1H66A

Crystal structure of human nad[p]h-quinone oxidoreductase co with 2,5-diaziridinyl-3-hydroxyl-6-methyl-1,4-benzoquinone
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
273
structure length
273
Chain Sequence
AGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H DEHYDROGENASE [QUINONE] 1
publication title Structure-Based Development of Anticancer Drugs: Complexes of Nad(P)H:Quinone Oxidoreductase 1 with Chemotherapeutic Quinones
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 86
structure length 273
sequence length 273
chains with identical sequence B, C, D
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2001-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1h66A00
3D7NA 3F6SA 4QOHA 1YRHA 3EYWA 1AKRA 1YDGA 2FX2A 5LLDA 2BF4A 3FNIA 5LBTA 1AHNA 1ZX1A 2Z98A 3EDOA 2V5UA 2AMJA 4LAFA 2FOXA 2QMYA 4YAOA 1FTGA 3ES9A 1AZLA 3G5MA 1FUEA 4YAWA 3GFSA 2B3DA 3OJXA 3FX2A 4H2DA 4C0WA 3ZHOA 1B1CA 5JROA 5F51A 1QRDA 1DXOA 3OX1A 1DX9A 3TEMA 4YALA 3NHFA 3O73A 5EMNA 1F4PA 2GSWA 5LJLA 1DXQA 4U7HA 4QOFA 4U7GA 2BZSA 5B3LA 2M6SA 3N39C 5B3KA 2FZVA 2QWXA 2QX8A 1JA0A 3FJOA 1FX1A 4CF6A 3W7AA 1H69A 5ULLA 1CZLA 2FCRA 4BMPB 1D03A 5NULA 4GI5A 2R96A 1J9GA 2QX4A 2V5VA 1D04A 3HA2A 2HNBA 3OVMA 1JA1A 2QMZA 3LT5A 2KQUA 1AKWA 1FLDA 4QOIA 4QOJA 1KBOA 3OX2A 2XOEA 3ESZA 4QOEA 4U7FA 3W79A 1FLNA 3B6IA 3HLYA 2ZKIA 2MTBA 2Z9BA 5F4BA 1XI2A 4FX2A 2BN4A 1CZRA 1CZUA 4HEQA 4D02A 1BVYF 1YKGA 1AG9A 2Q62A 1GG5A 3QFCA 3L9XA 4OXXA 3NHWA 2FAXA 2HNAA 2OHHA 1QHEA 3UXEA 2M6RA 4QODA 1J9ZA 1RTTA 1T0IA 2KLBA 4LA4A 2W5UA 4DIKA 2WC1A 4XDGA 1RLJA 5A4KA 1QR2A 1C7FA 2Z9CA 3N3BC 4ZVMA 3KAPA 1YCFA 2Q9UA 4H6PA 3QE2A 2OHJA 4YQEA 6NULA 2A5LA 1V4BA 1OFVA 3GFRA 1FLVA 4PTYA 1T5BA 3K1YA 3F90A 3OX3A 2QR2A 4J8PA 2F1OA 5LBUA 1ZWLA 2FDXA 1AKUA 3NHRA 2OYSA 4S24A 4YAUA 1WSBA 5LJIA 1TLLA 4PTZA 3K20A 1AKTA 2BPOA 2V9CA 4C14A 3RPEA 1XT6A 1YOBA 1QBGA 4QOGA 4N65A 3S2YA 5FA6A 1D4AA 2N1MA 1SG0A 3NHLA 4LTNA 4FGKA 1C7EA 4Y9UA 2FZ5A 3NHJA 2X2PA 1YCHA 4ZVNA 3NHKA 1FLAA 5EA2A 4FGJA 3P0RA 3NFRA 1CZHA 4CETA 3TZBA 1XYVA 4N9QA 1X77A 3B6KA 4C76A 1BU5A 2HPVA 3QFRA 3GAMA 1J8QA 4GQIA 1CZNA 3NHUA 4ZVKA 1VMEA 5EAIA 5BUCA 4HS4A 5TGZA 3GFQA 3NLLA 4LTDA 1OBVA 2XODA 2ARKA 2R97A 4DY4A 3B6MA 3R6WA 3U7RA 1FVXA 5F12A 2MOKA 1CZKA 4ICIA 3L9WA 1J9EA 3JSXA 4XDHA 3LCMA 3OWHA 3ESXA 2Z9DA 1XYYA 3NHPA 3NHSA 2FLVA 3W77A 2QX9A 1RCFA 4FGLA 4M0CA 4N82A 3F2VA 4GR9A 3TE7A 3UXHA 1NNI1 2RG1A 2X2OA 1YCGA 4NLLA 4NULA 1ZWKA 5FX2A 3NHYA 2OHIA 3O2NA 3B6JA 4BMOB 4LTMA 2D5IA 4Y9RA 3FVWA 1SQSA 5FUQA 1E5DA 1WSWA 1AMOA 2FVXA 3W78A 3KEGA 5LVAA 1AKVA 3HR4A 3FW1A 4F8YA 1AKQA 3N3AC 1I1OA 1RLIA 1OBOA 3KLBA 4ZVLA 3OWXA 4ESEA 3SVLA 1H66A 4YAFA 1CZOA 2MT9A 5LMCA 1TIKA 4Y7CA 3F6RA 4C0XA 3ESYA 1KBQA 4PU0A 3OJWA 2BMVA 2QX6A 3U7IA 5NLLA 2MWMA 4R81A 3KAQA 4DILA
chains in the Genus database with same CATH superfamily
4FGWA 4RSGA 4HDSA 2XYRA 3HXTA 3OO1A 4PLWA 4KJXA 2ZBRA 1HTWA 4OI0A 3O95A 1E4OA 3QA3E 1N3YA 1W19A 1DUSA 2QG6A 3B5IA 2I6UA 5HQJA 2ZUVA 3SE0A 4BWGA 3QUBA 4JFAA 1DKQA 2ZJZA 4MQBA 3IE1A 3A70A 3ER8A 4IIJA 1AHNA 1CRZA 1GRVA 3UGJA 4GI3A 1QNLA 4M22A 2HLDA 1KE2A 4OJKA 4Z1MD 5BUQA 5KTYA 1KEZA 2FJ0A 5T8KA 4X1IB 1G2QA 4IJUA 5JSZB 2X1HA 1Z45A 1DCMA 1GNVA 3PPYA 3T7KA 3R4CA 3KQQA 5EJMA 3CEAA 3FUCA 4OM8A 2NU9B 4ZCSA 1R6UA 3I3OA 2QLMA 4ISBA 2KLHA 3LD9A 4BX0A 5ERGB 3R5JA 4JLPA 2YYZA 4EB0A 2FG5A 1T0PA 3ITDA 4RTNA 2XVYA 4RTMA 2X86A 1FP4B 2I6TA 1N2CB 4WZBB 1VHQA 1RC8A 4JEMA 2REXB 3LC0A 1HYEA 2NZXA 1NVVQ 3SCZA 2CT8A 5BVGB 2QRQA 1YRQA 2RGBA 4G9GA 3O8NA 3PGMA 5H83A 3B7GA 3IILA 1C7QA 4I4TB 2J9FA 2WPNA 5J5AA 4IQGA 1WSDA 5BMOA 2XYGA 1NT2A 2V74B 1TPYA 3BRWD 4QREA 3X0DA 2P77A 2RBEA 4EUSA 2QT1A 3I8OA 4P93A 2GD0A 2FP3A 3RJZA 3EPLA 4BY9E 2PSJA 2MSNA 3BD8A 3AF5A 2WJWA 4G5XA 4ALJA 3HADA 1JTFA 5I3ZA 1KIFA 4GZLA 2PGXA 4U7WA 5HBRA 2CV1A 3GLHA 2JJ2A 1AZWA 5KWIA 1WZNA 4RHXA 3HUDA 2IITA 4QO7A 521PA 3KZOA 4RVUA 5FWNA 3IEPA 1DTWA 1TU4A 4FJ1A 4XIGS 2Q8QA 2JBHA 3T3MB 3GOQA 1QZXA 2Z56A 3HZOA 2CBGA 2XVXA 2CVZA 4RKYA 5JVDB 3VXKA 2OHFA 1X42A 4DZTA 1QVZA 3UAYA 3VAAA 1VBNA 1CB0A 1DXQA 2AFIE 2QT9A 4I5DA 1L0BA 1IY2A 3PSAA 4RJJA 4DADA 5TPZD 2BGUA 3T7EA 2BZSA 3WBFA 4HYTA 4EGFA 4HYEA 5ALMA 3SOPA 2BYTA 3EDCA 2FZVA 4QGBA 3RW9A 1CJSA 4PAMA 1ULAA 4XLLA 3U17A 1E3MA 3UQZA 4X1YA 1HQCA 2HPZA 2VP5A 2I4RA 3IQWA 4KPFC 1O4VA 1MH1A 5CB0A 2DQZA 2Q46A 4Q4AA 4RZQA 1JL3A 4WLVA 3RUCA 4MRMA 2J30A 4U8HA 3ZHBA 4RSHA 5JAPA 2AN1A 4UBNA 3FRJA 1EJ2A 2W6IA 3OU6A 1SCIA 3WFIA 3UFXA 1LFDB 4TKLA 1XZPA 4QDZA 4PXAA 4ZMSA 1NI4A 4QQNA 3U7HB 1N2EA 1VL2A 3CNNA 1XD2A 1MOPA 4Y18A 5B58T 2QUHA 1BE6A 4G4SP 2RH8A 4AFNA 2CLEB 1MX1A 3HVHA 1Z39A 3I6BA 1CUIA 4FCVA 4H0NA 4UW9A 1NQWA 5B4UA 3KWJA 5DH9A 5PNTA 4ZDWA 1R9JA 2ZRJA 1F1JA 4EITA 2F3SA 2G0AA 1QO9A 1Z6ZA 1PWZA 1P1CA 1E2JA 2YXPX 3EH1A 1RWVA 4KIGA 2P9FA 3FWHA 5HG0A 4GSLA 2IYSA 1YJ5A 1C0LA 2NVBA 2WSLA 5DKFA 2HR1A 3W79A 3LOUA 2OD9A 3ER9A 4MO9A 1PTKA 1XP8A 3SXJA 3WIUA 5KWVA 1I6MA 1KY2A 3WB1A 4DCNA 5DF1A 4KWHA 2BEUB 1KTVA 3LQ1A 1XNQB 3DVQX 4LN1A 2OB1A 5KHLB 2G5GX 1CERA 5L7WA 2M32A 3V7YA 3L8DA 5KNDH 1OXMA 1PV1A 2IZ5A 3CNQS 2WIGA 4FMCB 1J56A 4G5YA 2RI1A 4Q1EA 4RIHA 4B2IA 1ZJZA 3TBFA 1NUTA 1B26A 2GILA 2IZ7A 4CJXA 4BNMA 2XSZA 1RS0A 2LVBA 2G9NA 2BZ1A 2YYYA 2J33A 1NMEA 1MV8A 5SZIA 1IDOA 4PIMA 3RVLA 3U3JA 2WNIA 1YWGO 3LQRA 3QFCA 3VVBA 1BS1A 1U2GC 5LM3A 2BH2A 3G5UA 3IJPA 4WBNF 2DWOA 3G6WA 1CHDA 1NJ2A 3NAGA 4I6EA 4BRWA 3L0SA 4EBBA 1EEHA 4QM6A 1U5CA 4OQFA 3I9JA 1EH5A 3E1KA 1GYRA 2YXLA 1ILEA 1FYEA 4MVWA 4ZV7A 3BMCB 5LZ8A 3RHZA 1WBJB 3HJHA 2PZJA 3ODGA 3TZKA 1NVXQ 1P9RA 3EXHB 3P0IA 3AEQB 3RBVA 5A5GA 1ULSA 2M6RA 2DFLA 1KO1A 1VJ0A 3A37A 1FMTA 2H31A 3KT3A 3KTAB 5LNK6 2I6QA 1ILWA 2JH9A 1X14A 3DL2A 2CHVA 3IAEA 1W4LA 1IFXA 5DEIA 5IAAA 2DULA 1QHNA 1XKXA 3TR6A 3QE9Y 1PNOA 3E0QA 2BEJA 2VHYA 1NSFA 4A36A 2CE7A 2ZUFA 1EVYA 4OMCA 4C08A 2R6CA 4RF5A 1Y7TA 4CIVA 1PT9A 3GT3A 4E32A 5IXSA 4QE3A 2H57A 1E69A 5D86A 3R7NA 4URWR 2FTKE 4L15A 5G1OA 4KDEA 1WPQA 2BFBA 1GGNA 2GO7A 2JGJA 3CUVA 4CQMB 4I5GA 1VE3A 1YCFA 3C3EA 3GJRA 3HB5X 4PO3X 3IEVA 3ESAA 4BLPA 3ABZA 1EUCB 1XR3A 1YAJA 3IX7A 1HM5A 1SCAA 3MJHA 3MWEB 3OIUA 3PEUA 1JPUA 1SA0A 4OK6A 2ZPUA 4L3WA 3BTUA 1SIWA 3NAQA 5EJ2A 3WJ7A 4EHIA 3C4JA 5F64A 2CLKB 4EATA 4C9BA 2J31A 4H15A 2QE7A 3LV8A 3M4YA 1JHRA 1X9GA 2VZ8A 5DM2A 4IKOA 4O0LA 3TUIC 2ZIUB 3ERCA 4TLBA 4BO3A 3LBHA 4L3VA 5F9MA 3WMWA 3G2LA 3IIMA 2PMEA 1C14A 2PWBA 1ZITA 4GMGA 1L4YA 2V7VA 1JMKC 3QVSA 4GVLA 2QXTA 3WI7A 2ODWA 3FVQA 1CUBA 4R84A 2QW1A 4D8TA 2I80A 4Z49A 5I01A 2OV4A 3ZJ5A 1T5BA 3IBYA 1M6HA 1BGVA 1K7SN 3DT6A 3GLUA 4FHDA 3RC2A 3WIEA 2I8LA 3NEJA 2YFQA 3PCRB 5JFGA 4S0XA 5DTEA 4NL4H 4ECEA 3GV0A 2ZM6B 3QIAA 3GRUA 2RGAA 2VDVE 3PXGA 3QNMA 2I76A 4YRQA 2HGSA 1MZPA 3OZTA 2H1FA 1OXBB 4FEYA 3HNOA 4D43A 2FKNA 4KLNA 5B30A 4D0GA 1WCIB 3ELUA 3IR7A 1DAIA 3U6BA 1FSPA 4YT4A 1UBJS 5KNBA 2F55A 1GTZA 4YASA 3NZEA 4RSRA 3U3KA 3V3TA 3Q8WA 3GT4A 4L4UA 3ROXA 5DMHA 4BV9A 4X97A 1QG0A 3JSAA 3ETDA 2CN1A 4XGQA 1H4TA 1WSBA 3TAXA 1J8FA 2GA8A 4PHTA 3P94A 4UPEA 4L51A 4YRDA 1T10A 3AHGA 3LYLA 4KWCA 1P0IA 2FYTA 3FGPA 2KPOA 5T8KC 4OLFA 1ZG3A 5CLJA 3IT0A 1A9PA 1R6AA 3WGUA 1J6UA 2C0QA 2CD9A 3SGLA 4A27A 3AKDA 4QOGA 3QPDA 3ZWCA 1O95D 4DDMA 3MTDA 3N2YA 5CB6A 3TJRA 3ZHTA 1PS9A 2VF2A 2WWRA 5KIAA 1JFSA 2B0JA 1IK4A 4RM2A 2E4VA 4L0MA 4C89A 4C7XA 1I2MA 5LD2B 2I55A 3DPSA 4R7TA 1X1SA 3DE4X 5C5IA 4FQ5A 3ZIAD 4X65B 2ISSD 2OUKA 4Q4CA 1MW8X 2F8SA 4BKUA 1DAFA 1E2LA 5EVJA 5THXA 2P2DA 3GAZA 5FRDA 3QF4B 1Y63A 4H3VA 4Z3DA 4YY3B 2G9VA 1T8SA 3B1KA 2ECOA 2QTFA 3ADOA 2D7CA 4MIKA 4C0SA 5BXYA 3A6DA 2BRUC 3CF2A 3WGZA 4WOJA 5CVVA 2NO0A 5J47A 1V8DA 3HKEA 2H17A 3K1JA 3BXHA 1NUQA 5AM3A 1XVAA 4ZCLA 4FGJA 4RC9A 4HRVA 4P86A 1Z62A 4MPRA 4E2WA 4BUCA 2XI4A 3SS9X 4QNMA 3ZJYA 4D9HA 2BJHA 1X77A 4RTKA 1ECLA 2VYCA 2EEZA 2QOEA 2WYOA 1GRQA 1UFVA 2W6JA 3DDSA 1WV0A 3SDSA 3R1IA 4YDQA 3DXYA 3P9RA 1YZHA 3ZY5A 1B0AA 2QRNA 3EYAA 4RA6A 4X3PA 2L19A 4R5MA 4KI7A 3KKLA 1IMOA 1X92A 1GPAA 3VYVA 3LP6A 1I1HA 3SF0A 3ZXIA 4LHXA 2J6BA 3RVDA 1UKAA 4HS4A 1A8UA 1BXGB 1R50A 1WXGA 3MXOA 3IEIA 2Q3JA 4NE2A 2W2LD 3FVRA 4WI1A 5LIRA 5B1SA 4GP6A 5JATA 2JLWA 2FWMX 2Q4RA 5U9CA 2BTOA 5TLSA 5FNVB 2QLNA 2VZEA 5TPWA 4DC0A 3KYCB 3QU5A 1GSHA 3KQMA 4UAJA 5K20A 5JNTA 4DCUA 3DUWA 3EPJA 4WXEA 3O8QB 1M2OB 1L4EA 3T7CA 2O57A 3U5ZB 4RK6A 1YZKA 1PQWA 2E6KA 3JU3A 2GPSA 5HIAA 1DE0A 2XNKA 3BSSA 4OYLA 3KR2A 1NP7A 4C4XA 4PYIA 3P2KA 1YS6A 3KRTA 2GUWA 3BH6A 4TLMB 2FWRA 2O8CA 1F2TB 3VGJA 2NYUA 1SOWA 3LJKA 2BCEA 4B34A 4BNWA 4JHLA 3AF0A 4HTAA 3IP1A 3PNVA 4LNUB 4GBED 3ETGA 3GVIA 5AUOB 4Z4IA 3A28A 2RG7A 3ZIUA 4OFWA 2L18A 1YE5A 1PHPA 3QLJA 3ZG6A 3WDMA 1GQYA 2BDTA 4TS3A 3OFJA 1TECE 2YWJA 1PR4A 1BXRA 4WZAB 2GH1A 5DNVA 1HDOA 2X0NA 1ODJA 1QYIA 4NAHA 5DWQA 2W8BB 2N42A 3BXXA 1PL6A 4ITVA 2VJKA 5KC8A 2ZZNA 4PTLA 2GAIA 2XNJA 2QAIA 1RZ3A 2BCGY 3PT5A 5EJ5A 1RZRA 4N0DA 4M8NE 2C1XA 4ROTA 1W47A 1Z34A 3BTVA 5D5HA 3IAM6 4EHDA 5M5BA 5EG5A 1QH1A 1U1FA 3KKMA 5AXCA 5CYPA 1RI5A 3QXSA 3PI7A 3QXXA 1PBNA 1ZM2A 3NBAA 4HUQB 4LI3X 5D01A 2BSQA 1HNWB 3SLRA 1RRFA 3TVDA 1Q2UA 4GGMX 3M6VA 3EGCA 3TIVA 5L3QA 5SY4A 3IAS6 3P9ZA 4INZA 1K63A 4V38A 4YJ3A 1ZN7A 4DNFA 1JEYA 3AVTA 1TW3A 4MV0A 5IJ9B 1UK7A 1PZFA 2F3PA 5CDGA 3U4IA 1V3TA 1M1YE 2J4FA 3IUBA 3LKVA 3DLAA 3ETLA 4ZP1A 5JBQA 2DB3A 3JQ8A 4LXYA 2UVPB 3FCXA 1VKJA 1VIDA 2X4LA 1D07A 2Y4NA 3KQOA 3KLPX 4LIPD 5K3CA 4FZVA 3NHYA 4MYUA 4OKIA 5AKLA 4DIMA 3TQTA 5MN4A 4UVEA 1WIWA 4M1OA 2IYFA 4HH4A 1CUSA 4KYUA 4TZTA 3SFZA 4EO9A 1URPA 1U90A 4LY3A 4RD3A 3GJ3A 2H51A 1TKCA 1TCAA 1IWBB 2IPNA 3D7RA 1G3MA 1R8QA 3AZPA 3PQCA 4RD1A 4LG1A 5FYQA 1TJ5A 4CIYA 5KINB 2XGSA 3BBPA 3G9XA 3KDPA 1G59A 5DJ5A 1R8XA 3DTVB 5CM9C 4KR2A 2G80A 4TMZA 4OBEA 3FHTA 4GZMA 4OHMA 4J75A 2AD1A 3EQ2A 3R2JA 1KDOA 4PPFA 3BHIA 5C9ZA 3BRQA 3W5BA 3KUKA 3M5CA 2RDMA 2OZLB 1QC5A 3OJLA 1N5LA 2AHRA 3NKFA 4PC1A 3ZV4A 1CJUC 1KSFX 2WTAA 4MV3A 1JQLB 1KQNA 1XVTA 2VJLA 3F3YA 4B74A 2C7GA 4CKBA 4OX9B 4NXNB 4G1FA 1Q0HA 1YQQA 3BK1A 4TQAA 3JAWB 4J4HA 2OCPA 3WMRA 1EDZA 1EVZA 4RLFA 4ZA2A 1L5GB 2OCBA 3U1VA 4A0QA 3FOCA 3JZDA 3SHQA 4B3FX 3NU1A 4PNHA 3FNEA 5CEFA 4OAOA 2RBGA 1XZFA 4MW1A 4YTEA 4PSCA 1XPJA 4MH0R 5ICCA 1R27A 2FFQA 3FSGD 5JH7B 1L5WA 3BICA 5CW2A 4QGSA 3S8EA 4RQBA 4X24A 3EHDA 2ZYHA 4GE0A 3H9EO 2NZWA 3WQBA 2ZR7A 2ZB7A 3L5OA 1OPRA 4BPRA 4GAEA 3OD1A 3UWOA 3GFVA 3ESYA 1KYXA 4GSKA 5FP0A 2HWUA 3K0FA 3KU4A 1HETA 2ZE8A 3VYUB 2ECKA 4HMPA 3RIMA 2HMVA 1TU3A 2PM8A 1FPMA 2B37A 4CI0B 3ZW7A 3Q9NA 1ISMA 2R8OA 1GSOA 3R41A 3URMA 1Y1SA 5HEKA 3O8DA 1H6CA 2HA0A 2ZDHA 4RHEA 3GGCA 1LTQA 5ALDA 3SG0A 1OXTA 4MINA 1RI4A 2Q5CA 5CM2Z 4WLUA 2VPPA 2I3AA 1AGRA 1AHPA 2XZOA 3VC2A 1AKEA 1OMOA 1SXHA 1Y5MA 3AU9A 2QD1A 5H02A 3I53A 3ZDZB 3SEQA 3H11B 3VYSB 1YDHA 4P4LA 4MUIA 4GNRA 1DUVG 5FTKA 4ER0A 2C5SA 4II2A 5IS2A 1W52X 1XD8A 4M3NA 4BCDA 4CE6A 1HI9A 1V8FA 4A2PA 5C51B 2AFHA 3GQBA 4JUDX 5L8VA 2OXIA 4O1MA 1J24A 1KZ1A 1QGOA 3KHTA 3RC3A 2C7VA 3BOSA 1TAQA 3FMOB 4NPCA 5KYVA 3SIRA 4YRSA 4Z7OB 2DETA 3HTXA 3SXUA 1ZX1A 3NBQA 5GJBA 1CRQA 1WXEA 3IMCA 1U1EA 4J7UA 3U9TA 4EBFA 1DGQA 3H9UA 2PQ2A 2BTQB 4ZTUB 3PFFA 1THTA 1EXNA 4MO2A 1WMFA 3WO0A 5F73A 4RTOA 4NZNA 3QI7A 1N8TA 1ZQ9A 2FSSA 4HDQB 3NO4A 4K1XA 4HGYA 4PV7A 3IUSA 2Z5FA 4YRNA 5KSOA 3LPNA 2P3QA 2ORIA 4OFBA 4RY9A 2ZYAA 2FW0A 5DM60 2LE0A 2FQYA 3PRJA 4MVJG 2R7LA 3C4QA 1FUEA 4OL9A 1Z4IA 3FOWA 3NIDB 3A32A 3JQ7B 3O1HB 2B3DA 3D7MA 4O2AB 4LHSA 3S5JA 1YVEI 1FS4A 1FRZA 1SR8A 2Y1WA 3DEZA 3QBEA 3KPWA 3LO8A 4RSMA 5TNXA 5E8RA 3P0JA 2ZB3A 3H3FA 1C9JA 1H2HA 4I9UA 4YMSA 5IDQA 3UPUA 2WLTA 4B33A 1B8NA 1XFAA 2F67A 4PCUA 4XRRA 2ZWVA 5KHAA 3FH0A 4MMXB 1CSEE 1E5LA 3LGSA 3WB2A 3ZWXA 4LEIA 3LE8A 4Q05A 4FZ5A 3WKCA 1KMHA 2FN4A 2R6HA 3LVQE 5E1MA 4LHYA 1WUIS 3VYRB 4A5OA 5K0BA 1V9LA 5ILQA 2L82A 4DT1B 2UVQA 2D54A 3OETA 3VDXA 1NFFA 4UASA 1H23A 2VSNA 4A03A 1J8YF 4WTOA 4YBZA 2XUOA 1B73A 5IUKC 5IW8A 3MINB 3F5DA 4IDFA 3MN1A 2VTEA 1RAFA 1RHKA 2JA2A 3DHVA 2I4OA 5PGMA 2WINI 1ZUNB 3ZS9A 3QU7A 4JFRA 2VDMB 4BVLA 1GFIA 1PP4A 2M1XA 3GZTB 1TJPB 2DFNA 1FX0B 2G06A 3N05A 4KLRA 4ZEOA 2ENUA 5JQWA 2WEKA 3DHYA 2PRJA 3IP5A 4G9BA 4DM3A 1U7DA 1SUAA 4OEHA 3HXOA 1QF9A 1JLLB 1ESDA 2D7JA 5T67A 4O29A 4TLCA 5A4DA 2GM3A 3EVAA 1OV6A 3I52A 2AC4A 5IC6A 3WDKA 4KTVE 4M38A 2QMHA 4TM7A 3L40A 4X61A 3GXBA 4D57A 2R5FA 3N39C 1OX4A 2JFQA 3COVA 1UC4B 2A1UB 3FJOA 3IQEA 3VV3A 4DM4A 4OO3A 4RULA 3KKEA 1BDMA 2IWRA 3D8SA 1FFDA 4UTOA 2H7VA 2C78A 3KKQA 2EFEB 3ZTTA 2C5BA 4GI1A 1FVFA 3HB0A 4H4CA 1WULS 1VG1A 3IE2A 3NBXX 3R75A 4CQMD 1QHHB 3BJZA 4C2UA 4NNOA 4IFBA 2AF3C 5T4HA 2FPLA 2Q1XA 5B36A 1ZIXA 3P52A 5K3FA 5EMHA 1Z37A 4K0KB 1EB9A 4DR5B 2H5LA 1J20A 4RHCA 5CH5A 1WCV1 4DRXA 1DBIA 1E61A 2IEBA 3HA2A 4P4SA 4PPYA 3BXFA 4PQFA 5EKXA 4J0EA 1YVPA 1VOTA 4TPKA 2VHJA 1GOTA 4LGVA 1S96A 2ILTA 4NBVA 3GZNB 1LD3A 1PR0A 4B84A 1U04A 3ADKA 3AY6A 3DMDA 2YV1A 4EGJA 2PZ8A 1JR2A 2J7PA 1VZ2A 2VVTA 3PFWO 4H1TA 4AMGA 2XOEA 5DNUA 2PO7A 5L7YA 2WFLB 2CFTA 2O0KA 5CRIA 3PC8C 2IUTA 5A6SA 4EHAA 4BQNA 4IEFB 3PXEA 4FZJA 1H2BA 1JT2A 1MCZA 2DCMA 2XKAA 1GZDA 1Q2XA 3BJRA 3L7OA 3M0EA 3K1AB 1CJKC 3T12A 1H1DA 3QH4A 3QOYA 5A7HA 2O07A 3K2BA 3O3CA 2JCSA 3KE8A 5F4BA 3AIIA 2HI0A 4A91A 3PBKA 1NLFA 1UDBA 4FB5A 2QAGC 3ND8A 1MENA 1TIBA 4A15A 1I2BA 1ORIA 4B44A 4HEQA 2V55B 4KE7A 3E1SA 2E3JA 5JE8A 1U1GA 3B8HA 4RCVA 1YIDA 2PH7A 1CC1S 5ECYA 3LC7O 4EPVA 4BZWA 5FXMA 1L4GA 3UWKA 1UMDB 2JAXA 2QNBA 2JEZA 1OYOA 2P5SA 5LLSA 2R8ZA 5A0TA 1Q22A 2AWOA 2VHXA 3MCUA 1JHDA 4AL4A 2HNAA 3DL7A 3OMWA 3FTFA 1V9CA 1N78A 2GR9A 1IEVA 1ZRMA 4BLQA 4BUZA 1D2GA 3B8EA 3WB0A 5EZSA 3AR9A 4FFNA 4U2EA 5BV8A 2IW1A 2FPXA 1I1QB 1H2ZA 2D4HA 2TECE 4WA8A 1WS6A 1J2EA 3OZBA 3Q9LA 4ER6A 5KYKA 10MHA 3DE3X 2VTBB 1K3TA 1EHCA 4JKIA 1J9ZA 1NN1A 4GLBA 4WIAA 4GOND 2HA4A 3FPEA 1MO6A 1SUBA 4LWPA 3X1KA 1Z5VA 5CX4A 3O4HA 4RNDB 3RC9A 7ADHA 2ZXUA 1T6ZA 4GMXA 5C5DA 2C77A 4HL6A 2WUFA 1CQXA 1CT9A 1GQRA 1V26A 2IJGX 4L4RA 4V24A 5DULA 4YXWA 3TXAA 2VYVD 4JB3A 5L3VA 5EOVA 2REQB 3FWNA 4E94A 3E23A 3WWZA 5ERYA 1HBJA 5K3DA 4F3YA 1TA9A 3L43A 5CCBA 4OJMX 3BXPA 1LBHA 1OWMA 4ZALA 4C30A 3TQFA 3G68A 1KJ8A 1NXSA 2WWTA 3E53A 3KSAC 2AMYA 3D6MA 4XPIA 1H0RA 1V5GA 3RS8A 3OIDA 3AL0C 2DTXA 5KOHA 2C2OA 4ZKDA 5AKKA 5TQJA 1SVUA 2BFFA 1R64A 5DGTA 1OXKB 2OV1A 4E51A 1OC4A 5C8YB 1GUDA 2R66A 3FWYA 3GGJA 2UKDA 3VSCA 4OAQA 2E2WA 1PL0A 4Z5XA 2NO7A 1K9SA 2BKXA 3VAYA 4IDOA 1NN5A 1HEUA 3VMMA 1IBLB 4NBUA 3HH8A 4TVKA 1TEVA 3HV0A 3PE4A 2YMLA 2OZPA 4PTYA 3VKVA 5C34B 1L4UA 5LUAA 5ECDA 3OTOB 3NHAA 4OSPA 5CXXA 2WE7A 4UAUA 2QRGA 2LRHA 2BFPA 3CB4A 3COWA 1OGJA 5B3JC 4TV9B 1ISJA 3DULA 4P83A 3HRIA 5HIMA 4PX3A 1A9OA 5A1TA 3TF5A 6GPBA 2PX2A 1POWA 3QKTA 2G5PA 3S28A 5H0IA 4RF4A 3RGGA 2CDNA 1TK2A 2F1OA 2Q5FA 4QL3A 2ZYIA 2C2YA 1OLSA 3P19A 4FDVA 2VJQA 2QD3A 4NG5A 3DGFC 3AKCA 5K8VA 1K7CA 1M1UA 4UHKA 4V0SA 3U56A 4NP6A 1IN8A 2OPBA 2PU7A 2RHHA 1GUBA 2V7EA 2CXHA 1GGEA 4FXOA 2OYSA 4BMDA 4QA9A 5EKTA 3INRA 1Q0RA 1PUXA 4CUJA 4S24A 3SJZA 3IHTA 4HAIA 2WHYA 4EFDA 1Q3HA 2Q0XA 1LLUA 2ZRKA 5LQRA 1P7CA 4O1IA 2HBZA 1J5PA 1IVSA 4B6PA 1KJNA 4QDOA 4C0HA 1ZL0A 1XX6A 1I2ZA 3T06B 1K6MA 4CM6A 2D1SA 4M0KA 4N4AA 3NETA 4ARAA 2BI4A 3DBLB 2ZYGA 4MLDA 1RMQA 1SHLA 4O33A 5JMOA 2PYIA 2X5OA 3DHNA 1V2GA 4KUEA 1PR5A 1SUEA 3WXMA 3TI9A 3G9QA 5K5EA 5IX8A 1LBIA 4KRYA 4YLYA 4GR4A 2CUKA 1ODCA 1PJTA 3QBDA 3M3HA 3TXXA 2ZUEA 3V1KA 3TW8B 3UJDA 2AX3A 2XV1A 3VH2A 4HTFA 5DISB 3AF3A 3N2KB 4DLNA 3EIWA 2EERA 1U3DA 3W1EA 2BTEA 4OHFA 1NE7A 3DBOB 4BO8A 4D3XA 4OLBA 1X2EA 1OLXA 2AK3A 2HJVA 3BMXA 4GYKA 3UOAB 3CISA 4HEA6 3HFJA 3NHKA 1OZ0A 1TTPB 2WZDA 2MJLA 4G1VA 1M7BA 1QRTA 1H3FA 2NTJA 3EZ7A 1XHLA 4ENQA 1RPJA 1E0SA 2RI0A 3C15C 5BSGA 4IIGA 1MU0A 4KAFA 4XW2A 5A0FA 1THZA 3N86A 3U7GA 5IK2D 4RFLA 4DY6A 5A9SA 1G18A 3DVAA 4ED9A 3TECE 3GLRA 5TF0A 1ZJWA 5GWXA 1U8FO 2C2MA 1U1DA 2PYZA 4EAQA 3OIGA 3L06A 5BMVA 1QRAA 3DTVD 3U1TA 2D74A 1ODTC 4MAFA 1UBSB 2DC1A 1SBCA 1QUFA 4FDAA 4JZKA 2ZSDA 2PMWB 1G5IA 3D0RA 4AJIA 2V65A 2QGFA 4PGMA 1E99A 4YQYA 3S0JA 3EGVA 3WIDA 5JD6A 4L4YA 1BVHA 5CHEA 1CY0A 3ELBA 1I7PA 3KOXA 2Q07A 4CODB 5E2AA 5J2UF 2H59A 3B6MA 3H13A 2C8LA 4KJZA 4RYLA 4IQ8A 4DYVA 2B3TA 3SS7X 2HA5A 3R5HA 5LP6A 3IT3A 3AR5A 2V45A 4Q66C 4BNNA 4JITA 1WDMA 4AS1A 3AI7A 3D6AA 2O3RA 3A4LA 3L9WA 3ZWQA 2FUKA 4M49A 2D3TA 1YTUA 4RDCA 4RJTA 4X60A 1JQ5A 4OFZA 4TKVA 1SXJC 2HT6A 3ZDYB 2AZDA 5CA1A 4G1UC 2IEZA 3KETA 1R16A 3ESCA 3GFGA 4LRWA 2O0LA 1PK7A 5JNSA 1QWOA 5CNJA 3D7LA 3DVRX 1MC1A 2FXIA 5E9QA 4A0SA 2Y67A 3I12A 3Q5EA 4LSMA 5DHUA 1JA9A 3FPBA 3N8HA 1BEZA 3HE3A 2CLCX 4PFKA 4R8LA 1COZA 1KYYA 1WUKS 4URFA 3ENNA 2BT4A 2PKXA 5ECWA 2ZT7A 3UO8B 1JVNA 4CM7A 4EJSB 1M2KA 5HFJA 3GUZA 5TQVA 3RFUA 3TL6A 2IYRA 1WQ4A 1RCFA 4PZ0A 4PG8A 2HGZA 5D1HA 4XPZA 4Q16A 2GEKA 3F2VA 4X6XA 3VHQA 1J8VA 1W9MA 3SZOA 1E0JA 3X1WA 3JQAB 5FAKA 1AQJA 1Q92A 3PUJA 4Q3OA 4NMMA 5ECGC 1QUEA 5TQ0A 3GLFB 3I72A 5LSAA 3BMQA 2DZDA 2GZMA 4ZQBA 3SM9A 5COBA 3DEJA 1U9JA 2H2DA 3C2QA 5JFOA 3WA7A 5IUNC 3MT9A 3UK0A 2GJ8A 1AUVA 3PUXA 4AB1A 4EG4A 3OF2A 1UJ6A 2FFAA 3CGWA 5C1IA 3TQRA 3AUAA 4MA4A 5CP8A 2WZCA 4I81A 1UPFA 1A7UA 4DMGA 4JU9A 1RQPA 3IDFA 2OV3A 2V6IA 5E7IA 1R9NA 1QMGA 1SC1A 1Q0ZA 2DR3A 4EFMA 4AJ4A 1JXAA 2NW6A 2YJZA 4UEKA 4DJFC 3ZLJA 2Q3LA 1XDSA 1ISRA 2GT1A 5ALXA 4HBZA 2PR2A 4P2BA 3N0TA 1X0VA 3B13B 3IOMA 3ORSA 3QUSA 3C6MA 2SCUA 1Z16A 3KEGA 4NMLA 4CFYA 4N76A 4WMLA 1JBKA 3RREA 5CDUA 1G42A 2Q29A 5FBWB 4WY5A 5CFMA 5IM4A 2F00A 2Q9BA 1R6XA 2BOVA 3BL8A 5HFAA 5H8WA 1JR3D 4HLUC 1NR1A 1YIOA 3KWLA 1C4XA 2YNMC 2XRZA 2ZJAA 1N6IA 1K88A 4N6OA 3K5PA 3QKSA 5H7XA 2ZRAA 3AG5A 5JAUA 1W36B 2F4NA 8ATCA 4G0QA 1FDOA 5ESWA 3KX2A 2I1WA 3JYPA 3COZA 5JZOA 5K6AC 1ZK2A 4RL4A 4ZU1X 1QOPB 3SVLA 3OUUA 2D0OB 4WBNA 4JSYA 3ZD7A 4HQ6A 4R1PA 5BOSB 3BFXA 1OXSC 2OHVA 3WJAA 2GOYA 2YICA 3LY5A 5CDSA 3L7CA 4BCBA 1UODA 4PF1A 3VJKA 4ON9A 4R05A 3LNCA 2IV2X 1VMKA 3H5OA 3LCVB 2OE2A 1YKSA 3N7UA 3AVWA 1MQ9A 5DI3A 4CMBA 3PKIA 4KXXA 2WUWE 1T2VA 2HSDA 3OAAD 4KXQA 1WCXA 3WBBA 3PEVA 4MR7A 2RH5A 1U7XA 3L0ZA 4BZZA 1VCHA 3JYOA 3GRKA 3ED5A 3THYA 2NU7B 3HP4A 3LDUA 1O97C 1U81A 3B9PA 1SG6A 2W37A 4J7AA 4M2LA 4YGXB 1PQ4A 2WMOB 2D1YA 3FG9A 1JXOA 5JISA 3LBYA 3ITKA 4XYBA 4Y2HA 1MEOA 3TUJC 5IT5A 2ZBFA 4ZI7A 1B8UA 2QI9C 5DTJA 4FOPA 1YOVB 2A3NA 2A94A 1L7VC 2HA7A 1WUHS 3LXUX 3R24A 3LX8A 2I99A 4TTAA 3E48A 4J0FA 4DV4B 2CK3D 1Y3FE 4Q4JA 3WK5A 4GFDA 3BSYA 1H1LB 5G3ZA 1QIMA 2WF6A 4J0CA 5LA6A 4HSGA 5AI8A 1EFPA 3NHBA 3VISA 1ESCA 4QGFA 3S99A 3T35A 3IIEA 1TLTA 3G2NA 5L45A 1E1MA 4MROA 3HHPA 1X80B 1Z0AA 4JI0B 5FUXA 3OLQA 1N5MA 4TTVA 1AXGA 1G291 4RWEA 4W8OA 5JAOA 4AP5A 5JAZA 1EUDA 4UM8B 2H11A 1Q1BA 1RYHA 5LZ5A 3E35A 2GYYA 3F96A 3PC3A 4K8OA 1YRAA 4YDSA 3VR0A 4F2DA 4Y0VA 2P7IA 3V8BA 1KFJB 1S4MA 2FRVA 3KAKA 4NMWA 1EZ1A 2FR8C 4W5JA 1KJJA 2GEUA 2R6GA 3S8YA 2WWYA 2E87A 3EVFA 1TK3A 3MUFA 3W9BA 4J1NA 1VMDA 4UDOA 3NDIA 3CCCA 4F21A 1H65A 3FMIA 2G72A 4C0WA 1E9RA 4F4UA 1JF8A 1FL9A 4JBWA 5EWMA 1EFDN 5BV7A 1U3VA 1N2CE 4WZBE 2VDLB 3ZV5A 3I34X 3C98A 4G97A 4F4JA 2R8YA 2GBLC 2Z8ZA 3EZ2A 2GN6A 1RKVA 1YR7A 3EC7A 4NKRA 4S1TA 2B6NA 3ER6A 3VFDA 5A6VA 1M0WA 4KXWA 1W581 4ZT3A 2QTMA 4YALA 4FMPA 2JFYA 4US0R 3QLVC 4BNHA 5F5LA 3KUXA 4AKIA 2Q4DA 2GKGA 2VEDA 3GAAA 1Z2EA 5CA0A 1PKXA 3IR5A 4YUZA 1BCRB 1N7HA 4FDTA 1J25A 4GUAA 3GB9A 4F9TA 1Z8NA 2H1LA 4EF6A 1EXMA 2Z8YM 3GLQA 3SC4A 3HR8A 4LFBB 3LDFA 2GSWA 3P96A 2X7JA 2LDBA 4D5EA 5TQ2B 4WK2B 2HAEA 3E2IA 1BU8A 1GN9A 1MEJA 1O57A 5C4IA 2GPWA 4Q4LA 5KVCA 5LQDA 1W36D 2BCJQ 2O8BB 4R9UC 3V46A 1O08A 4NBKA 3M4JA 3SSNA 2VBCA 2P9EA 1LRKA 3NP9A 5FPPA 2YINC 4ZTZB 4BMYA 1TU0A 3OZEA 1VLHA 2WHPA 5EZYB 2BFWA 2GFQA 2ZYUX 3ZXYA 2POQX 4UPVA 3K9LA 1IRIA 2C61A 4YROA 4FONA 1EVJA 1Z22A 3DNMA 4CF6A 5B7QA 4GI2A 4P3YA 1DV2A 2JAWA 4QLOA 3I9KA 3ZLVA 3EEIA 1WZCA 2CXXA 1ISSA 4TWRA 4Q9KA 2AOTA 9ATCA 2GDZA 3K0AB 2A14A 3U31A 2RGYA 4ZOAA 2D5CA 1KMCA 1NUSA 1O03A 3OLCX 1ZCFA 4JYPA 3K09C 2E4XA 4M83A 1NF3A 3N58A 3NDJA 2I6FA 4PR3A 3EE6A 4Q1DA 5GV8A 3DOHA 1H4QA 3I4FA 1QPBA 2WILA 2DBRA 1NDQA 4WKBA 4HN9A 4XZ3A 1YJQA 3SI7A 4BNYA 3KR0A 3CA8A 5D00A 3F4BA 2JAUA 2ODPA 2BELA 3MGCA 4DARA 1OLUB 1V37A 2GM9A 2XTJA 4QNRA 4UKDA 5TY0A 1FU4A 3M6AA 4MKFA 9LDTA 2AQIA 3PNKA 1KOFA 2WK1A 1Z4OA 3CURA 4QTTB 4XFJA 3SQLA 3SS8A 1ZGHA 3OOHA 3ONEA 4XARA 3WLIA 4DSOA 1CEYA 1DV1A 4IMIB 4F04A 2BFMA 3TRJA 1XA4A 4K46A 3LF1A 2C7QA 4ZICA 4MQ4A 4HH1A 4BO9A 2IXEA 2GN9A 2NV0A 4Q12A 4JLWA 2ZRCA 3RE1A 1NRJB 4GBMA 3HDQA 2RHBA 1ABFA 5C52B 2H7CA 1I5OA 1T9HA 2VDKB 2DFPA 4XIFA 1F6WA 2WABA 4BFTA 2FSVA 3EGDB 3RSFA 3CVXA 1HDXA 2BN4A 1TO6A 4QVGA 3R09A 4IHJB 2J6CA 3BWBA 3VZRA 5A4AA 1RHUA 1D6JA 2H06A 1U65A 3QU9A 2QL7A 3RQIA 2FKAA 3EFEA 3FNRA 1E3SA 5C1PA 5CEJA 3U19A 4O2BF 3K9WA 3UT5A 3DAHA 3H1FA 2C4UA 3AU8A 1CQJB 1QH0A 2XY4A 3F78A 3FBTA 2F8LA 2R6AA 2EZ8A 3L0CA 4J2TA 3UH0A 3TLBA 1E1NA 1ZJ4A 1QF6A 4KEAA 2XVAA 1AG9A 3RU3A 1ZK3A 3H7AA 4AZWA 3HXLA 1R00A 1T5OA 4MNTA 4JB0A 4B3SB 2EFHB 4DLRA 3QU4A 4RWZA 3GJ6A 4OHWA 3CNBA 2X22A 4OPMA 1G8FA 1MJGA 2X23A 2W6NA 4AP6A 1FFWA 4R71A 4KFTA 2FRXA 3QNWA 2QORA 2BKLA 3WISA 1GPLA 3CH6A 2BFEB 1G7RA 3RVNA 2EQAA 4C6RA 4F9EA 1PWXA 2R8XA 1E7QA 5DNDA 2JJ8A 5CLGA 3AIKA 4E3WA 4EMBA 2C5HA 4GYYA 2CHUA 4M0UA 2JFHA 3WGKA 4NHEA 7GPBA 1TAUA 4D6YA 1NNSA 2GAAA 1IC6A 2UZIR 1E1QA 2XRMA 3R5KA 3PXBA 4ZI5A 1N8KA 2VA8A 2H2FA 2LDXA 3EIEA 3LL4A 1ZGCA 1EDDA 4X20A 3TCNA 3BWVA 3KT8A 4LA4A 1CK4A 3NONA 5DNAA 2QL9A 3PQDA 4JIGA 3DBRB 4DIKA 1Z5GA 4AO6A 1CJCA 1IATA 2JCVA 4XX0B 3USCS 1WMDA 3DG9A 4AUMA 5EFZA 1AXEA 1RBMA 1T5SA 1F4LA 3AFGA 3PVZA 1MJ5A 2PFSA 3PLRA 3P26A 4FYHA 3KUDA 4IWNA 2H1HA 4CEHA 4R2MA 4TKUB 3ZNNA 4ZVMA 4XD2A 5A3SA 1QYDA 4TRNA 3HI4A 1VCOA 4FYYA 4ZRNA 2QF7A 5DN6D 4YB8A 1UBGA 1W0JD 4NMXB 1VSVA 1TE2A 1HC7A 5DHPA 3SZLA 2GJKA 4XCXA 1A0OA 5C2JB 3FR7A 5EUBA 5ITZA 1UM9A 2QROA 1EZZA 4B2PA 4F84A 1XTUA 3L7NA 4KMMA 1JSCA 1QYCA 1YMQA 3TM4A 1K0UA 3QE3A 1RKBA 3UBTA 4N0EA 5DM1A 1P5HA 4Y1GA 1QQBA 2EDCA 5LQAA 2B69A 1GT6A 2FEOA 4ZGWA 2ZZKA 3G2OA 4JQOA 2OK8A 4LQLA 4Y98A 3CJQA 4BZXA 5G53C 1FLVA 1NXTA 2JANA 3D64A 4KK4A 2PGNA 4LMBA 4Z53A 3LP8A 4F6LA 3DR5A 4W5RA 4BJ6A 3I2HA 4NOKA 2ZTMA 4RETA 3SF8B 1F7VA 3F7TA 3L8GA 4Q48A 1E8DA 4A1OA 4AC9A 1QWSA 1JLMA 3F90A 1R74A 4P32A 4QSHA 4CF3A 3UHAA 4LY6A 2QNIA 2WNHA 1YC5A 3OZGA 4G0ZA 3DOEA 2J48A 5BQ3A 4G9EA 2WJHA 1Z83A 2IEDA 3MD9A 4MUHA 1YFLA 1B0ZA 2VJMA 2QI9F 3CYFA 4LX0A 4BOYA 2HADA 1VECA 1DKUA 5AHRA 1QFXA 4UUBA 5BURA 3K35A 4F56A 3HJUA 1YRBA 2JGLA 2YIJA 4WJZA 2RKBA 1YQTA 2XT0A 1UPTA 4EA6A 1Q6YA 3OCJA 2P78A 4MKGA 1T5IA 4R2LA 2IDKA 4MJXA 3B2NA 5A3JA 3OURA 2ES4A 3QVGB 4PTZA 1Q3TA 2W2NA 1XTRA 2ZI7A 2NPIA 3AHDA 1X87A 2W2KB 1U8UA 2BUAA 2WVAA 1AMUA 4TV8A 5H82A 4JELA 2M1ZA 2RHMA 1H4VB 1X6VA 1TADA 1EQUA 1JJAA 1ONNA 1TEXA 2FSUA 3ELDA 3ZV3A 4DIUA 4WA7A 4CMEA 1E7MA 1VLVA 1A69A 2WTNA 5K45A 3RBXA 1V7QA 1V16A 2VAMA 4AMZA 4C7KA 1D09A 1AHHA 2JATA 2OCYC 4DMMA 2TMDA 3JQAD 5KQPA 3U61B 3GPBA 2FFJA 1CY7A 2FSGA 4HDRB 3CUTA 3LQ4A 4NK4A 4YRPA 3Q7PA 3U9LA 4LTNA 3PE6A 1HMPA 2X76A 3GJYA 1T9BA 1YJXA 3CHYA 4QOSA 1IXKA 5FWDA 4YUWA 4H9GA 3DAFA 4OQZA 2O2IA 1XQYA 5EWJA 3HJGA 1USWA 2UYHA 3MWYW 1HT0A 4UATA 1IZ8A 3GEIA 1KJQA 4F1KA 2V6MA 4UXHA 2IZOA 1XZHA 1OXVA 4A0FA 3AJ9A 3WL4A 2VPZA 7REQB 4UVIA 3F1LA 4ZT7A 3AEXA 1CJBA 1EFCA 2TS1A 3W9YA 4W7HA 4WFKA 3AVPA 3B6KA 4YJ2B 3GG9A 2GTHA 3DS8A 3VR3A 4N9WA 1CVRA 2CDBA 1YIAA 4ALIA 5AW0A 4YDRA 4OOEA 3BE6A 1Y4SA 4PQEA 3OPVA 4GQIA 4WD3A 4ANFA 4JEHA 4MQUA 3UMCA 4DEYA 2ZRDA 5EAIA 2J5QA 4TZ0A 3MIIA 1PEDA 4RIFA 3NLLA 3PD7A 4D0SA 1PT8A 1PUIA 3O82A 4FI3C 2H63A 2CVFA 2Z3WA 4JB8A 5DLDA 1KS2A 3QFSA 5EN4A 2UVDA 2GEDA 3M1AA 3A6JA 1F51E 4WCFA 5DPMA 4Q3LA 4BLVA 1Q91A 2J7KA 1V41E 2J46A 4TUYB 3A3PA 2EWWA 3EGEA 1O94C 2W6ZA 1VBKA 4LXQA 5E6UB 4RKWA 4HGOA 1DPGA 4JKOA 1EWVA 2AI2A 2P35A 3KFLA 4L02A 4RK5A 3S1AA 4D9FA 4FT2A 4U2DA 3L8HA 5HA5A 1XG5A 2B82A 4PO9A 5JYDA 1W59A 3C70A 5ENDA 5DZSA 5C7LO 3GGGA 3CUYA 3IR6A 3A4IA 4KYTA 2OZKA 3TOXA 3A11A 4TYNA 1U6KA 4J3NA 1OBHA 1D1TA 4I9FA 4INJA 3BQ9A 5EQFA 5I7SA 4WDRA 1E9DA 1NNLA 3U39A 4PHFA 4TRMA 1CP2A 4BMSA 5GONF 1ANKA 1XD9A 2BEVA 4FHCA 4GPEA 1KETA 3G8AA 3GH1A 4YP1A 4QEDA 4BN5A 4MS3B 5K9ZA 2FPSA 3OT1B 4KVFA 4WZAE 3ZCRA 3AKEA 1C0EA 3HQ4O 1I4WA 2BMJA 1K8RA 1VP9A 4O4IA 1E2BA 2VC2B 1WPXA 1C9MA 2AKYA 2PAFA 3IEKA 3V00A 5AOCA 4EHFA 4IIBA 5CFRA 3IKTA 2R1VA 1G7CA 2H1WA 3QE0A 1QKJA 3ZEIA 1OF1A 5EY5B 3ZBTA 4X84A 1C4KA 1X38A 1GDDA 2QTWB 3FI9A 4GLJA 3UXHA 3LL7A 3ZLBA 4L95C 1NNI1 4B3MB 4RFSA 2QJOA 4CM4B 2JCXA 5JTTA 3B36A 1DC5A 1NF9A 1L3IA 2CLIB 2JS7A 2RAPA 2WD7B 1R0XA 1N4AA 4B0OA 4F9GA 5E0KB 4AJOA 2V7QA 2QJWA 3HGQA 4UBKA 1HSZA 3U4AA 1YQUA 4AJHA 2G5TA 2VNHA 1Q7GA 1IN7A 5IN4A 3SQXA 3DLPX 5JMTA 1E2PA 1JS1X 4OCZA 3RSGA 3YASA 4OXYA 1QAMA 2HSEA 1RC0A 2ESRA 2QUZA 3ZU3A 4QJ3A 4ND2A 2BGLA 2FPIB 2GVDC 2RB4A 4PYOA 3PT9A 1OH6A 5EKSA 3U7QA 1GQFA 5EJEA 2Z4TA 1CUGA 1KOLA 3DP7A 3HM2A 5AP9A 4UTRA 1TGVA 3W7BA 5IDVA 4FILA 4YRKA 5AESA 1E6UA 1RQRA 1X0XA 2GHIA 1JDUA 1JJ7A 2J9RA 4LYYA 1W0KA 4TWAA 2OD7A 1U9YA 3NHZA 3T1YB 1RRPA 3K8ZA 2C9ZA 2JPDA 2QVXX 2XZPA 1PJ8A 1G4UR 2Y05A 4TQGA 3QJGA 1I0LA 1NVMB 5FI0B 4DBZA 2A6PA 5AK3A 2WSIA 1IOWA 1T1JA 2HQ1A 4BNIA 1L9XA 4GG1A 4D98A 1MR3F 2O1WA 1Q19A 3KB8A 3L1VA 4L9RA 4XRGA 3JWGA 2FQ1A 3CG0A 3PTZA 3ICCA 3I5AA 3LQQA 3C3XA 2AR7A 4FWBA 1V3VA 5IVDA 3L1KA 3WWDA 3ZDDA 1X7GA 3WTBA 1E9CA 1ZOIA 4UU8A 5AT1A 3HKBA 4C3UA 1X7ZB 1RRMA 4LRYA 3SYKA 3KSUA 3U37A 4N5DA 1UXOA 4R41A 1REQB 4F11A 1UC5B 1ZKMA 1Q0UA 3IQZA 1XQXA 2Z2KA 4OJQA 2HB6A 2A84A 4JCCA 1NVWQ 4OREX 4TKZA 4BGVA 4L0DA 1M1YA 1TIKA 1X2BA 2J5XA 3KFXA 1RYYA 4HB4A 5G40A 1YQGA 3A3OA 3TB4A 3RHSA 1T5DX 2FN7A 3SZ3A 1TYZA 3D8HA 3EZ9A 4CW7A 3WKBA 4D9GA 4F3KA 2H54A 3E5NA 4ZCRA 5JAMA 2IHBA 2J32A 1A5AB 3F0TA 3O9ZA 1BROA 1F8FA 1RQLA 2YOHA 2QX6A 5B4VA 3CX3A 3JVDA 3OTIA 4KX3A 4O4JA 4F6RA 3SM3A 1G66A 4D3FA 5AVUA 1PT6A 3PA8A 4G5OA 4L8WB 5EJFA 1FDIA 1IQ0A 2CXPA 4DRYA 4EZBA 2A0FA 3W05A 1ZGZA 4UMDA 1U0JA 4F45A 3GCDA 4CIBA 3DV0B 3VGPA 1H2EA 2G1AA 1SA0B 4PSAA 1GQQA 4I50B 4N39A 2DH6A 1EJ0A 2OLJA 4IAOA 4JLAA 3ZYZA 3VVMA 1V8PA 1V7CA 2AIRA 3FUWA 3GBVA 4TVSA 4QG7A 5H4GA 2V3VA 2C3OA 1JG4A 1QX4A 4D96A 1X8XA 1C1YA 3NWBA 4J2OA 3UEOA 2AUTA 5I7VA 2WHXA 3EZ6A 1ONSA 4AZVA 1PNVA 4ZVRA 2EIHA 3TQSA 4NE7A 3CZMA 2WB2A 1QTIA 1U6IA 3GELA 2QP3A 4BP3A 2NU8B 4FTWA 2XCQA 4HB3A 4LHWA 2A0UA 1QQ6A 1OI2A 3QEMB 4YAOA 1S2GA 3KNZA 4U7TB 3ES9A 1PJRA 1XMOB 1WMSA 2Y0PA 1XLWA 4IZIA 1AZLA 2FZKA 2QPTA 2EL9A 3TLEA 3GRVA 2O1XA 4G4GA 2WYHA 4E6PA 4LRUA 1GT91 3B1YA 3ZXSA 1K5GA 1N34B 3LK7A 3UIEA 3DZCA 4ESHA 2P6NA 2FPPA 1QLJA 2MYNA 3UMYA 4GW3A 5FPKA 4CMEC 4KYVA 4Z54A 1AZSC 4TYMA 3OEEA 1D8TA 1ZNZA 2ZSBA 2QVYX 2H3HA 4MWCA 4QC2A 1SMKA 4EO4A 4BL5A 3BWCA 3WZMA 3PUWA 1TUBA 1ORRA 1TVKB 5TX7A 2R7KA 1G4AE 1OYVA 1JHPA 3HU3A 1QCCA 4RKRA 4HVLA 1F6DA 2CL5A 3ZHZA 1I4DD 4KGXA 4PC3A 4PY2A 1JR4A 4MVCA 4QHSA 3A1FA 1E79A 1M33A 3A6KA 1X9IA 1W85A 1HOXA 4KWIA 4US1R 4C6TB 1TRHA 1EGMB 4AMYA 2CFSA 3O73A 4Y2PA 1L7AA 3VZPA 3QVLA 1FP2A 4ID9A 4F8JA 5KQMA 1Z82A 2L2QA 1JEOA 1SVKA 4GICA 1NTOA 4ZXPA 1F4PA 1G5RA 3ZE7A 1A27A 5ETJA 4A2QA 5JIBA 1JRLA 4ZYZA 1JKIA 2WM3A 1ULUA 1U02A 3AWIA 1SKMA 3QVTA 1AU9A 1JKJA 1JNYA 5EMLA 1FUKA 2AR9A 2QJTA 1MQAA 5FI5A 4EQ6A 3ZW8A 3MWLA 3I9OA 1E32A 3GO4A 3M4NA 4YECA 2VRCD 1XRMA 2HIMA 3VR5H 4GM1A 2JL1A 1Z07A 4MPTA 2JBAB 4RHTA 4JI1B 4B46A 4D3DA 1AJEA 4US2R 4J1TC 1WUJS 3I0ZA 3HWRA 3K2EA 1OFUX 3OEWA 5H3CA 5K0GA 5KTOA 2HHCA 3M4ZA 2C58A 3EF3A 4N0QA 3VV2A 2H2IA 5H81A 1Q95A 2BFCB 4HDOB 4MW9A 3HKEB 3SX0A 5JAIA 1NQVA 4TM8A 3D9QX 4ZCMA 2PXAA 5BQ5A 5B3KA 1GDHA 3V42A 1X70A 4CF4A 3EIUA 4L4ZA 3T3DA 3EJWA 4KE8A 1CQIA 1HRDA 1YFKA 3QK7A 3N87A 2E37A 5TT1A 3V7UA 2NP6A 2OK7A 5KQRA 5K0LA 4WCFC 1F2UB 4IFEA 2WM2A 4FK8A 5JJ5A 2PSHA 1SRQA 2BKUA 3PWZA 3UN1A 3WRYA 2OD2A 4MPDA 1S02A 3Q3EA 1MUUA 2OBXA 4BFWA 3R7SA 3ABQB 3ZE1B 3F49S 4U63A 4IOJA 3OQOA 2AH5A 3IT2A 1DIAA 1XRJA 2WYUA 2DBZA 3UJBA 4EK9A 3L92A 3KXKA 3HM9A 4F5ZA 3ZOKA 4ISCA 2BEKA 3CRMA 2ZAIA 3K4PA 3L7LA 4DRZA 1IM5A 3VR4D 3E7WA 1NVUQ 4E12A 3GX1A 1Y9AA 2I29A 2XAUA 3DXZA 4OGGA 1CUWA 3RUEA 1K89A 4G4IA 1WNTA 1U11A 2OO7A 3WGNA 3WLTA 3Q6NA 3K72B 3X2EA 4K05A 3PUZA 4YI5A 3SYLA 4AG3A 2A0WA 3UAXA 1VE7A 3Q8KA 4JQZA 3KLOA 3T7SA 4EHLA 3ASZA 3GLSA 2SKEA 4RJ2A 4EHHA 1Y4AE 4IJKA 2P3SA 1A97A 2GAFA 3FTDA 2QLLA 4F2GA 3N28A 2QP9X 5J2UA 3GGPA 1P81A 3SIXA 4X1KB 1NOKA 5FPTA 2WY2D 3I32A 1U4SA 3H65A 2DEUA 1DC6A 3WGJA 3HCNA 2DY0A 2G6TA 3AJ8A 3JQ6A 4D9EA 3U1BA 4OHKA 3KZXA 4LS3A 4CUZA 1JHUA 4KPEC 3LECA 4KREA 1EFRA 2I2BA 1V11B 2W2PA 1IZ0A 2V03A 3MOSA 4RVGA 5CJJA 2JJQA 5AOBA 1PI3A 3OICA 1M83A 1Y1RA 2OV6A 4HN2A 3V8MA 3UMMA 4OXXA 5IVIA 1VG0B 3NIBA 5L4LA 3LVFO 2MSLA 2QXYA 3W9UA 2OHHA 2EBFX 4F3NA 3TLGB 3ORQA 4AXBA 4KXYA 3TAUA 3FMGA 3AUXA 1R18A 2VH1A 2XDYA 1FB5A 1I36A 3DDHA 1E3WB 3GWGA 3FZQA 4OL0A 4B7CA 3Q8MA 1GPYA 3PB3A 1UH5A 3FGOA 4LFAB 2IHUA 3DZBA 1KAMA 3Q3GE 1O58A 5L3QB 3IVXA 4YJ3B 1UJ2A 1JFFB 4BN0A 1M2HA 4B6QA 1CDDA 1C0IA 1RTTA 3FFAA 1UKYA 4A5SA 1T2FA 2QU8A 4Z1MA 5LYJF 5EHGA 4YHHB 4KN6A 4Z0TA 1UMBA 4U0KA 3ZDCA 3D8NA 3N9IA 2PPLA 4DR2B 3LAWA 1BX1A 3R6DA 1XLTC 3DCJA 4ZT4A 4XUDA 2PWZA 5GM2A 3WC4A 1QIKA 3EWAA 1FDRA 3AF4A 5IHPA 3FPCA 4XDGA 3GN1A 2QBYB 2R8BA 5TEVA 4B4KA 1XSEA 1BG6A 1EYZA 5HMMA 2QZ9A 3IVRA 1Q0QA 4EL5A 5INTA 3T41A 3PNYA 3V2HA 3LPCA 5AW4A 1EA5A 3IV6A 3AP1A 2JC3A 3DM5A 4W7IA 3B7PA 3W2FA 4I8XA 1E58A 5HBGA 4BB0A 4H6PA 2JFUA 4D6XA 4HGPA 2X0KA 3GRRA 3KJFA 2YXDA 3BRWA 2VDJA 1RWMA 1PF7E 3DLBA 1IM2A 1ZY2A 4YT2A 1IUOA 2JASA 1BYUA 4F86A 3OOSA 3L1UA 1VE9A 2FFBA 3RIXA 5BQXA 1P17A 4X54A 3OX4A 1GFWA 4RIIA 2AG8A 1RIFA 2JFGA 1O6GA 4NZMA 3FGZA 1F17A 3QA9A 5AHKA 1M10A 4JDPA 5AM1A 2DSTA 4CIWA 2IQ5A 3KQNA 2A8YA 5BYAA 3RAPR 5JH7F 1GCOA 2H9AA 5DEOA 2XYHA 4CIAA 2EC5A 1GZ7A 3GPDG 4R0VA 3BD7A 1RQNA 1KI9A 5KTKA 5K3BA 3FZNA 1PR3A 1KFEB 3NEAA 3H1TA 2XDQB 2BISA 3TOSA 1VGVA 1NLUA 5M2QA 4KW7A 3LYAA 2HM7A 2QR2A 4ZAXA 1H2YA 5FOSA 1RADA 3H1GA 3IO3A 3EDYA 5IYZA 2BW0A 3NYRA 3AFNA 2ECQA 4CM1A 5TPZA 3NTVA 4M36A 1TX4B 3BTOA 3LBAA 2ZXFA 3MWDA 1HV8A 2JDID 4O4LB 3CU5A 2QVLA 3SLKA 1GPNA 2VP9A 1X8LA 4JD5A 3KSMA 4URYR 1XXHB 3CNHA 2OKGA 4XKJA 2WAYA 2FSPA 2CVQA 4AROA 1P0MA 4I55F 1T0JB 1EP1B 3HN2A 6LDHA 2WUGA 3RO7A 421PA 1FFYA 1K8XB 2AVDA 4RCZA 3DC7A 1Y5IA 1ZBDA 2VJBA 2FWJA 2BHNA 2BI8A 3KJXA 3BK2A 3UWMA 5JT1A 2QTVA 4HXFB 2IEIA 4KR3A 5J63A 4QU5A 1NW9B 2ZJ3A 4UAGA 2WKWA 3JZMA 1HY3A 2PFGA 4BPBA 4N65A 4ZCIA 1DKOA 4LF7B 1DCFA 2VL7A 2QRLA 621PA 2YHAA 3CWQA 1A4UA 1NAHA 4AS2A 5B4TA 1WABA 1CYEA 4G8DA 4G5HA 1VIMA 1R4NA 5F35A 5T4FA 5HDBB 3NX4A 3RYCB 2GZHA 3OQBA 3PQ6A 5E6SB 4GKBA 2ZSEA 5JADA 2YJTD 1S3GA 2WWGA 4DJTA 5CAEB 3GHHA 2VI5A 3FKJA 4PGGA 2DLNA 1KSJA 3NPMA 1FTYA 5HX7A 4I1UA 3OKPA 4R7GA 2E5FA 2IKSA 1XJCA 3IAFA 4Q9HA 3VH1A 1UZNA 1YVDA 3EW7A 4IIYA 1OWLA 2VDWB 5D5QA 4ZVNA 4OM7A 4MVJI 2R751 2V54A 4GQAA 3O8LA 1WR8A 3PNSA 1EXVA 4HRXA 1G55A 1JWBB 3W5AA 1HNNA 3MTQA 3EQ6A 1OI4A 2H92A 4LNAA 4MQFA 1VLLA 2B9VA 5DN9A 3A9RA 1PSWA 1R5OA 5I3CA 4NMHA 3H1AA 1KFBB 4BTVA 2VDUE 4WGGA 1DEHA 1NM5A 3UJ7A 5GVSA 2P9YA 3QXJA 1AS2A 2E4AA 1TZJA 4IOKA 2C3PA 3ENQA 5J4VA 2QLTA 1ONOA 4Q6WA 1CZNA 4JMLA 5CURA 3VSDA 3E22B 3AHFA 4DNQA 3OPYI 3K70C 4IVQA 1LRLA 1F60A 1PJ2A 3KOZA 3U4QA 2CHQA 4HX2A 4IDCA 1U63A 1EHIA 1F1BA 2WU8A 1A96A 4JP3A 2Q2QA 3GRZA 2QRUA 4WFJA 4XJVA 4HQFA 2XOKD 3G2JA 2JLAA 4XR9A 1WHTB 1Z74A 2PXCA 5DOZA 1CEQA 5FPHA 1TUEA 1LCIA 5AKEA 4HDKB 2IV7A 4DTCA 3AHEA 4JLSA 1GITA 4JY7A 3T5GA 1AMNA 2V6JA 1RD4A 1SO8A 3MAJA 5LOVA 4RQUA 5FWXB 1PSDA 1KQGA 1LEHA 2RGNA 3SQOA 4D4IA 1SCUA 2XIQA 4MR9A 3V97A 2GO1A 1A9XA 2DUNA 3P9QA 3T52A 1HG0A 3U49A 3U60B 3AHIA 4C2TA 1JDPA 2QVBA 2E4ZA 5JCPA 5FQNA 3TAHA 4KI0A 2X7XA 2FH5B 4R1MA 3DB2A 4I36A 4ODIA 3DEKA 3O4GA 4GQBA 1ETHA 3WRYC 2NP7A 2FMFA 3FPLA 2WTBA 3VR6H 5AXBA 3GLKA 1SQ6A 2DXIA 4Y6SA 4CKEA 2X8LA 3M81A 5C5EA 2QMOA 4B45A 4EG3A 3AETA 1CF4A 2HU7A 2HRDA 3PE3A 3RJ9A 4QYSA 4X7BA 1P75A 4IILA 4DUGD 1P5JA 4O8ZA 2CXUA 3NRBA 4ETNA 3TYXA 4QPZA 2PJUA 4EHJA 3BGSA 1JG6A 1J7JA 3ITEA 4MVYA 3ZU2A 3F8SA 4MUEA 2BP7B 2GRUA 4CI9A 1GTVA 2VT6A 4LCBA 5HWSA 4FIZA 1JQKA 4RVOA 5AQ1A 2H1CA 1YZUA 2OQRA 4KSYA 2IYAA 2Y0DA 2DGDA 4N1AA 4I8DA 4YDHB 3TINA 3IKVA 1A72A 2GYWA 2HQSA 1I4TD 4U02A 3FMFA 4J1QA 2EFDB 3T1HB 2ST1A 4GR9A 1GR0A 3AR6A 2D8MA 3FE2A 2V6GA 2HHHB 4C0KA 2R60A 4MS4B 1N2XA 1AB5A 1RM0A 1EVIA 3AJAA 5CFLA 4F7DA 4BMCA 1H2AS 4BBPA 3LIPA 3KD3A 2UUAB 4F06A 1YCGA 2ZT6A 3K1ZA 4GU5A 2H1IA 5DTMA 4QBIA 3D0QA 4R2KA 2NUAA 3AB3A 5E95A 4ZU3A 4AZ3B 821PA 3UOWA 2VBGA 2EEPA 2XUFA 4L5AA 3IUMA 1Z36A 2C5LA 4WV3A 3MT0A 2P91A 4RZXA 1NI5A 3PIDA 3RSZA 2OENG 1JG2A 1BDHA 1NFQA 5I4BA 4WASA 3DOIA 3DPIA 2FDRA 4ZQEA 2EKZA 2LR0A 5LB4A 2CNWD 2O23A 3GBPA 1Z5ZA 3KB6A 3THXA 1P31A 2W93A 3EN0A 4QUKA 4X7PA 3CE9A 2LBPA 1UEJA 2OO3A 3A0UA 2QTNA 1U2TA 1WDWB 2M9MA 1RHRA 3OCVA 4M60A 4XSHA 5CG2A 7ABPA 1QIFA 5FUQA 2B4QA 2X40A 5JTUA 4AN1A 4FR2A 3U4GA 4OIMA 2IC5A 2ZRPA 4RV9A 4ZTBA 2ZQ5A 3E3LA 3OOEA 2X7HA 4NAVA 1TO2E 3I01M 4XQGA 3T3EA 4Y1FA 4JKYA 3QY9A 2JFFA 1NW3A 2CSUA 4I9GA 4B4VA 3HSSA 4CKCB 1R8SA 1OASA 2Z58A 3HEBA 3N3AC 3MSXA 4ALMA 2ATIA 1L6RA 2IYQA 3CLSC 1XV5A 1C29B 2FMTA 1O95A 3TGWA 3CH5A 2P3LA 1KI8A 1DG3A 1W2WB 4G01B 5TSDA 2XX3A 2CFIA 4DQVA 4RPIA 2Y1KA 4DCMA 5IT4A 2AJLI 1QFJA 3FLEA 4UHDA 4RY0A 3ZIAA 3W4IA 1NRWA 2X0RA 2YDYA 2ATCA 2V5AA 4B2YA 2X5KO 3T0FA 4DKXA 4CF7A 1OWPA 1QE3A 2D1RA 2Q7XA 2R2GA 4PO1A 3SNKA 2YWCA 5I9TA 1E5TA 2A1TS 2CHFA 1G21B 1INLA 5JNUA 2JJ1D 1OV4A 5LCXA 4R69A 2V7PA 3BFJA 2R8EA 1VKRA 5IVHA 4IICA 5AUPB 4DLUA 5T6BA 4CKYA 5KJCA 3T1TA 4E2ZA 3HN7A 4M9QA 4M0FA 2CDCA 2Q6IA 1H6BA 3HU5A 1P3DA 4Y0NA 2GX6A 3PD0A 3VR1A 4CNBA 1XTPA 1YS4A 3E9CA 1MD9A 3L7MA 2QLFA 2OAEA 2WYVA 3H4TA 3GMSA 4J6FA 1IPHA 4O4HB 4R81A 3ZZTA 2ZKLA 2FWPA 2SHKA 4P53A 1V0JA 2HA2A 4F38A 4XDZA 5K0ZA 3PQ5A 1SY7A 1TD9A 4K87A 4MB6A 5B53A 4D74A 5AVTA 3BX1A 1SPXA 2W2LA 5DX8A 3RM3A 1KFCB 2QIOA 3VI4B 3E6AA 3WMGA 2BF4A 1FMCA 1S8FA 1YV9A 4L5IA 3H0EA 5ABPA 4YUXA 4J6EA 1NA5A 1HKUA 4G65A 4MITA 2WJJA 1E63A 1DAMA 3NWOA 1KZ6A 2BMWA 3TLJA 4DF3A 3JAKA 4MEAA 1F8XA 1U7OA 1EFTA 2SBTA 3FETA 4LAFA 1H5UA 4YJKA 4ZCPA 2D2VA 3E9QA 1RXVA 4E03A 2XCUA 4Q1CA 5ELMA 2NOAA 3KZNA 1CUYA 2IU6A 3LOPA 4PZ9A 2UYYA 3H84A 5EPEA 1OLSB 3ROZA 1PTJA 2YIMA 3C41J 1DBRA 3ORFA 3Q15C 1UDWA 1HKHA 2WKRA 5FLKA 2EP7A 4B17A 1XCGB 1DWPA 2EBUA 5C7IO 1U3UA 4U7DA 1KYZA 2XE6A 4Y6LA 2DKFA 4UEQA 2A5JA 3LZCA 2C03A 1YB1A 4Z4GA 4D0NA 3A7EA 3WYNA 2R1TA 3M34A 1KO5A 4J7XA 5K2OA 1QRDA 2YOFA 1QOZA 3ZWAA 3CJRA 1QP8A 3NEYA 2HUNA 4PM4A 2Z43A 4U2CA 5C4GB 3GFBA 4CHTA 1H9CA 2ZI3A 2W6MA 4FDLA 5JBIA 2BR5A 2EX1A 5E9JA 1XZLA 4KMOA 4C6SA 2BSAA 1P2DA 1IRXA 3BORA 1M66A 3Q3VA 2C4WA 3K5IA 3UNXA 4JXZA 3TIGA 5J40A 3QP9A 2ZJOA 2AN4A 2QRVB 4HZGA 4RY8A 3X1YA 2Q6TA 4AZ0B 1ORWA 1BE1A 3LY7A 5KVSA 4MP3A 3FNGA 3K32A 3DDNA 1PGJA 2QG4A 1Z18A 3Q10A 4LKOA 5CXSA 3RUAA 2ONYA 4RU1A 2Z2ZA 3O74A 4U7GA 4DLPA 4G63A 1NL3A 1P7ZA 2Y76A 4X1IA 5REQB 1PQUA 3KS9A 4YMLA 5JSZA 3PF8A 4EMSA 3OZCA 1K2WA 1GPMA 2OO5A 3F1KA 1GZ5A 2BWJA 1ZVQA 1QB7A 2NU9A 1TB4A 2B6HA 4E07A 1KO4A 5KWJA 3RIYA 1LXCA 1EFUA 3GPLA 1PFVA 1FK8A 2AYXA 1FP4A 3NCHA 4MV8A 1N2CA 3PWTA 4WZBA 3BYZA 3EEFA 4BE7B 1ADBA 4QDKA 3SEZA 4MWDA 1WZUA 1UZUA 4GI5A 4QT4A 5BVGA 2PX3A 4YLEA 3COPA 4J0DA 4JYCA 3PHBE 4Y1EA 5K2MA 2AMFA 4AMUA 3INGA 4I4TA 1UFKA 3I45A 4BKRA 5TDHA 4DWVA 2FPOA 5CFPA 4JEUA 4JXJA 5AVXA 3T3IA 1XZEA 2JGFA 1DLIA 3E05A 3A1EA 1DAHA 1Y6RA 2N9UA 3EQ8A 4HH0A 1AHIA 4MP6A 3LX6A 2ZYWX 4OJNA 1MIOB 3JTMA 1ADGA 2O8FB 2IHJA 1FJXA 1ZGGA 5BSRA 4IGEA 1FLDA 1N6LA 1Y33E 4QOIA 1GKIA 3UPDA 3D59A 1GEEA 3CX7A 3PDIB 4P35A 3GFPA 1OFHA 1T8UA 3IRVA 4HDMA 3PNQA 4NZPA 2V8OA 2Y77A 2V98A 1KU6A 1OU4A 4H1HA 4LJ9A 4U7FA 3WDLA 3AWDA 3WK9A 4CV0A 1UKEA 3FSGA 1K5HA 5DGDA 4Z2YA 4A3SA 1T1EA 5JVDA 4DN6A 1I7DA 1JEEA 2MTBA 3GCZA 3K1TA 3OKFA 4UCWA 2YOGA 3VOAA 4FX2A 1VPDA 4EGCB 4CDMA 4TVOA 4YACA 3KYDB 1HZZA 4YK7A 5G4KB 3B1WA 4M1KA 1B14A 5C3MA 3QG1A 1Y89A 4H6VA 2XA2A 3EAFA 3OPNA 1BHSA 1JB1A 2RCYA 3KWMA 2O3UA 1RWQA 3HS3A 3MJEA 1TAGA 2KS6A 2Q62A 2IBTA 2O5EA 3I4LA 2HMSA 5FEMA 4X85A 3PDJA 3VC3A 2DU8A 5KAPA 1B6GA 1N0WA 1T8RA 5HQ3B 1NX6A 1U1IA 3IPCA 1F8UA 1SWWA 2RKOA 2Y1OA 3T7DA 4KB5A 1ECJA 3D2LA 3W8RA 5TVKA 1PL8A 1UAGA 2NQ2C 2VJNA 4LRSB 3E8SA 5LR6A 3DMNA 2PE5A 3GJ0A 2E7ZA 5T4BA 2W58A 2PUFA 3AF2A 1K8ZB 3QVVA 4NONA 4A7PA 3TVTA 4HWSA 2AMVA 4X3OA 1QCZA 1CY4A 1FA9A 3IP8A 4CMAA 5HNKA 3OZFA 1N5JA 1T6YA 1SC9A 2EFJA 5HIIA 4BQOA 5COAA 1RXYA 5ARCA 4DGSA 2QTAA 3VPXA 5FTJA 4CFSA 4ENSA 4KVGA 2J6HA 5DCWA 5C1OA 1GHTA 5BWMA 5CYOA 3A0RB 4RXUA 4F93B 1OH7A 1UXJA 3VPCA 2HQRA 1Z6AA 2VF4X 1I3MA 4D9BA 1Q7RA 1YR9A 4MK4A 4NCKA 5FOUA 2C20A 2DBQA 1E9VA 2NZ2A 4X94A 5EE5B 1PBTA 1VBMA 2WICA 1U9CA 1S5PA 4NZZA 2I66A 4YAGA 2VT3A 1GNPA 3D8UA 1JAIA 2RHWA 3EXG2 2BEUA 3GFFA 4N8EA 4WECA 1A2QA 2XF8A 5DI9A 1Q7TA 4RVHA 2FEPA 3RRZA 3X2FA 4B4UA 2VNIA 3HBJA 3KL4A 4ZVUA 2VT2A 1A5BB 3AL2A 5F33A 1V45E 1E9FA 2QE6A 2A1IA 2R6DA 4UREA 2HF8A 4ETWA 3LLCA 2OHJA 1U1CA 2PYDA 1NZJA 3OPMA 2QY9A 2QL6A 1EWRA 3LFHA 1UDCA 2J3JA 3NGMA 2PBZA 4EA7A 3NAZA 4R4JA 4QUGA 3QVMA 1L2TA 4ZV9A 2WT8A 3F6PA 4JBNA 4CCYB 1O9BA 1UMCB 4QXOA 3ABIA 4EELA 3AF6A 3L7KA 3R0JA 4PC7A 1KHTA 1V4BA 4TSFD 5T5QA 3CVVA 1P80A 2M98A 5L6MB 1EK5A 5SY6A 3IOYA 3BMCA 1GTG1 3HEAA 4M99A 4J4BA 4WBNB 3CRZA 4FBMA 1ITZA 1RXIA 2B2XA 2WM9B 3HEMA 3U26A 4DANA 3EXHA 3AEQA 1NPDA 5ALWA 1EE9A 1JFTA 1PAUA 1UJBA 5HTOA 1W29A 2PO5A 3KTAA 3QMPA 1GL7A 2YBEA 3KVRA 4MDYA 3G82C 4N8DA 3I8XA 4R2IA 4ZO9A 3SYRA 4G89A 1Z08A 4EA9A 4OTZA 2JF0A 4KLCA 4EYQA 1T36B 1T9CA 3T94A 4B79A 1CCWA 1GCIA 3HNRA 2HV8A 3A06A 4DYHA 3PKZA 3IURA 2CZGA 1M2FA 4WZZA 5G4LA 1ORDA 1E2QA 1A9QA 3GP8A 3F7MA 1JN0A 1SFRA 3PVCA 3OSUA 4BFCA 1DL5A 3NRCA 1B6TA 4UHCA 5CVTA 1BMDA 1YL5A 3GARA 4CQMA 1XDGA 2QKYA 3GMIA 1VHTA 2FWIA 3OIYA 3PUYA 4PFQA 3H42B 1EK2A 1EUCA 4MWTA 3MWEA 1HE4A 1TVCA 2QPAA 4PXYA 3OZ7A 2AOWA 1C8BA 2DHCA 4W1RA 1VYUA 2N1BA 1F14A 3NW9A 1AN9A 4MWEA 5JS6A 2X0EA 1SQ0A 2GEFA 2I6XA 4Y2JA 4OI4A 3CZ5A 2XF2A 4GWLA 2WTMA 4KXVA 1Q15A 4V02A 1V2HE 3PWKA 3CKLA 4U1RA 1NMXA 2AN3A 4HQNA 3K9HA 4I4CA 3CX4A 3SQDA 4C5CA 5HIKA 7YASA 1PEAA 2KBFA 3OZIA 1QGED 2D2FA 2FZ5A 1JT9A 1MEEA 5FI3A 3WQRA 1U7ZA 1O7JA 3ZQJA 3CRW1 5D5PA 2C8VA 3D0KA 3TJZA 3M1IA 2BGTA 2ZAYA 3G5AA 4N5IX 1B7GO 1XCJA 2VAPA 2WJ4A 3A3KA 5DSXA 2CYBA 1IJKA 1FYFA 2GHRA 3R3UA 4ZMRA 1GY8A 4G0NA 1X7YB 1E9BA 5LWHA 1TOAA 2QDKA 2BD0A 2Z95A 5FB3A 3UWDA 1USVA 3E5HA 1H8HD 5DSZA 1CZHA 5JSKA 2W9XA 5IHXA 3TZBA 2GXQA 3DQQA 3VU3A 2XXAB 5EWMB 1NZDA 1IWPB 2WFMA 4QARA 1WCIA 2A2ZA 5JCOC 2HPVA 2CGEA 4DLYA 4JLJA 3RSLA 4ID3A 1ZU4A 4M1SA 4LPKA 4IV8A 4C1NA 5KOJB 3UH1A 5CIQA 1Z68A 4KHPB 4GMHA 1ND5A 3A4MA 1J06A 3DAOA 1AIPA 1A8IA 4DMUB 1NBWB 3AVXA 2ZJ5A 3HJFA 5GTDA 2XWJI 4Q3KA 1OIWA 3TSCA 3WRVA 4EUKA 5JS1A 1Z5UA 3LX4A 2ARKA 4ENTA 3O84A 2HMAA 2WG0A 4BO7A 4N01A 3EA5A 3R6WA 3TDKA 1J4AA 1KKLA 2WIJA 2VWGA 1RTKA 3IAHA 4UTZA 4XM1A 3D3EA 5F12A 2R11A 1LPBB 3R9XB 1UINA 4QEKA 4CL0A 3HLTA 4NU5A 4DSUA 5KYYB 3DFZA 1SG9A 5CDFE 4IGIA 3RFCA 3RTDA 4XDHA 4CGYA 4E11A 2E21A 3QF4A 3WXBA 5DT2A 2PANA 2I91A 3G1TA 4RJIA 3WLRA 4G3XA 2VYVA 4FD2A 3EBOA 2EWVA 4RIEA 1UP7A 3SN6A 3QHQA 3TSOA 1E92A 1GG9A 2XJ9A 5EHZA 4IHKA 1OXUA 4P92A 2WT9A 4MGIR 2EARA 3LPAA 1IL0A 1B43A 5BUZA 2OCAA 4OGLA 2O54A 2FY8A 1IOZA 1G98A 3PDHA 1C7ZA 4D5GA 2ZIEA 2B7LA 1JIVA 2K5UA 2Q2NA 1LLCA 4WEQA 5B1EA 3FPHA 2X3FA 1ZRSA 3H4IA 4DG5A 4C5BA 5DWDA 2TRSB 4GEGA 5K0TA 3TLZA 4QTXA 3CMMA 5DYYA 4D8XA 4H1VA 4M0CA 4UBMA 1M2NA 1UFOA 1BXGA 4BFLA 2CJPA 3BS4A 2NUPA 4OB6A 4MB0A 4RBNA 4PLZA 1Z0SA 3MFQA 4WVFA 3FF4A 4S04A 5HZHA 1CP3A 3ECSA 2DQ4A 1P4RA 3DFKA 4NBWA 4XFKA 1QYWA 3KYCA 5FNVA 3REGA 2Y6UA 2XCSB 2DSNA 2O6LA 4YRCA 4LI0A 3IAXA 1PLJA 1CY8A 3O8QA 1M2OA 4AJKA 4QUEA 1L7DA 2AFIB 2ZRQA 3DKIA 4G24A 4QBKA 2NO6A 1ZZGA 4R1UA 4Y6OA 1A4RA 1Q6ZA 2BM0A 3TB6A 5KC9A 5ITWA 2RC5A 4Z4QA 1I30A 3LUPA 2GNPA 4KBYA 3KDSE 1F2TA 2I71A 4J07A 3Q3IA 3K16A 1A9TA 4UBOA 1DWOA 2NLOA 1P73A 1SUSA 5IFLA 4XOIA 4LNUA 3E3AA 4M8KA 4DMLA 3EBLA 2XMGA 1HDZA 4EM6A 5JZVA 2QYOA 1L7EA 2WJPA 1AMOA 1XQVA 2EKPA 2FPMA 2Z2JA 3TLYA 1LB1B 4NR0A 4WZAA 3DMTA 4H08A 2BDUA 4CLXA 2FWBA 1T8PA 2W8BA 3FW1A 1BA3A 1UT8A 1FEZA 1JNXX 2XCTB 3ZK8A 1AV6A 3VU8A 4I5FA 3A1VA 4JLNA 4LCJA 1D2AA 5I7WA 1T5LA 5F23A 4UC0A 3I9NA 1O8CA 5HUJA 5KJFA 4EVSA 3UMJA 1H4SA 4M9UA 3ICWA 5CTJA 3W0LB 4A0HA 4BGDA 3KLBA 1JG1A 2O06A 2PKYX 4UCFA 4ZJYA 3KEQA 4HUQA 1J09A 5FBKA 4MVJM 3FZYA 4IQ0A 3BXZA 2H4YA 1GRCA 1CZOA 2VKQA 2QU7A 3THWB 1I4LD 5FTMA 2C83A 9LDBA 1XK6A 1U0RA 3ND9A 3Q87B 4DIBA 1JHVA 2P9JA 4Q7KA 5IWCA 1PVOA 4C4RA 1ZEMA 1CUXA 1E3IA 1W96A 5HCNA 3WSVA 2YV5A 2JH3A 3LSTA 4RCYA 4BO1A 1GA4A 1W25A 3EIHA 5KB3A 4WXRA 2HCTA 5AFSA 1QHFA 1YC2A 2BMVA 1HE5A 2EYUA 2R3SA 3H2SA 1GNLA 1UPCA 2L17A 5DHRA 1NDUA 3RT9A 2OFPA 3SZMA 4E5MA 2K7FA 4Z9BA 4CKZA 3ZJVA 5LDGA 5KTRA 3ZZ0A 3FGNA 1MB4A 4GMFA 5D6NA 2KYRA 4PRYA 5IK2A 3BRCA 3VO8A 3UW1A 4LVUA 4QRDA 5AVKA 4PEVA 1EVLA 2OOKA 2XHZA 4OHVA 2ZS8A 1MA3A 4QYIB 3T5DA 2UYCA 3JQCA 4DTIA 3COYA 3AFHA 4IR7A 4XGKA 3DTVA 3NJ8A 4KL8S 4E4RA 2P2CA 4JU8A 1E1KA 3BZUA 1AF7A 2F9FA 2HXYA 2HFJA 3U62A 5CLHA 1TF2A 2V1XA 2B0CA 2ERXA 1Q84A 1U9IC 2OZLA 4MS1A 1X3LA 1YSCA 3ZCUA 1VL1A 2R7MA 4JENA 4N0MA 3A6PC 2O52A 1TZKA 1U3TA 2F7SA 4LXTA 3NTQA 2VAXA 5C53B 3V6MA 3ACBA 5DWVA 4EEKA 3AJDA 3ZDQA 5I4KA 1Q1QA 5JNVA 3JAWA 4EB3A