2OWEA

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRMYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 62
structure length 170
sequence length 170
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2oweA00
1CVIA 5AK0A 3GP5A 2HIAA 1C81A 2P2ZA 3D6AA 3EZNA 1C80A 3MBKA 2P2YA 5AJWA 1YJXA 2BIFA 1IHPA 1EBBA 1V7QA 1E58A 1TIPA 1ND5A 1YFKA 3DB1A 3BIFA 4ARSA 3QPWA 2WNIA 2AXNA 5PGMA 1BQ4A 1H2FA 1DKPA 3NFYA 2DWOA 2P6OA 2H0QA 4EO9A 4MA4A 3E9CA 5CDHA 4TSRA 3NTLA 1FZTA 3ZHCA 1K6MA 3IT2A 3EOZA 3D8HA 1QWOA 5CX4A 3R7AA 4D4LA 2RFLA 1C7ZA 1QFXA 2EKZA 3IT3A 3C7TA 2OWDA 2P30A 4D4MA 4JOBA 4FDTA 1BIFA 3O0TA 2P75A 4ODIA 3F3KA 4GPZA 2P9YA 3K4QA 3OI7A 5HR5A 2H4ZA 4EMBA 4FDUA 2I1VB 4PZAA 4IJ5A 3QPUA 4AROA 4HBZA 1SKAA 2P77A 3KKKA 1UJCA 1ND6A 2EKBA 2F90A 4GPIB 1T8PA 1DKMA 3IT0A 3LL4A 2H4XA 3HJGA 3IT1A 1E59A 4IJ6A 2IKQA 3LG2A 3FDZB 2P79A 2DWPA 5AJXA 3GP3A 3GW8A 3F2IA 1RPTA 2P78A 2EOAA 1DKLA 2HHJA 3LNTA 3QPVA 1RPAA 1XQ9A 3FDZA 5CU7A 3K4PA 2A9JA 2WU0A 4PGMA 2A6PA 1DKOA 2ENWA 1DKNA 3D4IA 4ARUA 1SK9A 1NT4A 2GFIA 4QIHA 4D4JA 3DCYA 2WNHA 5AJVB 3MXOA 4D4KA 5HTKA 2QNIA 4PZ9A 3E9DA 1DKQA 4E3WA 2YN2A 1SK8A 1V37A 2H52A 2P9FA 1QHFA 3E9EA 2P9ZA 2ENUA 3PGMA 5AJZA 1H2EA 5AJYA 2PA0A 1BQ3A 2OWEA 2P6MA 1FBTA 2HPAA 4ARVA 4JOCA 2YN0A 3FJYA 1SKBA 1RIIA 4JODA 1UJBA
chains in the Genus database with same CATH superfamily
1V6SA 4BV9A 3S8EA 3HCFA 4PC6A 5GONA 3VU9A 1CY6A 4ZDKA 2AFHB 1YJXA 1YONA 3V8EA 3I1JA 3WP0A 4V03A 2BEJA 3UC9A 3KQKA 4L6IA 3V2HA 2MJLA 3F3YA 5BV0A 5GIPE 4C7MA 2Z0MA 3I6IA 1JEJA 1HT1E 2HMYB 2I2DA 3OZIA 4IOKA 4ZEOA 5JEDA 3FRIA 4DCSA 1FDRA 4GBGA 5LOVF 4GPTA 3LRTA 4V24A 1EB9A 1DC6A 2X5XA 3N75A 2QQGA 1Y48E 1UM9B 4DB2A 2Q3FA 5CFLA 1EFKA 1DDIA 3RTGA 4KJXA 2XOEA 1HPLA 3O8RA 1G55A 3NNDA 2B9VA 1XU9A 2IYYA 3ETGA 4IYJA 5JXIA 3FHJA 3KJHA 3L6DA 4FC6A 2IUYA 1Y6QA 3DKKA 4NICA 1V3QE 2PVSA 3EGDB 5IKOA 1W1WA 2DBRA 2PRZA 5I9MA 5TEWA 1HDXA 1SCJA 2ORVA 2Q50A 3F6BX 3FWHA 1WIWA 2D4HA 3M6UA 4G8BA 3RAGA 1UP4A 5DEIA 4IUBS 2A92A 4F3YA 2PN1A 5B37A 1XU4A 1WY5A 3B7GA 1W0JD 3U5ZB 2W5UA 1H8HA 4F5WA 2HBYA 4ZTBA 1DAHA 2BGNA 3C3JA 4IICA 5BNZA 1IWPB 3WG9A 2F48A 1DIAA 1G8JA 1Y7LA 2LDXA 3N39C 4UAJA 5M2QA 4KDRA 1Q95A 1B1AA 1Z29A 2ETVA 3PQEA 4YCDA 4NPAA 4NG4A 1LK0A 3EDCA 3QNUA 1SZDA 2EDAA 2I4RA 1U81A 1XCBA 2HWKA 3C8ZA 4X45A 2IUUA 5I4IA 4UEQA 3Q7SA 3DM5A 1W5EA 5AJXA 2H06A 4M83A 2YJ5A 4XJTA 1MRNA 1OLSB 2MYNA 3ITDA 2IOHA 2NZWA 1QVVA 2UV8A 3QXGA 5CEFA 5BQOA 3NEAA 3R3XA 4MVJA 4G1BA 1UPBA 1QK5A 4C87A 4K03A 3RUIA 3N2NA 3LNTA 2FR0A 1I3OA 3TZHA 3IL2A 1VXOA 4B9EA 1M2VA 2OB1A 2Q9CA 4GPAA 3OPMA 2NPOA 4IMJB 1B43A 3BWXA 2C2WA 2AMJA 4GO1A 2IYVA 4EHDA 3BKWA 3KYDB 3O47A 4UCFA 3QW2A 4HQLA 2NYAA 1WOMA 1LBSA 4KPFC 3FTDA 4IZHA 4X84A 2PUCA 3AEQB 1N7GA 4K8RB 1MN6A 4OP3A 5SZIA 1H1LB 4YRFA 1C4XA 2MWMA 3T0GA 1EDBA 1NI3A 1JU3A 5F1KA 4EW1A 1T6XA 2GHQA 1VMDA 3CUYA 3PRJA 4AO6A 3ELBA 2BW0A 1R0XA 3I2GA 1IOZA 1C9EA 1NV8A 2XBLA 3H4IA 2IOFK 3IPLA 5D51S 1AO3A 1L7RA 2FHPA 3AHFA 3LCVB 2Q4OA 4KDFA 2I4TA 1E6CA 3CZQA 4LYGA 1WB9A 2W6OA 5L7TA 2OP1A 4FGKA 4J16A 3WQBA 2QPAA 3LXXA 3WIOA 2IYEA 3A3KA 2QTFA 1SULA 2YN0A 1D09A 5A5GA 1SIOA 5HRCA 3EYWA 4NARA 4RD2A 5JH7B 2CLFB 4ESVA 4FJ1A 1CJTC 4JJ7A 4AJ1A 2J6HA 3MCZA 4FT4A 3OJXA 1UADA 3HCCA 1FTGA 2NUAA 1D1TA 3A6PC 3IV7A 4DYHA 3R8XA 5LP1A 4X60A 2AJLI 3DR3A 3BSSA 4EEZA 5IARA 1EE2A 1I3LA 2ZIWB 3PC4A 4KGVA 4MV0A 5CXXA 4EG6A 4YO8A 1GQFA 1TIPA 2I2FA 4S2UA 4M7OA 3ZHXA 5HGJA 5JY6A 3BJEA 5LA6F 4DR4B 2ONKA 5PGMA 3UHJA 4BPRA 3NBXX 1OFVA 1H0RA 2OVBA 4G9BA 3WLOA 2BFFB 5G4KA 4CR8A 5CVDA 1NOJA 1QO0D 1S8NA 4P53A 5CIYA 1NLUA 3GOHA 4X62B 2QBYA 1K86A 5CDHA 2XB6A 1NUPA 4Q00A 4WGFA 3Q40A 3R7WB 2GTIA 3UK7A 3ZOZA 1FFYA 1ZK3A 1U3WA 1RAHA 1Z4IA 3GL9A 1EVKA 3IT2A 3K30A 3ULKA 5F5XA 2I6FA 1XHLA 2PSJA 4HX2A 1KYVA 4KUGA 5B6JA 4JX9A 1KBOA 2W8BA 4TMTA 4FDVA 1SC9A 1AKEA 1DX9A 3I01A 2GN8A 2JPDA 2VCHA 2DQKA 1FVFA 1U65A 2CJWA 1FU8A 5DSXA 4RX1A 2WT8A 1X80A 2IXAA 4L8VA 2ZJOA 3LCMA 2PLAA 5NULA 2RGAA 2JJYA 1SCIA 2IK8A 3AOEC 3R8CA 5AW5A 2MINA 5JPCA 4KMMA 3DZDA 4L3OA 3KETA 2BFOA 1X13A 2ZR7A 3OFKA 3U3XA 2YFQA 4YRSA 3CUVA 4BO2A 4X65B 2Z6UA 2BV3A 2QP4A 3USES 4IMRA 1KF0A 2FRVA 3ICOA 4JROA 3HV0A 3INRA 1CB7A 1X1TA 4P4TA 3LC7O 5ER6A 5FOTA 5BO5A 2JLCA 4H0NA 2P1ZA 3FVRA 3WJ7A 3U80A 1JU4A 2Z8XA 4XCVA 1U7UA 1U1EA 3U5TA 2BPOA 3AEUA 4FGLA 3C43A 4G3XA 4HRXA 3A28A 2M6SA 4L78A 1MAVA 1Q7GA 3TM5A 1POXA 3I5XA 3ZD7A 1FUYB 1WZEA 3WNDA 4GXTA 1CZKA 2Q3BA 1BHO1 2EZ9A 4OL0A 3U62A 3KWFA 2BFAA 3VYSB 5IYZB 1R0BA 4R83A 2UVDA 4LBYA 3DC2A 2CLMB 1IHXA 4BX8A 3MQ2A 1SC1A 5DM1A 1O8BA 1OYOA 3WMGA 3ZY6A 1MO3A 2GN4A 1N9GA 4U7FA 2L19A 3ONDA 1BCRA 5CDSA 4KYIB 4O4IA 2C84A 3DT8A 4PZZA 4ZAGA 2Y93A 3NWEA 4LW8A 4MUFA 4NNJA 1PZGA 2VT2A 3I32A 1T2VA 4RYLA 1JEOA 4NJEA 4KE6A 2OE2A 3SFTA 4CV3A 4A6DA 1O8CA 2Z95A 4UDOA 5BW4A 2ZYIA 4K46A 4Z99A 1W4BA 1ZO8A 1A9SA 1YV9A 4LZNA 1IEWA 4I50A 2PGAA 1DTWA 2OD7A 4ZN6A 3ZVRA 1MOZA 5C5DA 1QVRA 1NZFA 1CZHA 2JD1A 3CR8A 2UZ4A 1LNQA 1HORA 1W9HA 1YKSA 3KKEA 4DBVO 3FJYA 1ZVMA 5A05A 4GQAA 4MVJE 2E48A 4DDVA 1UM8A 1RHQA 1U8CB 4GQBA 4DMGA 1XZPA 2RBGA 1ODLA 1Q7BA 3Q5GA 1OB5A 5B1DA 1KEZA 4LA4A 4B3BA 2GO7A 1XZAA 4G1MB 4Q37A 1C7IA 4QQFA 1SVSA 2VDRB 2VNIA 1FF9A 2W6IA 1XVTA 1UF9A 3DWIA 3WLSA 2HDOA 2O7VA 1JT9A 5EXXA 3EVNA 3UJ6A 1B6TA 4J0CA 4ER0A 1B42A 1C7RA 1XYGA 2IEGA 3FYUA 1ZUNB 1VFNA 1WD7A 1XG5A 2WZBA 4M9CA 5EJGA 1XTKA 1SXJA 2P2NA 1SB8A 3CLRD 3ID6C 4WNCA 3NTLA 1J99A 1SVMA 1TZCA 1QYVA 4OYRA 2YWHA 3CX7A 1JEQB 1YNOA 1FYEA 1Z13A 4IKEA 3IDSA 3H5LA 3GLVA 4HGQA 2YXBA 1Z5OA 3WMRA 5LLDA 3ZWKA 3B5IA 3HB1A 3BRWA 1SBTA 1IIBA 1NMQA 4GWGA 3ZKAA 2C0CA 3E7XA 3SDSA 4D6XA 3I9JA 4BEJA 2FPGB 4FYJA 4RPIA 5CX1A 1A9RA 1U6JA 1UWCA 2JLUA 1XNJA 2L0XA 2XHEA 3PEFA 3P2KA 4OBWA 1MNQA 1DE0A 1YZUA 1UEIA 3ED5A 3GUUA 1NWHA 1OOEA 2H18A 2HK8A 3EISA 1UJCA 1ZGJA 1D2NA 1TAHA 4WA8A 4XARA 1U1CA 1DX4A 4C76A 2WP0A 4J91A 1JPVA 1YRHA 4NSNA 2UAGA 3IP7A 1Z2DA 4RZUA 2NUTA 4X71A 1EH5A 1Z5ZA 1HMYA 2QJFA 3N6XA 4YAFA 4YT5A 4P9NA 4Z2AA 4DR3B 1HE8B 1DOZA 4RXTA 4TTIA 1EXDA 1P45A 4MQFA 5I5EA 1RNLA 3WIBA 1NKVA 4Z49A 2X86A 2EXXA 3D7LA 4BFSA 3MCWA 3W1EA 4QPCA 1H2ZA 2COUA 3LYHA 3FOAA 1L7DA 2HPVA 3LUBA 1YRYE 3OLXA 2HHJA 3MTBA 3DKVA 4J0DA 4YDRA 3WNQA 3A1TA 4R7TA 4ZJUA 4XQGA 3OPYB 2A9JA 3AETB 4HYQA 2VAXA 4JR0A 3SJUA 1JR3D 3UJDA 4AL4A 1DKNA 1YTLA 3QLUC 3COPA 1E1QA 4UM8B 3UBTA 3CMMA 4OJQA 3QOXA 2YMPA 3HPQA 1YZNA 5DVZA 2XD9A 1PWXA 2PV0A 1I1OA 5DI3B 5JXWA 2OXEA 3CB4A 1VHTA 1DBPA 3P27A 1OU0A 4E70A 4WLNA 5B58C 2PH1A 4KWEA 3WP1B 1DBIA 4L07A 4IJUA 3TSWA 2NZXA 3JSXA 4Y7CA 1FFBA 4I8DA 4EL5A 4MR8B 5EKXA 5A71A 1YJBA 1NYQA 1D0VA 1S8OA 2REXB 4Q4DA 1VC2A 4WH0A 3QWBA 1W75A 3NM6B 5AMXA 4KFSA 5GONB 3DEIA 4IIDA 3VU9B 3WB1A 3GJRA 2OPBA 3OTHA 4AMZA 4CFYA 4AP6A 3ABZA 5FDFA 3MWKA 2H4JA 2ZYVX 5IASA 4CN9A 4M7PA 1EWRA 3C3MA 2FFRA 1JRLA 2B8JA 1CE8A 2R8BA 4CRWB 5JAMA 1X3LA 2JBHA 1JHRA 1NBHA 3W77A 3BH0A 3SC2A 2NIPA 1C3EA 2NVBA 1UAAA 4JLAA 2FZVA 4TZTA 1AQ6A 1A3CA 2XSZA 4A1FA 3K1AA 2JCSA 3CTMA 3RVNA 3DDWA 3LQFA 3ROTA 3NCTA 5LQNA 2Q6VA 3NYQA 1USUA 2Q4TA 3HFJA 4R2XA 5IVHA 3VV3A 4QREA 2RJNA 4G5QA 2AXNA 4YJFA 3EVAA 3AKZA 3IX7A 1A50B 4IV0A 2ZYAA 3M9XA 3KTAA 3EEOA 4NBVA 1HGXA 4V0OA 4QUEA 4XGIA 2OZLB 3JAKA 4JN6B 1KI3A 5FPKA 5LFAA 2V0NA 4OUDA 3HVRA 1XXLA 4RTMA 4ENRA 4IIHA 2PH7A 2I29A 2G08A 3ZD6A 3F4LA 1Z45A 3MGBA 1O9HA 4MV5A 4Y2TA 5EL0A 5GZ1A 2EKDA 2JZCA 2X5JO 3PD1A 4O33A 2HBZA 1YVUA 1JA1A 2WHQA 1Z2OX 1P6UA 5CX4A 2O8BA 5MDHA 2CXTA 1DBWA 2ZI7A 3JR3A 3P9CA 2ODNA 3VO1A 2ATCA 2QMEA 4YMSA 2OZKA 4TSFA 4HDAA 3ETJA 4IJKA 2NP7A 3VKGA 4WXMA 1H4VB 2ZUTA 9ATCA 4WNIA 4FWTA 1NUTA 5E8RA 4KP7A 4G5FA 4YRRA 2BSXA 3ZJYA 4RC9A 3WNZA 3GHYA 3QLVC 1E4OA 1N92A 1M0SA 1RU3A 2HCFA 2XGMA 1JEEA 1V16A 4U7HA 4WCDA 1YTUA 1RFLA 2JLXA 2VF4X 1KIMA 3GRVA 1ONSA 5FULA 3T9DA 4LDRA 4PZLA 1PF7E 1ZAYA 1EVQA 4YA6A 4KI7A 2CLDX 2ZSUA 4X6XA 3OIVA 2JLYA 1CEEA 4BDSA 2GD6A 2I99A 4FFSA 2PGLA 5FUMA 3VV2A 3JZFA 1GL9B 4LE0A 2IKSA 4P81A 2M1XA 3BDVA 4NABA 3TLJA 1SXJE 1M2VB 4J9VA 1IEXA 4MCJA 4R81A 2BCEA 4TSKA 4WGGA 2IDKA 4DQVA 5I7FA 1KVUA 1XKLA 4XIIA 1XYVA 5B3JC 1NOIA 4PIMA 3ZTWA 5F98A 4FYKA 2R2AA 1HWYA 2AI3A 3K2BA 5FV7A 3VH4A 3VZQA 4DY4A 4FZ3A 4LHWA 5ES3A 5I01A 1VIMA 2RCNA 2QLLA 4LXYA 2BM8A 4EA9A 4OB7A 1VLHA 4JB0A 4C03A 1P7YA 4U4AA 3WRVA 1FLVA 1D7OA 5IJWA 3P5SA 4DFDA 2C9DA 2VQ6A 1XL1A 3H65A 2G5GX 1YE5A 3HM9A 2XEXA 3RU2A 5FT9A 1EWQA 5IF9A 1W36C 1E8NA 1QP8A 4HXYA 4PC2A 3NIGB 4DQ0A 3ADBA 5HRAA 4K05A 3NB0A 5GPBA 5KYVA 4DQDA 1Y4ZA 4JFRA 4EATA 6AT1A 1LTKA 4R4JA 2ODTX 5FYDA 3KPUA 1L1QA 4MGEA 2NUAB 4IEFB 4AN0A 1WCWA 3PDJA 2R60A 1MAAA 4B3FX 4ZO9A 5T6MA 1HDIA 3FX2A 4NBTA 2B3TA 1PJ4A 1YE3A 1G9XA 1XK7A 3K35A 2F67A 4EAAA 1E77A 1MF7A 2H3HA 1N2OA 2A2ZA 2WG0A 3AOEA 3GGSA 3HKEA 1P1BA 3TI9A 4MVJP 4XJXA 1BHSA 3ZZNA 3DLAA 1DEOA 4LF4B 5JFGA 1LXCA 4IXDA 1C81A 3U7GA 3B9BA 3CZ5A 1VI2A 3LM8A 5G4KB 5JE8A 2ZAYA 1OX6A 2JHPA 2JAUA 1JQKA 4C0BA 4CG1A 2QBYB 4N8SA 4UMEA 1RMQA 3P9KA 1KO7A 2BWJA 2AN4A 2KWIA 1BRMA 2VHWA 3DONA 4PCVA 4EB3A 1J21A 4QXQA 2OAEA 4L9RA 5F7ZA 1OGYA 3C3PA 3QEJA 2YVQA 4DXAA 4PQFA 1UT8A 4AAYA 3GZTB 4IDFA 4B6GA 1Y7HA 3K5IA 4FT2A 2C4MA 4N0EA 2ZBUA 2LIVA 3ILXA 1G5PA 3EGEA 3MWDA 4LRWA 3VR3A 2DTDA 2MSNA 2W8BB 4ND8A 3VNAA 4ZI7A 2BYTA 1ZRMA 2RK4A 2CMFA 4BGDA 1CZOA 5FOVA 4MQ5A 2FRDC 4JBIA 1Q7CA 3LVBA 1GN9A 2AOVA 3ESAA 2CJWB 2VDWA 2RGRA 4AY2A 3LK7A 1Z6XA 4UNRA 1X80B 1ZONA 3A6DA 1MBZA 2DKFA 3AKCA 4TL8A 2IWHA 1U3FA 1XO1A 2Y1OA 1T5HX 5A0FA 3PUWA 4UMDA 3EVTA 2JFZA 3W4KA 2MINB 3TDMA 5ITSA 2VPPA 4RZ3A 2V4MA 3NVAA 1E99A 2PQ2A 1JPJA 2Z98A 4OHWA 4KVAA 2RG1A 5IULC 1E2KA 1MO4A 3IQFA 4M89A 3RCBA 3K70D 2X9GA 3NQ41 1RWWA 1PL8A 1G38A 4ZKEA 1S9DA 1S8FA 1YZGA 2QRNA 2ZRHA 5K0LA 4QEZA 5KX5A 1H8EA 1BQEA 2BL4A 2CLEB 3JYQA 4TS4A 5HIIA 4R3NA 4B35A 1SBNE 4B31A 5KNCA 4AN1A 2ACKA 5TNXA 3AUJB 1CY4A 1IYZA 1IHUA 2A7QA 3AEUB 3GUHA 3M81A 3D6JA 1Z7YA 5HFNA 4I6GA 1N6KA 1RW4A 3DMNA 5I9LA 3E5MA 4BL5A 4DV0B 4KRXA 1WBBA 1ZMRA 4EPXA 3HR8A 2DG2A 5DF1A 2DBVO 3B8HA 4X7MA 1E2DA 4IDBA 2IP4A 1HTBA 3CCBA 1GUFA 4G1CA 4UOEA 2VF2A 4IH4A 3KHUA 1HFKA 4YV7A 3GRFA 1XZQA 1WXXA 2XTMA 4F97A 1GKUB 3P2JA 3G9UA 1NQWA 1RXIA 1ZOIA 3EUEA 3OBBA 2C4WA 2Y66A 1N9GB 5H7XA 1BCRB 1NW3A 4YJKA 1HE5A 5JNWA 3SJBA 1NNUA 4HPXB 5D86A 4XR9A 2VAMA 2V3VA 4J0EA 1B1CA 1E5VA 1OBVA 1ISHA 1RMTA 4D74A 4NJEB 1II9A 3A3OA 3Q7IA 4N5HX 4OHMA 5K3BA 4DVGA 4LQCA 3IEIA 1KPHA 4F9TA 3I5AA 1FX1A 4RF3A 2NSHA 3P0EA 2GCGA 5DGCA 1Q1GA 4HLCA 3SEAA 4DL9A 1WULS 1D6JA 2ZR8A 3K6SB 5A7GA 4I50B 1THTA 5DFAA 2PUJA 1NBMA 3RKRA 4OI0A 1E18A 1DTWB 1FMJA 2P7HA 2WG2A 3ER9A 4HXFB 4ABYA 3NVKI 3MXOA 3QVSA 2WSSA 2JATA 1GM5A 5B6PA 4OQMA 3OIUA 1UZNA 1V9SA 3K53A 3HCNA 4Z4GA 3IKVA 2Y1EA 3GJ4A 1PO7A 5TLSA 1ISFA 2XQGA 4MMZB 5TT0A 2O14A 4OGLA 3RWBA 4CKWA 1E6LA 4O4JF 4A6XA 3G68A 1I30A 4EGAA 1ZGGA 3IAM6 3RROA 2BZGA 3FVVA 3BHJA 3WLHA 3SM9A 4J1TA 2FZ5A 4M1SA 2IIQA 1EJBA 4NECA 5HG0A 3ZIUA 2HPAA 2B7BA 3FW1A 4BKQA 1P3DA 1CDOA 1C3XA 1ZMBA 2CHVA 2NZVG 3HJTA 2YMQA 4GPBA 5CDFA 1AKUA 3W2FA 1DWPA 1ADJA 3FSGD 4GOLD 4ZARA 3GP5A 3AIMA 2XVAA 3W3AD 3KR2A 2D2VA 4MR9B 4M0UA 4EJ2A 5CCBA 2VP9A 2C4UA 2JHGA 3FYUB 5BV1A 1XMJA 1NBOA 2J3HA 3ER8A 4KQGA 3LP5A 4F56A 3O95A 1PT7A 1XD2A 3KO8A 3PT9A 4XDHA 5I7OA 2AJ8A 1SXJB 4IP0A 2G9QA 1RXCA 4RQUA 3TTUA 3ZNNA 4MVWA 2VPTA 3L6CA 2JA2A 4UU8A 4CKCA 1ZHFA 3I4FA 2OQIA 1Q15A 3PUYA 4W1RA 1S2MA 1R2QA 1FUKA 4HNUA 3G0HA 1H2WA 3QI2A 3OZCA 1WVMA 2AV6A 3KTOA 4OSEA 1FU4A 3SZ3A 3VAAA 3SR3A 1ZCJA 3VPFA 4PPNA 1GLVA 3A4IA 3TQRA 1LJ8A 1G8MA 2DR0A 1PQUA 2P62A 3MJFA 3RF7A 4D43A 2JIBA 2AEFA 3QLUA 3ZY3A 2KE5A 2BE7A 2WSMA 5KJ6A 4IMPA 1FSFA 1NQVA 1ML4A 4QYXA 3BF8A 5CX1B 3V1MA 5HP4A 2QTCA 3DT9A 1LRJA 5LJLA 2R4UA 3VNRA 1ZJ4A 2GFQA 1ZN2A 2MMGA 1XWIA 3PFBA 4P4SB 3RU3A 1TX4B 1CP2A 4CL8A 2GJ4A 5CT6A 3HBJA 3D1JA 5EN4A 3U4HA 2W42A 1QCYA 3QF4A 4QUDA 1JBEA 3DWEX 1OZFA 3TPFA 3RIMA 2CV0A 2ZIVB 4RTLA 4LE1A 3GCGA 1HFJA 3DZ8A 3WICA 4CODB 3GEMA 4OFZA 3DF9A 4R2HA 3K2EA 2NUTB 4GW3A 5GGXA 2JGKA 2P9QA 1ILEA 1Z0IA 2OCGA 2QTBA 3E9ZA 4KLCA 3PXBA 4L76A 4K9NA 3RSLA 1TGVA 3RW9A 4US2R 4L9WA 1B6RA 1NSYA 4PNPA 1IN1A 4Q7KA 4MQFB 3ISVA 3RYTC 1D1QA 1K6JA 4ZVQA 1K7XB 1DU4A 4XYGA 3T52A 4KTVE 1VI6A 3NX4A 2H07A 3QWIA 1I3NA 3FMOB 3NJ4A 4QTXA 5LP6C 1EZ1A 4AW9A 1Y4AE 5B1YA 3MSXA 3A05A 2NNWB 3E35A 3FKSA 5KCZA 4HWOA 1L5SA 4JI1B 3GW8A 3HVJA 3AF3A 2YQ5A 1MV5A 5IM4A 1CF4A 3I52A 4I4TA 4MW7A 3BE5A 2GAJA 2GYYA 2VKTA 4ZCIA 1GRCA 1IB6A 5F4ZA 3TSYA 4FDLA 3DDOA 4NE7A 1Q12A 3CUTA 1RPAA 2FEOA 3OU2A 1BMFD 2QD2A 2IYNA 3R4CA 3BWBA 4FMPA 1O9BA 1P7CA 4IGKA 1OXXK 4J3JA 4UD2A 5AK6A 3TNDA 4BMNA 2BKLA 3HGMA 3ZNPA 4UBJA 1ZFNA 1EX6A 2B20A 1PN3A 2QD3A 2W6MA 5GP1A 1XLVA 3S2GA 3CVWA 4ARBA 3QJYA 4B4OA 3O91A 3I9KA 2O6HA 2A8YA 4KR3A 1C1YA 3M6IA 2AI1A 5CNIA 4ID9A 4H7JA 5FYQA 5EESA 3G49A 5P21A 5SZHB 3I8SA 1ZDMA 1CE8B 3C1AA 4LWPA 2P4QA 1SU6A 3BWDD 2GHIA 1JDZA 1C50A 1JB1A 4X93A 5CH8A 5B2ZA 4BASA 5GTDA 5LMCA 4CG2A 4FR2A 3RR2A 2O54A 4TMZA 3GGOA 1MXHA 1SBHA 2Y68A 3SC2B 4NMLA 1KARA 2VRCD 3FPKA 3I42A 2GQ0A 1TAQA 1A97A 2XD4A 4PPGA 5HBRA 4ZK2A 3K1AB 1YE8A 1JQEA 3T1NA 2X19A 5EUBA 4KQMA 5BSGA 2TRSB 5DYNA 4YS6A 2WKWA 4LV5B 4YJFB 5CCEA 3ZY4A 5KYGA 2A0XA 2POCA 3U4MA 1SD2A 4L0CA 3ZH2A 3KTAB 5KTMA 5HX7A 2PL9A 1G66A 2Q1UA 4BLTA 1GG9A 4UJ3A 1ZOOA 3JAKB 2DP4E 4GBED 4MQLA 1JG6A 1WS6A 1YMUA 2E6KA 2VFAA 1E58A 3EA0A 3BRCA 3MTQA 1UCFA 1RAGA 4OUDB 4PS1A 3RO7A 3SYMA 3TBHA 1NBME 1I7LA 1G2OA 2ZB8A 3N2LA 4FBLA 2ECOA 5FFMA 1C2YA 4AZVA 2A3NA 2ZS9A 3B82A 3AG6A 2RGCA 2XMRA 3AVTA 1I4EB 3FAZA 1LEHA 3M3HA 4EO9A 1XCGB 4EUFA 2O8BB 2O2JA 3EC7A 1F51E 1KMHA 4GRAA 5A7FA 3KLBA 1PR5A 5KEIA 3S29A 1ZD5A 2O48X 2E55A 1JFFA 4OQXA 4W6ZA 5TMBA 4AS1A 3FOWA 3HDTA 3KLNA 1JWLA 4DCNA 1FZTA 3WE7A 2YNMD 4UFOA 3ZY2A 1YI1A 2OXIA 3OQJA 2JHAA 2CYCA 1ICEA 5IKMA 1VA5A 3SPXA 5IVKA 4G81A 3L04A 3C7TA 4MV6A 1NW7A 1V16B 2GZ1A 1Y3AA 3PNLA 1Z4LA 5CDFE 5JJIA 5CGZA 5JSYA 4X9XA 3LPCA 3QBVA 3SQDA 3DCIA 3RS9A 8AT1A 3JZAA 1HQKA 4LQDA 4M9ZA 3W04A 4CNQA 2PM8A 2F3SA 2QMYA 3LV8A 1V3VA 2LW7A 2VG8A 3H8JA 2B61A 5IF3A 3DDSA 4RUKA 2XRYA 4N0DA 1MO5A 3VH3A 3GPCA 1A98A 1KS2A 5T41A 2HN9A 1SD5A 3SVLA 4AJHA 1I9CA 4O29A 1CUWA 3ZDQA 4ATNA 3H1BA 1UXJA 3I5UA 3KKPA 4GZ5A 2FN7A 4UBMA 4A27A 3QU5A 3GNTA 5JTTA 3OCCA 2OUKA 4DCOA 1MFPA 2Q3EA 3VISA 4RW0A 1KR5A 4PRKA 3D0QA 3EVBA 2R86A 1JKFA 1KQ3A 4JB8A 4MKXA 1B2RA 5E1BA 2OBBA 2X2PA 4Q4LA 1W0JA 2V3WA 4UKDA 3HL4A 4A73A 5K6TA 1JG1A 1IMOA 3FDZA 4JBXA 3R75A 2X1MA 3TGPA 4K6KA 1N57A 2AFVA 3EJWA 3GUCA 4ZAWA 2IYQA 2VYCA 1DCTA 3C5WP 3OETA 1QZTA 3A3PA 3H9BA 4ZGWA 2NZ2A 4C2UA 1K6XA 1SUEA 2ZI3A 4AN4A 3IPXA 4PZCA 1WSAA 3PVCA 3B1JA 1Z5UA 3C2QA 4L08A 5TB5A 1DX6A 4EG1A 2QVGA 5CFMA 5K4GA 2BEVA 2XVZA 5J5VA 1U8XX 1UJ5A 4PIPA 3HKEB 1Z88A 1QQTA 4NY1A 5HFJA 1EWTA 2W2OA 3OM9A 3T94A 5KDLA 3OPNA 2SCUA 3F5MA 2OYCA 1E5QA 2IYPA 3ABQB 4IJWA 2B4KA 1FTSA 1VYVA 4JKYA 5KOJA 1AMNA 1RBZA 4IINA 4LWOA 2XNKA 1PKEA 3H4MA 3N0TA 2XTNA 3UV3A 3QM1A 1BSVA 4TTJA 3NH9A 4GRDA 3LHKA 4XI9A 4F1WA 1FS6A 3OIDA 4EFMA 1QC5A 5H0IA 1KI7A 1BA2A 3NC1C 3V6LA 3SIWA 3WI7A 1TJNA 3VR6D 3C4VA 1GKKA 5K0ZA 1YZVA 10MHA 3MWDB 2GK4A 4AG6A 1FNMA 4BLQA 4ND8B 3HA5A 4ZJZA 3U48A 5BWMA 3RUDA 5JDIA 2Y92A 1ZN8A 2PYIA 1YA6A 1G9TA 2VDWB 3UW3A 1W73A 1GRNA 1KXZA 3U4AA 2B21A 3H5WA 1T15A 2PKYX 3MMXA 3R44A 2P67A 1CZLA 2ZJYA 1T43A 4M1EA 1R0CA 3LC0A 4NQRA 3P5BA 3HCPA 3CPEA 4OHKA 2XLBA 1R9GA 2RGUA 4L9AA 1SM4A 2JHFA 3SLGA 3TG8A 2VSOA 1ZRHA 1NR1A 2ZROA 1T3TA 4IQFA 1NJ2A 4Q3DA 3U19A 2O52A 2APJA 3E9YA 4KR6A 3LUAA 3COVA 1TZ2A 4CEJA 1A4RA 4IGFA 3PG5A 5KX5B 1IL0A 3EB9A 4QYIA 4PO1A 4DDTA 4JOBA 2CLLB 4B3GA 1OKKD 4JD5A 3X2SA 2GZRA 2RGBA 2YBDA 4CTOA 5BXQC 1AQIA 2P3OA 4EOGA 1Y3HA 2QN1A 4REMA 5CDUA 2FEPA 2O1EA 3COYA 1TLFA 2GBGA 3WFIA 4HB3A 2VQDA 4II2A 2IU6A 1GSHA 3DZFA 1M7HA 3E3OA 1JFSA 2ZCJA 1KHTA 4HDMB 5F2EA 4QUHA 1VJTA 1X1BA 1D2RA 2OCLA 1QO0A 2ZI4A 5T3YA 1NX9A 3BXGA 4KO8A 4QDTA 2JIOA 5EIBD 2AVDA 4HLUA 1GGNA 3HB9A 2PO5A 3EA4A 4ITUA 2WHXA 3UCXA 3A27A 5K5EA 3LI2A 2G82A 2H2IA 3DB2A 3HM2A 1NWCA 1ICIA 1BFKA 3LAWA 1YUNA 4Q1EA 4BKRA 1QS0B 2W70A 3AR2A 3D5EA 1OLUA 5CNJA 3V55A 3QFSA 4HFNA 5HKOA 5BR8B 1OUMA 4KODA 2VNJA 1FBNA 5D85A 4AYWA 4CMIA 5K8CA 4GPEA 4CMCA 1K8QA 5AKYA 2R7KA 3PDWA 5ECWA 3P2EA 1AV7A 1ZUIA 5FPQA 3W4IA 4AX4A 4YRKA 2G6TA 2AZXA 1R8SA 1B8PA 1C2TA 1KJZA 4MULA 1PBNA 4DSZA 1GNPA 2HDNB 3OFJA 4L7QA 4F3RA 2YJNA 3VJKA 4Z2YA 1U0SY 4ENSA 2B7LA 4IG4A 1WB5A 4MYHA 3L4SO 2J32A 3K0FA 4LF8B 2IXGA 2DBQA 4BFWA 3A1NA 4NENA 4YX9A 1TM5E 2ZWAA 3F7TA 1KC1A 2PT5A 1JLMA 2QJTA 3MBOA 1H6BA 1X2BA 2HRZA 1J24A 1N0WA 1F4PA 2GNAA 2FNAA 5FWDA 1GKYA 3RASA 1MO2A 4YY3B 4YQFA 4Y30A 3CF2A 1CQIA 4LHEA 4DLTA 4M6WA 4YJHA 5HF9A 3TPZA 4F5ZA 1HLPA 3PL5A 2G40A 2YZNA 1QE5A 4YAUA 1XD2B 4ZV7A 1OTYA 1QTNA 3TOXA 1G8FA 2V5UA 5IZ4A 3K0SA 3KHTA 4PYLA 1G16A 2IW3A 1G3RA 4LZOA 2FZGA 4N12A 3VYVA 4CKCB 2A35A 2BDUA 2JEOA 2XCUA 1TMOA 2ATXA 3BPSA 1HOXA 3DV0A 4JS0A 4AJJA 5LP6A 4RELA 4EPWA 5SZJA 3TW6A 4HGRA 4NZPA 1LQ2A 5DEOA 1MA3A 2I9PA 2HSJA 3BAZA 1N1DA 3I28A 5JNLA 4TM8A 4DCGA 1M7GA 1JFVA 3EZ2A 3AJEA 5ER9A 1ZEMA 2NP6A 2AH5A 3H5OA 1GTJ1 2ARKA 3NXKA 3L3BA 1W5BA 1MJHA 4XJVA 2AOUA 3EYAA 1GAQA 4MVJM 1IAQA 2CEKA 2DZDA 4EY4A 4YAWA 1N4AA 3LH5A 1K0UA 2PIAA 1DAIA 1FDIA 2WM9B 1AO0A 3QF4B 2D2XA 4MIKA 3ZCUA 4J9UE 5F2OA 1RE1A 3B6MA 2VQ3A 3O7MA 5EKDA 1OIWA 1OF1A 1QK3A 4NFLA 4LSWA 5BYKA 3ST7A 3D2CA 1EJ6A 5D6NA 1PQ4A 1A9ZA 4G23A 4UUPA 4K6FA 4R84A 4XX0A 4JP1A 1HYEA 1N5MA 1FQKA 4HLDA 1PWZA 1EA5A 4GMFA 4C2TA 3KTFA 3G5LA 3E9QA 3RV4A 1E3MA 3FDIA 4JA2A 2HK7A 2V4UA 2NPFA 1ZKMA 4ETNA 4HB0A 1HRDA 3IBFA 4IWNA 3BB1A 4LGCA 2RI0A 2ISQA 2YN4A 1U28A 1LTQA 4BOYA 3IA7A 3VHQA 2BJWA 3MJEA 4I4TB 1JJFA 3GJ0A 3SBXA 4ZI3A 3WJAA 1JECA 4Y6LA 4MRMA 4TKUA 2HJ9A 1YHYA 5A4DA 2CL5A 4QGAA 5JISA 1U90A 1ZKDA 2XXJA 1I9GA 2YRFA 3KUKA 4QYTA 1U0OC 3GFBA 3N07A 2C5GA 4M38A 2DUUA 4F0JA 3NYWA 3KB1A 3AKEA 4KX5A 3DOOA 2GBIA 4AMUA 1W87A 4MJLA 4QOIA 4D3ZA 3ILVA 1CUXA 2A67A 4RK6A 4A7PA 5JYBA 4BXOA 2B37A 3W78A 3WNVA 2JIQA 4AKEA 1N5IA 3W1WA 1QGZA 5KC9A 2UYQA 3FUVA 3OMWA 1PFKA 4Q7EA 2D74A 4BNVA 3R3VA 5HE8A 3PGA1 4B3JA 5HKKD 1NATA 3EG9A 1JI0A 1V4VA 2H65A 1I0LA 4K6OA 2C9BA 1UZLA 3R24A 4FE4A 3F46A 1LRKA 2FJ0A 5JASA 1E5LA 4E07A 1FX0A 5IJZA 3FPEA 1FFAA 3KB6A 1Q1AA 1HT0A 3G1TA 3SEQA 4G07A 1SMKA 3AXTA 5AKGA 1SK8A 3BT7A 3TTVA 2OM2A 3NBAA 3I01M 4CTMA 4E15A 1RHMA 3KVNA 4MOWA 4IEIA 2CB9A 4M9UA 4YREA 1U1DA 2WUFA 4JJKA 4BDTA 4YIHA 3TM4A 1P17A 3OQ1A 4ACAA 3NRCA 3QFHA 1JR3A 3O3OB 2ZSDA 2GVDC 4L0DA 4IS2A 1PGJA 2ON6A 2PR7A 4C3VA 3FYTA 2VJKA 5KQPA 1C5KA 2BIFA 2IE0A 2DWUA 2HFKA 3PHJA 1YBVA 1KMHB 1EK1A 2RH8A 3ZHQA 2N1BA 2ATEA 3AHJA 1Q50A 2BEUA 5FOQA 2IITA 1JFFB 1E9BA 2HA5A 4W7SA 1QRRA 5A2GA 5LNK6 2EFGA 4B0OA 3PLNA 1BQ4A 2DOKA 2G1KA 1O5TA 4HQKA 5FNVF 1EA7A 2BEKA 2J1LA 1UOOA 1ZVKA 2JFBA 2RAVA 1AGRA 1I4LD 2I8CA 3AFNA 3JQDA 4BNXA 4IH1A 5JCXA 1SHUX 1E1MA 1PJSA 2BCGY 4XUCA 3HUTA 4H3HB 5IRCD 2P3LA 4RWEA 2UXBB 5UKDA 3WYFA 5DGXA 3DR5A 1W36B 4G0VA 3VTZA 4BU0A 5EQJB 4DIMA 2GRUA 2QY6A 4QBGB 2XVMA 2I3AA 5A03A 1E61A 1M0WA 2WD8A 3BTSA 2HO5A 3CX3A 1C7ZA 1SQ0A 1HDCA 4H1HA 4WLEA 4YMIA 2R8ZA 1R3DA 5AVJA 2PK3A 5TVGA 4G6ZA 1MB4A 2PGXA 2RHWA 3E2MA 4YASA 3IUEA 1S5PA 2ZIXA 3EXHC 3O8NA 1TVEA 5I45A 2EFDB 3IE1A 3AOGA 3NGLA 5JSQA 3IJ5A 2JGFA 4IIBA 4AZWA 3FIUA 4L57A 2CSXA 2PEZA 3G17A 3I12A 1CX9B 4KO3S 2I54A 4ZYTA 4BRSA 4WESA 2VPYA 4XA8A 1J2JA 1Z38A 3GVPA 3RVLA 1Y37A 3IVCA 4RANA 3V42A 2CNKA 3KKKA 3ZG6A 2AR9A 2UKDA 3W8RA 3HCAA 2O2GA 4BFZA 3WRXA 1UBLS 4E46A 3GVCA 5AXBA 1X1DA 3OA0A 4HUTA 3LE8A 3BB4A 3MTEA 1ZJ6A 2X58A 4LJYA 3P2MA 3FDZB 3LK6A 4G65A 3HLYA 3PD7A 1II8A 1KK2A 4MQ4A 1PWEA 4R1QA 1CYEA 2XNDD 3GCWA 4KIFA 4Q4AA 1RKXA 1TW3A 4GDFA 4J0KA 4G41A 1CUCA 8GPBA 3AH8A 2YX1A 4KQXA 3O03A 4WDQA 4DHWA 2H92A 1PIWA 2QVXX 4IWXA 2MCFA 2JA1A 4GYYA 5CH5A 5CH3A 3AR9A 3BJRA 2DXIA 3DZCA 1SQGA 3FTQA 2FXVA 4JYBA 4C6RA 2GXAA 3F47A 3S7ZA 2A4MA 4XQEA 4AICA 2BEVB 1TM4E 4JSYA 1Z3CA 4RD4A 1OT3A 2BSAA 5KVAA 1ZNXA 2D0IA 2FZ4A 2YZMA 1XMQB 4LJ9A 4ZMRA 3RTBA 1F7VA 5JCJD 2IYWA 4BC0A 1HMPA 4P3PA 3TD2A 5DWDA 2LE0A 2SCUB 4D26A 1ONNA 4PSUA 2XJ9A 4LMRA 1E3SA 4F2GA 3KQWA 5FLEX 4E51A 4MSUA 5KOJB 2OCDA 4LJ6A 2J0VA 3FMIA 4DA7A 1YWGO 3HDGA 3ADPA 2WJ4A 3NGMA 5J4HA 1BCSA 3W9SA 3DFZA 1XZ8A 3KAJA 3MT0A 1KZ7B 1S3FA 4IPTA 4UTVA 2I22A 1QC5B 3QVUA 4CF3A 3F8WA 5IKXA 2VCEA 1GPMA 2HJGA 1QLHA 1MPXA 3CJRA 2XODA 3KZMA 4FFPA 4PXSA 3LVRE 1E1KA 3RU9A 4PQEA 3OTWA 4OXKA 1IPHA 1Z4QA 2D5LA 1GITA 5LQRA 1KYTA 3ZPXA 5KU1A 2PZMA 3OLWA 5E2IA 2ZBEA 1Y4UA 3GK3A 2Z43A 3ETCA 1G2PA 4HO1X 2TMGA 4IXTA 4BPBA 3CH6A 3OJCA 3Q7RA 5JS2A 1UKAA 5FI5A 5I7VA 2Q4DA 1P2TA 1URPA 3ONVA 2WWVD 1M1YA 3MAGA 3VR5D 2XCIA 1RJGA 5JVDA 4RZXA 3L07A 4PYJA 5SY9A 5AVYA 2XI4A 3BIFA 1NAHA 1M83A 3PSAA 3V1KA 5KNDD 5DYWA 1L5KA 1VRWA 2AJDA 3ZY5A 5JU6A 4LXHA 4CEJB 1EWVA 2D1QA 2J7PD 3L7IA 3O9ZA 2CDBA 4ZOBA 2GPSA 1ZQ1A 2XJ4A 2VDUE 5E9JA 5EYPA 4QYIB 5FHQA 2JAQA 3B5JA 1ZHOA 1YGYA 3K5WA 4B43A 221PA 2GM3A 3T7DA 2ZBQA 1O77A 1U9ZA 1ZW1A 1O03A 3R7BA 1IBSA 3S7TA 3AY6A 1JKJA 2F00A 2L17A 2Q1WA 3QKUA 1AY0A 2R00C 4K9KA 4DPLA 4KQ9A 3ISJA 4JITA 2O3SA 2FQWA 4L4YA 3WO1A 2ZATA 2MR6A 2F59A 1JR3E 2ZT5A 4ZI5A 1HDRA 1RRCA 5H82A 5YASA 1FSGA 1FB5A 4PGAA 3D5QA 4UM7A 4UMFA 3UJ8A 4C3UA 4DC1A 2PBZA 1PUXA 2OO5A 1PVOA 4MI3A 1W4CA 4Q39A 2WWGA 4IH9A 5K7SA 1R4MA 3EVCA 1AV6A 4EJMA 2V7TA 1EJ0A 1OLUB 3M6WA 1LNSA 2B34A 1UFKA 4BP1A 5EVCA 1XF9A 4TKZA 4B82A 2Z3WA 5BQPA 4MAAA 5TEVA 4CMIB 2I65A 2JGJA 4PZDA 4V0LA 4KR2A 3DE6X 1P9WA 4PIVA 3DL2A 4F7DA 4PHGA 4X6LA 3V8RA 1Q19A 5KYXA 1NIJA 4GOXA 1GZ6A 5DN6A 1PGPA 2FA9A 4E3ZA 4K26A 4KXVA 1U2DA 4LZWA 1SVIA 2ZP1A 4QG7A 3WSWA 4GE3A 5EPUA 3T99A 2MMCA 3G9QA 1WBJB 2N0SA 3GPBA 1UBHS 1HZJA 3FETA 3IAUA 3OZUA 3K0FB 1HY3A 3PGLA 2Q5QA 2FPKA 4NU6A 5IHXA 4NENB 1DKRA 3WX0A 1DOAA 1HQYE 2K2QB 3D6VA 5I7EA 3N8DA 4D3FA 3QWFA 4YPVA 1L7MA 1EVJA 2JVKA 3EH2A 3L4BC 5KKCA 2OMEA 5AKLA 5BW6B 5LPNA 3O8CA 2QZZA 1Z8DA 2WSBA 4WJLA 1ZQ9A 4J7CA 1CQIB 1Z7WA 3UJAA 3A1UA 1C9YA 4IDOA 4M6WB 5CDTA 4N0QA 4KVZA 2JLVA 4YJHB 4D4GA 2EGUA 3K6RA 3N0RA 4HEA1 2VXYA 1PJTA 4AG5A 2WD7A 2IPAB 3E3NA 5FFFA 1QRUA 2Q5HA 3ZJ5A 1AK2A 1CUFA 3HHEA 3GQVA 2J59A 2JAHA 5IZCC 5EHXA 3PXXA 2F9FA 2NSYA 3NJRA 4C06A 1GU7A 3W9BA 5LP6B 3O2SB 4URZR 4BJ5A 4YNBA 1Z5WA 5TC4A 4PU0A 1L5NA 1QG2A 1AHIA 4X24A 2A88A 2GJ8A 2H9IA 2R5FA 5EHZA 1ML3A 2EERA 1CUBA 1P1KA 1R0ZA 5FOSA 2OBNA 2IFTA 1X1AA 1DSSG 3F5SA 3L7AA 3G2LA 3IHKA 5E4JA 1PQWA 1RE0A 1TLLA 3EEBA 4RABA 3IHWA 4UHEA 2ZYGA 3F8SA 2FMIA 2VC2B 1CNEA 4QWMA 5EP2A 2MR5A 2NGRA 4RVCA 4UTOA 1ARZA 1HTWA 1GPUA 2YXDA 3M3PA 1HYQA 3NOOA 1RYZA 5K45A 3IO3A 4MV7A 3DOCA 3ZI0A 1RWQA 2B1QA 2WU3A 4I99A 1ZA2A 4ZCMA 2VJCA 3KQYA 3Q3EA 1NNEA 3T3EA 3KQLA 1D4AA 5DDIP 2PH5A 3GDHA 3TFWA 4XVCA 3QOWA 4XX0B 2ANCA 1W4ZA 2JFQA 1K5HA 1O4WA 1E2HA 3ZI4A 5ES4B 3E6AA 4BVFA 4DJTA 1VHJA 4ID3A 5JTUA 1IG3A 1ORRA 3FZYA 1WUJS 1DT3A 3VDQA 2IHZA 3H2HA 3RVRA 1M8FA 3FSGA 4QVKA 1G3UA 3A14A 3C97A 5C32A 1DFHA 5EIAA 1TZJA 2EKQA 1Q83A 4R1NA 5DCWA 2Q6OA 4Q1CA 4XTRA 3VI4B 2OYSA 3ABSB 4I55A 1K4YA 3TECE 3E9NA 4M98A 4P86A 4B76A 2QLMA 3EASA 3NHSA 4Z3DA 1WDWB 1EE9A 2M6LA 1VCNA 1P4GA 3UUWA 1M1YE 1NJ1A 3DMTC 3OI7A 4HLQB 1VSVA 3I30X 5JXHA 4DV3B 2M32A 7YASA 4TKUB 3AEKA 5D3KA 1U2SA 5FL7D 1J0DA 2I3ZA 5CB4F 3OT1A 1T9HA 3HH8A 5FA6A 1EVEA 3KQQA 4YC7A 4F91B 2Q28A 4RTPA 1SKMA 1Z06A 2DUNA 2FN3A 3PA6A 1ZISA 3DV2A 3ET5A 5K3FA 2J07A 4IIUA 5KTSA 2GKGA 3M9WA 4PCAA 3B6EA 3LOPA 5LU8A 3CONA 1E1DA 3C6XA 3IDOA 2FP4A 3IS3A 3JWHA 4KSYA 2HQSA 2ZJ6A 1JLHA 2REQA 3U44A 4BXOB 2F9LA 4PTZA 4LXXA 5BSWA 1B16A 3AESA 4RHUA 1FPMA 1HI9A 1YSCA 1JLSA 2EOAA 1XEWX 2WAAA 3OCZA 3P4XA 4YUAA 1WHTA 3D4NA 3IMEA 4MPTA 4QSHA 4LV8B 4L4SA 3EG9B 2YH2A 1JG4A 3IVXA 3UVEA 1IEQA 3CM0A 1LI7A 2JCXA 2IC5A 4BFVA 4CV0A 1GZDA 5KAMA 3Q0IA 2R87A 4Q1DA 3TNYA 1FX0B 1T8TA 1EUDA 3LZCA 3TRIA 1E9CA 4KV7A 1NNSA 3FFXA 3P97A 3OZSA 4JC0A 4MDFA 1E20A 1Z26A 4AF6A 2AZ4A 5A4FS 2IU4A 4OL9A 5EQFA 4P5EA 5GOZA 5SYNA 2FRXA 2XITA 4D2IA 3T7CA 4BE4A 4ZOLA 4MQEA 5G0SA 5T4BA 3MTGA 2P35A 3P2IA 3LX8A 2GM4A 2G1UA 1GYRA 1RQ2A 1NE7A 3HCWA 3ZD8A 5IU6A 1A1VA 4HYYA 5KSOA 4JKIA 4DC9A 4MWGA 3TNLA 2QN7A 2V6MA 1FC0A 5ALKA 2FTKE 1Q0TA 1P91A 2HYDA 2WINI 3I9MA 3LW8A 3M4ZA 4L8WB 3GO4A 3QOYA 3GLIA 3L5KA 3M0EA 2IYRA 4KX3A 1NC1A 4WIAA 4XVHA 1Z5NA 3UJHA 4DR5B 1IWBB 5C9ZA 3UKDA 4Q3AA 2QA5A 4QLAA 4Q21A 2BEUB 5MHTA 1BJRE 4TT3D 4I4LA 2VBGA 5FQNA 4AWXA 2GDZA 3NBYC 2JH8A 5E1DA 2DJ5A 3UMRA 3DO8A 2BZSA 2ZSIA 3D3KA 4QZVA 1A9OA 5AICA 2WF9A 3SICE 1IHDA 1KERA 4MO9A 1NM5A 4CL2A 3LPAA 3ON5A 2DFPA 1A8HA 2ZDGA 1S4MA 3B20A 3P26A 3WZMA 2R6GA 4KK4A 1OGIA 4WFJA 3GP8A 2ZVQX 3AL3A 2ZVJA 5DTMA 1ZD4A 1XTUA 1DBVO 3LUGA 3IPAA 3OVMA 1UJNA 5TGZA 4AYTA 4PXAA 2FDCA 1Y5NA 1U2QA 3CRVA 3Q9NA 3W3ZB 5I8PA 1TM7E 2Q0HA 3ND6A 2EBHX 1XDWA 5CW1A 2ZIXB 1SCNE 3HUEA 2DPYA 1QANA 2FQXA 1G291 1YB1A 2GKOA 4RK1A 1IBMB 1Z0SA 4DRXA 2O57A 4LQ4A 1RXEA 4QBFA 3I0NA 2RHRA 3ZDXB 4H4CA 1AKYA 1MD9A 1NC3A 4WESB 2BD0A 3TSZA 4H0CA 1J22A 1FVHA 1BIFA 1E3JA 1WW3A 2BY4A 2WM3A 4MV4A 5TQJA 4DIOA 4P80A 4ICIA 4ZRNA 1E94E 3RK1A 2B4AA 1KKLA 3K1JA 1CR0A 1XK6A 3KG2A 3QVWA 1P1CA 5CJPA 4MI6A 1M1NA 1R0KA 2PSEA 2X4GA 2H2AA 4PPFA 2AXPA 1SVNA 1V9CA 1X8LA 1G5QA 2Q46A 5G40A 4EY7A 1LPOA 3V7WA 1CYDA 1II8B 2WHYA 3MD9A 3IR5A 5BOSA 1NTOA 2W0SA 4ZKDA 1E9FA 1GQOA 3GX1A 4BCCA 3IMCA 1OVGA 1XZLA 3RAPR 4BZWA 5E1MA 2H5JA 1YZHA 3IT0A 3KJNA 5D2CA 5E9WA 4B3TB 5M34A 3CC8A 4BWVA 4TLAA 2FGJA 1T24A 2G9NA 3BK1A 2WSIA 3HVKA 2LRHA 3QUBA 4X64B 4HR7A 4ZTZB 4NK5A 4IV5A 3A2KA 2XAUA 1E5DA 1ZITA 3BZUA 2FWIA 4C43A 4IVRA 1PT8A 4CQLB 1M0EA 1QJ4A 2OG1A 3O5AA 4BX9A 1ZM4A 1E9DA 1XVVA 2QD4A 1W2HA 3RHSA 2B9EA 4NYIQ 4OFBA 4OG2A 4WXPA 5ALPA 1QF6A 4HZGA 5LOVA 5ALZA 1ZL2A 1O0SA 3M1LA 4Z7JA 3V9AA 2A1TR 2E89A 2Q8PA 4FYWA 3QX8A 2NTNA 3H5IA 2J33A 3H2IA 1BCSB 2JGDB 3CZAA 2DEUA 3O2JA 3FWZA 5J59A 1NT4A 3F1LA 3PC3A 1TQ6A 4DDMA 3SX4A 3G7UA 3QIVA 4LGYA 3RFFA 4Q7QA 1XSEA 2IZ5A 1EFRD 1FTQA 3L0OA 2C7QA 4CQNA 3KPJA 3AP1A 2X9NA 4TMYA 3WXMA 4YRLA 2WPDD 4UEWA 5JLJA 4YN3A 1ZGAA 1ZIDA 3KM0A 3F2VA 3II6X 3OKFA 1GG8A 3NHUA 4C4OA 2FUKA 1UBJS 3EF3A 3R77A 3KWLA 4E7OA 5IT4A 4KXQA 1GA4A 2IL1A 1XJWA 3ACBA 2NO4A 1M1YB 3N2EA 3ZWDA 3RS2A 5JD4A 2RHHA 13PKA 4UHHA 1U31A 2QXUA 1OI4A 1E2MA 4HUQA 4XOUA 3MC1A 2QE7D 4IZ6A 5JVDB 4DKJA 4P8RA 2YC2C 1R10A 2EFCB 1BKYA 1OXUA 3AVQA 2PG3A 2OVFA 4WWHA 3WYDA 5C7LO 3FWPA 4FX5A 2AL7A 1VP3A 1A95A 4QGSA 1T6YA 5K05A 2IBSA 4EI7A 3PTAA 5EYPB 4AC9A 1LSUA 2R6R1 2C5EA 1GA6A 4DV7B 3NI2A 5T67A 3NHPA 4RHYA 5L51A 2E1PA 3UH1A 4Z0HO 3BGVA 1XKXA 4Z5XA 1T3HA 3G82C 3NANA 5L40A 3DS8A 1P44A 1JKJB 2WU8A 3B1KA 3O9MA 3PE3A 2GARA 2W4MA 4MJXA 2Q0XA 3U4GA 2DHCA 3VSAA 3ZU3A 1PR1A 4INZA 1JKXA 1P2SA 2IZ7A 1HKUA 4QFBA 1TVMA 3ZWWA 4KVFA 3SKYA 5IJ0A 1G3QA 4BYGA 1TEZA 1FL9A 4PYIA 1SVWA 2EX0A 1ZRNA 4ND2A 4WE3A 3SBEA 1V4BA 3X43A 2Q2WA 5JI2E 2D0DA 1W4RA 2AFRA 4JZYA 4TLBA 5FA5A 3QX9A 3VR0A 4C2AA 2V8BA 3GLIE 1F14A 1UFQA 2XZLA 2GBLC 2P4EA 1VZ3A 4ND4A 3A26A 1YJAA 1L4UA 4JT8A 3BBLA 5KHAA 3RB8A 3EPKA 1NUUA 2QN9A 3K15A 4GX5A 1EFTA 4NZMA 2IHTA 4QXMA 4Y9DA 1AF7A 2D2EA 5AVQA 3RT9A 3GEHA 1Q7TA 4HX5A 5KQSA 1G20A 2G9ZA 3ZDZB 3HYLA 5KVCA 1N4DA 3D4PA 4Z8YA 1GCUA 5KYXB 1U3VA 2VCYA 4EKDA 1DAGA 3ROQA 4LTDA 4P08A 2FUG6 2ZSAA 2B4RO 1GL6A 2XB4A 5FXMA 4NOMA 4MMYB 4KKXB 4JVOA 4G85A 4D3XA 5FA8A 2H4XA 3NP9A 4Q9LA 5JR3A 5E7MA 3K70B 1NVEA 4QEDA 4EARA 4D4LA 1BDJA 2FN9A 1JB9A 2Q5OA 2BGKA 2JH9A 4AYXA 3SKXA 1UJ2A 1HQCA 1DUVG 2C78A 3BXOA 3ZBTA 2CMHA 3AL2A 3AERA 1SPBS 2GZMA 4R1MA 4CLHA 1OKKA 2OV8A 3MJCA 4QLBA 1E7MA 1US8A 2FLWA 4GM4A 4RNCA 4CQJA 1E89A 1XVUA 3VA7A 4W9NC 3LP6A 4ARAA 2V4ZA 1EUCA 4JR1A 3W0LB 4DR6B 2BFEA 3LIIA 2FX3A 4NPHA 4YECA 3V4SA 4DT1A 4AMVA 1JMKC 3MHTA 1DKOA 4QQ8A 4UJ5A 5LZ4A 5JZSA 2JJ1D 1I2DA 2WD7B 3K72B 4M1ZA 1Y1LA 2VQEB 2WG1A 3D4IA 2BFDA 4JHLA 3IMGA 4QBKA 3UATA 2GPYA 3JATA 1YJ8A 3VBCA 1PLJA 1Q5PA 1VIYA 2RHLA 4PGGA 5B6IA 5IWAB 3VO2A 4YACA 3PUJA 5JJKA 1K2WA 1G63A 1AD2A 4WLOA 3KSBC 1ONBA 4RVOA 4OHVA 3PXUA 4QRDA 3FZGA 5E4TA 3HK2A 1BX0A 2PL5A 5BW5A 1EB8A 3FLBA 2WJ3A 3R2JA 5TPWA 3IAS6 4RGQA 3F4KA 1DPGA 2VBCA 2CHGA 4NFYA 4K7JA 3CKKA 4P98A 3N1UA 2A9OA 1J8DA 3SYLA 4CYMA 1QB7A 1E3IA 2V7XA 1MAWA 3B52X 4QYSA 1J8FA 2IX9A 2OWEA 3B1ZA 3DMTA 4NRDA 3OZDA 4S24A 4YLYA 1XN4A 2B2CA 5K9ZA 3QTLA 3TG2A 1ZC3A 1NFFA 1N0UA 2OY0A 2AJCA 1K5DA 1M76A 1XTZA 2IYZA 4KIGA 5EKSA 1CJCA 2BRUC 4GXQA 4KLNA 4XDGA 4HRVA 1W0CA 1Y6RA 1ZOLA 2ABWA 3CO0S 4IDCA 4MW0A 4BMVA 2QRQA 4D9JA 3A8TA 2QRVA 2HY7A 4QHSA 2YR0A 2M6KA 2PKEA 1VE1A 1PR3A 4M1YA 2JG3A 3D4BA 1SKQA 4LHYA 4F06A 2BBSA 2VUSA 4EY5A 2NU9A 5ARBA 1A2KC 4R9UC 3VNVA 3G7SA 4L2IA 4C29A 2Q07A 2H3EA 3NM5A 2CBZA 4G2TA 1XRLA 4X3CA 2QLBA 5DM60 1NG1A 4C4RA 1JSXA 3HU1A 1XMIA 2G04A 1PS0A 2QTVA 3KJIA 1GPNA 1JDSA 2WA2A 3LO5A 5JQGF 1JJBA 1WBDA 1MA0A 3NNSA 2P6UA 4I55B 3SS9X 1GGVA 2JJQA 4MXDA 4JL8A 4OXNA 1T0JB 2FWRA 2QTMA 4HN9A 4INPA 1DTSA 3MTAA 1KJJA 5FFNA 4XB1A 5AOCA 5C7YA 4F60A 3PWKA 3H1PA 1Z6QA 2JEZA 1O6FA 1JF8A 3AEKB 3LDGA 4W1QA 1E3DA 2PX8A 1E7QA 3DV9A 2WKSA 3QMVA 4U2CA 2J0UA 3V4ZA 5IX8A 5F3WB 4ZHQF 1QGOA 3HJHA 1KFBB 1KTVA 3OZFA 1GPDG 4NYJR 4AG3A 1E63A 3UH0A 4CV1A 5B1SA 2D1SA 2IPOA 2CL7X 2E21A 5DBHX 5K3FB 3COZA 3RUAA 5JCPA 3Q9SA 5CFZA 4UHDA 3I37X 4FCCA 5C7IO 2DH5A 1X7DA 3I9FA 1AKTA 2FP4B 1L4YA 3FOFC 2VNSA 2WFAA 2REQB 3U44B 1T3SA 3PB3A 3ROFA 4FHCA 3T1HB 3AESB 4PCLA 3GJ7A 1MGOA 3HBAA 3RSFA 1WHTB 4H1TA 1J25A 4FGWA 1SOWA 3WRWA 3H11B 4WERA 4H16A 2W2TA 2PY6A 1HNZB 3GV0A 4P92A 3LG2A 1WB4A 4JUDX 5C8XA 4G0ZA 1U0BB 1JIXA 2HADA 4EFLA 3FE2A 5F1PA 5LZ8A 4WUTA 1GYPA 1E6UA 3OAAA 1H2AS 5JCOC 5JXGA 2YV2A 121PA 1T5BA 3V8NA 3IODA 4DLAA 3QTTA 4ZCLA 1SBCA 3OZAA 3MF4A 1FFXA 3H9JA 1QAMA 2XRMA 4OMDA 5IH3A 4AUMA 3KSDO 4Y1RA 2FFJA 3U7IA 1OTHA 1E60A 2OECA 2NXWA 1SBIA 2OXCA 2QX6A 3CG0A 3EOBI 3HEBA 1K0FA 3PUXA 4MWOA 1DHTA 1ECFA 4OXQA 3JVDA 2ACVA 5FWAA 5J4LA 1KZGB 1ZR2A 4IQ8A 1YS4A 1YB4A 1G20E 3KXLA 1V5FA 1DRVA 3SDBA 3V32A 3IAEA 4OSPA 3W5UA 5IT0A 4YMLA 2R7LA 1RYBA 1A88A 1J0CA 2P9BA 2Q3MA 2QV7A 4O0LA 4RSHA 3K9QO 4IXNA 2C5SA 1ORWA 3H2SA 3K16A 4N41A 1R15A 3GLIB 1E2NA 9LDTA 1DUIA 1DXHA 4DNQA 5LVAA 5FJIA 3TSOA 3KZXA 1MT3A 2R2GA 4C20A 1CY0A 1OWNA 2ODBA 2DFTA 1UXKA 5I7AA 2EU8A 3EEYA 1UZMA 1Y3BE 3DE1X 2GPTA 3QVOA 3S70A 4N7JA 1OZGA 3C3BA 2JJMA 5K2OA 2XY4A 2PBFA 4KE9A 4MGHA 1Q0QA 5IABA 5CCDA 3GFVA 4JEIA 5EG5A 2AUTA 3R0IA 1LPMA 5DHAA 1B74A 3C6BA 2W2VA 1P80A 2J4FA 2WM2A 4EW6A 4PYKA 3RS7A 2P6NA 5HKKA 3KSZO 2I33A 3BDAA 4F86A 1QRAA 2NO6A 2AK3A 3IEPA 1AQUA 2Q7DA 4V38A 1SUPA 1CRZA 3C70A 2OUIA 4L15A 1N5LA 2ZUEA 5DRTA 3ERCA 1NQ5A 1NT2A 1PNQA 2CF6A 2W6QA 1TXGA 2V7GA 4PC1A 1V45E 5DBFA 3DXZA 4DRXB 5T5QA 4DCMA 3AV0B 5KPJA 2I2WA 4K5QA 3L7JA 1CHDA 2QK4A 2K5UA 1RAAA 3N0WA 1ISGA 4P33A 2C4HA 2XZTA 4G0QA 2D7DA 1R0YA 3RC3A 4EMTA 4LOHA 1XR3A 5IMBA 2F3UA 5BURA 4FNAA 2EGGA 1JEAA 3K1YA 1ID1A 1FSZA 3NBZC 4IBOA 1FZQA 1M1NB 2Y1FA 4DR2B 1K6MA 1S3GA 1J2YA 4JLVA 3R7AA 3RUHA 1LJUA 3WDLA 1DJNA 1S89A 3JWJA 3P9QA 2Z6VA 3KQTA 2AMYA 4UVHA 4AUNA 1IXZA 3L84A 3PGXA 4S0XA 3NWBA 5AOVA 3WSTA 3DQZA 3M6AA 5TDHA 4D9NA 3H8WA 4JH0A 3E81A 1YI8A 3BILA 1MVOA 1ZU5A 1O57A 1OVMA 1U3CA 2N1MA 2ZXEA 3FTNA 1YASA 3NV7A 1B6SA 3CVOA 3PXCX 3Q7PA 4IDQA 1WDKA 3HVUA 5C5CA 5EJFA 4CEIB 3LPLA 1DO0A 4PEVA 1XDDA 3WGTA 2H51A 1N5OX 3HBFA 2YWCA 1QGAA 2P69A 4E1AA 3BE6A 3LWZA 3LX6A 2OZEA 2ZFUA 5CIQA 3IDFA 4XIYA 1L8AA 2Z04A 2JIMA 1GSAA 3NAGA 1K66A 4UD6A 2W2MA 4TTPA 3VJLA 4DUGD 5K3EA 4QATA 2K2WA 2V7QD 3CHYA 3EW7A 3R0VA 5DHQA 5ALIA 3LKVA 4KO2S 5JDCA 4FBMA 1VLJA 1A0OA 1O97C 2QN3A 2VI5A 4BMZA 3L8MA 3K8OE 1NUSA 3PEUA 4RBNA 3IALA 4Z86A 5CAEA 5ITWA 3UTCA 4TQGA 5ALYA 3Q98A 2JBAA 4NMMA 3HJAA 2QM8A 4B6JA 2I03A 1SKYE 4ZVNA 4RTNA 2VBFA 2IP1A 4DG5A 3K4HA 3DDHA 3ZHZA 4BGVA 4F2PA 1PHRA 1AIPA 3ES9A 3NWJA 4YAIA 5CLHA 2VDQB 4UE2A 2QG6A 3UMSA 5GJVC 2O5CA 1XKTA 2VYFA 2QP3A 3ANSA 4IVQA 2HA4A 4PVDA 1QSGA 2ZTMA 1MVLA 1NLFA 3WLQA 4CFZA 3RVPA 4JLBA 2Y05A 1RM0A 2Z56A 2O3JA 3EMKA 3G2OA 4QVGA 2Q7XA 4RCZA 3B7PA 4W7IA 4YMWA 3KZOA 4JI7B 4DLRA 4RTKA 5TQVA 2ZDQA 4J43A 1WU7A 5BN5A 2CZQA 4ILKA 3IAHA 1NQXA 2G88A 4H17A 1GT91 4KN5A 4QC2A 1DXYA 4M37A 5T4EA 1UQTA 1QBGA 4OHUA 4FQ7A 4HUQB 4O2RA 1SEVA 2CMDA 4I4CA 2Q0SA 4G63A 1WDLA 4F21A 1EFAA 4RKRA 3IBGA 3ZW7A 4RGBA 4EQ6A 4JXXA 3A9CA 1U8ZA 5C52B 2EARA 4C0QC 2FEWB 5LQCA 2QLJA 4NNOA 4YFYA 2EL7A 3Q2IA 4BP9A 3VO9A 4DN6A 5GINE 3ENZA 1WVIA 1VGQA 3OBIA 3PGJA 4I2NA 1M1UA 3N70A 4OYHA 3V46A 2ZU6A 2FFAA 5E38A 5AVTA 3BD6A 4LY6A 1WB6A 4DCCA 4DPMA 5JRJA 2PX3A 2X1LA 4GLLA 1Q3KA 3SMVA 4F1KA 5COBA 3C4JA 3D2BA 3WL4A 1AU9A 1ZLXA 4DV5B 2VIIA 2WWFA 5T7BA 2Q5LA 2HF8A 3HFSA 5JCJA 2K87A 1N7JA 2P6RA 3DA8A 4DZZA 4G56A 4XH9B 4PLHA 5CEJA 1FRVA 1V7QA 1GCAA 1VIVA 3AFMA 2GBPA 4OQZA 4RZQA 2W43A 1Z0JA 3ZGVA 2J3LA 2CVFA 3H5AA 2VAPA 1BWPA 2ZIEA 4J0GA 4TT8A 2ZSEA 4B17A 4A2QA 4DMMA 4S05A 3KJFA 3JQAD 4UVIA 1DXQA 1N2ZA 2QB5A 3Q11A 3CCFA 4J4TA 1BX1A 1D1SA 4C78A 1VL2A 2P27A 4I19A 3BBPA 5DLEA 3NEYA 1EKXA 1S02A 3BWCA 5EWMA 1QFZA 1GGHA 1G20B 2YIDA 4NATA 1U3UA 3PQ6A 1A96A 4NZYA 5J4KA 5BQ3A 5JS8A 2XRFA 4QOGA 3K2IA 2BHNA 4BIMA 4TTAA 3E9RA 2FQ1A 1MIOB 4OH7A 2INGX 1HDEA 3FDXA 2CXPA 1F0NA 4I81A 4ESEA 1EFDN 1RAEA 2XUPA 4GI2A 2G9VA 4HH1A 3TGLA 2YFHA 3IRUA 3QPAA 4D92A 4GC5A 2XCRB 3DEKA 4FYPA 1CFJA 1FYFA 2F3PA 3C87A 3F6RA 4Q9KA 3RLFA 3OZTA 1L3BA 4HY3A 5EE5B 2BI7A 1TK9A 2NT3A 3AERB 4NBWA 1A7AA 3KEGA 4CFSA 5AKKA 4BEVA 3WQRA 1I6MA 1UIMA 1US8B 1I4TD 2C3OA 4PVCA 2BLNA 3IBCA 3CLTD 1P72A 2X40A 2O3UA 1EUCB 4LOIA 3VMMA 4ALNA 1QH8A 2BFEB 2HMWA 3UMJA 1ZK0A 4DT1B 4ARCA 2I8LA 3AF4A 3C1UA 4Z0PA 3F73A 4TROA 1HL3A 4YP9A 4CPDA 1KYIA 1Q3HA 3H5RA 1UXHA 4LI3X 4V2UA 2BFDB 4W6QA 1E3TA 4JHXA 1WNFA 1N6NA 3JATB 2NAPA 1J9ZA 4LVNA 4HVTA 3BXZA 5H16A 1HT2E 1EBFA 2F8SA 2G1AA 1V8ZA 5AHWA 5AW0A 1BA3A 5AIAA 4PBRA 5IAGA 1CP3A 1KSGA 1GY8A 3EPLA 2NSDA 3U3OA 1PJQA 2EJWA 3L7BA 3MFQA 2Y2UA 2H7CA 3HEMA 4TWAA 4DV6B 4KOEC 4RMJA 2CDNA 2HCBA 5KC8A 4Q03A 1PJRA 1CUEA 3M9LA 3FN4A 5AJVB 1Y89A 4AY3A 3NDRA 2XT9A 4CHTA 4R01A 4Y2UA 1DAOA 1U04A 2D1TA 3ENQA 3KPVA 5ERYA 5AW9A 3U81A 4TV8A 4KQCA 3S2SA 4RTOA 2DR3A 3GARA 1LWNA 3BD7A 3FNFA 2QRVB 2OHXA 5GJBA 3E5RA 4B47A 3SJ7A 3MGCA 4M0LA 1NY6A 1LX6A 2I6UA 3E0XA 3F97A 3NZEA 3GXBA 2ZLBA 4HGZA 5DM4A 1CR6A 1P7WA 2JRLA 1Z2NX 2NU9B 4L2IB 3MXTA 3TSAA 2H85A 2B8EA 4AKTA 1K6IA 2PGOA 4E5PA 4F5YA 2OGWA 3AUFA 5KTRA 3V48A 3QLEA 3PR2B 4DDUA 2H1CA 3I53A 3RC9A 4KV9A 1H9AA 3M70A 4BE9A 3MILA 5JZ9A 4L22A 1L7AA 1VHLA 2WQ7A 2QTVB 3Q41A 3T15A 3S2FA 5GVRA 3M2PA 4X63A 2NTVA 4QNMA 3KHKA 5TGDA 1UQRA 1DJPA 1GTVA 2Q5EA 3GUYA 2D0PB 2JRCA 3FH0A 5DSZA 1WG8A 4OGGA 2QZSA 2Y4NA 1V95A 1SKYB 1ONPA 1EYZA 1KEUA 1B93A 4D9GA 1WU8A 2W48A 2WB4A 4L02A 1VE9A 3UENA 4JEMA 4B73A 4CKYA 1G5IA 1DO2A 2WMYA 5ENDA 4C7XA 2NPIA 5IVPA 5I3ZA 2CVPA 3K9CA 4NHOA 2FN8A 5LYJF 3OF2A 3L77A 1U0FA 2N46A 4RV4A 1YZLA 2X7JA 1HLFA 1Z0AA 1Z2PX 2NVUA 1GSOA 2VBIA 2Z8YA 3F74A 4JMLA 1MW8X 1A8QA 2IP2A 1UXGA 2HJHA 3R5KA 2XXAB 1E0SA 3PX7A 3IT3A 2GK7A 4B87A 1XNRB 2P30A 3UKOA 3TXAA 1F7UA 5GY7A 4PC3A 3C6YA 1VDMA 2I3DA 5AHKA 1GTSA 1CF2O 4DCJA 2UXDB 5TMEA 1YB5A 3Q9LA 3E8XA 4H4DA 1UP7A 1AOXA 1Q16A 4WOBA 1VE3A 4O4JA 2NVOA 5FBZA 1JPNA 3MN1A 2KS6A 4D9IA 5B4TA 1T8SA 2FWBA 3L1IA 4FDUA 2I1VB 4PLPA 4TN5A 1GHTA 1XPJA 3QNWA 2A0UA 3I2HA 3ZXXA 4BFXA 5L4SA 4ADSG 4ZO6A 4CM7A 4BLPA 4H7IA 4ASUD 1KEVA 3SXUA 4Q02A 3QU4A 4UXJA 2NU8A 3U49A 4HLNA 4JC5A 4BECA 1FFXB 4MGIR 4BMDA 3BIJA 4II7A 1DC3A 4Y1RB 1PYDA 2QL7A 5AKXA 3W34A 4KLRA 2O8EB 1D5WA 4KVGA 1GNLA 2VSQA 5IBQA 1DMSA 3WLAA 1Q22A 1PFQA 2QM3A 5AK4A 2CV2A 2J3DA 3CKLA 1NXPA 4JVLA 4HNQA 3UTDA 1EESA 1EDDA 5THKA 2JLWA 1TMGE 1W48A 2VOEA 3RRXA 4EYKA 1VBFA 2XKKA 3KZNA 1M5RA 3DPSA 2G07A 2NO7A 3SYKA 3X0DA 3T0FA 3P0IA 3OQOA 1JHMA 4B74A 2QD1A 4QT0A 2QGFA 1M6VA 3VZSA 3AUXA 4W5JA 4A0FA 1I24A 5DGIA 1KIFA 2D8AA 3CEMA 3ENWA 3I45A 1RZRD 4P84A 1IZ8A 4GDMA 1XTPA 3OJ0A 3WGLA 3Q2KA 4AF8A 3B13B 3I1IA 7ABPA 3AMVA 4YVFA 5FI1B 2BFNA 3PA8A 2H9AA 4FLEA 4FS3A 5LZ9A 1A8IA 3EQ9A 2ATIA 7MDHA 5H4GA 3ZHSA 1IJKA 3LHIA 2OORA 4P36A 4LWZA 5ALHA 5E6UA 1R0WA 2IHKA 2PJDA 1SELA 4L74A 1F5NA 4RTSA 1A8PA 2MTBA 1RHKA 2LGJA 2P9ZA 2ZI5A 3PVSA 1AUVA 3ABIA 4OQNA 2ZJ1A 4XQCA 4EIWA 4CIBA 2ZYRA 3DZHA 1XVAA 2KBFA 5LDHA 4JCCA 4BMCA 3DZIA 4O2BF 4JKOA 4MO2A 1TYZA 2G0AA 4IHKA 3COSA 4P4UA 5HDBB 3BHMA 2NXCA 1P5ZB 2Q1SA 1P0FA 5E8JA 1SAYA 3DMPA 1EDZA 1K75A 1MJFA 2R4TA 4EG7A 4LQLA 2AX3A 4EAQA 2OQRA 4IDAA 4JWKA 4B8YA 1C9DB 2XQIA 4TV9F 3IP1A 5LBIA 1L7VC 3MM4A 1P7ZA 3D7RA 1QFJA 2G7ZA 2R97A 2VDPB 3NW9A 5GAJA 3VDXA 1ORVA 3OEED 2O59A 1CCWA 5KOYA 1UDRA 2F1IA 4GNKA 2FN4A 1W581 4FFDA 4NDAA 2VH5R 1N2XA 1OIVA 1DRKA 3X1MA 3MJRA 2F55A 3RAEC 3TW0A 3FF4A 2YV4A 2O0MA 3WR5A 1XTVA 5B36A 4HH3C 4MYSA 2Y67A 5JWRA 1DP4A 2XYHA 4HWTA 5KJFA 5HMLA 1EZ4A 4TT3A 4IEEA 4EY3A 2GEFA 4EEKA 4GLBA 4I9NA 5L9AA 5F52A 3MEQA 1WZ2A 1X94A 4H7FA 1Q1EA 2I9KA 5AVRA 3PKZA 2DT5A 1NKTA 3GIWA 2HSZA 4E2ZA 1JTVA 4QL3A 1RXWA 3WL6A 2BMAA 1X3SA 1VL6A 3I4LA 3C39A 1ESCA 1Z4JA 4KXNA 1GPH1 3P0FA 4BAZA 1KL7A 2X5NA 4X1OA 2YRWA 5DIZA 2DPHA 2HKIA 5CAEB 4BZQA 3BXHA 3NRJA 2JBAB 3UK1A 1BKSB 3N8NA 5MN4A 2CJXA 5A6VA 3QX3A 1RJEA 4C14A 4PX2A 1Y1RA 3V34A 2XDQA 1I4DD 3SIRA 1OJLA 4PZUA 4QOEA 1C0IA 1RAFA 1JIQA 1TVKA 1QMGA 3BE4A 3AHHA 3K8YA 1GZ7A 1RYYA 3NHAA 4N3CA 2PKRA 4Y2SA 1T1RA 4QJ3A 1RWBA 2B1RA 2QMHA 3V5NA 5EINA 3RNLA 2P90A 1GRVA 1NPTO 3DMFA 2CCKA 4YRQA 5SICE 1HDOA 1P4RA 2YVAA 3B89A 4BGIA 2HF7A 4J3FA 4Z1OA 3SQNA 3ETDA 4JELA 4V0NA 3B8EA 5C34B 1R8JA 2MU1A 3C0KA 1AQJA 5DWQA 8MHTA 3GEGA 5BN5B 1TMKA 2JARA 3ELWA 5CFQA 2B98A 1GRQA 1RLMA 3PICA 2YWRA 4K2HA 4K6CA 5EP1A 3JQ6A 4FFBA 3WKEA 3ZBPA 4CU5A 2DFKB 2FWJA 4URHA 3WA7A 3GDGA 1X7WA 1EPUA 2PMFA 3ANNA 1QYIA 4KU4A 1OAKA 3KAKA 2EZUA 3G23A 3S1AA 1JSRA 4EQ6B 1GZVA 2A9FA 1HRKA 3PC8C 5GWXA 3VR1A 2O7RA 3KRTA 4BHTA 4EGFA 4EITA 3LGAA 4G1UC 1W30A 3G8BA 1Y34E 3EMBA 1RXYA 1DQPA 3PIDA 4RLHA 2VHTA 1Y5RA 3LNCA 5BYAA 1GA1A 1TFUA 4W5OA 1UEXC 2EQAA 1DGQA 3KEQA 1QLJA 1A69A 4AO7A 1AKRA 1EGMB 2X1HA 5AO9A 3RRYA 3C7CB 5B7GA 1V6AA 4MARA 3U3DA 4IOJA 3TVYA 1KJIA 4ALLA 2X7HA 1LNZA 4EP1A 3GCZA 3VYTB 1RHUA 3OESA 3QYPA 2Q3LA 2AUMA 4RSRA 5IG2A 3UK0A 4KB5A 1F3OA 1XRNA 1KU6A 1OW3B 3E7DA 3TR0A 4CU2A 3A37A 4CI0B 4I5GA 1LBTA 1U0TA 4FOSA 4BEWA 3LWNA 4CMEA 2OL4A 3M33A 5A9SB 2P2ZA 3HCBA 3QLJA 3G85A 3F4BA 4D0NA 4QUKA 2R0QC 4CDMA 2VYVA 4K9RA 4JLSA 4BNNA 1MC5A 2VP4A 2ZRDA 2JJ2A 3FPSA 3GRAA 4MROA 5JAOA 2DHEA 1P6XA 3NOVA 1YQEA 1KA9H 2WJIA 1SR8A 3JR7A 3STVA 2ZW9A 4YDSA 1UKBA 3EFOA 1OYYA 5EWMB 3THRA 3WAKA 1Q74A 3EZYA 3HMQA 3BL6A 4ZT5A 4F6RA 2WBLC 3KUUA 3KJZA 3ESQA 5KDOA 1UJMA 3GNLA 2VT3A 3KR9A 1M67A 5TMPA 2QQFA 4IF6A 3E9CA 1A71A 1HT3A 5JS7A 1G98A 2HSEA 1KE1A 2QE7A 4KHPB 5CXQA 1V5GA 1K3UB 1S9HA 1Q1NA 2WR8A 4FK8A 4XWTA 2ZE7A 1G3MA 2ZXUA 1CULC 2D3TA 2JW5A 1PR0A 2ESRA 2W2LA 3WGOA 5ENVA 5KTOA 3KCQA 1CHNA 3K96A 4FN5A 4GECA 4WLVA 2XGJA 3DT6A 4LDQA 1JI3A 2I2BA 4NMWA 4JSTA 1UPFA 1VCHA 2WUVA 4BX3A 4ZMSA 1CQJA 2FUNB 3M5DA 1N78A 4E5VA 2C29D 1ZSVA 3EW9A 3M4XA 4AK9A 1P1FA 3LY9A 2PMBA 5K6RA 1EWYA 4A8JA 4NJOA 3GT4A 3KP1A 3GAZA 4UDYX 5CTAA 3ABOB 4F6CA 3FUXA 4RMGA 3D3EA 3NT5A 1OSNA 1JHZA 4TXMA 3OOJA 3VKWA 1U2EA 3TLEA 1NSTA 1QDLB 1OH5A 2XUZA 4R8RA 3RC2A 2A78A 1X6VA 2YMLA 3DYBA 2WVHA 2YRXA 5GOTA 5JS6A 1SC3A 2QI9C 1GDDA 3CPHA 3U9LA 3AGPA 3T12A 1T8UA 1WNTA 1Z0ZA 1AGPA 3B3AA 4G1VA 2EBWA 2ZIZA 5BY2A 1UWVA 2ZRQA 3D7SA 3BXEA 3JAMA 2BUCA 2V97A 3ESDA 1N3YA 5TT1A 3K32A 3E70C 4LCEA 3KXPA 5H02A 4YP5A 1KQNA 1HFWA 1WUKS 2JANA 3G88A 4CI9A 2RJ3A 2AJBA 2ZANA 4N8DA 1IU9A 4GR9A 1T0PA 1N2CA 3JQFC 4TV8B 3JRXA 2QYHA 4Q1FA 1TDJA 3CZ4A 1CETA 2P5UA 4C6TA 4CUKA 1TQHA 4ZT7A 1SIWA 2ZB4A 5DISB 1YDHA 4IKPA 3PKIA 4JI0B 2ERCA 1B2LA 1E0KA 2CXRA 3N2ZB 3PI7A 3RI3A 5J4YA 3RK0A 2IPLA 4JDUA 2HLDD 4XSGA 3T9EA 3I5MA 5FX2A 4Y1FA 2RGEA 4R05A 2CJFA 3KQMA 3CF6R 3T7EA 4G4IA 2P9JA 4R8SA 4WJZA 2WYHA 1TZKA 2F2TA 4QPPA 4ZT6A 4AVYA 4BB6A 3C8UA 3PNOA 4NFSA 3QPCA 1CIVA 2WAOA 2VEOA 2ZZKA 3M5CA 2I62A 4J49A 4QBTA 5ALQA 4QT4A 3BG5A 2KBEA 5I4CA 1GGEA 3C7KA 3DFUA 3GELA 2C0PA 3I9V1 5CM9C 3UHAA 3W1VA 2VNKA 2HJRA 2L69A 3FI0A 3L18A 4ZO4A 3ZBUA 1DQNA 3ABRB 4FZJA 1THZA 2WYVA 2NSLA 1G7SA 3EGOA 1I1HA 3W7BA 1YCFA 3CZRA 2H4HA 1ITZA 3UJNA 1GR0A 3SHQA 3VR4D 4PLYA 1K3TA 4C0HA 1KAOA 1FP6A 2PWPA 5FNZA 4ZVSA 4RF5A 2CE2X 2YJ3A 4MDYA 4FZ5A 2AYYA 3M6VA 4TL7A 4ZAFA 4AJOA 1XPOA 2ZBRA 3ORRA 2NVUB 4ZU3A 3HKCA 2H2FA 4LBWA 4DNFA 4PSDA 1P4AA 5CT5A 1EE1A 3R5HA 4RMNA 4CCAA 4P4GA 3JVIA 3QQPA 3TBKA 2EL9A 4U7DA 1NNLA 3TZLA 2I6GA 3HRHA 2Q2NA 3URKA 2ZUDA 4ZPXA 3PJRA 4ZEVA 3DE0X 2CEAA 4X8HA 1Q1QA 3GLUA 4EYEA 2GEJA 4RXUA 4MV1A 4WKPA 3LDFA 5K0NA 2X77A 3I2KA 3IGFA 3OMXA 1FQOA 3NJ8A 2UVQA 4Y6PA 3ROMA 3T1OA 3ZVLA 4JIMA 2IIPA 3SXUB 3VR2A 4BNWA 4C1BA 3AM5A 3RJ5A 4BNKA 1UK9A 2XWJI 4X91A 4F71A 4OLFA 1FFDA 1ESEA 4L7VA 2DT8A 3TUIC 2RB4A 1C30A 3VQTA 3F71A 3VTFA 2YW9A 3DBVO 3T9AA 1NRJB