3LI2A

Closed conformation of htsa complexed with staphyloferrin a
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
288
structure length
288
Chain Sequence
ASTISVKDENGTVKVPKDAKRIVVLEYSFADALAALDVKPVGIADDGKKKRIIKPVREKIGDYTSVGTRKQPNLEEISKLKPDLIIADSSRHKGINKELNKIAPTLSLKSFDGDYKQNINSFKTIAKALNKEKEGEKRLAEHDKLINKYKDEIKFDRNQKVLPAVVAKAGLLAHPNYSYVGQFLNELGFKNALSDDVTKGLSKYLKGPYLQLDTEHLADLNPERMIIMTDHAKKDSAEFKKLQEDATWKKLNAVKNNRVDIVDRDVWARSRGLISSEEMAKELVELSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Ferrichrome ABC transporter lipoprotein
publication title The Staphylococcus aureus siderophore receptor HtsA undergoes localized conformational changes to enclose staphyloferrin A in an arginine-rich binding pocket.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 91
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3li2A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3li2A02
5GGXA 5JJ5A 4FI3F 4B8YA 5KOJB 2PS3A 2XQVA 4FKMA 3ZK8A 1QH1A 2XDQA 4PM4A 1PSZA 5KOHA 3BE5A 4OVKA 4XPIB 3PSAA 4UTOA 4INPA 5GGYA 2XDQB 2YNMC 1H1LA 4GICA 3ZTTA 5B58T 1M34A 3AERA 2R79A 5HDQA 5M3BA 3AEUA 5FLYA 2PHZA 3HXPA 3PDIB 4WZBB 1M34B 5I4KA 3AETB 5CR9A 5KOJA 4K3VA 1ESZA 5BVHB 3R5SA 4IRMA 4CL2A 5BVGB 3LI2A 4HMQA 4NNPA 5CX1B 1G21B 2Q8PA 4TKUB 4XPIA 1N4DA 5KHLB 2AFHB 3R5TA 5JPDA 2MINA 3UJPA 2M6LA 4G09A 5M29A 4LJSA 1K0FA 2MINB 2O1EA 4HMPA 4MDYA 1KAHA 2OV3A 4OXRA 1QH8B 1TOAA 3MFQA 4BBPA 4H0FA 3EIXA 3PDIA 3AEQB 2Q8QA 4HN9A 4WZBA 1PQ4A 2RG7A 2X4LA 3AETA 1M1NB 3AESA 4WZAB 4NNOA 3HJTA 5BVHA 5HX7A 1MIOA 4WNAB 2OSVA 3G9QA 5BVGA 5CX1A 1G21A 3MINB 3AEKA 3AESB 4TKUA 4UDNA 1L5HA 3ZK7A 4DBLE 2AFHA 1MIOB 3MWFA 4FNAA 4MO9A 1KARA 3K1AA 4N01A 2XV1A 1N4AA 4INOA 1L5HB 1EFDN 3AEKB 3MD9A 4FILA 2M6KA 5AFSA 2ETVA 3LHSA 3K1AB 4OXQA 1QGUA 4WESA 5JG7A 4HMOA 1KAEA 2OGWA 1QH8A 2YNMD 2PS0A 3GI1A 4M7OA 3AEQA 1QGUB 3BE6A 4WESB 2XY4A 1M1NA 3U7QA 1N2ZA 4TKVA 4WZAA 2WI8A 2R7AA 3PSHA 2PRSA 1XVLA 1N2CB 2OV1A 2AFIB 3EIWA 4WNAA 3U7QB 4H59A 3MINA 4TKVB 1K7SN 4MLZA 4LS3A 4UDOA 4PAGA 1FP4A 3TNYA 4WN9B 3CX3A 1K75A 4ND8A 1M1YA 1FP4B 1QH1B 5KOHB 4ND8B 1G20A 1M1YB 3ZKAA 2XUZA 3TLKA 5M2QA 1K2VN 4G07A 1H1LB 2QI9F 5M34A 3TEFA 1N2CA 1G20B 2AFIA 2PS9A 2WHYA 2XH8A 4MX8A 3ZK9A 3MWGA 5JOQA 3AERB 3HH8A 4UTPA 3NU1A 3AEUB 4WN9A
chains in the Genus database with same CATH superfamily
2IHUA 3AUFA 4G63A 3FB1A 2CXOA 2X5JO 3GLUA 4KPUA 5F35A 4D0RA 5EZ5A 3K16A 2W00A 4UU1A 5FOSA 3W0LB 2G8LA 3PQCA 5DM60 5LFAA 2V6FA 3HCNA 3WKBA 3Q41A 4JLWA 1J1IA 1QVAA 2ZQZA 5EPUA 2HHAA 2XD9A 4FMPA 3HXOA 4A2PA 1PEDA 3IOMA 2IQIA 1NVKA 4AKHA 2QU8A 1ZIPA 3I9KA 3FA2A 3KLNA 5ARBA 1M5UA 3WV4A 4ND5A 2PK3A 4RY8A 2OYRA 2HK9A 3TXAA 4IQFA 2XMZA 1H6AA 2VS1A 2IHYA 2R5FA 3WWPA 2UUPA 1I10A 4EECA 2Z4RA 4IVPA 1KZ6A 1MO4A 3IIKA 3QVTA 2JRCA 3H5VA 3N7AA 1ORTA 3E7DA 2QX7A 2A9QA 4WZ6A 4L2IA 3STYA 3CX8A 1WS6A 2FMUA 2BGLA 3V4SA 4CKYA 5KNBH 3PCRB 4CMEA 1YSCA 1RI4A 3A8TA 3UJCA 4QUEA 1CS0A 1E3LA 3NOXA 4XKJA 2MDTA 1A2OA 3QHPA 3WYCA 1DFGA 1TI7A 5CPBA 1EUDB 4XX1A 4GRIA 1R9JA 4YJFA 3UN1A 1OH6A 4QSHA 3R3WA 4MJ7A 3DWIA 5JI3E 1G6Q1 4X8MA 1AQJA 2OVBA 2RI6A 1E1NA 2WHPA 5U9CA 4G4SP 3EBLA 3C8MA 2PKRA 5J47A 3G9UA 3A28A 4O4JB 4J0IA 4U0KA 4JNKA 5DBEX 3TW8A 1CQPA 1S2GA 3A3PA 4RTOA 4KQMA 3LFHA 3DZGA 4H7FA 1EK6A 2OHFA 1M5RA 1H0KA 3PHIA 2IX3A 2JH8A 3LQ1A 4KYIB 2OBYA 3WQBA 4JLUA 1ZOOA 4HR7A 1Z7YA 3FUWA 2E87A 4H4DA 4F3TA 2GCNA 4QXQA 5FBZA 3SHQA 2WIGA 2VP5A 2WYUA 2IOHA 4M7OA 3W3AH 4BC1A 4JJKA 4PQYA 4HPXB 3SXJA 4ZV7A 3HJAA 2FMXA 1C80A 4ES6A 2WTBA 1JLRA 3KZMA 2O54A 3OTGA 4HNQA 3A6KA 4YXFA 3KJIA 1FJHA 3X43A 2FR8C 1B8NA 5IP5A 4OD0A 1JPVA 3K9GA 1CHDA 1Z15A 2Z08A 1E1LA 4S1TA 2AG1A 3MTQA 5EKUA 3OTIA 3WSTA 4Z4CA 1G8KA 4K9NA 1XN4A 3C6YA 4MOWA 2BOVA 4B35A 2Z4SA 1Q1NA 3E03A 4K6MA 3KETA 1XEXA 1ULUA 4ARUA 4BO0A 1E2IA 4Y6PA 1TYBE 3AY0A 1NW5A 4A8JC 4OXYA 2EV9A 3TOVA 2YVKA 3E53A 2XKJE 4EYOA 1F2VA 1ZU4A 4EF4A 5AUPB 4AUEA 3QVGA 1P2BA 1YTLA 3HCDA 2A57A 3S2FA 1QO0D 5IAAA 1OXXK 3TQHA 1TEXA 1KF0A 1GCGA 3HJRA 4B2PA 4TLBA 5JJ5A 2FR1A 2VAMA 1VCNA 4EJ2A 3DBIA 5JY1A 3IDZA 1ZNZA 2IIVA 3LQ4A 4WFJA 4Z2YA 4G36A 2IDJA 2RBKA 3MG9A 5HHTA 2GCEA 1O6FA 4FDAA 2VRBA 1DSSG 3I6IA 4Y9UA 3EXFB 2BDUA 2HRBA 2PGJA 1F6BA 1RNLA 4MQFB 5CRIA 2RI0A 1SM4A 3UCFA 3PE3A 3KJQA 5L7YA 5JARA 1IONA 2I1WA 1UBRS 4LTDA 1HRDA 1YKSA 4N5IX 4D0GA 1T5LA 1KI6A 3QPWA 5CNIA 1JZTA 1YRQA 5KTMA 1PS9A 4JV5B 3PWSA 4WBSA 1WUJS 2H8KA 3DDHA 2J87A 3LHFA 4FOLA 3TOXA 1GGVA 4DR5B 1P29A 1KEWA 4QDUA 2FKAA 1NT2A 4M36A 4MW7A 3KT8A 5I7SA 4MVJG 5JJIA 4P93A 3C74A 1NRIA 3W1WA 1ZMXA 3T9DA 3HGQA 3T0IA 3ZHSA 2O2SA 4F1JA 2CMDA 4G8DA 3ZHRA 2E6UX 3N1UA 5BWMA 2MYTA 3AJAA 2PUDA 1UXGA 1KMMA 4FMDF 3WGLA 1A9XA 4DV4B 3UQZA 4HUTA 1T0IA 5BN1A 5LJLA 3W5DA 3DMRA 3G68A 2O2EA 2PH7A 3FZNA 1OZHA 4QG7A 1CP3A 4MV6A 1BDHA 5CP8A 1BOFA 2P35A 1EJBA 1HNXB 1SXIA 5TMBA 2O59A 1SWWA 1ADYA 1WDKA 4PNHA 4K03A 1C1HA 1B42A 3KAJA 2OXTA 5G0UA 4D02A 5DHTA 5TS2A 1TD1A 4N8EA 2WUWE 2PKXA 1B3BA 1B93A 1TZCA 3PEEA 2NWQA 2DHEA 1UIMA 4P92A 4CLEA 3ONEA 2HHCA 1BKDR 2RK4A 2HMUA 1Z0SA 4J91A 3FHLA 1HPLA 1DAMA 1IN5A 2ZRNA 3NYQA 3GFOA 3TX6A 4C7OA 4HLQB 3FBGA 3NTUA 3GJ6A 2R7NA 5TQJA 4KWTA 3ZJUA 4GFDA 3REFA 4BP9A 2WZBA 1GZ7A 3ZZ1A 1UXIA 5D85A 2QZJA 2J85A 4UEQA 3RUEA 3WK8A 2JIBA 1PT6A 1QYDA 2ZROA 4IX1A 4G6ZA 4MPDA 2O5EA 2RGGA 3KLMX 3KSAC 1FW6A 3LZDA 1TDJA 2PZAA 1IWOA 3ZD6A 4A8JA 3K73O 1G18A 2W5UA 4L3WA 1XD8A 1H2BA 1NN1A 1WCXA 2ZDGA 4PG6A 4P5DA 2R6DA 1QORA 2YOHA 2OV4A 2YQ4A 2VYCA 3Q7IA 1YR3A 5H7XA 2OOSA 3HPQA 4CG3A 4JITA 3SR4A 4UHCA 1KAGA 1R9GA 1RLMA 1M0SA 1ZH2A 2X8AA 3IVAA 1GNRA 5CNMA 1V9CA 1SQ6A 3TEFA 4J0JA 5EEGA 1FK8A 5CH5A 2G5PA 3CW2A 1MC4A 2ZBUA 3PC7A 4HDKB 4I0WB 1NBMA 2ZRMA 5K2MA 5KKAA 2O1WA 3EBPA 5LC1A 1T10A 1V6CA 1PI3A 1Z16A 2V0CA 2Q9AA 2HNBA 3CNHA 3PJEA 4OF4A 1MABA 221PA 2CJWB 1T9AA 5SY9A 1RRGA 4B8YA 4CVNA 4D6YA 2XQVA 3ZTYA 2YWBA 1P2FA 3MAJA 3SU8A 5BYKA 4KW7A 3UVEA 1PQUA 3LCJA 4YMWA 2H0RA 4WLOA 2J6BA 3CISA 1T2UA 2GTIA 1OPXA 3PNSA 5H81A 2CDBA 3IXMA 2MWMA 1M2HA 4FHGA 4NV1A 4Y1RA 3ZJYA 5L4NA 1XJQA 4YJ3A 4LYDA 4YCJA 2LVBA 1Q16A 2CMKA 1MHPA 1YR2A 4P4TA 1NN5A 5B6IA 4HNGA 3KAQA 5GADl 3C6ZA 3SJCA 3D5TA 3E3AA 2H29A 4GOKA 5M7EA 1K5GA 3CZ5A 3LCCA 2PUBA 1Z0JA 4UMFA 3RREA 1J5XA 3AETB 3E9QA 2P6MA 1CULC 3G85A 2WB2A 2DXIA 1PTJC 2P9GA 5SY6A 1M74A 3EZ2A 4U63A 4UJ5A 1N25A 5JUWA 1XOIA 3FNQA 3K9HA 1SOUA 2P9YA 1SCIA 1U1CA 1G60A 2HJRA 1Z4NA 4ARCA 3ZQJA 4KXUA 2QVYX 1RMTA 2M6LA 2CW5A 3A6LA 4UOZA 1WEHA 2I67A 4I4IA 1XMXA 2C5GA 4BMCA 1W2WB 1L4NA 1SXJA 3DUFA 3B60A 3WHPA 4NBWA 5ECWA 1OAKA 3ZWQA 5CB8A 1J2JA 1VLVA 3FDJA 1ZESA 4HLCA 5EC8A 4JJFA 3LLSA 4W1QA 1CP2A 1DHRA 2P3LA 4QU8A 2Q8QA 3SX4A 1WCYA 3B1FA 3T7RA 4WA7A 2ZWOA 1NR5A 5CCDA 3AUSA 3IAS6 4MWOA 5FB3A 3WLHA 1S2OA 1QX4A 3E9ZA 3RU7A 2PT5A 4CDNA 1ZKDA 4LVUA 1I4OA 4LV5B 3PJRA 1R0WA 3RUPA 3K1AA 4J76A 3UMVA 2OAQ1 1N4AA 5AVSA 3FTCA 4CKCB 3UV7A 4A03A 1F06A 4CODB 3WRXC 4RXUA 4V24A 3LF1A 1H23A 3FVQA 4G5RA 5EZYB 3COSA 4L85A 1T0PA 1NLYA 4ZK2A 4Z51A 4S3MA 2RBEA 1RQPA 4PFKA 2XYRA 4RUKA 4S1OA 5KMGA 1I1OA 1U28C 1X0VA 3MW8A 5JAQA 3ZXIA 5DXJA 4KRYA 1JW9B 3KZOA 4C0HA 2P91A 1A5SB 1MO6A 1PS0A 3Q6MA 2R1TA 1G1MA 4TTQA 5TLSA 3EIWA 2V55B 4CFZA 2GYWA 4QTZA 4Z3OA 3N2LA 3CLSD 4LAFA 4RMJA 1N2OA 1WDTA 4LBZA 5L6MB 4MW1A 4Z2AA 4IIFA 2OXIA 2JVIA 1WKBA 1TRKA 5FHRA 1P2SA 5GJCA 1CQZA 2QZ9A 3ZU6A 3EPJA 2O52A 3TFQA 4BE9A 1LNSA 1XBTA 2C20A 5CD9A 1ZYUA 2HPVA 1T2FA 2FETA 4FMBB 2WD7B 3LC1O 4YP1A 1J2RA 1TM7E 5M2QA 4FX5A 3AHIA 1PSWA 1WXIA 1WW2A 4LZWA 1KH2A 2XWQA 4U2KA 2EG9A 5C3UA 5KWEA 1MENA 4QYIA 2Y66A 3ZE9A 3GLIE 1MJFA 5BW4A 3PX7A 1I4TD 1Z5PA 2VNSA 3D3JA 4I50B 4OTZA 4ZEXA 4NZZA 3UCEA 1TUIA 6YASA 5ALVA 1OYVA 2YN0A 3K8ZA 4UHEA 3QE3A 1K7FB 3U62A 4WD3A 3VTZA 4AN1A 2UXDB 3OZDA 3E6AA 2J5KA 4EHBA 4QYTA 2FWNA 2JH3A 4M0UA 3SIXA 3HYSA 3WQRA 1G1AA 2C5LA 3ILYA 4YUYA 2AUNA 3RYCB 3H5WA 4MQEA 3BCSA 2BFBA 3O8DA 4HLDA 3S1AB 4DIFA 4YRDA 2XRFA 4O4HF 5T4BA 3TYXA 5EUBA 2AG6A 3NTXA 4UE2A 4XTRA 5HIJA 4B73A 2O0LA 4BQSA 3NPAA 3HYRA 1C0LA 4HDNB 3FYTA 4DBZA 4WI1A 2DFLA 2RHTA 3ZWYA 4FOTA 1KEZA 1YVEI 2FK7A 3M33A 4C78A 1DDOA 1BDIA 2AOUA 1PNTA 4DMUB 5GMOA 1FTNA 3EW9A 2HKIA 1JQJC 1L3IA 1SVSA 2R8EA 2YXLA 3JTMA 4IY1A 1CZOA 4F5WA 1NOKA 3L4JA 1NVUQ 1CUEA 3GHYA 4DYVA 1JH9A 3CEJA 3AIKA 3ACDA 3T7CA 3GN2A 3H1AA 2BBTA 3EQ8A 3R5JA 4ERXA 3FFAA 1HC7A 1NSFA 2ERXA 3T7AA 3GUHA 4JDUA 4I55B 3ZY2A 3HO8A 3IPRA 2AI1A 3LRPA 1W9MA 4XJSA 2VDNB 4MROA 4OL9A 2P1ZA 5LYYA 1OYYA 1YZNA 1H6DA 2ZSEA 3I4CA 3VJKA 2QUBA 3HB1A 2XF8A 3WMRA 1SOVA 1ZUHA 3CH7A 2R96A 4KI7A 4PZAA 1FFXB 3EIXA 3KAPA 4AW9A 1PDWA 1TAHA 1WTAA 2PD3A 1QG0A 4IQ0A 4LXQA 3TCKA 2WMOB 3WX0A 3GLKA 5BSWA 2ROQA 2BR3A 4FJ1A 3ABRB 5FOQA 1KY2A 1YUMA 1S2NA 1WUTA 3ANMA 3G7NA 3I45A 4GEKA 3WB9A 2NU6A 2JIOA 3CS3A 4MHSA 5IAEA 1R2QA 1L8OA 3IDOA 4J9UE 4PX2A 3WJ7A 1KARA 3UMFA 5KYGA 1GFWA 5AFSA 4XQEA 4Q1BA 2P9FA 3PUVA 4FOPA 2AIRA 4LDPA 3WOVA 4CQLB 1G16A 2G5GX 4E5SA 2O8FA 1XV5A 3ZCRA 4RDXA 1D2EA 2FG5A 3BJZA 4TM8A 1JIXA 5HKKA 2V4UA 4QAJA 3ZTWA 1GLNA 2B8JA 1N9ZA 3A31A 3EUFA 4HRAA 4BFCA 4CU5A 5CD1A 4X93A 2FLKA 1G8MA 1FPQA 2NU7B 3O4HA 1AMNA 4GPAA 3AUJB 2JJ1A 1NVWQ 4YRBA 3V2IA 4U3JB 3WK7A 2DTDA 4QARA 5HTKA 3U9LA 1EJ2A 4UUNA 3IIIA 1YZYA 4IGIA 3R76A 1CVRA 1N1EA 4HJXA 3UAOA 5DNUA 4NECA 2OESA 2JJ8A 3KFXA 1KZYC 1OU4A 1WCWA 2FQXA 2X3UA 1NULA 3MRTA 4Z0HO 2ZIZA 4ZU6X 3GRYA 1MEJA 2GEVA 3ILHA 4LTNA 4AM8A 1G6KA 4E33A 4EGJA 2XUGA 5FO0A 5AP9A 3HJHA 4MLDA 2PUGA 1UJ2A 1S96A 5LMUB 1J06A 3MYRA 3A4IA 5FTMA 2HD4A 4YIKA 2CNWA 1C30A 2OCDA 2P78A 3DNPA 4RENA 3UTCA 3SEQA 3PFGA 1N2CA 1JQEA 2BM1A 1AKRA 2C3YA 5JZSA 4FDTA 1MB0A 3NDBB 2FLWA 3FPFA 3PHHA 3PGMA 3TL2A 4BMPB 1Q0QA 4I19A 4ZICA 5KYKA 4TSFD 3T3OA 4U00A 2BFCB 1OAAA 1NNLA 3SOZA 3SZRA 1AKWA 1BW9B 2F8MA 3W6PA 3ZHXA 4Z4HA 1P77A 4QDKA 4MKGA 1QBKC 1ILEA 2FG7C 2ZCVA 1GCOA 2XOKD 3QVSA 4CKEB 2P5UA 1TQ6A 3SPXA 1YZGA 1X7YA 2IHVA 1DKRA 1EK1A 1OT5A 2NAFA 1N57A 4L75A 3JWPA 2G1JA 3RT9A 3DAGA 4CIBA 3OLQA 1GUYA 4C0AC 1YBFA 2CLCX 3F3KA 4EI2A 4LOJA 2IOFK 1RIFA 1VB3A 3UA3A 4OI2A 4IMRA 1AUOA 2CFOA 5H0IA 3IB3A 1FF9A 2F48A 4PTZA 1PJBA 4XCQA 5PGMA 5CNJA 3WR5A 4UFPA 5LA6B 1P3DA 3U1BA 4LZPA 3AMVA 3NFRA 2JHGA 4KTTE 1IEWA 4FWIB 1WPRA 1LLQA 3U81A 1YIDA 4GXRA 2LCIA 4EUKA 1ZH4A 2G80A 1VSTA 2QSYA 2FPIA 4RA6A 4DV2B 1XFDA 4N7BA 4AWXA 1F2TB 1T29A 4MS1B 4P08A 1DL5A 3LPNA 2YOGA 4UM9D 3W06A 3LZ6A 3LX4A 3BD9A 3N8DA 3OFVA 5BNIA 4M38A 2WE7A 3SQDA 1YIOA 2AD1A 3HG7A 5KWIA 1K8XB 3CNOA 2ZJ1A 1QYWA 2PGOA 3ANLA 1B0PA 4CLOA 1CQIA 4DT1B 1OWLA 3HMKA 2G9RA 2WPNA 1MA3A 5EQDA 4RHFA 1XNHA 3GLHB 2ZYDA 3RC3A 3WNDA 4IMPA 1RYBA 4YRRA 4AURA 1CJBA 4JLAA 2VDPB 3FYUC 3TPFA 4EL0A 2BGGA 1RR6A 3R7DA 4DQUA 5G4KA 4QOGA 5CLJA 4RVHA 2ZYAA 1N3BA 1GPAA 2PX5A 3Q7QA 4TSFA 1DJNA 1MW9X 4TWRA 1QK3A 2OSVA 3N8GA 3RIEA 2YV3A 4HQLA 3WBKA 1NW3A 2PRJA 4LFBB 1WUYA 1OB2A 3FNGA 1JEQB 1RLUA 3O8QA 4KLCA 2DU8A 5ITZB 5AH0A 3AY3A 5CLHA 5FWXA 5DFAA 5HF9A 2VYNA 3WLRA 1Q5PA 2G72A 4G0MA 4HQKA 4DYDA 3HVKA 2C3OA 3M7IA 5FUQA 3CRZA 1IQRA 2A78A 2JFGA 4W9NA 3PXGA 2Q2OA 3QFCA 2V98A 1YZTA 3QHAA 2KWIA 1FFBA 3V4PB 3DF7A 2EZ9A 4Y2RA 1RPAA 2HTEA 3NTRA 1A4IA 1I5RA 3D02A 1FNBA 3B3QA 3QG5A 3AYXB 4OUKX 3RC9A 4MVJM 1PU2A 2F90A 1TJ4A 1GR1A 2QZPA 1E0DA 1TM3E 3Q3GE 4JLMA 4UHKA 3H4IA 3X2EA 4U9IS 4KYUA 2A4KA 4RF5A 1XNJA 5ILOA 5E6SB 3WLKX 1E94E 1JPJA 2EBHX 3IP5A 1QC5B 1UZUA 2IYWA 4ZGGA 4RH3A 3IEPA 2ZBEA 2HOQA 1Y34E 1Q2XA 1IBMB 5I45A 4DS3A 3WLQA 4H7HA 1I33A 5AXAA 4ZT7A 4DSUA 5DULA 1ZN8A 2CSUA 1EFVB 4PC6A 1ACJA 3FPCA 5HZHA 3H9EO 2A5JA 1WB6A 4L8FA 1VMDA 3PFNA 4MWZA 1HBJA 4DIEA 3DZHA 4HF7A 2GPAA 1FNNA 2OILA 2Q3HA 3Q12A 2XYVA 4UDXX 3CONA 1VIYA 3GT7A 4WZAE 2B8EA 3IUSA 3ZU3A 1CQWA 1FTSA 3LDFA 1E3WA 4YB8A 3CLTD 5AKHA 3QQ5A 2WJ4A 3R3HA 4MWEA 4GZMA 1H9CA 1PQWA 2PGIA 3G79A 4IHKA 4JJZA 3HEAA 2ZG6A 3GQVA 4NMHA 2PX2A 1WIWA 1E69A 2WJHA 4YFVA 3BXXA 1J24A 1PE0A 1XHLA 2A92A 5EE0A 5C0OE 2OQIA 5JD3A 5JBIA 3G2OA 3ESYA 1OB5A 4GNRA 1IN8A 3L4SO 1F8GA 1P19A 3L9WA 1UJ6A 1BC5A 1NJ5A 2VA8A 3LRTA 3H9QA 1QVVA 4L4YA 3BIWA 4LY3A 1CDOA 3MGBA 4E4YA 3G88A 1N2GA 4MUNA 4PQEA 3TJZA 2A1UB 2WFMA 4KCGA 4QRDA 2I4LA 4ABYA 3V3TA 1EX7A 4IDGA 4P3YA 4E6EA 2XBLA 2G4VA 2F55A 4UATA 1CFJA 4EKDA 4DSTA 4XH9B 2XRYA 3LW7A 2XXAB 4I08A 1KRXA 2PMKA 1QKJA 1DOAA 2FEKA 2ZXEA 4HEA6 3G5LA 2Y68A 1QGDA 3C6QA 4KQJA 4X1YA 3F9RA 3C4VA 4K9KA 4KIUA 1OW3B 1E6UA 2J9GA 3NOQA 5DNEA 3T3MB 5CDUA 4KWCA 3PTLA 2AZTA 3V1LA 1PNQA 1RWQA 1K3UB 2H16A 4QPCA 5JNUA 2RJOA 3AJRA 4IXTA 3ZGYA 3ELBA 3VH2A 5C5EA 3L07A 2EJWA 2PFGA 3QJ5A 4UXIA 3G2KA 3WYFA 1PJAA 3GPDG 1GILA 5F2OA 5FEMA 1L5KA 4A7PA 1KHTA 4BFYA 1GR0A 2FQYA 4GS5A 2J8ZA 4U8HA 4ZOLB 3H1BA 2QR3A 2X5OA 3EAFA 4OOEA 1O6CA 4XSVA 4CLDA 2QPTA 5GAJA 4DA7A 1SWVA 4G5OA 1PZFA 4LC0A 1BH2A 3JW8A 3OCUA 4TKMA 1EGHA 1NT4A 2D4HA 4LHYA 4ZD6A 4DC9A 4OH7A 2IODA 3KUDA 2IYUA 3UOAB 3S81A 4N9QA 2AEEA 5JXHA 1V5IA 4RMHA 3IT2A 1A2BA 1DXYA 3GF4A 1O4VA 1X2BA 4LMAA 4IYRA 1K89A 3FLBA 4I66A 4KU4A 2DVMA 1U6IA 1YBMA 3IHLA 1D6JA 3ZVMA 1W76A 3ADKA 4LF4B 2AZDA 1N6PA 1V5FA 3GI1A 3ABOB 3LPDA 2DPYA 2AHOA 4D4GA 5AJUA 5ICSA 3SQWA 5TQ2A 1QMPA 2XITA 5K4AA 3IT1A 3N8HA 3QVXA 4YRMA 2HF7A 1XJWA 5KVAA 1KI7A 2CUTA 2FN7A 3VNRA 2GFQA 4JLKA 2IVZA 3K8QA 3RT1A 1Y1KE 4OXNA 1ZIOA 1L5NA 1KETA 3F1KA 4WV3A 2I2FA 2VZ8A 2AYXA 2ET6A 2QSZA 1DZIA 4GEGA 4XQ9A 1CZRA 2VSFA 3K0FB 1YD7A 4JXXA 3EHEA 3VBEA 3VI4B 1J5EB 2JLAA 2C1XA 2PXCA 2HJWA 3C85A 1NZJA 1EFLA 1TMOA 1ZZEA 5AWFC 4RSGA 3OEHD 4CTOA 3VYTB 1ZCJA 3LIPA 3EPPA 3ESXA 1Y3IA 1B8UA 4RPCA 1GXSB 4NCJA 4QUJA 1F51E 2P0EA 3NKVA 1G5FA 1M1YB 1SHUX 7AT1A 3G8BA 2XW6A 3ESRA 5T3YA 5T3UA 5KIAA 2A9OA 4I4TF 3F9CA 3EQZA 3DZIA 1K5HA 2G76A 3W6ZA 1MXFA 4EAQA 4ACBA 1G5IA 1SR8A 4S04A 3O3MB 4IOKA 3SGLA 4BVAA 4D8YA 4NEHB 1KQ3A 4KKXB 1CSEE 5E9WA 3DQPA 3GYGA 3LE8A 2DLCX 3GLFE 5D8DA 3SHFA 1TF5A 1AD2A 2R00C 1XX6A 3B1XA 3KSMA 1KNXA 5F7JA 4MDEA 4Z4FA 3GEBA 1ZXXA 5L40A 3N0XA 1CRPA 5I7OA 1RRPA 3AJ9A 1PUIA 1RW4A 2AA3A 1KOFA 3JQGB 3MCAA 4OKIA 4PR0A 4BFZA 1GM5A 4BLQA 2XDQB 4XYEA 5B5SA 2TECE 3NHJA 2RK6A 2Y71A 3NYWA 4U02A 1Z7EA 3T38A 3A7DA 4BJ5A 3ZLUA 3Q15C 4DRXA 2VSNA 1RJ9A 1HQCA 3LCVB 4NCKA 1CUJA 4GP9A 4FZ3A 4TPKA 5DLDA 5EIFA 3S3TA 1F2UB 3W8NA 3C8HA 5ALIA 1TYCA 1GGJA 3A1NA 5I3ZA 3LLMA 2PSDA 3CVVA 5ALGA 1WWKA 3RFTA 4CBVA 1HDYA 2CHFA 4Q37A 2QM0A 3T99A 5AVQA 2J3LA 3IOEA 4KMOA 1P7CA 2H51A 2NXJA 3HEBA 4HATA 4JI0B 1JSXA 4ZGWA 1AA9A 2O14A 3NM6B 4O4HA 1LBHA 4H18A 1RQ2A 3WYGA 3E7FA 5GM2A 3H8JA 4TL7A 2V1UA 5G02A 4RU1A 4LYYA 1QXSA 1NHGA 1LPNA 1UKYA 4ZVMA 3RHSA 3RTGA 4YR9A 2FRDC 2HUNA 4U0JA 3DVRX 2CJPA 2VYQA 2RC6A 2X7XA 4L6AA 2XMSA 4LKOA 4UBLA 4NRDA 1Q0HA 5CXSA 1PDOA 2YVAA 2Z3ZA 1E0KA 3I92A 1Z18A 3EVDA 3VVCA 5MFZA 2GUWA 5JR3A 4E07A 1JYEA 1V3UA 3GEPA 2CXRA 3U6BA 3X1YA 2OXFA 4BX9A 5BORA 5EZ6B 1MIOA 2F4NA 2SECE 5JLAA 4R2XA 5KNDH 4EQ6A 5AXDA 4MW5A 4AJ1A 5B2ZA 3RTBA 4RVFA 5LKRA 3NAMA 5DT2A 3S2SA 1IN4A 3IUPA 4RVNA 4M99A 3UK2A 2P9CA 1ZO8A 3E4CA 4NCNA 2YHIA 3WKCA 2NU9A 2QX6A 3OPVA 2BKEA 1WF3A 2RK3A 3CEHA 3KDSE 2J0SA 4BECA 1P60A 3TFWA 1PL6A 5FV7A 2R7AA 1ECGA 4ANFA 2W7TA 5AW0A 3OLZA 2RHMA 1Q0SA 1QTIA 1T25A 3HYLA 4FKZA 4UAJA 2B20A 4AIIA 1F3OA 4JIGA 3KYDB 1KPGA 3JYQA 5EIWA 3HE3A 3V8PA 2UYGA 4EY3A 2CVZA 4R7ZA 1GNLA 2QJTA 4LX8A 1PL0A 3ER6A 4OAOA 4QO7A 5EJ9A 1AKMA 1KSFX 5DSZA 4RLQA 2BFFA 5I9LA 2H2IA 1NW9B 3RT7A 1BHO1 3L1VA 5JFOA 3NWJA 3I0NA 1DBSA 4UEOA 1FYEA 1H85A 3GJ8A 5C1OA 3H2GA 3LKDA 8OHMA 3CCCA 5JXGA 3WKAA 2AN3A 1K63A 2PH5A 4MW0A 1R8SA 5KHOC 1PJZA 2VP9A 2DPHA 1GYRA 5EHIA 2VYVA 2IHTA 3TQQA 2FMHA 4ZQIA 2B8WA 2VHXA 3WQHA 1UT8A 4WE3A 5LJIA 3JZFA 5KTPA 4C7JA 1ICIA 2DE0X 3D43A 2PRZA 4LE2A 4AICA 1RFLA 2X58A 2ZWPA 4WCFC 4DN6A 4ILKA 3M5WA 1VHDA 1TJ5A 1BIFA 2X15A 4PEVA 3U49A 1ZXBA 4YONB 3QOYA 2P9ZA 2FYTA 4UHBA 1P75A 5SZKB 3SI7A 4DNQA 1CERA 4ALLA 3L1IA 3I61A 2HLDA 5YASA 5EZSA 2G1AA 4UFNA 5EINA 3NKLA 1W0JD 5E2AA 1NI3A 4N39A 4F2GA 2POQX 3EFOA 3SFVA 1TJPB 3D7NA 3KE9A 3KAKA 1QGED 1NLZA 5LZ7A 1K97A 1H69A 3H05A 3KOXA 4JUIA 4V38A 3W77A 1DEXA 1W9HA 3HO6A 1KYQA 1Q91A 3LL4A 4H0NA 4Q4HB 3CUKA 5CA1B 1W34A 1AH2A 3A06A 1BNCA 3SMQA 4UXHA 3TOSA 5CX1B 1JKMA 3N3AC 4XPIA 3WOHA 1C0IA 2OV8A 4D74A 1QG4A 4QUIA 2NZJA 5K0NA 3TE7A 3WL8A 1E6WA 2WHXA 821PA 4OJTA 4FQ7A 1Q77A 3RIXA 2KMLA 3ZY3A 5FJIA 1C3VA 2XB8A 2QJRA 3TRHA 4RFVA 5IT9A 1CZNA 1XQWA 4J1QA 1AQ6A 4RC9A 1VSVA 3L1UA 4M0MA 3E1KA 4KR0A 1NQAO 2XT9A 2WAOA 1U2PA 4B3GA 2IUFA 2L82A 3Q3CA 3DAFA 4I1RA 3F96A 1CVIA 3AESA 3CUTA 3PYXA 4NDNE 1JHDA 2A7QA 3MD0A 3KT6A 4NJMA 4BNZA 1TA4A 4P38A 3MHPA 3VQTA 2YWDA 3O7MA 3I1JA 5K9ZA 3D7SA 3L41A 1TM5E 3FCEA 3GUZA 4UZSA 1BRMA 2XNDD 4TLMB 4MS4A 4MGEA 4HAIA 5KB3A 1I30A 1E5LA 1R9NA 2PQ6A 3IBFA 5DNVA 3HHEA 2I55A 3A1CA 1FDTA 3TTUA 4MCIA 4ER6A 1R5NA 5CXXA 1QHYA 1MT3A 1R74A 2IYAA 2PSHA 3SC2A 2IKQA 1B0ZA 2NG1A 1EBUA 2QL9A 5DX0A 1LPSA 2F00A 2W2OA 3ACBA 5A6SA 3MJ4A 2QAIA 1IMJA 2H92A 4CIDA 1XCBA 1E2EA 4HDRA 1YHYA 5KJ1A 3B9RA 5TVKA 1IHYA 1WX1A 3BERA 4TX1A 4B9AA 3VDNB 3OZRA 1D1QA 5FBQB 4JCOA 3UT5B 1O94C 5K0ZA 4TKVB 3ILSA 2ACWA 4P5PA 3FOEC 4K9RA 2OBFA 2QTVA 1ISSA 1U2GC 1XVVA 4AJIA 5K8LA 4MQ4A 4KLAA 1GPBA 5H16A 1W30A 4A16A 1ETUA 2BGMA 2WM2A 3NIFB 1M75A 3QFRA 4G8BA 1L7RA 5F2EA 1DMRA 3P4UA 2JFPA 3AIMA 3LBNA 4KODA 4WCFB 2I2BA 4BRZA 1E7RA 1WZIA 5EQJB 4IPTA 4S05A 1A8SA 2AXNA 2C03A 7REQB 5E38A 3BK1A 4GXTA 4PYIA 1YDWA 3PVZA 2GD1O 2FN3A 2QNBA 3KWJA 3T4XA 5AKEA 3EGDA 4ITUA 3D4LA 3VKVA 1ULBA 1U94A 2VHWA 1NE7A 3KELA 2IHZA 2W9XA 5BN5B 1UM9B 1NG9A 1N2IA 1NFFA 1PJ3A 3EIOA 1AO3A 3BGSA 3LGXA 1TAGA 1C0KA 3EODA 1UBOS 4XQCA 3R23A 3QU9A 5ELMA 1XEAA 4QQFA 4B81A 1PSZA 1P4JA 4E5VA 1ZCBA 2JZNA 3JAKB 2MMGA 1N8NA 3DOJA 5KYNA 2A9FA 1H1LA 1YB2A 2CDCA 3T7IA 5IYZB 1KO5A 4Q3CA 4PAMA 4LF9B 2P67A 3I5MA 3DOEA 1Q84A 5AR1A 2IV3A 4B4UA 3QWIA 3GPIA 4WT7A 2YN2A 1JYFA 1L7MA 3GIDA 4JJ8A 4EFNA 3N2YA 2NTNA 3EC2A 5DXAA 3HXPA 1SHZA 3K9NA 2YWEA 1BJRE 5HE8A 4AZ0B 2HL6A 2IGBA 3OIUA 3PUKA 4PW0A 3VR5D 5HIAA 2Z6UA 3T9EA 1C2TA 1U8XX 2VNKA 4B43A 4XM2A 4XVHA 4F06A 1P44A 1E3JA 5IK2D 1JIVA 5L4LA 5JPDA 3KE8A 4MUBA 2BGRA 2PWPA 3KO8A 1EUDA 2JVKA 1KA9H 2O8CB 1Q0ZA 1KQPA 5AKJA 4O8CA 2NZ2A 4I8IA 5IJ9A 4LQ4A 3UFXB 2QM8A 3LECA 3PJFA 1MVLA 2FZVA 3MJTA 4M6WB 3DE4X 4EPVA 3ESQA 3G2HA 3D7RA 1DKMA 1N0VC 2C0PA 3Q1KA 3UJ7A 3TZLA 1RQNA 4ZARA 2WTMA 1X9HA 2HWKA 3HCEA 1OLXA 2MT9A 2Z5LA 3AF1A 4PO3X 4B7XA 3FOCA 4NBSA 1Y5MA 1HFJA 2BUAA 3T1NA 4UEWA 5HIMA 1QWSA 3O9ZA 2IPNA 3K05A 3FGNA 3OPMA 1XQ6A 3B36A 2EFDB 1WZ2A 2HRCA 2FFAA 2C97A 3ZXUB 4Y9RA 2VJBA 5TGTA 1DQNA 1FRFS 1Y7IA 1RM3A 3MILA 4R54A 4ZJZA 3KWFA 3LGSA 3M6UA 1ZC3A 5TGDA 2AB0A 1R3DA 5AICA 3VRHA 2E4AA 2PX0A 3GJSA 1KP2A 2OCIA 4JXZA 5CH8A 3TSOA 4P3XA 1AN0A 3UB2A 4N5HX 4BJHB 2XSZD 1N6HA 2JAWA 2ADFA 1NNI1 2IYZA 4GLLA 4PLFA 4UARA 2JKVA 4DR3B 2DR0A 4W4TA 4F1KA 2Z30A 4WZBE 4X1KB 2FPGA 3UUWA 3O1JC 2V65A 3C3AA 2XMQA 4XLTA 3E15A 3OT1B 5IK2A 3ZG6A 2M6RA 2HQRA 2VKTA 1SKBA 4PWZA 4TTSA 4AI6A 3DOOA 2HBRA 3MJFA 1G8JA 3L92A 5JS1A 3FNIA 1MV8A 4EUFA 2ECPA 2ORWA 1Y48E 2PJDA 2RIPA 1PHRA 1NQXA 1PVVA 3BTSA 4Q12A 3LJKA 2QMHA 1GFSA 4ZT2A 3Q9LA 3THRA 3B1WA 1P80A 2FSGA 1Y98A 4QUKA 5DBHX 3DD1A 2NXEA 1T1JA 3L6CA 2K4MA 3Q6IA 1X7WB 3NGXA 4ATNA 5JYDA 2XCUA 4GYWA 4Q4AB 5LBUA 5UKDA 3NHBA 2P9QA 5LZ2A 1YZHA 4HNHA 4OA5A 5BUQA 5A4DA 4IL5A 3QFHA 1IEXA 2V5VA 2CNNA 1XZDA 4D79A 3KX2A 1UOPA 2VWQA 1Y6RA 2BFEA 2W0SA 1R6VA 3RIMA 1F8XA 3QSYA 1ZITA 3R3SA 2TMGA 1RWWA 5HCIA 2AYZA 3GMDA 1QH1A 4BP3A 4L27A 1OYWA 2E5FA 5COAA 4M1SA 4B3DA 1G19A 3O4JA 4MQFA 4PS0A 5H8WA 1Z75A 1ZK0A 2LGJA 2GO1A 5EYPA 4FK8A 4I4TA 1NUHA 3IERA 2PU7A 4C4XA 1EIZA 3NMUF 5ALRA 2Z98A 1B74A 3RSHA 5B58T 1O5TA 5AM4A 2PX8A 3LLVA 5FBRB 3V80A 2V7QA 3WC4A 4ZOQI 1D07A 1KBQA 1L9KA 3G89A 1X7HA 1P6UA 3GK3A 3QYJA 5KQSA 2ZWAA 3TRFA 3WGIA 4OHBA 2GJKA 2WWRA 3THXA 3KYJB 2F9LA 3CLRC 4ZQBA 2BCJQ 5FL7A 4PN7A 5BVGB 4YCLA 2R8PA 4ZAWA 3SF8A 4FCVA 5JDIC 3PUHA 5IC6A 3PC6A 3Q8WA 2YBDA 2CLDX 5T57A 4B31A 1CF4A 1OPRA 1E4EB 3V4FA 5I48A 3IJEB 3IQZA 1GTJ1 4NFHA 3RVLA 4QYXA 2AH5A 3KPWA 1HQDA 4W5OA 3ME5A 5E9QA 2W6OA 4JC8A 2C7VA 3RYHA 1ZW6A 2X1VA 4IJ6A 3RSCA 3T15A 2XUOA 1Q1AA 3ZJ5A 2O23A 5D2CA 4G4JA 1KBZA 4PTLA 4U6SA 2QROA 3ND9A 1U0GA 3R24A 2FR8A 5FTLA 3FHOA 3GT3A 3RNOA 2WSSD 1L1RA 4DVJA 2YUTA 3PCTA 5IKOA 4NARA 3TBFA 4Q1EA 5JFGA 2GHQA 2O2XA 2XEXA 4YJGA 1UXHA 1DPGA 4CU2A 1QSGA 3N5CA 4TRNA 3B53X 1KC1A 3EZ7A 3ZXYA 3PR1A 4D82A 3CFYA 2CL0X 3ZX4A 3ZNOA 1SGWA 3EF0A 5FUBA 1RPTA 1CX9B 4DLAA 1VL0A 3H2YA 3HDHA 4JB3A 3W9SA 1X15A 5K6AC 1UZLA 3B89A 1EYZA 1UJMA 1HDZA 3TTWA 1A9TA 1OJ7A 2BEWA 4RZ3A 1M6HA 1JQDA 3WNQA 3PVCA 2G4CA 1TL7C 2O9JA 3QTBA 4QU5A 3IO3A 2P4UA 2JI6A 3BMQA 1R6XA 3U7IA 1Y8RA 4HH4A 2IQ5A 2SCUA 4WUTA 2PBRA 5SZJA 3ZW8A 1Z74A 3HY3A 4I81A 1DDGA 1X74A 5KYWB 4UHJA 2B35A 1M2VB 2EYUA 3A9RA 4JZYA 4WINA 4BWGA 2F8SA 1II0A 1A5BB 1VBNA 2CHGA 4I99A 3NEJA 4TWAA 1NNUA 5CG1A 1Z33A 4AJEA 1BHQ1 4PO1A 1UP4A 3BD7A 5HF8A 3V6LA 1RPZA 1ZN2A 2GZAA 3QG1A 3HS3A 3IQGX 1Z2OX 3VU3A 2M32A 1G6HA 3QKSB 5TVGA 4EGCB 2ATCA 4P33A 1FIUA 4R9NA 1XTJA 2N9UA 3WA6A 1OROA 4D8XA 3D64A 2QD3A 4ZOEA 4BNJA 2WSSA 4C08A 2NVOA 1ETHA 4CLRB 1M2KA 3BHIA 4YP7A 5KNBD 3VHRA 3GJXC 3IR7A 3GGOA 3IMEA 5DCUA 4AY2A 2CEAA 4KXQA 3Q6NA 5AW4A 4ECAA 5CM8B 4II3A 2HDOA 3O47A 4H6VA 3CLUC 2PD4A 4FD2A 3DOIA 1ISHA 16PKA 2MTBA 3AGPA 5CLGA 2AJTA 4IILA 4F4UA 2NP6A 2DY0A 2X1MA 2IEBA 1L7EA 2QRVB 3NIDB 4TS4A 5T4FA 1WPQA 2GETA 4XEHA 4QYSA 5J5CA 4N0QA 3DM5A 2H65A 4LHSA 3ZH9B 3IAS1 4AZVA 2JLSA 4ZI5A 2WTAA 1M2GA 2HQ1A 2HPZA 3VX4A 1UC8A 2COKA 2VPQA 3ER9A 1PWXA 4GQAA 1DIOB 1ESEA 3E3LA 4MHOA 3QF4B 3TQSA 4AO7A 1KZ4A 2KHZA 2XB9A 4H77A 1NF9A 2DKFA 3WIEA 4Y3UA 4ZQGA 3G0OA 1W36C 1EUZA 2QVZX 4DDWA 5IJ0B 3OHMA 1F0PA 1MRSA 3G5UA 2HFJA 5JLJA 3KJNA 3W3AD 4X64B 4B3XA 4DCPA 3OF5A 4EA9A 3MYYA 4N18A 1RABA 3BXZA 1RAAA 4M9UA 5HZMA 1NUPA 3CNEA 4U1RA 4N6OA 1I6WA 1EHYA 1KVTA 3RDPA 5E3IA 5TPWB 3U80A 1ULSA 1N6IA 1AB6A 4Q7JB 4Q9NA 3WKDA 3MMZA 4B44A 1V26A 2EX4A 8ADHA 4M1WA 3VO1A 2YJ5A 3PGVA 5AJYA 4M9RA 1E1CA 4J0EA 4NOJA 2IXBA 2M1ZA 2VH1A 1JU3A 2MSWA 3A37A 3B3AA 2GLTA 3FUCA 2WKSA 3OY2A 1E5VA 2XB4A 1FYFA 4CKCA 4PYLA 1DKNA 1ECBA 1Z6ZA 2IFTA 4L78A 4CL0A 4KPYA 1B1AA 1YS6A 3GPCA 4D26A 2M6KA 2J32A 3R9WA 4FILA 4ID3A 5IHXA 5EAIA 1RM5A 5JBQA 2XAUA 4OQPA 5K6TA 3K7EA 1EK0A 3EGVA 1PGPA 2HA4A 3JQ9C 3T5PA 1OFGA 2OGWA 3CKKA 4BO6A 5DBFA 4G85A 2PJRA 3ND7A 4TWZA 1QGUB 2CE2X 5FWNA 1TM4E 3P8ZA 4OSPA 1JQBA 2ZI7A 1SC4A 1R8JA 1MG5A 4CR7A 1G55A 4GD3Q 4PYRA 2EWWA 3L40A 4P4SB 2OV1A 3H7IA 3G8CA 3ZY5A 1S0UA 3ZZTA 5KJ6A 5ALMA 2KW5A 3SSOA 5K20A 2V7XA 3EBOA 1W85A 4MLZA 3QEMA 4O0LA 4FSXA 4AQ7A 1MD9A 3KVOA 3OWOA 4UDOA 4PAGA 1BGWA 4BLWA 4EJ0A 4YJ2F 1B4DA 3VO9A 4GI7A 4C14A 1Z37A 2ZVDA 3FRIA 5EI5A 2XCLA 5B37A 5DK4A 2ZE8A 3MMNA 1ZK4A 3W3AA 2C2MA 3DM9B 5DYNA 5A5FA 1NDUA 4POOA 2EFCB 2IU4A 3KTOA 4NYIR 1TUBA 5G2OA 5B2FA 1QZTA 1E9BA 5H59A 1XZBA 1GGNA 1YQDA 3V4OA 1PKXA 1V43A 2ILTA 2SBTA 1E9CA 1JSRA 1YC5A 2J4CA 3PUZA 5JPCA 3RUCA 2K6GA 5DX1A 1SVWA 1BU5A 2PX3A 4C0WA 4GL4A 1QPBA 1V1RB 2AC2A 4B6GA 5B3JC 3ZNQA 3DT9A 2AG8A 2ZDHA 1PTJA 4LDQA 4Z4QA 2WM9B 4EA7A 2CY0A 4GBJA 4OUDA 5A4FS 1NURA 1WMEA 4MWSA 1RBYA 3GGDA 4Z9BA 1CT9A 4ZHSA 2PXAA 3ZHZA 3M5PA 1R88A 3S5JA 2WG0A 3RTAA 4G5QA 5DGDA 2O7NA 4MXDA 4A8HA 4MVJH 3QPVA 3FPEA 2W90A 1OX6A 1IFXA 3AW9A 3Q9SA 4DPMA 2ZIVB 4EFLA 3IKLA 3ESAA 1CQXA 2JA1A 3L2OB 4IWYA 1JFTA 2GAOA 2Q4RA 4HKTA 4PX9A 2ZJ6A 4PHFA 5IUJC 4TQAA 2O3JA 5NULA 1JR3A 3B13B 3E0XA 4L7QA 2WJGA 4MI3A 1QS0A 3O5AA 1WUKS 4PU0A 3D1JA 3W34A 4KAFA 4O5OA 5BURA 2WJAA 1UFVA 4BQPA 3LOQA 1V8BA 4PG4A 4AJPA 1CY2A 1B3RA 1T4BA 1ZM4A 4JFAA 3WRXA 4E3ZA 2EW8A 3N2KA 1W87A 3ROZA 3UO8B 4BB5A 4BMOB 2BD0A 2RH8A 4LJSA 3WWZA 1KJQA 3GJQA 1FTQA 1Q11A 4HMPA 4NSNA 4OHWA 2VSQA 2ZJ3A 5HQ3B 1U28A 5ALZA 1YZLA 4JI5B 1M2WA 1TUEA 5FUWA 4HZUB 5IBRA 2LXNA 2F1OA 1AHNA 1QFMA 1U2ZA 3TDNA 3L7YA 4X94A 3WK4A 3ZDEA 4MI1A 3BWVA 1RAEA 4N5NA 5KZMB 1NJ8A 3FDFA 4L15A 4EHKA 3ICWA 4TL8A 1XIVA 3BD6A 4JZKA 4MUMA 2XUKA 1NW7A 4BVFA 4KH1A 5A7FA 4MO9A 3K2BA 4EPTA 1WMBA 3RSFA 4RHTA 5HIIA 3HUFA 4DG5A 3T7TA 5KI6A 1OH7A 1R4NB 3NH9A 4MEJA 5IKXA 2QTZA 3DV0B 3IEIA 5DCWA 3MSCA 1FLVA 2DFTA 1T5TA 2C96A 3MTGA 4KKVA 1ZMBA 5H1YA 3AKEA 5GJVC 3VTAA 1WDMA 4PHCA 4X44A 2QLJA 4HYQA 3RARA 3I2HA 1B73A 2ZSBA 1B16A 4U3JA 4WSOA 3L6BA 5U1PA 2ONCA 4BIIA 4O0MA 3PNOA 1N6LA 4BZPA 4KPFC 4MMYB 3U6KA 4FLFA 521PA 5IJAA 1S3FA 3HJBA 1Z82A 2CWWA 4ZO9A 1SCQA 4AC9A 4EB6B 1FL9A 2GAAA 2VRWA 3HCPA 4FEAA 1NATA 1AZWA 3B6ZA 4CWAA 4Z4EA 1P4GA 2X77A 3JATA 4Z86A 1JU4A 4YRQA 2XB6A 3H8VA 4JR0A 3TTTA 4D45A 1TZMA 3BSYA 4NI5A 4OMFG 5FWDA 5IBCA 4D81A 4JODA 4QHSA 3H1FA 3E0QA 3H4TA 3TLGB 4REQA 1RYFA 2B9EA 3E82A 4XGNA 3JQAB 4LWOA 2GSWA 3ETGA 2G0AA 4B3MB 4DV1B 1O08A 2DCUA 2XMBA 1IU9A 4MWTA 1V1MB 1O97D 2J41A 5DVZA 5AM2A 2NZXA 1MQSA 3JQEA 1C1YA 1V25A 2JK0A 2LWIA 2BV3A 3BQ9A 2FPMA 4QJBA 4TRMA 1BW9A 4XQGA 3RVOA 2R85A 3I37X 4XSGA 3WGQA 4MV9A 4C7MA 1Z7WA 3QU7A 5HK8A 1BN7A 1J21A 4OHXA 3K0SA 4F2PA 3E5HA 3BMOA 1YRHA 1E9EA 4O4LB 1QE5A 4R05A 1NC3A 3WDKA 1ILWA 3W9UA 2NUBA 3KK0A 5IX8A 1U7HA 5JWOA 1QIKA 1O03A 3C7AA 4GZ3A 1AA6A 3IB6A 2QD1A 5LA6A 4J8PA 1ZM2A 4B09A 3B9PA 4I5FA 1DWOA 3AKZA 2Q6OA 2OECA 1MB4A 5CLQA 3W2FA 4EI9A 2F62A 2QJFA 1Z2AA 3PS9A 4A6PA 3I9MA 2I9PA 2GLUA 2Q29A 3N2ZB 2GEJA 5KTNA 2ZRKA 2Q3JA 2QIPA 3FVRA 3GHHA 5TMDA 4YYZA 1EDZA 1TM2A 5L53A 1DCTA 1Z28A 2REXB 2V59A 3HYCA 2JLVA 3S0JA 1UK9A 4YV0A 3ZDBA 3DQQA 1OI4A 5DGCA 1VDZA 3AUXA 1R27A 3LG2A 1FCJA 3GEGA 2I3GA 4K6FA 2GZSA 4X7RA 2EWMA 1QP0A 4D6PA 4EBBA 1R9MA 1VIDA 3L01A 5AVVA 1IUKA 1K9VF 2Y1DA 4I36A 5EP2A 4F2WA 2C9MA 3B12A 3K35A 2O3TA 3LV8A 2JCBA 4JI3B 4DLPA 1UBFA 1Z63A 4LXIA 2JC3A 3T94A 3LO5A 3F2IA 3KQQA 1KERA 1Y7HA 3OQJA 3ABQB 1Z26A 4RHXA 1JEQA 1OZAA 2P9JA 1TVCA 5ITZA 2BBOA 1E79D 4LHXA 5EWJA 5M5BA 2ENUA 3QEJA 1XXHE 3OE1A 3B6EA 1V9LA 2JAHA 4OXKA 3STHA 2C7PA 3LOPA 3B5EA 5HKAA 1OKKD 3CUWA 1EMDA 1U8ZA 1KE1A 1JKXA 2PTGA 1GQQA 3T5BA 2Y1CA 3R0JA 2AF4C 3FCOA 1Y5LA 3KEQA 3G17A 3G3EA 4KDCA 4N8SA 4PRZA 4EHNA 4MVJE 4PXAA 1QK4A 1U9YA 2K7FA 2GESA 2GPWA 3COPA 2G77B 4FW9A 1OWPA 5SYAA 4DEYA 4WY2A 2ZBDA 1AIPA 1HTWA 3E22B 4J0QA 5G53C 4Y2QA 4B75A 2Y1FA 4F11A 3BXEA 2PRSA 4G9GA 4GSYA 1I80A 3HN2A 5LP6B 2GN1A 4I8XA 2Z58A 3KLBA 3PPXA 4KGDA 5B4TA 5B4VA 2YMMA 5CT4A 1FDUA 1Y6QA 4HB2A 5DNYB 1UEXC 1MQ9A 3JR7A 4C7XA 4BJ3A 1HR0B 2CFRA 1XE3A 3AVWA 2GHTA 1UPXA 3G0DA 5HKOA 2DHCA 1FBTA 3FMOB 4DMGA 3STUA 5JADA 1IPHA 4AMZA 4BKUA 1K8ZB 3IP1A 4Q4DA 5F9HA 1QYRA 1EFVA 3AI7A 1DT3A 3KKLA 2OZVA 1YBHA 2ZEJA 2VBFA 3GH1A 3LW8A 3PICA 3ZHTA 5IYZF 4ZI7B 4V1CI 4RLSA 1P0CA 4IDHA 3U19A 4GX5A 4QQ8A 2FE1A 1E3QA 5IHPA 2ZM5A 4LKRA 3HXKA 1QIIA 2VA9A 4KQCA 5JASA 1WXGA 3HNOA 3RF7A 4UTPA 5C3MA 1GSHA 1C8LA 2QV7A 4Q6BA 1EE1A 2I7VA 4HEA1 1LK5A 1QTRA 1Y0BA 4IV8A 2M6SA 4EGFA 5KOJB 3U7GA 1P7YA 1PZGA 4QWWA 4I5EA 2B4KA 2E4VA 3EQ6A 4B8ZA 1WETA 3AGQA 3M6XA 4TZ0A 3PSAA 1KDRA 3WNZA 1XNQB 3NUZA 1OSNA 1WXWA 3PNKA 4ROSA 1IC6A 2C2YA 2XE7A 1O9BA 3DE3X 4HXGA 2PVSA 4D6XA 2I8LA 2B98A 4FZ5A 3S2UA 4EVIA 4MKIA 2ZUTA 3JARB 2ZU6A 3L6EA 2A1UA 4W5NA 2O2DA 5KTOA 2FU5C 3FYUA 5AM0A 4BZZA 2QR2A 3HP4A 3OKPA 5F98A 1OH5A 1CE8A 2F2TA 3AX6A 2QMEA 4GHWA 4GOND 1CRQA 4JIMA 2B1GA 1KK2A 4NPCA 4DDUA 4PANA 1NBEA 4N1AA 3FE2A 3K8OE 2FGKA 3B2NA 5D3MB 1A5AB 3RJ9A 1U3FA 1HOXA 5LUAA 2G63A 3RSGA 1QZ3A 1L7XA 1U4OA 2ZB2A 3LD9A 3N8IA 1UKCA 1TC1A 4LF5B 1T9HA 2H7CA 2PLNA 4L76A 5BP7A 1NVDA 4F3NA 4KLRA 3LQ2A 1S2DA 2D5BA 3ANXA 3L7NA 2ZR0A 3SSMA 5F12A 3BGWA 1D6NA 3RTDA 1LS1A 5KYYB 1QIJA 3EEBA 4I1IA 3PDIA 2AMYA 3EY9A 1PQ4A 2ADOA 3CURA 3A9SA 2UKDA 3HY6A 1G20E 4DBLC 5EPOA 4F92B 3VYRB 4E94A 4UNNA 3LPCA 4KGXA 2YV2A 2QKYA 4B6RA 2J0UB 3EDMA 2YBEA 4ZFNA 5BXQC 5JVDF 1KAOA 3OQVA 5ALEA 1ZMTA 2YTZA 4DBLE 2I76A 1RXYA 1XZ8A 1GHTA 2QRHA 5A4AA 1PZHA 1DINA 2B8NA 3ZDDA 3C70A 3R6WA 4UCWA 3RM3A 1T2CA 1DC6A 2GN4A 3K2QA 3FZEA 4BASA 3DB2A 2H4HA 3CEPB 5FTKA 4DJEC 4TQUS 4NR0A 3BMCB 1JHYA 3UGKA 3PPVA 1UMBB 2ZANA 1PEYA 1Q1BA 2BFOA 4G3XA 2OBXA 3AF5A 1XUOA 1ACMA 1X1RA 3ET5A 4RVUA 4WZAA 4DCUA 1JFSA 4JASB 5DBIA 3RVKA 2JI9A 2YICA 4GVPA 1GG5A 2X5NA 1W4ZA 1JEDA 1PYDA 3DBHA 3Q88A 1TYAE 3L77A 3UANA 2JLQA 4JOCA 4J1NA 1FNCA 1J2TA 4IXWA 2JJMA 3FJ1A 3DC7A 2FZLA 5LOVB 1UQRA 3F8WA 1CY8A 1I7LA 1V4VA 2D54A 1X1TA 2PWAA 3HRKA 1HMYA 3IPXA 2VI5A 5KKNB 1M1YA 1U2SA 1GRVA 4U8GA 4YCCA 4LC9A 1KY4A 3JTEA 2IEAA 2N47A 5CGQB 1IATA 3L46A 3C3EA 4BQQA 1H8EA 1TD9A 1FYXA 4CF5A 5HM8A 3UAGA 4O29A 3DPUA 3H5AA 3EXEB 1LLCA 3ZBUA 4P0TA 4JVNA 4ZZ3A 1LDYA 2IKSA 3FGPA 2I9KA 2PS9A 4H6WA 3Q8KA 2BTQB 2GCOA 4UNPA 4B3BA 1JVNA 3OTWA 3VBCA 2UVDA 3D8BA 2Y05A 4EGQA 4JELA 2C77A 3B1KA 4K8OA 3BL6A 5DI9A 4YJ2A 3Q3JB 2ALJA 3DZJA 3QI7A 4JSYA 1TIPA 1U7UA 2F4VB 3O9MA 3NR2A 2OCLA 3TQTA 1PEAA 2AEFA 3GRKA 4I8DA 3WKEA 3ZBQA 1L8LA 6PFKA 3P9QA 4EG0A 5CUQA 1RHKA 2XDQA 4IUYA 3R09A 1K4MA 4WHMA 4GI5A 3IXQA 3M6MD 1ZJ6A 3QF7A 3JS5A 5K8JB 3U44A 3ZJVA 4GMHA 4KJXA 2VDRB 3BWDD 4GKVA 4B9EA 4EB3A 2EKPA 3LBAA 5CLIA 5IASA 1F2UA 1TVEA 4LJ7A 1WZEA 2R2AA 1A7KA 2X1LA 1R0XA 1N7HA 3SX0A 3ETHA 4WCVA 1JDBC 5J4KA 5LQJA 4YP9A 2HCTA 3GLHE 3GGJA 4ENSA 5FBHA 1CY7A 1USUA 5C8XA 1SK8A 1Z4PX 5HCUA 3ZV5A 4C7BA 3OLCX 2WYIA 1DIHA 3PFBA 3Q3HA 4GW3A 1KYZA 1ID1A 3HFSA 4HWOA 1XMJA 1XZFA 1ZCAA 4LISA 3W6OA 3L0OA 4AY5A 1XWIA 4BBZA 2H1WA 2P2SA 4P4GA 1YRBA 3BWYA 4BDTA 2D1FA 1DTWB 5COBA 3SNKA 1EJ0A 5KVQA 2JAQA 2UYHA 2XVZA 4GGMX 3P5SA 1EVZA 3VH4A 2QTGA 2XUPA 3FSRA 4DDKA 2NUPA 1VIVA 2NVUB 2DM6A 4RMGA 1YGPA 4TTJA 1J5PA 1O1YA 3OIFA 3VR3D 2PH3A 3G2MA 2I2CA 2I99A 5BV7A 3K0BA 3WY9A 1AM4D 3JZAA 5E9AA 1PFUA 1TC2A 3I6QA 3O3CA 3QJGA 4FGKA 2UYCA 2CV2A 1LDGA 3AKCA 4CLHA 3GRFA 3WE7A 3EEYA 1GUZA 4LDRA 4AF8A 3KPYA 5H3HA 2NM0A 4E5MA 1OUMA 5JSHA 1JDUA 1J1UA 5DWQA 3WK5A 3GUYA 4BRWA 1P81A 3QLVC 4LMRA 1AMOA 4WK2B 3FF1A 3ISJA 3L6OO 3WGJA 3MGCA 1D6MA 3CMMA 1EWQA 1QIMA 4IVNA 1C7EA 3EZLA 5F23A 3QFTA 4LHEA 2ZRPA 2ZS9A 3H97A 3W5IA 1PTKA 1T36B 4U5QA 5F9MA 2VNAA 3VKWA 4E7PA 4AKSA 4A82A 5BN4B 2D6FA 2FOLA 2Y76A 4BO4A 2YC4C 2OQRA 4JUAA 2OC4A 1BJKA 3H84A 3UKDA 3DCYA 4D41A 2R00A 3M1YA 1SC1A 3NBQA 1VTKA 2E21A 1DX9A 3KALA 4AZSA 1GN8A 1HE5A 2O07A 1QX3A 2PMBA 2WAAA 5IXSA 3L05A 3CSSA 3NC0C 1PJ8A 1GPNA 4IZIA 4NFYA 4CEJB 2XVXA 4WLUA 1Z6TA 2G1PA 5INTA 2DUUA 3LDHA 5TF0A 2FTKE 1N34B 3RUIA 1Q1QA 3NALA 1VG8A 2BLLA 3PYLA 2H18A 1L5VA 4ZJYA 2F9FA 4RK4A 1T1GA 1Q2UA 3OMWA 1FSPA 1WTCA 2CV0A 1DO0A 1DC7A 4M88A 3RV4A 5IF9A 3DQZA 2IEYA 3KB1A 1NVBA 5DRTA 1IK4A 5HQJA 3LK6A 3TD6A 5FL3A 5IT0A 4BVLA 4DA0A 1LI4A 3AQIA 1XTPA 2GDJA 1XYGA 1LPMA 1GV1A 2W2PA 3CVJA 4MKZA 4BMNA 4NZ9A 1K5DA 2ZRLA 3GBSA 5THQA 3ZS8A 1I5EA 1D2GA 1CY4A 3UW1A 3LLCA 2FRDA 2GZDA 1RKVA 3SE0A 2A3NA 2ZM6B 1A9OA 3RYFB 1DGQA 1BCSB 1GSAA 1S01A 4IHJB 1OHHD 4DMLA 4J4TA 4ETMA 4NV0A 2AXPA 3QNUA 5AYVA 4M53A 4Q4HA 2HO4A 3TUIC 1WBDA 3DDCA 4OLHA 2LDBA 4W8GA 1RPJA 1ZEJA 3GCXA 2VOEA 7GPBA 4Q3DA 3LUGA 1L2TA 2VK1A 2NO9A 1T3SA 2DFPA 4TTRA 4CYMA 1EFPA 1W29A 4ZXPA 3TW6A 3OM1A 4C3ZA 3TS1A 3PPWA 2F59A 4Q1VA 5KWJA 4AJLA 1XMQB 1WAMA 1KEUA 2XCTB 4EY8A 3I32A 4OFZA 1JXOA 2BL4A 2XQFA 1GG2A 1KOLA 4BX3A 2PGNA 5KO2A 3P2MA 3WNBA 1SIOA 1W88B 1T8WA 1RZUA 5DCYA 3R7WA 4MPJA 4UBOA 2ZXFA 3C16C 4J1TC 4CM9D 3GA0A 4WNIA 2OHXA 3RQSA 1SVOA 2YIJA 3OT4A 2GPTA 3GXOA 3PXEA 2I80A 2P7IA 1AXEA 2AN9A 3ZCUA 2XF2A 3ENWA 3NHPA 3VPHA 3K1YA 1QOQB 3FYSA 2P5SA 1K6JA 2YUIA 1L5MA 2QTAA 4JYAB 4MP6A 1LVUA 5CMLA 4QFMA 2C2HA 5DBGA 2ZT7A 3LPAA 3HDVA 1UMKA 3V8NA 3RK0A 4MRAA 4LVCA 1KTVA 3VYVA 3UWPA 2Z56A 4OQLA 4M1TA 5D7NA 1VHWA 4M9XA 5ALYA 4ZVSA 2GI4A 5DYWA 3UAYA 2JPDA 2EFJA 3EULA 4CMJA 2YZNA 1DEKA 5ENDA 4JYZA 1GO2A 2FDRA 4IOLA 4QWMA 5CJPA 1OTYA 3U3RA 2OAP1 5FWYA 1OHHA 2P2GA 5ARDA 5K3FB 3I42A 1JEEA 4A73A 5K51A 4TKVA 3HNPA 5I3CA 4ZOBA 2NYVA 3AFMA 4PCLA 1U5BB 1PQPA 3L02A 2DUMA 2X2PA 4GM1A 5BMOA 3RODA 2C5BA 4QJ3A 4N03A 5K99A 1G7RA 5FULA 5FPSA 3MQ2A 1JBKA 4WCFA 3VM6A 3K0CC 2J5QA 3QUQA 3JYOA 3MWJA 4TTVA 4KQ6A 4EAAA 2JDID 1HTBA 1GL3A 1L5GB 5A05A 5E1BA 3EB9A 5I4BA 3DVAB 2NQTA 2WM8A 4MRMB 4TV9B 3UHFA 3VPDA 4F4JA 7REQA 5FDFA 1Z34A 2KJQA 3CCFA 1VL5A 2XZDA 5DOZA 2FX3A 4FHDA 1L5QA 3EIFA 4RPHA 2TMDA 3LYUA 4C07A 5IJWA 1WMSA 2L0XA 3OU2A 2QMOA 1SCBA 1ZRSA 3VPSA 1QZUA 3ON5A 1P9LA 2PLWA 5ENVA 3ZNNA 1QP8A 1PX2A 2IZ6A 2WFAA 3L0YA 3M1LA 1FMTA 2BEUB 3Q9NA 5IJXA 1O94D 3B1YA 1OMOA 3IA7A 3NJ4A 4Y8VA 3E9MA 1MLDA 4YO8A 4Z0NA 3GVPA 3HCFA 4XD7A 5DIFA 5DKFA 3UB3A 3UAWA 4ZTZB 4G0OA 5J1TB 1VLQA 1FDIA 2FSSA 2UZAA 4GBGA 5LZ8A 5GTDA 3NT4A 3C3XA 1N32B 2R1ZA 5H4GA 2D5CA 1I3OA 2LKDA 2XIQA 2B7LA 1DFHA 2CLSA 1RJDA 1E2BA 3ROGA 3L7JA 4IH4A 3IX7A 4B6SA 5IYZA 4ROTA 4URYR 4EPYA 3HM2A 2BKUA 4CI0B 3WP0A 2NO6A 4JP1A 3KYCB 3RROA 1KOJA 4MWCA 4EEZA 2VJMA 3ID6C 4I3FA 2CBGA 1A76A 3ITKA 4YNBA 5KNDD 5IVHA 1TX4B 3BWEA 1GZSA 2FZGA 5CM2Z 2VH5R 2V3WA 3G49A 3OOSA 3ED1A 1VJRA 4KQ1A 4CT5A 1E1YA 1SCKA 1A2KC 1P72A 4YP6A 3WLOA 4D43A 1J49A 1YE8A 3FPAA 1QRSA 4HH3C 3K0KA 2O8CA 2Q6IA 2R62A 4HQNA 1M1UA 1P9WA 2Q8PA 3HZRA 4KSBA 1GL6A 1H9AA 3LYAA 4R5HA 3INGA 3C8ZA 3UFXA 2G25A 1I9CA 4R69A 5ERYA 3FGOA 3WGKA 3KHSA 3ZE6A 1ESMA 3DFMA 3N87A 3RS2A 2V97A 1CHNA 2M98A 3JQRA 3ILVA 2HADA 3OZIA 4FVTA 3P96A 5G0TA 2NQ2C 5DGHA 1J97A 1M83A 5CVCA 4ZO8A 1T5OA 5BSRA 4Q21A 1NVVQ 3IDQA 2G9ZA 2C9YA 4LSWA 1X7XB 2W2TA 2X19A 2XGMA 4J94A 1CFZA 1O94A 1J7JA 2OCPA 1HL3A 2XXJA 1JFFB 1TCVA 4KUHA 5IUNC 5LU8A 4EG6A 3RJMA 2ZSHA 5TIIA 1U2GA 3ZE1B 3MINB 1R00A 1UF9A 2NZ8A 1Z4IA 3GVCA 4M0KA 1J00A 1AURA 2ST1A 4RADA 3PL5A 4X91A 4FP9A 3EGOA 2Z0MA 3VOTA 1XMPA 3V4ZA 5AHRA 4CL2A 2ZRIA 1VPDA 1D09A 1XK6A 2QPAA 1EGAA 3DW3X 1JA9A 4HDMB 4QPNA 4CKXA 5I51A 5MDHA 4XE5A 3G0IA 1M2OA 4LJYA 1R0SA 4O02B 4P34A 4URUR 4GYJA 3LQFA 3NAQA 5JMPA 1LDNA 3EK2A 1GCUA 3LYHA 1ZY2A 4NYMR 4RBNA 2QYOA 4M60A 2OY0A 2VXOA 2UZ4A 1XHFA 2QBYB 1MTZA 3DWFA 3UG7A 3U9SA 1QLHA 1IPFA 2H48A 2J3QA 2QUIA 3F46A 4TMVA 4XDHA 5DZSA 5CDFA 2WP8J 1WHSB 3KZKA 4EBFA 4EITA 4W5TA 2A58A 3GEDA 1SKYB 4JSTA 1FVHA 1P5FA 1WV0A 1OXVA 4M9SA 3FAZA 4F21A 3LVFO 5K4HA 3E7WA 2ZUBA 4HQRA 4NZNA 3NASA 3CX3A 3VR4D 3ZWMA 4F2DA 3BG5A 1GL9B 1HDIA 3S29A 4QGAA 4A26A 2B8TA 2VDOB 2PDAA 2LRHA 4DLRA 1AKQA 3OBIA 2V6BA 1CQJB 1ZJ4A 4Y7CA 1I14A 2DR3A 5H70A 1UBTS 1X7WA 3IPLA 4GPZA 2GARA 3B6JA 3IBCA 3OE5A 4NEQA 4Q4AA 5M34A 1SPBS 3I12A 3W4KA 5DH9A 2FEPA 4O2AF 3NTOA 5A71A 4C2AA 1KFEB 3DFFA 3TQFA 1GPYA 3OZAA 5ILQA 4WH0A 2OA0A 3WLNA 1JAZA 3SN6A 1A96A 4LSMA 4YV7A 1WCIB 2N0SA 4OGKA 5DTIA 3PDHA 5FLEX 2IDKA 3CZ9A 1RXCA 1KK0A 2HWXA 6Q21A 1CUYA 4LXGA 5EOVA 1CJCA 1QHFA 1Y3AA 1SHLA 4RF2A 3O3NB 4YAFA 4KE6A 1V2HE 1KYXA 5CYPA 1T8RA 4FFBA 3LBHA 2WD8A 4RAOA 4RQAA 5E2BA 3SOPA 3N39C 5SZHB 4B83A 2V0GA 4N0PA 1ID8A 4Y2UA 2NZUG 1PQYA 1ZIDA 3OM9A 4HNAB 3SZ3A 3G9ZA 3KJHA 1CEYA 3SAJA 1F9AA 5BNWA 3KLOA 4ZVVA 4BZWA 1ZHFA 3FKSD 1AXRA 3F6PA 3M6IA 4NIMA 5L3ZA 1KDVA 5EIHA 5AOBA 2RONA 5FNZA 3TGWA 3NBKA 3MOGA 1JQLB 1G63A 3RADC 3C5WP 1L5YA 4B4KA 2OWEA 2P2DA 1Q1ZA 1OX5A 1QHGA 2I4MA 4ADSG 5U4XA 1KGSA 1KO4A 2Q0SA 2VAVA 3A58B 4F8EA 1YK0A 4GVLA 4R41A 1P91A 4D3ZA 3QKWA 3WGUA 2IELA 2I7TA 2VUSA 2X5KO 3I1IA 3KQUA 2P6RA 1U0HC 2ABWA 2PKYX 3D3WA 2PNJA 1DUVG 2Y0BA 3IO5A 4MDYA 4RD4A 3T3HA 2YIMA 4MA4A 4PG5A 4WGGA 6NULA 2G7ZA 1XZGA 3CB2A 3L7CA 2UYYA 2WPDD 4J0KA 4WZBA 2WJVA 3U3MA 3WMWA 1BCRA 1U0LA 2X4LA 4KR9A 3NWEA 4RZHA 2VDWB 2WOOA 4XB2A 4BFWA 1VDMA 3JYHA 4DRYA 3SC6A 1L4FA 9GPBA 5GJBA 3LMKA 1AZLA 3CLRD 4AG3A 1TK3A 1Z6GA 1RCTE 3SSNA 2ZBPA 5AUOB 4LZAA 3MN1A 3TJRA 3M5CA 3HUTA 4ZDKA 2Q5HA 4OJKA 2VUTA 1JMVA 1R4ZA 2DT5A 3ES9A 5JSZA 2VT3A 2Q07A 1YDGA 2AJLI 3BE6A 2HU7A 1XU7A 1U0JA 2AMLA 3FKSA 4A8TA 4EEKA 5GV7A 1PR5A 4Z1OA 3K70D 2GPYA 5ALDA 3HKCB 1FNSA 5CJJA 1GDTA 3TSYA 2H5LA 2QLFA 5MFPA 1H6BA 1ZK1A 3QX7A 1K7SN 2WFLB 1JH8A 3JQ8B 2E49A 3MAAC 3OM0A 3ZGXA 5JQGB 1K8RA 5KYWA 421PA 1BFKA 1IXZA 1PWZA 3OPXA 1CEXA 5L95A 2ORYA 4PXSA 2GJ9A 5CPFA 2NT4A 2X8JB 1JEAA 1JBEA 3F5QA 3PC2A 3QU4A 3QVWA 5HFAA 4YCNA 2B36A 3FN4A 4GNKA 2AF3C 3WIOA 3ND8A 2DJIA 3I9JA 1CZUA 1NBOA 3SC4A 2AG0A 2QE7D 2YY7A 3ICVA 4NJOA 5DOVA 4I3HA 4PYJA 4JYBA 2IEZA 2X42A 4E0BA 2GA9A 1U0SY 4QBIA 5BSGA 3ENVA 3F6RA 1XNRB 1PFWA 3FFBA 1UXJA 5EE1A 1UUFA 2W48A 2DFVA 4YMHA 3IULA 4G1CA 5C4MA 4JWTA 4DL9A 1U99A 2C29D 1OBOA 2L69A 2LP4Y 3M9LA 4RDHA 3VPCA 1QDLB 4K2AA 4CEHB 3LUKA 5M04A 3OFSA 4MEAA 2JFQA 4NU0A 1NKVA 3C5EA 1M2NA 1N9KA 3U37A 3MSXA 1QGOA 4BEJA 2JFBA 3OP1A 3HYNA 4DPLA 4PYNA 5JDIA 2FUCA 1C7RA 4F4HA 4BCBA 2BEVB 4P31A 3CNNA 4L16A 1A4RA 1N0UA 3A6ZA 1G7SA 1R3UA 3EPRA 2YN4A 4OJMX 5KSYA 2YV1A 4CL3A 1UEJA 1T4MA 1GTZA 3ST7A 2QN9A 1I8TA 1IY2A 4V0NA 1GU7A 4IV5A 1SQ0A 1ZQ9A 4HAOA 2IDZA 3A9TA 4TROA 4ZVLA 3MELA 4DLTA 3W2HA 4PAQA 4F91B 5AKLA 3WL4A 5LDHA 5DHPA 5E8RA 4KQXA 2B3TA 3QF4A 1WCV1 2I22A 3AEUA 5LQNA 3QKIA 3ZC3A 1T34A 5I4KA 4R01A 3FLMA 4FU0A 3QPBA 2IXEA 4Q01A 5IJ0A 3ESBA 4CUZA 2AFIE 2QW0X 4M37A 2WHRA 3DEKA 2ZSKA 2RSLA 2GYVA 3SLKA 5KHAA 4WJLA 3CN7A 3SR3A 1HZZC 4YUXA 2I7XA 2P41A 3VV3A 2F3PA 2Y6UA 3EXHC 1GPH1 1YVUA 2UYOA 4DCMA 2PX6A 4FQ8A 3VNVA 4C06A 1OBFO 1PR0A 1TKBA 4K8RB 3HL0A 2CXUA 4YRGA 2I3AA 3ZOZA 2DHQA 1VE5A 2J4DA 4WNYA 2VQSA 2G28A 4HD8A 5DTJA 3ELWA 5K6AA 1ONPA 3FWYA 1KK3A 1XT6A 3LPLA 3C3WA 3DGEC 5KNCD 2R87A 1T3ZA 3O2QB 3THSA 1X1DA 2C3MA 4CQNA 3LGAA 1SEPA 3FJOA 1UDAA 2B99A 4HK4A 1A97A 3GRVA 1BFDA 1RVV1 1FYDA 2JLCA 4MUAA 4X20B 3R7SA 4C6HA 4E30A 3SS7X 3EEOA 1NXXA 4P3NA 4L5AA 4YUZA 1W36D 2FY8A 3BREA 1QB8A 1UMDB 5FH9A 4MYTA 5BPFA 4MUYA 2Y8EA 1ZEMA 5J4LA 3MT9A 5SICE 1C7JA 2MCFA 4I1PA 3ICQB 1VYHA 1QGUA 4R5MA 1LI7A 1KI4A 2BJVA 4J2OA 1PZNA 2C3PA 4RETA 4P83A 5DSXA 5SY4A 4AYWA 3H5IA 2YFKA 3ZJ4A 4U2EA 4A1FA 2XNJA 1UOQA 1EVKA 2VF4X 2YXPX 4V3CA 3KQSA 3VC2A 4A2WA 5BOSA 5HJEA 1Z6XA 5LLTA 3B51X 4TMFA 2D13A 2BBSA 2QTCA 3MJEA 4HVAA 4IVRA 3OM8A 2BVNA 5E7QA 3BFVA 4AT1A 2JGRA 3BORA 5T4EA 1WEKA 1V8PA 5TJ9A 1JHZA 4TTPA 4ND3A 3RS7A 4JKOA 3AI1A 4YFYA 2OXEA 4UE6A 4F8JA 5AW9A 4UD6A 1KGDA 4RL6A 4D8VA 3I04M 3AUTA 2O8DB 4C0BA 3C5HA 4RE6A 3GG9A 4KPUB 1SRQA 1P7VA 2W4QA 2A94A 3T4EA 1D4FA 1JG3A 3VPFA 2FPPA 3LH5A 2WLTA 2D2VA 3O93A 2WHEA 4H15A 2YJ4A 1HLPA 4L5JA 5LKAA 1YJBA 4GH5A 5K8TA 3GZJA 1GCAA 4OHZA 1X7DA 4ZYZA 1U7PA 1X1BA 5D84A 2D1QA 4LRWA 4E5YA 3RSSA 1OILA 5FCDA 5C35A 4QQRA 1OCEA 4DUPA 4TMWA 2YY6A 4HS4A 2GEUA 3WIUA 4WBNB 2QD2A 3AHJA 3HH8A 4YCDA 3D5QA 3IUBA 5D1NA 2H5EA 3SBOA 2VUIB 2CGEA 1E9FA 2BEJA 2E82A 2VH2A 2Y3IA 4BYGA 1QIHA 1SB9A 3M4ZA 4Z53A 2ZUCA 4MW2A 4XUDA 2VQFB 4M0PA 4MV5A 4AVYA 4FDLA 1MQAA 1P1BA 1OLSA 1RJWA 1W4AA 2OPHA 3FD8A 5F1PA 5JRZA 1LWOA 1PK8A 1CS0B 3BQNB 5ETJA 3NZEA 3L1KA 4QTUB 5IVPA 3O03A 3CB4A 5EL0A 3H1GA 2QLLA 4EQZA 1UOOA 3D8RA 5DE3A 5HA5A 1XZMA 2Z95A 2F7SA 3LWZA 2QRLA 2HYDA 5IM4A 3DXXA 1BU8A 2ZSIA 4KN9S 1PWYE 4WDQA 2VWPA 1FFWA 3CXUA 3RAPR 4B46A 2PTHA 2WHPB 3ZNPA 4DB2A 1XC7A 4H7EA 4IUBS 1ELOA 3TJMA 4DWWA 1RAGA 5KTYA 3K9LA 4NZPA 3TW8B 1UP6A 4OHRA 2O2HA 2H17A 1A8HA 2VHJA 2NU8A 1EVEA 5BN3A 3JR3A 1XTUA 3JQ9A 4ZYLA 5K0SA 4RJIA 1U2EA 3QMMA 4BGIA 1QANA 2XQGA 4DM3A 1Q21A 4H2DA 4HZUA 3F5FA 4RFLA 1N92A 5E9JA 4E11A 1HGXA 2O19A 1U0TA 2YCLA 4WKGA 5A0VA 2AZMA 2GBGA 2FW7A 2YS6A 3QGMA 4E12A 3BDVA 4FCWA 5D51S 4P35A 4JLDA 4XTCS 2P75A 2QM7A 1IHOA 5DYTA 4NNOA 5AHXA 4B17A 1PHPA 1JDJA 1VXOA 5J2TF 4FS3A 3MBOA 3U60B 1W25A 3UWOA 3K9WA 3AR3A 2VVTA 4BQOA 4AJKA 1VZ3A 5I7AA 3LNTA 1S7CA 4QOEA 2R8XA 5AM1A 3HN7A 3Q0IA 3AEKB 3DULA 3EOBI 4FC6A 3U56A 4LI0A 4IV0A 1M6WA 4Z49A 5DW3A 4K5QA 2XVMA 4R2LA 1VPTA 2ECFA 4AY3A 4JC0A 4PO8A 1UADA 2H1SA 3RWOA 2ZI5A 1ZHOA 4TYYA 1AQUA 1XEXB 2D0PB 4LY9A 3ZWCA 4CCYA 3ZVNA 1FFHA 4TZ6A 4BC0A 2PMDA 4TXJA 1A8PA 1X8JA 5AHKA 2JAUA 2WJ6A 1JX6A 3PKIA 3H0CA 3U4AA 4ALIA 4C2TA 5KQGA 4JYMA 4X9XA 4QDOA 5B3JA 1OGIA 2CHEA 2XYHA 1N1GA 3GVXA 1HE3A 4MUHA 2HDHA 3FBTA 4I7EA 2QYSA 3QVGB 5FFNA 2F1RA 4LBYA 1Z5GA 2RHWA 4KDEA 3UMRA 2WJWA 1GP2A 3CPEA 4JVOA 1Y4SA 1ISFA 1AC5A 4OKNA 4HXYA 3IXLA 4C04A 1ZLYA 5IXJA 4REOA 1YRAA 1SBZA 4AS1A 4GDFA 4IJQA 4Y9SA 5ISMA 2WU0A 1SCUB 1J9EA 1H2FA 3BHJA 3SR0A 2QW1A 3GW8A 3IEXA 3BE8A 4FZVA 2D2EA 3W1VA 4IHJF 4DIDA 3OPYB 4IIVA 4AAYA 4DV3B 3WJ2A 3MRXA 5LLSA 5KQLA 1UFQA 1XCPA 4RJKA 3HJNA 3PQ8A 1YF3A 2C8KA 3RS4A 3RLFA 3LT1A 1Y33E 3ZHCA 1KZ7B 1BD3A 1GKLA 3NP9A 3KS9A 1HG1A 3SIRA 1W8IA 3F78A 4S1NA 4E5KA 3BIFA 4HLNA 1N2EA 1EB9A 4LZZA 1AHPA 1XCOA 3HFJA 4DKJA 1UWLA 4QASA 2PUVA 1NPYA 2EDCA 4OHYA 4DG9A 1NA5A 1FJGB 4O2AA 3X1WA 1DBQA 2WQZA 1B0AA 4UM8B 5F76A 3EQ7A 4J3NA 3ZWVA 4DNXA 2B21A 3JRWA 5KSOA 1F6WA 4BHTA 5GZ1A 3O84A 3UA4A 4YDRA 3EA5A 1LBTA 3GAFA 1QZZA 1ZFNA 4IFIA 2V4MA 3DF9A 1UC9A 2ODQA 4FYVA 2QENA 2RAFA 4J1SA 1ORHA 1VCMA 1KAMA 4IRMA 4LQLA 4RORA 3GELA 2XODA 5DNAA 3K0EA 3L6UA 4HMQA 4NENA 3ZHOA 3FI0A 3ZI0A 1CUZA 4JX8A 1UKBA 1KR5A 3Q1LA 3AHFA 2Q9CA 3NUGA 4HN4B 3T06B 1MGPA 4EP1A 1EFCA 1NW6A 3BFKA 2JIDA 2PKCA 5CW1A 3EC7A 1RI3A 2PMFA 5B3KA 4G1MB 3WAKA 2ZPTX 1DZ3A 1N7GA 1W1UA 4YROA 5TQ0A 3GPLA 4DCGA 4C4OA 4CE6A 3BQMB 1UFKA 2R2GA 4FJ2A 3DHNA 4L6IA 5HFNA 4DQLA 4F6LA 1YK1A 2P2NA 3AB8A 1U5CA 4G25A 1JAHA 4LI3X 3E5RA 3HK2A 1MAHA 3KNZA 2IOFA 3P2EA 1ORVA 4B6QA 4KXXA 4CQMA 3C98A 3O2NA 4LNAA 4LRSB 2BMAA 4KEAA 2PXXA 2K2QB 3LP8A 1C5KA 1H3FA 2NZYA 3O0DA 4A8JB 4BNIA 3Q3EA 1CDDA 3A0RB 5C1IA 2OQVA 5HBGA 3I5YA 3O8BA 2XUIA 4IVQA 3QV2A 4Z9YA 4GMDA 2GRJA 2XLBA 1JJFA 4B4DA 1A9ZA 2GDZA 3EVZA 2X0FA 2QS9A 1GZ6A 3OO1A 4UQPA 5H9WA 1P0IA 1WMFA 1JTVA 5HE9A 2CEKA 5JNSA 3UMGA 1E5XA 1JLMA 5EMHA 2EG5A 2Q3FA 3G2PA 3WYEA 3ZQKA 4Q3LA 3NXKA 4YQYA 1SXHA 3P7MA 1EVLA 4UEKA 1AS0A 3ITNA 4ME6A 1MGOA 2FPLA 3JXEA 3HM9A 2CT8A 1P7PA 1FMFA 2L18A 5BT9A 2HTFA 3V4VB 1NXWA 1W49A 3DYVA 3VV2A 4AJ4A 4CETA 1OBHA 2ZJ8A 3EJ6A 1F48A 3CF2A 3M82A 4OYRA 3S7TA 3KSBC 1NWHA 2MMCA 4A8PA