3LI2A

Closed conformation of htsa complexed with staphyloferrin a
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
288
structure length
288
Chain Sequence
b'ASTISVKDENGTVKVPKDAKRIVVLEYSFADALAALDVKPVGIADDGKKKRIIKPVREKIGDYTSVGTRKQPNLEEISKLKPDLIIADSSRHKGINKELNKIAPTLSLKSFDGDYKQNINSFKTIAKALNKEKEGEKRLAEHDKLINKYKDEIKFDRNQKVLPAVVAKAGLLAHPNYSYVGQFLNELGFKNALSDDVTKGLSKYLKGPYLQLDTEHLADLNPERMIIMTDHAKKDSAEFKKLQEDATWKKLNAVKNNRVDIVDRDVWARSRGLISSEEMAKELVELSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrichrome ABC transporter lipoprotein
molecule tags Transport protein
source organism Staphylococcus aureus subsp. aureus
publication title The Staphylococcus aureus siderophore receptor HtsA undergoes localized conformational changes to enclose staphyloferrin A in an arginine-rich binding pocket.
pubmed doi rcsb
total genus 91
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3li2A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3li2A02
3AEKB 3G9QA 1H1LB 3BE6A 3MWFA 5BVGA 4BBPA 4TKVB 3AETA 3AETB 2AFHA 3ZTTA 1H1LA 2Q8PA 1KARA 3AEKA 5BVGB 5HDQA 4WESB 1K75A 2AFIB 3R5TA 4ND8A 2PS0A 1N2CA 2XDQA 4N01A 1ESZA 1M34A 3MINA 3PDIA 3PDIB 1M34B 3MFQA 3TEFA 4UDNA 1N2CB 4UTPA 3AERA 4ND8B 4MDYA 2AFIA 1N4AA 2X4LA 3AEUB 4OXQA 5AFSA 2RG7A 2O1EA 4WESA 4WZAB 3LI2A 4H0FA 5BVHA 1G21A 2AFHB 3AEQB 3EIWA 4TKVA 1KAHA 3PSAA 2XQVA 5JPDA 1M1NA 2XV1A 4MX8A 4INOA 5I4KA 5M3BA 3AESA 3UJPA 5KOHA 5M29A 2OV3A 1QH1A 1M1YB 4PM4A 1N2ZA 3ZK7A 5M2QA 1QGUB 1FP4A 1G20A 2PRSA 4MO9A 5CX1A 4G07A 4XPIA 4B8YA 1EFDN 4LJSA 4WZBB 2YNMC 1QH8B 3HH8A 2Q8QA 3K1AB 4MLZA 2PS9A 2PS3A 2WI8A 4TKUB 1MIOA 4G09A 2M6LA 3PSHA 2OSVA 4HMPA 2QI9F 4IRMA 5JOQA 4UDOA 1XVLA 3BE5A 2MINB 3U7QA 1MIOB 5CR9A 5KHLB 5KOJA 3K1AA 4HN9A 4INPA 1QH8A 1L5HB 4OVKA 4WNAA 1K2VN 4WZBA 4WN9A 4FNAA 2PHZA 4FI3F 5HX7A 1N4DA 5JJ5A 4HMOA 2ETVA 3HXPA 1K7SN 5B58T 1PSZA 2XH8A 4NNOA 4LS3A 3TNYA 3CX3A 4WN9B 2OV1A 3ZKAA 1PQ4A 1M1YA 4WNAB 3ZK8A 1L5HA 4UTOA 5GGXA 1K0FA 1TOAA 4HMQA 5GGYA 5KOJB 3R5SA 2MINA 3U7QB 4NNPA 4FKMA 5JG7A 3AEQA 1G21B 4PAGA 5BVHB 2R79A 3NU1A 4DBLE 1KAEA 2XUZA 2YNMD 4FILA 4K3VA 3LHSA 4TKUA 4WZAA 3ZK9A 3AEUA 2OGWA 3AERB 2M6KA 2XY4A 3GI1A 4XPIB 2R7AA 5CX1B 3MWGA 5FLYA 2WHYA 1FP4B 1G20B 3HJTA 3MINB 1QGUA 5M34A 3EIXA 2XDQB 4OXRA 4M7OA 1QH1B 3MD9A 3TLKA 5KOHB 3AESB 4CL2A 4GICA 4H59A 1M1NB
chains in the Genus database with same CATH superfamily
2VK4A 4GRDA 1ECPA 4Q1FA 4BO3A 1TRHA 5A9SA 2JCVA 3LXMA 1TLLA 2PH3A 4MPRA 2FPWA 2X77A 2GLXA 3HY3A 4QM6A 4Q7KA 2XMGA 2H06A 3N8HA 4O2LA 4X7PA 4Q66C 5ALRA 3RTGA 3VISA 3VYRB 2Z43A 7AT1A 3EC7A 1JAYA 2PGNA 4DTIA 1J5XA 3CC8A 3NNNA 4YDHB 13PKA 1F2UA 4WOBA 1GAEO 3LW8A 1VM6A 3NXKA 1H2YA 2Q21A 5AXAA 1R6TA 4B9EA 4LJAA 2R6AA 3PDIB 1CD5A 2XZOA 3X1ZA 2BBTA 1W75A 3A26A 4BGVA 3RSFA 4ZAGA 5FOUA 4ARCA 1PQYA 3L1IA 3AUJB 2MSCB 2BFCA 3BCHA 4KFRA 3SCZA 2QTWB 3JSAA 3O91A 1SH7A 4PZ0A 4O4HB 4WCFA 4BQQA 1KH2A 2RDMA 3U1VA 3FWPA 3HXOA 5AUPB 4QJ5A 5ALVA 2Z3VA 3ABQB 1PW5A 4JCCA 1FMFA 4UBIA 1PR0A 2DMRA 2DCMA 4MVJH 4OFWA 1E60A 3GG9A 4RTOA 4DQXA 4IDPA 3PFFA 1M8JA 4MUKA 2FDRA 2PV7A 1L6IA 5REQA 2PMDA 1R3UA 3D6JA 2P90A 2AFRA 4Q82A 1M66A 1SBNE 2CEKA 4Z0PA 7YASA 2DTDA 5KAPA 4MS1B 1CUZA 2FQWA 3X1KA 2AVDA 3ENZA 3V7UA 3AFIA 3D3NA 3ZJ5A 5LL6P 3C4JA 4J1TA 2HLDA 1BE0A 3HKBB 5EIFA 3OIFA 1T0BA 5EKUA 1Z4LA 1XU4A 3MHTA 1B2LA 1D04A 1HDEA 2QRVB 3NHPA 3OO1A 1GRNA 3K9GA 2JJ8A 5ILQA 4H7KA 5TQVA 2VATA 1MO6A 4ARIA 1B8PA 3GLHB 4YPFA 3CFYA 1I4DD 5J47A 1ECJA 3J80A 1R0XA 5E2BA 1W25A 1ISFA 2H2HA 4D8UA 3A70A 3KVRA 4OQLA 1V95A 1EVIA 1NN1A 2IKSA 2C9BA 3BD6A 4Y7CA 1KDOA 1Z5PA 2JAUA 3CNNA 4LF9B 3QYJA 2WJWA 3STWA 2AZMA 2GPWA 2OM6A 2JHPA 7GPBA 1UBCA 2HB6A 4YUVA 3LSYA 2BF7A 1O94C 3ZDBA 3D6FA 2BH9A 4BLPA 1C8VB 3WGZA 1E2PA 2FQ1A 4CE6A 1DEAA 3HSYA 1RWQA 2YASA 3CTPA 3U7RA 1EFVA 2PD6A 4HWSA 3FPLA 3SY8A 5CFMA 3BQ9A 1ULZA 4HVTA 2X7JA 3P2JA 2GOYA 5BVHB 1X9IA 2O8VA 1WNFA 4O2AB 2V1XA 3UJ3X 2YNMD 3CZRA 3WLRA 4A2QA 3N8NA 2ZM6B 1NPDA 1V2HE 4PGAA 4JIGA 1XYGA 3K9WA 3BCSA 3M5CA 2CDCA 4J16A 4YUWA 2XRZA 1BH6A 5FLYA 1CE8B 2J9RA 4CU5A 5L3QA 4IIDA 3HHPA 3AJRA 1V8OA 3FLMA 1M2OA 1U7PA 3FTPA 1VJ5A 1FU4A 3C39A 4OFZA 4XASA 3ZWAA 4YO8A 2D5AA 4BRZA 4IX9A 3E1KA 5EZYA 5FEMA 5HTKA 3ZGYA 3F71A 1XTVA 1E2MA 3VOTA 2BDTA 1DHTA 1ZIDA 3ZI4A 4CM9D 4H1HA 3KXPA 2Z3WA 3JD3A 4HH3C 4XGRA 4EJ6A 2KQUA 1C7QA 1KP3A 2D5CA 4MLPA 4NENA 1JZQA 5CHYA 3UY4A 5IJ9B 2IV2X 2QV7A 2FMHA 2WICA 1ISRA 1NAHA 3R3SA 4QAQA 5JZMA 5L3VA 1I7LA 2XKKA 2PGJA 2V0NA 3UWDA 5HF9A 4DEVA 1C0LA 3IKVA 2O57A 1P9LA 2A59A 2AD1A 5G1PA 4CNQA 4E11A 4EVRA 4YB8A 2GEFA 1DC4A 5H70A 4TT8A 3DV0A 1BKDR 3NTOA 4YV7A 4MKFA 1FJXA 4LC9A 3BXXA 4BJHB 3THYB 1EBUA 3NVKI 2GK6A 4F4HA 1Y63A 5JSFA 4CKCA 2MMGA 1RQGA 1HDCA 3IP8A 3M5WA 2FOIA 1WCIA 1RT9A 3FVVA 3QP9A 4MI6A 2VHTA 2NNLD 2BCGY 2E9SA 4RJLA 1QU3A 1RLIA 1T91A 4DNQA 4UUNA 1R9GA 3C3PA 4IV5A 3UV7A 4TMKA 4R2KA 4J3NA 4ZXFA 1K8ZB 3HBNA 1J5PA 4PNPA 4Q02A 4MZDA 5I9TA 1W94A 5FOVA 1V8ZA 1Z63A 1VMKA 2Y4NA 3U3RA 4HAZA 9MHTA 3CLRD 4NMLA 4DQ0A 2R0QC 2BBOA 5M2QA 2GAIA 1KZ6A 2XYHA 4ZDWA 2ZTLA 4WA7A 1Z2EA 1U8TA 4U8HA 3UG6A 2D0PB 1F4LA 1Z6AA 2WLTA 4V2IA 1WQ3A 2CUNA 5GOTA 2OPBA 4DVJA 2PA0A 3EW9A 3R20A 2PBLA 2NXNA 3DT8A 4EHBA 5CDGA 3IEVA 4OH1A 4QICA 5BYJA 4X45A 1MIOA 5CMLA 4NMWA 1U7UA 2JJMA 3FDZA 5T67A 1LRJA 4TMWA 5T57A 3EEOA 1TT5B 1DWOA 1FYXA 1VG1A 4JU9A 1U9IC 1YA6A 3GN2A 1UZAA 4JXJA 4C0HA 3LCVB 1VE3A 4J0EA 3JQPA 3KQSA 1XTBA 4ILKA 2II6A 2HQSA 1S2GA 2LE0A 2Q1TA 5EJ4A 1MB2A 1LWOA 1Q7CA 2G0AA 3EIUA 3LKVA 4FI3F 2J6HA 3UM9A 3ZIUA 1VSVA 2IIVA 4M98A 4O2AF 4TQ9A 5B36A 2JFWA 3HXPA 5JJ5A 5L3RA 4ND1A 5FI3A 3T5AA 1S6YA 5CVDA 5I3ZA 1AKTA 4RXUA 5AIAA 1GXSA 3JAMA 2EZTA 1QPGA 1KVTA 3R7LA 3AI2A 5IP5A 4D2IA 1UWVA 2ZT6A 3K0FB 2YYZA 3KUXA 1RWKA 3PQ7A 4MUIA 1EXVA 2HK7A 1EGHA 5KTPA 1BXKA 1ZMXA 2NU7B 1Y7LA 2RI1A 3V00A 2FFJA 2VQ3A 3FUCA 4U3JB 4C0QC 4AZWA 2A5GA 2R11A 3DZ8A 4IJVA 1U98A 2UYCA 1I2CA 3E3MA 3W8DA 1AQIA 1QIFA 3GLTA 3D8HA 1UBJS 3M83A 1G0OA 1PJBA 1YASA 3AERB 1TIPA 4GMKA 1NFFA 4UEJA 4BVFA 3ORQA 5SZKB 3U4QB 1QIEA 5K0TA 3HA7A 5DCWA 1WXHA 3NGXA 3WNQA 1HURA 1E9DA 2GUWA 3QV1A 3CLRC 4LSZA 3ZH9B 2QOEA 1H85A 4PLFA 4XGIA 2OKGA 4AX8A 5A9RA 4IOJA 5K8LA 4V1CB 3M6UA 1U3GA 5K9ZA 1YB6A 4JR0A 1Z7EA 2B2CA 3OE5A 5JSKA 5IJAA 1CHDA 3RK1A 3VKFA 1YRWA 1JDNA 3PTAA 1E66A 4DADA 1M2GA 3M6AA 1N6KA 1DIBA 5HE9A 1H4QA 1T5BA 1DBVO 1UKAA 2ZB4A 5JWHA 1DCKA 1YB5A 3NWOA 4GP6A 4E5KA 2MSLA 4A8JC 3LNTA 1FP6A 1OWPA 1DRVA 1NYLA 2R00A 5JDIA 1AT1A 2R62A 4W63A 2G17A 4FXPA 5EMLA 1I14A 3UEOA 5KWSA 5IT9A 5KPJA 3D5TA 1XA4A 2MSDB 1X7GA 1L3BA 4LX8A 4MKHA 2JIZD 1DRJA 3M5DA 1MG0A 2O7QA 3VPCA 1DEOA 2FVYA 2IIBA 1XROA 3FKSA 5C5EA 4IH1A 3DEAA 1DXHA 1MT0A 1WULS 2V7XA 2ZRCA 4NU5A 4XX0B 4BUJA 3ZBTA 4OO3A 5HP4A 1IY9A 2Y1XA 4OHYA 5IS2A 3G9TA 1E89A 1ULTA 4HP8A 4ZU6X 2F55A 1C9JA 1SBIA 2JAWA 1CYEA 4AXXA 1VLLA 1DS6A 4W9MC 4WL0A 4KWTA 1J9EA 2PZFA 3IP5A 4F3RA 1A8QA 4Y0NA 2MYPA 4ZK6A 3VPBA 2OAEA 3F9RA 2ZSKA 1FBTA 3LK6A 4YMTA 2OGSA 1ZRMA 2X5JO 1YDFA 221PA 3NH6A 4I1OA 4OEHA 4BFTA 4HDSA 1C30B 5LB2A 5JAHA 1SIOA 1XHEA 1MEOA 3GT0A 3RRFA 1GSAA 1Z6QA 3WMWA 3HB1A 2R44A 4OIMA 4E5SA 4ETNA 5FH9A 2B1GA 2IEZA 2F48A 2V5VA 2Z1MA 4KR9A 2ZIZA 1UL1X 4GZ5A 1IG0A 4ZEWA 1THMA 1SVLA 4KQWA 1X7ZA 4LX0A 1BWSA 4PQRA 5EMJA 1XNQB 2CB0A 1QV6A 4RSMA 2VTBA 1Z4NA 3ONDA 3P2IA 3RQIA 7MHTA 4N6GA 1XZMA 3DPIA 1JKJA 4FFNA 1RKUA 1KF0A 4R1MA 2JAOA 2WUDA 2WF6A 4I5FA 2D8AA 5KHLB 1VLQA 5U4QA 3BL6A 4TT3A 1GPJA 4A8HA 1SEVA 4WN9A 2B5VA 4IH9A 1R5JA 1XCLA 2ZSJA 4I55B 4WD3A 5FAKA 1RQ2A 3L7MA 5JEEA 1HYHA 4EG7A 4F84A 2V9ZA 4P0PB 1W4RA 4BWYA 4QSMA 2IF0A 2VQSA 3KZMA 5BSUA 5F5LA 4W7SA 1DCTA 4A15A 1I2ZA 2AVNA 1XZBA 4IIEA 1UQUA 2ZBRA 4TLDA 4Z8YA 4BGIA 4L7QA 3QBDA 1BJTA 2QTFA 1XRMA 2FZVA 4NNPA 2BTEA 3EYWA 4RJ2A 2O0JA 3OTOB 4D9HA 1UODA 3CEAA 3T38A 4EGAA 4MUXA 5FQNA 4MAMA 5T3YA 4TVOA 1V8DA 4K9MA 2J7PA 2ODPA 1CUXA 3HJAA 3AEUA 3QLJA 1KDYA 1SKUA 4BC0A 1X2EA 4PGGA 3UKJA 2C78A 4ZO6A 4BMNA 3OT5A 4BP1A 4PC2A 4US1R 1A95A 3K32A 2XNCA 4CG1A 1A9TA 1NJ1A 2XCRB 2FZKA 2P62A 2D7DA 5B7GA 2FPIB 3DCJA 4MS4B 4NK5A 1GU7A 3GAFA 3R8FA 1IBKB 1SA0A 1Z8NA 3OCWA 4TZKA 2G6TA 4KXXA 2PMFA 3KKZA 2A57A 1T5OA 5ABPA 5A62A 5C52B 3GPLA 5JT1A 2C95A 2KM1A 3AF3A 1R4NB 4RZQA 5BV8A 3K16A 3WL6A 2X0NA 1FYFA 3JR7A 4JJ8A 5HTOA 1XTRA 5CCBA 4H1UA 3RWBA 3FE2A 1A7JA 3RSCA 3R5TA 3ZHVA 5KQRA 4HQRA 2CHGA 2P30A 3IQZA 4XTCS 1QGDA 3LZCA 3CH7A 5F76A 1XIVA 3G9UA 4EG0A 2JAXA 1XDSA 2ZULA 2ZBFA 3QELA 3LDFA 1YJ8A 4Q18A 4CUKA 2F6RA 3TRIA 1JX6A 4M9CA 3N1UA 3PD7A 4D0RA 4KU4A 5BWOA 1VKZA 4QYTA 1SBQA 2Z8YM 1XVUA 4EBFA 1N2XA 1U4OA 3TF5A 2Q5OA 1MX3A 1PGNA 1TM4E 1GFZA 2VHQA 3BAFA 2AX4A 4GMGA 5ER9A 5JZ9A 1EPUA 1CU1A 3GH1A 4BNTA 2CZQA 1UC4B 2O23A 4IBOA 4X95A 5C7OO 5JD6A 1NIJA 1JG7A 3O95A 4FFLA 4BLQA 4QL3A 1WAMA 2ID9A 3GZ4A 4V38A 3AUTA 1AS0A 4FLMA 1EP2B 1P9RA 3BRWA 1V3QE 3EW7A 1JHYA 4WW0A 1D2CA 5JXHA 1G98A 2XVXA 2P7HA 3UHOA 4MVJF 2RGDA 3BYZA 3D02A 1Y6QA 5EYPB 3W2HA 4D9KA 4U2CA 5JYCA 1DAHA 4EP1A 2ZBGA 1TADA 3KEOA 1D6MA 3K09A 4TVKA 4IHKA 4ZHQB 4EYEA 5FI0B 2GCEA 1QE3A 4XJVA 1Z2NX 5BR7A 2G1JA 3C3AA 5DCLA 3PXUA 2WILA 4IIJB 4I6JA 4D3YA 2IXBA 2PD4A 3AEZA 4WY2A 5AHXA 4EM6A 4XA8A 4NRDA 2JLXA 3R0ZA 4BY9E 1RWBA 3S55A 3REOA 2NSDA 4O0LA 1UMBA 3JQ9A 3D2CA 4GOXA 4L5JA 2QSJA 1S3FA 5EJAA 2ZTVA 3GMIA 1W85A 3GCDA 3MWDB 1K63A 4GOJA 5KKNB 3K6SA 3KSAC 5DCUA 4LKOA 3FYTA 3IULA 5FBQB 3FSEA 3ZKAA 1IOVA 1PQ4A 1YQTA 3JQGB 1J2EA 3NYQA 3QVWA 4OP2A 3LOUA 1L5HA 3WLKX 4J0FA 2JLQA 4UTOA 4XWOA 4ZYZA 2C7RA 1GDHA 5FPTA 1ZN9A 1B1AA 3DEFA 3OKFA 5E6SB 5DM60 3QF4B 3UFXB 5KX5F 3KV1A 3THYA 1GNTA 5AR1A 3SYMA 1KEPA 2RH9B 3RAPR 4U9HS 3VTZA 4E51A 1F0KA 3AEQA 2X2PA 3N59A 4BKRA 3RRMA 2C1ZA 3DT6A 3NGMA 1ZD5A 3UCEA 1GR1A 4YV2A 4R8LA 3U5TA 5TGDA 2DZDA 4YS6A 5J2TF 3RBZA 1KZ1A 4OYLA 2QR2A 3N75A 3G0GA 1Y6JA 4R9VA 2ZREA 4JLDA 5LCXA 4DWOA 3R9XA 4OYRA 1AKWA 2M6KA 5F1OA 1NXSA 2EFJA 3D6MA 1N8TA 2ZROA 5AXBA 1WTAA 4RPCA 4E32A 3F0TA 4N9QA 2VWPA 2ZJ0A 3TOXA 4JT2A 3VYTB 2BEVA 4Y9UA 3NJ8A 5FWDA 3V1YA 4EB3A 2UUBB 4BKOA 3TK1A 2YWJA 3ZWVA 4GXQA 1F5SA 2VNHA 2Y93A 3IAEA 3F9CA 5TDHA 4MGIR 3V8QA 4DA6A 3R0XA 2BTQB 2WJJA 3N0TA 2QXUA 1T5LA 2EF0A 2PWYA 3FRJA 1H66A 2J7PD 1G8YA 3AP3A 5JS2A 5FHRA 2VZ8A 3LHFA 5FPHA 5DULA 2H9IA 1ZOPA 3HCBA 2FZEA 4BQPA 2BFNA 2JNWA 1SFRA 1SU4A 4KRXA 3T54A 4FQ8A 3D31A 1ZSVA 2KS6A 4HUQA 3F7OA 4GT1A 1SXJA 2BELA 2ZYTX 3B8EA 3DBRA 2OLJA 3AYXB 5THXA 1NNSA 2GO1A 3GDHA 3WV5A 1YL6A 4N01A 2ZRMA 3BA1A 4IGKA 4F7DA 3Q8MA 3F7NA 3VM6A 5JJIA 3EPPA 3OQIB 2N42A 4IFBA 2PXHA 1PHPA 2C3UA 2Q0HA 3GFBA 3D3KA 3PIDA 3FNIA 2X1MA 3GDGA 4K26A 1GR0A 1FYVA 2ZSEA 4ND5A 1XK6A 2OXEA 1OSNA 2X14A 2PT9A 5AQ1A 4Q4CA 3DCIA 3PGA1 4R1LA 1G20E 3QF7A 3RJMA 1VI6A 3RF6A 4J2HA 4KO4S 1WZEA 4NV0A 4B47A 4IJWA 6Q21A 4REQA 3L0IB 2JD2A 3FNFA 3P7MA 1H2WA 4UM9D 5LQAA 3R0QA 2VPYA 4P32A 1V1RA 2CDNA 3R4CA 3NALA 4Q37A 1ULSA 1XQWA 2ZR8A 5H02A 2P5UA 2ZYAA 3TLGA 1OH5A 1OFVA 3BTVA 1PNOA 3OTGA 5TF4A 3PT9A 3TW6A 3L8CA 2PRSA 3L7CA 2YZKA 2BHSA 3ZVRA 2VAVA 1NAIA 4ENSA 1WVGA 5KTOA 1BHJA 1IAVA 3FSRA 1KGDA 4LFBB 1AS2A 1H5NA 2J08A 3ON5A 1FW8A 3VR2D 1H6CA 2N3ZA 5TQ0A 4JWTA 1Q83A 4XSHA 1KZHA 2MU1A 1S2IA 2BI4A 2NU6B 3ORHA 4FMCB 4NY1A 3U7QA 1QYXA 2ZXUA 1P7ZA 1KI3A 3QXHA 1L5SA 2ZJ8A 1BKSB 1XZNA 2B8EA 3CX7A 1JI3A 1OWLA 1LQUA 4LY6A 4OMDA 5LP6C 1P5JA 4ZU3A 1NJ8A 5HHTA 2PL5A 1RZUA 3K2BA 1JQ3A 4FWIB 1CP3A 1H0HA 3ANNA 4MRMB 2I7TA 2HMVA 4NJEA 5ALXA 1ZINA 4YECA 4P4UA 4Q3DA 1G2OA 2QJOA 4D9EA 4Z7JA 1MAUA 1ODCA 2FP4A 3NTRA 4HL6A 3CH5A 3QWIA 1E1KA 1IM2A 2WKWA 4PXSA 3C4QA 3ZCPA 1PUJA 1IE3A 4L5YA 3U3OA 1B7GO 1VL2A 2YS7A 3HQ4O 4IWXA 3V9AA 1WSWA 3AMVA 1KSHA 1T0HB 4B7XA 1US8A 2FEWB 4S2EA 3HDQA 3KM0A 2G04A 3TR6A 1DUIA 2E37A 3H1BA 4LTMA 4MYHA 3ILXA 4HLNA 2GF2A 4ZCQA 1QVWA 1JIKA 1A7UA 2GESA 3TOCA 1D2AA 1IXYA 4D3XA 1JECA 1WMSA 1YNSA 4HGYA 1AO0A 1VGVA 2DBRA 3E1GA 5A71A 2HLNA 4ZOLF 1HBJA 2J85A 1TUGA 1ZK4A 2KE5A 2FCRA 5DEIA 5IDVA 1IBCA 2YY5A 4G4JA 4F3YA 3L7YA 4OLJA 4U5QA 4RF5A 1COWA 4D25A 5LXTF 3E81A 5GWXA 5EJ7A 2B4TO 4K05A 2G5CA 2FZLA 1E2NA 2JIBA 1ZM3A 2EU8A 2C2BA 3FVTA 2VSOA 5FAXA 2PUGA 1RQPA 3M7IA 3L0BA 4EMBA 1NDUA 4IW3B 4UBLA 3TI9A 1NXTA 3YASA 4PG6A 4P4TA 2ZCJA 4CLXA 1Q0LA 1IXSB 1SQFA 1JW9B 2WNHA 3AHJA 2NXJA 3PNOA 4QVGA 3F6RA 3JPWA 3VKVA 2GA8A 2R86A 4WOPA 4R01A 3UK6A 4EZIA 4YC7A 3L7IA 2RI6A 1FNDA 2RHRA 4YMSA 1M0EA 4R1QA 1UT5A 2OHVA 3ILSA 3EXHA 3LUGA 4MS3B 4V2UA 5CPFA 2VZLA 1ZMBA 4GR5A 5TEWA 3LYLA 4RQAA 5BXYA 1FB5A 3BN3A 4O63O 1T34A 3HKDB 3SVZA 4N5LA 3OTWA 3ECCA 1EWVA 4RYDA 5EZQA 2VC2B 1YK1A 4ZZ0A 2PJUA 2A92A 1LBSA 1MB9A 1MX5A 2BC9A 3BRQA 4R5MA 2GN0A 1IEQA 5A5EA 4K9LA 2HIMA 4UUAA 5AYVA 4MYSA 5AOCA 1J8QA 1PZEA 4GWKA 1ATIA 3EGWA 3IPCA 1U8EA 1PNVA 2Z9DA 3A27A 4EI9A 1QHSA 2IYXA 1UMKA 2DC1A 4BQEA 2QQ5A 4INJA 2W70A 4UATA 1C5KA 2LVBA 1QP8A 2A3RA 3PXEA 4HC4A 2GD2A 3WLFA 2DSTA 4JBGA 2X7HA 2P68A 3E7XA 2RHDA 1Z68A 2ZYUX 3FPEA 2D5BA 4RGQA 5FWAA 1J25A 4ZT5A 4OHKA 4H0NA 1NW3A 3DFMA 1E7WA 3PFCA 1XBTA 2Z8YA 3PEEA 7ABPA 2XT9A 4UHHA 4CM4A 3PQ4A 3I23A 2YHBA 5SV2A 3W5UA 5G4KB 4NCKA 5HKLA 4DSAA 4FTWA 2IZOA 1EVYA 1P2SA 3H1GA 2J33A 4M76B 4RMHA 3Q12A 3QA9A 2XA1A 4MGYR 4YGYA 5THKA 3IV7A 3I8SA 4HRYA 5J5CA 4Y7DA 2IU4A 2ET6A 4BBAA 3A7DA 4E2XA 2WUEA 2NWQA 3S3TA 5B30A 1B3RA 1W1WA 3KYBA 1D8AA 4B84A 3O8CA 1T2CA 2X9NA 2IWRA 1D2EA 4FBMA 1H9AA 3H87A 1P5ZB 1QYCA 3WGHA 3UB2A 1W4AA 2RK6A 1VGQA 4MV9A 4GX5A 1BMQA 4RHTA 4WWHA 1Q0ZA 4UXHA 3RM3A 5EZ5A 5IHXA 1AKQA 4AQYB 3N5CA 1BQ4A 3PGKA 1FMLA 3Q3CA 6REQB 1YS9A 1KMCA 5ALLA 3ZH2A 4K9KA 4NJEB 4J0IA 3RSHA 3GJ7A 3TQIA 2XXJA 2AW3A 3ZXUB 3FTQA 3Q1KA 5KMGB 4OMFG 2CL7X 4WNAB 2NSYA 2JFPA 1G4AE 2AC7A 1C9NA 2L17A 1FFBA 2AI1A 1S3SA 2GTIA 2WJGA 3GV0A 1QFZA 4GM1A 3U7QB 2ISSD 2GR9A 3AF2A 1OFUA 3L07A 5I9MA 1Q84A 1QK3A 4QDTA 1EDOA 1Q16A 2P9QA 4BN4A 2LPMA 3A1NA 1H2FA 1QGYA 2Q6KA 4MKIA 2DUUA 1X7DA 3PX2A 1NW6A 4N4AA 1BHQ1 4OI4A 5DGTA 2B21A 4YRRA 5FOTA 3ZU6A 2M1ZA 4N48A 1CS4C 3DPUA 2CY0A 3IHTA 3GK3A 3Q5GA 5KVVA 2FSGA 4PW0A 1Q0PA 5DLEA 1T8TA 3B1FA 4HQ6A 5EPUA 3DFKA 3Q8WA 3GT4A 3WR5A 4DC0A 4L8FA 1U7DA 1ZKMA 4IHJF 5BN3B 1E4YA 3K8ZA 3P45A 3RHSA 2C2KA 4ZI7F 2ECOA 3NEPX 1R9JA 3TLGB 4RTLA 3JAWA 4F06A 1V1RB 3MRTA 2HC9A 2XUOA 2XDWA 3KZVA 4A82A 4B71A 3ZOZA 1NVBA 3DL2A 1JILA 5K99A 4NXNB 4CODB 3S1SA 2O8DB 2Z04A 5JUWA 1W36C 4L50A 2GZ3A 1IATA 2BUBA 3W3AD 1FDVA 1NTRA 3R7WB 1OT5A 1Q0SA 3OZAA 4GO1A 3WGOA 1GSIA 4RPHA 1UXKA 1IN5A 3SZMA 4C4PA 3GT7A 1V96A 3Q2OA 1XCOA 2JBWA 1Q1ZA 4I19A 5EINA 2OZEA 4DOMA 5CITA 2EQBA 3VR5H 4AG6A 2YBDA 5TJ9A 4BKPA 3ZWWA 2I8LA 4DIEA 4RACA 1MFPA 3UCXA 1Q21A 4OL0A 3OIYA 3QM1A 1W87A 3OJOA 1A4XA 4EAQA 3HDVA 5I6DA 1CEQA 4K1LA 4JB8A 2JFOA 2HCBA 2AYXA 3BGSA 2FZ5A 5B58C 4ML3A 3ZXYA 1MX1A 1SCKA 3PL1A 4PZDA 5IXJA 3L7OA 1EI9A 2IHVA 1YFZA 2IZ0A 2JRLA 2OCDA 3VZSA 1IJBA 3VYWA 4EQ6B 4RIEA 3PPYA 2GVDC 2ZWPA 4MV0A 4BFYA 4HS4A 3SZGA 4BIMA 1SBYA 4ZVNA 1GAJA 3BSWA 4NAHA 5HKKD 2RK3A 4XFKA 3HS3A 5B3LA 3CVVA 5K3FB 3L0ZA 3OPVA 2BEVB 2MOKA 1MAWA 5DI3A 3PI7A 2I34A 3QPBA 1AK1A 2NU8B 2HWYA 1E8NA 2GAAA 4R2LA 3E0QA 2DE0X 1VE9A 3EVFA 2ZUTA 1T4GA 4LZZA 2LD4A 1YIOA 4PC3A 4U39A 4Q4JB 1ZCAA 3UHPA 1MZVA 4KJZA 5LKRA 5ADWA 2XGMA 1G8FA 2C82A 2HA0A 3Q40A 3NX4A 3WRYC 3BXEA 2Q2VA 1SAYA 3I04M 4FNGA 4Q6BA 3WYAA 4CFYA 4TKMA 4FR5A 2WP0A 1U5BB 3ADOA 1JZTA 1P33A 3PNBA 3VVMA 2H4FA 1LPBB 4INPA 2IXTA 1AGNA 3B85A 1R9NA 3EYAA 4YJHA 3WYBA 1FYDA 1R3DA 4CR6A 1DARA 2ATIA 2XD4A 2WKSA 3IVCA 3IXQA 1UAGA 4HXYA 3Q7EA 5CTAA 1L4BA 4YUYA 5HX7A 1HNNA 1KK2A 1QWSA 3NTVA 3K6SB 5IVPA 2V9PA 3OOEA 1XAGA 2W0MA 4C06A 1N3IA 3H5RA 1PT6A 1L4MA 1ACJA 2D1QA 1EE2A 2O2ZA 3QEAZ 1PG0A 3G2QA 4US0R 2PSFA 4W1RA 2VJCA 2CN1A 2EFGA 1Z33A 5IZCC 1R15A 2QX4A 2D2FA 1VPEA 2DRIA 2PVCA 3SZOA 4B6EA 3I5YA 3IUSA 4N5NA 3IHWA 1G7SA 2C9CA 1GGVA 5EZYF 2VWGA 3CLSD 5THQA 4ANFA 3QW4B 4KVZA 4KACA 4FILA 4GWLA 1TO1E 1P0QA 2W4MA 4UHKA 1Q44A 3F4BA 4WLVA 3AQIA 3SQXA 1DWQA 1E61A 2OFPA 2VAXA 4P86A 4JK3A 4XOUA 3PHHA 1AN9A 3PHJA 3NIBA 1MMFB 2WE7A 2BF4A 4UVEA 3H1TA 1P6UA 2H59A 1ZXLA 1ZVVA 2IVZA 3D7RA 2D2IA 5BN5A 4CJXA 3KU1A 4DGQA 3SE7A 3IS3A 1E5LA 1BHO1 1OBHA 3KPYA 2YZMA 4OH7A 4UFNA 3DDHA 3TJRA 3S2EA 3NDRA 3I2FA 3SP1A 2CF5A 2GILA 3KHKA 3MWFA 4TMZA 4URHA 1X9HA 4H3SA 4RWEA 1JLRA 1PN3A 5FBLB 1AO3A 1DC5A 4BBPA 1SBZA 4BNGA 1Y8QB 1IHOA 1ZD2P 2XMSA 3ETLA 1GZ4A 1FYWA 4HR7A 4Y1RB 4B75A 1TUEA 3W05A 4TZ0A 4EG3A 1GVNB 3M1YA 2I6XA 5IW8A 1REQB 4RANA 1WHSB 3CCCA 4TWZA 1ZCFA 1HT3A 1SCUB 3ZHXA 4HAXA 1KDRA 4BAGA 2YWXA 4KR0A 4BCBA 1I94B 5SYMA 2WFAA 1OASA 2V7UA 4BMOB 4CMBA 4P3YA 4GYYA 1OBOA 1QHHB 5AXDA 2VAPA 4BO5A 2B2XA 1QLHA 1TZ2A 1N5RA 2GXUA 3HDGA 3KAQA 3VTFA 1RXWA 4MNTA 4RV5A 3R8CA 2DPGA 4I6GA 4N65A 3CB2A 3DM5A 2BFOA 5HILA 1V35A 1FQJA 3WKCA 4CPDA 3I05A 4L4RA 1WZ2A 4H7IA 1XGKA 3PB3A 5CURA 1PNRA 5B37A 1XNGA 4L6AA 3UH0A 3OTIA 4BFWA 5M3BA 1MA0A 3T1YB 2O8CB 2YN0A 2OQIA 3DBHB 3U61B 4I55F 2JAQA 4CG3A 1PF7E 1MR3F 4ZI2A 3ECAA 1IBRA 4RS4A 2B1IA 3LU1A 3SBOA 2O0LA 3WKDA 2FGJA 5LWHA 5HZMA 2R7LA 3H2KA 2QVGA 5KOIA 3ICQB 2DB3A 5D5PA 1M2NA 1VB3A 2CCGA 1L4LA 4NSNA 4XPIA 5LOVB 3IR6A 2CVHA 3C6XA 4HFJA 1JL3A 5BNWA 1KERA 1TTQB 1E8MA 1R0BA 2HQRA 2HU7A 2W2LD 3O8OA 4FEGA 2YQ5A 3WIEA 3I2KA 3P94A 3NKLA 3N3AC 4MK4A 1M2EA 3QY0A 3TUJC 4N76A 1U8AA 2C59A 2CHQA 3T9FA 3KQKA 5JH7A 3ZWBA 1VJDA 1KQOA 1M8GA 1U0SY 1D03A 1Z3CA 2OECA 3OKPA 1FFEA 4HWOA 4LZWA 1P2DA 4F1WA 4CGZA 3NUGA 3H9CA 1OZAA 2V59A 4G5YA 3STVA 4AX4A 3TPFA 3PLRA 5HRCA 3KQUA 2VP2A 1E3IA 3EG9B 1Z28A 2P27A 3N07A 3NOXA 2WSBA 2OHGA 1LFDB 2YRWA 2VYVA 1P19A 3QVMA 3U7JA 4R69A 4A0GA 4HX2A 1ACLA 4PVCA 2NTYC 4ZVPA 1L3CA 2W2LA 5KNDH 2YWCA 5FWNA 5LA6F 2HA7A 4L85A 3I37X 3P0JA 3BZUA 4ZHSA 3M1LA 3OJXA 3HVIA 3ADKA 4B4KA 1VGRA 4TOIA 4WSOA 5BRAA 5DGHA 4ZCIA 5CNIA 1IXKA 1RHMA 2QTBA 2LUOA 1CW2B 1P1IA 4ZT3A 1ZUNA 1VRVA 3C3BA 4QUEA 3RR2A 3B13B 2JGDB 2D0OB 1DAOA 1DI0A 4KAAA 4XARA 4D9NA 1PX0A 2HDNB 3ESZA 3HVUA 1F1BA 1VHJA 2A4KA 1E3SA 2L0XA 4TKLA 4YRTA 3K6KA 1K4MA 1SHKA 2ZRLA 2EDAA 2VRCA 3UBTA 1RM4A 3P9YA 2G80A 1UF9A 1Y0BA 1R7RA 1WF6A 4FMPA 2NXWA 4YAEA 1D4OA 1NVAA 3D2LA 2F43A 4I4LA 4QSHA 3SPXA 4URVR 3FYDA 4PZPA 4AG5A 1M3SA 3SQNA 4FX2A 1OAOC 1Z5ZA 3I2HA 5KSWB 3DVQX 1FUUA 1BRMA 3DOFA 4IIVA 1GV1A 4EW6A 2EHDA 4CXMA 2B6NA 5F7ZA 4DMGA 5HE8A 1PYOA 1NASA 4ZIRB 5JW6A 4CQMB 1MO4A 3WLPA 5HDQA 5HM8A 1M2WA 3RROA 1ODTC 2OESA 4Q4HB 2Y3IA 3AFNA 4PAMA 2RIPA 4X6YA 1EUQA 1SCQA 1XAIA 1A9RA 4ZJYA 4DMCA 4RTJA 3F3MA 3QSGA 1CJSA 1YJXA 3RRBA 3D7NA 4DA0A 3U4MA 2YHAA 2ZCUA 3F2IA 3FY4A 1CUBA 2FFBA 4Q16A 3K8QA 1O5OA 1IN8A 3MVEA 3BRWD 4NATA 3KFVA 4BMYA 4L28A 2YDXA 3AP1A 4KVFA 2VJNA 6PFKA 3K5WA 4R84A 1AC5A 4ZRDA 4M1WA 2V0GA 1K9VF 3OH8A 3T5DA 5TIIA 3DLCA 3GJ3A 3PZRA 3QNUA 3LF2A 4TS3A 3RSQA 4AJ2A 1B2RA 4BMDA 1HH4A 4AZ3B 1Y1RA 3BULA 4WKOA 1MQSA 1OX5A 4JLUA 4UE6A 3HDHA 3VJLA 5BYKA 1SBTA 5KYTA 4B80A 1K5HA 4DSTA 4ND2A 1VZ3A 3T9BA 4BMCA 3HJRA 4C2AA 1F6BA 1YZ3A 2PTGA 4IVRA 1A69A 2QP9X 3X1XA 2ZUEA 4ZT4A 1P2GA 3AI1A 4DNFA 3ZJVA 2FPPB 3LDHA 3DO5A 3OOWA 4BZPA 4DMRA 1SURA 2CLOB 3PF8A 4HZIA 3N9IA 4MWZA 1K7YA 1EXDA 1UCFA 4FD3A 4L27A 5LMNB 3GWZA 4J3FA 5AVVA 1K97A 1Q1QA 5LYJF 3TAXA 4XCQA 5K6AA 4J91A 4H7DA 2WSYB 1ZMTA 2QQ0A 3CPHA 2XGJA 3H7AA 3ELDA 1FRVA 3NKVA 3S68A 1SWVA 3G5TA 3TZLA 4B35A 4CI0B 1Z8DA 4I1IA 3AVVA 4IIHA 2G09A 3M6MD 3ZQUA 1ZMOA 3VGPA 4WZBA 4A92A 3DMTC 3FPSA 3EQ9A 1MPXA 1CUWA 1J00A 2OAP1 3JQRA 2WAAA 4PYQA 4B6GA 1HEYA 1N9ZA 5DHPA 2CVPA 2JI8A 3H3FA 4PU0A 2CJWA 1RRFA 4Q6WA 2W58A 5FJJA 4NV1A 2WABA 1K3UB 2AEFA 4LSMA 4HPXB 4YASA 4BCCA 3OFKA 3MIIA 1YR7A 2H31A 5GGYA 1KGSA 2H0RA 2XXBA 2R5NA 4NWIA 1NQAO 1NLFA 5BORA 1NYRA 1DAGA 1EX9A 1NJ5A 1QCDA 1UDXA 1K7CA 1FFDA 2OXCA 3A8TA 3H13A 3N0XA 1I0IA 3T7AA 3U0VA 1OGIA 3ETNA 3JASB 8ABPA 4IWYA 3DMYA 3I6YA 8LDHA 2HT1A 3GD7A 3OPQA 3NHYA 1SPXA 3I30X 2YZGA 5TMEA 5I7VA 4DMHA 3F96A 1Q11A 4AF8A 2Y9MB 1SBHA 4Q19A 1PYGA 4X1IA 5KYUB 1I36A 2PX2A 3WSWA 3QOYA 2VJYA 3BJZA 4PGMA 3K1YA 3ZDZB 1ENPA 4OXNA 1G20B 1AZLA 3MOSA 3QFRA 5D5HA 1U11A 2IYUA 3QLVC 4KIFA 4ALKA 5A2QA 5FBKA 4QYMA 1UBSB 1U3FA 3EXIB 3QENA 2QRPA 2WZCA 1LZLA 5HK9A 4YAUA 1UC8A 3LP8A 4EYQA 1YI0A 1DX9A 4ZYWA 1UIMA 2IH4A 3EXFA 5BR4A 1V16B 4AJNA 2DUNA 4FUQA 3WHIA 4RJIA 1KIMA 3IQXA 2P9FA 4X90A 1A98A 2Q4DA 3WO1A 1GAQA 2OHHA 2PWZA 3LF1A 1DV2A 4LYEA 2XDAA 4LOJA 4R3NA 4XFJA 2NU9B 4BNIA 1XRLA 3X0DA 1BFDA 1QC5A 4WMLA 2NSJA 2KB0A 4JT4A 1N2IA 1N6IA 1P1JA 3LQKA 3QU2A 2MIIA 3ERCA 1JP7A 3MT7A 1MNQA 4MQ5A 4LC0A 5FLXA 3IOBA 3A4VA 1IHYA 1N9GB 1QO9A 4I1SA 4J1SA 5AW8A 4INZA 4X85A 1C80A 4K1XA 4EITA 3CBQA 4RMNA 4JYZA 1JU4A 4C0KA 5AM5A 4KQKA 4L2IA 3O9ZA 3W9UA 1XG5A 3RSGA 2ZWMA 3IDAA 4UBJA 1E9EA 5EGSA 1QC5B 1WP4A 2FKNA 2BGMA 4XLTA 3WYGA 4AG3A 1M6HA 3TTSA 2CWWA 5BXQC 4JXKA 5J2TB 2X8AA 5CH5A 3BH6A 3U13A 3RANA 2VR1A 3OOHA 5FFMA 4ERNA 2CCJA 2AXEA 1N5KA 1YB4A 2G9VA 4CQLA 1TI7A 4W6ZA 5ITSA 1PD0A 4BRWA 1M74A 1T4DA 5FPYA 4BV3A 1ZNZA 1VG0B 2O2CA 5JFOA 3MILA 5IANA 1U63A 1XEXA 4G86A 3LYAA 1J8VA 4GZ3A 4MTCA 1AIPA 1YDHA 1GYRA 2W2NA 1XNJA 5HDBB 5A5VA 3M8KA 4RPIA 5AUQA 4CV1A 3KT8A 1H1DA 4ONEA 1Y7TA 3DYIA 4MW7A 3L41A 3A3YA 1C7RA 2C4TA 4GSKA 2NO1A 1NBWB 2E4UA 3I8XA 2HF7A 5L7TA 2XTAA 4RDXA 3MXOA 3DAPA 2D62A 1XMQB 1XVVA 2L2QA 4KIJA 4MHTA 2XMQA 4YXWA 3UUFA 4Y6GB 3DNMA 2FZCA 1KVUA 1YRHA 1IUOA 2ONKA 3FX2A 3GFGA 1E2DA 2E0IA 4JB0A 4DCNA 1QYWA 1MNAA 5A4KA 1LI5A 1RJDA 4QUIA 4XWWA 1E0DA 2A0FA 3D43A 4K6HA 4RW0A 5ED4A 4N03A 1DWUA 3LXUX 1T3TA 4LDNA 5JNUA 3VYVA 1XEXB 4LHWA 5BSFA 4RKYA 2CSUA 1R0SA 2DTXA 1OY1A 3KUDA 2WKPA 4TN5A 3DAHA 1YIDA 4MR7A 3W6NA 1K0FA 1USWA 3OCXA 1CULC 2R6R1 4D7AA 1AGRA 1YCDA 1MV8A 4JJGA 3FWYA 4CQLB 3LCMA 4M9QA 1PBNA 2VH5R 2O50A 1ZD3A 1SIBE 1II8A 5CB6A 5DMXA 5J2TA 4NCJA 5A6VA 2R79A 4NYIR 4RPGA 4M0LA 3SHFA 2I6GA 4LBVA 4QOEA 1WMFA 4BAZA 1YZHA 1O96B 4NC9A 1XC7A 3DV2A 4FMDB 4TL8A 5BWCA 3ONWA 4JEMA 4UUMA 3WIVA 1V6CA 1RHRA 1QHXA 1ZU4A 4BQIA 3M89A 3A1TA 4I4IA 4CTOA 2D2VA 1T9AA 5EIXA 4F7WA 3WK7A 2ZJ1A 3D64A 4M0FA 3ROKA 5K0FA 4OJYA 2PANA 3FGPA 3PA8A 3F7TA 5T4BA 2XNDD 4D5GA 2XUDA 1LNZA 2QV0A 1WWKA 2Q2QA 2VPXA 4FDMA 4HDRB 4L4YA 3I6QA 1JJIA 4Q3NA 5K45A 3UJNA 2OSBA 3FBTA 4AY6A 1HDIA 3WL8A 2O6LA 2GPSA 2VH1A 5C9ZA 4NPAA 2SHKA 3VHXA 1AQLA 4KX5A 5FI1B 3GLSA 3WWZA 2XTMA 1T26A 3OCZA 1HUQA 2XODA 1KOJA 3PR2B 1N7JA 4LRWA 4DSZA 4ENQA 3KJHA 4IZIA 4M1TA 3EXHC 3N6VA 5C81A 2UAGA 1QCZA 1P2BA 2Q1XA 4PFQA 1XU7A 5AHRA 1XKLA 1N8KA 1IRIA 4F9GA 1V7CA 2J5RA 3NJ4A 1E79D 4Y2RA 1VFPA 4HDQB 1E5TA 4DUGA 1HPLA 2BMDA 3QPUA 4BX8A 4PZAA 1W7AA 5E3IA 3A3OA 2V9CA 1MJGM 4P08A 1UBRS 2XT0A 2EJCA 2VBGA 1Y1PA 3DVRX 5FTJA 5DXJA 1JDZA 3ABOB 1LLUA 3SI7A 4L5CA 1Y4UA 4DBZA 3PUJA 4G37A 4GPD1 4N47A 2QUIA 3NAQA 2CXRA 4F45A 3KZOA 3GFSA 4DJFC 1K88A 4DA7A 3RU9A 5HOEA 1HNXB 1Z26A 1I0LA 3ZDRA 4MDFA 3AFHA 1CIPA 1YVDA 3KQWA 5HRUA 4NI5A 3HYSA 1QTIA 1V3VA 4C2UA 1DKPA 3MTJA 4UULA 3SQOA 1B74A 2G77B 4XVRA 3UG7A 1E1RD 5IFKA 2PUTA 4O4IA 2OUIA 2QVBA 2DFPA 2BN4A 4R2WA 4WUVA 3TS1A 2H63A 1C9KA 5LBTA 2GVZC 4XX1A 2EP8A 2W83A 2P91A 1CY6A 1JJVA 4GR4A 2VDWA 2ZSUA 3L4SO 2WVGA 1Q20A 2OBXA 3G2MA 3O8QA 1XE3A 4ISCA 2XDYA 4AZ0A 2V6BA 1XZPA 4EPRA 2FPPA 5DHQA 2HREA 2G0TA 1U2SA 4L78A 4X8LA 2H65A 1TZJA 3RKRA 5LP6A 3CRMA 1PT5A 3JARB 3WNVA 3ENVA 3O8DA 4RD3A 1MDFA 3HKEA 1E0KA 4H7EA 4MQ6A 3NUQA 2JHGA 1S2LA 2HLHA 1X7HA 3GGDA 3L9WA 1NVTA 2OCPA 3PPIA 1EKXA 1YWGO 2B20A 2IUEA 1EVJA 1WXDA 5CW1A 4ARAA 1NTOA 3M82A 2PBFA 1GNVA 1ST3A 3S2ZA 4DABA 3IB6A 4N3CA 1EE9A 1A4IA 2JL1A 1CCWA 4Q4AA 2VDVE 5F64A 3MB8A 1E7YA 3NHJA 5J43A 2UZ0A 1VCIA 2W2TA 3AR6A 2AFIE 1WXEA 3QX9A 2ES4A 3T4XA 1GO2A 5FTWA 4ICIA 3Q3EA 1A5ZA 4MIKA 3U9LA 1JSXA 1MRZA 3I64A 3RVLA 1P1HA 1CEYA 1J22A 2BTOA 4YCJA 1JTEA 3OPMA 2O8EA 1D2GA 2FQXA 1KZ7B 1OF1A 5I7HA 5LQJA 5L51A 2C2OA 3K09C 1KKLA 4DLPA 5CGQB 3T5BA 3GY0A 4Q9AA 4GZMA 2IOHA 3W6PA 4KE9A 5EXXA 3HJCA 1O77A 5BNIA 1SUFA 2GBPA 1W6RA 3K9CA 1Y3FE 4WBSA 3UJ7A 2WTEA 4FC7A 1PR5A 1PI3A 3W77A 2BMEA 2SECE 3BWCA 4MR8B 2WOOA 3LPNA 3WWPA 5JAOA 1PZGA 1RC8A 1QHHA 1CRQA 3ASUA 1KI2A 4H60A 4EIWA 1PJLA 3LVRE 1MBZA 1TM5E 5H4HA 3VPGA 1H6BA 2RSLA 1G2QA 1H69A 3FPJA 3HKCB 1THZA 4MAAA 2WVAA 2IEGA 4LWOA 1LC0A 1BFKA 3MF4A 2NZ8A 4KP7A 3IBYA 1Z07A 2JKYA 4LSWA 5B2FA 3NORA 5H9WA 5SYNA 4ZGGA 1KMIY 1ZUNB 2V4UA 3LP5A 2OK7A 5DNCA 3G88A 5LD2C 2XD9A 5KKAA 3A1DA 3ZV6A 3ROXA 2E82A 5AQEA 4NK4A 4LXUA 3RTAA 3C6BA 1XQYA 5TEVA 4MX8A 4L15A 4U7FA 3QPCA 4GH5A 5D84A 1I7DA 4ZOEA 2DQZA 1R74A 1XTSA 2ONZA 2W6OA 4DYVA 2D74A 2YDYA 3CCBA 3I52A 4IGAA 5A5FA 2HWWA 3I62A 4EUHA 3FSGA 1QIJA 1W19A 1CLUA 5CXUA 4XEUA 3OQOA 5DSXA 1X8KA 1Z2PX 3JQEA 2R1TB 1FFAA 3JYNA 1DP4A 3WB9A 5JSQA 4EHFA 1UK8A 3OZDA 4AD8A 1RQRA 1EFDN 1K8YB 3F6BX 3EJ6A 2OZPA 5CD9A 5C1OA 4H27A 5DYWA 1C9MA 1HYQA 5TPWB 1ONOA 2HIGA 2QEQA 1GTG1 2VDOB 3IOEA 4WERA 1O6CA 2LZ0A 3FZGA 2QD5A 1E9CA 3IP7A 1QV9A 2NZUG 1KK1A 3E35A 2Q6TA 1E32A 3UTDA 2HMYB 2GTPA 3AF1A 4AI6A 4WADA 1KU6A 3EPKA 3U62A 3O8OB 3CY6A 4RTMA 1WOYA 2QN8A 3K1AA 1EGQA 1VLVA 3ICWA 3LRXA 5CFPA 2BCJQ 3FIJA 5LOVA 2Y1DA 1WM1A 3U3XA 3S27A 4MCAA 4UUPA 4EB0A 1C1YA 3HNOA 4MW9A 1SOVA 1KMHB 2GWRA 4OHMA 2Q5JA 3Q7SA 3ER9A 4U00A 5IEBA 1P7WA 4PFKA 3A1WA 5F1YA 4YCSA 2FWMX 4F9EA 3HXQA 3RS9A 1IZZA 2CNNA 3V2IA 3VKGA 3F3SA 1JFTA 3LBAA 1X9GA 3DBHA 5JS1A 2XE7A 1FTGA 4GIBA 1CC1S 1F8YA 3JZMA 2C5BA 5GZ3A 2ZPTX 2KHZA 5I7AA 5KYXA 1X1BA 1IJFA 3E05A 4J0JA 4U9IS 4ARZA 1T2DA 2ANBA 1G38A 1AXGA 3NU1A 4Q15A 2QRLA 2ZWVA 3A9TA 1DIHA 2Z0MA 4Q4JA 5EWJA 1S96A 5G0SA 3FG9A 3ZD8A 1CQIA 3QX8A 2PRZA 2IPMA 3B5IA 3PGMA 1QHYA 5FUWA 5JAQA 3LY9A 4B7ZA 3OHSX 1U4SA 1PG5A 5DI3B 1YQ9A 1P1RA 1UXOA 1NJSA 2BMJA 3GEEA 1G9TA 2PKQP 4AMYA 3EIXA 4RVCA 4YRZA 4ESVA 1IEVA 1Q19A 3ET5A 1R37A 1K6XA 4D0GA 1M0TA 3ENWA 1BXGB 4Q3KA 5F1PA 2GKOA 5EPOA 1ICEA 1G6KA 2COUA 4O2BB 2Q1UA 1I2BA 3UOGA 3WIDA 5JDIC 3UT5B 2O3RA 3IELA 1A0OA 4QXRA 1NVUQ 2W22A 3JVIA 3BGIA 3JD0A 4PZCA 4PTZA 4RCVA 1C1HA 1G5FA 1OCEA 2RJNA 1KO7A 2VYNA 1G5HA 3AR3A 3CIFA 3DVLA 2AI3A 3E8XA 4I1RA 2VNKA 1XLWA 4V0SA 5IULC 2GM3A 3QFCA 1H8EA 3A14A 1WS6A 2C61A 2GO7A 5B2ZA 1L7MA 4R6XA 1W76A 4FIDA 1H2BA 4LZPA 2CYAA 4G25A 3FNEA 5A5DA 1F48A 5CBPB 4E5UA 1HDZA 3FPAA 3WL4A 3RSSA 5LMCA 2PT7A 3L82B 5LNK1 2JZCA 3CNLA 3FOWA 4RULA 2AMLA 2H07A 3E7WA 1L1FA 3SBDA 4Z9FA 1G3MA 3PUXA 1N6NA 1ZN7A 3IJEB 3UPUA 2EF1A 2Z8ZA 3FHTA 3W1EA 1OKKA 1XDZA 1V37A 2Q3HA 3HYCA 3WDMA 2QI9C 3ZE1B 4EKEA 3R74A 5KREA 4K46A 3UF0A 1KHHA 1TA9A 2DUJA 3CNHA 3GEMA 1KZ9A 3B89A 3G23A 3TLBA 1ZJ4A 2Z5VA 5AHKA 2JAHA 3DWGA 1GAXA 1B6GA 4LG1A 2I9KA 4UNNA 1TFUA 4JOCA 5U9CA 1QU2A 4OM8A 2FAXA 2J0QA 1LS6A 3K94A 1WXQA 2W00A 3MRXA 3BE4A 4YACA 4F6RB 1VBKA 1AH2A 1VDMA 3AHCA 1E5VA 3JQDA 3AR8A 4ZQHA 4DMKA 4HUTA 2YMPA 4K9DA 5C8YB 4HKTA 4IR7A 4C78A 1U5AA 1KIAA 1UINA 3NASA 5DK6A 2F1KA 2ZDQA 4KSBA 4AJEA 5E7MA 3FOZA 1JIIA 3C16C 4JLWA 3EMDA 3OU2A 4LOHA 4FUTA 5LZ9A 2R60A 4JP3A 4P98A 4W5QA 4B3MB 1FNMA 1Z56C 4LJ4A 4NIMA 5AVYA 3VNAA 4QNNA 3WJ2A 1EFUA 5EAIA 1LX7A 2ZAYA 1PV4A 1PLKA 2P2GA 2PTHA 4OBEA 2EKLA 1YQEA 4KOAA 2LV8A 3PGJA 2FV8A 1ISPA 2I6UA 4LTDA 4WNAA 1KJJA 1NMZA 5BW6B 5C0OE 1IQ0A 2A30A 1U2ZA 3H5NA 2QYTA 2D06A 2FOXA 4LF7B 1QFJA 2HSJA 2I76A 2XBLA 4DDMA 3EY4A 2WJIA 3Q5EA 1YIAA 1MN6A 1QGZA 3IQHX 4V0RA 6REQA 1ZOOA 5BSVA 5LLSA 1MAHA 3OF2A 2DF8A 1M1YA 3GP8A 2XECA 2AMYA 3FMIA 4DCOA 4YBRA 5K8JB 2FSUA 4FINA 2OGTA 2VT3A 4EUFA 1UC9A 1CS0B 2MWMA 4YJKA 5FTKA 2XBUA 3Q7PA 4NZNA 1NNUA 1GM5A 4P2BA 3FNQA 4CIWA 2AEEA 3WWDA 2JIOA 2ZE5A 5DE3A 4DVGA 2J3IA 3KR0A 3OM0A 5C1IA 3RC9A 3L0DA 1U6KA 1WY7A 5I7UA 1JHXA 3FZNA 2VH2A 4IHQA 4LNHA 4ZO8A 2I6FA 1JXQA 1YKFA 4WVLA 5JQGF 1WB9A 1SKYE 2HY7A 1I3OA 4QU0A 4JSRA 1I24A 1SZPA 2UYOA 5TC4A 2Y1LA 4AJ4A 2OXTA 5L7WA 2EATA 3O84A 4BNFA 2H2WA 2HWKA 1C81A 4CN8A 4N41A 2XWPA 2H4HA 1U9CA 4RJKA 1KI7A 3V6LA 1Q15A 3F3YA 3N7AA 2G36A 5LQRA 2NPOA 1X14A 3L6EA 2QORA 1KIFA 2QY6A 2VL7A 3HI4A 3LFTA 3VI4B 1PJ2A 2V7TA 3ESXA 1WDWB 4TTTS 3VYSB 3K6RA 4RC9A 4DNPA 5K0CA 1B6SA 3U26A 2YVUA 4OY3A 3ZZMA 4XWTA 1XMIA 2NO0A 2ZJ6A 3EUEA 3CURA 3GEHA 3R41A 4HGNA 5IABA 2DEUA 4YRNA 4ODIA 1Y80A 4KXQA 5KNCH 3IAHA 2RHCA 3C7AA 3VUEA 3OBIA 3AXTA 1GQFA 5IVKA 1KJWA 1V6SA 2ZIXA 1JQEA 4CR8A 5JARA 1DB3A 1VLJA 2XITA 4CF4A 1TKBA 3F1KA 2CUZA 3HUTA 1H3FA 3MWEB 4MQFB 3HKDA 5I8WA 1ZAYA 4RZUA 1Y33E 4E21A 3ODGA 1RP1A 3FFBA 4QPZA 1PD1A 3A6JA 1U04A 3EAFA 4Z4IA 3UMVA 3WLHA 3OPXA 2YX1A 3I9V6 2GBFA 2ISQA 1QIGA 3VU8A 3KKEA 4X66B 2VDLB 2PZLA 2ZYGA 2IS6A 3TDMA 2ZU0C 5GJWC 1H0RA 4WY5A 3I39X 5EN4A 1WABA 4YTEA 2WIDA 4IIBA 1ZZEA 2IYAA 1W1IA 2ZRHA 3NEAA 3D4OA 3QHPA 4YCAA 1GUBA 2C7VA 5DX8A 3S29A 1KEEA 1VIAA 1A7AA 1QSGA 1VYTA 2BEWA 1SELA 3IDSA 3MG9A 4AP9A 3C7KA 1NBIA 721PA 1SXGA 3SEAA 2I99A 3HP4A 1H5UA 3IJRA 2P2ZA 4R81A 5NLLA 1V45E 2EDCA 4B5KA 2HI0A 5BW8A 2PFKA 3N39C 2FFHA 1Q57A 2PMKA 1WDMA 4KR2A 1A2OA 2BM9A 3CF2A 2LCIA 1TC2A 3IL2A 4DHWA 3BSYA 3TX2A 4BXOB 5E9AA 4AP5A 3GFTA 1US8B 4PYMA 2YJ4A 2P4HX 2CDBA 1Q0TA 3IILA 3HRHA 3LCRA 1E6WA 4O5OA 5AVUA 2ZUDA 1NLMA 1BVUA 2YV4A 4OVKA 4ER7A 1DIAA 3JQBA 2CHUA 2LGJA 1S0UA 4XR9A 5E1DA 5HJ5A 4NJMA 3HCDA 5E6UA 2H5EA 1PR2A 3PZBA 1HM5A 4ESEA 2O8BB 2BFWA 2HN9A 4TWJA 3BQNB 3MAAC 2PQ2A 2REBA 1QRDA 3NCTA 2GQ0A 2Y0DA 2HHHB 4LS3A 1MZPA 2QL7A 4Z0HO 3CHYA 4P7GA 4QDKA 3DE3X 4CM1A 2RKBA 2FN4A 2FMUA 2FSSA 1Q17A 2X6TA 3EF0A 1R4MA 1ZVMA 4LDPA 4XB2A 3VH4A 2VDMB 2G9UA 3B78A 2WFLA 3WKAA 1NVFA 3A0UA 4DYHA 1ZN2A 3RUIA 3RTCA 1FUEA 2BZ1A 5JTUA 4R8SA 2DXIA 2NYUA 4NR0A 4LXXA 5E6RA 4AJ9A 3WL7A 4MLDA 4KFCA 4KVGA 2PZMA 4Q9JA 4YP1A 1OBCA 4IZOA 1Q3HA 2Q6LA 2QRKA 3E9ZA 4HJXA 5IBQA 4AN1A 2PFGA 5B1YA 3AWIA 1J39A 3HRIA 2EEPA 4FYXA 3O74A 1AJEA 3HR8A 5F7OA 3ZXXA 1MO2A 4HRVA 1X13A 3VO2A 4BECA 1CK4A 1N1GA 1FDIA 2R7MA 3BA6A 4O4LA 1HQYE 3LFHA 3FGZA 4OFXA 4Q9IA 1KETA 4FN4A 4CG2A 3PVCA 5DNEA 3RUHA 5BQXA 4UTRA 2CVQA 1LLQA 2PSSA 2J5KA 3ZDYB 5AVZA 3JV7A 4BIIA 3K9QO 3ZGZA 1J1IA 1OWNA 4BTVA 2XT6A 1W36D 3D6NB 1ZVKA 1OC4A 3TBKA 5CH3A 3K0CC 3TH5A 4BRSA 1GPH1 2EJVA 1NBMA 3PPWA 3X1YA 4KDFA 3ZU5A 4ZTBA 2JEOA 3EIHA 1ISJA 2QZSA 1KI6A 4YRQA 1LW6E 4NXMB 1WXGA 2RGNC 5I7WA 3WXBA 1UBEA 1R6XA 1N2SA 1OXKB 4X7MA 4Z2YA 4P5PA 1ESDA 4RAQA 3EFEA 2JGAA 4RY8A 1CNMA 1MEEA 3BJIC 3TO5A 4KIWA 2C42A 1URPA 1YB1A 2AOVA 2IUFA 4I14A 4Y2GA 4JS0A 4ERXA 5JCZA 3WGIA 3NZEA 3PFGA 3NBAA 1BX0A 2PL1A 1N4AA 1XN4A 4PQEA 3ZTYA 3JYQA 3OLXA 4WZAB 4FHGA 1HLDA 3G3EA 1DKUA 1PL6A 1N2HA 2NSLA 1XPJA 2D1TA 2OTCA 3IX7A 2AMFA 4IZ6A 2VDQB 1OZFA 3SE0A 1Z4QA 1V11A 4UQLA 4K8OA 4D4MA 3UMJA 4QOJA 1KC1A 3PJEA 4ZVTA 1C9EA 3G1WA 2HRQA 1UPFA 3WZ2A 4EABA 2QJRA 2WJAA 3Q7TA 1W581 1OUMA 2DKFA 2OOSA 1DG3A 3QVGB 2XVMA 4KXNA 4YN3A 4ZVUA 5SZJA 3V1LA 1RZVA 4NYJR 3IUYA 3F8TA 2CYCA 3HCPA 3OA0A 1XMVA 2I9PA 1ZJ5A 3VNQA 4DDUA 5EKDA 4UJ5A 4CHTA 3NIDB 2IUTA 3L77A 4IVNA 4LVNA 5ESXA 4BU1A 3EODA 4O33A 1NGSA 3R75A 4KC0A 3GEGA 2F1HA 2C7QA 4P3PA 1E58A 1QCYA 3BFPA 3LW7A 2EZUA 3A4YA 2OFFA 2P2YA 2NU6A 5AOVA 1TCCA 1YZKA 2XAAA 1Y8RB 2XOKD 5G4LA 4XD7A 2C4UA 4NNJA 5HA5A 1KAGA 1QR6A 2HMWA 4P7BA 1FFXB 3G8BA 3BC1A 3G2IA 3FYHA 3GHHA 4M89A 3ZKWB 2XW6A 5LBUA 4G2TA 3JQGA 3IAS6 3OJCA 4M0MA 5IDYA 4PHCA 1W88A 3CCFA 4BZWA 4IUDS 1N8NA 4EX6A 1B6RA 3EXAA 3DMTA 3G0HA 3EF1A 4RLQA 4G1CA 4W5HA 3HJHA 1UMBB 3CX3A 4UAVA 4AYXA 2RHWA 3O1HB 3O90A 1O0SA 2DFKB 3VHRA 2CKDA 1NLUA 1GSHA 4FM9A 4DHEA 2PWAA 3NBZC 1I1NA 1A5AB 5GADl 3PNMA 5BYBA 2YJ3A 4UM7A 1U0JA 2NN3C 2J87A 4NYJQ 1DIOB 1FP2A 1DUSA 5F73A 4PN3A 4ZYXA 2IA5A 1QQTA 3P8ZA 2K2QB 4EARA 1UJCA 4N0EA 3DFZA 4NDZA 1ZI8A 4U0JA 4CF7A 3QOXA 1QS0B 4IILA 4QDJA 2IBSA 4GGPA 2YXDA 4QWMA 4B32A 5JQGA 4BS9A 1D0IA 3ZVNA 3UK0A 3VA7A 2HXGA 1XLVA 2I2WA 3GRAA 3OQIA 3K2IA 1QQ5A 4IDDA 3KB2A 2IX3A 2NP6A 4LK3A 2HLPA 2O7RA 3EGOA 3UMCA 3WLNA 1X7YB 1L4UA 3H17A 2E4WA 2IYPA 4Z7OB 4GLFA 1JSLA 1TQ8A 3RYFB 4IXMA 2CE7A 3HWX1 5I7RA 4HCJA 2IYOA 2I4IA 1P81A 1DFHA 1GADO 3EHEA 3O4HA 2PM8A 5AKYA 3FNBA 3HABA 3VAZA 4YMUA 2LBPA 5BR1A 4KAXA 4OAPA 1QG0A 4M0KA 5JH7F 3KQLA 5J40A 2XUKA 1TA0A 1YMVA 3FGOA 1L4KA 2YW9A 4NOJA 1XZIA 1IVSA 3T3EA 2FUCA 3FUXA 2R6FA 4QTUB 3KFXA 1SXQA 3GA7A 3L0SA 4H1WA 5FT9A 5COQA 4EDHA 1XLUA 1D1PA 2XPCA 4KXYA 4W5JA 1K6EA 1SXHA 4YQEA 2DWQA 2G71A 4FYPA 4TQAA 3AUUA 2FR1A 3UOAB 2XSZA 4J7CA 1XKTA 4YRDA 4AROA 4QT0A 3V4FA 5IAJA 4F56A 4C3OB 1WG8A 3MTDA 1A76A 3QU5A 1JR6A 3IHKA 4R31A 1W0KA 3H05A 3HDJA 4QPDA 4YJ2F 5CVJA 3T9CA 4B3DA 1PW7A 4HDNB 4JLNA 1JA9A 2P5SA 3PD0A 5J58A 1T5DX 1V48A 3AEQB 5KQSA 4OGKA 1R16A 3UMFA 4GX2A 4O4LF 3PEFA 5EKTA 2IS4A 2E5WA 1CV2A 3QF4A 3SKXA 5E6SA 2IY8A 3QX7A 3WHPA 2W8BA 1L1QA 4XAQA 3NV7A 4H4CA 3NUZA 4BX3A 1EAMA 1JR3D 1Z0KA 2B30A 2NVOA 1DC7A 2YRXA 1I2MA 3CKKA 3M2PA 5JC1A 1WBBA 3I83A 1FU7A 2I3BA 2Q5CA 3USZA 1R27A 2F8SA 1WUYA 5TS3A 1WP9A 2WV7A 2QXYA 3LA6A 5AH0A 4NBSA 1MHTA 3U1TA 2P40A 1UOQA 1M5TA 1ECGA 2HO5A 3PUZA 3VAAA 4E6PA 1O89A 4JN6B 3WBJA 4MRAA 3OQPA 4QJ3A 2D5IA 5DIZA 1GPAA 1P1KA 1S7GA 3D3EA 4QBKA 4QJIA 4DPMA 4EDFA 4EUEA 2OB1A 3Q5DA 5H0IA 4BVHA 1E99A 3A28A 2PR7A 4P53A 3ACDA 1NNEA 2WPNA 3QVJA 2AUMA 5JS7A 3KEMA 1SVKA 1DDGA 3HBMA 3K71B 4JU8A 3BL5A 4V0MA 4CMGA 1Q7EA 3B5EA 5TS2A 4CKWB 4FP9A 4CKCB 2DERA 5CCEA 3IH5A 1RE1A 2VZEA 3II6X 1DKMA 3GLRA 3QEKA 1SVWA 1UUFA 2P8JA 3JY6A 3QMVA 3U4IA 4NCIA 1XD2A 2LXNA 1XUOA 5G0UA 4AJLA 1FUYB 4Q01A 1U0LA 3CVYA 3DDUA 3N2KB 3AZPA 2A0XA 3ZY6A 4HUJA 1H8HA 1CQWA 2H0AA 2B8NA 1DKNA 2BDUA 2HJGA 1TFRA 1HKHA 4BWVA 2FG5A 4IF4A 4R2HA 1NVVR 2EYUA 1RIIA 1ZGBA 2HPHA 3QKSA 2O5EA 5D8DA 4EB8A 1P4JA 1PWZA 3MCUA 1SC6A 1CUDA 3MOGA 5HEKA 3A6ZA 4DKXA 1DTEA 1TPZA 4X7RA 3RTEA 3ZXIA 4L07A 4B0OA 2I2XB 1EQUA 2JKVA 4YP9A 2VT7A 3I2IA 4IDGA 3R3HA 1ZHFA 4CR7A 4CIYA 1F1JA 5CLFA 4M1KA 1YI1A 1B8OA 4MUBA 1YB2A 2R6DA 4QQKA 2LKDA 1XQ9A 2ZDGA 3BK1A 3HCNA 2OMEA 3TLKA 5HXAA 3U7GA 4EA9A 2XUHA 2PY6A 3BZBA 4HWTA 5G3ZA 3HXKA 4CL2A 2VHYA 2X2OA 1KSJA 3E3AA 1NBOA 3MOIA 3OZWA 2YY6A 2K2WA 2WSLA 5ALJA 3WTCA 2NSHA 1R4NA 1P3DA 5HS6A 3RIYA 1BWQA 1J2JA 2VHZA 2IFTA 2Z1NA 4QGBA 4YT5A 1XRPA 2OCYC 4MWOA 5J4KA 3AV3A 1SA0B 4O02B 1UKCA 2P9GA 2PNFA 3V7WA 4A2WA 5KWJA 4RTRA 3NB0A 1B0PA 2NVUA 2CDRA 1ZH0A 2FY8A 4JMPA 1DADA 4AMGA 4DS3A 4LXQA 5ALUA 4ER0A 3G2NA 2X41A 1NI4B 2DBQA 4R1SA 4PLHA 5A4DA 1AKUA 4U6NA 3Q7QA 1NLYA 2QGNA 2CZCA 3D4BA 2IX9A 2O1SA 4FGJA 3HC7A 3ANTA 2JD0A 3KQPA 4HWGA 3T3MB 5HIAA 4PC7A 5BW5A 3AUFA 1YJAA 4MHSA 1RQ7A 4J4BA 1COZA 2WM3A 3R2JA 3A6DA 4JL5A 3WGYA 1QYVA 2FPOA 2OBNA 2AH5A 3D8RA 3PXCX 4MVJI 3L05A 1W34A 5AM3A 2F1JA 2QTRA 1T9BA 4WGGA 3W79A 2AWOA 2GPBA 1U8CB 2O6HA 2WG1A 1NONA 2OV3A 4QVKA 5MF6A 3GZNA 4C07A 1JSZA 3ZXSA 3EA5A 3AXSA 1LPNA 4ZEMA 1JQAA 1CB7A 1PFUA 4QARA 3QLEA 2BBSA 4ZDJA 3B6IA 2P4QA 1JQJC 3IIEA 4LDZA 2TMKA 3FKSD 4TTRA 1L3IA 4IDNA 4LJSA 2CK3A 3MQ4A 4BLUA 3CMCO 1GU0A 4MAFA 5DP2A 3T99A 5FDFA 2GETA 1BQEA 4DW8A 1XQ1A 4U3JA 1SG9A 4G5FA 4ZKEA 2VTEA 3LQ2A 4KQIA 3GRVA 1FTYA 3FWZA 1SVMA 5EY5B 1CERA 1VL1A 3FNGA 1N1DA 4LXTA 5JPIA 4NBUA 5BMVF 3QLVA 2OK8A 3IJ5A 5LM3A 3UJ6A 3ZYCA 3S7TA 4FNOA 1VP9A 1B16A 4AU1A 3JTEA 5A04A 4DAEA 1JI0A 5K20A 3V3TA 1N4DA 1PJAA 3A7EA 4KXUA 2WD7A 2JRCA 3GG2A 4O5AA 4RK5A 2BGRA 3RIEA 2DM6A 2MYUA 3ADCA 4JEIA 4XIJA 2CFOA 4ZMSA 1LB1B 1T4BA 4HG2A 1I30A 4U2EA 4IXNA 3VC7A 5JTTA 1Y6FA 3HVRA 3S70A 4JJ4A 1S4QA 3SX2A 5KYYB 1AY0A 3HB5X 5FYQA 2BFFB 1TM3E 5B7NA 2O5CA 4LMAA 5JCXA 2IU6A 4XOIA 4M9RA 2AN4A 1XRQA 2Q7XA 3QRWA 3DDNA 4Q3AA 4EGQA 1C3XA 1FK8A 5ELMA 3FDZB 1VPLA 2EKDA 2YC4C 3R6TA 4RQTA 1PQUA 3MWYW 3OFNA 4TT3D 3PNPA 4K0RA 3LD9A 4DLAA 1CR2A 1IH8A 3K31A 1WZIA 3E9CA 3OLCX 1X8XA 3PD1A 1ESCA 4S05A 1LCIA 4ZVQA 2WF7A 4JSYA 4V3CA 4E7PA 1IB6A 2DYKA 2PWPA 3E2MA 2I33A 4P83A 3TGWA 5KTMA 4E14A 1Z34A 4FMBB 1AMOA 1K66A 2YJ5A 5GJBA 2ZSDA 2JFXA 5K2MA 3UJ8A 1T2EA 1DJPA 4UMEA 3WMFA 4G0VA 2JARA 3IA7A 1GZHB 2YFYA 4PQYA 3HFJA 4CKEA 3RK4A 1MGPA 1DXYA 1ZH4A 2E49A 1Y34E 1TCVA 3ENNA 3I73A 3OCUA 4YNBA 2M6RA 1FS6A 1DO0A 1MOPA 3LT4A 3ZUPA 3QJ5A 3GNQA 4KPFC 3V32A 2EVWX 2BFAA 3OTHA 4CT4B 1LUAA 4GX1A 2R2GA 4W5RA 2XDQA 4H35A 4WNCA 3O3NB 3W5CA 1IBSA 3CLTD 2R1VB 2R1VA 3B38A 3L79A 4II3A 3B2QA 3DDOA 3ZLTA 3CT4A 1ZLXA 4Y2SA 2A33A 3EA0A 3IVAA 1D7AA 4WCDA 4EY5A 3A25A 2MT9A 2VJQA 1AURA 4B3JA 1BS2A 3Q2IA 3USES 1KY2A 5FUBA 4IXTA 1SXJD 1KO1A 3A36A 4GC5A 3W5VA 4J49A 1L7EA 1Y4ZA 5J9FA 3JWHA 1VTKA 3KO8A 4I2NA 5DTQA 4A8JB 4CKEB 1JBEA 1FJGB 4ENTA 4GXRA 5CBKA 2BHRA 3DHEA 1ZUD1 1EQ2A 3QVSA 1ZSNA 4CW7A 1HWYA 2EW1A 1GXSB 3FF1A 1IPEA 3PWSA 4CQNA 1RKBA 2YOFA 1WIWA 2ZRPA 2NTNA 4HBGA 3ZUGA 5E4YA 4KITB 3KAPA 1Z73A 2PKEA 4LRXA 5EE9A 4MULA 1DT5A 5HFJA 3RBVA 2W6ZA 4A0QA 5KYWB 3Q72A 5H82A 5CVVA 2YJTD 3HY6A 3RS0A 1VFNA 1T4CB 4P6VF 2Q45A 3T1VA 3MERA 3P9QA 3PRKE 2QI9F 4IEIA 4W8GA 3ZVKA 4IJQA 2ECPA 1NP3A 1PJ3A 1AMUA 2J8ZA 1AKEA 2BFFA 3L01A 3VSCA 4HNUA 5KYYA 1D2HA 4ZQGA 4M46A 5EMHA 1XZGA 3EH2A 1ES9A 3FPGA 2Z98A 3SQWA 5LSAA 1MC5A 3KJFA 3OP1A 3URKA 1A8HA 3ZX5A 4KMOA 4DANA 1UT6A 1ZKDA 1ZD1A 4FE4A 5FADA 3BPSA 1L5GB 3O38A 5IG2A 2VJPA 2OV1A 3OY2A 1X80A 1AV6A 2JJQA 2OAGA 3MXTA 2WTUA 1GG9A 1Z08A 1A88A 4I36A 1N6RA 3E9RA 5GJVC 4B81A 5IT5A 5JRJA 1NF2A 1U8XX 4RL6A 3K9FC 1TK2A 4AMBA 3IESA 1EGVB 3AOGA 1E2GA 4G1UC 4M9UA 1WCIB 3CH4B 2AI2A 2ILVA 1EXWA 2CNOA 4X3PA 3ZK9A 4B8ZA 3FYUA 4NCAA 1IK4A 2WT9A 2BONA 1KKUA 1EIZA 2FXVA 3CUTA 3MBIA 1WL8A 1ZK0A 2NUPA 4G26A 3OEEA 3UUWA 4QVIA 1L1EA 3GFVA 3KOZA 4OSPA 3RKUA 2I0FA 3OOYA 1T1GA 4A1OA 4XWAA 1HOXA 1K98A 1L0BA 1YUMA 3FZYA 4TXNA 3VXKA 1PEAA 2QRGA 3P0RA 2XDQB 3HM2A 3AI3A 1MJGA 2F9FA 2NXEA 4O8ZA 3SNKA 1OVMA 3SK0A 3CXUA 3VKUA 2DSNA 3K20A 4KXLA 3AM5A 1JYSA 1RBQA 5LUAA 2DWOA 4UHDA 5KSPA 3UXYA 1M8KA 2Q4OA 4DR7B 4OHCA 4TYMA 4QWWA 3BHMA 4RADA 1U2GA 1V1JA 2HA5A 5CT4A 1BVRA 5JD5A 2FYTA 4JODA 3AFMA 2R25B 4BHTA 3MMSA 4CCYA 2Z6AA 3LYUA 2YWBA 4Q7JB 4G0XA 3SBEA 3ZV3A 1VKNA 1U0TA 2BAGA 4D6PA 1DOAA 5B57C 2PV0A 2XYVA 3GUHA 5CFZA 5EVJA 3U39A 3RHFA 3QWFA 2FPXA 1NQVA 3W90A 3A2LA 5L4SA 2D2EA 1K7FB 2CNKA 3QPWA 4V0OA 3BDVA 4IH4A 4MPPA 4YFVA 4ZEOA 4C7BA 2C4WA 4ZQIA 2KBFA 3KEQA 1GCAA 4MTLA 4QDZA 4MEAA 3GD5A 5ETJA 2A9PA 1A77A 2J6BA 2P9TA 5F1KA 5A9SB 1MC8A 3NDPA 2ZT7A 1GG8A 1O87A 2X13A 5JSZB 2OCAA 2CBZA 1T13A 5JNTA 5KYKA 3M49A 4I5GA 3UJPA 1ILEA 3PNKA 2VVTA 2ESRA 2R8PA 1E6EA 3ETEA 1Y3CE 4OHRA 1QK5A 1XVIA 1X87A 4B5LA 1I33A 4HWRA 5H3LA 1GUAA 1JE1A 1Q0UA 2RHLA 3KJEA 1QPZA 1EFKA 3OEHD 3DXYA 3J81A 2WD7B 4HOYA 4X7BA 5KJCA 1Y81A 4P8RA 4TTSA 1I3KA 2G7MC 3LE8A 1II0A 3K7EA 3P9PA 3SAJA 3W0LB 4A3SA 4UFPA 4AJHA 1Y4AE 1Q1GA 2AZXA 3HU2A 2A78A 1QONA 1I3CA 2X5XA 1XD8A 5ALWA 4LNAA 1NRWA 1CJBA 2FCAA 1QRAA 1R6DA 2XOEA 3SKVA 1P73A 2AN1A 3H9QA 2PPVA 3G8AA 4PINA 2XUGA 3AU9A 3WA7A 3CF6R 4PC1A 2C4NA 5AK6A 1V26A 1SR8A 1OJLA 3IVGA 4FYMA 5CEFA 3EHDA 3CNOA 4DJJA 4RKRA 2P78A 4AW9A 2VHXA 2Y66A 5KNLA 3MLAA 2ZRAA 1A2BA 1T3LA 2N1BA 2X8JA 2X0IA 1GQ2A 2EW2A 3A4LA 1UPAA 3DMGA 3CS3A 4Q5IA 1MV5A 3GZNB 4N5HX 4BNJA 1R10A 5ESDA 3B1WA 1UKBA 1VJ1A 1X0VA 1HTBA 5I4BA 1G60A 3VZRA 3IUMA 4ED9A 3ZVMA 3DLAA 4LF4B 3WNCA 3AKDA 1TEVA 4MVJD 3PQ6A 4G4SP 1EGMB 1GRCA 3ZW8A 4B3TB 1QXSA 3MT9A 2J31A 5A1TA 2VYFA 4PXYA 3CRW1 3LKZA 3A1UA 3LQ4A 4DCUA 5FB3A 1GKUB 5EEGA 4I81A 1I6LA 1IWBB 3EDOA 3PDHA 1NBAA 4OQMA 1CUCA 2ZKIA 3U60B 4OX9Y 3LPDA 4TS9A 4A0RA 3T3IA 1ZRHA 1UBLS 2RFLA 2Q5LA 3SHTA 4JI7B 1ECCA 3C2QA 5TX7A 3S2UA 3DBLA 1SEPA 1EUDA 1THGA 2P9CA 3OPYI 3REQA 2QT0A 2VJKA 2ODEA 1F2UB 1G7RA 3AWDA 3WKEA 4DUPA 5JHGB 2DWCA 2GLUA 2Q8NA 5DTRA 1ILWA 1FXSA 1EM6A 3Q8XB 5I5EA 4ZEXA 1SKBA 1C8LA 1JVBA 2Y71A 1WVIA 3JX9A 3K1JA 4JFRA 1A5BB 1IU9A 1OROA 3PHBE 3MWLA 2AE1A 1E1YA 2QP4A 4GKVA 2VWQA 4MUGA 4CVNA 2I22A 2VDKB 4Q3LA 3T5CA 3I9JA 5BSGA 9LDBA 5E4FA 5KTNA 1VJTA 3KETA 3JD2A 5T6BA 1ZISA 2Z2YA 2O3TA 2QS9A 3EZGA 3K8OE 3U6BA 2VDNB 2XNSA 3RT9A 5I01A 4EHNA 2W6NA 1Q92A 3NFYA 4B6JA 1OX6A 1UJ4A 1X86B 4DNOA 3ZGXA 2H29A 1K27A 4X5OA 3K35A 4Q7QA 1H9BA 1OI7A 1F0PA 2ZI6A 4ZOAA 2OGUA 1DTWA 1BDHA 1GP2A 4IAOA 2VZ0A 2CVFA 4IDEA 4ZAFA 5L45A 5LJIA 2F3UA 1JMYA 5HFNA 4LC1A 3D7LA 2BYTA 1B93A 1O7JA 2X0KA 1MHPA 2VXBA 3OT1B 2WYWA 5J4LA 3V80A 3G2KA 2PH1A 3IDOA 3L8YA 1JR4A 3E27A 3Q6NA 4G97A 3CU5A 1Z83A 1JDBB 3DQPA 3OZXA 2ZWIA 4CEJB 1I7NA 1RI5A 4JBLA 2W2PA 3D7SA 4N1AA 1LZKA 2X4DA 2XLBA 3JZAA 4PBSA 3EPHA 4AKGA 2ACVA 3I1JA 1YBMA 3BBPA 5L6LB 1TX4B 3DF9A 1QH1A 3KL2A 4CTNA 1XT6A 2Z30A 4PO3X 2WF9A 5F3DA 1KBQA 2VWHA 5JNWA 3M9LA 1NVEA 2IEYA 4TWAA 4JI4B 2O0HA 5JQGB 4CKWA 3JZDA 3GQBA 1Z25A 1GNQA 1ONSA 2CXTA 2PRKA 2HPVA 2VI5A 3DTTA 4MYCA 4BN5A 4EI8A 5CB4F 1HDXA 3UHJA 1J2UA 5KQMA 2NV6A 5AJZA 4BATA 5ICEA 4E6EA 5ALQA 1IC6A 4XDYA 2WTMA 2Q9BA 2I6QA 3C8UA 9ATCA 1KFJB 3C5WP 4WLFA 2QIPA 2GPNA 3L6UA 1JPNA 4V0ME 1BVYF 3QVLA 4MKXA 5IYZF 1MIHA 1U7TA 3PUVA 3ROEA 2PX6A 1B73A 4LVOA 1BOFA 1ZGJA 3KYCA 2G08A 3C7CB 3GJXC 3U4HA 4RXTA 2ASVA 3WLSA 2J4FA 3DO6A 4BB9A 2OR3A 1L8LA 2HK8A 4HTAA 4LYDA 1ZUHA 3HCRA 3NYRA 4OLHA 2GN2A 5IBPA 4PSAA 2NX2A 3PDUA 1UDAA 3ZZ0A 3KQOA 4RMJA 1C7IA 4KFUA 4YP5A 1X38A 1BX1A 2VJMB 5CG2A 3FI9A 3QI2A 3UC5A 3HB9A 4NE9A 1M0WA 4EPTA 1PJCA 1NJGA 5HIMA 4X62B 1FFXA 2E55A 3LUHA 2VHUA 2ECKA 1RSZA 4XIYA 4CMJA 1P62B 1L7BA 4GPTA 4LWPA 4EG1A 1C0IA 1Y8RA 1Q0RA 3EWSA 4M7WA 3ROFA 3B1KA 4R1TA 5DIFA 3IAXA 1HETA 1HLFA 5AVXA 3DCYA 4CQMD 5CLJA 1NFQA 2Q5QA 2YUIA 2WYUA 2C8LA 2WF8A 4FDLA 3I34X 3UICA 4U7HA 1RJWA 2I7DA 3OZVA 3KQHA 2G67A 4D9FA 3PX3A 1J06A 3E15A 4I50F 4P4SA 5FJIA 2QQGA 2JW5A 5CIWA 3MFYA 5AM4A 3WDSA 3PYMA 1B15A 1QGUA 2ALJA 3GEPA 3DZFA 3HADA 2ZT5A 4YREA 3QVGA 2FRDC 4X97A 4A10A 1UR5A 2H8KA 2WWYA 1TRKA 5LB4A 3MD9A 4UCWA 5JXWA 4PYLA 2Y1KA 3O8RA 4R3WA 4PSVA 1HT1E 3WL3A 2ORWA 3TVDA 1KOLA 2RGUA 1VHWA 2JLAA 4BVGA 4ZQEA 3KUCA 5DLPA 3MIZA 1ORRA 3ED5A 4ZCPA 4G84A 1Y3BE 1IEWA 1G16A 1P4SA 3EUAA 3ZEAA 3QG5A 4FEAA 4ITVA 4RD1A 1HY3A 5E0OA 2LNDA 4JUFA 2QMUA 1IWPB 4V02A 3PCXA 3V7YA 3WKBA 3RYFA 5KJEA 3F2VA 4TLAA 1N2CA 1WHTB