4P7JA

Rat apo-comt sulfate bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
b'GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
molecule tags Transferase
source organism Rattus norvegicus
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
total genus 76
structure length 217
sequence length 217
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4p7jA00
5LQAA 1ORHA 1JG2A 1RJGA 5E2BA 2NNWB 4RTOA 2QRVB 1SUSA 2LD4A 3VC1A 4FT4A 3B7PA 3ID6C 1JG3A 5DRYA 4DCGA 5K05A 3EGEA 3GXOA 2OY0A 3KQWA 2AVDA 3OPNA 4C05A 3LHDA 3DMGA 4AZVA 4YUVA 5BP7A 1X19A 3GCZA 1SQFA 5IH3A 2JJQA 3DXZA 3PX2A 4RTJA 2JHPA 2A14A 2H00A 3MCZA 5EMKA 4A6EA 3LBFA 4FR0A 1YFLA 2P3QA 3GRUA 2GH1A 2PJDA 1YFJA 5LQRA 5LQCA 4P7KA 3T7SA 1IXKA 5E8RA 4DQ0A 3BKXA 5BXYA 5EVJA 3FZGA 3UBTA 5ICFA 5LQKA 3BGDA 1R8XA 3DLIA 3LCUA 3TKAA 1X1CA 1NV8A 2IDKA 2PV0A 3BZBA 5F2OA 3TFWA 3UJDA 1U2ZA 3DMFA 4E33A 4X1OA 4EQZA 5DWQA 4KDRA 4LECA 3G5LA 1RI4A 3UJCA 3BGIA 4O29A 1FBNA 4X60A 2FYTA 3CGGA 3FYDA 2FK7A 3CCFA 4H0NA 3NVKI 1Q0TA 3PB3A 2O07A 7MHTA 5DX0A 4FP9A 3PS9A 3KR1A 5DXJA 3SXJA 3OZTA 5ICGA 1JTEA 3EVGA 4HG2A 2FHPA 2WK1A 3EMDA 4IWNA 5GINE 4BP1A 1T43A 4YMGA 2CWWA 4KDCA 1NW7A 4PWYA 1NT2A 2ORED 1ORIA 5EZQA 5DM4A 3NJRA 1FP1D 3EVAA 1EG2A 3HP7A 4P7GA 2XYVA 5EMJA 4U7TB 1XDSA 2QM3A 3HCCA 3IYLW 2ZLBA 3KQYA 3KQPA 3P9IA 1BOOA 4X61A 5CVVA 5K8VA 2NP6A 3QV2A 2HR1A 2OKCA 2P7IA 5DTMA 1X1DA 2G70A 2P8JA 4HGYA 4C06A 3EMBA 5FADA 3GRVA 3THRA 2AR0A 4P58A 3ER9A 3ELUA 2AOWA 1SKMA 5LR6A 2YR0A 2ESRA 3ANXA 5CUQA 5EZSA 2GA9A 1ZGJA 3UZUA 2Z6QA 3P2EA 2XYQA 1WXXA 4C08A 4BY9E 3FPGA 5CVJA 2EJTA 1Z3CA 3K6RA 4DZRA 1I1NA 4PYKA 4KRGA 4RTLA 5CCXA 1QAQA 3A4TA 3JWGA 1SUIA 4OQDA 5GIOE 5HIIA 4F84A 3G2PA 3HEMA 3JWJA 3DLCA 4PYOA 4XUDA 3ERCA 3A25A 1R8YA 1Q0SA 3EGVA 2FRXA 3KPWA 2BR5A 4OA5A 2FCAA 3SGLA 1JSZA 3A7DA 1FJXA 3IHTA 3BWYA 3FPHA 1NBIA 4E2WA 5KQRA 1QYRA 2QE6A 3DUWA 3PTAA 4GC5A 4GBED 4JXJA 4L7VA 2O0LA 3C0KA 4LG1A 1OR8A 3TR6A 5G02A 3GGDA 5FWAA 3UJBA 3EVCA 3UA4A 2ZZMA 5GWXA 1NW8A 2IH5A 4GOMD 4GOLD 5CM2Z 4MWZA 4BLVA 5K0LA 2HWKA 1VP3A 5K0NA 5DRTA 2PX4A 4RTNA 1JSXA 2AOTA 2WA2A 4E70A 3FTFA 1EAMA 2ZSUA 3HCDA 3KR2A 4WVLA 4POOA 4RTKA 3FTCA 3OU6A 3KPUA 3C6KA 3LSTA 4CXMA 2ZFUA 3B5IA 5DLYA 4F86A 1KPGA 4YMHA 2YQZA 2R6ZA 4PONA 5K09A 3CC8A 3G88A 1KXZA 5CIYA 3KPYA 4RV9A 1L3BA 1NV9A 2G72A 3P9CA 3E8SA 3EPPA 5E2AA 2BR4A 4A6DA 3MCTA 5EKUA 4DM3A 5F2NA 5K01A 3DH0A 2PVCA 1L3IA 3DTNA 1JG4A 3KQMA 4HTFB 3D2LA 3DXYA 5DSXA 1JG1A 2G71A 3BKWA 1VL5A 1JTFA 3TM5A 2OBFA 4X63A 1F3LA 5EIFA 1QANA 2PKWA 3NWBA 1KIAA 1R74A 2XYRA 3THSA 3UJAA 4C4AA 2P7HA 2CMGA 4EKIA 10MHA 2UYHA 1NBHA 2AZTA 2PXAA 4PYLA 4IKPA 2BM9A 2F8LA 4ER0A 3AJDA 1NW6A 2FK8A 2ONZA 5E1MA 2PT6A 5T67A 3ME5A 4EKGA 3EGIA 3IEIA 4RTSA 1AQIA 1XXLA 3AY0A 3LL7A 9MHTA 5T64A 1BC5A 3UA3A 1BKYA 3GU3A 3E23A 3FPJA 2PX2A 4M38A 4GC9A 3SSNA 2IH4A 1L3CA 3M70A 3R6TA 2IBSA 4KIFA 4HTFA 3LKDA 1G8AA 4YV0A 3KQTA 4QQNA 3HA3A 5DM0A 2BM8A 3DMHA 4OBWA 4QVKA 4IV0A 8MHTA 4ER3A 1VQ1A 3EVEA 5C0OE 2NP7A 2GS9A 2ZZKA 2HTEA 2PT9A 3P9KA 3FUXA 4WXHA 4PINA 3GO4A 3M4XA 2ZWVA 3KQQA 3P71T 4MTLA 3VYWA 3QOXA 4R6WA 4YUWA 1UFKA 3BWBA 3JWIA 4GOOD 4E2XA 3OFKA 3HCFA 1RJEA 2OO3A 4EMSA 2B2CA 1XTPA 2HV9A 2PBFA 5E1BA 5GOZA 5H02A 4ER5A 4YV2A 3OU7A 5EOVA 4X41A 5LSAA 5M5BA 1VBFA 1AF7A 2P3OA 3H2BA 4DA4A 4XUEA 2AOUB 2DPMA 4RSRA 2OZVA 3KKZA 2V74B 3F4KA 3HCAA 4E30A 2UYOA 5K0JA 4RVDA 3EVZA 3GRRA 4R05A 4HSGA 2UYCA 3BT7A 1G60A 3DULA 4PIPA 5CVDA 2GB4A 4HC4A 4PYJA 1TW2A 3P97A 4RVGA 5EKXA 3UJ6A 3V97A 4GEKA 4GQBA 3T7TA 4RVFA 2ERCA 2GAFA 4GF5A 3NWEA 2PLWA 1YUBA 4KWCA 4PCAA 5E1OA 3RIEA 1TW3A 4PYNA 5EHGA 5FA8A 1RI2A 5DSTA 1G38A 1L1EA 3JWHA 2AN4A 4PGGA 3M6UA 5MHTA 3O31A 1ZHFA 2ONYA 3P9NA 5E9WA 1DL5A 3A27A 2PWPA 2PY6A 1EJ6A 1NW3A 2K4MA 4R6XA 5DM2A 2ZBQA 2OB1A 3R3HA 2OXTA 1JR4A 2VDVE 1ZGAA 4RVHA 3UWPA 5DTQA 1MHTA 3RW9A 5HIKA 5EQJB 1WY7A 3SSOA 2NYUA 3GWZA 3A7EA 5EMLA 3CJTA 4FS8A 4PNEA 2Q41A 2IFTA 2VS1A 1KPHA 4QPNA 4F85A 3G2MA 5BW4A 5JR3A 3NVMB 1JQDA 5DT2A 1RJFA 1ZQ9A 1X1BA 1AQJA 1V39A 1I4WA 2IP2A 3DP7A 2PX8A 3FYCA 3BXOA 4QTUB 1SQGA 2G8NA 2I7CA 3I5UA 4DF3A 5KQSA 4OBXA 3G89A 3GIWA 2ZIGA 3EEYA 3HCEA 1RJDA 3G2QA 3WSTA 1YF3A 1I9GA 4YUZA 3FPEA 1X1AA 2R3SA 2NXJA 5JUWA 4EVIA 3NDJA 1O9HA 3M33A 4GOND 3KPVA 4BLUA 4KW7A 5KS2A 2PWYA 2EX4A 3R0QA 3VSEA 4CKEA 3E7PA 3T0IA 4CKCA 3LPMA 5U4XA 1IM8A 3CBGA 3KQOA 1DUSA 3PT9A 3BUSA 3NW9A 4RYLA 2ZULA 3MTIA 2AOUA 4KVZA 2PXXA 4QPPA 3PFHA 1VE3A 2AOTB 1KR5A 3DR5A 5EMMA 3ELYA 1P91A 3C3YA 2QY6A 1MJFA 3REOA 5EPEA 3T7RA 3I64A 3LDFA 4HH4A 2Z6UA 5DX8A 3OZRA 5ICCA 4ISCA 3HNRA 3UJ9A 1HMYA 1QZZA 1L9KA 4ATNA 4RX1A 4AUKA 3G8BA 1EJ0A 2BR3A 3MB5A 3TMAA 3LBYA 5ERGB 4RTRA 3HVJA 4M37A 4C03A 1XVAA 3KR0A 4QVGA 3FPFA 2YTZA 1R6AA 5D1HA 5DXAA 3FUUA 3FUWA 2OB2A 2C7PA 5LQJA 3LGAA 2EG5A 2ZVJA 2ZIEA 2H11A 5HFJA 2P41A 3S68A 5GM2A 2JHAA 3HA7A 5DPMA 1N7JA 5K0CA 2V7EA 1KPIA 1YZHA 1SVUA 3CJQA 5E1DA 2C7OA 4CWAA 3TPZA 4HGZA 2ZBPA 2AN5A 4E31A 2IH2A 3ORHA 3SR4A 4RTMA 3KPJA 1TPYA 5KVAA 2EFJA 1RI1A 2P1DA 4QTTB 1JQEA 1JQ3A 2GLUA 5C9ZA 1KP9A 4YUXA 4ER6A 5GP1A 3BGVA 1DCTA 2YXDA 4PGHA 2XVAA 1P39A 5GM1A 2P35A 2AOXA 2WA1A 3LKZA 2GPYA 5D1NA 3SM3A 1R00A 3GJYA 4P7JA 4RTPA 2C7RA 2ZZNA 2E5WA 2JH8A 4FZVA 2PXCA 3AXTA 5KYGA 2AN3A 2FPOA 4EK9A 2YX1A 2CKDA 3OU2A 5K0GA 2UZ4A 2ZW9A 3QOWA 3EVFA 3TKYA 4CTKA 3G5TA 3C6MA 3LDGA 1B42A 3PVCA 3SVZA 2OYRA 3LCCA 3M6XA 3U81A 2YXEA 3P2KA 4LWOA 5FQNA 4M7RA 4PYMA 1IY9A 1XCLA 3FRIA 1FP2A 1YZ3A 3MERA 3SSMA 3EEOA 1G6Q1 1F38A 2VDUE 4OX9Y 1ZKDA 5CD1A 3NTVA 3V8VA 2ADMA 4AZSA 3G7UA 2VP3A 1WXWA 5HILA 1PRYA 5CVEA 2ZWAA 3HCBA 2CL5A 1G55A 3NDIA 1WZNA 4FGZA 1QAOA 4FSDA 4P7FA 4RWZA 1ZG3A 3EVBA 2NXEA 3AWIA 5FTWA 2IIPA 1O9GA 5LQNA 2P3LA 3HVIA 2VZ9A 4MQ4A 1NE2A 4AZWA 2Z6AA 3NMUF 2ZTHA 4YUYA 3SX0A 3SMQA 2VDWA 1FPQA 2ZIFA 1R18A 3G2OA 3MQ2A 4BP3A 2G1PA 2NXNA 5LQUA 4CKBA 3GNLA 3OE5A 1BHJA 1AV6A 4PIMA 3TOSA 3LDUA 4NECA 3DXXA 3UFBA 3CKKA 2DULA 3PLAE 5DM1A 2YVLA 3OZSA 5HIMA 1M0EA 5E8JA 2IPXA 2UYQA 4PYQA 1H1DA 4V0QA 1M6YA 4OQEA 3OE4A 2B3TA 1EIZA 1KYZA 1VPTA 3B3FA 1PJZA 3M6VA 1HNNA 4QDKA 3L8DA 5HEKA 2C7QA 1UWVA 3K0BA 5GIPE 2AOVA 3UJ8A 1XDUA 3I9FA 3P8ZA 3GRYA 2P40A 1XJ5A 3EVDA 3GDHA 1INLA 5DTRA 2JH9A 5C1IA 1RI3A 3B3GA 2N47A 2QYOA 3HA5A 3LX6A 1UIRA 3B89A 3C3PA 3HM2A 4XCXA 2O06A 4E2ZA 4Y2HA 5DX1A 4C07A 5FQOA 2Y1XA 3AXSA 4DMGA 2XBMA 4PCLA 1KHHA 4MIKA 4QQKA 5EGSA 1O54A 2OPBA 1M6EX 5HIJA 4BLWA 3O4FA 2BZGA 5K0FA 2IBTA 3O7WA 3M6WA 1N7IA 2HNKA 1D2HA 2AVNA 2PX5A 3DOUA 5T6BA 5HZMA 4GUAA 3G8AA 4DCMA 4ZTBA 4AZTA 5EHIA 3FUVA 3VC2A 4AX8A 1VP9A 5CVUA 5EEHA 5K0EA 5B1SA 2ZCJA 1G8SA 2I9KA 3TRKA 4CTJA 4ER7A 2H1RA 4OA8A 3UJ7A 4IV8A 3OFJA 5FUBA 4LWPA 3CJRA 2CMHA 3KU1A 1SG9A 1VIDA 5EG5A 3P2IA 1KYWA 3I53A 4Z2YA 2JG3A 1D2CA 3FTEA 3MGGA 2ZBRA 1EQAA 3ELDA 3R24A 5E9JA 4B17A 5BW5A 2I6GA 1P1CA 1D2GA 1NKVA 2JHCA 2PSSA 2O57A 3MTEA 4U7PB 5EEGA 3GRZA 4FT2A 5EIWA 3TQSA 2B78A 4G56A 4RTQA 1N2XA 1NW5A 5HOQA 3ER8A 2YUIA 5EC8A 3BWCA 4K6MA 4R8SA 3HVHA 2KW5A 4M36A 5E9QA 3KQSA 1Y8CA 4QDJA 4Y30A 5FA5A 3HVKA 5FULA 4R8RA 3E05A 2QRVA 3FRHA 2NXCA 2EJUA 2YXLA 1WG8A 2Y1WA 3LCVB 4E2YA 2IGTA 5K0BA 3X0DA 3A26A 5ICEA 3IV6A 3OCJA 3FTDA 3KR9A 3RODA 1WS6A 3KHKA 1XCJA 3BWMA 3MAGA 3PX3A 4PYIA 3FUTA 5FWDA 2I62A 2IDJA 5K03A 3MHTA 3R9XB 2HMYB 2PGXA 3B3JA 4FSXA 1P1BA 3LECA 3Q7EA 4V0RA 5FHRA 5FHQA 2AS0A 3TLJA 4E32A 5F2KA 3Q87B 4HRAA 5IKMA 3ELWA 4DKJA 1RI5A 4YV1A 4XUCA 1XDZA 1VLMA 3KQVA 4KIGA 2BH2A 3I58A 2B9EA 5P8WA 4UOEA 3HTXA 5CCBA 4MHTA 1YB2A 3CVOA 4C04A 2XVMA 2B25A 3PFGA 1QAMA 2O05A 5FCDA 3TM4A
chains in the Genus database with same CATH superfamily
1DPFA 3GZNA 3U4IA 2CL6X 4W7SA 1ONSA 4YRZA 3R5XA 5LPNA 4IMJB 1QXSA 2PMKA 3CKYA 4RULA 3T3MB 1JJAA 1D0VA 1N0IA 1N3BA 1G0NA 2W8BB 4HGQA 1Y9JA 2Q62A 4W7IA 1QGYA 2C7PA 2WJHA 1Z7WA 3OZEA 5EMKA 3TSZA 1AZTA 3FPSA 2A9JA 2EZTA 1J5PA 3FNGA 4NMXB 2O0KA 4EG3A 4F4JA 4AL4A 4R1TA 5JMOA 1HORA 1KNQA 4YHBA 4DA0A 1SKBA 2ID4A 2ATIA 4MKHA 4QJ5A 5LJLA 5MDHA 1KQ3A 2HWUA 4K6HA 4XA8A 2JAQA 1C7RA 2C29D 5TJ9A 3Q5EA 2PEZA 3M34A 4LNAA 4C7OA 1SBTA 3KT6A 3KYBA 1AGXA 1O97D 4DR6B 4O5AA 4TLDA 1COWA 1V7QA 3MMPA 3X2SA 1VKJA 5CLLA 3ROZA 5REQA 4UTRA 4F2WA 2CT8A 4C3ZA 3WV5A 1RYBA 4HY3A 5LNK1 3JQ9A 4R5HA 2FK7A 3Q8LA 1L7QA 2PG3A 2E2WA 2BD0A 3MAAC 2VN8A 4RZQA 3FX2A 4H35A 4OH7A 2B94A 3DE5X 4Q1DA 3W3AD 3OLWA 1DADA 5CCDA 2Q4OA 1I7SB 4K05A 4M9SA 1NQAO 4BCDA 1SVWA 5B7NA 2F8MA 4LE2A 4AJ9A 1N9GA 3IBSA 1OW3B 4IUBS 5J2UA 4I2NA 4PWYA 4CFSA 5EZQA 2RGDA 4UVHA 1P2SA 5ED0A 1CB0A 4IIBA 1MOZA 1CDOA 1DIRA 2JZOA 3B12A 3MUNA 4IIFA 2V9CA 4Z9YA 4AKTA 5ALFA 3PCTA 1QZ3A 4ODIA 4HI0E 3HFJA 1AZWA 2HIAA 5CLHA 2CBGA 5LWQA 3TOCA 3IP8A 2ENWA 3UUFA 1KMQA 1K6EA 3M4NA 5TNXA 2QT9A 5D3QA 3GRVA 1IQUA 3B52X 1SD5A 2OAP1 3EWAA 3THRA 2AOWA 3IFSA 1D1SA 3ONDA 4II3A 5J5VA 5LR6A 3R9WA 1E5QA 1OLXB 3OTGA 1ZGJA 4KPUB 4A2CA 4AMYA 4OI4A 4XRGA 5B36A 4PU0A 3WLKX 3LP6A 3QFSA 4CETA 4IMIB 3P9YA 3ZDAA 2ZVQX 4O63O 4FMBB 3OMWA 3FOBA 4DZRA 1EWTA 1IY8A 1OPRA 3OBBA 2XHEA 1YZQA 3EQ7A 4MV8A 3VQTA 4BMOB 5J1SB 1P17A 3MT8A 4XWKA 2BBSA 4RD6A 5GZ6A 3V4LA 4ZDJA 1IE3A 4ND6A 5NLLA 4FJ0A 1F2TA 4M4SA 1ICIA 3SPXA 1HDIA 3KPWA 1EBFA 1AX9A 3OQIB 3AFGA 1E3IA 1C7FA 2FCAA 4ADSG 3U56A 1W5SA 2BC9A 3M6IA 2NADA 3ONEA 4O1HA 4J3JA 1M1NA 1LBEA 1UJ2A 3IP9A 5IXSA 3U13A 1GITA 5J2TB 5EI5A 4EA8A 1QYRA 2BLNA 4KQ6A 2BGNA 1MIHA 3QEAZ 3KSMA 4JT8A 1D07A 1KO8A 1AZLA 4EHFA 1T2CA 2F7SA 1OFTA 4NIMA 1QR6A 1U6KA 2CHGA 4MR7B 1GNQA 4X71A 3O4VA 4GOMD 2QMZA 1H4SA 5K0LA 4A3SA 1VP3A 1I2CA 3LKBA 2IYAA 1YRYE 2WOOA 4E70A 5LOVB 2OBYA 5DYNA 2YL2A 1M2GA 1AE1A 1PL0A 5J5AA 3MQ4A 4QJBA 3RI3A 5HJ5A 1A7UA 5AK5A 4WBNA 3PFKA 2ZFUA 4LZAA 2EL9A 3T9BA 3TSCA 3ZS9A 4BO9A 2LDBA 1S3FA 3N8NA 5FPYA 3EY4A 2UUCB 4PONA 4ZO8A 2XZDA 4KQJA 3ZWVA 3DMTA 5IUKC 3N2LA 4JWTA 5BMOA 3CG0A 2D5BA 3IEPA 2XKJE 3WP1B 3WNVA 4DV4B 1N1MA 3RRBA 4HXFB 5AOVA 1KE1A 4A92A 2I0FA 3EW9A 2J59A 4G8JA 2F55A 3WYBA 1R10A 4HWPA 1S3IA 2FEWB 3ZV3A 5K20A 3AP3A 1FLAA 1NATA 1OZAA 4S1VA 3DLAA 4MRVA 4V03A 1FXUA 4K9KA 5E6SA 1A76A 5BO5A 1SKYE 3LHSA 1W73A 3A1TA 4WBNB 4PLHA 4CMBA 3OT1B 1JB1A 1TX4B 3EXFA 3IAAA 1KAGA 4GICA 4EKIA 3MMXA 3FNQA 2PXAA 5C8VA 1J00A 4FMCB 3QUBA 3AR6A 1X7YB 4RVNA 3ZY2A 4B3IA 2PFKA 4D26A 1QIGA 4A8PA 5KWVA 3EIHA 1G18A 3A6JA 3IKJA 1RXIA 4I4TA 5G0UA 3IEIA 1H8HA 4GVPA 4OL9A 3QI2A 4OU4A 4WOCA 3RV3A 4AWBA 2Z8XA 3QKSA 4TZ6A 1CY1A 1Z88A 2FX3A 1GQYA 2F59A 5DK4A 2IH4A 2KX7A 1OA1A 3M70A 3SE7A 1MENA 3ZK8A 4Y9RA 3HWSA 4NBNA 1WLYA 4LJAA 1D04A 4FMDB 1FRQA 2E4WA 2G0AA 4A23A 1UC4B 2IYUA 2FLVA 3C41J 2GBLA 1W4ZA 3OPXA 4JBIA 4NF2A 5CP8A 1NM5A 4YO8A 5ETJA 2C58A 2WJWA 2QDXA 1XJWA 2BLLA 1SK9A 4XVUA 1D0SA 4YLGA 5CA1A 4Z9XA 5C0OE 8MHTA 1MC5A 2GS9A 4H2DA 4QHTA 3O94A 2OV6A 3Q98A 4ZVTA 2HU2A 2FUKA 4KBFA 3QPUA 2QN7A 3SHVA 2RHMA 3HXTA 4H9GA 4AROA 1DEHA 4WY8A 2H7CA 3DOOA 1L6RA 4PTYA 4RD1A 2OO3A 2O1SA 2DJ5A 2IQIA 2B2CA 3C6BA 1OFVA 2HV9A 4IICA 5EWJB 5C81A 4YB8A 3H11B 4PO3X 1RXYA 4LHYA 3DB2A 4Y3UA 5FOWA 3ZTTA 3QP9A 2WMNB 4F3RA 3C6YA 4NZOA 1O95A 3A3KA 2DPMA 4UTZA 2IHVA 2FW7A 1JECA 4ZU6X 4HEQA 3O90A 2OFPA 5K0JA 1GPDG 4YAOA 5IWCA 2GCNA 2GEKA 3EAGA 4UQOA 4UUBA 4V2UA 4C7OB 3LCMA 1LD3A 1JR3D 4KVFA 1DFIA 4FJ1A 1CRQA 5IDXA 2EZ8A 3UQZA 5C3MA 2CV0A 4Q3KA 3FWNA 2IZ5A 1IONA 4TKVB 2FPIA 2ECFA 2PLWA 3UOWA 1CJBA 3AI1A 4WZAB 4BEVA 5JCJD 5JXJA 3R7BA 1ZEMA 2V9ZA 3DKIA 4D6YA 2OWEA 4C0WA 4RMGA 3TAHA 1N32B 4TMYA 2J9FB 4YJDA 2EGHA 1MAWA 1KOLA 5I4IA 1YJAA 1APBA 1A5SB 2PWPA 1CBUA 2K4MA 4OCZA 1CJUC 4B47A 1OXUA 1XTZA 3KIPA 2BMDA 4HWGA 4IOJA 5AXAA 3ZOZA 4C4YA 5BMVA 1OGJA 2JDIA 4HDNB 4CKXA 4L9WA 5H3HA 4QM7A 1A9RA 3O8OB 2ZUCA 4IIUA 4QSMA 2V5UA 4LMBA 3VR4A 3JR3A 3A9RA 4IZHA 3GWZA 3DDUA 1VE1A 4HWOA 3SJ7A 2FWBA 3V7WA 2UYYA 1IWOA 4P2GA 1E3JA 3GD7A 3NC0C 4V3BA 2IW1A 4GP7A 2IZ7A 5T4HA 1ZW1A 3UG7A 2GRJA 3H2IA 3RTBA 4MJLA 5JNTA 1RRMA 1PGQA 3KEMA 1DIHA 4LGCA 4TTAA 4OBXA 5EJMA 1OIXA 3IV9A 3TZEA 1RLUA 3FYUA 1PR1A 2CZGA 3OEHD 2PCJA 3H87A 1TNDA 2WJZB 2C94A 3FPEA 4IIXA 3WYDA 4DE5A 5FPHA 4KR9A 1VMIA 2C5FA 2O2IA 4EVIA 4UAJA 4XASA 3R5FA 1Z07A 1YUNA 3EQ8A 4H08A 2CXTA 2QF7A 3WIEA 5ADUS 1VIVA 1C30A 3E7PA 1ODFA 3NP9A 4KPGA 2B6HA 1WU7A 2V9PA 3K8ZA 4KK4A 2AIRA 1JKXA 4P4UA 1PL8A 3KT3A 3ED5A 1U1FA 2PEYA 3QKTA 3U7EB 2AOUA 1Q11A 4DSOA 4F4CA 1XNJA 2Z9BA 3BDIA 3UT5A 2BTEA 1GTSA 2C31A 1KR5A 2X9NA 4RHXA 3UMJA 1YK1A 3B70A 3LPDA 3I64A 3QIVA 4KZPA 1XQWA 3AV3A 5TRTA 2Z6UA 1UODA 4ISCA 1F12A 3M9WA 1IPEA 3REGA 3U5ZB 4DEYA 1GO2A 5JSHA 2PRJA 1NVKA 1Q50A 5LBIA 4XGKA 2CLOB 3OQJA 4V39A 2WQ6A 3C3EA 2HIHA 1I5EA 5JXGA 3RSLA 2ZBFA 2QRKA 1U7ZA 1CS4C 2VI5A 2WSYB 3DLTA 3K5PA 5CLFA 4MRSA 3HY6A 4IQ8A 1U8FO 2WVHA 5JAZA 3W4IA 2EG5A 3R3SA 2ZT6A 3BHNA 1FVXA 2DOKA 3EGDB 4NAHA 4P33A 2JHAA 3SS7X 5J2UB 5K0CA 4EOGA 2GT1A 4XE5A 2AN5A 2EKZA 3V4RA 1Y7PA 3KE9A 1Y6QA 4P6VF 4DBLC 1SCUB 5J4HA 2EKDA 4MQLA 4MEBA 1TZKA 2PZ8A 3NM5A 2BTQA 2WM8A 2QTHA 2DQZA 3ESXA 4MW6A 3MJEA 2XWBF 4D74A 4J1NA 4FBLA 4N03A 3D6VA 2VHXA 3CWQA 2YXDA 2AKEA 5CT4A 2XVAA 4HD8A 1X94A 2QLLA 4NMMA 1CB7A 4K8OA 3U39A 1P2VA 5HG0A 4EATA 4IOMA 2JH8A 4KXXA 3PQ5A 1FP7A 2RJOA 1P6QA 2QTFA 4NFYA 1FMFA 1EEXB 3MRXA 4KG7A 4QBTA 3R7NA 3ND9A 4DSAA 1QCZA 2A5JA 4ENUA 5DK6A 4FCTA 3GLGA 3CH5A 2WJ4A 2VH1A 1FLNA 3GT3A 4IIJF 3HV2A 5ILOA 3AM1A 1R27A 3QWFA 4ZOLA 3D5EA 2QX8A 1MJ5A 3W1VA 1YRAA 3LY9A 4GM0A 4JLSA 4IIEA 4JYMA 4ZJPA 4PYMA 1DINA 2GCEA 2ENUA 4BLOA 2PKXA 3K9HA 1YJXA 5E7QA 5TMBA 3BJMA 1QK5A 2VPTA 5CBPB 4Y2GA 1JDJA 3MGCA 4UHFA 1W0KA 3NTVA 4ICIA 4LN1A 3UAOA 2ADMA 2Q9UA 5F4BA 2QP3A 4YP6A 1DSSG 4C3OB 4XQEA 4C2UA 3GVPA 2QMEA 5CVEA 3UK7A 1EH5A 2IIPA 1HH4A 2TS1A 3H1EA 1NBWB 2CLSA 1UMDA 3HVIA 5DNWA 5DXFA 1SOUA 1P5ZB 1ZI6A 2ZTHA 1QHNA 4I2VA 3LFHA 2NUTB 3VVCA 1YQQA 1PT8A 3FYTA 3A1VA 3G2OA 2G1PA 1KH2A 3IT1A 2CK3A 4XYEA 3N2YA 1TT5A 2FFQA 4TV8B 2QRZA 2VDKB 3AF5A 4BQEA 3PENA 3KQUA 3COZA 2PNFA 4XXHA 1P75A 5P21A 1U0SY 1XAHA 3OZSA 4RH1A 3N0RA 3PXCX 1RYYA 5E8JA 2KI5A 1Z6XA 4LY3A 1DBVO 4KDFA 4EUHA 3FROA 3O5AA 3NBUA 2R6CA 1O95C 3ENNA 4R1NA 3COWA 4OQFA 4QDKA 1WZIA 2VHQA 1DBWA 5GIPE 2PS9A 1OKKD 1BRMA 4YREA 3U4MA 1NI4B 3GZJA 1VMAA 3G82C 1PQ4A 4JQSA 3RAGA 4UPEA 1VBNA 4DLAA 2JFWA 3AU8A 4C07A 4Q47A 1VRCA 1IBKB 1E2IA 3AP2A 2WP0A 1UBTS 1OBVA 3TCKA 5KOJA 2XY4A 1U7HA 3P4YA 3K70B 4H7FA 3K0EA 4NPAA 1KMCA 4A9AA 3EQZA 2IYPA 3GR6A 4Q9LA 1JLKA 2QGNA 4X90A 5JTUA 1BQ4A 4ZCPA 3OHPA 3OAAA 1GL9B 2C2YA 3L18A 4CTJA 2OAGA 2WJ6A 3HGMA 1C1HA 1NIJA 2QENA 5CU7A 5AI8A 1E8MA 2VTDA 3MWDB 4GMKA 4LWPA 2RD2A 5C18A 1J90A 2CMHA 3LHFA 1TM7E 1YZNA 1KHTA 1U9IA 2L18A 4KCGA 1RYFA 4PSUA 4RD0A 4ZVRA 4TMZA 3W34A 4EBBA 4WH0A 3WXMA 1LTKA 4QGFA 1XTTA 3MGGA 4MUXA 1IIBA 3RBVA 4B17A 3QHQA 3FMGA 4LMRA 1YE5A 2C1ZA 4EUFA 2PYIA 2JLVA 1X80A 3AUAA 3LIIA 3LRPA 4G4SP 4TKUA 2PUHA 5CA0B 3K9FC 3QVMA 4RPHA 4AG5A 3QX8A 5BV1A 1YBAA 2PAFA 4ZOBA 3SBDA 1R0YA 1JKFA 3AW8A 4DHWA 2R00A 1U2QA 1TC2A 1ZIPA 2W4QA 1J42A 4Y30A 5AUOB 1XZPA 4OSOA 4HNTA 2JIRA 1R9MA 5EIOA 2BBWA 3OZGA 3ZQUA 2EJUA 3LCVB 2VTBB 1W0JA 1FNCA 1RXUA 3GI1A 3MWKA 4GR5A 2IS1A 3AFNA 4EHLA 3D6AA 3SXUA 4EEZA 2F9FA 2L42A 1Z7GA 2PBRA 3BDAA 3GNQA 4HXEB 4ZHQB 2OXCA 1Y5IA 4PG4A 1KMIY 4R2JA 1PWZA 2AFHA 4R5MA 4TKZA 4D96A 4ZV4A 1PJTA 4KMRA 1V5EA 4WV3A 1ODKA 3SEZA 1P62B 3DFMA 5IKXA 3HTXA 4AO8A 1YC5A 4C04A 1N0VC 3UUGA 1T91A 3CRW1 1SA0B 5AKJA 4F2PA 3AVUA 2R68A 1RAGA 3B36A 4WJLA 1ZVJA 1W93A 2Y1FA 3KEGA 4RZ3A 4K5QA 4Q15A 2OAQ1 2WIKA 3OPQA 3B7PA 3OPYB 3A6ZA 3W3AA 4RD4A 4WPGA 3ZIAD 2DETA 1C41A 4LNUB 2HJWA 2D8MA 1MW9X 1FNSA 1WD7A 2JD2A 2P9EA 3G7SA 4NCJA 1SQFA 3T3EA 5CK5A 1UKZA 2Z9CA 3BRQA 1JMYA 3AEUB 1H6AA 1HE2A 5DKFA 1RPZA 1EM6A 1W1IA 2VSNA 2Z2XA 4LTNA 2PJDA 2X4DA 3SF0A 3DDOA 3DYIA 1F60A 4EO4A 3PXEA 2O2CA 2IXEA 4MB2A 4K6FA 3P52A 1NT4A 2FPXA 2J5XA 4NZMA 3FZGA 5EJAA 2GHTA 2NG1A 3ONWA 2VF8A 1GTRA 2JKZA 1KYQA 1J21A 2YNMD 3DLIA 2KS6A 1Q1GA 5AKHA 5K3CA 1NV8A 2X4LA 3FJ1A 4C3UA 1BMFA 4P93A 3UJDA 1U2ZA 3RS0A 1IN5A 1EINA 2DUJA 1FYXA 3JAKA 3F74A 2HQBA 2NLOA 2JBHA 4BC0A 4OKSA 4RY0A 4DQXA 4LAFA 4P1ZA 4LYGA 3G6WA 1E1KA 4UM8B 2EWWA 3QNMA 4O4JA 5F7JA 2FHPA 3RC3A 3MQFA 1BH2A 2OHIA 3FPKA 4LYAA 4U0KA 5DASA 5ISMA 3EFHA 1ND5A 4MUGA 1DBIA 1U0BB 1LF0A 4OLJA 3IIEA 3ZZ0A 4D79A 5ENZA 4HQ0A 2DT5A 3CYFA 2D2VA 1YNSA 4INJA 5I7RA 3EF3A 3USES 4X8LA 5JS1A 3HCCA 1QS0A 1OFUX 2QLBA 5BW8A 2CNDA 4YAFA 4BNVA 4TN5A 1VGVA 4QYIB 2OD9A 1GADO 3AG6A 4FGWA 2QD4A 3EISA 3KFLA 4EPVA 2CFTA 1LK0A 3IOMA 4R98A 5LUBA 1TTTA 3N0VA 3QBVA 4LF7B 2IEDA 1PZNA 2GA9A 3EBOA 4KXNA 1EVYA 4HQOA 3FNEA 3FPGA 1BO6A 4LK2A 3K94A 3EULA 3EAQA 4J0QA 4OSEA 3DFZA 1OWMA 3I61A 1AMUA 1YQ9A 3WGOA 3ZDXB 1X13A 2I4NA 1AB5A 4TVKA 4QGBA 4XEHA 121PA 4PYOA 4TRRA 5D5HA 3DTVD 4EVSA 1A9PA 3JX9A 5KI6A 4N8SA 1XB2A 3AJEA 3PRJA 3BWYA 3T5CA 4FLMA 3KZNA 2XE4A 4OQLA 4CQMA 2GBFA 1EX7A 3RADC 1CJKC 2RHDA 1SAYA 2H2DA 4KUHA 3E3AA 4LX8A 3OOSA 3GLRA 1U3FA 3C0KA 1OR8A 2O8FA 4HSEA 4Y2QA 4U8HA 3BIOA 4W82A 3WTBA 3AQ4A 4JDUA 1J23A 1O6ZA 4PE5B 2OVBA 2HWKA 1NVFA 2RGNA 4C0SA 3QKUA 4KQEA 2XH8A 1E4VA 4Q9NA 2DUNA 5IM5A 1ZGHA 5ALTA 4DUPA 4POOA 5KQPA 1THMA 1BFUA 3E70C 3X2FA 5AVWA 3SLRA 1GAEO 2DF8A 1U04A 5KVVA 2R8EA 3OFND 2X40A 2PT5A 2REBA 4X1KB 4HT3B 4B3BA 1MO6A 1ULTA 1AN9A 1EGHA 1ZPDA 2PVPA 1I0IA 4NOJA 3QLUA 2BGJA 3M5DA 5JRZA 5LYJB 1FQJA 3HQ4O 3ZGNA 1RMYA 1NHWA 2ATEA 2O2DA 3ZDZB 4UKDA 1AMNA 1JZQA 1GAQA 2G72A 2OCIA 3H16A 3P9CA 4ZRDA 2AXNA 3C3KA 5FWYB 4RHTA 1WUYA 4HQNA 3D1VA 4KBYA 5EKUA 3ROKA 3RBZA 4DM3A 1T26A 2Y05A 2PVCA 1L3IA 5SZKB 4AIIA 4MA5A 5G1PA 5KKAA 1TA9A 1R16A 3LYLA 1Y4UA 4M8NE 1JTFA 3TM5A 3PWZA 2QDKA 1GKKA 4K9OA 5FFMA 5C51B 3MRSA 2EOAA 3K0CA 4ZVLA 3G9XA 3ZU3A 5K6RA 2I1VB 4BVJA 1YB6A 3LWDA 4PYLA 2E6UX 4MRMA 4BP8A 4ER0A 4JI1B 1K88A 2DWQA 3TQRA 4E1VA 2JAXA 4EW1A 5LFAA 1I51A 2QVLA 5KQGA 2AW5A 3E53A 1GRRA 5IBPA 4AKEA 2B1GA 4RTSA 3Q12A 2AG0A 1XXLA 1YDWA 3N0WA 3P4UA 2H2HA 1AY0A 3DKPA 3NOQA 5TR9A 2AD5A 1ODJA 3R7WA 5HWSA 1RABA 4WOBA 3PQ4A 1USWA 1G3UA 4MO2A 1Z2CA 4FQ8A 4IS2A 4LQ4A 4ZDWA 1PEDA 2AR9A 3I23A 1Y1LA 2A9QA 4P54A 3LKDA 5DV9A 3CINA 3W2GA 4LRUA 3W9BA 1O6BA 1N2SA 4GKBA 5F1OA 5AVSA 1R4MA 1JLLB 2IEAA 3PA6A 5A9TA 1BS2A 4DG5A 1SHUX 2VEOA 4L8WB 5BWNA 5IKEA 2Q5IA 3T5PA 1CR6A 3P9KA 3K4PA 1W5FA 3MYYA 3Q7QA 1PGOA 2XJ9A 3AB8A 3NCTA 3OQ1A 2W98A 2ZWVA 3P71T 2I6UA 2X8BA 1N2BA 1TIBA 2G88A 2MHCA 4BJ5A 3I2IA 4EJSB 4EG4A 1I0LA 1USIA 4EB0A 1SPBS 2EATA 2GEJA 1Z08A 3N3BC 1JYEA 3ETDA 2Y9MB 2HMTA 3GPDG 1SC1A 4MYCA 4CM8B 5JYDA 3N0XA 1DC6A 2ABWA 4JY7A 5BWLA 3HI4A 4QDZA 2RBGA 1RPNA 3CUWA 3KKNA 1PFUA 4RSRA 1I7DA 3TG2A 1VG8A 2ZTVA 3G2NA 3HCAA 2O8EB 2XUZA 3HKDA 2CLMB 4ZC8A 1E99A 4HSGA 1WBBA 2RGRA 1YMUA 4ZQHA 2BDTA 3DDCA 4OEHA 4MUJA 5AR1A 3O8NA 3TAUA 1EFCA 3V97A 5CFRA 3BWVA 2KM1A 4I9NA 4PG5A 2Y27A 2HCFA 1G2IA 3UGQA 1LH0A 2D5CA 4XQ0A 3CZ5A 4EARA 1GTL1 4JI2B 3KKEA 1MT0A 2ZSAA 1G38A 1AO0A 3N87A 1EPUA 5KNBA 2B36A 2D5IA 2ONYA 1MFZA 3OSUA 4LFAB 1U7WA 2BFCA 2HM7A 3GJ3A 2MMGA 3UB4A 4BNXA 1P0PA 3S2ZA 3QLVA 1U7TA 2BWJA 3M9LA 3V2IA 4WY2A 1B76A 2CFIA 1T0PA 1YMQA 1T9GS 3LA8A 3HU3A 3RYHA 1RJ9A 2Y4OA 1E9AA 1TVCA 1O08A 5FBWB 4B6GA 5DULA 4ARCA 5ICMA 5D51S 3M5WA 1PTKA 4OD0A 4HX2A 1P9OA 4RSGA 1E3WB 4WFQA 4BYMA 4TS3A 5JWRA 2VF4X 2YYSA 1EQ2A 5FPPA 3DBLB 1EXWA 3DPIA 3HGQA 3PVSA 2OQRA 1JQDA 3S5UA 2YW2A 4LPSA 2PH1A 1WWKA 4JEIA 2Z95A 1DE0A 1TUEA 2HA6A 5H80A 2VBIA 3ZU2A 1EDOA 3CISA 5NULA 1R6VA 1H05A 4ZOQI 4MJXA 2H8GA 1KH3A 4C0JA 6REQB 1WP4A 4Q3OA 3VU1A 2XRFA 1QNLA 3EEYA 4RORA 5FTJA 4NU6A 1Q1EA 2IU3A 4HN2A 1LEHA 4NV1A 4G8CA 4D4GA 5K45A 5IARA 1DI0A 2FN8A 2YY6A 1U8CB 1WNTA 1ZD1A 3E84A 3ZEIA 1QHIA 2I2CA 3FMFA 5LN1A 1IM8A 1CQIB 5CJPA 2RARA 2VP5A 4HRYA 4KFRA 4WNCA 4UVEA 1DUSA 2RI0A 4AICA 2ZULA 3M7IA 2MYUA 2FDCA 1Z56C 3E7WA 1KRWA 2AB0A 2AOTB 4FDUA 2O6LA 2FEPA 4JR1A 4X7BA 4BZZA 4DLWA 4C4SA 3STVA 5EMMA 1U80A 4KXFB 1EVQA 2EC5A 1BG6A 5AVOA 1E92A 4ALNA 5JS8A 4UDOA 2WJAA 4ABTA 3PUIA 3JQCA 4YCBA 3QXJA 4DC0A 5AJZA 3R8CA 3IIMA 1PT7A 3LBYA 1YIDA 2NNLD 2NPIA 4WUVA 4CDRA 1L8OA 2VHVA 2Z5VA 3DDZX 4XDHA 4YJ2F 3FPFA 1D7AA 4UZFA 5DXAA 3KUCA 1FA9A 4O4LB 3V8NA 4EKDA 1RQPA 3OT5A 5TVKA 3S68A 3P7MA 2O1XA 4MP6A 4MA0A 1D2AA 4CMEC 4TGLA 1IRXA 3OCUA 1SXJC 1Y82A 2NUAA 3QX9A 1UMKA 2I2WA 5FAXA 3IEXA 3X1DA 4TVOA 1RXWA 4FHZA 3EIUA 5ENVA 1KBZA 3EMVA 1FB5A 1XAIA 3RKRA 5AQ1A 2QGZA 1TEHA 5C9ZA 1VRVA 2CHQA 4UXIA 3JARB 2OZLB 4IGFA 1WMDA 2HI0A 2XOKA 4JJZA 4XDYA 4NICA 4XWOA 3LIPA 3TE6A 1P39A 4YRBA 1FS4A 5TPWB 1IWBB 3OTQA 1KQFA 1Z37A 1U2DC 2E5WA 4MICA 4HNAB 2YJGA 5FBHA 3W90A 2AN3A 4X95A 4RGBA 3VHLB 4E94A 4R4JA 2IP1A 3ZHCA 4A8TA 2EJCA 5IU6A 1XV5A 1PN3A 2FU5C 3GEEA 5CB4A 3QOWA 4UM7A 5FR1A 1QTRA 4ZQCB 5K4AA 3E61A 3G5TA 3AU9A 1HWYA 3LDGA 2RAUA 1WRBA 1NUAA 1YFZA 1NF3A 2H8KA 2XA1A 3AR3A 3TRIA 4BKPA 4C4PA 1YR8A 5EYPB 1Z2EA 4LWOA 1XK6A 4JI6B 2E85A 4G0XA 4KI7A 3TN7A 5A0TA 2HH9A 4E08A 1L7AA 4L0MA 1BXGB 5GVSA 4X44A 1TYAE 1AXEA 3ND8A 4LDAA 2AQKA 4ZGBA 5ABPA 2OMKA 3EEQA 2RI6A 2VPWA 4X94A 2HB6A 1T9KA 3G85A 1B0PA 3GAZA 5SZHB 2VP3A 3ILHA 3KZCA 3F9CA 4L3OA 3L5KA 2Q8PA 5DBHX 3JQAB 2VNIA 2CL5A 3VU8A 4PZDA 2FZ5A 4FYVA 3MWEA 5CAEA 4PBTA 2PLFA 5JSQA 3KJHA 2ZPTX 1WUHS 1BNCA 5TSDA 2RIPA 4OH1A 1KFKB 1VSVA 2OWDA 2ZE8A 1JJ7A 2B37A 4V0KA 3QE2A 2HU7A 1BJRE 1UM9B 2BEJA 2G36A 3DWFA 2J32A 4U0JA 4P4GA 5CPBA 3UHFA 3HXPA 3QYPA 1W7AA 4BP3A 1DAEA 5EZYA 3LF1A 3ZU6A 1U1EA 4FNMA 2AF3C 4LS3A 4PIMA 2HYIC 3A4NA 5LLSA 3GFPA 3LUCA 3D0OA 3WV4A 2QZ9A 1GNTA 1RLTA 3PK0A 4WASA 4AQDA 3NPAA 3IEMA 2CSUA 4L78A 3R0IA 3GJ0A 2YWGA 3CBQA 1HG0A 1GGMA 4HLCA 1RAEA 4X84A 4EHHA 3F2IA 2BCJQ 2X0KA 2GPSA 1E69A 2UV8A 4XVQA 4CV1A 4DCPA 1NQWA 1EX1A 4BPRA 3O1JC 1QH8A 5BSUA 1US8B 5SYNA 4F3KA 1INLA 1RRVA 1SU8A 1Z7YA 2UUPA 4NBTA 4P4SB 3STTA 1E4EA 2JBAA 3SYRA 5C1OA 3O8DA 1Y9DA 2OV1A 2FV8A 4Z3DA 3L7NA 4EHNA 3I9V6 3NBQA 1CERA 4Q02A 2HPAA 2Y1XA 4IJKA 1WKCA 4CKBB 1PR2A 3PPVA 5ADHA 3QIAA 1D3AA 1P9RA 4MIKA 4QQKA 3VR5A 3NFRA 1KO4A 3EG5A 2YIJA 3GK3A 1HL3A 4P8RA 3BD7A 1MF7A 4D81A 4F3TA 2A1TS 3EGCA 3IURA 3Q1LA 1N7IA 4M8SA 3VAZA 2PZKA 5A1JA 1WB4A 1Q1BA 1BXZA 3KSAC 2EKQA 1GAJA 4Q9DA 4BLRA 3D64A 3FAZA 1MNAA 3B6ZA 3LQ2A 4QATA 1UZLA 4RENA 3RFCA 3V1MA 1I2ZA 1N9ZA 1RCTE 2PO7A 1OPXA 3A9SA 2HMVA 3KQKA 1U1IA 4M0KA 1DEKA 2I7XA 1E7RA 1ZS9A 3ZTYA 4AJLA 3A3NA 4WEOA 3IUEA 3A3OA 1EVLA 1FFGA 2WWFA 2ZYHA 4QU9A 3LLMA 5AO9A 4MUIA 4Z2YA 3CLSD 3D3NA 2PGDA 3I2HA 4PZPA 5C8XA 4NYJR 2CUZA 3KTDA 2GD2A 4ZO7A 5CCEA 2AG5A 1P1CA 2BKAA 3ZWBA 4BO3A 5IFKA 4KSYA 4M9XA 2WDPA 2A92A 2G4VA 1FJGB 1H5NA 1AKMA 1KI9A 2Z0MA 3I5XA 1IVYA 4UNRA 5JO0A 1SCAA 4IPTA 1Y1RA 2ZJZA 1Y8ZA 1OLSA 4Z0NA 3NWJA 1IRIA 2FY8A 1MVNA 1NX9A 4EVRA 3UTCA 3UJNA 1UJCA 1PS0A 4U6QA 1F5NA 4TZTA 3ADDA 2M2IA 3KZOA 1EK0A 1CJCA 1YAHA 2AC2A 1U0JA 2BGRA 1GUAA 2QLFA 4IMPA 3SYKA 5CXQA 1OFUA 1T4MA 2O3QA 2V6FA 1KEKA 2QLJA 2GPNA 4LQCA 4EG5A 1POWA 1I4EB 3R9XB 1A4RA 1T9AA 2DP4E 4F3YA 1Z4IA 1JLSA 1Z25A 2VCHA 2UZ0A 4O4JF 4BGDA 3VSAA 3LQFA 3VTKA 4YV1A 1W5AA 4XUCA 1QVWA 1PQPA 2CNNA 2BH2A 2ZIVB 2Z09A 1TTQB 2JCSA 5B53A 1VHWA 2WAMA 3WL6A 1EGAA 4F5YA 5IF3A 4TWRA 1Q20A 3LM8A 1NYQA 2XAUA 1Y98A 3HADA 5A5GA 1KP3A 4R3WA 1JG3A 4TS1A 4HDSA 1V4BA 4L6AA 4IOKA 1L4NA 2FZ4A 3EH2A 4PAOA 4XW2A 4GU5A 4YFVA 4FGLA 4MKRA 2A14A 4A6EA 1PCXA 3TVDA 1PAUA 5JCOA 2IK8A 3HJTA 4DAEA 4A0HA 2YV3A 1ORWA 1QX4A 1GRQA 2WIJA 3MHPA 3BRSA 3WA6A 3IR7A 3IPYA 1FDTA 2BEUB 3K5WA 5L6MB 5CURA 3LVQE 4K3UA 4HAYA 4FR5A 1QQTA 1Q22A 1R8XA 2WOJA 4LJKA 3HXQA 3LYHA 3TKAA 5TPZA 3BREA 1T0UA 3M9XA 4URYR 1KNXA 1Q6YA 1YJQA 4I8XA 3ROTA 3VR5H 3U9SA 4UBLA 3S99A 4ITUA 4US1R 5C4GB 4DWWA 3ITEA 1GIAA 1V9SA 3CCFA 4L07A 4UXJA 2VWQA 3AVXA 3HCNA 1JFVA 4B87A 3OM1A 5EYPA 1JEAA 1J0CA 3D54D 3U1VA 1S1MA 3R74A 3EZYA 5EMHA 2IOYA 4C7KA 4RIFA 3BJEA 3ZJYA 3WX0A 3U9TA 1DGQA 1T9DA 1PU2A 3B2NA 4ARZA 1J8QA 3I6IA 4HDRB 2UZ1A 1RFGE 3QPDA 4XOUA 1GGNA 3QLEA 2OBBA 4ZODA 4BV9A 3OQMA 4AKIA 1A27A 2C96A 2YJTD 1NXOA 2ET6A 2YINC 4LXYA 5H83A 4YJFA 4Q66C 1QP0A 1RHJA 4KVAA 1M6NA 1QOPB 1S9DA 2DC1A 3EZFA 3QBDA 4YFYA 3UC5A 4GZ5A 3QU4A 4AC9A 4JL6A 1JFTA 5K51A 3LQ4A 1DJOA 1X1DA 3V4SA 4YCCA 2DFVA 4LRYA 4OAPA 4FS3A 4P58A 3R0VA 1ILEA 5JH7B 2PYZA 2DHQA 2A86A 4E07A 5KTOA 1E2FA 1XR3A 3EK2A 5HCNA 4ND2A 2QROA 1W6UA 3X44A 1KI1A 4KRGA 2O2SA 1LLDA 2GSWA 1SQSA 4UNNA 1XN4A 4M0UA 5THKA 1ATZA 4NOMA 2A8YA 4F84A 2HC9A 5GQSA 4A2PA 1JGTA 3PNVA 4LWQA 3BF8A 3T3IA 3I5MA 2OUKA 4ND1A 1DBSA 4I55B 5J4VA 2VIIA 2QUKA 1V2GA 3LUDA 1LFAA 3QKRB 1W4RA 4M60A 2ZJ7A 2J6HA 1C0EA 3PV0A 4KZKA 5F12A 4C1NA 1L7DA 4MULA 4A10A 3HM9A 3AL0C 5JS7A 2OHFA 5EXSA 5EXTA 5IAEA 3KQHA 1HE5A 2IPAB 4EG1A 2JC3A 1DRWA 1J9EA 3LQ1A 4XWYA 3AR5A 3WYCA 4R0MA 1TGVA 5FWAA 1Z0FA 4BWFB 2QT1A 1OAAA 3DC2A 3DE7X 5BNWA 1NUHA 4NBSA 1XHFA 3UPUA 5H3CA 4DILA 3DPUA 5BN4B 3TLGB 1E2DA 3HKBB 4R2IA 1ZCFA 2ZSUA 3ZX4A 1UCFA 1UBKS 4R8VA 1Q92A 2NAPA 5KDLA 3T6KA 2R7LA 3B60A 4J2TA 5I47A 2N75A 1G42A 3REQA 1OUMA 5BR4A 2CF5A 3B5IA 1UJNA 2FSGA 3P19A 3QKRA 5A02A 2K7FA 2NU7A 2BFBA 1GPJA 1ZCJA 1PLJA 5IC5A 4GLFA 3FMPB 1S1CA 3HLYA 3OUUA 5D3KA 5IT4A 2WHXA 5CJ2A 3FTNA 4MQ6A 3DNMA 2R48A 3UC9A 2WABA 1QMGA 1R3UA 4GI3A 4I08A 3IVXA 3W05A 1U3GA 2PHZA 4E22A 3DV0A 2E87A 4RPIA 4U6NA 3UMVA 4GYKA 3DH0A 1QFZA 3CX7A 4Z0HO 1PSWA 5J4LA 3NDBB 2HK9A 2G71A 4BEWA 4PLCA 4LK3A 5TEVA 4OMDA 5ARDA 4UCFA 1CC1S 4IQFA 3B78A 4O3MA 4ZQBA 5T5QA 1XFAA 5D8DA 1P1KA 1E1MA 1OLSB 4BOYA 5AP9A 3CIFA 1EP2B 1X77A 3AZOA 3FETA 2JAUA 1PT6A 1YZKA 4OTZA 1P5HA 3P5BA 1NW6A 3GY0A 1OYYA 3O1HB 1UOQA 2CY0A 2VJBA 3R6WA 3E8XA 3EGIA 4DVJA 1Z8HA 4F6RA 1KQPA 4GI1A 4R0VA 4TMTA 3QY0A 6LDHA 4EYOA 4PQRA 4HZUA 4F1KA 3MINB 3ACDA 2ODPA 3FPJA 5ALLA 4V0OA 1L3CA 1KO5A 2RAPA 4V24A 1IHXA 4KIFA 4G4SO 5DB4A 1IL0A 2QB5A 3BH6A 3BXXA 4K9MA 4YR7A 1I01A 1M0SA 2FG7C 2QR5A 4XYBA 1W4CA 1J97A 1KSHA 1QFSA 2C5HA 5IK2A 4Z8YA 9GPBA 4YLEA 1PT5A 5EZ5A 1YR3A 1VQ1A 1I1OA 2E6KA 1KBQA 2HAEA 3K16A 3Q8WA 5D01A 5LU8A 3QX3A 2PT9A 2B5OA 3FZEA 2DT8A 1ZUWA 2XNDA 4Q3AA 4QOJA 3A28A 3AHJA 3FOAA 4QTZA 1M54A 4YUWA 2Q07A 3DEYX 3JWIA 4E2XA 4KPUA 4JI4B 1C9KA 1JS1X 1YCDA 3PUYA 4WGGA 4A5SA 5BSTA 4C29A 3HUUA 3FFBA 2H4WA 3N75A 1RYHA 1WZUA 2G7ZA 3LZ6A 1VBFA 4OQZA 4QRIA 1R6DA 3S7ZA 1P6UA 1FQWA 4EI8A 1PVOA 3RF7A 1Q7BA 4I5IA 2QJTA 3QA9A 4ILEA 2ZPAA 3Q9UA 5KUTA 1JKJB 2UYCA 3KB2A 5BNTA 1WR8A 3DULA 4BQQA 4V0NA 4JEMA 3SFVA 1RQLA 1M2VB 4D3YA 4OP2A 1X7HA 1Z5UA 1WHSB 4C76A 1Z0JA 1J8YF 1B74A 1T8UA 1U8UA 3T7TA 1YA8A 3F5MA 3TEMA 3TTWA 3TVYA 4YRKA 2PRZA 4C7JA 2HU8A 3FHTA 1GSOA 1N2ZA 3VZPA 1IAQA 4ENRA 3SYNA 1GXSB 1LSUA 2EQ5A 5EZYF 3OE1A 1GZ5A 1EHYA 4W9NA 2HMWA 5EKTA 1TMYA 3IVGA 3AX6A 4OHBA 2YXPX 3N1UA 4R6XA 3ROQA 2XDAA 2PYDA 1F6DA 1CRLA 3FH0A 7ADHA 1IBRA 2QQGA 5DEIA 2PQ2A 4ITRC 1Q0PA 3ZS8A 5K0SA 3NUQA 1K66A 2ZRGA 4MUNA 4O2BA 2UZ1B 3BXPA 3RW9A 1Y4ZA 4M83A 3V3KA 4D9HA 5B7PA 5E3HA 4NABA 1BS1A 4HNGA 3LK7A 1QR2A 1YI8A 3CEMA 1SOVA 1M8GA 4QPNA 3K31A 4ZVKA 4F85A 3GLHB 2XWSA 2FKNA 4H6XA 4N54A 3RUPA 3UAXA 3ZNOA 1L5RA 4REMA 5KX5A 3D1JA 2QTTA 1W4AA 1RWMA 4L57A 1X1BA 3WRXA 1TIPA 1GA6A 2AG1A 2CHFA 1TUGA 2V58A 3MCAA 5FJJA 1WUJS 3S27A 3SBEA 4KQKA 3I5UA 1KAOA 4LMAA 1ZL0A 3T99A 3UT6A 4DANA 1NN3A 4FB5A 2HIGA 5EP4A 1IHYA 2RDMA 1HT2E 3G0OA 3MCWA 4HDSB 4I1OA 2DFLA 2J9RA 1JDVA 2ATVA 2Y76A 3OJ0A 1IZZA 4OB8A 4UEQA 5A5DA 3NDJA 5JSZB 3TNYA 4OFZA 3F71A 4KVGA 4OOEA 5K8JB 4NC9A 4JYZA 1RNLA 2UXDB 1NLYA 4MWEA 1E0AA 4FOSA 1RW4A 3WKEA 2WDZA 3K5HA 2HKIA 1DRJA 3A11A 1LBTA 4MV3A 5AJTA 2BGMA 5DTJA 3P0RA 2R1VB 3U62A 2CMFA 1FSSA 3DR5A 5L3ZA 3REOA 1ZWLA 2C2XA 2ZEJA 1R5JA 3AVQA 3BGSA 1Y7TA 2OENG 1XEAA 2YZ7A 3K0AA 1NR1A 2M1XA 3LDFA 1II8B 4RVUA 4E5VA 5AW6A 4PPNA 3UJ9A 4AMUA 3V2HA 2ERXA 4GIBA 3WYAA 4KSBA 3L8ZA 4IJVA 3TQQA 3MB5A 4K26A 3WAGA 2ACKA 3ZQJA 2Y77A 2JBWA 4RY8A 3WO1A 2PX6A 5LD2B 3NUZA 4MV5A 3ZIDA 1XVAA 2H3EA 2VT2A 2X3YA 1ADBA 1CUXA 1R6AA 3VZRA 5F7OA 1ISSA 4RIGA 1UFVA 3SF8A 1NU6A 5BMVF 3JQDA 4BAZA 5IZ4A 4Z3KA 2YMPA 1IBSA 2C0CA 1DQPA 2R8ZA 5BVGB 1PE0A 1YJ8A 5DNVA 1N25A 3M5CA 4JHLA 2IH2A 1G5HA 3ENKA 2HSJA 1YS2X 4OQ4A 3CCBA 2CWDA 1HFEL 4YAJA 1Z4MA 1V8FA 1FTQA 3HABA 2UVPA 4I1RA 4NMLA 5DHQA 1PEKE 1W4BA 2Z3ZA 3OFSA 4NRDA 5KNDD 4ETWA 1PDOA 3T1NA 4X85A 1N7GA 1G2QA 2VAPA 2Y0PA 3C70A 4PGHA 5TQJA 3G0DA 3RBAA 3D7MA 5JLJA 1MC4A 4UE3S 1PNRA 3IP1A 4J03A 2GPYA 3SM3A 3SVLA 2ZZNA 2ZJOA 4IG9A 1YZVA 2WU4A 1LPSA 4YMVA 3RJ9A 1HT3A 1FRNA 1AVTA 1CE8A 4TXNA 5I4KA 1MTZA 1RVDA 3K35A 1V43A 3AM5A 4G81A 2CCJA 1K3TA 2OC4A 2RG1A 4L27A 2C88A 1AKWA 1HBJA 1ZIYA 2VKTA 3I01M 4D9BA 2ZIZA 2H9AA 2Q0SA 3JRNA 1Q0QA 2V1XA 3A31A 3I04A 5A3VA 2BW0A 1EKXA 3TOXA 2PGOA 2JH3A 2B4KA 1YVPA 2ILTA 3JQ7B 1JJIA 5FQNA 2QD3A 2C2BA 1F06A 4BNZA 1BROA 2QN1A 2CXUA 4I8IA 4MV1A 3I6YA 3B9RA 1M5RA 3UJ3X 1OOEA 1A4XA 2NU6B 3JAKB 4ACAA 2FDRA 5DCLA 1TD1A 4IRXA 1LCIA 4IDAA 3NDIA 4S1PA 3E1SA 1ZJWA 3SQDA 2F2TA 2W4IA 3ANTA 3WA7A 4B83A 2WAXA 4FCCA 1KEEA 1ZCBA 2ZE7A 3LT1A 3HL4A 3O3OB 1FPQA 3HHEA 4J1TC 3U3OA 4RV4A 5KSPA 2MSEB 3WB2A 2RCYA 5LQUA 3ASYA 1EVZA 2MSKA 2QX9A 3BICA 3ESYA 5J4YA 3O74A 1FF9A 2JJ2D 4P4LA 5CGZA 1AV6A 1HTWA 4TV8F 3HYLA 4P3NA 1FYVA 4PC7A 4L0QA 4B76A 2Q8QA 1M0EA 3WQSB 1PR3A 1LPAB 3C8ZA 3GEHA 5GJBA 2OFXA 4COKA 4B2LA 3W7BA 4L8LA 5TX7A 1ECGA 4K87A 2C7QA 4B8YA 3T1TA 2J0EA 2W8ZA 1RRPA 3L8YA 5DWDA 1I3CA 2H54A 1SUWA 2DPXA 4ALKA 4KIWA 4OKNA 2BHSA 3D2CA 3GYBA 5T57A 1M0WA 4FI3F 3E9EA 3LCJA 4E2ZA 1I94B 3ZHZA 4LQLA 3MAJA 1EP3B 2GOYA 1I4LD 3P2MA 3N7AA 1C9DB 4M0FA 5EHNA 3TI7A 5I3CA 1CRWG 1PR9A 3CVWA 5GV8A 2PUVA 1GDHA 1C30B 5LKRA 2BZGA 2QJWA 4TMWA 1QTNA 1VL1A 1N2HA 4MW4A 5FBRB 2WHQA 4B2IA 4B09A 4WSOA 2RHWA 3FCXA 1JSCA 3DQZA 5E6RA 2JGFA 2YWFA 2R8YA 1MX9A 3ENZA 5AHXA 3HKCA 1OXTA 5A7HA 5JPCA 1MKYA 2B1JA 1CULC 1JH8A 1GSIA 3DVAB 3IAEA 1JIKA 1G1MA 1OY1A 1SXGA 3KJXA 1DRVA 5DLPA 2P5YA 4LI0A 3ESZA 4EJSC 1XRPA 1ZXXA 2XE6A 3FGZA 4WCFA 3ZY4A 2H1RA 1H1LA 2HFJA 1XI2A 2QN8A 4YQZA 4NZZA 1JIIA 4K6OA 1G21B 1DDIA 5FYQA 3FD8A 4QUDA 3HN2A 4ZO4A 2DQ4A 1TGYA 2QBYA 5FFFA 3SR0A 2VSYA 3VRHA 2UAGA 3C1TA 4JCCA 1OF1A 4IHJF 1SQ6A 2WZQA 5DBEX 4MWDA 1V26A 2B69A 3GW8A 3PR2B 3TW6A 1MX5A 4GZMA 3GCGA 3HRIA 4EGSA 3RYFA 3COYA 1RWOA 4TQAA 2B78A 2R6R1 4KGZA 2FW0A 1TA0A 3OKFA 3NP7A 4L76A 1T36A 4Z1MD 2QW1A 3DL7A 4O4HA 4WNYA 1UP6A 1HYEA 5EP2A 1ZCAA 3WAJA 4Q00A 2PO5A 3GJZA 4YVFA 2COKA 3IVRA 1SBCA 1RPTA 2XNKA 3AHIA 3GT0A 1OZHA 3IQIX 3CF4G 4H1VA 1D8TA 1OJLA 2X7JA 1N0HA 1NYLA 2YXLA 2BMAA 2PMCA 1JZSA 4XQ9A 1KU0A 1KYTA 4U7WA 2F4VB 1ZAKA 2FR8A 4GXNA 3EZ6A 2WG0A 3RE1A 3CNBA 4M2LA 1WVMA 3PITA 2XQJA 3L0ZA 3CV3A 4IXTA 3OT1A 1U8AA 3TNLA 3C6ZA 3DEAA 1XSEA 3HUTA 3S1SA 1Z0IA 1FFHA 3DHNA 5BSRA 4I55F 3QZUA 4AS1A 4LYDA 5BWCA 2BYTA 3S1AA 4P35A 3CPSA 5DW0A 1Y34E 2RHRA 3ZW7A 3QGMA 4FDMA 4AF8A 5AUPB 3W1EA 4BNNA 5HM8A 4MJ7A 2FB9A 3EWNA 3SHFA 2V55B 4IWXA 2X42A 3HU2A 4O0LA 3M4JA 3F6YA 3RSOA 4RDHA 4WIAA 1UZMA 1O57A 2AFIE 4G23A 2JAHA 3F6PA 3PUHA 1HT0A 1H5UA 3V1TC 1RM0A 3FRJA 3MFQA 3PX2A 1CF9A 4ZT2A 2XA9A 3P1JA 2BEVB 2LZ0A 3VR1A 2EWVA 1CQWA 4AWAA 2GH1A 1LPBB 2Q3CA 3D5QA 5F78A 5TVGA 1QLWA 3F4LA 3W4JA 1GNLA 3EWIA 4FYYA 2PRIA 2IEBA 4HAVA 5EVJA 4L6IA 3QVSA 5SYAA 1GYRA 2J9XB 4P98A 4P92A 4RKQA 1TF7A 1TL7C 1TMGE 2WJIA 4HGRA 4O2AB 3DXFA 4GQAA 1QMPA 1WW3A 4WX2B 3V8MA 1JEDA 1ZMOA 3SC2B 5LVAA 4J6FA 3U7IA 3FYDA 1K08A 3P20A 2AGVA 1JHOA 1KETA 2PSJA 1XHLA 3AFOA 3NHBA 3W7AA 3QVXA 4RPJA 2G0TA 1Q0TA 2YRWA 1XVVA 1ZYUA 2P2GA 2ZE5A 3O84A 1QGED 4GXQA 3IDAA 4I3FA 4M1ZA 5IC4A 2O3TA 2CLHB 5L51A 1SHJA 2A33A 5JDCA 3W4KA 1G17A 4DYDA 1W1WA 4Q1EA 2P78A 1PEAA 2XMPA 1CF2O 4R83A 4GI7A 2DLDA 4LMPA 4HQFA 1CY8A 3N39C 1AKQA 3TO5A 4C0QC 3O4GA 3GG2A 3KQYA 5IM4F 1O95D 4F8JA 1IEXA 1TJ5A 2WQ7A 3KV1A 1GL7A 3I04M 3FI9A 3PGMA 4MAMA 1Q0RA 4S0ZA 3WWEA 4XEUA 1MJHA 4C06A 3ILVA 3TQOA 4ML3A 1AS3A 4XLLA 2WUDA 3HR7A 2JLUA 2YR0A 3U80A 1G6KA 5FWXA 3GN1A 2CFRA 3PNMA 5EGNA 3WOVA 2XYQA 3JAMA 2FEKA 4IRMA 4JIGA 3ZG6A 3TG8A 4LKRA 1LRKA 1Y7IA 1WUKS 3UANA 1Z3CA 1DJMA 1W76A 1QAQA 3PIIA 4JLOA 4O33A 3IBTA 2H5EA 1HPLA 1NW4A 1NZDA 4FU0A 3WK7A 4KACA 4BBZA 1KMNA 3SP1A 1CEQA 1CUZA 2XUQA 5CXUA 4KPYA 4FQ5A 2AFIA 1W49A 2LWIA 3N5CA 2J45A 2ZROA 3QVGB 2W2VA 1H2ZA 3DHEA 4ZARA 1QH8B 2W90A 4MVJE 1E79D 2CB0A 3ADOA 3JQGA 3M49A 5IT9A 4RCZA 2FAXA 3CR8A 3JD3A 3WJ2A 3WISA 8LDHA 1FZTA 5EPUA 3N74A 4R9UC 3P32A 4NHOA 4JCOA 1NJSA 3TZLA 3UKOA 2CE2X 5JNRA 4JXJA 2DLCX 2QTGA 1DWOA 1LW6E 1Y0BA 2I3DA 2IUSA 3JVVA 3H05A 3L06A 1ZMTA 1T0HB 3LQQA 4Y18A 3WGHA 4JXXA 1PW7A 5GWXA 4YAGA 2BEWA 3UV3A 2POQX 2EWMA 1HV8A 1LRLA 2VZLA 5H9WA 3I30X 4BLVA 1AC5A 2VT6A 3IERA 3KOOA 2YHIB 3PQ7A 3CMCO 3IKTA 2J3LA 4Q6WA 4U3JA 3PJRA 4JUBA 1ACJA 1FC0A 3HCDA 4ZALA 2OMEA 3TX6A 4ASUD 1ZH2A 1RU3A 4EY7A 1WABA 3BA1A 4B31A 4EKNB 1DRUA 3EJ6A 3DE3X 2IXTA 4MITA 1X7WA 5LZ5A 4GD3Q 4HRVA 1GTMA 2Q5JA 4NCBA 3QW2A 4QNMA 4C0XA 2OXRA 1KI3A 3VH1A 4GOKA 1UFRA 5JSUA 2YQZA 4Z99A 3D8UA 4KL8S 1E66A 1G21A 3DWGA 3ECSA 1SMKA 1L7MA 3IDSA 5EHZA 4PZUA 5AJYA 8ADHA 4FDLA 1NV9A 1ZGZA 3E8SA 2IPMA 2P6NA 3T7DA 4LEIA 1TYZA 3B1WA 1ISFA 3IPRA 2JS7A 4G0PA 4IVQA 4CQLA 4FW9A 3LL4A 3JAWB 3DE0X 2VJMB 4PX5A 1UWLA 1FDIA 3KLNA 3PC2A 4ZOAA 1LDNA 4QPDA 4HMOA 5KZMB 4ETIA 1M83A 2PKWA 2X15A 3JD0A 3BB3A 3K9GA 1DQRA 1L5ZA 1UEJA 1W2GA 4GNKA 1ETHA 4KRYA 4BZPA 3MUOA 1KSJA 3GB9A 4Q9AA 4GL4A 4M1MA 3TW4A 3Q5GA 4DTCA 2OZPA 2P75A 3Q72A 4M55A 1E2NA 4QIHA 5EIAA 2EXXA 4B79A 3VKFA 4QPZA 2Z8YA 5ALKA 3QWIA 5LMUB 1N6HA 1E6CA 1HDOA 2GPWA 4XIJA 1FNMA 3ETNA 3FVVA 4EKGA 4UFPA 3B6EA 2LIPA 1O58A 4QGHA 2FWNA 4FEAA 1ISRA 1ACLA 1VSTA 1II8A 2ZS9A 4YRDA 4D3XA 4Q7EA 5ALXA 2O5RA 4WECA 3R6TA 1NUSA 2E1RA 1G8AA 1P1RA 2WJYA 1RLMA 3HACA 4OIMA 4ZQGA 2HHLA 3QW4B 4JOBA 2BM8A 1UDCA 2JFZA 1HQYE 3QWHA 2X2FA 4M1YA 4HYYA 3K4HA 2PMWB 2Z9DA 1FDSA 3KL2A 4A7PA 1ZIXA 1IQRA 2WT8A 2HTEA 1FX0A 3TS1A 2QJRA 1M7HA 3ROEA 2XLCA 3AZQA 3HWX1 4M53A 3LYAA 1DZIA 4UTXA 3HNPA 4ROSA 2PBZA 2I54A 2EARA 3QMVA 1BW9A 1E58A 1JILA 2ZYGA 1O3YA 3OF5A 1CUIA 3OFKA 3C5VA 4N39A 1XD9A 3HWRA 4PSKA 2I33A 3GMIA 2YWRA 5H02A 2BMFA 1SWWA 1T8RA 1AQYA 2O2XA 1K75A 2VQ3A 1KI8A 1ZSVA 2ZDQA 3DSRA 3FFAA 4DA4A 4H3VA 2KHZA 4ENPA 3F4KA 4PFKA 4OK5A 1P80A 1UBJS 1N2EA 3DE4X 4QXAA 5HOEA 4KLNA 1UJ6A 4U2DA 2AW3A 5CVDA 1KZ7B 1DCKA 1QYWA 2NOAA 4RVGA 5EKXA 1ZUNB 1RADA 1KVQA 3RSGA 4BJHB 5G0WA 3Q6IA 1Q6ZA 4HXGA 5JAMA 3BQNB 3NWEA 1VGQA 4H6WA 2GTPA 4Q7LA 5JARA 3DOFA 2HOQA 5DLQC 2C3MA 3PDHA 3NYWA 1SK8A 1XCOA 3BL8A 5JISA 1G8YA 2GBCA 4WRRA 5KSYA 1W19A 2HEGA 1EJ6A 2EFHB 2HSDA 2A0UA 2O6HA 4R0NA 1EE9A 4UU7A 1U9YA 4ARBA 4BJ6A 3RRMA 4B3FX 2IYLD 1DFGA 4TWIA 4DQDA 2OCBA 4B5KA 3UWPA 1JWAB 2X13A 2DSTA 1FXWF 2VCYA 3F6CA 5CVTA 3HV0A 1XL1A 3PBKA 1RYZA 2H17A 4EYKA 5H16A 3T54A 4RGVA 4QJ3A 1RP7A 4RL6A 2CF6A 4F71A 5JR3A 3CLVA 3AJAA 4B4WA 3D6JA 1RJFA 3P9SA 1XD8A 3N28A 3ZYZA 1ND6A 3JATB 4MWTA 1T3ZA 6Q21A 2ZRNA 2QTVB 4JENA 3PU6A 4M0PA 4M54A 5CYFA 4DIMA 4CF7A 2QAIA 1KO1A 2RHLA 4CF3A 1DG3A 1Z4OA 2ZIGA 2CXHA 4WZ6A 5B1HA 4MHOA 3T15A 2C2HA 1X80B 2BKEA 2EAUA 3M6MD 3FPLA 4TL6A 5ALIA 4UU0A 3CLRC 1B0AA 6ADHA 1FFDA 4FXPA 2Q3FA 3N2EA 16PKA 1E60A 2C4TA 2NGRA 3DZKA 3I1JA 3TSAA 1VB5A 1U3UA 2LGJA 3E3NA 3D6NB 4KKVA 1C3JA 4MS4A 1Y1SA 4FFDA 3WB9A 4QARA 4AJKA 4CQJA 2IPLA 4KDEA 4JITA 3MTIA 5KMGA 4TRJA 3DVQX 3HKBA 4LZOA 1V3TA 2ZJ6A 4LRTB 1U0RA 3FOEC 2HWXA 3ANLA 5ESDA 1NVDA 3PF9A 4AJOA 4YXWD 3FOZA 3FDJA 5DX8A 3VR6A 5ICCA 4BB5A 3JYQA 5EJFA 4UAGA 1LKZA 3RROA 4YIHA 1PTJC 1A9XA 4UREA 1XA4A 2CD9A 4REQB 4DOMA 4I1PA 1Y4AE 3TB6A 1RWXA 2V6BA 3FMOB 2CLDX 5KYXB 3ONNA 4IS3A 2Z5GA 3JZAA 3W78A 4BNHA 2IVFA 1TCUA 2OB2A 1AXGA 4RUKA 4NPCA 4E2FA 2W9XA 1P4SA 4KE9A 4PCUA 3FGPA 2B3DA 1YASA 2YZMA 2ZQZA 1FQKA 3FDFA 1P0FA 3EARA 3HUEA 3ND6A 3PXDA 5DN6A 4PQFA 4CUKA 3B85A 1GILA 1XLUA 4M9CA 4NBWA 3T7EA 4GZ6A 3KPJA 4YRMA 2IYQA 1B8VA 1N3IA 4CG2A 5B37A 2PPVA 4RWEA 5COQA 5KVAA 2IS2A 1DHRA 1FYDA 2HCRA 5AK6A 4ZIRB 3EOBI 1PYOA 3N07A 3L9WA 2WYUA 4MW2A 3DCJA 1T2DA 1TIKA 3E9QA 4ZMSA 3G23A 3V8RA 4C6TA 5BOSA 4QEZA 1E0JA 2FSSA 4BB9A 4MWOA 1DVRA 2CCKA 4M0CA 4R1LA 2BONA 4BQOA 5JADA 2JLBA 4N9WA 3G9QA 4PHGA 4Y9SA 3STXA 2FVXA 2ZW9A 2IC5A 3RVDA 4Y6RA 3AJRA 1Q3TA 2GVZC 4EUSA 4B3GA 2GD1O 4XIYA 3SVZA 1JAHA 1VYHA 5CD1A 3DD1A 1WQ3A 3OZVA 2FE1A 3FDZA 1JAYA 2GEBA 2WSIA 2XTZA 3VHXB 1J07A 1PJBA 1IY9A 3FRIA 2EEPA 1QM5A 3WLPA 1GKUB 2QTZA 5BMVB 2VDUE 4OX9Y 3H5AA 1A8QA 4JP1A 4RFVA 3K0KA 2DEUA 5CDFE 1FU4A 4XYGA 3UVEA 2D3WA 2R6JA 4RNDB 1WXWA 1DO2A 4A03A 2W6NA 1QG2A 3HYNA 4IH1A 1YQWA 2ORVA 1ZNZA 2FGJA 3TBHA 2VZ9A 4MQ4A 5F3RA 3KHSA 2PMEA 3FVRA 2GUWA 4UUPA 3SMQA 2VDWA 2OFWA 2ZIFA 4G6ZA 4QDTA 4F8EA 2YJ3A 3VR2D 4LDZA 2DBZA 3NBAA 4F7DA 2IU4A 1Z0DA 1OCEA 1JHVA 4MI6A 1DBPA 5AOCA 3GOHA 3NBMA 3JQAD 3ZE8A 4CV3A 2JCYA 2GJKA 2ON6A 2WWYA 1QC5B 3CKKA 1Q16A 3O2JA 4BNTA 1F2DA 4UOQA 4TS4A 5T3YA 2Z56A 4BQRA 2HHCA 3ND5A 4PFJA 1RAHA 2G7MC 2O3SA 3CB2A 4PYQA 4X3CA 1Z4QA 1F17A 4JVLA 3PEUA 2CL7X 3BRCA 3L8DA 3CN7A 1D6NA 1L5VA 4DDTA 2P9JA 3I9FA 5HZGA 3WL8A 2P40A 2XUHA 2YICA 1VI2A 1GZDA 4FR2A 4OFBA 3RS7A 4EPTA 5JMWA 4TWZA 2C4NA 5H68A 3T7JA 4EFKA 1QWOA 2IE0A 5IULC 4Z4IA 5KAPA 5C8DA 3D6HA 1CZKA 3IULA 3KTOA 2F1KA 1A88A 1BWPA 4DJAA 2HLHA 2DHRA 2WTBA 3DLHA 3H2GA 4Y67A 1XEWX 2B4TO 4BEJA 3E27A 1R50A 4O4IF 5FBZA 5HIJA 2ECOA 2VHCA 1VCHA 1M2HA 2J1LA 3GEMA 1UPFA 1MB0A 3MN1A 3MTQA 4WL0A 5J59A 1D2HA 3VBCA 2AVNA 3IQEA 4XAQA 3H4TA 1Y8AA 2EP5A 2EYUA 3RLFA 1SU7A 2H57A 1AV7A 2XJ4A 3WY9A 3SDZA 2XUIA 1JEQB 2X0RA 1SH7A 4KO1S 1M34A 1V8OA 4QUJA 1PK7A 4QUKA 3THWA 3GCXA 4QDUA 1KVUA 4XWGA 2EFCB 5JD3A 2HCBA 2BJWA 1ZN7A 2ADFA 1PNQA 2XQIA 1YS6A 1ISGA 2DHEA 4NNPA 3CLSC 3VVMA 3RM3A 3WRYC 1ATIA 5JAHA 3SNHA 1A5ZA 3Q88A 2XT9A 3WGZA 2W2NA 2N9UA 3I53A 2QVYX 3CSDA 3L0IB 4YN3A 3NHFA 4A73A 2XZOA 3KSZO 3SIWA 3VJLA 2Q3HA 3KKOA 4K28A 5FNVB 4MR8B 2WR8A 2WM3A 1WQ1R 2HPZA 3ML1A 2Q6OA 3U44A 3KXIA 1H2RS 5EEGA 1EFRA 1KEWA 4ZCIA 2BHTA 1S6YA 4G9BA 4CLRA 4KFCA 1OAOA 3BMQB 1MIOB 3DZGA 5K4HA 1JHYA 1KTVA 1R0LA 3RQSA 3ZV7A 2H4XA 3ZIUA 1U0LA 1RM5A 3W79A 3TTUA 4Z5XA 3PSAA 1J2RA 2Z5FA 5KOIA 2I4LA 3KEFA 3KQSA 4KTTE 4IBOA 1GZVA 3EXHB 3ZH2A 5EJ4A 4S05A 1WHTA 1K9SA 3FRHA 3K15A 3Q0IA 4QODA 4C0HA 4KQ9A 3VTFA 1O4WA 4DIUA 2I87A 4MUYA 1NJ1A 1S8FA 1BRTA 1KGDA 4EW6A 1C0IA 3BTSA 5AKZA 3ST7A 1W36D 1JQ5A 2FOXA 3BWMA 2PWZA 2ZJ2A 1QQ7A 3KHUA 5SY6A 1A8HA 4MP8A 5CBPA 2XMCA 4ZQFA 1QOQB 2EW2A 2YRXA 4BZWA 3I12A 3U3XA 1SHZA 2G76A 2ZUVA 1JDNA 3TCNA 1XDZA 2DKFA 4J90A 3SS8A 1FIUA 2FI1A 5BYJA 4ECAA 4X9XA 3MWEB 5JQGB 2PN1A 1VDZA 2Y1LA 3G1UA 2Y71A 1Y3AA 2B25A 3LPNA 4N5MA 3SBXA 2Y67A 2SCUA 1UKYA 1ZOLA 3OCCA 3PPYA 1TQDA 3ITKA 4RADA 4F9EA 4ZYWA 3ODGA 5KYUA 1TPZA 2GJAA 3VC1A 4FT4A 4A6XA 3DQPA 1TMKA 3K73O 3E3LA 4DC1A 2UUAB 4JQZA 1E6EA 3BCHA 2P9ZA 1SQ5A 3PT5A 2HJRA 1YRLA 4YUVA 3K9CA 3V6MA 5EN4A 3F8SA 4G1EB 4N3BA 2C84A 1SOWA 4AQ7A 2J67A 4TQGA 3ISTA 1A8SA 1J24A 1N1EA 1V8DA 4AM8A 1Z3IX 3FA2A 2IHNA 3ORRA 5FXMA 4HOYA 3LW7A 5LQRA 5KYYA 2QVBA 3T7SA 2VUIB 1JJBA 3BKXA 3NM6B 4CIDA 4N0PA 4INAA 5HF5A 3L9XA 4JT9A 1X1CA 2QIPA 3BZBA 1HEUA 3QEJA 2ODNA 3C8DA 3FYUB 4TLMB 4ZEWA 1BKDR 1I3KA 1XRRA 5DBFA 4C4OA 1F4PA 2GILA 4AY3A 1QUFA 4AN1A 1L7VC 1T2AA 4A82A 1D2EA 1ECFA 4FJ2A 1QCCA 4JL5A 1JE1A 1EUCB 4H0NA 3AUKA 3GBSA 4HDQB 3U4CA 4QO7A 2R79A 4LXHA 1N6RA 3NASA 1C1XA 1NVAA 4HUQA 4FILA 4Y7DA 1Z0KA 1OA0A 1XJQA 5DXJA 4BO7A 2R6AA 2IEZA 4IWNA 2WU1A 2DSNA 4Q03A 4PLFA 4XM0A 4JSTA 5F5XA 1OWNA 5T4BA 3ZW8A 2SHKA 2QMUA 3DO5A 3PJEA 1GOTA 1Q95A 3BSSA 1BHQ1 4HVAA 5I4BA 1ZVQA 2VJCA 1FDVA 3BMOB 3I8OA 4G2TA 4X8OA 1FFBA 1VKRA 2R44A 4J0FA 5IJ0B 1E1YA 4ZXFA 2IYNA 2VAWA 5AM1A 3SHTA 1BOOA 1RM4A 4I6EA 2PSDA 1THGA 3VYRB 4JKOA 3AOEC 1T2UA 3BWDD 3ZYCA 5A5VA 1FDOA 2PWBA 3TSOA 4ZI7F 4YI5A 1J70A 2G07A 2GNOA 2JZNA 2PL9A 2ZIXA 1TADA 2WTMA 3R5SA 4BVLA 5FLKA 2ZYSA 1YCGA 3IELA 4HLQB 4PZ0A 5J23A 3KD2A 5CDFA 3UZUA 3E03A 3I34X 1OV4A 3P2EA 3QITA 4B7AA 1OH6A 2F00A 5CNJA 1QSGA 3GDOA 3KSRA 5CVJA 1TC1A 3JD4A 4LBVA 3FHCB 4ESOA 4B33A 4O8ZA 1CLUA 1QKKA 4Q4AB 1X1EA 4LZNA 1VLJA 4PFQA 3SKXA 2EX0A 2WV7A 4KOEC 1ESZA 1F9AA 1U28A 3IILA 4ZIRA 3NHPA 1N6IA 4HPWA 4NDZA 4TL9A 3SFZA 5IUNC 4OA5A 4CMEA 4KO8A 2A9VA 4KPFC 1V41E 3QVOA 1UPXA 3T3GA 4IDQA 1C1YA 1Z4PX 3FPHA 2Q2VA 3M8KA 2VQFB 3DUWA 1JHDA 2GVDC 3NAGA 2G9VA 4ZREA 1XPRA 4MTCA 1DU4A 3G9TA 1LU9A 2F64A 3LCRA 3CWCA 3WQQA 5JDIA 4W5RA 2C4HA 2ISQA 2Q99A 4PLZA 1P0CA 2OUIA 3OKAA 4QYSA 1X3LA 2WT9A 5E6UB 4JROA 3ZXSA 4L5JA 2KLHA 1Q1AA 2AJCA 1SELA 1RBZA 2QTCA 2Y99A 2AOTA 1U4NA 2ZRAA 4ND3A 4AIRA 4FC6A 2PQ6A 1WDTA 1QQ5A 4Z0TA 4I36A 4NAVA 4RKFA 4YNBA 3ZHYA 5HXAA 4ESVA 1GFIA 5CH8A 1LK5A 1EZ1A 1KEZA 3OG9A 1VKHA 2XHZA 3VR5D 5JFOA 1LSJA 2QSUA 3PHLA 4TZKA 3ZWQA 4B4OA 4JJ6A 4LISA 3RVOA 4A6PA 3EG9B 1JBQA 1TI7A 3EA5A 3W2HA 2R1UA 3BTOA 3GLQA 3JS5A 1LF5A 2ZVDA 3KPYA 3OAAD 2NAFA 2JATA 1NG1A 3EPPA 4INZA 4LA4A 4NV3A 5DMHA 2J33A 4Q18A 1NMZA 1OV6A 4XX0B 3TJZA 5JU6A 1WB6A 4C7MA 4CLEA 5FTMA 4EHBA 1POXA 1Y9EA 1U6JA 1U9JA 4HQ6A 1LFDB 4WOKA 3BMCB 2QSZA 1JG4A 3KQMA 4Y1RB 4MI3A 3NEYA 2W70A 3TPCA 3H86A 3SDBA 3BWXA 1N5IA 1OLXA 2BZSA 1IN7A 3E5RA 1EVJA 4II7A 4BQSA 3NWBA 4O4HB 3THSA 3PEYA 4YAWA 4FDAA 2F1RA 3RK4A 2ALJA 1I8TA 2VDRB 4M1TA 4DGQA 4S1OA 3S2IA 4ZEXA 3DL4A 3TIGA 1Q21A 1RXSA 2G0NA 5KMGB 1ULBA 1X8LA 2RGUA 3AJDA 2VQEB 4BKQA 4WERA 1ACMA 1PJ2A 4RYDA 2PLAA 4MS1A 1XK7A 1O96A 2IDZA