2OWEA

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRMYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 62
structure length 170
sequence length 170
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2oweA00
2F90A 2H52A 1RPAA 1YFKA 2OWDA 3MBKA 2IKQA 3GW8A 1NT4A 1QFXA 2H4XA 3LNTA 3PGMA 4PZAA 3R7AA 1K6MA 2P6OA 4PZ9A 1EBBA 2ENUA 1QHFA 1YJXA 2RFLA 2EKZA 3E9CA 4E3WA 3OI7A 2GFIA 3QPWA 5AJVB 3BIFA 1SK8A 4AROA 1V7QA 3ZHCA 1DKPA 1DKLA 3KKKA 3FDZA 5HTKA 2P78A 5PGMA 4TSRA 5CX4A 1TIPA 1T8PA 1QWOA 2P9FA 1DKOA 5AK0A 2HIAA 4D4KA 2WNIA 3NFYA 3IT2A 1E59A 1ND6A 3D8HA 2WNHA 3MXOA 1BQ3A 1FBTA 2P9ZA 5AJYA 4GPZA 2H4ZA 2P75A 4ARVA 4QIHA 3GP5A 3GP3A 2YN0A 4D4MA 4D4JA 1UJCA 3IT0A 4D4LA 3HJGA 2P2YA 3C7TA 1FZTA 2ENWA 2P2ZA 2A9JA 2H0QA 1DKNA 1RIIA 3LL4A 5CU7A 1RPTA 3E9DA 1SKBA 3O0TA 1DKMA 3QPUA 2AXNA 4JODA 3NTLA 2HPAA 4IJ5A 3K4PA 5AJWA 2WU0A 3QPVA 5CDHA 1XQ9A 2EOAA 2P77A 2HHJA 1H2EA 1UJBA 2PA0A 4MA4A 5AJXA 2DWOA 3IT3A 3LG2A 5HR5A 4JOCA 5AJZA 2QNIA 1E58A 4JOBA 4ARSA 1BIFA 4GPIB 1V37A 2DWPA 2A6PA 1CVIA 3FDZB 4FDUA 3EOZA 3D6AA 4HBZA 3DB1A 1H2FA 1DKQA 4ODIA 2BIFA 2EKBA 1SK9A 1C81A 3IT1A 1C7ZA 2P30A 2P6MA 3F2IA 4IJ6A 1C80A 2OWEA 2P79A 4FDTA 3E9EA 1BQ4A 3FJYA 4PGMA 4ARUA 3DCYA 3F3KA 2YN2A 3K4QA 3D4IA 3EZNA 4EO9A 4EMBA 1ND5A 2P9YA 2I1VB 1IHPA 1SKAA
chains in the Genus database with same CATH superfamily
4Y0VA 2B1RA 1R12A 2HTEA 1H3NA 3IUQA 1E9BA 3MM4A 3MTAA 4FHZA 3TVTA 1LFAA 2JKYA 3ROTA 2XEXA 1W1UA 4YUZA 1XF1A 4US2R 4KQ1A 1S7CA 3AW8A 5DISB 4LI3X 1CQWA 4QPCA 3UUFA 4TVSA 1Y8ZA 3PP8A 3K31A 2PXAA 1QIKA 2A86A 1ZRNA 2F4VB 3Q7IA 4J8PA 4Y6OA 4NSNA 3IQXA 2L0XA 3G8DA 1RXSA 1U2RA 1G3QA 4M0KA 1QK3A 2Y1FA 1YRYE 4ZO6A 1XZKA 5JHGB 1KC1A 1WPGA 1NI4B 4DV4B 3TAUA 2Q6KA 2Q8NA 3C1UA 5T8KA 1TYZA 2VPIA 5ITVA 3MS4A 4RJJA 1QTNA 4G4GA 5A4DA 4JI7B 2OP1A 4L5IA 2Q3DA 3UUWA 2VN8A 3ZCSA 2A78A 5L8VA 3TNJA 1EK6A 1U2EA 1AQYA 1XL1A 1PTJA 1FXWF 4IZIA 1UXGA 4QTXA 4BNTA 4QUDA 1TPYA 4ZREA 2ZVDA 3CLUD 3RASA 2RHDA 5DM4A 2NO1A 1OF1A 4GOKA 4YO8A 3LE8A 3IRVA 3PKJA 4MQBA 1GITA 3ZNQA 1Z4MA 3S4YA 3THWA 1GSIA 4BEWA 2BEUB 4K9KA 1INLA 1RPTA 2EKDA 3LD9A 5L51A 3ZD6A 1HQKA 3THRA 4QHYA 3R9WA 1Q1AA 4NBNA 4RK7A 1GPLA 2MSLA 1EFCA 1K7EB 4EF4A 3IJPA 4ILKA 4NYJQ 2Q5LA 3DDCA 4A2PA 1N6PA 2ZK7A 3FMFA 2WUFA 5TS2A 3MD9A 5LMUB 3GLGE 4AP5A 5FA5A 3RF7A 4O4JF 3A58B 1ZWKA 1CQJB 1V1RB 2IH4A 1TA0A 1XR3A 3G8CA 4WMLA 1G7CA 3N0XA 4RD0A 1Z0FA 2O2DA 5BOVA 4C7JA 4ZK6A 1KRWA 3KUCA 4BO1A 5CIWA 3RF6A 3BJZA 3LG2A 1U99A 1IPHA 2QPTA 1F17A 4MW2A 3K6SA 4N18A 2QOEA 1LLCA 5HPYB 3HZHA 3PUKA 5CAEA 4ITUA 2P3LA 3LTNC 3ZXYA 1ISJA 4HNVA 2VJQA 1MPXA 1X8JA 5EZ6B 2Q62A 1SH7A 3K2QA 3RSLA 1XZCA 4Z53A 2I91A 4L6AA 3QKSB 2IOFK 4TRJA 1QRUA 1U7UA 1NUQA 2VNKA 2O23A 2Z09A 2ZXFA 5L7YA 3DTVD 4BRZA 4MJLA 4DAEA 4D45A 4OQPA 4E4YA 4X92A 1JLSA 1R27A 2V9ZA 3DXYA 3LK7A 3T9DA 1OFTA 1J24A 3IR6A 2P2LA 4MW0A 1RJ9A 1LSJA 3G85A 3S70A 2E6UX 1XEAA 5B53A 1L5SA 2CLSA 3HSSA 4PN3A 2F43A 4KVFA 3T1NA 4L76A 3OAAD 1J20A 3DMPA 5HJ5A 3AVYA 5KTNA 3S2YA 1M6NA 5L7TA 2JS7A 1DT3A 1P7WA 1RI4A 3MJVA 4MR9A 2I2BA 4RLHA 5TC4A 1PDOA 3BL5A 2PZLA 3WK7A 1ZMTA 3RGGA 2I1VB 2PLRA 5LXTA 2AR0A 5LA6A 1DAHA 2VDJA 2WUVA 2Z4SA 3MBKA 1OTXA 5HIAA 2BGWA 2OCDA 3DO6A 1Z35A 3O75A 4FYKA 4KP7A 4MNTA 2FUCA 5CCXA 4JK3A 1JPVA 1O97C 5JJ5A 1R8JA 2DE0X 4H6XA 2B5WA 4ZVUA 2BGRA 3STTA 2OGWA 1M1NB 4ZICA 4ZI7A 5JJBA 4FGUA 3LLMA 3JQ9A 3PCRB 4U2FA 1GKLA 4WUTA 3N2YA 1J21A 4WN9A 2HWXA 2MTBA 3ADOA 1PLLA 3THYA 2RHWA 2PL1A 5LZ5A 5JDCA 4BKMA 1FUUA 2V8OA 1XCGB 3EG9B 3FIUA 1ZHFA 2RK4A 4CM8B 5BVGB 4W5OA 3SJ7A 1SQ0A 1EDOA 2P9FA 4C0KA 3GVCA 1PJ3A 2JGIA 2BKXA 5T3UA 1NLUA 2B1JA 5JHHB 3SSNA 1MAWA 2H4YA 3RGWS 2OFFA 3RANA 3ZV5A 2ROQA 4LG1A 3S40A 1V5GA 1ESDA 1FQKA 1VQ1A 1Y3AA 3KYDA 4WDQA 1OFUA 4N5DA 1XCOA 4IPTA 1N5KA 1HE4A 1I32A 1TVKB 2ADOA 5CW1A 2E5WA 2C3YA 2QENA 3P96A 1X8KA 3OJOA 1H2XA 1CJSA 4Z9XA 5DHAA 4IVPA 2QI9C 1DQNA 3EEFA 2Y6UA 5KKAA 1BWRA 1UDRA 4KIWA 4WCFA 3WK6A 1YJAA 3UBMA 4IMJB 2X76A 3IUPA 1AKWA 3QPUA 5E6RA 2BFEB 1XLTA 3I9V6 4GGPA 1HOTA 5B1IA 3U49A 4AUKA 4IIGA 3RPEA 3K09A 4YJ2B 2NUBA 2ZQYA 4DLKA 4I1OA 2A0UA 3DMHA 2GEBA 2JLYA 3DNPA 1XQ9A 5TQ0A 1KZ1A 1R4MA 2A9OA 1MTOA 3LBHA 4N54A 3U3MA 5JPDA 1XVUA 3JVIA 4U8HA 2GD2A 3I53A 1C8VB 1JU4A 1K4KA 2AOTA 2GEJA 2RI1A 3KQVA 3HCCA 3NONA 2IYSA 3AEKB 4HPXB 4LQDA 4X6XA 2Q5EA 3RKSA 2WWRA 4IO0A 3H5NA 5CW2A 4N5MA 2C95A 4NBTA 1TRKA 3E2IA 2EFHB 4HDKA 4NL4H 4GOLD 1E1YA 3E9MA 4RVDA 1IEXA 3KQWA 4WESA 4L16A 3V8MA 3GY0A 4PO1A 3ZQJA 4IHKA 4DLYA 4YXFA 3TBHA 1XZAA 4CKEB 4LMBA 3FNRA 3ZHVA 1GUAA 5FBRB 4BNUA 4F6RB 3ETJA 3QZUA 4URFA 3F8WA 3RTBA 4FDAA 3AKZA 4NBUA 1E1RD 2CDCA 4EG4A 5LQUA 3GJXC 5IASA 1QGOA 1XRPA 1PR2A 5JZBA 3AR5A 2CBZA 4GX1A 5DZSA 1QF6A 5AI6A 3NANA 4J1TC 5LLDA 4O5OA 1NW4A 1M7HA 4ZOLF 1SN7A 2HREA 2CL0X 3WNCA 2BBWA 4S12A 2HIMA 3I9FA 4F8YA 3MT0A 4JP1A 1A7KA 2CNWD 4N39A 1SCAA 3ZV4A 1L7NA 1IM2A 1LSUA 1JWBB 5CITA 3VI4B 3QTLA 1VJGA 2FZGA 5KYYA 2D4AA 3LL7A 1U2QA 1GRNA 2BCGY 5HMMA 5FV4A 3ANXA 5CB4F 2VT2A 4BWVA 5F23A 2O1XA 3TQOA 2ODAA 3PX2A 3OCJA 5EKXA 1T0HB 4OSPA 1Y8RA 1F51E 1DADA 3F6EX 4MUBA 1U7TA 4D8YA 3BD8A 3ONVA 2YV5A 1JLHA 3HI4A 4BP1A 1FPQA 1T9AA 1U5BA 2EG5A 3BL6A 3ME5A 3OIGA 4DOMA 5JPCA 1QGYA 4OIFA 5LQSA 5THXA 2VH1A 5ED0A 5IULC 2XNHA 3DTVA 1KOGA 3R8FA 3E2MA 4RCVA 3LUAA 1NVMB 5BT9A 5TV2A 5E8JA 3ZJYA 4PX5A 2IZZA 2Z2IA 2XGGA 4GPBA 2WPNA 4PZCA 2YVUA 3ESCA 2H1OA 2AR7A 1OD6A 1OZHA 3VR4D 3B9BA 3DG9A 3OAAA 2ZB8A 1IPEA 4BNMA 1ISGA 1TK2A 2OY0A 2QRQA 3P27A 1CFZA 3VPGA 2Z6AA 4NG4A 3PI6A 1SD1A 3CGGA 4JJIA 3ZQ6A 1MV8A 4M0UA 5A1TA 5A7FA 3OZBA 3MHTA 4YRJA 2AB0A 3C16C 1YKSA 3TLMA 1T2UA 4B7UA 2K7ZA 3D02A 4IGKA 3AQ4A 3PKIA 3DMDA 2EBWA 2UV8A 1IN7A 1NBWB 2CN1A 3QFHA 3SYLA 2GXSA 3D5TA 3L5OA 5G4KB 4DNQA 2CJXA 3QHQA 2ZIXA 4XDZA 3SBOA 1CYEA 3EPLA 1J1IA 4J90A 1FZQA 1W6UA 2GNAA 3BB4A 3MSCA 4MS1B 1H0SA 5ULLA 2GPAA 3RT7A 4C3UA 3NBZC 1NN5A 2P9QA 4YQYA 1QZTA 3E7WA 4OFXA 5GOZA 3TO5A 3A9UA 4WBNB 5HJEA 5I9LA 5IS2A 4BB5A 4H15A 3V1LA 3JATB 2AN4A 3UO8B 2WF7A 4BVHA 1UP6A 5IAGA 2A5FA 2HK9A 3IAS1 1G2PA 3MGAA 4K03A 4Q3DA 5TXGA 3ZK9A 1PUXA 3ZDXB 4XARA 2XODA 1SUFA 3ZS8A 4BRSA 4HH3C 1QIJA 5BOSB 5IKMA 2FRVA 5CH3A 3ZWMA 1ST3A 1YDHA 3OUTA 4DMLA 3IRUA 4RD1A 2D1FA 3IAXA 2NU8B 3EUWA 2I4LA 2XADA 4OQQA 1TFRA 2HF9A 3LA8A 4ZO8A 1C2TA 3KK0A 3R0XA 4LJ7A 5ESXA 2AI3A 3F6BX 2QLLA 2VDNB 2R2AA 1LXCA 4M0CA 1T0PA 3NYWA 1V1JA 4R7ZA 4XVQA 3IULA 4ZP1A 5KTTA 5JS6A 3ED1A 1I2CA 1JPUA 1T36B 1FMLA 1TQ8A 1L7EA 3QE4A 1R50A 4OBEA 2QY9A 4DLWA 3EF3A 3IA7A 3B78A 4I50F 4BMVA 2Y1CA 3BIJA 3TL3A 3TW8A 1FNMA 3ACBA 1XKXA 3PR2B 2VK2A 4DLUA 4WT7A 3MLBA 2WIFA 4XGQA 3TYXA 3V1YA 4EUEA 2XUJA 2ANCA 4GRIA 4OP1A 1EVJA 1DC3A 1KVTA 3ZJ5A 2P30A 2E4XA 5KYUB 5K8JB 3AX6A 2J4FA 3PNBA 4PYQA 4RYLA 4JR2A 4OK3A 3H2BA 3R8XA 3WP1B 4DVJA 4BGEA 1T2DA 2I29A 3SS9X 3LBIA 3ISVA 2KE5A 1ZN8A 5KWVA 3RLIA 4NH4A 2Q6LA 3NS7A 2JRCA 4H3HB 1XVIA 4LJKA 4RMHA 4BGIA 5C4MA 2CWDA 1VMDA 2O8EB 4O2BF 1HMYA 4OKNA 1WXFA 3B1XA 1KJZA 4ZU1X 5BYBA 3UJHA 3DOFA 1EUDA 4LJAA 1L2TA 3GWGA 3K96A 4FD2A 5LKAA 2XTZA 3L92A 1L5HA 1JEEA 2VCHA 4U02A 4A8PA 5EJ5A 3HACA 3L4JA 3PXDA 3QVMA 3ENKA 3DZCA 5CVEA 1JJFA 3A2MA 1AKEA 3NHMA 3QTTA 1WB6A 2I2CA 2R84A 3TZQA 3U60B 2MU1A 2MDTA 3CCBA 2RFLA 3D64A 3GXBA 4CR7A 3DD5A 1T35A 4JXKA 2MMGA 4JJ4A 1UBMS 3Q8WA 2WJ6A 1JAZA 2VHXA 1CNFA 5C8YA 2WF5A 1J56A 3ZE8A 3AVWA 1E1RA 1CZRA 1QBGA 2PAAA 3KO8A 4MIOA 5JD6A 2YRWA 3TZBA 3NIBA 3NWEA 1PR0A 4POAA 4E5SA 3AEUB 2P78A 1JR3E 3L1VA 4XGKA 5AK5A 3FPBA 4BO0A 1KTIA 2QQ5A 2Z58A 1RQ2A 3KR9A 1T8PA 5G0TA 3RIMA 1JU3A 3OF2A 1QMGA 1SVNA 1O94C 1DKOA 4JLKA 4H6PA 4K3UA 2C9BA 1RAHA 2CNWA 2OXRA 3HYRA 4RGQA 4EYKA 2IE8A 4WASA 1WKVA 5FTMA 4YTEA 1Z7YA 1BXRA 5AKEA 1NP7A 1PR9A 4TPKA 1AGRA 4CMIB 1Y1KE 3NGXA 2X8JB 1JWLA 4DV5B 2XE4A 5EC8A 4GT1A 5AESA 3H05A 3VJMA 4PX2A 4R1UA 4OX9Y 1GZ5A 5F9HA 3UICA 2COEA 4DQLA 2WE8A 4HATA 4FFWA 3OJLA 2C7OA 2IYOA 3R9KA 3IV9A 3KEFA 4HD8A 4W9MC 2ZATA 3VISA 3U7RA 2WYWA 3UMRA 2HQ1A 2DWUA 2ZYHA 1DPFA 3QE2A 1SOMA 2ZI9A 3IMEA 4Z49A 4MYRA 2IITA 4P22A 5GVSA 4QVGA 4NCXA 1L5KA 4KXXA 3GEHA 3H19A 4KXVA 4YRFA 1PJLA 1GM5A 1OI2A 4AO7A 1L8OA 5T4FA 2GERA 4D0NA 2O8DB 1SXJB 1UMBA 3KQNA 2FZKA 1VKOA 3E1GA 1UJBA 3GT7A 3RFFA 1N33B 1Y5NA 3A0UA 3NPMA 2O0HA 2E6KA 4HAOA 1RI2A 2PLAA 3DBHB 1DWUA 3DW3X 1FTSA 1D2MA 3LC7O 3NBYC 3TWOA 4N0EA 1L4BA 2X2EA 2Z2YA 4IVRA 3T5BA 1K63A 1RFLA 4C0AC 1NYQA 2AEJA 1XTZA 2ZJ8A 2JCXA 2CHUA 5A3VA 1DZ3A 5ILOA 4ZA2A 5EZQA 1URPA 3E7XA 4YRCA 3W1VA 4B84A 4EQ6A 4D3ZA 4DLNA 2VP2A 2HT1A 4H3VA 4AC9A 3TMYA 3B51X 3H1GA 1YQWA 2FMIA 4D3DA 3N5CA 4F3TA 5CRIA 3KTAA 3JRWA 5AI5A 2AKEA 2VTVA 4QUEA 1WCWA 1MN6A 3L07A 4KITB 4EB6B 1T8YA 4DLVA 3R5FA 4IDEA 3WA6A 1JT2A 1GNLA 4IX1A 3WOHA 3VO1A 2BONA 2PWAA 5DTQA 5I9BA 2JLXA 4QNRA 4NOJA 2HSGA 3MSXA 4BAUA 2VATA 2CYAA 1PLKA 2N0SA 3KE8A 4JLSA 1IFXA 4KE9A 4LWOA 1JDBB 1T1EA 4DIUA 5EJ6A 7ABPA 5LZ9A 5J23A 3L2OB 4BV2A 4ENTA 4U9IS 3LIIA 4TZTA 4Y6RA 4PZZA 5AKLA 2PUEA 2XB9A 1N78A 4DCOA 1PJZA 1FXWA 1I4TD 2H0RA 3QELA 1KI9A 1NHWA 2WMNB 4I0WB 3W9YA 3G7SA 1YHNA 1MCZA 2P67A 2AL7A 3W6UA 4ZIRA 3QH4A 4XPIB 3R7WA 2ZJ2A 4EVSA 2D2XA 3EOBI 4Q7JB 4CZ2A 2ZCUA 2D5BA 3IEUA 3FFWA 1USGA 3U61B 2XBLA 2IEBA 4M1SA 1F8YA 2HTFA 4L2IA 4RY8A 2QX6A 4BCCA 3TX6A 2MSDB 3Q9UA 3ET5A 4OSOA 3SJCA 3JWPA 4J03A 5ES4B 3OZ7A 2WT9A 3GJSA 3I9JA 3AY7A 1VFPA 3FBWA 2IYVA 3MNFA 3NH6A 3OT1A 3F9CA 3PRHA 4JLVA 4NFHA 2R00A 3R7NA 1JMYA 4EENA 1ZA2A 2NV2B 4MARA 2XNJA 2R7MA 4PLGA 3OUZA 3UFXB 3AR4A 2P90A 2AJBA 4FN5A 5F77A 1CJUC 2CY0A 2GHIA 3ABZA 4YP6A 3CZQA 4ENWA 1E3SA 3T1OA 2WZDA 1XTKA 4MRSA 3J80A 5HUQA 1QV6A 1TGYA 4B3CA 4DT1A 3ZWCA 2DCUA 2WMOB 3BCRA 1Z0DA 3TLAA 4WZAB 2D8MA 3GQBA 1E6CA 3DZGA 3W0LB 3U26A 4F4JA 3CWCA 4UTZA 3IOBA 1K7CA 3FMGA 1E9DA 4GSKA 5ALHA 4X3CA 1UPBA 2O5VA 2PD3A 1A50B 3L0PA 2QRZA 1ULSA 5CLIA 3SC2A 3VVCA 4CDRA 2ATCA 1U0BB 3U80A 2I4TA 1Q7CA 1PFUA 1Y7TA 4KX5A 1EM8A 2XHEA 5FPSA 5HE8A 3UJDA 3Q3CA 5CCDA 1FBNA 4HNTA 1DDIA 1KGDA 2CXUA 3OJ0A 4PLFA 4QD3A 4QDUA 1MRNA 2PSDA 2H1SA 1D4OA 1HYGA 1L7BA 1XAJA 1LPPA 1UP4A 3NETA 2GS9A 4HUQA 5HRCA 4KX3A 1UPTA 1VB3A 1RRKA 4GLLA 5T6BA 1VMAA 3QXHA 3HY4A 2DR2A 1R3DA 3LQFA 4NULA 3VV3A 2G1UA 2C2MA 4MUIA 3EPPA 5AOCA 3Q8XB 2QUKA 3NOXA 5DX1A 3C6QA 4RAQA 4WJLA 3QV2A 2GARA 2QR3A 3EWNA 1QIDA 2L82A 1JR3D 5DXAA 2EL7A 4RV4A 4QXAA 4AG5A 1L7RA 5E7QA 3QFCA 1E94E 1LPMA 4KXQA 4B31A 3T4EA 2GFHA 4Q15A 4A8HA 1CJBA 5DM60 3DWGA 3ETLA 2C7QA 1DXHA 2LPMA 1T3GA 1R8XA 4II3A 1HZZC 5G02A 1SA0A 5BSUA 4URXR 4MHTA 4ZVQA 1PWXA 5AVOA 3AUJB 3QENA 4TL8A 3LAWA 4FPXA 1PJ8A 1A9QA 1YRAA 2YC4C 3AUYA 3H1PA 1AZTA 3JD3A 3JWIA 4FDTA 5DNCA 4MPTA 1SWVA 3TXAA 1MLDA 1PWYE 2ZU6A 2I78A 3G2JA 2WAOA 2WRZA 5AT1A 4HWRA 5IG2A 5MN4A 3TSAA 4TV9F 1RZVA 1SQGA 4LF6B 3HJNA 1QHXA 1F2DA 1ZGBA 1GWNA 1T24A 1BVRA 2VDRB 3IS3A 2W6OA 2ZI6A 3TINA 3P45A 4NFSA 2GNPA 3HJAA 4YI5A 4DXDA 3C3EA 1J99A 2ZPUA 4Q3LA 1AXRA 1E5VA 5MGNA 4FYYA 5JZOA 4K2HA 2IYYA 2ECQA 3UJPA 4JXZA 4UCQA 3FI0A 1QRTA 5DSZA 2XTMA 3AHGA 3D8RA 1GNSA 2IIVA 3B48A 5FNVF 3TIGA 3O8LA 4CV0A 4J2TA 4EL0A 3I62A 3PPYA 5E7JA 3GH3A 5LJIA 4I4TA 2PZ8A 2FG5A 4DTCA 1TEXA 3OLVA 4B2PA 1HO3A 1JFRA 4JI4B 4NYIQ 1JQEA 1KHHA 2JCSA 3G2NA 2O9JA 1V9SA 3PQFA 3VGJA 3L0IB 2FUG1 2H0AA 4CMCA 3INNA 4GXRA 1YBHA 5KAPA 3RBVA 1XZFA 3MT9A 4EY6A 4Y98A 5LNK6 2Q41A 1F2UA 1QWOA 1ZJ5A 2FJUA 3KLNA 3KKPA 4E2ZA 1D1TA 1P73A 1P7ZA 3TGWA 1M76A 2D2FA 2ILTA 2WB4A 2ZVJA 1EIZA 5A2GA 5IT4A 5KDLA 1JG1A 4DWJA 3R3JA 4M7WA 1XD9A 5IUNC 5FF9A 1G6Q1 1HR0B 1QCCA 3WLFA 1PG0A 3QKIA 4O4LB 5KTMA 4PQEA 2BEJA 4G0MA 2F1HA 3S7TA 1HLGA 2PUDA 4MV3A 3C70A 4W1PA 2VBGA 3OE4A 5H0IA 2FG6C 2Q07A 1Q44A 5EN4A 4GXQA 3QNUA 4RESA 4MKZA 4WFQA 2C9MA 4F92B 3DWFA 4ZYUA 3OH8A 4W1SA 4ZHQF 2DC1A 2NTVA 1KEEB 1SUSA 1KDRA 3ESAA 1AHNA 3RSQA 3V9AA 4RACA 4X54A 2DFKB 3CTMA 4FYXA 4OEHA 3EEBA 5JDIA 3U9SA 1FRFS 3GJRA 4MI9A 3IEMA 2FW0A 1VLLA 3A6DA 4Q9JA 1I1OA 1YS1X 2DYKA 5CA0A 2NPFA 3TQQA 2PEZA 1G9TA 4JIGA 1JAIA 2QL6A 4ZOLA 2COKA 2ZRFA 4BIMA 4AX8A 5JCJD 4ZVOA 5AFSA 1VC2A 1MX5A 2OMEA 5DM1A 1ODSA 4F5YA 3WXBA 2X0IA 3I23A 1WCYA 2MSWA 3DJFA 3AILA 1Y1TA 2FPPB 2Z1MA 3E3LA 4CTNA 2B4KA 1RM4A 3DJYA 3FFTA 3JQCA 3M82A 1AKNA 3UHAA 5CB4A 1TD1A 1H6CA 1UBGA 1VZ3A 4I9HA 1UK8A 5D1HA 2AEFA 4MYDA 4V38A 3ZUGA 5I9IA 1LQ2A 1RZ3A 3BD7A 4MR9B 4RFSA 3EDQA 4CNBA 4JI1B 4IFEA 5AW9A 1HURA 3EQ7A 2ZJ7A 3G5LA 3H1TA 1M2OB 1GR1A 2V45A 2HOQA 1X7XB 1MQ8B 1C81A 2YRFA 2LV8A 3I01M 4LZNA 1YVUA 1S1MA 3I09A 2XDWA 4DARA 2QRVB 4IUCS 4L9SA 3SD7A 4B9EA 3ROZA 3S1AA 3ADPA 4OUDA 3PXXA 1BQ4A 2NVWA 1ZW6A 2KLHA 1G63A 1Z4IA 3HLKA 5EEGA 4CM7A 1N0WA 1GKKA 4M1YA 2PZJA 5AOAA 5J3JA 2XECA 1C9YA 1U9IA 1KI1A 2HRBA 2HUPA 1Z0SA 3WVNA 5CD9A 2WE7A 4JA2A 1AHIA 4FCWA 3L79A 4LYEA 4WHMA 3TLGA 4RIFA 5BV1A 5KNBD 2F1JA 3K8OE 3R7FA 2ZUFA 3PGKA 2GO1A 1NLYA 3DC2A 1S89A 2JKZA 2VIIA 4MH0R 4RNDB 4YUVA 1ZIXA 2VAVA 3WL3A 4D5EA 4BGVA 2IIPA 5K1ZA 2PKCA 2R4TA 5F7ZA 3T3IA 3EIXA 4G0VA 3VNBA 3OOSA 3VR0A 1N6RA 1J2YA 1JR3A 2ZWOA 1AZSC 1R6XA 1PYGA 4B6SA 5LDDC 5AI0A 5HP4A 1GGMA 1I33A 1GQSA 1PQ4A 4KLNA 3SLKA 1RJGA 3TSOA 5JY6A 1IIBA 4Z4IA 3QKTA 4M55A 4IKOA 5FAXA 1BNCA 3LUBA 4IXNA 4Y6PA 4D3YA 4OAOA 1T10A 4OOFA 4B8ZA 1GRCA 4PQGA 2RK3A 2XZPA 4B3DA 4Z54A 3EQ2A 3R5SA 4KBYA 3A7EA 2VXCA 1CZKA 2A9KA 1Z15A 2XA9A 3D59A 1KGSA 1YTLA 2BUCA 2RONA 4BOYA 3A4TA 3M8KA 1JXMA 2JANA 1P5HA 5KJ1A 3E5NA 1GPKA 5J4KA 4LXXA 3GL9A 5TQ0B 5HGXA 4XYMA 4BJ3A 1Z22A 3KSBC 3TG8A 4A15A 5LN1A 3TBFA 3EW7A 3H16A 4PXAA 1P3JA 2IIQA 2R6ZA 1OX4A 2IGBA 3CKMA 4NE9A 4JNKA 3HVUA 4QTUB 4G25A 5JBIA 4REQA 2JFPA 2XUPA 4HNGA 4I50A 5SZIA 2X0RA 3KL2A 3IVCA 3VAZA 1Z8DA 2F3QA 4HDKB 3WJ2A 1DAIA 1QAOA 1V71A 3A1WA 4GMKA 5E6SA 4UU1A 4V0ME 1K7XB 2J6BA 3SVZA 2MINA 4NLLA 3TW4A 1QE5A 3KJGA 4WESB 5TRTA 3KSZO 1LLFA 1M6VA 4Q9KA 4HS4A 4QFCA 3Q5DA 5B7QA 3K0SA 1GYPA 1US8B 3RYIB 3C3AA 1N2EA 2CYBA 2VJMA 2OFPA 1A72A 1ZOLA 2R4UA 3I2FA 4TTIA 5DMHA 3WB1A 1POWA 5CEEA 5ALLA 2H06A 5LMNB 5BR4A 3N3AC 3W2TA 3S2SA 2AWOA 4B4DA 1DQYA 2WA1A 4L5CA 2C61A 5I4CA 1YL5A 2G25A 2PS3A 2XTAA 4CEJA 5DN9A 4QM6A 1P72A 4XJVA 3MTBA 1MW9X 1KZ7B 1VLHA 2XAUA 4O2BA 3RVJA 3VYWA 4AZTA 2XZDA 3KJQA 3CNBA 3DR5A 2Q5QA 4YBRA 1RE1A 1B6GA 1BOFA 1WX1A 3ZWNA 5BPFA 1ZN2A 3FCXA 1JKXA 2G4LA 2Y2UA 1VKZA 2RGDA 2VYFA 3KVOA 3PS9A 3HB0A 3JYOA 4LYAA 4P3YA 1OKKA 3KZ1E 4LGVA 3A9SA 4KN6A 4KO4S 3BCSA 3AR3A 3IR5A 4JT4A 2X86A 4V0LA 3VJKA 3A9RA 3IVXA 4EG0A 2HRCA 2WJZB 2ZS7A 4KE6A 4LHSA 1OR8A 3K9QO 4U7FA 2IDKA 1UDWA 4QYWA 1DP4A 4JCCA 4OVKA 3X1DA 1ADJA 3WKCA 2CVQA 5KYYB 4FGSA 3KVVA 3ZGZA 3BXFA 4ARBA 5C1DA 3HP4A 4B40A 5AUQA 3TR5A 1GGFA 2D2IA 2IEAA 4MLCA 1XF9A 4BLUA 1U4OA 3NHZA 2H17A 2DFNA 4HQFA 4YIHA 1A2KC 4RS3A 3VYSB 1SU8A 4R1PA 2P8SA 4FYHA 5D86A 5ALPA 2QVGA 3V1MA 3PJDA 1XYGA 2OLJA 1I5EA 3C7KA 3ZDFA 1XNRB 2BTEA 3K9HA 1MO6A 5JCJA 2I66A 3BD9A 3OQOA 2HY7A 1CUVA 1FMFA 3CEAA 2VWGA 1YZYA 4AMBA 3HCBA 5K3FB 5FUBA 5H81A 2F4NA 2C7VA 2GJSA 4N6GA 3ZI4A 2O6HA 3O1JC 1AURA 1SUPA 1VJ5A 1T3LA 2P6OA 2FSVC 2VL7A 2WM2A 2R9VA 3HY3A 3M9LA 1DIOB 4IDBA 4NOLA 3Q8KA 1UT5A 5IVKA 1D6NA 3P9PA 1KKMA 4WQMA 3PJRA 2IEGA 4M9ZA 5CTJA 4XAQA 3L8GA 1XLWA 1NVWQ 1UBSB 3E1KA 1L4KA 4OI4A 4Z2AA 4KXMA 3CZCA 1X14A 2HXSA 3DPUA 1AZWA 4YECA 1U3FA 4DUPA 2FG7C 2QGFA 3H5IA 2ZSJA 3NOOA 4H0FA 1GSOA 2HMUA 4N3NA 4QREA 3RHZA 4IHQA 4E0BA 3RS4A 2GZ1A 3E9YA 1BJKA 1SOUA 4C6TA 2OMKA 1G3MA 5JZMA 3TQRA 3B1JA 1P1HA 4KH1A 3GT0A 3K9LA 3MWEA 1KR5A 2AYYA 4QQRA 4ZQBA 4KLRA 3SX0A 2OXTA 2GJKA 4RGVA 4OMFG 3HFSA 1FY2A 3IEPA 2W6JD 2WNHA 3NTUA 1NURA 4GMXA 4MQ4A 5BSVA 3KBBA 5IAOA 4BP8A 1ZVMA 1EHCA 3E22A 3I8SA 3D5QA 3L7BA 3S2UA 1Z8NA 4CHTA 5KNBA 5K05A 4ZC8A 3EVCA 5BN5B 1T6NA 1XJ0A 2CFTA 2YZGA 1KIMA 3QSGA 3WGNA 4O4LF 2RGRA 3NHBA 4JJZA 3KUDA 4W63A 4ZVSA 2QGZA 1DBPA 3OTWA 3V3KA 4TWIA 4TXJA 3ENNA 4DKJA 4OJMX 5GV7A 2DBVO 1RXUA 3GMIA 1JP7A 2QZ9A 4UNIA 5DWDA 2OO5A 3X2SA 3ZW9A 3QX3A 2V7WA 1J22A 1NUUA 3HVKA 2HSDA 2P9EA 3F96A 1L7XA 2ODBA 4MUHA 4YONB 5KEIA 1JWAB 2BISA 1IY9A 1JALA 5JLJA 2R11A 1Y7PA 3QVKA 4XR4A 2QUZA 2QZ4A 1GKUB 3IBFA 4U7WA 5SZHB 4DJJA 1N2XA 2YBEA 4Z4FA 4Y67A 1RJFA 1C3JA 3WMWA 5A04A 1KWGA 4CM6A 3R7DA 3REOA 4P32A 1FMJA 3BFPA 2YZMA 3DNFA 3GFBA 1G5PA 1UPCA 4KNVA 4E6EA 4M54A 4UU7A 2H7VA 3N74A 4KREA 4CGYA 2X1LA 4OXXA 3BE4A 4LRSB 4YDSA 3RWBA 5B1YA 1RZRD 2YMMA 4YJ3A 4OLHA 4CM9D 2DHQA 1E7MA 4G5YA 3U1VA 1G8AA 1P1FA 4DS3A 4N8DA 4O8CA 4ZTUB 3CVYA 4IOLA 4EW1A 1QAMA 1P1BA 3TS1A 3JSAA 3DLBA 1KI6B 4OJTA 4KR2A 1XV5A 3SIWA 2RBGA 3NU1A 2IT1A 3OCZA 2WWTA 3FOFC 3MCZA 3P9IA 2I7DA 4P7BA 3K6RA 4PC6A 3LO8A 4RVHA 4PWYA 4V3CA 4EPXA 3L1IA 1VL5A 2RBKA 2NO7A 3CA8A 2GM5A 3DE3X 3KOXA 4HLUA 3JYPA 2BFPA 4P4GA 1HDGO 1KK3A 1NDQA 1C0LA 1W87A 3GYGA 5D84A 1OIVA 5GJVC 4P0QB 1YL7A 3ZHOA 4R1OA 3SC3A 1NMQA 3B6EA 3AR2A 5A5FA 5C8YB 1GPAA 1QIEA 1HORA 2ZB4A 3E4CA 4CBVA 4W5HA 4HAVA 3NNNA 3B3QA 3ZQKA 4LOAA 1BVHA 1T1RA 1NNEA 3K1YA 1KP3A 1D09A 4HQNA 1E4EB 1SBNE 1WMFA 2RGWA 2W2LD 4QU9A 4PICA 5D8DA 3A1VA 3GW8A 5GP1A 2XF2A 4BBAA 4TYQA 5CT9A 1A95A 1XJCA 5IH7A 4YHHB 4Q4AB 1PCXA 3GWZA 2FSIA 3IDZA 1M74A 5DGCA 2ODPA 4PCAA 4GQIA 1WXEA 3E81A 5DTJA 5CDFE 4LOKA 1PX2A 3RSCA 3GZNB 4CIBA 2BM0A 1BXRB 5A4MS 1R18A 3GJTA 4BLPA 4ZT6A 3ET4A 4G4JA 4GWGA 1H69A 3GHHA 4UQOA 5IT9A 4J7CA 2PU5A 2WKQA 4MI6A 1CR2A 2YFKA 1Z26A 3KXPA 3IBCA 1CJVC 4PO3X 2OK8A 5E4FA 4EX6A 1P9OA 3OP1A 2A67A 3NAQA 3GLGB 1P4RA 4JUBA 1RTTA 3C3MA 1DAOA 1YZNA 1DOAA 2D3WA 3F3MA 4KRYA 4ZZIA 1NLMA 4B76A 2ZS8A 3QVGA 1F4VA 4YRAA 5DHFA 1VG0B 1RP7A 1YOBA 2REXB 4R2XA 2FPIA 5ALWA 4AG6A 3S6JA 2Q5FA 1XN4A 5EJ7A 4X9XA 5JVDB 1WETA 4ECEA 4YRLA 1ZD5A 3ZHTA 4AUNA 1OBCA 2IKSA 5ALIA 3NWBA 4IIYA 5JYCA 5JO9A 4OHMA 4OHBA 2EJBA 1F60A 5HVNA 3VKFA 1T2VA 4D9FA 4QTYA 5AXAA 1GL6A 3W5AA 2J3QA 1J8VA 3R3WA 2G06A 2NU6B 1G17A 3TL6A 1DKMA 3KWFA 2BW0A 4UMVA 1O5OA 3V80A 1GZVA 2PHZA 2N3ZA 4DR1B 3V1KA 2F9MA 4HQOA 2EFJA 2Z5VA 5TMPA 2GLUA 4QYXA 4R83A 5BRAA 1FP7A 2ERXA 2IW1A 2ZIGA 3LBAA 2VJOA 3F7OA 2CSUA 4XTRA 4PZDA 4BKOA 1AD2A 1E2PA 5KWIA 3LY5A 4FW8A 4KE7A 3FZYA 4Z4CA 1QNLA 1UKEA 2GN0A 1Z82A 2FZ4A 2DPLA 4PBRA 2RC6A 5DHTA 4E6PA 4FB4A 4YRSA 1A1VA 2HCFA 1E2BA 2JFYA 2JZOA 4P53A 2W6JA 1XNQB 2IVZA 2AXQA 1BTOA 3PFGA 1P9NA 4H1HA 3A1UA 4TLEA 4PRKA 2H5JA 4GPIB 4HNHA 4UE2A 3OZEA 4X60A 4D80A 4K88A 5BURA 5AVZA 3DEYX 1JKJA 2E0IA 1LRJA 3ECSA 3A7DA 1EB9A 3L77A 1AQJA 3KKLA 1E3QA 1KI3A 2JFZA 5CG1A 3WGVA 5FNVA 5J63A 1UJ5A 2H2FA 1NXWA 1YCDA 3RH0A 2B25A 3V4ZA 2ZR8A 4URUR 1KR2A 4K7JA 4LYJA 2BSAA 1WO8A 2R44A 3RAGA 3ZQUA 1U0EA 2VPWA 5HFJA 2PL3A 3LCRA 1LBQA 3OPXA 4NICA 4O0LA 4JLNA 4K81B 5FO1A 2VTEA 3ZD7A 2LVBA 4E2WA 1L3IA 2FR8C 5AVTA 2JIBA 2QSZA 3UTCA 3VO2A 3R7WB 4RPGA 1AE1A 5KVVA 1NDUA 3AIIA 4QUKA 1XQXA 3IEXA 5TEVA 2AI1A 2IY7A 1LS1A 1OH8A 4IG9A 2P9YA 4LZJA 3MTDA 1U3WA 4BMDA 1B7GO 5KX5B 1XQYA 1ACMA 4L2IB 2YV1A 4DYHA 2W6NA 1SGWA 4PWZA 4XE5A 2IKQA 1L4FA 3QTBA 1M5TA 2BFCB 1RZRA 2YC2C 1XD2B 5JSUA 1CXZA 2BGUA 4CM9A 2B5OA 2ASVA 2H59A 2WUEA 3G0CA 3NKVA 3PWKA 4OUKX 5A5VA 5C31A 1E6LA 2ZB3A 4PQRA 3MTJA 1SEPA 1R0ZA 2XMDA 1FFEA 3IDSA 4NBKA 4QQNA 4R0VA 1TKRA 3QOXA 4A5SA 1HE8B 4CEIB 3TGPA 1YMUA 1P1CA 1U4NA 1LX6A 4UARA 4V0OA 4I66A 4F4DA 1SHJA 4MVWA 3GCWA 3F73A 4I6JA 4TVOA 3WDMA 2XVAA 4DT1B 4ZHQA 3PXBA 4QOIA 2X40A 3KKKA 3PQ7A 1B6SA 2FX3A 4ZCPA 3W5VA 3LKZA 2OZEA 3GQBB 1HUQA 3SHOA 3U3RA 4FJ0A 1U8YA 1LC0A 2O2CA 4JL8A 4M0PA 2FFJA 3BQ9A 4XLZA 2XI4A 1WMEA 1N5DA 3EULA 1ECBA 1GTG1 8ATCA 1QDUA 1WXXA 3PR1A 5K3CA 1T2CA 3FLAA 4YI3A 5E38A 1UK6A 1FS4A 1B15A 2QTAA 1E2DA 1IHDA 2H4ZA 2IBMA 2V7QD 3Q0EA 1SQ5A 4L8FA 1IN8A 2YHIA 4QG7A 3R7BA 5DM70 4DSUA 2VRCD 4XWYA 2NPOA 2VZLA 5IWAB 4YFYA 2W2LA 3QRWA 4IOMA 1ZM7A 2VJKA 2QRKA 3IT0A 3E4DA 1T3TA 1K6JA 3MWDB 2GN8A 2H2IA 1XMQB 2QIPA 3O84A 2ONKA 4BU0A 2XUHA 2WWIA 2Y71A 4L5JA 1DC5A 5I3CA 4W5TA 2WIBA 7REQA 3ORYA 1XRNA 3W5CA 3KYBA 4I9NA 4RK0A 3JQFC 1G21A 3TOXA 3PXUA 4JUFA 1WXIA 4PZ0A 4ENUA 3JZIA 3ZD8A 2P6RA 4ZXPA 3ZXSA 3ZCUA 1NXQA 1G6OA 3CW2A 2HDOA 2O20A 4NZNA 2A9QA 4HTFB 4IUYA 1G8HA 3L6CA 4RZIA 3STYA 1H2BA 4MYSA 3GEGA 1YR9A 1PR5A 3VJLA 2PGNA 1ADGA 2WMDA 1S8NA 2O3JA 3HCEA 5TS3A 3UAZA 1IOLA 3IMKA 4BVGA 4BGDA 1JVBA 4GLOA 5CNKA 3WI7A 3DFZA 1DXOA 1RXCA 3Q40A 4F4HA 2B94A 4Q3NA 2OB1A 5HSGA 1Z5NA 2JH3A 3WDLA 4DG9A 1J70A 2PBLA 4GSYA 2NZYA 2X41A 2FB9A 4U9UA 4FGZA 1R16A 1DCMA 1EX9A 3PGXA 2JB9A 4WXHA 5BN4A 5TB5A 2JJYA 5DNEA 5HDBB 1R7RA 3ASYA 3EGWA 4ARSA 4P0PB 3VSBA 1RLJA 3AG5A 1JE1A 3HN6A 4AZ3A 3VH1A 4UXIA 5D6OA 4ER7A 1Z38A 3F2IA 5CJ2A 4DJTA 5I7VA 1PNQA 1EQUA 1TM3E 1VYHA 3CWZA 1DMRA 1WZUA 2CLMB 1GEEA 3A1SA 3BSFA 1U1FA 1IATA 4CLRA 4C08A 3D0RA 3BMQA 3FDJA 2K87A 4EK9A 2ZZNA 2O8CA 4LSWA 1QYRA 2B4TO 4R31A 1MR3F 2Q5HA 1RMYA 2VDUE 3H0EA 3LQQA 4DN6A 5DT2A 3I34X 3EVFA 5EP2A 1NVBA 3ZGYA 4EYOA 4PSCA 2JEYA 2V6MA 3TD9A 3O90A 5CK4A 3TB4A 1JHPA 4BKPA 3BAZA 1ZDMA 1CZOA 4XSGA 5A9SB 4YRNA 1DFHA 2VTKA 4C29A 3WK8A 3H11A 4G63A 1ILWA 2BMAA 2A1TS 3VYRB 2W8BA 4DMUB 1ZOPA 1F2UB 2X0NA 4D42A 4YMHA 3NVAA 4O3MA 2RARA 1HE1C 4CI0B 1J90A 1TT5B 2J31A 3FYDA 4QOFA 1KS9A 2I34A 1E20A 3RU2A 1K5DA 2WQZA 3JQ7B 4IQ0A 2CT8A 2KWIA 3I2YX 3AVQA 1P4AA 3KZXA 4LVUA 3TE6A 3T3EA 3U9TA 2H1WA 2H1FA 3BUSA 3RFTA 3RRMA 3TDKA 4ASUD 2CMHA 3EVDA 5GVRA 1UC4B 4QVKA 5K0NA 4CFSA 1DCTA 2CLHB 3D54D 2HCTA 3FDZA 1JMVA 2VQSA 3IIMA 4V03A 2REOA 1G6KA 3LRXA 4LF9B 1PK9A 4YCCA 2BN4A 4C4AA 1JJVA 3K9NA 4IILA 3ZIAD 3ZV3A 1LPAB 4ZCRA 2UYOA 2DY1A 4MWTA 3UB4A 1YIOA 2XR1A 2ZDGA 1ODTC 1NW6A 2M1XA 4KAJA 5DV9A 1JS1X 3CX4A 2WSSD 1MEOA 4TTAA 1PW5A 2BVNA 3I5MA 4ND8B 4BVKA 1C14A 1RWXA 5JVDF 5SY4A 2R5FA 2TMYA 4YT8A 5KU1A 4IIEA 4D4HA 1FZTA 3X1WA 3ICPA 1F9EA 1H8HD 1X42A 2AG8A 4UUOA 3ESDA 3LDGA 1O54A 4BC0A 4MJ7A 2OBBA 2IOHA 4FHCA 2OZVA 3RC1A 1ULUA 2X2FA 1NYRA 1SAYA 3O73A 2B4AA 4WN3A 3ZBTA 1WS6A 2IYRA 2WK1A 4K9SA 4YCBA 4R68A 4B3BA 2FN4A 4LY0A 4MYHA 1T15A 4YX9A 3B38A 3UXHA 5C3MA 2IYNA 4XFDA 1YHZA 3A4IA 3TNLA 1FF9A 3PV0A 2V9PA 1HA3A 3BTUA 1EINA 1H2EA 3OA2A 2ZE6A 1G20E 1LPNA 3PXCX 5CUQA 4R0MA 1EDBA 5SYNA 3H2GA 5C5DA 1J0DA 4EO7A 5ICSA 2DBYA 1Q7GA 3OQIA 1SRQA 4RE6A 4R9UC 3D6JA 4U7TB 3WFIA 4F85A 5HR5A 1OZGA 2JVKA 2R60A 2UUBB 2JJ2D 3RR2A 3LHFA 3X1YA 1HC7A 1MH1A 3GO4A 3S1AB 4DDVA 2V7QA 2H9YA 4L51A 2DWCA 2WTBA 2VRCA 3LXMA 5FO0A 1H2YA 5F2OA 4YCSA 2DLNA 1GPBA 2AEEA 2HKIA 2LNDA 1IDOA 4FDUA 4LQ4A 4KFRA 3EARA 4OXRA 3E5MA 4KPFC 2D00A 1H6DA 1ODIA 3HO8A 3MN1A 5MN5A 2E4ZA 4ZANA 4DLAA 1DX4A 4JKYA 3JASA 3GFQA 1F2TB 1DO8A 1OXKB 2XDYA 5JD4A 1JLLA 5B1HA 4XYEA 1XROA 1YVPA 1PYDA 2VF5X 4Q4JB 2IU3A 5BVHA 3GRVA 1BXGA 4PLZA 2TYSB 5KSPA 1Q21A 3NB0A 2WF9A 2YMQA 4NU5A 3EGCA 1GCGA 3OVMA 4X3OA 2OA0A 1IRXA 2WHQA 3HJBA 1H4VB 4H0NA 4M6WB 4QNMA 4Z8YA 3GLTA 2D7JA 4IYRA 4ZAZA 3UNXA 1B42A 2OHIA 1OMOA 1QUEA 2CF6A 1ZNZA 3P9QA 2H1CA 3TZ6A 5CDFA 2F9FA 3U4DA 4WINA 5KX5F 2GF9A 2OC4A 1PWZA 4M4SA 4MPDA 1ZL2A 5ICGA 2QBYB 1O8BA 3FPJA 3ZNOA 1QHFA 3OC0A 4YQFA 3LQ1A 3WBKA 2PXCA 5EWJA 2PIAA 1L7AA 4AO6A 2O3UA 2JGJA 4MS3A 4LGMA 4PEVA 4HGQA 2PANA 3UK2A 3KEOA 1E2JA 2VH2A 4TMYA 2I99A 3STHA 5ECYA 2A5YB 3VH3A 4S05A 1D5WA 1E2FA 3B20A 2Q7DA 4ZDWA 5C7IO 3AIOA 3N8KA 2PJZA 3AHCA 2A1UB 3F7MA 2VP3A 3C2QA 3WGQA 3DF7A 3COPA 4RMNA 4REQB 3HABA 2DKNA 1L5GB 3KALA 3VTFA 1UJMA 1NTOA 3N8HA 3ZWQA 2ST1A 3M4ZA 4KWIA 1XLUA 3GD5A 1WZEA 1Z4QA 4P84A 4ZCSA 5LKRA 1ABBA 1QMPA 2PCLA 1M6VB 3LGSA 4XUEA 1DG9A 1ZHHA 5TF0A 3TJRA 3ZDAA 1AUOA 3HR7A 4EVRA 3VTAA 1IDN1 1KK1A 2YY7A 2XPCA 2R8YA 1NL3A 1SOVA 2EFGA 4AF8A 4D4JA 5BR1A 5EL0A 1VPVA 4JB2A 3U3KA 3T94A 3TEMA 1DKNA 2IFTA 3DVAA 4IEFB 3E0QA 1HT1E 1X8XA 3LP5A 3P0HA 1HV8A 1GQQA 3EDMA 4PG6A 4C22A 4ARZB 4W9NC 5B30A 1GCUA 3NBKA 3BORA 3PFWO 3KR0A 4B7CA 4BP9A 2J0QA 3RC9A 3TI9A 3MC1A 4OHPA 4C7XA 4H6VA 4FR5A 2BKUA 3FTEA 4LK3A 3W4JA 3RHSA 4H2DA 3GLUA 2QV0A 2HA0A 3A8TA 1C5KA 4C43A 1U0RA 5J4HA 1FQJA 3HSKA 4CIDA 4ZAXA 1RQRA 3SR3A 3LYAA 2I4IA 3AP1A 3SZLA 1JDPA 1ZGCA 5JRZA 3M6VA 4D97A 5CGZA 3EXAA 3ZIAA 3O8CA 1AB6A 4IZOA 2NACA 3DBLA 4LZAA 1CUEA 2WSYB 4Y30A 3ANMA 1J5EB 1H2ZA 5ERGB 3AXTA 2CLLB 2Q3FA 4G85A 2GD1O 4JYBA 2WSSA 4GWLA 2V7PA 3WJ1A 3X1JA 3ZWXA 2QMYA 2SBTA 3UF0A 4ZU3A 1T6ZA 4BFLA 3C39A 4CCYB 5JO0A 2CL6X 4KOAA 2C9YA 3DVSX 4LRUA 1P19A 1IYZA 2GCGA 3V4SA 2WLTA 1WAMA 1H8HA 2HA7A 3IB6A 3LRPA 3HKEA 3ND9A 4MGIR 3TQCA 3V4OA 4F1WA 5AVSA 3W5BA 3WMEA 3FRJA 5EIOA 1FDIA 3QLVC 4P93A 4FZJA 2C00A 1BW9A 3CO0S 5H3HA 3VR6H 1PEYA 1RQGA 3PC6A 5DFAA 1RI1A 1NPYA 1Q92A 1LVUA 1TJPB 1CY7A 2Q2WA 4YV7A 1R64A 5MDHA 2YVAA 1P4HA 2IZOA 2C31A 1XDGA 2VKTA 2H51A 3T12A 3H2KA 1BRMA 3O2NA 4A92A 3DCJA 5FWNA 5JMWA 2LCFA 3ZDDA 1NV8A 4YS6A 3HM9A 5EMNA 2FW1A 3M3HA 2NZWA 4PQFA 4REMA 3EZLA 2JJ2A 3OQPA 4X1YB 4LPKA 5F76A 1UF9A 3W6ZA 4J43A 2C4HA 3GRCA 4BX9A 1CU1A 2IX9A 3PUVA 3MWEB 4L22A 2QN8A 4DNOA 1ZESA 2XWPA 4YV2A 2P40A 1E3DA 1NG1A 2BP7A 1HEIA 4B44A 4EPRA 1FOEB 1YRBA 2LWIA 3GBVA 3QX7A 4TLCA 4X8HA 1C9EA 1F7UA 1PD0A 2VUHB 3BZBA 4DDHA 2PRYA 4CTMA 4IF4A 1EQ2A 2ZAMA 2Q4DA 4FUTA 1Z7EA 4UM8B 2KYRA 3PE3A 3REQB 1R2QA 4RTPA 1IBCA 2GEUA 3TNFA 3I2GA 4CYMA 1MO4A 3G9QA 3BXHA 4I81A 1UOOA 2E18A 3AUKA 4A91A 1NAHA 1Y80A 1U04A 4CG3A 4DSTA 1DT5A 3ADKA 1B8PA 5E6UB 4E5UA 1BQ3A 5FP0A 4U2DA 4WGGA 4CTOA 2XVMA 3I01A 2GN4A 4DHWA 4EFLA 3DL4A 3IOYA 1Z4JA 3FVTA 3KR1A 3NRJA 3PYXA 3EBLA 2QAGC 5AQEA 3QU2A 2J09A 4CW7A 4QJ5A 2J0EA 3QLEA 1B8OA 1F3LA 2J1LA 3M7IA 4YMSA 2GI4A 3DR3A 4J94A 1ABEA 2BCJQ 1NYLA 2WSBA 1WE2A 2GA9A 3CTPA 3E9DA 3JS5A 4L4SA 4S3MA 3VQTA 2WY2D 3BFXA 1RLUA 3ZY2A 4NOMA 3WIBA 4YJ3B 4W5NA 4WOPA 5LWHA 1PU2A 3HYLA 3LHDA 4HDRB 4MHSA 4C7VA 2A33A 4ML3A 4GPTA 4LI0A 2NZVG 4OHXA 4OM7A 5KVCA 2DETA 4JVMA 4TUYF 3RU9A 1HNWB 5BRJA 2QUJA 4G5OA 4NABA 5IEBA 3SYNA 1S6YA 2UZ4A 3K73O 3LWDA 4F2HA 3L1KA 1NBEA 5LQAA 4AG3A 5J1TB 3IT3A 3NRCA 1UOEA 3EDOA 1PZHA 1XQ6A 2JI8A 2JIQA 4PLHA 3KZCA 4G1BA 5FOWA 1SOAA 4DIBA 10MHA 4LOLA 5CA1B 2HU8A 5DP1A 1I01A 1A9TA 4GR5A 5GIOE 2DZDA 4H4DA 4M0MA 4GZMA 3DOIA 5DGXA 1PR3A 4GNKA 5F2EA 2GFQA 1T9GS 3LY8A 5IM5A 3G82C 3GT3A 5CFLA 1TEHA 1MB3A 1PI3A 1OU4A 2XUIA 2JFUA 2JIDA 2QR2A 4E70A 3R5KA 1OFHA 1XFAA 2KS6A 2O0JA 3QXSA 4ESEA 3VNQA 1XMVA 5EMJA 1EA5A 1YIDA 3DSRA 4B2IA 2UXCB 4J7XA 2ZJYA 1GGKA 4LGCA 1EBUA 3D6UA 2VNHA 1WY7A 4R9RA 4BYGA 2EFDB 4Q4LA 4Y0NA 2FSPA 3BPSA 3G1UA 4L5AA 1Q83A 1JSRA 5DHRA 2X3YA 3CUTA 5ADHA 3KG2A 4YGYA 3R24A 4G5GA 4YHBA 1OAAA 2QU8A 3RTCA 1FFHA 2ORWA 4I08A 4GMGA 1IM8A 3ZWDA 2V3WA 4UHDA 2XCSB 3PQ6A 2IP1A 2XEDA 3R40A 4HGRA 4IYJA 2WD7A 2IP4A 3K35A 4KWCA 4ABTA 2QUBA 1KBZA 2R7LA 2IUTA 4G8CA 5EPOA 3HWX1 4DB4A 4B6RA 2ESRA 3GLKA 4J0KA 2ZB7A 5JU6A 5H80A 2QGNA 5H16A 3TKLA 1V96A 4YJFB 3QVGB 2PFSA 1VSBA 1I6WA 2QTVA 1PG2A 2ZTVA 3CF6R 3IMGA 2VAPA 5LFAA 2FPIB 1GCIA 4HBGA 4MV8A 3KB2A 4QX6A 2YHAA 3KKMA 5AVUA 3NQ41 2CFRA 1XG5A 1TX4B 4PG4A 3CKKA 4NK4A 3QPBA 2JJ1D 3B70A 4F93B 1ZXLA 3Q85A 5AW3A 2XHZA 1I0LA 3PQ8A 4O63O 3BS4A 5JZSA 3KSMA 1TZBA 2YJ3A 4M36A 4P3NA 2J48A 4NU0A 4BMNA 1O95D 4N7BA 4PC3A 2JFQA 2ZWPA 4YCLA 1THMA 3WFZA 2BFFA 3PXAA 3EEIA 3QUAA 1W9MA 2PPVA 2C77A 3B5IA 3QLVA 2DXIA 3CE6A 2QJOA 4GM0A 5DOZA 5B64A 5IXYA 1MB2A 3DFMA 4S24A 1QANA 2FMFA 1N3YA 1Z6QA 1AGPA 3EA4A 3AVOA 4AQYB 4HH4A 1EXNA 4DA8A 2NTJA 5AKIA 1JE0A 5B7NA 1VJRA 6NULA 2BMDA 2PVPA 1J5PA 3QGMA 1MH9A 1WULS 3B5EA 3OEHD 4TKMA 3HMQA 3T0IA 3TZCA 4UOEA 1JDTA 2YJ6A 4NV0A 5AJWA 3VKUA 2YYSA 2XGJA 1YV9A 4CLXA 5AWFC 5HKOA 2VQ6A 3B85A 1SPXA 1MO2A 1NBOA 1Z2EA 2E4WA 2EDAA 2ODNA 1RZUA 3AM5A 3PYLA 2Y0DA 2F8SA 1QVWA 5ESRA 4D74A 2BHRA 3C5CA 1VRVA 1JHZA 4EW3A 3LGXA 1IY2A 1OE0A 1Y81A 5ES3A 4D4GA 1RYDA 1UWCA 3W4IA 1YZGA 1RAEA 5GQSA 4C9BA 1W0CA 2NYVA 3F98A 4HLCA 5ILQA 3X2EA 2FEMA 3FRIA 4XGIA 3UATA 4E1AA 1W35A 3CSUA 3N2LA 1BOOA 2JDID 2WVAA 3S99A 1E6MA 3PHLA 3HA5A 3IUEA 3VR5D 1GPH1 2IW3A 5JCPA 4Y0AA 1POXA 4ALJA 1TVCA 1Z2PX 3ESYA 4PFJA 5FLEX 3RHFA 4EY3A 5LYJF 3OZTA 3CE9A 3DZ8A 3NORA 1XJQA 2P1ZA 3PDHA 3RJMA 1MW8X 4I1SA 3H17A 3MMXA 2H57A 1G2OA 2PGJA 1KJIA 4BNDA 3HKBB 3MS2A 4FSHA 2H9AA 4DF3A 1W76A 4A0QA 2H65A 2WHRA 1E2GA 2SCUB 2HA4A 3PHIA 1H1LB 4TTTS 3TSZA 2WU3A 2HF8A 3GFTA 4E03A 3BMOB 3K1ZA 2DUUA 3B82A 3FUUA 4R4JA 1KVQA 1AUXA 1PJAA 3MFQA 3MJ4A 5KHOC 5ALJA 3E03A 2C2XA 1QQAA 3D1JA 4RU1A 2WFMA 2CKMA 2Q5JA 1FXSA 1T4DA 1SUIA 2ZYSA 2AW5A 3BVPA 1PR6A 1YS2X 1R0LA 1ODKA 1P0IA 2OHXA 3RBZA 3GVIA 5T67A 1HBJA 1Z4PX 3VSDA 4RXUA 2JLUA 2Z2XA 3QE9Y 1ZQ1A 3FNFA 4P5PA 4M8NE 4ARAA 4CG1A 3EPJA 2P0YA 2Q0XA 3PR3A 2Y4OA 1NU8A 1BWQA 2ECOA 3AY0A 4NAUA 1E1CB 3AP3A 3W5IA 3U31A 3FMVA 4MCAA 1NASA 4U9HS 1VE6A 4ATNA 3RAEC 4DEVA 1NW9B 2V4ZA 1ADYA 5EHNA 4AKGA 2NUPB 3ELBA 1GXSA 1V45E 2FQWA 1XYYA 4RK5A 2ID7A 2WTAA 5CX4A 5ADUS 1DJLA 2DULA 3P20A 4B35A 5FWXB 4URYR 4D4KA 1G19A 2GYWA 3WGGA 2HK7A 3WB2A 4HVCA 4M0DA 4P5EA 3OZVA 1SD2A 3OF5A 1X80B 5AK4A 3A26A 4ZVKA 3ZU2A 2HDHA 3SIPA 3MK31 5FBWB 1G21B 4I8IA 5IRCD 1D7OA 2AH5A 3FOWA 4RHCA 3U7GA 1E0KA 1LF5A 1Q1GA 3EVAA 1A9ZA 4YYEA 4DANA 3EMDA 2HN9A 3WZMA 3FTPA 3IO3A 1R5NA 4KIGA 3BULA 3D81A 2O59A 1T13A 3N6RA 4Z0PA 4IUDS 4QXPA 5FIUA 4F7WA 5IC4A 3U56A 3BTOA 2XNSA 2R8EA 3A2NA 3MOGA 3LPNA 4EWLA 5IN5A 4A8JC 2OAGA 3C24A 5CFOA 2D1QA 1ZVQA 5EJIA 3UA3A 1B0UA 1WM1A 3HK2A 4B32A 4OLFA 1ENOA 1JIKA 1E2UA 1JH8A 3AU9A 3T4XA 4GOMD 2BGGA 3D3WA 3MF4A 4QBFA 5BN4B 1SCBA 2JJ1A 2NXCA 1TKCA 1KBOA 3N0RA 1RXYA 1YU9A 4QPNA 2HD4A 1TD9A 3RADC 1O6CA 2IH5A 3K3PA 4OA5A 3I2KA 4NYIR 1I4LD 2RGCA 1JG2A 1N9KA 2ORVA 2OXFA 3ZTTA 2KBFA 3N0WA 1FJGB 4GL2A 4RQUA 1G66A 4QWMA 4OXQA 4C7MA 1C50A 1UZMA 4UNRA 3B6KA 7GPBA 4XIJA 1O95A 3GPBA 5CA1F 3LF1A 1E58A 2WDPA 4J3JA 3ZWBA 2PUTA 1BS9A 3JQAD 1JHXA 2JEZA 3N1UA 3QE0A 5IJ9A 3EEQA 1ZCFA 3B6ZA 2O8CB 2PT7A 3AF2A 3AR7A 4UUAA 4K8OA 4RAOA 1EYZA 1VPWA 1AJEA 5CXQA 2PEYA 1FVFA 4KPUB 3R6GA 5FI3A 2IP2A 1Y4AE 5IBQA 1XRLA 3CRZA 3EQ8A 4A5OA 3DYIA 4HZUA 4JB8A 5EE3A 3WGUA 4K28A 3VJRA 1N5OX 5E9JA 3O8BA 4TXNA 4YIKA 1LNQA 3ECCA 4ER6A 1SHTX 2W8BB 1VL1A 2OWEA 3IXLA 3OEHA 4JOSA 2BMEA 5B1DA 4LHYA 1VMKA 4H3KB 3TH5A 2R6FA 1U2GC 2ZUUA 3TOCA 2CCGA 4PNHA 1I0ZA 4AF6A 3I0ZA 3L6BA 5F78A 4MX8A 1P62B 2WI8A 2B8EA 3KE9A 3NALA 3PRKE 2DTDA 4V02A 3H3JA 1JEQB 3NDJA 4FBGA 3UJ6A 1QGUB 2PU7A 4IRMA 3GJZA 5F35A 3TAXA 3BH0A 1OIWA 4BNNA 1J06A 2G9NA 2I2WA 3RVNA 1BQEA 1CJTC 1AT1A 4BLOA 3W3AD 4XB6B 2V7GA 3HS3A 4RELA 1CS4C 1NBHA 2QMQA 1EVYA 4BNIA 2JDIA 3HCWA 5I7AA 3AESB 4NJMA 5F12A 3TLXA 1J9EA 1P2BA 3T06B 3VR5A 3E8MA 2PFKA 2DRIA 2C59A 1SD5A 2CLEB 1VHLA 2GB4A 5JWOA 1KRHA 3KPUA 4EKNB 3MINA 3SMQA 4B80A 1HDXA 4LZOA 1KZYC 1BA3A 2YWEA 2G5CA 3GA7A 5A9TA 3TZEA 1ZIYA 4ABYA 1XVVA 4F06A 4FMDB 4XB2A 4FM9A 4G84A 3ESXA 3JD0A 3B6MA 3P9KA 4KQCA 2P9HA 2ZQZA 1RACA 4Q9NA 5SZJA 2FSHA 3UHPA 2X2OA 2ZUBA 2XYGA 2XWJI 3CZMA 1Q1QA 3D4OA 2R96A 2AN1A 2DR3A 1NMXA 4D3XA 4AJLA 1IZYA 5F21A 4AJHA 1QBKC 5KYXA 1TQ6A 3IDOA 1OOEA 1KVUA 2O2SA 2X4IA 3NC1C 4YR9A 2JBAA 2JGLA 3EXIB 3EC2A 3ENZA 4DLTA 5COAA 2Q0QA 2AMVA 5T4HA 4EAQA 4MUNA 3ESRA 3KDSE 2Q9BA 4DVGA 4MSUA 3ZW7A 3GPIA 4EECA 4MW9A 4LJ4A 3PNVA 1AQNA 3W7BA 1PEKE 3IQHX 2YCBA 4ITRC 2WKWA 2H18A 1NUTA 2I62A 4URVR 1IONA 1XTSA 4Q05A 2G1KA 1Z47A 1LC3A 4F4FA 1M83A 2ZETA 4P3XA 5JUWA 1YQUA 1Z4LA 2A94A 4X7PA 2AMFA 4FP9A 4K46A 2XV1A 5CFQA 4OU4A 3BKWA 4G1UC 5BSWA 2WYOA 4F1JA 2NAPA 2VNAA 1HTTA 1F7VA 3FNBA 5LOVB 1DC7A 3JU3A 1IG0A 2O8BB 1YBMA 1J97A 4RHYA 4Z1OA 4C0LA 4U2CA 5KJFA 3IOEA 2XD4A 4D0LB 4US1R 3QYJA 2FCAA 3WYNA 4XFJA 1QU2A 3CEJA 3ZWAA 4IMPA 5JANA 1JLLB 1Q7TA 5JQGB 1WMAA 1E89A 1W8IA 5JALA 4I3FA 2V6BA 3X1XA 3DFFA 5I47A 1BXGB 4HGNA 2AMYA 1JV2B 2JLAA 3S44A 2MYPA 1SR8A 2IYWA 4RPLA 1WTAA 5PNTA 4ECAA 1KP9A 1SXQA 3E18A 1VZ2A 4JLJA 4N4AA 1IHYA 1YUMA 4EELA 1FSZA 5K3DA 4LJSA 4QSMA 4BWGA 1PL0A 1PK8A 5NULA 4KMRA 3HEAA 2DHRA 3HA3A 5INTA 2V9CA 1P61B 4KYTA 5JYEA 2HMVA 3AF1A 1ZKDA 2O1SA 1E9VA 3H9EO 4G01B 4OOEA 3DAOA 4YREA 1TM4E 3QVOA 5JIBA 4L9AA 4N3CA 4YT4A 1GKYA 1Z5VA 4EYEA 2I1WA 1NQAO 1VIDA 3HM2A 4OI1A 4HAUA 2W48A 1DTWB 1KAGA 3NV7A 4JMLA 2BZ0A 1PBNA 3PSAA 1LZKA 4YMVA 4FHGA 1QHIA 1Y9JA 3UJ9A 5H8WA 2BDEA 3K8ZA 1Z0UA 1OZFA 4BC1A 6ABPA 2D1TA 1BGXT 5TVGA 4ISBA 3P2IA 5A71A 3KFLA 4A10A 5K4GA 1SXIA 3HKDA 1W47A 3FCEA 3QLUC 1A4XA 2GBIA 1JMKC 4XUGB 5JSFA 1P1JA 3QWAA 1E7RA 3JQAA 2EKPA 5IKOA 1DQRA 3LT5A 4X00A 2AV6A 3MJTA 5DBEX 4EP1A 4ID3A 1VHWA 2R25B 1YDGA 1SVLA 1TK9A 2YOGA 2IDMA 2ZIUB 3DNMA 3KJEA 4Y6SA 5LM3A 5EKTA 1NA5A 2Z1NA 3WG9A 1V95A 2GZDA 3RRNA 2GEDA 4PAQA 4I4CA 1W581 2AOUA 1DAKA 3GRPA 3ZIUA 1YOVB 1EP9A 1P5ZB 2XMZA 3SF8A 4OQMA 4N49A 4CFYA 3KEQA 4X94A 4FQ5A 2MCFA 1A7UA 2B4QA 3KELA 1USWA 4HMOA 4HFJA 3TX2A 1Q1ZA 3O8RA 1I2MA 2DUWA 4PRZA 1GPYA 1E4VA 4Q39A 4CRWB 3DLHA 4MRMA 2I87A 4LYDA 1NM5C 3HXPA 3KPWA 4K9RA 1PEDA 2M32A 1JECA 1NNSA 4WXPA 5TDHA 5KYKA 3GFFA 2QTMA 3CUEF 3N53A 2QYOA 4A82A 1OYOA 2QLJA 4IS2A 4MA0A 1KZ4A 2ZYTX 5C2JB 3FWKA 2YUIA 2VSNA 3TUZC 4GDFA 4P3OA 1J25A 3W3AA 1R5JA 3AK4A 4H77A 4XWWA 1U2GA 4GOJA 4C14A 3DBLB 1LDBA 3I2HA 4GAEA 1RAAA 1XXLA 3HKCA 1Z33A 1Y1RA 1IIRA 4C87A 1IN5A 1OXSC 3FXAA 4P92A 2Y66A 4DMFA 3JWGA 1OA1A 2ZJ3A 3F67A 4G5SA 5E0KB 1ONSA 3TECE 2WILA 1IZ7A 2EBFX 4NJEB 1NWHA 4QHSA 3G2OA 4ZI2A 1VIVA 3PQCA 4OXKA 1WPRA 4I4LA 1F14A 1GGEA 1N5MA 1YZ3A 1NN0A 1BEZA 1MX3A 1YKFA 4FC7A 3R3SA 4X6UA 4KQWA 4M83A 3QF4B 1N1DA 3BB1A 3BWVA 3OJWA 4MUEA 1OBVA 5CH8A 3H2IA 5K51A 1RRVA 4JEHA 2QSUA 1BW9B 4F2DA 2X1HA 4Q02A 5MFZA 2IC5A 2JI6A 1BG6A 1OAKA 1QP8A 3GV0A 1X2EA 2WZCA 1MVLA 2PH1A 3S3TA 4ZGGA 1TJYA 1CY2A 2OBFA 1P75A 1E61A 1AHPA 4IEEA 1CJCA 3GGCA 4AYWA 4J29A 5FX2A 4GRDA 4YT5A 3R5XA 3KEMA 3I6ZA 4QODA 2EKBA 3S68A 4Q1FA 3RWMB 4LSZA 3T3MB 5BSEA 2XGMA 1TCUA 2CFOA 1CQPA 3ZHUA 2WUGA 4BV9A 3JYQA 3OO0A 2R0QC 1AKMA 2Q1UA 3GX1A 4YLGA 1K06A 3IEKA 4BFZA 1SG6A 5FPYA 4Q7MB 4AIRA 4DQXA 5DGDA 3KZOA 4R2WA 3RS5A 3W1EA 4CKBA 3N6VA 5A4AA 1H9CA 1MDBA 4RA6A 1KQNA 4GBJA 4V1CI 5DK4A 1CD5A 1ZW1A 4UD6A 4G23A 1HZJA 3FX2A 5ALRA 5KTKA 1XK6A 4P9NA 3L7CA 3FZNA 2VHJA 4FTWA 1GTSA 4C03A 3A3PA 2I33A 3H86A 3PUWA 1CUFA 4CIYA 3PDIB 4NYMR 4L4ZA 2IOYA 3H9QA 3FYUC 3OTGA 5DLDA 5F5LA 1RXVA 1M7GA 2YFHA 1M8JA 3OX2A 2HYIC 5KQGA 1H2HA 3IOMA 4IUBS 4EHJA 1Y9EA 4I46A 3L4BA 1N2CE 4HEHA 3P0EA 1IOWA 1FFXA 2PUWA 2FE4A 3A9WA 3P9YA 1RDFA 2UUOA 5EUMA 1YB1A 2PX8A 4Q5IA 1Y7LA 5DTEA 5JYBA 4RETA 4ZV9A 4P4NA 4EG8A 5HNKA 1DX6A 1EFDN 5G3YA 1I2ZA 4C0QC 1I94B 1CR4A 5IZCA 2OD7A 3FGPA 4Q1CA 4IIHA 2FQQA 1L8QA 1P4GA 5J58A 4KAAA 2JFNA 1DC4A 4NEGA 2FX2A 3QEJA 1LDNA 4C3ZA 5BMVB 4LVCA 2DMRA 1ZGGA 4G5HA 4QGHA 3ZG6A 3ZY3A 3MT8A 5G53C 1LGYA 3NFYA 1OLXB 2JAQA 2EJVA 2L2QA 4M76B 4AKSA 4D9JA 3E58A 2X5OA 3MOIA 2ODQA 1GQFA 1P6XA 3DTNA 1Q3HA 3A1TA 3ZNPA 4QRDA 3C8MA 2I4OA 2CNOA 4LUCA 4N0PA 1AUVA 2FUKA 4CQLB 1XEFA 2O05A 3BL8A 2B61A 2FN8A 4KFTA 3TD6A 1TXGA 5FI5A 1PRYA 2VF8A 4L3VA 1IUOA 1VL0A 4PY2A 2HZ7A 1XPJA 1PT8A 2PS0A 1BMQA 3HU1A 2O1WA 4WLNA 1ZJ6A 1C41A 1W85B 5LYJA 2E48A 3CN9A 4TGLA 1HE2A 1OUMA 2O2EA 3F1KA 4P7FA 1COWD 4WA7A 5DBFA 1XCPA 1XVLA 2BFAA 2G28A 2BJWA 4IIUA 1DIBA 4NCJA 4PFSA 4R1TA 1N57A 4U5QA 5FTNA 2RGNA 4PRLA 3STXA 5J4VA 1S96A 1WUIS 2I6QA 2WU0A 1ONOA 2FMHA 2OG1A 4P4LA 2B9EA 1UZNA 3QEOA 3QLUA 1E96A 2Z30A 2IUYA 1RHJA 3R4VA 2AG6A 3UWSA 2Y76A 4HAXA 5LOVF 5EP1A 1JG3A 5H3CA 1UOQA 3TFOA 1DG3A 4F9GA 2IHYA 3ZHQA 1Z36A 1STOA 1I1QB 2DKFA 2GF2A 2GBLA 3SXJA 4H4CA 5ALKA 2IXEA 3ZVKA 4NPHA 3EZ7A 1R9NA 3F6PA 4ESHA 3HNRA 1H05A 2ZJBA 3L9WA 5BSFA 3B12A 1YQDA 2FWMX 3CH4B 4M21A 1PSDA 4DLPA 3NDBB 1SC1A 2OVFA 2C2BA 3MQ4A 3PEVA 1Y89A 4L5BA 2A84A 3B7WA 3D7MA 2FCRA 3O21A 4FOPA 4ZCQA 3RYTC 3ZOZA 1MRZA 2G6BA 3RAJA 4PIPA 1HNXB 2E21A 1KMQA 2YCLA 2XRZA 3V3TA 2ZE7A 3HCRA 5FRDA 5BQ3A 3F5MA 1BWPA 1CYDA 2VFAA 5B36A 4HH1A 4XQEA 3VDNB 1IK4A 4FC6A 4HQKA 4Y2PA 2FDCA 3C4VA 4HYYA 2FN9A 4ZVTA 3FAZA 2AJCA 1NSTA 2HK6A 2ZYGA 3KHSA 2QZJA 1ML4A 2YVLA 3JD2A 1CK4A 2RHMA 1CQZA 2RHGB 1D2GA 3AUTA 4KV7A 4EO9A 4KBFA 1GRQA 3IIJA 1NE2A 2GM3A 4M1OA 4G0QA 2H29A 5K0FA 3OIYA 3AKDA 3DE5X 2XQIA 1NXXA 3AR8A 1PG5A 2AK3A 1MEEA 4AZVA 4BMOB 3TZLA 4PHHA 1QDLB 1R0KA 1RRPA 1T29A 1PGOA 1WJGA 2YYYA 4MQFB 4NONA 5HIIA 4CF5A 2LRHA 1B6RA 1F0YA 1HRKA 2NO6A 1XDZA 3HY6A 3AW9A 1ZBDA 2HQOA 5I7FA 1OI7A 4JQZA 3IAS6 3FTQA 3RVMA 4B45A 5MHTA 3CNOA 1K3FA 1KFJB 1GAJA 1KJNA 3H65A 1NQ5A 4QDOA 4UHFA 4ZQGA 3ROQA 4OMCA 2XB2A 4Z4QA 1S2OA 4RDHA 4IW3B 3RM3A 4D8XA 3T5AA 1ZIDA 1K2WA 5BNFA 1U7WA 1OZ0A 2QVZX 3OOWA 1U0TA 3NHKA 1PR4A 2YVKA 3M70A 3M1AA 3W3ZB 1R10A 1BVYF 3KVRA 2X8BA 3QOYA 2B98A 3UCFA 3SK0A 1B2LA 1DFIA 3L7DA 3RS7A 3X0DA 4HX5A 6Q21A 4ARCA 3ZHXA 1TT7A 4DSZA 1G20B 3Q7TA 2P4HX 4ZEXA 1EVKA 4CMAA 3D6VA 1N3BA 1M6EX 1V8DA 2WYIA 3HVJA 4XQ0A 5IDXA 1FB5A 2BEVA 2Y93A 4DDTA 1ZOIA 1NZDA 4RE5A 1JDJA 1GPNA 1P17A 2I65A 5FJJA 1Y6RA 4BQSA 3W34A 3DUWA 4TQGA 3EEYA 1EFTA 1T3HA 1ZK0A 2EIHA 3IKLA 3GDWA 4LIPD 4J6EA 4R54A 1K3UB 5DF1A 1XNJA 4ZRDA 1G8FA 2X6RA 3W2EA 2WM9B 2DQKA 2I8CA 3CU5A 4XLTA 4A0HA 4CU2A 4BVEA 3PHHA 1GAXA 2C20A 3G9TA 4EATA 1Y6GA 3JAKA 1IRIA 4V2IA 5FBHA 3WMRA 1W44A 3EFOA 5IDWA 1A77A 1QF7A 5JQWA 2VKQA 4JHLA 4MV7A 3VZDA 1PJBA 2WJJA 2OZPA 3GPCA 4I1PA 3VUFA 4FKZA 1DIRA 4IV5A 4X64B 1PBTA 1TUIA 4G8JA 1KMHB 5CCBA 2GPYA 4QDKA 5TT1A 4NNJA 1UJNA 5BSRA 3NHFA 3NV9A 9ATCA 1K27A 3EGDB 1Y3HA 3CB2A 1CLUA 1CS0B 3UAYA 1C9MA 1OXBB 1WVIA 4BNDB 2N1BA 4QBIA 1NHGA 4R1MA 4YJHB 4CM4B 4BFSA 4OFZA 4CQNA 1YZLA 2BHTA 1ZXXA 1C8KA 1EGHA 1FYEA 1X1QA 4OI2A 1J07A 4B71A 2GLXA 4IDCA 4KHPB 1U9ZA 4J75A 3RQSA 3U7QB 5ITSA 2QAGB 5K2OA 3GEBA 1K8ZB 3C98A 4YCMA 3HDYA 3JALB 2PT6A 3AJAA 4QDZA 3COZA 1BHO1 5HA5A 3ZY5A 4AJJA 4C5CA 1I3LA 4OO3A 2RKBA 2DBZA 4RF3A 4MWSA 4TKLA 1VRCA 5C7LO 2HSZA 1ZI6A 3CS3A 5DSXA 5GWXA 3O4RA 1COWA 1QM5A 3HI6A 4UREA 2A9FA 3LVBA 3ROMA 1K8RA 2XTNA 1W1WA 1MO5A 1WKCA 1KH1A 2G08A 2NYAA 1X0VA 3L8CA 3RS3A 2BEWB 3P2MA 4A73A 4EJ0A 5CLQA 1KYWA 3IP1A 4BVJA 3GRKA 5BNWA 2V1XA 5EZSA 4F21A 4CMKA 5C32A 1J0CA 4WK6A 4Q18A 2AG1A 5DK6A 5KOIA 3ROXA 3L82B 2WUWE 3FKQA 3AVPA 3K5WA 3PTLA 5BSTA 5F7OA 3VNVA 2OV8A 2YDYA 1O6GA 4UDOA 1GVNB 3Q8MA 821PA 3GUYA 1ZEJA 3GVHA 3HGQA 4IS3A 2EW2A 2GOYA 4JYPA 2ODEA 3WLNA 5JRDS 6PFKA 1E3LA 5A4FS 5FI1B 1BYIA 1VHJA 1W0JD 1R9JA 4XX1A 2BFWA 3VHLB 1OWNA 1U9YA 1YVDA 5KS2A 2XMCA 1NF8A 5TQ2A 3FOZA 1KKLA 3PQ4A 1EUCB 5F4BA 4DILA 3TRIA 4GWKA 1NN3A 5EI5A 5HKAA 3OSZA 5C80A 4WGFA 1AKQA 4PGGA 1P0CA 3LUPA 4DBLC 1AB5A 2AXPA 3IQIX 4JGBA 4M9SA 4TSKA 3VBCA 4EFKA 1ZD8A 1I7QB 5JS7A 2JLZA 2O7RA 3AVTA 3OD5A 1HMPA 4TV8F 1GAEO 2PKXA 3AIMA 1M1XB 4ZQCB 3LWZA 1GNPA 1K9SA 3INRA 4G4IA 3WV4A 3C0KA 4PYIA 2B78A 1U98A 1TW3A 1XO1A 4RTJA 1ESMA 1KY4A 1QDEA 2F62A 4NNPA 4YAJA 3SM9A 4AD8A 4HWOA 4FLEA 1R8SA 5F52A 2EWVA 4CG2A 4S04A 1P45A 3CEPB 3HVRA 1W52X 2QTFA 1QGAA 3CLHA 2OQVA 3WGJA 5K8VA 1P1KA 1ZN9A 3EOAI 4FWTA 2J0UB 3DDWA 1IZZA 3OPYB 3PQEA 2OYRA 3GLFA 3DT9A 1RIIA 2QYTA 4FU0A 4KGVA 1A9PA 2BFBA 2XTJA 1OV6A 1QFJA 3EZGA 3V2HA 3WYBA 1M0WA 3Q98A 3W05A 1I4OA 4XASA 2APJA 5LDHA 2G5GX 1ZJ4A 3SJBA 4EI2A 3QXJA 3BREA 2V74B 4RJ2A 4GECA 1WCIB 5IJ9B 5FJIA 1C9JA 3CXRA 4C88A 2IY9A 4P5DA 1O6ZA 2Q0SA 3WBJA 4CMJA 4AX4A 4ZEMA 4JOQA 4MKFA 5I7UA 2BJVA 1U3UA 1AM4D 2NVUA 2C7BA 3VMMA 3IESA 2V7XA 4MUAA 4MWZA 2R6HA 2O8FB 3T7SA 3JQDA 1FSFA 3KM0A 2QE6A 3WLQA 3OT5A 1SC9A 2QTNA 2VR1A 3K16A 2ZE8A 1I5OA 2SKCA 4FR2A 2EP8A 4MR7B 1UK7A 3LFTA 3P0JA 2W9XA 1D9XA 4DSAA 1YBFA 1GEGA 5BQPA 2WZQA 3MIIA 1LPSA 2FPSA 5JJCA 3QOWA 2CV2A 1GP2A 2ONYA 1HE5A 4OHWA 4CE6A 1UIMA 1NW7A 4QUGA 2MYTA 3UJ7A 1SELA 3G3EA 4AVYA 3KUXA 5DIFA 2CKDA 2ZFUA 3MILA 3PDWA 1JVNA 4MDHA 3RNOA 3OFVA 4H08A 1GZ4A 1T1GA 3DW1X 5LLTA 1IH8A 3PVSA 2VDOB 1C7ZA 3AUUA 1HG1A 1L3CA 3AHEA 421PA 1YASA 4BBJA 1M9NA 1NQUA 1JIXA 4EARA 3CZ4A 4GFDA 5HF8A 1MJFA 4GD3Q 4B3XA 4BE9A 5E0OA 4LFBB 2I6GA 3O4GA 1V1MA 2H1IA 4O4HF 2HC9A 3NBAA 3E2PA 4F3KA 1T1JA 3RVBA 1DBQA 4LEIA 2JHGA 1RWBA 4MLDA 1A2BA 4MJ3A 2WSIA 3AETB 3R41A 4LKRA 4G6ZA 4EOGA 5CLGA 2C98A 2XXAB 4QNNA 5HKLA 1E6EA 4ONEA 3DLPX 4UM5A 1H2RS 2AE2A 4K6HA 5HIJA 1GTL1 3CBGA 1EK0A 1Z73A 4L73A 3JAWB 5JI3E 3K8QA 5IMSA 2O2ZA 1HDYA 3IP5A 1B4DA 2HCBA 3F47A 1RYBA 4C4PA 5A4JA 4BFUA 2UYGA 4RVSA 3JQBC 5D3MA 5F3DA 4EFMA 3ANNA 5KYXB 1F9AA 1N6IA 4GS5A 2YWGA 3PDUA 5EJFA 3D7RA 3RODA 4BX0A 3U16A 4MVJI 4C7BA 2DUJA 2GNOA 3V4VB 5TLSA 1EE2A 3N28A 4OSEA 4DQ0A 5AJUA 3U48A 4EH1A 4YMGA 3RYHB 1DJOA 1ZUNA 2J4CA 521PA 5SYMA 4UDNA 2UYYA 1PQWA 3T7DA 3VU0A 1TTPB 2DFTA 4Q47A 5BORA 2A0XA 1KPIA 3J81A 3SBXA 3NUQA 3F97A 3UFBA 2AZDA 4NFLA 4Q6WA 4TVKA 5AR1A 3WWCA 1I3MA 3FWHA 4RHUA 3L02A 5DX0A 1AKRA 4IG4A 3CJTA 2HAEA 1GA4A 4M98A 3I6MA 1S2MA 2Z2ZA 1VJ0A 4CV1A 1VSUA 4DTIA 1UCFA 5JAPA 3GHYA 3RYCA 1L7DA 1RLOA 5BMOA 1VLQA 2QM3A 1YO6A 3U17A 2QW1A 1MRSA 1OB5A 2CLDX 1E9AA 4G1MB 2QLFA 3H5VA 1ZM9A 4QYSA 4XSHA 1DO2A 2RG1A 3QJ5A 4DV0B 1D7AA 2WWXA 1FUIA 3EGXA 4BAZA 3TVYA 2VHCA 1W0JA 5DGIA 1VHTA 5TF4A 2QN3A 4UFNA 3MGCA 4F3YA 2XMRA 3O4FA 3PEWA 4PLTA 4OA8A 4EI7A 2QRHA 4QO8A 1Q7RA 3FWZA 2PSEA 3HFGA 3T7CA 1EZ1A 3RVPA 5CVJA 5EJ8A 5GZ3A 3L0DA 2GHRA 3D6MA 1DU4A 4HRYA 2AUMA 1N0VC 1ZPDA 1YR6A 4AUMA 4C0SA 4PIVA 4RWEA 5IK2D 2ZPTX 5KWJA 4ZCTA 1RE0A 1W75A 4Z4HA 4YRQA 5T4BA 2OB2A 4RK6A 3N2KB 1PP4A 5H68A 3BD6A 3BWMA 3ED5A 2DB3A 2H8KA 2W2VA 5JW6A 4U3JB 1GCOA 5EJ4A 1Y48E 1BRTA 3R44A 2UYQA 5ARDA 2VZ9A 4LV6A