1H66A

Crystal structure of human nad[p]h-quinone oxidoreductase co with 2,5-diaziridinyl-3-hydroxyl-6-methyl-1,4-benzoquinone
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
273
structure length
273
Chain Sequence
b'AGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H DEHYDROGENASE [QUINONE] 1
publication title Structure-Based Development of Anticancer Drugs: Complexes of Nad(P)H:Quinone Oxidoreductase 1 with Chemotherapeutic Quinones
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 86
structure length 273
sequence length 273
chains with identical sequence B, C, D
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2001-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1h66A00
4ZVMA 4QOGA 3W78A 5F12A 3TE7A 3QFRA 1YOBA 1WSWA 1AKUA 1TLLA 1D4AA 3GAMA 3K1YA 1YCFA 4GR9A 1TIKA 3O73A 2BPOA 3LCMA 3GFSA 4QOJA 3HLYA 2V5VA 4OXXA 2ZKIA 4XDHA 3TZBA 4YAOA 3NHFA 4H6PA 3S2YA 4QOFA 4ICIA 1DXOA 3N39C 1H69A 1VMEA 4LTDA 1RTTA 3L9XA 3KEGA 2OHHA 2FX2A 3NLLA 5LBTA 1YCGA 3U7RA 3NHRA 1AKQA 1H66A 2AMJA 1ZX1A 3KAPA 4DILA 1T5BA 4Y9UA 2BZSA 4NLLA 5LJIA 1CZNA 3K20A 2X2OA 3NHSA 4U7GA 2QX9A 5LLDA 5LBUA 3W79A 1KBOA 3UXEA 3ESYA 2RG1A 1DX9A 4C76A 4GI5A 4Y9RA 4N9QA 2OYSA 3NFRA 4BMOB 1FLAA 3ZHOA 1RLJA 2HNAA 3OWXA 4H2DA 3R6WA 3NHKA 3L9WA 1C7EA 3O2NA 1CZOA 2F1OA 2Q9UA 3EYWA 2XODA 4YAFA 2FOXA 1BU5A 5EA2A 3G5MA 4J8PA 1GG5A 3KLBA 4NULA 1SG0A 2A5LA 3B6MA 3LT5A 3ESZA 2Q62A 2KQUA 1FLNA 3NHWA 4DIKA 3F2VA 1QR2A 5EAIA 3OX3A 1CZHA 3N3AC 4C14A 2Z9BA 1ZWKA 2B3DA 2D5IA 5LMCA 3OVMA 1KBQA 4CETA 2MWMA 2MT9A 4R81A 5A4KA 2Z98A 2FCRA 4LAFA 1J9GA 4ZVLA 1OFVA 2MOKA 2QX4A 5NULA 3FVWA 3NHUA 4FGLA 1AZLA 5TGZA 1FTGA 3NHJA 4LTMA 2HPVA 4S24A 6NULA 1XT6A 2QX6A 5EMNA 4XDGA 3B6IA 1J9EA 3F6RA 3NHLA 4QOHA 1B1CA 1QHEA 2MTBA 2W5UA 4FX2A 4PTZA 4Y7CA 3OWHA 3OJWA 4F8YA 2R96A 3NHYA 3QE2A 3OJXA 5LJLA 1YKGA 3B6JA 4FGJA 5NLLA 4BMPB 5FA6A 4DY4A 4PU0A 3ESXA 3FNIA 1OBOA 1AKTA 5F4BA 4ZVNA 1CZUA 2OHJA 5LVAA 2Z9DA 4GQIA 3OX1A 1AKVA 3UXHA 4C0XA 4D02A 1FVXA 2HNBA 3FW1A 3RPEA 4YQEA 5B3LA 1F4PA 2BMVA 2WC1A 1DXQA 4N82A 2Z9CA 4CF6A 2M6SA 2V5UA 2QX8A 3ES9A 1J9ZA 1I1OA 5JROA 4N65A 1BVYF 1AKRA 3W77A 2FDXA 3W7AA 4U7FA 1SQSA 2GSWA 2QR2A 5ULLA 2OHIA 3F6SA 3P0RA 3GFRA 4U7HA 1CZLA 2QMYA 3NHPA 3FX2A 1X77A 2BF4A 1V4BA 2ARKA 1D04A 1ZWLA 3KAQA 3OX2A 1E5DA 3B6KA 1CZRA 3JSXA 1T0IA 4YALA 3QFCA 2BN4A 3EDOA 1JA0A 2FLVA 5F51A 2R97A 4M0CA 3FJOA 3U7IA 5FX2A 4YAUA 1C7FA 1J8QA 1NNI1 1AKWA 1AG9A 1RLIA 4QOIA 4QOEA 2FAXA 2FVXA 1JA1A 5B3KA 1QBGA 3D7NA 1CZKA 2X2PA 1QRDA 1FUEA 2V9CA 3GFQA 4HEQA 3HA2A 2N1MA 2FZ5A 5BUCA 1AMOA 4ZVKA 4FGKA 1XYVA 1FLVA 1AHNA 4QODA 2XOEA 4HS4A 1YRHA 3TEMA 1YCHA 1YDGA 3N3BC 4LA4A 4C0WA 3F90A 1D03A 4ESEA 2M6RA 2KLBA 2QWXA 2FZVA 4PTYA 1RCFA 1XYYA 3SVLA 1FX1A 3HR4A 1FLDA 1OBVA 4LTNA 5FUQA 1XI2A 1WSBA 2QMZA 4YAWA
chains in the Genus database with same CATH superfamily
5GWXA 3QMWA 4RPJA 2JJ2A 4RNCA 2ZAGA 3WL8A 3STYA 3MUNA 4XARA 3R0IA 2V3WA 1IHOA 3T4XA 1KQPA 2G9ZA 3PPWA 1E6UA 4P6VF 2WABA 1RC8A 3HB9A 2ZB3A 1GHTA 4R83A 3H11B 4DFDA 2WUVA 2WJ3A 3AOGA 3Q7IA 1F8UA 1C1DB 3QG1A 3KETA 2AXNA 5EE1A 2IS1A 4LUCA 2ZB2A 1DQNA 1Z26A 3G1TA 4E2YA 1OZ0A 5FTMA 5KTPA 3CNLA 3I0ZA 4E13A 2WVAA 4RXTA 2HRDA 1D4AA 3ND7A 1R37A 2AUTA 4XFDA 4CM3A 2PUEA 1PBNA 2OGSA 4K8RB 4MLZA 1U9IC 2CW5A 1RWQA 3N2KA 3WLHA 4C7MA 5JCXA 3BWVA 4CEJA 4CZ2A 4DJAA 5CCDA 3I5UA 1T5LA 2V5VA 4MAMA 1M2WA 1FXSA 2CHVA 3W8NA 4RHYA 1JXQA 4W5RA 4H35A 1PT9A 4Q12A 1PL8A 3L4BA 4BE4A 3QRWA 1ABEA 4CR6A 1XRPA 2DSNA 2OCAA 4ANFA 4Q4AA 5JUWA 1V1MA 2OVBA 4OYHA 3ZTTA 4DSNA 4HWPA 1OTYA 2BM1A 4DNFA 1CQPA 1N2EA 3D3JA 2GLXA 2ACWA 2ZBGA 3D54D 5AW4A 3NOOA 1E9FA 3MT0A 1XPRA 2FRDA 3GA7A 3HP7A 3OIWA 4HRXA 3GPCA 1PNRA 3TM5A 4GGMX 2VDJA 4LWPA 5TEVA 3L9XA 3TSZA 3OQBA 4RZIA 4FCTA 5EIXA 3NDBB 1N2ZA 2BFOA 4B73A 1IY2A 5KX5A 3EIQA 2IW1A 2HMVA 2OWEA 3G0CA 2AR9A 2LCIA 1J2JA 3WJ2A 4Y6QA 1ZGGA 4ND7A 1Q0RA 4MWBA 5EIHA 5B1YA 1DDGA 1FS4A 2AJTA 3DKIA 1B76A 4PPYA 1TKRA 4KLRA 1TEXA 4M76B 4NBWA 4TTPA 4WX2B 4E3WA 5EXXA 5I9SA 1T29A 3GCZA 3IKVA 4YRGA 2CF6A 2XA1A 3N2KB 4BLVA 4CEJB 3OCYA 4YJGA 2EW2A 3GI1A 3TVTA 2C5HA 2CJYA 1ATIA 5H4GA 4YRNA 3ZDBA 3C7CB 1C2TA 1L5MA 4NBRA 3W4IA 1WUTA 1WXIA 3NHSA 4ECEA 3DGFC 3B53X 4B5KA 3SQOA 3AUFA 4X5OA 1U0EA 4PINA 1R4NB 3JRXA 4YQYA 4DIOA 4F6LA 2CLMB 1KI1A 1ZGJA 1ADGA 1V1MB 4FDTA 5A7HA 3U9LA 5KYKA 1KEKA 1QX4A 2YY5A 1DJOA 3AFGA 2I65A 3QUAA 4URFA 3W79A 4B6JA 1KBOA 1AF7A 3CW9A 1JHUA 4K9PA 2E55A 3EMBA 5BSMA 2FZKA 3WRXA 3EGWA 4YRTA 4EG4A 4KYVA 2YUIA 5BR1A 4LOAA 4PVDA 2G25A 5B55A 3PEUA 5IU6A 2NPIA 2H1OA 2QM7A 4YQFA 4L8GA 5LL6P 4LBVA 4BMNA 3MTBA 4QELA 1OASA 4KHPB 3LS2A 1A5SB 4M54A 1JFFA 3RNLA 2QSUA 3ASZA 3MJVA 2R6HA 4AROA 3QV2A 1DAEA 1U8TA 4JS0A 2W4QA 3AU9A 3V2UA 4NG5A 4QDTA 3CIOA 3U3XA 3FRHA 5DBGA 4XYGA 3FAZA 3OZWA 3DXZA 3CW8X 3JD1A 4AP6A 1U7DA 1W0KA 4KNYA 3KR2A 3TTYA 2CWDA 2FPWA 3GPIA 4O4JF 2XODA 5DNWA 1FJ2A 3GJ8A 2AN3A 2HLNA 2J30A 4FR5A 2BGNA 3H5IA 4E0BA 3HB1A 4Q01A 5A9RA 3Q3VA 2CK3D 1KFBB 1TO2E 1K5GA 2QM3A 1XZLA 4AF7A 4JUFA 2BH2A 4B3CA 1GR1A 3T8YA 3M4YA 3QKSA 4C4OA 1SEVA 2O52A 4Q47A 3PQEA 1LNQA 4FX5A 2XQVA 1UC4B 5K4AA 1N3YA 3OCVA 4MV8A 4BFLA 4UD6A 4DUGD 4EM6A 4FLMA 4AUKA 4B3DA 4IOJA 1GPJA 4XAQA 1FBNA 1CW2B 3JSAA 2G9VA 3F2VA 5AW7A 3MIZA 1Z8FA 5FWNA 4D74A 3U1BA 3FTPA 2Y2UA 1V11A 2EX1A 3QPWA 3NVMB 4KFTA 3AR2A 4OHPA 2DUUA 5CDYA 2RAPA 3HUTA 1GA1A 1QG0A 1VMIA 3QVWA 4I55A 4E03A 4UU7A 1LW7A 5BV0A 5C8XA 2N46A 5AW8A 1BSVA 2XD9A 4WL0A 4Y6LA 3FNBA 2ODEA 2EARA 1P4AA 3EA5A 1SEPA 1NI5A 1TD9A 3KT0A 4FHFA 2JJ1D 3L3BA 3FTQA 1DO2A 1BX0A 1PNOA 3QUCA 5FWXA 1DXYA 4AX8A 4PONA 3ELYA 1HDIA 4LJ5A 1HT2E 3PZBA 4Q1VA 3WYGA 5KJ1A 3WQQA 2QTBA 1MA3A 1YH3A 1RLUA 3L8GA 5HRCA 1HKUA 4WCFA 1EVYA 3LXUX 5L7YA 3LGAA 5MN4A 5LNK1 2P35A 1CJCA 2O2DA 3UMSA 3H84A 2E37A 3DBVO 3I73A 4M86A 1WCIA 2OV2A 4ZDWA 3RWMB 2XVMA 1G8SA 2Q7OE 2VJCA 5J2TF 3W5SA 4BO1A 5GTDA 1BG6A 3QKSB 1BO6A 1LC3A 2XAAA 1QQ6A 2BR4A 4XWWA 2MOKA 2I2WA 1LW6E 2QX4A 4KBYA 4M1KA 2NYVA 1ZOLA 3KQYA 5FRDA 1YZHA 1XTQA 4O2BF 1TYZA 4DQLA 1DTEA 1ZN8A 1XTUA 3A7EA 1XDZA 1NKVA 3JQAD 1QZ3A 3WYBA 4REMA 1STOA 3Q7SA 3FSGA 1E1RD 4ID9A 4V0LA 3ZWOA 4EPTA 5JAPA 3CH7A 3CVUA 2NP6A 1D0IA 2BTQA 2P9YA 3OJOA 4N5MA 4MUKA 4X61A 3LBFA 4RD4A 5CB6A 3SKXA 5EE5B 1MQ9A 5I7HA 1OH6A 4JJGA 3GNLA 3QLVC 3SQDA 4H7PA 1WQ3A 1KMHA 2LV8A 3CIFA 3VJMA 3WNBA 4RGBA 2DQZA 5DTMA 1AGYA 3U4IA 4NFYA 1XN1A 2ZJAA 4GLLA 3VYWA 3W2GA 4U00A 2UDPA 1TF7A 1XMIA 3CR3C 3Q15C 4NS1A 2YC2C 4XH9B 1H6BA 2TMKA 5CLQA 4KMSA 1N2HA 1MPXA 1P77A 1WCIB 2D4HA 2DWUA 4IIVA 4Z9AA 1DO8A 3HGTA 2IV7A 1JJFA 1PFUA 2OZLB 4TN5A 2HQBA 2ZETA 4OHBA 4WCVA 2ASVA 2BKLA 2RONA 4EW6A 1IK6A 1ADFA 4TVKA 4GPBA 4KIFA 1FDTA 4KOEC 2PR7A 1GLNA 3L0YA 4GSKA 1Y4DE 1X13A 1ORRA 4OHZA 3OZGA 1Z0SA 5L4LA 3KZMA 4ZAXA 3QE2A 1EFLA 1EGHA 1M6WA 1Z5OA 4OB8A 4DQUA 5K09A 1P0FA 2HADA 1XKTA 3BILA 3LV8A 4XVHA 3U3ZA 2CY0A 5CVCA 1XDWA 1OZHA 1GTJ1 1Z4OA 3DE1X 3N75A 3MJDA 4FGJA 4N6OA 5EERA 4KYIB 3WLFA 2XMDA 3IIEA 2KPOA 2BTQB 3E9ZA 5KKAA 1FS6A 4ISBA 2A33A 5KQRA 3LPLA 1Z16A 2Y27A 3GO4A 1PVDA 1MV5A 3LI2A 4XWTA 5ELXA 1Z4QA 1KMHB 2YJNA 4YLGA 4EZBA 1FZTA 1OXVA 2GZAA 3C5HA 3ENKA 3OLZA 1SC4A 3FVRA 1G2PA 3JYHA 4CUJA 4EW2A 4N3AA 1KRHA 5JXWA 2OZVA 2WW8A 3LP8A 4D80A 5HUHA 1YU6A 3Q5GA 5F7XA 5L40A 2QU7A 1G4HA 2CLSA 4JASB 2XD4A 3MHPA 4D9BA 1QO7A 3FHJA 1XXLA 3IRUA 4AG5A 2BR5A 3IIMA 4V0OA 1EG2A 1TIPA 3AEKA 3UXHA 4CNQA 1U3TA 1BFDA 1H0SA 2NUAA 2WJWA 3IPAA 1ISHA 1BKYA 4XIIA 4ZEXA 4AZWA 4BZWA 3ZKWA 1U8AA 2X0IA 4MKFA 2VTVA 3PHLA 1M2HA 2XMCA 1HMYA 1R12A 2ZIAA 3WWDA 1JR3A 1RXYA 3OZRA 1GQOA 4LOLA 3TQTA 3EEOA 4LXYA 2CJXA 3KE9A 1ZUNA 2GJAA 4IGFA 4JL6A 4A8PA 3TD2A 1Z15A 1EMDA 1LSOA 3PFIA 3ZIAA 2P5YA 1DXQA 4N82A 2PFGA 3WFZA 3UJ9A 2IDJA 1ZUD1 4GGPA 4G1BA 5KVQA 4N12A 1J9ZA 1I1OA 3V4RA 1U2QA 2BLNA 1ABFA 4KXUA 4M2LA 1DAHA 2JW5A 3VR4D 1AKRA 3KBOA 2IP2A 1OFHA 1QIFA 2Z4SA 3PVCA 3N58A 5JZ9A 1P1JA 3KM0A 2E3JA 2ZSEA 3I3OA 4DR4B 1OKKA 5JAOA 5BO5A 2P0AA 4PLVA 2VPTA 2NT4A 1YDWA 2WNSA 4KQJA 4LDQA 1Q12A 5JMPA 4LKOA 3TX6A 3VR4A 5EIEA 1OFUX 4N5HX 3HWSA 3ABIA 3O8DA 1R8QA 2ZT6A 3IPLA 1E2PA 3K9GA 5KHAA 2JEYA 3ZWBA 4AUMA 3E3AA 3GN1A 4WZAA 3E82A 3GFRA 3L0SA 3QFSA 3QU5A 1CZLA 2NWQA 4YACA 1JXMA 3SN6A 3NHPA 4EHNA 5KYNA 3AEKB 1TUEA 4MWSA 4RKFA 3U4GA 1X9IA 4QM6A 4M8KA 1CE8A 1KP3A 1MVLA 1Z6GA 3WWOA 2HL6A 4N7BA 2QPLA 2PGJA 3AIKA 4W7HA 4QFMA 3JYLA 5IJ9A 4C4RA 1N5RA 3A6JA 3EWIA 3OFSA 5KNCH 1XTPA 1JYSA 5B6PA 4BIIA 4PCLA 4ZHQF 5I7FA 3K35A 1EKXA 1RZRD 2I22A 2HU2A 2X13A 3UANA 3U62A 1IN1A 2Y1WA 1KQGA 1LK7A 1OGYA 3D6TB 1KVUA 5DBOA 5G4LA 5F7OA 3JXEA 2OMEA 1K0UA 1E5DA 1MDBA 2ZRIA 5JIBA 4QYMA 3B6KA 2XT6A 2GARA 4Q7KA 2VEDA 1DZIA 1FOEB 3B5JA 5H0IA 2J0SA 1SKYB 3B2NA 1XHLA 3F46A 2QD2A 1W76A 2ZT7A 4K9OA 4TM7A 1DUVG 2JVKA 3M83A 1U6KA 2RGCA 1QVRA 4U2BA 2P9TA 3ZI0A 2I6UA 3ZBQA 2GD6A 1VE9A 4HNTA 1Z5VA 2P91A 1AX9A 1P0PA 2BUBA 2OGUA 4M0UA 3ZDYB 1KRWA 2GZ2A 1I94B 1MB2A 4TXMA 3GG2A 2AW5A 1CVRA 1RCTE 4U7WA 3SCZA 5H3HA 1A97A 5IC5A 4JOSA 4WZAB 5ED0A 1DFGA 2F90A 3D2BA 3U9SA 1DADA 4J0HA 1K8ZB 4DAOA 3RAEC 1JZSA 1U2SA 2JIZA 3LVFO 3UW3A 3ZW7A 1RW4A 5AOVA 3TGWA 3NBFA 1CE8B 3P9QA 3MVEA 3HABA 4FLFA 2XRYA 2A1TR 2F1JA 1D6JA 4WACA 2YH2A 5IJ9B 4RLFA 4UTPA 5H70A 1B6GA 3GW8A 1IVYA 3AHDA 2J07A 1COWD 2YDYA 4L2IA 1WHTA 1UXIA 4MDYA 2WDPA 1ZOIA 2J0QA 1VHJA 4LSZA 4DMGA 2CN1A 1WM1A 1FUIA 5AXAA 3WWEA 3SZOA 3WYNA 1SXIA 2GERA 5FUYA 5I48A 3G68A 2P4QA 3GD5A 1YONA 3O8NA 2WPNA 3IKMB 1MORA 4N7RA 4HLUA 1A95A 1SA0A 2OLKA 3HA2A 4OQDA 3WP1B 3Q7EA 4BFYA 1EUYA 2GESA 2OA0A 3IO3A 2JNWA 4MOWA 4RVUA 4WK0B 1UEIA 3DBHB 3A1UA 1EVLA 4MKXA 2HFKA 4FGKA 4OL0A 2Y0PA 1PGQA 2HJSA 3NEYA 1IG3A 5FBWB 5JALA 2HHLA 1KHTA 1AHNA 2IXAA 3PDJA 4OK6A 4OO3A 2UYHA 2I62A 3A4YA 2J3EA 4C4XA 4EHIA 2CL7X 4L5IA 3O0DA 1L7NA 4TTIA 1JHOA 1R6AA 1XCGB 1R0SA 3LUFA 4HS4A 1HLFA 2I6FA 4QU8A 4X7BA 5CPBA 4DV2B 4ZI2A 4EHLA 1Z29A 4TZKA 4X54A 4MEAA 4MYCA 3WV4A 2JZCA 4EFDA 5ICGA 4ZVQA 2GZHA 3F7OA 4HN4B 4ENPA 1JUDA 1NRJB 1XMXA 2IYLD 3AIIA 4YR9A 3VTAA 3FUTA 3I6IA 3RU3A 1J23A 3KHTA 3IEKA 1BZYA 1DX6A 1OGIA 2O8BA 1CY6A 3ANMA 3MTGA 3R3VA 4R8VA 4AMVA 3RASA 4G37A 4B3BA 5JANA 1V3UA 1X1DA 2KLBA 4L2IB 3HLTA 4OJNA 3PT5A 5IKEA 4EG8A 2PA0A 2AHOA 2VDPB 3LF2A 4L5AA 3ELUA 4OSEA 1KI7A 3CGWA 4S0ZA 1QZXA 5I7AA 4CIVA 1BDIA 2I1WA 3OKAA 1HDEA 3JWGA 4UCWA 4XWOA 4ZYYA 1RT9A 2FA9A 4HS9A 1PGOA 1S7CA 4ZYVA 4R1PA 1LLCA 1YMQA 1ZMOA 1MJHA 4J2OA 4MPRA 4X6UA 3Q98A 4C22A 3EASA 1YL5A 4X20A 4RCZA 1UFRA 2RG7A 3DH0A 3J81k 3F73A 4GZ6A 3UWPA 3CRW1 4LECA 3CR8A 3UJAA 4DQXA 1CK4A 1OLOA 1PSDA 1J1ZA 1ETUA 1TOAA 2BEVA 3A9RA 4ZRDA 5BYJA 1SBYA 1RXSA 1S8AA 3L06A 3STUA 3ZWQA 3BRSA 1JAHA 3TSWA 2PBFA 1GNQA 3LX6A 1S2MA 3G5AA 3LBHA 4WJZA 4IMRA 4BN5A 4ZCRA 2WJGA 3DLHA 5KBYA 1O96B 1QG4A 1E7SA 2AI3A 4FT2A 2FWJA 4QZVA 1HTTA 2FPKA 3QH4A 3AEUA 5CLIA 3VYSB 3F47A 521PA 4UPDA 1A9QA 4MP6A 4BKUA 2OFXA 2XLBA 1OJ7A 1U9CA 2BI8A 4H31A 1CJKC 5G2OA 4M8LA 3WGYA 2NO9A 4PAOA 2QMOA 4EOGA 3AUTA 5ENZA 5I3CA 3AL0C 5CU7A 3ZCUA 2YWDA 2FN4A 1FYXA 2WT4A 3B13B 2VFAA 4QRIA 4XX0A 4H9GA 4ZJPA 1GNRA 1YS4A 3QQPA 2HRZA 4H0CA 3JYOA 3PNYA 1ESDA 1NTRA 1TQDA 2C3PA 5KEIA 5LN1A 4MO9A 5IMBA 3T1OA 3HVRA 5FOTA 3N0RA 1K7SN 4F3NA 4ZICA 4ZMBA 5C4MA 5AVSA 1C4WA 1G60A 4LC9A 4N0QA 5DH9A 3FMVA 4POOA 1DARA 1EXMA 3D1JA 4X20B 2H06A 4BQPA 3JQCA 4Q7JB 4JLMA 3GRKA 5FOUA 1ZN2A 4JEIA 5LYYA 3E1KA 1X94A 1IFXA 4OQMA 4X95A 2WR8A 3LO5A 4I1OA 1L5RA 4QO7A 4MYRA 2WJIA 4Z2YA 2BSAA 4NCAA 4N3CA 3NU1A 2JIPA 5FJIA 1E98A 4RGQA 2CLIB 2N3ZA 1P1BA 2GVDC 2YRWA 3HG7A 3LVQE 4N3GA 3S2YA 4ICIA 4A8JB 1J6UA 4I55F 3RWBA 1H69A 2C8KA 4HLCA 1T1SA 2JFHA 4H6XA 1RTTA 4I1VA 2HJ9A 4EG6A 2EQAA 5AI6A 2KYRA 4BECA 2VA8A 4D8VA 1L8LA 2I9KA 4GKKB 16PKA 3H65A 1H66A 3R5FA 2ZSIA 3S2SA 1PS8A 2B98A 4NESA 2PH1A 4M7OA 2RGDA 5FOWA 4K28A 3RS8A 3SDSA 1RXEA 4BQEA 5GJBA 4PM4A 1T5BA 3PXBA 4MTCA 1KMNA 4W9RA 5AVJA 3SXJA 4XX0B 4ZCSA 4F7DA 2YVKA 5AHRA 1JJIA 4IR7A 3EVBA 4Y9UA 1J90A 1KSGA 4KQ2A 3EZ7A 1JF8A 2BZSA 3DZJA 3REGA 2A3NA 3BMOA 1DPGA 2WIFA 3WLIA 4M9UA 4TVSA 5TV2A 1KFCB 4RUKA 4F3KA 2B35A 3A4NA 3ROTA 1S3IA 4ARVA 2DUMA 4LF6B 2ZVJA 1VIDA 2XQJA 5ELLA 4RHTA 4MCHA 2P8SA 2NXEA 1VI6A 1XAGA 3K20A 3HM9A 4KREA 4KODA 5FL7A 3ZG6A 1EGMB 5JNLA 2DLNA 5DSTA 3DV0B 3KEQA 3HU3A 5KTRA 3ZJTA 4O4HB 1YZTA 3C45A 1CLEA 5I5EA 1P1HA 4YHBA 3GDOA 1F8YA 4G3XA 2GZ3A 4RZ3A 1RVV1 1GV0A 1K08A 1ND6A 1YO6A 3V3KA 3ZZ1A 5BOSA 3PEWA 1AUVA 2WZBA 4WNCA 1UAAA 1K2VN 4KPFC 1NVDA 3EZFA 3LOUA 1DDOA 3KEOA 3QNUA 3DXFA 2IEDA 1Y1KE 2Y05A 3ZLTA 1D2EA 4BIMA 2VG8A 3LDHA 3QVMA 3ZJYA 2HBYA 2JHFA 4UVEA 1XKQA 1PJRA 1G17A 2A7QA 2BFPA 3K6KA 4Y9RA 5LU8A 3SXUA 1ZH4A 5LB4A 2WV9A 5CH8A 1LU9A 3PSAA 4US1R 5E7QA 1UT8A 4BMOB 1MENA 1RFLA 1JLRA 1LBEA 2PSFA 3AF5A 2AI1A 3BE4A 4GT1A 4JC8A 3VZDA 7ABPA 3BMOB 1ZC3A 1JHAA 2VDVE 1ODCA 2Y6UA 4Y98A 4ZOEA 1SUWA 4K8OA 2XE6A 4V0NA 1GGMA 3H5TA 1GJRA 4QFDA 3EFBA 3SBEA 4RK4A 2QL7A 4NK4A 5EEGA 4NU8X 1OA0A 1XTTA 4MHSA 3UAVA 5KYWA 4Z1OA 1QIMA 1DQZA 5JVDB 5HRUA 2JBWA 4DHWA 1X80B 3DEJA 4QX6A 3U44A 2WFAA 2WNIA 2ZRPA 4O25A 3U56A 4GOJA 1JECA 1SG0A 3I2HA 5BOSB 4M9CA 1CV2A 3L7AA 1ZOOA 2YWBA 2Z0MA 4ND2A 2X5OA 5I8PA 4U63A 5L4SA 4PGFA 1WEKA 4D25A 2CNKA 5FULA 2OFWA 2MU1A 2PWAA 4PIMA 2IHBA 4AZSA 3DE4X 5DMHA 5B4VA 2AQIA 1DRJA 5BPHA 4QPDA 1Y1RA 1SHTX 3RREA 5KWIA 5AOBA 1N7HA 1QR2A 3M6AA 3PNKA 4P4UA 5DJ5A 2PBLA 2VJMB 3AUYA 3EDQA 1P4HA 1QHSA 3O3MB 4NG4A 1YDHA 2P4EA 4N48A 1UDAA 4MIYA 3PIDA 3MYRA 5DULA 1OWOA 2O3TA 3DBOB 2AN5A 4EHBA 4WRRA 5BP7A 1ISSA 3ZDCA 4AI6A 2MMGA 4BQQA 3QA3E 5U9CA 4HDKB 3CKMA 3KOMA 3PWKA 3OEED 2IU4A 2R85A 3D59A 3MD0A 4GKBA 1LLUA 1VHDA 1VJRA 1WUKS 2LIPA 2J3JA 3DJYA 5CVDA 5LQKA 5K6AC 4RMGA 1UQRA 2H11A 4N01A 1PFGA 2HMTA 3H05A 4B4UA 2EBFX 2O8EB 1W0JA 5CT9A 1K88A 4A73A 1WQ1R 3HXKA 2ZB4A 1NWCA 1EQAA 1T2UA 1LFAA 2BCJQ 4ABYA 2A30A 5TQVA 3TR0A 2O1SA 3PPVA 1DBSA 4LHYA 4XRGA 2ERYA 2B1QA 3LUJA 3I6ZA 1V25A 1KPIA 5E1BA 2HU8A 2OHFA 2JK0A 3E15A 3JWEA 4NQRA 5ALWA 4UU8A 1U7OA 1X38A 3EXFB 2ID4A 2X3UA 3F7NA 4II2A 3V3TA 3DFMA 1EDOA 3D3NA 1E8NA 4PGGA 4R4JA 3ZZUA 3L0CA 1L5KA 1OH5A 1YA8A 2XV1A 2Q5JA 4Z53A 3OLYA 3GLTA 2ROQA 1JHDA 3E8SA 3EQZA 1NASA 2D2VA 3R5KA 4DJEC 4W5OA 1IZ8A 3LE8A 4S24A 4UEOA 3UCFA 1BHSA 1O6GA 1R27A 5J2UB 3PUKA 3DTVB 1O5IA 2JGNA 2MMCA 1ISGA 1PE0A 2J1LA 2QU8A 2WT8A 4DJDC 4XDGA 4OP1A 2V7EA 1SOAA 3G6KA 4MRMA 4YO7A 1AXRA 3PWTA 1R4MB 1V8ZA 2WAXA 1RAFA 1MVOA 3M6FA 4IIFA 3VZBA 4NCHA 4WT7A 4YPFA 4CMHA 2PQ6A 2WJ6A 1MAVA 1RI2A 3AUAA 3Q3CA 2FYTA 5IXSA 3THRA 3IT0A 4JT4A 3GRCA 4PAGA 3SJCA 5IFKA 3R44A 4NIMA 5KJCA 1L5OA 4XGNA 4DEXA 2W5UA 4IZHA 4CT0A 1YTUA 1L5WA 5KYYA 1VE3A 1T1JA 3DZ8A 1OPXA 5EL0A 4RF2A 1CUDA 2X9VA 1QC5B 4JBWA 1WETA 2VDMB 2RDMA 4GX1A 1UPAA 2LP4Y 1RNLA 2B83A 1BHQ1 3B70A 3E9DA 1G21E 1IBMB 5BQPA 3QLJA 2PMBA 1CUBA 3MPUA 3S2ZA 4MYDA 1YKGA 1I01A 4FR2A 4QOSA 1JDBC 3TFOA 4R2WA 4D98A 2ZRAA 3E7WA 4WK4B 3T5DA 5AM1A 3TN7A 4EMBA 1UWCA 1V1JA 1DE0A 3MWEB 2LW7A 5IKPA 4LHXA 2ZBUA 2C4KA 4L8FA 4ZVPA 5ERXA 5CT8A 3WKBA 1SUFA 5SY4A 1MD9A 2XE7A 2UYQA 4M9QA 2ZTHA 5KWEA 3RIEA 4LS3A 3RD5A 4KLZA 5F4BA 4MMYB 1OWPA 1JKJB 1KKMA 2Y1XA 3OZSA 4HZUA 4WKPA 2WG2A 3PXGA 3TVDA 1L4GA 3AKEA 3LUAA 3IBCA 4J75A 2PBZA 3NQ41 1WUHS 1ZXXA 2XMRA 4C3OB 1OXUA 3OX1A 4DAEA 1PN3A 2O7VA 4YV7A 2FE4A 1E96A 1W5AA 3GP8A 2ZUSA 4QDXA 1H3FA 3GXOA 3IC5A 2XDAA 1GA6A 4CV0A 3E9CA 2AOUB 2AZTA 5AR1A 2OM2A 3U48A 1H4SA 2XTJA 4ZMSA 1U2PA 3BHIA 5JQGB 1XRLA 4PZEA 5H3CA 1G8JA 3TTTA 2GXAA 5B1HA 3LKDA 1N6RA 3WIVA 2JVIA 3GLGA 3VO1A 1Y9ZA 1X7WA 2C9DA 1PHPA 3RE1A 2MINA 1IUPA 2OB1A 2FLWA 3N76A 3HEMA 2VLBA 3KYDA 3U3MA 2I4MA 4QARA 1CQJA 3ZY3A 1M2OA 1L6IA 2R6AA 3F6CA 2PK3A 4R6XA 2EX4A 1SC3A 4F5WA 4HBGA 3S4YA 2DH5A 3H6HA 3WQRA 2H63A 4EENA 3PSHA 3E5HA 4HH3C 5CUQA 2IEAA 7REQA 3MWDA 4L75A 4PSUA 5LCXA 4KE6A 4Z3OA 2OYCA 3ETJA 3N8KA 3WRWA 5KO2A 1T3SA 2C88A 3B9QA 4WECA 3W2EA 1GQSA 1ZJZA 3WA7A 1WUIS 2HC9A 4TWJA 5EE3A 3SY8A 4U7HA 4ZYLA 2ALJA 5BVHB 1OXXK 4IDBA 4IG9A 1U81A 2CLLB 3EEBA 1UANA 4O4LA 4UUAA 2CB0A 1FPMA 2RGAA 1OYOA 2HF2A 4L8YA 4QREA 3V8EA 3WMEA 2WAOA 1Z6XA 3QKTA 1NRXA 4JSRA 1PL7A 1YR9A 3TOVA 4YRPA 1D2HA 1VJDA 3TBKA 4X91A 4P93A 4S2EA 2H29A 1CHNA 1DC7A 4WUVA 3ELBA 2B37A 1L5ZA 3PUZA 1P91A 4MW5A 1TTQB 3LFHA 4W5WA 2YMQA 3INTA 5SZIA 4YYEA 2ADMA 2V59A 1EU1A 5C52B 2NZYA 1V6SA 3EDRA 5FBKA 5LB2A 3NM5A 2VNHA 3OX2A 2X2FA 1FNDA 1L7VC 1Z28A 2X0KA 3A1NA 4POAA 4Q6WA 5SV2A 3RVBA 4RPLA 7ADHA 2O06A 5JCPA 3PV0A 3JSXA 1MB4A 3TUIC 1DIRA 1WY5A 4M37A 1QH1B 4EP1A 5DTEA 2W7TA 5DM70 3M6WA 1U8FO 3E2PA 1Y8QA 1P7PA 2CBZA 4MW4A 1FQWA 3UEOA 3V4FA 3ANYB 1H4QA 7REQB 4DMCA 3O82A 2FSHA 4KLNA 4K6MA 1E3MA 1QIEA 1IATA 3GCXA 5SICE 4OH1A 4N8DA 2F55A 3BSWA 5ES4B 1Y81A 1O6FA 2XXJA 1Y3BE 1FRVA 2WAMA 3DLPX 1EI9A 1G8YA 1QS0A 2WSYB 1WMAA 2LKCA 4DPMA 4DR7B 4Q3LA 4UHDA 1C7FA 4GOOD 3OPXA 4PPFA 3WRYA 3ZLVA 3R0ZA 4P5EA 2JB9A 1J00A 2LR0A 5A2GA 4V1CA 3GY0A 1H85A 4PC7A 4KVFA 4IIGA 2B94A 4CI9A 5A7FA 1X92A 2OHXA 3UHPA 1WVIA 2B4QA 1YJCA 2ABWA 2RJOA 3OLWA 4EDFA 1SR8A 1FNSA 1PIWA 1O95D 3FWKA 5BSVA 3N2GA 2JASA 2H4HA 1DC4A 1Z2NX 3UZUA 2DY1A 3SEAA 4YWHA 4ZMRA 3C39A 2VF4X 4BDTA 5FNVA 1TFRA 4PQFA 1WY7A 3E0QA 1IXZA 3LGXA 3NYQA 2E6KA 3MFQA 4PLWA 4TMZA 5J1TB 2VTEA 3RS0A 1QHGA 1T3HA 1O9HA 2QI9F 4KR0A 1OWNA 2OG1A 1F9EA 1RRKA 1U7UA 3CG0A 5BUCA 2AEJA 1I2MA 4IHQA 3TW8A 1G6Q1 4N47A 4WI1A 1ACLA 1LSUA 2ZTLA 3AUXA 2R8PA 3DA8A 3LL7A 3CVWA 3CNQS 2PKWA 4JLNA 2WOJA 3EUWA 1KOGA 2VP5A 1XROA 4FFBA 3O8BA 4AQ7A 2NADA 1D2MA 5CPFA 4I7EA 5DLPA 1Z0UA 2O2JA 4NDZA 3DV2A 4UHFA 1SKMA 5KAPA 1USKA 5I9NA 3NG1A 2CK3A 4FLEA 4MI6A 3RU2A 4L57A 2X5KO 4GRIA 1IN4A 1D0VA 1RAAA 2FWBA 3L0PA 3SMVA 1SGWA 4BBJA 4RZQA 4URVR 5A3JA 1T9GS 1U5BA 3Q11A 4AXBA 2GN4A 4HVCA 4GEGA 1ZU4A 3GPBA 1FYEA 3IAHA 4N5NA 5K3EA 2ZRCA 4HWTA 4YIHA 5EOVA 2C2YA 3N2GB 4NDAA 2H1WA 1PZHA 4JEMA 4DUGA 1ZD9A 2XYGA 2NO0A 1GPYA 5FNVB 4XEUA 4D2IA 3U60B 2E49A 4KQ1A 3TNYA 1CETA 4MV4A 4G2NA 1PWXA 1H6AA 1XYYA 2H2HA 1KH1A 3OM8A 1E58A 1FMJA 4KFSA 5C5IA 1NZDA 2R79A 5KNBH 1FX1A 5KHLB 4DDHA 1FLDA 2ZYGA 1V9CA 3BDVA 3GUZA 1NJ5A 4N8SA 4JVLA 1U2GA 1CERA 2OLEA 2CZQA 2E4AA 1IOLA 4FEGA 3HKDA 4HMQA 4K9KA 4NOJA 4DCJA 5T41A 2JAHA 2JK1A 3HDYA 4PNHA 3Q8KA 1C9DB 3GF4A 1UWVA 3C70A 2EJVA 2ZUCA 4L0QA 1KRXA 4JI8B 1UBTS 3KQQA 2ZCJA 3OT5A 4FHGA 3SKVA 3QF4A 4Y7DA 1IUKA 4MINA 5AVOA 1E6LA 1TYBE 4FXPA 3DQZA 3DOUA 5CAEA 4V39A 3VBCA 1PFVA 3F5MA 4AMYA 1PJ8A 1U1IA 2BFNA 1C3JA 2KI5A 3QKRA 2YV2A 5AHOA 4ZVMA 2QTFA 3MG9A 1ML4A 3T3PB 6REQB 1CNMA 2WLSA 3T9FA 1XXHE 1PGJA 5JNTA 3ND6A 3HU2A 1XRJA 1P44A 1TECE 1XG5A 3ICOA 4C0JA 1QMPA 5K0TA 4ZO4A 3O21A 4WLUA 1MT3A 2GNOA 1Q6ZA 3WFIA 2VRBA 1ULZA 4MUFA 1ZM4A 3ZQUA 3EZYA 3ZJ5A 3CZ9A 2Y0BA 3VJRA 3JQAA 3QUSA 3CE9A 4NH4A 3SSMA 3ZI7A 3AHFA 5EQDA 1C41A 1NP7A 3VZSA 4XB6B 4ZD6A 1DJQA 1NATA 2XTMA 1VP9A 2AT1A 2VRWA 1MFZA 2IDZA 2BTEA 2EKLA 4LI0A 4UEQA 3IUJA 1GA4A 1MZPA 2AL7A 5HFNA 3KZVA 10MHA 2BY4A 4O4IA 2QQEA 2OO3A 3GEGA 3JQBA 4YFYA 4EW3A 2PAFA 1UFKA 2X4GA 2WF9A 4FYXA 2ZUVA 5ECYA 2IITA 4XEHA 2GB4A 1ZIOA 1KYWA 1RP1A 4MV3A 5EUQB 5BUZA 5CAEB 1TVKA 3R6GA 3ZE2B 2FN3A 2DXIA 1GAQA 1TZJA 2QRKA 1PYOA 1HDZA 2C2ZA 1HA3A 1P6UA 4TYQA 4CT4B 1DWOA 5DNYB 2J3HA 3AZOA 2MSCB 3BF8A 2EKQA 4NS4A 3UATA 4DNPA 2PT6A 4ETNA 3ZWVA 2GFHA 1K8YB 2QR5A 3QJGA 4XQEA 5GP1A 1YC5A 1IH8A 3IB6A 3K2EA 3NVDA 5HE8A 4BFVA 2FR8A 4KEAA 3GMDA 5ALYA 4ZTZB 4R2IA 2BE9A 2NAFA 4NLLA 1PJQA 2AN4A 3JQAB 4URXR 5JH7B 3BJMA 1G8FA 1GG9A 1V45E 2EJBA 2H85A 2VI5A 1H0KA 4HZIA 2DCMA 4KQWA 3NYRA 2V54A 2XUPA 2X2OA 1ZGCA 4MS1B 4RJ2A 3VPGA 3L6OO 2PRKA 4RACA 3HJUA 4GI2A 4M1QA 4PQGA 2CE2X 1L1EA 4GBMA 2C00A 3TLAA 2MYTA 4JXJA 2CXQA 3DZKA 4O4IB 5EZSA 1E18A 4V1CI 1QDLB 1YVDA 4GX2A 2JI9A 1OMOA 3GLUA 4HNUA 5G4KA 5LBUA 3RVMA 1O0BA 4IJ5A 1NNLA 1OTXA 1YUMA 4QTUB 4EPXA 4EWLA 2M2IA 1TVKB 2QKYA 3FXAA 4IDFA 5FWYB 2GNPA 1W75A 3H6GA 4P38A 1NOJA 1U2DC 3BH7A 3FFWA 1DX9A 3VXKA 4N18A 4JNCA 3GLFA 4YYZA 4ALMA 3DOFA 4FUTA 4CCYA 1SULA 2F8SA 4C6RA 4KUGA 1U0SY 1KQOA 2FFQA 5CP8A 5EUCA 1APBA 2OBMA 3EWSA 1UL1X 1V4VA 2YICA 3DL0A 3T7IA 3A70A 1YDEA 4C87A 1R0CA 3AC0A 4HNAA 4L76A 1C7EA 2QQ0A 3QVSA 1QKJA 4G5RA 3U9TA 3K92A 4YJ3B 5G3ZA 1GPMA 4DTCA 1PD1A 1AZTA 4DB4A 1VG0B 1YI1A 1ORDA 2OV6A 3I76A 1DBWA 1M34A 2RHCA 4RHEA 4DDVA 2D8AA 1QPZA 2JBHA 3FI9A 1A5TA 1A0OA 1U31A 2I71A 2V7XA 4I5EA 5MDHA 1W49A 3F8TA 3T7DA 1D3AA 3K1AA 1LPBB 3QXJA 4UDOA 3R7WB 2NNLD 4QPJC 3IDZA 5I8ZA 5KSYA 4MHTA 1BE8A 3H1GA 1OBHA 3UNXA 1FZQA 2PSJA 1EFPB 3R6DA 3MCUA 5TRTA 3SE0A 4DB2A 2CBXA 4LDPA 1Z8HA 5E4FA 1XGKA 3DL7A 3IAM6 3WP0A 2YY6A 3ZU4A 2MR5A 5EJIA 4DM4A 1D6MA 3ZNOA 5CIYA 4Y2QA 4UTOA 1Y6JA 1PD0A 2WM2A 3P1JA 3ZD9A 2YMMA 4N5LA 5DYTA 3GLFB 5H3LA 4ARZA 4CCYB 1QNFA 2VSNA 1BN7A 4W5TA 4N8EA 2O59A 5F9MA 1C3VA 3I8OA 3U7JA 4U3JA 4F4HA 4R0NA 3UY4A 2BFWA 4IQFA 5JTUA 4BGDA 1X7YA 4WZZA 4DG5A 1XVIA 2E9SA 1RZRA 4NPCA 1L5VA 1ZNQO 5LMCA 3QJYA 3DOIA 5K4GA 2UYCA 4PGHA 4FGUA 5KVAA 1HFEL 1OR8A 3OFNA 2WYHA 3V8NA 1Q0UA 1RWPA 2EWMA 5E7JA 2ZTUA 1LTQA 3WGNA 3AWIA 2BDUA 4Y0AA 1G5TA 1CCWA 4WBNF 4Z6KA 5AJWA 1SMKA 3I72A 4HWSA 4AF8A 4G6ZA 3GNQA 2Q6VA 5A4KA 3HNRA 3PYXA 3HO8A 3ROFA 4OHUA 2ZRBA 3DONA 2HTEA 4IEIA 4LBYA 1BA3A 4WZBB 1T2NA 1FTQA 1TI7A 2GRJA 4C05A 5KNBD 2DC1A 3DMPA 4FN4A 5CEJA 4YQZA 3ZOZA 4BN0A 2NTVA 1VRVA 3L1IA 4XVRA 3OZIA 3ZDDA 4PZ0A 3DM5A 4BO8A 2QQGA 1PJZA 5NULA 5BQ5A 2DWPA 3EW7A 2I2CA 3CLKA 4R8KA 3TEFA 2R751 1RHKA 2R86A 3STWA 3MUOA 1YZLA 3ZH2A 1OFGA 3KV3O 1N5DA 2QV7A 1BTOA 3NWOA 4OV6B 3HP4A 1WMDA 4RSHA 3UAGA 1F4VA 4WXYB 2A5FA 3ER6A 4XQ9A 2VYND 3L8DA 4RXMA 4U3JB 1AZLA 1JMYA 3DO8A 4KRXA 5JCOC 1FTGA 1CRZA 3QIVA 2P40A 1X7YB 5EZYB 3H1AA 3SFVA 3SK0A 3ORRA 5EJ6A 1PUJA 4U7PB 4JU9A 1COWA 1J99A 1OIVA 3UG6A 4OLBA 1NBWB 2PNFA 2PY6A 1QFMA 2WSLA 3QQ5A 3CEPB 4O4LF 4PPNA 5C5EA 4D0SA 3FB1A 1T6XA 1M2GA 1CDEA 1OGJA 2AR7A 2NXJA 2Y1FA 3JQFC 1TUGA 5FUVA 3RJ5A 4BX3A 3FYSA 4C7BA 2G4VA 2RCYA 3T4UA 3HLKA 3PKIA 4DA7A 1W5SA 1NQUA 1T6ZA 2IF0A 1WW3A 4U39A 4UZFA 1B1CA 1SPBS 4F9TA 1W88A 3WX0A 3T06B 3NP7A 2JLSA 4G4JA 3SLGA 3RG8A 3WHLA 1XAHA 5EJ2A 2EL7A 1PKEA 1NIJA 4LE1A 4UHKA 2HCFA 3OJWA 3FZQA 2C07A 3UV6A 3ASUA 1DPFA 1UBJS 4WFKA 1MX5A 5FBHA 4QG3A 2BYTA 1BHJA 2R68A 1NNEA 5J63A 1I4TD 1TB4A 1KVSA 3IEMA 2C20A 2QJFA 1TLFA 5WRFA 3AR5A 3VR2D 4D3SA 3RRMA 3QXCA 1RACA 1KVRA 5LC1A 4D43A 4EITA 1SZJG 3WZLA 2OAEA 3HA3A 3GLQA 4WKGA 1XP5A 2WAYA 4Y67A 4XWKA 3EGXB 4IRUB 3CPHA 3I5XA 4UFNA 5CX4A 3DOOA 1PJSA 3A26A 4BMPB 4KIUA 2QG6A 5EKXA 2JLAA 2Q50A 4M22A 3UH0A 4Y8VA 1BX1A 3INNA 3PF9A 1MW8X 1ESEA 1GL6A 1EX6A 2B2XA 1LDEA 2Z4RA 1ADCA 3DKRA 4RPCA 4C7XA 5B4UA 1JDVA 3HBJA 2NMVA 5AW6A 2EW1A 3G2MA 5DIFA 2CL6X 1A7KA 5AO9A 3V32A 3G2NA 3BHMA 2VRCD 3RIHA 2HH9A 1UQUA 2I7DA 1LJ8A 3D6HA 2FRDC 4X97A 4J4HA 5HIKA 1A76A 2H0AA 1QFZA 1F3OA 4MV7A 3V1NA 3WMXA 1W88B 3DQQA 2QG4A 3LCUA 1PGPA 4C04A 1M76A 1NV9A 1RR6A 3QP9A 4G1EB 2AXQA 3FDJA 4WASA 4Z4FA 2R8ZA 2WWXA 3H2KA 4FN5A 4RHUA 4E5MA 1T10A 4AP5A 5T4EA 1EYZA 5GM1A 3FW1A 3MQ2A 5JNVA 2Q5CA 4V02A 1LLFA 1RKBA 2XXAA 4MQEA 5DV9A 5FWDA 2D7DA 4HDRA 4RWZA 2V6BA 4NY1A 1J0EA 3AZPA 3CMCO 1IDN1 4RTPA 2PXCA 3KT6A 3W6NA 1TTTA 4IDHA 1ZXBA 3ZU3A 1JU9A 4YCSA 1HQCA 1SU8A 1AO0A 1MJGM 3KXPA 2UXCB 1DRUA 2CEAA 2ZE5A 3HSKA 3R6TA 2I3GA 1N3IA 4GMFA 4IHJB 4GX5A 1M2JA 4L28A 1XU7A 1BN6A 2IUEA 2P68A 2VK8A 2BHNA 2DFNA 2NXWA 2Y9MB 3FVVA 3LBIA 4KOAA 1QIGA 1DKNA 3LRXA 4HHEA 4PCAA 4XD7D 1BE6A 3P20A 2BFAA 4D9MA 3J7TA 5ECGC 1OAOA 5TJHA 1RLMA 3AY0A 2GUGA 5BYBA 4E7OA 4HK4A 3Q3HA 3RSOA 2F62A 4QVKA 4QHYA 3M49A 1PR0A 4DGQA 3EZ2A 5EJFA 1Z36A 4G1MB 4LOIA 4JUCA 3RJZA 1CUYA 3B1VA 3LRPA 2FUG6 4HDMA 4RDXA 2QMYA 3D3WB 3FYCA 2W2MA 3D1VA 3HBFA 4GI3A 1V0JA 1XR3A 2D62A 1DEXA 5A06A 3BL8A 3V6LA 4DHEA 5J3JA 2WD9A 4CM8B 2JBAA 3PRKE 1EB9A 4NRDA 5AJTA 3GL9A 3H5WA 3ZDAA 4HDRB 2GCEA 2C96A 3MRXA 1ODLA 4MEJA 4BTEA 4KQ9A 4IIHA 2H1SA 1ACJA 3GROA 4DC0A 1G3QA 2MYNA 5BSRA 2B8NA 2ARKA 4MRAA 4QDOA 4KLAA 1CUAA 3TB4A 1T8TA 2ZATA 5EZ5A 2XIJA 4F2PA 2JFFA 2QZJA 3KZNA 3Q7RA 3CLUD 3QFCA 2BN4A 4G9GA 5A3SA 2HXSA 1MGOA 1NBAA 4EEZA 2Z2KA 5L6LB 3DD1A 1N9GB 3FPCA 3PT9A 4N6GA 2FLVA 3H2ZA 2QYSA 2WQZA 5EPEA 1YL7A 2R62A 5FO0A 5CG1A 2RHMA 4IEFB 1NVAA 3DG9A 4A36A 2GHTA 2CHUA 3L7DA 1PNTA 5B7NA 1Z88A 1ECLA 2O2GA 3C7TA 3G7UA 4LSGA 4CLOB 5C0OE 4YMSA 5L9AA 1A9PA 1A88A 3NTOA 4TUYF 1WBJB 2JDID 2JS7A 1AGXA 1FJXA 2PDAA 4G8CA 4GD3Q 4EB6B 1R1DA 2C1XA 1GQRA 2PL9A 2R6ZA 3G8BA 4IVPA 4OD0A 5H80A 4ER6A 5BNIA 2BL4A 2Z1DA 2QA5A 2JBAB 3B3FA 3E7DA 9ABPA 2H1LA 1MX9A 2OO5A 3THOA 1PJ4A 4B2IA 5HJ5A 2J67A 3RSLA 4M1WA 1ARZA 2REBA 3FBWA 4WIAA 3KPJA 5A9SA 4K7JA 2FW8A 4J7UA 3GX1A 1FC0A 3FOWA 4P7JA 2A9RA 1DWPA 2AFVA 3K16A 1CZKA 1UBCA 2DKOA 2H7XA 2I6XA 2WIKA 1U2EA 2BMJA 2IDMA 3G2PA 3K0FA 1AQYA 2Q6IA 2X1MA 1GRRA 3ORSA 4FCCA 4J16C 1EHIA 3MINB 4WLOA 3VBEA 4BAUA 4UAJA 3R3JA 2FMXA 5CCXA 3WMGA 3THWA 3KEFA 3NEAA 4YAIA 1IIRA 4ZDJA 4NDNE 4PBRA 4GR4A 2HV8A 4J1QA 3QXSA 3OO1A 4L02A 5IW8A 2OPBA 3F5DA 1LPOA 3DB1A 4EY6A 5C2JB 4ZVUA 2ONZA 1QGOA 1UK9A 2VDNB 4LY3A 1CF4A 4W7SA 4MQLA 1T9GR 3GEHA 4MLCA 1M74A 4QODA 3UWKA 4NZPA 3HZHA 4ZVRA 2KM1A 3NUQA 4LSMA 5CFOA 1CNFA 3X2FA 2X8WA 3ZY2A 1EX9A 1GRCA 4GOLD 1HT1E 1W2GA 5BSTA 3ZWYA 3VPDA 1Y5MA 2Y4NA 1TZBA 2WMYA 3JQPA 1MQ8B 2G5GX 4KFUA 4BMZA 1RQ7A 2I3ZA 2Q6TA 2IHZA 4HQ6A 1A50B 4ER7A 1KPHA 1YQQA 1YZ3A 2NU7A 4XXHA 2BGMA 4QUEA 5A71A 1N7JA 5JFGA 4IHAA 2RHOA 2D7JA 2HJHA 4CT5A 2FSIA 1JQ5A 1Z13A 4PZYA 3JZDA 3JVEA 4PLTA 4U6SA 4X44A 3K0FB 3RR2A 8GPBA 2GM4A 3BEDA 2HLDD 3PS9A 2RKBA 1AQLA 3AIMA 5ALRA 3ST7A 4FMCB 2G7ZA 2PHZA 1G6HA 3K7EA 4B82A 2Q8NA 2WNHA 4G26A 4EH1A 1WOMA 5EMJA 3BRCA 1Z4IA 3THWB 4JXZA 1U65A 2MIIA 4BUCA 2HIMA 2R4UA 1EP9A 1GPKA 4Q6BA 3KT3A 1RQNA 1GQQA 3GT7A 3HY4A 3P26A 3VC2A 3OD5A 1QSGA 4LV5B 1XD8A 3RAPR 1F48A 1YR3A 3H8JA 1JIUA 3T3EA 4BGEA 1NLFA 3HI4A 2EDAA 1HQDA 1CR6A 1ODSA 1ZD1A 3DVQX 3NRJA 4XPIA 3SIPA 2PUBA 4JUIA 2PRYA 5J4YA 1Z0AA 5FNZA 1SVNA 5D1NA 5HBRA 2YN2A 1GRNA 3OEEA 4RD3A 5KB3A 5LMNB 1ZI9A 5DTQA 2VHUA 5GJCA 1L7BA 3KKLA 1VYVA 5AKKA 1AQ6A 3RM3A 2BSQA 2A8YA 3BB4A 1WUJS 2EZ4A 3JWIA 1PR6A 4ID3A 2ZWVA 5JYBA 4TN1A 3FNGA 1JI3A 2C2GA 2GK4A 2HA4A 1W4CA 2F64A 2HFJA 4S05A 2JAUA 2IXDA 1PJTA 1Z3CA 2OCLA 4LRWA 2PMCA 1Y3IA 2PMDA 3RW9A 3TE7A 4BNMA 2EQ5A 5FV4A 2I2BA 2DY0A 5DI9A 2W83A 3P2MA 3PBKA 1AKUA 3AF2A 4AWXA 3TE6A 2VNJA 3B8EA 2FQQA 5EXEA 1Z07A 2HTFA 4DSZA 1EXWA 5FQNA 4DSOA 3RUCA 4QU0A 3Q3IA 4O2AB 5C46F 4KNVA 4RTNA 4BMCA 1TIKA 2CYAA 5C32A 2XGMA 3J7AC 4DSTA 2FLKA 3A1CA 4F45A 1OPRA 3HYTA 1DKUA 4G0WA 3NTQA 4PWYA 3T3MB 3UCEA 4OX9B 1NKSA 1VKJA 5F64A 3ZS8A 3LC1O 4OLFA 1PFQA 5BSEA 2GN8A 3FR7A 1AZSC 1ZI8A 3Q87B 1NYRA 2WHQA 2X6TA 2LZ0A 3DVAA 1Z5WA 4UJ3A 1CUEA 1HDXA 3CO5A 1KGSA 2ZTMA 5AQ1A 4V3BA 3KUDA 5KQSA 2QAJA 2EJTA 3CRMA 3FA2A 4TQUS 3MM4A 3OTHA 1RJWA 3R0QA 1H1TA 1P8JA 2ADOA 1LBSA 1A2OA 3LZDA 1K7CA 1ZNWA 3T9DA 3VTFA 1TT5A 3OZ7A 1FMCA 3CUYA 4BXOB 1FP1D 4ZJYA 5KQPA 3LFTA 4Y1FA 4CLDA 2PGLA 1BDMA 4EJ6A 2R4QA 1KYQA 3KJXA 4A2CA 3ZHQA 3M33A 4BV8A 3BXEA 1SBCA 2YFHA 4X64B 2GJ8A 4EK9A 2JZOA 1E5QA 4U7JA 1GUBA 3RHZA 2OKCA 2HOQA 3U6KA 2VN8A 3H3XA 3D0RA 3PUXA 3JTMA 2IT1A 3DAPA 2BVNA 4HRAA 1JL3A 5EPOA 3TR6A 4GMXA 5BN3A 1MC5A 2XGSA 5B1DA 4EYKA 1J20A 4H7DA 4C2TA 2CCJA 2W8BA 4ZC1A 2WICA 4QECA 3OP1A 2YIMA 2HT6A 1DO0A 2GCOA 1R88A 3WGIA 3CEMA 1U0TA 1Y4ZA 2WTNA 4NVRA 2Y99A 1MV8A 4LQCA 2P6OA 2P3SA 3C74A 2O7QA 4HFJA 1K7FB 1UP7A 1ZRMA 2XCOA 3BXPA 4HJXA 5CNIA 2AC4A 3LX8A 5KDLA 5K03A 1AHPA 1ZIDA 4QXOA 4WDRA 4QD3A 3N0XA 1JIVA 2BISA 2CXPA 3ACCA 1F12A 4X62B 1GAWA 1TAHA 2PZGA 1F7UA 1AK9A 4ND3A 4YJHA 2C0PA 1RE1A 4KQCA 5I5GA 4BLTA 1TQ4A 1DV2A 5F1PA 5KOJA 1W4ZA 3IMEA 4WFJA 2FWIA 1P7VA 1FU7A 2IQ5A 3V7YA 1U99A 1F9AA 3TD6A 3VO2A 3FPLA 1D4OA 4GI5A 3K3PA 2HB6A 4B35A 5LOVA 2VBFA 1QLHA 3F2IA 1RQPA 5E1OA 5EESA 3DDSA 1FLAA 2AEEA 2IZ6A 5AHXA 1X3SA 1AV7A 1RMQA 4YIKA 4GC9A 3LT2A 4ZRMA 4C7OB 3EODA 4M7RA 4YMTA 1RYDA 4IDPA 1RPJA 2YMPA 2FKAA 4PZUA 2HMSA 1QZZA 3CX7A 4IY1A 1HLDA 1NLYA 1I13A 5K0CA 1Z82A 4HB0A 2IGBA 2JJYA 2FOXA 1M8FA 1O97C 3CF4G 3QPUA 5D86A 4HRYA 3VDQA 1X74A 4F71A 1ECJA 4GL2A 2H4FA 1A9OA 3FUWA 1JDSA 2VT2A 2C4WA 4C03A 4DARA 1RWNA 2AG6A 3WYAA 1DHRA 4A5OA 2R11A 4MS3A 5JSZA 4O63O 3G2IA 5HFAA 2N1BA 1R5BA 3D0KA 2G76A 1ADJA 4BQOA 2OR3A 2YXNA 5DBEX 2PIAA 2Y67A 2BEUB 3S27A 3M1AA 4RAQA 2FPRA 1F20A 3EJ6A 2GPJA 1MXFA 3G9XA 4RVDA 1IJBA 3W7BA 1MO6A 1QGYA 3LVBA 1IPFA 1UBHS 1ZM9A 5IYZA 4FC7A 3K2IA 5CTJA 4XE5A 1Q1BA 2F9LA 1ML3A 1DJLA 4GPD1 3VC3A 3WDKA 1NMEA 3ZE0B 3N2NA 3VKVA 3QKWA 2OBNA 4MVJE 4UPVA 4W6QA 4YWJA 2W71A 3MGAA 3AR6A 4CHGA 2PS1A 3PCTA 4R7GA 4C7JA 5IAKA 4EUSA 1R6BX 3L41A 4IDCA 5EJ4A 4QEDA 1SUDA 4EYGA 1Z47A 4WFQA 2JHCA 4TYNA 3L82B 3VVMA 3V2HA 2IF2A 4F6RA 2XMBA 4FCWA 2PNJA 3TOSA 1QRUA 2VZ8A 4YXFA 1V48A 2X7HA 4BCBA 1T6YA 1AM4D 2J31A 1B73A 3Q4GA 4PO8A 3G17A 4ISCA 3VDMA 4AMZA 1N5OX 3O75A 3GMIA 4RVNA 3UVEA 2FEXA 4CRWB 1OLUB 3TIVA 1T9ZA 4R41A 3L49A 2J9RA 2B4KA 4I1YA 5KYGA 2Z09A 4CF5A 2YJ5A 3ECCA 4X8LA 1PWYE 2O8CA 2C5SA 1VOTA 2YJZA 2QGZA 4AJIA 4MS3B 2RKOA 1QHNA 1AKNA 2Q3BA 3FWNA 2JLRA 4OJQA 3MMPA 5AVYA 1PI3A 1R66A 1TW2A 1FFBA 2WDZA 2I67A 5EJ8A 1JPVA 3V46A 2P90A 1QRTA 5D00A 2WUGA 3N05A 2GZDA 3ODGA 3EEQA 3QXGA 5HIJA 3TBFA 3T61A 1Y6FA 2P9FA 3JZFA 4JBGA 3UT5A 2BGWA 1CJTC 5IYZB 2HBRA 3D8TA 1ZM2A 3CBGA 1OB5A 4CFYA 3Q72A 5ALFA 1M1NB 3GFFA 3PXCX 4FD3A 4ON9A 2ZXUA 3UBTA 1Z45A 5CLFA 1RXIA 1BEUB 1CDDA 1XRRA 4X3OA 5AM0A 1MEJA 1NL3A 1PEYA 2PYDA 4KZPA 1BJKA 3FWYA 1E3DA 2R00A 5ITWA 2XYPA 1P1RA 3OT1B 4GECA 3V1LA 1O95A 4IKOA 3ZX4A 3A3PA 4O02B 3LO8A 5K3OA 2ZZMA 4F6RB 3A1WA 6GPBA 1CX9B 2GN9A 1F2UB 1DS6A 1LK0A 3AKDA 5JV5A 2PZBA 2ZEJA 3AF3A 1MAWA 1NURA 2OTCA 2Q41A 4HVTA 2EW8A 4MR7A 4D79A 2DFPA 4HWGA 4A8JC 4KW7A 4L5JA 2JFZA 5ILGA 4D3YA 4DNXA 8OHMA 1LRJA 4JLJA 4B4WA 4ZTUB 3USZA 1Z75A 5BRAA 5I4CA 1QHEA 1QIKA 3JRWA 1HTWA 4MW9A 3GEBA 3OC0A 4AC9A 3BJRA 5GADl 1E59A 3LDGA 3TI7A 4CL3A 1YOVA 4HMOA 4M1TA 4NE9A 3RYFB 4KR6A 3CVXA 1H94A 1WPQA 4AZ0B 4MB2A 5CDUA 1WOYA 2I6GA 3D0OA 5AM3A 5EMMA 5ICCA 3B5EA 4HD8A 3JYQA 2VHYA 3OIDA 4LWQA 3I9KA 3L43A 5FTLA 2PM8A 1J8DA 2CF5A 4ZQBA 3KHSA 3O1HB 4I5FA 4X6LA 1FFEA 4RM2A 5BN4B 5JSYA 1QIHA 4R31A 4NV0A 2ZTSA 1NR5A 2K2WA 4RVCA 1HETA 3ZWAA 2DR2A 1V96A 3I0MA 4LMRA 3T38A 1E2LA 1R0YA 2I5PO 1X9HA 1IZZA 2XCQA 4UCQA 3FF1A 3ILVA 3SGLA 4TTRA 3WYDA 4EG5A 1RQLA 1CQXA 1FUKA 1LDGA 1A4RA 4M87A 2RBEA 3GEMA 4B2YA 3PDIB 4EMSA 5J4VA 1KIFA 3VI4B 4MR7B 4XJTA 1LGYA 5CJJA 2FMKA 2DFTA 2EYQA 3EH1A 4Q19A 3EVEA 2ORED 1T1RA 1YB6A 2A9KA 3C7DB 3CHYA 2OC9A 3NVKI 2PX0A 2Y1EA 5E6RB 1U3UA 1UDWA 3M3DA 1NBME 3ROEA 3G0OA 3VPCA 3LQ2A 4EVSA 3H7IA 1YB1A 4LRTB 1WIWA 1QYWA 3NHZA 3LD9A 4BATA 4KQIA 3MJHA 1Z4KA 3N2EA 3ED5A 3VMFA 3RPEA 2GASA 3BGSA 3NTXA 5JASA 3G0HA 3COPA 1TYDE 1ZJ5A 2B5WA 1DBVO 3UC5A 4KITB 2VYVD 2ZJ3A 1VMKA 1GPAA 1F4PA 1RYEA 2YZ7A 2AG0A 1Y5IA 1A1VA 4KYTA 1W4AA 3EQ2A 4RDCA 5LXTA 5TT1A 1NNUA 1F6BA 4IWXA 3TZ6A 3M5DA 4QU9A 2CYBA 3F4BA 4Q9KA 3UAOA 5A62A 5JT1A 4O8ZA 4NENA 1ID8A 4KNWA 1U3WA 4MCIA 1XP8A 4N40A 4ZIRA 4N65A 4DLBA 2IZOA 3IQIX 3CLRD 3KXLA 1O8BA 2XZDA 2ZIVB 4EX7A 5JYCA 3DLCA 3AKZA 4KVAA 2DETA 2I3AA 3TRDA 4URZR 3I04A 3ZGOA 1E2KA 4XOIA 2Y0EA 2KLHA 4EL5A 1SCNE 2C4HA 3QWFA 3RFXA 3UXYA 1RC1A 1WDMA 4I3FA 3VC7A 1U5CA 4ZYTA 4UXJA 4QYWA 3RQSA 1FS5A 2GSWA 1PJCA 1TGVA 3KBBA 2JLWA 4RKWA 3AQIA 4YFVA 2P5UA 1TA0A 5AQEA 1H2BA 3F6SA 3NTRA 1SC6A 3P0RA 4UC0A 1EB8A 2RH4A 1TNDA 4BRZA 1ICEA 5JMOA 3I62A 2KW5A 4ZYXA 2ETXA 2CLOB 1QR6A 4RCVA 1Y9EA 2A86A 1KE1A 1KY2A 4HADA 1EWTA 3EFHA 3NKVA 1R8YA 3EW9A 2LCFA 1H2HA 3WYFA 1U0FA 2WKRA 3KOWA 5B3AA 3WNVA 1X8XA 4R1TA 2Y1LA 3CPEA 1Q0HA 1NVTA 2R8BA 2GEBA 1SQ5A 1O9GA 5LXTB 2P4UA 3EFOA 5KNDH 1OF1A 3CUWA 4TV8A 4EFKA 4IDEA 1ZJYA 2PMWB 3UUGA 4ZOLF 1ZSVA 2IY8A 4X6XA 1A8QA 3BMQB 4WK2B 3BJZA 2GOYA 5LZ2A 4MKHA 4WVFA 3OCXA 1C1HA 3OQIB 3RSSA 4BNJA 4K0RA 5C1DA 3LQ1A 2FWAA 1B15A 2VHQA 3GJ6A 5EIBC 4UNIA 4QQ8A 2P4SA 3V1TC 4ABTA 1X2EA 4FONA 2C3UA 1RAGA 1ZIPA 4F93B 3CVVA 3PR3A 4AYXA 3BAZA 1HWYA 3KL2A 3WNCA 1L7PA 4J7AA 1RD4A 3Q10A 4H17A 3AQ4A 4WBSA 5B64A 1N6NA 3OFKA 3LWZA 1U90A 3MGGA 1L6RA 1VPLA 3M82A 4IV5A 4J7XA 1QU3A 1R0KA 1X15A 4Y2VA 2PGIA 4Q37A 5H83A 3R75A 3T7TA 3B6EA 1Q0SA 3C1UA 4S12A 1ZISA 3MNFA 1P29A 2AFHE 1W8DA 1JP7A 1E3LA 2J0VA 4BB6A 3MMXA 1BGWA 3R4VA 3BK2A 3LY7A 2RHLA 2GBLA 4GYWA 3TDNA 3S81A 4OU5A 1X1RA 3CPSA 2C1ZA 4FW8A 1SXJE 4LJ9A 2V03A 3JR3A 3U40A 5I47A 2LPMA 3QNWA 1J24A 2PWBA 1DJNA 2XWSA 3AU8A 3LECA 4KGZA 3BXZA 1KAOA 4FS8A 1U0BB 3QEOA 3EFOB 2D2IA 4TV8B 1OSNA 3AFNA 2XKKA 1WRBA 5C5DA 1BD4A 4LXHA 2IOHA 1EFHA 4P34A 3OWOA 1JA9A 1T0HB 2JCYA 5F5LA 2V9CA 5HCNA 4G63A 4ND6A 4B46A 2QXTA 1BAPA 2QQ5A 4Y2XA 1WXGA 2WG0A 3JPYA 1YVRA 2FPLA 3L40A 5FCDA 1S7GA 4HYQA 3ZY4A 4EYQA 1EJBA 2HDWA 4OI2A 2YHIA 1XTIA 1RWKA 2GVNA 2YV4A 1XNQB 3VR6D 5FKJA 2X2EA 3TS1A 1UR5A 4DREA 2JFPA 1CEXA 3FWPA 1CC1S 3RTEA 4KWTA 4IVNA 4D97A 4D8TA 1CRPA 1C7JA 4MK4A 1JHZA 3NBYC 3DDHA 4H60A 4A91A 1IYZA 2VDOB 3U19A 4Z4EA 3CUVA 3SX0A 3EQ9A 1NVEA 1H5QA 1QUFA 2RHGB 3FKJA 2HX1A 4PAMA 3KV1A 2WA1A 3WKDA 2QVXX 3LQFA 1EFDN 4FI3F 2AI2A 4KV7A 5JATA 2ZI6A 1ZRSA 3I0NA 1Z2DA 3RG2A 2GAOA 3RC8A 4AXXA 3D6MA 3H8VA 3KUUA 4NMMA 5IP5A 1ODKA 4U2KA 4LXQA 1EFTA 4YDQA 3D43A 2Q2QA 2ZRMA 1S2DA 1DUSA 1RBYA 1IIBA 4AZTA 4OMUA 1KL7A 4J3NA 4P80A 2CJFA 5K2OA 1XMVA 3C1TA 4DJJA 3IDQA 1EK0A 1KZ6A 3B60A 4PV7A 2CVHA 3VISA 4GKVA 4FMDF 2IKSA 2HGSA 2EKDA 4LBZA 1VE6A 2GEDA 3SYMA 3I6MA 1FRFS 1NT2A 4Q3BA 2R7AA 4F9FA 5ENDA 3ZLJA 5JDCC 1QYVA 3PNVA 4KQ6A 4Y1GA 1B42A 1OV6A 2JLCA 2YHIB 3H7AA 2HCBA 2PX2A 2SHKA 2QD5A 2V3VA 3PFKA 3T5GA 1ZGHA 1HDGO 1ZK4A 2BI4A 3I37X 3KRTA 3W9UA 1AMUA 1JE1A 5DP1A 3UYLA 3D1LA 1OBVA 1Q1QA 3HY6A 4LC0A 1P72A 2GF0A 3TLBA 2I87A 1DEAA 5T6MA 5GJWC 2H54A 3ENZA 5LOVF 1EP2B 2O4CA 1KP9A 1E2MA 2REQA 3G79A 1JDZA 3KCQA 3L8MA 3VO9A 4YRZA 4HLDA 1XF1A 1B74A 2CSUA 1DG9A 2QMHA 3W5AA 2H17A 5IS2A 2GZRA 2IYSA 2XDQA 2ZT5A 1ULAA 3D6AA 3NOQA 5KNBA 1VJ5A 1BH2A 4QT0A 3ML1A 4FSXA 3L4SO 2Q3LA 4LZAA 3ETCA 1FVFA 4KPEC 4PGAA 4H0NA 3HYLA 1DTWA 1AO3A 1WWKA 3BK1A 5LP6A 3DHEA 1ST3A 1W0CA 3MS4A 1G5RA 3FZGA 5TMPA 2CMKA 1L5HA 2CJWA 3EXEB 3WLAA 2C92A 2H51A 2YJTD 1EJ6A 1M6VA 2BAGA 2ODAA 2GMWA 2I7TA 3D31A 2R5NA 5HTKA 2DHRA 2Z43A 1JVSA 2VYNA 5FFNA 4E5NA 2AYYA 2PL5A 1YRQA 3AF4A 3KLOA 1BRMA 5AP9A 2R9VA 2QRGA 1TW3A 2G0TA 2ZKIA 1ZIYA 2Q5OA 3CJTA 3DT9A 3E23A 4ZAZA 1T36A 4A1FA 4RMHA 4E5KA 5B7PA 1QDUA 3HV2A 5FF9A 4ZGBA 1KAHA 4BP9A 2YYAA 5DX0A 4ENSA 3O9VA 2ZJ8A 2QS9A 4X84A 1V8DA 2SBTA 1QDEA 2FUEA 1W5TA 1JPNA 2WJJA 4DMLA 2G8NA 5L6MB 3KJGA 2G71A 4XSHA 3VI3B 1WAMA 1MNQA 3KSMA 4YJFB 2QY9A 3W6OA 4JODA 4AULA 5EP1A 3T3GA 3DWEX 5SY6A 1DXOA 2QRUA 1AXGA 2OUKA 2X22A 5KDOA 3SC2A 1AGNA 3V6MA 2Q1UA 4Y30A 3BCHA 3NAGA 4DC1A 4UPEA 3D81A 3RIGA 3T3OA 1KARA 4WKBA 2FJUA 1ORHA 3GVHA 1EGVB 3JW8A 4FNAA 4X66B 4ADSG 2BMFA 4ND8A 3WNQA 2QUJA 1IXYA 1OLXA 2BR3A 2V9ZA 3MS2A 1E3WA 1H6CA 2C84A 3FFXA 1IMJA 3KJNA 3HYNA 3KQSA 3WXMA 5D87A 4FWBA 4DWOA 3LIPA 5K0GA 5LP6B 2DLCX 1WJGA 3HRIA 1IEWA 1L5HB 2CJWB 4DMUB 5H7XA 4MQUA 3VR2A 1M6VB 3ZDEA 4URWR 6ADHA 3HFRA 4GE0A 2F4NA 2AYXA 2XIQA 3RROA 4HX2A 1X1SA 4IAOA 1A72A 3DKPA 1V7QA 3EAFA 1C9NA 3G7NA 2KJQA 2G36A 5F98A 2P3LA 3MCWA 4X9XA 3RVDA 2UU9B 2JGLA 1SKBA 3U4MA 2EYUA 4ETMA 4HVLA 3G0DA 3CF6R 3DPIA 1NUAA 1MABB 4QNRA 1VL0A 4RIGA 1BC5A 2ZIUB 3TDMA 3TQIA 2P6RA 3EG5A 4CWAA 2FSFA 3E7FA 1FFXA 3LY9A 3EX7C 2JGDB 1CIPA 2VRCA 4IDDA 4TYWA 1LCIA 1GARA 1XCPA 5BW5A 4WKOA 1Z2OX 3JARA 1UM9A 4J0FA 1W19A 4N5DA 4MO2A 4XIGS 4IQ4A 5K45A 1FY2A 3OZUA 2PUFA 4BLSA 5F73A 3FUUA 7MDHA 2FK7A 1NX9A 1FW6A 4LQDA 3BT7A 3DNMA 1UOPA 1WXHA 2M1ZA 3L0IB 3PQ3A 3QHAA 4PO3X 4W6ZA 5TQJA 5E2IA 1OLXB 4YECA 1C4XA 5MGBA 2BKUA 1C2YA 3IODA 2Q45A 3RVRA 3WZ2A 1LXCA 2AC2A 4W8OA 1CY1A 1J8FA 5A9TA 2W6ID 2NZXA 3EMVA 3IEIA 3QELA 1RLJA 1UH5A 1RRPA 3FOAA 3PXDA 4NZ9A 5AOAA 1F51E 5TY0A 5G0SA 1E3IA 4CEIA 4QQKA 4KH1A 3IQWA 3QIAA 3FTEA 5JXIA 4XR9A 4KXXA 3AV0B 1YF3A 3Q2KA 1B0ZA 4HGPA 4S0XA 3O74A 4ZI5A 1PT5A 2XT9A 3LCCA 2QM0A 3Q85A 3L6CA 5AI9A 4MVWA 1ZQ9A 3H8SA 1K89A 1ODJA 1Z83A 4N5IX 3C8MA 3V42A 3IE1A 5IBQA 1UT6A 1ZKDA 3K4QA 3QX8A 5ALOA 3JWPA 5TF0A 1G5QA 3DFUA 5CNKA 3CTMA 4BB5A 2Q3EA 1U28C 2UV8A 3E48A 3GP3A 5INTA 1WB9A 4JITA 2XYVA 5ES3A 4QNNA 3SIWA 2BEWA 4L4UA 2FW1A 2BBTA 4ZVSA 2XRZA 2IYEA 3O2JA 3JARB 1UM9B 4KIGA 5FTWA 2IV2X 3SJUA 3AEZA 4A2PA 5LZ4A 1VJ0A 1XMJA 4HXYA 3I64A 4W1SA 3ED1A 5EVCA 4YUYA 1Z7GA 5FTNA 3NH9A 3RVOA 3V8VA 3Q8LA 3UAWA 1B6TA 5JMWA 1JN0A 3K70B 1OX4A 2IUFA 3BIFA 4RA9A 2H2DA 5EIOA 3HH8A 1UC9A 3NXSA 2ZE8A 3WL4A 1CYEA 2AQ8A 3JVDA 1Z9BA 1U6IA 5BW6B 1HMPA 1NVUQ 3IT2A 3FLMA 4GICA 4UMVA 4NEHB 5FR1A 3K8ZA 5JBNA 3K15A 1T5HX 3DP7A 5A6VA 1JSCA 5ALPA 3N07A 2I03A 1Q20A 4DWWA 3ZEIA 5IVHA 1KK0A 1ZWKA 6LDHA 3VPHA 1JX6A 2FG5A 4MRVA 4U4AA 4B17A 5JRJA 3KXDA 3X0DA 1XF9A 2L42A 4BWYA 5J4HA 4OGGA 1SVMA 1L8OA 2WWFA 4MPTA 1UKAA 1E94E 1EVKA 4DLUA 4AD8A 4F9GA 1MT0A 2WTXA 5K9ZA 1Y6QA 3DAFA 2DB3A 2BHRA 3IP3A 2K87A 2P0YA 3KALA 3KUKA 4FKZA 4O6VA 3K6SA 4ED9A 2FZWA 2FMUA 2GDJA 4YNBA 4AY5A 4LAFA 5FPHA 2HXGA 4H59A 4BQIA 1KETA 2ZG6A 3PP8A 1GR0A 4ER0A 3IX7A 4L9WA 2BEWB 2GEJA 2VUTA 3DWFA 2UXDB 2FK8A 3FYDA 4K1LA 2PD4A 4PBSA 1IRXA 2QJTA 4GXNA 3TAUA 3L5KA 3QFFA 5K3SA 3B7PA 4P58A 1YASA 4PHFA 1HI9A 3AVWA 2JDIA 4XJVA 4LDRA 3T1QA 1VSTA 3U0BA 1EM8B 1AV6A 1OX4B 4FE4A 5DHPA 3X1WA 2ST1A 3FNEA 4O3FA 4KMMA 2A84A 5KYUA 3SZGA 3SQWA 1R7RA 2QBYA 5DM60 5C1IA 4ZO7A 5DNAA 4JI6B 1Z63A 2FMFA 2ZYAA 2UZIR 4PQEA 5JNUA 4B2LA 3PUJA 4JOBA 1U8XX 2VNIA 2GJ4A 4TXHA 2XXBA 2W2XA 4MVJD 4D0LB 3VNSA 1UBRS 4E30A 4OFBA 2A57A 3KQLA 2ES4A 1QV6A 1SWVA 2WHPA 3B6ZA 3LY5A 3H4TA 4QJBA 2PZLA 5BWBA 1W36D 1SHJA 2II6A 3K6SB 5K3FB 4CE6A 2G1JA 1P2FA 4DA0A 2J3QA 1XZFA 5EWJA 5AMXA 2EXXA 4IIXA 1K6XA 3DEFA 5CVEA 4AJ1A 4CUKA 3HK2A 4KAFA 4D4KA 1G5HA 4EGCB 2JLXA 4UHCA 2R2AA 4IUDS 2QUAA 1AN0A 3RAFC 1YA6A 4J1TA 4OI1A 2ZB7A 3ND8A 4M8SA 3PQ5A 4KUHA 4HDOB 3HBNA 1YQEA 3LPCA 3I53A 1Q7CA 1ZR4A 1PGNA 2FPIA 4PHHA 4E12A 2BIFA 3VR5D 4D56A 1XNHA 1OWMA 4RLQA 4YP1A 4DRXA 2NO4A 4CIAA 3B6JA 2Q5HA 4GZLA 3T4EA 5KYUB 4HV4A 3X1YA 4JA2A 2QBYB 3L8CA 1GUYA 4BE7B 1Z12A 3DE0X 2O8VA 3MQFA 2Q1XA 5FA6A 1E92A 4G4IA 2BKVA 4ASUD 1KA9H 4XASA 5ISMA 3TD9A 1ZESA 4OKNA 5AK5A 4L7VA 2JCGA 3TB6A 4JQOA 4BO5A 2H8GA 7MHTA 4KXWA 2HLDA 4PYNA 1WCXA 5LMZA 2XA2A 2C9OA 1IN8A 1JEOA 5EI5A 1OT3A 1KJJA 2EAUA 3DMDA 2N42A 2WHPB 1FSSA 1M8GA 3O03A 3F6EX 2D1TA 3MGBA 1Q92A 1NF3A 3BA1A 3BXOA 1WD5A 2Z9DA 3GJXC 4IGIA 3VVBA 3VJLA 4EVQA 4JB2A 1WZIA 1VSBA 3BXGA 1ADYA 3KZKA 4G2TA 4RQBA 3QU4A 3RVJA 4BX0A 3O8CA 2OZPA 3IDOA 3TCNA 1MG0A 2W2OA 4O1HA 2BBOA 2PH3A 2IH2A 3RNOA 5KOHA 4Q9HA 3RADC 4RK0A 1XMSA 4YQEA 4FGSA 4CN9A 1TD1A 3W5JA 3X1XA 4U02A 3B3QA 5EHZA 2NUTA 2PZFA 4X7PA 2HZBA 2EZTA 3RF6A 5DCYA 4MRNA 1T5OA 2FPIB 3W9SA 4BJ5A 5IBCA 1B3RA 2WC1A 5SZJA 5CDFE 3VA7A 1E3QA 2ZIWB 3CU5A 3V9PA 2ZRKA 3VKHA 1UJ2A 1GL3A 1NN1A 3ITNA 4PYLA 5IHPA 1M2NA 5IT0A 5F76A 4CYMA 1X1CA 3BOSA 4BB9A 2GYYA 2PRJA 5D2CA 2VJOA 1OQAA 2Z08A 3AB8A 3SP1A 4YMVA 2H9AA 5CVVA 2CVOA 2IY7A 2JATA 3RV3A 2NZ8A 4GC5A 4HDAA 1O1YA 1UMBA 4MA5A 4QUIA 5JXJA 1KFKB 2BFDA 3C3WA 4EHKA 5KPJA 1Z8DA 3D8UA 3DVRX 4PRKA 4JZKA 3ROXA 2A5YB 4JVSB 5F2OA 4JP1A 1TUIA 5F52A 1OD6A 1YQUA 2RARA 3TTUA 1QRAA 4Q3OA 3M1IA 3W8DA 2J6BA 1M6HA 2O05A 3CKKA 3TECE 4Z51A 4PRLA 1NM5C 5BVGB 1XTSA 3BREA 4EA6A 3DZIA 2X0FA 5BNZA 1WF3A 1NBMD 2A0FA 2GYWA 3P4UA 5TPWB 1JAXA 3AVQA 3OSUA 4ZKDA 5KJFA 4YPVA 5L7WA 1HFWA 2MSDB 2X15A 3PC2A 2XTZA 4UXIA 1X7GA 1YV9A 2NU6A 3KYBA 4QEKA 4D41A 5JY1A 5KMGB 3QWBA 4JBNA 2G08A 3E5MA 4PAWA 4V0ME 4CM1A 2BGUA 1H1LB 5DN6D 3RUAA 1U4NA 3HCBA 1ZONA 1HE4A 3QX9A 4L8LA 1YZGA 2DYKA 2O50A 4P98A 5ALUA 4ALJA 4U9IS 4EVIA 2AFIB 1B16A 2JHPA 2DERA 2XRMA 1BXGA 3WIOA 3UOAB 1JBEA 3UMMA 2OSVA 3OOHA 4FB5A 1UMBB 3DDCA 1XXHA 2XNJA 2BOVA 4YCMA 3MAJA 3E9NA 1G64A 1HUQA 1D07A 1KSFX 4II7A 5E9JA 1N7IA 2WWTA 1W93A 1MLDA 3DMHA 4JP3A 3TBHA 4B8ZA 2IPMA 1CY7A 4FQ8A 4TKVA 3CNHA 1SC9A 2L18A 5DB4A 3TG2A 2Y0DA 4KRGA 1NG9A 2VDWA 3DC2A 4M3NA 4QTXA 3I9MA 4DA4A 4HB3A 1NVMB 1WVGA 2EP5A 2JPDA 5CX1A 1M66A 2A0KA 1E79A 3F9RA 1HT3A 4R1UA 1MCZA 4WAUA 4E3ZA 1HEYA 1AG9A 1Z2AA 3U4AA 5A0TA 3RS4A 1TRKA 1CP2A 1SN7A 5IUNC 3ADPA 4FSHA 1GAEO 2FAXA 3HB4X 1FFDA 1HRKA 2IU0A 5AM2A 2J9XB 1CQZA 2F17A 3LA6A 1JA1A 3OECA 3OIGA 4NNJA 3PC7A 3M9WA 4NCBA 2FJPA 1REQA 2K6GA 4KHZA 1RE0A 2X7JA 2XF2A 3PKZA 5I9LA 5BRNA 1Y9DA 1P1FA 4LJLA 1WMSA 3EWAA 3KKNA 4MIKA 1ESMA 1VA5A 4BFTA 4JI7B 3M6XA 2D1YA 3GRZA 2Q3DA 1WP4A 2A7XA 5HHTA 1MC1A 2FRXA 4UBJA 3FUCA 3KK0A 3WK8A 3RTAA 3AG5A 2X19A 2QLLA 3AJ9A 3DGEC 2VDRB 3G2OA 1V16A 4MARA 4DCCA 4K9RA 1BXGB 1RU3A 4BN4A 2ZRJA 1Y9AA 4GG1A 4X8MA 2DTDA 1SCUA 2OORA 1XDSA 3NEPX 4I4CA 4NC9A 1MAUA 3SBXA 2CXOA 4H1UA 1XA3A 4TSRA 3SX2A 4H3KB 2YZMA 2HUNA 1LS1A 5CFQA 1RJFA 2JI6A 3K5IA 3IT3A 3HJHA 3H86A 5FXMA 5EJEA 5IAAA 3HDTA 3ZBTA 4DBLC 1QHFA 2H4ZA 1XZNA 5HK9A 1KAQA 1KFJB 1JB1A 1YJ8A 1DXHA 2ODPA 4MPPA 2YFQA 1WKVA 2XB9A 2V1UA 1UC8A 2UVQA 3DDWA 2WWWA 4BVFA 4F91B 2ZJOA 2YJ4A 1X8JA 3I9JA 1K75A 3O31A 1BYUA 3ZDFA 1K3FA 3MTIA 3W5HA 3X43A 1B0UA 4WESA 4ZANA 5AW1A 1EFCA 5FO1A 3AF6A 2BJWA 1SXJD 1YBHA 3MWGA 3VSEA 4DLPA 3BMNB 1OVMA 3LBAA 1TMYA 3VUEA 3G88A 4Y2JA 3J80A 4UVGA 1DVRA 2B1JA 2DWQA 4FYMA 4HDNA 4A23A 3EOZA 3UB2A 1I3KA 4I14A 3BICA 4BKMA 3HR4A 4GXRA 1OC2A 3BFPA 2QJOA 1RKVA 3O2SB 4JQYA 2YTZA 1SCUB 2XCIA 4CQLA 3FNHA 3FE2A 2AA3A 5CR9A 4YT8A 3NBKA 3WLRA 3OTGA 2HJGA 2W2KA 3BH6A 1NXWA 1ZD3A 1T5SA 5CT6A