4P7JA

Rat apo-comt sulfate bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 76
structure length 217
sequence length 217
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4p7jA00
3EMBA 4QPNA 3TR6A 2IH4A 3FTFA 2HTEA 3HCDA 4E2ZA 5HIJA 3EEOA 4GQBA 3KKZA 3GGDA 2H11A 5M5BA 2Q41A 5LQKA 3DXYA 2EFJA 3G88A 3SR4A 3DR5A 2IGTA 3PX2A 4C4AA 3HVIA 1G8AA 5EMJA 2GB4A 3PB3A 4ER0A 3EEYA 1L1EA 4QDJA 4M38A 4MWZA 4FSXA 1YFJA 3NMUF 4HG2A 4A6DA 2DULA 1EJ0A 3CJTA 2QY6A 5K0NA 1QAOA 3E05A 5LQNA 3KQVA 1XDZA 3TPZA 4RTJA 4AZVA 4V0QA 2WA1A 3SSNA 3BWMA 5BW5A 3UJ7A 3GO4A 5GWXA 3OZSA 1BHJA 3GRZA 4PIMA 4RTMA 3LPMA 3ELWA 2XYRA 4P7GA 5CVUA 5H02A 1N2XA 4OQEA 3G2OA 4XUDA 4ER5A 3CCFA 4M36A 4WXHA 2JG3A 3LDGA 1KXZA 5DRTA 2FK7A 4GC9A 5IH3A 3UJ9A 3TRKA 5T67A 3R9XB 4Y2HA 3ER9A 4F86A 2ZIEA 2PWPA 2GS9A 3B7PA 4AX8A 1JR4A 3BXOA 2PX5A 3DLCA 1G38A 2IH5A 4DA4A 3SSMA 1SQFA 4EK9A 2YX1A 2FRXA 4P7KA 4PYQA 3ERCA 5DTMA 3KQSA 5U4XA 1AQIA 4YV0A 1IY9A 2XVAA 2YVLA 1X1BA 2C7QA 2GPYA 1IM8A 3B89A 5HEKA 4DCGA 2PT6A 3FYCA 3MCTA 2CWWA 2OYRA 1X1AA 1DUSA 2OPBA 2PJDA 3GIWA 1FP2A 3LECA 2R6ZA 4EKIA 5CCXA 3FPHA 1P1CA 3OPNA 2ZLBA 3FPEA 2AOVA 2PXXA 3LCUA 1YB2A 3CJQA 4KDCA 4OA5A 4E2YA 3V97A 2ZULA 4YUVA 3C3YA 3QOXA 2UYQA 3UJ6A 1VBFA 1ORIA 2JH8A 3D2LA 5GM2A 5LQCA 3NWBA 4RVGA 4QPPA 2NXCA 3T7RA 3TQSA 3CJRA 3SVZA 4CKCA 5B1SA 3JWGA 3KQWA 3LDUA 4CKBA 5CCBA 3TFWA 1YZ3A 5E1DA 3R3HA 2CL5A 4RVFA 5DPMA 3PFHA 2BM8A 5GOZA 2F8LA 3EMDA 3UJBA 5EIFA 3NVKI 3OFJA 2OB2A 3CGGA 5CVEA 5EG5A 2C7PA 1Z3CA 2G1PA 3NJRA 2PWYA 1ZQ9A 3JWIA 5E2BA 2HR1A 2ZW9A 4KWCA 4OA8A 4ER7A 4EQZA 4OBXA 4QVGA 2B25A 1VE3A 3LKZA 2EJUA 5E9QA 1SUSA 2BH2A 2UZ4A 2ONYA 2H00A 5EPEA 3EVAA 3MAGA 4CTJA 5BP7A 1D2CA 3GNLA 4PYLA 1FBNA 4FSDA 5GP1A 4BLVA 1NW3A 5FQNA 3CC8A 3IEIA 5KYGA 1M0EA 2ZIFA 2ZIGA 2N47A 3A7DA 4PYOA 1KPIA 2Y1XA 3GWZA 3GRVA 1VP9A 1NV9A 3A7EA 5EEHA 3ELYA 3HA3A 5E1OA 3LDFA 3OE4A 4RVHA 3KPWA 1N7JA 3B3JA 5FTWA 3GRUA 2PXCA 5FADA 4RVDA 3MTEA 1PRYA 1JG3A 3EVDA 3KQPA 4G56A 4MTLA 2IDKA 3UFBA 3WSTA 4C04A 3FUWA 1QANA 4ER6A 2P41A 4P7FA 2R3SA 3VYWA 1AQJA 2YR0A 2BM9A 4C08A 3EVEA 3HA5A 3FTCA 1KYZA 4POOA 3NTVA 5F2OA 4M7RA 2UYOA 3P2IA 3RIEA 3G8BA 1RJEA 5EKXA 5C0OE 4HSGA 3EVCA 3P2EA 5E9WA 3G7UA 1ZG3A 2ESRA 3UJCA 4AZSA 2AN3A 5EZSA 5EC8A 1JQEA 3LSTA 4E31A 3C6MA 3DXXA 3EVGA 4RWZA 2IP2A 3OU2A 2LD4A 3FUVA 4R8SA 1IXKA 2JH9A 3P9NA 3FPGA 3KPVA 1AF7A 3FRIA 5T6BA 1EJ6A 2PKWA 2P3QA 2XVMA 4KW7A 5DM4A 5DSXA 2PX2A 1JTFA 3SMQA 4CWAA 1BOOA 1VP3A 2P7HA 2AOTB 3BKWA 4RYLA 3BGVA 4F84A 5KVAA 5CVVA 3KQQA 2G72A 5D1NA 3HCBA 5DXJA 5DXAA 3P9CA 4E2WA 4CXMA 2A14A 1XDUA 3QOWA 4PONA 5FULA 3DH0A 2NNWB 3R6TA 4YV2A 7MHTA 1H1DA 3TKYA 4DQ0A 3SGLA 5EKUA 2PXAA 2ZZMA 2JHAA 2GAFA 3AJDA 2PSSA 3KHKA 3M33A 3SX0A 2O0LA 3BUSA 2HMYB 3HTXA 2AVDA 3LBYA 4FT2A 4X1OA 2G8NA 1KYWA 2ORED 1RI2A 2OZVA 3GRRA 3PVCA 1KHHA 3UA3A 4LECA 1F3LA 2ZSUA 3GRYA 5EHIA 4C06A 2AZTA 3G89A 4NECA 5DWQA 2UYHA 3DTNA 3ANXA 3KPJA 3I64A 5BW4A 3M6XA 3UA4A 3NW9A 4DCMA 2AS0A 1YF3A 3G5LA 2XBMA 4GF5A 1NW6A 1ZGAA 2ZZNA 2AVNA 5HZMA 5KQRA 2AOUB 3ELDA 4FR0A 1BKYA 1X1CA 3I58A 3R24A 4HTFB 3KPUA 1D2GA 1P1BA 2B78A 1EIZA 3EGEA 4PCLA 5EZQA 1JTEA 1YUBA 3A4TA 1RI3A 3A25A 4CTKA 4YV1A 1SKMA 1I4WA 3SM3A 1O9GA 1WZNA 2OO3A 3LHDA 4FP9A 4GBED 3THSA 2CKDA 4OBWA 2IDJA 1NV8A 2EG5A 3EGIA 5JUWA 3OU7A 5DM1A 4FZVA 5K03A 3NDIA 5E2AA 3KR0A 4MIKA 1SVUA 1UWVA 2WK1A 3G2PA 3AXTA 2QYOA 5GM1A 4BLUA 5K0EA 2FPOA 3NDJA 4GOLD 3HM2A 4GOMD 4QQKA 5EOVA 4YUZA 5BXYA 2ERCA 4XUCA 5IKMA 2H1RA 1I1NA 4UOEA 4QTUB 4EKGA 4RTNA 5E8RA 2CMHA 3KR9A 1KP9A 5ERGB 2P7IA 2IBTA 1VLMA 2AOTA 3MCZA 1KPHA 2PX8A 2Z6AA 3CBGA 5CIYA 3OU6A 3A26A 3FTEA 3HCCA 3OZTA 5FA8A 3PLAE 3SSOA 1QYRA 1RI5A 2EX4A 2PY6A 3DXZA 3HCFA 3MTIA 3PX3A 4R05A 4C05A 5DT2A 5DTQA 3FYDA 2JHPA 5HIKA 5C9ZA 2ZWAA 4RTKA 1L3CA 3REOA 3M4XA 3E7PA 5FHRA 3SXJA 3VSEA 4HGZA 3MHTA 3BWYA 5DLYA 5DM0A 1QAQA 2V74B 2OY0A 4PYMA 1N7IA 2QRVB 1QAMA 1D2HA 5K8VA 1R18A 3I53A 3ORHA 1O9HA 3OZRA 4PGGA 3THRA 1R00A 1NW5A 1WS6A 2BR5A 3DMFA 5HILA 3AWIA 3GCZA 5GIOE 5DM2A 3RODA 4E30A 1KR5A 2HNKA 3VC2A 3LCVB 5LQUA 4E2XA 2GA9A 1SG9A 4IKPA 4LWPA 1JQ3A 3R0QA 5DX8A 3TM5A 4MQ4A 4E33A 4HRAA 2PBFA 2YUIA 4EMSA 2ZCJA 3G8AA 4PYKA 3HVHA 3I9FA 5GIPE 3OFKA 1PJZA 1MHTA 2PGXA 2Z6QA 4ISCA 5FWAA 3JWHA 2AOUA 2YQZA 3FUTA 1RJDA 2AOWA 4H0NA 2Z6UA 4EVIA 3FUXA 4HTFA 5LQAA 4FGZA 2YTZA 3AXSA 1NBIA 3V8VA 4C03A 2O57A 1XXLA 3NVMB 4PYNA 4QDKA 4QTTB 1VL5A 2C7RA 1NW8A 5EMKA 5MHTA 3EVFA 3FPFA 4DF3A 5G02A 3T7SA 5K09A 4XUEA 3S68A 2PV0A 1O54A 2BR3A 2YXDA 5CM2Z 1JG2A 4R6WA 3OE5A 5CVJA 1NE2A 3PTAA 3P8ZA 5LQRA 3Q7EA 5ICFA 1R8YA 3UWPA 3HVJA 4K6MA 4X41A 1VPTA 1I9GA 5JR3A 4BY9E 1QZZA 2K4MA 3BWCA 1RI1A 3P9IA 3TOSA 2VDVE 3B3GA 5EQJB 1INLA 5LQJA 5D1HA 4E70A 4PGHA 2VS1A 1SQGA 1EAMA 4GOND 3TMAA 3B5IA 5HIMA 1NW7A 5K0CA 1EG2A 5EHGA 1HMYA 1OR8A 5FCDA 1RI4A 4RTSA 2JHCA 1JSZA 3I5UA 4AZWA 5ICGA 1KPGA 1MJFA 3P9KA 2IIPA 1YFLA 2G71A 1NBHA 1JQDA 4FS8A 4PCAA 1R74A 3BWBA 3MB5A 2ZFUA 5K0BA 4RV9A 2NXEA 3A27A 1Y8CA 5P8WA 1U2ZA 1G8SA 1SUIA 3CKKA 1ZGJA 3C6KA 3LBFA 3MGGA 3RW9A 2P40A 5DSTA 5DRYA 4P58A 4PWYA 3M6WA 5F2KA 5K0LA 4LG1A 2DPMA 2QRVA 2FCAA 3HA7A 1L3IA 3KQMA 3KU1A 3DMHA 1WXXA 3FRHA 3K6RA 3LL7A 4XCXA 4BP3A 1HNNA 5F2NA 4DZRA 3QV2A 3EVZA 1G55A 1JG1A 4BLWA 1WG8A 4E32A 3H2BA 5DTRA 5K0JA 3KR1A 2AOXA 2P3LA 5DX1A 4DM3A 5ICEA 2ONZA 1WXWA 3P97A 4OQDA 1FPQA 4YMGA 2OBFA 4M37A 4YUWA 3FPJA 4WVLA 2QE6A 3KQYA 5EVJA 4RTOA 1X1DA 1JG4A 4HC4A 2I7CA 4OX9Y 2I6GA 2HWKA 1NKVA 4YUYA 3LKDA 2FHPA 4DMGA 3LX6A 4X60A 5DX0A 5C1IA 2O07A 3F4KA 3E8SA 3HEMA 3JWJA 5EGSA 3UJDA 1WY7A 5CUQA 9MHTA 4L7VA 5ICCA 1RJGA 2AN4A 2VZ9A 4GC5A 2AN5A 2P1DA 4YUXA 2O06A 3HP7A 1UFKA 3IHTA 5HOQA 4KIGA 2B3TA 3U81A 3FZGA 1XTPA 2G70A 3FUUA 3O31A 1ZHFA 5K01A 1XCJA 2NP6A 3ME5A 5FQOA 2HV9A 2NP7A 4X63A 4ATNA 1F38A 5T64A 3NWEA 4V0RA 3UBTA 4R6XA 4RTLA 3UZUA 3K0BA 4GOOD 1R8XA 1YZHA 3KPYA 3ER8A 4RTRA 5FA5A 2XYVA 4KRGA 3M6VA 4ZTBA 4KDRA 3M70A 3DLIA 5E1BA 2IPXA 3EGVA 2VDUE 3TKAA 1BC5A 1P39A 2P8JA 2PT9A 2B9EA 3LCCA 3MQ2A 4LWOA 3EVBA 2ZVJA 3GXOA 5EEGA 4U7PB 4B17A 2FK8A 1NT2A 2ZZKA 3MERA 3C0KA 4X61A 4JXJA 5HFJA 2XYQA 1L3BA 3M6UA 2WA2A 2Y1WA 2ZTHA 2AR0A 2NXJA 2OB1A 2O05A 4PYJA 4C07A 1L9KA 3BT7A 2PLWA 3DULA 1TW2A 4HH4A 4PNEA 4KIFA 3G2MA 2IH2A 3OCJA 1M6YA 2EJTA 3BGIA 1UIRA 3HCEA 1FP1D 3ID6C 5FUBA 1ZKDA 2E5WA 2ADMA 8MHTA 2BR4A 3EPPA 3HVKA 4RTPA 2P3OA 2IBSA 3Q87B 2I9KA 1G6Q1 4Z2YA 2GLUA 3KQTA 10MHA 3O4FA 4PIPA 4AZTA 1XCLA 1X19A 4F85A 4GEKA 4AUKA 4IV0A 5LR6A 2QM3A 3IV6A 5E9JA 1KIAA 5EMMA 3CVOA 3BGDA 1VIDA 3KR2A 5K0GA 4R8RA 3AY0A 4QVKA 1G60A 3X0DA 4RTQA 5KQSA 1Q0TA 1DCTA 3HNRA 3DOUA 1ORHA 3BKXA 3GJYA 4ER3A 2C7OA 2P35A 5EIWA 3P71T 4FT4A 2PVCA 2JJQA 2NYUA 3ELUA 2ZWVA 1B42A 4KVZA 4YMHA 4BP1A 3KQOA 2I62A 1R6AA 5CD1A 1DL5A 3G5TA 5EMLA 4GUAA 3PT9A 1RJFA 3B3FA 3LGAA 5GINE 3O7WA 1XJ5A 3DUWA 1TPYA 2FYTA 5K05A 1FJXA 5FHQA 4MHTA 1T43A 3DMGA 2V7EA 4Y30A 5FWDA 3VC1A 3HCAA 5K0FA 3DP7A 4DKJA 2CMGA 5E8JA 1Q0SA 4RX1A 1VQ1A 5HIIA 2VDWA 3PS9A 1XDSA 2ZBPA 2IFTA 4P7JA 2PX4A 4PYIA 3UJAA 4A6EA 2BZGA 2GH1A 5LSAA 1TW3A 2OKCA 2VP3A 3E23A 3T0IA 3TLJA 3FTDA 1V39A 3L8DA 3T7TA 5KS2A 4O29A 2OXTA 1M6EX 3BZBA 2KW5A 4CKEA 3GDHA 2UYCA 4QQNA 2NXNA 4HGYA 2ZBRA 3PFGA 4RSRA 5CVDA 5E1MA 2YXLA 4IV8A 1AV6A 2B2CA 1P91A 3GU3A 3UJ8A 1EQAA 3TM4A 3G2QA 3P2KA 2YXEA 3C3PA 1JSXA 1XVAA 3IYLW 4PINA 4U7TB 4IWNA 2ZBQA
chains in the Genus database with same CATH superfamily
3PFNA 2W8ZA 4DLNA 1AQ6A 3KTFA 2NU9B 3O3NB 3EEOA 1QQAA 3EBLA 1U3UA 4J7AA 3GCWA 3L6EA 3A9CA 2MSDB 2HPVA 1BEEA 4KSYA 1RWMA 3RVMA 3E3NA 1ZIOA 5E3JA 2FPWA 4G1EB 4F12A 2A9JA 3W1WA 5I4CA 1UBNA 4DZTA 1EFPA 2QRPA 1R3UA 2BKLA 2OHJA 1UJ2A 1G1MA 1SZCA 5KNDH 4IDCA 4NFLA 3ZKAA 2ZUBA 1TTPB 2LTAA 1FIUA 3WIEA 4CM3A 1QAOA 1IBSA 5AVQA 1GOTA 4F38A 4UE3S 1N3LA 3HUTA 2AZXA 3ROKA 3QW2A 2ETXA 1PAUA 1UP4A 1H2EA 1UOPA 1VYUA 1XAGA 3LM8A 1WZ2A 3O21A 2P9HA 1VJDA 2VCEA 3WWCA 2F1KA 3LY5A 5AI4A 4J29A 4W5OA 5LDGA 2JJYA 5IVKA 4MDEA 4MQ6A 2OKGA 2QN3A 4LHEA 1TVCA 5IZ4A 4IRMA 1RMQA 5IH3A 4HZIA 1RC1A 2Z8XA 1H2ZA 4HB4A 1PQWA 4IHKA 3ZXUB 2RD2A 4JBIA 4CQJA 5I6DA 4OCZA 1EZZA 3N2YA 3AG5A 1XRLA 2QE7D 1LVUA 2PX5A 3EARA 4N8SA 3AX6A 2QV7A 4Q7JB 3UCEA 4EW3A 3G8CA 3PR2B 1RM5A 5AVKA 5B6IA 2PHZA 3FB1A 1E2UA 1YB7A 5ES4B 1SBQA 1IM8A 3ZN2A 4UVGA 4GZ3A 2FN8A 2Z2KA 3IJ5A 4J0QA 4WLNA 1EWVA 1TK3A 5L4SA 4HQOA 2NXWA 1COZA 2FY8A 2R751 1T0UA 3OJLA 1X1AA 3GIWA 2NM0A 3ED1A 4FDAA 1M34E 1K68A 4RCVA 3TZKA 2IWRA 5GJBA 4Y1RA 1E1MA 1KMQA 4JX9A 4DV6B 3CJQA 1NSTA 3ZJYA 1JYFA 1CLUA 2QYTA 3VKFA 1R50A 2EFYA 2F2TA 3PZRA 4FGKA 4UHHA 4ESHA 1S2NA 2NU9A 4ZQBA 4JODA 2R4UA 1A9XB 4DRZA 1D1SA 1DC5A 5JZSA 4LRXA 5ULLA 2WYUA 4BMSA 4EO7A 3LQFA 1DG9A 3EW9A 2HJSA 4JYMA 4O33A 3EDOA 3TFWA 3VH4A 4C3UA 1ZUD1 1DQNA 2HGSA 4RK6A 1F6WA 1ZSYA 1V0JA 4XD7A 4RBNA 4Y6QA 5KVVA 4BECA 5JANA 2ZBDA 2X1LA 2WJWA 5CVEA 2JK1A 1GTG1 1QORA 1Z3CA 2D0IA 1CX9B 4RD2A 4BKPA 2VHEA 4P0QB 1Z26A 4TMTA 1MOSA 2Z09A 1PJ8A 5AJZA 2QVBA 5LIPA 1VE3A 1RVV1 4QUIA 3WHPA 1YZLA 3ZNQA 3BX1A 4N9QA 2XMSA 4FILA 3WB0A 3ZDQA 4BO0A 4GP9A 4Q4DA 3RANA 3JQAD 1L4HA 4PYLA 2BUCA 3FFAA 1X13A 3MTDA 4DY6A 3QBDA 3CC8A 4PPQA 4YFVA 1GR0A 2ET6A 4LDJA 2WY2D 1JXQA 5BQ3A 2O4UX 3HPQA 5CCDA 1TVKB 1MB0A 2N1MA 3M5CA 3RF7A 5MDHA 1NV9A 3JSAA 4F2HA 4YAKA 3IMKA 2JFFA 2DTXA 2WAXA 3PJDA 3LDFA 5L9AA 4QWWA 1N7JA 2I0FA 3LG2A 4N7RA 3VHLB 2ECOA 3T4PA 4Y7CA 1ZI9A 3DVAB 1PRYA 3HKEB 2QQ5A 3RFFA 1K8QA 3GA0A 4PXAA 3QSYA 4YA6A 3SBXA 1YIOA 3OPQA 1ULZA 3U3MA 5IJWA 1H2AS 1PVDA 2YZKA 3K7EA 3EBOA 5K0SA 4XYEA 4N49A 3BCHA 3CRW1 3B51X 4FDTA 3WGGA 4CLOB 3UJHA 3ZJUA 1P4SA 4LX8A 4R0VA 4QYMA 5FL7A 1RPNA 1A97A 1XHLA 2IYUA 3HN7A 3D7MA 3Q12A 2WJVA 4G9GA 1A9XA 5CJPA 3OLQA 4Q3AA 4GX5A 1E63A 3RT7A 1FJ2A 5EC8A 1Z0JA 5I9MA 1E7YA 1GPNA 2D1FA 4K3UA 2CMFA 3DXXA 1I51A 1TZMA 1PQYA 1MZVA 5FI5A 3UAXA 4CF5A 1C9JA 1ODFA 4MVJH 3FPGA 4JBWA 4Y9RA 1TCVA 4WZZA 1XZEA 3X1YA 5DSXA 2A9KA 4A0HA 2AN9A 2DT8A 2HPHA 4Z4QA 1BDHA 3JS5A 4I1OA 3ITKA 4CI0B 1RMYA 2VEDA 4B2YA 1J2YA 4D56A 3AKDA 1FE8A 4IS3A 3VNAA 2FP4B 2JH3A 3DCYA 3DPIA 3JYLA 4MQEB 5DXAA 5JSKA 1DUVG 3QYPA 2NNWB 3JSXA 2GXQA 3KJNA 3NTUA 2L82A 4ENRA 2IEIA 5CR9A 2VJLA 1OX6A 2F3QA 2VR1A 1OASA 3KAJA 3B8EA 2AG6A 3Q1LA 4O25A 4M9RA 3CS3A 2J6HA 3G1TA 3M33A 5IFKA 2XW6A 3VKGA 3O38A 2JZOA 5KWIA 2ORED 3DT8A 1YC5A 4ZOAA 1JHUA 2GPNA 2B8EA 3VAAA 1S02A 3ZIUA 3R40A 3SCZA 4BFLA 5KREA 3GUVA 3OZ7A 4CIBA 2C2ZA 1M3SA 2ZCVA 3DVAA 1SCIA 3HKEA 2VDLB 5FBZA 4QTXA 5JWRA 5L8VA 1ZJYA 2PGLA 4LAFA 5HW0A 1DIGA 3AYXB 3OEHA 4KMSA 1Q0LA 4RV4A 4S0XA 1NFQA 5AKIA 2AS0A 1RAFA 2NT3A 3AIOA 1JZTA 4LXHA 4NLLA 1K5HA 3ENVA 4LCBA 3VDXA 3ER6A 1B8UA 4E4TA 4ZHQB 3GOQA 3PQCA 1N5LA 4JEMA 5JXHA 1LXCA 4CLOA 2IS4A 3FPAA 2RHRA 2I1QA 4ALKA 1G9XA 4IMPA 4EUKA 2VNJA 3O75A 2HDWA 3ZOZA 1KI2A 2PFKA 3UH1A 3AM1A 1JE0A 2SCUB 3GZ4A 4YJ3F 3WNZA 4C2AA 2INGX 5JH7B 2ZUEA 3EWSA 5E2AA 3K1AB 1IOVA 4A8JA 3P52A 1SVUA 1Y0BA 2C94A 4FUQA 4DMUB 4EATA 3MBIA 3DDNA 1DKOA 3IB6A 4GPZA 1ECPA 2HJ9A 1VSUA 4LV8B 4REOA 4DBLC 3WZ2A 2GJAA 4RQUA 3M81A 2H1CA 4YP5A 4COKA 4Z9AA 2GUGA 4MPJA 1KYYA 1W4CA 3KD2A 2GK3A 3ZVRA 5LP1A 3WIUA 1G98A 1ULAA 2G25A 5JYEA 2GDZA 3G3EA 3INNA 5EP3A 1MZPA 4IGFA 1USKA 2WJZB 4JJFA 4A8HA 3A26A 2FP4A 4ZP1A 4MQEA 4ZO4A 3ZW7A 1YE5A 3HU5A 4O0LA 3FYDA 4HFRA 4LZOA 3RTEA 1U90A 1ZWLA 2PU5A 1DO2A 3JYNA 3NEYA 1LLDA 4PNZA 4U2KA 3RGGA 2H2FA 1N7IA 4XVRA 3U3ZA 4KHPB 2C0PA 4C0JA 4PGGA 3KZXA 1PJ4A 1YWGO 5D5HA 4HNHA 2PANA 4OHFA 4G0OA 1G9TA 4LMBA 2B98A 1D07A 3HZHA 4FFNA 4J0FA 4Q12A 4UHKA 5LUAA 5AI8A 1YS9A 4J0IA 1O58A 3EIXA 1Q21A 5EJ7A 1UCFA 3CZRA 2AX3A 3H4VA 2FOIA 1RWXA 1KYTA 3UG6A 5TVKA 3W4KA 2PMEA 5AHKA 3H9JA 2QSJA 4CR8A 1YR3A 3SZMA 4DIDA 1C1HA 2QZZA 4LBYA 4EVIA 2HSGA 4ZHQA 1IN8A 1YJ8A 4LSZA 3RTAA 3T9FA 1ZRNA 5LQAA 2QY9A 3NZEA 2O57A 4F4FA 2PGJA 2PZKA 1UJNA 3D4OA 2C7RA 5HIAA 4K5QA 4ZV7A 4Z3DA 2A1UB 4D96A 4EZBA 3BM5A 5C5DA 2WYWA 2YXDA 4GNKA 2SCUA 5JD3A 4DCJA 5JH7A 4LTDA 1SHTX 1EQUA 2JIZA 3CSUA 3K1AA 4HB2A 3QVKA 4QHSA 5D01A 6AT1A 5JXGA 5IVDA 1JKFA 1QGUB 4IJVA 4HNQA 3BWCA 4MMXB 4U2EA 4BMVA 5BYKA 5LIRA 3MLBA 4B6FA 1RYEA 1O94A 1Y34E 4DBVO 4RM2A 5EQJB 1TC1A 3B5IA 2DFNA 5DI3B 1POXA 4P08A 2C83A 4P22A 2GA8A 4NATA 2NTYC 2QLMA 3AHFA 4LYEA 1EK0A 4D6PA 1U3GA 5F2EA 3E3OA 4U1RA 4EB3A 2PT7A 4W82A 5EMJA 2B1IA 3E4DA 5EXXA 3WMXA 5CDGA 1RLJA 5IUJC 4QG3A 3LBFA 3EIFA 3MGGA 4EHDA 1I36A 3C8DA 4M8KA 4DOMA 4YYZA 4YAWA 3W9UA 4DQLA 4UUQA 5BOVA 4CTNA 3RQSA 1XD2B 4REMA 2A0XA 4TMWA 3STXA 2WTEA 2LBPA 2HJVA 3W5UA 3FRHA 4IR7A 4P5EA 5HKLA 5SYAA 2REQB 1HNNA 4L3VA 4HK4A 5HX7A 1J5EB 1I7DA 3DMNA 3WDSA 4PS1A 4MKFA 5J1SB 1DBRA 5LPNA 1ENOA 4YO7A 1JHQA 1GKIA 3EPRA 3G0GA 1Q0PA 5BRNA 1X1DA 1X80B 3CTPA 4JASB 1ZH6A 3SFZA 5IJAA 4OX9Y 2ZDHA 2HWKA 4MVJE 1FVXA 4PZZA 4UBNA 4J1NA 1XLWA 1OIVA 5JJ5A 2XEDA 3UJDA 1O89A 2YWEA 3A1DA 1ULTA 1OCEA 4HGPA 3X1WA 4BO8A 1GZ4A 4DB2A 2R4TA 4JYPA 1Q44A 2V6BA 2A1UA 5HFAA 1SHLA 5M34A 2IU3A 4KIGA 2XUPA 4MKRA 5IDYA 3RAPR 3ECSA 2G70A 2ZT8A 3MWYW 2JANA 4DPMA 3L6RA 2ZJ3A 2RGRA 1TYDE 4OOEA 2HF7A 1QGUA 4LXYA 4UDXX 1ZZGA 4LMPA 5FQOA 4YPOA 2NP7A 4FOPA 2P9YA 3HL4A 4BU1A 1B8NA 5HE9A 4QASA 1EDOA 2C2KA 5DI3A 3W9SA 4D2IA 1VYTA 4KGVA 3PNSA 2EHDA 5BN1A 2BEUB 1CZUA 3R5SA 5B36A 1X1RA 3FUCA 3REFA 1PGJA 3H4TA 4KDRA 3X1MA 2TRSB 1BC5A 1JMYA 1P39A 2PT9A 5J4HA 3LH5A 1P2DA 4LWOA 1CUEA 4EPRA 1SHUX 4Y67A 3P5BA 2IXTA 5IX8A 1ULSA 4NFHA 1EEHA 2IODA 4ZVTA 4C4XA 1PV4A 5ITZB 2IS1A 1U8ZA 2M6SA 4NOLA 3ROFA 4B71A 2AR0A 2AXNA 4YDRA 1XD2A 3WE7A 5IWCA 4M7OA 4PNEA 4KIFA 3HKBB 3OCJA 3UK1A 1QHSA 1ISGA 2BT4A 3HCEA 3K9NA 3CLRD 1VG8A 2REQA 3COWA 1CZRA 1YL6A 1J9ZA 2JRCA 3JASB 4UTZA 3WYCA 2IYEA 1TD1A 4JFAA 6YASA 4OUKX 2QS9A 5AW0A 3QPCA 4UAGA 1ZN2A 3AV3A 2PZBA 1UUFA 4B34A 4NSNA 4DIOA 3S2UA 3NUZA 3WKBA 2VF2A 4Q4LA 2W6QA 1G6Q1 2VG8A 1L8OA 5AW7A 5BUCA 4MINA 5BT9A 1X80A 2PH1A 4NOKA 3Q9SA 2XB2A 3PEYA 4RXMA 2XMQA 5DHTA 2Y0CA 4F4JA 1FQWA 5E9JA 4Z51A 3D7LA 3IFSA 3N70A 5K0GA 3RS2A 1WE2A 1TADA 1NLYA 3PC6A 3FGPA 2NU7B 3LA6A 4D4KA 1BCSB 1NJ6A 3IODA 4IMJB 4JJKA 1U7PA 4NDZA 3UAGA 5KNBA 3HRHA 3Q3GE 3T4XA 4F8YA 4ZAFA 4ASUA 2RJ3A 1I2AA 4M87A 5U1PA 2ZB8A 1OGYA 4KVZA 5KPDA 2IRWA 1TD9A 1Y1QA 3KAKA 4WV3A 3ZZTA 4NG4A 2JAOA 3K4HA 3PNYA 1PHPA 2UZAA 1G2IA 3RSLA 2EP8A 1ZL0A 1CUXA 4LHSA 5DCUA 1PJRA 5KMGB 5J2UF 3RAGA 1VFNA 1WMAA 2BCGY 4NVRA 4OIMA 2R6JA 2XSZA 2FQYA 2JFQA 3B1JA 1YCFA 2M32A 2P6MA 1GG5A 2XAUA 3GHHA 4JWTA 2BEUA 5DGTA 2WWVD 3ZHYA 1QF6A 1FUEA 2W22A 3FTPA 4QEDA 4V2IA 3VTKA 4Z4EA 4URHA 4HXGA 1U3WA 3JALB 4KQXA 3DZCA 3QMVA 3ORYA 3E23A 3AR4A 4Z7OB 4A2PA 2DX7A 2QT1A 4KAJA 2XV1A 2J9RA 3LUKA 3NU1A 3OQJA 5A02A 4FFBB 1ZD2P 2GM5A 3GDHA 3IUYA 4FXOA 2NXNA 4I5FA 3SOZA 5ITZA 5JZOA 2UYCA 1LNSA 3LWBA 3F71A 1TUGA 1BFDA 2XRYA 2B2CA 4EJ0A 3HKBA 3NBMA 5AW9A 4FMCB 4NEQA 3SN6A 2I6FA 3JASA 1CSEE 2AWNA 1AJEA 4GRAA 1GLNA 2NT4A 3IJPA 4F3YA 4BO2A 1ZUNB 3AVPA 4UZSA 3N6RA 2GSWA 4QPNA 1E32A 2UV8A 3R8XA 3EY4A 4AO8A 4LF7B 2EZ8A 1XJ0A 3LLVA 4XJXA 3OUZA 1O3YA 3PXXA 5M5BA 1TQ8A 4FDLA 1M2JA 1W25A 1LDMA 3UV3A 2VP9A 1BO6A 3BA6A 2VN8A 3DTTA 4CKBB 2PUEA 3TL2A 1T26A 1XRRA 1MJGA 3D5QA 3I9OA 2GB4A 3PB3A 3Q5DA 4YRRA 3EEYA 1L1EA 3ZI4A 1GZ7A 3ZY5A 4FSXA 5IT9A 1BQ4A 2NU7A 4I1RA 1BCSA 2QD3A 5JNWA 2VH2A 3ONNA 4NE2A 5C2JB 3TPZA 1EVKA 2Q1UA 3DE4X 2X8LA 4B3MB 1G4HA 1MW8X 5BSVA 4RVUA 3UJBA 5CVUA 2J5KA 3GLSA 5LN1A 4KN6A 2G9NA 1TAGA 1HL7A 1SD1A 4F11A 5KMGA 4D8VA 1RLIA 2P4UA 5JJBA 3NR2A 5T67A 4E13A 5KU7A 1N2ZA 2FGKA 5EWJB 5FWYB 3AM4A 4ZYWA 3C1AA 1CIPA 1IOLA 1Z6AA 3T3PB 4AROA 1Q7CA 1QR6A 1PZMA 1FYWA 1J20A 2QNIA 3X1DA 4DA4A 1Z17A 2QG4A 3GGPA 4B76A 4P7KA 4YAGA 4ZFNA 3JALA 4YJ2F 3IVAA 4OXYA 1Z8NA 4FFRA 4HAOA 3R5JA 4B3IA 1OBCA 2OFPA 4NXNB 4S2UA 3QF7A 3FWHA 4D4HA 1UPFA 2VJPA 1WZCA 3KT0A 5A5EA 2WT4A 1NULA 1K7SN 2XQIA 1Q11A 4U8HA 3GLKA 3KXLA 4HSEA 5ALPA 1N78A 1G3QA 1SB9A 2EJCA 4U2FA 2WJ3A 4L51A 4GMDA 1XRMA 4R2KA 4AIRA 4X0EA 4PAMA 4UVIA 2GPTA 1EK5A 5TT1A 4GP7A 4YR9A 2WVJA 4Z53A 4E2YA 2PNJA 4DYVA 1ZUNA 1XAHA 2FDCA 3U4CA 1ONBA 1PZNA 5ECGC 3VZSA 3ZVKA 1K89A 2ISCA 1GITA 4AP5A 1J8FA 3AVQA 1A82A 2QJFA 3G0DA 3NWBA 4KK4A 4CCAA 2DR2A 3NHKA 1OXUA 1ZXXA 2FPXA 1RXVA 2FG7C 1SAYA 4P4NA 5IMBA 1QHHB 1NLUA 3MA0A 2QTBA 5H80A 3VA7A 2ASEA 4CKBA 4RORA 4QOJA 3WGTA 4FEGA 3IERA 3B2EA 4ENSA 4FNAA 1DX4A 4OX9B 2AI3A 1E9EA 2CJFA 4G89A 5CXSA 5ALMA 1YACA 3SD7A 1E5TA 1IBCA 1WY5A 4N47A 2ZJ8A 1CC1S 2C2HA 3T0FA 4KXMA 5C53B 4HT3B 1FY2A 1ZMTA 3MYYA 1JWAB 3L93A 1TVMA 3F46A 4U63A 3L7MA 3L43A 4JCOA 1SOWA 5EUBA 3VO8A 1DJPA 3RVRA 1CUZA 4O2BF 2UZ4A 4WKGA 4HNRA 3AFGA 1GPMA 2A67A 4O1HA 4TRMA 5GP1A 4CDNA 5M7EA 1XV5A 5EWJA 5FWYA 4MVXA 1YZTA 2XXAB 5KYGA 3K0SA 2VJAA 2VSXA 5ERXA 4IM7A 3RSCA 2WFZA 1T2VA 3MTAA 3CEHA 2DR0A 1LI4A 1ORRA 4R8VA 5EEHA 1YZUA 2VAPA 2P62A 2ZSJA 3IURA 4BN4A 4AWBA 2G9UA 1AUOA 3MJRA 5K8TA 3QPDA 2IXBA 1N9ZA 2J85A 3AOGA 3O4VA 4BNUA 3HDVA 5ENZA 3WSTA 2QI9C 3T3IA 4BNFA 1VKJA 3FRJA 3ZBUA 1GVNB 1T5DX 1JDUA 1VCNA 2MYUA 3CZMA 4FE3A 5AH0A 4QXAA 5BYBA 1RWOA 4LWQA 4EDFA 5IVHA 4Y6SA 2WUGA 4MGYR 4YJHB 1TQHA 1R15A 1S96A 5LLTA 4CBVA 2B34A 3A9VA 5I7OA 1QIMA 1QR2A 2DFVA 4C2BA 3F98A 3OX4A 3QHQA 2ISQA 2R79A 3A6KA 3QF4B 3HL0A 5TGZA 3IAEA 3G7SA 1ZJJA 4H1UA 4PG6A 4XCVA 1KTIA 1XVTA 3QEBZ 1Y1PA 3JAKB 3LNCA 2VEOA 5AVSA 4WXMA 4OEHA 5F33A 3TQTA 4HNVA 3LHFA 3BQMB 3TEJA 4JP5A 3VYVA 3Q8KA 2FA9A 5KAPA 1QHHA 2Y3IA 4RF5A 4FZJA 4DV1B 1NVGA 3X2FA 3CZ9A 1EWYA 1RABA 4LX0A 3WOVA 1ENPA 1T0HB 2VUTA 2LD4A 4E4YA 1UMKA 2XKBA 3SHQA 2AXEA 3FRIA 3KWLA 1NXXA 5A4IS 2FSHA 4DIUA 1F8UA 3MCUA 4FIZA 4LIPD 4TWIA 4RDXA 3GLFE 1C30B 4X1IB 2X9NA 4Z9XA 5BN5B 4V0MA 1N6LA 4RKWA 5K6RA 3G0CA 1E2KA 2XMPA 4FHCA 3V1NA 5COBA 1EKXA 3AM3A 3WK8A 3KZKA 2ZI9A 2D3WA 2NO0A 2A14A 2DZDA 4FLMA 2PUJA 2EZTA 4X6LA 3RV4A 3STVA 4B32A 1W1IA 1HL3A 3EDQA 1EP3B 7MHTA 2PKXA 3O4GA 1II8B 4BNMA 3CUTA 2GEKA 4MW0A 6NULA 4UZEA 1XG5A 2NZXA 2PIAA 4JL5A 1UANA 3A1TA 1IN7A 2Z98A 2O2CA 4IZIA 4KU4A 3WVNA 2DMRA 2XXAA 2J3LA 1C14A 1NXOA 2HJGA 3K8OE 2VPYA 3D0KA 3HTXA 3IUEA 1QH8B 1K88A 3EYWA 1KYWA 1LTHR 4ARUA 1VHWA 5DGDA 5E7MA 2CNWD 2YINC 4ZN6A 5B7QA 1NN1A 2FE4A 1I3CA 2CFCA 1V9LA 1IN5A 2JW5A 4KTTE 5SYNA 5FR2A 1GUBA 1H2RS 2DRIA 1LTQA 4C06A 1V41E 5KTMA 5AJUA 1T0JB 3MS4A 2UYHA 1HTTA 1RFGE 1RBYA 4ZOEA 3OC6A 3W8DA 5A5FA 2DTEA 3JWEA 3DDUA 5AKXA 3S2YA 3WLMA 4B4WA 4QOSA 1YF3A 1JQ5A 1DAHA 3WK4A 1IEXA 4YJHA 2Q1XA 2NYRA 2O7RA 1NA5A 1YI0A 3AT1A 3L7DA 3ZVMA 1EFAA 4HTFB 4U5XA 4CLRB 3QF4A 1GRCA 1NVTA 4Z8YA 4LGVA 2C59A 4ND5A 1Y6ZA 1H0SA 4GKBA 4OJKA 1SKMA 1O0CA 5JG7A 3KKMA 2LKDA 2OV2A 4ARZB 1WUIS 2PZFA 3JAKA 4DQVA 1NV8A 4PVDA 2J3DA 1ABEA 1E6CA 1U1FA 1CEXA 2V1XA 4QXMA 5TRTA 4OL0A 5JNLA 3WGVA 2I22A 3ZQUA 3WXMA 5EOVA 1FQJA 2IT1A 5FA6A 2ERCA 2W2QA 1PTJC 4TOIA 1ONSA 2ODTX 2ODAA 4EJ2A 1JV2B 4R2LA 2CMHA 1C30A 1YZFA 4KH0A 4X1IA 5BN5A 1T3HA 1S3FA 3G79A 4ED9A 1CULC 3TI9A 1JT9A 1V2HE 1XVVA 3G1WA 3BERA 3LW7A 4J0KA 4QE3A 3ILXA 3OT5A 4NAHA 3V1UA 5K8VA 2NYVA 1J2JA 2IIQA 1GKUB 2QSZA 2IY7A 1WXIA 2E48A 3SSOA 4YT2A 1MX3A 1RZRD 4EA9A 4L8YA 3MRXA 1C0PA 2RH9B 1J42A 3LS2A 1DWUA 1II8A 2YZ2A 3REOA 1XTTA 3M4XA 4BJ6A 3QENA 4HGZA 1L8QA 1FLDA 2AD1A 2FW8A 2HUPA 3C85A 2FQ1A 2QGNA 5KVQA 4B3HA 1AGRA 4MW1A 1UC4B 3ORRA 1QH8A 2D54A 4MWEA 2BR5A 2QN8A 3KJIA 1YS6A 1SXJB 3WGHA 1KR5A 3HRKA 2DAPA 4G63A 4MA0A 5LQUA 4IKPA 2VJYA 2BF4A 4LJAA 4LWPA 2K2WA 3A6DA 1W4LA 3KOMA 4QICA 3VH1A 1J0BA 2YFHA 4MW5A 2LDXA 1VGQA 2WTAA 4FPXA 5FR1A 4DG9A 5J43A 4N6GA 1TCAA 4MQUA 1W0CA 4YBZA 4N7BA 2BISA 3FUTA 4HYYA 4HTFA 1Y4DE 4CLRA 5ALGA 2YTZA 5DNDA 2P6OA 4M7PA 4MROA 3O1HB 3EWNA 1A9YA 1O7JA 5IJ9B 4FWTA 2M1ZA 1DAOA 2I87A 4N54A 3SXUB 5MHTA 3LWDA 2C2WA 4WKNA 4DA7A 4ARZA 1MP0A 3PYLA 3G82C 4MGHA 3S2GA 1JNYA 4DNXA 4LJ4A 4IOLA 1FSPA 2P11A 2ONCA 4LJLA 1UM8A 4V1CB 3B7WA 4JITA 3B2NA 3U26A 4R7TA 1VHQA 4HDAA 1QFMA 1NBOA 3B3GA 1G4UR 1U31A 1DCFA 2CNOA 5FI3A 3RSFA 3FXAA 4KLAA 2PO5A 4IGEA 4IIYA 4OXIA 4DSTA 1WSBA 2PRYA 4ETIA 3R3SA 3FNQA 4EUHA 4DUYB 2W43A 1MN6A 1ONNA 5ICGA 5IDWA 1CRZA 2RK3A 2F3UA 3TRFA 4DRXB 2DH6A 1K6EA 1O5IA 2DUNA 4HNAB 3LT2A 2WPDD 3S8YA 1Z5UA 3UF0A 1V5FA 2RARA 1KO1A 1XSEA 2SHKA 3L1KA 2PUFA 1NRXA 2JIDA 4ZVRA 3UQYS 2Y27A 5T3YA 3ECCA 1W9MA 3W5JA 3O83A 1PT8A 2E2WA 1CB0A 1WQ4A 2JGRA 1KI1A 4L28A 5EGNA 4P58A 4PWYA 5A4JA 3AKCA 4YJDA 5LA6F 5KWVA 1PR0A 3OICA 4W63A 5FI0B 1OB2A 3H7AA 3DMHA 2QGFA 1YZYA 3B1XA 3FLBA 3HWRA 4NZOA 1NG1A 1NQ5A 2GILA 4P7BA 5JXWA 3PI6A 1SXJA 1RD4A 2X0IA 5E95A 3TLXA 3N7TA 5EQDA 2FSSA 3EQZA 3F9RA 3GPIA 3PPYA 4PRLA 1GG9A 4DR1B 1RT9A 2ONZA 4OQDA 3Q6MA 5EJMA 1X74A 4WLEA 4M37A 3P9SA 5EKSA 5EVJA 1U28A 4X5OA 3QG1A 4Y2RA 3PD7A 4BE4A 1XUOA 1EFTA 5IBCA 2QTGA 1A9OA 1RWWA 1YHYA 2ST1A 3R0ZA 5F3RA 1I3NA 3FBWA 4NL4H 4QL3A 2RE8A 2CNKA 3HEMA 5ARDA 5C35A 2FRDA 4JJEA 4RACA 5IJ9A 1ZAYA 4XWYA 3ESXA 3QXHA 2ADOA 1H2BA 1RJGA 1WB5A 1Q0HA 2QQGA 2AE1A 2B1QA 1P8JA 1UEXC 4FYVA 1NRIA 3SXUA 5IUNC 4IXDA 1PYOA 5J9FA 3ZJ4A 1GFSA 1YRBA 1RBZA 1XQWA 1IE3A 5LD2B 4KODA 4R1MA 3FUUA 5EINA 4EA7A 3E6AA 5F4ZA 4LGYA 1J07A 2MR6A 4V1CA 1BHQ1 1W4AA 1WMEA 3KTAB 4JS0A 2B37A 2C4KA 1B2RA 4NJOA 3O1JC 4M9ZA 4PLGA 4BMXA 5ENVA 4B7AA 5B7GA 2JLXA 2GRAA 1MEJA 1TF5A 1Z4NA 2VA9A 3Q40A 4YCCA 3OJXA 4GMFA 3PV0A 3ZWXA 3M7IA 4ZTBA 1YJAA 5JZMA 2Q2WA 4DA0A 4DRXA 1R4NB 2H59A 2VDUE 4HLDA 3R7FA 3TKAA 2W9XA 4EB6B 5ITWA 1T1IA 1YQTA 1N33B 4Y6GB 2GK6A 2ATXA 1PNQA 3GXOA 2WE7A 1FTSA 3CUUA 3MB8A 3FMPB 4J90A 5TV2A 1RYFA 4TZ6A 3WZLA 2BKEA 2ZTHA 5FWNA 2NXJA 2O05A 2VT3A 1DADA 1RJWA 2YOFA 3RADC 3A4LA 2QVZX 3DHVA 1HYGA 3KKEA 2W6OA 4QLOA 3JD0A 4UKDA 3BJIC 1VG9B 1AZLA 1QGYA 2ZSHA 2FN7A 2Q0HA 4N40A 3PUYA 1IMOA 5FOWA 1ZR2A 8MHTA 4YRGA 1T9KA 3BTOA 1GUZA 4KGZA 2VA8A 1GPWB 2C4HA 4BS9A 4F93B 1RM4A 2JAQA 4Y6RA 5HPYB 4REQB 4YONB 4DQXA 4GECA 2PUVA 3WJAA 3HGMA 2E5LB 3TL6A 2KWIA 1KEVA 1BE1A 2VO1A 3WK7A 2Y9PB 2Q3DA 1G41A 1V26A 3IUNA 4RZ3A 4RHCA 2CZQA 4IEFB 1JQJC 1QHYA 3U5TA 2C7OA 2O0JA 1GQ2A 3EIQA 2EYQA 3RK4A 1IK4A 4FT4A 4XX0B 3S8EA 1OBFO 3FNIA 1EUZA 3BF7A 3VUFA 5CNKA 1I2BA 1R8SA 1V47A 3FLAA 4X97A 5LBIA 3GPLA 3TLGB 1M8KA 1XTSA 3QE3A 1SUPA 3PJGA 2C0QA 4HAIA 3G5TA 4LSMA 1I32A 4RMHA 2I03A 4XR4A 3VI3B 1RJFA 1J2RA 4BEBA 3KTAA 3KB1A 3D1LA 5DYIA 1E5XA 4NYJQ 3WL5A 4DDMA 1WZEA 1U8EA 4U6NA 3RG2A 1L1RA 2ZUSA 1F2TB 1E2FA 3DAOA 1HZZA 3GARA 3GGGA 3NHPA 2FLWA 3EXFB 3NRBA 2RKWA 4MPRA 4OOFA 2Q7XA 2IFTA 4P7JA 1R4NA 2PX4A 4AMVA 4W8GA 4EB6A 5JT1A 1W8DA 4KO4S 4DAOA 1YK1A 5KDDA 1F8XA 4HLCA 3WB1A 1V39A 3GZTB 2MINB 5C5IA 1AC5A 1U5CA 2AG5A 3I3OA 3QE0A 2K87A 1JH8A 3LXXA 1WO8A 3DHWC 1W85B 1RE0A 3HBFA 1FFAA 1L4FA 1ZMBA 3E5MA 1BNCA 3RLFA 3ZGVA 3M4JA 4J03A 1TZ2A 2QX7A 3H97A 4HLQB 4X1KB 3WJ1A 2P2CA 1LRKA 2GZRA 1F48A 3CX7A 3IVGA 1TLTA 2XUKA 4EYGA 2YY7A 4OHUA 1TU4A 3MJVA 3P2KA 4YNBA 1WQ1R 3BICA 3EODA 3OIFA 6LDHA 1N8KA 3U0VA 1TMYA 4Q9KA 1GN8A 4CLEA 2Q2OA 3EIWA 2HFKA 3QXCA 4REQA 4MA5A 3R9KA 1KEKA 3CNNA 3EDRA 4IDFA 4CKCB 4GZ5A 5TQVA 2ONJA 2WTUA 2RKBA 1G8AA 1JHXA 1V8BA 4TKUB 3L07A 1ISRA 2IYXA 4M0MA 1I5RA 4BBJA 1M5RA 4M38A 1Z37A 4OHYA 1H22A 4Y0VA 3TKLA 1BMTA 1ICEA 2AMYA 3IE2A 3KE8A 4KLZA 7AT1A 2VF5X 3WLQA 3CJTA 3X3HA 4PAOA 1YJQA 4CL3A 5KC8A 4GBJA 4XX0A 1GEEA 5G3ZA 3PWZA 3ZHQA 5GWXA 2XEXA 1U04A 1BHJA 1QQBA 4DMMA 4CL2A 1Z0ZA 3ZUGA 2XYRA 3DL4A 2XNDD 4RK7A 1N2XA 3FIUA 5A03A 1XP5A 2H4JA 3L3BA 4HF7A 4RIHA 5LKAA 1G18A 4HDMB 4DDWA 1KFKB 1F2TA 3T1YB 1TRKA 4ZMRA 1V6SA 5KOIA 4WASA 2SICE 3BF8A 3SS9X 1KDRA 5H82A 3EXFA 2ZJYA 2IHUA 1YDMA 4JELA 4ZI7F 3BBLA 3UKOA 1JIUA 3TO5A 1Z75A 3CZQA 3KEOA 1P9OA 4GR5A 4HZGA 2GHTA 3GLVA 4UJ3A 5JAQA 2MINA 3ROEA 4I81A 5BWLA 2GPYA 1WKVA 3HBLA 2ZYTX 1P1IA 4BX8A 2H9YA 5HEKA 4HWSA 1SC3A 1W85A 4TS1A 1ZINA 5CT6A 1RRMA 5K8LA 5J3JA 2V7XA 3CH5A 3EK2A 4P82A 4OP3A 3VHXB 2JPDA 2Q07A 2QJOA 4X1KA 3PX7A 4XTRA 2VRCD 2FETA 2N1BA 3HZZA 3KSRA 4M1KA 3AI3A 2A3RA 4CLDA 1V1MB 4B85A 3AGQA 3PUJA 4OBBA 2BJVA 3LX4A 1ATZA 3ZZUA 4RNCA 4BAUA 4QBKA 1ESDA 1ORIA 1VGVA 5JNTA 5LB4A 1A9SA 3SQDA 1G7RA 3ZBPA 3RRMA 4UULA 1PDOA 4ITUA 3T6KA 4WN9B 3ZWDA 4C2TA 3D5EA 4PLZA 4Q34A 4G41A 4WOCA 2DVMA 3EH1A 4GFDA 3UMRA 4CKCA 5EN4A 1OLUB 2EWMA 3NTQA 2GTHA 2EL9A 4LUCA 4FS3A 4TKUA 3KT8A 4ZODA 2OCBA 4BFVA 2HDOA 2YHIB 5AW2A 4YAFA 4EI9A 1VLJA 1HO3A 1W76A 3R77A 1P7CA 1DG1G 3RC2A 4KITB 2D6FA 3R3ZA 1H8HA 2E1PA 2VSFA 1ZXLA 4QDUA 3KUKA 3GVXA 4HAUA 2C1EA 3LKZA 1M1YB 1OT3A 5ESDA 2FJUA 2ONYA 3Q0IA 4DLKA 5FB3A 1AH2A 3V8PA 3UT5B 1GZ5A 2AJBA 1BD4A 4IQ8A 4HDMA 4MRRA 5KSPA 5A1JA 3NI2A 1Z6XA 4E14A 1BROA 2GAIA 3D8UA 4JJIA 4LZWA 3TQOA 4EFKA 2P8SA 1DPFA 1NVWQ 1CRWG 2QNRA 3H8JA 1U8AA 4B4DA 5C4MA 5BV0A 4ID9A 5IK2A 5B3JC 4LEIA 2Q3BA 4YJGB 2DGDA 2A57A 4UTRA 5HM8A 1N34B 1L8AA 2JKVA 2FMFA 3II6X 4YP1A 4RVDA 3M6MD 3ZR4B 3WGUA 4M46A 1NUSA 4C04A 4W5HA 5K8CA 5I3CA 4DN6A 1Q83A 1MC5A 4LYYA 3U31A 2Z8YA 3IAFA 5CVTA 2CLOB 3VHXA 4OQZA 4BPBA 5EIBD 4QOIA 1XFDA 2GCOB 2PPLA 5CW2A 5EA2A 1NW4A 1S3IA 3WMFA 2W98A 4LYAA 3NTVA 5JASA 1V1MA 4NHEA 1PEAA 4IBOA 1DAPA 4MW9A 5IF3A 5LQMA 3G8BA 1VFPA 1LF5A 1I4DD 1L1QA 2D2IA 3DXFA 4HMQA 4KWHA 5A4AA 1K6JA 1PSZA 1YULA 3I6IA 1ABFA 3GAAA 4TWRA 5JD5A 3Q7QA 1MB3A 1P0QA 4DWVA 2O5EA 3VR0A 3DYBA 3N7UA 4RZXA 4WN9A 5ECWA 2OBLA 3ICOA 3WK5A 3ROPA 3OT1B 2BTOA 2C5HA 3HADA 1OLUA 4EFNA 4QLBA 2P9TA 2IP2A 2OV1A 5JDCA 1UDBA 2WZCA 2YHIA 4CT4B 4TZTA 4H7PA 5FBKA 4KLCA 4R31A 2HXYA 1EJ6A 2RGYA 2ZEJA 4HVTA 4JSTA 1YB6A 2JB9A 5JXJA 2XT0A 3SQMA 3OOSA 3U7HB 1Z82A 4LSGA 1C2TA 4F84A 5JJCA 1HYEA 1JPVA 1Z5OA 2WAMA 3A4MA 3C41J 4KVGA 4OJMX 4RJ2A 5D1NA 5FPTA 3U48A 4BGDA 4PQEA 1M1YA 3O84A 2AW3A 2LIVA 1ZJZA 2Z3ZA 3IEMA 4HD8A 2ID8A 3NEJA 4G5FA 3GT0A 1M83A 5FBLB 5F4BA 3TS1A 5FV7A 3UT5A 4QT4A 4YRIA 2WWYA 3U60B 1SD5A 1H4QA 3JZIA 1MB9A 3DOIA 2IP4A 2X3UA 1Y63A 2ENUA 5DWDA 3TBFA 2FNAA 1CUFA 3QYJA 5ALKA 4DJ5X 2WUWE 2IJGX 2VZEA 5JECA 1SHJA 1LC0A 4LECA 2BSAA 4Y7DA 4YJGA 3WL3A 2YVKA 5IW8A 1BVRA 1E0KA 1LV8A 3QRWA 1W7AA 1BW9B 2A35A 2XQVA 4MH0R 3O6VA 3L1JA 3W8EA 1J70A 4MV7A 2JJ8A 1XC7A 2AE2A 3BB4A 3ADOA 3C16C 3UA4A 1LFDB 2POCA 2HM7A 3P2OA 4RPKA 1WF6A 5MN6A 4AKSA 2RK4A 2H54A 3H5WA 1I3MA 1NW6A 2GCOA 3DFZA 1NBWB 2VFAA 3ETDA 3NBQA 1A95A 3GJ7A 3L82B 4FR0A 3I58A 2QZ4A 4KN8A 1T6NA 1KO4A 2AZDA 3C5HA 4LZPA 4M99A 3ZHSA 3RFXA 8GPBA 2GFIA 5JCPA 5KSYA 1A8SA 1RI3A 4YV1A 1MX9A 1ADJA 1CW2B 2WEKA 5AO9A 4YRJA 2KMLA 1J99A 3M2TA 1PR1A 1Q0QA 4RLHA 2AD5A 1ODIA 4HVAA 2BAGA 3DHNA 1MAHA 4GPD1 5KTRA 1HPLA 4O4JF 5J23A 1GZ3A 5D5QA 3U61B 2WK1A 3OT1A 4BBPA 2QTZA 3EQ9A 3AXTA 5GM1A 3AEUB 5B3LA 1JJBA 4KN5A 1HX7A 2XJ4A 3QITA 1AKYA 4R1SA 3ZE7A 1Z0KA 4BXOB 1R0CA 2H1RA 2R5NA 1LX6A 1YH3A 3JX9A 1SCDA 1RQPA 1NYRA 3HJGA 4LY3A 3L06A 3ASUA 3LDHA 5E8RA 3PTZA 1MENA 4HX2A 5K4GA 1PNVA 2RHBA 3K5IA 2P7IA 2X58A 5KU1A 1OXXK 2FSVC 2V7PA 4C3OB 2LDBA 4JLDA 3BREA 1KVSA 4QD3A 1FEZA 4XSVA 3AR3A 3ZK8A 2AFHB 4TYMA 2V58A 1NG9A 3PLAE 1FFHA 1JN0A 3Q7PA 3F3YA 3PX3A 5HCNA 3SWWA 1ZSVA 2XRMA 4JHXA 4BFZA 2EW2A 3L04A 3LPDA 4P36A 2XTMA 2IYVA 4BWGA 4E3WA 4RTKA 4GMKA 3S2SA 4W8OA 4BNIA 3BCUA 2C92A 1ONOA 1RYYA 2I2DA 4WGGA 3ASVA 1ISHA 2JIBA 5KQPA 3ZQ6A 3SNKA 3ESDA 4MCHA 2OILA 3M6LA 5AI0A 1L7RA 2D5BA 3ESAA 2XNSA 1B76A 3NKVA 3JD1A 5CHEA 3RYIB 4X45A 3C7CB 2FTKE 4XXHA 3QFHA 4F96A 4E30A 2R8RA 1RM0A 1U3DA 1ZUWA 2XB4A 5KVSA 3ZD6A 1WTCA 1BW9A 3HBAA 3TW8B 2IF0A 4HAZA 4YMLA 4FM9A 2I6XA 3G8AA 4PYKA 5C81A 3E81A 4J75A 4BO3A 2QX9A 2X0DA 1KQGA 3TG2A 1PZHA 3AMVA 2YVAA 3D3QA 2ASVA 5L45A 2J9FB 2OSVA 3NC1C 4G84A 2PX6A 1YR2A 4E94A 1V25A 3PIRA 4ID3A 1V8OA 1VL5A 4QTTB 3KEMA 3LQ4A 2QVYX 2OD9A 3AU8A 1KBZA 4U7WA 3VV2A 3PJRA 2V5AA 3MW8A 4KQCA 5WRFA 3ZX5A 4L16A 4D9MA 1O54A 4B2PA 4WIAA 4EP1A 2NYAA 3NDPA 5LQRA 2CDCA 4MCJA 5JCXA 4J3NA 2MSCB 2OP0A 4H27A 4EY7A 5KYYB 3DV9A 3QNMA 3UKDA 2EV9A 3ZWNA 5AUPB 3AEUA 3QU9A 2V03A 4PPYA 1EE1A 2XUZA 1YNSA 4RD1A 4WBNB 4BXOA 5FPQA 3RUIA 4TWAA 1WAMA 4LE1A 2J3QA 3JZAA 1IJEA 4TSFA 3TMAA 1NXPA 4E70A 4B3SB 4Q4CA 5AUNB 3AHHA 4LZNA 5KSZA 4O5OA 1JXOA 4AZWA 3QNWA 5IHXA 4MICA 4XD7D 3GCXA 3DKIA 3ZDBA 2F4NA 4IEIA 5KNDA 2AFHA 4NICA 1JJFA 3HR8A 1WR8A 4X54A 4FS8A 4QYTA 4CM9A 2BSQA 2HRZA 2ZFUA 1L5OA 5FIUA 4MGEA 1PTKA 1MGOA 3GPDG 1X86B 3PPWA 2QIPA 2IUEA 5COQA 5EIHA 3AW8A 4MXDA 1R66A 3DWFA 1Y4SA 1WXXA 3JVDA 3K6RA 3RYIA 2IEZA 2AFIB 3W8FA 5F2NA 3EVZA 4GR9A 1WG8A 2YMLA 2SKDA 4B44A 3A6EA 1WIWA 4FJ2A 4M0LA 4E32A 3JQRA 1Z62A 5G40A 4DM3A 1VL6A 4N03A 3WGLA 3TW8A 1EVEA 1RKQA 3LX5A 1KZ4A 3FI0A 3Q2IA 3RFUA 4OLAA 4R7GA 2B4AA 3I30X 1UZNA 2G09A 2YQ5A 2MSNA 2ZB2A 1CQZA 2QM7A 2WSYB 1FW8A 4K6OA 4JYBA 4L75A 4HTAA 2J9FA 1EX7A 3R2JA 4JNKA 1ZHHA 3UGJA 2CF5A 3ODGA 1SVIA 1E66A 2R44A 3HH8A 3OWHA 2H1LA 2R96A 2QT0A 3SJCA 5ABPA 1GR1A 1JHZA 2LV8A 1K7FB 3N0XA 3PUHA 4HNTA 4RSGA 2WMYA 1GPDG 1ZK1A 4YP0A 1VB3A 4CF4A 4Z5XA 3FZGA 4XRRA 3IAUA 4LE0A 1RHQA 5FL7D 2VK1A 3S99A 4I1SA 5BUZA 5KYYA 1LJLA 1Z2DA 3AZQA 4ND6A 3WG9A 2MHCA 2VKTA 1K75A 4QOHA 2OZKA 4YJKA 3NWEA 4WBNA 5FX2A 4GXQA 3IA2A 3NP7A 5ALEA 2A9VA 4NDNE 4E5DA 3EOAI 2VK2A 3UYLA 3HXLA 3L0ZA 4FKBA 1PEYA 2E7ZA 2PM8A 4HRXA 2IVFA 4FLFA 2DY0A 2X2FA 3I6MA 4UC0A 1WWKA 2O48X 1UWLA 2QLJA 2GZAA 2HEGA 3DEIA 2FUG1 1ZO8A 2NW6A 1QO7A 1YDHA 3NTRA 3AOEA 1FFYA 3QX9A 3IAAA 2LKCA 1V4BA 4IUDS 1JZSA 4UTOA 3HDHA 3SHTA 1A5AB 3MT0A 2C4TA 16PKA 1L5HB 3ZNOA 1TZJA 3LAWA 4AYXA 3GVPA 3NEPX 4IRUB 4ZT2A 1H5QA 1I6KA 1JLHA 1E79A 2VNAA 3GLIE 4ER0A 4O3MA 3E5NA 3FROA 1PWZA 3P0JA 3BL6A 2AFIA 3M4YA 4AJKA 3ZHRA 4ZEXA 5CW1A 4MI3A 1D3AA 5K3EA 1YU9A 3A1WA 2VBFA 1T2FA 1YUNA 3RS5A 1AF4A 3G9ZA 3CEAA 4Z4HA 4AU1A 1JIVA 4X6YA 2ZYSA 2BMAA 3FB4A 5TMBA 2GLUA 3KQTA 1GTJ1 10MHA 4HQFA 4EEKA 1KK1A 3QKRB 4EF4A 3T7AA 4AK9A 3OZBA 2VP0A 5LR6A 2H4WA 2QL5A 4UMDA 2B1GA 4LVCA 1T0IA 2V96A 1AXRA 3DMTC 1JFVA 3HB7A 3OEHD 4NBNA 1J9EA 4QT0A 4WA8A 5AJYA 4BKOA 4DS3A 4F3NA 2ZROA 2CXNA 1FCJA 1ZXBA 1I01A 1KU6A 2BEVB 2G4VA 3FE2A 3HJAA 3GJYA 3IPRA 3O2NA 1EVZA 3DJYA 3DMYA 3O8LA 4PZPA 2GAOA 4RIEA 1E6UA 1VJ1A 5EIWA 4KTVE 4RM3A 3GAZA 4KMMA 1QHFA 2EJWA 1LQ2A 1QB7A 2F8MA 2OEPA 4IFBA 4NCHA 2Z9CA 1NI3A 1GAEO 3MILA 4R98A 3ZUPA 2FG5A 4JKYA 3PT9A 4Y1EA 4D9IA 1KJNA 1MABB 3FCOA 1OZFA 4EY5A 1X1QA 2JFBA 3H7IA 2P79A 3KZOA 4ZT6A 4HVLA 2R8EA 4GKAA 1G19A 2VK8A 3OUTA 3HCAA 4DAEA 1XQ9A 2FQQA 3AVYA 4BJHB 2W2LA 3QTTA 4OFZA 4BO5A 5KQLA 1WB6A 1KFCB 2XOXA 4BNYA 4BV2A 1HDRA 4NJMB 5BSGA 4NEGA 3TOZA 3U7EB 1LCIA 4QAJA 1YZKA 2H08A 3UCXA 3UGQA 4QJBA 2A0KA 4DR3B 5KS2A 3G85A 2ISSD 1Z3IX 2M1XA 2OCLA 2XMGA 3IAS1 1OILA 3IVRA 4NCIA 4NP6A 4XFKA 4ACAA 1YBAA 4MEAA 4YCDA 2WWRA 1L5HA 3UVEA 5JYCA 4W5TA 4EECA 1EZ1A 4D3FA 2YXLA 2J5XA 4GNRA 1AKUA 4IUBS 2YJ4A 3Q5EA 2C2XA 2XUDA 4UDOA 5DK4A 3DLHA 2PX0A 1KDVA 4HUJA 3GJ4A 5CTJA 2Z57A 3EAGA 3NT4A 3UFXB 2R8PA 3EFEA 4U7TB 4UFPA 4IWNA 4WACA 3T06B 4EABA 4JXXA 2VPTA 3G5MA 4P84A 2AWOA 1Z2CA 2BZ0A 2I2WA 3AINA 4BNDB 2KB0A 2QRLA 2PCLA 3C39A 1I33A 1VA5A 3C1TA 1JQAA 2UUAB 4OHRA 4G0XA 1OIXA 4Q9DA 3QKRA 4D74A 2GN4A 4JI8B 1B3RA 2E87A 4C4AA 3FHLA 4RY8A 4UTPA 5A6SA 3Q8LA 2Y77A 2YV3A 4TX1A 3F8TA 1ZIXA 1G0OA 3DZHA 5BSFA 1A69A 3WX0A 2BEVA 1M9NA 1QVRA 5GADl 3IKTA 3E0XA 4Q7KA 3DO5A 1DGQA 3RVSA 1DDGA 2ZYWX 1EE9A 1V8FA 4N6NA 1XNGA 4HATA 1J1ZA 1K3FA 3GO4A 3FWKA 1YRAA 2WP8J 3AI2A 4LA4A 3RC3A 1PNTA 2SNIE 5H02A 4BJ3A 2HA2A 2WM3A 1GAWA 5GV8A 3I5XA 3WR5A 1FYEA 1NIPA 1GPKA 4YMTA 1MABA 1EUDB 4FYIA 3LDGA 1Z4LA 1PJBA 2JIZD 2TSYB 1L5KA 3EPLA 521PA 4RZ2A 1ZN7A 3CW8X 4OQ4A 4Y18A 1WNFA 4DMHA 3ER9A 3EAQA 1ZCZA 3VAZA 4D4JA 2ZJ0A 1QO0A 2GS9A 2JI7A 1O94D 5AHOA 1OAOA 4BJ1A 1V6AA 3PC4A 4JLNA 4W9NA 3R0IA 4OXXA 3WKAA 3ZXSA 1K06A 1CZKA 1E2BA 4NJMA 4LOIA 4OMFG 2O5VA 3KQSA 3MK31 2IV2X 1CVLA 4I99A 5EZYB 4B2IA 3G68A 4GQIA 1IY9A 1JUDA 4OB7A 1E9RA 2JIQA 4WY2A 4BYMA 5K5EA 3WHLA 4DCGA 2ODQA 3QMWA 4JBGA 2R00A 4N0PA 4PBRA 1XZGA 4N9WA 4KQ9A 1HT1E 2H4YA 2R4QA 3DE2X 1DUSA 4G24A 5E0KB 2W5UA 2WNIA 4XFDA 1U6JA 3GLUA 1P1CA 4JJAA 2AEEA 2PH5A 2WNHA 3VM6A 3HDJA 1QBKC 2PVSA 3UFXA 4L5JA 1TUEA 1ZK0A 1OLOA 4XWTA 1MG0A 1PVOA 4BO9A 3NT5A 3H1GA 3OO1A 4ZAYA 4BNLA 2BBOA 4BNDA 5KNCA 3IV9A 4JEHA 4US0R 1E9AA 2DPLA 1CUCA 3PL1A 3R20A 5AXAA 3P9YA 5IU6A 1L1FA 4ENWA 3CLUD 1SKYE 3DQQA 5KZMB 4MEJA 2OCAA 4JT4A 4LWZA 3SQOA 3FVWA 2QX8A 4IY1A 4YQYA 4AG3A 4BRWA 5C5EA 5E1DA 1H6CA 5KTKA 3I2JA 5EE3A 1Z39A 1ZGCA 3LE8A 2H2DA 2F8LA 3O91A 1XKLA 4XPZA 3H1BA 3M4ZA 2ZWIA 1GA6A 3KYJB 4Q9JA 1M2KA 1B74A 3IXLA 3OOEA 4HAXA 1QG4A 2OB2A 4QUEA 5EG5A 3CU5A 4A82A 2PYZA 3F5MA 3MQ4A 4ZPJA 4DCUA 1P3DA 1WSAA 2Q5FA 1I5EA 3NYWA 2AF3C 4LBWA 5EP2A 3LBHA 4DJEC 4KWCA 1AMUA 5A2QA 3HDTA 1F51E 1GRVA 3PUXA 5E9QA 2XMDA 1QRSA 2HY7A 2BH2A 2ATEA 1EUDA 3FPLA 1Y6FA 1B6TA 1PUIA 2Z5VA 1D2CA 3CT6A 2ZJ6A 3Q7TA 4OSEA 1MC8A 2GVZC 3D7KA 2XNKA 1KEZA 5F9FA 4CEIB 4K9SA 2H4HA 3I6ZA 4R1OA 1XJWA 5SY4A 3UMGA 1XXHE 1VP9A 1A8IA 4C78A 1ZRMA 1C8KA 1JHVA 3I2IA 1A7JA 1IOZA 1CNEA 4N0DA 4LXUA 2I7DA 2XD9A 2YHUA 5DP2A 4G07A 5EZYA 1WUHS 5FNZA 3IUQA 1DXYA 2IPLA 1ISIA 1C41A 1XFAA 3KQPA 2ID4A 4XOIA 1H05A 3GW8A 5HTKA 1YU6A 2XDQB 1I7LA 1N2OA 2BMVA 4B48A 1IHUA 1SPBS 1L5ZA 3ADCA 2EBFX 4D3XA 2D1YA 2QD5A 2XCIA 2V55B 3RT1A 3LUGA 1Z8DA 3D81A 3L1VA 4M7RA 3A2KA 1HRKA 1Z4JA 2H0QA 1N7GA 1QG0A 3OFNA 5EKDA 2DOKA 3V1YA 4PU0A 2VZ0A 1EDDA 4ZCMA 3RS3A 2QQFA 3PTLA 3T5GA 2WTBA 4DR2B 1JGTA 2ZBGA 1A04A 3ZGOA 1LSOA 3CWQA 4RS4A 2W4MA 5K3AA 1CY2A 3IEVA 3NHBA 2IW3A 3OVMA 2DLNA 4UHEA 3U37A 1M54A 2IYNA 4CEJA 4R8SA 4AZ0A 3SX2A 1S9DA 2GKGA 2H5JA 4OMDA 5KDOA 2XVMA 3PQ4A 1CY7A 4MV5A 4NS1A 1K8YB 3KL2A 4KR0A 1TA0A 2CHQA 1RYNA 4NJEB 4W9RA 3U56A 2X5XA 3NRCA 4UU1A 4TPKA 2IEDA 4IIBA 2GD0A 1O97D 3V2UA 5KVAA 5KNBD 2DEUA 3BVPA 5DXJA 1ZD8A 4LK3A 4ASUD 1GGEA 3QUQA 2WMDA 4PONA 3SU8A 2LIPA 3S1AB 3BFJA 4YV2A 3LP6A 4N5MA 1H1DA 3O7MA 3ZCVA 3QEMB 3INYA 3SGLA 1GU1A 4NYMR 2PXAA 1ZVKA 4A91A 2D2XA 4EHIA 3AJDA 1DSSG 1JLKA 4C5CA 4CEIA 5JSYA 4NWIA 2AJTA 1P5ZB 3EFHA 4ZCRA 2XNHA 1N0HA 1FS4A 2XSZD 4NBRA 4B3CA 3HU3A 3PICA 4ESVA 1J00A 2Y9MB 3ICEA 1ZWKA 1IQRA 4AY4A 2XZPA 1UMDB 4RPIA 3O4HA 1CJUC 3E1KA 5D3MB 5JWOA 2CLHB 3GZNB 4MVJM 5I5EA 1OY1A 5ILOA 1JECA 4NFYA 4CEHB 5KNLA 5AM5A 2JA2A 5DWQA 2H2IA 4KQHA 1CJVC 3UCFA 5LC1A 3Q7IA 4NFSA 2XDQA 5AW4A 1SQ5A 1JA9A 1Z28A 3N5KA 4QODA 3B9BA 3OOYA 1H4SA 1ZKMA 2BFMA 4DCMA 2F55A 1KI7A 3HLKA 4II3A 2YUTA 2IC5A 3KCNA 5AKYA 5DU2A 3ZE1B 1NQOA 3O94A 4XR9A 4C22A 1OV4A 3OIUA 4JC8A 5THQA 3R24A 2WUFA 1JHAA 1NM5A 5G4LA 2B4QA 3LQRA 4D02A 1UJ5A 3I3SR 1ND5A 1L6IA 2COUA 1YDGA 2QXTA 4HB3A 3TSYA 2JGJA 4CU2A 1FS6A 2DWPA 3G0HA 3WLSA 4U2DA 4WRRA 1A77A 3D43A 3FDXA 5HM6A 1NNEA 3L46A 1UWVA 1C7QA 2FZ5A 2ZI7A 3RVLA 3IBYA 1FC0A 2VWQA 4QQKA 3CLSD 3UW3A 1EFKA 3RRNA 5L4NA 1UDCA 1DXOA 4FYXA 1U8CB 1A27A 5FWXB 1PT9A 1UXGA 3AUAA 2HHLA 1JFRA 1P0MA 1PQPA 4NJEA 5DSZA 5IHPA 5TGDA 5ERGB 1Z8FA 3KZVA 3VPBA 3ZCRA 4GQAA 4EG8A 4DR7B 1Z4OA 2YIDA 3Q3JB 1DXQA 4HLUA 3N53A 3PHGA 3WJ7A 5HTOA 2QRJA 3A0UA 2KYRA 3S1AA 1V7PC 4OHVA 4Y9TA 1WDKA 5HIKA 3E5RA 3KB8A 1C29B 2H85A 1LEHA 5AM3A 3QEMA 4J07A 4I8DA 4TS3A 4X3PA 4X6XA 4ZJUA 1Y5MA 1QAQA 3F8WA 2CCKA 4UCWA 2PBLA 2RGAA 1S7GA 3C3XA 4Z6KA 4JDUA 2QEQA 3QMPA 1V1JA 4TRRA 4BTLA 2RGNC 1ZW1A 5LMNB 1DOAA 4QHYA 1PBNA 1UMDA 1F9AA 3BG5A 3CXRA 5D3MA 1E58A 1I24A 1I6LA 3GZNA 2G82A 4CEHA 3PEUA 4KO8A 3ROQA 1M10A 2Q62A 2MMCA 3DNFA 2YWJA 3WGZA 1LLQA 1V6CA 3Q5GA 2HWWA 5AMXA 4HDOB 2AYYA 2ZDQA 4AF7A 2DBYA 4AECA 4EMUA 3I9FA 1ZOIA 2C4UA 3OX2A 4G5HA 4B6QA 5B6JA 3PEWA 2Q2NA 2XYPA 2WSBA 3Q10A 4H0NA 1ZONA 4RY0A 2QVCA 4ENUA 2PZGA 3FUXA 4ZOLF 3E84A 3KO8A 2Q3JA 3VDRA 2DECA 3WSVA 1G5QA 2ILTA 1XXLA 3ZWBA 2PL3A 3HXTA 1NW8A 3BZWA 3L8YA 2XCTB 4TYPA 5G02A 4ZAXA 3TNJA 3PC7A 3B1FA 1Z4MA 2WPNA 3Q4GA 4DMLA 2UYGA 3DOOA 3P0FA 3T5MA 2CVHA 3TOSA 4MO9A 3UV7A 3KKQA 1P19A 4QOEA 2F1JA 1XYGA 1RQ7A 2VDVE 1GPH1 2VNHA 3PFKA 2D0OB 2HHAA 4K9QA 2VTDA 4MI1A 4R81A 5D1HA 5FWXA 3RSQA 1A71A 5JFGA 2G8LA 4FBMA 5K0CA 1K86A 1OR8A 3JD4A 1IUNA 2PU7A 1NWCA 2YIJA 3LUAA 4PLVA 4CMEA 2IYZA 3KDAA 4FDMA 1FSSA 2XR1A 2E4VA 5DYYA 1WU8A 3C74A 3TAUA 4YASA 5JBQA 4QNMA 4JSYA 3EJ6A 3HVRA 1MO3A 4R8KA 5LP6C 1ZAKA 3BXFA 1CYEA 4UNRA 1VPLA 3B6JA 3T3EA 2C95A 1P5JA 4P0TA 2QMEA 4Q3OA 4Q1AA 5BQOA 5TEVA 3RW9A 3BL5A 2BV3A 3ACDA 5A05A 3RWOA 3UK7A 2P6RA 2FXIA 1L7QA 2UAGA 3AW9A 2VSYA 5FTLA 2H6EA 1EE2A 2MMGA 3E61A 2AN1A 3OA0A 1WVIA 3PD0A 3CV3A 4DW8A 2UUOA 3JPYA 4XARA 4DZRA 3J7AC 3QLTA 4O2AB 5BW8A 4JB0A 1KRXA 3MXOA 5CH8A 2HK7A 1UDWA 3R6WA 3WLEA 2Q6TA 5M3BA 2LP4Y 1OI7A 1QCCA 2WF6A 2X0RA 3H2YA 1SBIA 3AIIA 3QUAA 4FOTA 2BTQB 4O3FA 4CGZA 4XB2A 2NMVA 3LUDA 2XTZA 3AR8A 3EXG1 3PNVA 5T6MA 3VTAA 5BYAA 4MB6A 2ORVA 3FDZB 5HVNA 1QUFA 4PLYA 1KMNA 3WLOA 5DX0A 3P0EA 5BWCA 4AJLA 4YXFA 4OLBA 5J40A 2WQ7A 2XE7A 1E9CA 3CPJB 5CUQA 5B55A 2I66A 5H0IA 1EBFA 5ICCA 1R4ZA 3B9PA 2VZ9A 4NZZA 4GC5A 4E5PA 4Y1GA 3ZPXA 4ARIA 2E82A 1T2CA 4EY8A 1UWKA 2VHZA 1X9IA 4C0XA 1PX2A 4R1NA 4WLOA 1P4AA 2PYDA 1A8QA 3S4YA 5K01A 5BWNA 1AQLA 3SR3A 5AIBA 4H7EA 1RIFA 3A3NA 4ZDJA 3LT0A 3FZYA 4C4SA 4MKXA 3H11B 4HO1X 3U4GA 2FJPA 1NAHA 4RJLA 1NJ2A 2ZOSA 5C32A 3ER8A 3QH4A 4Q3KA 2PKCA 2XYVA 3H9BA 4GZ6A 5DBEX 4B6JA 2V5VA 1TIPA 1UBFA 2G17A 3L7IA 4QPCA 2VCHA 5ER9A 2JCBA 4OPMA 1F8FA 3GPBA 3UK0A 3KQUA 2PWBA 1E1QA 5TMPA 4EITA 3E3LA 3LOPA 1H0KA 4F2GA 2D13A 1PW7A 2GAAA 2ZU0C 3CR8A 3E1GA 4X61A 3C0KA 2G5TA 3B5EA 1L7XA 2IF2A 3SK0A 2WA2A 4PQYA 4FXPA 2X41A 4K9PA 1T35A 5AYVA 2A9RA 1I30A 1OLSB 4KIWA 3CLRC 4P54A 2EJTA 4A5OA 1UC5B 3PF8A 8LDHA 1TJYA 3WB2A 5KVCA 1V8ZA 1NNUA 3A4YA 3DFKA 3EF3A 4IO0A 4LXQA 4O2AA 5LB2A 1LS6A 2ID9A 2PNFA 3K0HA 4K46A 4IP0A 5C1BA 1IBMB 1C7JA 1E3WB 1U6IA 4QBHA 3I73A 1P2VA 1WD5A 1JLMA 1Y1TA 2FZGA 3RUHA 2BTQA 3H6KA 2FPUA 3SE0A 4ARSA 4AZTA 4GXNA 1V96A 4EYOA 4B75A 3OY7A 4L4SA 4DM4A 1GTVA 1DIBA 1SBTA 3FDZA 1RKVA 1F6BA 2ZRDA 3HUDA 1D2RA 3L4BA 4RTQA 4KXFB 1I2ZA 4Y1FA 3VC7A 1DCTA 2ORWA 1ORHA 3PUKA 5DIZA 3IAHA 1TFUA 1ZIYA 1UDAA 3G5UA 3QKIA 1UK9A 2QTRA 4JGIA 5L3RA 1T36B 1SBZA 2IHKA 4QPDA 4BP1A 2PFSA 4LOJA 4E4RA 1QFSA 2J46A 2HIMA 4ZICA 1FTGA 2AB0A 1NC3A 3GFOA 1JKJB 2V7VA 1XJ5A 3VR2A 4DCTA 1M6HA 2E9SA 4DEVA 3H11A 3GPCA 1YRHA 4MVJI 4PY2A 4YRLA 3TRIA 4HDCA 3OWOA 4NR0A 1QX4A 3TOCA 4ZMSA 3CZPA 2C3PA 3VU9B 1ZK4A 2AC7A 3HMQA 2GR9A 3KJXA 2D1SA 2ZVPX 3WLPA 2GOYA 4QG7A 3KALA 5EQFA 5CEJA 5CT5A 5DHRA 1ZN9A 4KQ1A 4BQRA 1ITZA 2GBFA 1TE2A 5LP6F 2R87A 1J1UA 1YT5A 1G5FA 4I4NA 2VJOA 5CVDA 1ZL2A 4KE8A 3LHKA 4BB6A 2F1OA 4PHFA 4CV1A 1KJYA 5FNVF 1OLSA 4OYRA 1FDRA 4MS1B 4OMUA 4BL5A 1JP7A 2OA0A 4AJPA 1EXDA 2W2PA 1D03A 3LFUA 3IYLW 4U2CA 5CA1F 2QG6A 3TR6A 2VAVA 4LE2A 2C54A 2JCXA 1E3WA 3HCDA 2D0PB 5AK6A 4GQBA 3KOOA 5AT1A 4KR9A 1JDBB 4QRDA 5T4BA 3SIRA 2I71A 3WYNA 4KNVA 3DXYA 3MJCA 1DS6A 2BFAA 3UW1A 2PSJA 2QR3A 2F9MA 3ENZA 3V48A 1XEAA 3T5AA 1KDPA 2C5SA 2J0EA 1YFJA 4F9TA 5CFQA 4UTNA 4HDSB 4KXQA 3P2JA 3HKDB 5IAAA 5L95A 3Q3HA 1FMFA 2QDXA 1LS1A 1XDZA 1XN1A 1RCUA 2O4CA 2ZI4A 1CUWA 1T36A 2AX4A 1P5FA 1P0IA 2VP6A 4G5OA 4XDZA 5FTJA 2D1TA 2NSHA 1MMFB 3BJRA 3GRZA 5IAGA 3QE2A 3QU5A 3S2FA 4DJDC 4DXDA 1V7QA 5M2QA 1HORA 1JKJA 4ZRDA 2C9DA 4G85A 4WXHA 5JO9A 2N75A 1GJRA 3STWA 1ODKA 2NN3C 3PFFA 1N1MA 2CBGA 3RJZA 3URMA 4KR3A 4R2HA 1Q57A 1QIHA 2Q5CA 4F86A 1XZFA 3B38A 3GR6A 3JYQA 5FT9A 3SQLA 3VU9A 1HDCA 3BCRA 3U9TA 2IH5A 1XVUA 4LCEA 4B82A 2FRXA 1YR6A 2CV2A 1W5FA 3ICWA 4P53A 3T5BA 2OFXA 2JJ2A 4TTJA 3W1VA 1G8MA 1DEAA 5F5NA 2A1TS 9LDBA 1DEHA 1LBSA 3B89A 1UBHS 1ZGHA 2WP0A 5JPCA 3MJFA 2FKNA 1SHKA 3G9UA 3RVJA 4MP3A 2L42A 2QD4A 1ZC4A 1P6QA 1W5SA 1W4ZA 2C84A 2CWWA 2E3JA 2FVYA 2I33A 3M6FA 4HFMA 2NTEA 2XT9A 1ISJA 4KPYA 1VSQA 1M5UA 2XUHA 3I0ZA 1GTL1 2ZLBA 2GPAA 4MS1A 2PXXA 1O8CA 4NRDA 3WIDA 3V97A 4IIXA 5KYNA 2CHGA 3C4JA 3EG5A 2EATA 4QTYA 2CVOA 4K9RA 1S3SA 4TKMA 3D2LA 1SXJD 1WZUA 2IY9A 4XWOA 4GHWA 1XCOA 4WEQA 2GJSA 4G3XA 3ORFA 3IR6A 3H19A 4NH0A 3VXKA 4NBLA 4AF8A 1Z7GA 4AG6A 1K92A 1QRAA 3OTQA 3MRVA 2O59A 4P3XA 2RAVA 5AHWA 1K6XA 1KSJA 2FKAA 4C9BA 1E8MA 3PIIA 1HY3A 4R1LA 4YYEA 1UPXA 2FW9A 2J31A 4K6KA 1E0JA 2BM8A 4HDSA 4B1FA 2BGIA 4RD0A 3H3XA 4KIUA 4BV3A 3A6LA 3HKDA 5H81A 1B23P 1BGVA 3BDAA 3C8UA 4OQLA 2Y68A 2V6JA 4AWXA 4PZ9A 4C0HA 1ST2A 2I7VA 4XPIB 4FR5A 5GY7A 4D8YA 3TD9A 1G21E 3K53A 5I4IA 3OM0A 2CXSA 4I14A 4L4ZA 3EH2A 3ZK7A 3JWIA 3VSAA 3SVTA 1HFEL 4BNWA 1RVDA 1VI6A 1QQTA 1VE6A 2B25A 4KPGA 3W79A 4G25A 3LHSA 1F9EA 1NURA 1KDOA 3KBBA 1GQFA 5E6UA 5EPEA 2OO5C 3NOXA 5JOQA 3GNLA 3PFCA 1RZVA 3HFGA 3K8QA 3O74A 1C4XA 3NGXA 4YN3A 2YBDA 2RI1A 4EYKA 1M0EA 1T5SA 2ZIGA 1Q92A 3A7DA 4G23A 3QV1A 4L15A 4L9SA 5C8YF 2WYVA 4PZCA 3VPCA 3GDOA 4AJ1A 3A3OA 4UAJA 1AHNA 3MJHA 4DQDA 5I8PA 2PO7A 4DCNA 2JGMA 4A6XA 4I1VA 4CYMA 5L7YA 3EXAA 1OMOA 1MO5A 1YHNA 1GPAA 2AHOA 2BMEA 2OMKA 2PXCA 3AJ9A 3AHCA 3EB9A 4DEXA 3WA6A 1AIPA 1PW5A 1UXIA 1OH6A 3QVLA 4ENPA 2EEZA 4YP6A 4LZAA 5JVDF 1O8BA 2JBAB 2RHLA 3DF9A 4HJXA 2XGJA 1QANA 4C6TB 2P41A 1NMZA 1QGED 4DLTA 3NX4A 1AQJA 2F67A 2X1HA 3R8FA 3UMVA 1KJ8A 3EVEA 3NANA 2VQSA 4MJLA 2HF9A 1P3JA 1GRQA 1JG6A 3B85A 3GT4A 1NN0A 4GOXA 5FTMA 3ZCQA 2H57A 4NBSA 1G8YA 5AWFC 4NBTA 5KYTA 1I14A 1SBHA 1RM3A 2GN6A 2LPMA 4P3OA 5E9WA 1F6DA 4ZZ2A 5GOTA 2VWHA 4AZSA 2JGNA 1A8HA 2AN3A 3VR3A 1D2NA 3QG5A 1ICIA 3WLNA