2OWEA

Crystal structure of tthb049 from thermus thermophilus hb8
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
b'MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRMYPELREIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ribazole-5'-phosphate phosphatase
publication title Crystal structure of TTHB049 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 62
structure length 170
sequence length 170
ec nomenclature ec 3.1.3.73: Adenosylcobalamin/alpha-ribazole phosphatase.
pdb deposition date 2007-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 2oweA00
2DWOA 1ND6A 1DKQA 1EBBA 1C81A 1RIIA 4ARUA 3K4QA 2IKQA 4ARSA 1DKNA 2HPAA 3MBKA 3OI7A 2P2ZA 3K4PA 2WU0A 3E9CA 3KKKA 4JODA 1C7ZA 1RPAA 1T8PA 2EKBA 3E9DA 2P6OA 5CX4A 4GPIB 1SK8A 3BIFA 2P6MA 4MA4A 4AROA 2PA0A 4IJ5A 1SK9A 1UJBA 1RPTA 1SKBA 3FDZB 2WNIA 5AJYA 3QPVA 3D8HA 3F2IA 5AJZA 1QFXA 2YN0A 1SKAA 2OWEA 1QWOA 4EMBA 1QHFA 2WNHA 3DB1A 5AJVB 4ARVA 2P77A 2P9ZA 2HHJA 1BQ3A 1FZTA 2OWDA 1IHPA 3FDZA 4GPZA 4HBZA 2P2YA 3GP5A 3R7AA 1NT4A 3E9EA 4QIHA 1DKMA 3IT1A 1TIPA 3O0TA 1ND5A 3LNTA 5AJWA 2EOAA 1C80A 1YFKA 4ODIA 1BIFA 1K6MA 2BIFA 2GFIA 2YN2A 3F3KA 3NTLA 4PZAA 4PGMA 3C7TA 4D4JA 2H4XA 3GW8A 4D4KA 2H4ZA 3D4IA 3GP3A 2P9FA 2P9YA 2ENUA 2P79A 1DKPA 2QNIA 5AK0A 3QPUA 4TSRA 4EO9A 1E58A 1CVIA 1BQ4A 2EKZA 1V37A 2F90A 2RFLA 3EOZA 3EZNA 3LL4A 2P75A 3PGMA 4PZ9A 2AXNA 3LG2A 1H2FA 4IJ6A 2HIAA 2I1VB 3ZHCA 2H52A 2P78A 4FDTA 5HR5A 1H2EA 4JOBA 1DKOA 1DKLA 2DWPA 1FBTA 3DCYA 3IT0A 3QPWA 2H0QA 3HJGA 3D6AA 5AJXA 2P30A 1UJCA 5HTKA 3IT2A 4D4MA 3FJYA 5CDHA 1XQ9A 5PGMA 4E3WA 2ENWA 4FDUA 1V7QA 1YJXA 1E59A 3IT3A 4D4LA 3MXOA 4JOCA 2A9JA 3NFYA 5CU7A 2A6PA
chains in the Genus database with same CATH superfamily
3AUUA 1GTMA 2K87A 3W1VA 3RAFC 1ILWA 2QVLA 5PNTA 4MICA 3RRXA 1IU9A 3WV5A 3KZKA 2ZAOA 4HQKA 3G6KA 2VNHA 4WRRA 1C7RA 1JI3A 4XD7D 1IJBA 3CEJA 5TDHA 4US2R 2HBZA 1C7EA 3GYGA 2P3SA 1TA4A 2BI8A 1TADA 5DHPA 2Y6VA 1CUUA 2NZ8A 1RBQA 2RGXA 4QLBA 3HEMA 4ARZB 1EFDN 2APJA 1LLQA 1AGXA 2G9RA 4IDCA 4PU0A 4X92A 3TI9A 2IQ5A 4ZU6X 4D3SA 4PO3X 3A4NA 4Q4CA 2FVXA 3FCEA 3THWA 2IBSA 2W2LA 2BFNA 1PL8A 3RJ5A 1FXWF 1TUGA 1ZH0A 2YXPX 3K5IA 3ZJTA 1T5IA 1GU7A 5JPDA 1E0AA 4DUZB 5EIOA 3GCWA 2GZ3A 3OZWA 3HE3A 4DIBA 4A15A 5JCJA 4GW3A 4E6EA 5JOQA 2ZI5A 1BX3A 1R9NA 3LU1A 4C0LA 4AN1A 4JT9A 1N8SA 421PA 4DJTA 4EA8A 3S7TA 3ESYA 4EYGA 1XNQB 3UJ7A 4NONA 4OB8A 1DCMA 1JKFA 1DAPA 1K9VF 2AA3A 4NP6A 2A9OA 2YZNA 2Q6TA 3D4LA 3QIAA 1CSEE 5FBRB 1K8RA 5K6AC 3QV1A 1U2DA 4E5KA 4HDNA 2JC3A 4FOTA 3N76A 5KZMB 3RCBA 4ZRNA 2J31A 5FI5A 1SUDA 2JVJA 2DT8A 3L6UA 5ICMA 1GOTA 1L1EA 4GLBA 3OT5A 4DLNA 1SUSA 1O5OA 4GQAA 1TVKB 4X64B 4MLCA 1QK5A 1R27A 2QZZA 4TSFA 1WXIA 2LIVA 2GD1O 1GZUA 3GLGE 2OCAA 3L6BA 5AJWA 1JHMA 4G0ZA 1GG2A 2OECA 4PBRA 1NY5A 2WTXA 3V5NA 4QOHA 2IEDA 2JJ1D 3RKUA 1UDWA 1PEYA 1BS2A 4DR1B 2A1IA 1W34A 1WMAA 2H4ZA 2XB2A 3ESCA 3JWEA 1BYUA 3OZGA 4C3VA 5LL6P 3JZIA 3WRWA 2EZ8A 5F33A 1A9OA 3YASA 2FJPA 4CM7A 2AFRA 3GFGA 1W49A 4OFZA 1GZSA 5E6UB 3KUXA 3UMBA 4CIBA 1BYIA 3HB7A 4HDSA 1CC1S 2O3RA 1USGA 3HEAA 4MR8B 4QO7A 5AVQA 3FSRA 1UXKA 2GD0A 3GDFA 4J1NA 1PK9A 4QFCA 5EGNA 1B8VA 3V4LA 2FPIA 1L6IA 4I9HA 1TUIA 3OM9A 3DUFA 2CB9A 3UT5A 3WKCA 2QI9C 4OHZA 4OHVA 2OY0A 4S0ZA 3O4HA 3TSYA 3ZHVA 4DDTA 3OTWA 2D5BA 2O2SA 3PEWA 3UMYA 4CT4B 3AHIA 1JG7A 2M6KA 2QN2A 3NHFA 3LY9A 5CIYA 1KDOA 1N2ZA 3LX5A 2XUDA 3MMSA 4RGQA 3T5DA 1KH2A 4DB2A 2VRWA 3L49A 2MIIA 4CI0B 3O47A 3BGIA 1QRRA 3FX2A 2IPLA 3G1WA 4R2KA 4PSKA 2RGBA 1SCJA 3CG4A 3GMIA 3MFYA 3W9YA 1ITZA 2EP8A 1E4YA 4KDEA 5E6RA 2AEJA 5IC5A 1CS0B 3DXZA 3WNVA 4CU2A 4DOMA 2AR0A 3TZHA 5KSOA 1WRBA 2Y0CA 4ZN6A 4G8BA 1R5NA 1SC4A 3RTCA 1PR5A 2PRZA 2I3GA 3C3MA 3ENNA 1BXRB 2FCAA 3E18A 3KUCA 4JI8B 1L5OA 1RMYA 2XF2A 2GBLC 5KKAA 5CYGA 1JG2A 1JJFA 2K5UA 3LC2O 1JNXX 4J9UE 5FFNA 4KX5A 2F3UA 3DKKA 4PHGA 5E9AA 4BJ5A 3DCNA 1HE8B 2ZBQA 1OW3B 4MV5A 1MOPA 5I7SA 1D2MA 1ULAA 1KU0A 1JPNA 3F3MA 4YMLA 2Z8YA 3FPLA 1Y8CA 1Z2DA 2C9MA 3I01A 4K5QA 3GJXC 5FYQA 3X43A 2A7QA 2YIMA 5ALVA 2A8YA 5BQXA 1PTJA 3MMXA 2WYUA 3LYAA 1GV1A 3K0BA 1D9ZA 5HIKA 2UYGA 4BDTA 4OBBA 2IHNA 1N9GB 1SIWA 2QJFA 4BX2A 3K70B 1FUUA 5JARA 4UUQA 1HPLA 2Q5HA 5BQPA 4QUKA 3SQLA 1LNSA 3PCXA 3UM9A 5BSFA 7ABPA 2CDCA 4NJOA 4O2LA 2BN4A 4AN0A 3DOUA 5KEIA 4CETA 4RTQA 3EHEA 4E5YA 3ZBUA 1B2LA 1WMDA 4IV8A 5FBQB 2WNHA 4G9EA 5LLSA 2DBQA 4R16A 3NJ8A 3LTEA 4Y9SA 5CP8A 2QMZA 2MYTA 5ALYA 1FJHA 3A2LA 1LRLA 1HKHA 2XE6A 3TX2A 1CRPA 1Q7GA 4PC3A 1HQDA 4Q1FA 1FJ2A 1M2VB 1KAMA 4W7SA 3NIWA 5ERYA 3I6MA 2ODWA 5C5EA 1XDGA 3A70A 4JCCA 3VKUA 3N5KA 4JLOA 3C7KA 4R98A 4DNPA 5I4IA 1B8PA 3KE8A 2KQUA 4OGGA 4ECEA 1UADA 1IQ0A 5AKJA 4AECA 3FBTA 1VBKA 3SSOA 3DZJA 1EPUA 4U2KA 1SHKA 1J7KA 2ZRFA 2OHGA 3C8ZA 4P4SA 4M87A 4ROSA 2QRKA 1KFBB 4NF2A 1WZ2A 3H2YA 3TZBA 2D2XA 4CQJA 2Z2JA 1Z0DA 2DLDA 5J43A 2FEPA 5JWRA 5IP5A 3JX9A 4OHCA 5HIAA 2ID9A 3EVZA 4YFYA 5TB5A 2ZGVA 4A8TA 5JCPA 4GP7A 1T0BA 3Q15C 3KTDA 3UK1A 3FBGA 4WL0A 2WA2A 3B85A 1FSFA 3CLUC 1V8PA 3FWNA 1YS4A 3H0KA 3IQWA 1U9ZA 5AW1A 1ZIYA 2WHPB 1WUKS 1WVIA 4LJ5A 4PN7A 1R9JA 4I4IA 4PSVA 2C03A 4JVLA 1DTWA 3HDTA 4FMBB 1G5TA 3KQPA 2P2GA 1KDZA 1YULA 4OLFA 4D4GA 1GLGA 4AQ7A 3FDIA 3L6CA 5DM2A 4C6RA 4HVLA 1NXOA 1TVCA 4FE7A 1TUEA 4JLKA 4F4HA 3OC0A 4EEXA 4Z4HA 2XY4A 1AH2A 1L5RA 3BRSA 3EMDA 5AVKA 4UDNA 1TYZA 5DHAA 3NIBA 3VR4H 1ZR2A 3N28A 4BRWA 1P77A 2F1HA 3CF4G 5AM2A 3ICOA 4QOGA 1Z4KA 1IEWA 4FMDB 4HWSA 1AKWA 1CFJA 3EXHC 1I2CA 1SMKA 3B1JA 3BREA 1S2DA 3AWDA 1NIJA 4BQFA 3L40A 4JKIA 4R71A 4DLWA 3F5QA 2REQA 3DFUA 3K9QO 1CR2A 4FCTA 4P2GA 3HTXA 2FPWA 4GBMA 4PAQA 1XVTA 5AD1A 3MWYW 3JASB 3P9CA 2PWYA 5FUWA 4UOEA 1NYRA 1V41E 2B5OA 4JYBA 1UPAA 5DW3A 3F4BA 5JZVA 4AICA 3C6QA 3K32A 1FS5A 1KMIY 3BCSA 4ZO6A 2VDOB 1DLIA 2W6JD 2WWHA 2B35A 3DMRA 1XZPA 3ED5A 3TLKA 4B75A 2JKVA 5TNXA 5SYAA 3UB4A 3MNFA 1P3Y1 1Z3CA 2KI5A 4U9IS 3UEOA 3WSVA 4HGPA 3IBYA 1MMFB 4B17A 4MVCA 4ZZ1A 1P7YA 3MT9A 3ECAA 2EFDB 1Z6AA 2WM9B 4OJYA 3ZLBA 3G9QA 3ZUGA 4BN4A 4TQUS 3MOSA 1FYXA 2WHQA 3ZHRA 3SSNA 1EP3B 4BQNA 2C4UA 1ZAKA 3IAAA 4EUFA 5KNCH 1KHTA 2XAAA 3FF4A 1DAMA 2XTJA 4Y9DA 4M0PA 5IHPA 5K0BA 1YS1X 1PFYA 4HMQA 1U4SA 1T4GA 3FGNA 4I14A 3HHEA 1H1TA 1FX1A 3Q0IA 4NQRA 4FHEA 4U7DA 3CLRC 2XTAA 2IYSA 4V3BA 2BGKA 2MSWA 3QG1A 4K46A 5GTDA 4JQOA 3VYWA 4KUEA 3WWOA 2OHXA 4YJGB 3QJGA 1CE8A 1J0XO 2WHYA 3Q7RA 3Q8LA 3WKBA 4QVGA 4CTOA 2QPAA 1ISHA 3GT4A 3OZSA 2QKYA 4R2WA 3IP5A 4E4RA 1TI7A 1WY5A 1J22A 4F4FA 2OESA 3IAM6 3I28A 4BO3A 4IDPA 3BD6A 4DSZA 4B80A 2GJSA 3DOCA 1C9JA 1FFGA 4GSLA 4YK7A 4K9RA 5D5QA 4E09A 3NOXA 1S3SA 4LWZA 2JFNA 1TUBA 3GPBA 1NW7A 2Z5VA 3OPYA 4IDBA 5K4AA 4LVUA 3SE0A 5HZMA 4DEXA 3N2IA 2O2DA 1KZGB 2E4WA 2I3AA 4RELA 4YUZA 2YXDA 2FLWA 3OIVA 3TLXA 1AQ6A 5G4LA 4DLKA 3IQXA 2CLCX 5LQRA 4RZIA 3EUEA 3O75A 1KSGA 4OATA 2VAVA 4A10A 1RPJA 3TYXA 4CKCA 3C5EA 3O8QA 4FVTA 1G9TA 4YJFA 3X1ZA 2BFWA 4BLRA 1N6HA 4E2WA 1R0SA 1VYUA 1ZC3A 3FYUB 4OL0A 1R0ZA 1HOTA 1SHLA 1U3VA 1Y8AA 2A58A 4QGAA 5EYPB 4O4HF 4QGGA 1C3JA 2HO4A 3ROEA 1PR0A 3DFFA 1XK6A 1YZUA 4MYRA 4YDQA 3ESAA 3M1LA 5A1JA 2HMUA 2P5TB 5F2EA 3ZG6A 4O1IA 4EX6A 4FT4A 4ENUA 3LUGA 5TT0A 3UWDA 1II8B 2NOAA 4QELA 1ADGA 1QX4A 5D3KA 1OCEA 1Z8DA 3VR3D 4C76A 1LDGA 3FTDA 3J7AC 3D5EA 4HNUA 1A9RA 3CH5A 4JXZA 5ARDA 1HFKA 1A96A 2AMJA 4CV2A 1DKUA 4CM8B 5KWVA 3EEQA 5KHOC 4ZGGA 1GTG1 4MVJG 4JBIA 1YOVA 2D5LA 1IFXA 4DG9A 1JHAA 1L7OA 4JLJA 5CT5A 3QV2A 2EFHB 3B3QA 3GWGA 2WFAA 4WOPA 1ETUA 2ZT5A 1RZVA 3C4QA 1BHO1 3G02A 4MI1A 1JECA 4MMXB 5ALNA 1JDBC 4W5WA 5JSZA 3SHOA 2H1LA 1J2EA 3LVRE 5A5EA 4R31A 3ICQB 1U0TA 2IZZA 2JLBA 3L04A 1OXMA 4CMGA 1M0TA 5CK4A 1OA0A 3BWCA 1FXUA 3RQIA 4DUPA 3W4KA 1UK9A 1YMQA 4YRTA 4DQDA 4OLAA 2E0IA 1G7TA 4LRTB 4PW0A 1M5RA 4BX3A 1NTRA 2QN6A 3DE3X 2HRZA 4NFHA 4EUNA 5DNUA 2YHSA 3B3GA 1M76A 3D3WB 3O9MA 4OB7A 4QPNA 1ECCA 1KYIA 2XWBF 3JAWA 1GEEA 1LVHA 4Y7CA 5FYDA 5BWMA 3R41A 4N5LA 3EQ8A 3CBGA 3UJPA 5FHQA 4C4XA 4RFSB 3U7JA 1O94A 2XXJA 2ZYAA 1ACLA 1E7QA 1JQBA 2CL7X 5KYXA 4GBED 3TDNA 3OZAA 4JC0A 4DAEA 2NU7B 3ELBA 3B6KA 5HS4A 1POWA 2O8DB 1VKNA 5M3BA 2PUGA 4P53A 3NXKA 1AV7A 3CLSC 1NBMA 1PFVA 2QYOA 4HAYA 4IVRA 2ISQA 3K4HA 4HMOA 3PXDA 4F72A 4JB0A 2VFAA 4KN9S 4A0QA 1DADA 1PD1A 4IL5A 5DGHA 5K0LA 3M4NA 4OB6A 4QYMA 1MPTA 3RS8A 3TBHA 3WVNA 1F0YA 3W5HA 1X92A 3FOFC 4CM6A 1SUPA 3KXLA 4B3IA 5JU6A 1JHXA 1QANA 2DUUA 2J9RA 4R2XA 4UJ3A 5KQMA 1DCFA 4HGZA 4HQOA 1OOEA 1KVRA 4QWWA 3K9LA 4G5OA 3CX7A 4I3FA 5IBRA 4CTJA 4CTMA 4KIGA 1ZK3A 4YRGA 3B6EA 2PLAA 3L84A 3PPYA 4AJ4A 1A5SB 3I1YA 3L9WA 4YRBA 1BQ3A 5DE3A 2O14A 4URUR 5J2TA 4CMJA 4YMWA 3SZMA 1D1SA 3SIWA 1NRIA 1E1NA 1SQ0A 3ZQUA 2LXNA 1UEXC 2QM0A 1UAAA 1ZBDA 3E70C 3LKBA 3QU4A 4E1VA 1GU0A 4G4SP 2XDWA 2NGRA 2QSZA 2QN9A 3URKA 4CM1A 3FKQA 4S1TA 3V8MA 4I3GA 4D79A 2IYPA 1A9XA 4D26A 2GAFA 3LCRA 2QW0X 4QDKA 2V74B 5CD1A 2HY7A 2DLCX 4LFBB 1E7WA 2WJPA 2ZRHA 3AB7A 3K5PA 3OOJA 4FYMA 3V55A 3F5FA 1N6OA 1TC2A 2PX6A 5DGIA 5IANA 4BO9A 1Q2UA 1N2IA 4L5YA 1PV4A 3R7WB 5AJHA 4CKEA 4LHVA 5T7BA 2VCEA 1OH6A 5CH3A 1QVZA 3PGMA 3ED1A 3H11B 4H6WA 3MRSA 4Q4JB 2ZJ5A 3AUJB 3OU6A 3PRJA 1PK8A 2NO5A 1P4SA 1RXSA 2A94A 2JZNA 3DV2A 3OSUA 4PINA 3I5MA 3OCJA 3LPCA 4RCYA 5FNZA 5BN4B 1X1TA 4G5GA 5ES4B 1H8HD 4Q7LA 4YONB 5L45A 2CLDX 4TLLB 1AXEA 1O6BA 1E60A 3DD1A 1DMRA 2VYQA 4NJMA 3LC1O 5KPDA 3ASUA 5TLSA 1XN4A 5KU7A 4MUGA 4PN3A 4OREX 4KITB 5CDFE 2ONKA 4FEGA 3BHMA 5H81A 4X1OA 3WLMA 1GPH1 1OTHA 4PQEA 5H1YA 1GEGA 3CZ9A 2WWYA 3TO5A 1HT3A 4DLBA 2CZQA 1RWQA 1SD1A 3QE9Y 3C14C 2FEOA 6REQB 1TVMA 3RT1A 3THXB 4G6ZA 2VJMB 1C9DB 4Y6OA 3MUOA 4FQ8A 3UANA 4EJFA 3KR2A 3MXOA 2RK6A 3ETDA 1GUBA 1MJGM 1PGJA 1E2GA 4LMRA 4DJDC 3KPJA 4WX2B 1ONOA 4KR9A 5GIOE 4FN5A 2OBYA 4C7BA 5JY1A 1EUCA 3RVRA 1EFCA 3I30X 3KPVA 4G5RA 3S3TA 2RARA 3B9QA 3D8TA 1RDFA 4DXAA 4LXYA 3Q9LA 1TAGA 3RSOA 3UTDA 3MG9A 3V48A 2FMHA 2I2CA 2CFSA 1NONA 3JW8A 3NBFA 3HB0A 3NR2A 3TD6A 2D59A 2FWMX 2JFXA 3PEUA 5H3HA 4PFKA 4QBIA 3NVAA 4FGUA 1XJCA 2EKBA 3OQIB 3RRYA 5IDWA 3AVVA 2HAEA 1SKUA 2Z0MA 3TG8A 4B4UA 1Z0SA 2R8OA 3UV6A 3RIYA 5CB4A 3C5WP 4C7VA 3RIEA 3KZCA 4PYIA 5CFNA 4REQB 2WJGA 3GDOA 1NMZA 2OZVA 3R6GA 2AW3A 2AG8A 3B70A 4G5FA 1XTSA 4IG4A 3FAZA 5HG0A 1ZNYA 2PGAA 1SXJD 1V6AA 2WK1A 4JLDA 4HP8A 3SJAA 4QGHA 5DGCA 2NNWB 3UFBA 4EHJA 1WXXA 3NG1A 4N76A 3PK0A 1PZMA 1JVSA 3GQBA 1KSJA 3QU7A 2B8JA 3GCXA 1ZC4A 2M2IA 4TUYB 1ISGA 4DLRA 1DC3A 1XZGA 3AG5A 3GU3A 1AF4A 4YN3A 5KUTA 2LDXA 4B3RB 2WIJA 4JVMA 4D56A 4DCUA 3SKVA 2GX6A 3GP5A 3PPWA 4LJYA 1KZ6A 4MTLA 4OSEA 1ABEA 2XA1A 1U94A 1AGNA 3EDYA 4NOKA 3STUA 4Y3UA 1C50A 5IZCA 1GPBA 1QQ7A 5JWHA 1WXHA 1XNHA 3OJWA 5B2EA 4BGIA 1QFJA 3A4LA 5HXAA 1XGKA 2Q8PA 3KQTA 2AQ8A 1SXQA 3BH7A 3ITNA 4M8KA 4WVLA 1YHNA 4Y2XA 5BOVA 4FHDA 3FG9A 3WL4A 1JIXA 1MAHA 4JP5A 5AK0A 3EASA 5U9CA 1DWOA 2FDCA 1H4TA 2TMGA 2XVMA 3R76A 4CR7A 5AH0A 4TKVB 2CNNA 5L7YA 4C2TA 4BFXA 2YYAA 2EF1A 3N8KA 2B98A 2BFDB 4JSYA 4MUIA 2ACKA 3MB8A 3SHVA 3PC8C 4DLPA 5KDDA 4YAUA 1XQ1A 3W8FA 4EL0A 4OXXA 1RPZA 1ZRSA 2D4AA 2VRNA 3OBBA 4LYDA 5E6SA 5IEJA 3LCCA 4C08A 1WTAA 1LX7A 4AWAA 5I6DA 5K8CA 2YY6A 121PA 4G4SO 1GDHA 2GPSA 2C0PA 2O0MA 1G41A 1T25A 4LG1A 1D2NA 3WLFA 3DNFA 4HR7A 3Q7IA 5J2TF 5LA6A 1BO6A 1NURA 3VJMA 3W5DA 2I66A 1SVIA 2PWZA 2PR2A 2F1JA 1IG3A 1GRCA 1GT91 1UJCA 4KLZA 4EJ2A 3WO1A 2ZAYA 4QT0A 3TZQA 4AX4A 1UDBA 2G4LA 2Q99A 1W0CA 3VPHA 3ZKAA 1TEZA 4JN6B 3SYLA 1PHRA 3NUGA 4B73A 1T8TA 2J3HA 1Z17A 2YZKA 4DA0A 4UULA 5EWJB 1HDYA 4XIYA 3O26A 1QM5A 5G40A 1JRLA 2JATA 2F62A 2A0YA 4BE9A 3BFPA 4PAOA 3DCIA 1DX9A 3KUUA 4C1BA 4O4IA 1R0XA 1JLMA 5LCXA 1Z6QA 5LKAA 4WEQA 2GPNA 2XUQA 3GDGA 2QG9A 3U49A 1SRRA 4C05A 2V45A 4CPDA 3T3OA 5JXIA 2AMVA 2HLNA 2I55A 3I53A 4NBLA 3U44B 3BHIA 3MGBA 4QGFA 1SUWA 2H4YA 4RJLA 2P2ZA 3A27A 3PIRA 2VDPB 1OZGA 1HFEL 2IXTA 1C0LA 2VP6A 3OJEA 4IFIA 1XDDA 2VQDA 4DIUA 4EKGA 4ZVPA 3MWGA 5HK9A 4RFVA 2JEOA 2NV0A 3CJTA 1X2BA 4MW0A 3ZZNA 3RVDA 3UGQA 2P6MA 1QRTA 1XD9A 3U6KA 3BWMA 4S0XA 5DT9A 1P8AA 1QHHB 3H5AA 3ML1A 5EXDA 3NMUF 1MRSA 3HCPA 3TECE 3DZGA 1P6XA 1A95A 4YEDA 4KBGA 2VC2B 3GFFA 1KMNA 3AFMA 2ZJ2A 1Y1KE 3VQTA 5FOTA 1WV1A 2IHBA 3FI0A 4P3PA 1LTQA 2AC2A 1IBRA 3K96A 2W48A 3GGSA 4O0MA 4C20A 5K8VA 5KTKA 1H85A 2DHDA 4IIJF 4JUBA 2Z8YM 4Y2SA 2GHQA 5TT1A 2X22A 4R3UC 4C3OB 4CXMA 2FP4A 4IWYA 3WMWA 3B5EA 1H6AA 3I4LA 1TF5A 4PO9A 4C43A 4DREA 4ZICA 4OBEA 2OXCA 1CVRA 2BP7B 4WZZA 5E7QA 1O95C 1T29A 5I4BA 3Q3EA 3ZIDA 3AXSA 2KBEA 3DC7A 3L5KA 2EFGA 1NBAA 2Q3HA 5LMCA 4YECA 2GTIA 2LKDA 3JQ7A 1QGDA 1DKMA 3C8UA 3P97A 2JJ2A 3F7TA 2P2DA 1K08A 3F73A 1QIFA 1TECE 2BIFA 2PU5A 5K0EA 2GDJA 2FA9A 1C3EA 4FNAA 3T0IA 1FFSA 2OCPA 1Q0ZA 2IOQA 2LPMA 3EUFA 4LRQA 4MO2A 2Y68A 4X00A 4ARZA 3KX2A 4G89A 1N6KA 1Z56C 2PH5A 5CB4F 1E4VA 2FDRA 5ALIA 1X8XA 2VO1A 5JZSA 2NTYC 1NN5A 3ASVA 3FLEA 3QKUA 3AKZA 1XPRA 4EA6A 3ODGA 3G49A 1Y5LA 3VVCA 2AOUB 5FL7A 1Z2NX 1DBPA 2FQXA 5LNK1 1TB4A 5JD6A 4LF4B 1Y7TA 4KFSA 3ABQB 2R6DA 4XWYA 3G3EA 4ZDIA 2IDJA 4U7HA 4ZDJA 3HMQA 1TXGA 2GPWA 2ZIVB 1GNPA 1YBFA 3COPA 2CVQA 3V6LA 4B3CA 2P78A 4BFZA 2O50A 4X6UA 4M1OA 1PJBA 3CMCO 1ZKDA 1CUVA 3RRNA 2LWIA 3GFOA 3ENKA 4K40A 2QTRA 1J1IA 2INGX 3N2YA 4ZVTA 4DR7B 3I6ZA 4OFWA 2LGJA 1E3MA 1HYHA 3DLPX 3QFFA 2W70A 4MQFA 2Q4EA 1Z7GA 1PQPA 2J6CA 1J8QA 4DBZA 2IE8A 1PQYA 2QM8A 4MHOA 4RNDB 2EIHA 5FI1B 4Y9RA 1SURA 5K8UA 2XGJA 4FWTA 1PYDA 1WZNA 1WUJS 1SVOA 1XTUA 2POQX 4ARAA 1JW9B 3T7RA 1UK7A 2XRMA 3UPUA 3OQMA 4LA4A 5KOYA 3JQDA 4I8DA 2XHEA 3K3PA 2RGRA 3WQQA 2OV8A 5KBYA 3N75A 5K1ZA 4DDUA 2BLLA 5DN6A 2YFYA 3GFTA 3L93A 5UKDA 2UZ1A 4X1KB 4MVYA 4G0PA 4OEHA 2BHTA 3LKVA 3GOQA 3L46A 4WBNB 1U7TA 4X9XA 1OV4A 1JWLA 3TJRA 1H8EA 2MWMA 4IQ0A 5JQWA 3JR7A 3P27A 5CX4A 3N70A 3LNCA 1XMSA 3RYIB 3KT6A 3OH8A 3V1YA 4E5NA 1WSBA 4WJZA 4ZHQB 1PR6A 4BRZA 1AB6A 1P3JA 1UWVA 2I4TA 3MK31 4JEUA 3ZTYA 5FO1A 1XXLA 4LHZA 4ZYUA 3UUEA 3MLBA 4KL8S 6NULA 2G1KA 1LU9A 3BN3A 5A7HA 4WAUA 3UAOA 4A27A 3DZ8A 5B1IA 1NJFA 3RV4A 3HDQA 4P8RA 1PBTA 1GCOA 2QIOA 3W7BA 3FOZA 4QL3A 1W36D 1IPHA 1XAHA 2JIDA 3ZZTA 5J2UB 5JFGA 2G76A 1CS0A 3F90A 3OHSX 3RHSA 4WCFB 2OZEA 4U7WA 1JXOA 1Z7EA 2ZPUA 4O4IF 3TNYA 5CA1F 4JB8A 1MHPA 1ZD4A 4BEVA 3T1YB 4WH0A 2ILTA 1IY8A 1MQ9A 2R68A 5GOZA 3TAUA 5JS1A 3LIIA 1BXRA 1ZR4A 4H59A 2C4KA 1T9BA 4ZHSA 3IQZA 1XCOA 1Q0UA 3HV2A 2HF7A 1GAQA 5EUBA 5HA5A 3UY4A 1UODA 1I7PA 1IZ8A 1SR8A 3SBOA 2O0LA 2EOAA 3GD7A 1BN6A 3OZTA 1N3IA 2CV0A 4JSRA 1B93A 5BY2A 3BKXA 2ZTMA 1U8UA 3KJQA 3S2IA 3WIUA 5JCZA 2DWUA 2WD9A 3K9FC 3E9RA 3IV9A 4AK9A 1QVVA 1UDRA 3R5FA 3RSCA 3KXPA 1EWYA 3RM3A 3C7CB 4NCIA 1KPIA 4E21A 3Q12A 1KA9H 2A4MA 4WNAB 4F1JA 5SZHB 1V37A 3EOZA 2D5CA 3FWZA 3B7GA 3LPNA 3QMMA 2PKCA 4KODA 4QJBA 4KXNA 4R0VA 3RS5A 5ALKA 5SZKB 2O7RA 3B6IA 1ZG3A 5K4GA 1S96A 5AI0A 1J2UA 3TNJA 3FR8A 2F6RA 1JVNA 2FUNB 4HS4A 3VC3A 3FYTA 4FNGA 1Q0QA 5L6LB 7REQA 3UMRA 1HZZA 1ST3A 4BLSA 1HK7A 1LKZA 2V7BA 3KL2A 3KKNA 3B1KA 5J4YA 4XIIA 3LXUX 3UMJA 5AI6A 1RJWA 1ES9A 2N9UA 2B92A 3DPSA 1N3BA 3DS8A 3RFTA 2B0JA 3VGPA 2UYYA 5BSMA 2QLNA 3IUPA 4M1WA 5FDFA 1N2HA 1PUJA 1RRKA 1F2DA 1LJLA 1RLJA 1YVPA 2WYOA 3IUEA 5EIHA 4BVHA 5TVKA 2EL9A 2GK7A 5EJ2A 3CZCA 1KDYA 2VXCA 1G2IA 3CZ5A 3V00A 1L4HA 4IV5A 3VC1A 4Y0NA 3VZSA 2Q3BA 1MC4A 2FSPA 1X7ZA 3GRAA 3SFZA 2FETA 3ZJUA 2AXQA 4AY5A 1ZMTA 4L75A 4MVWA 4E70A 5A5FA 3IQHX 2B2NA 3MCVA 2HUNA 1M66A 3K6RA 4M1YA 2J4CA 4V3CA 2RHCA 5ER6A 1BDIA 4EPTA 2B1JA 5LXTA 1OZ0A 2V9PA 5H3LA 1THTA 1UBKS 4I2NA 1PFKA 2CJYA 3BZUA 3IJPA 1F14A 3R0XA 3U4HA 3M0EA 2GZ1A 2AVDA 2JGKA 1RBYA 1AA6A 4IWNA 3PNQA 4PIPA 4F9GA 2C8LA 2FDXA 4MCHA 2QR3A 4TWIA 5B2ZA 2G1PA 2JI9A 4XW2A 2WHPA 1DBQA 2AMLA 5BN5B 3DCJA 1S2MA 3QYFA 4EABA 1XZNA 3IMCA 4OD0A 2AHOA 4C5BA 3BK1A 4ZVKA 4IHJA 4GR4A 4IS2A 5ICEA 5IDXA 4P7GA 4RHEA 2YY7A 3D8BA 3T34A 3TRFA 5IYZB 2GKOA 3TVYA 1FRVA 2X0DA 4BUCA 4B1FA 3I2KA 2GK4A 1OT3A 4DIOA 2H16A 3BTVA 4CFZA 3STVA 4D44A 1ONPA 5L51A 4TMWA 1YDGA 4XVHA 3ER6A 1IVNA 3SZOA 3TQHA 3H6HA 4Z9XA 3ESQA 4B79A 2W5UA 2C0CA 4ZQBA 2EFCB 4QLAA 1E18A 3H5OA 1UF9A 2QW1A 3PUVA 4FINA 2VNAA 3DOJA 1R4MB 1D6MA 1R4NA 3WJ7A 3FZGA 3WLRA 1G1AA 1HE3A 1AO3A 4Q9NA 1KEVA 2VUHB 4QYXA 4V0NA 4XDYA 3NC1C 2HHJA 2WPDA 2NSLA 3HY6A 2VJOA 4K1XA 3AEQA 5FFMA 4QUIA 3JASA 4A6XA 4P0PB 4AZ0B 1C0EA 1B0UA 3E2PA 5JYEA 1U98A 3AL3A 4KO3S 3U3MA 1A71A 4I1YA 5EIBD 3VR5A 4BCCA 4EKDA 1U3GA 1CDDA 3R3ZA 1PKXA 1R50A 1ULTA 4XLTA 2O8FB 1C80A 4OP3A 4IIXA 2AQKA 1OV6A 2NZWA 3GMSA 1U7XA 4HDAA 1EKXA 1XDZA 3PFIA 3L4KA 1GQQA 4X8OA 1EGMB 1SQ5A 4LQCA 3N05A 5B3LA 2WWVD 1K0UA 4C4OA 1OF1A 3RKSA 1OMOA 3R6LA 5GZ3A 4TMVA 2ZAIA 1UM9B 4Y67A 1IAVA 1CERA 1SHZA 2EKZA 3IJEB 1WY7A 3LT1A 3BFJA 1FFAA 5KNBA 1CZOA 1KOFA 1UAYA 2B7LA 4PBTA 2TECE 4R83A 1P0MA 4ERNA 1D2GA 3EW7A 5BYKA 5BVGB 5BSEA 5CFPA 1XVIA 2B34A 1E7SA 4DCJA 2Q50A 1EE9A 3PPXA 4B3GA 1L8XA 3NLLA 2H9YA 5KOIA 2A1TR 1M1XB 1YACA 3E22B 1NPDA 3AF2A 2YJ4A 1EBFA 4QQ8A 1UP4A 2QX6A 7YASA 2NZXA 2XVAA 3HNOA 3CNLA 4XB2A 4UU0A 2C78A 4Q1BA 4DKXA 1VRWA 2KYRA 5JDCA 1YZVA 5HTKA 4WD3A 1W581 3R7LA 2R7LA 4I8IA 4JL8A 4WUTA 3U5ZB 2G1UA 2HL6A 1B6RA 2HLDD 3B52X 1TYAE 1ZMOA 3C6ZA 1Y4UA 2CVZA 3CPEA 2C54A 5THKA 3SI7A 3GJ3A 4LV5B 2RHOA 3OF2A 2JCBA 2EP5A 2EV9A 1E4EA 5D3QA 4W7HA 1ZY2A 2JLSA 3HJNA 5CRIA 2LV8A 4C4TA 1YI8A 3B2NA 1AHNA 3HKEB 1M54A 2W22A 4XZ3A 3PDIA 1NKSA 1EX7A 3X2EA 2VPXA 4Z5XA 3GPLA 4G86A 4H15A 4JJAA 1QGAA 2E49A 1W35A 3DEFA 1DOZA 4E08A 2PS3A 3G2QA 2OMEA 1CZUA 3EIUA 1Z4NA 5HSGA 5LP6A 2YR0A 4EVRA 3IVXA 5ELLA 1QK4A 3H5RA 1JI0A 5HRCA 2AEEA 4KAJA 1GAJA 1RPAA 2D8AA 2R7MA 2RJOA 3E9DA 2ADOA 3QVKA 4QDJA 5DIZA 5B3AA 4CGYA 1XRSB 2Q3EA 1MG0A 1SK8A 2R7NA 3Q4GA 5EL0A 3TBFA 5LJLA 5HM8A 1Y8ZA 4YRQA 2FPRA 2Z4TA 4QBTA 4D5GA 4G1VA 2DG2A 3T15A 1P4AA 1QKIA 1V16A 4X20B 1BVUA 5G0VA 5T4FA 4JI6B 1XXHE 5DT2A 4GRDA 1IZZA 1Z25A 5HF6A 3VZRA 4D9BA 2GUGA 3IAFA 4ITRC 3HP1A 1CF4A 3D8UA 1OGIA 2RGNA 4XUGB 2Q62A 4CV0A 1FL9A 1SVKA 4JL6A 4DADA 1B0PA 1ODLA 1UKAA 2QUJA 2O3JA 1NQOA 4H0FA 3N07A 3JQ8A 3C6XA 4CIWA 1JJBA 3DPIA 4IQ4A 4GICA 1GY8A 5CXXA 1T6YA 3D3NA 1MFPA 2VUUA 4QEKA 1UMBB 5LXTF 3I5XA 4EJMA 3C87A 4PX9A 1I4OA 4NDNE 5DXJA 1F8UA 2IHZA 3Q9NA 1MC1A 2I6FA 3FFWA 4G1UC 4KYVA 4PONA 4WGGA 4C6HA 2XZOA 4TS4A 4H4EA 3PQ8A 3Q8WA 3A9CA 3FZQA 4G36A 5JXWA 5JFOA 1R0BA 1HFJA 1AB5A 4B43A 4L27A 4B84A 3EK2A 4Z7QB 1NNEA 3F74A 5HIJA 3D7SA 3O31A 4BX9A 1UBHS 4LZWA 3RVJA 2Z6AA 4IHJF 4TSKA 2OKGA 4JGBA 2FZGA 3FLBA 2JJ1A 3TFWA 3P9IA 4M53A 5FPKA 5TY0A 3PQ5A 3WB1A 2O57A 4JT4A 5FNVA 4DG5A 4DV2B 1JVBA 3ILXA 3USZA 3MJ4A 3ANSA 5NLLA 2ZFUA 4A7PA 4A0FA 1O0CA 4FQ5A 4IGAA 3I0ZA 2J0UB 2JVKA 3BWDD 3PG5A 3WTCA 1R0RE 1SJ9A 3ND6A 2FR8A 4HRVA 1H2RS 4KQFA 4CDNA 1RHJA 1ZP6A 4FMDF 1YS7A 4EYEA 5BW5A 4CGZA 4Q1AA 2O8BA 3W3ZB 5HJEA 3FFXA 2YWDA 2HEIA 3RARA 4A0SA 1P19A 3LT5A 3RTBA 2JH9A 4BNJA 1RZRD 3NTRA 4C0BA 3F5MA 3G5AA 3BDIA 4DPLA 5KKNB 4Z53A 2V59A 5HCNA 2CXSA 3U3RA 1LI5A 1MLDA 2FG7C 2XMBA 4GZLA 4MQEB 5DK4A 4JZYA 5ALDA 3WXMA 1Z0UA 4TPKA 4GWGA 4OKIA 5B58T 3DVRX 3HB4X 3PXUA 2AN5A 4QOJA 4UFOA 3F6EX 4OHXA 4LNAA 3JYQA 3OY2A 2EAUA 2FSHA 4IIUA 5DNAA 3GZNB 3KYCA 3MT7A 3PHBE 3L4BA 4L07A 4P3NA 4RIEA 4TV8A 3M6XA 5ITZA 2WWXA 1CUEA 4LCEA 4TYNA 1NQAO 1ABFA 2JG3A 4UAGA 4JVNA 1VIDA 3TSWA 1W36B 3L6RA 1KETA 1WCWA 2E3JA 2HA6A 1FCJA 2PBLA 4FJ0A 3FPFA 2HA5A 3P9SA 3LPAA 3H1BA 4WQMA 3JWGA 5U4QA 1NT2A 2BGRA 5HQ3A 5EKSA 2NXWA 2VJAA 1YHZA 2ZXFA 3ESDA 3WADA 3H5WA 3HJCA 2R6GA 3D31A 5C7LO 4Z4QA 1TT7A 4JB3A 2HADA 1VCNA 1A88A 1T36A 2MR6A 1EH5A 1HOXA 3JWIA 3WGVA 3NDPA 3KQQA 1O54A 2D2VA 1T5LA 4NBKA 2W6QA 2P5SA 2VLIA 1QHYA 3IMFA 4QQRA 4FYJA 1MV5A 4IIHA 5B64A 4M4SA 4ZCSA 3IHLA 4D9JA 2CCKA 3DW3X 6PFKA 2JLYA 4CFYA 1KY2A 2FOLA 2L17A 3HZHA 5IVIA 3RSSA 4AUNA 2YC2C 3M3HA 2C5GA 1SUIA 1R8QA 2PLFA 2CMDA 1X13A 5A3SA 3UK0A 2J33A 3QLVA 1YRYE 2C07A 4KZKA 5D6OA 4KAFA 2YWEA 3B9PA 2VHYA 2VP9A 4EHDA 2FEWB 1VYHA 1XTZA 1A8HA 2I1QA 4I08A 1K0FA 1Z4OA 4LY9A 1MAWA 1WZUA 1K6JA 2QTAA 1LSSA 2VXYA 1IVYA 3QWHA 3ZEAA 2QW8A 4M9XA 3FROA 4AZWA 5FCDA 3G0OA 2DCUA 4JB2A 1FFHA 4ONEA 3EMVA 5FEMA 1CW2B 2RGAA 4R2HA 1XPOA 5LP6F 3GJ6A 3L7LA 3LNTA 4WY5A 3RG8A 4RVNA 1A1SA 1FNBA 1YFJA 3AL0C 4PZAA 3ER9A 3HDYA 1XMXA 1NQUA 4N0MA 2BSQA 1JJIA 1GG5A 4JUDX 2YNMA 3GA5A 1Z22A 5IDVA 2P79A 3TL3A 4S05A 5T4EA 1PJ4A 1PR9A 3NHWA 3TL6A 1TTQB 5DYNA 1SZPA 3T9AA 4AFNA 3EFOA 3FCCA 1T4MA 2WU4A 3LBAA 3OURA 4HGYA 3ZVNA 4FGZA 3OFKA 3QX3A 2K6GA 1FQWA 2BWJA 4XTCS 3DC2A 2IY7A 3CBQA 4YT4A 2VK2A 2WJWA 4I9GA 5LJIA 3V2HA 3BPSA 1VXOA 2GVDC 3ZDZB 3H9JA 1N33B 1CYEA 2P4SA 2OXRA 1NBEA 4HGQA 4OJNA 3LWBA 3F98A 4WASA 4ER7A 1RI1A 4DMMA 3I9NA 2PKRA 1V4NA 1HYGA 2CE7A 2UZAA 3QMVA 1PG0A 3H2GA 1K7CA 6AT1A 4RKRA 4JI2B 3E27A 1VP9A 2VYND 1IWOA 2C7VA 1CJUC 3D6JA 4JC5A 3OOEA 4FB4A 3RYCB 1D0SA 3Q3HA 1DLJA 2F4VB 5EE0A 3JQEA 4D0RA 1TKAA 1XWIA 2EGUA 5DOZA 1CP2A 4GVXA 1V25A 3HJHA 5IFLA 1N6RA 5EINA 3HXOA 1KL7A 3QE2A 3PGXA 4G8JA 2X0IA 2OBMA 4TWBA 1UDCA 2AS0A 2C7QA 3D1JA 3WNQA 3IBGA 1RP7A 2NU9B 4LOJA 2NSDA 4WESA 1ADFA 3LIPA 3KEFA 3I61A 3QFSA 4Z6KA 1PS0A 2I2XB 3GGOA 3QF4B 5IRCD 1QQ5A 3DP7A 3ZI7A 2A3NA 2VJKA 4C3UA 4YQZA 2XZLA 5FNVF 5TPZD 2ATEA 1PV2A 1AMUA 3F6SA 1Z6TA 4KFUA 3NHBA 4HLNA 2N1MA 4GI1A 4TKVA 1FE8A 4TVBA 4FNOA 4D80A 2ZT7A 4YACA 3DLHA 1IPEA 1G2OA 1IEXA 1S8OA 3B8HA 4HBGA 4O02B 4R54A 2CZGA 4V1CI 1YDWA 3EAQA 4N3AA 1PS8A 4M86A 4OAOA 1RC1A 4LISA 2XT0A 5DBOA 2DLNA 3QUBA 2W6JA 2FMKA 3CFYA 3C6YA 3QI7A 4RVOA 5ESWA 2XXAA 3GK3A 4Y2RA 1MGOA 1ZCBA 3MELA 4LWQA 5DMHA 4EJSA 3ICPA 3DF7A 1CB7A 4YIKA 1ULZA 3RUFA 5IKPA 1VMIA 1NHWA 1SCBA 4HI0E 2IEZA 1CZHA 1MXFA 2QZPA 1DRKA 4KCGA 3O8OB 5L53A 3O38A 5IULC 1J33A 3OPNA 3VZQA 5JTTA 5JSHA 2BL4A 2JAUA 3K0AA 3ZGYA 1O2DA 2N0SA 3TG2A 1O9GA 2DQZA 4MCIA 4TV8F 4KW7A 5HVNA 3VR6D 5ECYA 1OE0A 1B00A 1LDNA 1D1TA 1N0VC 1ZK4A 1JYSA 1N0IA 1ZJYA 2AL7A 1Y33E 1CY6A 2Z30A 3T5PA 1GUAA 3SIPA 3IPLA 3LUHA 2BEWA 5C46F 2OHFA 5E7MA 4MS3A 3P45A 4HRXA 1WHSB 1R15A 2A0FA 4QVKA 3LL7A 2J41A 5J9FA 1FP4A 3GBSA 5GIPE 5B6JA 1KK3A 4TTRA 1NNSA 2XMDA 3WNCA 4IXDA 2AB0A 3A6JA 4HJXA 4RYDA 4O0LA 4IBOA 4I9FA 1W85A 4LJSA 1MX5A 1USVA 5A6SA 4D99A 3U44A 2Y1DA 1AKQA 1AXRA 2G8LA 3F3KA 3H2KA 1G64A 4ZV4A 1TIBA 2A0WA 2NUPB 3QFRA 4YMUA 3T1TA 1WETA 2NN3C 4I6GA 3WNZA 1BEZA 1NX6A 2OCDA 1JKJA 1N2SA 3QX8A 3C1UA 5CIWA 3IKTA 1PFWA 3DJFA 4ZODA 1DUIA 1VDMA 1U8TA 3BB3A 4MLPA 4NV1A 2B6NA 5D5HA 5FLEX 1I7SB 3AGPA 1NVXQ 2X4LA 3ZWCA 1EVZA 2EJVA 2JGFA 4ICIA 4DTIA 4F92B 1D5CA 2IUEA 1KI6B 1GXSA 1QHHA 1UBRS 2AC4A 3UJBA 2DFKB 5AI4A 3D0RA 2ZZMA 1VMAA 3IBSA 4FW8A 1Z8HA 4ECAA 3EZGA 4DXHA 1C8VB 2LZ0A 2NU6B 2OVFA 2WWTA 4JK3A 5FFFA 3ZKWA 2NVOA 2Q3CA 1KWGA 1QQAA 3PHLA 1DAEA 4N5HX 1Q11A 2CXHA 3NEJA 2JASA 5TS3A 1NVEA 1X0XA 2X2EA 2ZCUA 3ROKA 2JA2A 4FBLA 2C3OA 2X2OA 3KOUA 1XBTA 2YZMA 1J1UA 3VR3A 4AWXA 3P19A 4RD2A 3K73O 1XAGA 4I2VA 5DLYA 1FLVA 5LKRA 4EVIA 1W30A 2HXGA 2IHTA 2O5VA 2F3PA 1XHLA 2QT1A 2BM0A 3CVOA 2BW0A 1AHHA 2O06A 3D0KA 4WKBA 3TPCA 1RT9A 1F12A 2HIGA 4WFQA 3TDKA 4JJ7A 4ESHA 3MQFA 1L5KA 2Y2VA 4ZGBA 2QV7A 2VUSA 1VPEA 5IBCA 1VMDA 5AW7A 1TJYA 1WA5A 5J4HA 4NBWA 4RORA 5LD2B 3STXA 4EY5A 1M7GA 4ZAWA 3IKJA 4B35A 5CA0B 1ENPA 2ISCA 3A9TA 2WG0A 4F9FA 4BWYA 1OAAA 4M0UA 1IJEA 1RQPA 1FUEA 4V39A 4X0EA 1Y9JA 4XGQA 1WXEA 3CGWA 2DFNA 1WUYA 5DOVA 1NOJA 4KSBA 4DZTA 1E2HA 4Q66C 2OUIA 1J2YA 2VPQA 4XJSA 2P2CA 3F7NA 1UBMS 2YWFA 3NOOA 1OX4A 3MYYA 4I36A 2P2NA 2ZJ3A 4WERA 1YZQA 1VBMA 1JKXA 2OYRA 3O2SB 1XL1A 1HNXB 3E9CA 1G6OA 2QRVA 1RPNA 4PLGA 1YNOA 4DJJA 1KMHA 1QIMA 4E3ZA 4G56A 3CUYA 4O33A 2X19A 3DW1X 3NWBA 1EHCA 1FNNA 1LC3A 1LVGA 5I8ZA 1SG0A 5T41A 4MDEA 3MTJA 3KFLA 3OIWA 3SHQA 4M0DA 4II2A 4QSHA 2OENG 3H4MA 1PSWA 2NWQA 4KRXA 3VISA 1OGYA 3ZHOA 4KQ6A 3T12A 4JOSA 1XKLA 1W4BA 3G9ZA 2DAPA 2BGIA 3FFBA 3I0NA 3KS9A 1AGPA 3L6DA 5JNTA 2NUAB 4EPWA 3UQYS 4OCZA 4EY7A 1R00A 4JR1A 2ZI3A 4PR0A 1S01A 1A7AA 2QTMA 2I34A 4GKKB 3UAWA 3HVJA 4ARVA 5AXBA 1EE1A 4PLCA 3KSAC 1U28A 3A6ZA 2CBXA 2IXBA 2XTZA 3N7AA 3ZZUA 1K2WA 1ZM4A 3OCXA 1G4HA 2PRSA 3E7PA 2HPHA 2GN9A 3USCS 4BKMA 5TQ0B 1TAHA 4G2TA 3L3BA 4J76A 4E5PA 4BZZA 1T2NA 1O3YA 4OFBA 3TQSA 2IZ7A 3C7TA 4WWHA 2ZREA 3EZYA 4X1KA 2CHQA 2O0HA 4G0YA 4LJRA 3AEXA 5GJCA 2B7CA 4JXJA 2ZRIA 2C1ZA 4NR0A 5JAQA 2V4ZA 3U7QB 3ONNA 4F5ZA 3GIDA 1T24A 2Z5FA 4RHFA 4BCDA 1MOSA 3AJDA 5FAKA 1BDHA 2QE6A 2RD2A 5KCZA 1CHDA 1P2FA 2BFEB 3NXSA 1OX6A 3CLUD 3R5TA 4O2RA 4PTYA 3WLOA 3EGCA 1A5TA 4K6OA 3N53A 4F2HA 4G3XA 1NNI1 1G5IA 3GH3A 2ZE5A 4Y2PA 2XBMA 2WQZA 1QO7A 2JLCA 3NP9A 4AS1A 2JIBA 3MC1A 2HJSA 4WGFA 4ZVNA 3PL5A 4ALMA 5IXJA 1R12A 4TLMB 1E79D 2ODTX 1JDJA 2PX0A 3LBYA 3EUAA 3A7EA 1RAFA 3IAEA 2VLBA 2A3RA 3MQ2A 1RLOA 3QNMA 5EKTA 3PVCA 3NUQA 3FVTA 1OSNA 4FCWA 4WCFA 3R7SA 1H8HA 1K7FB 1ZHFA 2UDPA 1XTQA 2XUFA 2XIJA 4FE3A 4IUYA 2VAXA 4OJQA 4XSVA 1TL7C 3MJHA 4BVGA 4CNBA 4ZOQI 3IT2A 4JD5A 4R9SA 3A8TA 3BYZA 5F21A 1T9GS 3VHLB 3ZQ4A 5E2AA 2H4FA 3M89A 1W96A 3VYSB 5KTTA 3F71A 2QXUA 3KJGA 2OAEA 1RI2A 4U5QA 3SQDA 5CR9A 1IQUA 1LI4A 1CIVA 5LQUA 1G1MA 2JCYA 4YT8A 2ZB7A 2ZYWX 1RD4A 1U80A 1WE2A 1EJ0A 4FONA 3PLAE 2OAQ1 1QU2A 3UHAA 4DLZA 3ORRA 5HILA 4I1UA 1I4WA 4JYPA 1LSJA 5BQOA 4KQ2A 3ZTWA 2VH2A 4ZDKA 1ADBA 1MJNA 5LYJA 2NU8A 3IKVA 5JRJA 5MGBA 3WGGA 4XX0B 1U90A 1XQXA 1YDFA 2Z58A 2WSLA 3PT9A 2GO7A 5DWQA 2IDKA 1Z33A 1WP9A 4BWFB 1FF9A 1YL7A 1SBYA 2LCIA 4RJTA 5IK2D 2NQ2C 3KKZA 2R1VA 4MAFA 3E6AA 5CT6A 2MHCA 4PZPA 1JV2B 4HO1X 4ZDWA 1FMJA 5LBIA 4P84A 4MVXA 4Y6QA 3FCAA 2P0YA 3BC1A 1D6SA 2VL7A 4MA0A 4HX5A 2AOXA 1YJ8A 3MOIA 3CLRD 3VPXA 1KYZA 3I04M 3N6VA 1E1CA 1WIWA 4KO4S 3AUAA 2P1RA 2XWQA 1TKBA 2EZTA 1JIKA 2H3HA 1ICEA 2WT4A 3G2HA 4QG7A 1EWVA 2PNJA 5KO2A 1SXJA 4IFEA 4NY1A 2O8CB 2HHCA 3C1AA 1L7QA 4I1VA 1UJMA 2PD4A 4O3MA 1G8SA 2QR2A 3ZD8A 3MTEA 1UAGA 1U6KA 3VU9B 2F9FA 4AJNA 2OZLB 1R4ZA 3C1OA 3O3NB 4JVOA 4TKZA 1LXCA 1WWKA 4EG4A 2JLVA 2CBZA 1QOPB 1X8JA 2PPLA 1XQYA 2QL6A 1TIPA 1H2XA 3J81A 3RRJA 3MJEA 3VI3B 1TVEA 2FPUA 3D54D 3Q5DA 3Q9UA 1Z6YA 4Z4FA 2IUUA 2XV1A 3ZJVA 3LHIA 4JQZA 2LCFA 3A04A 1DTSA 1FXSA 3IVAA 4YJFB 3WRXA 2YMLA 3B6ZA 4IV0A 1S8NA 2IP4A 4JUIA 3TD2A 3JAKA 5AVZA 2JI6A 4E2XA 3QXXA 5TEVA 1TTTA 2PO5A 5KB3A 1DBWA 1YVDA 5IXYA 2PKXA 1SBQA 1W59A 4BU1A 2F90A 4Q82A 3DHYA 4NKRA 2C77A 2Q2QA 1ODJA 5FBLB 4J9VA 3SVTA 1VA5A 1VGRA 3D2BA 1HDIA 4IJ6A 1DAHA 4MMYB 3U40A 3CKMA 1TW3A 2CT8A 4W1QA 3IURA 1ORHA 3L4JA 1FDOA 1NI4A 2IF2A 4AMZA 1SHJA 2R87A 1Y6JA 4PCUA 2QMYA 4YI3A 1QLWA 4KACA 2D13A 2QLFA 4FYIA 5EIWA 3PP8A 3WGKA 3D6AA 4H35A 4KLCA 3C43A 4BC0A 1KO1A 4KK3A 2CSXA 1W5SA 1KIFA 1L1QA 4WA7A 4RE5A 4DWVA 4XPZA 4PZ0A 4MUKA 4ZTBA 4X1YB 3CPJB 3IULA 4LJ9A 2O8FA 5EXEA 4U8HA 3RD5A 5BNZA 4LJ4A 4QYSA 4WBNF 3UBTA 2XD9A 3AR8A 3AEKB 2RAPA 3CLVA 3S40A 2YH2A 5U1PA 2VOJA 5CU7A 4G84A 2B4QA 4PXYA 4JLUA 5A2GA 4NG5A 1PBNA 1E2QA 1WB6A 4KI0A 1WQ3A 1G7CA 3IJRA 1DKQA 2REXB 4XVQA 4XJXA 3IXQA 4EI7A 5SY9A 4BUZA 4ZHQF 5BPHA 3Q7PA 5T8KA 1CUYA 6ADHA 2ZUFA 3V1TC 2BEVA 2I87A 5J1SB 1OGJA 3UK6A 4ZOLB 4HVCA 5IH3A 2IKQA 2O9JA 3ZWOA 4CKBA 1M83A 4HLUA 3FRIA 2QD1A 2AUTA 2H2GA 2QQFA 2VWQA 3RODA 1SXPA 4Q7EA 1JKMA 2C3PA 2X23A 1Q19A 4UBOA 4BVAA 3AF5A 3WGHA 4GYYA 4GI5A 3LX8A 2ZM5A 3DG9A 3VNVA 1PT7A 1QYVA 1OWLA 1WU7A 1S3IA 2AR7A 2C7GA 4CCYB 1IMJA 3M2TA 4FYKA 2E2WA 3NPMA 3WK8A 5CFOA 1ZLYA 3AJ9A 2F4NA 1ETHA 1UANA 3B1YA 4YP5A 5AW2A 4YCNA 3CUEF 1SBCA 3B9BA 2X4IA 5T6BA 4KDCA 1AKVA 3QG5A 1P1FA 2W4IA 4I5EA 5E8RA 4MKGA 3PTLA 4ADSG 5DF1A 1S9HA 5C3UA 2XCIA 3TOVA 5IVKA 4YUVA 2OK8A 4D46A 2DQ4A 3N9IA 4RK1A 5ILGA 3WQSB 5KYYA 1DIOB 3PQCA 3R3HA 1LGYA 3I9KA 2QD5A 4FW9A 1W29A 3NVMB 1DSSG 2DSTA 3GFQA 2QL9A 3R5KA 2V7UA 1KU6A 2F00A 2WSIA 2VHJA 4EYQA 3ZC3A 2GS9A 2HHHB 5E4TA 5FBZA 1B6TA 2DPHA 1H6DA 3HVHA 2O2JA 4UAVA 4AXXA 3MWJA 1BD3A 3R23A 4HKTA 3M82A 5GM1A 1FEZA 5AUOB 3A3OA 3OQVA 3PNMA 3HYLA 4XCQA 4A1OA 3MSXA 4K9NA 1H1LB 1JLRA 2P9YA 5DHQA 3IELA 1CV2A 2RK3A 3ILVA 5K20A 4NU0A 1F4PA 2GJKA 1CUDA 2Y2UA 4LGVA 2FSVA 1PRYA 2C57A 4QYWA 2FZ4A 2ZAMA 3HJRA 3ZDFA 4P3OA 3MSCA 1MO2A 1ID1A 3LL4A 4TZKA 3L4EA 4BXOB 3DE4X 2EG9A 2WSYB 1OLSB 4E15A 1Z3IX 1WVGA 5IN4A 4MDHA 1HZJA 2IKSA 2YS7A 1S2OA 3FNRA 4WVFA 1T13A 4LXQA 1IZ7A 1T5DX 2C3YA 4WZAB 4B7AA 1XR3A 2G40A 3WB0A 1H2ZA 4D97A 3IQEA 2H1FA 1IN7A 2BBOA 2JKZA 3OHPA 4MJ3A 1Q22A 4Q7QA 5C5DA 5K4HA 4O2BB 1YJ5A 3D1VA 4CHGA 1QE3A 1O8BA 3DBIA 4NC9A 2PE5A 5KWEA 2SKDA 2V1XA 4M0MA 4TM7A 1DX6A 3ITKA 2PLRA 1RWKA 3WIOA 1UXGA 2P3OA 3G89A 2H2FA 4RXUA 4HSGA 1O9BA 3LRXA 1G21A 1G42A 1XEXB 5CDSA 1EQ2A 1HDZA 1N1DA 1OFGA 4DNXA 1K8XB 1QIEA 5KSZA 1RBMA 3WAKA 5K05A 2OXEA 4M49A 2O4UX 3IE1A 2K2WA 5HKBA 2QA5A 3ANMA 4K88A 2I4MA 4IF6A 2CF6A 4TKLA 2NVBA 5HFJA 3LWDA 3OA0A 4DEYA 2RHHA 2B4TO 4H7JA 4U7GA 4DLUA 5EWLB 5IYZF 2HA0A 4IQGA 1KI8A 1B74A 3IALA 1IXYA 4FJ2A 1UZLA 2W2XA 2I4LA 4A26A 2F3TA 4LRYA 1WMEA 2NW6A 5JS7A 1PYOA 4QRDA 1G98A 5AW8A 1X3LA 4W5RA 4CNQA 1J9EA 1P81A 5BR8B 2OD7A 1W9MA 2PHZA 3WDKA 3JD4A 2B36A 5KTPA 5E4YA 1G63A 2FG5A 2XSZD 3PUXA 4HUQA 4XUCA 3A2NA 3EDMA 1OH5A 4IJ5A 4KDRA 2V54A 4CCSA 2AUNA 2JD0A 4JP2A 1IIBA 4FHCA 3BTUA 4RCVA 2F2TA 1BOFA 2WV7A 1YI1A 1IUPA 2FPSA 2F43A 1E9AA 4RPLA 4ZA2A 3VUEA 5JUWA 2FWBA 1KY4A 4U2DA 3ZE0B 3PQEA 2NYUA 3IEMA 2HRBA 4OUDA 2GPYA 3N3BC 2MCFA 4LDRA 1OBFO 2WKWA 2COKA 5BYBA 1A7UA 1VKJA 5K2OA 1YIOA 2AFIB 1UFVA 4YIHA 1PTKA 1C3LA 1U9CA 2VTBA 3UFXA 2E37A 3B51X 4QXQA 4C7MA 2RI6A 1RJFA 1TTHA 4P83A 1WS6A 2WWFA 5KOJB 3FDZA 5CGZA 4ZC1A 5KHAA 3R7AA 4WOJA 1FUKA 1JR3A 1NPYA 3A1UA 3V1LA 6CHYA 3PRHA 3REOA 3NH6A 3JVVA 5JCOC 1QFZA 2O0JA 4CU5A 2CMKA 3WWZA 3KV1A 3AM4A 5FX2A 2PKYX 2WR8A 3I37X 4K2HA 5AHWA 1A72A 3SSMA 5B7NA 4PPNA 3FA2A 1DJNA 2W4MA 2Q7DA 3VMFA 2F55A 2O2HA 2UU9B 3PFNA 4O25A 4BL5A 3GUHA 1QMPA 1QVWA 4DSUA 1MKYA 4LTNA 5K8LA 2XKBA 3FH0A 1F0PA 1G7SA 4HTFB 1J2TA 1SKQA 1U7OA 3UA4A 2QUHA 4UTXA 1QTIA 2VNIA 4LDAA 1D03A 1MX9A 3M70A 2CXNA 2JFZA 4WECA 2WJAA 1MNAA 3KKMA 2FUKA 4ZYXA 5JWOA 5F76A 1PZFA 4MNTA 3EPKA 4J29A 3AMVA 4O63O 3QX9A 2WY2D 4Z9AA 1A97A 2GN8A 2FV8A 5AYVA 3RKRA 3N2GB 1ZA1A 2WUFA 4KI7A 3Q5EA 4R01A 4ZO7A 2W2OA 3QVVA 3PT5A 3F1LA 3QQ5A 3ZY6A 2X0NA 3K5HA 4G5QA 4FTWA 4P2BA 4RABA 3VHQA 1C1DA 1NW3A 3LYHA 1CQWA 4BNGA 1UMCA 3VZPA 3GQVA 2QF7A 3WYNA 4CYMA 1NR5A 1WKVA 2NPOA 1SY7A 3VV3A 4BU0A 1WR8A 2GUWA 1IULA 5IC4A 5CAEB 1MJFA 2KB0A 4L5CA 4MUHA 4B44A 5E0KB 5L9AA 2WA1A 2HQSA 3OCWA 3IJ5A 3PEEA 4M89A 1I36A 1EEHA 4OU4A 1Z88A 1XZFA 4RD3A 2P35A 1YR6A 2XWSA 1G4AE 3WHPA 1DNPA 3NBMA 4Q9IA 1FP2A 1GNQA 4U3JB 4NHOA 4PHTA 1FTNA 4DMGA 1OLUB 2QTBA 1XVAA 1Z6ZA 2WAAA 1CQIA 3RYFA 3GXOA 2ROQA 3H2ZA 3LP8A 4MOWA 4ZKEA 3WGJA 5L7WA 4OLJA 2PXHA 1L7PA 1Q92A 2DHQA 4ZK6A 3C5VA 3Q5GA 3CU5A 4BEWA 3AHCA 4BP9A 1WOYA 1GKUB 4XB6B 3GXBA 4R7TA 3L8FA 3RRBA 2PEYA 2WSMA 1E7YA 2BF4A 3C45A 2X1VA 4J03A 2X86A 1AD2A 1GLVA 3JQFA 4QHTA 3BUSA 5DGDA 3GFSA 5J40A 4LYFA 1P75A 2FN8A 1O87A 2RHBA 3LPMA 4R9VA 3TDMA 1TOAA 2A84A 2PSJA 2OGUA 3O21A 3L7MA 5E9JA 2O1WA 3KBBA 4UNRA 1DO8A 5HF8A 4DNOA 1BGVA 4FGWA 5AFSA 1FRNA 3VHXA 4AMUA 1E7MA 3KQNA 3HYSA 3N0VA 4RWZA 5BNFA 4YMHA 3W2FA 2NU9A 1YR1A 5A9SA 5J47A 3K70C 1O77A 4CF5A 2AZMA 5JNRA 2X5XA 1DPGA 2XOEA 3U3KA 1PQUA 3QF4A 1PW5A 1T8YA 2R6ZA 3PR3A 4RDCA 5ANRB 2I8AA 5K0SA 2WABA 4LX8A 4H1TA 3SLRA 4K03A 3QEOA 5AW3A 2PVCA 1TFRA 1WXDA 3EIOA 4FFLA 3CVUA 3F9RA 1AIPA 2CFTA 2BMAA 4MP8A 2GZRA 2CFCA 2QGFA 2X0EA 5HM6A 3S2SA 1R5JA 5AUNB 4HH4A 5MF6A 5EIAA 3M1AA 4WY8A 3UHFA 4IUDS 4FFBA 4S1VA 1W1WA 3HUFA 5JJKA 1JDBB 3K0FA 1ZDMA 3EA4A 2HQ1A 5ALFA 1V6CA 3P9KA 1DHRA 2R6FA 4KMOA 4OHBA 2R1TA 2PH7A 2V9CA 5DNVA 3PJDA 3P2MA 1CBUA 1ZLXA 4LFAB 3LCVB 1KI7A 4QD3A 2XX3A 1B14A 1PJAA 3DL2A 3TSOA 3FOAA 1AF7A 1K89A 1TK9A 1OFIA 2I2WA 3MERA 2JKYA 3VR1A 1G5QA 2P9JA 3ZE1B 2FZVA 4D92A 1T4DA 4HK4A 4UMEA 3W9UA 2YWXA 3KL4A 4NCXA 1JDTA 3O3OB 5JASA 3Q8MA 5T4BA 1GPMA 3TR5A 1FQOA 1JS1X 1A5AB 2FWJA 3C97A 4ZOBA 3GNQA 4M1MA 5CX1A 1PR2A 2TMDA 3QTBA 1N8TA 2PD6A 3AXTA 4NE2A 4FYPA 1M2KA 3LLMA 4GWLA 3U17A 4CMAA 1J99A 2H7XA 3CR7A 4BO6A 2V6BA 3T7JA 1VHLA 3EVFA 4LHWA 1E1MA 3FPAA 1DG1G 1VLZA 2IYQA 4UBMA 5LQSA 2DHRA 4DC1A 2YOFA 4LE2A 2SKCA 1CTQA 1VMKA 2D7JA 2ZSJA 1AUPA 1P2SA 4QATA 1GRRA 3DQPA 1IB6A 3GIWA 5FOVA 3BMNB 5K8JB 2HLDA 2Z6VA 1NG9A 5A4JA 1PWHA 1HTTA 2VPWA 3CQ9A 3E5MA 3QLJA 3UXEA 4UHHA 2QTNA 4K9SA 2CLHB 3WGOA 5JALA 5CG2A 4Q3CA 1NSYA 2EATA 4HQ6A 3UOWA 7MDHA 1A3CA 2VNKA 4RVHA 4KLRA 3ZXYA 1DP4A 2I54A 4ACBA 4YRSA 3ZXSA 3KKOA 4V02A 5LIPA 3F6YA 2B4AA 1KI6A 2ZR0A 4ZYTA 3LZCA 5B37A 2B94A 3OZCA 4BC1A 2HPAA 2R4QA 4GI7A 4RDHA 4DIKA 3QOXA 4KYIB 1IK6A 4RTOA 4QXOA 3IOCA 3WWYA 3NATA 4IH9A 4L4RA 3O5AA 5FTKA 1ZJWA 4TRJA 4YVFA 3O8CA 3ABZA 5BVHA 2P90A 4JKOA 7AT1A 4M99A 1EWRA 1ONNA 3COZA 2SKEA 1OFHA 4L0MA 4PXAA 1FSPA 1X80B 1LY1A 3LUBA 1WDMA 2WU3A 3ME5A 4LE0A 5EMMA 1FDWA 3RAPR 5CCBA 2AI1A 1UZUA 3A14A 3ENZA 5BR7A 2GZ2A 1Z26A 3M2PA 3L9XA 3V1UA 3W5CA 2IA5A 1M2OA 2V6MA 3HL0A 1SZJG 2B6HA 3E5RA 4NENB 4Q3KA 2JRLA 1Z39A 4UPVA 1XPUA 2HCFA 5AJZA 1K7SN 1SWVA 2HF8A 2Z1DA 1DWUA 5EZSA 1M8PA 3RIHA 3RHZA 4EGJA 5I01A 5CITA 1JWAB 2B83A 5FBHA 3PVZA 4LXXA 3VH3A 1L4KA 2YUIA 4ZQFA 4D2IA 1WULS 3PDJA 5CA0A 3R8CA 1TM5E 2FRDC 5HKAA 1IN1A 4RACA 2VSYA 3OX2A 4G63A 4WN3A 1XG5A 4C78A 1RWPA 3A6LA 4DDVA 1WL8A 4QAJA 1VI2A 2X76A 1W88B 4MINA 4BYMA 1T2CA 2GAOA 1YCFA 3DDZX 2HJVA 3JTMA 3NTLA 3OIGA 3DBRB 1APBA 3GN1A 5JDCC 1C5KA 2P4UA 4F4IA 3WYFA 1XCJA 4A0HA 3I9V6 2EKDA 5A0TA 1S7GA 1PS9A 3Q2OA 3QP9A 3RFVA 3WMEA 2B1IA 2DZDA 3TLAA 4CMEC 4GH5A 1TU4A 3T1HB 3SPXA 2JGJA 1G7RA 4B6RA 4EMSA 1Z83A 2VP0A 3FOEC 1KYQA 2C4HA 4C04A 4HN4B 2NNLD 3ANYB 1XMOB 5C1PA 2HRDA 1QV9A 2BI7A 2WOJA 3K1JA 2D00A 3I5UA 2HLHA 4I55B 4TN5A 4FK8A 3UWMA 2XDQB 5DTJA 1KOJA 4B76A 4ETMA 3BT7A 2DR2A 4QJ3A 5ADHA 4H60A 4D41A 1DI0A 3EIEA 3FYUC 3NTQA 1RHQA 2CUKA 2ZRJA 3LUAA 4O8ZA 4CF7A 3G2KA 4UNIA 1XCBA 2ATXA 2PV0A 1E2MA 3I52A 2XCRB 3LZDA 3VSBA 2JAWA 3CYFA 4P31A 4QU5A 3ZHZA 4G4GA 4ROTA 4F46A 2BJWA 3LM8A 1CZKA 4UEKA 3IT0A 4WTOA 5DTQA 5AW9A 3IESA 1RZRA 3ZDDA 3OC6A 2XQJA 4D8UA 4I4CA 2ZYTX 5CCXA 2QYTA 3OE7D 2D1QA 1X9HA 3LWZA 4MR9A 1W0KD 3IIKA 3GJSA 4D3ZA 4Q01A 2WD7B 4L3WA 4ENVA 1TCCA 5CEFA 2HCRA 1CIJA 1M1YA 4J07A 5B4TA 2WWWA 1VDZA 3LUPA 1RM3A 4GQIA 2G3YA 5DK6A 1TIKA 1H42A 1TMYA 4P22A 3U7QA 1A27A 2VXOA 1W5EA 3GUZA 1JLLB 2JIMA 2QE7A 4Y2GA 5JAPA 1CS4C 4MWOA 3PX7A 4ZFNA 5EIXA 5IF9A 2WI8A 2ZI7A 5TJ9A 2IYOA 1BS9A 2QX9A 2VOEA 3CWQA 1LPBB 4MS1A 4NEGA 1N57A 1NVBA 2J6BA 4BFVA 1OHHD 2Q1XA 1U3DA 1V9LA 3QVSA 4FT2A 1YNSA 4NMHA 3JQ6A 1N9ZA 3KVYA 3JU3A 4TLAA 3NHPA 2YVAA 3OQNA 1F1JA 1ZXLA 4XQ0A 1F7VA 1U8XX 1UKYA 3LHFA 2CCJA 4L4SA 2VP5A 5ERGB 1Q1ZA 1KZ9A 3NRBA 1GRVA 2AYYA 2BEKA 3HU5A 5ALGA 1ZICA 4L1KA 4MUXA 1XZEA 4NABA 4AO6A 4Y7DA 1NXSA 3CM0A 3U60B 2DBYA 1X7GA 2W6PA 4OAQA 1SN7A 1TMGE 2FQ1A 2X42A 3LA8A 4M8NE 1D4FA 2G6BA 5BWOA 2GHIA 5D2CA 3A05A 2GFHA 3W77A 1VL2A 3KK0A 4OO3A 1IZ0A 2ZK7A 3K09A 4L02A 4GLJA 1ZW1A 1QSGA 1GN9A 2QVZX 4UE2A 4XYEA 3OQPA 3UAVA 5CJJA 1IBMB 1KEZA 2M6SA 5JQGA 3I3SR 4AJ2A 1R0KA 5JEDA 1Y82A 3H13A 2AZXA 4NCAA 5DP1A 2YVUA 3LC0A 4GOMD 1VGVA 1FDUA 2I76A 2YX1A 2YZ2A 3MHTA 4Y2YA 2QTFA 2WE8A 4NNPA 1H4SA 3C4VA 2V7WA 3E2MA 3RUEA 4YQFA 4BNHA 3GD5A 3LT2A 2QBYA 2IS4A 2YRFA 1X7YB 2XVZA 3EQ7A 3K9BA 3SDZA 1MV8A 3BQNB 2ZU0C 1J24A 5EZYA 4UM7A 3F6BX 4J75A 4H18A 5GM2A 1FP6A 2V58A 1EG2A 4YCAA 2AI2A 1E6UA 2NSJA 4NNJA 3FZEA 5G4KB 2FQYA 4ZYVA 5HIIA 4DM7A 2ZYRA 2WLTA 3PQ3A 4DFDA 1RLIA 4RTLA 1FP1D 1RQ7A 3FCSB 2DBZA 2VNJA 4FKMA 2IY9A 4CKWA 3D8NA 2QT0A 4DWOA 3WJAA 5DM1A 2CL5A 4GOLD 3K6SA 4IDDA 1PVOA 1WCV1 5CA0F 3N8IA 3IA2A 3F3YA 2FAXA 2AJBA 2XA9A 1E8DA 2J6HA 1DBRA 3S6JA 1Y34E 2CJWB 2QPOA 1P0PA 4TTSA 3HKDB 4EW2A 1PDWA 3HZZA 1W6RA 3BH6A 1DFGA 1QBGA 4YPVA 2ECQA 3VGJA 3VU9A 3KLOA 4H4DA 3IXLA 3FY4A 2IOFK 3NYQA 4BJ3A 4XIFA 2ZITA 1XDBA 4HDKA 5AUPB 4GOXA 1ZD2P 3AV3A 4XJVA 5KWSA 3GLUA 5DGTA 3RR2A 1D8AA 5JBQA 5JR3A 4B3TB 3HH8A 3V3TA 1W52X 1ZFNA 2IUSA 1RRPA 1EK0A 1B1CA 1JHQA 1Y8RB 2REOA 3DDUA 2E6KA 3DR3A 2F1KA 3GLTA 3Q7TA 4GAEA 2CNKA 4D6PA 1B43A 1DXOA 4D9NA 3TAXA 2XQFA 3PXBA 1KI3A 1O57A 4YGYA 4BJ6A 2FLVA 4NESA 3O92A 4ZI7A 1NPTO 2CLEB 1GPNA 4I66A 2FWAA 2XR1A 5TPZA 1BKDR 5FR2A 3Q41A 2H2WA 3KHTA 2OHJA 4E94A 2R1UA 3BXHA 3SR0A 1H0HA 4ZGWA 1JF8A 3PWTA 2QMEA 4JBYA 4QRIA 5HCUA 1M9NA 1J06A 4QBFA 1O03A 3H8SA 3TQQA 4H1HA 4L3OA 3GLHB 1TT5A 3D64A 4A5OA 3OQBA 4I4TB 4C0AC 5DH9A 4L2IA 2Q7OE 3CPHA 1POXA 4PRYA 1QS0B 1JPVA 4HNVA 3FB4A 1UKZA 5P21A 3AVOA 2WF5A 1XTPA 4OYYA 1W25A 1VPDA 2H2AA 3AOGA 5MN6A 4EATA 3N8GA 5JSKA 4YJ3B 2AUMA 1P72A 1XT6A 2PANA 3KQMA 4FZ3A 4X1YA 3L8EA 4I81A 2J5BA 1UEIA 2P9EA 3U1BA 2QU7A 3JRNA 4RLSA 4EQ6B 1XI2A 1Y89A 4X6XA 2RAUA 5K6AA 1PSZA 4IJUA 4Z7NB 1NGSA 1Z0FA 2WF9A 3VR6A 4P58A 5KJFA 1I13A 2H1SA 4YPOA 2PAFA 2W42A 4XRRA 5DIFA 1ZNWA 3SR3A 1MCZA 1M34B 1XNRB 3U4QB 1J5EB 1TU0A 3P7MA 1R8YA 4P32A 1EGQA 1KEEB 3DZFA 3VC7A 3ZCPA 2XCTB 2WG2A 4HWRA 1CEYA 3X0DA 3O0TA 4Y2UA 1E6LA 3GLFA 4FFPA 3S2EA 2OZPA 2EJTA 2GYUA 2DSNA 4FP9A 4UTVA 3VTKA 3BORA 4X8HA 5EXXA 3W5SA 2YBDA 16PKA 1BD4A 1LNZA 2XJ9A 2QN3A 2XNKA 4KQJA 2F3RA 4EQZA 3MJCA 4UEWA 4O4LB 4XM0A 4PYQA 4W4TA 1XCMA 5GQSA 2UUCB 4NH4A 4ND3A 1DZIA 2QLMA 1EK2A 1C9NA 4JJKA 1TU3A 5GP1A 3HA3A 2GNPA 3EZ7A 4W8GA 4P0TA 5JHHB 3L7YA 3RC8A 1CR4A 3U09A 4UUOA 2XB8A 4D3DA 3DR5A 1U5AA 4GGMX 1M8FA 2F1RA 4MRSA 1BWQA 1PD0A 4QFMA 3A6GA 4YP6A 2ZJFA 2X8JB 3DVAB 4PG7A 3MN1A 4AJ9A 1VPWA 4XOIA 2F8SA 5T4HA 5KNBH 3M4ZA 3HUUA 2IL1A 5DJ5A 4BNNA 3PXCX 2ZVJA 3DO5A 4J0EA 1T43A 4P7KA 3X1KA 2E4VA 3GLGA 5CDUA 1RYMA 2GLUA 2EGGA 1NP6A 1UBTS 1DFHA 4ZTZB 2HBYA 5JAZA 2UYCA 4H1UA 3TOSA 3BG5A 1IJFA 3M7IA 1DUVG 4KKVA 1DJOA 1HFWA 1RQ2A 1Y6RA 2QAGC 4BECA 2OMKA 5JSFA 3DHNA 1I5OA 1I2DA 1RC0A 4IQ8A 1S1MA 5EZYF 1ZSVA 3AV0B 2Y8EA 1D2AA 2E21A 3O4GA 4MJ7A 1SB9A 1H1LA 3Q40A 5I8PA 1SZCA 3RT7A 1M6VA 4DT1B 1KPGA 4BNYA 1U2PA 2V3VA 2IW1A 3TIFA 2WVJA 4J7CA 3OZUA 4QDXA 1E98A 1MAUA 3TRJA 2HFKA 3GRRA 1I24A 4RVCA 3FSGD 3OQHA 5I45A 5K6RA 3HXLA 3RABA 1PT6A 4XASA 2CSUA 4AF6A 4DDMA 4E31A 2GXUA 2GBLA 1O4VA 1Z2AA 4RDXA 1NZFA 4LYGA 3KD3A 4M21A 3M9XA 3UENA 4DA9A 2IEBA 2BFFB 4XIGS 4KFCA 4FYXA 4I1SA 1Y3DE 3B8EA 3AKYA 4RPJA 4V0SA 3P9NA 3RREA 3BFXA 1UBSB 2NXEA 1JFVA 2IYZA 1ZN7A 1NXPA 1T8PA 2QN7A 3Q3GE 1Z16A 3V8EA 1TCAA 4LDNA 4ND8B 3SCZA 1XP5A 4RJIA 5FLYA 1B3BA 2WUGA 2ZUEA 2ZANA 2QPLA 2X5JO 2YASA 2CHFA 3K0CC 1Y81A 1SK9A 3FVVA 4DQ0A 5ALHA 1R7RA 4IRUB 1P1RA 2QG4A 1BXGB 4Q6BA 4C7XA 4JLNA 2AFHB 1QBKC 4JUCA 1C4WA 4EGQA 1IC6A 4KWCA 2WG1A 3EA5A 1KQOA 4EMBA 1QOQB 2MINB 3GDHA 4FWBA 3WLEA 1GCGA 5ETJA 5JZ9A 4LIPD 5AKXA 1WOMA 1FC0A 1KDPA 1R3UA 2QUKA 2W8BA 1L7VC 4QJIA 4I6JA 1I80A 2Q0SA 2IHVA 2VF7A 2PPVA 1LQUA 2JGDB 2OP1A 3HBMA 3O4FA 3OJOA 4DM3A 4DLAA 4ZI7F 4MLZA 4PTZA 1JHPA 1WVMA 4I19A 3EXG1 4CMBA 4UUBA 4DUGA 1GG8A 4PLVA 3NGXA 3H86A 1VE6A 1XNJA 1U11A 4MRNA 2GYVA 1UJ4A 3K2QA 5FA6A 4F2PA 2CXPA 2JEYA 1OPXA 1SUBA 4L8LA 2NTVA 3CY6A 1TO2E 4Q4LA 1A2OA 4BNUA 3KUDA 4NXNB 3DKVA 1R6AA 4RF4A 3JYOA 4R4JA 4NZPA 1N5JA 5B12A 4Y8VA 4W9MC 4I46A 5D7NA 4BMVA 4C22A 5BYAA 5LBUA 4TM8A 1QP4A 3FYSA 4RF5A 1IOLA 1RJGA 3UUFA 4KQXA 4KWHA 5IAGA 4Q9JA 3SYKA 1MU0A 1G6HA 2XQKA 1IPFA 1MH1A 1RWXA 1ZXXA 1MOQA 1Z7YA 2ZYDA 1OIWA 1BRTA 2R00C 3L8MA 1QCZA 2FWPA 1HT1E 1T2EA 1XKQA 1GR1A 1IEVA 1JXMA 4F3CA 1SWWA 2ZSUA 4YT5A 5IT4A 4BNFA 5C7IO 4M76B 2M1XA 3PVSA 1JDPA 4QODA 3G5MA 1KOLA 4ZEMA 3MTGA 1CUWA 4BLOA 3RB8A 2ATCA 1X87A 3TRDA 2PDAA 3I0MA 3SVZA 4JYMA 4Z0HO 3QKWA 2PSEA 2C92A 4ME6A 3UKJA 3PC6A 2H3EA 1Y7HA 3I6IA 3A0RB 3CW9A 4YCDA 5BSVA 1U8AA 3A6DA 4ER0A 4MCJA 5EMJA 3RJ9A 2C98A 1C7JA 4KYUA 2ZJOA 2H51A 3COJA 4B4VA 1R2QA 4ZT3A 2DP4E 3W90A 1GGKA 3HCFA 4WFIA 4NFLA 4M8IA 3P0IA 1VSBA 4IDGA 5CHYA 2G17A 3D7LA 3FKJA 3M6FA 3OCVA 3OVMA 4QHSA 4YQYA 3EXHA 2AIRA 3T9CA 4IDQA 3VR4D 1LPSA 4C1NA 2BGLA 3B53X 4HN2A 3NP7A 3V97A 3PA8A 4O08A 3TLMA 4CW7A 1IXSB 1M33A 1T6XA 3EVNA 1Q3KA 3AY3A 2V7EA 2KSQA 3C41J 1ID8A 3GBPA 3SZRA 1WW2A 3R4CA 2I6TA 3ZWBA 1TCUA 1YGYA 5D87A 5FUXA 2X4GA 5C4MA 4Q02A 2PXCA 4F97A 3N2NA 5EHXA 3FAKA 3WA6A 3PEFA 2IIQA 3VO8A 2W2NA 2WVGA 2IYYA 3BK2A 1PGPA 1NLMA 2MSDB 3KAKA 2YJNA 3V4SA 3WMXA 1NVAA 2Y6UA 4EY3A 5DLQC 5G02A 3CIFA 4DPKA 4W5OA 1IDOA 1TC1A 4YRAA 2V7QD 3HDVA 3BILA 3T5CA 1YB4A 4A2PA 4R9UC 5HP4A 3VNUA 3NZEA 5AJUA 3PTAA 1RWNA 2HWWA 3C3WA 3QPDA 5IK2A 3MUFA 5B57C 5BMVA 1KXJA 4GLFA 3CVXA 2H9AA 5JJIA 5AO9A 2C2XA 2QQGA 4N6GA 3EGDA 3CVJA 4OM7A 2NO1A 1RLUA 3ENQA 1KJQA 4KXFB 4LDQA 5KNCD 5KC9A 3HUEA 2E5LB 1GGEA 4R8LA 1UPXA 4DR4B 5GPBA 3JQAD 2HUPA 2D62A 2R8XA 5H4GA 4E07A 4HTAA 4I5FA 1NASA 4X3OA 4U2CA 3R9IA 1GQOA 3EZFA 4XPIA 2VATA 4UQOA 1GAXA 3D6UA 1DEAA 1RYYA 5H9VA 1AURA 3H9GA 4FI3F 4OTZA 3HCOA 3P4YA 3WK9A 3EFBA 3ZNQA 2EGHA 2IH4A 3NTUA 4S1NA 4U3JA 1GIAA 2D0DA 1ZNQO 1EFTA 3CRVA 3DOEA 1D07A 2CDRA 4IX1A 4ZO8A 4NS4A 4GX0A 4UU8A 3VDMA 2BCEA 3F3SA 3IUYA 2VHCA 2J3IA 1QAQA 1WHTA 1ZUWA 1BIFA 3RUPA 4ZI3A 5ICCA 2ZQ5A 3D3QA 3KJHA 1QU3A 4OI1A 2O05A 3D7NA 1ZBQA 5IAJA 2YJTD 4L85A 4AMVA 4ITVA 3C74A 4UHDA 5EXTA 1L5LA 1O6GA 1IBSA 3TOXA 1NXTA 1DKPA 3VUFA 3RTAA 1U0BB 3FD8A 3U0BA 1R0LA 4YJ2A 1ZI6A 3V1MA 5C7YA 3K8OE 5AIBA 2QRLA 4P7FA 4AJJA 3NV9A 2IPAB 3EGXA 4NULA 3KQLA 2V96A 1M3SA 1LQ2A 4IO1A 1N36B 4LC0A 5FPSA 5ILQA 2XXBA 3WAJA 4LF5B 4XDGA 1XEAA 4IIBA 4XJTA 1Y5MA 2OO5C 4U5XA 4AZ3B 1KS2A 2H18A 1F8XA 3ITDA 4UHKA 1ZONA 2G4CA 4PX5A 3CLHA 5JS6A 2RGWA 3CJQA 3WGMA 1F2TA 5GONA 1W2WB 3G8BA 3W4IA 2EG5A 3JSXA 1MIOB 5F77A 3QFTA 3CF4A 2PRJA 3DZKA 3GRVA 2PYZA 4EG3A 2WF8A 1PVDA 4PE5B 4HAXA 1ORDA 3COVA 3K9GA 4RJJA 4KVZA 4KXWA 3C1TA 1PG5A 3T7TA 1GADO 4NJEB 4K87A 1E2KA 5EN4A