3TD2A

Crystal structures of peptidyl-trna hydrolase from mycobacterium tuberculosis - form 5
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
187
structure length
187
Chain Sequence
b'MAEPLLVVGLGNPGANYARTRHNLGFVVADLLAARLGAKFKAHKRSGAEVATGRSAGRSLVLAKPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDLEFGRIRLKIGGGEGGHNGLRSVVAALGTKDFQRVRIGIGRPPGRKDPAAFVLENFTPAERAEVPTICEQAADATELLIEQGMEPAQNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Structures of new crystal forms of Mycobacterium tuberculosis peptidyl-tRNA hydrolase and functionally important plasticity of the molecule
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 53
structure length 187
sequence length 187
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 3td2A00
2MJLA 4FOTA 4YLYA 3TD2A 4OLJA 3TCKA 4ZXPA 4FNOA 3KK0A 1RYMA 4IKOA 4JX9A 4LWQA 4ERXA 3TCNA 3V2IA 3TD6A 1RYNA 4JY7A 2Z2JA 3NEAA 3OFVA 2Z2IA 4FYJA 5EKTA 4FOPA 4HOYA 4JC4A 5IVPA 2JRCA 4Z86A 3P2JA 4P7BA 3KJZA 1RYBA 3VJRA 4QD3A 2Z2KA 4DHWA 4QAJA 4QT4A 5B6JA 5IKEA 4QBKA 2LGJA 4DJJA 5IMBA 2PTHA 2NAFA 4JWKA
chains in the Genus database with same CATH superfamily
3DWIA 3OM0A 4NBUA 4MKGA 4IHQA 4MJ7A 4EUEA 1SCNE 3HFSA 3K2QA 3WVNA 1NHWA 1JBEA 3VR6H 1US8A 4TV9A 4HEA1 3QYPA 2IV3A 4RTLA 3U4IA 4ID3A 3UA3A 4DT1B 3QKTA 3ND7A 2RONA 1ESMA 1GRRA 2A33A 1IIBA 3L5KA 1TEXA 3E9DA 1UWKA 3OU6A 4TL8A 5AM0A 4RHUA 4B83A 1QFZA 1ZGAA 4L27A 2IY8A 3KXIA 5CEJA 4F6LA 1UMKA 4DR6B 3B1FA 4KBYA 4R98A 1F1BA 1XK7A 3PFNA 4RK1A 3ASZA 4XQ0A 3N2GB 5JALA 4X8HA 4R2IA 5KYXA 2HB6A 5A5DA 2WTUA 1JDSA 4MYTA 4CQJA 2DM6A 3VKFA 3BFPA 4HP8A 5KAMA 5C7OO 4P1ZA 3R74A 1ORHA 2ES4A 3JPYA 4NS1A 2XHEA 2M98A 4F6CA 4KV7A 3QVSA 3H75A 1TYZA 1GM5A 3L1KA 4NZNA 3G1TA 2WG1A 2ZTLA 4MRNA 1VMIA 4N1AA 2VJMA 1VHDA 1II0A 3VYTB 4F93B 1YI8A 1QG0A 3FTNA 2Y0EA 3X1XA 2JJQA 1R0WA 1D9ZA 2ACVA 2GETA 4GOLD 4PSKA 5AXAA 1BZYA 2IOYA 2VHJA 3LXXA 3PQ5A 5M34A 3Q88A 3C5EA 4Z9BA 4DRXA 4KITB 3IXMA 3BJMA 2B4AA 5B64A 3NBMA 1WF3A 3T7KA 3KOZA 3V4FA 1V5EA 1DRVA 2HU7A 4N5MA 3ZHQA 5FRDA 4HMQA 5I45A 2H07A 4ARZB 4FYWA 5IM5A 4E2XA 4R68A 5ARDA 1C3EA 3HDQA 4MYDA 3DFFA 3UJNA 1A95A 3UMBA 1YMQA 2A7XA 1HT0A 1K1EA 3MYRA 1Q19A 2X1HA 4PLWA 4C0SA 1XCPA 1QTNA 3FPGA 1ODKA 3HGMA 1ZKDA 3KEMA 4PTYA 3VC7A 4HVLA 2XRMA 1W36C 2FKAA 3QEMB 3MTAA 3WGYA 5FL3A 1E61A 1A9TA 5LQMA 1LV8A 5EXXA 3ZD8A 4K8RB 4URWR 1DB3A 1J7JA 1JAXA 1YRAA 1XL1A 5CK5A 4BX0A 1VKHA 2Z6AA 3RVRA 5B5SA 4CM9A 1WM1A 1JA0A 2QX6A 3CVJA 4IH1A 2CXUA 3CU5A 3MS7A 4BUZA 5IZCC 2QMEA 3DP7A 3QA3E 1ZA2A 4RK0A 2A9VA 3ESQA 3FFXA 4G5FA 4C3UA 4DJDC 1NQVA 2C7VA 1TKAA 3HFRA 4V39A 4HUTA 4ZJZA 4UARA 4OK6A 1G98A 4Q9HA 1ZI9A 1G8HA 4QSHA 5LP6F 4PHHA 4JNKA 5K4GA 1RJ9B 1YL7A 3O38A 1E6KA 4OXXA 2HJVA 3HK2A 1OZFA 4EDHA 2OR3A 5CCEA 2B20A 2EP7A 3E3OA 4KW7A 4RKRA 4WY5A 4L57A 4U2KA 2F43A 1FY2A 4WAUA 3FZEA 3MC1A 4V0NA 2WZDA 2FMTA 4UNRA 3KEFA 1BA3A 4CLHA 1YSCA 1Z2CA 5TJHA 3RI3A 4R0MA 1EFUA 2UU9B 1A2QA 1AGYA 2CUNA 2QLTA 3MJSA 2WJWA 3L6CA 3R6WA 3BWEA 3MEQA 4YTEA 4B7ZA 1OBCA 2OV3A 3OQMA 3GZ4A 2Z58A 5HF6A 1N3BA 3E5HA 3QE3A 2HDWA 3C6KA 2FUCA 4NNOA 1L1FA 3ABSB 4DNFA 1RPNA 2UUBB 2BEVB 3U4GA 2ECQA 2WHXA 1C3JA 4IJ5A 1JHXA 4PLZA 4F9TA 3KSMA 3HJNA 3W2EA 5KNDA 2GGSA 2IBMA 2NAPA 4I1VA 4LFCB 2XCTB 5G3ZA 1Y5RA 3IEMA 1WXWA 1YB5A 2Z5FA 2ZB7A 2ZRLA 3AZOA 3D8SA 5BW6B 4M49A 3SEQA 1JMKC 3KQNA 1K68A 2HQRA 3GA7A 2PLNA 3RTGA 4I81A 3RT1A 1XZ8A 1N9GB 2LIPA 3CYFA 3GVCA 1H5NA 1SBZA 1YE8A 2IYTA 3C3KA 1NJSA 1VKZA 4WJKB 2G80A 3I39X 1G2IA 4M0MA 3PQFA 4KR9A 1YZKA 1OZGA 1RCFA 3L9XA 3OOYA 1P4RA 2O2HA 5BQXA 2I4OA 3X0DA 3KFLA 5DZSA 3WDLA 1Y81A 3M5WA 2VYFA 1JR6A 3KJEA 1YNOA 3EYAA 4TV8F 3OEWA 4RVNA 3CNNA 1VKRA 2NG1A 4EBFA 3VNBA 4GPZA 4JXZA 3FTDA 1J20A 2CXPA 2ZYSA 3OPXA 1BCRB 1JEJA 1N5IA 4I8DA 5C31A 2ODWA 3ZR4B 5IJZA 4CLOB 3JD1A 4N0MA 4JJAA 5HIMA 2ONZA 3PNKA 1MOZA 3JTEA 3OQIB 1HETA 2E1PA 2ZI5A 1DV1A 3AFNA 3ZX4A 4X71A 2ID8A 4P3NA 1ZUNB 3T12A 2XV1A 1DEKA 2OFFA 3UAXA 3G0OA 3IVXA 2NVOA 5FUWA 5ALMA 3KUUA 4NI5A 3KB8A 1J0EA 2QM8A 4AVYA 5GAJA 5JH7F 5KWEA 5E9QA 2CHUA 2DMRA 1P9NA 4M1MA 5HM6A 2JG3A 4URHA 1VJ0A 1CQPA 3G2JA 3MERA 3Q12A 3QITA 4JKOA 3O7WA 1XTKA 3EWSA 3I1YA 3W2TA 4ZV4A 1N2EA 1ONPA 5ER6A 2X9LA 2OUIA 4CPDA 5EIFA 2WJHA 2Z6UA 4UEWA 1K63A 1UJ6A 2JI8A 3KSUA 4UTZA 1YACA 3LLCA 3SX0A 2R6GA 5REQA 2CLLB 5I5EA 4Z9YA 4JI0B 1ZGCA 1HL7A 5KUTA 4X66B 4LV5B 4UULA 2I4NA 3HB7A 3PXAA 2V6MA 3K73O 4A23A 5LD2C 1GFWA 2J6CA 1G2PA 1YO6A 3M1IA 1J5EB 2FPIB 4L7VA 3FIJA 2CE2X 1A5SB 3DOOA 2ID7A 1P2BA 5BNZA 3OIYA 1ZS9A 1Y3BE 3QXSA 5IDVA 2PY6A 5JNRA 4D4HA 4ITRC 3NOOA 3NAGA 4ND3A 1FXWF 3WLIA 1JX6A 2V7VA 4I1IA 3TQQA 1S7GA 2QE6A 4Z9XA 5CW1A 1ZO8A 5A9TA 5CX1A 3TFOA 1TIPA 4C30A 1A2KC 4MUFA 1N5OX 2X2FA 3C3JA 3K2IA 5H68A 3UG7A 4A0FA 3SXUB 3ESYA 3Q0IA 1N2BA 2IYEA 4PGAA 4IIYA 1L5KA 3RRFA 3PGJA 5FPQA 3R7WB 3QYAA 2DFLA 4P5DA 3EC1A 4X1YA 5EJGA 1MEOA 6ABPA 2JC3A 3HPRA 3LC7O 4QXMA 1L4HA 3JQPA 5BVHA 1EFKA 3KWJA 3E9YA 1UJMA 5AJXA 4AO6A 4PXYA 3MWDB 2ZB2A 3K8OE 1A77A 1S8FA 3AUXA 4RF2A 4GDFA 1UFKA 2OLKA 3C7AA 5EUBA 3C3YA 3EOAI 5KYNA 4CU2A 3QPWA 4CCAA 2MINB 4MEBA 1K7SN 3AEXA 4UPDA 1EIZA 2VOJA 3AF2A 1R8SA 2PGXA 3P19A 3ZZ0A 4F1JA 3JX9A 2ZTUA 3ZQKA 2LZ0A 2Y8EA 3BVPA 4R2KA 1Z2PX 3DKKA 3SPXA 1H1LA 4V2IA 1EFVB 3FYSA 4LY3A 1IY0A 1RKBA 5LQRA 1VHJA 1JHVA 2FWRA 1NY6A 2JAXA 4EHKA 1KEEA 5HR5A 3WQRA 4Y18A 3SM9A 2JARA 2EBWA 2CYBA 2OBFA 3L0CA 2FDCA 1M2EA 1TNDA 2WZBA 3KYCB 2V4ZA 4L4YA 1KETA 821PA 5LQNA 3AHGA 1ZK2A 4B4VA 4YBZA 4D3SA 2OXIA 4NFHA 5TLSA 2FEPA 2XB8A 1ECCA 1TCCA 3GAAA 1JECA 3KCQA 4X84A 4EEZA 1JSCA 4RQAA 5DBFA 2V9PA 3TSOA 1M1ZA 4W7HA 2NNLD 1T6YA 5E7IA 3U0BA 2E1RA 2V1XA 5BSFA 1KA9H 2QORA 3FJYA 3EXAA 1PX2A 3RTCA 4V1CA 2ZR0A 2FOIA 4M55A 3GZJA 3MJFA 4YLYA 4DQDA 5JCJA 2PUFA 1UBFA 3A7DA 2E6UX 2XUOA 4JGIA 3IP3A 4LTMA 4W8OA 5F78A 2P90A 1CYEA 4UHHA 5KQRA 1TMGE 1XEWY 4OHXA 1P7YA 1MAWA 2CYAA 1NVWQ 2FN9A 1VECA 3VZSA 5BNIA 1Z5GA 3E0XA 3R3UA 4OFXA 5EKUA 1I7SB 2R2AA 3ZD7A 5DV9A 3EVNA 3PFWO 1BRTA 5E6UA 4B1FA 1VYVA 1SKBA 1KK1A 4R0VA 3WL3A 3O83A 1SFRA 1UAGA 2FG7C 2JGJA 4JUAA 1ZIYA 1GGVA 3TDMA 2EXXA 1SULA 2QZPA 4GH5A 3ZXUB 4DY4A 3SU8A 2OHOA 5C32A 4MOWA 2CFSA 4KWCA 3SHQA 4ZVKA 4JLMA 4AZ0B 4E94A 1TU4A 1LU9A 3UWSA 3ZS8A 1G3MA 1PJQA 3JWGA 4GVXA 3K0BA 2DWQA 1FZTA 1KBOA 3ND6A 1KVQA 3M9LA 5F4BA 4LGVA 4RYDA 1P1JA 3JQEA 1VA4A 1B93A 2C8KA 1K8XB 2RAUA 2VC2B 1D4FA 1U2TA 2Y99A 1B1AA 5EC8A 5EFZA 3BGWA 3U4DA 2OC4A 3RAEC 3BWCA 5DIZA 4YHHB 4Q19A 1Z6GA 2CZGA 2FXVA 3N7AA 2AMYA 4NJMA 3QKWA 1Y8RB 3HNRA 4Z53A 2C3UA 4J43A 3GF4A 1E4EB 5K0TA 3ILXA 1L3BA 1RRPA 3IMCA 5SZKB 3G2IA 3VU9A 4DKXA 3OZAA 2WNSA 1M6EX 3OJOA 2H5JA 4G1FA 1M6WA 1DAHA 2OHVA 4MMXB 2NADA 4F71A 1YHYA 5JYEA 4JX8A 3HP7A 1D6SA 3IAM1 3R0ZA 1KMMA 2NM0A 4FU0A 1MO2A 2LDBA 3CLSC 4C5AA 4II7A 1T0BA 4L0MA 2NT3A 4H3VA 2CXQA 2XDWA 4M0DA 5FYDA 3K5HA 4KFSA 1WABA 4C0HA 3NYRA 1U7WA 1TQ8A 4L6AA 1KARA 3QUSA 2JFZA 4MGIR 2PX5A 4K9OA 4L22A 4U3JB 4NCIA 1JLKA 2V7TA 2EBUA 3UJBA 3CSUA 4ZYTA 2JAPA 1J49A 3RHSA 3RTEA 1YE5A 2O8EA 3KQMA 3H04A 2X23A 1VB3A 1MG5A 1HA3A 2DKNA 3E5NA 3KL2A 3RO7A 4EYQA 2ATXA 1XG5A 4KUHA 4LW8A 1Q21A 2BHLA 3ZI4A 1L4LA 1INLA 1R0RE 1V5IA 2OOKA 2B21A 3LC1O 5KYYA 1FFWA 2RGUA 4FSXA 4Q24A 3SDSA 3BDVA 2RAFA 4W1PA 2C1EA 5A2QA 1V3TA 4NWIA 4MJ3A 5TT0A 3OE7D 4TKUA 1CJCA 4AECA 1R27A 2PGOA 4DLLA 5IH7A 3RG2A 3ZI7A 3VR3A 4YCSA 3EIHA 3PHBE 5U9CA 3JAKB 1DGQA 4FNAA 4CN8A 3TAXA 3D5EA 1EP2B 1PV1A 2OVFA 2PZLA 1UBJS 2PUCA 2VR1A 1V71A 4HT3B 4INOA 4D0SA 3UW1A 4RESA 5B57C 3JY6A 3PXEA 3NORA 4WZBB 5E4FA 5FULA 4TKZA 3ZD9A 4PSCA 3TLMA 2Z95A 3R4CA 4ER0A 2VHYA 1GKUB 2ZWAA 3E3MA 4XJSA 4RC9A 1JPVA 4FX2A 2HCBA 4Z54A 1B2LA 1FUKA 2VPQA 4RZXA 5EAIA 3T9EA 1G60A 1J56A 1L7MA 2COEA 3H19A 4N3AA 1KC3A 4I5GA 3R7BA 3ZLUA 3CXRA 1CUFA 3SQMA 3FB4A 1ZZGA 4HFRA 5DSXA 4DDMA 1R4AA 1CTQA 3FTCA 1GKIA 1V6CA 1RW4A 1PGOA 3H83A 1E9SA 1YDWA 2JBWA 5KWSA 1I5RA 4X7PA 1JEDA 1JG4A 2ZIGA 3ZU4A 1JDTA 1LKZA 2C5BA 1SB9A 2ZE6A 5JSKA 1I7DA 1SPBS 1V8OA 1NR7A 1UBGA 3QOWA 3PLNA 2QUJA 4GC9A 4JCCA 4HNUA 3GUHA 1AS3A 1J2RA 4U2CA 1OH8A 2XCUA 2VF8A 3ICQB 3A31A 2KYRA 3GJXC 1O8BA 1Z74A 5CURA 4PGFA 4NEGA 1EBFA 1DRJA 3GW8A 3HO6A 1KK2A 1ZGHA 2V4UA 3K9GA 1D5CA 1Y4SA 1YL5A 3RYCA 1M6YA 2W2PA 4BEJA 3VU8A 2DPLA 4L73A 1TF5A 2F1OA 4DV1B 3MAGA 1XCMA 1RHRA 2R8ZA 3QH4A 2NU8A 1QP4A 2F9FA 1DX9A 2JKZA 2OO5A 3VQTA 3CW9A 3HY6A 2VYCA 4AJLA 3S8YA 1ZONA 4H0FA 1MGOA 3QPUA 1B8UA 4ARAA 1DOHA 5L3QA 4QT4A 3TMAA 2GESA 2QBYB 4RPIA 1NVAA 3D6VA 1KEZA 1RI5A 2Y0PA 4NBTA 1RD4A 2VO1A 4BRSA 4E0BA 2V7QD 2ZIVB 5C4IA 3A06A 1IXYA 4EKDA 1E92A 3C4VA 1NUSA 4QASA 3MMZA 5DGHA 2KBFA 3LYHA 4X44A 1DKUA 2WKWA 2I2BA 1KDVA 1V3UA 2VT2A 5WRFA 3VXKA 1XAGA 2R25B 3E53A 4Y2TA 1P9RA 4UM9D 5FI1B 3RTAA 4YCCA 5ES4B 4ER6A 3BEOA 3ZH9B 3TLZA 2P9GA 3S81A 5KC9A 3EAQA 4B73A 1C14A 4N82A 3AO0B 3NFRA 4DT1A 1DELA 2AL7A 3PD0A 2BPOA 1JAZA 4L4SA 4YRGA 1Z5OA 4RW0A 1EVQA 3F8WA 3EZLA 3NTUA 3HCNA 2SKEA 2KW5A 5CX4A 5AUPB 1DAPA 1WS6A 1S2MA 2IYFA 2X19A 3N2GA 3SICE 3QE0A 1CVLA 3PIIA 3R8XA 3L07A 2FTKE 3DOUA 1Q95A 1W87A 3CUYA 3FUTA 1NBAA 3H4VA 1XV5A 3B1KA 2WSYB 4KWTA 5THKA 3REGA 5KYUB 1T1EA 1JVSA 4YASA 3UGQA 1OFUA 2G71A 3ZZTA 4O3MA 3KLNA 1MIOB 1G3IA 2QPLA 4OA8A 4WL0A 3RGGA 5L53A 3CURA 3KPYA 2OOSA 3WLJA 2HPVA 1L7RA 3TMYA 2ZRQA 1VCNA 1RCTE 3AFOA 1DDOA 2BE7A 5J4HA 3AEKB 4HJXA 4HGRA 4QRDA 4KNWA 2PYZA 3DL0A 4X8OA 1X1EA 2ZTSA 1T5OA 4ZIRB 1ISSA 1N2XA 4DLAA 2WSMA 2C9CA 4I4TB 3QOYA 3FNGA 1AZSC 2NT4A 3FKSA 3IELA 1FP2A 2CWWA 1B6RA 3HN7A 2XB9A 2ZVPX 1RJEA 3O2QB 2B78A 5HMMA 3SIWA 4XUDA 4KP7A 5KC8A 2ASEA 5AW6A 5HEKA 4ZDKA 5CYFA 3ZCTA 2J5RA 5F4ZA 2HK7A 2QRJA 5BN3B 1OR8A 4G8CA 1Y1RA 4MWSA 5AVTA 3F90A 4QSMA 3RABA 2H06A 1MB2A 1K6XA 3PZBA 4HCJA 4RD0A 1KE2A 4R8MA 1HYGA 4KAJA 2FHSA 4L9RA 3UUGA 4PYJA 1X1SA 5K0ZA 1XYVA 3DXYA 5GZ3A 1YI1A 3QEMA 1EZZA 1QRDA 4ZZ0A 3QTLA 2IYVA 5HJEA 4FZJA 4BLTA 1E1MA 1E79D 3GDOA 3O1HB 1HDGO 4B4DA 4DXAA 2IPXA 3IHTA 3NHZA 2PJRA 1BFUA 2EC5A 4Q4DA 4UNPA 3SEZA 2JIOA 4ZVNA 5IKOA 1AKRA 4OUKX 3IUQA 3OMWA 4PF1A 5H7XA 1YA8A 3JVVA 4BMXA 3ZZUA 3COVA 1SHKA 2JFWA 3WWEA 2BGNA 4Q15A 1V16B 4RVUA 3KZOA 2VH2A 3MOIA 2BTQB 3T5CA 5EZ5A 1LPBB 4TQGA 3EQ8A 4E21A 2QY9A 4B2PA 1COZA 2WT9A 4LZJA 4Q7EA 4WLNA 1VPLA 4DZTA 2H59A 1RJ9A 5JAZA 5BQ3A 3L3BA 3RVBA 4AZSA 4KFUA 3S2GA 4RSHA 1Q1QA 5CCBA 3WGVA 1KI1A 3GR6A 4R7TA 3Q0TA 1GQ2A 3WJAA 4FUQA 3JU3A 3RIHA 3QVKA 1UBTS 4M38A 2PN1A 4E3WA 3K35A 1PD0A 5BYJA 1JMVA 2GK3A 4AMGA 2R7AA 3OO0A 4WZAB 3VDQA 3EQ2A 3EBLA 4Q7LA 1KEKA 1DJLA 2EJTA 2ZDHA 4C22A 5BYKA 4DIFA 2WBLC 3SSAA 2G3YA 5C5IA 1KBQA 2ZYIA 2BEVA 4TYWA 1GYRA 2B36A 1IXZA 3O3MB 1M2WA 1H0RA 2HIGA 4J0QA 1JG1A 4DDWA 3PX2A 5BO5A 3TF5A 5FKJA 3LMKA 1VBNA 4EPWA 3EJ6A 4UAUA 2RI1A 1L4NA 2AEJA 3H8JA 3T0GA 3K1YA 4Z7NB 1SOVA 3ZVRA 2X5OA 4ZZIA 2UXCB 4UE2A 3M6FA 4KQCA 4BAUA 3GIDA 4OX9Y 3H3JA 4M37A 4LAFA 4O2BF 3IAFA 1T3SA 2WDPA 3LUKA 1B42A 3CKKA 1N9GA 2LUOA 3A2MA 2CNNA 2RI6A 4EPVA 3FYCA 1ZICA 2L69A 1L7VC 3NTOA 4PZYA 3NMUF 1T3ZA 4BQQA 3ROQA 2GBLA 1KOLA 2HSDA 2A5FA 1X0VA 4BQNA 3JWJA 1DLIA 4DDHA 2QYSA 3EGXB 3ZOKA 1QONA 2PJZA 3LW7A 4DCSA 4F4CA 1MJGA 3T1OA 1JI0A 3X1MA 3VPBA 1AUQA 1L7BA 3HGTA 3I2FA 1ULSA 2Q7XA 2G6TA 1R16A 3LZDA 1T1IA 1A50B 1RE1A 3TUZC 1U9ZA 1GL3A 2QN7A 1BCRA 2PZMA 5EG5A 1BMTA 1NSYA 1J0CA 4RF4A 4C14A 3O9VA 4CLOA 2O48X 3OQIA 2GEBA 2NUBA 3RRMA 4PBTA 3T38A 3WIUA 1U8TA 4YN3A 4BJ6A 2O2IA 2ZYRA 4CKZA 1ZUNA 3A6KA 1W5EA 5IVDA 1L9XA 4NOJA 1P61B 4FFSA 3U3RA 1UPFA 2DZDA 1WMFA 4X6UA 5K99A 1UT5A 4OYLA 2AEMA 4HB4A 4HFNA 2RKBA 2AOVA 3MCTA 1NF2A 4WLVA 2QM3A 3L8MA 4MCHA 2JFUA 4LRYA 4OBXA 4J6EA 2BT4A 5K6TA 2P35A 4NF2A 1V26A 3NALA 2P6RA 1E1LA 2R6AA 3TZ6A 5BRAA 5A6SB 2QAJA 2R1ZA 3EFOB 5JD3A 4EJ2A 2VCEA 2YWXA 3CLHA 1AIPA 4IDOA 2COUA 1KORA 3KJFA 3SYRA 4LDJA 3RH0A 3LFTA 3WC4A 1FJXA 1KDTA 2R65A 3WWYA 3P9KA 3EXFB 3A11A 5A9RA 4ETIA 5AOAA 4NE9A 3ZLTA 2DXIA 2YKGA 4IGFA 2I1QA 1TO2E 2E5FA 4NMXB 3I61A 5J47A 221PA 5LQAA 1UC5B 1WNFA 3K5WA 5CP8A 2RHJA 5JI2E 3N2YA 2FPIA 3VSEA 3OQHA 3W2IA 4DILA 4I9FA 2ZVJA 1FPMA 4M3NA 4YPVA 2LCQA 5JCZA 1NLMA 1QB7A 3TAUA 1U28A 3I62A 1ZCBA 2ECPA 3LWDA 1WVGA 1YHZA 3N07A 3LH5A 1PW5A 4XJTA 1CRPA 4KVAA 4R1TA 3B6JA 3A9SA 3CG4A 2LKDA 3LT5A 1N5RA 4JUFA 2DBYA 2QNIA 2H2HA 3IKVA 1JJFA 2BCJQ 2HPAA 1NONA 2NO5A 4FCTA 4MEAA 4XYEA 4E4RA 5I5GA 3H1FA 3SXUA 3NUZA 1JLLB 4A36A 2VBFA 5L40A 5GTDA 2P9FA 3R7WA 4QO7A 1E6CA 3H5TA 2QMZA 3QYFA 5ESWA 3Q5EA 1YJCA 4QNRA 2UUOA 2ORVA 2WI8A 3EN0A 3L1JA 3OQPA 1KZGB 4ZZ2A 5CDUA 1A9PA 1EGAA 1B3RA 4XCQA 1X7DA 4EW1A 3L7AA 3I12A 4KWHA 4NPHA 2IL1A 3RF7A 3QM1A 2XECA 1WOYA 1MB0A 2K87A 3HYRA 4MPJA 1HH4A 3HL0A 5DTMA 2Y1GA 1HE4A 1C0IA 2X7JA 3BL5A 4WUVA 2X8JB 2EIXA 5HQ3B 5ICEA 2IVFA 2WTXA 3DOHA 2FZWA 3EXG1 4KPUB 3TSAA 1J1UA 1CY8A 2GASA 3C7CB 3OKAA 2IS2A 2R8YA 2MINA 2PSJA 3RSHA 3TM5A 5AJHA 3CCBA 1RXYA 4FSDA 5K3CA 2QWXA 1UK7A 2Q7DA 1XLTC 3WZLA 4BNUA 1VJDA 3BIWA 5DCUA 1H2RS 1U0FA 4AJPA 4DBLC 1KR2A 2PCJA 2XUIA 2XDQB 1EFVA 2XIQA 1NX6A 3M6WA 4RS3A 1O96B 3A4NA 4M1QA 3RKSA 3JATB 3PITA 4UCQA 4A8HA 1TLFA 5IXJA 4TLEA 2ADFA 3RV3A 2GQ0A 1RPJA 2QD1A 4IO1A 1C4WA 1H3NA 3KYCA 4RELA 4F3YA 1HRKA 2XCIA 2AC4A 3ACCA 3KHSA 2EWVA 3HC7A 3MYYA 3ONVA 2OPHA 4EOGA 3D2AA 3IUMA 1AGNA 1N0WA 2FW7A 2C2ZA 3GVPA 3FVQA 4FYXA 4HEA6 2ZDGA 5L45A 1DINA 2YZ2A 4ASUA 1PZHA 1QHHA 1VJRA 3VHXB 1MH1A 2Y4OA 3MSXA 1AE1A 5A9SB 1J0AA 1EM8B 1G21B 1VLJA 2AWOA 5JCXA 5EXTA 3IHKA 1UCFA 4UAVA 3CW2A 3DC7A 3U17A 1L5ZA 1ADYA 1RLIA 4K28A 5LZ9A 2AH5A 1Z2EA 2QRNA 2VH1A 2Q5HA 2EL7A 2D8MA 3AKDA 3B78A 2HMYB 4GECA 4L0DA 2QX7A 2C7PA 2VBCA 1M2KA 1CC1S 4G41A 5JAMA 5CLIA 4MPPA 3F8SA 3THXB 3ZJVA 4H16A 4RF5A 2WYIA 3DZBA 2JIDA 1LQUA 3GPBA 4DABA 2J6IA 4OQEA 4YP7A 2AXQA 4TLLB 3ENWA 3DV0B 3K20A 4YXWA 5IUKC 1SU4A 2BM8A 2GA8A 5D8DA 4GMXA 5B3LA 4Z7JA 2Z4RA 5EYPB 3KYJB 5G4LA 3OUUA 2GILA 3AILA 2CVFA 4JGGA 3FRHA 2AGVA 3O47A 3MB5A 5J2TB 3IMFA 4JHXA 3SKYA 1GZUA 1U9IA 2RGNC 3HJCA 4AZ0A 1RFGE 1NP6A 3T4PA 2O2SA 5KAPA 3LUDA 3HB9A 1JXQA 3NATA 1OGYA 5E1BA 3CTMA 3AUUA 4Z2YA 3QWBA 3RS9A 5GM1A 5JD5A 3MLBA 5JISA 5JYCA 3PL1A 4BFCA 4RTOA 2GFQA 1KU6A 1EB8A 1E2KA 4XDGA 4JU9A 1F60A 1VE7A 2C97A 3K0AB 4E6PA 2IEZA 4XYMA 4QKQA 4JLUA 5CD1A 1GZ4A 2IPOA 2MTBA 1Y8RA 3DR3A 1J0XO 1EVIA 1NY5A 1P5RA 1E4EA 2IQIA 5HIIA 4DLZA 3KQTA 1YDHA 1O95C 4MQEB 2I91A 1TA9A 1DEAA 3WJ7A 4QNMA 2EATA 2J3QA 4YAOA 5TSDA 3SZGA 2MIIA 3K9QO 3ROZA 5JSQA 2P77A 2PRZA 1DBIA 3K09A 3DAPA 1Y3HA 2HJSA 1DTEA 2VQDA 2XNKA 3KQSA 4UNIA 4M83A 5JASA 2KE5A 1AK2A 2QZZA 1QTRA 4R51A 4XRRA 3IIIA 1CYDA 3ND9A 2GBGA 1TADA 1TEVA 2BHTA 2GTIA 2IHTA 4HKTA 4ZOEA 5GV8A 2R8OA 1MDBA 4BQOA 4Z1OA 1QIKA 1ZSVA 4J2HA 5LD2B 1XNRB 3O4RA 4JWTA 3JQAD 1RQNA 4BP8A 2P2CA 1I13A 4DARA 1JA9A 3K3PA 1ETUA 1JU4A 1PQWA 2F3SA 2GZAA 5K3EA 4XE5A 5FBHA 4NK4A 1XAJA 3ZE9A 3ZBUA 2DKFA 4OLAA 2HF8A 2GEKA 1U31A 4U3JA 4MI1A 4RTJA 2WHPB 2RIPA 1O08A 1TMYA 3ECCA 3KR2A 3LP8A 3M9WA 4K9SA 1C50A 4P82A 3RK4A 4LCBA 3UBMA 3PICA 3TXXA 2O1EA 4OOEA 4AIRA 8GPBA 4RTPA 3IUSA 3X1WA 1WY7A 2QX8A 4B81A 2H92A 1XDZA 3H4IA 5EHGA 3FOFC 1E4YA 3I6MA 3R24A 4LOIA 2WWYA 8ATCA 1TUIA 5JNSA 3QF4B 1MEEA 1A97A 1GTJ1 1L3CA 1OTXA 1TRKA 1WDTA 1X9GA 3C3MA 4R40A 4KRYA 4TSFD 4EFMA 3D7KA 3ESXA 3EXIB 3UKOA 2FP3A 4RPLA 2HQOA 5CNMA 5B4TA 2X8LA 1ESNA 3JAKA 4U7FA 3AR9A 4D0LB 4JAVC 5E7MA 1PHPA 2OHHA 3HXKA 3CRRA 6NULA 1V6AA 4PS1A 1F9AA 1K7XB 5GVRA 1BJRE 3GWZA 4N49A 4WZBA 4ZQCB 1TZBA 3LHFA 4LYFA 2PU7A 4CIAA 2AJTA 5JC8A 3HWRA 4TN5A 3MT8A 4DR4B 1NE2A 3TGLA 4CKXA 1KDOA 3D4OA 3DKVA 1YBFA 3LXUX 3UJHA 1SVUA 1LW6E 1RSZA 2JAOA 2IXDA 2VHZA 2B9EA 5FADA 4ARCA 3L7YA 1JE0A 4F6RB 2ZB3A 1KJ8A 2H3HA 2P2SA 3A4TA 3M6MD 1PDVA 3PNLA 1JR3D 5EMNA 3T1HB 3MTQA 1T6NA 2ARKA 4V0SA 4I1OA 4J16A 5FAKA 1KJJA 2PYIA 3CH5A 4JT4A 4GR4A 4AWAA 4HRYA 2SECE 1AU9A 4N0PA 1TTQB 2F1KA 4TYMA 4LZAA 3OJ0A 1YZUA 2QUZA 4BDTA 3M70A 4D97A 3M6VA 5EPEA 3ZDFA 1Z22A 3S55A 2CV1A 1GA4A 3AFMA 5BOVA 2HQ1A 3THSA 1IU9A 1YONA 5PNTA 1OY1A 4TMYA 4WKPA 4P54A 3WGQA 1P5JA 4I1PA 1XMPA 3IIEA 1XF9A 1C9EA 4MR8B 3TR6A 5KWJA 2N0SA 4LWQA 5CVEA 4YRIA 3IP9A 4JFRA 2IHZA 3UJ6A 3F67A 4W5QA 3GEDA 4GOXA 4J03A 2PZAA 4Q9NA 5CHEA 5KSWB 3J81k 1J2EA 2PUAA 2R3SA 1OQAA 1VI6A 1XEXB 4IY1A 4DV5B 2HWYA 1HFKA 3E23A 1KOJA 4I3GA 3L8YA 1NM5C 3YASA 3IODA 1H93A 4ENWA 3U4QA 1QB8A 1TTPB 3CR8A 3IE0A 4IQFA 1OX5A 1Z75A 1ZISA 2QBYA 5CA0B 3L1VA 5JBNA 2QU8A 2XKJE 3NPAA 1MA0A 5FCDA 3QPCA 3QNWA 1JZTA 4YGXB 4ZEXA 4E46A 2AT1A 2GCPA 5LR6A 2OYRA 2Q3MA 4MCJA 4QEKA 4M76B 1KYWA 1R6BX 1NQUA 1P0IA 1R0XA 2WSBA 2ZIEA 5AKZA 3RBVA 4YDQA 2ZUUA 2Q99A 2ONJA 1P6UA 2FPPB 2H4ZA 2PKEA 1NFRA 2NXCA 4J94A 3NBQA 2OT3B 4LF4B 2O2GA 2QA5A 5D5HA 4LJLA 5AVOA 1YBHA 4O4LB 3TLGB 4IR7A 3H1AA 3AHHA 3IQFA 3AVOA 3L4BA 4HOYA 2EG9A 4LSWA 4PGMA 3QFRA 1QLJA 4XYGA 3WMWA 4A2CA 1UOPA 1WETA 1ID8A 1MD9A 2HHCA 1QYCA 1Z0SA 2ZRHA 3EPPA 1KQNA 5JRDS 3HFJA 1AQNA 1B15A 4Y1RA 3N58A 1RBZA 5FX2A 3PHJA 4QHSA 4LE0A 3TZCA 3S1AB 2P8JA 3VR5D 4QT0A 5FOXA 5T6MA 4H4DA 1UFOA 1OXMA 1Z4KA 1V3VA 2VTKA 4A8JC 2G4CA 4MI9A 1I3OA 4NBLA 3KUKA 5M04A 2AVDA 5EHZA 1GG5A 4EUSA 1MIOA 4PLTA 3BN3A 2ADMA 3TLYA 1JHOA 1MW9X 5J1TB 1DQSA 2R8PA 3EIFA 1M8JA 1ORRA 2RHHA 2WJIA 3FVRA 3IAEA 1A5BB 2CCKA 4URYR 1WVIA 4BNLA 1KS9A 2D5CA 2IJGX 1G55A 2W9XA 3JSXA 4OQDA 4QU0A 2OORA 4MV9A 1TRHA 2C4HA 3AEKA 2R6HA 4IYRA 1SB8A 4U9HS 3RCBA 4M88A 3SZLA 3TR0A 2Z1NA 1ZD9A 1VZ3A 3PGVA 3T34A 3OWOA 4I1RA 5KNDH 4NP6A 4XPIB 1JNYA 1E64A 1DJQA 4HYEA 2YCLA 4IIXA 3W0LB 1K5HA 3GRKA 5DCWA 4L8WB 4ENQA 1JL3A 2AVNA 4HC4A 2W0MA 2Q8PA 4GM1A 4PVDA 2XZPA 4P0TA 5HKOA 1P73A 2PKYX 2YIVX 3G0IA 1FS4A 4BC1A 2AXNA 3OTIA 5LVAA 4OHPA 2ZUBA 1DC3A 1L5HB 4JMPA 5H59A 2B7BA 4FYVA 3TPCA 2JANA 1R6VA 5BN3A 1Q57A 1J0DA 1Z2NX 1JHUA 2H2GA 1FQKA 2KLBA 1P72A 5HYVA 1KOFA 2A59A 3NJ8A 3EGDB 3FPFA 3LY9A 1HTWA 3HRKA 4AMYA 2IZOA 1LUAA 3U1TA 2CXTA 3TD9A 3TNLA 4A73A 1DDIA 1YR2A 2HOQA 4CKCB 2NOAA 2XAAA 4EJSA 3DTTA 3WHPA 1BFDA 4MH0R 3PXCX 4E70A 2HMVA 2IYSA 4ITUA 2UZAA 3NEYA 3VJKA 1HNZB 2QT1A 5HF9A 1E2NA 3S27A 1V16A 4R84A 1LBTA 1I01A 4GL4A 4Y0NA 2BTQA 3DFMA 1NUUA 1P9OA 3BYZA 3PQ8A 4FDAA 2GJ4A 4NFYA 4RIEA 5TF4A 1JB9A 3W6OA 1OAOC 1X7WB 4HDSB 1YVUA 2A78A 4TKMA 4PCAA 4M1WA 3B6EA 4FLEA 1V7PC 4X45A 2PT5A 3CRQA 1KWGA 5ADWA 4YJHB 2VAPA 4ZQBA 3UICA 2DUMA 3JD0A 3PQ7A 4CF4A 5HFJA 2BEJA 1MIHA 3ABRB 4ILEA 1CDOA 5KDOA 1PKEA 2Q4TA 3L92A 1SXPA 2J7PD 1W36D 4LK3A 1CF2O 4WZAA 1E60A 1NMEA 1JR3E 2HHAA 4CLEA 4MW6A 3S6JA 1IHYA 4HN2A 1RYDA 4PR0A 3ZWVA 3ZVMA 5C5EA 1PX0A 4MUIA 5KYVA 4LCJA 4PHGA 2QUBA 3CNQS 4JUBA 4NCNA 2CEKA 3LLSA 4IV5A 4EO9A 1F51E 3HCOA 1QSGA 3CMCO 1PGPA 4CFZA 3GRAA 1EYZA 4QA9A 1YUNA 1XQWA 1GGJA 1MJHA 1S1MA 2QTZA 2HT1A 1PWHA 5GOZA 1FU4A 3DR5A 1XZBA 1Z6TA 4K9PA 4XUGB 3A2LA 3FNIA 3ZN2A 2NXNA 1CIVA 1WQ3A 3LP5A 4OY3A 4YALA 2YJNA 3ZGZA 1O6FA 2AFHB 3PHLA 5CVUA 4B3HA 1CE8A 4MITA 2BRUA 1EESA 1YQXA 5IAGA 2BFNA 2OXCA 2FR8C 1X77A 2OD7A 3VDRA 4JP3A 3KPJA 3JWIA 1J8VA 5EIAA 1XU7A 2DX7A 3H9GA 5AJWA 1PK9A 3KJIA 1SXGA 1XFAA 4JOQA 3SBOA 3WLOA 4DWVA 4EVRA 3EGXA 3S8EA 4M0CA 5J63A 3P0RA 3KCNA 2JIQA 4HN9A 2X3YA 4UATA 3UH1A 3IAM6 4IX9A 1E63A 2PZFA 4XGQA 1QAQA 2RH9B 5AVJA 1BGVA 2J9YB 4IIDA 4IX1A 2N9UA 3FG9A 4OHKA 4EB3A 1S9DA 2XUGA 1WULS 3H11B 3UJCA 1FE8A 2KSQA 4GRIA 4KE7A 1ISIA 1SVWA 2PSEA 3ANXA 1XJQA 4RIFA 3DO8A 4RVSA 4HV4A 5L6LB 2VVTA 5DMHA 4BKRA 2WLSA 3HLTA 3HO1A 2HTEA 4X00A 1N32B 3ROPA 4M54A 1B74A 5I9BA 1QHNA 4ZVMA 4WMLA 3O3OB 3C98A 4CDMA 3C6ZA 3TFWA 1ZG3A 1SJ9A 1IBKB 1G42A 1IUNA 3DJFA 1QYVA 1WUIS 2ENWA 3FR8A 4GO1A 5JQWA 1ADCA 2I1LA 2WJZB 2IUYA 4AWXA 3P45A 3SDZA 4BKPA 4KHPB 4GI3A 2I03A 3G0HA 3K0CC 1E1CB 3ABQB 2EW2A 3FYHA 3HBLA 3FTFA 5A6SA 2CMFA 3OBBA 1NU6A 3EFOA 3KQWA 3ZHVA 1PYDA 2H48A 3G49A 4I9UA 3GVHA 2CWDA 1GTRA 2M1XA 3ZW7A 1RKQA 4XIIA 3RSLA 3T0IA 5BR7A 1V1MB 3OTOB 1D1QA 3ETLA 3PWSA 4X6XA 5IFKA 2W6JA 3B85A 3Q41A 4QQNA 3EXFA 2ZI3A 3SZMA 1RYZA 1Q7EA 4D5EA 4UDXX 1W5TA 4YWHA 1FDIA 1E6WA 5CXSA 4BQEA 3RYIB 2BZ1A 4QJIA 3I8XA 1GZ3A 3NIFB 1P2TA 2Z5LA 1WU7A 4RTRA 5BUCA 4QZVA 4S2UA 3CLRC 4KN6A 4FKZA 4TVKA 1GYQA 4RULA 1J90A 1XTRA 2OXTA 3VPFA 3KTAB 4NG4A 1WTAA 3QVLA 1A8QA 1PZGA 3IUPA 4NCJA 4P34A 3VOTA 5FDFA 1IUPA 1W5AA 2DG2A 3KAPA 3OFND 3RIXA 2Z5VA 2Q8QA 5T3YA 4GX2A 2J3DA 2P2LA 3PFGA 3FCEA 2DBZA 2J7PA 3CNHA 3K0KA 4BV8A 4TWIA 3O2SB 2WB2A 4BMZA 1JQ3A 5HMLA 5IMSA 1DUSA 3T7AA 2R5NA 3LF2A 4IF6A 1ZXXA 1JLLA 1FLAA 3FI9A 1MQ9A 4IDFA 4WECA 4C0JA 4DSNA 2IS6A 5LWHA 1P3Y1 2VOEA 2IP4A 3TXAA 1UZMA 2DQYA 3GD5A 4LRQA 1ZW6A 2VSOA 3B38A 3W9BA 4GBED 4AI6A 1K88A 1SH7A 3OUTA 4NBWA 4QLAA 1T3GA 5EQFA 5BYBA 5K0FA 3MMPA 3HDJA 5GPBA 1SURA 3R0JA 1V3QE 3I5AA 2IXEA 3DNPA 2X8JA 3ZE0B 4KPUA 3A9WA 1XN1A 2HW8A 1JLSA 2WDZA 3RASA 1TT7A 1YULA 4Q4LA 3UZUA 4X3PA 4BVBA 2J7KA 3GD7A 1DCKA 2HO4A 2XDQA 1EWKA 3A25A 1U6JA 3JATA 5CVTA 4J91A 4FGJA 2R62A 1I4OA 4P3XA 4BNKA 1D1TA 3S68A 1A7UA 2NO4A 2ZWPA 4O2RA 1P44A 3PF8A 3ZG6A 1UMDB 1XCGB 4R2LA 5A62A 1ZEMA 2XTNA 4UVEA 1IPFA 2C98A 3DCYA 1WMBA 5KYUA 4R71A 4MULA 1E9BA 1KYXA 1T4DA 3SQWA 4JJKA 4MDHA 3HU5A 2ACEA 2WVAA 4F92B 1W0KA 2N46A 5B58T 3VHXA 1CJUC 3FGZA 1QMPA 3R4VA 2VTEA 4FYIA 1EM8A 1G21A 1SIBE 2P2NA 5CFNA 2YYYA 3F3SA 1OXUA 3FX2A 2YVKA 2H29A 1QIEA 4GEKA 1E9DA 2W58A 4ZK6A 1TLLA 1OILA 2KLHA 3IR5A 2CL0X 4BO9A 2PMWB 4B46A 1QF7A 1USGA 5JBIA 3WYAA 4G65A 2I8CA 4EO4A 1LBEA 2B82A 4U2EA 1FC0A 6LDHA 4R3UC 5LFAA 5EXDA 3THXA 1QJ4A 2B0CA 2JGKA 3BHNA 1DEOA 2YVUA 3ENVA 4P7GA 4WT7A 5BN4B 4BO8A 4DV0B 2QQFA 5EHIA 4BKOA 2BFWA 5DTJA 3CNOA 1YNSA 3PR1A 2VP2A 3DV0A 3D59A 2XEDA 3QLJA 4YIHA 4CMJA 4L16A 2IWHA 1DJOA 5EYPA 1AKVA 4KXXA 4RANA 1VP3A 4BNIA 2Z6QA 4K2AA 4MWTA 1E3WA 1LF5A 4U9UA 5BWLA 2D0OB 2AC7A 5J2TA 1NW6A 1Z36A 1KY4A 1X80B 1MPTA 3CVWA 1HOTA 2VJLA 1HZJA 1X1BA 2D3TA 2V3WA 2QM0A 3AK4A 3IUYA 1MBZA 1Z18A 1PS0A 4U6NA 4IKPA 3FYUC 3V7NA 3DLBA 2V45A 5DOZA 3CZCA 2AI3A 1RWNA 5L4LA 3U1BA 4J4BA 1TVEA 3K0FB 4ND5A 2IP2A 5D86A 3UB2A 1OFIA 1G1AA 2OBYA 3NW9A 1NQOA 3BAZA 4RDIA 1SHJA 3C6XA 1WO8A 5ERGB 1X8XA 2RHLA 1P8AA 1FRNA 3FDFA 3H3FA 4RV5A 1V4NA 1SVNA 1U2DA 3BZUA 1RQ2A 3HYTA 4FVTA 1E0SA 3VO1A 3HBFA 3K0AA 4BBJA 1N5DA 2P9YA 1R5OA 3N3AC 4GP7A 1Y3FE 2L0XA 5LZ2A 1ESDA 3T7JA 4X7MA 3RNLA 3ORFA 1M0WA 4IUDS 3PC8C 1I30A 4MB0A 4F5EA 3LKZA 1E7WA 1MN6A 1NJ8A 1G66A 1N3IA 3C8HA 4BNZA 2JH3A 3G9ZA 5GGXA 2G0TA 3LQQA 4BWYA 1XDWA 1HLFA 5G4KB 6GPBA 3O3CA 2FWIA 2YC4C 3HM9A 4UCFA 2F9LA 1Z25A 4AJHA 1DC5A 1I6KA 3CEHA 1ZJ6A 3CF4A 4FR0A 4G89A 3SYKA 4M9UA 4G86A 1ZJZA 3IQHX 3IE1A 1SC9A 1UDXA 2PAAA 4J4TA 4KWEA 4M1EA 1B8VA 1YCGA 5DHUA 3T9AA 1R9MA 1O9GA 3AUAA 1G18A 1HK7A 2D1QA 3BGOS 5K09A 4GZ5A 2X1MA 2V0GA 3OQJA 2YTZA 3WK8A 4EFNA 2HL6A 1Q6ZA 1O3YA 3K1ZA 5TMBA 3BWMA 2VJYA 2OV6A 2W2LD 1T1GA 3LKBA 4I46A 1THMA 1LW7A 3I5MA 4Y6RA 2AXEA 1XVLA 5FAXA 2HMSA 1RXUA 3HZHA 3O1LA 1KAQA 3T5DA 2P79A 1FFEA 3DZDA 3MRVA 2D7DA 1PP4A 1KKMA 1W94A 5JNUA 3QF4A 1M1UA 3QUQA 3RS5A 3GA0A 5BW5A 3OOJA 2DE0X 1H42A 4PFQA 4EGAA 3VOBA 3OCVA 3EXIA 1E0DA 4AJ1A 2LIVA 3FAKA 5MGNA 1AA9A 2UDPA 1A1VA 1Z5ZA 3N3BC 2XYPA 1DQNA 1NU8A 3OVMA 3J7TA 4JP5A 5D3ZA 4C3ZA 1C3VA 1V7QA 4FEGA 2QEQA 3WP0A 1FJ2A 1V25A 4RNDB 3HCCA 1E8MA 1G41A 4J1QA 1IAVA 4DF3A 3UT5A 2ZVDA 3CLSD 3NM5A 1ZLXA 3AR7A 4B31A 3E70C 3N70A 3PT9A 2R4TA 4A0QA 1F7VA 2BJVA 1LD3A 1K8QA 1CUUA 3KOOA 1K27A 1GZ5A 5LMCA 4LK2A 1CJMA 2WAAA 3LO5A 1J42A 1XOIA 3I9V6 1U8ZA 3AW9A 4FZ3A 3WB0A 2JZOA 4F6RA 2ZVQX 1FUUA 4Q3KA 4QU5A 3GFSA 5IP5A 1K7EB 4PIPA 2CBGA 4QM7A 4JN6B 1EGHA 3ZIAA 4O4JB 2PANA 3U3MA 1PZNA 3G8CA 4CTJA 4G5RA 3E3LA 4I0WB 3C1OA 4K9KA 5DT9A 3HA2A 1XZDA 1DL5A 1D2RA 4H7EA 1P19A 2G72A 3H2ZA 1MW8X 3ZC3A 1IFXA 4X60A 5GV7A 3CN7A 5HNKA 4N47A 1ZA1A 2EU8A 3G79A 2V0CA 2XNCA 3E48A 4BLWA 1RWQA 1SCAA 2OAGA 4OSPA 4BP3A 1KQPA 4UUMA 1RYEA 2R79A 3ESRA 4H7IA 1BGXT 3PE3A 1C0EA 4Z8XA 5L7YA 2JJ2D 3B1WA 3IP8A 4MR8A 3SS7X 2WUVA 1O6BA 1XCBA 4EJMA 1A8SA 3LX5A 3JQQA 4D6XA 2KPOA 4GEGA 1OA0A 3IT3A 5EWMB 1WZ2A 4EI2A 1CR6A 1NVUQ 1OZAA 1EUZA 5K45A 3T5BA 4EYKA 4YUXA 4K8OA 4YP9A 1XEXA 4BVEA 3G6WA 2O8FA 4I4TF 4OHYA 2F6RA 3JYQA 1E1QA 3KWMA 3ESCA 3CUKA 5A7GA 2QTTA 3OZSA 3BBLA 1BROA 3UENA 2JNWA 1PU2A 1FX1A 1W19A 1BS1A 2Q3CA 3A3PA 2G82A 5CA0A 3RAFC 3FF4A 4QPPA 3H5NA 3SE7A 4KN5A 1IZ0A 3HY4A 1Y34E 4FDVA 2NXEA 1LWOA 4LSMA 4Z4FA 5BMVB 3W8RA 2C07A 1JWBB 4JU8A 4QUEA 1L7XA 2C5HA 1NFFA 3A58B 4RL4A 2FPPA 4QWMA 4EHLA 2ZWIA 5BQFA 1NLUA 3ZE2B 1KIFA 1U8AA 4J0JA 2FG6C 3TLGA 1FDWA 4O4LA 4CM7A 5DJ5A 1KSGA 4CN9A 1YQUA 2O7SA 2XTMA 1CVRA 1THTA 4GX0A 1TVKB 3CISA 4JI3B 3WV5A 4R8SA 1BX1A 5LP1A 2Y1KA 4DQLA 2ORYA 4PINA 4DJAA 2VF4X 3H6HA 2PUVA 3R0XA 4GU5A 3RHTA 4YUYA 3N0WA 1XMVA 5LL6P 4F1KA 2AD1A 3AIIA 3B3JA 2AQ8A 2BCEA 4TMKA 2EZ8A 4WLUA 3S1AA 4LYHA 3RQSA 3TJMA 4EYSA 2QRMA 1KEPA 1PNQA 2E2WA 5B3KA 1OX6A 3FMGA 2ASVA 1BD4A 3FMPB 3AYXB 4XVRA 4B6QA 1GLNA 3EYWA 2GK7A 1OAKA 1SVKA 1YRLA 3EARA 1C1XB 3OLXA 1SOUA 2I4LA 4MRSA 3P2EA 2X4DA 4D9KA 5EERA 2QRGA 3RIGA 3VKHA 5DASA 1XRSB 2LBPA 3L7KA 4H15A 1N6LA 4NL4H 4BVKA 1EQAA 1V4BA 3QOFA 1FJHA 3U26A 3VYWA 5B7PA 1XMJA 4MRPA 4B09A 2Q3EA 4JQCA 2GYWA 3RSCA 3UMCA 4L74A 3BH7A 1NUTA 3IBTA 1A9OA 4XPIA 6CHYA 5KPDA 3PQ4A 1CCWA 3BOSA 1FDSA 4KMMA 1YQWA 2P9ZA 3M83A 4YFYA 1RWPA 2QTMA 3AESB 3AVPA 2HRBA 4TXNA 4E5PA 5KVAA 3GG2A 1G8SA 3SJUA 4M4SA 1XR3A 1U8XX 4PYOA 5I7UA 4B71A 3VM6A 1KNXA 4YPOA 3E7DA 1P7CA 2A14A 3KKPA 3KQHA 3LT1A 2BISA 4JELA 2BKEA 5ALSA 5B1IA 3TM4A 2JASA 4N8EA 1L5HA 1HLGA 1KBZA 5ELMA 1ZCJA 2OQ2A 1XTTA 3RJMA 5HJ5A 4UW9A 1YZNA 4K40A 3U7QB 5H4GA 3DTVD 4B7CA 2JJ2A 1FSZA 3EGDA 4C4SA 2VDNB 2CJPA 2BTOA 1TB4A 2D54A 1RAEA 2CKMA 3DAGA 1OXSC 4IXWA 3DDSA 1ZNQO 2XEXA 4HGZA 4RIIA 5ALRA 1LTHR 3UYLA 2E7ZA 3KD2A 1DXOA 5CFPA 1UKVY 3ZHRA 1RRKA 3GT0A 1POWA 3RD5A 5FI0B 4KMRA 3ZK7A 4E5KA 3SZOA 2WICA 2WPDD 4C87A 4F85A 2JHCA 2VDRB 2VSNA 4UVGA 4BMNA 2ZUTA 5LXTB 4C2UA 1NUQA 4WKOA 1KI6B 1UDRA 2BDTA 2HA3A 2CFOA 3HI4A 4IDHA 4KACA 4X97A 4CIVA 1FLDA 2IPAB 2R5FA 5I47A 3ZWCA 4TZTA 4E2ZA 3K9FC 3V4LA 2HF9A 4J4HA 3IIJA 1MX3A 5DM1A 3TEFA 5HE8A 4BWGA 1SMKA 1XF1A 4UZEA 1ISJA 3D1JA 5GM2A 2GPJA 4LF8B 4OHRA 1QRAA 2OA0A 3ETCA 4DVGA 2NYUA 1B14A 2C95A 3FMOB 1X7WA 2QQGA 3F5SA 3N05A 3QKRB 4HDSA 4NYMR 3RJ9A 4D5GA 1XVTA 3BE4A 1SM4A 4CV3A 3U9LA 1DWPA 1V48A 2BKLA 2E37A 3TOXA 4HDAA 2WW8A 1MOQA 1RU3A 4P93A 4RA6B 2CZQA 1KVTA 4MZDA 2B69A 5I4BA 2H63A 2J6BA 3UOGA 5I9LA 4BL5A 3VPXA 1GPNA 3GLHE 1KYQA 4PLCA 2DLCX 4V24A 4QOFA 5B2FA 1IXSB 3O4FA 4DJEC 5JV5A 4ZV9A 1ZK4A 5DXFA 3KPVA 4JSYA 1LTQA 2ZE8A 3FCOA 5EQDA 1LLQA 4FUTA 3SVLA 3OTWA 1DKPA 1QO0D 1Y9EA 1U3TA 1MXFA 3W1VA 4XGIA 3ZDXB 3TIFA 2ZIAA 4BKUA 1SBNE 4IP0A 3UUWA 2BMAA 5TEWA 1SVOA 2Z4TA 1OMOA 1LVUA 2Y71A 3I2HA 1YR9A 2HUPA 5D2CA 1E1KA 1KVUA 2C5LA 2CN1A 2FPWA 2XYRA 3OE5A 2AFHA 2ZJ5A 4PRYA 1H9AA 2JCBA 3TK1A 1FP6A 5KVQA 3H2SA 1C8KA 5AW3A 3LSTA 2EFEB 3G7SA 4MI6A 5IF3A 3GPLA 3JVIA 5FT9A 4R1OA 3QP9A 2PBRA 1TW3A 3KFXA 3V1YA 3TQFA 4DS3A 1RRCA 3QLUC 4HPWA 2Q5JA 4R81A 5BMOA 3NC0C 1CS4C 1MAHA 3G6KA 3LLVA 4B2YA 3EOZA 3OP1A 4BV2A 1QP7A 1P0FA 3A1WA 1QYRA 5AW5A 2PQ2A 2EDAA 3I0NA 5I4CA 2E49A 2ODNA 5T57A 1B16A 3H11A 3T1TA 1TO1E 2FZ5A 2XT6A 2XMPA 5KTKA 1PR4A 3BDIA 4R01A 2C2KA 4U7JA 1KPGA 1YASA 4Q9KA 4ENRA 2YDXA 2M6LA 2OHGA 4Y9SA 1XXLA 5K4AA 5BV0A 1YT5A 3OZEA 3CZ5A 3BWDD 1PGNA 3SI7A 3LVFO 1G17A 3ROMA 5F5LA 3P97A 2IOFK 3KXKA 4IGEA 1EPUA 3DOIA 3PK0A 2RHWA 2ICAA 3NYQA 3PEWA 1F4VA 1HORA 4Y2SA 3TQOA 3OURA 1MAAA 3RWBA 1E1CA 5FNVF 1WCXA 1G291 3U60B 4P80A 5KZMB 4K26A 1DKQA 2DFTA 2XF8A 3B20A 5F77A 2ZDQA 3M6LA 4EH1A 2FYTA 2P6UA 4QVKA 1V1MA 5FB3A 3WLKX 1VE3A 3NCTA 3Q72A 1TTTA 4OFZA 1ATZA 2J1LA 3PRYA 1SKQA 2XTZA 3E84A 2O8DA 3UHOA 4AS3A 4FOPA 4ETNA 3CLTC 4RJKA 4EIWA 4UJ3A 3G5LA 3H05A 5TR9A 1NJFA 3RE1A 2IZ7A 2ZULA 4QFBA 3WISA 3AGQA 2FWPA 3E8MA 3EIXA 4BNYA 1HDCA 3IKJA 3W04A 3UFBA 5DLEA 2BHRA 5D85A 2QD2A 4C3OB 3IX7A 1L5LA 3DMTC 3IEIA 3KTAA 2AFHE 3W5SA 4IQ0A 4K3VA 4A6PA 2VRCA 4N76A 1VG8A 3ILVA 5EHQA 4EHFA 4UMDA 5AFSA 2JLSA 1QLHA 4LMAA 2O7QA 1ISHA 2AR9A 2C0CA 1J0BA 2FE1A 2OCDA 2VUIB 2X0DA 3RVNA 1JIQA 2PMFA 5IVHA 3ELWA 3DLHA 2W6OA 3A26A 1PLLA 6PFKA 2VAMA 2RFLA 2POCA 3NAQA 1DCTA 3MF4A 1GOTA 4L5JA 4H1HA 2Q4OA 4HZUB 4CDRA 5IAOA 1IK6A 1CKEA 1LS1A 2GJ9A 2OGWA 3ZIUA 4F56A 1I9CA 4IFIA 3UT6A 4E08A 1E2FA 2G88A 3L46A 5L3ZA 3BHIA 3S2FA 5F1OA 2WVHA 1KFKB 2XMDA 4QU9A 5J2TF 1KP2A 1IAQA 2MSWA 3WFZA 4FFVA 4LRTB 1XPJA 3GJ3A 4I1UA 1VLLA 3HA7A 1TYAE 3BQNB 4XVQA 3CZPA 3FWNA 1TT5B 1G16A 1IWPB 1NMZA 1P0CA 1TCAA 1DMSA 2Z9BA 5J4KA 2BFBB 5M5BA 4ALIA 1JHQA 1XXHB 1HYQA 1N9KA 1NRJB 3HJAA 5HWSA 1KRWA 1SHUX 4KO1S 3H5RA 1NF9A 5H4HA 2ZRFA 1TF7A 4G0VA 2BGRA 3GFGA 3KJQA 1DX6A 3AIOA 1DT5A 3NR2A 4MQ5A 4UZFA 4JJ6A 4I4CA 4HTAA 3A6FA 3PNPA 4YROA 2YWDA 4EFKA 3TBHA 4RZ3A 3X1YA 5IYZB 2OC9A 2O52A 4C0AC 1EHYA 1UMDA 3IUNA 1E3SA 1IWBB 4ZYUA 2Q6TA 5M3BA 1I4LD 3VYUB 3D8UA 3H9UA 4JB3A 2ZBGA 5CVVA 4CDNA 7ADHA 1WB9A 4DCCA 3QYJA 3SC4A 1THZA 3BL8A 3ASUA 2EBFX 2X14A 3JRXA 2YVLA 5FTKA 2ISSD 1WMDA 2QJWA 2XB4A 3CY6A 1FYWA 3D4NA 3LI2A 3R6DA 5CLLA 1RC8A 3NRBA 3IRVA 2VKTA 2Z08A 3HJTA 3RQIA 4EA7A 1CY2A 4JITA 2Q0SA 1OD6A 4LX0A 1QQTA 2XD9A 3GUVA 3H2YA 4Q4AB 4ZO9A 3D54D 4FXPA 3QEKA 1I5EA 3TTSA 5M7EA 5IU6A 3B51X 4IIHA 5DRTA 2H5IA 5BSMA 3AL2A 4B7UA 1ZPDA 5CG1A 2X0KA 3CWQA 4BEWA 1JJBA 1TIKA 4O63O 2MR6A 2ZYGA 4LSGA 1VKNA 4YC7A 2P6NA 5B7NA 1KY5A 1P1IA 4KI0A 2C1ZA 3ZGVA 3DQPA 2I78A 3TX6A 1MUUA 1FTWA 2PBLA 1KZHA 5DW3A 1LVHA 3PGKA 2D7CA 4TTPA 2JB9A 4D56A 1JJ7A 1T8WA 3KTDA 4ZVSA 1H0HA 4ZI7B 5J4YA 1Y1SA 2GBFA 1Y7LA 1L8QA 3MT0A 3ZWBA 1X80A 4LECA 4DVJA 2G7MC 4PZ9A 1RQGA 4GL2A 5E8JA 3M6XA 4PW0A 4G5HA 4QYTA 1NI4B 3PCRB 1L4YA 4HF7A 3GJZA 4RS4A 4C08A 3RS2A 4GPEA 1O58A 4PPQA 3K0FA 4ONEA 4P2BA 4H7HA 2AFIE 1W88B 1VPWA 1U2SA 3GFVA 3KUCA 4H35A 2BYTA 2EYUA 2ZCUA 4TS1A 1DX4A 5GP1A 4WBXC 2O8VA 3FXAA 4X92A 3U81A 1SU8A 5K8CA 4ARIA 2DTEA 4MPRA 2BGLA 3T3MB 3TJRA 3WRYC 4AUMA 1RPZA 2XSZA 3N87A 2NUAB 4NBSA 1M1YE 1ZMRA 4PR3A 4C7JA 4PXSA 1CUDA 4JEUA 2A0YA 1Z0JA 5EGNA 4LSZA 2A0WA 4JBYA 5G0UA 1K0UA 3UK2A 2ZI6A 4ON9A 2R60A 3ZEIA 2IGBA 1E8DA 5C3UA 4MHTA 3I1FA 3MUFA 2MYUA 3A6LA 1M66A 4NMLA 5F52A 2A5JA 3ISVA 5G4KA 1JQ5A 2VHUA 2JFXA 2I2WA 2Q6LA 3GDGA 2Q5OA 2FMFA 3UQYS 3NLLA 4ZAWA 3R3JA 4HY3A 3KV3O 1PEDA 2C3MA 2O2EA 4ZEMA 4IMIB 4FR2A 3E2PA 3Q7EA 4H1VA 3WHKA 3FGNA 1WY5A 1UBMS 1QV9A 2FSVC 4MS1B 4O3FA 3UCEA 5IHXA 1XU9A 2X4GA 5AIAA 1ULAA 2FETA 2NO9A 4N0QA 4MDEA 4GMHA 3CB4A 2HK9A 5FPKA 3UMFA 5JSZB 1H0KA 1LEHA 1MZVA 1T9GS 1JYEA 3G1UA 2PWPA 1N0IA 4TXMA 2I2FA 4HMOA 3CB2A 2ZJ1A 5A03A 3DBRB 1GZ6A 3EUFA 3STWA 2NP6A 2XUAA 2R66A 1A69A 2JDID 1GQQA 3PUJA 4C4ZA 1PTJA 2GZMA 3FLBA 5A1TA 2AB0A 1KEWA 5CVCA 1DAFA 1TC2A 3NEAA 3OLYA 3U62A 4B43A 4REQB 1KDZA 3ICCA 3PV0A 2JI9A 1O95D 1P3JA 3GEBA 2ORWA 4N5NA 3AQIA 1NXWA 3GRPA 4IS2A 2XOXA 1QGOA 3PIRA 1KIMA 2JD1A 2O0LA 4PX5A 4CV1A 1HT2E 3ZV7A 1PFWA 2MWMA 5JZMA 3D5QA 4LJKA 5AKEA 3SEAA 1V2GA 1SVMA 3I73A 4JENA 3JAMA 3HDTA 2QHXA 4LVCA 1D1SA 3T4EA 5GJCA 3UAZA 4ZTZB 4H4EA 3EXG2 3K32A 1IZ7A 1JSXA 1XLTA 2ZIUB 3GELA 2RBKA 4FHFA 3G9TA 1GFSA 4L9AA 1CIPA 4FYYA 3DPSA 4EM6A 5JY1A 1PJLA 1ICIA 2CD7A 3OSZA 2HV9A 3PHCA 5LPNA 3UW3A 4OI0A 1XMXA 4D96A 3MMXA 4O4JA 1Z9BA 2UZ0A 3BCUA 2GM9A 1XZEA 4PSDA 4FQ5A 4HLCA 1Z0FA 4J0IA 5CDFA 2X5KO 1EB9A 3FNBA 3H9EO 1DC4A 1UEJA 2WWRA 3AR2A 2EWMA 3QE2A 4G01B 2HN9A 3EIUA 3JQGB 4UEJA 1PWXA 4G1MB 1STOA 1Z56C 5JSFA 2IYRA 1DBSA 2KBEA 4TMZA 5F7JA 4AY3A 4YUZA 3KG2A 2M2IA 5L3VA 3EVCA 1AS2A 1J4AA 2H7CA 2DT5A 1N1DA 4B3JA 5AVZA 4OMCA 4JJ4A 4A6XA 3CXUA 1SHTX 4JI4B 1BVRA 4CKYA 2EEPA 2DLDA 3HUDA 1A9RA 1OFHA 5G3YA 3OPNA 5BSEA 3FHTA 5A3QA 4HPJB 5EWMA 1X1CA 1YRBA 2BR5A 2P67A 4LYJA 3PWTA 2MT9A 2HF7A 5IEBA 3D7RA 4ACBA 1MF7A 1HX7A 3DDZX 3W4KA 4X91A 3SLGA 4C78A 5DDIP 2WIBA 2RGAA 4Q66C 4WK0B 2YJ5A 5IDWA 1UBUS 1ZMOA 2FLVA 3THYB 2G28A 4HADA 2YXBA 4NIMA 4G1CA 4TQUS 4EX6A 2HCJB 1VG9B 3DXFA 1E3IA 1EH5A 1VG1A 3TQCA 2A7QA 1RI4A 5AVYA 1FNDA 3UG6A 3E6AA 4C1BA 1B43A 4LJ5A 4KSBA 1CUCA 1KI9A 2D13A 3PQEA 1AS0A 2XCQA 4B5KA 1M2FA 3N0RA 1PS9A 3PXDA 1VGQA 2EKPA 2IXBA 3S5UA 5BUSA 1JDUA 3CWZA 4J0EA 3TOSA 2RGNA 2ID4A 3QU9A 4F91B 5BMVA 2GBCA 1XZNA 5BSVA 1QS0B 3AY3A 5JAUA 2FSGA 1N1EA 3TLCA 1QGAA 3C8ZA 3RFVA 4B34A 2OLJA 3O8RA 1SK8A 3FCAA 5DRYA 3LOQA 1B23P 1WKBA 3K6KA 2Z57A 4WXYB 4G24A 1A8IA 1T1JA 1P62B 4FI3C 4Q6WA 2Q07A 4F4HA 2A1TR 1VBMA 2Y67A 2G83A 4D9IA 1TVKA 4O4IB 1FYXA 1OGIA 1IHPA 4DBLE 2BBSA 1QHSA 1R4MB 2XVZA 4K6OA 4DLWA 1DTWB 5ALUA 4ZOQI 4BPBA 4FFWA 4C7KA 5BQ5A 4AO8A 5JOQA 1PRYA 4P3PA 5EXSA 4EG5A 1MJ5A 2VZLA 4NEQA 5JQGB 2HK8A 3HV2A 1P18A 1Y6QA 1CJTC 2CHGA 4ND8B 4UCWA 4AJ9A 3BMOB 3IBFA 4C76A 5CDFE 1K89A 4FILA 4QC2A 3C6MA 3FPCA 3D3KA 2L42A 4ZQFA 2G76A 3S2ZA 4UTOA 4AYWA 4Q1EA 4Q3EA 3H86A 3WQHA 4DUPA 4QJBA 1R9JA 1C1XA 1UZAA 1DAGA 3UAYA 2ECFA 1Y98A 2PV7A 4V2UA 1FTGA 2VF7A 1HQCA 3RBAA 1ONSA 3NUQA 2AMLA 1FSGA 3QBDA 5ICSA 2JEYA 1L7EA 1U3UA 2OCIA 2HQBA 4LE2A 2WMOB 1U02A 4EF5A 2X15A 2ZSJA 2H65A 3NV9A 3QVJA 1TDJA 4AROA 3EIWA 1GIAA 2FEKA 2NTJA 4C2BA 3A1VA 5F9HA 1QQAA 4KQWA 1E94E 1ECPA 3BRSA 3MS2A 1MMFB 4GMDA 4L9SA 4N3BA 3VR5H 3C3CA 1XYYA 3CMMA 4W7IA 3SS9X 4DLRA 4M8LA 4BBPA 1IATA 2N47A 1ZDMA 2NU6B 4PO1A 5LJLA 5DYNA 1L4GA 1NLYA 4G4SP 4US0R 4CIDA 2ZT6A 4H60A 1ORIA 3UJ9A 4MYRA 4EHIA 3VTKA 2Q2OA 4CODB 2QVBA 1T1RA 3PQ3A 3T1NA 2HIMA 3PVCA 4R1SA 3EMBA 4AZ3B 4D8WA 3MPOA 1TAQA 2HPHA 4BNXA 5ILGA 5AVUA 1W9MA 3SN6A 2Q3HA 3FYDA 3RS7A 4W6ZA 5EHXA 4W9RA 2ZITA 4NS4A 3TTYA 1XNHA 3BXPA 3U7QA 1U7PA 3E7WA 2QTVB 4JVSB 3I5YA 3SP1A 3ES9A 3ODGA 1LPMA 1A82A 2ZI7A 1M8FA 4O02B 5DNDA 2VEOA 4CEJA 3E8XA 4Z99A 4R9RA 3WYDA 1JIKA 1KYVA 4FQ8A 4GZLA 3WGHA 3AHEA 3KDAA 3DEZA 2NO6A 5FTNA 5J2UB 4N3NA 4JJ8A 1QPBA 4C0XA 2PFGA 1QRUA 4OQFA 3HKCB 2EQ5A 5LXTA 3PP8A 3K9NA 4NZ9A 1ZH6A 1NLZA 4L8VA 3SJ7A 4BLPA 2OQRA 1ZR2A 3AHDA 4ROTA 2B5OA 4BS9A 3E35A 4XGKA 5JW6A 1I10A 4BGUA 3QTBA 4TQAA 5DNWA 2F90A 2WP8J 3GDFA 3RFFA 1TQ4A 3DZKA 3Q7IA 4JLOA 1OFGA 4H27A 1D8AA 1QVAA 4PGGA 4W4TA 3IQDB 4DWJA 3VNRA 1SUBA 3F5FA 1M6HA 2GDJA 4PSUA 4X65B 5JZ9A 1BE1A 1FOEB 4M99A 4L1KA 1FW8A 3QKRA 1Z4QA 2YN4A 3ZGNA 4H6XA 4E07A 1KHTA 3Q9NA 1B73A 4U2DA 1T3LA 3H0EA 4BYGA 4EG0A 4G8JA 4NZMA 4DV7B 1XTPA 4I8IA 5JXWA 4FGWA 2BUBA 2Q27A 4UEKA 4KIWA 3EW9A 4P3OA 3SZRA 1K6EA 4RA6A 2INGX 2J4DA 1IDN1 2WZQA 3FBWA 1JFFB 1DQZA 2OAEA 1KVRA 4LN1A 3L9WA 3STYA 1PJ3A 2IUTA 1LPSA 1RPAA 3C3AA 3HCBA 4TUYB 4XOIA 1BKSB 1H8EA 3A4YA 4OB8A 4H0NA 4PGHA 2FQWA 1FTNA 3R3WA 1NM5A 1W96A 4IVPA 3A9VA 1ORTA 3RYHB 5I7SA 4D81A 2ATCA 2ORIA 3DL4A 1MHPA 2VNIA 1KYZA 4KREA 4RPJA 5NLLA 2HMTA 3AJ9A 4CUJA 1EK0A 2FUNB 2PZ8A 3N8NA 4QTTB 3MMSA 4CLXA 4WBNF 5A0TA 3OFSA 5CYPA 2J3KA 5G02A 1PEAA 2J0SA 5P8WA 2R11A 4TVSA 2YMQA 4HAYA 1FFXB 1PJBA 1A7AA 2EW1A 4JXJA 1EGVB 4I2VA 1ESEA 1PWZA 3DMRA 5HUHA 2H5LA 4ZOBA 4P7JA 2Z2XA 1E58A 4JBGA 3VAYA 2WKSA 4JL8A 1NG1A 4LZPA 1DHTA 1R9NA 4B3SB 5FH9A 1Y9JA 3M4JA 4DCGA 3R5SA 4C4PA 3MXTA 5IK2D 2CB0A 2YV1A 3DKRA 3HADA 2GZRA 3B82A 2AW5A 4F3NA 2OQVA 3L7IA 3G2MA 2Q3LA 4JKIA 2AN1A 3LZ6A 3K70D 2QLNA 1Q7CA 2VXCA 5LYJF 3G8BA 4AP9A 2OKCA 3ZHTA 4EG8A 5JY6A 3LDFA 4J7XA 1G3RA 3C14C 3VVLA 1G6OA 5KKNB 2P65A 1I0ZA 3BORA 4F60A 2RARA 4PPFA 2IWRA 3B9QA 3GFPA 3NT4A 5JROA 1O77A 1AKQA 4N4AA 1SBQA 1O7JA 4CGZA 3MCAA 3JYPA 1UPTA 1TUBB 2YXLA 3H17A 4MCAA 4AYXA 1X3LA 3FNFA 4HZGA 4AS2A 4GT1A 5AKJA 3K1AB 5ALDA 1GV0A 3LAWA 2P75A 3AG6A 3EDCA 4MIEA 3LOUA 3L7BA 3EC7A 3RJTA 2CFRA 3NTRA 2QL6A 1YB6A 3ELDA 3FDIA 2IHVA 5TQ2B 1W4BA 2AR0A 1NBHA 3FCCA 4PONA 5C46F 3ZYZA 4WDRA 1VCMA 4XQGA 2PH5A 5IPFA 1R64A 1QJCA 2CFIA 3GLSA 4B80A 5LQJA 1V1RB 4DB4A 3I05A 4IHKA 3GEMA 3GWGA 1G5QA 2BFCA 1YWGO 2C8VA 2XZTA 4ZOAA 3LUBA 1F3OA 5AW9A 1PT7A 4EX7A 1TQ2A 4P33A 4BLVA 1BXRB 1IONA 1J9GA 4K0RA 1PZFA 2HAEA 4RJJA 4BX8A 1I2CA 1UOQA 1V5FA 4TWZA 3P2IA 1C7IA 3V1MA 2V3VA 4BMSA 5AKIA 1D1PA 3ILYA 3OJXA 4YRAA 1PGJA 4Q9AA 4O1MA 1RYBA 4CVNA 4D3DA 3LC2O 5JDCA 4I5FA 5I9IA 1R5NA 2B25A 2H18A 1SELA 2AE2A 4OH7A 2PKRA 1DPGA 4L3WA 1GTL1 2H1SA 2VTVA 3IBYA 5FV7A 1XA3A 1Q0PA 4KQ2A 1OOEA 1IRXA 3IMGA 3TQIA 4KLAA 4CMEA 3ZPXA 2OSVA 3JYLA 4FJ0A 4JJFA 3IH5A 2YXPX 1I7NA 2ZCVA 2DR0A 2O50A 4GGOA 4GUAA 3V00A 5K8LA 3EDRA 2ETVA 5FD8A 1CUIA 1JH9A 5A0VA 3TEJA 3KR0A 3GAZA 1O9BA 1GUZA 4W1RA 4NPAA 3R76A 1IMJA 1C9DB 5KX5B 1JAHA 3WNZA 4B3MB 5DXJA 2BMFA 3WWDA 4BFYA 2RGGA 1T5TA 3V2GA 2GLUA 4LY0A 3RFUA 3L7CA 4NYMQ 1TL7C 2C3OA 4V1CI 2R85A 4YJ3B 4P36A 4XCVA 1CF4A 3FY4A 4C88A 4JT2A 4QYMA 4F97A 3CVXA 1T9CA 2BSAA 4HFMA 3AEUB 2R8EA 3A6JA 3MCVA 1TT5A 4YREA 4ZRNA 4EUKA 2PNFA 4PHCA 4XD2A 1G3QA 1AK9A 1Y82A 2EX4A 3EG5A 4ZVVA 3RROA 1OAOA 5JHGB 5JIBA 5EMLA 2PTGA 5B4UA 1TZMA 4AJNA 3PPYA 2B35A 2BFBA 1LNZA 2UVQA 3ER6A 3T9CA 1XXHA 4O4HF 4ER5A 4W5WA 2Z1MA 1YS6A 3GNTA 1WL8A 1EDEA 2SICE 4FI3F 2W37A 2GNPA 3UMSA 4BNVA 1OWPA 4EGCB 5JS7A 1RLTA 3AL0C 3KQVA 1QTIA 1TK3A 3AEQB 1KEVA 3RODA 5IYZA 2AQKA 1Z07A 1JKJA 5EP4A 4HQNA 4YCNA 2JLXA 2YN2A 3RUEA 1WSDA 1MTOA 3OWHA 1M2GA 1UC9A 2R86A 4Z0TA 4CQMD 2OQIA 1RLMA 3TW8B 3UMVA 4C7MA 7ABPA 1FFDA 4Y2UA 1C2YA 4G3XA 4AXBA 3DE3X 4F2DA 4C2TA 1F7UA 3FUVA 3RR2A 2PKQP 1RC1A 1OCEA 4U63A 5AXCA 5I7AA 2WWFA 2PX4A 3U09A 1ZLYA 4B2LA 3EA5A 1JDBC 2PSSA 5AMXA 4Q4AA 2WA2A 3CR3C 4F4DA 2FR8A 4H4CA 3HRHA 1X7GA 4RAQA 3L84A 2KQUA 5BR1A 2JHAA 2NO0A 4P7FA 3HSSA 5FR2A 4H6VA 4I99A 4N6OA 5EE1A 2VP4A 1KQOA 4FLFA 3R20A 4L2IB 3WB1A 5C1IA 3L43A 2XUKA 2GZ1A 3I2GA 5TV2A 4KRXA 1NBMA 3DYVA 3F6BX 4HBZA 1UKYA 4XR9A 3IXLA 4RKQA 1G4UR 1WRBA 4ZI7A 2D4HA 1UUFA 3ADOA 4JX9A 2Z83A 4A26A 5IEJA 2QJOA 1JP7A 1TYEB 2GN6A 2JIPA 1GQRA 4RMHA 4W1QA 2R48A 4H7KA 5FBQB 1DKMA 1BWRA 1DPFA 2EJBA 2F59A 2Q5FA 3AB3A 1NI4A 5LA6F 3JALB 2E5LB 1R15A 3DDUA 2OB1A 3MOGA 3U3JA 3ZK9A 4XKJA 1WIWA 4YDSA 3FZQA 3LDHA 3RS3A 3URMA 1TX4B 1T9ZA 2JI4A 3H6KA 3PR2B 4G0OA 4HAVA 3SYMA 2QY6A 1UIMA 2NWQA 2A0XA 2WNIA 3OT1B 1NAIA 1EVEA 1BMFD 1WXHA 4LF5B 4DA9A 4H7FA 1GPMA 2VFAA 4NDNE 2NUAA 4FT2A 2ZK7A 3ACBA 3E9NA 3K0CA 3OAAD 2H16A 3A7EA 2W6ID 4ZC8A 3BULA 3SLKA 2HU8A 3WZ2A 2Q2NA 4CMGA 4YJ2F 1XAHA 1XWWA 2A84A 2B83A 4O4JF 5BWNA 3FMVA 5AHKA 5HBRA 1QK5A 1J22A 2G9RA 1CR0A 3A1DA 3CINA 3F98A 4J7AA 4KPFC 3COYA 1R6TA 3NTQA 5HG0A 4I2NA 3AP1A 4JC5A 4I3HA 4UVIA 3LYUA 4JH0A 5DK6A 5CDHA 2J67A 1GRCA 1ZY2A 3AM3A 3SSMA 3R6GA 1D4OA 3CV3A 3P9RA 5BQPA 5IJAA 1GZSA 3OY7A 3QIAA 5F35A 1NPDA 4LWZA 2WHQA 3S2IA 2CBZA 3SJAA 3R1IA 4HDMB 1RMTA 2IIBA 2WOOA 3C24A 3DC2A 5E9AA 5CFLA 5A06A 2Z1DA 1V7CA 4QPJC 1GNPA 4BTEA 1DU4A 2PRIA 3F6RA 3DBRA 1LDYA 4U2GA 4B3DA 1GYPA 3WTCA 2P6OA 4NNJA 1AV6A 2E4AA 3BXEA 1I94B 3BGDA 5FTWA 1HR0B 1OXTA 4REQA 4RZQA 1LC3A 3G13A 3DVSX 3PHHA 2HRQA 1N6OA 2GB4A 2CE7A 4GBMA 2I6UA 4HRXA 3IBCA 5AK0A 3TTWA 3RBXA 4WACA 4DM3A 1NN1A 1OIWA 1XZKA 4JLAA 3VR6A 3L1IA 3WIVA 2XRYA 4L5CA 4CTOA 1L5GB 5BMVF 1G8FA 1RRMA 1XQ9A 1E32A 2FH5B 3HRIA 3FZGA 4J3FA 1AQLA 1P0PA 4FNGA 5DBOA 1ADFA 3KB2A 5H9WA 1WV0A 5HF5A 4NCHA 4WOJA 5EWJA 1WX1A 2OCPA 5IBCA 1NOJA 4GQAA 2YWHA 1O54A 2CNWD 4MP3A 5FO1A 2P5TB 3K4QA 3OQBA 4YP1A 1NNI1 1WVMA 2YMPA 3ONEA 1XVVA 3INYA 4MYSA 1G1MA 4MUGA 4NE7A 3SQNA 3VX3A 2PS0A 1H2BA 4UUQA 3VR0A 5BXQC 2GD2A 3OCCA 5JEDA 2CNKA 1U0SY 2E21A 1EP3B 1CQJB 1N1GA 2BP7A 1M9NA 1O4WA 3PDUA 4A8TA 4YRZA 3OICA 4AQYB 3ITEA 4J75A 5C7LO 1LPPA 2F62A 3CEMA 2G5TA 2PGLA 3LJKA 1CT9A 4G1EB 1E59A 1XBTA 2BLNA 4D1YA 3JQGA 1PL7A 5HKAA 2REQB 1NMYA 4I4LA 4FHDA 4ESHA 4OO3A 4NY1A 3USES 1II9A 1E9VA 2JGAA 2V7BA 3FCXA 3PFKA 3ZQJA 2HKIA 3A1FA 3KKKA 5EUMA 4B0PA 1YKFA 1C7RA 1K75A 1NZFA 1OLXB 3GJ0A 1QNFA 1PSZA 4TLBA 1Y8CA 2RAVA 3STTA 5E6SB 1USVA 3F6YA 2G5CA 4EF6A 2Q50A 4QEZA 1MOSA 1F8GA 1YB7A 4QYWA 2ANCA 5FHRA 5HVNA 3FOWA 5A4KA 1YV9A 5D5QA 3DMPA 1MT0A 2AQHA 1UDAA 4ALKA 5AKKA 2W6IA 1MAUA 1G20B 1JR2A 4JVMA 1FS6A 3ZNOA 1GDTA 2VG8A 3R3HA 3WO0A 1F5NA 3ANYB 1G8JA 1OXXK 2BBOA 2HA6A 4KJZA 5EZQA 2D5IA 3TRIA 1TYCA 2V9CA 4R2WA 3AFHA 4A4DA 2IX9A 1OKKA 1ICEA 3OD1A 3ILHA 4U8HA 2VJQA 4BGDA 2ZKIA 1E18A 3KLBA 4UMFA 1RWOA 5AJUA 3E81A 4EPYA 2X76A 3NOQA 2FPSA 3G8YA 1XVAA 1SVLA 5P21A 1NGSA 2W6ZA 5IAKA 4YCDA 4KV9A 5GINE 1D7AA 3DGFC 4FW9A 4P3YA 4HVCA 1GGEA 3BTSA 5C35A 4HN4B 4UTXA 2YHBA 3GOQA 1W75A 3ZIDA 5CYOA 1IN6A 1XNQB 3ND5A 4BMOB 1BE0A 4HFJA 1LLCA 1XD2B 2M1ZA 4Y98A 3ORRA 4Z0NA 3HXQA 2G1AA 2JGDA 3WA6A 1XAIA 2ODPA 2XWJI 1PFVA 4LNUB 1UJ5A 1KFEB 3PGA1 4IHJB 2EKBA 4R69A 5F76A 3PENA 4CKEB 1WCV1 1R10A 3TO5A 4UM8B 5LXTF 3F8TA 4QLOA 1UH5A 4L6IA 5JQGA 4CM8B 4ZMSA 4TS3A 1Q1NA 1RLJA 1YD7A 1P2GA 4ND8A 2V6GA 3K9CA 3OJEA 3BMOA 3PTLA 4HDRB 2WD7B 2BHNA 3IAS1 3IPAA 4RGYA 5K3SA 3D6MA 4ZT4A 3WMFA 1EJBA 3L6UA 4OYRA 1L4FA 5DBHX 1W29A 4FP9A 1NURA 5G0VA 5HS6A 5THQA 3UVEA 3PUIA 3ENKA 2DUNA 1UKBA 4ZI3A 4ZGGA 3C74A 3PC7A 2P4HX 3BB4A 1QH1B 1VJTA 1TU3A 2E6KA 2J9ZB 3EEOA 4JDUA 5C8ZA 1F3LA 3M1AA 4XWYA 1PNOA 3NV7A 4LRXA 4X41A 2WV9A 4NICA 2CHEA 2VT7A 4ICIA 3VFDA 3WKBA 2FEWB 3IDOA 1RRFA 1VG0B 4AF8A 3PCXA 1BYUA 2C2XA 4XLZA 1BWQA 1BSVA 3KOMA 4ZXFA 1ADGA 4C29A 4LC1A 4XIGS 3PCTA 5LIRA 2Q8NA 2NU6A 4LV8B 4NQRA 5KCZA 3TE7A 4HH3C 2BR3A 3G88A 4OGKA 5HRAA 4UQOA 4Z3DA 2JAWA 1LSUA 3HLKA 1T5LA 2LRHA 5A4MS 1SUPA 4AZ3A 2PVCA 4ITVA 2YY6A 1VRCA 1XD8A 3SC3A 1LK5A 3CNLA 5IC5A 5IM4F 3CE9A 3EWNA 2O2CA 3OUZA 1ECBA 2B7LA 1I4WA 1FZQA 1OA1A 3IALA 4LDZA 5JZBA 3DVLA 1QYXA 3HXLA 5T8KC 3OQNA 3HBAA 1U2GA 3WLTA 1VL1A 3OM9A 3NHFA 1P80A 2QTVA 5B55A 5JJBA 4W5HA 2VSFA 4YDHB 5I4KA 2O8CB 4G2NA 2VQ6A 3LPLA 4KE6A 2FCRA 3QX9A 1WG8A 4HGNA 3WLPA 3INNA 2FFBA 3K5PA 2BC9A 4EGSA 1QG6A 2CK3D 3KBOA 4LXHA 2J85A 3S2YA 1TVCA 4B6FA 4EW6A 2RMKA 1T15A 3MAJA 1ZM7A 4GFDA 4I5IA 4E22A 5J2UA 5AR1A 3CTPA 1KIAA 1VZ2A 3GB9A 3LHIA 3HKCA 4XGRA 4M46A 4AT1A 4UUNA 5ALOA 3B2NA 2QENA 1ZZEA 3W06A 2EGUA