3Q7TA

2.15a resolution structure (i41 form) of the chxr receiver domain from chlamydia trachomatis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
96
Chain Sequence
PKHVLLVSEHWDLFFQTKELLNPEEYRCTIGQQYKQELSADLVVCEYSLLPSFVLVLLDFFDEETSVDLLDRGFWYLIRPITPRILKSAISLFLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulatory protein
publication title The atypical response regulator protein ChxR has structural characteristics and dimer interface interactions that are unique within the OmpR/PhoB subfamily.
pubmed doi rcsb
source organism Chlamydia trachomatis
total genus 32
structure length 96
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3q7tA00
3RVPA 4ZPJA 2FKAA 1M5TA 3CLKA 4YCSA 1E6MA 1RXIA 4HNRA 3H1EA 1RZRA 1Z26A 2IPMA 2PUFA 4ZMRA 4LDZA 3C6QA 3RVNA 3H6GA 4S04A 3GBPA 2VK2A 3E3MA 1QP7A 3SQNA 1P2FA 1DG9A 3EGCA 4YGXB 1QNLA 2OENG 3Q15C 1YS6A 3FGZA 2L19A 2FSPA 3RVKA 3FFWA 4MPTA 4D6YA 2WWVD 3G85A 1ZH4A 3TMYA 3A3KA 1VLZA 3KSMA 4NQRA 4Z4GA 1ZITA 2PMCA 3L49A 4F11A 3MF4A 2OQRA 1APBA 2PL9A 4XAQA 1CEYA 4E7OA 2IDMA 3DLHA 2VUHB 4YLEA 1AB5A 5DLEA 5JNUA 1BAPA 2JB9A 7ABPA 2W42A 5KI6A 4MQEA 1XHEA 1USGA 2QU7A 2FMHA 3OQOA 1VPWA 2H3HA 1U04A 1NXPA 1RZRD 1BDIA 5IC5A 5GQSA 1EWTA 2JK1A 4ZMSA 3T6KA 2FQWA 3LUDA 4Z0NA 3JY6A 4XXHA 2JCGA 1BDHA 4MQEB 3HUTA 4N41A 2FN8A 2GKGA 3Q7SA 3QEKA 2NUBA 3RVOA 1ISRA 2L17A 2GWRA 3Q41A 1YK0A 4MS4A 3QEMA 4MRMB 4Q7EA 5KQGA 1NXVA 4H3KB 2PJUA 1YVUA 1ISSA 1NXTA 2R25B 1A2OA 1MB0A 2ZWMA 3TD9A 4EYGA 4RWEA 2QVGA 3IPCA 3F6CA 3O2SB 5KQLA 1Z25A 2E4VA 1XHFA 3JVIA 4L85A 4RK6A 3HVRA 1NY5A 3BREA 4IRXA 4W5TA 2Q5CA 3QLUC 1FQWA 4RU1A 5EWJA 3O74A 2LBPA 4RXUA 1MVOA 3OQNA 3EODA 3RVMA 3QELA 4CBVA 3D02A 3HSYA 1ABEA 2QW1A 2QZJA 2MSWA 3H5LA 1S8NA 3MA0A 1DRKA 5JNSA 5EWJB 2FVYA 3C3KA 1KGSA 3IPAA 2ID9A 4HNQA 4N0PA 4WT7A 1OXKB 2IPLA 4MS1A 1EAYA 4LRQA 3T95A 1JBEA 2YHBA 4Z9AA 5I4CA 4OG2A 4NCBA 3O1HB 3QLTA 1DCKA 1Z18A 3NNDA 4OLBA 1GCAA 5HM6A 1P6UA 4DQDA 4M88A 3SM9A 3SNKA 5IULC 2CD7A 1GLGA 1DBPA 2E4YA 3C97A 3NHMA 4EYQA 4ZJPA 4MS1B 1USIA 4XASA 1NTRA 1ZVVA 4L4UA 4YS6A 1JWLA 3KLOA 3KHTA 4N76A 4RY8A 2GI4A 1D1PA 3CTPA 2NT4A 5FBHA 2BGGA 1AB6A 1BVHA 1LK0A 5FWYA 4Z99A 5JNRA 5ABPA 4JAVC 4KK4A 1EWVA 3UK0A 4RXTA 4WXMA 2GBPA 3LFTA 5D2CA 1QP0A 1TJYA 3HS3A 4LZLA 3D8UA 4JOQA 1M2EA 3H6HA 5FWYB 1EHCA 1U2QA 4G0XA 1DP4A 4EY3A 3M6MD 2ID7A 1NXWA 3GBVA 3IP5A 1YS7A 5DGCA 3RQIA 2PAFA 4RK4A 3LUGA 1QKKA 4TLLB 1JDNA 3H1FA 4G0MA 2FQYA 5C5CA 2L18A 2MYPA 3MQ4A 4XFKA 1TM2A 5BRJA 2E4ZA 2FTKE 3KYJB 4OTZA 3LTEA 4DN6A 2FMKA 2QSJA 4PZ0A 2CWDA 4LE2A 4OBBA 4YO7A 3N8IA 1OXBB 4FE4A 3RVLA 3I5AA 1DRJA 3I42A 4GNRA 4JB2A 4IMJB 3QLUA 1JYEA 4G86A 3LMKA 5TQ2B 4D6XA 2RDMA 4FE7A 3QX9A 1RXEA 1L5ZA 3KYIB 2R4QA 3LUKA 1XWWA 3LKVA 2FLKA 3QLVA 3MMNA 1A0OA 2FMIA 1QQAA 3H5TA 3VNBA 3HCWA 4Z4IA 3CNBA 3LKBA 2FN9A 1ZHHA 2PLNA 3JPYA 3RH0A 4O1HA 1JLKA 4MYRA 4YV7A 1D2AA 1CHNA 1EFAA 4N0QA 4EYOA 4S05A 2RJOA 1Z13A 3CZCA 2AYXA 3F73A 3OMXA 3O2QB 2IKSA 3BRSA 2JBAB 2LUOA 4Y9TA 1USKA 3OLVA 4MRMA 3TO5A 3GRCA 1BDJA 1F4VA 3DGFC 4ML3A 4G0PA 1B00A 1LJLA 4H60A 3GV0A 2A9QA 3OLZA 4KQ9A 4MR8B 1J56A 4RKRA 4ETNA 3LUCA 5KQMA 5TE9A 3N53A 3N0RA 9ABPA 4MR7A 4TMYA 3S99A 1YTUA 1IIBA 4WZZA 4MS3B 2IOYA 3IP7A 3MYYA 4MLCA 3EAFA 5B3JC 3DZDA 3OO0A 1U8TA 3F7NA 2F8SA 3FFTA 3O1IC 3OM1A 5BRAA 2HPHA 1TMYA 4EVSA 2WJWA 4RK1A 4RSMA 1GUDA 3BILA 3JPWA 4MR7B 2WY2D 3SY8A 5IEBA 5BQ3A 4KV7A 4EYKA 3B2NA 3F6PA 4Z4CA 2F8TA 3SAJA 4JASB 1KRXA 3EJWA 1LBIA 4RS3A 4LX8A 4YP9A 4O1IA 5EWLA 2HQBA 4MAAA 2MYTA 1SD5A 1TLFA 4LE0A 4TLMB 1Z2EA 3CG0A 4XLTA 3LUAA 4RY0A 3Q7RA 3FMVA 1QP4A 4KRFA 2PL1A 3HM9A 4E7PA 2PUCA 4IILA 1LBHA 5CNIA 3H5WA 5TQJA 2P9HA 5DTEA 4YR7A 5EWMB 1U0SY 5EWLB 3ROFA 2PE5A 4JP1A 1YIOA 4MGEA 3GA5A 1A04A 4RK7A 1ZDMA 4P1ZA 4WUTA 3ILHA 3EQ2A 3IDOA 1M2FA 2A9OA 2RJNA 2HJ9A 4IF4A 1DCMA 3GWGA 3KKEA 2E4XA 3NBMA 2HSGA 4O5AA 4N03A 2R47A 1Z12A 2MYNA 2NZUG 3URMA 3Q9SA 4G0ZA 4LE1A 3IP6A 3CU5A 3CFYA 4W5OA 4RY9A 3CKMA 1Z15A 3L6UA 3LUFA 5DCLA 4YRZA 2L2QA 2J48A 3CS3A 3RVQA 4PE5B 4PYRA 1W9HA 3ROTA 1JH9A 2NZVG 2PUAA 4NCAA 2QXYA 1RPJA 1TVMA 1E6KA 4RV5A 2WRZA 3K4HA 1JX6A 2TMYA 3A10A 1MB3A 2MSKA 1Y1LA 1E6LA 1NXXA 2P4UA 3G1WA 4F8JA 4DADA 2CHFA 3T8YA 3GYBA 3CZ5A 1VKRA 3O1JC 1SXHA 2QV0A 2WJAA 4ZYLA 4MLDA 2I6FA 3QK7A 4RK5A 5JS1A 1C0EA 1GCGA 5IX8A 4KPYA 1HEYA 1PNTA 3VNAA 5CNMA 1QPZA 1QMPA 3HUUA 4Q6WA 3MIZA 3ILYA 4XARA 2PUBA 2MSLA 2A9RA 5KQPA 1U2PA 4KNYA 1MIHA 2GX6A 3BRQA 2WMYA 2VUIB 5TQ2A 5KC9A 4KREA 2FLWA 2FQXA 3H5VA 3MM4A 2LP4Y 4YWHA 8ABPA 4JA2A 4KK3A 3W9SA 4Z4FA 1NATA 5TPWA 4MQFA 1RNLA 4NV3A 5JS2A 1JHZA 3N0WA 4PEVA 2HQOA 1ZESA 4Z4HA 3A0RB 2YHAA 2PUEA 4WXEA 1DJMA 3NHZA 3OMWA 1GUBA 3O2JA 4F3TA 2JBAA 4KQCA 1K66A 3M9XA 4RZSA 1KMIY 5TPWB 4MQFB 3HDVA 3CRNA 3OQMA 3H75A 1P8AA 3M9WA 3DGEC 3C3MA 2JVKA 3O21A 4G0YA 4MR8A 2PKXA 3C3WA 3H5OA 3RVJA 2DRIA 3NNNA 1DBQA 3Q7TA 1FSPA 2PUDA 2NT3A 4MS3A 3DBIA 2ZAYA 2FEWB 1URPA 5IEJA 5E3JA 3UUGA 1W25A 3FDFA 2IYNA 4UHJA 4EUKA 1YMVA 1ZY2A 3K9CA 3NNSA 3EQZA 2MYUA 2WB4A 5DKFA 1D4ZA 3R0JA 3EULA 2PUGA 5C5EA 1ZAYA 5IUNC 1PEAA 1PUXA 1ZGZA 1DBWA 4QPJC 2R48A 2CHEA 2FXIA 3FFXA 2QVCA 4EVRA 3OM0A 3KG2A 3N75A 4IGAA 4GPAA 3OLYA 2AYZA 1SRRA 3KLNA 4G0OA 1E2BA 3BBLA 2E4WA 5HSGA 3GL9A 3KS9A 4OLAA 3N6VA 3P9YA 5IUJC 5IUKC 5F64A 3RVSA 4NICA 3H5IA 6CHYA 5EWMA 5CHYA 1JFTA 5CNKA 2FEPA 3CG4A 4UHKA 4KVFA 3HK2A 1JF8A 6ABPA 4MR9A 1KRWA 2JVIA 1QO0A 4KMRA 1SXGA 1DCFA 4Q6BA 4QICA 5GOTA 3N0XA 1Z2DA 5KC8A 3JTEA 1PNRA 1MAVA 5T7BA 1VRVA 4HNSA 1DC7A 3OO1A 4N47A 2QR3A 1JFSA 1Z16A 1ZN2A 4HYEA 4B09A 2IPNA 1P6QA 3JVDA 3E61A 3JS5A 1EWKA 1ZH2A 1LJUA 4G0QA 4MS4B 4WWHA 3QEMB 4MR9B 1JL3A 1JYFA 3QLVC 3A0UA 1M5UA 2JRLA 3DLBA 4G97A 2LPMA 4FB4A 5FBKA 1L5YA 2HQRA 1D5WA 4D74A 2V0NA 1PEYA 4RKQA 1ZGGA 1JFVA 4KZKA 4TN5A 5BR1A 5IBQA 3O75A 3LUJA 1DC8A 3LUHA 3I09A 4Z9BA 3HXMA 4Z4EA 1FFSA 3QELB 5JNTA 1QO0D 3I45A 5TQ0A 2H0AA 3KCNA 2N9UA 2B4AA 1BA2A 3KJXA 2M1ZA 4W5RA 2RGYA 2A9PA 4LDAA 2E4UA 1K68A 2B1JA 3H1GA 3HDGA 4QYMA 5TPZA 5KWSA 2O20A 3SG0A 1R8JA 1QQBA 3HO1A 2X7XA 3IP9A 5HQJA 4RXMA 5T3YA 5HKOA 5FWXA 1CYEA 1FFWA 1F51E 3QX8A 4OATA 3GT7A 3OLXA 3HEBA 1I3CA 1UDRA 4IMIB 3EDCA 1ABFA 4EGSA 5TQ0B 1DZ3A 5JNWA 4P98A 4F12A 3TB6A 1Z17A 3T38A 4H3HB 5JNVA 2KYRA 2IPAB 2JVJA 3CHYA 3KTOA 2LIVA 5CNJA 3HJFA 4ETMA 5FWXB 2XDYA 1NXOA 2FEKA 4W5NA 1YMUA 1C4WA 4RDCA 3HV2A 3HZHA 2VYCA 3TX6A 3OLWA 5B3JA 1YK1A 3LOPA 3UKJA 1SXIA 2M98A 1JDPA 4KFCA 1D1QA 5TPZD 5ED4A 1PHRA 1H9CA 2FMFA 4JB0A 1FFGA 4RK0A 4F06A 1NXSA 4W5QA 4ETIA 4PICA 1T34A 4EVQA 5PNTA 1WETA 2FW0A 3RVRA 4QYWA
chains in the Genus database with same CATH superfamily
2GILA 3MUOA 1SC3A 4G01B 4K6FA 3B85A 4MUFA 3OFJA 3NS7A 1HQDA 4TTVA 3WKAA 1NGSA 1ORWA 3M2TA 4OA8A 3MWEA 4JI0B 4M7OA 1SR8A 2DMRA 4ZMRA 2R8OA 2X77A 1JS1X 2AA3A 1QP7A 2SBTA 3EWIA 1L5RA 3SQNA 1L4LA 5JZBA 4FR0A 1Z5WA 1EQUA 1X87A 4IIBA 4KIUA 1SZCA 4NCJA 3A7EA 2L19A 3K6RA 2EF0A 3ROZA 1O95D 3RBXA 1C9YA 1EVIA 1D4OA 4FYHA 4QDXA 3KSMA 4O25A 1MRZA 4Q3OA 1UQRA 2EFCB 2ZTSA 2RGDA 1C80A 2A5GA 2VN8A 5LUAA 3L7OA 3DAPA 3GN1A 3NBKA 3ZD8A 2BDUA 1VMKA 2GAOA 2IA5A 3AJ9A 3N7AA 5P21A 5E9JA 4CEJA 5EGNA 4TMWA 1QYXA 2R751 2VAMA 3QYJA 3L0CA 4MVJA 3KXKA 5T3UA 2XMQA 1KQFA 1ICIA 2G17A 3C2QA 2R1VA 4NCXA 1VPWA 3DDCA 3WL8A 5A4FS 1V1RA 1T0HB 2RK3A 3ET4A 4UD6A 4G41A 5GY7A 3CUKA 3LPAA 5AW0A 4RSGA 3DYVA 5FPSA 3UMSA 1LPNA 2R5FA 5AXBA 6YASA 3NMUF 2FQWA 4JSYA 3U0VA 2WILA 1WM1A 3LUDA 3ZCSA 2ZCUA 3R41A 4MVYA 2P41A 5SV2A 2Q9UA 4R6XA 3PXDA 1CY2A 4ASUA 4CQMA 1NP3A 2COKA 3W7BA 2CV0A 1C7FA 3COVA 2Q3DA 1FSZA 5T64A 4EM6A 1I7SB 2A4KA 1WTAA 1VL1A 3UPDA 1PYGA 1N3IA 3STHA 3L8ZA 3N5KA 1DELA 3JQCA 4JYCA 1ECGA 1EGVB 2CN1A 4HH3C 1NXVA 3AFIA 4MRMB 3AEQA 5LZ8A 2LDXA 5KQGA 2QBYA 2I2DA 4BNFA 1Z0KA 1JE1A 4RWEA 5FV7A 3T3EA 3A1NA 4Z0TA 5CCXA 4MVXA 5FPHA 1TVEA 1A4IA 5EQDA 4HP8A 3WS7A 5A02A 1MJHA 3Q8LA 3BPSA 1XHFA 2ZPAA 2F1KA 3VQTA 3ESDA 3AHEA 3H2ZA 4RU1A 3BD7A 1Z0SA 2VT7A 1JHQA 1K3FA 4QULA 4C7BA 4Z53A 4WNAA 5EESA 5CITA 2OQ2A 3D1JA 3LJKA 4B7AA 1VCOA 3D02A 1QGOA 3CW9A 1Q0SA 4YUXA 4OXNA 3ROQA 2XITA 4RL6A 3AJAA 1X8JA 4UTOA 1Z6AA 3LNTA 1DBIA 3VR0A 4XTCS 3E8MA 4WT7A 3C6ZA 3RHTA 4U0JA 1VSBA 4UPDA 4BCCA 3RFTA 2UUAB 2IXEA 3BL6A 1XJWA 4CF7A 4DANA 2LV8A 3ZCXA 1SM4A 3FVTA 2AX3A 3N7UA 3VO1A 5C1BA 1QF7A 1II0A 2ZIFA 3L1IA 5T4BA 1VYHA 4KN6A 4FHCA 4XPIA 3WLFA 1BEZA 2G9UA 3CZ9A 4KQ1A 3RVDA 1ZVVA 4KITB 5JH7F 4BVAA 1M10A 1D6JA 1XO1A 1FE8A 1XZFA 2CCJA 2H1CA 1KY3A 2OLEA 2WSIA 3I9MA 4OHOA 4XDHA 5EUQB 3T1QA 5E1DA 3W1VA 4BVBA 1KBZA 2NT4A 1PEDA 1V96A 2X5OA 4D0NA 5MGBA 2EL9A 5FTJA 2V8OA 3H3JA 2AJDA 2XZLA 2W83A 4D9JA 5ELXA 1EYZA 1NW9B 1OBFO 1QOZA 1ZD2P 2C00A 2LRHA 2ODWA 2PX3A 2QW0X 2DCUA 3B6ZA 3O3NB 1N2CB 4QECA 1H23A 1POXA 1PX2A 3D3JA 4ZZ0A 2X40A 2EFYA 3MCVA 3BK2A 5CT8A 2QRVA 1RJ9A 4OO3A 3RLIA 2X2PA 1TJYA 2Q28A 2C2KA 3GJTA 5HFNA 2D7DA 3D8UA 3OPXA 1CDZA 1T3GA 4YRLA 3IE1A 3RUDA 2GBGA 5BUZA 3SZGA 1WY7A 4Q1CA 5ITVA 3V2UA 2FSFA 3ZJ4A 3B89A 3WQSB 1Z56C 5FTMA 3RASA 4BVEA 4RTLA 5EQJB 2Q9CA 1K92A 3R1IA 1LI7A 1NAIA 5DNDA 4KNVA 1ILWA 3ZKAA 2GEVA 1A7JA 1Z82A 4N49A 3P5BA 4RMNA 1QFSA 2CLEB 4IKPA 4A8HA 1NM5A 4Y2YA 5IJAA 5FT9A 2GO7A 3KYJB 4BP8A 4G25A 4F86A 6REQB 2MINA 3UY4A 1P4JA 2JFZA 5H0IA 1A96A 1AQUA 3KWFA 3IBCA 1BMFD 4UVIA 1DBRA 1I0IA 4FWTA 2YUIA 4DRXA 5ADUS 2VSOA 1TYEB 1VZ3A 3FGPA 3QLUA 2JZNA 2YIDA 3B3AA 4OI0A 1TB4A 3ZDEA 1A27A 1VL5A 5TQ2B 1KO7A 2A9KA 2XCQA 3VYSB 3EQ6A 1AGPA 1Y3CE 2OXFA 2OQIA 3K0KA 5B3KA 2JFYA 2XJ9A 1XQ9A 1J39A 4H9GA 3L3BA 4XDGA 2ECQA 4XD7A 5AVYA 2P11A 1IWOA 4K6HA 4QJBA 3DAYA 3UH0A 2IIVA 3CUVA 2GR9A 3GAFA 1SVLA 3P20A 3E1SA 4U7TB 2GWHA 2Z5GA 4EW6A 2XLCA 2ECKA 4PLPA 4LJ7A 2N0SA 4IG4A 4MKFA 1EFAA 2B8WA 1BQ3A 2RJOA 1LI5A 2QGNA 2QV7A 1Z13A 2DWPA 5H70A 5B12A 2VZLA 4UNQA 3QYFA 1C1HA 2I4MA 3QXJA 1BD3A 1R0WA 1K5DA 2LUOA 4HCJA 1YBHA 3QOFA 4YMHA 1AQJA 3PEYA 1Z5OA 3R7DA 2FLVA 1I6WA 4HQRA 4NABA 1KAMA 1V45E 4EAQA 5JHHB 4MHTA 1U0GA 1O94C 2ZE5A 1P9OA 2B7BA 1UJMA 1V2GA 1Z07A 2A9QA 2CVHA 1R4AA 2PS9A 3FNIA 4WASA 5TE9A 4D9FA 4BFCA 1O0CA 3T3NA 2FW1A 3QE3A 9ABPA 4K5QA 5BSEA 3ND8A 3NOQA 1ENOA 5JALA 1OR8A 2XWQA 1L5HB 4CFZA 2NYRA 3PGMA 4MS3B 2GERA 1CY4A 3GGCA 1UMCA 3SJBA 4TROA 2Q6VA 5EL0A 4LMPA 2Y1KA 1QV7A 3C8HA 1YJ8A 4F3YA 1DQZA 3ED1A 5JAHA 3FFTA 4FVTA 4N12A 4RGBA 3HR7A 2N46A 1EFTA 4D3YA 2D2VA 3J81k 3WGIA 4HTAA 3KD2A 3HCPA 3FSGA 1H42A 3KD3A 2M6LA 5LIPA 3T1VA 4R2HA 4YRSA 1KEPA 1HX7A 4S1PA 5B1EA 1PT9A 2OWEA 1Z28A 3BE6A 1TI7A 4NG5A 4ITUA 1XIVA 2EDCA 3BGIA 3BAZA 3CX6A 3EGDA 1KDYA 2VJMA 1E92A 2J8ZA 4BE4A 3ZHTA 1DUIA 3Q7RA 4PX5A 3U0BA 3ER6A 3EC1A 4HWOA 4PR3A 1GL7A 1LBHA 2IY7A 1T3LA 3SR3A 1GN9A 1Z73A 3IT3A 3MTDA 2I4RA 3LXRA 2AR9A 1M0WA 1KMCA 1EP9A 3TLYA 5IC4A 1WMDA 2B1IA 3FZGA 3D4PA 3J81A 1KYIA 2J6IA 3GJ7A 1P5ZB 4D8UA 2WLSA 3FWZA 4RGVA 4P2GA 3AF6A 1O1YA 4MVWA 4B2IA 1ISMA 1FBNA 2H2WA 4M8KA 1BE1A 2YMQA 2ZRNA 1F3LA 1GD1O 1T4DA 3H7AA 2NUTB 3QXHA 1J8DA 1YJXA 3AOEA 3OP1A 4DLUA 3URMA 3Q9SA 4AUKA 4K9OA 4YHBA 3UJAA 3PUXA 2I0FA 2B6NA 1T3SA 4EWLA 3QF7A 4TQGA 1CRWG 1T2AA 2C8LA 2Y93A 4HDRB 4JLPA 5AHRA 1SUAA 2FY8A 3G2NA 3L8DA 5D8DA 1OXXK 4KXWA 2FDRA 4NY1A 1ORTA 3U3OA 1FXWF 2OGZA 4E1VA 5ILOA 1R9NA 4GNKA 1N2IA 1QG2A 1FNBA 2I54A 3VPDA 2XUZA 1PFUA 2LKCA 1WVIA 3A10A 1YQXA 2Q4BA 5IHPA 1DTWB 1U8UA 3H04A 3KJGA 3UAVA 2NZWA 2CNNA 2H2DA 3VU3A 1GNVA 2YIJA 4EHJA 5J47A 4HI0E 2HV8A 2P2ZA 4G5OA 3TEJA 2YX1A 3WGZA 2HRZA 3DOIA 4X7BA 4EA7A 1XT6A 1HE8B 3K5HA 1SD1A 4HAOA 5AW8A 4G5YA 4LWPA 2I2AA 1GSHA 4F2GA 3RSLA 2FEXA 5BRNA 1GCGA 1RYDA 4BE7B 1PU2A 4KFTA 3PTAA 4YBRA 3VNAA 2Q7XA 4R2XA 1T5IA 4ZRMA 1J2EA 4CKBA 5LXTB 1YZUA 4GXTA 1RKXA 5JASA 3BRQA 4QYSA 2HBZA 2HH9A 1G4AE 1WSAA 2M1XA 3RWOA 4OIFA 4PFQA 4NOMA 3GEEA 5DLDA 3RIMA 2XODA 3W9YA 2HU2A 1CLUA 2ZT5A 3Q5EA 5HJEA 3L4EA 4DLZA 1KJIA 2CMDA 4P34A 1QF9A 1FDUA 3T3IA 1XJ5A 1JTFA 4XVUA 3GLGE 1Z63A 2O2ZA 1MNAA 2MWMA 3KXIA 1IOZA 1MO5A 1NQOA 5J2TF 2F00A 1MOSA 1PR6A 1V9CA 3EW7A 5EP2A 2B69A 4G5FA 3V1UA 2C4WA 2PUEA 1M2JA 1N0UA 1XMJA 4GE0A 4MIYA 3RK1A 2VDUE 2O57A 3NR2A 1ESDA 3FOFC 4AMZA 3UT5A 1I1OA 1RRVA 2GEKA 4ABYA 1K66A 2EKPA 3KDAA 4CG2A 3NW9A 2Z9DA 1R8YA 1FP4A 3DL4A 3FNFA 3PK0A 2QAJA 4Y9RA 1EJ6A 2KB0A 4RZ3A 5DGTA 4ZEOA 3RUEA 2B94A 1WU8A 4UZSA 4F4CA 3LRXA 1NYTA 2FQQA 2D3WA 1G5IA 2YS6A 3A4NA 4DMUB 4QJ3A 2W7TA 4Q3DA 5K99A 2OBYA 4EB6B 1Y5RA 1XJQA 2GVNA 4PGMA 1OA1A 1PGPA 2GSWA 3EK2A 4QBTA 5DGIA 4BGIA 4R84A 4Y6QA 5I9BA 3D5QA 4V24A 2BELA 2GJ9A 1KDOA 2AZTA 2VHCA 3NXKA 3PA6A 2CJWA 2AMJA 4OAQA 4EUKA 2YYAA 2J67A 4ZK6A 2WK1A 5GADl 4IFIA 2VOJA 4GGMX 1G7RA 1Y98A 1RVDA 2XDQB 2X6RA 3OTIA 4DJDC 2IC5A 4J3FA 1P7CA 2BFDA 3U3JA 5A5EA 5KJ1A 1ZGZA 4EHIA 4KQKA 1KTIA 1TA4A 3FPKA 3L77A 4J4TA 3SZRA 3V1KA 1GZSA 4M7PA 1I6KA 1WE2A 3F96A 1E2QA 4M9QA 4PG6A 2WSSA 1TQDA 4Z4IA 3IJRA 1GKYA 4U7FA 2DWOA 5K09A 1HDIA 2R2GA 4IVNA 4RTQA 5KZMB 4ZI5A 3N75A 2V7EA 3GVPA 5BSWA 4TZ0A 4L2IA 1UDWA 3BCRA 5H1YA 1U3WA 2B2XA 2DJIA 4UMFA 4YPOA 1W0JD 1BQ4A 3DDNA 5HGJA 3BGWA 3SC2B 3WAKA 4I4CA 2O06A 1EUDB 3U7QB 4Q5IA 4YAKA 2UXDB 4L8GA 2P7HA 4W1QA 2FEPA 1ZK0A 5B1HA 5C1IA 2JGNA 4O4JB 2REQA 3N07A 1NM5C 4FFWA 1QSGA 2I3ZA 4QXAA 4X45A 4QQRA 4PHGA 2ONKA 3L7BA 3WBJA 3AOGA 4KMRA 4QATA 4BAZA 3GLRA 4B80A 1PFVA 2VLBA 2HPZA 2P2SA 2ZSHA 4HYYA 4HQOA 2BAGA 2OQVA 1A8SA 4CYMA 1E3LA 4C0WA 4V0NA 3Q3GE 1NNUA 4BMPB 1ECJA 3LSYA 2R7KA 2BKLA 4HYEA 3UJ6A 3DTYA 3PQ4A 1EFKA 1JHRA 1YBMA 1WXGA 3VPXA 3SC6A 4AWAA 3CO0S 4EUNA 5A0TA 4BECA 4RSHA 2YKGA 4GP9A 1YKGA 3LWZA 1M75A 1O9HA 1VHTA 1Y7TA 2DBRA 4IEIA 2MT9A 3BGVA 4YDSA 3R7NA 4UQLA 1XXHE 4I6GA 1F48A 2LPMA 3SEZA 5HUJA 2VDRB 3CA8A 3OQHA 3ZWYA 4XCQA 4H27A 3SCZA 2W90A 2P8JA 1O6FA 4LRUA 4QUDA 4NBKA 4TN5A 4NZ9A 3Q1LA 5IBQA 1KZ1A 4M22A 1I14A 3AW9A 3C5CA 3RYFB 3SLKA 4Y2RA 3ZNPA 4B5KA 4N5DA 4PLHA 1IBKB 1YJ5A 3CEMA 5LBUA 2N9UA 5L95A 2B4AA 3DQPA 5ALHA 1MJGA 4KGDA 3QMVA 3KL4A 3BWMA 5DM1A 2O20A 5KDDA 2AOTB 2GKSA 3PXAA 2Z6UA 3HO1A 2IUEA 1D2EA 1FFWA 1F51E 2VT6A 3ET5A 4WKNA 4WTOA 1F7VA 4II7A 3FHCB 3WGMA 1KVUA 3SC3A 2OCIA 5CP8A 1E4YA 1K4YA 1C3JA 2NO0A 1JHDA 4JLWA 3N6XA 3D6JA 1AGXA 2QE7A 4LJAA 4RKYA 1DHRA 5NLLA 4WINA 1Z17A 3TDKA 4BZXA 2Q2QA 5K01A 3TOVA 3TJMA 2FE4A 5JNVA 4IYRA 1JLMA 4FOLA 4WESB 3DJFA 2X0KA 4GI2A 4ZYYA 3KR1A 3O94A 3GW8A 4MO2A 3QH4A 5A0FA 1YL6A 4ENPA 1Z5VA 1SU4A 2QTLA 3D0KA 2BZ0A 4I4LA 4Y6GB 3PRKE 1NP6A 5JEDA 4RMGA 4EDHA 5I5GA 2ZJ0A 4PPYA 2Z3WA 4INAA 1DS6A 1KL7A 1VCMA 2XVAA 1M34E 1Q19A 2HNAA 3DP7A 4AFNA 1ZUNA 3AETB 3SX2A 5IAAA 1ESZA 1WU7A 1H5UA 1NVXQ 4FONA 2PGJA 4HTFB 2DFKB 5BSKA 1MTOA 2FSHA 3ETEA 5E0KB 1C8VB 2XADA 4XX0A 2FFBA 1CYDA 2W6OA 4QLOA 1CTQA 1J24A 1NI3A 4CKYA 2TSYB 1P62B 1DQNA 1OPXA 2J31A 4IDHA 4H2DA 3T7CA 1TYAE 5IN4A 1OF1A 5HIAA 4PO8A 5JZOA 3SWWA 1RS0A 4L08A 3VHLB 4BO1A 3H6GA 4ZU3A 4ZN6A 1LWOA 1TYCA 1U8ZA 3JWGA 2NUPB 3OJCA 3RC9A 2Q2VA 1YCGA 1YS6A 4PYKA 1N78A 2G71A 1CUUA 3MJVA 4N4AA 4GUAA 1Z8DA 1JEAA 1CZUA 2QQGA 3F6RA 1WZEA 3AOEC 1SG9A 3CKLA 1GG2A 4PSUA 1QM5A 1JR6A 3G85A 3TLGB 3E7PA 3TMYA 4ZP1A 1L8OA 1DAHA 1L7QA 5BT9A 3V1MA 3WL3A 3P32A 2C94A 1H2BA 1BN7A 1JIQA 2IIPA 1BHO1 3RIEA 3N5CA 4RHCA 2QTFA 2EIXA 4OPMA 4KEAA 3GAZA 5MHTA 3I5UA 3M89A 3CF0A 4MQEA 3HJAA 3P9IA 4OXQA 2PRZA 3GLGB 2VTVA 1J0XO 2PZMA 4CJXA 1PJ4A 1EESA 4GWKA 4DR1B 3BORA 3A31A 1NIJA 1VMIA 5GQSA 2HBQA 3LG2A 3UYKA 2CLCX 4OQYA 4YFVA 5CFLA 1S9DA 5KYWB 1T8YA 1AK9A 1WP9A 1Y3HA 2IJGX 3K0HA 3MWFA 3TSAA 1GADO 5L3ZA 4ZGWA 2ZETA 3AF1A 1F6WA 2G63A 2Y99A 5GJCA 3G79A 4UM9D 2BMEA 3WWPA 1QRSA 1G42A 1TJNA 3G7NA 3U7GA 2VHJA 2Z56A 4HJXA 1ZNXA 6AT1A 1WUHS 3T9AA 2E9SA 5JAOA 3Q41A 1UPFA 5D5QA 4B7ZA 1Y1TA 1GZDA 1NUHA 1SKUA 3B20A 1GPMA 1T9ZA 1TZMA 1NXTA 1MGOA 2ZRCA 1N2ZA 3WQHA 5IHXA 2JH9A 1MH9A 2WHEA 2ZYIA 1NBWB 4GDFA 4IIVA 4QU8A 1ZZGA 3EN0A 5ETJA 3K05A 3U6KA 4RK6A 1JG7A 5FJIA 4CEHB 4LHZA 2PRKA 2Q5CA 3U44A 3OETA 3KAQA 4L6IA 5AHOA 4DW8A 4E1BA 821PA 3FYCA 2I2CA 4LJ9A 4K28A 4QXPA 1RYZA 3PDIB 2WZQA 3PEEA 4CF5A 4QDUA 3H6KA 4WFKA 1WB9A 3IQWA 6ADHA 3VAZA 4R1LA 3ZEAA 1GRNA 2D5AA 4C2TA 3AUYA 4Y1RA 3QE9Y 4IP0A 4EIWA 2PANA 4FS3A 4MV8A 5B7GA 4BJ1A 1GPH1 1YHZA 1J20A 2IZ5A 2PFGA 2QTMA 3BQNB 4UREA 2JBWA 2NU6B 2DFNA 5H59A 3TQIA 2O1XA 4YP0A 3M8KA 1QZTA 3DR3A 4ZO9A 1IRIA 1CDDA 5D6OA 4NCBA 3S0JA 2VSNA 1KKMA 1X1CA 3HKDB 2BJHA 1AIPA 4HWPA 3ZQ6A 4AKHA 4UU8A 3TI9A 4JH0A 2W2LD 5IT4A 1BOFA 3BF7A 2B4YA 2FPKA 3EXEA 4L6CA 3WY9A 5F35A 1KY2A 5L3QA 2FZVA 3ZJVA 1DRVA 2COEA 3K70C 2ENUA 1VG1A 1K89A 2BBTA 2PQ2A 4LX0A 4M0KA 2GCOB 4OYYA 3GFOA 4EPXA 1GL9B 1WCIA 4DHWA 3BT7A 4EB8A 4DV2B 3ZJTA 3LPNA 4DMCA 1V48A 1C3OA 4WHMA 4A0GA 3WNQA 3A6DA 1KJQA 1JIVA 1LQTA 1YRQA 4AJEA 3BL8A 3Q3CA 3E0QA 4QU5A 1OX6A 1R6UA 1CHDA 3HJRA 2JDID 1HA3A 2RK6A 2XTJA 1MQAA 3FLMA 5B3LA 2GZSA 4X7MA 1N6IA 3IHKA 3DPSA 1DVRA 2W11A 1KS9A 1NFQA 3FMOB 1XE3A 4Y1EA 2IYAA 1QCYA 1MV5A 1VKOA 2RBEA 2CNWD 3DE4X 1JEQB 5DO9A 1YS7A 3HJBA 1DV1A 1E2HA 3WHKA 2YH2A 3EZ6A 4TLLB 4RVFA 5HF8A 1ZUHA 1MO6A 2E3JA 1OYYA 3H4IA 4LXQA 4WZBE 5C18A 1B8NA 2L18A 3L18A 4F97A 8LDHA 3UOWA 3W4JA 3KQHA 2OV1A 4XQEA 4FB5A 2HSJA 1ZD3A 4IDOA 1T9CA 2A7QA 2AFVA 4UXJA 1HEUA 4H7JA 4KXUA 5C2JB 3T1YB 1O7JA 3R5FA 2M32A 4U2CA 3BZUA 1NV8A 3DT9A 4TS9A 2IXTA 3VR5H 5C7YA 1FYVA 4HFMA 4OB7A 1ATZA 1B6RA 4OSEA 3PX3A 3TMKA 2XOKA 2BWJA 4YROA 5ESRA 1JSCA 2ARKA 4BKRA 2WAOA 4MTCA 1G3RA 4YAWA 4D6XA 4URFA 1XDUA 3LPLA 4Z9FA 1W35A 1NNEA 4RD1A 1Y3AA 1GILA 1O77A 1ZIDA 3HFRA 3KYIB 3LUKA 1T8WA 2YVAA 3VSAA 1VBFA 3O7MA 1Q44A 1QFMA 3ZE8A 1VCHA 1HDEA 4DCNA 3OCVA 3EOAI 3RH0A 4D81A 3BIXA 4S2UA 4WCFC 5LA6A 4PRZA 1ZA1A 3AEKA 3ASVA 1CJVC 1G41A 3T61A 1SELA 4BEBA 4ZK2A 2CNBA 1M34B 2HJHA 4V03A 2YXEA 4FGJA 3T9BA 2EAUA 2XSZA 2XYHA 4WXRA 3ZOKA 3MRTA 4MH0R 3BERA 1XRJA 3Q6IA 2OD9A 5KYUB 4XWKA 5MDHA 1CDOA 1KYYA 1DIGA 1ZIYA 2AF3C 2PPVA 1VIAA 3EWNA 1VB3A 3AY3A 1K3TA 2AS0A 3PFHA 3QLJA 4FC7A 4ML3A 2NTEA 2OBXA 1UOPA 2A57A 5DSZA 5J59A 6Q21A 4B73A 1SBTA 3F67A 4AG6A 4L0QA 2CW5A 4NH0A 2BHRA 3DBLB 3RAGA 4H6WA 5KVSA 1ZK4A 4M86A 3MCTA 2VDOB 1J2YA 1T1GA 2GDJA 3JATA 3UBTA 3DE3X 2HY7A 2QPLA 2ZIWB 1QKIA 2OBLA 4XQ0A 1OB5A 2QQ0A 1FYFA 4AYWA 2XUKA 4GEKA 4PLGA 1KDZA 1NF2A 4I5DA 2I1WA 3BE4A 2WR8A 5KCZA 2B37A 4ALJA 3R5TA 4MV7A 4EKYA 3OKAA 1PZMA 2QSZA 2VRBA 3UMYA 3FB1A 5I9SA 2PR2A 3R20A 1L6RA 3D6FA 3G89A 4KC0A 3DVAB 3C5EA 2PGLA 2Q5LA 3M4NA 4TKUA 4URWR 3I9FA 1KRXA 3F8TA 2QRGA 5T8KA 1F0NA 1LNQA 1REQB 2YJ3A 4KXXA 4RS3A 2VFAA 2EF1A 3OM8A 2E18A 1X7WB 5JMPA 3WQBA 1PL7A 2HO4A 1R5NA 4ZI3A 2QRUA 1HT3A 1LNSA 2QM0A 3W0LB 2Q4TA 4BWVA 5JWRA 1LW7A 3MLEA 3DAFA 3ORRA 2JIZA 1M73E 2EEPA 2I66A 2NN3C 3RTEA 1NMYA 4TQUS 4LXGA 3K70D 4AJNA 4RSRA 3WJ7A 1XNGA 4CM9A 4BMOB 3NU1A 1HGXA 1U31A 2J6HA 3HJNA 3MMSA 4INJA 3RHSA 4IOLA 2NLOA 2R87A 2X1LA 3VNRA 4DEYA 2OAP1 4V0MA 3UMVA 1IYZA 3PR1A 2GK7A 4CTOA 4AZWA 1KI7A 1DO0A 3I76A 1ONPA 2EKDA 5LBTA 1TK9A 3H8SA 3IDQA 2PRJA 4JS0A 4DV5B 2XXAB 1YRWA 2WSMA 3F5QA 5M29A 4W9RA 5YASA 1XPUA 4PAMA 3G2IA 4LTDA 2WKQA 2BEWA 1JG2A 5A71A 2ZXUA 3K53A 3G5AA 1GY8A 4IIJA 5IZCA 4X9XA 5JSHA 4O2BA 3RROA 1F14A 3KXLA 4XEUA 2DLDA 3ZHYA 2XRZA 4I3FA 5J63A 4DUPA 3IKMB 3O8OB 4EI9A 3G68A 4HGZA 1BROA 3DH0A 4JVLA 1EZ4A 1G3QA 1P7ZA 2OY0A 3C3CA 4OHRA 1RPJA 4PX3A 4B84A 4D6PA 4EARA 1L7OA 4LF9B 1UP7A 1UMBA 2PY6A 1M6HA 1NVEA 1XHLA 2TS1A 3G1WA 4ESVA 4ROTA 2CHFA 4H0CA 5FP0A 1NBAA 3DMHA 2ZWVA 4DADA 2X0JA 1XTSA 4I50F 4QGHA 4C2UA 3EEYA 4ZCPA 3CW8X 1OBCA 4E2XA 2FWRA 1RYNA 3TZKA 4HVCA 1QFYA 1BU8A 1WKCA 4R0MA 1N5IA 3TZQA 4CM7A 3MTEA 3NEPX 4YIKA 4IAOA 2QVYX 1A50B 2GZAA 3QBVA 2CBXA 2OZLB 3W3AA 5FADA 5AW4A 1TW3A 1N7JA 3C85A 3ROGA 3S40A 4NECA 4C4TA 5GZ6A 3ASYA 3H83A 1H2RS 1SA0B 4Q02A 1SVKA 3RSGA 3WAGA 4FGZA 3ZDRA 4ARBA 2FRVA 3TXYA 4YJDA 3VAAA 1MB2A 1ZAKA 1YDEA 4KQMA 1UEIA 4Z4HA 2FDCA 1H2WA 1ZGCA 5JVDA 1VE5A 2WUEA 4CV3A 5JNUA 1FS4A 2IE8A 2R96A 2Z83A 2QP9X 3OE7A 2AEMA 2Q45A 3K8OE 1W5TA 4OQQA 4LYJA 4PPQA 3UXEA 1IIRA 3QFHA 3I9OA 5IKXA 4JI2B 4BMNA 1ZW1A 5K3FB 5C34B 2VA9A 3IJPA 3ZZ0A 2Y0BA 3QW2A 4GT1A 1TM7E 1X1AA 2KLBA 4PYMA 4YASA 1VPDA 3WNBA 1I32A 1R4ZA 1CQZA 2R62A 3FNRA 4I55B 4I1PA 3IE0A 3TUZC 3NWJA 2LIPA 3OHMA 3PHCA 4TZ6A 3PDJA 4PM4A 1W30A 2X9NA 4B75A 4DCJA 4E03A 2VJBA 1Y4UA 4MEBA 1YD7A 4YJHB 5K3SA 2W58A 4DDHA 2AD5A 1IOWA 4HWGA 2YVUA 3G2OA 2VDWA 4LDJA 3RBZA 5J4YA 1P80A 3DPIA 1USUA 2XB2A 5AXAA 4WZBB 1TYBE 1UODA 3TTTA 2DERA 2WICA 2I33A 2J45A 4REMA 4B3GA 4NS4A 1ZY2A 2HF7A 1RABA 2YWEA 2AGVA 4P7GA 3ZD6A 2OZVA 3B1XA 4BMSA 5JD3A 1P4GA 1TKRA 5BOVA 5JSUA 2B4TO 1EGMB 2JAUA 5KUTA 1NXQA 2AQHA 3L4JA 2H57A 2VHQA 3WK5A 1A9YA 4RCZA 1OILA 3DKVA 5E6UB 3KJIA 1C8KA 1BFDA 1WOYA 1Y80A 1T9AA 2C98A 4U39A 3AHHA 3FCYA 1C41A 1ZICA 2YOFA 4IIYA 4G1EB 5CJJA 2C3PA 4CKXA 4C0KA 4EKEA 1E63A 3KLNA 2ZXEA 2ZJFA 2HBYA 3GL9A 1IQPA 3RTCA 2E82A 1RAGA 2Y1FA 1MXFA 2NGRA 1K86A 3KS9A 4QYTA 1HY3A 2O7RA 3WR5A 2JHCA 4C7VA 5F64A 4EOGA 2YFYA 3MNFA 3DCNA 5CLJA 2J3DA 1R4MA 1GZVA 2QMQA 3CG4A 2P0EA 3OT4A 2B82A 2A9JA 1P6XA 1VJRA 1VPTA 4KVFA 6NULA 4L1KA 4CUJA 1IZZA 2FWNA 2RHRA 4K8OA 4QAJA 5G0SA 4QICA 3VNUA 3KKKA 6LDHA 2FP4B 4AP6A 3ZV4A 1SWWA 3WYCA 5J1SB 4JYBA 4N47A 4KLAA 4DY6A 1VG0B 1U6KA 4PZZA 3HUEA 4Y6RA 1ZR4A 1Q0LA 1HSZA 1Z0UA 2H5JA 4ALMA 5J4HA 3ZY6A 1E61A 5CXSA 2PKQO 1EWKA 3VI3B 5JO0A 3C39A 3JWEA 5JQGA 5FWNA 4PX9A 4NU6A 1XKLA 1UBSB 4Q7QA 3VXKA 1QONA 2I62A 2Q8QA 3A9TA 3Q7EA 5AIAA 2A5LA 5HDBB 5TRTA 2XNDA 1RHKA 1XWFA 4CL2A 2G6BA 1E2NA 4JL6A 4LZNA 2WY2D 4BX9A 1L5YA 3O3CA 5BWNA 3OE5A 1RYFA 2AH5A 3FUUA 3SZMA 3IUJA 5ECDA 2QQ5A 1UBFA 2YJ5A 4KZKA 3T12A 4GP7A 3LUJA 4LG1A 5JWOA 1GRVA 3LY8A 2K5UA 3K73O 3R6GA 2E7ZA 2BDEA 3KT0A 1VMAA 4JVSB 3LUBA 5DVZA 3W90A 2H1SA 4X1OA 4CN8A 4LXUA 4W5RA 1LD3A 1RAFA 4LDAA 4QYMA 1J9GA 4FYWA 3HDGA 5CEJA 5K3OA 5LQMA 1QQBA 4X97A 1DEXA 1TXGA 1WR8A 3L8FA 4B34A 5FWXA 1SAYA 1W5AA 3HEBA 1I4LD 1PHPA 4MUIA 1HFWA 1JH8A 3DF7A 4ZV9A 3OT5A 4U9HS 2IHJA 2WD7B 4EGSA 1R5JA 2QUJA 4KDFA 1LVHA 5CTJA 9LDBA 3I01M 4G3XA 3U7EB 3ZV3A 4NBVA 1Q17A 3QVUA 1QUFA 3PHJA 2KYRA 1WHTA 3HKBA 2VCHA 3PD0A 5L40A 2PGXA 4ETMA 3B9PA 4OGKA 1XZNA 2ACKA 4K9DA 3DVSX 4F3NA 2Q3EA 4HNHA 1NYLA 5ILGA 1L5VA 1B0UA 2AC2A 4R3WA 5T8KC 1STOA 3UHPA 4JL8A 4R9NA 5BW5A 3LY5A 3NHYA 2OR3A 2BOVA 3I9NA 4RYDA 5I9TA 2GF2A 4Q9JA 3CSDA 5TPZD 3UXMA 5C51B 4XDYA 1H9CA 4JBWA 4CQLB 2V3CC 3KVYA 4KXQA 5AJZA 3TTVA 5EIXA 1QVVA 3V55A 1RQLA 5L45A 4TV8F 3EVGA 1A4XA 3HU5A 2CJYA 3C6MA 1W85B 3A37A 4MINA 2R86A 2I87A 1E6CA 4MPRA 4M49A 3WADA 4XAQA 3IJEB 3UMBA 1CEYA 1KEEB 4IJMA 4ZPJA 1M1NA 1P0CA 5DWQA 2ZTVA 2BIFA 5GMOA 4GI7A 2NUAB 4BB9A 4D80A 4HMPA 3E7XA 2DKFA 1B8OA 3FIUA 3KJFA 4LDZA 4KSBA 4G37A 1VLMA 1Q3HA 5FNVB 5B37A 4UVDA 1Z0ZA 3K6SA 3GK3A 1QNLA 2Q3BA 5DB4A 2ZT6A 1DXQA 1AZLA 1Q7EA 2OYSA 5GONA 4LVNA 4MQUA 1S6YA 5KAPA 4AF7A 3UGQA 1BMTA 3RU7A 3T7DA 4PYJA 2AN9A 4N7MA 1OLUA 3C98A 4CL8A 2G9ZA 4U7HA 3EEQA 1CUWA 2OHHA 2OCBA 2BGLA 3EVDA 4XEHA 5AI6A 4YQZA 1PWHA 1Y3IA 3DMNA 4X1IA 4B4VA 4KVZA 1P3Y1 2X5XA 1CZLA 3GLQA 5DP1A 1KVTA 3X3HA 4KKXB 2VUHB 1JWBB 1KVQA 3HJUA 2GARA 2QJOA 4C7MA 5KJ6A 3IUYA 3DE7X 4YRJA 3PPWA 7ABPA 1SZPA 2W42A 3TDNA 3TLXA 3SHWA 3CN9A 2AFRA 1G3IA 8ATCA 5LOVF 2NSDA 2G5PA 2ZAGA 1GFIA 3MS2A 3V34A 2CXRA 2DUUA 2BGNA 2J5RA 2GVZC 2G8NA 4D96A 3NPAA 3G82C 3T0GA 2JHGA 3CR3C 4JP8A 1I80A 1L5KA 1C3EA 4Y2HA 1B42A 3OPVA 1E94E 5EPEA 1V3VA 2B5OA 1U90A 3REFA 3NHKA 2C83A 1NDQA 4LDQA 1BA3A 1HG0A 4XYLA 1UL1X 5JFOA 5JRJA 2RCNA 4D92A 4GPEA 1Z2PX 1GTVA 5L3VA 5E8RA 1YK0A 1L3CA 4MS4A 4XYBA 1ND6A 1SC6A 1H2XA 4QG7A 4QUEA 3GRUA 2REOA 3OFNA 4R7ZA 5DDIP 2JCSA 2GYYA 1M2OB 2DLNA 1VM6A 2QVGA 4B3XA 4OYHA 4OM8A 2ERCA 1WB6A 1T9BA 1QO9A 4HMQA 2Y0EA 4L3WA 4LOJA 4RW0A 4ISCA 4P3PA 3N2KA 1IZYA 1I2BA 3O74A 1C8LA 4NP6A 5DN6D 3D3WA 1KEZA 5TGTA 1JFFB 3B6EA 4G1UC 1O03A 1SVNA 4DILA 3R24A 2G1KA 1TEZA 4BLWA 5LP1A 4OXYA 4JLVA 1UT8A 2XYRA 3AB8A 1Y9ZA 2R68A 2X2OA 2V0CA 4JOSA 1U0LA 4ZU6X 1ZQ9A 2C2BA 4ZZ2A 3VMFA 2PUAA 5JNSA 1TU0A 3QW4B 4FSXA 3EZLA 2ZUEA 2CE7A 3RODA 1NC1A 3C3DA 1RLTA 1VYVA 1IVSA 1JSRA 1FNDA 2WHQA 4IEFB 1E6WA 2FWPA 3CE9A 1LFDB 1HMPA 1P5FA 1A8HA 1UQTA 2H4JA 4IW3B 3PC3A 1RYHA 4Y2JA 3I5MA 4E33A 3HWRA 3NNDA 4CCYB 3UHFA 4QUHA 2R6FA 3EARA 1GIAA 2O07A 1MFZA 5LQAA 5IKMA 3FBWA 5I9IA 3O5AA 4ZXPA 4XASA 1IZ7A 1V3UA 2ISQA 2W71A 1KYZA 2Q49A 3KHTA 4FJ0A 1RADA 2GI4A 4UCQA 1LS1A 2VS1A 1Y8CA 1DADA 2JL1A 4OL9A 1SCNE 2QTVB 4FQ5A 4COOA 5K0TA 3CM0A 3OZTA 1K7FB 5G3YA 2OAQ1 1W4RA 3ZWMA 4JAVC 1T4CB 2WJVA 3TBFA 1Z29A 1GUYA 1XDZA 1XU9A 2KBEA 2IXAA 4L9SA 1C14A 1ENPA 4K3UA 5HPYB 2WVAA 3I9V1 1JU3A 1XN4A 3KKLA 2HUNA 3I2FA 2V97A 1VHQA 2OHIA 4QASA 2C9CA 3T7TA 4OSPA 2L69A 1E1DA 5K51A 2P1RA 4D79A 4BUJA 4QBFA 4RHYA 3VU8A 3I58A 4Y2XA 1XEWY 1ZM4A 2JARA 2QN6A 3ZLUA 3P9RA 3LX6A 4W1PA 1N7HA 3C3PA 1WXDA 2AWOA 4HGOA 5A9RA 4Q05A 3B2QA 1C7QA 2VVTA 3QIAA 1T6YA 4OBEA 1DDGA 1H1LA 4XCXA 4BZPA 3MMZA 5ADVA 3RSSA 1LVGA 4M2LA 4UMDA 2K87A 2JI6A 4G9EA 2APJA 1Z7BA 1FTYA 4PZ0A 2ZBPA 1KAGA 4LE2A 4YXWA 3L0IB 2GPSA 1NG9A 4YI3A 1DGQA 1T5LA 2ODBA 3QIVA 2VHTA 2PTHA 5AMXA 4EJ6A 4LQDA 3ONWA 2WAMA 4GP6A 5I8PA 1E3MA 2PT7A 3R6WA 4QXMA 5JCOA 2VQFB 3MJTA 4X1KA 3PNBA 4EI8A 1Z6QA 1RAAA 1DL5A 4V38A 3BZWA 4WN9A 5EUMA 5I7VA 3H4TA 1PT6A 3LECA 1WG8A 1K8XB 4LDPA 4DMRA 2EX4A 3OIFA 3HRIA 2XE8A 1F0KA 3JPYA 3NJRA 1L7DA 3ADBA 4YV7A 1XRSB 3PC8C 3HPRA 4W99A 1QAMA 5CX1A 1GNQA 2R11A 3AF0A 3Q0EA 3WVNA 4IH1A 4DABA 4DLWA 4AULA 3M82A 4P4NA 4NDAA 1Q11A 4HJRA 3TFQA 4QGGA 4R31A 2CY0A 3D7SA 1KI1A 1VJ0A 4Z2YA 3BRSA 1WZCA 3DTVD 4AZVA 4EKGA 4P5DA 5ES4B 4ZVOA 2Z6AA 3LWDA 3LKDA 4LPSA 1F3OA 4LRWA 1MN6A 2ZSFA 3LVQE 2XI4A 3FLEA 1KJJA 3ITEA 3OLZA 2BRUA 1Z6PA 3ABQB 4RGYA 1QVZA 5D85A 4M1TA 3NJ8A 3JAKA 4ZWNA 4QDTA 1JHUA 5A05A 1IQUA 1L1RA 2WTMA 1IIBA 4M36A 1YTUA 1AKQA 3HN6A 5JH7B 1TUBB 1DAKA 2YVQA 2Z5FA 5ITZA 2BZ1A 1CY1A 1W4LA 3OZGA 3CCCA 4MLCA 4E3WA 5DU2A 3HDQA 1UXOA 1ZI9A 4TKVA 4Y0VA 3F7NA 2F8SA 4KR3A 2IYUA 3IOBA 3FE2A 4P38A 3A6KA 2RCYA 3C1TA 1KFCB 2G1UA 5KTSA 1HNXB 4WA8A 3U4HA 1DCTA 4YFYA 4EYKA 2PSJA 3IIIA 1FX0A 5AI8A 3I5XA 2C5EA 2F8TA 2F1IA 2OXRA 2AKAB 1OBOA 1GWNA 3PGXA 2Y1XA 5EWLA 4MAAA 2ZT8A 4BFWA 4ZAVA 3A6GA 5BOSA 5JQWA 1Z0AA 5KYYA 3UJPA 1QK5A 1EWRA 1RPNA 2LW7A 1OT3A 1XA3A 1VI6A 4Q3KA 5LQSA 4ENUA 3O4JA 3QA3E 3GHHA 5HF9A 5JAZA 3KLMX 1BKSB 4JK3A 3BK7A 3ILSA 3S1SA 2IEYA 3SJZA 4YR7A 4AF6A 1U0SY 2DGDA 5C0OE 2XUOA 2XMGA 3D8HA 2JGKA 2DPXA 4B0OA 4DDWA 3GJ6A 5LYJA 4FYMA 1RLUA 1M2WA 2ZI6A 3E9YA 3EE6A 4YK7A 4RVNA 5CA0A 5FL7D 3C5HA 2W6JA 3MGGA 4QX6A 4E94A 4A23A 2J3LA 4D0LB 2IF2A 1PCXA 4C4ZA 1HO3A 1V9SA 1LSUA 2CVZA 3PEFA 4KP7A 3U1TA 1JNYA 2OKGA 3C0KA 2ZOSA 2I7CA 2CBZA 3VM6A 2NZUG 3NKVA 3LQKA 1FFYA 1XD8A 4OFWA 3CZ4A 3OURA 1NR1A 3H11A 1P4SA 1IBRA 1RP7A 4PLWA 1GVNB 3VH2A 4JR1A 1IM2A 4F8YA 2P62A 3N8NA 1UJBA 1W1WA 4MUNA 4O0MA 4QPNA 3RVQA 4R8SA 4HNVA 1Q1QA 4ZOQI 5THQA 2J9YB 1HE2A 1T2EA 2C57A 2NZVG 3L79A 1T8PA 2JK0A 3ZJYA 3GJ4A 1JX6A 4ADSG 4PBTA 1NNI1 2QQEA 1NLYA 2MSKA 2VSXA 2ZJ6A 1CQJA 3PUJA 1PJRA 2P9ZA 2NG1A 4B5LA 3PJRA 1OX4A 1SOUA 4MV0A 1TC1A 4RJ2A 3SQOA 5FBQB 3MFQA 3WIOA 1WV1A 1LLDA 4MLZA 2PKCA 3FMGA 3IL2A 3CUEF 4RFSA 4M1WA 5IX8A 2YXPX 4RCVA 4P4SA 5CNMA 3ZW7A 2VDJA 4N6GA 2GD6A 2ZUBA 4KX3A 3ILYA 2ZDHA 4J0FA 4TSFA 4BCBA 1UXGA 2P2CA 3OP4A 2DKNA 2P4HX 9ATCA 4QM6A 1HRDA 1IHXA 1ST2A 1EEHA 1WXQA 3N74A 1FVFA 3OOYA 1JMKC 4QTZA 5JYEA 1QZZA 2Q50A 3JD4A 3LT2A 1DI0A 3OAAA 4QUIA 4L78A 4YWHA 2C9DA 8ABPA 3K1AB 5ALNA 5C3MA 2RI6A 4ID3A 5TT0A 3RIGA 3ZZTA 1T2FA 3AFMA 4MPDA 1J25A 5IDVA 3RFUA 3KT6A 3M6LA 5HTOA 4FPXA 1ZESA 2WM8A 4JDPA 3FKSD 3QY9A 1XP5A 2W48A 3TKAA 3VO9A 5CIYA 5ENVA 4HRYA 1UKEA 3H9GA 3KQWA 4NI5A 3OZEA 3TEFA 2D5CA 5C5IA 1JJIA 3HBAA 4E5MA 5BV1A 1OWOA 2ZTLA 3M1AA 4J7XA 4X6XA 5IC6A 3ADDA 5IVDA 2BE7A 1WPQA 4FJ2A 4DIKA 4YUZA 3IEUA 3G1UA 3O21A 4MGHA 2ZRLA 1JLLB 1Q84A 5DHPA 3SLRA 3CRRA 4FXOA 5EKDA 4G5HA 3AINA 2HB6A 2X86A 2VQEB 4HXEB 3G8CA 1O8BA 2LNDA 4DIUA 3UXYA 2GFIA 3NBUA 2OHFA 3S6JA 4CTKA 1QF6A 4JD5A 2D2FA 3FKJA 5FOVA 3C6YA 4GWLA 4TS3A 1WMEA 4ZZIA 2IRWA 4P0PB 1DTSA 1E0SA 2NO9A 4KVAA 2J9FB 3QBDA 4X95A 2IVFA 1JVNA 3OF2A 3L06A 3BMNB 4I14A 1LA2A 1PGQA 1WQ1R 1CIPA 1PUXA 2CYAA 5KKAA 1YQQA 4X90A 4D8VA 4TRRA 4OX9Y 4AC9A 4RACA 3TNFA 3H86A 1MIOB 4JC0A 1ZXLA 3WLHA 1LQUA 1K3UB 2J87A 4CL0A 1E1QD 2GN2A 2V4UA 4W8OA 2XMPA 4O4HF 3ELWA 3K0FB 1EXDA 4KR0A 3ZWDA 2HT1A 5CLFA 4RA9B 4UHBA 3KYDA 3B7WA 2JJ1A 3W2IA 1V8OA 1C7ZA 1EMDA 2GRJA 2UUOA 3KYBA 3N6VA 3P9YA 5K9ZA 1IDOA 2VRNA 3LGAA 3HB4X 5TS2A 3D8RA 4EY8A 4YMUA 5CNKA 3G9XA 4XR9A 3DOUA 2QD4A 4JHLA 1R0XA 3NORA 3STVA 2ZQZA 1JDZA 3M49A 4JBHA 1HRKA 1R5BA 4O4LF 3B8HA 1QU3A 2YV3A 1JDUA 3G0DA 4DV1B 2O19A 3M1YA 1C0KA 1FYXA 1MAVA 1YCDA 2ZPTX 4RPKA 1RRPA 3UJNA 3PNKA 1N6NA 5A3SA 1Z16A 5CPFA 3X0DA 1TJ4A 2IOFK 3PP8A 4MB6A 3JYPA 3ZXYA 4ZYVA 4UDYX 1GU1A 2PUJA 5EIEA 2OHXA 2YZKA 4GPZA 4MVJI 2JCVA 3EH1A 4Q12A 5IT9A 5DGXA 2NU9B 5K8CA 1K6IA 1E9AA 2GS9A 2IDJA 4FW8A 5G0UA 3NC1C 4ZC8A 1U8AA 2I4LA 3SS9X 1UBEA 3K9QO 2GFHA 4AIRA 3U26A 1TPYA 4UM7A 4F2HA 2IEDA 1P7VA 2B92A 2I6XA 2QSUA 1QHHA 4MW1A 1UINA 4CEIA 4Z4EA 1DAEA 2NZJA 1BE0A 3GEDA 4G5SA 5KOJB 4TLBA 4W5HA 2H0AA 3INGA 3OBBA 3OFND 3PD7A 3PQ3A 1TD9A 2Q1YA 2Z2KA 5FEMA 5KTOA 1GRQA 2SECE 2W6PA 3F5FA 3GFBA 2YJ6A 3GDGA 4PXSA 5IJXA 2POCA 5LP6F 2O2SA 2GYVA 1BGXT 3HU2A 2BRUC 3M6XA 1PZHA 3L1KA 2SKDA 1U0HC 5GVRA 3CVYA 1HLPA 3GT7A 3IEPA 3OLXA 4WBSA 1UDRA 2NO7A 4RY2A 2Q0HA 3LZDA 4XWTA 3OQVA 4FZJA 5G0WA 4CM5A 4MHOA 2DXIA 4D8WA 1GUZA 4FLEA 1OIVA 4CM8B 1GO2A 5F77A 8GPBA 5C9ZA 4AZTA 1VJGA 2Q0XA 4NEQA 1RAIA 1U0FA 2GPAA 2J41A 1F17A 3G9ZA 2JVJA 2NXEA 4US1R 5JIBA 5EFOA 4TL7A 3UAYA 5CAEA 4AJ1A 1C0IA 4BLUA 2MSDB 1EUCA 2AX4A 1WCWA 4BO8A 1SK9A 1V5FA 1V2HE 1KMHA 1M83A 4HN9A 3SF8B 1F5NA 3TQSA 2R79A 3DHWC 1Q21A 3FYUB 4GVXA 5DK6A 5EVCA 3TX6A 1BCSA 2W6ZA 3DMGA 3TSOA 1UWLA 1BJKA 2OBBA 2RHOA 3DF9A 3WFZA 5CBKA 1F0YA 1VSVA 3OPMA 5TSDA 3SKXA 4QU9A 5LQRA 1PVVA 3CISA 1L7AA 4LNUB 2YIMA 1U7ZA 4U2EA 2F3QA 1OQAA 2Q46A 3E9RA 5KS2A 5EP1A 2P9BA 4O1MA 2WMDA 3GELA 4HV4A 4ZTBA 3I73A 4AN4A 1PIWA 3ZJ5A 3LC0A 2G0NA 4TKZA 5EP4A 1FLDA 2G80A 5DHFA 1VE6A 1DUVG 4YJ3F 4MI6A 1XQXA 5L7TA 4NESA 1UFVA 4ZT7A 4V2IA 3T4PA 1P39A 4A6EA 3D2AA 3I72A 5EA2A 1Z26A 2IPMA 3COYA 1KKUA 5T6BA 2Q3LA 3DLTA 3HRKA 3QA9A 4OQZA 3OIVA 5JARA 1XVUA 1DJQA 5DOVA 3WA6A 1QX3A 1SIUA 1KOJA 1ORRA 1XCLA 3A1FA 3Q15C 3CNLA 4NENB 4DDMA 2HPAA 1SY7A 1Z8FA 2F43A 3V8RA 1J90A 3FGZA 2JLUA 1JDJA 3CLUC 2JGFA 3HUDA 1FP2A 1E3QA 4C7KA 1ZJ5A 5E4JA 3GR6A 1ZUWA 3IPLA 5LBIA 2IPXA 3W5UA 1TQ6A 1NUAA 3Q6NA 2H63A 2HCBA 3FCEA 3LSTA 4NFYA 4QU0A 1E2MA 1Q1BA 2Z2YA 3THXB 3N2GA 2IDMA 1PL8A 1EINA 1U7XA 3ANSA 1XELA 3H2BA 3MRSA 5LR6A 4PIMA 1S8AA 4U1RA 3V3TA 2VWQA 2ZJ2A 3I0NA 3S7ZA 4BRSA 4R4JA 4ZOBA 2RGRA 3NIGB 1H1TA 2R5NA 1CVIA 4KN5A 1VTKA 1XUOA 2G72A 4ZODA 1RZRD 1FDIA 2GT1A 1NN3A 2VJKA 2VTKA 4I99A 5C35A 5FUMA 3OCWA 1MB4A 3QJGA 3QVWA 4HDQB 2EP8A 2P3QA 3AVQA 4TXMA 1QAOA 2BY4A 4O29A 4F4IA 4OEHA 4PG7A 1NVTA 4CG0A 1BXGA 3V8QA 1V7ZA 1Y0BA 1Y42X 2QNBA 5BW8A 1FMFA 3AZPA 1RSZA 4XI9A 4EEKA 5AWFC 1VCNA 3MS7A 3R5KA 4UBNA 2YHIB 3MELA 4MW5A 1R0SA 5JZSA 4BPBA 2B8NA 2QI9F 3CX8A 3N2IA 4TQ9A 4WLFA 3CGGA 4JXJA 3K0EA 3RRMA 1T35A 2NTNA 3SK0A 5DXAA 1LZLA 1PSWA 1SG0A 4M1YA 3WC4A 3ZCUA 2AJLI 3HSKA 3BMOB 2ZUFA 4IDDA 1NJ2A 3VDQA 4BNTA 4BO4A 1NY5A 2BGWA 2OT3B 5HF5A 2WYIA 1K06A 2ZYAA 1SPBS 3NUQA 2C8VA 4XWGA 5JSQA 5BVHA 1NQWA 2N75A 5JI2E 4I1OA 1P75A 2IVZA 3SYMA 3QELA 1GT6A 3U7HB 1O9BA 3PR3A 4WZAA 1QFXA 2GDZA 1PG2A 1IMJA 4K88A 4BLTA 4FFDA 2CBGA 5DHQA 4J76A 3T3HA 4NFLA 1W6RA 3AUFA 1VBNA 3QYAA 3L07A 4ZO8A 1W52X 5FFFA 3K4QA 4IS3A 5FUVA 1C50A 2XMSA 3OEHA 4MV9A 2DPGA 1EB9A 1Y1SA 1HTBA 3GCGA 3QXGA 4L7VA 1MFPA 2QQFA 3NYRA 5T41A 3AQ4A 2HLDD 3QU9A 2Q1UA 2IH5A 3HFGA 5JRZA 4F85A 1EFLA 3QLTA 4B3JA 2NQ8A 3RI3A 4IQ4A 1CY7A 4MGYR 3TQOA 1HWYA 3WNZA 1CSEE 3OPNA 4CGZA 1V25A 1RWBA 3E5RA 3H1BA 3ENWA 3GLHA 4O4IF 2GXAA 1JPNA 1I2DA 5IM5A 1UT5A 1YUBA 4W7HA 3IHWA 3SVLA 3GDHA 3LIIA 4TLCA 4QLBA 2BFFB 4TT8A 1DEOA 1XEAA 5IM4F 4GPIB 4H7FA 4MWSA 1BVHA 1YDWA 3GDFA 1LK0A 1Q16A 2W43A 2FRDC 4ZAYA 4MVJG 5G4KA 5CDYA 4LGCA 3VC7A 3AI7A 4P31A 4UD2A 1NW4A 5CW2A 3QU4A 2HA0A 1YQTA 3W2EA 3PX7A 1Z33A 3VNSA 4QJIA 3A2NA 1HT0A 2ZIAA 1FVXA 3IFSA 2BM0A 3PNLA 3CIOA 3CWZA 3A1EA 5DT2A 3SFVA 3VU1A 2GPJA 1U2QA 1PWZA 1ZD8A 1ORVA 1WUJS 3IPRA 4EKIA 5M34A 1AU9A 4DLXA 3KHUA 1PQUA 3B82A 3SZUA 1BVUA 3ETGA 4B3HA 1ML3A 4IXWA 4DR2B 3TH5A 1ZCAA 1E1RD 1T9GR 3FZEA 3KTAB 4ENQA 1MC1A 5BSRA 2FPWA 4NPAA 5AM1A 1EM6A 4XUCA 2DQZA 4DXHA 2C9OA 2XB6A 5EZYA 3CF4A 3GLIA 1J5EB 4UPVA 1KO5A 4HUTA 1P0IA 3QI7A 3T7JA 1DKMA 2IS1A 2QSJA 1ETUA 1ZIPA 4OUDB 4XR4A 3ZWOA 1VJTA 2XF8A 1FYEA 3B1ZA 3LW7A 3FETA 1MPTA 4EG7A 3HDHA 1I7LA 1E3IA 1YI1A 2IUTA 4OFBA 4QPCA 4GOKA 1A71A 1VG9B 4HDKB 4V2UA 1I51A 1RMYA 5BURA 4U9UA 2ASEA 2FPIA 1Z75A 4QTUB 3RDPA 5JCXA 1S3FA 4X5OA 1YH3A 1I33A 3JZMA 3C87A 5HUHA 5SZHB 2YW2A 4DJAA 5JD5A 3PUKA 4I2NA 4LECA 1Y48E 3O4FA 1PFQA 3IR7A 1E77A 5ARDA 1QX4A 1XLTC 2DH5A 1JLKA 3PPXA 3AF3A 1VGVA 4IIFA 3V4ZA 2WIKA 4S05A 1Q7TA 4W7SA 2B7CA 2YJ4A 1G5TA 1ZA2A 4PCUA 1U1FA 4F4HA 5EERA 3D6HA 4X91A 3RSCA 5K3AA 1D1SA 1X7ZB 2NZXA 3L41A 3OAAD 3PDUA 3PITA 4BOYA 5JW6A 1P3DA 4MUHA 2V4MA 4MRMA 3OT1A 5E4YA 5FR2A 3RS0A 3HXPA 4MGZR 1SB9A 3SEAA 1COWA 1S8OA 4ZKDA 4D41A 1AZWA 4X61A 1Z08A 1BW9A 3GV0A 4UFNA 2VNSA 1FTQA 1UZMA 2Y2UA 1UWKA 2H00A 5HOEA 3QOYA 4GHWA 5I47A 2PGAA 3NT4A 2HLNA 3AFGA 3EGXB 1BXRA 1XWIA 2O23A 4KAXA 4ZJUA 1QQ6A 3LT1A 2NNLD 2PCLA 1Q2XA 1JPUA 4DMGA 5JE8A 2EJVA 3G5UA 4OHBA 4GE3A 4Z4QA 4BMZA 5IVKA 3RRBA 1YHNA 1PG0A 3CVUA 4FX2A 3RBVA 4BX0A 1UBCA 1GPKA 2XYVA 4MR7B 3OVMA 3GWZA 3HE3A 3ZGXA 4ZYZA 4UXIA 5JXWA 3B2NA 5DYTA 3HXTA 1HNNA 4L4RA 4CQNA 4H77A 4PIVA 1ANKA 3Q98A 4LX8A 4TVBA 2WM3A 3L7MA 3CC8A 1J6UA 3PKIA 4DG5A 4KRGA 4QVIA 1T4GA 2GK3A 3TE6A 1ZMOA 1WLSA 2O2GA 5DNUA 5KPJA 5B58T 2PKEA 4RVGA 1E3WA 4KRFA 3WMWA 4MZDA 1NR7A 1IXYA 1RYMA 4M37A 1NNSA 2XGOA 3C74A 3O8QB 3QVLA 4Y67A 2CMKA 2PLAA 3AKEA 3WLNA 1TEXA 5J5VA 3VNQA 3KVOA 1S2OA 2ONCA 1SKBA 3VR6H 4LJSA 1HXHA 3JRNA 2FQ1A 3GA5A 3KQVA 4ZDIA 1R0ZA 1YDMA 3AONB 2VBFA 3BFKA 2QIOA 3G2JA 4MRVA 4QHSA 1KO4A 1KOLA 3R76A 3H42B 4EKNB 2VCEA 5F76A 3OH8A 1PJSA 1UEJA 5T4FA 3AESB 1KE2A 1K7XB 2X7HA 1UOQA 1N2CA 3E23A 5SZKB 1EX1A 3ONNA 4LZZA 4H0FA 1X8LA 3R6TA 2OILA 4YQEA 1LB1B 1ESEA 4B7XA 5E3IA 3Q3HA 4V0RA 4ZANA 3TTUA 1U8CB 2H9AA 4Y2PA 3IP6A 1IEQA 3JQ9A 5CRIA 5D3MB 3DLCA 1O0BA 3K8ZA 5A1TA 1QXSA 4ND5A 2ODNA 2L2QA 3CUWA 1A2BA 2BM9A 1KP2A 2ILVA 4IICA 1XOIA 4C01A 1JH9A 4Q39A 1CJTC 3JQAD 2QXYA 2XTNA 1KZ7B 3BSFA 3UWMA 2O3QA 2TMYA 4ENSA 1KYTA 1H4SA 1R4NA 4MDFA 1YOBA 1IG3A 1Y1LA 4YI5A 3GLFE 1FU7A 3AR4A 3A1WA 5CJPA 1D6MA 6REQA 2QZ9A 1T0JB 4BX8A 5EJEA 1GYPA 4GZ6A 2BR4A 2BBOA 2ZJZA 4L73A 2B21A 4B8WA 1RXWA 3QK7A 2FJPA 4EUHA 1AUVA 4IXNA 5BT8A 4W9MC 4NE9A 4I8DA 3VZBA 1PNTA 2GASA 1W4BA 3GRKA 3TDMA 5IBCA 2DUJA 3B3GA 3HUUA 4OGGA 2RC6A 2J85A 2ENWA 2WDZA 1OGYA 1P33A 2XHEA 1ARZA 3HVUA 4PHHA 4D4JA 4ED9A 4FDUA 4RH0A 1JDBB 1HC7A 3QG1A 5TQ2A 1Y1QA 5HZMA 1ZJYA 2FLWA 4P4TA 2GN9A 2CZQA 2LP4Y 1WBDA 4LCJA 5KNCD 3FF4A 3QLEA 3UCXA 1YZYA 4HXGA 2VNKA 3W9SA 4DSZA 4UE3S 1OT5A 2QVXX 1XB2A 3EZ2A 2XQJA 2QTZA 3E0XA 3D4BA 3S44A 1D4AA 3BKWA 2BMAA 3KQQA 3HWSA 4F3RA 1IOVA 3PQCA 1OD6A 1KAOA 3B1JA 4ZALA 4WN3A 1ZH6A 1H3FA 3NHZA 3RR2A 3ZHOA 4UEOA 1LTQA 4TS1A 5CD1A 3PJEA 2VEDA 3TZ6A 3NPMA 2ORWA 4MQFB 1IAVA 1QHXA 4D26A 2PU7A 2EX0A 3CVWA 2J09A 3WLPA 3ZCPA 3KJQA 4M7RA 1QGDA 3ZEIA 2XA9A 2BFCB 1N9GB 3BD6A 3UAGA 2IFTA 5B6JA 5KTKA 2OC4A 4JP3A 1TZCA 5EAIA 2W22A 3COSA 1L5HA 2QG6A 5F51A 2D5BA 2H59A 1DAMA 2PUWA 2AIRA 3MJSA 3IR5A 4MS3A 3DBIA 1BQEA 1N8NA 2X76A 2AVDA 3NANA 2A1TS 2HTFA 7YASA 4RFLA 4BL5A 3JD0A 4FDTA 4WLUA 3D7LA 3AHJA 3FMIA 1XN1A 3FF1A 2AK2A 2G25A 3RANA 3UJHA 3EQZA 3LFHA 2DECA 3PICA 3F0TA 2YZNA 1D4ZA 4P2BA 4BAUA 2PUGA 5BSVA 1Z5UA 5F9HA 2FN4A 5BR7A 4KDCA 4YC7A 1ACJA 1JQKA 5G2OA 5JFTA 1U3CA 5JCJD 4GOMD 3DZCA 4US2R 1DZIA 1P0FA 4MVCA 2HXYA 3GEIA 3ZXSA 4B2PA 3HBJA 4A36A 1Q91A 3UK6A 3WA7A 3RKSA 3G8AA 2IPOA 3NAZA 1KK0A 2R6CA 3MBKA 5G0TA 2C4NA 3JXEA 1WW2A 4IGAA 2NO1A 3C3BA 4G0OA 4JI5B 3KQSA 5JLAA 2WWHA 3GNQA 5TJHA 3SR0A 2A0FA 1PRYA 1V8ZA 3DBHB 4HRAA 1OZGA 4HKTA 4FFSA 5SYAA 2V45A 1F8FA 5KWEA 3EIEA 5JJ5A 4JJZA 1QC5B 3NHJA 5LWHA 2VPPA 2P35A 4IIGA 1FF9A 1Y6QA 2GZDA 1A97A 1M8FA 5KBYA 4F3KA 3ZLVA 1CWUA 1EVZA 3CCFA 5LU9A 3W4KA 3OG9A 4I50B 1YJAA 3BXOA 5K3DA 1WQ4A 1QO0A 1JIIA 2GM5A 4PIPA 5CVDA 1QB7A 1WPGA 3AI1A 3E22B 2DPMA 1R6DA 3LYUA 1YZVA 2A1UB 2BCJQ 2A58A 1ZD5A 1XRRA 2P9GA 2JJ2A 3DEFA 3GYGA 4ZA2A 1P45A 2QR3A 2NUTA 2FMXA 4J0EA 2ES4A 3R7FA 3UAOA 3D3KA 4WNCA 4GD3Q 4Y0AA 4YR9A 1SCKA 2W2XA 4Y1FA 3F4LA 3KEFA 4UEWA 2RGCA 3A4LA 3TZBA 1X1TA 4BTVA 2I3DA 2XZDA 3MJRA 5IH3A 2IIBA 3GOQA 4OQ4A 1A69A 3BFPA 2P6UA 4YRPA 1ID1A 5KVVA 2HN9A 4ITRC 1TF2A 3CUYA 1PR2A 3MMXA 3UA4A 5AVZA 2IS2A 1E4VA 4YCJA 2Z09A 4X20B 3O4GA 3DP9A 1J2JA 2F3SA 4O0LA 1WNTA 4AQYB 5TQ0A 3WV5A 3RF6A 4P22A 2PJZA 4D4HA 5C37A 3QUAA 1CUEA 3NZEA 4NULA 5KYXB 1CUXA 1JXOA 1PSZA 3DUFA 3JQ8B 4CIDA 5FPTA 5BVGA 3PHGA 4MVJF 3STUA 3KJNA 3TF5A 4A8JA 3CZMA 2QGZA 1V37A 5LXTA 1D6NA 4H7IA 4QA9A 2ECFA 4TT3A 4EY4A 4B6JA 4RELA 2ZSUA 1QGYA 4DHEA 2B25A 5CVCA 5AJUA 2OB2A 1DZ3A 3FVWA 3PUVA 5F1YA 4LY9A 3GEPA 1E9BA 3GMDA 1HDRA 4YXFA 4HAYA 3O47A 2VH1A 5GJWC 3V2HA 1R64A 1OXMA 4JWTA 1DWOA 3C4JA 4YJ2B 3HJFA 4WNIA 4I81A 1W44A 1Y4DE 3VUEA 2QVBA 4AJ4A 1O96B 2P9JA 2GF0A 3HCOA 2Z43A 1QHFA 5JXJA 4M9CA 2R9VA 3GPIA 1QDUA 5DCYA 4RDHA 1E58A 2HQ1A 3BK1A 2GUGA 3U7JA 3L0DA 1JDPA 1W76A 4P84A 4KFCA 1VJCA 2RHJA 3ITDA 4KE8A 5JZ9A 1DIBA 2AC7A 2ZWAA 3AF2A 3LVFO 3ML1A 3VYTB 3R4VA 4GVLA 3VDNB 2DYKA 4F06A 4G36A 1FXUA 1LV7A 5E3HA 5BQXA 2A94A 4TZKA 4F5DA 2P6NA 1N2XA 2C92A 3RYCA 3D43A 4YAFA 4X62B 1DOAA 3DE1X 3M6FA 4TVSA 2BEUB 3RVPA 2ZSKA 1JRLA 1QPGA 1X15A 1UJ6A 1NL3A 3CLKA 4J1TA 2HDNB 3A36A 4U02A 4AG5A 4NZOA 2HX1A 4BQOA 4X8LA 3WGHA 3KVVA 1P3JA 4C89A 4S04A 2PKRA 2CLMB 3B7PA 3BRCA 2PZ8A 5CBPA 3GLFB 1QIMA 3E3MA 2GK6A 1EQAA 2I6GA 3FHLA 3NHAA 4UUMA 3IQXA 5I7AA 1DDIA 3DB2A 2FPGA 3SVZA 5T5QA 2YW9A 3OICA 4UUBA 5FUYA 1TMGE 2XB8A 3FFWA 4D6YA 5C80A 1UM8A 1XALA 3K94A 5K0ZA 4BV8A 1T9KA 2DSNA 4RVHA 4WAUA 4DJFC 2CLOB 1R37A 5BXYA 1HH4A 1IL0A 4L8WB 5FL3A 4ND8B 4G1BA 3NM4A 4PYOA 4BEJA 2ZFUA 3NAMA 1LDEA 2H7VA 2JATA 3BXFA 4AB1A 1GA4A 4OB6A 5JY1A 4L8LA 2HNKA 4P8RA 2RGUA 4IO0A 1EDOA 3MAAC 1WSBA 2HIHA 2KSQA 3I1FA 2CMGA 2ZREA 4NR0A 3ZLBA 1F2UA 3G0GA 1U04A 4JQZA 4O4JA 4PZCA 4YGYA 4HVTA 1UZNA 1HK7A 5THXA 5E6RB 3WLTA 1V8PA 2Z6VA 1NMZA 3MXTA 5CYPA 1SBHA 2YZGA 2WMNB 4HWTA 4Y2GA 3ZPXA 2AJCA 3FBGA 3VDXA 1OWNA 2C07A 2XWSA 3ZCRA 3H0EA 3KRTA 1SHZA 2NUBA 4UW9A 3PJGA 5KX5F 1NJ1A 2UUCB 1TOAA 4X92A 5DBEX 5K0LA 1ISSA 3Q6MA 5EC8A 1MB0A 2ZAMA 4QAQA 3ZG6A 1GQSA 4JFRA 4TL6A 1PG5A 1XJCA 4Q4AB 5AJYA 3STXA 4EGCB 2FZEA 1AOXA 2HC9A 2H4WA 4PVDA 3TNJA 4DCGA 1NRWA 2W00A 4LY0A 1GDDA 1JR3E 1U3DA 3C16C 3GVIA 4LW8A 1Z7GA 3TSZA 1TT7A 4N6NA 2RG7A 4RDIA 3A06A 4B1FA 2HA7A 1OFGA 3LPMA 4FYJA 4IS2A 3RVMA 3WKEA 5J2UA 1KJ8A 1ZRHA 1PT7A 3E15A 1XU4A 4KAJA 1M8GA 1VLQA 2A0XA 2O7QA 4K40A 3DKPA 4EITA 1I94B 1G66A 4KODA 2I8CA 1P60A 2UYQA 1R5OA 2B8EA 5BV8A 4H3VA 1Z6YA 2XWPA 3QUQA 4TV8B 3RS4A 4AYTA 2OL4A 5EHXA 2X0IA 3RGGA 3E6AA 3IPAA 4B3TB 2IYVA 1SXJA 1QTNA 3VR4H 1EAYA 2QGFA 1YDGA 2X8BA 3FTPA 4IJQA 4U3JB 2JRCA 2O8DA 4NU8X 5BUSA 5AKXA 3LYHA 1ZRNA 3CLRC 5DIFA 3T5BA 2XE4A 4RD4A 1S4QA 3JD1A 4K6CA 4E32A 1DCKA 4OREX 3V33A 2P9QA 3VTAA 3QFRA 4HWRA 3ZTWA 3A6FA 3FSEA 3DL7A 5BN3A 5K3CA 1GLGA 1ZM3A 4GYWA 2IYWA 3ZK8A 2PIAA 4B4OA 5HOQA 4A0HA 2FWAA 5TNXA 4A9AA 1NVBA 4M8LA 1ZIXA 1U2RA 3N39C 1KC1A 4X8OA 1MQSA 3MN1A 2D0PB 3ZC3A 4YMVA 4N5MA 3PIIA 2DT8A 2FGJA 3FPGA 3BXZA 3AETA 3VTFA 3VDRA 5IRCD 5DHUA 2JAQA 2BSXA 2ST1A 2YBEA 1Q0UA 1U7HA 4Z99A 1ZNQO 5ADWA 2AXQA 4ZEMA 2A0KA 4HADA 3NRCA 4WXMA 2RHMA 5FUBA 3LQFA 2A67A 4ZVNA 3AO0B 3EDMA 4CVNA 4GL2A 4DNFA 1KH3A 1BGVA 4PAOA 1YFLA 1I4WA 1THZA 5LOVB 2FUNB 5AQEA 3HJGA 1C9JA 1IN4A 1I1NA 2OHOA 4URHA 2QAGB 1MJ5A 5SZIA 5HCIA 1E2GA 2BEJA 3ZZNA 4ZCMA 2ROQA 2I4IA 4RVSA 2FAXA 5FTKA 2IHTA 4BFSA 4Y6LA 1RBZA 2C88A 2Y9MB 3MLAA 2OYRA 1Z5GA 2VJQA 3SZOA 5K8JB 3GCWA 5E6SA 4BNUA 4HDCA 3REGA 1E3SA 4C6TB 5BR8B 3OOEA 3IQIX 3BFJA 3PQFA 3TLGA 3UBMA 5E7MA 5T4EA 2JIMA 3AM5A 1HQKA 3FJ1A 3IMGA 5E2BA 3AXTA 2CWDA 2Y3IA 4ZC1A 2RFLA 1OKKA 2X3FA 4EFMA 3HGTA 1I3OA 4EI7A 1G8AA 1GZ7A 1K97A 1RR6A 2OCYC 3EXIA 3W6OA 3V6LA 2ET6A 2XUHA 3I42A 3TFWA 3L2OB 1RLIA 1ZEJA 3MT7A 5JSZB 4A3SA 2HIMA 1QQ7A 4YMIA 5C8DA 4C0HA 1IM5A 5FPKA 1XZIA 1PAUA 4D9HA 3GLGA 1U5BB 3ETDA 3M3PA 2WD9A 3A1VA 2FB9A 1Y1PA 2X9VA 4GF5A 1H9BA 4G4GA 1KFJB 1ZK3A 9GPBA 5KYWA 4JT2A 3U1BA 2X1MA 1D2AA 3AVOA 1D0IA 3DYBA 4PQFA 3L7LA 1DPFA 1JLHA 2FPSA 2AMYA 3IQZA 1A9SA 1FYDA 2UZ0A 3LCUA 1OMOA 2K2WA 4TTJA 1VSTA 1Y9DA 4V0KA 2AYXA 2IGTA 1GZUA 2WWRA 3VU9B 3WP0A 4BQFA 3O2QB 2B4KA 5EVJA 1N34B 3W79A 5AVTA 4FE3A 3HBMA 4UEQA 4NZPA 4XSVA 2QUZA 4ZAXA 1Z35A 3DGFC 4DR7B 3WSTA 4LVCA 4U5XA 3B5IA 2PR7A 1M9NA 1H3EA 2PKYX 4CEHA 3K0CC 3NM6B 4D9CA 1V7CA 5G40A 2ILTA 3OEWA 5AJWA 3ULKA 1ZN8A 1W88B 5DNEA 4LI0A 3EC7A 2DZDA 5IKEA 3EAFA 4DMMA 2RC5A 3S8EA 3THWA 1U8TA 2JKYA 3ELBA 2XQIA 1MTZA 3M4XA 5BRAA 1JGTA 4R05A 2Y6UA 2FSUA 1JW9B 1TZBA 3BILA 5D87A 2PX4A 3OZRA 2YJTD 4UUPA 3ONFA 4MW6A 1FVOA 1UJ2A 1QMGA 3PCTA 5AOAA 2FZWA 5B2FA 5LWQA 3R3JA 4ER0A 2WLTA 4AMVA 1XRLA 2ADMA 2BHSA 1RBQA 3GJYA 1Q6ZA 1U5CA 1Q57A 2J7PA 1G3MA 1H85A 2G28A 2HQBA 2W37A 2Y8EA 3KKPA 4HFJA 4EDFA 4FFPA 2HU7A 2XRYA 3D64A 4U2BA 4EL5A 3PF8A 2C99A 2VPYA 3HLKA 4YJFA 3MAJA 3FMVA 3Q3VA