3Q7TA

2.15a resolution structure (i41 form) of the chxr receiver domain from chlamydia trachomatis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
96
Chain Sequence
PKHVLLVSEHWDLFFQTKELLNPEEYRCTIGQQYKQELSADLVVCEYSLLPSFVLVLLDFFDEETSVDLLDRGFWYLIRPITPRILKSAISLFLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The atypical response regulator protein ChxR has structural characteristics and dimer interface interactions that are unique within the OmpR/PhoB subfamily.
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Transcription
molecule keywords Transcriptional regulatory protein
total genus 32
structure length 96
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3q7tA00
1DG9A 3TB6A 1TVMA 2HQRA 3CG0A 1QO0D 5IBQA 1MAVA 2FQWA 3R0JA 2FMFA 3CKMA 1L5ZA 4NQRA 2E4WA 2V0NA 2WJWA 3IP7A 2W42A 2Q5CA 4WXMA 2R25B 3H1EA 3IP6A 4HNQA 4YP9A 2FMIA 4Y9TA 4IGAA 4RK4A 1URPA 4MLCA 1SXIA 1NY5A 1ZY2A 2H0AA 2TMYA 3N8IA 2GI4A 4MR8A 1NXPA 1S8NA 1XWWA 4MQFA 5HM6A 5IULC 4HYEA 4W5QA 4KFCA 2B4AA 4RU1A 2VUHB 5GQSA 2H3HA 4NCBA 3Q7SA 3FFXA 1DP4A 3KHTA 5JNRA 1P6UA 4IRXA 4MS4A 1A2OA 2AYZA 4RY0A 3URMA 4W5RA 4PE5B 3EJWA 1YK0A 1YMUA 2PLNA 3G1WA 1APBA 1EWVA 3RVJA 3T6KA 4Z4EA 4KQCA 3NNDA 3RVRA 2QXYA 3OLYA 4N47A 1QPZA 2FQXA 3DBIA 4MS1A 4NV3A 1ZH2A 2IPLA 3A10A 3HDVA 4JOQA 4MR9A 2MSKA 1QO0A 4OBBA 4N41A 1E6LA 4RDCA 5KC8A 1NXVA 3O75A 1LJLA 4ETNA 5ED4A 3HS3A 4KV7A 4YLEA 1PUXA 3OQOA 3LMKA 3MYYA 5EWLA 1JDNA 2PUFA 3EQZA 4YGXB 4RY8A 5T7BA 2ID7A 2FMHA 1GCAA 4Z9AA 3A0UA 3CRNA 3G85A 2PUEA 1ZGZA 2FKAA 3O1JC 4CBVA 3RQIA 1Z25A 3TX6A 2QZJA 2PUBA 2PL1A 2M1ZA 2E4YA 3RVNA 5TQ2A 1VPWA 4ETIA 1Z17A 3EULA 3OLVA 3QEMB 1NXSA 1H9CA 1QP7A 1QP0A 3LUHA 5IX8A 3C97A 4JAVC 3I45A 3JVDA 2IPMA 4IILA 4IMIB 5KC9A 4Z4GA 1J56A 3EAFA 3GL9A 2L17A 3OO1A 2B1JA 4NCAA 3BRSA 5BQ3A 1ZAYA 1CEYA 3CTPA 4O1HA 1DRJA 3KLNA 1D2AA 3O2QB 3RVOA 3LUFA 1SRRA 4ZJPA 4LDAA 2LIVA 4Z9BA 4EUKA 5D2CA 4ZYLA 4EVRA 3CHYA 3BILA 1VLZA 2CWDA 4QYMA 4UHKA 1USKA 1DZ3A 4O5AA 2E4VA 3GWGA 4Z0NA 3Q9SA 5C5EA 4E7OA 6ABPA 1XHFA 2PAFA 4S05A 1VRVA 2NT4A 5EWJA 4MAAA 2FMKA 3FGZA 2LPMA 1QQBA 3NBMA 5JS2A 1DC7A 2HPHA 1F51E 3ILYA 4MR7A 4YCSA 2E4XA 1DBQA 4RWEA 4DADA 4JB0A 4OLBA 3LUDA 3W9SA 1U0SY 1ZH4A 1FFSA 2PKXA 3H5IA 1TLFA 3KYIB 5C5CA 1JH9A 3LUCA 1MB0A 2NZVG 4YWHA 1KGSA 3JVIA 2JK1A 3TO5A 3C3KA 3OQNA 3QEKA 3MIZA 9ABPA 4M88A 3JTEA 4EY3A 2FXIA 2JCGA 3IP9A 4MYRA 4EVQA 4G0MA 3QEMA 2JBAA 2FEWB 1FSPA 2HQOA 4N0QA 1DCKA 3HXMA 3N6VA 4D6XA 1BDHA 4RK1A 5EWLB 3Q7RA 1HEYA 3QELB 1ZVVA 3H6HA 3D8UA 5HQJA 4F12A 2YHBA 3Q15C 1QQAA 3DLHA 2A9RA 2MSWA 3Q7TA 4ZMSA 2GKGA 1QMPA 2PJUA 3GBPA 2QU7A 5DGCA 1YMVA 3RVPA 3HEBA 2LP4Y 4RK6A 2CD7A 1XHEA 5I4CA 4GPAA 1JF8A 5CNIA 1NXXA 5TQ0B 3LUGA 2ZWMA 4H60A 1BDJA 3QK7A 2A9PA 4OATA 3RH0A 3L49A 3TMYA 2R4QA 4RK7A 2FLKA 3H5OA 4MQEA 1CYEA 2WB4A 2HJ9A 4MRMB 5TPZA 1JDPA 4ML3A 2IDMA 4WT7A 1OXBB 5EWMB 4RS3A 1D5WA 3QX8A 4MR8B 2E4ZA 2L2QA 1L5YA 2R48A 1NXOA 3M9XA 5TQ2B 5HSGA 3SQNA 4FE7A 2OENG 3M6MD 2FSPA 4EYGA 2FTKE 3ROTA 3IPCA 4Z4HA 2M98A 4RKRA 3O21A 3H5VA 3UK0A 5JNTA 2HSGA 1TM2A 1M2EA 1LBHA 1VKRA 1SD5A 4EYQA 5CHYA 2IPAB 1DC8A 2NUBA 1SXHA 2JBAB 4JASB 3D02A 4LDZA 1GUDA 4XARA 5TQ0A 1BDIA 2MYUA 3SG0A 4F06A 1Z26A 3HDGA 3NNNA 3DGEC 1KRXA 4NICA 4MS4B 5TE9A 4S04A 4B09A 2MYPA 4N0PA 1PEYA 5DKFA 5F64A 1GLGA 3IDOA 1RZRD 2A9QA 1NXTA 2N9UA 4W5TA 4KQ9A 1EHCA 4KMRA 4TLLB 8ABPA 3GV0A 4YS6A 4W5NA 4YRZA 4FE4A 5IEBA 1TJYA 4Z4FA 4F8JA 1T34A 1W25A 1YIOA 2FVYA 4XAQA 3MF4A 3O2SB 5E3JA 5FBHA 1Z2EA 3EGCA 4HNRA 4F3TA 1U2PA 2FW0A 3NNSA 3FFTA 1JBEA 3QX9A 4ZPJA 3B2NA 3MA0A 3JPYA 4MQEB 2QVGA 3F73A 3CG4A 4LZLA 4N76A 4YR7A 3N0WA 3LKBA 1BAPA 2ZAYA 1D4ZA 1U04A 5EWMA 3BREA 3NHMA 4YV7A 4XXHA 3F6PA 2MSLA 4O1IA 3ROFA 1UDRA 2BGGA 2CHEA 3FMVA 3GRCA 3M9WA 3QLVC 3QLVA 4LE0A 4P1ZA 3OO0A 1USIA 2JVJA 4MS3A 1PHRA 4H3KB 4WZZA 2JRLA 1M5TA 3KS9A 3CU5A 2HQBA 1EAYA 5CNJA 3HUTA 3GT7A 3O2JA 4OG2A 1DBWA 3DLBA 4L85A 4QPJC 1JYFA 1P6QA 4XLTA 3N53A 2PE5A 1ISSA 1ZESA 4JA2A 1JYEA 1ZITA 1MB3A 2P4UA 2WMYA 3H5TA 4RXTA 1FQWA 1ISRA 3QLTA 3BRQA 1JHZA 4D74A 3MM4A 1FFGA 3LFTA 4WXEA 3I09A 3OQMA 3JY6A 2LUOA 2MYNA 3ILHA 1ZHHA 1DBPA 2ID9A 2L19A 2PUDA 3IPAA 4GNRA 3E3MA 4IMJB 5KWSA 2VUIB 3H75A 1Z2DA 1RZRA 2QV0A 3SNKA 1E2BA 1Z16A 3F7NA 4HNSA 3SAJA 3HK2A 1QP4A 4MQFB 5BRJA 1YS6A 3LKVA 3F6CA 4MRMA 4Q6BA 1U8TA 3HCWA 3HZHA 6CHYA 5IUNC 2PUCA 3P9YA 1A0OA 3T38A 3FFWA 2J48A 2AYXA 3O74A 1P8AA 3KLOA 1B00A 1OXKB 2X7XA 4QICA 1K66A 3DGFC 4RSMA 2PMCA 4KZKA 4KVFA 3EQ2A 3OLZA 3JS5A 5TPWB 1QKKA 4G0YA 1LK0A 3H1GA 1BA2A 2A9OA 1IIBA 1GUBA 4MR9B 4Q7EA 3T95A 1JFTA 1MIHA 4OTZA 2FN8A 2JB9A 3IP5A 4H3HB 5FWYB 1YS7A 1D1QA 3LUJA 3C3WA 3N0XA 4G0QA 3EDCA 4G0PA 3MMNA 1F4VA 2RDMA 2R47A 3A0RB 5FBKA 3BBLA 5KQGA 1TMYA 4QYWA 2JVIA 3H6GA 3RVKA 3O1IC 3N75A 1W9HA 5TPZD 1JWLA 3GYBA 4RXUA 1ZN2A 2FEKA 4RV5A 5JNSA 2RJOA 3EODA 2PUGA 3QELA 3GBVA 5PNTA 1ABEA 2FLWA 3H5LA 1ZDMA 1DRKA 1JFSA 1ABFA 1DJMA 3LTEA 1YVUA 3H1FA 4W5OA 1Z13A 3HVRA 2PUAA 4Z4IA 4UHJA 4JB2A 4LRQA 3SM9A 4PZ0A 2WJAA 3RVSA 5KQPA 4KNYA 4RY9A 4KRFA 2O20A 2L18A 4G86A 3VNAA 2RJNA 5JNWA 2IYNA 1RNLA 3A3KA 4G0ZA 1DCMA 3DZDA 4G0OA 1YK1A 4TN5A 5JNVA 2QVCA 3JPWA 3KJXA 4MPTA 2RGYA 4Z99A 5KQMA 3K4HA 3S99A 4ETMA 3KSMA 1LBIA 1BVHA 1NATA 3I5AA 1RXIA 3RVQA 1Z18A 1K68A 3CZCA 1DCFA 3RVLA 3OLXA 3HSYA 4TMYA 3KTOA 3HUUA 3CS3A 4YO7A 4RK0A 3HJFA 3FDFA 4LX8A 3KG2A 4Z4CA 2P9HA 3N0RA 5DTEA 1PNRA 3I42A 1Z15A 2F8SA 1Z12A 3CFYA 5IC5A 5BR1A 2KYRA 4G97A 4LE2A 1EFAA 5GOTA 3RVMA 5DCLA 3UKJA 5JS1A 2CHFA 3CNBA 4FB4A 3L6UA 2YHAA 1GCGA 1JX6A 1EWKA 2GX6A 2WRZA 3OM0A 5FWXB 2NZUG 4IF4A 1C0EA 1WETA 1Y1LA 2DRIA 5HKOA 3GA5A 4XASA 4N03A 2FEPA 2IPNA 2VYCA 4JP1A 4RKQA 1CHNA 1AB6A 2PL9A 3HM9A 7ABPA 2FQYA 4MS1B 5DLEA 3KCNA 5EWJB 4WWHA 5TQJA 5KI6A 4EVSA 2F8TA 3H5WA 1NXWA 2IOYA 2XDYA 2I6FA 4DQDA 5FWYA 1NTRA 3E61A 3O1HB 3OM1A 1JL3A 3T8YA 4WUTA 4ZMRA 1D1PA 1A04A 1SXGA 1USGA 2IKSA 4L4UA 3OLWA 5T3YA 1YTUA 3C3MA 2OQRA 5B3JC 3KYJB 3OMXA 3C6QA 4G0XA 2QW1A 1E6MA 1ZGGA 1QNLA 1E6KA 3CLKA 4RXMA 5KQLA 3HV2A 2WY2D 3MQ4A 5CNKA 1C4WA 3LUKA 4MLDA 3UUGA 3LUAA 4MGEA 1M5UA 2MYTA 4PICA 5B3JA 4TLMB 1LJUA 1I3CA 1JFVA 2FN9A 2VK2A 4LE1A 4E7PA 4F11A 2GBPA 3OMWA 4RK5A 3NHZA 4PEVA 3CZ5A 4MR7B 1PEAA 3SY8A 5IEJA 3HO1A 4MS3B 3TD9A 5CNMA 4PYRA 5TPWA 4KK3A 4KREA 3K9CA 1KMIY 4EYOA 4KPYA 1MVOA 1RPJA 1AB5A 1JLKA 2QSJA 2QR3A 3QLUC 3QLUA 1RXEA 4RZSA 4XFKA 5IUKC 3VNBA 5JNUA 4EYKA 1R8JA 3KKEA 1EWTA 4P98A 1KRWA 2GWRA 5IUJC 1U2QA 2LBPA 4EGSA 2NT3A 4DN6A 5FWXA 5ABPA 4D6YA 1P2FA 3LOPA 3Q41A 1PNTA 1M2FA 2WWVD 2E4UA 4Q6WA 2JVKA 1FFWA 4KK4A 5BRAA 4OLAA
chains in the Genus database with same CATH superfamily
2WYWA 1IWBB 2GCPA 4B46A 4Q12A 2HFJA 1C8KA 1MAVA 2B1IA 3COWA 3OMLA 5F5LA 5JSYA 2Q6TA 5B1HA 1HURA 4Q4AB 5A0VA 3KYCB 1HKUA 3SF0A 4DDVA 4J91A 5I9LA 4P4UA 3KM0A 1LSUA 4OM8A 1ONBA 5U4QA 2CXQA 3I0ZA 3ZK8A 5AKZA 1D1SA 3N8IA 4GM1A 4MMZB 4H18A 4GYYA 3WR5A 1N57A 3MUNA 4U7TB 1T5SA 2HH9A 4E88A 1O08A 2GWHA 4PYJA 2ADFA 2J0EA 2GASA 4R8MA 5I8ZA 2JGEA 5JD5A 2P6MA 2OYCA 1DP4A 5JNRA 5U4XA 1D2NA 1DAOA 4PINA 1P6UA 2V4UA 3AHDA 5DWQA 3MLBA 2QPOA 1SD2A 3WMFA 2O7SA 3GJ8A 3WK4A 4RKFA 1EWVA 4GEKA 1G5QA 3KPJA 4PSDA 1G60A 1PK7A 4BBJA 2P2CA 4RVNA 3GEHA 3MMZA 4U4AA 1OKKA 4GH5A 4MGKR 4G37A 3HJGA 4XB6B 4P93A 5ALOA 4FFDA 2FQXA 2MCFA 1IG3A 2WTBA 2HCRA 1JI0A 1ZH2A 2Y1GA 3OZDA 2PQ2A 1E6LA 3EMVA 3CZQA 3IMCA 1K7YA 1JSRA 3G5AA 4IDAA 1UQUA 1UBTS 4IOMA 4WVFA 3DE4X 3BC1A 2GLXA 4LHEA 4PZ9A 4D45A 4B79A 2DPHA 1Z0DA 4I55F 3LWBA 5ELLA 3RT1A 5A1TA 5GJCA 1BMFD 2H54A 5AT1A 2P7HA 1XRRA 4Q3AA 3UAVA 4TYYA 1QS0B 4YGXB 2I4OA 4PC7A 5DTJA 3PQEA 3RJ9A 4A8TA 2B6NA 2FMHA 3LQQA 3VU8A 2OQVA 2Y1DA 4RW0A 1K86A 1L1EA 2CYBA 4UXJA 1P3DA 4ZRNA 5CA1A 3CRNA 4UCWA 4M1WA 4YRGA 5DSZA 3CKKA 1T8PA 1G17A 2JZCA 2W6OA 3DTVD 4ZEMA 5L3SA 2NTVA 2ODBA 1XEXB 2P75A 1XOIA 2B4QA 5K6RA 1BXZA 2H18A 4P80A 1ZCAA 1E4OA 1IJKA 4Q9KA 5F7ZA 5ALRA 2JEZA 3W9BA 4YUYA 1H9CA 3LUHA 3AGPA 5IF3A 4RCZA 3EUEA 4CTOA 4BFCA 4TZ0A 3SJ7A 1YBHA 3UCFA 3WL4A 2DYKA 1IY0A 1FX0A 1TK3A 3FCUB 3AFHA 4ND6A 2GTHA 2YNMC 4Z4GA 4RUKA 1P4HA 1F2UA 1Y3HA 4IDQA 4BDSA 2GD1O 3FSEA 5AXBA 3DLAA 4WH0A 4Z53A 1C8VB 2DBRA 4D4JA 4AUKA 4LV8B 4UNQA 3RSZA 2ZSAA 4E07A 4MA5A 1V45E 1PS9A 2RI6A 4YRIA 4AQYB 1Z4MA 1SRRA 1Z0ZA 3E3OA 2OB2A 5C1DA 4B3JA 5FEMA 3D8HA 2NU6B 5AK3A 2XUIA 5BORA 4XIGS 5EE9A 3N0TA 3SQLA 2RGEA 5K0FA 3UQYS 3C87A 1CVIA 5DWDA 4L9RA 1ZZEA 2C61A 1N6NA 2ZJ7A 5C0OE 4LCJA 1RJWA 5H5JA 2HTFA 2ZULA 2A33A 3UJDA 4NG5A 2NQ2C 4MV1A 3FNBA 3AJ9A 3RS8A 3DMGA 3VOAA 2PFGA 5T6MA 3SDSA 1OZFA 3WSTA 1BOOA 1U8AA 1ZD3A 2VAXA 2YINC 4WK6A 2AXQA 3BQMB 3L7JA 1KDYA 4V2IA 1UP4A 3P8ZA 4ZK2A 1Y8CA 3DAHA 3H19A 3PHBE 2FOIA 4IG4A 4NSNA 3M1AA 1VCMA 4ESEA 1E62A 3ZH2A 5EIBD 2LCQA 2XZOA 3S2EA 3F0TA 3PKJA 1A4IA 6REQB 1Q0UA 3OLCX 1GKIA 2JIMA 1JKJB 2QRZA 4BXOA 3AFMA 3NB0A 3TZCA 3JWGA 3DOIA 4BVKA 3LUCA 1JLHA 4YWHA 3AFGA 3KKLA 3C3KA 3OQNA 2JIZD 4BLPA 3R40A 2XMSA 3EHDA 4N7BA 1NT4A 1RI1A 2YC4C 3I1JA 5DBEX 3NATA 5FUBA 2PS9A 4C0XA 5HJ2A 4B48A 4EVQA 3U6BA 3BXFA 4ZANA 2G0AA 5ITSA 3EZLA 3OOWA 1DXQA 1JQLB 2I3BA 4HDNB 5FR2A 1MVLA 2Q5QA 5FAXA 1EVQA 2P9QA 2L42A 5AFSA 1XO1A 3QRWA 5F73A 2NPOA 1WPXA 4D26A 1Y9ZA 1PN3A 1JHDA 2ECOA 2GKSA 2VP6A 2WWTA 2YHBA 1C7JA 2XOKA 2ZREA 3PEUA 2MSWA 3F5DA 5CVEA 2HDWA 4BQRA 1COZA 3C8HA 3BUSA 1E7YA 3C0KA 1WXQA 4NCIA 4TSRA 2G9NA 1V9CA 1WB6A 1XZAA 2NTEA 4UBKA 4GXQA 4AD8A 2F8MA 4X6LA 5ALWA 4B9EA 1KWKA 2ERXA 2Z3ZA 3Q5EA 3IEPA 5KSYA 4RK6A 2J41A 1NLYA 1SRQA 1WBDA 3AVTA 3GJZA 4B7XA 1L7DA 1UQTA 3V48A 2XY4A 4EBBA 4NAVA 2P9JA 2Q3CA 4COOA 5I8PA 4P0PB 2RK4A 3CRQA 2A78A 3RBAA 1F4LA 3MZ0A 3PIIA 2WUGA 2CXSA 3F4LA 1FXSA 1W0KD 4OATA 7ADHA 3T34A 5ALEA 4KSBA 1VDMA 1EP3B 5J4LA 3TMYA 4CI9A 4HBGA 2HYDA 4ND8A 2VPTA 2J0VA 4E2ZA 1T2EA 5B1SA 5KYWA 2ZRMA 5LBUA 3NHSA 2JAQA 2AIRA 2G28A 3W1WA 4ANFA 3HA5A 1D5WA 3EUWA 4RS3A 1G4UR 1NI4A 2QE7D 1BWQA 2C8VA 1JWAB 4K6CA 4AMUA 4D4MA 3HJFA 4G26A 2BPOA 1LFDB 2OORA 1OE0A 1ETHA 1QYRA 1U9IA 2M98A 2VYQA 3JASA 3VR6A 2BUAA 3AESA 5C3MA 3ZKWA 1TJ5A 1U8EA 1A71A 5JNTA 1IRXA 3KSAC 3KVNA 3QWFA 3WGKA 4W9MC 2ZBQA 2R1TA 1XNGA 2R6GA 2Z4TA 4LBVA 2DETA 4GOND 4Q7JB 3DH0A 1Y9EA 2I78A 1T3GA 1T2FA 3DKIA 2G9ZA 4CMIB 4HDMB 5JRZA 4BGDA 2C2OA 1HXHA 2IIPA 3V7YA 1ODSA 3BSWA 4QTUB 2VUTA 5A0FA 1N8TA 3TFQA 3UWDA 4AO7A 4G0VA 3O94A 3OQIA 2Y93A 3R9WA 1LWNA 1BDIA 4F06A 2BHNA 4XUGB 1YIDA 2KPOA 3KPVA 3M5CA 2QMUA 1L4LA 4CDMA 1F2DA 2SKEA 3EXHB 4PONA 2DKOA 3OUZA 5IAJA 5BPHA 4FFNA 2XA9A 3Q6NA 3GDHA 3ZXSA 3JQPA 1PIWA 4GKBA 3KJNA 4W5TA 3AYZB 2W4MA 4L3WA 5JZSA 3WGGA 3ED1A 1QH9A 1E3SA 2R6AA 3ZGOA 1UIRA 4GEGA 1CNEA 1Q1ZA 3QVTA 4RENA 1SIBE 3HPRA 4FE4A 2AYYA 3Q12A 5AP9A 2VCYA 3TB4A 1O6FA 13PKA 2ONKA 1ML3A 2GZAA 1TJ3A 5B5SA 1ORTA 2WM2A 5E2AA 1TU3A 4H6WA 1N8KA 2C4HA 5AK0A 5FCDA 3TD2A 4O08A 3C8MA 1U98A 5CM9C 2N47A 1KAQA 3MCTA 5J5CA 1H2ZA 4DNQA 1RAFA 1RACA 2EG9A 2O2DA 1W5TA 3UANA 2NU8B 3QOFA 5TC4A 1XNRB 4MQEB 3B5IA 3VH4A 3QFFA 5BQ5A 3RK1A 1UDXA 1D0IA 3L92A 3VZSA 4W5QA 4ZOCA 4GZLA 3ONFA 1AG9A 1TW3A 1H22A 4R83A 2Q1YA 3IRVA 3QIVA 4K9DA 5TJHA 4X24A 3DDOA 2GESA 2D0IA 2A0YA 3ROFA 3WNVA 1L5KA 4NAHA 2CL0X 1ECCA 2R5FA 2PUWA 3GRCA 1A8UA 4GGOA 4Z7NB 4R2IA 4PO1A 5K0SA 3OZWA 4DIMA 2CB9A 3AT1A 3DDZX 4M6WB 4X00A 4X71A 5JDCC 4HZGA 4LTNA 3ZHZA 4OSEA 1UQRA 5EL0A 4EEXA 4YYZA 1H6CA 2HQBA 2BFEA 1NBMA 1PNVA 2UU9B 3JRXA 1YMQA 3HUTA 4GGMX 1EQAA 2R86A 4P53A 4L8GA 1C7IA 2RCNA 4MUJA 3D2AA 1VL5A 5KYKA 1WCIA 4R1UA 4D9FA 1W76A 2BGRA 3F1KA 3MRVA 1YNOA 3N53A 3GA7A 4XLTA 2FZVA 4DM4A 1IBLB 1T9AA 2YL2A 1W85A 2WMYA 4C3UA 2N0SA 1MO5A 2V9CA 1ISJA 4OV6B 5SZHB 1CUEA 2WWFA 4A8JB 4HB4A 1NNUA 2QMEA 4BX0A 2C98A 1FS6A 2DFNA 4L95C 4LDQA 2B3DA 2PQMA 3OZTA 3QYJA 5BXQC 3IVXA 1K8QA 3TBHA 2CNNA 2I33A 1UWVA 1W0JA 1ADBA 4DWJA 3SNKA 1GRNA 3HCDA 3WHIA 4AKSA 2ANBA 4YMIA 1SCIA 4B6OA 2J6HA 1H9AA 2X5NA 3SE0A 1O0SA 2EEZA 1JLLA 1II0A 2IOFK 5FDFA 1CSEE 1XTVA 3IPYA 4P84A 3P5BA 3SKXA 5C35A 3IJ5A 3WX0A 1I10A 3UYKA 2LDBA 1ORIA 2J48A 2APJA 3UOGA 2XF8A 4ASUA 3HKDB 1R0CA 4JLAA 2BFMA 2OBFA 2PYDA 3AWIA 1M76A 4H31A 4Q7KA 5C53B 2X2FA 4RPJA 4CM9A 5E1DA 3B1WA 3ECSA 2PRJA 1OYOA 1BA2A 2A9OA 3HR8A 4F1JA 4FNAA 1RLOA 1GDDA 2BGMA 4LGVA 1E7WA 2UZ1B 5FWYB 2XAAA 4D1YA 4M60A 3WY9A 1QFJA 1RRPA 2NNLD 2C5GA 4DNFA 3WYEA 3N2EA 5U1PA 2FP4A 2ZI3A 1NPDA 5DHQA 3A8TA 3K0AB 3RB8A 4EB6B 3IQWA 1V8PA 3ISVA 1HNWB 1GN9A 2Y1KA 5LQAA 1TAUA 4Q47A 4DSZA 3HR7A 1JU3A 1VJ5A 3BWXA 4WADA 1E5DA 2VUUA 4ZGBA 2H7YA 1JLLB 3Q72A 2VBFA 4GPIB 4Y3UA 3FTPA 2H16A 1ICIA 2H85A 3GGCA 5FJIA 2AKEA 2GN9A 4ZYXA 1JFSA 3B9RA 3VMMA 5K0CA 1W30A 1DJMA 1FMCA 3K0SA 3OCYA 3VSDA 1U1GA 3BA6A 1GITA 3PQ3A 1PT8A 1SG6A 2BHTA 3DL2A 2R8EA 2IU3A 4IUDS 3TEMA 3WG9A 1BN7A 1QZZA 4DWVA 2H07A 4NABA 5CFRA 3E9DA 4X8MA 4EKGA 1Z35A 1PK9A 4OUDB 3WIEA 2H52A 4OU5A 1UMBB 3PEFA 3X3HA 2ZU0C 1S9HA 5FPSA 1GM5A 4ENUA 4CMGA 1Q7CA 3COPA 4E94A 3CUVA 3WLQA 4EUFA 4ARZB 2DT5A 4J0GA 2R5WA 3IBFA 3CLTC 4LK2A 3LXXA 4DRXB 4HPXB 4GKKB 2ANCA 2FK7A 3FI9A 2OZEA 1NW4A 4EI7A 1NATA 2ZG6A 5TVGA 4AMYA 5BUQA 4KWCA 4I4TF 2WW8A 1N3YA 3CC8A 3KWFA 2JLSA 4U2BA 1ZNXA 4G3XA 1FDIA 3NC1C 5JAMA 1SOMA 4YUVA 1WKVA 1M1YE 5IT0A 4RZIA 5LZ4A 2VDVE 3F6BX 2HWYA 4P7KA 1VLVA 4N9WA 2C94A 3MWFA 2QAGA 3HRIA 4OOFA 4DA6A 5C7OO 2CK3A 3CMMA 1I7NA 2I3ZA 4JDUA 5FX2A 3FKSA 2P69A 5IC5A 5BR1A 4EKYA 2OG2A 3SBXA 5JE8A 1AM4D 3T9CA 5JWHA 1OBFO 4EKEA 4FYJA 4V03A 3E1GA 3THXB 2ORED 2VLIA 1O95C 2YHAA 6ADHA 3CPHA 2F7SA 2O8DB 1C0EA 1OR8A 3RSLA 4GOXA 4YFYA 1Z0AA 1ADFA 3WFZA 2VHYA 4IGKA 3ADBA 1IOZA 3DP9A 3OCJA 4MKRA 4Z9XA 1QC5B 1QRRA 3CA8A 4X0EA 1I36A 5TR9A 1EH5A 4JP5A 4L57A 3UFBA 2ORVA 1G2QA 1U2GA 2YDYA 3RS9A 1G3UA 5CB6A 1VCIA 1XHLA 2OGZA 2BIFA 2C5LA 5FXMA 1SAYA 1XLVA 3QJ5A 5UKDA 2OY0A 5KI6A 4ER0A 4F5DA 2F8TA 1NW6A 4J0QA 1CTQA 3V2HA 2PL3A 3QKTA 4HEA1 4HQLA 3OM1A 4MW4A 3QYPA 4FBGA 4UUOA 4OH7A 1NAHA 1SKYB 2JJ1A 4U7GA 3VV3A 1A04A 2G9RA 2VDPB 5KOIA 4BFUA 3ZNOA 5JTUA 1AUXA 3ELBA 3AR4A 4FXOA 2QAJA 4K6OA 1G21B 4LPKA 3KB1A 2XITA 3L82B 2VOEA 2QAGB 4TX1A 3ORHA 2AN4A 5EYPA 1R88A 1QVRA 5DYGA 3TXYA 1UC5B 3TLCA 1E6KA 4BEJA 3CVYA 1Y3AA 4G6ZA 3IMEA 5DHUA 521PA 3EGOA 3DZKA 5IU6A 4MLDA 4G1FA 3UUGA 2R8XA 3JQRA 4KFTA 1WHTB 4XQ9A 1OLSB 2OBLA 4I0WB 3WB9A 5J1SB 5FBRB 3VX3A 3AU8A 3QVMA 5AVUA 2G40A 2J4CA 4QLBA 3RYIA 4LYDA 3ZW7A 3A14A 4WXHA 1L0BA 1B1AA 4FD2A 4Y1RA 4EX6A 4YECA 4CQMA 3LT0A 5ER6A 5BQOA 1V1JA 4DR2B 1ULHA 1XVLA 4TM7A 1YE8A 3PQ8A 1F8UA 4IVPA 2VDWB 1CUIA 3I61A 1JHRA 4XFKA 2WWGA 3QLUA 4UULA 1FTYA 4IV8A 2FDRA 5H9VA 2WWIA 3WQBA 2X13A 3U56A 3MFYA 1M73E 1TYCA 1KMCA 1V16B 1ZHFA 2VDQB 3L0PA 3O8DA 2FEXA 2MMGA 2YWXA 4IIVA 4B5KA 4CW7A 1Y6FA 3PP8A 3OZSA 5BYBA 5FWXA 4A0GA 3OTGA 3KJGA 3R41A 4C6TA 2E4UA 3U4AA 4CUZA 4GKJB 4ZPJA 3HU2A 1EUCA 2I91A 5BMOA 4WLOA 2ZYRA 4B2LA 2BM1A 2CNLA 1NFFA 1SU6A 5IBQA 4FFLA 821PA 4IQ4A 3RTBA 1SVNA 3ABZA 4UTOA 2V0NA 5HS6A 4B3HA 4BKRA 4FCVA 2I7VA 2AKAB 3CH6A 3HG7A 4LJYA 4X7MA 3SZ3A 1X1BA 2WSLA 3O73A 3NCTA 4AF7A 1OKKD 4IGAA 1REQB 2OGWA 2VEOA 1X0VA 1X1CA 1YB6A 1BGXT 3DL0A 4LWOA 2CXUA 5H8WA 2GI4A 4UEQA 2OZVA 4DVJA 3ZU5A 3CNNA 1E2GA 2YUTA 2H7CA 4QJBA 1A98A 4WBSA 3WLTA 5LU9A 1D6JA 4B73A 4DS3A 1NT2A 2VUHB 3LHDA 3ZVRA 3CVWA 2RKWA 1JG7A 3HVKA 1MABA 5E4FA 4TYNA 3URMA 4N3CA 1JG1A 3PPIA 5DNUA 3UJAA 2QD3A 1RI5A 3V2IA 5DF1A 1HE4A 3RVJA 4C4PA 1D04A 4II2A 4OQFA 3KP1A 3JWHA 3SS9X 4QYIB 2QTVB 2H1IA 3HCNA 4R68A 2BHLA 1I9CA 4IHQA 3UXEA 5E9AA 1AZLA 5KYTA 1DLJA 2AN1A 2WJYA 2X8LA 1C30B 2QY9A 4NOLA 2ZI4A 4CKCA 1PQ4A 2WIBA 1CZHA 4OUKX 4RDCA 1P8JA 4HAVA 1A88A 2W6MA 5I4IA 3L8ZA 3I8XA 4Y30A 4OAQA 4ZI7A 4IH4A 1BQEA 4S3MA 1TM4E 5AUQA 3AWDA 1T9HA 2CFCA 2ZBPA 3SSMA 2P90A 3KQWA 4IL5A 2DMRA 5I47A 5A7HA 3L9XA 1N1MA 1GOTA 4OHZA 5JWOA 4Q1BA 2YOGA 5JZMA 2VDNB 2VJYA 4G9BA 3HB7A 4JFAA 2ZZMA 2EDCA 4HDSA 3TLYA 3Q3GE 1RQPA 4IDFA 4DLZA 1KYVA 4OF4A 4TKVA 3QU2A 2VO1A 3K7EA 4N3AA 4RSRA 5KWEA 5SYNA 1TGYA 4DV7B 4YIHA 5HJEA 1X0XA 3L1JA 2A9KA 2I62A 3OLVA 4TS1A 2FDCA 4OU4A 5EUMA 1NG9A 4OVKA 3QKIA 4DLNA 1FA9A 4MCJA 4PBSA 4Q34A 2WUDA 2IGBA 1E0DA 3GLQA 3FCOA 2G4VA 1X14A 5C8YA 2QMOA 5EJ2A 1FSZA 4I5FA 2PBZA 3I8SA 1K75A 1PSDA 1OU0A 1W93A 2L17A 4O2LA 1KPIA 5JAPA 4L51A 1GTG1 2O3RA 3OU6A 1O6BA 3CTPA 3PNKA 2HFKA 3NHLA 1KOFA 3AVPA 5JS7A 3LPMA 1X1RA 3GVHA 2EJVA 2PEZA 4H15A 1XZFA 2V7BA 3IQEA 1R9JA 3V8EA 3W5AA 3EVEA 1WIWA 3EGIA 1QK3A 1AN0A 1TPZA 2ZQZA 4KIGA 3KT3A 4TS9A 2IXFA 1HFJA 3DDSA 3ON5A 3G9QA 3OZGA 1PR4A 2E4VA 5L3ZA 4Y1EA 2RJ3A 3ENQA 2FH5B 2GEVA 3V1LA 3LY9A 1S2GA 1MEEA 3MRSA 3OPYI 2WLSA 3PL1A 4PNZA 3TRJA 3DKPA 3G13A 4AWAA 4RV4A 3ZHYA 4XVUA 2QVLA 3GROA 1MFZA 1PL8A 1SIOA 3FGZA 1ACMA 1ZWKA 5J4VA 3KR0A 3GQVA 2HPHA 2ZBEA 1AO0A 1M2HA 4RWEA 3OIWA 4EFNA 3RVDA 5FH9A 1ODCA 1QHFA 3EZ2A 3JYNA 4LBZA 1EB9A 1U0SY 1W46A 2XVXA 4MGHA 3W9SA 6LDHA 1XTUA 3USZA 1MOQA 4IOJA 4ZCTA 4QOJA 4KQ6A 1HYQA 2F62A 1TM1E 1JH9A 4INJA 1MOZA 2X7JA 2NZVG 1NGSA 2GCEA 3IESA 2RGDA 1PEKE 4E14A 2CWWA 3UJ9A 5ELMA 3F4BA 3OPXA 4TZKA 4D3XA 2QM0A 3BDVA 3PGMA 1DAMA 1RW4A 4BCCA 2E0IA 3MWJA 4CQMD 1RXWA 3PCRB 1I1HA 2OZKA 5IYZF 1SOAA 2GB4A 4E5DA 1G5RA 1R16A 2KBFA 1K3FA 4M0MA 5B2EA 5HK9A 2ZYVX 1T10A 4DVGA 5HF9A 1V8FA 2QM8A 2AT1A 2ZYIA 2A1TR 2RSLA 1EINA 1IH8A 2IUUA 3A6EA 1PVDA 2WWXA 4X64B 4BJ6A 2H8KA 4J0HA 4KAAA 3H7AA 4C0WA 4Z51A 1Y5IA 5KTRA 5C4MA 4M9CA 4EZEA 5KYUB 4KJXA 1JLRA 4ZMSA 1ZNZA 3MS4A 2CUNA 2GHRA 3DNFA 4QHSA 5CX1B 2OC4A 3CVXA 3OHPA 4ROSA 1N7GA 4I5IA 1AZTA 1E4VA 2VF2A 3N6XA 3RVPA 1UAAA 5DBFA 2CD7A 4DC1A 4LHYA 1XAIA 4RCYA 3W77A 1T5HX 5BN1A 1YQGA 1VMDA 5DLYA 4U6SA 4X85A 3G02A 2K2WA 2CZGA 3VDQA 4G65A 2ZWMA 1CUVA 1AZWA 1R6DA 1GLVA 3AFOA 3LOUA 2BTOA 2D6FA 3SC2A 3C4QA 1T3LA 4RK7A 1EAMA 5B30A 2VTDA 4UTNA 4MRMB 2Y1XA 1DCTA 4QPPA 1OXBB 1QBGA 4J43A 5IH3A 1PTJC 2E4ZA 2D2IA 3E9ZA 1UJ6A 1OYYA 1SQ0A 4NE7A 3AP3A 4HFRA 1XPUA 4F1KA 1J2YA 1PT5A 5BW5A 1B42A 1UPCA 3KYDB 1HQCA 4H08A 4NBSA 1UOEA 3VR3A 2BMVA 4BNFA 4ARUA 3AI2A 2QVYX 1T4BA 3EIHA 1FX0B 1KMHA 3LBYA 4L7QA 3SXJA 2BEJA 2OQ2A 2HSGA 1Z3CA 2A35A 2HHJA 3RU7A 1AKWA 1TK2A 2R2AA 2YCLA 3EBOA 1SZDA 3N2NA 1I6LA 2QLFA 2KSQA 3I4LA 4PHGA 1Y1TA 1SBZA 2EG5A 1G38A 2A92A 2JBAB 2PWZA 4DCCA 3Q3EA 1RXCA 5ICSA 5KS2A 2A6PA 1E2IA 2QHXA 2WYOA 3PA8A 4RLFA 2QTZA 4Q9NA 3UJPA 4L5YA 1CS4C 2MYUA 3R44A 1E1LA 1E4EB 2PSFA 1N0UA 2HLNA 2QRLA 2W2XA 1XXHE 4MS4B 4H0CA 3IDAA 4EB6A 5K0JA 2YZKA 4RIFA 3CGWA 4G25A 1PR1A 4WD3A 3M6FA 2JG3A 3NBXX 4FMPA 1V3TA 2QTTA 4GOLD 5C80A 3RUDA 3VC3A 1GGKA 1XFDA 1IQUA 2YHIB 4PLGA 4R1OA 1M66A 4OCZA 1EHCA 1PJ8A 2ZBGA 2ZXEA 4DA4A 1VLLA 1P39A 2ZDGA 4EYSA 1AF7A 1GUZA 3N7AA 1NG1A 1QIFA 1GGHA 1H5QA 2CVFA 5BSUA 2IXTA 1H3FA 1LK5A 1L8AA 2O05A 4YRDA 4XJSA 2XCRB 5HFAA 2PA3A 4G07A 5AHWA 4HVCA 2RGBA 3C3JA 4WK0B 3RFFA 4K88A 3PYMA 4P81A 1U0GA 5FOVA 4G4GA 2C7OA 4QQNA 1CY0A 4Q9DA 1DARA 4LGYA 3DOEA 1QP8A 4YR7A 3GRYA 1TCUA 1TKRA 5ALJA 2OLEA 1OMOA 2JFWA 1PI3A 4XB1A 3UMGA 1GFZA 5G0WA 2PV7A 3D3JA 1YBMA 4ZVVA 1GRRA 2WK1A 3IUYA 4AKEA 1EG2A 5AVSA 1N7IA 3V9PA 2IS6A 1SHKA 1YWGO 3GFFA 1WLYA 5A71A 4HNAB 4WX2B 1IB0A 3L1UA 2NZJA 3O2JA 1LV8A 3RASA 3ZWXA 4RE5A 5KYUA 2CFRA 4ZAGA 2PT7A 3ABSB 3RO7A 3P45A 3QV1A 4RA6A 5JQGF 4A92A 1A69A 2RBKA 4HN9A 2QJFA 4IGIA 1B43A 1ZITA 2XH8A 1M1UA 1Q7EA 3VPGA 2HWXA 1TEXA 3EGVA 4KE8A 4JVOA 1QG4A 2B36A 1A76A 2HZ7A 3NYQA 4NBKA 3JWEA 1T3HA 1F1BA 1R7RA 4LY6A 3CRMA 3GGGA 2XGOA 4EHIA 3A6HA 4X90A 4L27A 4IFEA 3K5IA 2V96A 4N8DA 4OHKA 2D00A 2Q9UA 3KJFA 1YNSA 3EPLA 1NV9A 1WKBA 3VHRA 1YS6A 1YQUA 2R00A 4WESA 4MRMA 3E05A 1JQBA 1U8TA 4NDNE 2FX2A 1MIOB 1QGAA 2H3EA 5EZYF 1OBHA 3LECA 4JJGA 5FPHA 2J5XA 3M6IA 2CJXA 5E7JA 1VRWA 5TMDA 1NJ1A 1KEZA 4QDTA 2V59A 1HUQA 1PZFA 3NTXA 4OQMA 3RFTA 3G2IA 2ZTUA 3QE4A 3FZYA 3NWJA 1N2IA 3CV3A 4Q3BA 4HUQB 1DBRA 3I01A 3I05A 1P7VA 3QXHA 1PV4A 1AH2A 3AH8A 4Q18A 4E5PA 1XRMA 3O26A 4AL4A 2XKKA 5K0GA 3T3NA 2RMKA 3RHFA 3I3OA 2OXCA 3W1VA 1Q50A 4DT1B 4YRLA 1G64A 3K9HA 3REOA 1R6VA 2XE8A 4MUGA 4QXPA 4ZAWA 5HX7A 4MYSA 4EGAA 1Y8RB 1FMTA 1ZJJA 4LDPA 1YRBA 4YJGB 2X4GA 2G1UA 4MVJH 4XM0A 2EXXA 1TYZA 2VHXA 3MTBA 3RARA 4WHMA 4DB4A 2QQEA 2AFHE 4MVJG 2MINB 3OE7D 3QYFA 4CIAA 2XMDA 1OAKA 1QV9A 4YDSA 2PUAA 3LLSA 2EHJA 2QRVA 5LBTA 4A10A 4FQ7A 2I4MA 3GUHA 3C4VA 2RJNA 1J49A 2IYNA 3MJHA 3MCAA 4Z5XA 3LRTA 5J4KA 3GLFB 4GGPA 4DCSA 1U3VA 3ANYB 2AFIA 4DLKA 1NYQA 3G2QA 4F4UA 3ZDBA 3OKCA 3FTCA 3H16A 4EA6A 1BG6A 3DBVO 2PX3A 2DHQA 4LVNA 3D6JA 4YP5A 2QWXA 4URUR 2NO6A 4FDMA 5HBGA 2PCJA 3IAFA 1U1CA 5EE3A 2ISQA 3O90A 1R0KA 1K68A 1EE1A 3CZCA 3RVLA 2C5AA 3U0BA 4DUGA 4D0LB 1G63A 1U28A 4LZOA 1JHAA 4UUPA 2C57A 1U7TA 2XA2A 3IAS6 3T4PA 4JIGA 1LGYA 3BGWA 3WYGA 4CKWA 2E21A 4U9IS 2WD7B 4UATA 3UQZA 1E9FA 4B40A 4WL0A 4F2HA 1E3TA 2XMPA 2NW6A 1S2MA 1Q1AA 4FC7A 3JD0A 2C5SA 3AKCA 4HX2A 4GX1A 4JVMA 3PGLA 2C83A 4M7PA 3SHVA 1ZSYA 3D3QA 1M6HA 1MAWA 3PDWA 1OXUA 2CMDA 4JT8A 2CNKA 3IT2A 4DCOA 2G82A 1FNDA 3DEIA 1R9NA 1MQAA 1WMEA 3DF9A 3F6EX 4G0NA 2GX6A 2ZTHA 1CYDA 2QX8A 1NVFA 5JCJA 3MFQA 4HQ6A 2WUEA 1VLMA 4KDFA 2WHQA 1P4GA 1AE1A 3NHAA 3MIIA 1EQ2A 1XTKA 3FTDA 5AOVA 1ZGHA 2FPGA 4A2QA 2JD1A 1N5KA 1H1LB 2VPYA 1V6AA 3BXOA 4BRSA 3U3XA 4UM9B 2C8JA 3RI3A 3N05A 5KPDA 5TVKA 2J32A 1CE8A 3LPDA 4JJ8A 4MS1B 4Z0PA 2XMQA 3OOHA 4XCVA 3IP1A 4NYMQ 3T7RA 3LIPA 4ZQIA 2OGTA 3WOVA 2Z2ZA 5CR9A 5JISA 5JADA 4LIPD 1QHNA 3SS8A 3VH3A 4ZAVA 4B84A 3REQA 2I3DA 1TZJA 3U3OA 4QSMA 5FWYA 4FBLA 2J4DA 1JL3A 1B6GA 1K2VN 5AKLA 1XMJA 1MJFA 4OI4A 1OZ0A 4OP2A 4BATA 2BH9A 4YRQA 4WMLA 4YVFA 3AF3A 4TTJA 2Q0SA 1E77A 1E69A 5KZMB 1FU4A 2W11A 2PX6A 3MTAA 3VYTB 5KNLA 4ZT4A 3VU0A 2JFXA 3FVWA 2WA2A 4PZAA 4ZO6A 1P0QA 4BO1A 3ZHVA 4RXMA 5B3KA 1DS6A 1ODIA 1O87A 2F1IA 3N6RA 4S1NA 3U9SA 1KBZA 2BEVA 3KD3A 1MO2A 5DHSA 1NW8A 2WOJA 1J0CA 1HE8B 2BCGY 2PPVA 3W6OA 5AESA 3DV0A 4A3SA 4BNDA 4ZC8A 3N8GA 4LHXA 2XCQA 1MR3F 3WNCA 1QORA 3ZWAA 2FFQA 3KV3O 1CS0B 2V3WA 3THOA 4PS0A 4RKEA 4DXAA 2JLXA 5CDFE 3PKIA 3VYSB 2VQ6A 3BCRA 3ND8A 3OIUA 4GZ3A 2GXSA 4DCVA 1JLKA 2QSJA 4JMLA 5CAEB 4YNBA 5H70A 1T4CA 4A26A 3GLUA 3ZNPA 4B7CA 1BE8A 1R8JA 2R84A 1AXEA 3CO5A 3TI7A 2FFBA 1XZPA 1XKTA 3L0DA 1GDTA 1K3UB 4RPIA 5CYPA 3QOWA 1THZA 3ZWNA 3E5MA 2P40A 4O3FA 1DKQA 1EFHA 4O2RA 4WNAA 1EE9A 1JDTA 2VAVA 2YH2A 1WMFA 3HXPA 4UEOA 4RWZA 3OI7A 2O5CA 3FAKA 1CY4A 3JALA 5AI8A 1JN0A 2WDPA 4TLEA 5BSGA 4XJXA 2GJSA 4MA4A 2C3PA 5JJLA 4WXMA 1Z0FA 4FOOA 1KY4A 1ZYUA 3DLPX 4WKOA 3KOYA 1EVJA 1EFVB 1LKZA 1E1QD 5CURA 2XUOA 4HAUA 2ACEA 4YN3A 3WDSA 5FOQA 5CXQA 2K2QB 1R74A 1FDRA 1ECFA 4MQFA 4MGZR 4MUYA 4LFCB 2PWBA 4KE9A 4C7KA 4OMUA 3DFZA 1KK2A 1PR9A 1GRVA 1E60A 3OQBA 4HMPA 2BHRA 4DR1B 2Q3MA 1W5AA 5EJIA 1I7SB 1F8XA 3V4FA 1Z6YA 2E49A 3VPFA 4QAJA 5KNDH 1QO7A 1TQ4A 4MV4A 3H11A 1XU7A 2GBGA 2ROQA 2HRCA 1G20B 3FR7A 3R3YA 4JR0A 1Z7GA 1EBFA 4JL5A 3WLIA 1QPZA 2JA2A 4OKSA 3WB2A 4DFDA 2I4LA 3QV2A 1RJGA 5GJWC 2H8GA 3A10A 2J07A 4JOQA 2W8ZA 4TMZA 2MSKA 4B35A 4BP9A 5AQ1A 5KTKA 4QTYA 1J21A 3A6DA 3RYCB 4H7DA 5BQXA 1HPLA 4KUGA 4QO7A 5I7WA 3HCEA 2OESA 3RU2A 4ZMBA 4A27A 1JDBC 2JLVA 4KYUA 4RPGA 4W99A 5BSMA 1P91A 1KJYA 4JLMA 1V5EA 4MV6A 4RY8A 1FYWA 4HUJA 4KSCA 4DJAA 3FWPA 3A7DA 3B1XA 1NW3A 3L7NA 4RD0A 5IMSA 5KX5B 1KI7A 2P6NA 3N70A 5TLSA 3G85A 4RVOA 2QW8A 3PZRA 5FOTA 3ZHQA 3CBGA 3QPBA 4DC9A 3K96A 4F60A 4WFQA 4ZEWA 2YRFA 2PL1A 1EUDB 4DR6B 1YV9A 3BE6A 4HYYA 5TQ2A 1WVMA 5JWRA 4Y2YA 2NZXA 2PSHA 3PWTA 1K2WA 1NXSA 2GH1A 1FYDA 1YZVA 3LO8A 2FVXA 4ZU3A 4D02A 3O03A 1BHSA 2V7XA 5LZ7A 1VOTA 3GDWA 1NBIA 5DULA 4L0CA 3VI3B 3JVDA 1U63A 1KBOA 4MQ5A 5D8DA 4ZO4A 1D9ZA 3B60A 1AC5A 5KNBA 4KCGA 1WW3A 2NNWB 3N3BC 5CLHA 1Z4OA 1WMAA 1ZAYA 1NHWA 3IUBA 1FXWA 2LTAA 2Z5GA 2ZRPA 3NM4A 3CCCA 3OECA 4AY3A 2M1XA 3IXLA 3L4EA 1MPTA 4Y98A 4FDLA 3LUFA 1WMSA 1ORWA 5AO9A 1QCDA 4US1R 1KVUA 4CCYB 2AMYA 1VZ2A 3NYRA 1PFUA 1OYWA 1XEFA 4KG7A 1ZVJA 4EW1A 1LLCA 2P3OA 4A5OA 5D2CA 4MQ6A 3X0DA 4DR7B 3OTIA 5CK4A 1UM9A 4BLOA 3R8FA 1YDGA 3B82A 4F7WA 3DPUA 5TF0A 2FPRA 1SVUA 3P4UA 4K87A 4YJKA 1M2NA 4BIMA 1ZR2A 1L4EA 2BEWA 5EPEA 4MWTA 3CLSC 3L6EA 1DZIA 3G2OA 4I6EA 2EHDA 2GJ9A 2NT4A 2H4YA 5J4HA 2GAIA 2QP4A 1XQVA 4AY5A 3DLTA 5BMVA 3CR7A 2ACWA 5JEDA 4HQRA 4LZJA 3O93A 3X44A 1GDHA 2CMGA 1KXJA 1MO4A 1ZIPA 4BE7B 1RT9A 1TPYA 3EXG1 4KVGA 1KIFA 4OQNA 4JJEA 1TEHA 2P2DA 4C14A 2P6UA 4JB0A 1RVV1 4JVLA 4KXVA 1Y3CE 3QNMA 2C7GA 3OH8A 1ZH4A 4QUIA 3ZGVA 4BQNA 4E22A 3X1KA 1ZZGA 3D1LA 3ND9A 4AJ1A 5JCJD 3WMRA 2FW8A 1VYVA 2HY7A 1U5BB 1IEXA 2ZUUA 4BGVA 2GEDA 2IOHA 4F9TA 5BQFA 3P9CA 5GZ6A 4DV4B 1NW5A 3TLAA 5FA6A 2WU0A 3LKZA 1HEIA 1NTOA 3Q0EA 1ZD8A 2JAPA 4OYHA 1GTSA 2XBMA 5A5GA 3HJBA 3OESA 2WPDA 3HO6A 3QEMA 1B23P 1QH1A 1JTFA 4X93A 3PCXA 2I7DA 1XJ0A 4HQFA 4C21A 5EKXA 1BROA 1FDWA 1XTBA 3D1JA 4JA0A 5M2QA 4WCFA 2R4UA 4R9UC 3WK7A 4NJEB 1YASA 2KMLA 2D0DA 3QELB 1FNBA 3UVEA 3D8UA 2V98A 3DM9B 3Q15C 2O2EA 3QU9A 4S0XA 5LDGA 4E1VA 5C37A 2CMFA 1EJBA 2A86A 1P2GA 1UT8A 2PJUA 3R7AA 2A0XA 3HCPA 2C2XA 3ONNA 2J3HA 2B3TA 2FRVA 2UYOA 3G1UA 1J25A 4OMCA 1G2IA 2FF5A 2WNSA 3AHHA 2YJNA 3JQAB 1YFJA 1I5EA 3K8QA 2C4TA 2ORWA 1I24A 1R6AA 5L40A 1R4NB 3WBFA 5DCYA 5DGXA 2MWMA 3IAM6 1BDJA 2IS2A 4OHWA 3N2KA 1KJJA 2ATCA 2YQZA 5BSRA 2W2QA 4FINA 1VGVA 1XLTC 4KQ2A 4ZQBA 2J9XB 5LFAA 4PQGA 4ZCMA 2LKCA 3H5OA 3EPHA 4WTOA 3EVCA 2IT1A 2HJ9A 4CMCA 1TO2E 1NM5C 5KSZA 1PFKA 2HLDA 2Q6OA 2WJ3A 4QXOA 4R84A 1AQUA 3AM5A 1PGQA 4ZPXA 5F35A 2UZ4A 3STXA 2EW8A 1KGDA 4F92B 6GPBA 1G4AE 5G02A 3WP1B 3K31A 4ROTA 2AJBA 3WOHA 2P3SA 3C6BA 4ACBA 5LYJB 4CFZA 1DIAA 4GICA 4AQ7A 5CU7A 2HPVA 2BCEA 4A9AA 5IKEA 4LS3A 4D8XA 4NOJA 5IH7A 5AVYA 4DWWA 4BVHA 1HKHA 1P17A 1B15A 4OP1A 4F84A 1HT0A 3M8KA 4YCBA 1NE7A 4MB0A 2HRZA 2VFAA 5CJPA 3R74A 4B43A 3VZBA 5B36A 2AOUA 4IIEA 5FBWB 3RAEC 4I19A 2F4NA 4JZKA 4MWGA 3SKYA 2GK4A 4AJ9A 3CXRA 3WICA 5JW6A 5CITA 3T7JA 3SG0A 3LA8A 3GZJA 3JQQA 4NICA 1DRWA 2X4IA 4WACA 3WHLA 3A9VA 2CLKB 4N1AA 3MPOA 3SZGA 3HYRA 5J2TB 5JT1A 3SZOA 1L1RA 5L4LA 1RYEA 2QTHA 2X9VA 4PLZA 4O3MA 1A2BA 4K81B 3QVXA 3O8RA 4I1PA 1G1AA 2AK3A 5BYAA 1XZIA 5B12A 2BOVA 1IFXA 1HRDA 2X5XA 4BP8A 5LYYA 1KE1A 3VVCA 1TUBB 5IAOA 1HL3A 5C18A 1HEUA 1W25A 3AXSA 5J59A 4W1PA 3D2CA 2HJHA 3AF5A 3BJIC 3ELUA 1QUEA 1U2PA 4LXQA 2YZ2A 2ZI6A 2BGLA 4NBTA 1X7DA 2O52A 2VWGA 1NVGA 3WI7A 2G9VA 1WUTA 3GLGB 2QRPA 5FOWA 4AU1A 1YDHA 3W5BA 4YJ2B 3GLFA 4Z3KA 1BAPA 5CH3A 1V8BA 1XP5A 2NO5A 3RYTC 2HIHA 4MWDA 4YACA 3W9UA 2HJGA 3PXXA 4F6CA 4YV7A 4HNHA 1PZXA 2FGKA 2QYTA 1ML4A 1R50A 1GNRA 1M0WA 4AJOA 1NQOA 2CHEA 1G0OA 3P26A 3T1QA 2VPZA 3WGLA 7AT1A 1T1GA 3AVUA 1ZX1A 3UEOA 3KSBC 4WPGA 4EFMA 3I6IA 1LPPA 3NTRA 1OBVA 3TRHA 1WF3A 3FRHA 4C4ZA 1OXVA 4PYKA 3RW9A 1DI0A 3WLHA 4BUCA 3ZCVA 3MILA 2VH1A 2FJ0A 3GT7A 4ARVA 1AGXA 4G5OA 4UE2A 4YJ3A 1ZOOA 3CH7A 2AN9A 3IL2A 3NWEA 4QPJC 4D7AA 4PC1A 1LTHR 3DVAA 3G2JA 3IQGX 1Y5RA 4M99A 5I9TA 3EQ9A 1ISSA 1L4GA 1C7RA 2JGFA 5EKSA 4WQMA 5K51A 2IE8A 5D86A 2RHDA 4KXUA 4RXTA 2C99A 4D74A 4ZI2A 3T5AA 1IDOA 3I76A 1FSFA 2CHQA 2DY1A 1OC4A 1HG1A 5H81A 3RRFA 3IKLA 2QQ0A 2QL7A 3FDXA 3PPVA 1JR3E 3UMFA 1G9SA 4LJRA 1YQDA 1D2RA 1FW8A 1P5HA 4CQLB 2ZIZA 1ENOA 2YWGA 1CNFA 2CVZA 3AHGA 1X3LA 3FBWA 3JRWA 4QPZA 1OASA 2WF9A 1J5PA 1O54A 1UIMA 1T5TA 2QTFA 3C3XA 3KZMA 3MTQA 2YN2A 4QTZA 1Z16A 4AAYA 4YPVA 1BCSA 4AYTA 3V33A 4I1VA 5F51A 5KTSA 3HXOA 5FTMA 5IXSA 3SWWA 2LZ0A 3LLCA 2AMLA 3I2IA 2QTGA 4BMSA 5JASA 2AHRA 3L7DA 1AXRA 1P1BA 3UC5A 2DVMA 4AMBA 4IJVA 4D9NA 4K3VA 1VE6A 1E0SA 2X0IA 5LQMA 2DECA 3DHYA 5GJVC 3ZIUA 3BFXA 5MF6A 1L7PA 1DQPA 1Z88A 3CMCO 5JHGB 4OXNA 1ZRMA 3HI4A 1U99A 5KJCA 4QM6A 621PA 3R7BA 1L5RA 2XIQA 3HUEA 5DLDA 1F0YA 3GUVA 4FFMA 4JUCA 4O4IB 4P82A 4KPFC 2YRWA 3V6MA 4CM4B 1Z7EA 4HNTA 1DTSA 1H65A 3BD9A 3DDCA 3FNIA 4H1HA 5EQJB 2FB9A 2OAEA 2PQ6A 3O7MA 4OXYA 4BFVA 5LU8A 4XWAA 5ERXA 2H08A 3E2MA 4ZAYA 1BJKA 3HWWA 4EGJA 4IIJA 1CZNA 3D3WA 3K53A 3UAYA 4XGIA 4M9RA 1X19A 2WE7A 3OPYB 4QOHA 2QRMA 1SUEA 5FUMA 3KOXA 2ZKIA 2A9VA 1UXHA 3IURA 1DWUA 3UV7A 3VYWA 2WSSA 2XTMA 3A6GA 1HZZC 3PC8A 3PXBA 4J1SA 5BXYA 1XN4A 2FEKA 2IYOA 2W6CX 3AOGA 3MT0A 2PUVA 5F3DA 3TMAA 3NIWA 3LP5A 3T3GA 3ZD9A 3WIVA 4PPQA 3TJMA 4NDZA 3UW3A 3A27A 4WJZA 5ICMA 4N7JA 4X65B 4N5IX 2M6RA 1EK6A 1FP4A 4NYMR 5IJ0A 2NSJA 4JZYA 4MV9A 1C80A 1EEXB 5DP2A 3CUWA 2I7TA 3OLQA 4IWXA 1T2DA 1WZNA 4NV0A 4QG7A 4MW1A 4F71A 3CUTA 3OFND 3TJZA 1NP3A 2A8YA 1G8FA 1N2CA 3W05A 4TSKA 5DW3A 4QUDA 2ZS9A 4TV8A 1UT6A 1I30A 2XTJA 1JHUA 1X15A 1H4QA 1PYDA 5LNK6 3OCCA 3L4JA 3PNVA 2BF4A 2NSYA 3H0KA 4J0FA 1DL5A 4LECA 4MPTA 2XUAA 3FZNA 3KJXA 4KQHA 1R15A 1ZP6A 1IY8A 2NYRA 3K4HA 3M6UA 3MTEA 3NHBA 3O4JA 4BVGA 2ZANA 1UADA 1FJGB 1D09A 2B78A 2FZLA 3A4YA 3RVQA 1BE1A 2RH9B 1YZFA 1AD2A 4CMIA 4UFPA 1KAHA 2VT6A 1YQ9A 2BMAA 5ALPA 5FI5A 5MHTA 4HSEA 4Z7JA 2EFCB 2EJUA 1DOAA 4NQZA 4RHEA 3QUSA 4G5FA 3V8RA 5CG1A 2HO5A 2FU5C 3MTJA 3BKWA 2H2AA 2B20A 3EGDB 3O4HA 5TQVA 1CG6A 2PVCA 1KAEA 3OD5A 2YV2A 1GARA 5INTA 1EFAA 3DPSA 2BKEA 1P18A 4AZTA 4RSGA 2CW5A 3OC6A 4FB4A 2XWQA 1NVWQ 1ZIYA 3H83A 4K7JA 1F60A 3I6MA 5EGNA 3JARA 5LLTA 1VPLA 1YCHA 2GCOB 2NZUG 2O4CA 1NF2A 1GVHA 1TVKB 1RRGA 4HS4A 5PGMA 5HKOA 4A73A 4RTKA 1WETA 2ODEA 2OOSA 3WXBA 4AKIA 2IEBA 3E7XA 1LI5A 4HWOA 3T5GA 3IBCA 4B85A 4EJSB 3K2BA 2B7BA 4RF4A 1SUFA 1CHNA 1LDEA 1PL6A 3C5CA 1IPEA 1N2BA 3FPFA 3LBHA 4UKDA 4Y6OA 2FN3A 1I0ZA 4MGIR 5EWJB 4YRNA 5BSWA 1U7PA 3K6SB 4WINA 4F85A 1DWOA 3OP1A 4XKJA 4YCAA 1E63A 1QHXA 3VTAA 1RRVA 2VCEA 1UBMS 3EXEA 3NUZA 5FHQA 3WLMA 4I2VA 4PAGA 5REQA 2PWPA 1HF3A 2AI1A 4MW9A 3ZG6A 4US0R 2AE2A 3ZCPA 4GAEA 4M9UA 3ELDA 3I6QA 1PJCA 3GPLA 1EIZA 4PHTA 1USGA 4OHVA 3WV5A 4YT8A 4MUHA 4RM2A 3D6AA 3OEHD 1VPDA 1MXFA 3C6QA 3D4LA 2QW1A 4G5SA 3DAFA 1M2JA 1N34B 2X14A 4JMPA 3HM2A 3PWKA 3TMKA 5BV0A 2B9VA 2OBNA 4DTIA 2PRKA 2ADMA 3AI7A 4XRGA 5C52B 1EA7A 2RCYA 4JD5A 1NVVQ 3CLTD 1TZMA 4NRDA 1CWUA 1P81A 1QQ7A 1U80A 4Q03A 1LJUA 2JLBA 1JFVA 5AVJA 5T57A 5AUOB 4F3KA 6Q21A 4LY0A 2QRNA 4JI1B 3ZWWA 4MYCA 3HE3A 3OJEA 1LPAB 1RQ7A 2CXTA 3O92A 4RZSA 2HF7A 4WIAA 2HA6A 1IAVA 3OTHA 2Y1LA 2WSYB 1DBIA 2WAXA 3AERA 4UBOA 3SBDA 2ZSDA 4OLHA 1M7HA 2IS4A 1QLHA 1P7PA 1UFOA 5SY4A 3WAJA 1WR8A 1J9ZA 3AUAA 2C0QA 1RKXA 4Q6WA 3ICOA 2RHOA 2CDAA 1TRKA 1DG9A 2I2XB 3GRKA 1KO5A 1X1DA 2J67A 3PHJA 3RVBA 1QB7A 3U60B 2BRUA 4ER6A 2JIRA 3HEMA 1U9ZA 2VT3A 1Y7LA 5HKLA 4HNQA 3H1EA 3EOBI 4JLWA 5ECYA 3FR8A 3GUCA 3VR6H 3WGTA 2YOHA 4BBZA 5JMWA 1FDVA 1B3RA 3B1JA 4I8IA 4RK4A 1II8A 1ZY2A 2H0AA 3PGKA 2G88A 5EMHA 3GNLA 4EHFA 3JYLA 3ONDA 5FL7A 5DISB 1IUPA 2JD2A 4CMHA 1QF6A 2CMHA 4XQ0A 2YIVX 3L7IA 2XKBA 3KR9A 1DX9A 7MHTA 3VRHA 1WQ3A 1O96B 3K30A 3UJNA 1U0EA 4KH0A 1E2JA 4DV6B 4CU5A 2KJQA 3JW8A 2ZCVA 4ILKA 2R97A 4KMOA 2V97A 3P5SA 2Q0XA 5F7JA 1GG8A 1MD9A 2SCUA 3IHKA 4MTCA 1W36D 1J99A 1HV8A 3H0EA 3KTFA 3NHPA 3ROMA 4DZRA 4J03A 4QASA 3JD3A 4L4SA 1NLFA 2C42A 4FSHA 1T1SA 4UEJA 4HGZA 2Y0PA 2XBUA 3GUYA 3QP9A 2W6PA 1IU9A 4LMRA 3VM6A 4CEIB 4FONA 1UC4B 3B38A 4MS1A 2AVNA 4M2LA 4CHTA 4YB8A 5HZHA 2FWMX 1UBUS 3HKBB 3TLEA 1PR5A 5DNEA 4JQCA 3CPSA 3NUGA 2BVNA 4MVXA 1J1IA 4ETNA 1QTQA 2GJKA 4EG7A 1OC2A 5D1NA 5FO1A 3E15A 2HHHB 5EIWA 1AO3A 1JDNA 3BZUA 4LHZA 1JU9A 4HWKA 3L46A 4AJHA 2XDQA 4Z2YA 1YRYE 5ULLA 5KIAA 4BFZA 3EW7A 1ATIA 3UA3A 5JROA 3LJKA 3FHOA 2AK2A 1SZJG 3QTLA 4JQZA 3P96A 1F6DA 3PIDA 2Y3IA 4OOEA 2QZJA 4EUEA 1W59A 3IUSA 4NMLA 4OD0A 4ARZA 2VJMB 3VYUB 4NHEA 4RZQA 1VPWA 2ENUA 3G8CA 3NG1A 3H86A 1E58A 4H1TA 1NE2A 4R9SA 1L5HA 2ZS8A 3PWSA 2YS6A 1ZD5A 1E2PA 3Q2OA 3I45A 5SY9A 2WF8A 4QOIA 3WYDA 4KO2S 5K4HA 4EA8A 4NI5A 5KO2A 2ZJAA 1WUHS 3FDJA 4JBHA 3ABOB 3LPNA 3IT0A 2TYSB 4YUZA 2NUTA 4KWHA 2YW2A 3FCYA 3IV9A 4IY1A 3EFOB 3BGSA 1M1YA 1D2AA 2GPBA 2RAFA 3E0QA 4IG9A 4LISA 1TYBE 4DPKA 2OBBA 3ADPA 4ZO7A 2X8BA 3SFVA 2QYSA 2O2XA 3VNRA 5ADUS 5ADWA 3DVRX 4ZJPA 2O6HA 3AJ8A 2VYND 4R81A 3H2ZA 1QIMA 5CW2A 1RLJA 3A9CA 3EG9A 1NKVA 2J3JA 3A28A 1UODA 4P36A 1DQSA 4DIEA 2YMMA 1XZ8A 1N6KA 1DEOA 1XTZA 3ZIAD 5E8JA 1EWRA 3STUA 3WNDA 1RWNA 4S05A 1RRFA 1CRWG 2XGGA 4LXGA 4NK5A 3PC7A 1SCDA 4MB6A 2FMKA 4W6QA 2X8JB 4HN4B 1NVAA 4FWIB 1TIKA 5FD8A 1Z5OA 1ZLXA 3EXG2 4IWYA 3SXUB 1GAEO 4MR7A 3T94A 3RS0A 3FOFC 3RADC 2W6ID 2CYCA 2X3FA 3NEJA 4IRMA 4DDTA 4RULA 4BMVA 3MJVA 3LUDA 4MCIA 5JG7A 2X0DA 5JYBA 4DV2B 1TM3E 5C5CA 4PY2A 4QZVA 4IZHA 4M0DA 4RTMA 5CT4A 1WY5A 4DEVA 1GRCA 1Y5LA 2PX4A 4UVDA 1II9A 3OIGA 1KYZA 4UNSA 3KKKA 5GGXA 2X3UA 4UM8B 2FXIA 2JCGA 5E8RA 3SGLA 3TW4A 1U2DC 1GR1A 1UPAA 3NOQA 3KAKA 4DUGD 2JCBA 1NJ5A 2BMJA 3NTVA 1V3VA 5DH9A 2QTMA 2C5EA 2H11A 1SVIA 2BLLA 3CJRA 3RYIB 3ZEIA 2QIOA 1C1YA 2XKAA 4D41A 4OL9A 1HFWA 4A2WA 2HCTA 2B2NA 3IEIA 4YV2A 3RKRA 3O4FA 3D5EA 1UMCB 1T2NA 4BNTA 3WBBA 3JATB 5JSHA 4P3XA 1NN5A 1PYGA 4MI6A 3L0ZA 1A8IA 3TWOA 4X7PA 3ETEA 2C92A 2PSDA 1JE0A 4QXQA 3ZLJA 1B76A 2CLCX 2XE4A 3E4CA 1ZMXA 3M6AA 1SHTX 5D5HA 1I3LA 3RT9A 2C7PA 1UXIA 1HQYE 5BSHA 1E9EA 3AQIA 3OE7A 1EXVA 1EYZA 1HL7A 4TSFD 3SEZA 3OY2A 4NCKA 3B13B 2I0FA 1KAMA 3WKDA 3K4PA 4RTPA 1WSDA 1LV7A 5JDIC 3HA7A 1YCFA 2DB3A 2XZPA 3QUCA 2OK8A 3G2NA 1OZAA 5BSEA 3DHWC 1KKUA 2G67A 3PNSA 3U49A 3KQNA 3TTVA 1PDVA 2F1KA 2Q49A 1RS0A 3M3HA 1G5PA 1SKYE 4KQWA 4NE2A 4PR0A 3W7AA 2C2KA 5L45A 2DEUA 3D0KA 1RDFA 3HI6A 4X9XA 2ZXFA 2GR9A 4XCQA 3T06B 5K3CA 1XJ5A 5CJ2A 3DHNA 3K92A 4YV0A 4NLLA 2WB2A 1O4WA 2PKQO 1UMCA 1XTRA 1TM2A 2WVHA 2FFHA 3KSZO 1TAGA 2JC3A 3VPBA 3VXKA 2DBYA 3V46A 3P9PA 3ZOZA 2VNJA 1CLUA 3QOXA 2EAUA 3L0YA 4IJMA 1ZNYA 1U4OA 1EFVA 1I2DA 4IZIA 4NZPA 4RTRA 4A36A 2QYOA 4J16A 4N8EA 4JASB 3R7NA 4QPCA 1E18A 5AKGA 3H9QA 4XARA 3F46A 4P4TA 4P35A 1A77A 3OBBA 5CLIA 1VBKA 4AY2A 4HF7A 1Y4AE 3BYZA 2VJCA 4JEUA 1YDFA 2R751 2B69A 4LRYA 5BQPA 4KQ9A 2ZTLA 3K32A 3WGOA 1S9DA 4IBOA 1DQYA 1I4WA 5AM0A 1H2AS 1MJGM 5IEBA 2Z30A 2X42A 3OTQA 1RC0A 3TIVA 4A6DA 4K9LA 1L9XA 1P5FA 3SEAA 1CVLA 3D64A 3V55A 2I22A 4EG1A 3GCGA 2VP0A 1AK9A 1Z2EA 5FKJA 1YDWA 2C59A 1OPRA 3LL4A 4H1UA 3J7TA 2ZBRA 4NBLA 1TYAE 2NACA 4FIZA 5AW9A 1MZPA 4C88A 2Y71A 3JPYA 2Q2NA 1N0HA 1KFJB 2FW6A 3TBKA 5AW2A 4RM3A 1DX6A 3LKBA 3N0WA 3PQDA 2GEJA 2PUJA 4AKTA 1JHXA 4X6XA 3RUCA 4C1NA 3GLIE 4IIGA 1OAOA 2PBFA 4EJ6A 3RV3A 4PN7A 3PPWA 2LDXA 4KIJA 5KTYA 3N8KA 4PZZA 4XXHA 1E3WA 4XVRA 2MSLA 2PZEA 1L1QA 4FEGA 4O1IA 4KLRA 4NOKA 5K3SA 2GF2A 5CW1A 4D8WA 2X5OA 4EABA 3OO0A 1P1CA 2QU8A 1C41A 3S7TA 1TD1A 1LVHA 3U31A 5D6NA 1KFCB 2ONYA 3U4MA 4F4CA 1YL7A 1ZEMA 3KS9A 3CU5A 1Z6XA 3N3AC 3PFKA 3AINA 4YDHB 1EFLA 3JAKA 1DIGA 1WP4A 2REOA 3AVOA 4J9UE 1W2HA 1P6QA 4GWGA 4JWKA 1F4PA 5IKOA 1N2CE 4G01B 3R75A 3ZQ4A 3ETDA 1BCRA 3KQLA 4BLQA 4Z1OA 1HE1C 1H8EA 2Q3JA 3FNHA 3WSWA 2IOFA 4KI0A 2ZCUA 1OTXA 4QXRA 2Q7DA 1YFZA 4ZYVA 5IC4A 5L3QA 3KZCA 3EA0A 4BPBA 3HZOA 5I5EA 1T9KA 4DJ5X 1CW2B 3C1OA 2VDUE 5K0BA 4BS9A 3E3MA 1GEEA 4CDGA 3RQSA 3MJSA 4HQOA 1W47A 4FGKA 4MWZA 4J0DA 2FWNA 3O7WA 3NXKA 2QV0A 4GLFA 4OYYA 1N6IA 4A0FA 2WIKA 4K2AA 5AM3A 1IXYA 2IP2A 2WG1A 3UMMA 3F49S 1QP4A 3T0GA 4HGYA 4Q6BA 1Y3IA 1XRPA 4D79A 5C7YA 3HCWA 1RBZA 1VB5A 1T4MA 4FZRA 3F90A 3PZBA 2IIBA 3DO8A 5LB4A 1XCGB 5FUQA 3AY7A 2IEZA 3IELA 2W2NA 4O4HB 2J0SA 1BOFA 2FQQA 3O74A 4UQLA 2XAUA 1V6SA 4ND2A 2FZCA 5JHHB 4H3SA 3TTTA 5HW0A 4N3NA 5JALA 1K66A 2CT8A 2K5UA 4DJFC 2GTIA 3DT8A 1I7DA 4D96A 5E6UA 5TPWB 3HB4X 4G0YA 3WLRA 2HZBA 3A3YA 4A1OA 2JH8A 5A6SA 3H1GA 4MIOA 2YWHA 3G5UA 3GJQA 1I5RA 2WA1A 1YB2A 4MR9B 4BHTA 4D98A 4OTZA 1NJSA 4K9NA 5HOQA 1O9GA 4BNWA 1AKVA 3N0XA 5CVJA 1KR2A 2I1VB 4X6UA 2FRDC 2AZTA 3SZMA 1EFPA 5KWVA 1QM5A 1JHQA 4QQKA 1RHKA 3SHOA 4S24A 2F6RA 1F2TA 4K8RB 3IBGA 4R40A 2F67A 5JC1A 4DXHA 1NLZA 3I23A 1I4OA 2ZS7A 1A9XB 1GGNA 3FYCA 3V4ZA 4JSTA 4PYQA 1BVRA 1E1RA 2RJOA 3L6BA 4EI9A 2WD7A 4OJMX 4UZEA 4E0BA 2PUGA 1KPHA 1JHPA 3QELA 2P4SA 1YZLA 3GBVA 2YHIA 1L7AA 4X60A 4L3OA 2A5GA 4C20A 2VPPA 1GA6A 3V2UA 4M7OA 1QZUA 1ZSNA 2BKAA 4IWNA 3LTEA 1CBUA 3MGAA 3X1JA 4D9GA 3S1AA 1E2KA 3U2QA 2OV3A 4MITA 5CCXA 1XZDA 4MUEA 1K0UA 2B5WA 1N9KA 3P9IA 3ZLVA 3AZQA 1AF4A 2P8JA 1KI8A 2XCOA 4KNYA 3YASA 1ZIDA 1QWSA 4DL9A 1QJCA 5CXSA 1YBAA 5F12A 5JDCA 4UMDA 4I9UA 4V0QA 2PBRA 3EIEA 1YK1A 5AYVA 3GP5A 3JPWA 5ALDA 1IHYA 1Y7HA 1YR7A 1UUFA 1V7ZA 3GVXA 3TCXB 1P33A 3VDMA 4QKQA 2NZ2A 1GPUA 4JGBA 5AJXA 1U1IA 3AFNA 4MTLA 5ADVA 1ZNWA 1Z06A 4YRFA 3UJ8A 2R6FA 1U7ZA 4B2PA 4YC7A 1SGWA 3HUUA 4P54A 5MGBA 3D8TA 3CS3A 4ENTA 3DXZA 1J2RA 3K6RA 3W5CA 3ZY6A 5AOCA 3PQ6A 3BGOS 1A7JA 1W48A 3QI2A 3P9SA 5ILQA 2JAHA 3T7EA 5EMKA 3M4XA 3PSHA 3BH7A 1KP3A 4D9JA 3CCFA 3EGXA 3AJEA 3QVGA 1UK6A 2G08A 4XGRA 5GOTA 1KEKA 3KQYA 1U3GA 4QDKA 4FYVA 1GYQA 2IQIA 3T9EA 3EMBA 1P2UA 3L6UA 5A5FA 3AILA 1JX6A 4K1LA 5CYFA 4YMUA 1C50A 5BR7A 3GGDA 2DQ4A 3HDYA 2ONZA 2AQHA 1ZJZA 1T5OA 2ST1A 4IH9A 4KXWA 5T8KC 2D5IA 4I66A 2VHEA 4PLVA 5F7XA 4JVNA 4FS8A 4F38A 1EU1A 4RTJA 1OIXA 3ZBUA 4UTXA 1N5RA 2JGJA 4OHMA 4FMDF 5JVDB 4WWHA 2X5KO 4FMBB 1W0KA 4J6EA 2WSMA 4ZOLF 5JO0A 4DDUA 1HY3A 1SCJA 5LXTA 1YBFA 2VYNA 3IHLA 2E87A 1A4RA 5F7OA 1RM3A 1K5DA 2GO7A 2DUNA 1Y1SA 1HT2E 2A67A 2HSJA 1CZUA 5T3YA 2WMOB 4M7WA 1GIAA 2W0MA 1FFEA 3C3MA 1ZUIA 5EMJA 4LJKA 1XKQA 5BOSA 1CUGA 2IXEA 3P1JA 3RPEA 4F56A 2QX7A 3RRJA 5DM0A 5I9NA 1PX2A 5K45A 1VHJA 2B99A 2QL6A 2WUVA 1PS0A 1RBQA 2UYYA 1WKCA 5AKIA 1DWQA 1QDUA 2ZBUA 4BGUA 3ER6A 1K97A 4IIHA 3HLYA 4QLAA 4WVLA 3O3OB 3UENA 4BFXA 4BWGA 1RIFA 5DM70 2FRDA 3E84A 4F72A 4F11A 2RHHA 4PNPA 5DK4A 4KJZA 4E7PA 3UATA 3QFHA 1P74A 4Q3EA 2XRZA 4G5YA 2R8BA 1YS9A 4IHKA 2VSFA 2AC7A 1GZ7A 2CY0A 1UL1X 2O1SA 3OFVA 4FGLA 1N8NA 1C1XB 3G0CA 4M9SA 3HADA 3ICCA 2GPNA 3N74A 4FOTA 4PU0A 1R00A 5H9WA 4UCXA 1ECBA 3IIEA 2J59A 4LQ4A 4D3SA 3PRKE 4IDGA 3H11B 2X19A 3X1WA 3KKEA 4NJOA 5KTTA 3W3ZB 4CL8A 3ZX5A 1ZL0A 4IJ6A 3JTMA 2VAPA 3KT0A 4WN9A 4JBWA 3BT7A 1V2HE 3GEPA 1L5WA 3ESZA 3T1OA 3K20A 3FHTA 3C45A 1O95D 4DA0A 1MG5A 3M9LA 5M7EA 1ZJWA 2PS1A 1IC6A 3ZZTA 2PYZA 2ZYAA 3H9UA 5FPQA 4HFNA 1QFSA 1NZFA 2E4WA 4FJ1A 1F0KA 3PNBA 5IDVA 4G2NA 5T4EA 2DZDA 4TVBA 3T1VA 4L08A 2BY4A 5FJJA 3FHLA 2F9MA 3RS5A 3PSAA 5I4BA 5DE3A 4H27A 2EKLA 1TO1E 2BWJA 1URPA 2ZUBA 4RKWA 1T2UA 2PCLA 5K3AA 3GQBA 3S68A 2I6XA 1ZC4A 3OIDA 1P2DA 1R0RE 2R6CA 1LVUA 2DP4E 1FUEA 4HT3B 1JEQB 4C01A 3S44A 1A2OA 4OK6A 3EJWA 4R8VA 1PJSA 2PLNA 1V95A 3CEMA 1L2TA 4HP8A 2PBLA 1B6RA 1GU1A 3AF4A 3BWDD 4G1EB 3T6KA 4P31A 3UOWA 4K9OA 1P2VA 1RCTE 1E4YA 1XMPA 2OCPA 3AEQA 3D0RA 3DXFA 1X39A 1VI2A 1Q1EA 2HMWA 3MLAA 3NVMB 3WISA 5K6AC 3AVWA 4HOYA 3LU1A 2VP2A 4TMVA 3ACCA 3MG9A 4YY3B 1GPKA 2G4CA 1E5XA 4G56A 3FSJX 3BWBA 1CS0A 4V3CA 4OHXA 5L6LB 1SVMA 3UAXA 3FTEA 2QZZA 1IATA 3REFA 1PFYA 1QGUB 3ETHA 3ZZUA 3SBEA 3WLKX 2QX9A 1NVKA 5C1BA 2OCLA 4FT4A 1RD4A 1D0SA 4BBAA 4JUIA 2QR2A 4AXBA 4FJ0A 4KMSA 2IH5A 5DNAA 3NP9A 4GR5A 3UOAB 5JSUA 2Z1MA 4C07A 4BO3A 5C3UA 3EUAA 2YYAA 4M89A 4MVJE 1W75A 1RC8A 4NPCA 1NKSA 3AEZA 3CNQS 5D5PA 1ZVMA 5A3SA 4BQFA 2M1ZA 4E5SA 1Y80A 1RC1A 3KQMA 2Q3FA 4H9GA 1JR4A 3WMXA 3BIOA 2W9XA 4TQUS 3EULA 4J2TA 4UM5A 1T1JA 4RETA 5LA6F 4MO9A 1SA0B 2P5YA 1OFIA 3MCZA 3NIDB 3ILXA 4HAIA 1BKSB 4M83A 4CF5A 2CV2A 2C2YA 1JA1A 3R6DA 4FPXA 2CXNA 3HBJA 4BNHA 1UBJS 3EFBA 3ITDA 4WZBA 1E5TA 3B1VA 1QFMA 4F4HA 1TVCA 2VDRB 2RKBA 3ZW8A 4JNKA 2CCKA 2XT0A 1EUCB 2GK3A 3P4XA 2NPIA 4QUGA 3IILA 1QG6A 5FEUA 4M0FA 4RV9A 5IBPA 1OB2A 5CFOA 4Y7DA 5FUYA 4QYMA 3P2YA 1ISPA 1VXOA 4U8GA 2VS1A 2MOKA 4P32A 4U6NA 3BHNA 3TFOA 1XHFA 4QDJA 2NYVA 2V7PA 3S8YA 1LZLA 4EZIA 1R0YA 5IDQA 4Q4HA 4R7ZA 4EJSC 1BFDA 2JIOA 5JS2A 2ZJZA 4RSHA 1DJOA 3R3ZA 2ONCA 4F2WA 4YUXA 4AO6A 2GFHA 5CH5A 5BWBA 4J1TA 3IMFA 2FUG1 4DLBA 3M2PA 4ZT5A 4KL8S 3RRZA 5LQCA 1FP2A 4EPTA 1R4AA 4DKXA 3FKSD 3EK2A 3K70C 4O4JA 2EKDA 3E03A 3PF9A 4ER5A 5ILOA 4JEHA 3DWFA 3NJRA 1LSSA 4MP8A 1GL7A 3NJ8A 2M6KA 4TZ6A 3N59A 1HX7A 3PQ5A 4LSZA 4O25A 3Q5GA 3KJIA 3LVFO 4FCCA 3U39A 4EA9A 1N3BA 3Q11A 4MYRA 4IXTA 1E9SA 4LJ6A 3TRDA 5GIPE 5KAPA 3U26A 2OCGA 2QMHA 2Z95A 4HDMA 3TLJA 4BNIA 4RFSA 4O2AA 3PJFA 1JEQA 3M3DA 2HQOA 4YMHA 2WWWA 3S2SA 3IQIX 4X1YB 3T52A 2VDMB 4C5BA 3IP3A 2HNBA 2QZ9A 2EV9A 3PYLA 5KCZA 3GLIA 3OZCA 1L7RA 2EL7A 2HK8A 3EDMA 4L9AA 1SELA 2V4MA 3SZLA 3SZUA 1PJ4A 5C32A 3SLRA 1LZKA 1T29A 1UMDB 3THYB 4INPA 3SQXA 16PKA 1OFGA 1N78A 2X40A 5AW4A 3PLAE 1CIVA 5G4KA 4MWEA 2FG6C 2ZWPA 2IHJA 2QVXX 1G3IA 4RQTA 4OBEA 4EMUA 4U1RA 3P52A 1WX1A 3IQXA 2IZ1A 3D2LA 1KEWA 4CYMA 4I9GA 3KL4A 2BFPA 2IYAA 3K6JA 1XZHA 2B8NA 3RJZA 1Z8NA 2A9PA 1E6WA 1JH8A 1T3SA 2B8TA 3EPRA 4KQ1A 2EKZA 5DMHA 3RBXA 2DHCA 3TKLA 2ORYA 3VBEA 2ZSBA 4DCTA 2HQSA 5CCBA 2PS3A 2WNIA 5CUQA 4UNNA 4HH0A 3QENA 4I4LA 4LY9A 3CW9A 1BEZA 1LLUA 2IDMA 3TLKA 1H1TA 1DBVO 1E2NA 1FQJA 2NQTA 3M6LA 2L69A 4WFJA 4X97A 2L2QA 3VKGA 2XZDA 1JR3A 5J47A 1BX0A 4LV6A 3K73O 3HL0A 4TV8F 4XWKA 1SPBS 2CDBA 2DGDA 4HGNA 4FZVA 3BN3A 4OUDA 2XVAA 3JWPA 3ZU3A 1XF1A 1Z6QA 3P2JA 5A9TA 4BL5A 2OHXA 4K86A 5D3MA 3V8BA 5EESA 1Y6GA 4RKRA 3L7AA 3PQCA 3TLZA 4HY3A 3L5KA 3PDJA 3AEYA 4DG9A 1L7OA 2REBA 3OU7A 2R1VA 5CD9A 2H5JA 4GM4A 4HH4A 3NZEA 3HFGA 4H7FA 5JZ9A 3EGEA 1JTEA 2HRQA 1BN6A 1QSGA 3DFUA 1N92A 5TQ0A 1Q0HA 1ENYA 1Z26A 5G0TA 4PYLA 3V00A 2Y1OA 2P5UA 4ZKDA 1WLSA 4UUQA 4Q4JB 3DP7A 1MA0A 4GFDA 2BFBA 1N0WA 3IAXA 1IEWA 4LBYA 5TE9A 1KVSA 1S96A 2F9FA 3CVJA 2X0FA 4XDZA 5F64A 4JBNA 1PEYA 1EESA 1UOQA 2BKVA 2DWUA 1Q3KA 2FA9A 4EB3A 3PXAA 3T5CA 3R9XA 3UTDA 2WHEA 3O1LA 3ZU2A 5IZCA 2IWRA 4YS6A 5C1OA 4WKNA 3JQBA 2CCJA 3HXKA 3E0XA 5L6MB 2WZBA 1X87A 4XQEA 5BMVF 2XGJA 1IM8A 3LI2A 2XSZD 2IH4A 3F5MA 2PMKA 4B0PA 1ESZA 4X95A 3LNTA 3T9BA 4AX4A 4F3TA 3NNSA 2GUGA 4AT1A 1J8YF 5H02A 3DHEA 1EK2A 1WY7A 4ZVSA 3MA0A 2VL7A 4LNAA 1WHSB 2QVGA 1WABA 3ENZA 3C3BA 2EFHB 5LP6F 1JALA 2JDID 3A11A 4REOA 3ZJ5A 2JHCA 2ZAYA 4GECA 2Q5EA 4PZPA 2OWDA 4X94A 4JOBA 4CLOB 3NHMA 4UCFA 5FB3A 4BY9E 2AEFA 3RBVA 3QXCA