M5BA 4J7AA 4Z1MA 5HRCA 1E7YA 3LYLA 5KX5B 3L6RA 3KJQA 3T9DA 1SVSA 2R85A 2FWAA 3FVRA 4KQEA 3VAAA 3FPHA 4CCYB 1ZNWA 5HUJA 3EWNA 4RZIA 5K0TA 2PUGA 1NF8A 1UDBA 3HC7A 5FX2A 4ZAZA 2PH5A 2WV7A 3H17A 3RSHA 4YAEA 4D0RA 1T2UA 1PSWA 2ZU0C 3M7IA 4MMZB 2D8MA 2UXDB 4CPDA 3PQ5A 1JA9A 2B7CA 3ENQA 1KZ6A 2PO7A 3GQBB 4ITVA 1QZZA 3TTUA 4P0TA 3B9PA 2IV2X 3LX4A 5E6RB 2AE1A 3Q2OA 1E1DA 2DQ4A 3V4LA 3I5UA 1Y6GA 5LMNB 5CR9A 2ZS8A 3HO8A 4JSYA 4HAIA 4KYIB 5CIWA 5ALZA 4G37A 2XCIA 1BZYA 4KXNA 2ETVA 3P2KA 3KKPA 4TKMA 1IVYA 1JBKA 3FYUA 2YH2A 5I8PA 3TI9A 3FWYA 1QP4A 4IV0A 1TQ6A 1EP2B 5FWDA 4LC0A 3ADDA 4FD2A 1RRFA 2F67A 3GFPA 5FPQA 1C4KA 4D9HA 4AZWA 3LF1A 2IZOA 2UUAB 5KPDA 1DKLA 4B8ZA 3GARA 3Q3HA 4WACA 2XKJE 4L4XA 1Y6QA 5DV9A 2HNBA 1GG5A 4P58A 4QJ4A 2MIIA 4QYMA 4CMAA 5JNWA 3ZV6A 3CZ4A 1YDHA 4HZUB 3EUEA 4UAGA 4C89A 4AQ7A 1RAIA 1ZICA 2X5JO 2QLLA 4JLBA 3IDAA 1J42A 1UFOA 2Z2KA 3IUMA 3TM4A 5HFNA 3GDGA 3QIVA 2B98A 5JY1A 1VHTA 5FL7D 3B7PA 4QUBA 1XXHE 2AUNA 4M98A 3ADOA 1H8HD 2O50A 4TRNA 4UHCA 3I58A 4RQBA 3N2GA 5JRZA 3FPKA 1RKXA 1IB6A 1P7WA 2BH9A 2A7QA 3L4SO 4GOJA 1Z4LA 3BHNA 3RCBA 3RKUA 4S24A 3TYXA 3UXEA 2NU9A 2IYRA 3GEIA 1BHSA 4DMUB 1Q16A 3SQWA 1K7EB 2IYWA 4HX5A 1WB9A 4AYWA 1E6EA 3Q3JB 1SVMA 2FFHA 3Q88A 4RL6A 3F73A 3B1KA 3DNPA 1JLKA 1GCUA 4G5SA 4Z0HO 1FFBA 1N6KA 3D5TA 3WP0A 2XXAB 4B5LA 1BCRA 5GIPE 3GLIE 1ZMOA 4EKEA 4G89A 1ZP6A 4KACA 5CXUA 1LDMA 4LNHA 3FUTA 4WADA 3T5GA 5B3KA 5HK9A 4I50B 1P2VA 4JC8A 4UUQA 3W9SA 3DAYA 2Z1DA 4CIVA 4KLNA 4YCDA 2QUBA 3DS8A 4BZPA 3E1GA 3UUEA 1G21B 2FU5C 3AVUA 3A04A 3SIWA 1D09A 1A04A 1ZD4A 4O2LA 4OHYA 1R0XA 1ML3A 3T12A 3HJAA 4M7WA 1I4EB 3RTCA 3GRAA 4AURA 1JE1A 1EFTA 4OMUA 1MJGM 3T3HA 2B7LA 3E81A 3O2QB 3EYAA 3V34A 3WB2A 5CEFA 1KU0A 1QS0B 4CCAA 5JVDA 3ZE2B 1Z08A 3ORFA 3KZKA 4IX9A 3KUCA 2OXCA 3MJRA 3FOBA 3VH2A 4TV8B 3NYIA 1NZFA 5PGMA 5ABPA 2JIMA 3KYDB 3TLYA 3MSCA 4MQMA 3UC5A 1QG0A 3EH2A 2WYOA 4QOIA 4ZU1X 3NVKI 1NN5A 3TOZA 2P2NA 1R5JA 1CIJA 3WK7A 4AN0A 5HQ3B 3N9IA 4UQLA 1SG6A 3KTDA 1ORDA 2IHNA 2YMLA 4PX9A 4TLDA 5LJLA 2ZK7A 3Q8MA 3F9CA 3NHPA 4GL2A 3OCXA 5CVEA 3KZOA 3T4UA 3JW8A 5FIUA 4FKBA 4WIAA 3X1XA 1HQCA 2I9KA 2PS3A 5HKKD 3PFBA 2BMJA 3IPLA 4ZQEA 4BFCA 3DMYA 2CLKB 1WPRA 1SEVA 2O20A 3IPXA 1MV8A 1U2DC 1SKBA 2JW5A 3ECCA 1TKAA 3D0QA 4C4PA 5C8ZA 4GZ5A 4NFLA 4ETNA 2YDYA 4TL8A 4G8BA 1AKYA 1RFLA 2L42A 4LRUA 3E48A 4EW3A 1X3LA 1FDWA 1YBHA 1NULA 4PXSA 3E2MA 1RXUA 1WUKS 1YR9A 1I10A 3ETCA 1E69A 5KQPA 1AURA 1IC6A 1LRKA 3CCBA 5K03A 3L4BC 1NQUA 1SCBA 4HMQA 4XX1A 5FRDA 1T5DX 5A04A 3DZ8A 4FWBA 1UBOS 3CNQS 2XQKA 1RI5A 3KBBA 4OYYA 4WY5A 1VL6A 5F9HA 3QKRB 3OJ0A 2VT7A 2RAFA 3M3DA 1D1TA 3VVLA 2HUNA 3GDWA 2PGLA 1SFRA 3IPCA 1YOVA 1KNQA 1S0UA 3ETNA 1IZ7A 3MS2A 3W3AA 4HWSA 4ZOLF 2HDNB 4U5XA 1VSTA 4FEEA 4NCXA 5DOZA 1YK0A 4Z9BA 3WNBA 3FSJX 1NU8A 1H6DA 4ZJZA 2O07A 4MUNA 2PZJA 3U37A 2YY5A 2ES4A 3HSSA 1X7HA 2LGJA 2RB4A 3W5UA 3LP8A 1L3CA 2P3OA 4GR5A 2QY9A 4QXPA 4YJFB 5HMMA 5IS2A 2BISA 4KFUA 2NW6A 1X38A 4EBBA 1UKYA 1TVMA 3OC0A 1MENA 4JCOA 4XOUA 4ANFA 4L3OA 4MQUA 4ZPXA 1G2OA 3LX5A 1HDIA 4F6RB 3GHHA 1GUYA 4QXOA 2G6BA 1PLJA 4NYMR 3TDMA 1EDOA 1E9BA 4XGIA 1C7JA 4BJHB 1RZUA 1Z2PX 2IKSA 4E7OA 1EFUA 1EHCA 3IEUA 4DR2B 1EB9A 1LF5A 1N2XA 1U4OA 1Z6TA 3DPIA 3I73A 1SC4A 3KAJA 4PLCA 3DDNA 1MQ8B 4K26A 4MLDA 5DSTA 4BLUA 3KQHA 2UXCB 3A9WA 4GKVA 2OO3A 1CZOA 1DBSA 1HF3A 1Y9EA 3B6EA 5GONB 4N54A 1O4WA 4HGOA 2Y68A 4RF4A 2JLCA 4J0GA 4CTMA 2ZRGA 3HJFA 2J46A 1JEYB 1SK9A 4YJDA 2A9OA 4OHCA 4CQLB 4UNNA 5DMHA 3AKCA 3M4JA 4KODA 5FV4A 3HU1A 1EK5A 4QPJC 1M76A 2AQ8A 4FZVA 1Z4QA 3R5JA 2PS9A 4OQZA 1FFHA 2XW6A 3ESYA 1W8IA 2HW8A 3U4MA 2MR5A 2OHOA 3NDBB 1NVGA 4UATA 2ADMA 4GPTA 1E94E 1WMSA 2FDXA 4QREA 3RFVA 1FW8A 1X80A 1WS6A 1B73A 4RK1A 4JLAA 3R1IA 3VNQA 3D6AA 4PW0A 3SE7A 1JIUA 3I0ZA 3H9QA 2R5WA 4CN8A 1B23P 3EARA 1HGXA 1RWQA 3EGVA 1ESCA 3HJBA 1LPSA 2INGX 1FEZA 4TM8A 1Z0ZA 3KWLA 3NT2A 3IT1A 1TIBA 3C70A 4XRRA 5J63A 4BFLA 2E5LB 1F8YA 2FWJA 2G7MC 3VYSB 2DAPA 3OEYA 4PBRA 1MDFA 1PJ8A 1PR0A 3HB5X 3KB6A 4EEXA 4O1IA 4RV4A 2LDBA 2CF6A 1AOXA 1DAKA 3O0TA 4WFJA 2ZQ5A 3OM1A 5C5IA 4QDJA 3TTSA 1UT6A 2M32A 4Z7QB 1CWUA 4G1FA 3PEUA 4L2IA 4DLAA 3ZV5A 5U4QA 2P8JA 2O2CA 4MYCA 3JX9A 2R3SA 2RAPA 1IWBB 3BJRA 3K0AA 4MW5A 3BSSA 3VC1A 1U7PA 5DCWA 4OY3A 5DBHX 1RU3A 4KSYA 3F49S 1JIIA 2G1UA 4Y6OA 1CYDA 4FGZA 1R8JA 2P2DA 2VJMA 3HKBB 4G67A 2ABWA 3L01A 3LPAA 4OHKA 1MTZA 3KYCB 5FPPA 4C2AA 1XN1A 2FETA 5AWFC 3WLQA 5JS8A 1GPJA 3DE4X 1FPQA 1ULBA 3IUJA 3SR3A 2HBRA 3A2LA 2H31A 3KOZA 1A4XA 2NTJA 3NT4A 4GE0A 4HN2A 4QSHA 1LJ8A 1G7RA 3BQ9A 1NXQA 4JLPA 4KVGA 4Q02A 1D4OA 3Q7IA 1GGNA 3NRJA 1ZH0A 2YJ6A 3C6KA 5L7WA 2C0PA 4C4AA 5CRIA 4AJ9A 2HWKA 3MJSA 2B1RA 3EA4A 4R2KA 4RSRA 4JLDA 3NVAA 1X1QA 3RO7A 3ND5A 5KYUB 2NQTA 4EW1A 5BR8B 3MCWA 1GCAA 2C9OA 5EIWA 4QBTA 3FUCA 3OEED 2QM7A 4LI3X 4JEIA 1E4OA 4TLAA 1HOTA 1QYDA 1JZTA 3AV3A 3U1TA 4RHYA 1PFWA 4ZOBA 3RQIA 4EVRA 1MBZA 1NPYA 5CH8A 4RNDB 2IFTA 3AM5A 5IDYA 5H1YA 3BSYA 4KXXA 1ZGJA 1RTKA 2E49A 2R7NA 4Z4FA 4PQEA 1FXWF 1MIOA 2VFAA 3RG8A 1NUPA 4HH1A 2QJRA 1VIYA 1MAVA 4URHA 1I5OA 1BE6A 4F3NA 1G8PA 2PS1A 3I62A 1X8LA 3N6RA 3EVEA 2ZREA 4R01A 1BNCA 2CUZA 3ZQ6A 3THYB 3DG9A 4I36A 1AKMA 4OHVA 1SGWA 1Q0ZA 1JQDA 3MVEA 2JK0A 1Q21A 3WWZA 5CAEB 4BMXA 4M0DA 1E2EA 2O8CB 1ZMXA 2R87A 3TXYA 3OJLA 1QOZA 2R11A 1R64A 4RXTA 2JFQA 1XVIA 1B6SA 4FNAA 4FDUA 1XA3A 4BKUA 3AHDA 1GXSB 2R8EA 1CT9A 1OFVA 3PT5A 1RQXA 3IPAA 3NEJA 3QI7A 2W22A 1Z12A 5DSXA 1FTSA 1P0PA 3BJIC 1J2RA 1Q3TA 3A4TA 1E2MA 3EGXB 5EXTA 1QZXA 1P9WA 4TKLA 2ZJBA 1TPYA 1HRDA 1KI8A 1NLYA 1T91A 4KWCA 1LBQA 4YI5A 4CM5A 1QGYA 1E3JA 1EXWA 1OWPA 1TCBA 1VJ0A 4QDZA 3VZRA 3B38A 2C7BA 4Z3DA 1GU0A 4YR7A 1U2TA 2DY0A 4I4TF 1E9AA 4Z86A 3HL4A 1MFPA 3MJEA 3M6FA 5AKYA 1UJBA 4B2PA 2MSEB 1CETA 1GPYA 2O8EB 5KTYA 3PLRA 2J6BA 1DJPA 4OFZA 3BFXA 4R2IA 4IIEA 4UEKA 3AH8A 5HBRA 1ONOA 4MWEA 1VLVA 2LR0A 3JY6A 1FTNA 2UZ3A 3E53A 1LA2A 3KT0A 3ZNNA 4NXNB 1LBEA 1RD4A 4U7FA 4RTMA 3LC2O 2RHJA 1FXSA 3GUZA 4G1VA 4QRIA 1I1HA 5HDBB 2B82A 1CY1A 1BO6A 1A50B 4E12A 1Y7IA 1ID8A 4RMHA 4IQ8A 1II0A 1IY8A 1ADJA 1UEJA 1WKCA 2J9FA 2ZJ6A 1W2HA 2Z1MA 1SCAA 2CVZA 4LX8A 4CHGA 1SIWA 1QTRA 3IR7A 2NAPA 3AO0B 3WS7A 1DLJA 5LU8A 4XUGB 3JZDA 1J7KA 4CMJA 4PZYA 4UBMA 3IQWA 3T41A 2ZUCA 1FX1A 1IQRA 3PKZA 5ECDA 4F12A 1OLUA 1SKYE 2PT7A 3KEFA 1ZIYA 3OLWA 4HAWA 4RELA 5H02A 5I9MA 3REQB 3UJPA 1FP6A 2OY0A 3NX4A 2XKKA 2P62A 1WZ2A 1K8XB 3MUFA 2H4HA 4B4KA 1I94B 4KIWA 1JMKC 4G5XA 1RR6A 4WXMA 1UMKA 4I5EA 4R4JA 5KOJA 1T1GA 1XG5A 2QPOA 2OC9A 3E9ZA 4GQAA 2R66A 1P5HA 3PVCA 3U62A 4F86A 3R9XB 1FFEA 1OLSA 1WUJS 4U00A 3ADCA 2LZ0A 1EP1B 1JSRA 1K86A 2V54A 2AWOA 2YW9A 3CWQA 1ZK4A 3O6VA 4JU8A 1Y5LA 4BX3A 2H4WA 4HZIA 4AKGA 2X8WA 4MKXA 1FP4A 3H1TA 3H1PA 4JBGA 1Q0HA 4KH0A 4JJ8A 1UDXA 1VPEA 3DXZA 3UY4A 4M4SA 3BGVA 3OIVA 3ZI4A 5JWOA 4RJJA 2QZZA 4TZTA 3UQZA 3PHBE 4HYQA 3ZXIA 3JQDA 3B1VA 2HEGA 3EG9B 2V03A 1K5GA 3VOSA 4A3SA 1DP4A 1PL0A 4KR9A 4GXTA 1L7VC 4KXUA 4IMIB 2H18A 4ABTA 1G2QA 1YFLA 5JSKA 4KPEC 4TYYA 3H5RA 3GEBA 1SBHA 1CK4A 2G07A 3C85A 1JAZA 1YB7A 3AY0A 2D0PB 2QEQA 3MCTA 3ZNOA 2F62A 3BRWD 1D1PA 3CNOA 1BFUA 2CKMA 2G06A 3KQVA 4HRYA 5JJLA 3N74A 2V98A 3JPYA 3QPBA 1SD5A 4ALKA 4EFKA 3RRMA 1PJZA 1G7SA 1V7CA 1TTQB 2EAUA 3H11B 1QLHA 2BFEA 2HWWA 1PNTA 8OHMA 1DOHA 5M2QA 3W7AA 3QFTA 1SZJG 1EFPA 4QG3A 3AFGA 2JBWA 4DSTA 4EPTA 4ZIRB 3HZHA 4XYEA 4OB6A 4KVAA 4YP9A 5COBA 3CB2A 3E82A 3R77A 3Q12A 4CMIB 2ESRA 1SEPA 2QG9A 2VTEA 4OSOA 1V2HE 4NE2A 4GLJA 5LUAA 1BN6A 1EXNA 2P8SA 1E0SA 3RAFC 3KVNA 5AIAA 1RJDA 3TW6A 2IYFA 3WGOA 5KYXA 3QI2A 1PFYA 4E70A 1BGXT 2A0XA 2Y1CA 1ZSYA 5MGNA 1QPBA 1VL2A 2H51A 4NCHA 2J3DA 5EL0A 5F21A 4DLKA 3VJLA 2P6MA 4E33A 2FH5B 5CA0A 2FPIA 3RH0A 3S7TA 3D4PA 2QM0A 5FWXB 3UH0A 2B30A 1WZIA 4CM6A 4HB0A 4HQNA 5BOSB 2ZTMA 3HPRA 3OE1A 4EI8A 4CIBA 2QE6A 1HFEL 2HCTA 4FHZA 1J2EA 2XNHA 3N5CA 1XZQA 4P80A 3ROQA 5IC4A 2BF4A 3GJ0A 4I4NA 3BWYA 3VDMA 2P1ZA 1EGVB 3GFOA 2H7XA 4CKEB 4R9VA 1A97A 4DLUA 2H63A 2AKYA 3DH0A 2VDVE 2XUHA 5AQ1A 3BHIA 3JZFA 2P5YA 2IS2A 2QTRA 2QL5A 1DKQA 2EVWX 1NZDA 3B1ZA 5LYJB 2V7QD 1VPLA 4OKSA 4ZOLA 4DC0A 3V4VB 4WCDA 3X1MA 2ZRNA 1JLMA 1JSCA 1FVFA 1O6CA 3KJXA 2RK3A 2F64A 4NI5A 2BEVB 3EJWA 3R0VA 3JRNA 4B73A 2EW8A 3R3SA 4IZIA 3TOXA 2QRHA 3RHFA 5SZIA 5E4FA 4YACA 4N1AA 4LPKA 4WUVA 1ZW1A 3AINA 4M7OA 3RUHA 5J5CA 3GLRA 2JIRA 1ZZGA 4IFBA 1STOA 2C07A 2FPPB 4QUKA 4EYQA 4US2R 3AIOA 4X8OA 3C5VA 1D4ZA 1ZGHA 5CJJA 3QLUC 4CNQA 1P6UA 1WEKA 2AFHE 3QY9A 3TECE 5DM2A 5HZMA 3G5LA 1A9QA 2CLHB 2Y93A 4X62B 5IW8A 1CB0A 1NP6A 2YINC 2WY2D 2AOWA 2W6MA 3TQSA 3G89A 3C7TA 4A8JB 4DLLA 2BTQA 2ODNA 2VSYA 4JJFA 2DXIA 2Z30A 2PVCA 4I1OA 2DFPA 1MV5A 3HN7A 3NTOA 4WL0A 1R4MB 3BE8A 1E7RA 5J2TF 2XUDA 3ZZTA 3IT3A 3JAWB 3RW9A 2EX0A 3WIVA 3LA6A 3DB1A 3WQBA 1XTSA 5T4FA 1ZM4A 5C53B 2HPHA 2P4SA 1XTVA 3CE6A 4HGZA 4RJ2A 2WMDA 3MFQA 3U7IA 4DCNA 3GD7A 1OTYA 3KZNA 1DPGA 2WFMA 1HEYA 1IN4A 2IYEA 5JADA 3KVRA 4CDMA 3GUCA 5A7HA 1IFXA 3QEMB 5F1OA 4GDMA 1JDBC 2IP1A 1TLTA 1WDMA 1ST3A 1QHNA 3NKVA 3P45A 3GWZA 1HT3A 2J3EA 3NH9A 4EVQA 4KMSA 1XPUA 1NAIA 2EEPA 2JJ2A 1N0IA 2PT6A 3N3AC 1EG2A 5CHEA 5CX1B 2ET6A 5DGXA 2XUOA 3KE8A 4DT1B 4GGPA 4GECA 3WQHA 2ZIGA 3QLJA 3ZZUA 5TVKA 1I4WA 3AY3A 3OOEA 4CI0B 2YZKA 4UXIA 5AR1A 1G1MA 2QN8A 2P0EA 2XB9A 4L6CA 1P2TA 3ORQA 5FTKA 1PVVA 4J2HA 2BBTA 3HB7A 4ND8A 4CM9D 4L02A 3THWB 3G7NA 1XJQA 4LN1A 4RWEA 1N2CE 1JHUA 1U3GA 2OCPA 3LT1A 4QUGA 3KQKA 1C0EA 3GFRA 3CH4B 3MWEA 1W0JA 3Q3IA 4RPCA 2BFDA 4F0JA 1XHEA 1DTWA 4URVR 2NVUB 3C14C 3HABA 3DBIA 1F6WA 3BZBA 5JCZA 2B4TO 3GPDG 5JQWA 1D4AA 1J07A 1NSYA 4OKIA 5IAEA 3UGKA 1NXPA 2GAJA 2OAQ1 1SPBS 1NYRA 4LXGA 5DF1A 4KW7A 2WC1A 3FVVA 4L5YA 4EUNA 1P2FA 1UWKA 2GM9A 3FKSA 3FYDA 5M7EA 1EHIA 2XADA 3ETLA 3M6WA 3RASA 5IZ4A 4Z9XA 1UMCB 4UPDA 3PA8A 2QLMA 3WB0A 4BNDB 4NR0A 5AW2A 1YVUA 2CXXA 2WJAA 3K2BA 1PDOA 3VH3A 1OU4A 3KUXA 4IGEA 2HHCA 4LYAA 2D6FA 1TZBA 5KCMA 5J47A 4B7AA 3LNCA 4BUJA 2I3BA 4CU2A 3DWEX 1KPIA 1WSWA 4TUYF 4OG2A 3SXPA 4I3GA 1TA0A 1TF7A 2DH5A 1VCIA 2IXBA 3EXEB 3MJFA 1A76A 4BRSA 5KDLA 4Z7OB 5KINB 6ABPA 3ILYA 1Z0DA 2VJPA 3PU6A 3RS3A 3PFCA 3FPSA 3P9RA 4R1QA 4AG5A 5K6AA 3ZY3A 1GPLA 1LBIA 3H0KA 3V1UA 4B7UA 3LRXA 4B2YA 3QIAA 5EZYA 5B1DA 1AJEA 2R25B 1GZ4A 4MR8A 1A2BA 2R751 5EY5B 1YZKA 4B33A 2X1HA 2BE9A 4PG7A 2O8DA 2HLDD 1WO8A 4GRIA 4HAOA 4ARIA 3DMRA 1RMQA 1I13A 2PZLA 4OB7A 1FNCA 2W42A 1EVIA 2QYHA 5IFKA 4Z4GA 4YJ2A 4IZOA 1RYEA 1J7JA 1YQQA 5F76A 3U7JA 2MSWA 3RUAA 1U2EA 3V00A 1UCFA 1YRQA 1RBYA 5L3SA 1WULS 2BMWA 2C59A 5ITZB 3BSFA 4KQMA 4GWLA 2Q5QA 2MSKA 1VP3A 2P2GA 2B94A 3ANNA 4JITA 1Q1ZA 3VKUA 4K05A 1J39A 3GJRA 3T3MB 3U19A 4U63A 1XHLA 3FB1A 4EQ6B 3PQ3A 1LX6A 3LU1A 4F56A 3GJYA 1ADFA 2LTAA 2Q0SA 3CNBA 3R3JA 1NVKA 4WNAA 3TG8A 5KAPA 5SY6A 1L9KA 1JDPA 1KDRA 1AT1A 1UPBA 1AG9A 1M1ZA 4N6GA 4Q4DA 2VLBA 2OBBA 5J59A 3ZJUA 3Q8WA 2ZI5A 4GAEA 4FYXA 4R1NA 2JAXA 3VRHA 1FYXA 3A1EA 1OYWA 1DX6A 3DM5A 5CDSA 3CR8A 3CF0A 2V0NA 4DVJA 1XD2B 2IU6A 2YZ7A 3RTEA 4DV1B 2J8ZA 1CZUA 2A92A 4LW8A 3SYMA 1CZKA 3V4SA 4UPEA 3H8VA 4YJGA 3EEOA 3T9FA 3CEJA 3QPCA 1XEWX 4MOWA 2UZ0A 3JYHA 2V7PA 3NORA 2DWPA 3SLRA 3STWA 3F4LA 4MR9A 3REGA 3S1AB 3RHTA 2Q4TA 3F78A 4GRAA 4RIIA 3W2FA 2ONZA 2WT8A 4ND6A 4YXWD 3T3NA 1T5TA 1U5AA 1DCTA 5MF6A 3UV6A 2D5AA 2X40A 4DWWA 1VGVA 1Y3AA 3I01A 1AKQA 4NNPA 4XQ0A 1QKKA 2OCIA 2AEJA 4FNMA 5HG0A 3K9NA 1FLDA 1QRRA 2Q1YA 1ZOLA 4R40A 1QHHB 2FFQA 4FX2A 2BSXA 4RK6A 4ZI7B 2GO7A 5BW8A 5AHOA 1NXVA 3O84A 1NJ5A 4HWTA 2PUWA 3ISVA 4QGFA 4JB3A 4BX8A 5BSEA 3I4FA 3JVEA 4Y2UA 3Q7RA 5KOHA 2BR3A 4KKVA 4GKJB 2P5TB 1U11A 2GN6A 1U0NA 2H1HA 2VDJA 1WCWA 4FDVA 2PKRA 3TMAA 4BVKA 4MI3A 2KJQA 1FSSA 3KLPX 3P32A 5AVJA 2PE5A 2BMVA 1SULA 3Q72A 2M2IA 5HOQA 2QP4A 1N6HA 4ZHQA 3DZIA 4WZBA 1YRWA 4YGXB 2JHAA 3QX8A 4PYRA 3V97A 2F8MA 3FDZA 1DJMA 1JQKA 1PK8A 3CONA 4I55F 2IPXA 2Y1EA 4AYXA 4QQNA 3I01M 2HJWA 3Q40A 5TS3A 3C3DA 2EZ9A 3HHEA 4F1JA 4G26A 3LOPA 3FI9A 2Q5HA 3M34A 4D4MA 2CD9A 3B3AA 3BXFA 4D4LA 1HQKA 5FI3A 3ELDA 2AC2A 1B74A 5I9BA 1NN0A 3GA5A 4MP8A 1HO3A 2PSSA 1SB9A 3GUUA 3SNHA 2P9TA 3PGKA 2F55A 2GR9A 3PENA 4IL5A 2QT9A 1AO0A 5JCJA 1D5CA 2NIPA 1OBOA 1WUIS 3BILA 3MCUA 1UP4A 1IEQA 1E6WA 1NM5C 1O97C 1DZ3A 4IMRA 4MP3A 5F3WB 1JHQA 3NBXX 3ANSA 4D74A 3K1YA 3GL9A 1ZGBA 2OXRA 3ZLJA 2G70A 5BP7A 2P6PA 4K81B 1YS2X 1C7FA 1Q1QA 3TPZA 1MB4A 3B9RA 1FFDA 2QPAA 4NMXB 5C5CA 1PK9A 1GITA 1O96B 3PNQA 1AQUA 3QFCA 4FEYA 1CEYA 2O8CA 2VK4A 1A8HA 4ZYLA 5J9FA 2XMBA 4RK7A 2BFMA 1D2NA 4ALJA 4IDCA 4BAZA 2YJ5A 4ZQCB 4ZYWA 1DRWA 2XUGA 2Z8XA 2Z5FA 1GAXA 1EDDA 2YHUA 2QAGA 4FGLA 3MTDA 2OQRA 1JU4A 3WMXA 1HDCA 3LDUA 4RKRA 4E4YA 4EW6A 3ICCA 5KOIA 1X74A 3E27A 2O0KA 3FAZA 1U6IA 1ZEJA 2WE7A 5IHPA 4IIYA 1TEXA 4L8LA 1KEEB 4WGGA 1CNMA 4FEAA 1KQFA 3AEQA 1CW2B 1CY7A 5BUSA 3ZD9A 2Q46A 1PYDA 4WOJA 5SY4A 1FDOA 3L7JA 4GF5A 4A0FA 3ZDEA 2WABA 1DFGA 2QK4A 2ECOA 2OCGA 4UUMA 4LSMA 4LGCA 1R0YA 2GJ9A 4ND5A 6REQB 3WGZA 4L51A 1W0KA 3SDBA 1S89A 2DH6A 2JH9A 3HR7A 3HWRA 3QXSA 4UM7A 1PV2A 4BCBA 2D4HA 2SKCA 3IEVA 4B4UA 4LDNA 1I7NA 5BR1A 1UC9A 5LP6A 3VI4B 3UYLA 4IS3A 3PXDA 3B6ZA 1G8MA 5ENDA 5CH3A 5CYOA 2WA1A 2IU0A 3OIWA 1ZYUA 2FLKA 3RWOA 2XT6A 3NHSA 1JI3A 1WP9A 1XD8A 4A27A 1EUDA 4EHHA 3SBXA 3SY8A 4OP2A 4HGYA 2BGJA 3ZLTA 3GDFA 1A9SA 3MOSA 2VBCA 3KC2A 4ITRC 3ZJ5A 1Y6FA 1QQAA 4UM9B 3WLSA 1Y89A 3AZOA 5DN6D 2Q3HA 4UHJA 2PRJA 4TVSA 5LU9A 4RA6B 2QTZA 3O95A 2I9PA 4BU0A 1E7QA 3NWJA 4WLUA 1JEQB 1GIAA 4ZVMA 2VXCA 3L7DA 3OZ7A 1H8ED 4MZDA 2FZ5A 2QM8A 1EIZA 3CUEF 1YR7A 4X20A 3UWKA 4O4LA 3O38A 5KTNA 3U4DA 4PSUA 3RUDA 3H19A 3GIDA 3IB3A 3BORA 4OJQA 4FGWA 3BB3A 4MPJA 5AVZA 1IY1A 2XOKD 3AEKB 5JASA 4F2PA 2QXYA 4EB6B 5KMGB 1FX0A 4TL7A 3OIFA 4IEIA 1ULHA 4R8VA 4RV9A 5IZCC 2GRUA 1QU3A 2KYRA 1LK0A 2B5OA 4OMFG 2ACVA 2O8NA 4QARA 3TLKA 1IU9A 2CUKA 3JSAA 1JS1X 1WXIA 2AG5A 2G04A 2YXDA 4YCSA 1TC2A 4QLBA 1HZZC 5KNDD 4DXAA 1BOFA 2AA3A 2IV7A 2ZIFA 3ZCUA 2WWRA 3IFSA 4MW4A 2WVJA 4PXAA 1DCMA 1Z5WA 1KGDA 3KUKA 4WVLA 2JD1A 3WNQA 2CFSA 1DV2A 1QIMA 2IJGX 1Y0BA 3DFZA 4MMYB 4W1PA 4L5IA 2ZSBA 4OBXA 4ZC1A 5E38A 1J0AA 1XVVA 2WHXA 3CR7A 1JQBA 5KX5A 4W4TA 2IUSA 2OD2A 3IAHA 1K6EA 2GWRA 1ZU5A 1JVBA 3OQJA 5K3FB 4TMWA 5SYNA 3VR3D 1OOEA 2RDMA 3KQNA 1U3CA 3UB2A 4IV5A 1L5HA 3SHOA 4A8HA 4TQ9A 1PD1A 4DUZB 1NLFA 1UBHS 1SKUA 2MWMA 2P0AA 4IKOA 1L5ZA 3TIXB 1PT8A 2X7HA 5BPFA 1MP0A 1JN0A 3PFFA 1JIXA 1OC2A 4E5PA 1Q2UA 3Q7QA 1DKPA 5I9NA 4XLZA 2PD6A 2BGRA 4RJKA 5DE3A 3GNSA 2FPUA 3MPUA 4ZAXA 4GX2A 3PDIA 4RMIA 2VXBA 2YYYA 3KLOA 4XIYA 3W78A 3KYJB 2IYYA 2NV0A 2I4OA 3DV2A 1JALA 4X61A 4YRJA 3TB4A 5IABA 2LKDA 2RHDA 4PC2A 1ODIA 4HPJB 1RS0A 4GM1A 3OOWA 4YK7A 1RPAA 2QRQA 3C6XA 3MN1A 3UMYA 2VRWA 4RPKA 1Q1AA 2D3WA 4NJEB 2W7TA 3NCTA 2YRFA 5E3JA 3OQPA 4K3VA 4P33A 3U4CA 2Z8YA 3ELBA 5KEIA 4CCWA 4PLPA 4C06A 4UM9D 4J0DA 3F2VA 4RACA 2R48A 3D43A 5DX1A 4ZU6X 5BRNA 3REFA 4F9GA 2GN4A 3A3PA 1OSNA 3HG7A 4HBZA 4IIXA 1Z2NX 1M54A 3N3BC 1R9JA 1ZXBA 4AULA 3TSOA 4H7JA 5ESWA 1NJ1A 4OI4A 3E4CA 4FU0A 5E1DA 1AN0A 3VKWA 3VTFA 5C7OO 2P9BA 2WMYA 3IKLA 2XI4A 3IP1A 5IHXA 5AVOA 1RQGA 1G20A 4J16A 2JD2A 4A0GA 2WHEA 2NO6A 5B30A 2VHUA 3GLFB 5AW9A 1CERA 2BH2A 2Q5EA 1ODCA 2I78A 3CVOA 3UOWA 1DAGA 1F2DA 4R1TA 4U2BA 3KPYA 4GSYA 1OYVA 3AXSA 1Z8NA 3W05A 3BD6A 4LRTB 4AWAA 3S2IA 3QUSA 3OE4A 3U1BA 1OXUA 2IIPA 1ZNZA 2Z8YM 1IDOA 1OIXA 1B7GO 4RMNA 4DLSA 5IJ9B 2MYPA 3EFOB 4J2OA 1X2EA 1TM3E 1Z18A 3GW8A 3TW8B 4BLVA 1YQDA 4GS5A 1HY3A 1LF0A 1Q95A 1RC0A 4HDKB 2QMQA 2F2TA 2ATEA 2IA5A 4HVCA 1BXKA 1I3MA 1REQA 3R8FA 2AK2A 4IFTA 4E5MA 4N0DA 4ZKEA 3DKPA 4LHEA 1E9DA 1WA5A 2ZR9A 1R74A 3D6HA 3HDQA 4FMCB 4PCUA 1JYEA 4K46A 2ZB3A 4PC7A 2XB2A 1E5TA 3COVA 2YWXA 1U3VA 5J1TB 4D3ZA 1FSGA 4MV5A 1NI5A 3DNMA 1TZ2A 3L46A 1ZI6A 4L9SA 2NSDA 2D2IA 5J4YA 4I19A 3DVRX 3STUA 4DR1B 1K92A 4G84A 2C8LA 5HK8A 1KAMA 2G5GX 5EXEA 3H2ZA 1HLFA 4LVUA 4RPIA 2B8JA 4YTEA 5INTA 2DQZA 1L1RA 3L5OA 2JGKA 4GOXA 4LDAA 3NTLA 5CA1A 2ZTUA 5KHAA 2QN6A 3VR5D 4ERXA 5CFLA 1OXBB 2FPMA 3K3PA 1Q6YA 3H18A 2JF0A 2P11A 1C1HA 2Q45A 1E79D 5F51A 2G5PA 1U9IC 3HKDB 2AZXA 3PX3A 4MVYA 3BMQB 3H97A 4GBGA 4RFLA 5T7BA 3HEAA 3VZBA 3IEMA 3QEBZ 1H3NA 4LYJA 1YO6A 4X7PA 2IXTA 4GI5A 3ZH9B 2ID4A 2PH3A 4PG4A 4YCAA 2WUFA 3TCKA 3K92A 4MUHA 4QPZA 4BLSA 2VZ9A 4BX2A 3FOWA 4I8IA 8ADHA 1FW6A 2QU7A 2FW6A 1SA0A 3IO3A 3QXJA 4IJKA 1V8OA 4FFPA 1TCAA 2VDNB 3A4YA 4BLWA 1U7WA 4JUIA 3FOCA 3ND7A 2FVYA 1F0KA 1WHTB 4LK2A 2BZGA 3RRYA 3SXUB 4F3CA 5LNK1 1XNRB 1IJKA 1V6CA 4ARAA 5HZGA 4GMHA 3IX7A 2PRIA 1JW9B 3SN6A 2W4QA 1N3YA 3DFFA 3R4CA 4JXZA 3A3YA 3KDAA 3GJ5A 4FPXA 1S3IA 3BGSA 3MAAC 3FHOA 1Y3FE 2ID8A 3KT8A 5KYWA 2VA9A 3JZIA 3QWIA 1D2HA 1PL6A 2FSUA 1EFVA 4O02B 4QPDA 5AOCA 3WOVA 3WZLA 5FTLA 1BEUB 3TNDA 4XQGA 1XZAA 2XBUA 3ACBA 1Y5NA 3RWBA 4EHBA 1HL3A 1T8YA 4NU0A 3N0RA 7MHTA 1C50A 2O6LA 2BKEA 2HK9A 2QUIA 4J9VA 3T7EA 3DAGA 4J6FA 3FR8A 2O23A 1GPNA 4OGLA 1SU8A 4EUEA 3KLMX 1RCFA 5T6BA 4CT5A 4R84A 1UKVY 3HUFA 4MIOA 5IAOA