3Q7TA

2.15a resolution structure (i41 form) of the chxr receiver domain from chlamydia trachomatis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
96
Chain Sequence
PKHVLLVSEHWDLFFQTKELLNPEEYRCTIGQQYKQELSADLVVCEYSLLPSFVLVLLDFFDEETSVDLLDRGFWYLIRPITPRILKSAISLFLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulatory protein
publication title The atypical response regulator protein ChxR has structural characteristics and dimer interface interactions that are unique within the OmpR/PhoB subfamily.
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Transcription
total genus 32
structure length 96
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3q7tA00
3JPWA 1JLKA 2B1JA 2HJ9A 2IKSA 1JDPA 5BRAA 3N0WA 5HKOA 4M88A 4RKQA 5TQ0A 3HSYA 4Z4FA 3H6HA 5TPWB 1ZVVA 1F4VA 4NICA 4EYQA 3N0RA 1PHRA 3HDGA 4KQCA 5TE9A 2QVGA 4WXEA 2NZVG 3IPCA 3GA5A 3F7NA 2FMKA 3JTEA 2E4ZA 4H60A 1ZH4A 1R8JA 2LUOA 2QV0A 4PYRA 4Z0NA 1LBIA 3CS3A 3HO1A 2XDYA 2PKXA 5KQLA 4ZYLA 2PUGA 1J56A 3TX6A 4KNYA 2YHBA 2X7XA 3QLUC 3RVRA 1M5TA 2R4QA 4RKRA 3HK2A 2RDMA 4TN5A 1QKKA 4EY3A 1E6LA 3JY6A 3R0JA 4QYMA 3FFTA 1AB6A 1NTRA 1BA2A 1ZAYA 2FN9A 2E4VA 3T6KA 1ZH2A 3H1FA 1PNRA 4RXMA 3M9XA 3UUGA 3BRSA 4Z4EA 5TQ2B 1FFGA 2ZWMA 1CYEA 1Z15A 2FW0A 3KYIB 2TMYA 3HJFA 4O1HA 2NZUG 3FGZA 1D1QA 8ABPA 1SXHA 2CWDA 3CZ5A 3NHZA 4Q6BA 3MYYA 5T3YA 3F73A 3A3KA 4MS1B 1JL3A 3HVRA 1D4ZA 4HNRA 2CD7A 1BDHA 3SY8A 2FSPA 5KI6A 2L17A 3BREA 5CNJA 2FQXA 2PL9A 1FFSA 1VPWA 4KREA 2O20A 3OLWA 4PZ0A 4EYGA 4L85A 1Z2DA 2WWVD 1YS6A 1ZHHA 3RVQA 1SD5A 3O2SB 4RV5A 3HV2A 4MGEA 1BVHA 2GKGA 2PMCA 1JFSA 1QPZA 2Q5CA 3MMNA 4OATA 1JFTA 5CNIA 1C4WA 2ZAYA 1F51E 2PLNA 3FDFA 1Z2EA 2JBAA 3ILHA 1BDJA 3N0XA 1MB0A 1DBQA 1H9CA 4D74A 5IUKC 1JH9A 4PEVA 2WRZA 3EODA 2FKAA 3MQ4A 5EWMA 4MS3A 1RXEA 4S05A 3C3MA 4IGAA 1GUBA 1GCGA 1RZRD 3QK7A 4OG2A 4Z4GA 3NBMA 3SAJA 1KRWA 1MVOA 3H5OA 2A9PA 3KLNA 3O2JA 3KYJB 4MRMB 4TLMB 3Q7TA 4XFKA 2PL1A 4EYKA 4ZPJA 3BILA 3T38A 2R47A 1GUDA 4YRZA 3DLHA 1EHCA 2WY2D 1QQAA 3IP7A 1EAYA 3I45A 5HM6A 4N41A 3DZDA 4RK7A 3D02A 4RU1A 2L18A 3CU5A 3TD9A 1VLZA 2E4UA 3C97A 2PUFA 3KJXA 3H1EA 5FWYA 1Y1LA 2ID9A 1GLGA 2LP4Y 3A0RB 3KSMA 4JOQA 1W25A 4W5RA 2JVIA 4KMRA 4G0XA 2FTKE 3RVKA 1JYEA 1U04A 2GI4A 4H3HB 3F6CA 3O1IC 4IILA 4N03A 1EFAA 5IULC 4G0OA 1ABFA 1NXSA 1NXVA 1QO0A 2E4WA 2HQOA 1SXGA 4Z9AA 3CLKA 6CHYA 1FSPA 3QX9A 1QO0D 4G97A 5DTEA 1YMVA 2IPNA 1PNTA 4NCAA 3QLUA 1AB5A 3P9YA 1Z18A 3LUDA 2DRIA 3E61A 3LUJA 4EVRA 1JBEA 4MR7A 3URMA 3E3MA 4W5OA 3QELB 2FQYA 4HYEA 4N0PA 5BR1A 5JNVA 2WJWA 2JCGA 4MLCA 2ID7A 2R25B 1NXTA 2CHFA 3JS5A 3KHTA 4FE7A 5IUNC 3DGFC 4RY0A 4O1IA 2NUBA 5TQ0B 3CNBA 3Q7RA 5JNRA 3LUAA 3OM0A 2QU7A 3DGEC 3NHMA 5CNMA 5EWLA 1A2OA 3EAFA 4G0YA 1KMIY 2QXYA 3DLBA 1P2FA 3ROFA 5I4CA 2FMHA 4WT7A 1BAPA 4MQEA 4ETIA 4JA2A 1USIA 4RZSA 2OENG 4IMJB 2R48A 2PUBA 5IUJC 4CBVA 4KQ9A 4L4UA 4EVQA 4Q7EA 2FN8A 2MYUA 4WWHA 5IEJA 4F06A 3RVOA 2V0NA 3TB6A 3BRQA 3HM9A 4KV7A 3CG0A 3HXMA 3LUFA 4KRFA 4RDCA 4IF4A 1A04A 2L19A 3HUUA 5C5EA 1P6QA 1DJMA 4G0PA 3OMXA 3MF4A 4YWHA 1SRRA 1U0SY 3QLTA 3GT7A 4Z4CA 1M5UA 3OQNA 2VUIB 1DCKA 3FMVA 4Z9BA 2HSGA 3HUTA 4UHJA 5EWJB 2LBPA 4ZMSA 1APBA 2PE5A 1DC7A 4QICA 5TQ2A 1M2EA 2LIVA 4DN6A 4LE1A 1NXPA 1TJYA 1S8NA 3H75A 3LOPA 3H6GA 5C5CA 3L6UA 5IX8A 1QP4A 1KGSA 2FEPA 3N53A 2JK1A 2PJUA 3SNKA 3OM1A 4EYOA 3OLXA 5KQGA 4FE4A 3DBIA 1VRVA 2WB4A 1TM2A 1DC8A 4E7OA 4MQFA 3OO1A 1ABEA 4LX8A 3MA0A 2GX6A 1OXKB 1I3CA 3QLVC 3W9SA 1ZGGA 3LUKA 4KPYA 1U2QA 1NXOA 1MIHA 2WJAA 2FEWB 5GOTA 5HQJA 5JNWA 5KQMA 3CHYA 3NNDA 1B00A 2MYTA 1UDRA 2F8TA 2QSJA 3O75A 2IYNA 3S99A 3OMWA 4W5QA 3IDOA 1D5WA 3JVDA 3VNBA 4LE2A 2MSWA 4JP1A 2JBAB 4DADA 1EWTA 1U8TA 4ZJPA 3LTEA 7ABPA 9ABPA 2FVYA 3L49A 3N8IA 4F3TA 5GQSA 2OQRA 3OQOA 5DGCA 1JHZA 4Q6WA 4KK3A 1ZITA 3JVIA 5EWMB 4MS3B 4P1ZA 1OXBB 4JAVC 4IRXA 5TQJA 4XASA 3EQ2A 2JRLA 4F8JA 3QEMB 5FWXA 1ZGZA 1GCAA 4RK6A 3Q9SA 4G0MA 5KC8A 3IP5A 3KG2A 3O74A 4KK4A 1QQBA 3CTPA 5B3JC 3A10A 1MB3A 2RJNA 4UHKA 3GBVA 1Z25A 3LKVA 3Q7SA 4MRMA 1JYFA 4XLTA 3OQMA 3O1JC 4YR7A 4NV3A 1ZN2A 1XWWA 4WUTA 3RVSA 5JS1A 3C3WA 3CFYA 4YLEA 1E2BA 4N0QA 1JWLA 3HCWA 2HQBA 1ZDMA 5ED4A 5FWYB 4MR9A 1YS7A 3Q41A 4RK1A 3QX8A 2N9UA 3TMYA 3JPYA 3H5VA 3MIZA 3RVJA 1MAVA 1DCFA 3IP6A 1DBWA 2JVJA 3H5LA 1K68A 2FMFA 2F8SA 2E4YA 1DRJA 4MYRA 1YIOA 3M9WA 5TPZA 2A9QA 3IP9A 4FB4A 3KS9A 4MR8B 4KVFA 4MS4A 5DLEA 4F11A 5TPZD 3LUCA 3RVMA 4YGXB 4YS6A 1EWVA 1EWKA 1Z13A 4RK0A 3TO5A 5BQ3A 2QVCA 4XARA 1DG9A 4XAQA 1YK0A 2IDMA 2PUDA 1PEAA 4MAAA 4MR7B 3CKMA 1YMUA 3F6PA 4MLDA 4RWEA 3N6VA 5JNSA 3OLVA 1CEYA 2H3HA 4W5TA 1C0EA 3GV0A 4RK4A 1E6KA 1XHFA 1DBPA 3HS3A 5PNTA 1TLFA 3FFXA 4Z99A 5TPWA 1HEYA 4RY9A 3C6QA 1URPA 5IEBA 2B4AA 1SXIA 4RXUA 1LJLA 3LKBA 3T8YA 2NT4A 3ROTA 3NNSA 5EWLB 2PAFA 2A9OA 3O1HB 4NCBA 4H3KB 1ZESA 2IPLA 3N75A 3D8UA 3RQIA 4IMIB 3UK0A 2FQWA 4OLAA 1A0OA 3HDVA 2AYXA 1DCMA 2RJOA 4MQEB 4RSMA 4LE0A 4PICA 3QLVA 1E6MA 3CZCA 2FEKA 2KYRA 3O21A 1YTUA 2A9RA 1Z26A 5D2CA 1P6UA 3EDCA 4LZLA 2MSLA 1YK1A 1DRKA 2MSKA 1LK0A 4P98A 2JVKA 3Q15C 3I09A 3I42A 4Z4HA 5E3JA 5JS2A 4QYWA 4YP9A 2AYZA 2L2QA 1NXWA 3KCNA 3OLZA 3UKJA 1IIBA 4E7PA 2E4XA 3NNNA 4N76A 3GL9A 5CNKA 4EVSA 3K4HA 3GYBA 3GBPA 4MS1A 4OTZA 3SG0A 2NT3A 3RH0A 5EWJA 4S04A 5JNTA 3QEKA 4G0ZA 1JFVA 4YV7A 4Y9TA 4YO7A 4ZMRA 1U2PA 3H5TA 4EGSA 4G0QA 4RS3A 5B3JA 2GBPA 2FMIA 4PE5B 6ABPA 2PUEA 2CHEA 3EGCA 1P8AA 3HEBA 3KTOA 1LBHA 5CHYA 3CG4A 5KQPA 4MQFB 4HNSA 5FBHA 1JDNA 1ISRA 1RNLA 1Z16A 1D1PA 2PUCA 2FLWA 3LUHA 5BRJA 4F12A 2H0AA 1Z12A 2BGGA 2P9HA 3I5AA 2MYNA 3C3KA 4XXHA 1QMPA 4NQRA 1NXXA 3KLOA 3SM9A 1QNLA 3G1WA 1ZY2A 4G86A 3O2QB 5DKFA 2YHAA 2LPMA 1T34A 3M6MD 3T95A 3GRCA 4D6XA 2VYCA 2IOYA 5DCLA 4O5AA 4QPJC 5IBQA 1XHEA 4RK5A 3RVPA 1PUXA 4RXTA 1M2FA 5T7BA 1TVMA 1USGA 3EULA 3H5WA 1W9HA 2QW1A 2FXIA 1LJUA 1TMYA 4KZKA 4D6YA 4DQDA 4JASB 1D2AA 1JF8A 2IPAB 2QZJA 4GNRA 4EUKA 1RZRA 5FWXB 5KWSA 4KFCA 3H5IA 4GPAA 1FFWA 2IPMA 4MPTA 2PUAA 3QEMA 4ML3A 3ILYA 3HZHA 4ETMA 3K9CA 4HNQA 2VK2A 4WZZA 4TLLB 3BBLA 1FQWA 5JNUA 1CHNA 1BDIA 2I6FA 3OLYA 1NATA 2GWRA 2QR3A 3GWGA 2RGYA 4LDAA 1ISSA 1WETA 3RVLA 4RY8A 1RPJA 2VUHB 3EJWA 1NY5A 3VNAA 4YCSA 1YVUA 3LMKA 1RXIA 3RVNA 1JX6A 4MR9B 3LFTA 1VKRA 4JB0A 1Z17A 4LDZA 4N47A 4B09A 1USKA 1KRXA 5IC5A 2JB9A 2MYPA 3KKEA 2M98A 4W5NA 3SQNA 2W42A 1QP7A 2P4UA 3CRNA 4LRQA 2FLKA 5FBKA 1DZ3A 3A0UA 2J48A 3LUGA 4TMYA 5F64A 3EQZA 5HSGA 5KC9A 1QP0A 4OLBA 4ETNA 4MS4B 4OBBA 3G85A 1DP4A 1L5YA 4Z4IA 1L5ZA 2WMYA 2HPHA 2HQRA 4MR8A 3QELA 3MM4A 1K66A 5ABPA 3OO0A 2M1ZA 3B2NA 4JB2A 3FFWA 4WXMA 1PEYA 3H1GA 3IPAA
chains in the Genus database with same CATH superfamily
3JPWA 3WMXA 3KAPA 3R44A 2PRIA 4W1SA 5K0TA 1QRTA 4RKQA 5HKKD 3RJ5A 4IKPA 1Q0HA 3H6HA 5TPWB 2YJGA 2NZWA 4NK4A 5WRFA 3WMFA 3E27A 3X1MA 4Z53A 1ESCA 2DAPA 3A3YA 5BNWA 1ODLA 1L7DA 3JALB 1EK5A 5H80A 1GPLA 2JJ1A 3G8CA 4G23A 1ADBA 3AGQA 4H4EA 4DPKA 5BN3A 3MINA 4CKWA 3D9QX 3F7NA 1SU7A 5ALQA 2WT9A 3RUAA 3ZI0A 5AI4A 4OX9Y 1T43A 3NT5A 4Y6LA 1KETA 5LB4A 4FC6A 5C8ZA 1KAOA 1Z2OX 4FINA 2P6PA 4HAWA 5JJ5A 1KI3A 4AMYA 3PLRA 1L5HB 2O2HA 4EO9A 4G5FA 1ZKDA 3TX6A 1CWUA 2HWUA 1PT5A 3H16A 4IJ6A 1W48A 4D8UA 3UZUA 4RKRA 4AY5A 4TM7A 3OJCA 3FOAA 1H4SA 2JHGA 1YT5A 1IIRA 3HM2A 4FMCF 4QYMA 4ZPXA 2FWIA 1GHTA 2WFLA 4FEYA 4W9NC 1E1RD 3GLFE 5ER6A 4G85A 1THZA 1W5TA 2B34A 4ITRC 1TCBA 2CXHA 1DKUA 5H83A 3ZX5A 4QJ3A 1E6UA 3PXDA 3LVRE 3UXHA 3E82A 4Q7KA 3OZWA 2YUTA 4FNGA 1BKDR 2R44A 4ZI3A 3AVXA 3HNOA 4FQ8A 1GYQA 4O1HA 1XU4A 4Q19A 4XQCA 2HFKA 3OUUA 4R1TA 5EXSA 1AHHA 3CPSA 4QTZA 4RE5A 3SQXA 3A3KA 3H2ZA 1JL3A 3L18A 2HWKA 2YJ6A 3NBUA 1F48A 2JJ8A 1NNI1 4HAIA 3LY5A 4LW8A 1K8QA 4RA6B 1DSSG 1F1JA 2O6HA 1R16A 2IP1A 4A6XA 5BR4A 2FQXA 4DMRA 5L4LA 5E2BA 3DMTA 3I01M 3HBNA 2YWDA 3RPEA 4KE9A 4RPGA 1CZKA 1O89A 3K72B 5FTJA 3GPIA 2H1IA 3MOGA 1U1IA 2UZ4A 5L53A 1SVLA 2VEDA 1IK4A 3K5IA 2CCGA 4MMYB 4RV5A 3EZYA 2EGHA 5LU8A 4IVPA 1N5JA 1ZK0A 4KE8A 1TZMA 4FU0A 4MGEA 2PKWA 2JCBA 2KJQA 3EXFA 1RXYA 5MFPA 4ZK6A 1A9YA 3VJKA 1J8YF 1OB2A 1UKYA 2IGTA 4AI6A 1FNNA 3DHVA 1KJZA 1EMDA 1FPMA 4L7QA 4V0RA 1PEDA 4ZYZA 2CT8A 5FJIA 1OFTA 4LGVA 3R5JA 1NF9A 4URZR 3TFWA 3FNIA 3ULKA 4UTRA 2XYGA 3H04A 1EE9A 4D74A 3AL3A 3PNQA 3UIEA 3EODA 3TM5A 1RFGE 1XQ1A 1YO6A 2G0TA 1XVVA 1Y5MA 2WWXA 4KN9S 3V8PA 3C3MA 2LW7A 2CCKA 1JQDA 2FR1A 2EDCA 3BHMA 4NFYA 3L01A 1TMKA 2J4DA 3I3SR 3W0LB 1RKUA 4G0NA 1NUHA 2CLKB 1KEUA 1PEKE 5A7FA 5AUOB 5B36A 3DFIA 3KYJB 1FP4A 3PNMA 4ENTA 1I14A 3GJXC 4PZ9A 2OYCA 1U4NA 4CQLA 3LP5A 4BLRA 1ACJA 1LTHR 1L6IA 5JY6A 5AJHA 3HFRA 3LC1O 2W11A 3QW2A 3H19A 1FQOA 4CF4A 2NPIA 2QXUA 3CH4B 3W3AA 5AHWA 3PHIA 3VR6D 5IMSA 3ZV6A 2P4QA 2E4UA 3F2VA 2ZBQA 1TGVA 3WV4A 3T9CA 3VV2A 1I30A 2R79A 3I9V1 3GAZA 4I2NA 2PXXA 2C04A 1WKVA 4MKZA 1SBZA 2PSFA 4W5RA 2JVIA 1ZUD1 4V0ME 1X8LA 3EXG2 4C08A 2OV2A 5I01A 2PGOA 1JAHA 2G3YA 4HCJA 2MSEB 2HQOA 1NXVA 2O9JA 5DMHA 3WZ2A 2VBCA 1Q57A 4DLWA 1FU7A 2D0PB 5C3MA 1VIMA 3L79A 4QVKA 2TMGA 5CLIA 4GMGA 1ODIA 1PNTA 3ITEA 4KSCA 2ZTUA 4MV9A 2PSHA 2C88A 5KBYA 4M83A 5DRYA 2NLOA 4LWOA 5TQVA 3CEAA 3WZMA 1HDOA 3O8LA 1J00A 3ONDA 5DNDA 5E2IA 7MHTA 1YCGA 4N6OA 1QIMA 3TPCA 3PGMA 3EMBA 5CG2A 3K9BA 2VQEB 4GLOA 3BMNB 1GRRA 4PBSA 4OB6A 1JLLA 1BDBA 1C30A 3DYIA 2OK8A 3H2SA 3KT3A 5ARDA 1C1DA 2G9QA 5FHQA 2VF8A 3TJZA 4JJZA 3PUYA 2FSSA 1I5RA 4JKYA 2ZYRA 3PJEA 2A30A 5GGXA 3X1JA 2GTIA 2GCOA 3LVQE 1A2OA 3OECA 3D31A 4ZJUA 1X39A 5M7EA 3L06A 4KWCA 6GPBA 2AQIA 4BLTA 5I7HA 3DL0A 3A6KA 4CFYA 1R4MA 1PR1A 3VFDA 2IOQA 1W76A 2G4LA 3TLAA 3MYRA 4KQ6A 3NB0A 4B76A 1MQ9A 3S2GA 2XNSA 1T1JA 2AG8A 4YRAA 2ICAA 1QHIA 1PSWA 3MT0A 3GRRA 1G64A 4IZ6A 3ZXYA 1E2QA 3LIIA 2V0NA 2LVBA 2I91A 1ZOOA 1UFOA 4RNCA 3BOSA 5ICSA 3VNUA 3NWOA 2VDJA 2CK3D 1P7VA 3AKDA 4KWEA 3EFBA 3AM4A 2Y1LA 4RVCA 3PNPA 4IH4A 1ZISA 3R24A 3H2HA 1OFIA 1PUIA 2PCJA 2OWEA 4LXQA 2FSUA 3UEOA 2IUFA 2WJ6A 4QOEA 3BK7A 2ZIXA 5IH7A 4R6WA 3TKAA 6AT1A 3OE1A 4RELA 1CHDA 3SVLA 1GSIA 4Q9AA 1Y34E 3I53A 1STOA 1KH1A 4PYIA 3ONFA 4UVGA 1CDDA 2AJ8A 3WL6A 1CY7A 4WXRA 1ETHA 4OI1A 4CKXA 2ADMA 1UDBA 4HZUB 2Z98A 4JSTA 4HYQA 4ZT4A 3RKRA 4DUGA 2BGKA 1Z73A 4HQKA 5ESDA 5KNDD 1W6UA 1UWKA 2OXFA 2OHFA 2X19A 1TW3A 1QAQA 4Q4AA 2XWJI 1KQ3A 3GN1A 4DMKA 4MQFA 3R7SA 3CX8A 3NAZA 4IWXA 1BMFA 1VE7A 2R2AA 4OLHA 1QE0A 1QOPB 4UTVA 3DTVD 3QLVC 1YS9A 2JAQA 1F6BA 4TXMA 3VU8A 3D0KA 1U2QA 3RHTA 5JE8A 2C9MA 1SN7A 4RTMA 3GRAA 1GNVA 1DFHA 1RYFA 2QN7A 1QE3A 2BBWA 2R2GA 1HQCA 3LPNA 3K1ZA 1X2BA 4WK0B 4YJGA 3RGWS 5KOYA 1DX9A 5GP1A 1A9XA 1C80A 3DMNA 1Y6FA 2R96A 2BHRA 3IAHA 2IYNA 1X13A 4KU4A 3MT8A 5ALRA 1VHTA 4GZ3A 2VDRB 2Z8YA 1DPFA 5CR9A 1KU0A 1PJQA 1UFVA 1HLFA 2NNLD 5EP2A 3S2FA 1NG9A 2CD9A 5C8YA 1S96A 1P1RA 2B25A 3UFXA 3V34A 5IXYA 1UIRA 2WJ3A 2EJWA 4Z7OB 5EIFA 1NW4A 1UPAA 1WU7A 2ZJFA 3EASA 2KE5A 3E1KA 4OREX 1SCQA 3JQAD 5ALYA 3ESZA 1N25A 4JU8A 4C05A 2WTEA 2FOIA 1CLUA 1UBJS 4MUXA 4CCAA 4QYIA 3TUZC 1C81A 4JP8A 2LKCA 1P4RA 4BB0A 2M32A 3N0TA 5IPFA 3VNVA 3PYLA 1ILWA 3HUDA 1ID1A 1WRBA 2ZI3A 3VDRA 2HTEA 5IDXA 3GFBA 4P92A 4Q48A 2ZITA 1N1MA 2JJ2D 2TS1A 1N5LA 1V5IA 2FSIA 2YC4C 1P0PA 4MUBA 1VSUA 2ECPA 2ACEA 5DBEX 2IYOA 3VVMA 2IP4A 3CFYA 3OHPA 2GPWA 3ZU2A 4ZGGA 1KAQA 3ZYZA 3J81k 1DX6A 4ZDKA 3UYLA 3UK1A 1ODFA 5AM2A 5BYKA 5JSHA 2VP2A 1E2FA 2A5FA 1C3LA 3FOEC 3KD2A 1PFQA 3D8SA 3AESA 4MV5A 3L4KA 3LBNA 1Z06A 3TGPA 3C3PA 1EIWA 4LJLA 4B85A 1NR5A 3GDGA 1D0VA 4EGJA 1HYBA 4AZ3B 1CY4A 4DLRA 1T24A 1ZAKA 1W96A 4HLDA 3JAWA 2VKQA 4KZPA 1DRJA 1Z6PA 2HQSA 1JG7A 1MJGA 2XYQA 1T8PA 3Q5EA 4QJIA 1EESA 3UICA 4AS3A 4GMDA 2ZYWX 4KN6A 4S2EA 1YUNA 1WWKA 2A78A 4MR8B 1DKNA 4Y2HA 1YS4A 1LBTA 4LJ9A 1XG5A 1P4HA 4JJAA 3ZHSA 2ZSJA 2C97A 5EJ2A 1I2BA 1I36A 4F0JA 5I3ZA 3E2PA 4I1OA 5BN4B 1OA1A 5ITSA 1NFRA 1U2DA 1OX4B 1Z47A 5J2TA 3H8VA 4B6PA 1R6TA 4L51A 4IIJF 4KI0A 1E6KA 1RE0A 2B36A 2WPDA 4RX1A 4WIAA 3IKTA 3C14C 3NYQA 4C76A 1TYZA 1R10A 5JATA 2WIDA 5F98A 2VVTA 1XHLA 2XE6A 3ENZA 4J7CA 2FZWA 4CKYA 2A2ZA 2ESRA 2VHWA 3DE5X 3R7LA 3T8YA 1DLJA 3NNSA 5EIEA 1YFJA 1K9SA 1U3TA 4LMPA 4NQZA 5F1YA 5F52A 3EC1A 4X20B 4I8XA 2BWJA 1A1SA 1CETA 3TFQA 5BO5A 2H9IA 3HDTA 1VMDA 2XUKA 1SCBA 1W4CA 1ECJA 2O23A 2X1VA 2CLMB 5DHRA 3HV0A 1I5EA 4TT8A 1QG4A 4ZQHA 2DR3A 3R3VA 4JI5B 4C4OA 2ZDHA 5L9AA 2P6NA 3O0DA 4LXYA 2OT3B 3B1KA 3CJTA 4RJIA 2AOVA 2V7GA 1LS6A 3NC1C 4JS0A 3WP1B 3LYLA 3ZDZB 4BV2A 1W36C 1CEQA 2WG0A 1T8TA 1H9BA 2C98A 4D97A 3D7KA 4P98A 5H3LA 2JFHA 3W06A 3QYFA 1THGA 3Q15C 4UTZA 4ARVA 1JKJA 1J6UA 3ROEA 2WU1A 5C51B 1BN6A 1SUWA 2OC9A 3AI2A 1WOYA 5KYYA 2W2TA 4B47A 3UKJA 3LXRA 4KLCA 1GILA 3WMRA 4WZBA 4U00A 2CLLB 1V9LA 3WGKA 3ZH2A 3TZKA 1E4OA 1IATA 3W1WA 3W5AA 1D2GA 2DR2A 3UAOA 1BNCA 3EZFA 2O2CA 1FMJA 4BVBA 2KLHA 3Q9NA 3GLIB 3FYCA 4E12A 4X95A 3HJNA 3RHZA 2PD3A 4XW2A 4CKBB 4J9VA 4MVJA 2GFHA 5LA6A 2JFGA 3CV3A 3DP9A 2NVWA 1AC5A 1YQEA 3ABRB 4NV0A 5B3JA 5ELLA 2BI4A 2BEVA 1LDMA 4ENWA 1U3GA 4W4TA 3P45A 4BJ6A 3HB1A 4G6ZA 3VNRA 3UV6A 3SZLA 1Q20A 2ZIAA 3T0FA 4EAAA 4TXNA 3A6JA 1U31A 1BMQA 1NDHA 1H9AA 2X4LA 3PCXA 1U8XX 4Q02A 3T0IA 4CFZA 4NWIA 2JFFA 4MVJP 1V6CA 4BB6A 1AU9A 3OURA 5C7LO 4HPXB 2AWNA 4DARA 5BQ5A 2PTGA 2W70A 1K3TA 3TAXA 3U7GA 1T3ZA 3O2QB 1W29A 3LHSA 3AF0A 3L40A 1Z8DA 3MT9A 3T95A 1BHQ1 2PH5A 4QDOA 1UM9A 2IOYA 4ZEVA 3BXHA 2IXBA 2QVYX 3DM9B 4QPJC 5LZ2A 1GTZA 5EIWA 4K9PA 1E5DA 2ZQYA 3BB4A 3DZHA 3ZXIA 4LI0A 2CUTA 5EZQA 1TK9A 4XJTA 3EULA 3DNPA 4RLHA 3SEZA 4FZJA 4XOUA 1NUUA 2QRZA 3MPUA 4KZKA 4C0XA 1SD1A 2DTXA 1Y9DA 5C18A 3UCEA 4C6HA 4LC1A 3G7UA 1WCV1 1RZRA 4D26A 3M49A 2DPHA 1FFWA 2J8ZA 3UCXA 2OCGA 4IDCA 4II7A 1QR2A 4ML3A 5EMJA 2TECE 2IGBA 4GC9A 4X8HA 3KR0A 1DE0A 4IINA 3SF8A 3BZBA 3HP4A 3GZNB 3AMVA 4BVGA 3EGXA 4RMHA 1U3UA 2VK1A 2BF7A 3CRMA 5LIRA 4NTZA 1XTSA 3H9QA 5A4MS 2BSQA 2IXDA 1LD3A 1HFKA 1SHLA 3F9RA 2BM9A 1HXHA 2OWDA 5CTJA 3AO0B 2OXIA 3U2QA 2JBHA 1QONA 4ZT2A 4ZHQF 4MRNA 1AQNA 1JBQA 2J41A 5FPKA 2Z58A 3CLUC 5J47A 5ERGB 3IFSA 1ZUNA 4KHPB 1C1XB 3TRJA 3K30A 1N1DA 3PYMA 4JEIA 3RSHA 4W5NA 3M5CA 5B3KA 5GMOA 1XCMA 3D6UA 1M9NA 3IIKA 4XWYA 5CDSA 5L51A 2PKQO 3G3EA 1JEQB 2JIOA 3EQZA 3DB2A 3DPUA 3CUEF 4GEKA 1DP4A 1G3IA 4R2JA 2IBSA 2EFYA 4NDAA 4JUDX 1J8VA 1IDOA 2VWHA 4FYYA 3QKWA 3E05A 3QVVA 4Q4LA 4DLNA 1Q0ZA 3BPSA 7ADHA 3OE7A 4M1SA 3KQUA 1RRVA 2A5YB 4P82A 4CM9D 1XNGA 4F5WA 1O5IA 1BE1A 4CEJA 1DGQA 2ZVQX 1N6HA 2B4QA 3A6EA 5F76A 1L7BA 5K0FA 3RAPR 3WNQA 1UJ2A 4P31A 5AI6A 3ID6C 4Z4FA 1MO3A 2EAUA 3DCNA 2BZ1A 1CIPA 2EP7A 4KNVA 4EY8A 1XMPA 1JMKC 1IBRA 3B9RA 3RUIA 4HAXA 2YWRA 4R7TA 2QVBA 3NYIA 1GG8A 5FT9A 4Y7DA 3AIIA 4Q34A 1OFUA 1G6OA 1QU2A 3IQXA 2Z2JA 4G1MB 4QE3A 2WHXA 3IUYA 3WWDA 3R2JA 1UT6A 3VYSB 2DCMA 2DMRA 3ZY6A 1EK1A 2PUGA 3H9GA 1ZJ6A 2H85A 1RE1A 1NLZA 3S2IA 3NEJA 1IUNA 3NKLA 2H9AA 4F4HA 1M6WA 1OILA 5K5EA 1X3SA 3QPAA 4L15A 2O8NA 3DXZA 1GTJ1 2PUHA 3KPWA 1LV7A 3PSAA 5JDIA 4PWZA 1L4BA 3ACDA 3JYHA 3LY7A 1JTFA 1TZ2A 3BDVA 3R0JA 3PHBE 4HQ0A 2VBIA 4DQKA 2GBLC 3FFTA 4DWVA 1ZU5A 3TLKA 4P84A 3Q9UA 2NO4A 4ZEOA 3WL8A 1IVNA 3D8NA 5C1BA 4XCQA 5HF9A 3WDSA 4TTVA 1WVGA 1L4KA 1YVDA 2Y1FA 3L4EA 3ZC3A 2XVMA 5BOSB 3F4KA 2ZWMA 2CJPA 4HDNA 3WLMA 1Z15A 4RVSA 5DOVA 1IHOA 4E30A 5JAOA 2QU8A 3U49A 1G20B 1ANKA 4YFYA 1KZGB 4MPDA 2CVZA 3P9SA 4M9CA 2GBFA 3WLRA 2B8JA 1IJFA 3VGPA 1I6LA 3OJXA 1GCUA 4R0VA 2IU6A 3SY8A 3AY6A 3W4KA 1R0BA 4MGIR 2JD1A 4BQIA 2GK6A 1OE0A 1T36B 1W581 2AE2A 4MVJH 2RGEA 1NP6A 1LJ8A 1UBCA 5B6PA 4PQFA 4L07A 2XMBA 3QOXA 5EEGA 3ZK7A 1JHMA 1YS6A 4IIDA 4C0JA 2ATVA 2MR6A 4GLLA 2BFDA 4CM4A 5HVNA 3X1YA 2P2LA 1BU8A 1NX6A 2YZGA 4PG4A 1ADJA 1LPPA 2H1CA 5M2QA 2A5JA 5D5HA 2FPPA 1T2EA 4IFEA 3NDRA 4R68A 1F51E 1M75A 2ZRJA 2UVQA 2H5LA 2DOKA 3H5AA 3ILHA 4Z3KA 3ZHCA 5IDQA 3BQMB 5AK6A 1EKXA 1SKAA 3W79A 4FVTA 4EFKA 1QRSA 2INGX 3V8VA 4UU1A 4EMTA 2UVPA 4DXDA 3AWIA 3BXZA 3DF9A 1EK6A 2XMDA 3PPYA 1LLCA 4KXYA 4IHQA 5KTPA 3H86A 3TM4A 2WZCA 5T4FA 4V0MA 4DRXB 1QCYA 4JJIA 4KE7A 3V3TA 1WB6A 1GN8A 1CJUC 3PC2A 4X60A 5L3SB 4F1KA 3I1JA 2Z5GA 3V1UA 4KO1S 1T9BA 2QAGA 5TGDA 1KRWA 4O2AA 3H0EA 1PJSA 1UOOA 3JQEA 1MA3A 1O8BA 4MRMB 2ATXA 3GT0A 2RKWA 5KSZA 2NQTA 4A26A 3BK2A 2ACVA 1YUMA 3NXSA 4FYVA 4H31A 4HS4A 4WNYA 2WTXA 4XDHA 5FOSA 3T38A 5KSYA 1EHCA 1KY4A 2A0KA 3CNQS 3OX4A 1SUCA 2ZCVA 1ETUA 5T8KA 1TW2A 4XPZA 5HM6A 3R5XA 3G7NA 4IX1A 5DT2A 1NJSA 3EPHA 1BMDA 2VOEA 3K09C 4YCAA 3EG9B 3U7JA 4BPRA 2VP6A 4EPTA 5JAPA 1ZGAA 4MVXA 2E48A 3HKCA 5JAUA 2I2DA 4ZT6A 4A15A 1KERA 3R0VA 5JJIA 3OA0A 3FHOA 3DLAA 1XCPA 4XCXA 2CXQA 2WAYA 3PFNA 1GU7A 1NW9B 4IILA 4JOBA 4UNSA 4F3NA 1X8JA 2HJWA 3ZDDA 1YCDA 3ZV4A 4JYZA 3GLUA 3AHGA 3CLRC 4IJUA 4QUBA 1KPIA 5AKZA 2AVDA 1OBOA 1ONOA 1QO0D 2IOHA 3EH1A 3GEGA 3QX9A 4G97A 4P8RA 4AKEA 3THWA 2JGJA 3AKEA 2Q3FA 2R9VA 2E85A 2ZSIA 4QULA 4BMCA 4G4JA 3LW8A 1GPDG 1XA4A 5ECYA 1CK4A 1E1MA 5TGTA 3I2IA 3R7WB 2YXEA 4PXYA 1ODSA 1JBEA 4AX4A 3THOA 3RU7A 1YZUA 3L93A 5IDYA 1N2CE 1W35A 4YWJA 1UPFA 2YJ3A 1HZZC 4CL0A 4LVUA 2ZRNA 2F59A 2R8RA 4FHZA 5F21A 4DCUA 5LYJA 4IAOA 1BO6A 2F3RA 3GJZA 3ZDEA 1I3LA 2X4DA 1M0TA 2IIPA 4OA8A 5DTJA 4EX6A 4PO1A 4UCXA 4Q7LA 2A57A 2JJ1D 2XKJE 2RKBA 4YJKA 3A6LA 3VHLB 3WDMA 5IJWA 3PQDA 3A2LA 2YNMA 4D0SA 3LE8A 4L1KA 4RTOA 5AXAA 2AG6A 2Q28A 1PLJA 1P2FA 1LEHA 2AWOA 1VOTA 2GCPA 1DOHA 2W2LA 3CE9A 3JALA 3ROFA 4EI2A 2WQ7A 3MHTA 1SG0A 2Y0PA 2FPSA 3CRW1 3NV9A 3OQVA 1NVXQ 3KEOA 4BIIA 2ZRKA 1O97C 5E7JA 1IPEA 5DISB 2BFAA 1CC1S 3DMYA 3R75A 1NLYA 2HXYA 1B2LA 4TRNA 1FW6A 4ERNA 4YP0A 1EWYA 1KI6B 2ZT5A 3HRKA 3M6IA 4WWHA 4DM3A 5E9QA 3ZWMA 2VAPA 2HU5A 4FFBB 5DW3A 5JY1A 5LBUA 1U65A 5LNK6 1QC5B 3FWZA 3NBYC 2RAFA 2ZAOA 3ASYA 3ILXA 2P40A 1PGOA 2WR8A 3CJRA 3IESA 1QGAA 2CKMA 2I3DA 3FPCA 1K7CA 4G0PA 1J5EB 1HLGA 1LPNA 1T6ZA 4N7JA 3C5HA 3W34A 1KJWA 3WQQA 3B70A 2V4UA 2VHQA 4R40A 1D1TA 1LV8A 5DZSA 3K71B 4ZVMA 3HDHA 1CRQA 2QQGA 1RP7A 3RK0A 3TK1A 4F38A 2LIVA 2HLHA 1KHTA 2WW8A 3GLRA 2FDCA 1DDIA 1NXPA 1TJYA 2H18A 2D2IA 2XQFA 3LK7A 4MTLA 3MJRA 3MERA 5AVUA 5ER9A 5HS6A 2Z3VA 3JD4A 5HMMA 4QUIA 4UFNA 2NU8A 4OXIA 3RFTA 4ENQA 4UFPA 3HJGA 5B57C 2WJVA 2ARKA 2ZLBA 3DBIA 4J0KA 1V1MB 1RXUA 3FUCA 4CLOB 1TTHA 4DSUA 3WSVA 4E5UA 2UXDB 2GXQA 4KX5A 1IBCA 4WKBA 4AZTA 4C0WA 4DEXA 3ACBA 2DPMA 2Q29A 4S1OA 4ECEA 1SCUA 4F46A 4MYTA 5SY9A 3E22A 1IJKA 1I3CA 2PO7A 3I04A 2F8LA 2RCNA 1WUKS 3L8EA 4IKEA 4KMMA 2B6NA 2PYIA 2XB6A 3EWAA 4PPNA 4EMUA 4KITB 3R7AA 4J29A 4ARZB 4IHAA 4E4YA 3T5PA 1X7DA 4PAGA 2F8TA 2JARA 2XVYA 4D9NA 3GEIA 1E32A 4DF3A 4ZAFA 1GQOA 5KPJA 2GQ0A 5DTMA 4KGDA 3WGHA 2IX3A 1G20E 4OHYA 4B3GA 3UT6A 1J42A 2EBFX 2OILA 3GAMA 3PDIB 1AXGA 4GKVA 5F4ZA 2HDWA 4BL5A 2OKCA 1U0BB 1TQDA 2G82A 1BCRB 1K4YA 2VWQA 3JVIA 3RLFA 3SJZA 1IJBA 2W9XA 4OK5A 3KUUA 1Z4LA 3RC2A 4KGVA 3MD9A 3CKLA 2R1VB 1RABA 2E49A 3KT6A 3BZWA 4H08A 1NVTA 2HJSA 2P9BA 4EKDA 5IM4F 3C3DA 3GDWA 1SUAA 3JQGA 4EUEA 2OBLA 2IYZA 1L5LA 3PF8A 4FWBA 3QPDA 3N2YA 4LKRA 1JKFA 1PWZA 3AEQA 1NUTA 2BFFA 4KQJA 4ZAGA 2Y0DA 1GGVA 4M7OA 5LXTF 3DMTC 3T99A 1NFQA 4B9AA 4MV0A 3W8RA 3O4JA 4EGFA 1BSVA 2ZI6A 1G63A 4LRXA 2YVAA 4I7EA 1GTMA 2Q9CA 1W4AA 1N36B 1M7GA 821PA 2IXGA 3M33A 1OGIA 3RS3A 2QLBA 4ISCA 3UWKA 2HW8A 2J6CA 4X8MA 2IIVA 3NC0C 3RTBA 4BGEA 2N9UA 3T34A 1UFKA 4J8PA 1ML4A 2NPFA 3RVJA 4E46A 3WIUA 4U2DA 3IP6A 1MMFB 2F1IA 1BN7A 1H93A 1UJNA 2NZ2A 1P1KA 3O0TA 3OM8A 3QVWA 4ZQIA 2HMAA 3U6BA 2BGNA 5FPSA 4ESEA 5DNUA 4HNUA 1DNPA 3MLAA 4R54A 5C2JB 3O82A 1KY2A 3QXCA 4KUEA 4R2MA 4DMLA 2C1EA 3PQ3A 2PVSA 1XP8A 5CT8A 4LJRA 3QFFA 3QFSA 4PYKA 1NASA 2PD6A 4G4IA 3WQBA 3TO5A 4ALKA 2X0RA 5EERA 3M5PA 5AWFC 1KEPA 2JEYA 4TUYA 3TPZA 2FHPA 2ALJA 3TZBA 5LD2C 2IYPA 1K63A 5DT9A 1JZSA 3E84A 2ASEA 4TKVA 1IC6A 4ARAA 1NF2A 2VJDA 4D9GA 1KFCB 3ZTYA 3IE0A 2X0JA 3SVTA 2V6FA 3HS3A 3AGPA 3MB8A 3EFEA 3F3MA 2X3FA 4ZVOA 1I2CA 3C6QA 3NH9A 3T1VA 2XD9A 3UMVA 3WGMA 2ZWVA 3EC7A 3NS7A 4WLFA 2YWFA 4ZCLA 1J2JA 1Y9EA 4MAMA 4O4HF 3VM6A 3SOZA 2ZJ3A 4YYEA 4B7UA 4NX2A 1PK9A 4URWR 1EVIA 5EPEA 1WUJS 2QK4A 4ZVTA 4UDNA 2PG3A 3UKOA 3CSDA 2IUSA 5CEEA 1I0IA 2AIRA 2V6GA 3FPJA 3GHYA 3AL2A 4GO1A 1MOZA 3F2IA 1TEZA 3FNFA 1A5AB 5T4BA 5KCZA 2Q1XA 4XSVA 2G76A 2VHYA 1O94A 1YTLA 1SXJC 2X2OA 2ZYAA 3DO8A 4DPLA 4JKIA 4EQZA 5I9LA 3TZLA 1P2UA 2IYFA 4J1NA 3W5CA 4OQZA 3MGKA 2C00A 4NATA 5B58C 1JT2A 1O1YA 2BZGA 3HBLA 2KYRA 4RFSA 1XSEA 3OD1A 3DMDA 4X1KB 4DV3B 1YTUA 3E70C 3IOEA 3EVNA 2ISQA 4KWTA 3TQHA 2PY6A 1H1TA 1S8FA 1E6EA 1GUAA 1TAQA 2VPYA 1JWAB 2B99A 3VHQA 3R8CA 4CT4B 2OR3A 3NTOA 4PSVA 2HMYB 2ZIVB 3H3JA 1Y4AE 2O0KA 3NR2A 4ER7A 2KLBA 5DM60 5EEHA 2GM3A 5F7OA 5K05A 3M83A 2ZRFA 1F0PA 1ONPA 3JQPA 3NAQA 1NYLA 1WPXA 2H63A 2QE6A 1M2VA 1V2HE 1WB4A 1WXWA 2DFLA 4XSGA 8ATCA 3ILSA 4N40A 3ADPA 4NBUA 3ZD7A 4FUQA 3AHIA 3TCNA 1AH2A 1NI4B 2QG4A 4MS1A 4GICA 4Y2SA 5JYBA 3FZQA 2XODA 3CLHA 2Q21A 1KQFA 4DUGD 4YV7A 4HDRB 2UUOA 5JJBA 1YZLA 4RTSA 3WIDA 1USWA 4GRIA 4RS3A 4GP7A 1T6BY 4Y1FA 1IVYA 4RDHA 1BMFD 1TYBE 2PUEA 4OV6B 2CHEA 1I51A 2LDBA 1GLVA 3OZRA 3DL7A 4ONEA 4DCCA 1TCAA 4ND8A 3J81A 1ISRA 4UARA 5DK6A 3EIWA 5FYDA 3FMPB 4D5GA 4K6HA 1CYDA 5IYZF 4AMUA 2P5UA 4F56A 2QUKA 4TOIA 4I46A 1SEVA 2GLTA 3RYIA 2W2PA 3EUFA 5KYWB 2RHTA 1O7JA 6PFKA 2G1AA 3OCWA 1E4YA 4NENA 2XTJA 4HBZA 5GJWC 4CIXA 4A8HA 5CITA 3SICE 1VIYA 1TB4A 3GIWA 5DKFA 2Q5EA 2C2XA 2I7CA 2HYIC 2D3TA 1BE6A 1N6IA 1TF5A 1VPTA 1U7UA 2G5CA 5DCLA 1NR7A 1AKRA 3VR2D 2KQUA 1P91A 1OHHA 4RXTA 3RYCA 4EB3A 3O9ZA 1VXRA 4EHKA 1WQ1R 2UAGA 2BSAA 2W4QA 4G1UC 1J2RA 1Y1PA 3LQKA 4U7WA 4YQEA 3VPFA 2HI0A 3ZE0B 4EEZA 4Q03A 4QO7A 1KY3A 1ISPA 4WOJA 5FTKA 4RJTA 3KTFA 1FP1D 1N5OX 2BMFA 3Q4GA 1ULTA 4GPAA 1E59A 4EUHA 3L7MA 4MGZR 5A3VA 5FUYA 4IOKA 4I2VA 2IF2A 1KVRA 1FX1A 4DC9A 1U11A 1RR6A 3VR3A 1RHJA 2AF4C 4INZA 4IV0A 3DDNA 4L9WA 4OXXA 1CJSA 1NP3A 1D2EA 1JIXA 5GAJA 3V2HA 2X1HA 4FTWA 4X1IB 3WJ2A 4C6SA 5H1YA 4EKIA 3TB4A 4W5JA 4ZVPA 3DKIA 2HBZA 3LL7A 4I9HA 5DFAA 1LC0A 1RPNA 4BP9A 1CD5A 3VNAA 5C52B 1F4PA 3K9WA 3QITA 3NASA 4V03A 4DJFC 3FZYA 2JGRA 2P9QA 2YVKA 2LXNA 3RVNA 4UVEA 1Q7RA 3LFTA 2WU3A 2IW3A 2AGVA 2RIRA 3KJQA 4L0CA 2REQA 1F6WA 1QZZA 1X14A 3Q7IA 4PFQA 3MMXA 2EZ9A 5AJUA 5K0NA 4B7XA 3M4NA 4KV9A 1V47A 3AI3A 2HNKA 2W42A 3AV3A 3IVGA 5DK4A 1RCFA 1Z0IA 3SYKA 3SE0A 4UM5A 5THKA 3NGXA 1UQUA 1L5ZA 1NN0A 3EG5A 5JH7A 3BTVA 3KU4A 1C9JA 4MR8A 3G9ZA 3A6ZA 2HWXA 2M1ZA 3B2NA 3WL3A 4E6PA 2AF3C 3JQFC 1SBQA 3T4EA 1KJYA 4W5WA 5EMHA 3E3AA 5HF6A 1P9RA 3UYKA 5BN4A 3H1GA 1P0FA 1T3SA 2PL3A 1E9AA 2NVUA 2HAEA 2IHJA 3OAAA 3OWOA 4Q1FA 1J1UA 1YJXA 4JX9A 1CUHA 1OX4A 1P17A 1WOMA 1II8B 2P2ZA 3V00A 3SZGA 4WSOA 3PQ6A 1H0HA 4LJ4A 1G18A 2C1XA 3V2UA 3WADA 1ZVMA 4B8ZA 1IRXA 3G23A 1UH5A 2SBTA 1WHTB 1L5NA 5FBWB 1GL9B 2C9OA 2DWPA 2ZIGA 4RC9A 1WZ2A 3A7DA 4NNJA 2R00C 5CCXA 4LWZA 4X3CA 1T8YA 4PYRA 4WK6A 3ROGA 5B4TA 3FZGA 3B82A 5ALZA 3S29A 2IDJA 4GBGA 4BKMA 3D8BA 2HDHA 5A6SB 2FWAA 3QFTA 1N57A 4R6XA 4ZEXA 4DIDA 5M5BA 3KPYA 1E94E 2HIGA 3I1FA 5FHRA 4RGYA 2OBBA 3SDSA 3ZDXB 4AUMA 2IHBA 2VAVA 1WUTA 3RJTA 1ZD9A 3L6RA 1S4MA 2CMHA 2ODPA 4RD2A 4Z1OA 4QAQA 2ZULA 2PRYA 1KZ4A 4RXMA 1EG2A 1VKZA 1DOZA 3L02A 4H7PA 1MG5A 4JXKA 3V7YA 2V7PA 5AI0A 4FFSA 1CYEA 4CZ2A 4PYMA 5AM3A 5TMDA 1RJ9B 2QB5A 4PR3A 3BM5A 1N3LA 3M6VA 1JHDA 3RCBA 1ECPA 2BFBB 3RC3A 3S40A 3W2FA 1SBYA 4QUKA 3ZCTA 4MVJD 3PNBA 3U7EB 1TU4A 1GAEO 1K6JA 1RWBA 2QLTA 1BDHA 4TQGA 3K6KA 3OCXA 3GLHA 2L17A 1H2RS 3ZY5A 4JVSB 5AOVA 2JLUA 3PX7A 3K31A 2O20A 2YQ4A 2YMMA 2VLBA 4PX9A 4BC1A 5LM3A 5LQMA 4L85A 2YZNA 2GJ4A 3GPBA 2OLJA 3WLNA 3PU6A 1WE2A 3AG5A 4J90A 1SD5A 1PGQA 4Q66C 2H52A 2ZJBA 4Q93A 6ADHA 1OIWA 4LWQA 2GKGA 4GLFA 4AZSA 2YRWA 5K8IA 2F3TA 2G17A 1XCBA 3WGZA 1T3GA 1ZNZA 1R8QA 1GG2A 1GNRA 2ZJZA 4MB6A 1Z22A 2IF0A 4LS3A 4NZZA 1DG1G 4AYTA 4P5PA 1FDVA 4CIWA 2PLNA 4Q3LA 3AVPA 5JQGF 1SQ6A 5GZ6A 1TFUA 3WGLA 3RSQA 3G1UA 2Z8YM 3NOVA 1K5HA 1NRXA 2I55A 4GPEA 2W7TA 4LA4A 4D8WA 4XEHA 2UYOA 2HRCA 2WRZA 4PEVA 5F33A 2DPYA 2FKAA 3O8OB 4EARA 4IJMA 3ZOZA 4KR3A 3GZTB 3KZMA 1GUBA 2QVXX 3OESA 4IGAA 4KXUA 1Z6GA 4PGAA 4XFJA 3RIYA 4YCCA 3QK7A 2PPVA 2RG1A 1RZRD 4Q05A 1LZKA 1PT9A 4LYDA 4ZTBA 3KSRA 3SAJA 3VAAA 4IJWA 2GVZC 3C7DB 3G9UA 4MINA 3NORA 5LZ7A 1S4QA 2HX1A 2DFNA 2GEFA 5AKKA 1JKIA 2Y8EA 1UCFA 3OOEA 1EUDB 2I6GA 1ZXLA 2HLPA 3VMMA 4IO0A 3OZDA 4OJKA 4EP1A 4A8PA 1AY0A 16PKA 2ZPAA 1E60A 3W3ZB 4RVNA 4DNXA 3GZNA 3QJ5A 3DOHA 4XLLA 1JPVA 4XVCA 7GPBA 1N2CA 3EF0A 1VLZA 4AYXA 2Y1EA 2ZJ2A 3HWX1 3C97A 4HB4A 4PO8A 2AJBA 3AUKA 3FYTA 1F14A 3TN7A 5IRCD 4GI1A 5T3UA 1B8VA 4Y9UA 1QBGA 2BJVA 4WV3A 5LZ9A 2BTEA 3LFHA 1DKRA 3CTMA 1AXRA 4H3HB 5EZ5A 1H65A 4DABA 4MVCA 1JR6A 2HCBA 3B78A 4WOKA 1SXGA 3CLKA 3PHLA 1WBJB 1FSPA 1EUCB 3E4DA 1CU1A 5A71A 3R9KA 1MJGM 1USUA 2F1RA 2OM2A 1PTJA 3JQCA 2ORVA 5G1NA 3GGGA 1EA5A 3DKKA 4KAJA 1WNFA 2J45A 3QY9A 4NAVA 3IAXA 3WLQA 5E3HA 3GGJA 4DR5B 3W6ZA 3OE7D 2F2TA 3SPXA 2OVBA 3F3SA 5BQPA 4D0LB 4HFRA 2QJOA 2V7EA 2JBWA 3ZU3A 3HCNA 1ZD3A 1OXXK 3E3MA 1FUKA 1QYWA 4PC3A 4QPCA 1R8XA 3PBKA 4V0QA 4DWWA 4FMCB 4QBTA 2PLAA 4AUNA 2JCGA 1DWUA 4MI9A 5EMNA 5C8XA 3VKFA 1SHZA 1R3DA 5ALDA 1Q3HA 3KQVA 4RY0A 1PG5A 3TBFA 1QHYA 2OHIA 2VDWB 4TTTS 5DSTA 4P6VF 5CXQA 3B2EA 1QQ6A 5J9FA 3DC2A 3HCBA 3X2FA 3CWCA 3DEAA 3KB6A 2F90A 3B5EA 3OZCA 4B3TB 3K0AA 5KSWB 1IK6A 4EDFA 1XTBA 3USES 2CNOA 4LSGA 4FJ1A 3ZCPA 3EEOA 4BYGA 1GSHA 4DLTA 4JA2A 1P3Y1 1II0A 2CLCX 4ETIA 4IMJB 2R48A 3NJ8A 2C5GA 3WRXA 4BLWA 1Y81A 2EP5A 2H08A 1GG9A 1VG8A 1OJ7A 1BC5A 1X1QA 1NX9A 1V5GA 3HC7A 4OQEA 1KU6A 4AJOA 4BKPA 3D7SA 3RIXA 5JCPA 3OMLA 4L6IA 5IHXA 1BS2A 2FN8A 4M8SA 1ZSNA 4RGVA 3NBXX 4XDGA 5F1KA 4DWJA 3GGPA 3G2QA 4V1CA 3KQKA 1CR1A 2JHPA 2RARA 1SC9A 4BO6A 5LUBA 3I62A 3HXMA 1CRLA 1UMCB 4OJMX 1AGXA 1HDCA 3CUTA 3O38A 3QHAA 3SK0A 2XF2A 2HH9A 4ENRA 5K99A 4JI0B 4Q9IA 1BE0A 2VYFA 3ESDA 1ST2A 4IDQA 2VQ3A 4N8DA 4IIFA 4Z4CA 3UMMA 3NVAA 4TTQA 1G5HA 3EAQA 2YFQA 3FMVA 3GJSA 3CO5A 2JLXA 3OEHA 4UHJA 1OAOA 1TKRA 1VPVA 2GPBA 2MINA 2QNIA 2QKYA 1X9IA 1V8PA 2PZGA 3TAUA 5FOTA 4LJSA 5BOSA 5LQUA 3H75A 1AD2A 1GDDA 4TZKA 3CR3C 3EVFA 2DQZA 3LX8A 1T9DA 3DFFA 3O03A 2OMEA 5AKYA 3UATA 2HUPA 4CTNA 5C5CA 5IX8A 5JARA 4R41A 2ZSKA 5BW4A 1LW6E 3NBKA 3A27A 3L7DA 3HGTA 1PGNA 4IHKA 3BFPA 1M0SA 5BSVA 2CHGA 3HA5A 4B80A 4DC1A 4YMLA 2ZYDA 4MQBA 3Q3IA 4TV9A 3E7PA 1U0FA 4G5SA 5AK4A 5FJJA 2EATA 2FWNA 2MMGA 4ZXFA 2B2XA 3TQIA 3AVUA 1NI3A 3LUKA 3LGAA 4OLJA 4O2BF 3P9RA 4BO9A 2PT7A 4DLVA 1T29A 5JNWA 3RS2A 1NBOA 3WP0A 5TEWA 5T5QA 3BE5A 3G0IA 3NDIA 1NF8A 3R0ZA 1GZVA 3BRCA 4KWHA 1OR8A 5DM0A 3ZH9B 5KOJB 2TSYB 3PFCA 2FXVA 3P94A 2H4WA 3NHSA 4QFMA 4DG5A 1G6HA 5I48A 1WX1A 3DP7A 4JP1A 4LE2A 1DB3A 3MHPA 2QL9A 3KUXA 3DFMA 5AW5A 1A9PA 1G8MA 5F5LA 4KDRA 5EHQA 621PA 1B7GO 3CF0A 3GP5A 5C8YF 4X92A 2BGLA 4E03A 5HBRA 4H15A 1G8FA 1XF1A 2WWRA 3N2EA 2DQSA 3WK8A 2NTVA 4DVJA 1TE2A 4FGSA 1DUVG 2FYTA 3HJCA 1T0UA 3GARA 5FWXA 5BN1A 1GRCA 3JARB 1E1YA 3Q9SA 3IP5A 4R84A 4ZOLF 3SF0A 4CG3A 5AVVA 1NOJA 2IYSA 3VC3A 4IFTA 1PZEA 3K9QO 2HHHB 3O9VA 4MW9A 3U5TA 2DBVO 2QX4A 2AG5A 2B78A 1GPWB 3A10A 3KR2A 4UHKA 5A06A 5C35A 1H3EA 2QI9F 5AHXA 4DJEC 1IPHA 4MRMA 4P7KA 3QJGA 3C39A 4H4DA 2H1OA 2QR2A 5DHFA 5H81A 1ZN2A 1NZDA 4OYLA 2YVQA 1SULA 3QWHA 4G4GA 2VJNA 4EF4A 1JWLA 4UFOA 4LXXA 4WKPA 3M4ZA 2CL6X 3K5HA 1SUFA 5DEOA 3EG9A 2X0IA 4RTKA 2C2GA 5FNVA 3MN1A 4JELA 2D1SA 2GN4A 4XYEA 3KXPA 4XWKA 1A72A 3LLCA 3MBIA 2B5OA 3E8MA 3U4DA 2V6MA 2P1RA 5FLEX 4BAGA 1BJRE 1P1HA 2NG1A 4R9SA 5EHNA 5TPZA 4GRAA 2D8MA 2EBWA 4EZEA 1RJWA 3LUCA 3RSSA 1O6GA 3U6KA 2B94A 4GYYA 1EWVA 4HHEA 2NAPA 2W2VA 2GRUA 3A1FA 3JYQA 3KYCB 1YZQA 5IKOA 2DJ5A 1Q44A 1VI5A 4TS4A 5DDIP 1QZ3A 5I5GA 2OGTA 2V7VA 2ZR0A 4QDKA 1JQKA 5DHPA 3DH0A 4BLUA 4FDLA 4RABA 4LJ7A 1ZXXA 5M34A 4BUJA 3DVSX 3UB2A 5BURA 1Z0KA 2F8MA 3G0BA 4PPFA 3HA2A 1FYXA 2P7IA 1YNSA 3ZS8A 4HNVA 4Z99A 5I9TA 1HEYA 3CPJB 1UDXA 2OHXA 1Q0RA 1X87A 4TYWA 2NYRA 4PCVA 4PAWA 1Z45A 1X80B 2CJWA 3DDWA 4JODA 1P1JA 2EOAA 2AG0A 1OD6A 1RI5A 1SK8A 2C0CA 1ADFA 3F5QA 1DTSA 2H54A 2ZTHA 3IPXA 4P0TA 5FI0B 2QBYB 3LECA 2PKEA 3W05A 4NBRA 5HRAA 3IKVA 3CRZA 1Z5NA 4XVRA 3RODA 5FQOA 5ESXA 3ZQ6A 5BMVB 1KK3A 3PWZA 1PTKA 1OIVA 3OPMA 1A9OA 4FP9A 4N3CA 3WI7A 4HB3A 2IDZA 1OA0A 1U7PA 4IQGA 2GT1A 4YRDA 4Y3UA 1UR5A 1VL8A 4GECA 3VSCA 3LOUA 3BB3A 4K28A 1WXGA 2QIOA 1E18A 4JT8A 3FNRA 4MW1A 3FWHA 4OHWA 1YDEA 2GPTA 4WUVA 3WRVA 3WYNA 4MOWA 2P69A 2P6UA 4LXIA 4MUFA 5EKUA 2I54A 1PT8A 3Q12A 4FFDA 5AVZA 1OLSA 4HLUC 5EJAA 1QVVA 4A1FA 3R09A 3VSBA 2MSKA 5JDCA 1LK0A 4P4SA 3ZZMA 1P0MA 1Y8ZA 4FFBA 4E2YA 2M1XA 3INNA 1I33A 1DWOA 1OOEA 3EB9A 5GJVC 4NBKA 5JS2A 3OIWA 2XBLA 4KJXA 4FSXA 1US8B 4B3XA 3OLZA 2I03A 2OCXA 4KH0A 4L9AA 5CT9A 5ITVA 4EFDA 1GD1O 4R8KA 2P35A 2WTNA 5FA8A 2A9JA 4DLXA 3DEZA 4MKRA 1K86A 1IXSB 4OHPA 4W63A 2X5NA 3S8MA 5CNKA 4O4IF 1TF7A 3EXEA 2WD9A 4XX1A 3L92A 1OXUA 3VJMA 4EVSA 5LQAA 3SG0A 3DO6A 1BGVA 2VQ6A 3JCZA 4S04A 3BFJA 3IB3A 3JVUA 2Z6UA 1G8HA 1CUXA 5DPMA 2PXAA 3BCUA 3UJHA 3F7OA 5IKXA 1XEAA 3C8UA 4DIOA 1DHTA 4F7DA 4PZEA 5EY5B 3SR4A 1X15A 3BSSA 1ZMOA 3GJ6A 3LLVA 4PZDA 4JENA 4ZO4A 1KOGA 1I2ZA 1D6SA 1KY5A 2DBRA 1XX6A 6ABPA 1V41E 1FW8A 5ALJA 4B84A 1QR6A 1BFKA 4AD8A 2YNMC 2PGLA 5HF5A 4BNDB 2BGWA 3BULA 2YXBA 3FTQA 3KVVA 1VIVA 3E1SA 3PF9A 3BWXA 3M7IA 3O7WA 2GJSA 4XVUA 4JJ6A 5SY6A 4MQUA 5K0ZA 2V8OA 5CCEA 4KOAA 3FDXA 2QUBA 1R6XA 3C8ZA 2C99A 4ZCRA 1J2UA 3TLXA 2ZSBA 3G1WA 2JGAA 1A8QA 4BWGA 2YHAA 1U9YA 1F8XA 3M6MD 1HE4A 1PYDA 1QTQA 4J07A 5MHTA 1MX1A 4HX5A 3SE7A 1AKUA 1DBRA 2UYYA 1Q7EA 3CBQA 2FZCA 2PZFA 3OIGA 4L57A 1GAJA 1FP6A 4W8GA 4YAWA 3AKZA 1DWQA 1EBUA 4BEBA 5JO0A 1X77A 4UXIA 5AKHA 1ZPDA 3DV0A 1I01A 3CGGA 3ZJYA 2PO5A 5BRNA 1OYVA 2BMAA 2GILA 1AKWA 2I34A 3R5FA 2JF0A 3RYFB 4KLRA 3AL0C 3FCYA 5SY4A 3P0RA 2C2WA 4FGJA 2F7SA 3A2KA 5JSFA 3HZHA 5GONF 2O7NA 3RBVA 1CXZA 1FQWA 2V96A 2C8LA 2DT5A 2OKGA 4Q7MB 4K3UA 2ID4A 3K0CA 2GS9A 2VDMB 5LZ5A 4IVNA 3L84A 4KPFC 3WLIA 1T8UA 4G89A 2I62A 2J09A 3ANNA 4IIJB 5EZ6B 4GYKA 1KZ7B 3HGMA 3GFGA 3K1AB 3M34A 4IRMA 3TZHA 1KI2A 1LBEA 1U9CA 3GEEA 4RVHA 2FAXA 2PWBA 3UC5A 4DDVA 2H8KA 3LMKA 5MDHA 2CMKA 5L7TA 4MMZB 2H31A 3KKZA 5MGNA 4V3BA 3PE4A 1GYRA 5LMNB 1OXVA 4K46A 1U7ZA 1WS6A 4RVDA 1V35A 4C2BA 2PNFA 2CXUA 3ZCQA 4D9HA 3P9CA 5KVVA 5G2OA 4BQFA 3C70A 1FOEB 1HPLA 1L3IA 3DF7A 1ZUIA 1UPTA 2AX3A 4P4TA 4WNIA 2HPHA 3QLEA 3QELA 2MWMA 4W1RA 2OXTA 4NBWA 4E4TA 1F2VA 1RWPA 1T2CA 4JGGA 4MV3A 4OXRA 5IT4A 4LF4B 3STUA 2FJPA 3PE6A 4WXMA 3MW8A 4U6NA 2OBXA 3CCFA 2PA0A 4BWVA 1J23A 2EP8A 3FCEA 2XW6A 2F6RA 2IKSA 4MITA 2LD4A 3ZNOA 3FVVA 4OJQA 3HSYA 3B1ZA 3RBXA 1CQXA 1QQ5A 2ZUFA 1C8KA 1QNFA 1M34B 1YJAA 2C77A 1FJ2A 3BE8A 3ZN2A 4HBGA 1OLXA 1GZHB 2HEGA 4EPRA 3RAGA 4D9IA 3JQ8A 5G3YA 3U44B 4CL8A 1EJ6A 1LDYA 1BH2A 1IRIA 1QQ7A 1S8OA 5IVIA 2Y92A 3NDPA 3R0IA 4RVFA 2Q6KA 3DZIA 3WNCA 1IWOA 3C5VA 3F71A 1R0SA 1HQYE 4GX1A 1KI9A 2FMKA 1I2AA 2B69A 2OFXA 2ZAMA 1O94D 5KKAA 1R8JA 3UNXA 2B5VA 3FAKA 4DA7A 4Z0NA 4FYMA 2E18A 1QMGA 4IPTA 2J0VA 3PFHA 1XTRA 5DJ5A 1SURA 3D7LA 1Q6YA 2O19A 4J03A 1E3WB 3RNOA 1OYYA 1VGRA 2O8BA 1I2MA 2VL7A 3ZIAA 4QTTB 4DSOA 5JLAA 3DVAB 5AIBA 1XXHA 4IY1A 2ZUCA 1ZAYA 3LRXA 5FA6A 4E94A 1B43A 2FZGA 2J59A 2P2NA 1BOFA 2PGXA 2VF2A 3JTMA 3J7TA 1RYBA 1MIOB 1NURA 4I1IA 4P3OA 3GEDA 4MKXA 1Z5VA 2V4MA 3PKJA 3E4CA 4J76A 4HDQB 1ZRMA 3DT8A 1ZN9A 3Q3GE 4WOPA 1YL6A 2WM9B 3ZHZA 1P2BA 2NTYC 5F7JA 1FXUA 2R5NA 4QXOA 4CLEA 3FOFC 1ZI6A 2E89A 2R11A 3PDWA 1U9IA 3KEQA 5KS2A 4D9CA 1T13A 1U8YA 3UBMA 4RZHA 1E62A 1XDDA 4KUHA 3ZXUB 5FTLA 4DT1B 2FSPA 3OPXA 1AUPA 5A6VA 2ZRGA 4E70A 2Q9UA 4HK4A 3QKIA 2G06A 5FO0A 5C1IA 1XVIA 3II6X 4AP6A 2BRUC 1RZVA 4IMPA 4CODB 3NVKI 3T3DA 3C3AA 2C2MA 5EJ7A 2XBMA 3M4XA 4K2AA 1J5XA 1EE1A 1Q1GA 1IB0A 4DCJA 1Q12A 3SXUB 2BTQA 2ZIFA 3I04M 2EIHA 4JNKA 1UFQA 2ODWA 2AX4A 2ZSHA 5JAMA 3MXTA 4TL7A 5I3CA 3AFMA 1PT7A 5LQCA 2DJIA 3BHIA 4KKXB 5BSRA 5E8JA 4NOJA 1Z2EA 4LSWA 1VLHA 2E87A 3DDUA 1TOAA 1CY8A 1SQSA 5DM1A 2JIMA 3B9BA 1OHHD 3CX7A 3A05A 3A9TA 2YMLA 4RJLA 1D2HA 4V2IA 3MJCA 5AXDA 5IAJA 1NI5A 1K0FA 4ITVA 4X44A 4OOEA 4XB2A 4BNXA 3ZE9A 4YY3B 3ZXSA 2F1OA 2GEJA 2XA1A 1GCGA 3AX6A 1SG9A 4DMHA 2O4UX 4Z4GA 4PHHA 1OH6A 1Y7PA 2FW9A 2CUNA 1F5SA 1WW2A 1IG0A 5D6NA 1AO0A 1N2IA 1CT9A 2OMKA 5LQSA 1V5EA 2GBIA 4LFBB 4MYCA 3L3BA 4PNZA 2XZTA 5AUNB 5JRZA 2VUSA 5KU7A 2A9VA 1T5TA 2O5CA 2ZYGA 4CEIA 1XPUA 2R1TB 4YDHB 3VR3D 1F06A 4XVQA 4C7OA 5JASA 3ORSA 1XMIA 2R6GA 3NTQA 3ICCA 3DZBA 4U2GA 3CNHA 4N41A 2XKAA 3KHUA 4PQRA 5E4FA 2Q5QA 5EXDA 5JD6A 2Q4OA 4MKGA 5AI5A 1L8OA 1C41A 2YWXA 2FEXA 4D4IA 3A8TA 4P3NA 3IDAA 1T5HX 1V8ZA 3FPFA 4GZMA 4M0DA 1CB0A 4EABA 1VG0B 1TQHA 3KKLA 4TS1A 3A9UA 2ZE6A 3I6MA 2YQZA 2EX1A 4P86A 4M86A 3RWOA 1S8AA 2EKQA 1I6KA 2RGCA 1EVKA 1T9KA 3VC1A 4LDNA 3LSYA 2W4IA 2LKDA 2C7QA 4OIMA 4FW9A 3PC7A 4AJNA 1OI3A 4M4SA 1Q21A 1S5PA 1VC2A 2NZ8A 2OBYA 4CCWA 3PK0A 1RYEA 2QTVA 4AJKA 2ZU6A 4DLUA 2C54A 3IQEA 2PZJA 1JQBA 3EMKA 2QTMA 4MR7A 5E7QA 5F5NA 2C07A 5EYPB 4EGCB 1XCJA 2UZ1B 1XL1A 2QYHA 3ZK8A 1EYZA 3FDZB 2JATA 5C8VA 4OQXA 2FFRA 3OAAD 3B1FA 5E6UB 2WJWA 5HBGA 3PDHA 1C4KA 1VRWA 4PLYA 5F1OA 4LFAB 4DFDA 1V43A 2JAUA 1U0NA 5IUNC 3H2GA 1G59A 5G41A 1WMEA 3VGJA 3O4RA 3KOWA 1Z8HA 5BNTA 3DT6A 3O4VA 4QTYA 5FR2A 1IY0A 3CZQA 1PV4A 4AY6A 2VPZA 3OKFA 4M76B 2X6RA 2NO9A 1RCTE 4HYTA 3R9WA 3RRJA 3JW8A 4Q3DA 2HK7A 4TZTA 2QE7D 3STTA 2QNRA 4GSLA 2Q6IA 2SKEA 2VYNA 4YJHB 5F2EA 4D8XA 3DBOB 4IIVA 5D5QA 1DHRA 1FFXA 1KAMA 2XGSA 2FMHA 3IMEA 4IH1A 1J24A 4JDUA 4QTUB 3PL5A 2EJCA 2VTKA 4BFYA 3WIBA 1P1IA 4Z0TA 1WDTA 2RI0A 1FNSA 2HA4A 3KOOA 1EHYA 2DLNA 3I37X 2AQ8A 3DD5A 2PEYA 4NJMA 3L8HA 1PR4A 2Z2IA 1SZPA 1JW9B 1XZQA 1IONA 2IZ6A 3FD8A 1QLHA 4F06A 5A6SA 2CMDA 3BRQA 1RM0A 5BWOA 3AB7A 4DJJA 4E2XA 2MHCA 1W73A 5KJ1A 5TF0A 4AN4A 3HY3A 2WE7A 3HI4A 2DUMA 2HRQA 3OC0A 2IYQA 4LISA 2IOFA 2L19A 2RGWA 3OZUA 1QK4A 5F7ZA 2C2ZA 4UUBA 4OFXA 5EFOA 3WYEA 2VP3A 4C29A 2A92A 2WMNB 3OETA 4RJKA 5K3FB 3WX0A 2XIQA 4WCFA 3TR0A 4NCJA 4XDZA 3RI3A 5HZHA 4XQEA 4R2WA 1APBA 2W6PA 3V9AA 2WHPB 1ZG3A 1N2XA 1UBMS 1B26A 1XTIA 4PGGA 4YN3A 1TC2A 3NMUF 5ADUS 2IV3A 2A9FA 4WY5A 1DQPA 2RHCA 2IQ5A 1GFSA 5AKGA 1CY6A 2JIZA 3EIFA 1N2ZA 3V4FA 1SC4A 1MNQA 4P38A 3WTBA 3JWJA 3MMPA 1N9GB 3K6RA 4CUZA 3VZQA 1ORHA 3NHAA 4QXQA 2QQ5A 4TYPA 5HJ2A 2B30A 2XGOA 5T4EA 1DEOA 4AMZA 1AOXA 1WKBA 2FU5C 3WGGA 4X8OA 1G6KA 1X7ZB 2GPJA 2FFAA 2Y1GA 3QHQA 2GX6A 3IUPA 3PFIA 4EG7A 3JYNA 4TRRA 3C7KA 4R83A 4ARSA 1N4AA 2GZAA 1NQVA 1YC5A 2ZQZA 3EYWA 2YY6A 1FDRA 4N18A 4P35A 2EFDB 2Y4OA 1GL3A 3J80A 4YQZA 3F4LA 4XB6B 2AK2A 4WBSA 2QW0X 2VS1A 3JQQA 3MBKA 4L27A 2ILTA 2JGNA 3I0ZA 5FUMA 4MHTA 1H2FA 5CMLA 4X91A 3QWFA 3GJQA 2MSWA 3BD9A 3F97A 2YW2A 1M6VB 1WL8A 1FIUA 1ZXBA 1Q0LA 1J0DA 3NOOA 2H2IA 2L0XA 4HFMA 2PLFA 4UMVA 5ES3A 3UWSA 4UBNA 4QD3A 1JHZA 1V8FA 1F8UA 4DY6A 1NIJA 1J8FA 1HYHA 1N7IA 1UKBA 2M9MA 2POQX 4I3GA 2DG2A 4BV9A 4IRXA 1CJCA 1N2OA 4INJA 4MJLA 3RUPA 2Z2ZA 5EQTA 1Z88A 5AW8A 3OE4A 1V0JA 4X8LA 4BXOA 3IP8A 2G28A 4F8JA 1WR8A 3BB1A 3E9RA 4PX3A 1Z29A 3KG2A 1C7ZA 3SCZA 3WB1A 2HF9A 5CX1B 4EF5A 2Z09A 2OFWA 4ZQBA 5G40A 2OCIA 4I6EA 4RJ2A 1PCXA 4NZPA 2JLBA 5I7EA 3GMTA 2XCTB 4YR7A 2CDRA 4A0GA 2X8AA 5GINE 5FTMA 4B4VA 2CV2A 3T4PA 1FFEA 3RVSA 4YLEA 1FFCA 5ESWA 3U4HA 1NBWB 3FIUA 4W6QA 1ULSA 4KXVA 5I9IA 3NIFB 3NOQA 2FPWA 1DC4A 5ED4A 3AIMA 1IYZA 1FDUA 1NHWA 3CUYA 2PMKA 2Z04A 4AWXA 3EOZA 2D7CA 1SRQA 2EGGA 3AUAA 3E3NA 3FA2A 4HLNA 1VBMA 3W8DA 3U7FB 2ZJYA 1YIAA 1LTQA 1LQ2A 4OSPA 3OCJA 1UC8A 2XMRA 4I5GA 4G5QA 1X1AA 2VFAA 1AM4D 1QYXA 2CLHB 1RHQA 2YMPA 2YRFA 4E2FA 3GFVA 3HWSA 1XGKA 3M9WA 5DGHA 2A9QA 4TT3A 1KO4A 1UJCA 3G79A 3C85A 2HWWA 3RRNA 5ALTA 1PX0A 3E7XA 3RVMA 2WZDA 4Q18A 5JZSA 2QVCA 3GLSA 4XARA 1QH1B 4UAGA 1I0ZA 4MRVA 4C43A 1PEAA 4K6MA 3I92A 2KM1A 3D3QA 1TM7E 4P58A 1K6IA 3V1KA 4XIJA 1G38A 5IJ0B 3AEZA 5HZKA 2AI1A 4MKFA 1RYDA 4PS1A 3GV0A 3ZV7A 4CCYA 2VHEA 5PNTA 3THYA 1TLFA 2O14A 2IH2A 2GVDC 2B4AA 1Q1NA 1FRFS 3AP3A 3SZOA 4J0JA 3LKBA 5DX8A 4AP5A 4YMHA 3FB1A 3NBZC 1V6SA 1T4DA 3LYHA 1Z5GA 1DEKA 1U0GA 3IBYA 3LYUA 4Q15A 3TOVA 1U3VA 3F1LA 2X42A 3IA2A 3GD7A 4H3KB 4E32A 1R6VA 4JEUA 3CEJA 2AQHA 3LJKA 5I8PA 4Q01A 2AFHB 1T5DX 3GC6A 3LI2A 3N2GB 4U5QA 3UK0A 4UOZA 2QJFA 1K1EA 1F8FA 2RGBA 3M1YA 1DCMA 4RSMA 5H5JA 4BJ5A 4GZLA 1YB7A 2GN9A 1V6AA 4I50A 4UREA 4YRMA 1BGWA 3AKYA 2PX6A 4YRIA 5E38A 5JFTA 4CMJA 4QVIA 3EZ7A 2GDZA 3O73A 1AHNA 3RT7A 1RRKA 1ZMBA 2BFOA 2NPOA 3OCUA 1NNLA 1BD4A 3DOUA 3TW8A 4CLRB 4RHTA 4ZVQA 4TWZA 3W2EA 1N5DA 4GX0A 3UO8B 4OY3A 3ZCXA 1JPUA 1NHGA 3HNRA 3OKCA 5FI5A 2FPGB 5J2TF 3M6LA 1UMCA 2HTFA 4BFVA 5BWCA 1FSSA 4RGQA 4YB8A 3OEHD 1JMYA 2CHQA 2NYUA 3UG6A 3QMMA 1FA9A 1N2GA 3NNNA 4XLZA 4CM6A 1HFJA 2IY8A 3Q3CA 4YDQA 5JECA 4N76A 1IEXA 3MUOA 4OK6A 1VGVA 5H9VA 2HSDA 3KO8A 1I94B 1O03A 3A4YA 1Y9JA 3VZPA 2A1IA 4A03A 5KWIA 5I7SA 4JI7B 2R6JA 4C4SA 4AKIA 5KJ6A 2I7TA 4PAMA 1Y8CA 1XTQA 4EGSA 5F2NA 4HH1A 3LIPA 4UMEA 1NONA 2PM8A 2A0XA 4L2IB 2FMIA 4A5OA 6NULA 3ZJ5A 4X1YA 3PNSA 1CZLA 2YVLA 3VR5H 1LBHA 2JFQA 1JFFA 3GXOA 4U8HA 5JJCA 4GLBA 4O6VA 2XNHA 5KQPA 4L8GA 4YALA 1Z5OA 2NXEA 3CLSD 3CCBA 3LVBA 5DO9A 3Q85A 3WO0A 5JZOA 5BRJA 5LXTB 2EJTA 3D64A 4O2LA 4EG4A 5BVHB 4E5PA 3R3HA 5AJTA 5B6JA 1IZ0A 1G8AA 2CXPA 5HDQA 2W6OA 4MTCA 1QMPA 4KN8A 4NQRA 3HU2A 1THMA 1NXXA 4F04A 1JG2A 4M36A 1QNLA 3EVZA 5I8WA 1PJAA 4CMBA 1QDUA 4AY4A 4C7XA 2PS9A 3G8DA 4DS3A 2AH5A 2B0CA 5A9RA 5HJ5A 1R0LA 3QNMA 4TWRA 3WWYA 4O5AA 3FVQA 3V4LA 1VFPA 1E1KA 2ZS8A 4PFKA 3PXGA 3AUSA 1NC3A 2CNBA 2NU7B 4A23A 3TTXA 4CHGA 2OECA 2UYGA 4BQEA 4X6UA 3EXHA 3GPDG 4OQQA 3K4PA 3RC1A 2BH2A 4HY3A 1HDXA 4IZOA 5LA6F 3QLJA 1IY2A 3CW9A 2QX8A 2O7RA 1PFUA 3B52X 4UEKA 3H5IA 4KN5A 3VKGA 1BQEA 2ZI4A 4E31A 5GIPE 1CDOA 4PTYA 2FI1A 5KOHB 2GESA 3JARA 3UC9A 5CEJA 3JVVA 3WWPA 3B6MA 3BBLA 4RIGA 4HAUA 2GETA 1XB2A 5CDTA 1MHTA 3U4CA 1T3HA 2BT4A 1KBZA 3D54D 3GWGA 4QOSA 5EIAA 1QS0B 4DLBA 4RULA 4W5HA 4J9UE 1CJKC 1GZDA 1JT9A 4JY7A 1YFZA 1VSVA 1N3BA 1ECLA 1GKLA 3L46A 5I7AA 2Q07A 1A71A 1B0ZA 2XXJA 4CNQA 1ZGJA 4YROA 2FA9A 1KPGA 1E2MA 4AT1A 4O4HB 3IVAA 3LU1A 1NPDA 3KVNA 1HYQA 3DFZA 5J4YA 5ALIA 1YCHA 1UK6A 1VKRA 3PNYA 3Q5GA 3IVXA 4WL0A 4C6TB 4FGLA 5CIYA 5CVDA 3A9RA 1CBUA 1XL0A 2DHCA 3DKPA 2A1TR 2I2BA 5CJ2A 1TPZA 1JIUA 2X8JA 2XVZA 4MV4A 4G0WA 3I58A 1EJ2A 5NLLA 4LYHA 4N5DA 4P3PA 4LY3A 3WK9A 3NH6A 4FT4A 3OCCA 1XWFA 1DELA 4JLDA 5CH5A 5HEKA 1LF0A 1Y63A 4U5XA 4WKCA 4WY2A 2WP8J 4R01A 3SBDA 3K6SB 1E2PA 1FFDA 1XRRA 2HA3A 4HWOA 1K66A 1KIAA 1D6JA 3ISJA 3OO0A 3U4QB 1KJQA 1R6BX 3FSJX 2G25A 1M8JA 1H42A 2XCLA 3CLVA 3NHRA 4WY8A 3LP8A 4ZDWA 1WF3A 1RAIA 2NSYA 3FZEA 2AEJA 4CL2A 3STYA 2O2GA 1A82A 4ENSA 2AI3A 3LBIA 2HJ9A 2JCXA 3E5RA 2AOTB 1AGNA 3H1BA 5L4SA 2G80A 2BGMA 1PJTA 2V0CA 1GRQA 1KSHA 1S2OA 1XKXA 3B12A 3P7MA 4IS3A 4WHMA 1PHRA 3C74A 2OXRA 1SCDA 1SCJA 1SKBA 5DNAA 4EW3A 3PP8A 5A4JA 3WWZA 2QVGA 3K9LA 5CAEA 4MV1A 4PRYA 4RVGA 3CX6A 2J6BA 3TQFA 4S1NA 5ED0A 2DFVA 3GPCA 1N6RA 5HTKA 3FUXA 2QBYA 1NVDA 1Z4QA 2J3EA 4XYGA 1F7UA 1VL6A 3D5EA 3D6TB 3GBSA 5B2ZA 2ZCUA 3PB3A 2F67A 1EP1B 2G63A 2NXNA 2ZJ7A 1O2DA 3EOBI 4PTZA 4V0LA 4ZQCB 5CURA 4DZTA 4OHMA 2CXTA 2PZBA 2R4QA 2A7XA 3D5QA 1VYVA 2OGUA 4BVHA 5EUQB 3I2FA 5IYZB 3FTEA 1RM5A 2ZCJA 1F9AA 4PWYA 1GNPA 4PIMA 3UMRA 2E4VA 4BAUA 1UWCA 3H1FA 3U7IA 1OI4A 1T6YA 3LDHA 3BRSA 2B8TA 1I1HA 2W2OA 1PAUA 1PWHA 1GL7A 3N9IA 2R60A 4BTVA 3I5XA 2FKNA 2OO7A 2ZKLA 1YQTA 4LHZA 2JI9A 2OM6A 1RQ7A 3GX1A 3SC4A 3HJFA 4GKKB 2CWDA 5A0VA 1QYRA 1CEEA 3GVIA 3QE3A 4CF5A 2F55A 2AFHE 2EKPA 2FRDC 3EQ6A 3I8OA 5TJHA 2DEUA 4G07A 2OC4A 1XLUA 1EB9A 3OFVA 3PRHA 1VPWA 2O8DB 3TZ6A 3OLWA 4EJ2A 3WNVA 3SX4A 2WAOA 4GNKA 4OI2A 5P8WA 1JS1X 1ZQ9A 2RHOA 1W4BA 2CNKA 2ZBEA 2P75A 1W94A 3LX4A 4Z6KA 1XDBA 2QG9A 1E1CA 2Q27A 4G9GA 1EGVB 2Q5CA 4LRSB 4GM1A 4C20A 5JMOA 2Q4EA 4F2PA 3INGA 2D00A 2NXJA 3HXKA 3H4IA 4HG2A 4FKBA 1I3OA 2I6QA 1DV2A 1ITZA 1JXQA 1ZLXA 2GAJA 1DX4A 3N70A 4OHOA 3RFUA 5JTTA 2BKUA 1MB0A 3ABSB 1H9CA 2IZ1A 1S7GA 4LF9B 5C1PA 3BCRA 1FSGA 5F4BA 3CJQA 3OPQA 3O5AA 1NVVQ 5ECDA 3QEAZ 1NT4A 4ESHA 5LIPA 3FSEA 1H8ED 3AFGA 2PD4A 1UEIA 3VNSA 2I2WA 4IHJF 1QO9A 4O25A 4FB5A 1QHHA 3KOMA 4KFTA 3O2JA 2A9PA 4JBIA 1Q95A 4KW7A 3HKEA 2VDLB 3PLNA 2WJHA 1LB1B 2ZM5A 3CIFA 1OWPA 4P83A 2GKSA 1IUKA 1XMSA 2AB0A 2WIGA 4GPD1 1ZRSA 2Y3IA 3VZCA 5FUQA 5ITZB 1JPJA 1E3IA 1NKTA 4YRZA 3ECSA 1O9BA 5LQDA 4C2TA 3UK2A 1CF9A 2Z8XA 4G8JA 5KNCA 3M82A 3D02A 3NI2A 2WKRA 3O9MA 4JLVA 2N1BA 4DMMA 2J9FA 1DAOA 3TLMA 1JILA 3M4JA 2Y0EA 2XGMA 2NUAB 1JALA 3JZFA 3E9NA 3KOXA 2KS6A 3H1EA 5DX0A 2CVQA 4JJ7A 3THRA 4MVJI 3K1AA 4N6GA 3AH8A 2JFUA 3TI7A 2Q7OE 2O8FB 3KSMA 1CNMA 2HBRA 2AD1A 1U7DA 4CN8A 3A28A 2OSVA 3QKUA 1ABFA 2AXPA 2NADA 2NU9B 3MJVA 4I36A 5THXA 2C2YA 1RIIA 1M1XB 4KGXA 3MJDA 1WV1A 2O57A 2YXLA 1OZAA 1RBZA 1W49A 2YWBA 4O2AF 1Z18A 3TIGA 4P3YA 4HATA 1VJ0A 1H2EA 1Y6ZA 3IRUA 3OE5A 4I1SA 2BLLA 1WXHA 2DY1A 4KIJA 4OQPA 2WKQA 5LQRA 1GZ3A 2PYDA 5D8DA 4NOKA 3KBBA 5AW0A 2Q1YA 3WBKA 5J3JA 4NDZA 4QJ5A 1JFLA 4L9RA 2RGGA 5CUQA 3CF6R 3TWOA 4EZIA 1DJOA 4B2IA 5DW0A 5KJEA 4DEYA 1BQ4A 4IXWA 1A7UA 4O1IA 1FSZA 1ZUWA 3AOEA 3Q8MA 4ABTA 2YS7A 1KIMA 4QLAA 2IKQA 3K0CC 5EKTA 5LKAA 3I3OA 4DIMA 3KZXA 3NHMA 1M74A 1E7QA 4F5EA 4LEIA 1JQLB 4J0IA 1EFPA 4LOJA 1IN1A 2HNBA 2JEZA 4CR7A 2PZEA 3DLBA 5B3AA 5B1HA 4NYIQ 4KCGA 2JD2A 1JEJA 1G8PA 1YR1A 1BOOA 4LMAA 2XLBA 3WTCA 1USIA 3CSUA 4J0EA 3E5HA 3KUKA 1IHXA 3TGWA 1J2EA 1NVFA 2IHTA 1GOTA 3LL4A 3ZIAD 4MB0A 3TQSA 1YE3A 4OO3A 1M72A 4ROSA 2JLYA 1E3WA 1A50B 2TRSB 2RG7A 3RTEA 3QYPA 4ZVRA 3CISA 3RRMA 5IFLA 4RDCA 3KQYA 2W2XA 3HUUA 3GCXA 5UKDA 1H5UA 1LNZA 1UKZA 4HGOA 4I81A 5EJFA 4YWHA 1YBVA 1NV9A 4MP3A 4BMYA 3CZPA 5HGJA 5JQGB 1A8IA 4B3MB 3M6AA 5B1EA 5LYJF 2DU8A 2WSBA 2WINI 4Z9BA 3T7AA 1DDOA 1C8BA 2HOQA