3RROA

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from vibrio cholerae
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
247
structure length
247
Chain Sequence
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-ketoacyl-(acyl-carrier-protein) reductase
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
total genus 90
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3rroA00
1M76A 3RUCA 3WBBA 3IP3A 1M6HA 3EHEA 1GU7A 4IINA 4Z0HO 5L7TA 5CAEA 3E1KA 1MFZA 2PFGA 1AN9A 2HSDA 2O4CA 4DL9A 5I7SA 3P5SA 2VHZA 3H9UA 1JDJA 5DZSA 3TNLA 3I9NA 4RORA 3TL3A 3ZWXA 2VZ8A 4BQRA 1B7GO 3IUSA 3GY0A 1A4UA 2F1KA 1VM6A 1B3BA 4JJFA 1T24A 1DJNA 3EMKA 2X8LA 3VC7A 4BO8A 3RU9A 1ZJZA 5KNLA 3GUCA 3IQDB 3FBGA 5JMPA 1V3UA 5ILGA 1I32A 2RH8A 1H5QA 4RL6A 4ALNA 4GI2A 4YQYA 4URFA 1NQOA 5IDYA 3JD4A 1NVTA 5JAMA 1GV1A 2J3KA 1B8VA 1BDBA 5U4QA 1U8XX 1SB9A 4FFNA 3L0DA 4CMAA 2BMAA 4J91A 1GUYA 2XXJA 3VPSA 3G79A 3ZHZA 3CUKA 4AJIA 4XR4A 3HQ4O 2CVQA 4IJVA 3VAZA 3VH4A 3FF4A 1GCOA 3CSDA 5L40A 3SBOA 1ISIA 4Q9NA 2P4HX 3JQ8A 3PWSA 2VYNA 3K96A 4BNWA 3N58A 1H93A 2P5UA 3BMNB 1I10A 1HL3A 4RPHA 3SVTA 4P4NA 1DRVA 1YOVA 5KKAA 5T8KC 4D3DA 3LC7O 3I23A 2X86A 4FJ0A 4MINA 2X7HA 1L1FA 1Y8QB 2O23A 4GKVA 2JD0A 3GVIA 2PZJA 1XLTA 2O2YA 4GH5A 2NU8A 2FY8A 4DC1A 3MJ4A 3NT2A 4IDFA 4JGBA 4K26A 1ZBQA 3WX0A 3GNSA 2YUTA 4UULA 4Y98A 1C14A 3JYLA 4XIJA 4MVJM 3GDFA 2HO5A 3DBLA 2NU7A 2Q1TA 3RKUA 1JN0A 5A3VA 1U3UA 4KUHA 5CHEA 4MIYA 2J3HA 1X0XA 4PZEA 3GVXA 3ETDA 3BMOA 1Y6JA 3DZKA 2CVOA 1J6UA 2ZIZA 4WNIA 3E9MA 5KIAA 1U2GA 1K6JA 3GEGA 3ZU3A 4OKNA 4F3YA 5GZ1A 4ROSA 2VRBA 4FJ2A 8ADHA 3KB6A 3DZHA 3LVFO 1V35A 4XQGA 4RDIA 4C4OA 3V1YA 4Z6KA 3RBVA 3WJAA 4IS2A 1UDBA 2OGUA 1MA0A 1LLQA 3A1NA 3GAFA 4EJMA 1RYDA 1PU2A 4E0BA 1A72A 4IIUA 3BMCA 3OSUA 3VDQA 4P4GA 3KYCA 4AG3A 1OI7A 2V65A 4NJMA 5IXYA 1P1JA 3PVZA 4LK3A 4XGIA 3ZN2A 3BMQB 3GF4A 4ONEA 2PR2A 2X9VA 1PX0A 1VL0A 1JWAB 4IM7A 5JYDA 2I65A 4PLCA 3FPLA 4RPKA 5CDYA 5ER9A 5K9ZA 3ADOA 4R1TA 5DP1A 3WGYA 3NJ4A 2J6IA 3LC2O 3KSDO 5B37A 2O3JA 3HB5X 3ZWMA 4BKQA 1GTMA 4YCAA 3JSAA 2UUPA 4O0LA 5CDGA 1PGQA 2FN7A 4CM8B 3OFSA 3BZUA 3DHNA 1PTJA 3TRIA 1LXCA 4F45A 4FB5A 5CEEA 1NFRA 4XJSA 4DQXA 4HFJA 1I36A 3WBFA 4YAGA 4CPDA 2UYYA 2EIHA 1C0KA 2I76A 3IP1A 2GN8A 2DTDA 2AHRA 1YJQA 1MLDA 3MJSA 4BB6A 1P1KA 4IDGA 2JHFA 2W2LA 3VKUA 3DTTA 4AJEA 2EW8A 3JQDA 1C1XB 3OJEA 4CMIA 4HXYA 2QYSA 4TVOA 4BNUA 4YT2A 1EK6A 4FFRA 1HSOA 3L4BA 5COAA 1QMGA 2NTVA 3BHMA 5JLAA 1PJLA 1WPQA 1DHTA 2BI8A 3GN1A 1CQIA 1QV6A 4Q3AA 2YYYA 3QWBA 1SO8A 1E3EA 4CUKA 4JK3A 2Z95A 1ZFNA 2BRUA 3BTSA 3DAGA 1Q7BA 2IXAA 3ZWNA 4E32A 5BQFA 4YYZA 2DUUA 4OYRA 2GZ3A 4Y6SA 3KEOA 3PJFA 2ZQZA 4WEOA 5JMWA 3MOGA 5JY1A 1ADBA 4FOOA 2HMSA 4GX5A 4XX0A 1YQGA 3V2UA 4ID9A 3R3SA 2I67A 3MEQA 3LT4A 3LK7A 5EMHA 4N5MA 4L76A 3O26A 3Q3CA 3WGHA 2GRAA 1QORA 3A06A 5HRUA 4PG7A 4CV2A 4MVJE 5I7EA 2G1UA 1GUZA 4OMUA 5L95A 3O9ZA 1CERA 1MXHA 4FCCA 3Q2KA 2A35A 1NP3A 1Q0QA 2QW8A 3GVPA 3PEFA 5DCYA 3G3EA 2B4RO 3B1FA 2W2KA 3M1LA 2GERA 4IBOA 5KVSA 1KC3A 3GOHA 1EVYA 1T1SA 2HMTA 3GZNA 2AEMA 3E9NA 4TRNA 5IDWA 4RVUA 3MWEB 1XG5A 2VOEA 4GLLA 4H15A 2NACA 3WGTA 4UVGA 5DCUA 1ZK1A 1XEAA 3D1LA 4GX1A 1D8AA 4HBGA 2XAAA 4J0EA 3GGOA 3IKTA 2XXBA 3FBTA 5H82A 1W0CA 4M86A 4D41A 2FSVA 3ANNA 3FNHA 1WXDA 1GV0A 4UVHA 3KYDA 4J4HA 3MWDB 4DMMA 3ZW9A 4MP6A 4ILKA 4W82A 3T7EA 4RLHA 4BV8A 4CLOB 2J8ZA 2R00C 1ZK2A 5THQA 1U2DA 2Y99A 1NVGA 1Y9EA 4UVDA 5J23A 2CMDA 2OO5A 2E82A 4XGKA 1VPDA 1SZJG 3NGLA 1E3IA 1U28A 4NR0A 5IN5A 1TLTA 3E18A 3WSWA 1CEQA 3RU7A 1MGOA 2HLPA 2DTXA 1RM5A 2B4TO 3BTOA 2GD1O 1X14A 1YWGO 2Q1SA 2VOJA 1A5ZA 1LTHR 4RVDA 5JC8A 4IQGA 4Q3EA 4HFMA 4BKUA 5C5IA 1I3LA 2P5YA 2X5JO 1CQJA 1TT5B 2A4KA 4YRBA 3WGIA 1YH3A 1E3WB 1YO6A 4IDEA 4X54A 4OQYA 4DPKA 3OJOA 4UUNA 4ZU3A 3HE3A 2GPTA 4HUJA 5TF4A 1GQYA 3BIOA 3S55A 4B7XA 5COBA 4A2CA 3G17A 1OAAA 4OGWA 3D4NA 1PSDA 1AXGA 3L4SO 1KC1A 4GVLA 3QSGA 2B5VA 4TKLA 5G4KB 1UZMA 2Q46A 2EHDA 5THKA 1HDRA 1LDGA 4TRMA 4Z0PA 3F47A 2DUWA 1LSOA 1SAYA 1G0NA 1N92A 1A27A 1X1TA 4LSWA 4AICA 3IL2A 4XDZA 3WFJA 2H5LA 4DQVA 3DZJA 3S2FA 2O7QA 3RJ5A 5HWSA 5JY6A 9LDBA 1EEHA 1H6AA 2NQTA 3FTPA 1WDLA 3RBZA 2IYOA 2JJYA 4ALIA 1DAPA 3AOEC 3ZWOA 3NX4A 4IZHA 1W6UA 4E6PA 4YWJA 4BHTA 3M6IA 3DBVO 5ER6A 3DFUA 4BS9A 4R68A 1LEHA 1PR9A 1XIVA 3DEYX 1EFLA 4B3JA 3QE3A 1A9YA 4LW8A 1E7MA 2GASA 2B35A 1GY8A 3ROKA 4K6CA 3JQAD 5DULA 4ZVVA 2Y1CA 3W6UA 3EUWA 1DBVO 3ASVA 3TSCA 3PQFA 3JYQA 4CJXA 4Z3KA 4YEDA 5DBFA 1ZW1A 5IZ4A 2PH3A 3R1IA 2YV1A 4FR5A 4W7HA 3PHHA 2WE8A 1JAXA 3NDIA 1U1IA 4W9NA 1XU9A 2C59A 4KQXA 5DCWA 1B26A 3RC2A 1WW8A 1E3LA 1ZNQO 2HRZA 3BXXA 4NU6A 4WLNA 5F5NA 2EV9A 3S2EA 4B7UA 1Q2XA 3PI7A 3RROA 1SCUA 6LDHA 4CMGA 1RKXA 2Z1MA 1KEPA 3TZQA 5KOIA 1IE3A 3C8MA 1NBOA 1Z6ZA 3JQ8B 1R37A 1DFGA 5B4VA 2G5CA 2C7VA 4Z9YA 1BW9A 3I83A 1J49A 4ND2A 4A73A 4EJ0A 5I9LA 1ADCA 3ZV3A 2YHUA 4L9RA 4N54A 2JFGA 2J3IA 4TVBA 1HSZA 3NKLA 3P19A 1HF3A 1RM0A 4EW6A 5BSEA 4ND1A 2C20A 4I5GA 4B4OA 2VUUA 1LSJA 2DLDA 1O9BA 3NYWA 1ENYA 1E77A 5FF9A 4BNHA 3P2OA 3Q11A 2VT3A 4EDFA 3AK4A 5JBIA 4I8XA 3PK0A 5B4TA 2G82A 3DBLB 3KRTA 3ENKA 5B1YA 4F6CA 5ILOA 3HG7A 1NQTA 1EBFA 2FWMX 1FK8A 1KVSA 2EGGA 4MPDA 4QEDA 3BMOB 1PJBA 4FDAA 4G5HA 2Y1DA 3TPCA 4AVYA 4R3WA 3AM5A 4OOFA 3S8MA 2DQ4A 4Y9DA 3I9OA 3K9QO 2GDZA 2NU9A 4BO6A 1A71A 3G1UA 1LU9A 4ZGWA 2RCYA 3HHPA 5DP2A 5ENVA 3EVNA 4UEOA 3W4JA 1Y5RA 2AA3A 3JCZA 2FRDA 2ZKLA 3P7MA 4BUCA 2ZB8A 1VSVA 2PKQP 3GPDG 4R5HA 1FDWA 3U0BA 2CF5A 3BMCB 4O63O 4MP3A 1DC3A 3KYCB 4BO5A 5C7IO 3K2EA 1R0KA 1HZJA 5GMOA 3EAGA 5TT1A 2ZB7A 1PZGA 5T8KA 3U3XA 3WIDA 5FI5A 4DLLA 2RHRA 1DAOA 3OBBA 3DBHA 5TGDA 4CUJA 7ADHA 5TLSA 4YXFA 1T2AA 1TVEA 3GMSA 2OP0A 3JD2A 4CM9D 1J5PA 5HS4A 4IY1A 2PK3A 3RVDA 4WASA 5TJ9A 4IQ8A 4HY3A 3OHSX 2AMFA 2NUAA 3U62A 1QYWA 1NHGA 3U9LA 1U7TA 2VCYA 3D4PA 4PLPA 4HNGA 2GGSA 2BLLA 4UREA 4A7PA 2I5PO 2EJVA 2WD7A 2YW9A 3E03A 1MC5A 4GBJA 2RBEA 2ZK7A 1DFHA 2IE0A 1PJQA 2JCXA 5KVVA 5IDXA 2GUGA 3RFVA 3L6EA 3GNQA 3H2ZA 1H0KA 3ZWYA 4A10A 2HKIA 4Q3CA 1JTVA 4PG6A 3JYPA 1HZZA 4EYEA 3E48A 2BH9A 1WNTA 3VVCA 3RUEA 4IGFA 3OA2A 1C1DA 5JAZA 1GCUA 4DVJA 2AE1A 2D3TA 3ICPA 3QW2A 1Q1NA 1FDUA 1P0CA 3IDSA 2WWRA 4ALKA 4CMIB 3V2GA 2VN8A 2YY7A 3HZZA 1HE4A 3FNEA 4GSKA 4QX6A 2PKQO 3EZYA 3WTCA 1EK5A 3QLJA 3RCBA 1PL6A 1UJMA 2NNLD 2TMDA 3JYNA 5L4SA 4QTZA 2VWQA 4RQTA 2W98A 2X0IA 3O38A 4ZRMA 1QXSA 4B3HA 1LLCA 2BFOA 1FDTA 2AXQA 5BNTA 5L9AA 3K30A 4D3SA 4JXKA 5GY7A 1A9ZA 3JQ7A 1F8FA 1PJTA 5IN4A 4GPD1 2UVDA 4CM6A 4PLZA 1O0SA 3RD5A 1DB3A 3I4FA 1UXKA 3JTMA 3OQBA 3NT5A 3M2PA 3VZPA 5JPIA 4YT5A 3QVXA 4IIVA 2EERA 1EE9A 1VE9A 3GT0A 1F17A 2C5EA 1R0SA 2EP7A 3WWYA 4ITUA 3QJ5A 4NH4A 5EJ2A 2W2KB 1C0LA 4ND5A 1VL6A 2YQ5A 3L6OO 3VTFA 4OQZA 3GZNB 2X58A 1T1RA 3ANLA 4BOYA 3IJRA 4CMBA 4YA6A 2EKLA 1GL3A 3DHEA 4XQ9A 3X2FA 3MTJA 1ZMOA 3LT1A 2AQIA 2I99A 2HJRA 3PZRA 4P38A 1HE3A 4WLUA 4JQCA 2V6FA 3NRCA 2ZATA 3GC6A 3JQ9C 3K92A 3D5QA 3KYDB 1ZVMA 5AQ1A 3EDMA 4RPJA 4YRDA 1QLHA 4J7UA 4AJNA 2CFCA 2GYYA 3D3WB 4OXKA 1CYDA 3WSVA 3WXBA 4W9NC 4N7RA 3HDQA 4UUPA 3UH1A 4TZKA 4Y67A 2BKAA 2FOIA 3ASUA 4ZQBA 1Y5MA 3DFZA 4HP8A 1KY5A 4MJLA 3AI3A 4DYVA 4MVJI 4XD2A 2AEJA 3L6DA 3KEQA 1KOLA 3WFIA 2B5WA 2GR9A 5ITVA 3NAQA 3NDRA 4JP2A 3ZNQA 5CEJA 3HDJA 1QV7A 1U5AA 1WAMA 5KKCA 3ENNA 4I5FA 3PZBA 1QYDA 2PD6A 3FNGA 3WB9A 5G0VA 1BWSA 3AFNA 4ZHSA 4DWVA 2TMGA 4YDRA 4J9UE 2GN4A 1LI4A 3UUWA 3HFGA 2POQX 2VYND 3JQEA 3LF2A 4I1IA 3IAHA 3TZCA 3Q9UA 2F00A 1VKNA 4BGEA 3U4HA 4KUEA 3EY4A 4AJLA 4NZ9A 5AXAA 1H6CA 1LNQA 1I3KA 3DC2A 4PVCA 3GQVA 4OOEA 2EEZA 2HK9A 2X9GA 3VKVA 3UF0A 3ZNPA 3ZV4A 5G0TA 3ZNOA 1NASA 4XRGA 1GUFA 5ICSA 2X1HA 3WGZA 4L4RA 2G76A 3HDYA 4WCFC 1HE2A 3DZIA 1KERA 1PQPA 3ZGYA 3SEFA 1UP7A 2O3QA 2A94A 4FJ1A 2R00A 1H6BA 2YV2A 4AJ1A 2V6GA 2JKVA 5JSFA 3MTGA 3ZWAA 5I7VA 2W90A 1HEUA 1ENPA 1UP6A 1QKIA 1QYCA 2WSBA 4NDNE 4Q3DA 5JAIA 1XELA 1E6WA 4E5PA 1P1RA 1P1FA 1TI7A 4Z9XA 3KBOA 1M67A 1UXHA 1YXMA 3OIFA 1XGKA 4M55A 2ZJ1A 3QVTA 5BSFA 4H7PA 1V3VA 1YBVA 3FI9A 3PIIA 4WLOA 4R41A 4G2NA 1YVEI 3AJRA 2IZ1A 1Z82A 1LSUA 1NTOA 1LSSA 3OJLA 3PHIA 4O5OA 5ES3A 3WGGA 3ADPA 1IB6A 4FFLA 1VJTA 4JNKA 1PGJA 3FTNA 1CIVA 3D5TA 3E8XA 4BMVA 3RC9A 3WYEA 1GZ6A 1UR5A 2CF6A 3E6AA 2PZMA 4JROA 2D2IA 2H6EA 3OIDA 1DC4A 1R4NA 4N18A 4R1SA 5T6BA 3GFBA 2ZTUA 3Q2IA 3AU8A 3PJGA 1KEVA 4EEXA 3SLKA 3H8VA 3F3SA 4MKXA 4BNMA 4MDHA 2BGKA 4PLHA 2QZ9A 1N1EA 4GGPA 4R5MA 3DQPA 5L7YA 4OSOA 3WS7A 4OO3A 1M6WA 4M8SA 3PHLA 1I0ZA 3B1KA 4NFSA 1GR0A 4BNYA 4BNVA 1BW9B 5JW6A 2ILTA 1BGVA 3LSYA 5FEUA 4WOKA 5LCXA 1BVRA 1F14A 1ZCJA 3DR3A 3LU1A 1X15A 3JQAB 4LSMA 4MVJG 3U5TA 1QR6A 3AOEA 3DHYA 4CLXA 4JJIA 4L4XA 4ALMA 3W6ZA 2FP4A 1QYXA 4J9VA 4MIOA 4EJ6A 3DMTC 3IOYA 3ANMA 5G2OA 3ZWCA 4XWYA 1NPDA 3E9QA 1W73A 1ZXBA 1E1LA 1LLDA 3G49A 5A05A 2W2LD 1NPTO 3FR7A 3DZGA 4IPTA 4OHUA 2JAPA 3WDSA 3C3XA 3ZH2A 1LC0A 1DHRA 1J0XO 3VZRA 4LMRA 1ML3A 2D0IA 3SJ7A 3WNQA 3TF5A 2GF2A 3RUHA 2W8ZA 3I9KA 3AUUA 4RVSA 4ESOA 3VH2A 4CLRA 1ADFA 4QFDA 1I5RA 2DBRA 2D1YA 1I2BA 1ONOA 3VDRA 2GZ1A 5BR7A 2HMWA 3O8QA 3NTRA 4G81A 2RAFA 4NIMA 1ZJYA 2PA3A 4FIZA 1QSGA 3ZDFA 1TXGA 4U7WA 1VI2A 3A9WA 4I9UA 1QLJA 3GLQA 3JQ6A 4FS3A 1KETA 1GPDG 5K6AA 1E6EA 1ISHA 1H9AA 3IJPA 3D0OA 4R9SA 3O4RA 4ZICA 4U8GA 4W99A 4BMSA 3GUYA 4XQCA 3GRPA 2EXXA 2X0NA 3VH3A 4NK5A 1H9BA 2GNAA 3BHIA 3H9QA 1DOHA 3JQGA 2A92A 2OORA 3SJUA 3FNFA 3K6JA 3DAFA 5TT0A 3EC7A 3QVOA 3GDOA 2FSSA 4XA8A 2G0TA 3WLFA 3ETGA 4I9HA 5F1PA 2DBZA 2Y0DA 2I3GA 4A0SA 1U4SA 4DUPA 3ORFA 3PXXA 3CPSA 1ZMTA 4NU5A 3TFOA 2D4AA 4CQMA 3HUDA 3H65A 4RDHA 1R4MA 3D3EA 4JJGA 1W4ZA 2WD7B 2PY6A 1I8TA 2CVZA 1EFKA 1MG0A 1Y8RA 3DB2A 3I3OA 4WLFA 1FDSA 2C07A 3BTVA 3SXPA 1AHIA 3JQFC 2H63A 1T2EA 2VRCA 2CD9A 1UDAA 4D0RA 4PG8A 1JKIA 3C1OA 3WYCA 1IUKA 3JQBA 5JXWA 4LN1A 5AXBA 1X0VA 2JHGA 3F46A 2PD3A 4IS3A 3K73O 3EW7A 3OEYA 4GWGA 2VHXA 4EEZA 1P3DA 2V7PA 1PQUA 4GQAA 1YBAA 4OKIA 4YB8A 1KYQA 1O95A 1LDMA 5T67A 2BFAA 2NV6A 5EPOA 3OF2A 2GZ2A 2J3JA 3AM3A 2Q1WA 4NNJA 1EBUA 1TEHA 3UGKA 5G0WA 1HDXA 1ID1A 4Z0TA 1DC6A 2WM3A 2O2SA 2FPIA 1R12A 5JNLA 1LLUA 1IZ0A 3ZHBA 2PGLA 4TROA 3VTZA 3H9JA 4DYDA 1M66A 2YHIA 3PRJA 3JQ7B 4BO7A 2IRWA 2YDXA 3OQ1A 4KUGA 4B7CA 4Q3BA 3LDHA 2NVUA 3WYBA 1DO8A 4XDYA 3GHYA 1XDWA 2VNAA 2OXIA 5L4LA 4YQZA 3PIDA 2P91A 2Y05A 4GVXA 3MOIA 3WQRA 4IMRA 4D7AA 5DDIP 2C2XA 1PZHA 2FPGA 2LDBA 1G1AA 1LQUA 2X9NA 2Q4EA 1RYEA 4CL8A 4OIMA 4W6ZA 3UCEA 2BFMA 1SEPA 3AW9A 4LISA 1PGNA 3H2SA 4FC7A 1BXKA 3TJRA 2YZ7A 1HRDA 5EN4A 4R69A 1YB1A 3PJDA 3QY9A 3I6QA 3AUAA 3A28A 5TC4A 1BRMA 1Z45A 2C5AA 3OP4A 2ZTLA 2OUIA 2Q45A 3JQCA 3QVWA 4KWHA 4DGSA 4E31A 1Z7EA 3MJCA 4KWIA 4CQLA 4H3VA 4E21A 2DAPA 4C7KA 3N7UA 2AG5A 3WOHA 4CMEC 1HLDA 4E2XA 1SB8A 2EKPA 4WOJA 4GAEA 5DN9A 5IZCA 4XYGA 1BTOA 3DTYA 3NJ8A 1VLLA 2QIOA 2ZTMA 4WLEA 1BMDA 3R0IA 3RWBA 3WGQA 4DQUA 1YB5A 3LQFA 3HN2A 1B3RA 2Q49A 3UVEA 2NVBA 2VTDA 3KHUA 1RJWA 3PP8A 4H16A 3TZHA 2FHSA 5F3RA 3JYOA 4UEJA 4YJGA 4L8VA 4IXTA 5TS3A 4PLVA 1SMKA 4PVDA 3PLNA 1T2FA 3KXDA 1BSVA 2IZ0A 4K6FA 3F6YA 5MGBA 3KUXA 2D8AA 1HYEA 2J5RA 3GZ4A 4ZQFA 4FFMA 1DFIA 1NQ5A 1P45A 3GMDA 3WQSB 4DBZA 4D45A 3PTZA 1ZSNA 1FJHA 3KSZO 2X4GA 1N9GA 1PJ4A 5HA5A 5CDTA 2GCGA 4TRRA 5FI3A 4G65A 5G4LA 5GZ6A 2DT5A 2ZB4A 4GLOA 1DIHA 3UW3A 1LDYA 2Q4BA 3M2TA 4LVCA 1NYTA 3E5RA 4BMNA 4R3NA 2AQHA 2YFQA 1D7OA 1PJCA 3JQ9A 3PQDA 4RJTA 1SPXA 1P74A 3D4OA 5JCXA 4FGWA 4KZPA 4OXNA 5F5LA 3UKOA 2Q2VA 1HDGO 4BNNA 2DPGA 3EK2A 2VTEA 5A02A 5A03A 1ULSA 1PJSA 3B1JA 3KM0A 1OFGA 1HT0A 2Y1OA 4YJHA 4FC6A 5CPBA 1GAEO 3ZWWA 3V2HA 1PQWA 3MJTA 5A5EA 5JFOA 5U9CA 3WIEA 3PFWO 4R9RA 4P8RA 3KTDA 4FBGA 2X0JA 2FPPA 2Y68A 1Q0HA 5DNAA 5K6AC 3ON5A 4XB2A 2CSUA 4J1SA 3Q6IA 3CMCO 4Z9FA 3DOOA 5A9TA 3RUDA 1YOVB 4OL9A 4XYMA 4D46A 2O7SA 4AJ2A 4ZJUA 3CMMA 2C54A 3C7AA 1T25A 1PJ3A 2H9IA 2I6TA 1T26A 4RF3A 1Z74A 3GH3A 4R1UA 4DBVO 3VPXA 3MCVA 2Y1EA 2DVMA 4IZIA 1JWBB 4GSLA 1E3JA 1R4NB 2X22A 4UVIA 1IY8A 3B70A 3H5NA 3AFMA 4YT4A 1M75A 1WMAA 4WEQA 4WCFA 3UOGA 1F12A 3ZV5A 1GYQA 3X2EA 4CR7A 1P33A 4TQGA 4CMKA 1PGOA 4JP3A 1WMBA 4J1QA 1PS0A 3TDKA 1T2CA 1EVIA 4EUEA 3CINA 3QV1A 3SC4A 1DC5A 2DFVA 2O3RA 2P68A 2BF7A 4N5LA 1E1KA 4LVUA 5F21A 4RVFA 1YE3A 3H9EO 4M1QA 3CIFA 3UAGA 3F1KA 3JQBC 1TA4A 2J5KA 1N2SA 4M89A 2WYWA 4K9DA 2VHVA 4CLDA 1ZEMA 3BHJA 2OL4A 1O5IA 1NX6A 5T5QA 4O6VA 2E49A 1LDEA 1WZEA 5JC1A 1E0DA 3UCFA 1E7RA 4F46A 1AGNA 4KTTE 3AUTA 1UZLA 4L73A 4NJMB 3KETA 1GZ3A 4UEKA 1PL8A 4LRSB 4PLYA 3C1AA 4JBIA 4XJTA 3ST7A 3TN7A 4CM8A 4XCVA 4DLBA 1VL8A 1U8FO 4HFNA 1Y81A 4D42A 1NR7A 2UAGA 1NNUA 1KEWA 1U7HA 5TRTA 3ZHYA 4II2A 2X23A 3V8BA 3LT2A 4MVJD 1DXYA 3NTOA 3LT0A 7MDHA 2O50A 4DA9A 3K8ZA 5FFFA 1DIAA 5CDSA 4RVGA 4KQWA 1HE5A 4TZTA 2HAEA 5ICMA 1OZAA 2R2GA 4CLRB 2AEFA 5I9MA 1B14A 1U3VA 1DEHA 2YV3A 5C7OO 3ITKA 3W1VA 1WWKA 4AJPA 2BHLA 2FMUA 1JKJA 3O8QB 3VPHA 1NPYA 3OA0A 4BIIA 2UUOA 4CV3A 2IDZA 3OH8A 4GGOA 4PN3A 3JD1A 5EERA 4TKMA 4XYLA 4AJOA 4AL4A 3IC5A 2E37A 1V0JA 1KS9A 5G0SA 5B4UA 4XZ3A 1DJQA 1R16A 3PPIA 4AJHA 1I24A 1H94A 4YTEA 3NV9A 1OBFO 3C7DB 4E33A 1M2WA 3TL2A 3KVOA 1XA0A 1UP4A 3D7LA 3DOJA 4MVJA 3JQGB 3PQEA 3DMTA 2B83A 4FFOA 1AE1A 3GG2A 1E5LA 3KSUA 3Q0EA 4OH1A 3I4CA 6ADHA 3L77A 4PFJA 1JLLA 3RAJA 4B3IA 4LCJA 4NPCA 5L51A 3F1LA 4U6QA 4RLSA 1PZEA 5IFLA 3I9LA 4RVHA 2VZ9A 5AYVA 3RJ9A 4FGSA 2B0JA 2RIRA 3ABIA 4KMSA 4U6SA 1DRUA 3NEPX 4CQMB 4D44A 5IZCC 2CY0A 1R4MB 3S2IA 1KVTA 4PCVA 3QWAA 4DXHA 3DBRA 4DTIA 3VVBA 2NADA 4UUOA 2VWGA 3INTA 1Y8RB 4GX2A 4DC0A 2LDXA 5TQVA 1ZO8A 5DT9A 3RI3A 5KJ1A 1ZK3A 5F1OA 1D4FA 5A1TA 4PIVA 4BNLA 5KJFA 5KTKA 3I9MA 4D43A 1P31A 4RV9A 1A7KA 2ZQYA 3C24A 4YJFA 1YDWA 5U1PA 5B12A 4BNXA 1ULUA 4R1NA 2UV8A 2RHCA 1P9LA 1ZKMA 4BNKA 4OXYA 1XU7A 2PKRA 2E4AA 3QQPA 4FOSA 3IMFA 2QX7A 2GN6A 1AUPA 3W8FA 1ORRA 2BGMA 4E13A 1ISMA 1NFQA 4QT0A 5JO0A 1ENOA 2B36A 4CM3A 1RM4A 1EQ2A 1E1NA 1HKUA 1P44A 3ROQA 3ZCXA 5FWNA 2P9GA 3DZFA 1G0OA 1YBMA 3HWRA 1EUZA 4BO9A 1V6AA 5I7FA 1GD1O 3RIHA 4J7CA 4L74A 4IMPA 3FD8A 4HFRA 4O59O 4DIOA 1UDCA 4CV0A 2D59A 4WJZA 3ZHXA 4JN6B 3RASA 3AY7A 2NWQA 4CLEA 1LQTA 1ZSVA 2NQ8A 3UN1A 2YHIB 3PYXA 3A14A 2V6MA 4S1VA 2ZYDA 2H1SA 3Q1LA 1Z73A 5CG1A 1DLJA 2NVUB 4JCOA 1NHWA 1WP4A 3CKYA 1J4AA 1VRWA 4J16A 1WVGA 2VYVA 2WYUA 1S7CA 1O94A 3LF1A 4RF5A 2HU2A 4GKBA 3JQFA 4RQUA 5TSDA 1MG5A 4Z3DA 5IXSA 4HNHA 3KZVA 1O8CA 1ARZA 1DSSG 1SBYA 1NVMB 2Y67A 3QWHA 1PJ2A 3B20A 1KVUA 2JL1A 4YBZA 2QG4A 1I30A 3P2YA 4BKPA 3FSRA 1OC2A 3UCXA 4I5EA 3SX2A 1NAHA 1C0PA 5G4KA 3PGJA 3C85A 4IDBA 4LRTB 4NK4A 3QWIA 3STHA 1N1GA 4J49A 4RZHA 5JDIA 1GFSA 5EIOA 5A9SA 4DLAA 1SEVA 4BO1A 4CQLB 5BNIA 2FR8A 3KLMX 2EW2A 5L53A 4NHEA 3ONFA 2BELA 1PIWA 3U09A 4B79A 5IAAA 5IJZA 3DO5A 2D5AA 1Y7TA 4JX8A 1HDZA 4ZQEA 2EKQA 1PS8A 2NSDA 3VZSA 1BVUA 1ZUD1 1Q7CA 4FD3A 4E4YA 4RPLA 4R16A 4A03A 1DIGA 1EE2A 3T4EA 4ALJA 1NWHA 3DZBA 2RH4A 1F06A 1GZ4A 4EITA 4TMFA 3I5MA 4EGFA 4CR6A 4YJGB 2VUSA 1XSEA 4C7JA 3NGXA 3IIEA 3QHAA 4EBFA 3AY3A 1YGYA 4S3MA 5CG2A 3GK3A 1ISFA 4KOAA 3DMYA 3CE6A 1SC6A 2P9EA 2V6BA 3Q9NA 5C37A 4YJDA 1F0YA 5JYEA 1ONPA 5TNXA 4RO0A 3NT4A 3DAPA 4IDDA 5ITWA 5CP8A 1H2HA 2QQ5A 2OFPA 3VZQA 4PG4A 5DF1A 2DC1A 4IGEA 2QHXA 4PRKA 1N9GB 3HNPA 2C2YA 3WLEA 5CDUA 1NFFA 3GG9A 4CM7A 4K1LA 1E1MA 4R51A 2IEBA 3HADA 3SLGA 4J3FA 1IOLA 5DBIA 4FQ8A 3U4CA 3CZMA 4BO4A 1JVSA 4KDFA 1IPEA 4FPXA 1G6KA 1B8UA 2DKNA 4CMEA 1XHLA 4QUKA 1VC2A 1EUCA 4LCEA 5DOZA 1P77A 2EF1A 1E7YA 4QO7A 4BKOA 4PRLA 3FRJA 4E5KA 2DBQA 3CH6A 3GN2A 1CETA 3K5PA 4QECA 3L9XA 1B8PA 4YJHB 3RKRA 1UAGA 1DPGA 3TQHA 1X13A 4PGFA 3SC6A 1R0LA 3G0OA 4J0FA 4NFHA 3RUFA 1GEEA 4M87A 1TB4A 2VQ3A 1HDCA 4UVEA 3RQSA 4D79A 1JAYA 2B37A 3D64A 1UXJA 3AM4A 3MJEA 2YQ4A 4NBVA 5KVQA 3ULKA 4FW8A 3ZU2A 1FXSA 4RGBA 3VOSA 4IUYA 2EWMA 4BKRA 1DRWA 1BXGA 1EMDA 1IL0A 3HN7A 3GVHA 1YL6A 3OICA 4E5YA 3ZU4A 1A4IA 1ZK0A 1HETA 4IDCA 1F8GA 5T57A 2O3TA 5JDCC 1K0UA 4CM5A 1XQ6A 2OP1A 4BGIA 4IXWA 1LDNA 3NDJA 4MIEA 4CM4A 3ZW8A 1E3SA 4QQRA 4ZQGA 2FR1A 4NMHA 4YPOA 4WCFB 4J6FA 3AI1A 1DIRA 3QP9A 4WNCA 5LDGA 3GA0A 4MKRA 4XYEA 2QRKA 2J5QA 3UHAA 1BHSA 1YL5A 3ZWPA 2SCUA 1HLPA 4BL5A 4E3ZA 2JCVA 4E2YA 4R01A 3ZU5A 5JAQA 5LDHA 1B0AA 1P0FA 3F5SA 3KYBA 4JBHA 2ZYGA 1CWUA 2E6UX 3GHHA 3KV3O 1ONNA 4BNTA 1QG6A 1WDMA 3OIGA 1R6DA 1FDVA 4CQMD 4EUFA 1PR3A 2GSDA 1A7AA 4XKJA 4BNIA 1CJCA 1SOVA 3WQQA 1VJ1A 3GNTA 2UDPA 2NM0A 1KVQA 3RFTA 3ROMA 4PLWA 1N7HA 4O1MA 4NBRA 4FSHA 1E5QA 2VRCD 4K28A 3V1TC 2X6TA 4B4UA 4TWRA 1UAYA 3FN4A 1MP0A 4I9NA 4M54A 4E30A 3RUIA 3V5NA 1IYZA 3DBHB 1BDMA 3PDJA 1GQ2A 3EYWA 1EUDA 3U4IA 4NQZA 1PS9A 4XEHA 3WMWA 2X5OA 4KDEA 1OOEA 1X7DA 2ZCUA 1MB4A 2I66A 4WECA 3O03A 1ISJA 2PH5A 3INGA 1TT7A 1OC4A 4EI2A 3AWDA 2JD2A 3OETA 3CEAA 2DTEA 1Z75A 3DONA 4YAEA 1Z7BA 1Q7GA 4BO2A 1PL7A 4E5NA 1E7WA 4TSKA 4NI5A 2B69A 1HYHA 2X5KO 3RC7A 3DWFA 4ND3A 1KY4A 3QWFA 1JA9A 2G17A 2WEKA 3OM9A 4NBWA 1N8KA 1K6XA 5L7WA 2NTNA 1C1DB 5A9RA 3FWZA 3FWNA 4AFNA 5IF3A 1ZXLA 1OMOA 4IJWA 1ZK4A 3EGOA 4XR9A 3LYLA 4B8WA 5BSHA 5EQDA 5KWEA 5HBRA 4BQPA 1P1IA 3DOCA 2Z1NA 1L7EA 1PZFA 2NVWA 4IQ0A 4GL4A 3OEWA 3WICA 5JDIC 3PGXA 2Y0EA 5CEFA 4HX5A 3TOXA 2Y1FA 3AOGA 1HDOA 1PWZA 1KIFA 1I33A 2DM6A 2ZJ0A 3LLVA 3TOZA 2EG9A 2P9CA 1MUUA 3RFXA 2NU6A 4YACA 4QFCA 4ZN6A 2VT2A 1H2BA 2Y0CA 1GDHA 4RCVA 4DPMA 3VHRA 1AHHA 4ZD6A 4A27A 2P2SA 3DBRB 3F4BA 1YS4A 3GR6A 3MZ0A 2CNBA 1YB4A 1UUFA 2OMEA 3GAZA 3GPIA 2JAHA 5I8WA 4DRYA 3LLSA 3IS3A 3S1LA 2PGDA 3ZZNA 1HDYA 5H81A 4BNGA 4E2ZA 1I3MA 1EDZA 2PLAA 4BNFA 4OJNA 4YJFB 3GEMA 3DXFA 1ISGA 3RC1A 3L07A 1FF9A 3CTMA 1KVRA 2BFPA 3G1TA 1IULA 2IZZA 2NTJA 1Q0LA 5L4NA 4MP8A 3KO8A 5HTOA 1BXZA 1XWFA 2OBNA 3D3WA 2DBVO 1E92A 3KOUA 5KJ6A 3HSKA 4HADA 3AY6A 1C0IA 2HCTA 4QO8A 4CLHA 4QXMA 1H6DA 1PEDA 1PWXA 4NBTA 4MVJH 5BT9A 3PHJA 4GMGA 1UZNA 2NLOA 1EVZA 4IDAA 4MOWA 4BV9A 3UICA 4U5QA 2IEDA 3B6ZA 3U49A 5C3MA 1I01A 2OOSA 1NR1A 1QYVA 3PDUA 4XYBA 2CDBA 1GQQA 4J90A 3ROPA 2GLXA 2HMUA 3PJEA 2P4QA 1JW9B 2O3UA 2HK7A 2R6JA 2VHWA 5JE8A 1U4OA 3WGOA 1GADO 1QP8A 2GN9A 1YDEA 1ZEJA 1DLIA 1VKOA 5H83A 1W8DA 3EVTA 2HRBA 2XF8A 1E6UA 3NTQA 1NAIA 1S6YA 2AG8A 3UFXA 1U3TA 2IYPA 5A5FA 4XB1A 2C0CA 5L45A 4EZBA 1JU9A 1I2ZA 1ZSYA 2WYVA 1LBEA 5A3JA 2WDZA 1NXQA 2JD1A 2CUKA 4CV1A 2OHXA 1NM5A 3BAZA 3COSA 4OAQA 4RPGA 5A9SB 1C3VA 3WTBA 5C7LO 1ADGA 4CMCA 4E5MA 3VPFA 1LUAA 4IJUA 2HJSA 4NFYA 1R15A 1HXHA 3GGPA 4ZA2A 5JO9A 1GYPA 2W4QA 1K5HA 3JV7A 2QYTA 1E7QA 2JFHA 1NQAO 2PZLA 1ENZA 4P22A 1RWBA 2C7GA 1YKFA 4J7XA 1R66A 4EUHA 4HV4A 4DIFA 1P1HA 2O48X 3EZLA 3GRKA 4J1NA 3L9WA 1GEGA 3GFGA 3BMNA 4DMLA 4NBUA 2YFHA 2JFFA 1K2WA 2YJZA 2B4QA 4J1TA 3T4XA 4LMPA 5CPFA 3MJVA 1WDKA 5EQFA 2QZZA 1IZ9A 2XOXA 2YDYA 4II3A 1Y8QA 3HB4X 2FR0A 3OJ0A 3TWOA 1WZIA 2DPHA 2WJPA 3H6KA 4MVJP 1DIBA 2ZCVA 1O6ZA 1VJ0A 5F1KA 2ZTVA 2VUTA 3PFFA 3VH1A 4WK6A 1KEUA 4PLTA 5COQA 3AI2A 1MC4A 5KCZA 2E48A 2OZPA 3PYMA 2PWZA 1B15A 1E7SA 2HK8A 2AW5A 4D0SA 3OQ6A 5JS6A 4F6LA 5KJCA 4XGNA 4FFPA 5LC1A 1I2CA 4IJKA 3BA1A 1YL7A 3K2BA 1I3NA 3WWZA 1HYGA 3H3JA 3ZWVA 3H5RA 4YR9A 3KLPX 3ZNNA 2PV7A 2DFDA 3LC1O 4PLFA 3CXRA 3PWZA 1YJ8A 5DBGA 3HFSA 3LZ6A 3WJ7A 1CF2O 4Q39A 4RF2A 4XRRA 4MO2A 3T7CA 1DDOA 3NUGA 3JQAA 5I8ZA 4GMFA 1EVJA 2C82A 1Y1PA 3F5QA 2ZYAA 3RUAA 1IHYA 3L4BC 2BD0A 3H3FA 3DL2A 3W4KA 5EINA 2Q3EA 3S2GA 1LX6A 2EP5A 4NG5A 4CODB 3BMQA 4B4WA 1Y9AA 2Q2QA 1JKFA 3A4VA 3N74A 5HM8A 2Q2WA 2WE7A 1UXIA 3BYZA 3ZV6A 4ALLA 2CDCA 5TX7A 1K3TA 4MKZA 4W4TA 1JQBA 4ND4A 4P4LA 5I9NA 3I6IA 3ONDA 2VHYA 2PGJA 2EJWA 1BXGB 2IODA 3QIVA 3C7CB 4JLWA 3E5MA 4GX0A 4Q3NA 3RBXA 3AU9A 4J4BA 1RM3A 1PGPA 2WD8A 3GVCA 4E2WA 4INAA 3ZWBA 4CR8A 2BGLA 5AVOA 2JCYA 1AXEA 2HQ1A 5GZ3A 1LC3A 3PWKA 4CM4B 5AOVA 4DIBA 1L7DA 4BGVA 3K31A 5AXCA 1GYRA 4QSMA 5TJHA 1EZ4A 3C1TA 1SNYA 3TZ6A 3ICCA 3QRWA 3AUSA 1K89A 2ZB3A 4CL3A 4CMHA 4FN4A 5TIIA 1ZH8A 4JIGA 1RPNA 4J2OA 2PTGA 3FR8A 4HWKA 1U9JA 1EDOA 1C1XA 3WG9A 1WLYA 3IUPA 2IXBA 1LDBA 4WUVA 5EESA 4NJOA 2OBYA 4WCDA 8LDHA 3DDNA 3R6DA 5DOVA 3QVSA 1CDOA 1XKQA 3E82A 1VSUA 4HKTA 4PG5A 5HS6A 5T64A 2A9FA 2I3AA 2AQKA 5K0ZA 1JVBA 1UH5A 2PNFA 3W8DA 1CRWG 2AQ8A 3JD3A 3PHGA 2ET6A 5G0UA 2VWPA 1LRLA 2Z5LA 3H7AA 5EL0A 4TRJA 1LA2A 2Q1UA 4YRAA 1EQUA 4YAIA 3PLRA 5CFZA 4PLGA 2EGHA 2D5CA 4MVJF 5JCJD 2AE2A 2VNSA 3M1AA 1T4DA 5JDCA 4E12A 3TZKA 2PZKA 5A06A 3H9GA 1XQ1A 4CMJA 1XR3A 5BNFA 1LRKA 4BO0A 1KBZA 1IPFA 2QRLA 1B16A 1YQDA 2DU8A 1B2LA 2FZEA 4A5OA 1MXFA 3ETEA 3CZRA 3I1JA 3OMLA 2FZWA 1SOWA 1HTBA 2GO1A 4WPGA 4CM9A 4D3FA 1X1EA 1XCBA 4J43A 3F9IA 4L75A 3VPGA 3IKVA 3ZI0A 1T2DA 2CDAA 4L4SA 1YONA 4BO3A 1D1TA 3FCOA 3JD0A 1N7GA 4BGUA 4YAKA 4PZDA 2O4UX 4B4VA 4CM1A 3OJFA 1X7GA 5A04A 1MV8A 1D3AA 5JCJA 2BI7A 5L3ZA 3WR5A 3R3JA 1YQXA 2VYVD 2HMVA 4GWKA 1ZZEA 4Y8VA 4UUMA 2Y1GA 5BSGA 2VWHA 3ITDA 5AXDA 4J2HA 4CLOA 2Q99A 1FMCA 2VZ0A 1K6IA 2CZCA 2Y93A 1V9LA 2WMDA 4U0JA 2HDHA 3WNVA 4DREA 4WLVA 4WGGA 5ENDA 3RSHA 3I52A 4RZIA 2Y66A 3QA9A 4XIYA 9LDTA 1T4BA 3HJAA 2X0RA 1GPJA 3FHLA 4N5NA 4R54A 4UAGA 3V1UA 4BNJA 1BG6A 4CUZA 5ADHA 2HUNA 4WE3A 1HWYA 2PD4A 4Y6PA 5IDQA 4I5DA 1U5CA 4ZRNA 4AJ4A 4R4JA 5IG2A 4Y6RA 3GDGA 3BTUA 2I9PA 2WTBA 4KTVE 4BVAA 4U0KA 1V3TA 3H4VA 1LRJA 3H5AA 5MDHA 3INRA 4ZQHA 4OSPA 1TT5A 4XQEA 2QRJA 1MX3A 4RF4A 1E3WA 4A26A 4LGVA 4AJJA 5KJEA 4JBGA 3OECA 1IHXA 4WKGA 4OM8A 2O3SA 4DPLA 1NWCA 3F4LA 3FPCA 4YAJA 1O89A 1ZIDA 4M49A 3WMXA 3ONEA 2Q50A 4B8ZA 3GEDA 2XPCA 5KVCA 1YRLA 3TFQA 4PZCA 3PYLA 1LJ8A 4KP7A 1N5DA 4YVFA 3HDHA 4I08A 1U3WA 1MFPA 3U4DA 4L0QA 1XYGA 1UXGA 4BNZA 4YT8A 5A4DA 1X7HA 3W4IA 4BB5A 5FYDA 4W7IA 2C29D 1V8BA 1QRRA 3I9JA 4J4TA 3UXYA 1D1SA 3W8EA 3GGGA 4AJKA
chains in the Genus database with same CATH superfamily
1M76A 3HGMA 1UBOS 2AN9A 2I3BA 3EN0A 4LYEA 3RUCA 4B43A 2UVQA 2HX1A 3IP3A 3L1IA 3FVVA 3C8HA 2LWIA 5K51A 3THWB 1DU4A 2YKGA 1LPBB 2HY7A 2ALJA 1V2HE 1RQ7A 2I4RA 1AN9A 2I9KA 3EE6A 4DL9A 5ILQA 4BLTA 2ZBFA 2CLIB 4HLDA 3I9NA 3QXXA 3KJQA 2TS1A 3OX2A 3TL3A 5CB6A 2PUGA 1JDBC 4Q1DA 4RKRA 1G7CA 3PGLA 5F7OA 3IUSA 3GY0A 4HDNA 2F1KA 3FSEA 1N2GA 1DJNA 5B1SA 3FYUA 4AECA 3ABRB 3ZY4A 3RU9A 1ZJZA 2XITA 1WXXA 1JSRA 2E6KA 3IQDB 5D51S 1UPXA 3AI7A 2RH8A 2BTQA 4ALNA 2C4UA 2AS0A 3DT9A 5D5QA 3CF4G 2EIXA 4YQYA 1NQOA 3T9DA 4PWZA 5F52A 3D2LA 1SQSA 2W6MA 3JD4A 3QKUA 5FOXA 1SOUA 4G09A 4LC0A 3MAJA 4C04A 4EJFA 1Z0DA 1BDBA 3K0FA 4X95A 4ZOCA 3RIEA 1U8XX 3RPEA 3GEEA 4JMPA 1CVRA 3LXUX 3L0DA 4CMAA 2BMAA 5LUBA 1GUYA 3G79A 3HM9A 1LPPA 3ILXA 1LQ2A 3HQ4O 2CVQA 3C3WA 2QI9F 1KJQA 1PT6A 2YXEA 3GP3A 3TB6A 2UZAA 1TD1A 5E1BA 3SBOA 2B2CA 4AQ7A 2B78A 4Q9NA 2P4HX 3JQ8A 4MQLA 1PR1A 4LZNA 4QG7A 4Q4CA 4DG8A 2PS3A 2ZJ7A 2GPYA 3QYFA 4HAIA 4MAFA 5DEOA 4BEBA 2SKEA 3D81A 3VU9A 1YVPA 4ZO7A 4D98A 3FNQA 5EXDA 3WYAA 2P5UA 2Q3FA 4RVOA 3QLVA 4XASA 3PNOA 1YOVA 1P17A 1PFQA 2C3YA 2H18A 4NXMB 3ENWA 4FJ0A 1EP2B 1C7ZA 5LU8A 4RTOA 4IUCS 1YF3A 3D4BA 4GKVA 1VI6A 1V11B 2XMGA 5AKYA 2PL1A 4NCNA 4GH5A 4DC1A 3MJ4A 2HA0A 2O0LA 3WX0A 2C5FA 1ZBQA 4FYIA 3GNSA 1SKYE 1XZQA 2I6UA 2YUTA 1GPKA 1I0LA 2QU7A 1C14A 4P35A 3QE4A 4XIJA 4ZMSA 1OR8A 3GDFA 3DBLA 5F23A 1DKNA 3KKZA 4IMJB 2Q7DA 3RKUA 6REQA 2PAFA 3FPFA 3AUKA 3IURA 3T7AA 4PYMA 2CSXA 2G0AA 4MV7A 4PW0A 2IELA 4R7GA 2ORVA 1XQWA 1IK6A 4ETWA 3RAEC 3GVXA 4JJ8A 2QTRA 4B3SB 1U3CA 3UHPA 3DZKA 5BWMA 2YR0A 2NP6A 4UTRA 5IUJC 4C2BA 4WNIA 3O82A 1K6JA 3GEGA 8ATCA 4OKNA 4WVFA 5TQ2B 1O4WA 3ECSA 1KZ9A 4BFWA 5K4HA 1V4BA 2VQ6A 3LKZA 1V35A 4RDIA 1D2EA 4UU7A 4DMCA 3TXXA 1HZZC 4ITRC 1E1QA 1MA0A 1LLQA 1YUBA 5T4BA 1TQDA 3KR2A 1BFUA 1QGED 3FCXA 2H3EA 3L8FA 1D6MA 4BQQA 2A3NA 4E0BA 1A72A 3BMCA 4ERXA 3ED1A 1V16B 2V9CA 3ZVNA 1P60A 4KHZA 4AG3A 3DUFA 5BWLA 1RS0A 721PA 3U9SA 5LQKA 1K6EA 1PLLA 1WY7A 1BRTA 5JQGA 3PVZA 1G42A 1PR5A 2WIDA 4XGIA 4J8PA 1MIOA 1FFEA 3VR0A 4ONEA 3NQ41 4HWSA 1VFNA 4AKSA 3GLHB 3G0IA 1PFYA 1L4LA 1ZUWA 3VR6A 3CLRC 3DE0X 4C6RA 3DMPA 5ERYA 2OB1A 3D0QA 3F5MA 5DP1A 3BSSA 3NJ4A 4LJKA 4KIUA 5HUJA 1NSYA 1IZZA 2J6IA 4WA8A 1AO3A 5IF9A 4RTMA 3ZS8A 1CULC 2O3JA 2ICAA 3HB5X 3ZWMA 1MHTA 4WY5A 1PP4A 1R4AA 3SICE 2D1SA 2Q6KA 1C1YA 3D54D 5DNVA 2HA2A 5CDGA 4Y9TA 2W83A 4CM8B 2Q1XA 3DHNA 3LD9A 1JQAA 2FX2A 2WTXA 3WXMA 1P2FA 4MWCA 5IJ9A 1BKYA 1CJSA 4DAEA 1QHYA 5I4BA 3JXEA 4HDKA 4J0HA 5F35A 3D8RA 4UMDA 3VOTA 3KQQA 2I4OA 4R84A 1M6NA 4A1OA 4DQXA 4QJIA 1HH4A 1IM2A 1WG8A 2UYYA 2EIHA 2WVJA 5EP3A 2GN8A 2DTDA 4X7RA 4URXR 2BZ0A 1XNJA 4QVGA 2V54A 1DNPA 3LG2A 3FFAA 5TE9A 2B7LA 2R96A 3R7AA 4F3TA 3KZOA 4E4RA 1MVNA 1REQA 3HCBA 1QJ4A 3JQDA 3LY7A 3OJEA 4KIFA 4J2TA 1CFZA 1KMNA 2DETA 2QYSA 4FFRA 5J4HA 5JLJA 3L4BA 4MITA 4KB5A 1XLWA 3N7AA 2JIZA 1QMGA 2WT9A 2QF7A 3H11A 2PXCA 4OHCA 4S0XA 5IAEA 2BI8A 5JV5A 3SYRA 4DR5B 1CQIA 2V55B 4Q3AA 5JATA 1EGQA 1L8QA 5FI0B 4C3UA 4Z4GA 1P72A 2HFJA 2J6HA 3FYSA 4JLJA 3BTSA 5CBPB 4UNIA 4E5SA 3IO5A 4MGZR 2R84A 5J5CA 2BFFA 4FKZA 2DUUA 3UJ6A 4X85A 4D9BA 2JAUA 3FM9A 4B1FA 1ECLA 1EPUA 2C5LA 2JH9A 4WEOA 4XXHA 2J5BA 2VL7A 2ZIFA 4GX5A 1Q7EA 2HFKA 2PHZA 1X7YB 4XX0A 5TEVA 3REQB 1GFWA 2EFDB 4Q48A 2PN1A 2Z30A 5E2BA 5BSTA 3T3GA 2F8TA 2I67A 1BCSB 3J7AC 1A9XB 4WUTA 1CR1A 3IR7A 2PSFA 2M98A 1Z28A 2QGFA 3NHAA 2IXTA 3E9RA 3WGHA 4CV2A 4GF5A 2G1UA 4DIDA 4MW1A 3I8OA 4U7JA 1BEZA 2VUHB 4CL2A 5L95A 1KOJA 3DCIA 2HLDA 4LOIA 1E6KA 3EJWA 2V1UA 1M83A 4FCCA 3Q2KA 5IJ0B 3D7SA 4JXJA 1NP3A 1Q0QA 1G6HA 1QE3A 2IDMA 4G1MB 1GT91 5A4FS 3G3EA 5H3LA 2B4RO 1NKVA 2FW1A 3B1FA 3OD1A 5B6JA 5LP6B 1KC3A 3EPPA 4BP8A 5C51B 5E1MA 3HVRA 1S3GA 2RHJA 4JEMA 4HDCA 1TMGE 2CJPA 3A8TA 2FQXA 3F2IA 5JCOA 1X38A 1V5WA 1PBTA 2LGJA 4ZCQA 3K0HA 4RVUA 4EGSA 3PXEA 3MWEB 4F2GA 2NO6A 4L5IA 4GLLA 2OCXA 1S2LA 2DYKA 3DEAA 1E60A 2A0XA 2QS9A 4PRYA 1XEAA 3D1LA 4UVGA 4BVLA 4ENRA 3OTGA 4F45A 1EM6A 4HBGA 3TECE 2XAAA 1V41E 4FB5A 4LXIA 5H82A 2AYZA 3BT7A 1E9SA 2I1VB 3AHFA 3GLRA 4UVHA 4B83A 1OWNA 4J4HA 4DNXA 3HKEB 5KTMA 4FINA 1UAAA 1MJHA 3MUOA 4OX9Y 3NVKI 2XCLA 1D1QA 1OZFA 1KO5A 1IG0A 1OA1A 1V1RA 2JANA 3AETA 3EZFA 4OA5A 4RLHA 4W82A 1IWPB 1WZ2A 5LZ2A 4TOIA 2J8ZA 2WJVA 4J0QA 4KFRA 1U0BB 4F7WA 5CA0B 2XNDD 2Y99A 4M9CA 3VU0A 2XCIA 2B25A 4TV8F 2PKXA 5BNWA 5AW5A 4YUYA 5C5DA 3DVAA 1X1QA 3LWBA 4UVDA 2HW8A 1ULAA 2XOEA 3WRYC 5J23A 5LQMA 1KAGA 5K8VA 2BFCB 3TSWA 4CQJA 2VSNA 1CQXA 3NP7A 4FKMA 2NZWA 5C8XA 1E3IA 1Z5GA 1MC1A 2EW1A 2PRIA 3C8DA 3OCCA 4NR0A 4QODA 1TLTA 4X1OA 5EQTA 1J25A 4LKRA 4QHSA 3E18A 4YMTA 2O2XA 2O5VA 1ZGJA 5A6VA 4YV2A 1KF0A 2DTXA 4HO1X 2AXNA 2QRPA 4MQEA 2B4TO 2N42A 3GRZA 4EOGA 5LPNA 3DEZA 3OOWA 1UT8A 4GE0A 1C29B 2VOJA 3EVEA 2XKJE 5E4FA 5IVDA 1LTHR 5BRNA 4US2R 3JARA 4ZTZB 5EKXA 1H05A 1TAHA 3VNAA 2G1KA 1XO1A 3EEIA 1SG0A 3OQVA 4YRBA 4U9HS 1QVAA 5IVKA 2ISQA 3K1ZA 1CUCA 2A1TR 4LTMA 3K1TA 2C2ZA 2IU3A 3W2HA 4V0LA 3TLMA 1QS0A 5TF4A 1QHFA 1HTWA 3C3JA 4N3GA 1FFSA 4G0ZA 1T29A 1W5BA 4KQ6A 5COBA 3G17A 4ZVKA 3ZKWA 5JTUA 2PUJA 4YCNA 5LD2C 3ZJTA 2YASA 4Q1BA 3IKMB 4ZOLA 1AXGA 2PVSA 3L4SO 1CEEA 2JZOA 4D9KA 4GVLA 1RXEA 3DH0A 3QSGA 2VKTA 3TJZA 1CC1S 4MI9A 1VLHA 4EGAA 1B23P 1DG1G 2B1QA 3NJRA 3MMNA 1YIAA 4GMDA 3U39A 1I51A 2PPVA 3HLTA 2H1OA 4G97A 1X1TA 1A27A 4NCXA 3N2NA 3HB0A 4XDZA 2X8BA 3DOHA 1TF7A 1N6HA 4DQVA 2EGUA 3UGQA 2DUNA 4YO8A 5EJ5A 9LDBA 1YASA 1NSTA 4ALIA 1WDLA 4ZYTA 3AOEC 1W59A 3S2ZA 4M1YA 3ZWOA 1CRLA 3ADDA 3VR2A 4YWJA 2VQDA 4GOJA 4TWZA 4MICA 3KL2A 4LF5B 1Y1QA 3G82C 1RQPA 5A2GA 3LRXA 2WUVA 1J0EA 4EVRA 3P4UA 1NR5A 1GCGA 1Q5PA 4ZEMA 2F3PA 4TLEA 3NHUA 4ZXFA 4DRXA 3TR5A 4B5KA 5CYOA 1A9YA 4HDNB 4LW8A 3OESA 4X7PA 4YMVA 1UK6A 2GASA 2CEAA 2H00A 4MEJA 3AMVA 3QX7A 4EGQA 3HU3A 4EW3A 3LIPA 1W25A 1RQLA 2A3RA 4OH7A 3AF3A 2ZT6A 1J1IA 1ZIPA 2BTQB 4PS0A 4YEDA 1LW7A 1ZW1A 3ADCA 2Q8QA 1P9WA 3GLKA 3WGVA 2BM9A 5DXFA 3GUUA 4AW9A 2J9FA 2OGZA 3ZDRA 3DDZX 3K0FB 4DKXA 2QVLA 3HTXA 4MW7A 3G5MA 4U2KA 4E94A 3CIOA 1GGKA 3PXDA 1BS1A 3AL3A 4B82A 1U0HC 4KQXA 1B26A 2W6IA 1WW8A 3RC2A 1KFCB 2PWAA 5JNUA 1I2DA 4KLRA 2H0QA 1FUKA 5DSTA 1PJZA 3IUYA 3L4EA 3VXKA 4B7UA 3RROA 4LZWA 5FUYA 2UYHA 5HP4A 5KQRA 5DWDA 1ZVVA 1RKXA 5T6MA 2CLFB 5KOIA 1IE3A 1H0RA 3LH5A 1XRQA 2FKNA 3JQ8B 1R37A 3RIYA 5B4VA 1JJFA 5EE0A 2JCGA 5DI3A 2NO7A 4B2PA 1K5GA 1TOAA 3VU9B 2ZJ4A 4BMPB 4F9TA 2R0QC 3UB3A 1ADCA 4KYVA 3NAMA 4L9RA 1QONA 2I8AA 1YU9A 2JFGA 3BORA 5HR5A 1QIGA 1FTQA 5LLTA 1YFJA 2DHEA 1LFDB 3G1WA 1WDTA 2N75A 2WFZA 3P19A 4KCGA 5C2JB 3VNQA 4S0ZA 5BSEA 4ND1A 3O8NA 1XTRA 3D8NA 3K0BA 3PDCA 2VUUA 4JYMA 4MW5A 4CDRA 4YR7A 1LSJA 2BF4A 4BVGA 1IUPA 3FJYA 1DI0A 4MI1A 4PM4A 1QGYA 2W7TA 4G6ZA 1S01A 3SQNA 4RTQA 4ZVOA 3T15A 1M0WA 1Q6YA 3EXFB 3Q11A 2VT3A 3AEUB 3AK4A 5KYUA 5DYIA 3NV7A 4I8XA 4CGZA 2BRUC 1KK3A 4IJ5A 3RODA 4DM4A 3DBLB 5B4TA 5KTNA 3TQCA 6REQB 3QE9Y 3AJ9A 1GZ7A 2XE8A 3GFPA 2P40A 3MWKA 1WY5A 3PKIA 4TLBA 3R7FA 4DQ0A 2AVDA 3UJ8A 3KZKA 1ABBA 2NT4A 2EGGA 3VR5A 5FWYA 4IVPA 1DWUA 2IIPA 3PLAE 3M5PA 5J58A 4G5HA 1MB0A 2I2XB 2P0EA 4MQMA 1UM9A 2R8OA 3ZTTA 1SBCA 4AVYA 1JPJA 1KJIA 1WOMA 4F9FA 4YY3B 3AH8A 3BRQA 4CN8A 2DQ4A 5KZMB 3V4VB 1QHGA 1XN1A 3I9OA 3LLCA 4Y9DA 1D2AA 1NMEA 1UEJA 2A9RA 3FF1A 2AFHA 4BO6A 3FZYA 1F4PA 3SFZA 1WP9A 4AIIA 1DE0A 1X87A 3HHPA 4Q05A 4AZ3A 4QKQA 5IW8A 4HB2A 1XXHE 5ENVA 1YDGA 3TBHA 2FLKA 3W4JA 1Y5RA 1YTLA 2ZKLA 1FNCA 1YS6A 4KAAA 4BUCA 4X7BA 3GPDG 3WL3A 4R5HA 4I4TF 2CF5A 3BMCB 3I1IA 2JNWA 5LIRA 1DC3A 1OJLA 4KRXA 1DCMA 4KRFA 4IKOA 3HA3A 3DUFB 5ILOA 3D8UA 3JW8A 5GMOA 2E55A 3EAGA 3SWWA 4WNYA 3ESXA 3IEIA 521PA 5JQGB 3ASYA 1MIOB 4P1ZA 1JE0A 2IQIA 1UMCA 2J6BA 2C7PA 2AMJA 3RSLA 4LCBA 2BE9A 3DBHA 2W2QA 2ZSEA 4CUJA 7REQA 5BV8A 2XGJA 5DN6A 2H31A 4YXFA 4L50A 1TVEA 2GILA 3JD2A 3PQ4A 3F74A 3ZQ4A 4IW3B 1VMAA 1Z5OA 5KWVA 3M6UA 3FTQA 2XNSA 2ARKA 3WLRA 3DKVA 3D4PA 2PTHA 2JH8A 4QRIA 5EA2A 4OI0A 3IE2A 3QE0A 3UMGA 3IUBA 2M6KA 3TIGA 2IL1A 5A62A 1ORIA 3KZMA 2QX4A 4ASUA 3N53A 5IJ9B 3LGXA 1MVLA 1T6ZA 2IE0A 3G8CA 5KYKA 2NUTB 3F3MA 4HDKB 2FSIA 2GUGA 3D8HA 3L6EA 5JSKA 4IWYA 2JI6A 4M1KA 1ST3A 2C31A 1U28C 2QV0A 4Q3CA 2FX3A 4PG6A 3WP0A 3JYPA 4TZ6A 1HZZA 1YQ9A 1Z5ZA 2GM9A 3FZEA 3OT5A 5AKKA 5HQJA 3RUEA 4BJ6A 3BE5A 3N6XA 4PQYA 3EEYA 2QL5A 4P5DA 4RWZA 5JAZA 2A67A 4PPGA 3KLOA 1TNDA 3K9CA 3WYFA 5AVYA 2CCJA 5ARDA 1REQB 3W9BA 2G04A 1J9GA 1YS1X 4UFPA 3V2GA 1SZCA 4OQFA 4Z53A 1HE4A 2C8KA 2IGBA 3OLQA 1BGWA 5AICA 4CKCB 5J5AA 1EK5A 1EE1A 3H11B 3FGZA 3QLJA 5CK5A 2UYCA 2QGZA 1D6JA 3OTQA 3RCBA 2M32A 5JMWA 1CQIB 1GZDA 2B5OA 4P98A 5DLYA 5JU6A 2CNWA 4QXAA 4W63A 2NNLD 1CDEA 1NL3A 2Q0XA 1I7DA 3D4IA 4C5BA 4G0VA 3ONVA 4JU8A 1O97C 4RQTA 4MV0A 5LQNA 4ZRMA 1ESDA 1HLFA 1YB6A 3N2KB 3ZDCA 1SQ6A 1T1IA 4B3HA 4ZV7A 1HQKA 4YJKA 1USKA 5BNTA 4UD2A 3UWPA 5L9AA 3TG8A 4L3WA 4D3SA 2IXDA 4JXKA 5GY7A 2DECA 1A9ZA 1F8FA 1PJTA 2XDYA 1XDUA 1JMKC 2W22A 5IN4A 1ZN8A 5LYJF 1UFKA 4CM6A 2C9ZA 3KEMA 3L8DA 4PLZA 1A8SA 1DB3A 3N76A 3TD6A 2Y6VA 4BN5A 3PNLA 4BRSA 4ENWA 1NQUA 4FS8A 2Z58A 6ABPA 5BQPA 4EKYA 1JKMA 3IVRA 4FCWA 4DJJA 2IS6A 1G8KA 3T3HA 1HUQA 2OCLA 5SZKB 1DBWA 3QUQA 1JL3A 1LWNA 1S2IA 3QHQA 1NNI1 4JC5A 4AF6A 3WWYA 2VSYA 5M29A 2O0JA 1CUYA 4ND5A 2QU8A 5JZBA 1Y5IA 3UBTA 1USIA 3MUFA 1DADA 4DUGA 5CB4F 1NW8A 1K97A 1T1RA 1WU7A 4JWKA 3D5EA 3E81A 4LWZA 3TM4A 3NHRA 3WE7A 1GA1A 4CMBA 4YA6A 4CW7A 1NMQA 3ZU6A 5IWAB 3TAXA 4Q1FA 1ZMOA 2B2NA 2EZ9A 3LT1A 2HRQA 1G8FA 2BLNA 1LBSA 2I99A 2OPBA 4JZYA 5DX8A 2GVNA 3LPMA 3I5AA 2I0FA 3QYJA 4NZNA 1Z0AA 2V6FA 1Q83A 1SXJE 2MT9A 2ZATA 3E7XA 3GC6A 4D9JA 5B7NA 1CG6A 3M6VA 2QENA 3D5QA 1ZVMA 2IU0A 4RPJA 1QLHA 3TQQA 4GDMA 3AETB 1ZCBA 1V1RB 3DBOB 3R77A 1V8DA 4N8DA 4OGFA 5DLPA 2BSQA 3NHKA 3SJZA 2QT9A 5K0GA 4LXGA 1S7GA 3WSVA 5KS2A 3L8CA 4NVRA 1RPZA 4EG1A 1B74A 4W9NC 1L5FA 5DNEA 3RRNA 3WAKA 4JI4B 1JQDA 1QRSA 1GNLA 2BI4A 4QBIA 1E0AA 2H4JA 3CUWA 4K0RA 1N2CE 2O07A 4JGGA 4N7RA 2GAAA 3HDQA 3L5KA 3DVAB 3L1HA 4Y67A 2R11A 1JILA 2FOIA 3MQFA 4ZQBA 3DE4X 5E1DA 4K40A 1KY5A 3QEBZ 3AI3A 4REQA 3DNMA 4P33A 4YO7A 3L6DA 1ELOA 1VZ2A 1KOLA 3NYQA 4RS4A 3WFIA 2IHZA 2YMLA 5K03A 4IEFB 3AP2A 4D0LB 3NAQA 4U9UA 4P0PB 5CEJA 3HDJA 1FP4A 1U5AA 1WAMA 5BUQA 2BHTA 4PX3A 1LH0A 3ENNA 4MQEB 4ZREA 2PD6A 1EP3B 3GRYA 3TSZA 5G0VA 3WAGA 4DANA 4QELA 4Q9IA 5BSKA 1AS2A 2VP5A 3W6OA 3I42A 1FRNA 2KSQA 3JARB 3TSYA 1E0KA 1NA5A 1LI4A 5EXPA 5A71A 2GUWA 4YV0A 1NDUA 3RVMA 2VYND 2J7PD 3JQEA 3ZCVA 4CCWA 2EEPA 1E2GA 1RI5A 2F00A 4Q1AA 1YR3A 4KUEA 3T5DA 3EY4A 3U3ZA 2J48A 4AKHA 2HQBA 3UJ9A 3V80A 3VBCA 3DLBA 1QS0B 1I3KA 1XNGA 1YOBA 3GRFA 3QHPA 5JCZA 4L5CA 2IW3A 1VPTA 2QAGC 1RIIA 3GCXA 5DHTA 1OBCA 1Z07A 1H2XA 2C9DA 4XB6B 3BEOA 3ZNOA 3GLGB 3ZKWB 2XV1A 4OHPA 2GK6A 3D8BA 4U2EA 1AKYA 2PLFA 4ZOLB 1V9SA 1GARA 4G1BA 5DASA 1P75A 3ZY5A 1TKRA 5KYWA 4HC4A 4XD7D 4LDRA 2XODA 2O3QA 2R4TA 4P7FA 3S70A 4WXRA 4DSZA 3HEBA 4U2CA 2YV2A 1TM4E 2W6PA 2O1XA 4JDPA 3LX6A 4QPPA 2JKVA 1JMYA 2XQIA 2HC9A 3MTGA 4GPTA 3X0DA 1JE1A 1QFMA 3ZWAA 1CZLA 4MKHA 2GPWA 5I7VA 4JWTA 1ZL0A 3NNNA 1HY3A 1CUAA 1N57A 1EU1A 1RZ3A 2OAP1 2WAXA 3SYMA 3FGOA 3WRYA 1N1DA 1ZGZA 3RH0A 4CT4B 3CV3A 4E5PA 1MPXA 1P1RA 3BUSA 5KNDH 3FKQA 4LWPA 2QMZA 4UUBA 5LP1A 1NUHA 4ZJPA 1JG4A 4AF7A 3LFHA 4D9GA 2JGFA 1K8XB 3E27A 1QFJA 4NX2A 1JH9A 3H42B 4TLCA 2ZJ1A 4WY8A 4GMHA 4N01A 4RVCA 2D1RA 4R41A 1Y8ZA 3N2IA 4G2NA 1YVEI 1JR2A 2FKAA 2IZ1A 3OJLA 4O5OA 2DGDA 2VS1A 2UUAB 2DHCA 5J2UA 1ZNXA 3BWBA 4FFLA 4M9SA 4EFLA 4X5OA 1S5PA 2YN4A 4ZZ3A 3CRVA 3FTNA 1JG1A 2VZEA 4DLWA 1CIVA 2A0FA 1S8AA 4XCQA 5BSRA 4C06A 4BMVA 4F06A 1JDZA 3V55A 2YWEA 2GKGA 3RC9A 1KMHA 1GZ6A 3TR6A 3ZIDA 4JROA 4OKSA 4WXHA 2D2IA 4AY5A 2J9FB 1E2QA 5TR9A 3OIDA 2FLWA 4O4LA 3GGCA 4F84A 4HGYA 4WIAA 3AU8A 2YBDA 1U5BA 3H8VA 5KYXA 5BO5A 3F3SA 4MKXA 1NBME 3E3MA 1KFEB 4QTUB 3BVPA 2BGKA 2CL0X 2DY0A 4UM5A 3OKPA 3UY4A 2NNWB 3AC0A 4QTYA 5KOHB 4DQLA 1GGEA 4YUAA 3DQPA 5HOQA 1TKCA 4YRQA 1E6CA 2YOHA 2HXGA 3P9ZA 2RI0A 1XZPA 1CUIA 4OO3A 4EKDA 1M6WA 2GHIA 2XWPA 3L04A 5KX5A 1W1UA 5C4MA 3B1KA 3VYTB 2DWQA 3ED5A 3QEJA 5DI3B 3UEOA 1C9DB 2CUZA 1IVYA 2V7GA 1AG9A 5JW6A 4NYIQ 1N3LA 2C88A 1BGVA 3UMBA 5FEUA 2YVKA 3DGEC 4MB0A 2IYTA 4LZZA 3VJLA 1BVRA 1W0KA 4MVJG 1ZCJA 4MV9A 1X15A 1E8DA 1Z36A 3AOEA 3DHYA 3ZZ1A 4YUZA 2FP4A 4LE0A 2EBFX 4JT4A 1YZKA 1EUQA 4TUYA 3IOYA 3WIOA 3SC2A 5G2OA 1MNAA 2O8CA 2AJLI 4XWYA 4GYJA 1ZXBA 1S8NA 5BMOA 4HEA1 3KJHA 4L9SA 4MQFA 3OURA 3IKJA 1E1LA 1LLDA 1QLWA 2KLHA 5KYUB 4JGIA 3OZFA 1NPTO 4GW3A 3RYTC 4PSCA 1X80A 1QH1A 3AR2A 1W93A 3U80A 3K1YA 4EY6A 2OK7A 2JAPA 4LRWA 2PDAA 3IP8A 3R0JA 4C01A 1T3SA 5H3HA 1D09A 4LDAA 3T34A 5FWYB 1BZYA 5LMNB 2PL9A 4O5AA 1G8AA 3ZLVA 1DHRA 1J0XO 2WSSD 3EZ9A 1UM9B 4KOEC 3WNQA 4QPZA 4PWYA 3K35A 1SHUX 2SKDA 1K92A 1N6NA 4PNPA 1QGOA 1QQ6A 5K8UA 1Q7RA 3WRWA 1ADFA 3EPKA 1I5RA 1MOPA 1C81A 2AFHB 3VDRA 1KDPA 3A2MA 1L7NA 2NPIA 4Y6QA 3EXHC 4AZ3B 5BQ3A 2C4NA 3VNBA 2RAFA 3QJGA 3DVSX 4JNCA 2PA3A 4XVUA 1ECFA 4ZYWA 2P77A 3A9WA 3CZPA 4DV5B 1QLJA 1UOPA 5IC5A 2HTFA 1THGA 2RBKA 1V5FA 1KETA 2AB0A 2NQ2C 5I4CA 4V1CA 4OHYA 1E6EA 3UK7A 1ZOLA 2NYVA 4RKYA 5IEJA 1DT3A 1E64A 2OBLA 2FNAA 2OBMA 3GRPA 1A4RA 2EXXA 3VH3A 2RCNA 2XD4A 3BHIA 2IWRA 4BVBA 3U44A 1IBKB 3ICEA 3CRRA 4LOJA 4Q1CA 1C9YA 1UMCB 4M9XA 4CFZA 7REQB 2VXOA 4NBSA 3DTVD 3K6JA 3NPMA 3DAFA 3OVMA 3QVOA 2ACWA 2F3SA 4YWHA 5TT0A 3LLMA 4CIDA 2C03A 3U17A 4A0RA 1G16A 4XA8A 1H1TA 2G0TA 5GGXA 2JGDA 3ETGA 1N5LA 3CNQS 2OPHA 1XEFA 1PVVA 3TUZC 1D6NA 2Y0DA 3CVJA 4FMCB 1YTUA 4GDFA 1U4SA 3R7LA 3B2EA 4JC8A 1WHTA 3PFGA 2G1JA 1ZMTA 3CPSA 3NTUA 3PXXA 3SAJA 3NIBA 3PNKA 5G40A 4DSTA 2VJAA 3HUDA 3K9NA 2FGKA 4G0XA 4OATA 4JJGA 3U60B 3SNKA 3H2BA 3KQPA 5AP9A 2VK1A 4EB8A 2PY6A 4W5RA 1F1BA 1OX4A 2CVZA 1J99A 1EZZA 2MSDB 2X0KA 2AV6A 4KXUA 3DB2A 3I3OA 2ZTHA 2ZITA 4UTPA 5C3UA 3H8JA 1G7RA 3JQFC 4UMVA 1GNVA 4EABA 4Y1GA 1JG7A 4MVXA 4LHYA 4PG8A 5E7QA 2PSSA 5TGZA 2JRCA 3FHJA 3MJRA 3WYCA 1I7NA 1IUKA 1XDSA 4EDHA 3DCJA 2PX0A 4LN1A 2VSXA 5AXBA 3EAFA 3L1VA 1G21E 3C45A 1GQRA 2E7ZA 4YRIA 1NI4A 1V7CA 4FP9A 2RAPA 4LRYA 5HIMA 3OKAA 1FYFA 1JEJA 2QG9A 4K2AA 2VHXA 1HTTA 4UW9A 5EKDA 2HDNB 1XHEA 4YMIA 1CZRA 3WA7A 2J85A 3ZJ5A 2F6RA 4GQBA 3ER9A 4YRCA 1KOFA 1O95A 1L5NA 4DHEA 2NV6A 2AX3A 4TLMB 1V9CA 4EELA 3OZEA 1UJBA 3OOJA 1EQAA 1CR0A 2JI4A 4NNJA 5AT1A 4A91A 4AUKA 3DE5X 5GIOE 1DC6A 1KQ3A 2WM3A 3DE6X 4GLFA 2WKQA 2AF3C 4YIKA 4JIMA 5JZMA 1T5IA 1H23A 4JB0A 1KZHA 5JNLA 3OWHA 2I87A 4OXRA 1TZKA 3VTZA 4QWMA 2JIRA 5AVTA 1NG1A 2I8LA 4CKYA 2ERCA 2ZYWX 1DJLA 3A3KA 3NVMB 4ZI7F 4FX5A 4Y30A 4WZAE 3O2NA 4Q3BA 4DIUA 4NV0A 1Q1GA 3D3JA 3DXYA 3K6RA 5I7RA 5J47A 2VNAA 1DWPA 4Q4LA 2OXIA 4YQZA 3PIDA 1FJGB 2AI1A 4TTTS 1WXIA 2F55A 1Q21A 5E9QA 3TMAA 1GWNA 1AV7A 3H9CA 4Q03A 5FXMA 5IVHA 1QQ7A 1ZIOA 3E9YA 3OU7A 4L5YA 1MQAA 4BE4A 3GROA 3KFLA 2FG6C 2LDBA 1ZVQA 4YK7A 3ZE1B 4RWEA 1QOPB 3PXGA 4D96A 4DLKA 3FUXA 3T8YA 4OGGA 1N2CA 1RTKA 3V1MA 2QPOA 3TI9A 4NEGA 3LHDA 3CVXA 1GO2A 4OIMA 3MINA 1X1SA 2BFMA 4W6ZA 3RHTA 3ICQB 5JRZA 2IYFA 5EKUA 1PVDA 2OYRA 3V6LA 3I3SR 4TTRA 3ESRA 1D8TA 1T8RA 3UANA 2AIRA 1BROA 3PJDA 2C42A 3QY9A 2MYUA 2QI9C 3A28A 3AUAA 4M9RA 5TC4A 5MN4A 4EBBA 3IPLA 4IILA 1WEHA 2C5AA 4DGSA 4KWHA 3QVWA 5J4VA 1E2IA 1KI9A 1R6UA 1FBTA 4H3VA 1M2HA 2ZYUX 4E21A 5FPPA 3TQTA 1BMTA 4KVFA 3WOHA 4CMEC 1O03A 1OQAA 4YDHB 4ZOBA 1MO5A 5HZGA 5AI9A 1SB8A 5DN9A 1AKNA 5IZCA 1JLKA 4CTNA 1FS5A 1Z22A 4EY5A 3NJ8A 5JAUA 1T4CA 2ZTMA 3OWXA 1OKKA 5GJCA 3FMGA 1BH2A 2GQ0A 1YB5A 3K7EA 2P9TA 3LQFA 4ZZ2A 1Y7PA 3UVEA 2NVBA 2VTDA 5FHQA 4ZVLA 3KHUA 4IFEA 1L6RA 1RJWA 3PP8A 3T99A 1XK7A 3TZHA 3VHQA 3MUNA 3CLUC 4MO9A 4REQB 3VO8A 4CU2A 2RKBA 3JYOA 3N8IA 5CLFA 2H11A 3NH6A 4M1SA 5FRDA 1WUYA 5TS3A 5HJ2A 4ZEVA 4PVDA 1XQ9A 5CK4A 4C6TB 4OM7A 3KX2A 1BSVA 2IZ0A 4RS3A 4ZYUA 3F6YA 4YUVA 3REGA 3VOAA 1FP4B 1Q7TA 1Y3IA 2D8AA 3PDWA 4R3UC 4YCDA 1DBRA 1HYEA 2H7XA 3IT3A 4MH0R 3U61B 1R8YA 3QJYA 1ZD1A 1R0WA 4DJEC 4XFJA 1K3UB 4ZVRA 3WQSB 4Z5XA 3AKZA 2NAFA 5IT5A 3IESA 3MS7A 4X7MA 3QFHA 4GKAA 1MB3A 1KO4A 2P3LA 3KSZO 2WJZB 2YS7A 4LMAA 2X4GA 3RRMA 2XT6A 5LNK6 1XZJA 5CDTA 5LBIA 2WWXA 2FSGA 1EK1A 2WHYA 4G65A 4HB0A 5G4LA 5GZ6A 3FKJA 3M89A 2GJAA 4JCCA 3DMDA 3EZ2A 5E2IA 4DCVA 1NVWQ 1IEXA 2BFDA 1SR8A 2DG2A 4KX3A 1VLZA 1UBHS 4RA9A 1H0HA 2DT8A 4LVCA 3KOWA 5TMDA 1SVUA 4R3NA 1X7XA 2YFQA 4RJTA 3KOXA 3ES9A 2IV2X 3KLBA 4RKEA 4FGWA 4MW6A 2QLBA 4OXNA 5F5LA 4ACAA 1VHDA 5HMMA 1OFIA 1EXNA 3V34A 1W2HA 5KYWB 4A15A 1AS0A 4FFBA 3SCZA 5K2OA 2BGNA 3GT4A 1L5MA 1YZVA 5A7FA 4EWLA 2OWEA 3N6RA 3QH4A 1E5XA 2C3UA 2W6ZA 3GJ6A 5EHGA 3VR5H 5AW7A 2WG2A 4RD3A 5IBPA 3QMVA 3DVLA 2BGUA 3TLBA 2DEUA 3A27A 2Y1OA 4Q4DA 4HEJA 4FC6A 4R2XA 3V1LA 3ZLTA 5FUVA 1PQWA 4OFWA 4I19A 5TARA 1ZIYA 3UMCA 5JFOA 5U9CA 4P8RA 4FBGA 2R6ZA 1R1DA 5CLJA 3NBUA 1HBJA 1CY2A 2DWUA 2Y68A 3K94A 1RBYA 5K6AC 5A4AA 3QX8A 4BKMA 4H35A 3ESCA 4R0VA 4XB2A 1PT8A 4J1SA 2OHIA 2C83A 3LBIA 1XDGA 3FLBA 2ONYA 2QUJA 2BMJA 2WVHA 3P9XA 5AJZA 5C1BA 1P6QA 3RUDA 1DDGA 1SVSA 3NBMA 5KSZA 1RWWA 5J2UB 1CUDA 2O7SA 1QFXA 2CHEA 2FWBA 2OQRA 3BBPA 4JLAA 4DQKA 4CBVA 2C54A 2ZJBA 1ZU5A 3UWDA 2WMYA 1T25A 1PJ3A 2H9IA 5D84A 4B6JA 5JEDA 2GNOA 3VI4B 3TVYA 2HHLA 3MGCA 1XX6A 1JG3A 3EDOA 2OA0A 3VPXA 1XZBA 1B00A 3G5LA 4HYYA 4N7BA 2QAGA 4NF2A 5AO9A 4EI8A 4UNQA 1F4LA 2GETA 2V45A 3HO8A 4H6XA 3GP8A 4WLUA 5LD2B 1P5HA 4UVIA 1IY8A 3EQ6A 1E3TA 1E2PA 5CVTA 1TZBA 2A9QA 3VR4D 1WMAA 1GZUA 1KZ4A 2R5NA 3FVTA 5HIJA 2VP6A 2ZVDA 3SSNA 4AN1A 1F12A 4YIHA 2H0RA 1J2YA 2H5EA 2FFHA 4NC9A 3TPZA 5JNTA 1P33A 4CMKA 3M9WA 4RELA 1SUDA 4JP3A 4JY7A 4NTZA 1JXQA 1H8ED 3IT1A 1PS0A 3MHTA 4EUEA 2L19A 5CFQA 5KX5B 3QV1A 1RWMA 4H1TA 1KXJA 3BILA 5FBHA 1J7KA 2EARA 3EVZA 2BF7A 4YYEA 4LVUA 5EXEA 1YE3A 4DUYB 3GAMA 3D0RA 3R20A 4D9HA 4F21A 1V26A 1N6IA 4JEIA 5BNZA 2NTEA 5BSVA 4RULA 5EHZA 3WHLA 3FDZA 1NW3A 2FGJA 1U2RA 2VJBA 2GZRA 2WYWA 4K9DA 4M89A 4CLDA 1YCDA 4D8TA 1U2QA 3AILA 1O5IA 1NX6A 1XMQB 2FP4B 5T5QA 3T3OA 1QGAA 2PKCA 4PFKA 1LDEA 1M72A 4TUYB 1AVTA 1N2ZA 3IILA 1KIMA 3P94A 1AGNA 3SC2B 2ZROA 4PIPA 5ALJA 3IA7A 3PDHA 4ZT7A 1SVOA 4L73A 4NJMB 4LXTA 4PBTA 3KETA 1RXCA 2VH2A 3C1AA 1EDDA 1VB5A 1ODLA 4URYR 3SKYA 3ST7A 2V03A 4CEHB 3UV7A 1VL8A 2IOHA 2QMYA 3UHFA 3WB2A 4C03A 3PXBA 2UAGA 4XARA 4PV7A 1X80B 2XBUA 1UCFA 1OE0A 1QH1B 1U7HA 1UWLA 2OBBA 4HGNA 5EG5A 4MUEA 5TRTA 3PUXA 4II2A 2HBRA 4RKFA 1RQRA 1AQ6A 1RBQA 1RHKA 3ONNA 1DXYA 3ZKAA 2YJ6A 7MDHA 2O50A 3GFSA 3MCUA 5GTDA 1CF9A 1JALA 2LW7A 3K8ZA 2NZJA 4TS4A 5FFFA 5FLKA 4HYEA 1NOIA 4CKWA 5KQSA 1L8LA 5CDSA 3FNIA 4YJ3F 1CNMA 4B75A 3U4MA 4TZTA 4A0GA 2HAEA 4JLVA 1GTL1 5ICMA 2REOA 2R2GA 3QVMA 3UA4A 1VP9A 2UZ3A 4DEYA 1IAQA 1ORTA 1SUIA 1U3VA 2HRDA 2LD4A 2YV3A 2AUNA 1P4HA 2IUTA 4TTAA 3W1VA 5C7OO 5A0TA 1DBQA 3NBQA 4U5XA 3OA0A 4BIIA 2UUOA 3QTTA 3OH8A 4PN3A 2Z8YM 4MUMA 5EERA 4NZZA 4XOUA 5GVSA 2J32A 4RPIA 4BKRA 4XYLA 4ZK6A 3KD3A 4AJOA 3UK1A 5DHFA 6GPBA 1QDEA 3DLAA 1V0JA 2BDEA 3LY9A 3PT9A 3SM3A 2VUIB 4KR3A 4XZ3A 5D7BA 4YN3A 1T8YA 2FDRA 4V1CB 3PPIA 5AVUA 1I24A 3DLTA 4I6EA 4MYRA 1YVUA 2PVPA 4YTEA 4EMTA 1TUIA 2QPAA 3ORHA 1OBFO 3RVNA 1F4VA 2XB9A 4XJVA 3P26A 3L06A 1A8UA 3U44B 2C5HA 2XOKD 4AO7A 1JGTA 3D7LA 5DHQA 4MVJA 2OMKA 1LBHA 3UJ3X 5FFNA 5CLLA 2B83A 4FFOA 3Q0EA 4KYIB 5GAJA 4UBLA 3I4CA 4PYIA 2ZDQA 1SKMA 2IEYA 2I62A 1XK6A 1SRQA 4DG9A 5CLIA 4LCJA 1G21A 1XALA 4LZLA 2JGDB 4NPCA 4TT3A 1DDIA 3TTUA 2O5CA 1VG0B 1E9CA 1KPGA 4BZWA 4QJ3A 4ENQA 3AHEA 4KH0A 1KU0A 1WHTB 2VZ9A 5KAPA 2PAAA 1YZUA 1DRUA 2JA1A 3BH0A 2FA9A 3MTDA 2YVLA 4OHFA 2VPXA 1T3GA 4UHJA 3PS9A 3S2IA 4H7FA 3JWHA 3PUWA 2NXNA 3ABZA 3QWAA