4P7JA

Rat apo-comt sulfate bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
217
structure length
217
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 76
structure length 217
sequence length 217
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4p7jA00
5EHIA 5EG5A 2PY6A 3THSA 4C4AA 2UYOA 2YXEA 3NDJA 3UWPA 1D2GA 4AZTA 1WXWA 2GPYA 4LWOA 1X1AA 4X1OA 3C6MA 3JWGA 1XJ5A 3PFGA 5EKXA 3ELWA 1PRYA 3NWEA 5P8WA 3UA3A 4CWAA 2WA1A 1IM8A 4ER0A 2P7HA 4E2ZA 1SG9A 2BH2A 3IHTA 2OB1A 3E05A 4RTLA 5D1HA 4QDKA 5C9ZA 5FA8A 4EKGA 3G5TA 2ZZKA 3PS9A 3LCCA 5ICFA 2EJTA 5DX1A 4KDRA 1L3IA 4B17A 3AXSA 2EFJA 4O29A 4PYMA 1KHHA 1R00A 3DXXA 2H11A 3WSTA 8MHTA 1N7IA 1RI5A 2Z6AA 1ZG3A 2GAFA 5E8RA 4RVFA 4MIKA 3U81A 5HILA 5T64A 3ORHA 1VL5A 4AZVA 4FSDA 1ZKDA 2YXLA 3UZUA 3FRIA 4GOMD 3OFKA 3SVZA 2IBTA 1QYRA 4KIGA 4ATNA 4PYKA 3M4XA 4P58A 2DULA 2PXCA 1FP1D 3PB3A 5F2OA 4GC5A 4HC4A 1G38A 5ICCA 1FPQA 2GLUA 3AY0A 5LQAA 3B3GA 5K0JA 2B25A 3P8ZA 5CM2Z 4C06A 3HCEA 4IV0A 4OA8A 3TKAA 2B9EA 3C6KA 5KQRA 5EEGA 1JG1A 1JQEA 1V39A 2FPOA 2PXAA 3LDUA 4GOND 4IV8A 5EIFA 5KS2A 3P9NA 3PFHA 5T6BA 4YMHA 1XDZA 4GF5A 4RTMA 1BKYA 2I6GA 2EG5A 4FT4A 4QPNA 1T43A 4CKCA 3HA7A 1X1BA 3UJAA 5EZSA 3TKYA 1SUIA 3EMBA 5KVAA 3DMFA 1QAMA 5U4XA 1SQGA 4E33A 2Y1XA 4E2YA 4LWPA 3P97A 4EVIA 4RTJA 4R8RA 4X41A 3M6VA 3SSOA 3KQMA 4GC9A 3KKZA 4P7FA 1JQDA 2B3TA 3M6XA 1B42A 1AV6A 1I4WA 2PJDA 2PX2A 5DX8A 5F2KA 4RSRA 1KYWA 3R24A 2AN5A 4PYOA 5GINE 1Q0SA 1X1DA 3Q7EA 5T67A 2HV9A 1NE2A 2ZIGA 5EMJA 2DPMA 1NW5A 1P91A 2ZWAA 5KYGA 3DXYA 5C1IA 3GXOA 1BOOA 4IKPA 5JUWA 3BKWA 5DSTA 4RTNA 3FTEA 4MQ4A 5DTRA 4EKIA 3EVDA 4QDJA 5JR3A 3SSNA 1MJFA 1NBIA 3P2IA 2JH9A 4PWYA 3VC2A 1L1EA 1ORIA 5LQNA 2HWKA 1XCJA 3CCFA 4P7GA 3HCBA 3P9IA 1N2XA 4X60A 1VBFA 2FYTA 2CMGA 3CJTA 4L7VA 1HMYA 3LHDA 5CVDA 5DXAA 3UBTA 4X63A 3OZTA 3ID6C 5LSAA 4QVKA 2OKCA 2P3OA 2P3LA 3HCFA 5E9WA 4QTUB 1OR8A 1ZGAA 5EZQA 4BLWA 1L3CA 3DH0A 1QAOA 4RV9A 1XDSA 3ER9A 2UZ4A 2C7QA 1RI3A 3A27A 5CIYA 2P3QA 2NXEA 4HTFB 3F4KA 2I7CA 5DXJA 5EMLA 1ZQ9A 3BZBA 3SSMA 4EK9A 4PINA 3ERCA 4F85A 1RI4A 4R8SA 4GOOD 2ZIEA 3O31A 3RODA 1SKMA 3OU7A 2NXJA 3MAGA 5FCDA 5HIJA 4AZWA 2QM3A 5K0BA 5HIKA 2EJUA 5EPEA 2QRVA 5CUQA 4DZRA 1EG2A 5FADA 1VQ1A 2AS0A 4PYIA 5DLYA 4ER3A 1DUSA 3SX0A 3MGGA 3KQQA 3LECA 4FGZA 4OQDA 1AQJA 2G8NA 4XCXA 3KR9A 3OFJA 3TPZA 4OBXA 5CVUA 5CCXA 3OZSA 3OPNA 1G55A 2VZ9A 3M6WA 4R6WA 5BW4A 2GS9A 4CXMA 2PT6A 3BWBA 4FT2A 4R6XA 1NT2A 5CCBA 2H1RA 2Y1WA 5E1BA 1Z3CA 2ZULA 3EVCA 4GUAA 1JTEA 1YUBA 3KR1A 5EC8A 3EVEA 4E32A 3HVJA 3GO4A 1NV9A 1NW8A 3V97A 2G71A 2JHPA 3DR5A 1JTFA 4C07A 4P7KA 1WG8A 3A7DA 5HIMA 3VYWA 2ZCJA 4KIFA 4QQKA 3PX2A 1EQAA 3FPFA 4PONA 3EEYA 1XTPA 3C3YA 4YUVA 2AVNA 2BR4A 3LSTA 4CTKA 3B89A 1EAMA 4RTKA 4M38A 3P9KA 1IXKA 5DWQA 2VDWA 1KIAA 3UJDA 3H2BA 1VE3A 4DCMA 3E23A 4MTLA 4E30A 1TW3A 4AX8A 4KWCA 2XYQA 5FQOA 4RTPA 3FUUA 1O9HA 3C3PA 2Q41A 3KHKA 3R9XB 3NDIA 3KQVA 3DTNA 2OPBA 3T0IA 2NP6A 4POOA 4AUKA 2XVAA 1RI1A 3FRHA 3T7SA 4E2XA 2NYUA 4ISCA 3ELUA 1X19A 4V0RA 3G8BA 3LKDA 2VDVE 3MB5A 4PCLA 4WVLA 1TW2A 3P2EA 5DM1A 2IDKA 1RJGA 4OQEA 4H0NA 1P1CA 4PYLA 3EMDA 5DT2A 4UOEA 5HZMA 3KR0A 1G60A 4GOLD 4HG2A 3UJ6A 5E2AA 4U7TB 2HTEA 3KR2A 2V7EA 4WXHA 3LGAA 2I9KA 3AJDA 3Q87B 3HM2A 4DKJA 4FR0A 1L9KA 2BM9A 3HTXA 4FZVA 5GOZA 3UFBA 2HMYB 2P1DA 1M6EX 5CD1A 4MHTA 5B1SA 4XUDA 2ZVJA 3JWHA 2NNWB 4CKEA 4ER6A 1HNNA 1XCLA 2E5WA 3O7WA 2B78A 4QQNA 5D1NA 2AN4A 3OE5A 5HEKA 1G6Q1 3G2QA 4LECA 5FWAA 5K0EA 3BT7A 2ERCA 4RVDA 5E8JA 1EJ6A 4YV2A 3UJCA 2OZVA 4M37A 3B7PA 3FYDA 4M36A 4AZSA 3TM5A 3I58A 2IH5A 5FHQA 5E1OA 4Y2HA 1UFKA 2O06A 2ESRA 1JR4A 3I9FA 3FUTA 2GH1A 1DCTA 4PYNA 4P7JA 1AQIA 5BXYA 3V8VA 3SXJA 4DF3A 3LCUA 3PVCA 2ZIFA 2KW5A 3I53A 4E2WA 2BM8A 3FPHA 3D2LA 3MTEA 4QPPA 5EKUA 3OCJA 4XUEA 4YUZA 1U2ZA 4A6EA 3OU2A 2FK7A 5EIWA 3A25A 4XUCA 4PGGA 3FTDA 3A26A 4RVGA 5DSXA 3GWZA 2IFTA 2BZGA 5K0CA 1KR5A 1VPTA 1WS6A 2IIPA 3CJQA 3I64A 3E7PA 3MCZA 1ORHA 3OU6A 1JSZA 4U7PB 1KPIA 4G56A 2ZLBA 3FUXA 1UIRA 1G8SA 1JG4A 2PX8A 3DOUA 3NWBA 5CVEA 1H1DA 4V0QA 5EMMA 1YFLA 1D2CA 3I5UA 2QRVB 1WXXA 2IGTA 3KPJA 2NXCA 3G8AA 3P71T 3PTAA 1KP9A 5EQJB 4E31A 5IH3A 2I62A 4DMGA 1M0EA 1YF3A 2ORED 5GWXA 3MTIA 4C08A 3HCAA 3HP7A 1F38A 4ER5A 3DMGA 5ICEA 2PX5A 2FK8A 3GIWA 3C0KA 4HRAA 3SM3A 4YV0A 2IBSA 3FZGA 3S68A 4RX1A 3K0BA 1KYZA 1SVUA 1XDUA 3OZRA 2ZZMA 3TR6A 3X0DA 2PWYA 4KRGA 2AR0A 5EOVA 3KPUA 1NW3A 3HNRA 2PXXA 2NXNA 1NKVA 4YUXA 3CJRA 2AOXA 3QV2A 2IDJA 2K4MA 1F3LA 3GGDA 4A6DA 3NJRA 3EVZA 5EGSA 5CVJA 2ZBQA 3TFWA 5ERGB 4PNEA 2FHPA 3HCCA 1L3BA 1PJZA 5GP1A 3MCTA 3B3JA 1G8AA 2AOWA 3R3HA 2GA9A 3GRRA 3SGLA 4PIPA 1R8YA 4RTQA 3G89A 2PKWA 5DM4A 3VSEA 2YXDA 2VP3A 4BLUA 1YZ3A 3CKKA 2OXTA 2AOUB 2V74B 3KQWA 1ZGJA 3EGIA 2WA2A 3MERA 1O54A 3B5IA 2P7IA 3UJ9A 3A7EA 4FP9A 4MWZA 5GM2A 1YB2A 1EJ0A 5EHGA 1R74A 2P8JA 2JHCA 3DLIA 2H00A 5FWDA 4X61A 3KU1A 2VS1A 3LPMA 5M5BA 2ZSUA 3EVBA 3KQTA 3M33A 4FS8A 4HSGA 3KQSA 4RTRA 1BHJA 1I9GA 1VIDA 3FPGA 5LQRA 3TLJA 2ONYA 3KQOA 5EVJA 5E9QA 2HR1A 2AOVA 2AZTA 2VDUE 3OE4A 2AOUA 3UJBA 4M7RA 3DMHA 4FSXA 2YVLA 2PBFA 4QVGA 3EGVA 3R0QA 3FUVA 4JXJA 3TRKA 4PGHA 2F8LA 2AN3A 3TMAA 4GQBA 4NECA 3NW9A 3HCDA 1QAQA 2ZFUA 5FQNA 4HGZA 3EEOA 5E1MA 2PLWA 2O05A 5DX0A 1FJXA 4C05A 3BWCA 3KPYA 2OBFA 3BGDA 2CMHA 3FYCA 4RTSA 2C7OA 1JG3A 1Y8CA 3IYLW 3BGIA 3GJYA 2YX1A 5LR6A 3DLCA 2WK1A 4PCAA 2YTZA 5K05A 2P41A 3EPPA 3M70A 2C7PA 2AOTA 5IKMA 3LCVB 3GCZA 5HIIA 3P2KA 3FTFA 4C04A 2YUIA 3RIEA 1SUSA 2BR5A 1ZHFA 3GRVA 5FUBA 2CL5A 1NV8A 1AF7A 3HVIA 3NVMB 1XVAA 2AVDA 5DRYA 7MHTA 3BWMA 3AWIA 3CGGA 2QE6A 4LG1A 4RYLA 3RW9A 2ZW9A 4YV1A 1YFJA 5H02A 5K01A 5GIOE 5MHTA 3ANXA 3NMUF 2PGXA 5DPMA 4KDCA 4HGYA 3CBGA 5E9JA 1QZZA 2O0LA 3KQPA 5E1DA 5FTWA 3TOSA 2C7RA 2JG3A 3MHTA 3REOA 1QANA 3VC1A 2OB2A 3HVHA 3CC8A 3HA3A 2IPXA 5K0LA 4CKBA 5DM2A 4EMSA 2IP2A 5K03A 3G2MA 3FUWA 3KQYA 3NVKI 3LDFA 4R05A 2ZWVA 3TM4A 3SMQA 2P40A 3A4TA 1NW6A 3LBFA 5BP7A 1JSXA 4Z2YA 3G5LA 5LQCA 3MQ2A 2Z6UA 4PYJA 2OY0A 5DRTA 5K09A 1R18A 4E70A 2PWPA 1P1BA 5GIPE 4DQ0A 3ELDA 5FA5A 4EQZA 4BY9E 4ZTBA 4RWZA 1DL5A 2LD4A 5EEHA 3UJ8A 3EGEA 3HA5A 1RI2A 2UYQA 5FULA 2R3SA 3GRUA 4DA4A 3PT9A 2PV0A 5CVVA 1M6YA 2GB4A 3KPVA 4PYQA 2ONZA 2G72A 2FCAA 3QOWA 2YR0A 2ZTHA 4F86A 4OBWA 3GDHA 1N7JA 1RJDA 2JHAA 1KPHA 4PIMA 5DTQA 3FPJA 4OX9Y 2JJQA 4HH4A 4RTOA 2XYRA 3HEMA 3L8DA 4IWNA 2PVCA 1O9GA 2PSSA 2ZBPA 5LQJA 5DTMA 3LL7A 3DXZA 4QTTB 3ER8A 1FBNA 1INLA 3NTVA 1KXZA 1NW7A 3GU3A 2P35A 3GRYA 2QYOA 1IY9A 2OO3A 2FRXA 3AXTA 3LKZA 3QOXA 4OA5A 3TQSA 5KQSA 3ELYA 4YMGA 3EVGA 5C0OE 5HFJA 3DUWA 2XYVA 4DCGA 4C03A 3BGVA 1VLMA 2O07A 1JQ3A 3P9CA 1R8XA 3EVAA 4GEKA 4BLVA 4YUYA 1MHTA 2IH2A 2XBMA 1VP9A 2CKDA 2ADMA 3EVFA 3G2OA 3T7TA 2HNKA 3DP7A 4KVZA 3UA4A 3DULA 3G88A 1I1NA 3IEIA 1XXLA 2A14A 3BXOA 3B3FA 3FTCA 2XVMA 4CTJA 2CWWA 2O57A 4YUWA 5LQKA 2ZZNA 1RJFA 1WY7A 2YQZA 4GBED 4BP1A 5LQUA 5FHRA 4ER7A 1R6AA 2G1PA 3R6TA 5HOQA 1VP3A 3KPWA 3M6UA 4K6MA 3PX3A 4F84A 3JWIA 1RJEA 1TPYA 1KPGA 3BWYA 5GM1A 2G70A 3G7UA 2IH4A 1NBHA 3BKXA 3PLAE 3CVOA 5K8VA 2B2CA 3LX6A 2OYRA 3SR4A 3ME5A 5BW5A 3HVKA 2QY6A 2UYHA 5DM0A 1D2HA 1UWVA 1P39A 3GRZA 2PX4A 3GNLA 1FP2A 2Z6QA 5ICGA 2JH8A 4KW7A 2NP7A 3T7RA 2N47A 1Q0TA 10MHA 5G02A 4DM3A 4RVHA 3IV6A 4Y30A 1SQFA 3O4FA 3BUSA 3FPEA 1BC5A 5E2BA 5K0NA 3LBYA 1WZNA 1YZHA 5EMKA 3E8SA 5K0FA 3UJ7A 1X1CA 2EX4A 4HTFA 3THRA 5K0GA 3G2PA 9MHTA 2PT9A 2ZBRA 5F2NA 3LDGA 3JWJA 3K6RA 2R6ZA 1EIZA 2BR3A 4BP3A 2UYCA 1JG2A 2AOTB
chains in the Genus database with same CATH superfamily
5EG5A 3VKUA 4DW8A 2JLUA 3THSA 2PGAA 3PUYA 3TE7A 2Y2UA 1IEXA 4JU9A 5T5QA 3WMXA 3WMGA 4NESA 2D0OB 4BLSA 3QX9A 5L6LB 4Z4QA 1YTUA 3DV0A 5KTRA 4ZTZB 5E3HA 3ICEA 1DIGA 3MJFA 4XSVA 3D02A 1VHLA 2IJGX 4XRRA 5CMLA 1MQSA 2OCIA 3ZNQA 5P8WA 4EG6A 1XEXB 4WDQA 4CWAA 4QULA 3EDCA 4E08A 1KI3A 4NF2A 2XVYA 4E2ZA 1XYGA 1ZGGA 4PXSA 1NQVA 2ZIVB 5IZCC 1J0AA 2A9VA 2ZJOA 5LBUA 1EQUA 1OU4A 2C82A 3E4CA 3IT2A 1GKLA 4YREA 3TIVA 4D9CA 1F14A 5IMBA 4HCJA 5IM4A 1C8VB 1AUOA 3IAS1 2NVUB 5KQLA 3FHJA 1JFTA 4Q9NA 1ABEA 3KYJB 3H0EA 1CQPA 1NVDA 5ERYA 3SHFA 1II9A 2NLOA 1FX1A 1W29A 3L7MA 3QVLA 4S2EA 3WSTA 7GPBA 1G63A 5CAEA 3WLJA 1JL3A 4JEIA 4G67A 2PSJA 3H8WA 1DWQA 3CEAA 1ST2A 1ZKDA 1QFJA 2VP0A 4G25A 4GI2A 3RS3A 1NKTA 3FSRA 4NONA 3NEPX 1Z4NA 1KFEB 4GVPA 3BXPA 1XIVA 4IJWA 4G8DA 5EUQB 1JFFB 4LQ4A 1FPQA 1SOAA 3T1OA 5ICCA 1ZK4A 3ZIDA 4NENB 1P0PA 1YAJA 3LPCA 4RFSB 2CYBA 5EP1A 4F9GA 1CJVC 3CB2A 3NU1A 2JIDA 4ZYLA 3B6JA 2QZSA 4M8SA 1MX1A 2P0EA 2B69A 4FMDB 4WOCA 1U7HA 4GOND 1Z4JA 1G59A 1M7GA 1PR4A 2XMGA 1XDZA 3LRPA 4ZVMA 3VTZA 2HU5A 4AKTA 1GPMA 4PZDA 3PYLA 2OL4A 1DV1A 1Z2EA 4PSVA 5E0KB 1C3VA 4BO2A 1QAMA 2QTVA 4JA0A 3G2IA 1DDOA 3OFVA 4Q3OA 3CUVA 4MV6A 4HKTA 2IXBA 3H6KA 3ABQB 1SD1A 3IUEA 4IDCA 1RWXA 4CMHA 3EXHC 2WAAA 5LL6P 4KXWA 4GHWA 4WN9A 3M6AA 3ND5A 4ENQA 3F73A 4BBJA 5ED4A 3WNQA 2V7UA 3GC6A 3KFVA 4B76A 4FYJA 5C5IA 2GFIA 1D4AA 1SCAA 1U04A 3AUTA 1U6IA 3L5KA 2BFFB 1K4KA 1SK9A 2QL9A 2YASA 3T9BA 1A9OA 1GNPA 1ADBA 3JQGA 2OCGA 3ZE6A 1MG0A 1R0WA 2DP4E 1COWD 2H18A 3DXYA 3H8VA 3CCCA 3O4HA 3GXOA 4RTNA 5H4HA 4JC0A 5SZJA 4BLOA 3NHAA 2IPOA 4DLXA 3RJZA 4RSMA 2PLAA 3TSYA 4P34A 1KJNA 4XYGA 3CZ4A 3CHYA 4FNAA 4KQJA 4WH0A 4ZVNA 4DA0A 3HCBA 1UPTA 1LSSA 1IZ9A 5HDBB 5CBPA 5EESA 4M21A 4KYUA 1HE5A 2C4VA 5D3ZA 2C7QA 1FMFA 1WOMA 2VQDA 4G1MB 1GSHA 1ZD3A 1WF3A 2GD2A 2MSKA 5EXTA 5DXJA 5EWMB 2C5HA 1QLWA 1ISSA 3HJGA 4KREA 5JXIA 4HH0A 3SBOA 4W5WA 2GBGA 4XARA 5TY0A 1AKVA 3MMXA 4QOGA 2BJVA 4G9BA 3RT1A 3SMVA 3WQSB 1RRKA 1L0BA 4MSUA 4ZGBA 1N5IA 2D2EA 4OV6B 2QGNA 2C99A 1W4AA 1AQJA 4A2WA 1OFIA 4FKBA 1Q0PA 1LC0A 2BSQA 5CVUA 1CFZA 5JV5A 2I3AA 1OAKA 2QB5A 1S01A 5BPFA 3IBTA 4KXMA 1P9RA 3QE4A 1IQPA 2X0IA 2L82A 1T8SA 3M82A 4EPRA 4F97A 3C5HA 4MB6A 5D3QA 4N6NA 3HJUA 4REQB 5BOVA 3OI7A 3ESDA 3MYYA 2ECOA 1JTEA 2I2FA 3B12A 3KP1A 3C98A 4LMRA 2TSYB 3OT4A 4H31A 4PC1A 3TUIC 4HL6A 1BFDA 3ZUPA 3U5TA 3PSAA 4XQEA 3PBKA 5AKEA 3TYXA 2HHAA 1EFHA 7AT1A 2XWJI 2GYWA 2M98A 5H82A 1L1RA 1OGIA 3Q0TA 3E1GA 4UKDA 4EL5A 3WFZA 4CTKA 3ZJYA 2YXBA 4JBYA 2BV3A 3RFXA 3P9KA 1FLNA 3SDSA 2NZVG 3WKAA 2VP4A 4DWOA 5ES3A 1D2AA 3AHGA 2F55A 4P0QB 4GR9A 4DADA 4E30A 1KTIA 2Q6OA 1AKWA 1G21A 2VDOB 4G4SO 3Q3GE 2XJ9A 5A9SA 1WB6A 2QTAA 2CJXA 4KCGA 4M8IA 1VBNA 2ODWA 5A4DA 1ZCJA 1B74A 2XY4A 3NHJA 4I8XA 4MWTA 2I4OA 2ERYA 4A8JB 3MWFA 1CNFA 5ETJA 4IHKA 1XAIA 4DIFA 2GZMA 3EZFA 4D9IA 3Q5EA 2C83A 3KK0A 3QKSB 3LO8A 3GJ5A 4L74A 1PJRA 4B83A 4CFZA 5HJ5A 1IE3A 5DT2A 5B3LA 1EFDN 5ITZA 1F60A 3T5BA 3UJ6A 2AF4C 3W5UA 3THXB 3HBFA 1IN1A 1PNTA 1WDWB 4OU4A 3ZLVA 3LGAA 2I9KA 1Z8NA 4GVLA 4RK1A 2GETA 1UM9B 2BFBB 2XT9A 5BYAA 2HKIA 2VK2A 3PIDA 4C01A 1QH8A 4UNSA 3WRWA 3DNPA 4I8DA 2XGSA 3G02A 3HXTA 4I1RA 3EIFA 4XUDA 4CMKA 1MC1A 2GPAA 3UJNA 2ETXA 4GS5A 4Y2JA 1XCLA 3OETA 1N2EA 4QQNA 1ZH0A 1IY0A 4HNUA 5LVAA 2YZNA 3DDCA 4UU0A 4ZQHA 1CF9A 2ODEA 4B7AA 4O1HA 2DJIA 2OZVA 1K89A 3OX3A 2NUAB 2QX8A 4AZSA 1R8QA 1UFKA 1GYRA 2CVZA 2J3LA 3K9HA 3Q7RA 5IYZF 1D6JA 4ZOLB 1F4VA 1Q50A 3ZW8A 4DY4A 4KQXA 1KKUA 4DSTA 1UXKA 2A84A 4S1WA 4UNNA 3OEED 3NM5A 1D5CA 4FDUA 2ONKA 4JLPA 5EMNA 5EKUA 3RRNA 1MAAA 4BVHA 4YR9A 3U61B 2JAPA 5LNK1 4BWFB 3M3HA 4REOA 4UEKA 5EIBC 5JW6A 5MN4A 2FK7A 4AZ0A 3HYSA 3DWEX 1H8ED 5DSXA 2D00A 1P60A 2I34A 2X13A 3VU1A 1R6BX 2ZKIA 4IGAA 2AC7A 4Q3EA 4ANFA 2OHVA 1U2QA 1NBWB 3AFIA 3O3NB 5FTMA 3K5WA 1GFIA 4DN6A 3WGOA 1OB5A 1M34B 2TMKA 1KJIA 4WASA 1OI4A 1XCOA 4LE1A 2CD7A 5EMMA 2EU8A 3I8SA 2AJBA 2LIPA 4WCVA 4A82A 2H2AA 3P71T 1QO0D 5EN4A 3JVDA 2A1IA 3GOHA 4ZALA 4HAYA 1C0IA 3GARA 3B8HA 5IH3A 5LQDA 3D0RA 3V8EA 4DMGA 2ORED 5TF0A 1E2QA 2OTCA 5KBYA 4PCVA 1EK2A 1E6KA 1OYWA 5FWYA 3A0RB 3EZGA 3PKZA 4JOCA 2GRUA 3FZGA 3VNSA 1BS1A 1O1YA 1OXUA 3K0BA 4H6WA 1IC6A 3OUZA 3AF4A 3FDFA 3IAFA 2WKWA 3H87A 2CV2A 4ZU1X 4HX9A 1K7FB 3MMPA 1U3CA 1UBNA 3A1VA 3LY9A 1VBMA 1JU3A 2M32A 2NTVA 4G4IA 4TRJA 4CLOB 2IXGA 1YB4A 2AI3A 1WF6A 3ILHA 3KQKA 1KE2A 3NGMA 4BAGA 1NKVA 2G1KA 4MIYA 1M34E 4WZBB 4GPIB 2WKQA 3GGDA 3BIFA 4FYVA 1H3FA 1N0VC 4YAIA 3EVZA 3Q6NA 1KQFA 2TYSB 2ZBQA 3LA8A 3NDBB 5T4FA 2ZU6A 2QQEA 5LZ8A 4ZU3A 3GJSA 1KDOA 1DOHA 3E1KA 4XQ0A 5TQ0B 5GP1A 4YQYA 2FRDC 3UPTA 1F20A 2IZ0A 1KETA 4LBVA 5FAKA 1ZOPA 5K8CA 1P7ZA 4IXWA 4HBGA 1ONBA 4WD3A 4KI7A 3JQAA 1O87A 1X74A 2IUFA 1HRDA 1Y6FA 5FWNA 2OXTA 2W90A 5BN4A 3QPVA 1W46A 3AI2A 3OEHD 2WDPA 4GOXA 4O8CA 4Z8XA 1WUJS 4W82A 4RQBA 4LGMA 1NULA 1CR0A 5EWLA 2ZTMA 5GM2A 2DTXA 4J6EA 1HYHA 2DVMA 1QZ3A 1W2HA 2FQWA 1N0WA 1NTOA 2PJZA 3D8TA 4ARSA 3SFZA 4AMZA 5M5BA 1EE9A 4HDKB 5F73A 3TQCA 3NM4A 4ZJZA 2O52A 5JZBA 1RNLA 4QUIA 1A2BA 5LQRA 4E1AA 3IUJA 3E5HA 3OQPA 2I78A 3KQOA 4WZBE 3B38A 4PSCA 4UATA 3WGLA 1QF9A 2F1JA 4TM8A 3GA7A 3R2JA 3I4FA 1KYVA 1N1MA 1SM4A 4MH0R 4N3GA 5EE0A 4Y98A 3NP7A 2R25B 5JEDA 1EWVA 5M3BA 2GCOB 5KYWA 3OFND 4JBLA 2P90A 3HI4A 1KSJA 1ENOA 1EB9A 2PQ2A 2ZJ2A 3IUQA 4G1UC 1NOJA 5JIBA 1YJCA 3RS9A 5KYUA 2FZWA 1ORWA 1U2DC 4ZD6A 1ZEJA 4HGZA 5ALOA 4GGOA 1L4EA 3M9XA 5FUXA 1FYXA 1Y8AA 3HABA 3KPYA 3R0XA 3RROA 3OTHA 3QFTA 1ESEA 5LQSA 5LWQA 4X7RA 1T5DX 3GUZA 4QUJA 4RTSA 3L8YA 3V7WA 1K7SN 2YX1A 3KEFA 4IVNA 2I29A 5KOHA 2QYHA 4Z9XA 4MGHA 4ONEA 1Z29A 3MEQA 4DSAA 2CSUA 2IK8A 5A4FS 4TQ9A 3ZV7A 1RAHA 3RWOA 1BFUA 4FB5A 3G0CA 1BQ3A 4EHHA 3FVWA 3TTUA 1W47A 2JCBA 4LZAA 1NYLA 4BMSA 3FCEA 5SYMA 3FCXA 1XVAA 6YASA 3DLHA 2AR9A 4P1ZA 4TTAA 4UBMA 1GQFA 2OLEA 3KVRA 2JGAA 4L28A 4V2IA 3LKBA 1SCIA 1XLWA 3QU5A 2O3RA 5IVDA 3ANXA 1KEPA 5A7GA 2V3CC 5KQPA 5J47A 4MR8B 3CBGA 5E1DA 2F1HA 2C7RA 5EIBD 1SHKA 2R1ZA 1WDLA 2XMQA 3VC1A 2OB2A 2EFHB 4OQMA 3QU4A 2NYAA 2FX5A 4FYXA 3N0TA 1BDJA 3RF7A 3FUWA 4CMIA 1WPGA 2C4UA 4F56A 3FPSA 3AHFA 4LDZA 2ZWVA 3FUCA 4YJHA 4L8VA 1NZDA 4GU5A 5HKLA 1R64A 4BWGA 4QBGB 5IJ0B 3L7KA 2QIOA 2J4FA 4G1BA 2IUSA 1EGQA 1W85B 3JQBA 4FVTA 4S24A 4YT5A 1EU1A 5C8VA 2PD6A 1CUIA 1M2FA 4GRIA 1XZGA 3NIFB 5EEHA 1PS0A 1XFDA 1PAUA 3RYFB 1JWAB 4DMCA 4Y6OA 4CF6A 2VTBA 3SLKA 2ZRLA 5FFMA 4DJAA 1P7PA 4CLRA 3K72B 3SBEA 1TU0A 1Z45A 4MQLA 4C89A 3GWGA 2LCFA 3AX6A 2JHAA 1LDYA 4FOTA 4S1VA 1KPHA 2PNFA 1W5SA 1WKBA 3HMQA 4EI7A 1LLFA 3T5MA 3Q3CA 4CCYA 3COVA 3BJRA 4LYGA 3TQFA 3TQSA 3DVAA 1S1CA 3I9KA 3B70A 3ZNPA 3G8YA 3ZGXA 5HFAA 4TMFA 3K8ZA 2EZTA 1C8KA 1VCOA 2HHJA 3KKQA 3OQBA 4YB8A 5FL7A 1MAHA 3QWIA 4ZV9A 1YU9A 4BAUA 3EVFA 4L75A 2BEWB 1O95C 4LGCA 2O8DB 4LJ4A 1AK1A 2GBFA 4MVCA 1DBRA 1UXGA 2IYOA 1X87A 3KL2A 2G82A 2RGDA 3D81A 4HWPA 2OENG 4OP1A 3VR6D 3DM5A 2ZJFA 2P67A 1WDKA 4I4NA 2PKQP 2QS9A 2L42A 3GRFA 1KVRA 2ABWA 3M6UA 1GTL1 3QMPA 2IYRA 1IMJA 1GUDA 1RWMA 2QN7A 1TPYA 2J6BA 1G9TA 5HVNA 1UC9A 4YRLA 2WAXA 1Y3HA 3CVOA 4KC0A 4EA7A 1UDXA 5EJ7A 5KDDA 1KBZA 3QEJA 3ZVLA 3BK2A 2UYHA 4O2AB 1D2HA 3BHNA 2GASA 4HDNA 1VJ0A 3D2AA 4X6YA 4YK7A 5AJXA 1E7MA 1TYEB 4G0MA 1Q0TA 4KQGA 1EZZA 2HADA 2HJWA 2HSJA 1REQB 2RGNA 5LP1A 5EHZA 4RNCA 4QD3A 4RZXA 3BUSA 1YK1A 1JW9B 4ZAVA 1V16B 4LKRA 1P1KA 2GPNA 2Z2YA 2ZBDA 5CHYA 2X7HA 4TTRA 2FFAA 3PXGA 2QRHA 1DHRA 1I6WA 2JS7A 3PPIA 3ICWA 2EFGA 1XEFA 3UJ7A 3RSLA 1QUFA 1VKOA 1PF7E 1GPUA 2ZRHA 2KQUA 1TO6A 2CUKA 1XDDA 3T7KA 1NG1A 3UAZA 3WQQA 1VG0B 2ANCA 2QRKA 3CRZA 1C7FA 2JLCA 3F90A 4RO0A 1P31A 4DARA 5B6PA 2Z2IA 3R41A 1E20A 2UYOA 4CIDA 3K7EA 2C9BA 2BUCA 4IG4A 5K3DA 4EUEA 3MA0A 3EWNA 1K7CA 3T1VA 1PKEA 3N0VA 2GCEA 3IVGA 2IW3A 2QTRA 4W9RA 2W0MA 2HRBA 2XTZA 4XYBA 3U48A 1DEHA 4WECA 2WIJA 3NWEA 5T8KC 4BRUA 2F7SA 4BJ6A 3EODA 4NABA 4JYMA 4BKQA 4E6EA 2IYVA 4FW9A 2JA2A 3KSZO 3ONEA 4L0QA 5BQOA 4F8JA 3DEZA 1H22A 3H1AA 3RVSA 3L46A 1UKEA 4IX1A 2ZYGA 5LFAA 5DCWA 4BE4A 5FPSA 1LQ2A 3LJKA 1JI3A 3QVGA 1QBGA 4U63A 3BERA 1DQZA 1Y7IA 4IF6A 1M2OB 3B1KA 5G4LA 1AMOA 1XR3A 1VHQA 2I7DA 3OY2A 3PDHA 1EP2B 1NVKA 1X1TA 5MN6A 2HK7A 4ODIA 1N7IA 3AB7A 1JEYA 2GLXA 2QQGA 4YS6A 3HU2A 5AK6A 2YJNA 3JZFA 4PO9A 3EC1A 1IK4A 1Q57A 1VL5A 4M7WA 3CKMA 4KQKA 3UZUA 3VTFA 3IVRA 2R97A 5PNTA 2RK3A 5FYDA 1TKBA 1OBFO 2P5UA 3ADCA 1FP1D 1K5HA 1Z5VA 2QK4A 4L16A 1E92A 3SHVA 1M6HA 1MRZA 3D4OA 3FDZA 4KXQA 3CEPB 3VAZA 1XVVA 2JCGA 1SA0A 2WM9B 4ZC1A 3K4HA 3E5NA 3JTMA 1DKOA 2X9QA 3L7LA 2HDHA 4RY8A 4C06A 1QG4A 2L17A 4JOQA 3C6KA 1N4DA 1OTHA 2BGUA 4EHDA 5IDQA 1K8YB 1VJ5A 5EEGA 2VUTA 2Y71A 3VJMA 4ENTA 2NU6A 5MGBA 1IBSA 4G09A 1WIWA 2ZUWA 2OV6A 3QEOA 5A5EA 1D7AA 1WEHA 1UDCA 2GD0A 4RXTA 2NSHA 2B4KA 3DMFA 1RTTA 1I30A 1WO8A 3E9ZA 1SQGA 3LS2A 4G97A 4H35A 1E4EB 1WQ3A 4QEZA 3TVDA 3BSYA 3T9DA 1TZKA 2XKAA 4G0OA 1FMTA 1JZTA 1T4CB 2MSLA 3R0ZA 4IDAA 4D5GA 3SDBA 3T3MB 1P6QA 3QBJA 4C20A 1TM5E 1O95D 4BNYA 3P0IA 5J63A 2JJ2A 1L6IA 3EIQA 1B42A 3AJ9A 1AV6A 4D9KA 3C2QA 3F6EX 2JD1A 3KSDO 1TJPB 1QIGA 4I3FA 1H94A 3MWEA 3ZHZA 4EF5A 3O38A 3SQMA 3IULA 1C30B 1Y9AA 2VJCA 2HA4A 3R3ZA 5ILOA 3H5VA 2R86A 3ZU6A 3ZZ1A 3AF5A 4MA0A 1PV1A 3AL2A 1ZZEA 2OFPA 4AMYA 2D1TA 2VJQA 1NLMA 2XUJA 2Z1NA 3HDTA 4DJEC 4YYZA 3P2IA 1NBIA 3CURA 3K9WA 2HEGA 5DIZA 2B1QA 1JHPA 3BWVA 3QITA 3H5NA 5K6TA 2P65A 5DNWA 2SKEA 3F67A 1C4KA 1Q16A 2BSAA 3P9XA 2G77B 4DWWA 2R8EA 1Y7HA 3AEQB 2P2ZA 4ZKDA 1H05A 4QOIA 1OCEA 4R1NA 3A27A 4CKYA 2QDKA 2XYPA 3D8NA 5CIYA 4N0MA 4QAQA 3UK6A 4MRNA 3D59A 1IMOA 2O59A 5T3YA 2VQEB 4B7XA 1CPYA 1OYYA 2ZIEA 3HYNA 1C2TA 3P32A 2IE0A 4V3BA 5GY7A 4ADSG 4ETWA 4BUCA 2PRJA 2GKGA 1WSBA 2XOKA 3AHEA 2DCMA 3MAGA 1NNI1 2Q07A 3OPYA 5FCDA 3BIJA 3EOAI 3SBXA 5HQTA 3S1AB 2R5NA 3JASA 1EX7A 1V4BA 3DM9B 3HKDB 3CQ9A 5G0VA 1AHHA 4QTYA 3EX7C 3T5DA 2FWRA 3P0RA 1OYOA 1DC6A 3N75A 1VSUA 1F8FA 1Y5IA 5FV7A 1WBDA 2ZI7A 5HIAA 4C29A 1X15A 2AG8A 1PR3A 1QG6A 2VQSA 3IELA 2XRZA 1ZA1A 4F60A 4IH9A 2WWXA 3HV0A 4L1KA 5IYZA 2CXPA 1F8GA 5JWRA 1HYEA 3BDAA 3C3DA 3F6PA 4QFCA 1ZX1A 1J25A 2WYUA 3HDYA 2G9VA 5B4VA 3FXAA 4MR7A 3CLRC 2OXIA 3K94A 2CL6X 3COWA 1KEEB 2JHPA 2G36A 3FM9A 3CMMA 3PNKA 5FUVA 2QJTA 3I2KA 3FSEA 4FQ5A 4K8RB 4NU5A 4WKOA 5IW8A 2BE9A 4MGEA 3HZZA 2CVHA 3NJ8A 4BTVA 5DK6A 2OBNA 5EXDA 3BCRA 3HJBA 1XTPA 3JQEA 4RMHA 4D6PA 4JB8A 4AYXA 3DPIA 1E7WA 1KAGA 2WTXA 2PTHA 1DKLA 3HN6A 3LQRA 4X8LA 3IAM1 1ZFNA 1P1RA 1W76A 2HW8A 1LVHA 4BEJA 1NXSA 3RK0A 3HCNA 4HWRA 1XOIA 3CCBA 4PLFA 2BISA 4A2PA 2E1RA 2RJOA 4M1ZA 5FO0A 5FA6A 5HDQA 5B2FA 1CXZA 2ZP1A 3FUUA 4AICA 5TQVA 5ANRB 1KYYA 1VDZA 2PUJA 1E3WB 4C21A 1Q3KA 4QIHA 1IIBA 4FK8A 1AQ6A 4POOA 4A03A 2BD0A 3UOAB 2NYUA 3RS0A 1QHYA 3HFJA 3T3HA 1BU5A 3CG0A 4RY0A 3EULA 4X00A 3UGTA 4LUCA 4CN9A 2AYYA 4XB2A 2OBBA 4CMEC 121PA 1CNMA 1XELA 1D2NA 1UZLA 1SC1A 1WCYA 5EWJA 5FUWA 2R6FA 4CQMD 1MN6A 1ZS9A 2BMDA 3EUAA 4NAHA 3RAEC 3KOMA 4ZJYA 3ZU2A 2ZT5A 1NQWA 1LBQA 1UADA 1NHGA 2ODQA 3OP1A 4RCVA 1D0IA 2X5NA 4AMUA 3A4NA 1AHNA 4E3WA 2ZVJA 1H6BA 1Y33E 1DBSA 1M6VA 1YI8A 3A70A 1HLPA 3P2JA 1QX3A 4MKRA 4X8MA 4YRMA 4X20A 2B78A 4XE5A 3I6YA 4Z99A 5BWNA 1ZM2A 3LX5A 5JD5A 2QVGA 2G4VA 1KZ1A 2VRNA 1C4XA 1EJ6A 4HLQB 3SM9A 3ZC3A 1I0IA 3NEJA 5E7JA 4DPLA 4FB4A 1BAPA 1OGYA 3V8QA 2QRZA 1J8YF 1KL7A 1RXYA 3A9VA 1TM4E 1EM8B 2GH1A 4BEVA 1P5HA 2B35A 4B31A 5JCOA 3RLFA 1DKUA 3PNSA 4P7JA 5CFRA 2ORWA 4DF3A 1BXKA 3AZPA 3LQQA 1EIWA 3H2HA 3JQPA 1NQOA 5KU7A 4JUBA 5JSQA 3K6JA 1M2KA 2P2CA 5K4AA 1DELA 2B4TO 3X1XA 2QQFA 1TVCA 3MUNA 4OI0A 3MT0A 2RK4A 1ZUIA 1RQ2A 4PGGA 3GWZA 5T41A 1ZBQA 5A4MS 3G5UA 3OOJA 1RRCA 4OJYA 4PY2A 1PNOA 2ZRDA 3E7PA 3HKEB 3KKOA 5CB6A 4GR5A 1EDEA 3ODPA 4M1TA 1TA9A 1OT5A 2ZLBA 3AEUA 4PNZA 4F11A 2O2ZA 4RW0A 4Q3LA 3TSAA 1IQ0A 4QJ5A 1UPFA 5DMXA 1GNVA 3I5UA 1TMYA 1QONA 2PN1A 3TWOA 4CODB 3WL5A 3D6JA 2FV8A 4YV7A 2I8AA 2AI1A 5JCJA 3RYCA 5IRCD 1EVEA 3OJLA 4MWCA 3VNBA 3L8CA 3R77A 4O4IB 3M8KA 3A9SA 4CCSA 1P1FA 5IT0A 3T0FA 3SLRA 3AFNA 5CT8A 4KUEA 1RP7A 1NVVQ 3C0KA 4URWR 3IC5A 3TNJA 5CDFE 4WN3A 1OPRA 2F43A 3KVOA 2H3HA 3TQIA 1VIMA 1QH1B 4LMBA 3D6UA 4URYR 4JMLA 1O77A 4OIFA 2WSLA 5AVUA 3QTBA 4ITVA 2VN8A 4BP8A 3CLRD 1W36B 3OWHA 1EK5A 4C1NA 3QTLA 1L5HA 3NHZA 5LNK6 4YJ3B 1WSAA 3HO1A 2HRRA 3JARB 4UDYX 5B1HA 2A9JA 2IYNA 4BE9A 3V8RA 2VBCA 1Z4MA 3BXFA 4NAUA 3GLHB 4MPRA 3G6KA 4B6FA 3G5AA 5JZVA 1PJAA 1QCCA 1Z0SA 1CSEE 2ZTUA 3B6IA 3DO8A 4U6QA 4HGRA 1DQSA 3VVMA 2O8FA 2Q3FA 1W5BA 5F3RA 3WYDA 4IHJB 2AOWA 3AHCA 1HOTA 1R8YA 3ZHQA 3V8BA 3JALB 2P4SA 2CNLA 2FWMX 2FUEA 4CPDA 1M8FA 4RPLA 5BNFA 3VZRA 1H69A 2AGVA 5EVCA 3VNQA 4MCHA 2FPUA 3TUZC 3TN7A 1QKKA 4Q9IA 3UJ9A 2AXEA 1WNTA 1YRQA 1JFVA 4OHRA 4BZPA 4HX2A 1TJNA 1KQNA 4RGVA 4RPGA 3WNBA 1HDIA 2IHUA 1TM2A 2GK6A 1A69A 4G6ZA 1DKRA 4HNHA 2XKKA 4QVIA 2EW2A 4YRBA 4GWGA 3G0GA 3M1IA 3F5QA 3PNQA 4GW3A 1JVSA 3AFMA 4GBGA 3VO8A 3GLHE 1O94C 4EO7A 4P0TA 3QUBA 3VXKA 2IZ1A 5E6RB 2WNIA 1GKYA 2VAWA 4JR1A 2C4WA 4FGUA 1E64A 2PFKA 1BOFA 1JSRA 3D3NA 4FFRA 3V46A 5CXUA 5I4CA 3TMAA 2PZLA 3ANNA 1Q0UA 3D3WA 4FYYA 4UXIA 4ZREA 8ADHA 2C20A 5C5EA 1RLMA 2EP5A 5AXAA 2QG4A 3TIFA 5AHXA 3NHWA 1WW8A 4DDUA 3ESXA 1HI9A 3IYLW 5AW5A 5B58C 1DAPA 5JH7B 5KX5B 1IQRA 3A06A 3F9RA 5DGDA 1G3MA 1USWA 4ON9A 2OGTA 5AVXA 4PX5A 4B74A 4CCWA 4UM9B 4ZYTA 3EK2A 4BMVA 1NVWQ 2YUIA 2GSWA 3GW8A 2XRFA 5G1NA 3TMKA 3OX1A 4GKAA 4NBLA 4XGNA 2IDMA 1IL0A 3DAOA 3SSAA 1QK5A 3D6TB 2A35A 4QTXA 5DHRA 3PTLA 4D9NA 3BWMA 1CRPA 3RW9A 2QE6A 1VA5A 1CLEA 4RKWA 1M2VA 2HQRA 2ZB4A 2F3SA 1C7QA 4FUQA 1RYMA 3TW6A 2CNDA 4HN9A 4HGYA 1MOPA 4UFNA 2R00A 2QTFA 2ZUBA 1JPVA 4WL0A 4BNXA 5L8VA 5DCUA 1E1RD 4BB6A 4ENPA 3K1TA 5K0LA 3TL2A 1KHTA 4HEA1 2WV7A 1R4NA 2GZSA 2UUPA 3JQFC 2DU8A 3O1IC 2I6TA 4PC7A 4Q9AA 5J4HA 3CVUA 5GJBA 1KOFA 3PE3A 4RDXA 4QBIA 5AJUA 5C51B 2BFNA 4E03A 1DT3A 4WZAB 2B8WA 2ZAMA 5KYYB 4M0EA 1RW4A 1ZUNB 3QLUA 4HQOA 4PLWA 1CQWA 3VPGA 3I3OA 4LF5B 4ENWA 1E3TA 4RZ2A 1B0UA 1RWPA 3D1JA 1EXMA 3MUOA 4HQNA 7ADHA 5GMOA 1I10A 3SNKA 2PJUA 3EB9A 4FBLA 5JDIA 5ILGA 4QX6A 3K1AB 3IJRA 3LPLA 1GR1A 3HH8A 4LISA 4I9GA 3JSAA 1P8JA 1MORA 3S7ZA 4YT8A 4OBWA 3FOEC 1FRNA 5C7OO 1VL6A 3O4VA 4UMEA 1QOQB 1IBCA 2Z9BA 4B3MB 2YYSA 2VHUA 3IMGA 2YFYA 3A6PC 1T2NA 1J33A 4UFOA 5ESWA 1J7JA 4NXNB 1YA4A 1Q0HA 2GCGA 2HZBA 3AEKA 3DOFA 1JB1A 3AXTA 2VWGA 3I8OA 4MV9A 4ZC8A 3OCYA 1VYUA 4DCNA 2MYPA 3ASZA 5JC8A 1JSLA 1U4SA 3EVGA 2FSHA 2MIIA 3U60B 2GNOA 1YJBA 2DR0A 2O8CA 5LYJF 4FHZA 1SCNE 2XE7A 3ONWA 4I5GA 4JNCA 1AN0A 4BV3A 3NKVA 3OUUA 4XYEA 3C8ZA 5EJIA 2J6IA 4Z5XA 1SOMA 4MUMA 1O5IA 4YP5A 1CNEA 1RXSA 3BXOA 4K05A 3ZBUA 3ABOB 3L06A 4K7JA 4AROA 2ODBA 4HDQB 1YBHA 4R7GA 1A7UA 2RJ3A 5TR9A 1T29A 2OORA 3R6TA 2ZS8A 2REQB 3INGA 2GZRA 2BHSA 4RAQA 5IX8A 5B55A 5JSZB 1RHUA 4GI7A 1S0UA 2DKOA 1OLOA 2VOJA 1B6GA 3CUKA 3LCRA 1R0SA 4WZZA 3QHPA 5P21A 4XWKA 2H54A 3OZXA 4QXOA 3VZSA 2HK8A 1K1EA 4HAXA 3FG9A 4NFLA 2L19A 3DAPA 3WOHA 2MDTA 3GZJA 1R5NA 3HB5X 2RFLA 3ZYCA 4RLHA 3NHRA 1QHHB 3G8CA 5A5FA 1ZN8A 4BVFA 1O94D 1VPWA 3PXXA 2BELA 2XB9A 3DZ8A 1HYQA 4Q5IA 3S8YA 1WDTA 1HUQA 1BC5A 2GAIA 2J0UA 3OCXA 3OEWA 1QGAA 1E79D 1Z17A 2HQSA 3FAZA 4HNRA 5KEIA 2ZPAA 4LYFA 3ZIUA 1CUUA 3CUTA 2ZUTA 3S2SA 4IDDA 3WR5A 1HETA 4N8SA 1X1CA 3PYMA 4YMWA 4KIJA 1AKQA 3PI7A 4IDQA 2C03A 3RBZA 1XP5A 2XEXA 3FCAA 4GR4A 3E5RA 3TRIA 4D81A 2P11A 3K6RA 4A0FA 4TXNA 1SPBS 3ZV6A 1JR3D 2UUOA 3OESA 4RIIA 3H2GA 1QPGA 1NQAO 2CMDA 3KZOA 2GBLC 2WI8A 4NFHA 1NF9A 1G4UR 4EJSA 9LDTA 4OF4A 5ALRA 3VSAA 4DHEA 1FC0A 2IS4A 4GLJA 2OZLA 3LPAA 3SG0A 2JLYA 3OX4A 2A5FA 1BFKA 2GZHA 3IAEA 4FMDF 1GPLA 3IOMA 3T1TA 4U5QA 4HWOA 4L0DA 4ER0A 2FZVA 3Q2OA 3B3AA 1L1FA 2W4IA 3DZHA 1AKTA 3LFTA 2OB1A 5LKAA 1M2GA 1H66A 5BYJA 1DAKA 1Q7EA 1IM2A 4LK3A 4RTLA 2BRUA 1X6VA 2VO1A 1UKBA 1ORRA 3PVSA 3VR4H 3ENNA 4F71A 5BUQA 1A4UA 2R60A 1QNFA 1X2BA 4QQ8A 5A3RA 4DDWA 4QNRA 1X80A 2C4NA 3JRXA 1A50B 2VYCA 3L0OA 2NZ8A 2FSUA 3TSWA 1NN5A 5CEFA 1JR2A 1CJUC 1KYQA 5FBRB 2I1QA 5ELLA 1PTKA 1C0LA 1NPYA 2D74A 5JWOA 2NV0A 4PYKA 4CM7A 2I67A 4AX4A 4QOEA 3UH1A 3A1WA 1V1MB 3LX4A 3AINA 5CP8A 2B9VA 3EE6A 4IH1A 5LIRA 3M4ZA 4FFWA 4AJ4A 3R9XA 4M55A 4IV0A 3PXCX 1H2RS 1GUBA 2XLCA 2Y05A 3Q40A 1TIBA 2XA1A 3H97A 3PA6A 4QTZA 5CGZA 3G1UA 3RAGA 3MWYW 1GQ2A 1JQEA 4L3WA 4MUBA 1Z75A 2OC4A 4W6QA 3RRZA 3HV2A 4JSYA 3V48A 4NK5A 5C4MA 1LPSA 1BKYA 2E3JA 3UH0A 2Y6UA 3EMVA 3EJ6A 3ZIAA 3HA7A 3FOZA 3AR6A 2Y0BA 1ZIXA 3MMSA 1JDBC 2QSUA 4Z0TA 2WY2D 2BEVB 1I7QB 1P45A 3LQKA 4MQEB 2YYZA 1FSZA 3TSCA 2A3RA 1W73A 3LBAA 3PNPA 1G20B 1Q44A 1COZA 1G7TA 2VHJA 3IESA 5E4TA 4PAMA 3VR3D 4K1LA 1JQDA 2B3TA 2X3UA 3FH0A 3WLNA 4O4HB 1V11B 1FOEB 1VL0A 1P73A 2M1ZA 2XR1A 3FN4A 3T9CA 3ZY4A 1AK9A 1LW6E 4OHWA 2QUAA 3LQ4A 2HZ7A 5AM1A 3HCRA 1Q77A 4LJLA 5TT1A 1ZKMA 1E9DA 1YR9A 2GZAA 1B8NA 3QKRB 3OQNA 2HV9A 1OOEA 1UQTA 2HLNA 4KGDA 3D8UA 4OI2A 4B40A 2C42A 4F45A 5L53A 3WIUA 3DONA 1ML4A 2JDIA 4BVLA 8ATCA 2H1LA 5KTPA 3OZCA 5BQPA 3NHKA 3DS8A 3JWPA 4QNNA 4NYJR 2AFIB 2WU0A 4PWYA 4IEFB 4OMUA 1NMZA 4WNIA 3NONA 1KI6A 3ZQKA 1F0PA 3FD8A 1PQUA 3H9UA 1SWVA 3ZCQA 4YPOA 2HT1A 2Z3WA 2IZ5A 4PSUA 2PS1A 4QU9A 1YR8A 2HX1A 5DXAA 4Z3DA 1FUYB 3GJ4A 3IXQA 3HBLA 1RYNA 2OKCA 2ZAYA 3CSSA 4LHSA 5E9WA 1G20E 4CM5A 3TTSA 3ZNNA 1P7CA 1QHGA 1Y63A 3AKEA 5EXEA 4Q48A 3TQRA 4H7FA 4DJDC 5KHOC 3F4KA 3D5EA 5JO0A 5BSTA 3EWSA 2NADA 3ZXUB 5C2JB 2P91A 3GX1A 4G01B 1KIMA 1VL8A 2Q4DA 5FKJA 2QJWA 2XH8A 3EA4A 3LTEA 3GGOA 2VDJA 1HLDA 4RELA 3VX4A 2YHIB 1VA4A 4RA6A 4BV9A 4HFRA 3ESYA 2FJ0A 1XPUA 1LKZA 3V4PB 1DTWB 4L57A 2P4EA 2XVZA 4J16A 4XJSA 4MDYA 1T2CA 4X54A 5FTKA 4FGZA 3RS7A 2OCDA 2P62A 2C4KA 4JXKA 3SX2A 4ZHSA 1ZD5A 2E4XA 3DD1A 4IBOA 4NS1A 3DPUA 2B4YA 1T2AA 2G1AA 3EUEA 2H1CA 4BGDA 1IN4A 3DT8A 4CLHA 4KJZA 1H2EA 1WMBA 2Y1WA 3LDHA 3RNOA 4MCAA 2EWVA 3ANYB 1U98A 2BKEA 2C4HA 2WIGA 1BYUA 1PZHA 2A1TS 2RHDA 2FA9A 4JQZA 5EC8A 3W5IA 3GO4A 4QDXA 3ZLUA 1O6BA 4JUFA 3B85A 1TT5A 1DRKA 2UXDB 4RFLA 1YS9A 3GJ7A 5GZ6A 3R7SA 3SE7A 1RXVA 1JB9A 1Y6JA 1QFYA 1YRYE 4G5HA 4UDNA 1E1NA 3RJ5A 3RANA 3BE5A 3PQ2A 1E1QA 1E77A 2ZE8A 2CUTA 1I6MA 2FW0A 2PRKA 1ODTC 4IYJA 2C9DA 2DWPA 3HUEA 4RPCA 5EJEA 3ISVA 4IXTA 3STWA 2ZRJA 3D1LA 5DHPA 3H0KA 2W5UA 3GFOA 1X92A 3LAWA 1NGSA 4KPUB 4JR2A 1E3MA 1TU3A 3BZWA 3KC2A 4UEOA 5I9LA 3JZIA 1MJNA 4KWCA 5ALVA 3K0FA 1WVMA 4IIYA 4QARA 1ODIA 3QFFA 3ZVRA 5K4GA 4LGVA 1QGDA 3PD0A 4IJ6A 4AUNA 4RHEA 1N5MA 1KU6A 4Y2UA 2OPBA 2NP6A 4LV6A 4ZOLF 4DQKA 4F5WA 3GEIA 3VRHA 3I3SR 3FROA 3JZDA 4V0RA 3WIVA 1IY2A 2DZDA 4ND3A 1H6CA 4Z51A 3TGPA 1YQUA 1WU7A 3E22B 1CUVA 4PYLA 4LN1A 2IL1A 3TLZA 4DT1A 1C1XA 1JLLB 4OUKX 4U7JA 3FMVA 1KMMA 1XFAA 2QQ0A 3UCXA 2MOKA 4KXVA 1KGSA 1K4YA 2FMFA 4S35A 1G17A 2QM8A 3GUYA 4AWXA 3L0YA 2ZRMA 3NC4A 4YMSA 3AZQA 1B1AA 2MYUA 2QVZX 3L04A 1K4MA 3N8GA 5CNIA 5GOZA 1DIBA 4KVFA 3IQXA 2WU1A 1JE1A 2DQZA 2YXPX 3RYHA 4F9EA 2WJGA 3FW1A 4ER6A 2GTHA 3QK7A 4BWVA 5K0EA 4JLOA 4DA9A 3W8DA 3UEOA 2O2IA 4M37A 2QLTA 3KETA 1AS0A 4B84A 3DZIA 3I58A 1UP4A 5ISMA 1RACA 4LXXA 1JKMA 4AF6A 2O06A 4B79A 1NC3A 1SBTA 1U90A 4EGQA 2HDNB 4A23A 3QXSA 1Q7TA 1TK3A 1PJQA 2UZAA 3AW9A 2OP1A 4DIBA 3VHRA 2RHJA 1V1JA 3TZKA 3D2LA 3MTEA 4LHWA 3EGXA 4HNAA 3CNHA 4IRUB 1P74A 4Y2GA 4R2JA 3RV3A 3VR0A 4YUZA 2ZSAA 4R7ZA 3VKWA 3A25A 3VBEA 1YGPA 4WNYA 5SY6A 4NG5A 3VISA 1GUAA 2PH3A 3FNHA 4ZPJA 1WS6A 2NPFA 3VO9A 1E5LA 3MPOA 4BZXA 4D26A 5IBCA 2VCHA 1G42A 1P19A 2EJBA 4MVJP 4UUOA 4ZEXA 1KVQA 2VDPB 3PPWA 1HKUA 2BC9A 3E53A 3T34A 2WHXA 4DV3B 1E3IA 2FMIA 2WWGA 5LM3A 1IQUA 2IT1A 2OC9A 2XNJA 3E9YA 1A97A 4UVEA 1PHRA 1WW3A 2WE8A 4YRJA 4AP9A 1RHRA 2PGDA 4Y2PA 3EXEA 4ZVTA 2QAJA 5TQ2B 1RYDA 3ELBA 4ESVA 2JANA 3PDIA 4HWKA 3ZN2A 3N70A 4MWBA 1DFGA 4BJHB 5FV4A 2EGHA 5CDYA 1UP7A 4U6NA 2OAQ1 3S68A 5CFQA 4OHYA 1KYZA 4LJKA 5IANA 1XDUA 2WIDA 2O9JA 2JGJA 4RZUA 2Y1KA 4YAEA 2XDYA 3TB4A 2HJ9A 1PR5A 4AXXA 5KTKA 4B3BA 4KRGA 4D4MA 1BXRA 3NG1A 1B41A 4MQFB 2BCGY 1E7QA 1GZVA 1US8B 2XAAA 3BA1A 3EARA 5KKCA 3TG8A 4JEUA 4OXQA 1A9PA 1U9YA 5GAJA 1B0ZA 2K4MA 5KOJB 3TH5A 4H1VA 1RWKA 2GM5A 3CLTC 3KYCA 4JASB 1O89A 3ITNA 2ZDHA 2P0YA 1FIUA 2YYYA 1B23P 3T41A 1H2XA 2JLVA 4EY7A 5I3ZA 3WGHA 1LJ8A 4OFWA 1N8TA 1RYEA 2EP7A 1CJTC 2P8SA 2XBUA 4QPCA 2OPHA 1UWCA 4OHPA 3C74A 1FXWF 1K88A 1XCBA 2OE2A 5EJ6A 3EPKA 1KBQA 3T95A 1CG6A 2CLFB 2GO1A 3I9V1 4P3XA 1ZGJA 4YASA 4YRSA 4BVAA 1S3SA 4DDMA 1UKYA 2EFDB 4R2IA 3DV2A 3RF6A 2BZ0A 2P7IA 1XALA 2Z5LA 3A7EA 1EJ0A 1R74A 3PQEA 4IFIA 1BKDR 4R1QA 5D51S 3VMFA 4MP3A 3DOJA 4G0XA 1KS2A 1FU8A 3GD7A 3NV9A 1R9JA 2NU7B 2Z30A 4YFVA 2O50A 2HA7A 1HE8B 1XMIA 2ZUCA 5HJ7A 2C54A 3AP3A 4HSGA 3BAFA 1ONPA 3QU9A 2IU6A 4LZPA 2NO0A 2QTCA 2X1LA 1YR1A 2OLJA 4IF4A 2DKNA 2ZSBA 1P18A 3H83A 1H6AA 4X64B 5JCZA 2VWQA 5K5EA 2DBQA 2ZR8A 1SBNE 1VRVA 3JR3A 3Q7QA 3R6LA 3ZHSA 3G82C 1X3SA 2QPOA 2XMZA 4U7WA 1Y81A 4EENA 1AS3A 1HE2A 3CLHA 3TGLA 5HW0A 2IYEA 2X2OA 4GZLA 1MO3A 3JQAD 1FJXA 2GQ0A 3CWQA 5FQNA 5JAIA 5DX0A 5I4IA 4TXMA 1V8OA 3MJVA 5LYJA 3T4PA 3FZEA 3PQCA 4MAMA 3SX4A 2R6HA 4ZDJA 1FUEA 1Z0AA 4GECA 4D45A 3QBDA 4YMUA 4OGWA 3RU7A 1WOYA 1KMHB 1JMYA 4QU5A 2GF0A 5HQJA 1ZRNA 2Y4NA 3N07A 5DBIA 4DKXA 4YT2A 1A5AB 2C3OA 2ES4A 2Z1DA 2V55B 2ZYUX 5HIIA 4ND6A 2LUOA 4EP1A 1T1GA 3CR7A 3W4JA 1E2BA 2OOSA 2ZU0C 1XDGA 2CL5A 1UK6A 1W4CA 1YASA 1XTKA 2D2VA 5I7HA 5H1YA 3SS8A 2WG0A 3IRVA 4W6ZA 4H7HA 1WHSB 5H02A 2RGNC 2GN2A 3N7UA 5K3SA 2G9QA 4B3CA 4BX3A 7REQB 4L5CA 2QVLA 1XEXA 4R1PA 3D5QA 3N1UA 1LLCA 1QBKC 3DGFC 4IMPA 2PR2A 4LY9A 5AVZA 1NL3A 2C5GA 2DFVA 2EXXA 3F6BX 3KSMA 3LUFA 3KTOA 4LHYA 3HVHA 4HRXA 4REMA 1E8NA 4BFZA 3QSYA 2PUBA 1WW2A 5EZ6B 1M66A 4E5DA 4C4ZA 2NOAA 4N7BA 3G2MA 3PUWA 4PHCA 4DV4B 4OXKA 1A8SA 4K6CA 4OMDA 2QROA 3EOZA 4LTDA 2IOHA 3K32A 2NVUA 1UEIA 2GTPA 4PO8A 1ZDMA 4WY2A 5T4HA 2FW6A 2WJIA 4QRHA 3ROKA 4Y0VA 4LF6B 1P17A 3ZHBA 2K7FA 3HM9A 2CN1A 2EIHA 1JWLA 1PR2A 2WAMA 3OCVA 1R18A 1DRUA 2WC1A 2HMAA 1DO8A 1EP1B 4HHEA 1L8XA 1USKA 2LD4A 4A5OA 2VT6A 4ZU6X 4EGAA 2GCPA 3GUHA 2C8LA 2IRWA 2MWMA 2EJVA 1FZTA 3WGZA 2QTBA 3PT9A 1SBYA 2ST1A 3CZCA 4F2DA 1XX6A 2FXIA 3BL6A 3GT3A 4OKNA 2P9HA 1JFFA 2CF6A 4ZV4A 3TPCA 2ZIXB 4O2AF 3OJXA 4NENA 2J41A 4WLNA 2XNDA 4JLJA 4E51A 1G8MA 1OWLA 1LBTA 1N4AA 3DWIA 4OBEA 1KKMA 1QVAA 2WBLC 1VGRA 1FP4B 2EC5A 3NCHA 4G26A 1V9SA 1ZAKA 2QUHA 2FUG1 4I2NA 3TNFA 5LD2C 1QE3A 3F4LA 3ENWA 2IZOA 2NWQA 3SJUA 2XE8A 4CMGA 4LFAB 4OA5A 2QYOA 3H2ZA 1OT3A 3VV3A 1TUBB 3CB4A 1TZCA 1OA0A 1VKNA 4KRYA 2FSSA 2VYNA 3LBNA 2WSYB 3CLTD 1XF9A 3P9CA 4RU1A 3EVAA 1OKKD 5B30A 3I37X 3LDAA 4KMOA 4Y3UA 2F8TA 3WQHA 4LNHA 2XX3A 4N18A 4OIMA 3ROTA 1E0SA 1JKXA 3DP7A 2M1XA 3EZNA 4P53A 3LH5A 3IO3A 2GBCA 5G0UA 1T1RA 1XMVA 3IALA 3O8OB 4TMWA 1VE5A 4WE3A 1M72A 4CTJA 2OZEA 1WY7A 5B2ZA 1RDFA 3ZWAA 1W35A 3C7KA 1VXOA 4IQFA 2KYRA 1UK7A 4J7AA 5DEOA 3NKFA 3DLTA 4LZNA 4UUBA 3SFTA 4A1FA 1D7OA 1JEAA 2BFFA 3P0JA 2C2MA 2DETA 4U00A 3X1KA 2VHVA 4MGZR 5C18A 4GKBA 1YHZA 1JQKA 5K0ZA 1KZ7B 1W9MA 3QEMB 2I4LA 3IB3A 1FQJA 1LQTA 4Q3CA 2I54A 5CEEA 1FP2A 1ZK1A 5TLSA 1B7GO 4FYPA 1TDJA 10MHA 4I9FA 4JB2A 3X44A 1FB5A 3OCZA 5JNUA 3ROFA 4EH1A 4QUBA 5FL7D 1Z36A 4NJMB 4D02A 3AHDA 3LC7O 2VKQA 1EK0A 3LBYA 4XEUA 4PN3A 5B64A 2YWBA 1YZHA 1SVLA 1DS6A 2D1QA 4GG1A 3DE2X 4HQLA 1GNRA 2H0AA 1JIQA 1NJSA 5HZGA 1KR2A 2A78A 2FUCA 2NXWA 1J22A 4R1UA 5K3AA 2X8JB 1AJEA 1P44A 4QDTA 3OM9A 3EF0A 3PUJA 4TYPA 1EIZA 4W5HA 4BP3A 3KZVA 5F3WB 1CD5A 3P1JA 5ILQA 2CVFA 3EBOA 1SVKA 5KJEA 1R0XA 1IY8A 1FZQA 3WLHA 4OJKA 3MD0A 2O2CA 3EZ2A 5IFLA 3D4BA 1ZP6A 3EMKA 4NCKA 5B7QA 2GCIA 5E6UB 3V4ZA 2FN8A 3DT6A 2V5AA 3ZCRA 5JNSA 3QXJA 2WA1A 1ZIPA 1YFZA 2AUNA 3IMFA 3OQHA 5JNLA 4R16A 3HY3A 3GLFB 1FP6A 4Y6LA 4REQA 3T3NA 1EVIA 3H84A 4H1TA 5C9ZA 4MA4A 2O5RA 2W6MA 3MN1A 1L7NA 5EXPA 1SUBA 5I7RA 1RE0A 4KR2A 1GRCA 2FFRA 1F2UB 1U2PA 2CD9A 4KDRA 4XDGA 3EIEA 3UHOA 4LI3X 1K5DA 3QFHA 1EZ1A 2IS2A 4RKFA 1HQCA 2Z2ZA 4O29A 3DXXA 1H4TA 1EJ2A 5E95A 2GAFA 2XYHA 4L0CA 5E8RA 1NYQA 4P98A 3EIXA 2QXUA 3ONFA 2QPTA 4Y1EA 4QRIA 4MVXA 3FRIA 2VUIB 3RVMA 2IBTA 1G6HA 2QUKA 4UASA 1K8ZB 2I2CA 4OMCA 2JEYA 4EI8A 4PLZA 1OBCA 3V1NA 3WGIA 2R6CA 3NCTA 2W2QA 3PWZA 3W5VA 4MRRA 3FCCA 4L9WA 2A0UA 1JQBA 1SUAA 4UULA 3GLFE 4KK3A 4X6UA 1EP9A 1B6SA 4A8JA 4GMHA 3G2JA 4BO4A 3W5AA 1OMOA 2HQ1A 3KEMA 4KSYA 2NTYC 1XNHA 2PZ8A 2ZB7A 3LUPA 3QKSA 5IASA 2Z6VA 3GMSA 4KE6A 4WZ6A 4LA4A 4YFYA 5EZSA 4DLAA 2FNAA 2W2LA 1Y98A 1Z6GA 2XW6A 4JGBA 1GRRA 3THXA 4KQWA 1Y42X 2I55A 3KALA 4EDHA 4ZT7A 2V9PA 2R84A 2WJZB 3FB4A 3M6VA 2BFBA 4KV7A 5DGHA 3TJRA 3VFDA 3WRVA 2R6JA 4BBAA 3VH2A 4BFTA 821PA 1WDMA 3FAKA 3GUCA 3LGXA 3FZNA 4XDYA 3NASA 5DX8A 4RSRA 3NXKA 1QC5B 2VPWA 5C1OA 2QYSA 3K8QA 2WIKA 4PYOA 3EBPA 3NBXX 1Q0SA 4HT3B 2GBPA 1XU7A 4KPEC 1S2LA 2G63A 4GUDA 4U2BA 3TOVA 1IZ8A 2HTFA 2ZG6A 1BOOA 2ARKA 2JJMA 2NUAA 3DEHA 2E55A 4INJA 2RONA 4MQ4A 3EVDA 3RB8A 5BT8A 5CCDA 1Z08A 2M6RA 5LQNA 1WULS 1W93A 4GDMA 4ZOLA 3SN6A 3WRYA 1ZRSA 2Z4SA 1L5YA 1IEVA 4J0IA 1AGXA 3HWX1 3UBTA 1A95A 4P5PA 4AVYA 3H5WA 1P7VA 4FLMA 4RK0A 3HLYA 2YCLA 3OHSX 3ER9A 3VR5D 4MNTA 4B81A 1XDSA 1Y5NA 3D4NA 3ICVA 4P36A 4PLTA 4R9NA 5CIWA 3VZBA 1JVNA 2WUEA 2A1TR 3DF9A 4LK2A 3HJFA 1AZLA 2FFQA 2JJ2D 1KORA 1ZQ9A 2HJHA 2ZKLA 3WQRA 4EVQA 2HBQA 4MJLA 1WETA 1MDFA 1SVMA 3W5DA 1L7MA 1N2HA 2GM9A 4WTOA 4CNQA 1M34A 2EL7A 2FWAA 3M4NA 1R6XA 3AUKA 3BK1A 4Z1MA 1NVFA 1N36B 1ST3A 1N6LA 521PA 1C9MA 1H65A 1P2SA 1CFJA 2CNBA 4N5MA 4ND7A 3SX0A 2JFZA 4RH0A 1N5RA 4H2DA 3NTRA 2JGDB 2ZJ5A 3M5CA 4P2BA 3RPEA 5BV2P 3ESCA 1RBZA 4ID3A 2YW2A 3OPNA 3SIPA 4I0WB 4RMIA 1ULAA 2OOKA 2PA0A 3EAFA 3KJEA 4BJ3A 4MYTA 2EQBA 1MVOA 1ZN9A 2E4WA 3D6AA 3NHLA 1X77A 4F2WA 3K5IA 1ZRMA 3T4EA 3LL4A 1GSIA 4ZI3A 3DJYA 3EAGA 1Q1GA 2YC4C 1KZ4A 2WYIA 3JAWB 3HSKA 2FUNB 3I12A 3N2ZB 1PJ4A 4IM7A 4B1FA 3A7DA 2WF9A 3HB1A 1SRQA 3K0HA 3BD6A 5LZ5A 1HV8A 1W34A 1Z16A 3QLVA 1J90A 3FPFA 4WZBA 3DE5X 2YOHA 3OIDA 4K46A 4OL0A 4C4YA 2AVNA 2BR4A 1Z38A 2B83A 1M9NA 3F74A 2VLIA 1UBOS 1KI7A 4P6VF 4E6PA 5E3JA 5TQ0A 1AV7A 4ERXA 1SKAA 3QX7A 2GNAA 5DW0A 1A2KC 3GK3A 1Q6ZA 2PKXA 4TM7A 4QHYA 4N5DA 1WL8A 2P6PA 4DMMA 4FWBA 1CY4A 4P9NA 2XCSB 3P5SA 3V2IA 2R68A 4OSPA 1G64A 1CZRA 4D9HA 3D7SA 4OKIA 2CXTA 1YQGA 3TL3A 1C3JA 4DQXA 5F5LA 5BVHA 2OCKA 1F51E 1NXPA 1V5FA 2QZ9A 4HDKA 2W70A 4YJGB 3DYBA 4JAVC 5JAQA 5K6AA 4UOEA 3IE2A 3BILA 1ZGZA 3G2KA 3OF5A 3PGKA 4YCLA 4P7BA 4QYIB 1JLRA 2YXNA 4MW2A 4F1JA 1S9HA 3TLMA 1MT3A 2ZDQA 3CF0A 1EBUA 3IP6A 1RR6A 2D1RA 4IRXA 2BBTA 2JGIA 1HA3A 3LUBA 2IXFA 3HB0A 3T61A 1T13A 4CL0A 5A3VA 1C7EA 4BYGA 5IF9A 2CJPA 2GCOA 1NYRA 4Z4HA 1AH2A 2FZGA 4HRVA 5A0VA 3LVRE 1RAGA 4URXR 5B1SA 1EFAA 5DKFA 5C31A 4BO6A 1T6ZA 4K9NA 5ALXA 4DGQA 2XB8A 1J21A 1D9ZA 1B8OA 2FG7C 3ORQA 4LECA 5KAPA 4C2AA 2ERCA 4Z7OB 4PGAA 4RVDA 5DN6D 4O4IF 3GJ6A 3AQ4A 2PUWA 3C70A 4EF4A 4OOEA 3VPAA 4A16A 4HLDA 4B32A 1S6YA 1JR4A 1YB7A 2YQ4A 4CMAA 1ORVA 3ZH9B 3ODGA 1AQIA 3T35A 3V8VA 3SXJA 3MELA 2ZSKA 1QGZA 2VA9A 5G3YA 1B6TA 3L7AA 1IHUA 2R6GA 5HK9A 1CUJA 4MR8A 2B98A 4MV3A 2R2AA 4YJ3F 3A26A 4RVGA 3T1YB 5A5DA 1ZJZA 2NT3A 3B2EA 2Y1OA 3ROZA 1ZGCA 1XJQA 4IR7A 1SCDA 3BK7A 4ASUA 4F3YA 4DQDA 1V5EA 3KLPX 1JSZA 1TYZA 2YS6A 2H48A 4G56A 4WKGA 3GEDA 3RFCA 4H1WA 3BD9A 2PX8A 3BVPA 3FRJA 2R7KA 2CLSA 4IHJF 5JU6A 2IW1A 4M76B 3RARA 3TI7A 4M98A 3VPHA 3KPJA 3VYRB 3PTAA 2I6QA 3ECSA 4BMOB 5IJ0A 2ZSEA 2JVJA 2Q3CA 1IPHA 5AI8A 4BNZA 3A1NA 3D7MA 1W85A 4DIMA 1DSSG 1H9AA 3E3OA 3I6MA 1E2HA 4MUJA 4E4RA 3WG9A 1XZAA 4J3NA 3RYFA 3N8NA 3DMGA 1DBWA 2OXRA 3K9NA 1ZCFA 3VU3A 1QU2A 5AW8A 5IKXA 1CEQA 2NTNA 2PBRA 4V0ME 5DOVA 1Q1QA 1CVLA 1JDJA 2C78A 2VRBA 2R00C 1VG1A 1NG9A 2WMOB 1LSJA 5J3JA 1HZJA 4F4JA 3WLSA 3F9IA 4DUZB 2QPAA 4UPDA 3KOYA 1XB2A 1TAUA 3GJTA 1O6CA 2PXXA 2EVWX 2WHQA 4PFSA 4PQYA 1U0NA 3L40A 2OSBA 2C2ZA 4WLOA 1QV6A 2YV5A 3G9ZA 3GZNB 2D2XA 5EGSA 3QLUC 4CMJA 1F6DA 1ODCA 2D5LA 2NZYA 1J99A 4M0DA 1KRWA 4XX0B 4KMMA 1GGMA 5DLDA 4IJQA 4G2TA 4XOUA 3PNOA 1CY7A 5KX5F 2BFCB 3AR7A 3N2NA 1LNZA 4HP8A 1PGOA 1PWXA 2BEWA 4IIJB 4EUFA 2QRQA 5JH7F 4AS1A 3ZKAA 2JBAB 2YXDA 1YVRA 2O8DA 2WTMA 4DWVA 2SBTA 4HMOA 2JFWA 2EGGA 1N8NA 3AVWA 3QSGA 1FTGA 1W19A 1YZUA 4JUIA 2AG0A 1OXVA 5DWVA 5F1OA 3UPUA 3M6LA 4NSNA 5EPOA 1GPBA 4P3KA 5HM6A 2RGXA 3DOEA 3VU9A 3E6AA 2PMKA 1NLFA 3C8DA 2V7TA 2HK9A 3DHWC 3KQSA 1WMAA 2Y0CA 1ISRA 1FCJA 1YB6A 4I1PA 3HBJA 1W4BA 4H60A 4L8YA 5TE9A 1OZ0A 4O2AA 3A6EA 3GRCA 5I7AA 3LUAA 2YY6A 3J81A 2EIXA 4OK5A 3TIIA 1IN8A 4JCOA 2EZ4A 1REQA 3O7MA 3MJRA 1BRTA 4ZCIA 1TXGA 1OWPA 3R0QA 3TRKA 3M6IA 4KQ6A 4LJ7A 4RWEA 3PHJA 1V16A 1BQEA 3KVYA 3W3AH 3FHTA 5IBPA 2KB0A 5FEMA 1GXSB 4JODA 2ZI6A 3R9WA 2R8ZA 4FOLA 3ZPXA 2OORC 2QR5A 4JL5A 1MB9A 1K6MA 4P4NA 4GKKB 4LC1A 1YQXA 2BGMA 3OCCA 1XE3A 4PPGA 1KFJB 4JY7A 5K3CA 1Z2NX 2PLRA 3JYOA 3LOPA 4H6XA 2HYDA 3CF4A 4UHHA 4XEHA 1GRVA 2NU8B 3I9V6 5CFPA 4IOJA 3INRA 3LKVA 3R8FA 4KGVA 2F90A 3JU3A 4G1VA 4WNAA 2BGGA 2ZANA 4NDNE 5HRAA 3L6EA 3ZS9A 3WZLA 1RQPA 3FGZA 4AN0A 1B0PA 4JZYA 4RYLA 2ZUFA 1CS4C 1W88B 2AF3C 2IF2A 1IBKB 1YOVB 4LGYA 5KSYA 2O0LA 4P81A 1HRKA 1T2UA 3KAPA 3NWOA 3LQ1A 4MVJH 1VCMA 4J0QA 1PJBA 4MHSA 1Q95A 2IY7A 2IPXA 1T2DA 4XWWA 1Z82A 2JD2A 4BYMA 3EBLA 4MLPA 3FJOA 4YTEA 4IZIA 3CR8A 4NDZA 2RHRA 5FWXA 3KE9A 4MYHA 4CFYA 2J9RA 4U3JB 5HBRA 3ZX5A 3GVPA 1GT6A 2Q27A 1Y4SA 3AM4A 3WDKA 3PEWA 1GPNA 1M2OA 1G16A 2BMEA 2E49A 3CS3A 1TYBE 2YWFA 3A2LA 2VYVA 4IMRA 3RVNA 3TFOA 1CDZA 1JDUA 1PEDA 4OH1A 4YAJA 5K2OA 5A4IS 4WK4B 1JEDA 2NYRA 4JVMA 4EJSC 3BTVA 3GYGA 3DL7A 4AJEA 3QVSA 3BEOA 2AFHB 5WRFA 1P3JA 5FOXA 5IDWA 3NH6A 2XUAA 1SRRA 5AO9A 5TPWB 1M6YA 4PYQA 2NUBA 4CLEA 4DY6A 2HA5A 1YJ8A 2VH1A 3TX2A 1N7JA 3E9DA 1PR9A 4KYIB 1JN0A 1A9YA 1EDOA 1GGFA 2JJQA 2O2DA 4Z4GA 3RIMA 4RKEA 2R4UA 4XQ9A 3ENVA 5BN5B 4YCJA 4GX1A 5JTTA 4C4PA 5IHXA 4TMVA 4JQOA 3QY0A 4YONB 2IIBA 2FPXA 2ZK7A 2YIMA 1NT4A 3TLAA 1R8XA 3WRXA 3OP4A 3G8DA 1NIPA 3H2JA 1E4EA 1XU9A 4KAXA 4MOWA 5ALTA 2BGRA 2HNKA 1T4CA 2PU7A 1NPTO 3A9CA 3KYIB 2UKDA 3MRVA 3Q6MA 4BNUA 3L7DA 4B2PA 4TQUS 1PJ2A 2AFHE 2A14A 1FDIA 3FTCA 1UJCA 1ZL0A 4OHVA 2O57A 2QR3A 2CDBA 5A6SB 4C0SA 3BSFA 1BMFA 5K8JB 2MINB 3ZLTA 4QE3A 3TLEA 4DCSA 2R751 1L4FA 2F1KA 2IS6A 4YP0A 4R9RA 3O95A 3IPLA 3RIYA 1ECPA 3TR0A 4M0LA 3BKXA 1NN1A 1ZIYA 4I3HA 5K3BA 3W5CA 3OM1A 3GELA 3CTPA 1NVUQ 1Z7WA 4MYSA 4V2UA 4IIDA 1MT0A 1N1GA 2K5UA 4FONA 1JR3E 1MA0A 3D6FA 1GN8A 5ICGA 5JXHA 1HH4A 1LSUA 1OLXB 4UHJA 4ES6A 1U0BB 4MVYA 4Q02A 4ZODA 3S81A 3M4YA 4G0YA 4K9QA 1L7DA 2RAUA 2ZUUA 4P86A 5EHQA 1P2TA 1U63A 2ZAOA 4ID9A 1T0IA 3HZHA 5ALEA 5MFPA 3M0EA 3GLQA 2R7MA 3JQ9A 3GP8A 1H0KA 3AEQA 3EEQA 5EUBA 4RVNA 4QXAA 3TG2A 5EHXA 4CM6A 1ICEA 1ZSVA 1EXNA 1PUXA 5BORA 3WK6A 4TKLA 2AIRA 1QIKA 4GICA 3WC4A 3TAXA 5BYBA 1MJHA 2AC4A 4QYMA 8GPBA 4CETA 5F2NA 3VPBA 1V6SA 5B4TA 3IJ5A 2GZ3A 3PHHA 5L40A 1I5RA 4N7MA 1FVFA 3G7SA 2IHTA 3OLCX 4CM9A 2CXNA 1WCIB 1UOPA 3R8CA 3KL4A 1K7YA 2CXHA 2EWWA 2IC5A 1TVEA 3HKDA 3PLNA 4IOLA 5ADWA 3DE3X 5L45A 1FFBA 5EL0A 5LLDA 1Z0ZA 4LSWA 4PG7A 1HE4A 3KOXA 4U2FA 4WKBA 1JDZA 2BF7A 2WD9A 1HFKA 5SYNA 1NDUA 5CT9A 1QGUB 3LLSA 4ZT2A 3PF8A 2RH8A 3ZS8A 5BRNA 2P7HA 4QKQA 3FVQA 2A33A 1Y3IA 3GZ4A 3GDFA 3R0VA 1A8PA 5IFKA 1OV6A 3F7TA 3M5DA 2H1SA 3WNCA 3CRW1 4L73A 2P2SA 5NULA 1KEEA 4JMPA 2VAPA 3V00A 2UZ0A 3GUUA 5EQDA 2BFMA 3P9PA 2AE2A 1OJ7A 4O4HF 2ZBGA 2BEJA 1T3TA 3QVUA 4IAOA 2E5FA 4J16C 4C88A 4AQDA 5GADl 2YS7A 3EZLA 1K06A 1NF8A 4MZXA 4NU8X 1JH9A 4L5AA 1KC1A 1KSHA 4KAFA 1XQYA 3SVZA 1JYEA 1NOIA 4LMAA 4KQ2A 3KLBA 3ZEIA 2ZDGA 1FF9A 4XGKA 1HDRA 3GT4A 5IC5A 3U09A 2C1ZA 3BIXA 4MV4A 2YIDA 2FP4B 3TLGB 1APBA 1E3WA 4Z7QB 5DHQA 3HCEA 1IZ7A 1CUBA 4OA8A 4KR3A 5KQRA 3H9BA 1ZIOA 3GVIA 1OHHA 1LTQA 1GM5A 2PXAA 3UT0A 5IEBA 1T1EA 3MTGA 1XGKA 2PRIA 1NWHA 2YL2A 4H3HB 4YMHA 2I6GA 4EY4A 1T5OA 3W8FA 4J8PA 2A7XA 1FDUA 5J5AA 4KRFA 2YRXA 3DBRB 2ZVDA 4RYDA 3CMCO 4TTVA 3WDSA 4MRVA 4LSZA 4NCJA 3OLVA 4R54A 1SZPA 4CR6A 3Q1LA 4D7AA 2NNLD 4LKOA 4R5HA 4TL9A 3MRTA 5BSGA 5A7FA 2P3SA 2IYWA 2Q99A 4GRAA 1YT5A 4AY4A 3BE8A 5L51A 1P2DA 4D74A 2CZQA 2H7YA 2HA2A 2V7GA 2GZ2A 4RXUA 2O14A 1MEOA 3ZE7A 2WW8A 3L01A 4DPMA 5KDOA 4ARCA 2A7QA 1GL9B 2R5FA 1O8BA 2IEBA 3FWHA 2PZBA 4QXQA 6REQB 2PMBA 3K9QO 5JUWA 5JBQA 1USGA 2P2NA 5DSTA 3ZK7A 2H29A 3A0UA 2YOFA 3BF8A 5U4QA 3QV1A 3CVWA 2WSMA 1XTQA 2V6FA 3BB3A 2JEOA 2WJ6A 1Y7TA 3H9QA 1ORIA 1EM8A 4M9ZA 3HP4A 4QA9A 5DNEA 4PR3A 4EG0A 4LDJA 4F5YA 4UHFA 3TXAA 4F9FA 1ZD9A 4RANA 1KQ3A 1RS0A 3H9CA 4HLNA 4OLHA 2E0IA 1XDBA 2LVBA 1FYWA 3CJTA 1EFCA 4MKHA 4X63A 5F3DA 2JRLA 5CDFA 4ZVOA 4FE3A 5LLTA 4P3YA 1U65A 1KERA 1G66A 2A1UB 2YJ5A 3HUDA 4RV9A 3X1MA 1LWOA 4MW7A 4K0KB 5DI3B 3IKJA 1X0VA 2TMDA 4PTLA 3GLGB 2HF9A 3QWFA 1ZMOA 3IO5A 4PHFA 2FF5A 2MSDB 3KFXA 2ZRIA 4CGYA 4ZCRA 3DBOB 1PZMA 3QPBA 1IVYA 3HKEA 3VDRA 3K53A 4LI0A 3L9WA 1U2TA 3SZ3A 1R8SA 4K3UA 4DC0A 3PC7A 3HB4X 1UINA 3RC9A 3UQYS 1C81A 4X24A 1IHDA 1P72A 1G7RA 2P9YA 3CW2A 2HDOA 3OJOA 5DI9A 5CUQA 5BSWA 1VQ1A 1W8IA 2JDID 3P5BA 3DW3X 4PYIA 3ZCXA 4E46A 1HTBA 2G6BA 3MGGA 5IC4A 5JNWA 5AM0A 2ZVPX 4O4IA 4HJRA 2XWBF 1KIFA 3UWDA 3HRKA 3SKVA 1G55A 3WIEA 4GXTA 1SBIA 3DYIA 3QG1A 2PUHA 2ZBFA 1RMTA 5CCBA 2VSOA 3SZOA 1JQ5A 1SKQA 1XZFA 2WF6A 3R20A 4J94A 3I45A 5KWVA 1ICIA 3O91A 3QE9Y 1QH1A 4K5QA 1X42A 4UFPA 5A9SB 1YE5A 2JJYA 3KR1A 3PR2B 3EVEA 1Z5PA 3HVJA 5JJKA 5CR9A 3WMWA 2C5BA 3H65A 4AULA 1IAVA 2E85A 4B33A 1WG8A 2GHQA 1S8NA 2KLBA 2XXJA 4GX0A 4E22A 4Y6QA 2AJ8A 1CF4A 3ENZA 3RCBA 4I36A 4YJ3A 3JARA 4BMXA 3UFXB 1V3VA 4TPKA 2COKA 4JT4A 3LSTA 2G5CA 1Z06A 3GLHA 2VDQB 1S8FA 1EAMA 1W30A 2XB6A 1ZIDA 1IXKA 4NCBA 2O20A 3DDZX 2DT5A 5GVRA 3H99A 3P20A 4G5YA 2VAXA 3UJDA 4YDQA 1NJFA 1RHKA 2BBOA 4IHJA 5DYNA 4WGGA 3SOZA 3VR2A