2OWEA

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRMYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
total genus 62
structure length 170
sequence length 170
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2oweA00
3K4QA 2P78A 5PGMA 1FBTA 3NTLA 1H2EA 1DKOA 1DKPA 2F90A 2P75A 3QPUA 4HBZA 3DB1A 2HIAA 3O0TA 5AJVB 2H52A 1QFXA 1QWOA 1UJCA 1QHFA 1SK9A 2DWPA 2QNIA 1YFKA 3MXOA 3BIFA 1EBBA 3IT2A 4E3WA 2OWEA 4TSRA 2P6MA 4FDTA 4JOBA 2H4ZA 3FDZA 3E9DA 1K6MA 2P79A 4GPZA 2ENWA 1UJBA 2AXNA 3KKKA 3MBKA 1FZTA 4GPIB 4ARVA 3OI7A 3D6AA 1SK8A 1DKMA 4D4LA 5CU7A 3D8HA 2P2ZA 3ZHCA 1BQ4A 2GFIA 2A6PA 5AJZA 5CX4A 2P30A 3HJGA 1DKLA 1XQ9A 2IKQA 3GW8A 2P77A 4FDUA 5AJWA 3IT3A 3F3KA 1H2FA 1E58A 4JOCA 3LG2A 1V37A 1IHPA 4PZAA 2EKBA 2P9YA 3F2IA 5AK0A 4MA4A 3EOZA 2I1VB 3GP3A 3FJYA 2P2YA 4JODA 2OWDA 3D4IA 3DCYA 5AJXA 3E9CA 4D4JA 1SKAA 2EKZA 2PA0A 3LNTA 2RFLA 1C80A 4ARSA 2EOAA 5HR5A 1ND5A 2ENUA 5AJYA 3E9EA 2WNHA 3QPWA 4PZ9A 3R7AA 4D4MA 2P9ZA 3GP5A 3IT1A 3IT0A 1T8PA 2YN2A 1ND6A 1BIFA 3EZNA 4PGMA 5CDHA 1RPTA 1TIPA 2H0QA 4IJ5A 1RPAA 2WU0A 2YN0A 5HTKA 1E59A 3K4PA 1C81A 1DKNA 4D4KA 2P9FA 3LL4A 2P6OA 1YJXA 2A9JA 4ARUA 4EMBA 4EO9A 1BQ3A 3C7TA 1SKBA 2WNIA 3FDZB 4IJ6A 2H4XA 1V7QA 1RIIA 2HHJA 1NT4A 4AROA 2BIFA 1C7ZA 2DWOA 4ODIA 1DKQA 3QPVA 1CVIA 3PGMA 4QIHA 3NFYA 2HPAA
chains in the Genus database with same CATH superfamily
1LU9A 2J32A 2DBRA 3FNQA 4HRVA 3W2GA 8ABPA 2XKBA 1U8AA 2OLEA 5EP1A 2K5UA 4DM7A 3NBQA 5J2UB 1HT0A 3WGOA 3NWJA 5A02A 1OIXA 5AIBA 2PY6A 4UCQA 2QOEA 2J46A 3NHLA 1F0KA 3ZWDA 4CHGA 3JASA 1CRLA 2WIAA 4NECA 1JR6A 1J8MF 1GQSA 2ZS7A 3GV0A 3D5QA 3H99A 4BO3A 4D74A 5JLJA 4YO8A 2OWEA 1C1HA 5LDHA 3R5SA 1SN7A 4DN6A 5EJAA 4N3GA 2V5UA 2FUKA 2QU7A 3N8NA 3PGXA 4MJLA 4B82A 4AJ2A 2CUNA 2FP3A 3Q0IA 1QQAA 3M4XA 1ZR2A 3D0KA 3QYJA 1J9GA 1GUFA 3HEBA 4NABA 3FMPB 3PGVA 4ZVSA 3OPYA 4G5GA 2H8KA 5KNCD 4ESEA 5DJ5A 2VF5X 4J29A 1I3KA 5DEIA 4B7ZA 4KFRA 1O89A 3VH1A 3DHVA 1LLFA 1CR1A 2I6GA 2WMDA 1LC3A 3NC1C 2C4VA 3H9GA 1XB2A 2EARA 4IXMA 4DLXA 3E4CA 5CP8A 1N2XA 2ZQ5A 3R20A 1LVUA 4IDHA 1ECLA 3MPUA 5DN6A 3LUPA 4PHTA 3MMNA 4ENTA 2HR1A 3UN1A 2I87A 3MWJA 3L0OA 1SZCA 3AUAA 3PHHA 5HJ7A 1FRVA 1L5VA 2V59A 4BQQA 3T9AA 4TXJA 1EQUA 1UJ5A 3N5CA 3OECA 1IUOA 1VLVA 1WXFA 1RJDA 3W8EA 2ZT6A 2OO3A 3ZGVA 3UT0A 2B20A 5BOVA 1TJPB 3SI7A 4PSAA 4EY4A 1OH7A 1RT9A 3D2BA 4BX2A 3TD6A 4B3SB 5EIBC 3O3OB 3FMGA 2CJWA 4YN3A 1CZRA 1B1AA 5K3BA 5IHXA 4QUHA 4W6QA 4JODA 3RSFA 3DNFA 1RAIA 4BASA 3O8CA 4U63A 2NW6A 3VI3B 5TMPA 2FWBA 3HBJA 1WXIA 4EVQA 3GFOA 4ZANA 4OLAA 2CF6A 4NK5A 2XF8A 3IA7A 4BMNA 4NPAA 1L7QA 3DZIA 5EIWA 3TTVA 2G5TA 5D87A 3K4HA 2Q3LA 4ND8B 2EF0A 4IEIA 3U2QA 1D6NA 1SWVA 3SX0A 1ABBA 2FE1A 5KZMB 1SIBE 4AO6A 1NXPA 5GZ1A 4QGBA 3MLBA 2INGX 1SG9A 3IVGA 3KZCA 4TRRA 5CDHA 1JQEA 2A7QA 2NQ2C 4MDHA 5BWOA 4PYKA 4RVOA 3LI2A 5HRCA 5FV7A 5KQMA 2ONYA 1E3WA 2IOFK 2JS7A 3OSZA 3OOJA 3PJRA 1M1NB 3BICA 5IM5A 4U7PB 4AX4A 5CLLA 3F9IA 3PEYA 4MUJA 3P27A 5EPUA 4MWEA 4WTOA 4HAIA 1MO5A 1U0NA 2M6RA 3C7KA 4FYJA 2R79A 3D3JA 3WK4A 4BNYA 2Q9AA 3F1KA 4L6IA 3KDPA 2YX1A 2VO1A 2OP0A 3K2BA 1D1QA 1J8YF 1L1RA 1I30A 1NFQA 2QL9A 4Q9NA 5HFJA 4DW8A 4CTKA 1TYEB 1QP7A 4CUKA 4OH7A 1LH0A 5KTTA 2DWCA 2FR8C 1TEVA 4JLWA 3O9ZA 4FYYA 5PGMA 1H2EA 3L0DA 5HBGA 3SC4A 1GYPA 3JQFC 3I0ZA 4CQLA 3WC4A 1YB7A 2C4UA 1ZUNB 2G17A 3FHCB 3A0RB 3LQQA 1TPYA 4MV9A 4ENWA 4QDOA 2W71A 1PLLA 4KDRA 4J4HA 4DV3B 1GRQA 3NT4A 3CH7A 2Z4SA 3R9IA 4J3FA 3B89A 5I51A 4RAOA 4UW9A 4C43A 4BFZA 2IYQA 2ODPA 2PX3A 3K73O 5B12A 1QRUA 2XB9A 3A70A 4US2R 4G0XA 3DFIA 3H3FA 3ETJA 3GLTA 1SU6A 3X1MA 4BQRA 1YRLA 4ZI5A 4DIOA 5JH7A 1OLXB 1SVKA 2R6GA 2X13A 4V2IA 3NYQA 1ZMTA 4KHZA 4LI3X 3SYMA 5FWNA 5TMBA 5HUJA 3GA5A 2WSYB 4JQSA 4DA8A 1D0VA 2UU9B 4ARCA 3SEQA 2QE7D 4L76A 2DFTA 1MX5A 3D1VA 4U6QA 2A5LA 2VT3A 4EG7A 1BH6A 2ZCUA 1T6BY 4L8VA 3G2QA 4M7RA 4E5KA 2CY0A 1JECA 3UWMA 3TX6A 3S29A 4YRRA 1WCIA 1P2UA 5G1PA 5CDUA 2W6OA 3GI1A 1VSUA 2JI7A 2Q46A 3K9NA 5ERGB 1UP6A 4YJ3F 1IBRA 3UXMA 5KWJA 3ANSA 1P5RA 3WK8A 1DRUA 3UC9A 1FK8A 1CZNA 3FHLA 4Y9DA 2XAAA 4Q18A 3UQZA 4YAGA 2FU5C 3FCUB 3WNVA 5E8RA 4UCWA 3QXSA 5BN3A 4I1UA 4FDUA 2WU1A 1E2JA 4UAGA 1F8FA 2VHXA 1KAMA 3ZD6A 3JQGB 3IUYA 5JZSA 2TECE 2W2OA 2PMBA 3G5TA 1TYDE 2X58A 4ZALA 3TLXA 1GDDA 4D9HA 1Q3KA 3X1DA 2XJ9A 1WX1A 1FW8A 1J2RA 2NM0A 4GI7A 1LSJA 5DISB 4E08A 4D79A 4Z1MD 1ZITA 1YRHA 2I78A 2Q5CA 3ONWA 3ND7A 4I50B 5EIHA 1XWIA 3DCYA 3H1GA 1VG1A 3L8GA 2HUNA 1ZC3A 3E61A 5FFFA 3BH7A 3VAYA 4K26A 2COEA 2IVZA 1PGQA 1W1UA 2HRZA 3MLAA 1EVQA 3UT5B 3HJAA 1Z5NA 1E7RA 1WXGA 1OLSB 1L1EA 1FP4A 2X22A 3L77A 5KVQA 3L6UA 1XPRA 5HMLA 4BJ6A 1PSDA 1I9CA 1FFXB 3IT1A 4BFVA 4NZZA 3PHLA 1R6UA 4W1RA 3RAFC 1P7WA 2E5WA 2X2EA 2J07A 3FCSB 1PJQA 1DBPA 3MAGA 2AKYA 3VMMA 4CLRB 5JHGB 5J2TB 2H17A 4WK2B 1IAVA 1WV1A 3D7NA 1NNUA 3P0RA 4JKOA 1SC4A 3C16C 3C87A 3OD1A 5K8IA 1GXSA 3ICOA 3HZHA 5KC8A 1IJBA 2QRGA 2FN8A 3L6DA 1OI7A 4ZAZA 3RRFA 1NN5A 1WB5A 3SYNA 1M5RA 4L4SA 3P9SA 2VAXA 3TLZA 3A1EA 1PTJC 3ZXYA 4R1NA 1V9CA 3UMJA 2J9RA 2J9ZB 2VRCA 1Q17A 2ZCVA 3KUKA 4NNJA 1U0LA 1RMTA 1JBQA 4CIYA 1EUZA 1TIBA 1GZHB 3DP7A 4WASA 4E07A 1W85B 4BBJA 2AFVA 1N5DA 4RGQA 1ZVVA 2CJPA 3JARB 4N01A 4UEKA 3OLVA 3F98A 1QPGA 2ZYIA 3L5KA 4LCEA 1T43A 2B8EA 3RU9A 1B8PA 4LJ6A 2X2PA 5LYJA 3EFHA 4YQEA 1SVWA 4INOA 3OM9A 1XRRA 5E7IA 2IJGX 4UATA 2MTBA 2EP5A 3K09A 2WEKA 2GJ9A 1PE0A 4IFIA 3MUEA 4GLLA 3B53X 3VSEA 1UWCA 4F04A 2XVAA 2JGRA 3ICCA 5A7HA 4UXIA 5JU6A 1SWWA 2GM4A 2AMLA 1N8SA 1KP3A 2I62A 1FB5A 1ZL0A 2FR8A 1X38A 2R1TB 3GJQA 3O7WA 3WIDA 3LUDA 4C6TA 1GPDG 3G1WA 2Q49A 2ZYRA 1QKIA 2BJVA 1CFJA 2XTNA 3PFWO 4CDRA 4IIHA 2OZEA 3IIKA 3JWIA 4TL7A 5J58A 4J1TC 4AD8A 5JXIA 1H1LA 3UHJA 5J43A 1XP5A 4S2UA 1IRIA 1ZD4A 3H4VA 4H3HB 1NURA 4TMVA 3NWBA 5T4BA 3R3UA 5AVWA 2B0CA 4X65B 2X4LA 3DEYX 5E6RA 2FJ0A 3DV2A 4EF5A 3HK2A 3T9BA 9LDBA 4CEIA 4LRTB 4KQ2A 4C21A 4IIUA 4YCDA 1CIJA 3QLTA 5FDFA 5D7NA 1CZLA 1ZU4A 1ZCZA 4IDGA 4MNTA 3GEDA 4W6ZA 5CLGA 1NU6A 3T38A 3TM5A 1XJ5A 1QF7A 2QSUA 3PT9A 5JAHA 3EX7C 2GEFA 1GVHA 5A5DA 3ZWXA 1JJBA 4CJXA 4CKWA 3TLEA 1EAMA 2CKDA 1FNMA 1T5OA 1MW8X 3SE7A 1UQUA 3CNHA 3RTCA 1WNTA 1OCEA 1B1CA 3IAXA 2H29A 2P67A 1Y6JA 2H1OA 2AEFA 1EK1A 2Y1LA 3WWCA 5B1HA 3OKAA 2VHUA 3FSGA 1DBQA 3D3KA 4WN9B 3G7UA 1VBFA 3FRIA 3LH5A 3OLQA 4FX5A 3M33A 4YRLA 4D9JA 1RVDA 1LPMA 1X70A 2VUTA 4LTNA 4D6PA 4NCXA 1JZQA 5TPWA 5CVTA 3EXG1 1PGOA 4KXXA 4RY0A 1PK9A 3OLYA 4LDRA 1CJUC 3CPSA 2IIVA 2FPLA 2WD8A 4ON9A 4U7WA 3OICA 2R48A 5LOVF 3C5HA 3A36A 4HMPA 1IXKA 3HWX1 5EHNA 9LDTA 2A88A 2LRHA 4OMFG 5HR5A 4KMMA 5FO0A 2NXJA 1Z4NA 5AW4A 5KOYA 5JH7F 2NU8A 1TZCA 1YR1A 2PUFA 1Z2CA 2BFWA 1T9AA 1L7NA 2AMJA 3H9CA 5FOUA 1ISGA 3AKDA 4XLZA 3SOZA 1YOVA 3V8PA 4UU1A 3PXXA 1REQA 4MIYA 3RIXA 3QOWA 3S5JA 2GH1A 3QOXA 4YHBA 2IQIA 3AXTA 3GARA 3MT9A 1ZLYA 5C8YF 2IYVA 3NUGA 2LCQA 1RLIA 3SICE 1M33A 3HZRA 2I9PA 2ZVPX 5AXAA 1EX7A 1Q6YA 2JZCA 2PV7A 3OWOA 4J91A 4RXTA 1T35A 3C3PA 3NM6B 3OZEA 2QW1A 4RZSA 4IIJB 4C6TB 2VPZA 3NC0C 4PYOA 4ZJUA 4JJEA 4LF6B 3HXMA 3ZBTA 5JAUA 2YY5A 1EWYA 2ZJOA 1CY2A 1A97A 1CRZA 1XTTA 4A6XA 3P71T 5FUQA 3WLMA 2JFHA 3T4PA 4LRXA 4WK4B 4KWTA 4N9QA 4IXWA 1SZDA 2JHFA 3FLAA 4PPGA 3WVNA 1EFRD 5F3WB 1RBYA 1YJ5A 3QBEA 4ZYVA 3NH6A 1MKYA 2HAEA 3I6MA 1IY0A 2XCOA 5FPHA 4EHIA 2VUUA 1ZCAA 3EEIA 3T06B 4LNHA 2H2WA 3UMCA 1M6VA 3G2LA 3O0TA 4HX2A 3RC9A 1PT9A 3ADCA 2X19A 1VJDA 1XDWA 2LTAA 4Z3KA 2Q2NA 1H2RS 4H1VA 1Z56C 2NZVG 3IQHX 1EFAA 3ICQB 4PNEA 3F90A 1JSLA 4GBMA 1AQJA 1ADYA 2KE5A 4AZWA 2I71A 3R0QA 4F2GA 3HR8A 3HB1A 2R2AA 4L28A 1H4TA 4OAQA 2RC6A 2GK6A 4UBJA 3SS8A 2O14A 3TO5A 1CQPA 1QZTA 1DAPA 4DJJA 1G63A 3GDHA 5H7XA 4RXMA 2VQEB 3X1XA 1BXZA 3CLKA 3FR8A 3E53A 1J42A 1NIJA 2G09A 3EQ2A 3L5OA 4FZ5A 5B53A 3ZCSA 1M76A 3FRJA 5J5CA 2AQIA 2BC9A 3P32A 3PTZA 1VDZA 2W22A 3VOTA 3LIIA 4PN7A 1AKNA 3ZYZA 4K81B 4D4LA 2XNHA 1TZMA 1WIWA 1V41E 3NNDA 4DRYA 1GPMA 1DGQA 5DGXA 2X3FA 3VPSA 3GLGB 3W5CA 1IBMB 3TWOA 2NT4A 2Z2IA 1XTBA 3PGA1 1HNZB 1GUAA 3FSRA 4LOJA 5HS6A 3A6DA 5KTNA 2O5EA 1XAGA 1QE0A 5IDVA 3VAZA 1XN1A 2C3MA 4UBMA 2CVHA 2ZRLA 1R5BA 3A28A 3FKSA 1RJEA 1MAAA 2Y1GA 1BEZA 2CV1A 3LY9A 3EPRA 2CWDA 3TE6A 2B8WA 4Y18A 5LZ2A 2Q1UA 5KX5B 3HJTA 1GPUA 1YJ8A 3COWA 5DYWA 5AUQA 4PXSA 3RAJA 5JD6A 1XMXA 4ITRC 16PKA 4JXKA 2ZJFA 4EYEA 5ALFA 1PFYA 2DFDA 4GOOD 3BBPA 2HK7A 4B2IA 3KFVA 1QVWA 1EP2B 4QQFA 3SCZA 3BB3A 3WDSA 2J08A 4Y98A 1AQUA 1VPVA 1M2GA 1OGIA 2WINI 4UTOA 4B2YA 2JH9A 4HNAB 3IDOA 2A5GA 3RKRA 4CQMB 5C4MA 3B20A 4EEZA 1TUEA 4I55F 4YJ2A 5H81A 3WWOA 1DWUA 1A5AB 4TROA 2REXB 3U49A 4UTRA 4JLOA 4AN0A 4YLYA 3IE0A 1Z18A 2NU9A 2YCBA 4MW6A 5KPJA 5IMBA 5K0ZA 1KI1A 1D5CA 4AUEA 5KX5F 4K6CA 4HXGA 5TARA 5L9AA 4RTSA 1OZGA 4PSDA 4JI3B 1VE3A 1NLUA 3LD9A 4YH1A 4K9NA 2M1XA 4K2HA 3DMYA 4PLPA 4BRSA 5JTUA 1DE0A 2LD4A 2WA1A 3DOCA 1OJ7A 2D0OB 2QLNA 3BHIA 1EGVB 2PSFA 2YQZA 3JQ8A 3KOUA 4K28A 4CM9A 3TNYA 1ENOA 1HYGA 1H42A 3SEAA 3MJHA 4P82A 2FXVA 1C7EA 4A8TA 4BNXA 2UUOA 4NE9A 5E4TA 3RROA 1YVEI 4TXNA 5DHRA 3HTXA 4WBNF 1MC5A 3PUVA 1X87A 5IARA 1CUDA 5HQ3B 1RIIA 3A2NA 4OQMA 2PXHA 3EQZA 4KWCA 1J90A 4XJSA 3T7JA 3VR6H 3WLEA 4YX9A 1WB4A 2DY1A 4C0QC 1AURA 1QH0A 1YQTA 1WSDA 1LV8A 2CE2X 1X7YB 4J90A 5ALDA 5I7SA 1QHGA 1KETA 4HP8A 4DPMA 1RHQA 2J0EA 3WWPA 3QF4A 1H2WA 3A25A 3DB1A 5BYBA 4DCVA 3OE1A 1C9KA 4HLNA 5THQA 4GX0A 2MWMA 1ZI8A 4PN3A 3PU6A 4MGYR 2XXBA 1M66A 1AQLA 4EW1A 1ULSA 3K92A 4P7BA 1PJLA 1NU8A 1VE5A 4MHSA 4O5AA 4XFKA 3RRBA 1YA6A 2WD7B 3OZFA 1IIBA 3ESRA 4QTZA 4B79A 2F2TA 4FD2A 4FYKA 2B82A 3OESA 4WBNB 1EWTA 1N57A 3PUYA 1ZK3A 3UHAA 4A92A 4LNAA 5DHTA 4Q3BA 1AIPA 3FNIA 1KMQA 4MRAA 4DXHA 3E1GA 4YT2A 4YRGA 2PM8A 1YR2A 2Q2OA 4LIPD 4JXXA 1T2CA 3IQIX 3GO4A 1OT5A 3TPFA 4EW6A 1GPYA 2BHLA 3FOCA 5BY2A 3OC6A 5DNDA 4IZ6A 3HEMA 4NDZA 1V3UA 4JJZA 2BLNA 1GRCA 4UM7A 1ESEA 2B1RA 1QHHB 3PHCA 4HRYA 3DMHA 2R44A 2CNWD 3C7AA 4Z4FA 3L8MA 1GTL1 5CBKA 1E3IA 2PMFA 3VU1A 5FOQA 5KYUB 3MVEA 1FNDA 1RM3A 4OAOA 1U0RA 2YNMD 1ESNA 4ZA2A 2G9NA 3A1UA 3LT2A 3PNKA 3QOFA 3T7DA 3T3NA 2CK3D 5JJIA 2VAVA 4FWTA 2F00A 3L7YA 1J2JA 4EMSA 3GWZA 3L43A 4AJLA 1NX6A 3KRTA 1QYVA 2FF5A 3CZQA 1XCBA 3DE5X 3TQFA 2IX3A 1PS9A 3EZGA 1IVSA 3WZ2A 1UBLS 4QOEA 4Q4HA 4RHTA 2WWHA 2DJIA 1NBMD 1UEXC 1SVLA 3EOZA 4G8JA 1U9ZA 2MSWA 2BFBB 3MM4A 3LK7A 4GSKA 1E5QA 5JYEA 4F8YA 2R4UA 3JYNA 5JHHB 3A1SA 3G2IA 4J07A 3OPQA 1D6MA 3VR3A 1Y8AA 4FFNA 4URYR 2NQTA 1NV8A 4AY3A 4B8YA 3NPAA 4CKWB 1LB1B 1E60A 4CN9A 3NHBA 1KFKB 3K72B 3LY5A 5EJ9A 1V8DA 1JXQA 3QMVA 2W2LA 4MS1A 2PYIA 2RAVA 1PVDA 2EFCB 2OFWA 4UJ3A 3FDFA 4BX8A 3HYNA 3MGBA 5E4FA 5H4GA 3PC2A 2HQRA 2XTMA 2JGLA 4UKDA 1FS5A 1YDGA 2Z57A 4YCJA 1GPKA 2YN2A 1MFZA 3MWGA 3BKWA 5IDXA 4QU5A 1IEVA 3IP7A 5BO5A 3O95A 1CJKC 1RRPA 1SD1A 1UL1X 1BWQA 2WOJA 3FPCA 1AX9A 3OF3A 2O5RA 4OGLA 3VSDA 2AEEA 4NJMA 3VM6A 2DUNA 1V39A 4MVJE 4PZZA 2ASEA 3AF3A 1G2PA 1IK6A 4RA9B 3UQYS 2P4SA 5JV5A 4AI6A 4D8WA 4DZRA 2ZTLA 4RVUA 2PUCA 1VXRA 3HYCA 4HLDA 3MMXA 4LYFA 1Y5MA 2R8YA 4DLVA 5ALKA 3WLQA 1XRQA 5DT9A 1AGXA 1HE5A 1K06A 1D2MA 1O54A 4BN5A 4PYJA 3SNHA 1UMKA 1KYXA 1KI8A 3EB9A 2RI1A 2Z3VA 2IDMA 5AM2A 3ZDDA 2FA9A 1J2UA 2EX1A 4QREA 4JGGA 4AQYB 4QRDA 2ZTVA 3VR5H 4QPZA 3AERB 5E6UA 1A4XA 3DEJA 5FOTA 1FFBA 5ECYA 1ORWA 4WI1A 3RANA 2PUJA 1HDOA 2PZEA 1K7YA 3DP9A 3QK7A 4WCFC 4KQEA 1SB9A 1HYHA 3ELWA 2YWEA 4CF3A 3WGNA 1H65A 5BPHA 3MCAA 6AT1A 4WWHA 4R05A 3MT0A 3OU7A 3SEFA 2ZZKA 2XQGA 1D2EA 1N5MA 1WU7A 1YUNA 1ZM9A 2XZTA 2FUG1 3LVFO 3NYWA 3UJ9A 1PQYA 2R6DA 2RAPA 4JASB 4EAQA 1DADA 2Z8ZA 2Y1FA 2FUG6 4J0IA 4Y9RA 1J09A 4RKQA 3VOAA 4B09A 2GN4A 3G2OA 3NTXA 1NR5A 5J2UA 2ZAOA 1FUEA 2DZDA 2YVUA 2QSJA 4HDSA 4W8GA 1TFUA 2VR1A 4M0KA 3CVJA 3GUYA 2Z95A 1WOMA 3KDAA 3OMWA 3IOMA 3REOA 4PS1A 3VU8A 4F6RB 5IJ9A 5HGXA 1DOAA 1LBHA 4XH9B 3ND8A 4BQNA 4WNAB 1XQXA 2GD2A 3JQFA 3RE1A 3DMRA 1FMTA 3U6BA 1YRBA 2W6NA 5IDQA 1IAQA 1SZPA 1W4CA 1KAEA 2H1HA 3QYAA 2K2QB 3KX2A 4L27A 3TSYA 4LF4B 1QQ5A 2A1TS 4JJ8A 4W99A 3JZMA 4EIWA 4UQLA 2OV4A 3M3DA 3U81A 1M1YE 1RADA 2B5VA 2YC4C 2VYCA 2JIOA 1PGPA 2J0UA 1AXRA 4QHYA 2YQ5A 2YWFA 1HURA 5G3ZA 3GR6A 1E1QD 4MUMA 4Y2JA 5D84A 2ZB4A 4C76A 1JI3A 1XPOA 3GJYA 5CB0A 2FW1A 1FUUA 3KCNA 4V1CI 3UV7A 2FE4A 5CM9C 4C3VA 3E8MA 5DSZA 3F8TA 3TL2A 5EJ5A 5IUJC 5KTYA 3IAHA 3MPOA 4JLJA 3JYOA 2CF5A 4U7JA 4JV5B 2JLSA 4YCMA 4BE9A 2OM2A 3NYRA 2H1SA 5IAOA 4HEHA 1G2QA 2B61A 3ZJ5A 4DQUA 2X8JB 3ENVA 1DX6A 4G09A 2YWGA 4PQFA 5CVUA 2PA3A 3QKSA 1DFHA 3LNTA 2OHJA 2FJPA 4H35A 1CUAA 2J9GA 4R9UC 3D4BA 4E2ZA 3X2EA 1K63A 3KT3A 1LK0A 3IP6A 4INJA 3QEMA 1D9ZA 1ECCA 3CR3C 2EJBA 3U09A 1YB5A 4YJ3B 2X0IA 3NBFA 1FVXA 3DCJA 2JAUA 3UAVA 4KKVA 1WY5A 3PC4A 1H8EA 3CWCA 4RKWA 1EH5A 1ND6A 4RM3A 3AERA 5CGQB 3LCCA 1JJ7A 2HHAA 5E6UB 3UGTA 4C08A 5AVUA 3GLSA 3QHQA 5E1DA 3MN1A 1UC4B 2W7TA 3CTMA 1X1EA 2XV1A 1D2GA 1NSFA 5CEFA 2EC5A 4Q9LA 4XCQA 3UCEA 4E2WA 2NX2A 4OD0A 4ER0A 1S01A 4OX9Y 4NS1A 1EHCA 2XW6A 5SY9A 1S5PA 3C3EA 4KGDA 3BXPA 2PS0A 4N65A 2VF7A 3F6RA 3FPFA 4GM4A 2AKEA 2E4ZA 1IUPA 3A3YA 2O3SA 4BGIA 3ZNQA 1AA6A 3ROMA 4TLAA 5BW8A 2OFXA 2PIDA 5EE0A 4GP7A 1KKMA 4IVPA 4DSUA 2HY7A 5AIAA 3HMQA 4E5YA 4BLWA 5EYPB 1ZBQA 3NIBA 3ORSA 4PG6A 2EKDA 3OC0A 4D46A 4B3XA 4DBVO 2PH1A 4R68A 1N5JA 1XYVA 2RD2A 4LQCA 1DIOB 1N2ZA 2ZTUA 3EGXA 4ZRDA 5KAMA 5G1OA 2FW6A 4XSVA 2X0EA 5EOVA 2QI9C 4GE3A 3MW8A 3WNCA 1LC0A 1JTFA 3NHUA 3IEXA 1VKRA 2QRPA 3ZV5A 1IG0A 3BDIA 3SC2B 3ZDBA 2WG2A 2RSLA 4RK0A 5FJJA 2FSIA 4JUIA 1KTIA 2N1BA 3ZV6A 2WT9A 2OZKA 3NVKI 1YQ9A 3U60B 1PR9A 1ZAKA 3CLRD 4MYSA 5CCEA 5K0EA 1VKJA 1XTKA 2YOHA 1NXQA 1M2OA 1C7JA 2WVGA 3QI2A 2RGYA 4JL8A 3IVXA 1VFPA 3KOMA 1GG2A 1EJ2A 1ZW6A 3C1OA 4AICA 3MEQA 4EWLA 2RBGA 5EXEA 1ECJA 3QEJA 2D54A 3C4VA 2YVLA 1OOEA 5D6OA 4L3WA 1BQEA 4EPTA 5JZMA 1X77A 4KK3A 1GU1A 3VU0A 5BR1A 1ODSA 4BWGA 1SQ6A 2P4QA 4P7FA 5JO9A 1BVRA 3HXTA 4ZQHA 3DBLA 4ZGWA 2ZXUA 4JLKA 3COJA 3HCEA 2GLTA 4G3XA 1O4VA 2YZNA 3OZBA 5IH3A 3DDNA 3GB9A 5TNXA 3JX9A 2NN3C 3TQRA 3VDRA 1L7EA 1PR1A 1FJHA 1SIWA 2I2AA 1C9MA 2JFNA 2P40A 4HFNA 5F5LA 1PVOA 1PBNA 3C3MA 4M8IA 2B3TA 1DKLA 5ER6A 1KTVA 4FR5A 2CEKA 3P9RA 4ED9A 10MHA 2ZRDA 1TI7A 4W1QA 1FDVA 4ROTA 1WSBA 3RQSA 1T3TA 3QFFA 2KMLA 3O5AA 3VHXB 3UJ6A 1A95A 3ASZA 3NBAA 3WO1A 1FW6A 2PL9A 4L4RA 1F9EA 2VYNA 5G2OA 5AVVA 1EPUA 1GFSA 2GNPA 4PQRA 5F12A 4XGRA 1SCUB 4DMKA 1TC1A 4GQIA 3SD7A 4KFUA 5BN5B 1C3XA 3ENZA 3K0EA 5HF6A 4YMTA 2PQMA 3AHJA 1FEZA 2PZBA 4MW1A 2B5OA 3CEJA 1G8JA 1KYQA 3EEYA 3H8JA 1ORTA 2NUPB 4FZJA 4QT0A 5J2TF 2IW1A 1BVUA 1KYWA 3W90A 2J3DA 5ICCA 1OB5A 4M76B 4OOEA 4DWWA 2WSMA 2Y4OA 3H97A 2UKDA 2CLCX 3RTEA 4YR9A 1FFAA 3TNJA 5AK6A 4OU5A 4N4AA 5C53B 2DB3A 4ZARA 3IT0A 2HLDA 3NLLA 1LBQA 4G24A 2G8LA 3CSUA 4Q4AA 3PL1A 5KTMA 3ADDA 4S1VA 2RGRA 3DBHB 4MWSA 4G0QA 3GX1A 3ROTA 2E4XA 4QEDA 1Z16A 1ZQ1A 3DHYA 5DK4A 2R1VB 2AF4C 3UA3A 3DZDA 4CV0A 1IEWA 2QS9A 3NDJA 1X80B 4R1PA 1FDUA 5DV9A 1IZ8A 1AHHA 2HU5A 2P6OA 3RUHA 4KXLA 2PZFA 1I14A 2F4VB 2GBPA 1MAWA 4MCJA 3WWYA 2YZKA 1QFMA 2Y77A 3TBKA 2QLBA 1I2BA 4B45A 4N3BA 2Z4TA 2RHCA 3WP1B 4DV1B 4PLHA 1L5QA 2WQZA 4MV8A 4JCCA 1XQVA 2V98A 5BMOA 2NTVA 1Q92A 5EJ2A 1O58A 1QF6A 2HK9A 2IHVA 4X64B 3MWEB 4TKLA 2A3RA 1DAMA 4AY4A 4H6WA 1J39A 4HT3B 1AUXA 4F5YA 2OA0A 1EI9A 4JFRA 4MRNA 4M98A 4CM3A 4B76A 4KAJA 4QXRA 3RKSA 1ZMRA 2UVDA 2DLNA 4UTNA 3NTRA 1P3DA 4KLRA 3NBKA 4O4JA 3MJEA 4C7JA 3PCRB 3R0JA 3ADOA 3I04A 4IIVA 3PIRA 4X94A 4V3CA 3IBCA 3SSNA 5M29A 4PGAA 3DHNA 3RSGA 1E7SA 2D5CA 4LS3A 1HE3A 1EFTA 1RLMA 1ADGA 3X2FA 1GLNA 3KSBC 1KDOA 5KYKA 1G42A 5ALNA 1JHPA 3BXEA 3H9EO 3L7MA 3FVQA 3IEMA 2JIPA 4J7AA 5FLXA 4N8DA 4ZYUA 4G4GA 3GGJA 2V74B 2UYCA 4GDFA 3P2YA 4BB5A 4B4OA 5HUHA 3L49A 2YIVX 3OCXA 4WACA 5H3HA 1RPNA 1KO1A 3DZBA 3HYSA 1GRNA 1K8RA 2HPVA 2VUHB 2Z1NA 3NOXA 3VO9A 3WLRA 2QRUA 5EHZA 4DR7B 4Q9DA 3HEAA 4DY6A 4YT8A 3R9XB 3FSEA 5F4ZA 3TOVA 1VGQA 3FYDA 4JUDX 3IKJA 1NUAA 1NQVA 3M2PA 4L8YA 5EL0A 1P33A 2I1QA 1L7DA 2VPQA 2ZP1A 4UFOA 2JRCA 4DIEA 4G5YA 3C0KA 2IXGA 1TM5E 2VRCD 3R5TA 2XRFA 1E5DA 1MPTA 5JWRA 1JF8A 4HDCA 2AJDA 4TL9A 1EXVA 2BUCA 1XDUA 2W8ZA 3GQBB 1WVGA 4N82A 3PUJA 3IEIA 4BC1A 2GBFA 1C9YA 2ZGVA 3NX4A 1AN0A 4O2BB 3HWRA 4ZEXA 5JDCC 4QOJA 1N2BA 1IG3A 4Q4JA 4YDRA 1JIJA 1HT1E 4V0QA 4Q16A 2O2JA 3UIEA 4IIYA 4H7JA 3FH0A 4OVKA 2WD9A 1Q19A 1R00A 1JIUA 1LPAB 2BFDA 2GCPA 2OKGA 3FTPA 4ZVTA 1UM8A 3L7OA 2PA0A 3S1LA 3ZE6A 3UJHA 1S2GA 4P4NA 4UDNA 4OP1A 3E7FA 3L01A 4DLNA 3CCBA 3MK31 1X15A 4FDLA 4R16A 1GGNA 2R8RA 2Z2KA 3RYHA 3NH9A 3ZD7A 1L9XA 3KFXA 3OCJA 1KH3A 2NO1A 2Q5FA 3O38A 2VOJA 3WSWA 3SFVA 1E69A 1UQTA 5EUCA 4EJ0A 1T0BA 3WKEA 2X7XA 2XGSA 1RU3A 2RI0A 2YHSA 1A98A 3OJLA 1B76A 3G0CA 5ULLA 4URVR 3D8NA 4W5WA 2CNBA 3RVKA 5EPOA 5CH8A 3I01M 1ZNXA 4RS3A 1VHJA 4TT8A 4ABYA 1LWOA 3BFVA 1GV1A 4G97A 3VYWA 1U3VA 3RUCA 3UJ8A 2HW8A 1V48A 4YMLA 3E18A 4AN1A 4HWRA 1MHPA 3G1UA 4K6FA 2QR2A 1JHOA 1Y7PA 2FFAA 1CKEA 3CJQA 2DHRA 2GJ8A 2B69A 1WXHA 4NCJA 3R76A 3BTVA 1O9BA 3BGSA 1KA9H 2IYWA 3QEMB 4IIXA 1FX0A 1BAPA 1QLJA 4C14A 3PUKA 3S2GA 3JTEA 4QQKA 5JC8A 1CUIA 1M2OB 4XX1A 2ORWA 3WGMA 2OR3A 3KBBA 1MO2A 4CL8A 3HADA 1N2IA 1EVEA 2OBFA 3KPYA 1TD1A 1Z7EA 3NHWA 5JEDA 3W4KA 1F38A 1M54A 1YQWA 2G5GX 2D5BA 1IOZA 1B8OA 3DLPX 1DLIA 1X2EA 3VO1A 4PX2A 4AJPA 1OV4A 3JVDA 3TGPA 4DAOA 3KWJA 3RVBA 2UYYA 3ZQJA 1YL5A 1GZ3A 2QVXX 4MP3A 5JJLA 1CF2O 1BD4A 1XLUA 3W77A 4JYZA 3UG7A 1Y6GA 3ZZTA 4RD0A 4ENVA 3PWKA 2IODA 4YMSA 2NU6A 1SHJA 3IDAA 4IXNA 1ST2A 4JMPA 4PQYA 1A9XA 2C42A 4AL4A 5DNEA 1WCIB 4E5DA 4TRJA 1PEKE 1W5BA 2VBIA 3H86A 3HA7A 3WS7A 3MBKA 4E6PA 1XLVA 2X15A 4K1XA 3HJFA 3LF2A 1TLTA 1K1EA 1XALA 3L0YA 3HDTA 2BAGA 4IDBA 4M8NE 5DBFA 1RAGA 3PQ5A 4NICA 4R9NA 2I5PO 2PXXA 4K8RB 4NZOA 3PUWA 4GLFA 1PG5A 3KP1A 5JQGF 1I7DA 1IZZA 1ESZA 3TUIC 4C0BA 1M74A 4X8MA 2R6FA 3WLTA 2VG8A 1IQ0A 421PA 2C7BA 1M2WA 3D4OA 3JW8A 4YT5A 4H7KA 5CFZA 2VVTA 4JU8A 4JB3A 3T3MB 2FOXA 3BGWA 4X92A 2JAOA 4GOLD 4M36A 5DXAA 3L7DA 1CRWG 2R68A 4ENPA 5DH9A 3W5HA 2JDID 1KU0A 1UBSB 3G79A 4KXWA 1XDDA 3M6LA 2ONJA 2H65A 2W58A 3CH4B 4HQOA 3PUHA 1W76A 5LJLA 1X1CA 3KJGA 3JD4A 5P21A 3LDFA 4XOUA 2QY6A 1FJ2A 5ICGA 5AK0A 1PK7A 2HU7A 1ZRHA 3G2HA 3WMFA 1NM5C 4JP8A 1Z22A 3KXPA 4Q0MA 3VVLA 1CNEA 3EBLA 4YV0A 1JPVA 4X9XA 5JQGB 5C1IA 1S8NA 4RY8A 2FYTA 2J6BA 4XVQA 3JWJA 2VJMB 2OKCA 1O9GA 5ELMA 1G20A 1QHEA 3P0IA 4JNKA 1TW2A 1QFSA 1K66A 1J2TA 1K8ZB 1VB5A 1Q57A 3A10A 1WM1A 2QVGA 1E2UA 1X7ZA 3G0OA 1NDHA 3EH1A 2WSLA 4O8CA 4QT4A 4UOEA 1U9YA 3LFUA 4WEOA 1N0UA 4I4TA 5KDLA 3DTTA 4AP6A 3UGJA 1GGFA 3HKCB 1C7FA 1KL7A 1X1TA 1FDIA 1I3CA 1LDGA 3K9LA 5A5GA 3VX3A 4FR2A 1L2TA 4RETA 3UWSA 1B4DA 2OXFA 3X1JA 1NONA 5A4IS 5I4IA 2BMDA 3LQYA 1D7OA 1XU7A 4I6GA 2R6JA 5EKSA 4HI0E 3NRBA 4UJ5A 1E4EA 1POWA 4E6EA 3NBYC 4EFLA 4JBNA 4NY1A 4OUKX 2V1XA 4Q1BA 1UFVA 4ZV7A 4ZN6A 2YKGA 3IFSA 3LW7A 4NZYA 1NN1A 2YV2A 3TJRA 5DN6D 3BMCB 1O57A 1T4GA 2C77A 2H4XA 3D81A 5H02A 3WNDA 5JS8A 3RT7A 4O1MA 1HWYA 5CX1A 1R0WA 2NUTA 4JIMA 4L8FA 1NP7A 5CITA 3INTA 1W35A 1ZICA 1R8QA 1ZH6A 2PUHA 5ELXA 1D2RA 2PUAA 3QJ5A 3GZ4A 4ONEA 2QAGA 3FWHA 1KQOA 4MW4A 5BQFA 3G89A 3DWGA 4MEAA 1CWUA 3PHGA 1R88A 1US8B 4G89A 1RRFA 4FUQA 4ZOLF 3W34A 1JDNA 1BCSB 4ERXA 1RWMA 1TJYA 3S27A 2EJWA 4FS8A 2UYGA 2VXOA 5ELLA 5ICFA 4XUDA 4AS3A 1JSXA 5JCJD 1Z8NA 1MG0A 1MRNA 3NRCA 3OLXA 1GU0A 1OE0A 2QMZA 2QI9F 5JYBA 5KOJA 2AR7A 3OOEA 1LPOA 1X7XA 5B4UA 3I6ZA 3U16A 2Y76A 4M60A 1T6XA 2D0PB 2X40A 1ZPDA 2JL1A 1AKWA 2ZRMA 2YXEA 3OQJA 2A78A 3QI7A 4HFJA 5HEKA 1OZFA 2CMDA 4KQMA 3Q8LA 4JVOA 5FJIA 1L6RA 1AKUA 3CX7A 1W5TA 1HYBA 2OGUA 1YHZA 2JA1A 2EP8A 4M0EA 5C8ZA 3I9FA 2JCBA 2MJLA 1SBTA 2JGJA 2OFPA 2PHZA 3LBNA 4K9LA 4QDZA 4B32A 4B3IA 2DTDA 3E15A 1BQ4A 3OPYB 3AEUA 4LJYA 4B5LA 3RWOA 5KJ1A 1Z4PX 3KEQA 3W8NA 1KAHA 2WT8A 3BERA 4BVJA 4I1PA 5D3QA 3NDRA 1JR3E 3K1AA 1KSFX 1I01A 2CXSA 3HJGA 3Q2IA 4JC0A 4YRDA 4RTRA 4Y67A 1RNLA 3U48A 5JALA 1HDRA 4Q3KA 4O0MA 4X6YA 3ND9A 3WL7A 5GTDA 4JJFA 1B14A 1YZFA 2WPDA 2YL2A 1CXZA 1XVTA 1WW3A 1HDXA 1W52X 1QHYA 1E3DA 4IGFA 2Q4BA 4LHSA 1WXXA 2P1RA 1FTWA 4ASUD 1N6PA 1ULAA 2YXNA 4GXQA 1ODKA 2Z43A 1T5HX 2V7GA 1J5PA 3IHLA 1OUMA 2C5FA 4C0XA 1LSSA 1SEVA 1V5EA 2Z98A 3I5UA 2P2NA 2UVPB 1MEJA 5TT0A 5KNDH 5DCUA 3L6OO 1CJVC 2Q5QA 4NARA 1S3SA 1UPCA 2BM8A 2ENUA 2HJRA 2WWFA 4Q4DA 5ALXA 1K9SA 2CL6X 3BE8A 2OAP1 4OX9B 3BK1A 1I7NA 2H5IA 3F4LA 2XX3A 4F5DA 1PEDA 1PZGA 1M2VB 2V97A 1PWZA 5JR3A 2OV6A 3TIXB 2IFTA 1JS1X 4GRDA 2PGAA 4L9WA 1PWYE 3OT1B 3F9CA 4IM7A 3KQOA 1KZHA 3L4SO 4UZEA 1RLTA 2H2GA 1V8ZA 3MCWA 1CP2A 2XTZA 3HV0A 4O5OA 1RI5A 2OD9A 4M8SA 3S8EA 1WS6A 1KHTA 1DT5A 1CY1A 2JB9A 4S3MA 1ZIYA 3BFPA 3OE5A 1SCBA 3B9RA 1UK6A 2ZBVA 4INZA 5A9RA 2QBYB 2DX7A 4QGFA 3BH0A 3T7KA 1Y3HA 2P11A 4KMOA 3T1NA 1SKBA 2FPWA 3ZR4B 1G64A 1Q7BA 2RGDA 1PO7A 3I32A 6REQA 3R7LA 3HY4A 4JEMA 1PR6A 4G0VA 1FYFA 1RKXA 2HLHA 3CT4A 3OTOB 1E3JA 1M9NA 2YJGA 4ME6A 4D4HA 1E3QA 4PPYA 3KOXA 4MYCA 4JJ6A 1GGEA 1XCOA 1XZHA 2BELA 2XIJA 2Y0CA 3JD2A 3USCS 3TB6A 1IM5A 1UPFA 3HL0A 5AJVB 1ZJJA 3ZHQA 5CFLA 1VA5A 1XK7A 5KQSA 4RPCA 5G53C 3S1AA 3EXG2 4L9SA 1YBFA 2CDNA 2CFCA 2QRNA 1A96A 3JAWA 2RGUA 4TV9F 3LKZA 4MQFB 1NUPA 1VE1A 4OL9A 3PGJA 4MIKA 2NT3A 5T64A 2PGNA 1BN7A 1XZJA 2UDPA 4RV4A 4C7XA 1WMAA 1Z33A 3QV1A 3K6SB 4RD1A 5T5QA 2MCFA 1Q21A 1RLOA 4QWMA 4ACBA 5B2FA 1UINA 1RWWA 4BE7B 5A4MS 3ORQA 5DDIP 4QOIA 2ETVA 2PZAA 1EUCA 3RT1A 2JI6A 1TGVA 2DFNA 2Q1WA 5E4YA 2BE7A 2ANBA 1EE2A 1N3IA 1P7CA 1T5BA 3ZX5A 3HN7A 4I5EA 3KG2A 4QVKA 5EHGA 1Z0ZA 2Y92A 3D1LA 1A2OA 1HKUA 3BHJA 1ISJA 3HFRA 1NQAO 3NKFA 1WHTB 5ALZA 5JRZA 5LOVA 1JYFA 4B7AA 1N7GA 1NPTO 3RK1A 7MHTA 4YUAA 2JARA 1AT1A 1IBSA 1SUSA 2DT5A 2J5QA 2VKQA 1YH3A 3ASVA 4JOQA 4ZO4A 3LZ6A 5JZOA 2VH2A 2JA2A 2GM9A 1KMCA 3A1WA 3OCYA 3T8YA 3W5VA 5B2ZA 2QX8A 1W5SA 2A9VA 2X0RA 2YR0A 1I4EB 3GFGA 2IZ5A 1E0AA 1E1CA 2MSNA 4NWIA 1N33B 3PR1A 3AQ4A 3VDQA 3AVXA 2IV3A 4EX6A 1T2AA 5C32A 5HRAA 1RZ3A 5KTRA 1OHHD 2UUPA 5BSGA 2JJMA 2D2EA 1NLFA 4R3WA 1XU9A 3O2SB 3R3XA 3GJXC 1BDMA 1JT2A 1TW3A 1AY0A 1RQGA 2ZRIA 4NV0A 2W42A 2FN4A 3GHHA 1W0JA 3PFCA 3ZLBA 3QU9A 4H3VA 3PR2B 1TK3A 1EBFA 5DLEA 4EGAA 4OIFA 4BQPA 5IZCA 4HKTA 1P45A 4AFNA 3C6BA 4PW0A 1MC4A 3ETNA 5I9BA 1KPHA 1E9CA 1J23A 1UJ2A 3F6SA 5L6LB 1NRWA 5AJYA 2OVBA 1TOAA 4KNWA 4PZ9A 2R00A 1DBIA 5SZHB 4DLTA 3O2JA 1AQNA 4NYMR 2FSVC 2N42A 3JATA 5LBUA 3C8MA 4REQB 1Q0RA 5DPMA 1RSZA 1Y3IA 5FTKA 1GM5A 1SQFA 3L9WA 4EELA 1ZM7A 2NVOA 3IXLA 3KL2A 4M0FA 3IESA 3W2HA 4XW2A 4DCPA 1KJQA 3D43A 1DP4A 4YRKA 4WINA 3RJTA 4JYAB 5LIRA 1E6UA 1QAQA 3QX9A 5ANRB 3QH4A 3GWGA 4BB9A 2R2GA 4RJKA 1PDWA 4JKYA 2WICA 4PGGA 2GLUA 1K97A 4O63O 2XUIA 2Q4OA 5F2NA 1U2TA 3TQTA 3K0SA 2EAUA 4IRUB 4E4YA 1N75A 1TYCA 1XXLA 1VSBA 2WZDA 4MQFA 3S2EA 3I05A 1TT5A 2Y67A 4A26A 1YU9A 2QU8A 2ZIGA 3KJIA 3SMQA 2B8JA 3MAJA 1P2VA 1W46A 1NV9A 4LSZA 1YFJA 4J7UA 4KFSA 2I55A 2ZSAA 1NF9A 1Q2UA 2NGRA 4HBGA 3FFTA 3HBMA 4BNKA 5JBIA 1MOSA 2VUIB 3P26A 3PGMA 4CI9A 3K9BA 3MIIA 2FEMA 4MV0A 1RYEA 4EOGA 3WADA 3Q3JB 4P92A 3REQB 1I3MA 2PH5A 3SZOA 3FMIA 1WLSA 3QE3A 4R2HA 3GZTB 1Q22A 4J2OA 4BNWA 6GPBA 2OCPA 2AMVA 2C5GA 4OO3A 4P34A 4BMZA 4F71A 1H2BA 1Z6QA 4Y2QA 1M34E 2VK2A 2YASA 3D4LA 3CUTA 2HC9A 3HVKA 4MVJF 1C3JA 4FIDA 4Q3LA 1V4BA 2J0SA 1UBJS 2YMLA 2RB4A 2WLSA 4NMWA 4P9NA 3E7DA 5EVJA 2ZROA 5EP4A 4AJEA 4CU5A 5KJFA 3F5MA 3MJCA 5C80A 1U0BB 4DXDA 2IOFA 1V8BA 4UUQA 5JASA 1FFSA 3KHKA 1M8FA 2C2XA 2VXBA 1KORA 2QW0X 1NKVA 2XYPA 4G63A 3UYKA 1VKNA 1W30A 2PGDA 4Z1OA 3PJDA 5HJ5A 4ESVA 2FHSA 2BYTA 1GEEA 2OQVA 4DCCA 4F97A 1ENYA 1XTIA 2C59A 3GVXA 2DBQA 1IHOA 1QIJA 2XWSA 5FTMA 4NH0A 3TEJA 2RHTA 3RUAA 1P5ZB 1XI2A 5HGJA 4V2UA 3TFQA 1APBA 4KNVA 1BCSA 3TLAA 4YPOA 1MJHA 4MKGA 1NHWA 2QG9A 4TZTA 4KQGA 2IF0A 4LCJA 3ELBA 4KKXB 4U9UA 2FK7A 4KPYA 5BQ3A 4B7UA 3ZDXB 2XSZD 4X6LA 3Q8MA 2ATEA 5DLQC 2Z6UA 1ODIA 4FEGA 1CETA 4ARAA 3W7BA 1TO1E 1LBEA 1SY7A 1M83A 2C2BA 5I48A 1XFAA 1OX4A 5IC5A 4CLRA 2I80A 4KQ6A 1M1ZA 1NTRA 2ANCA 2NU7B 5GOTA 5GADl 3B51X 1V37A 1AH2A 1MX3A 4AO8A 1BHQ1 1EGAA 2QV7A 4PX3A 4DREA 2XEDA 5FOSA 4MSUA 5J40A 3Q72A 3RTGA 5H4HA 4CL0A 3IAM1 4W4TA 3V3KA 4ARIA 3NAQA 5A03A 4UTVA 1SBQA 1R18A 4HNTA 2XCRB 5M2QA 1U1EA 3KJHA 5A3JA 2XUKA 4UQOA 4G8CA 2M9MA 3PUIA 4KQFA 5T8KC 4BP8A 4O29A 2OOKA 1LDEA 1FYWA 5CTJA 4ARSA 4BUJA 1LZLA 1YS1X 3TECE 2FRDA 3MMPA 2WNHA 4I3HA 1W19A 3BWDD 1DIAA 2IXAA 2FZWA 4L5AA 2RAUA 1K68A 4JL5A 2QTAA 1JR2A 3Q0TA 1L3BA 3ZCUA 2DLCX 2Q5OA 1W0JD 1CTQA 2V03A 4J3NA 3BMOB 4I2NA 1TM1E 1DJOA 2QTWB 1XTJA 1KEWA 3DQPA 4XCVA 5DZSA 4NE2A 1QHIA 1YGYA 2O2HA 3CG4A 2G04A 4X97A 4Z0NA 3ZHOA 2GYVA 4EH1A 1QQ7A 1O8BA 3QE4A 4DCGA 4MRMA 1OX6A 2VFAA 1L7XA 4MYTA 2C5HA 1C81A 4QKQA 1EUDA 4RCZA 3MOIA 4TYMA 3IE1A 3OZSA 4H6VA 1KEZA 1MXFA 1V11A 1VCNA 1JUDA 1XZCA 3G0GA 1P72A 3MUOA 2IHJA 1G7RA 1GSOA 2VXYA 3F7NA 4XWAA 1UODA 2I4NA 2ZPAA 1E61A 5CJJA 4BRUA 4Z2AA 1IPEA 2IYXA 2QP9X 3FDZB 1NE2A 3KVVA 3TYXA 3F2VA 2EV9A 3GPCA 2DPGA 2Y1WA 4QE3A 1A72A 4TS4A 1US8A 5IT4A 1X1SA 2SCUA 1GNRA 4NPCA 5K51A 1KMHA 4Y6RA 4NOKA 5GP1A 1EX1A 3CE9A 5LP6B 1VG9B 5A05A 1FYEA 1U6JA 3NS7A 1I8TA 1T1IA 5K0NA 3VDMA 3ENWA 4J0CA 2J0UB 3FPHA 1X6VA 1GAWA 1Y48E 5KTOA 4Q1VA 1BMFD 3ZW9A 2A4KA 5LOVB 3CEMA 4D8TA 5EP3A 1TL7C 3ZE1B 1YB4A 2CWWA 2O8BB 1P6XA 3KWLA 4RANA 2F3QA 2BEWA 4D44A 5A1JA 3IEUA 3TBHA 1JXOA 1Q12A 1ZO8A 2JCVA 4OM7A 3RSQA 3SMVA 2BJWA 4DA4A 1XMOB 2BGGA 4H4EA 1P0PA 3T95A 2WKRA 2BSQA 1TEZA 1T2FA 2Y0BA 1B00A 1D6SA 1NPYA 3ON5A 4RHEA 4RVCA 5FP0A 5AW9A 1KY2A 3B5JA 3ZPXA 4GMHA 3ZJUA 2OLJA 4J2TA 2QYOA 2X5KO 2X0DA 4QA9A 3GEBA 1YJQA 2ZAYA 4QDJA 5LP6F 1WWKA 2OZVA 3PNVA 5A7FA 3VR2D 4NBVA 4F6LA 2ASVA 2GTHA 5C8YB 1Z26A 2N9UA 4AP5A 1D1PA 1G9SA 4FKMA 4Q6BA 4DYHA 4F60A 4RKYA 1BE8A 1G41A 2H92A 3HSKA 2PRZA 3N2YA 1X14A 3N2GA 5DULA 1J0EA 4OHBA 4RZIA 2FPPA 2NQ8A 2OM6A 4OM8A 4CDGA 1N36B 4NCHA 1CD5A 2QEQA 3QLUC 1EHYA 2BDEA 3UV6A 5CJ2A 4BMCA 4BX0A 1XEWX 1E7WA 3VC2A 2I3DA 2YXBA 5CT4A 2XKKA 1NXVA 1DBRA 2BGJA 3LO8A 3LUCA 4H18A 4OHKA 4WKOA 5DM2A 3THWB 3OUZA 2GO7A 4PO8A 5ESWA 4UFPA 4RKRA 3VPCA 3ADBA 2HJ9A 1ZXLA 3QBTA 3WL5A 3GLGA 4OJKA 4B4UA 2IYAA 2VYFA 3DLIA 4NYJR 3JWEA 4TRMA 1DAHA 5KHAA 1KO7A 1U28C 1BJKA 3PD7A 4HVAA 1UWVA 1O8CA 3ODGA 4FKZA 2UZ4A 1THZA 4P5PA 1M5TA 4RQAA 2HX1A 1V7PC 3HY6A 5KHOC 1L5OA 3LGAA 3Q41A 3QMMA 4N0MA 3KU4A 2Z0MA 3C15C 2XUDA 3DL7A 1YZNA 5DB4A 5L3QB 4P83A 1AF4A 1BS9A 3LWBA 1NYTA 4LJ9A 5DI9A 1DO2A 3EIXA 3OQIB 1AG9A 1ND5A 3DYIA 4MUBA 4RD6A 3MJSA 4RABA 4DAEA 5A5VA 3PQDA 3ZU3A 3ESBA 2H3EA 1EFKA 1KS2A 3X43A 2UXDB 3D6MA 3EPJA 2BZGA 4L3VA 1E1LA 3I58A 4PLZA 4AC9A 1TTTA 3K1YA 1VECA 3CLHA 3JQ9C 1KZ6A 2VK8A 3JQQA 4CKXA 1VL0A 2GBGA 2P5UA 4DJTA 4KU4A 1QIDA 4CI0B 1MVLA 5DTRA 5IKOA 1IJFA 2HBZA 1OREA 4O6VA 5TE9A 3P9IA 2XODA 1RFGE 2G82A 3HPQA 1NFRA 2WPDD 4WJLA 3QVOA 2Q5EA 3DA8A 4IS3A 4LX8A 5ES4B 4HWTA 3T7TA 2Q9BA 2AFIE 2ERCA 1F6DA 2F8SA 3W4IA 4M6WA 3W6UA 5JBQA 2HO4A 4IH9A 4M1QA 5JS2A 3NIFB 3EMDA 3WX0A 1HRKA 5BNTA 3CFYA 3K3PA 2I76A 5F9FA 4BCCA 2NU8B 3B12A 2P5YA 2QVLA 3VFDA 1VMIA 1W7AA 2HJWA 2QTTA 3L79A 3WRYC 4GWKA 1PLKA 4J75A 4V0OA 2O7RA 2QKYA 4XWKA 3LX6A 3FWYA 5LQJA 2C83A 1FLAA 2F3UA 4H2DA 1YJAA 1KXJA 1Z4IA 3Q7QA 2BEJA 4RPGA 4O02B 2ET6A 4DDWA 3HO1A 2F9MA 2P5SA 2F67A 4U7TB 3MINA 5FB3A 3B1FA 4HH1A 1IU9A 4CG2A 5M04A 2CL7X 1JKJA 2A84A 3WLJA 3LQFA 3FYTA 1MIOA 1GG5A 4BOYA 1I6MA 3E35A 3OM1A 4DFDA 3LXMA 2IZOA 1BX3A 1V7ZA 3OSUA 2XLBA 3IPCA 1YKFA 3IOBA 4Y2PA 6LDHA 3JD1A 1U3WA 1W4RA 4DLAA 1SKMA 1YBVA 4FMCB 4GKKB 3RSLA 1FZTA 3KC2A 5F76A 1FTNA 2NTJA 4OBBA 4N8EA 4MAFA 4KQXA 1KEVA 1T8TA 1B93A 1O6CA 2WD7A 3A4VA 4G25A 3EY9A 4HDAA 4HLQB 2PCJA 1HT3A 4HR7A 3L1VA 4MLDA 5AMXA 3T7EA 4F2PA 1OV6A 3PX3A 1UWLA 3ESZA 4KMSA 1ZYUA 1QCYA 4DMMA 4CFYA 3OAAD 4Y7CA 2GHRA 2GFIA 2DR3A 1YZQA 3E3NA 3QTBA 3EEQA 4M0LA 2A6PA 4M89A 5ALSA 4NXMB 4P36A 1OF1A 5B1EA 1O95A 1MB2A 2BKLA 2L19A 2GPWA 4RHCA 2ZK7A 4UXJA 4A0HA 2O52A 4X71A 2LCFA 2OUKA 1EVKA 1MNQA 4I2VA 4MKZA 4HUQA 4QGHA 2C4NA 2IBMA 4RJIA 3LPNA 2IEYA 4J4TA 4R1SA 1N9ZA 4F91B 3BRSA 1HFEL 1P4RA 3KYIB 2I4IA 1CB0A 4Z2YA 3FBTA 1T9BA 1VG8A 4QU0A 4Z9XA 1F5SA 1U7ZA 1HEYA 4KMRA 2PDAA 3DDOA 1V9LA 1B3RA 1MA3A 1XEAA 3H2ZA 3KLPX 4UD6A 4CVNA 1JHYA 5IKXA 3ZWWA 5ISMA 1GPBA 4MW7A 2VPIA 3LGSA 3PA8A 4M1EA 4B80A 3P2MA 4FKBA 2FSSA 2A67A 3B13B 4GM1A 4Q82A 1IHUA 1TXGA 4ND3A 2W2LD 3FNFA 8GPBA 4AKGA 2R1VA 2PH7A 1E0SA 4N3AA 4ENUA 2O8NA 5BVGB 5KKCA 1P1HA 1N25A 4TMYA 1JMYA 2P0YA 4FCCA 4XFDA 3HRIA 1EDEA 2FR1A 2VK1A 3IUNA 1KPGA 2W11A 1T2VA 3OZ7A 3GLIE 2NPFA 1NBMA 1YR6A 2R7MA 1BDHA 1RPTA 2Q6IA 3K70B 3FJ1A 1NVKA 1R0RE 3E9NA 4BKMA 3RVOA 5A3RA 2ZETA 5B55A 4ND5A 4TV8A 4EMUA 3CGGA 2WHRA 1E1NA 3BUSA 1Z88A 1UKCA 4W7SA 2X8BA 3LRXA 4U2CA 2QSZA 2XDQA 4G23A 3WDLA 1QG0A 4BNJA 1T29A 4MW5A 1FDTA 3A1TA 3OJ0A 4LC1A 4B9AA 2PR7A 3OO0A 4DARA 3UCFA 3ZZ0A 3AY7A 2V45A 2B2CA 3UG6A 1NVBA 1OAKA 2DHEA 1Z5ZA 4FDAA 1JDUA 4ZOLB 5L40A 3TNFA 5BSWA 3EIUA 5F73A 5AM3A 2G06A 4RVNA 5DHQA 2VNSA 2BWJA 3RU3A 1Q1ZA 3PF8A 2HIMA 4AT1A 2UVQA 4LHEA 5F5NA 2PLNA 4EVSA 2BM9A 3M5CA 4OGWA 1T2DA 3AILA 4U8GA 3WB2A 1NR7A 4R5MA 2NYVA 4EB6A 3FFWA 2R8OA 3O4HA 1CJCA 3I73A 3NV7A 4JCOA 3NBZC 4TWJA 2KSQA 5LVAA 5AI0A 3EZ7A 1D1SA 1PS8A 3RJ5A 2HDOA 2PU5A 4OXRA 4BEBA 3OOWA 4E3WA 3IQZA 2H4ZA 4IOJA 1YQEA 2BSXA 2DQKA 4HC4A 3WLIA 4MV6A 4D80A 4BC0A 5DNCA 4M0UA 1R8JA 3KB2A 4HEA1 1NUUA 3R40A 2C2HA 5BNIA 3GPBA 4GFDA 4UARA 4ZOEA 3BRCA 2GZHA 4Q4HB 1I51A 3WAGA 1FRNA 5DBIA 1QRAA 4WIAA 4U1RA 3FYUB 3AEZA 4CFSA 1WUYA 4PYIA 3DHWC 5D5QA 2G71A 2IUTA 1ML4A 3DV9A 3ZIAD 3PTAA 3PFHA 4K03A 1R4NA 2OYSA 3HN6A 1L4FA 4FW8A 3RW9A 3UJCA 3ZWVA 1I7QB 3IUPA 1VSQA 2QAGB 5AP9A 3LCUA 1PT7A 1XQ1A 4ND8A 1W96A 1JHUA 1FX1A 4V0ME 3AHDA 3C3YA 5PNTA 4C4OA 2GPSA 1XZAA 3EXHC 3F3KA 4TUYB 1KZ7B 2J48A 2HQBA 1SOVA 3DEFA 1XV5A 3QWHA 2FFQA 1NY6A 2KJQA 5F23A 1USKA 5THKA 2BM1A 3CX6A 3H4TA 2A86A 2WUVA 2H1LA 4D0GA 2CLIB 3BIOA 1IZYA 4ZJZA 4EGQA 5C46F 4F4JA 3EIQA 1MTOA 1OYOA 3DTVD 5GV7A 4BAGA 3I5YA 1Z06A 2QRVA 4R7ZA 5FV4A 3O1JC 3TZLA 1U8EA 4F6RA 1WUKS 4FI3F 1PLJA 1CF9A 3HJRA 4KDFA 4JH0A 4LOIA 2X6QA 4BMPB 2QZJA 4BQEA 4Z9YA 3AUYA 4YCNA 3JZDA 4LA4A 2BEUB 1KFBB 3TKLA 4BO7A 2FDXA 1P0QA 2VJBA 1SIOA 1D04A 2BW0A 1ZD5A 2O7QA 3IUJA 3UMFA 3P8ZA 1ZSYA 4XGNA 2UVPA 5IS2A 4HLUC 3VXKA 3ZCTA 2F1RA 1Q0ZA 3G8DA 3OTQA 3UB2A 4LKOA 4CNQA 3G49A 3LBAA 3IV6A 2ODNA 3R5KA 3CB4A 3LUBA 2O0HA 4UVEA 2BFBA 2UZ3A 1YZGA 2DPHA 3N7AA 4W9RA 4YJFB 5JXGA 1YZLA 3K16A 2FZGA 2Q3FA 1A77A 2I7VA 3AEQB 3W2IA 1SELA 2PO7A 4PTZA 1HSZA 4CEJB 5KNCA 5DFAA 1A1SA 2H00A 4EMBA 4TMZA 1Z6GA 2C0QA 1Z25A 3ZI4A 4BEVA 5K0GA 2XBLA 1ZS9A 2SKEA 4RH3A 1CUFA 1CZHA 5FWXB 1V5WA 3NWOA 4MKHA 4DJEC 3GGSA 3HU3A 2TS1A 1QV6A 3OJOA 4JQOA 4DNOA 1WEKA 3I45A 2DR2A 1S6YA 4DSAA 4XQ9A 4DB2A 3R6LA 1WO8A 5CD9A 4TV9B 2AMFA 3G59A 1OQAA 2O1XA 2B7BA 3P20A 1QANA 1FBTA 3ZZUA 4JZKA 3K6RA 2AHOA 1ZK0A 3CLTC 3PEUA 3QHPA 4IP0A 4Y3UA 1UDAA 3H5RA 3AF2A 3NAZA 3P9KA 5K4GA 3PNQA 1NSTA 3LXUX 3N75A 1WUTA 1NVAA 2P2GA 4P2GA 1MEOA 1U0EA 1DIRA 3LY7A 3BTOA 3GLFA 2JFFA 4G81A 2DQYA 2YJ3A 1GZ5A 3VSAA 4ACAA 3UNXA 3PQ8A 1SVOA 2GD0A 1MU0A 2I22A 5FPKA 3QGMA 3ZZMA 4YJHB 1CFZA 4IJVA 3U4DA 2X41A 2D6FA 2OHIA 3LX4A 2HB6A 3MTDA 4QL3A 1L5HB 1OXBB 1SAYA 3Q1LA 4HO1X 1K6EA 2PMEA 3I3OA 4LJ5A 2A0UA 4DG8A 1SXJB 4DV4B 4FM9A 1PBTA 1A9TA 3QF4B 1TMOA 1UBNA 2YDYA 1YCDA 2E49A 3I5MA 4FFSA 4HFRA 3GELA 1RPZA 1C0KA 3AK4A 4TYYA 4UE3S 2H9AA 4KGVA 2YW9A 3SHQA 1NXOA 3LWZA 2V7QA 3DBVO 1ML3A 4A6DA 4XQ0A 4A7PA 1E1KA 3L7KA 3GC6A 1BKYA 3EWAA 3DNPA 1LDBA 5YASA 1XQ9A 5KHLB 3ABOB 3KO8A 1UADA 3GNQA 2OO5A 1XXHB 4EK9A 2C7QA 2C9MA 1Q15A 5EXDA 1Y3BE 3QNWA 5FWYA 2NXCA 3JCZA 3VH2A 4U2DA 3DC2A 3BKXA 1AHNA 4OB8A 2YJZA 2QJOA 4OJQA 4DDVA 5TQ0A 3QTTA 2V5AA 4BUZA 4F85A 2A9KA 1VIDA 5C5CA 4C5CA 1Z6YA 1YAHA 2EBWA 4A6PA 4WKGA 4FGKA 2GZMA 4MUHA 1GZDA 3WJ2A 1SHTX 5ARBA 2CXXA 3E9CA 4N5IX 4CMIA 4HGNA 1W6UA 2PN1A 1IMOA 5A5EA 1LVHA 1CYDA 2WF8A 1ZLXA 3AW9A 4EF4A 5ALRA 3ANXA 1PDVA 4GGMX 4ZD6A 3AC0A 1THTA 3SXJA 3TCNA 4OIMA 2ZR9A 1I32A 1A82A 5C8DA 5CA0B 3ZWYA 1M2FA 5H0IA 3DGEC 1E79D 3JD3A 1KH2A 1JP7A 3A9SA 3AMVA 4CUJA 2PWBA 1H66A 3K71B 1AUVA 5E38A 2J4CA 3O2NA 4L4ZA 4PLTA 2CLDX 2XHEA 1KO4A 3SVZA 2NXWA 3NR2A 4RF4A 3EGVA 4ETWA 1W2GA 4U0KA 4TVSA 4GVPA 4GGPA 2VTDA 1MF7A 4BFTA 2A9FA 3RGGA 4CL3A 5AM4A 2WHQA 1PQ4A 2KBEA 2UYHA 4QO8A 5ER9A 2GT1A 2ZB8A 3EA5A 4QTXA 4Y6PA 3TL3A 2HWWA 1T6YA 1X7XB 4G1UC 1I4TD 1Z5PA 3QTLA 2WM2A 1GUYA 4OSOA 1PEYA 2W37A 4JENA 5G0TA 4IQ4A 5IVPA 3L0PA 2Y8EA 4HJXA 3EVBA 2A9RA 3A6LA 4C6HA 4DMLA 4XLTA 5DWQA 5JSUA 3O3MB 4DLSA 3LV8A 1Y7LA 4F4FA 3RHSA 5JNLA 1C7RA 2R5WA 3CF4A 3R1IA 4HATA 2I2WA 2YFYA 3OF5A 4L6AA 1U80A 3S7TA 1H2FA 1DQZA 3UKDA 5BWCA 3GEGA 4IVRA 1ZRMA 2JFXA 4G0ZA 4X63A 1L8XA 1HH4A 2QJWA 2EJVA 4DNXA 3SJBA 1Z37A 3SFTA 1LLCA 2AG1A 5KOHB 1B2RA 1QIIA 1QZZA 5JATA 1OWOA 1KZYC 2RH9B 4QHTA 5I9LA 4HDQB 2J31A 4KRFA 4I7EA 3U7RA 1NMQA 1VHDA 3QM1A 4TXHA 3K9FC 2RG7A 2C7VA 2YW2A 3C3BA 4CEHA 4IIBA 2VYQA 3C5WP 4ABTA 3DVSX 3WFZA 3G9TA 4JT2A 4L2IB 4ZT2A 1SC9A 2BBTA 1HL7A 1X3SA 4O2AB 3S7ZA 4BS9A 4W1SA 4LMRA 1ZKMA 2ZIUB 3I72A 4IEEA 4CR8A 1I2ZA 3CZRA 3SK0A 2FZLA 4IY1A 3HKEB 2ZUUA 3CQ9A 4OHRA 5CDGA 4WW0A 4B3RB 2VN8A 4L57A 2FQQA 4IDAA 2RHWA 1OMOA 2F48A 2IEDA 3ZDYB 2M32A 3TUZC 1NNLA 1QO9A 3KAKA 2QRMA 3THRA 2OSBA 2FN9A 1G4AE 2V6BA 3E5NA 4GBED 1JFTA 1G3QA 1G9TA 1GD1O 1UFRA 1ZESA 3DO8A 3F7MA 2HD4A 3N9IA 4CCWA 2C0PA 4PS0A 3PRKE 2AN4A 4KFCA 1HDCA 3ZQUA 3DPSA 3A3NA 1K7FB 4X61A 4ZCPA 5CR9A 2IYOA 3TLGB 1S8AA 2P6UA 1TD9A 1Z45A 2OHHA 3GLQA 3AY0A 4BO8A 2HQ1A 4PYNA 3OLWA 1QTQA 3EWNA 2RARA 3MJ4A 3LHKA 3BD7A 2C5LA 4DTCA 1WE2A 4R41A 4O33A 2P2LA 3ZDQA 3H5WA 3OPXA 2I3AA 1DI0A 3Q3IA 4MUYA 4URHA 2Q07A 4LJAA 4D4JA 3R3HA 4R6WA 4DLPA 1VMKA 3BSYA 3WXMA 5DGDA 4RD2A 3VR5D 3IUSA 1RVV1 1FDWA 3L82B 4F4IA 4B3TB 4ML3A 3BMNA 5ALUA 1Z0DA 2DT8A 4X95A 3MILA 5AKYA 1SULA 5CB4F 4C4TA 3H83A 2ADOA 4LJ4A 2Z58A 5I45A 5A04A 1GZVA 3GFSA 3W2EA 1Z8DA 1RR6A 4CW7A 4MDYA 3DB2A 4TKUA 4UDOA 4BX3A 4ENQA 1Y9JA 2QTBA 1TEHA 4OI1A 3VKGA 4E31A 5CIWA 4TVOA 3B6IA 3SJCA 3DLTA 5BVHB 2IHBA 1SGWA 1OKKD 1V7CA 1YJCA 4MLCA 2A57A 2NZWA 4R2MA 3W05A 2H4YA 4OATA 3HVIA 2VKTA 3IDQA 5DMXA 3GCGA 4EPXA 4FSDA 1GP2A 1SB8A 1YHNA 1D2CA 2YFQA 3GMDA 4AYXA 4WBNA 2D74A 2WMNB 1X9GA 3V55A 1GL3A 3VDNB 1ZA1A 5CB4B 2B1QA 3BG5A 3HCBA 3JS5A 1P9LA 5BSMA 1J0BA 2H2AA 2DPYA 1ZXBA 3M4NA 3P0JA 4IHKA 3NFYA 1USWA 3M4ZA 2ACKA 2PVCA 3D6TB 1CRPA 1EU1A 3BRQA 1SXJA 5ENVA 4CMEC 3VRHA 1BE0A 3LTEA 3TXXA 4CQMD 1U8TA 4RK4A 4IMPA 1RMQA 5ILQA 1WZEA 3U4QB 1QP8A 1Y5LA 1CBUA 4XYLA 4QARA 1KMHB 3HG7A 4IILA 2ZKLA 3TQHA 5A4AA 1T2NA 2Q0SA 1G291 1Y89A 3RYIA 3SBEA 5D6NA 3AOEC 4CTMA 1Z17A 1H6BA 1WHSB 2AZTA 4R1UA 4YFVA 1ULBA 3LVBA 3SSOA 4H6PA 5H9WA 3EQ7A 4FU0A 4LXGA 3T4UA 4ZQCB 1HQYE 1WW2A 3NOOA 3Q9SA 1NP3A 1QPBA 3AJEA 4PCUA 4XJVA 4AS2A 4UMEA 1YI1A 3EIFA 3B1KA 3K0HA 4LECA 4LTDA 2WAAA 1H94A 1IBLB 4JBWA 2WU8A 2IPLA 4FONA 5H1YA 1ICIA 4XB2A 1E6CA 1SXJD 4LV5B 2FFBA 1R0ZA 1E64A 4AF8A 1SQGA 2QMOA 1ZH4A 3LWNA 2JJYA 4MYRA 4DWJA 3M9XA 4NESA 5F3DA 4LBZA 3D8HA 4FYPA 1BC5A 1QIFA 1WMDA 1ZCJA 2C92A 2D8AA 3EVDA 3FTNA 3M6VA 3MLEA 5CYFA 3UWKA 3SIPA 3ZVMA 1FXWF 4LXIA 1PX2A 3S0JA 1P7ZA 1PJCA 4I1OA 4X93A 3ZTWA 2SBTA 3LRTA 1QZXA 3N76A 4HDMA 3ZX4A 3UWPA 3KQKA 3NJRA 3GRCA 1NVTA 3WK6A 3I64A 4HQRA 3WE7A 2B2NA 1W8IA 3FMOB 2HSWA 3T1QA 4KXMA 1MZVA 3BULA 3RIHA 1P0CA 3CN9A 3HB5X 4LWOA 3PFFA 1FDOA 4TKUB 2VSNA 4RZUA 3BK2A 4QDKA 2AN5A 1AVTA 4OYRA 3EVGA 1E9BA 2ZB7A 1KRHA 4MI6A 3T3HA 4XVUA 4AMVA 4EI7A 1D4AA 4FMCF 2JI8A 1QB8A 3FD8A 2J3IA 4IHJF 1CEXA 1MQ9A 5AVQA 4JD5A 1CCWA 1IXRC 1Y1SA 2GJKA 4K9SA 4BN0A 1JXMA 1IM2A 2BEVB 3LYUA 5JVDF 3ANTA 1H23A 3VAAA 1BEUB 1WXDA 5I9TA 1K7SN 2OBBA 1F2UB 3Q15C 4IYJA 4BZPA 4DT1B 1FX0B 3LP8A 1I1NA 3FI0A 5I01A 3N6VA 1KJNA 3UB3A 3VR6D 1Z39A 4N0DA 7REQA 5LIPA 3NFRA 5DP2A 3DJFA 3VBCA 2GVDC 2IK8A 4EPVA 4R3NA 4NZPA 2L82A 4BO6A 2II6A 2ORVA 3RM3A 3ZLJA 3B1YA 3A32A 4UEWA 2HA6A 4PSCA 3ES9A 3PV0A 5CJPA 5T3UA 1QX4A 5TB5A 1I3NA 4MVJI 4C9BA 1C8KA 4DDKA 4NBTA 4OJTA 3C85A 3GU3A 2HCTA 1E98A 1F2DA 3PYMA 5BRJA 5CFNA 2FWJA 1A9RA 3RYFA 3KM0A 3DYBA 4WZAA 2ZZNA 4Y8VA 4ZHQF 1LQTA 4JC8A 3ABRB 2LVBA 1MQAA 3UTCA 2WE7A 1E5VA 2PZMA 3RS9A 3RH0A 1V1MA 1UMDA 2XKJE 3VPXA 1G59A 3FTCA 4FHCA 4U4AA 1MNAA 2IZZA 4MCHA 3QA9A 4BCBA 2VDQB 1B42A 5K3CA 2RK6A 3HLTA 3KTAA 2C4TA 5GONB 2I34A 2DC1A 5EKTA 3TQQA 5BV8A 1M1UA 2JPDA 4X1KB 2H52A 3HDJA 2XCQA 4G0PA 1RXYA 4NVRA 3T7CA 2F9FA 5KYTA 5HIJA 3NHJA 1DLJA 4HAZA 4BKOA 2DAPA 2ZR7A 3CNQS 1F17A 2AOUA 1ODCA 3DC7A 3GJ7A 3RU7A 4ND1A 3CO5A 4IJMA 5AHOA 1N3LA 2DHQA 1WRBA 5DEOA 5K09A 3L4JA 4L51A 1M0EA 2I6FA 2IEZA 2HK6A 3Q9LA 2M6SA 4P81A 4EKGA 1K6MA 4C01A 2B7CA 5EMHA 4QQNA 4EAAA 1TA9A 5B3AA 2F1JA 4ZOBA 1YZVA 3O84A 2P65A 4IR7A 2J0QA 1T5LA 4NAUA 3HVRA 3QVTA 3JPYA 1DBWA 2GAIA 2JEOA 1V47A 3RAGA 4TQ9A 1XYGA 5MN6A 4XQCA 4U39A 1MPXA 1XZMA 2BGRA 1SK8A 1YA4A 4DG5A 1YDWA 2YC2C 3LCRA 5BYJA 1RQXA 3KQQA 1KF0A 2P7HA 3HUTA 3PDWA 2H4WA 4R3UC 3AV0B 2C1ZA 3CNOA 2EGGA 3GAZA 2HCFA 4MVCA 3QLUA 1VBKA 2ZJ0A 1ZJZA 2ZWOA 2A59A 4QLOA 2H2IA 1HA3A 2Q3DA 2I8AA 1T15A 2GEUA 3AETA 5AD1A 3SIXA 4L2IA 4MIOA 3FOFC 1NOIA 1W4BA 3AVPA 1GRRA 1DEXA 1T4CB 3LG2A 1GR0A 3FIUA 4NFYA 5EXTA 5LP1A 2VCEA 3EUFA 1A9PA 1Z15A 3GK3A 4F06A 3C7CB 3CUUA 1BXRA 3EDQA 4KPGA 5HNKA 4G8DA 4MA4A 3BWYA 2KS6A 2C29D 2QP3A 3WLKX 1FP2A 4YR7A 2JIBA 5DHAA 1ZN9A 1VIVA 4NDNE 5KOJB 1JLLB 2ZYHA 2J45A 4H60A 1CUHA 3OY7A 5DM1A 2XLCA 1WV0A 2W6ZA 5ECDA 1BWRA 2QN7A 4GKVA 2VP5A 4KXQA 4B73A 1J8DA 1TJ3A 3T3PB 1GL7A 2AWNA 3C8HA 4EI8A 3M4YA 4X84A 5HHTA 1E4YA 3QPWA 4EB0A 1NUHA 3LK6A 1XD2A 2PT7A 4F4DA 4ZDIA 4OQZA 1BHO1 1MXHA 2QUBA 4G65A 3VH4A 2J67A 1EUDB 4LQ4A 3V8VA 1JA1A 1PEAA 3HDGA 4DC1A 1M7HA 5A4DA 3BZUA 1QFYA 2OLKA 1CQZA 3C3WA 2DYKA 1BIFA 3GQVA 3LJKA 4JX8A 2VQ3A 3H2YA 1NKSA 2E18A 2EWVA 4WA7A 1JIQA 1NTOA 5EHQA 3SM9A 1DC4A 4B75A 1B0AA 4LYYA 4EB6B 2FPIB 3Q98A 1GGVA 2A0WA 3AM1A 2FLVA 4MX8A 5HYVA 2PS3A 3QEAZ 2OGWA 1NE7A 3AUSA 4R5HA 3GYGA 3M70A 4UZFA 4OL0A 3CUEF 4CR7A 4FFPA 4ZVKA 4ZV9A 2VHTA 1ACLA 3ADKA 3RFFA 5FI3A 4GUDA 2Y1DA 1QRDA 4I50A 5DCYA 4KR6A 3G3EA 5JSQA 4AG3A 3BHMA 4DQVA 4RHFA 2BDUA 4BXOB 3AUKA 3E3LA 2C5EA 3KK0A 4HYTA 4FGZA 4AKEA 1TAGA 3T3GA 1YDHA 2OHXA 3QYFA 2G63A 2O2XA 5AI6A 1IN8A 3DEAA 3FPLA 4ZAWA 2AOWA 2CVFA 4UHHA 4C7VA 2ERXA 4L0QA 3SWWA 1P18A 4KNYA 3DUFB 3E48A 2QT9A 1DEHA 2QE6A 3UW1A 5AOBA 1OWMA 4HPJB 5GQSA 1RYYA 4AG5A 5AM5A 3SQWA 1E2EA 1RYDA 4MGKR 2ZT5A 4ZIRA 4X90A 2IUYA 3S28A 2D8MA 4B71A 3N2GB 1VYTA 4JBXA 3R7FA 1JA9A 4I4TF 1I13A 1BXGB 3GFBA 4NCNA 4U9HS 1YRAA 5CBPB 1QQ6A 3JAWB 3ZNNA 5ESXA 4U6SA 3OURA 3DFMA 2X8WA 3TSWA 3ZQ6A 3PQ3A 4FHDA 2PPVA 1E2BA 4B3CA 1TPZA 2JKVA 3P9QA 3QKTA 5FOWA 1T4DA 1NBAA 2KBFA 3E7XA 1IVNA 2ZPUA 3PDIA 4O2RA 4DRZA 1KYYA 3KKQA 4KBGA 4YXFA 4L8GA 1E89A 2IOHA 3HHEA 6YASA 1PKXA 4TMXA 3NBXX 1KARA 1U3FA 4F3YA 5JVDA 4A2QA 3W06A 4DUPA 3FFXA 1G3IA 4MDFA 4DMUB 3KVRA 2J9YB 4TYQA 9MHTA 3FETA 5D00A 2GZ3A 3FVTA 1E2HA 2JAHA 1I10A 3ASYA 3A6EA 4NHOA 3BXZA 4M9ZA 1RXSA 4JLMA 1R6AA 2VP6A 4M6WB 5IJ9B 1U2PA 4E5NA 4KXFB 4ZVOA 5C1PA 3OY2A 2G1UA 2CJYA 1G6Q1 1H0SA 4G9BA 4P4UA 3F78A 3OQVA 2HQSA 1N77A 5CG1A 1PFGA 3GVPA 4CMHA 3EIOA 3WGZA 3BJIC 1Y9DA 1EQ2A 1R37A 2NXNA 2ZI4A 4NG5A 5TEVA 2J3MA 3EDCA 3H7IA 3FJOA 5IF9A 5M5BA 2JVKA 2QW8A 3ETLA 1MN6A 4TS1A 3HR7A 5A3SA 4RL6A 1L4NA 4OB7A 3LQRA 3K1AB 1T4BA 4PYLA 3GT0A 3NASA 4WY8A 4XDYA 2HDNB 1J06A 5E9QA 3IAFA 3TAHA 1KIMA 3CKLA 1H9CA 3WFJA 3MD0A 1E7YA 2D1SA 3IAAA 2IUUA 2XSZA 1YZ3A 5IX8A 1F0NA 1S3GA 3U0VA 1J49A 4NNOA 5B5SA 4EUFA 5IG2A 3A26A 4WCFA 2ARKA 4DGSA 3U4CA 4QU8A 2Z9DA 4WT7A 1H2AS 2C20A 3PB3A 3PNMA 4MR7B 4HXFB 1ZGGA 1V6AA 1Z8FA 1P9OA 2PQ0A 2REQB 2H0QA 3N2LA 2KM1A 3ZQ4A 4OLHA 5CHEA 5TSDA 3JY6A 5CMLA 5HFAA 5FHQA 1GGKA 1QO0A 1E59A 1AKMA 3HP1A 3W4JA 3TX2A 4D02A 5BR8B 5C5IA 4AY6A 1J20A 2IP2A 1Y9EA 3ST7A 1NGSA 5KQRA 1RHMA 1T8YA 5CD1A 4M8LA 1NMYA 5JSYA 3PGKA 1Z36A 1PHRA 3W8DA 4IBOA 4IQFA 2OMKA 4G0MA 5TIIA 3QUSA 1WDLA 3LVQE 1FXSA 2CV2A 4H0NA 3ZLTA 5BN1A 1K5GA 3HNPA 4MQLA 4OHXA 1QAMA 3AOEA 1K9VF 4ODIA 4UVHA 1XJWA 2WIGA 1P1RA 3PTLA 3A1DA 4BL5A 2C8LA 4W1PA 3ILXA 4MP8A 5CFRA 3MWDA 2WDPA 3NGMA 4MUXA 1NLZA 1E62A 3GUZA 1BE1A 3K6JA 4JGIA 2LIPA 4EA6A 1FUKA 1K08A 4WPGA 3RVJA 5KNDA 3OEHA 1QGUB 5B4VA 2I91A 2ZDQA 4P54A 2P6PA 1JHMA 3WOVA 3FKJA 2FR0A 2FSVA 2X1LA 3FPGA 5K3DA 4P38A 2FPGA 3PC8C 3LLSA 1REQB 2QNIA 3AKYA 3FYHA 3B6KA 1UMBB 3RYTC 2WJ4A 5GMOA 1I1HA 4V3BA 1KE1A 4G1MB 4CM8A 5MN4A 1ECBA 5H3CA 2P5TB 2QTFA 1SG0A 3TW8A 3OJEA 1HEIA 1NA5A 3FPBA 2XH8A 3G5MA 3AB7A 2XUQA 3LQ4A 2VDMB 4M1KA 4CQMA 4IH1A 4JI2B 1AMUA 3W78A 4WKNA 3AFHA 5KMGB 4HMQA 1AMNA 5GONA 3OZXA 1AKEA 1GUBA 5GINE 3SLGA 3GPDG 5BVGA 2Q6TA 4DR4B 2OZPA 3E2PA 4IX9A 4PC6A 3OU6A 3AU9A 2QM7A 2BI8A 3JQGA 4ZKEA 3VV2A 3HQ4O 1BRMA 1LJ8A 4AKTA 2NUBA 4FNGA 3HFGA 3BM5A 2I1WA 3E6AA 1U9CA 3JR3A 3A05A 3D6UA 1EP3B 2DR0A 3M2TA 1JKIA 5NLLA 2L2QA 4I9NA 1FP7A 3IVRA 3VU9A 4B3BA 5CA1A 3WMXA 4LFCB 2GK7A 2WFAA 4N3CA 4OGFA 1KEEA 2G6TA 3AP2A 1C1DA 1D2NA 1WB9A 3LPCA 2NSLA 4PZEA 2F7SA 1VLJA 3ZN2A 4U6NA 3ECSA 3B6ZA 3B7WA 4R0NA 4RVGA 1H85A 2L0XA 2QJRA 5H82A 4EYGA 3DAYA 2RHMA 4BV2A