3TD2A

Crystal structures of peptidyl-trna hydrolase from mycobacterium tuberculosis - form 5
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
187
structure length
187
Chain Sequence
MAEPLLVVGLGNPGANYARTRHNLGFVVADLLAARLGAKFKAHKRSGAEVATGRSAGRSLVLAKPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDLEFGRIRLKIGGGEGGHNGLRSVVAALGTKDFQRVRIGIGRPPGRKDPAAFVLENFTPAERAEVPTICEQAADATELLIEQGMEPAQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Structures of new crystal forms of Mycobacterium tuberculosis peptidyl-tRNA hydrolase and functionally important plasticity of the molecule
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 53
structure length 187
sequence length 187
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 3td2A00
3TCKA 3TCNA 4FYJA 4P7BA 4Z86A 3TD2A 4ZXPA 3KK0A 4JC4A 4ERXA 4JY7A 2PTHA 4FNOA 2Z2IA 2Z2KA 4HOYA 1RYBA 2NAFA 5IMBA 4YLYA 5IVPA 4JWKA 3P2JA 2MJLA 3VJRA 4QD3A 4DJJA 3OFVA 5IKEA 3TD6A 4FOPA 4DHWA 4QT4A 3V2IA 2JRCA 1RYNA 2LGJA 4FOTA 4OLJA 5EKTA 4LWQA 5B6JA 4JX9A 3NEAA 4QBKA 4IKOA 3KJZA 2Z2JA 1RYMA 4QAJA
chains in the Genus database with same CATH superfamily
2I2BA 4XFJA 2H9AA 5K6AC 4XLLA 5KSOA 1R6UA 3U7QB 4FGUA 1VI2A 3TD2A 1R4ZA 4MJXA 2NU8B 4GQBA 3KLNA 5C1IA 3HNPA 1M76A 5D3ZA 3CVUA 4B71A 4UJ5A 3IEKA 4JOSA 4NJEA 3RSSA 4LECA 1PJQA 1IN4A 2XJ9A 3NGLA 1XU7A 1Q22A 3TW6A 1R8QA 2O5RA 4UAJA 1Z0IA 2VSOA 2QJRA 4QRIA 5COQA 2XE7A 5EMHA 4B3JA 2GEBA 3DT9A 1C1XA 4L4SA 5AKGA 2EX1A 1E3JA 3GF4A 1VL0A 1Z63A 3DGFC 4LMBA 4QU8A 4EPTA 2JHPA 1ZM7A 1T2UA 2CLHB 1MQAA 3IQZA 5ILOA 1IYZA 4PYIA 3W5DA 1G2QA 2DYKA 1JG1A 1AM4D 4M1ZA 1K75A 1UBFA 1D2HA 2CYBA 2N0SA 2ZYAA 4QOFA 2BJVA 3GBVA 5TT0A 3KLBA 1QCCA 2JI6A 3I9LA 5JUWA 4YAIA 1XHLA 3DXFA 4Q7EA 1E2IA 2FF7A 5DXAA 5EXPA 2CNLA 2NUAB 4KE8A 5HWSA 4XGNA 2ZIAA 4DBLE 2C9BA 3LKBA 3NHPA 3HZHA 4N3GA 1BE1A 3U61B 2H3HA 3FMGA 2F1OA 4EHKA 3D5TA 3ZD7A 2JIPA 1EUDA 1FNBA 3R9KA 4UCWA 1W8IA 2QSYA 2C54A 1QK4A 5I9LA 3FBGA 3OIWA 4ZVQA 3QVWA 1A96A 2IOYA 1XTPA 4GD3Q 2NXEA 2YJ6A 4M38A 4E94A 4CDNA 4XD2A 2LDXA 2B1QA 3G59A 3HKEA 3NHSA 3RPEA 1N6RA 1P3Y1 2FRVA 3F6BX 3GLHB 2GYVA 3OFSA 4R8KA 3RJZA 4ETNA 2WM3A 1IATA 2XJ4A 1EK6A 4UU1A 4JU9A 4RZQA 4I9FA 3SC2A 3DDOA 3WRVA 2C78A 1GPUA 5CBPB 2ZYWX 1O95D 2IPLA 4Q1BA 4NE7A 1AZLA 1L5NA 3LQ4A 3L7LA 5CGZA 16PKA 1RS0A 4KBGA 4ZU1X 1ZCJA 4JEMA 4PGAA 4FDTA 1ORDA 2I7CA 1W76A 2WIFA 5EYPB 2I2AA 3LL7A 2VJDA 4L0MA 4QTUB 4GOLD 2XNSA 3U1BA 2GLXA 2QL6A 2X3UA 4LC9A 3T12A 3ROMA 2OCXA 2AL7A 5KZMB 2SCUB 3MW8A 2CVHA 2DBVO 1DWPA 2AH5A 3JYNA 2ZUWA 2JLWA 3I09A 1ZMRA 2CHEA 1L3BA 3GZ4A 5E2BA 5C18A 2IXGA 4CEHB 1GSOA 4EOGA 3W77A 3VPAA 3W6PA 5BUSA 4MCJA 3UUGA 3QYFA 4NZPA 1PJZA 1Z2CA 2RC5A 2AFIB 1GPJA 3LCVB 4PPNA 1DBRA 3DOEA 5J40A 1T6ZA 1T5OA 2A8YA 2VHUA 2C77A 3D7KA 3DJFA 3DLAA 5D3MB 2MCFA 3FJOA 3DFZA 1H0HA 3KJGA 4EWLA 2IOFA 4UDYX 1PS0A 4EHHA 1T2AA 1Z6PA 4ZZ0A 2QTBA 4X44A 1FRVA 5AKHA 4B3HA 1OIXA 5IT0A 1AV6A 1Z0KA 4GS5A 4O2BF 1UWLA 3B6KA 1HNWB 2Q27A 5LA6A 3SAJA 4C04A 2BTQA 1YZHA 3E9DA 1E2MA 3FWKA 3WRXC 2NXCA 2IHJA 4NHEA 2OHJA 4CJXA 3LUBA 3LW7A 4UDXX 3RKSA 2TMKA 1MU0A 1TD1A 1TGVA 1L4MA 3KD3A 4F4FA 4JB0A 4OOEA 3W2IA 4F9GA 3FNBA 1GDHA 3JVDA 1YS6A 2CL6X 2GESA 2DRIA 3LKZA 3MCVA 1UBUS 2AB0A 4HI0E 3DTVA 2P6NA 4P4SA 1M2VA 1EU1A 2PO5A 1QWSA 3QFTA 5JU6A 1HH4A 3E4CA 3Q0TA 3TFQA 5K8VA 4ND5A 2Q49A 4QJ5A 1P91A 4F96A 5DT2A 1AT1A 3KVNA 4LHSA 4N18A 3OHSX 4S24A 4R68A 3SKVA 1G5TA 2XQIA 4DUGA 1E58A 2FQWA 4KTTE 2ZJ5A 4IRXA 2FCRA 3U4AA 3UMGA 1IBRA 3I04M 1OXVA 4Z9AA 3PD7A 3V8QA 1K63A 2YV3A 1MT0A 1XTTA 3DB2A 1ULZA 3LQ2A 3DD1A 3KB1A 2HK6A 3F8SA 3FSRA 4A8JA 1T4MA 2NG1A 2VH1A 3GJYA 2YRWA 4C07A 1USWA 2AVNA 1GYRA 1AUQA 3SE0A 1W25A 3CJRA 4Q18A 1AK1A 2WTXA 3VX3A 7REQA 3L0IB 4DA0A 1KSHA 3EW7A 2GCIA 3C7TA 3RYFB 3EG9B 2CV0A 1SC3A 2XW6A 4D44A 5A4KA 3CLSD 4M37A 4QXRA 2GBFA 1DAEA 1C9NA 4YQZA 1WXQA 2C7BA 4XSGA 2K4MA 4QBFA 5BNFA 5IX8A 2ZIXB 1YF3A 1XI2A 1FE8A 1M2OB 4UCXA 5TNXA 3U3OA 1HDIA 2CMGA 1NP6A 5G0WA 3V8NA 5BN3A 2EJTA 3OX4A 3V9PA 4GMKA 1UKVY 5LDHA 1NJ8A 3PQFA 4WFKA 3H9QA 3TM5A 1XQ1A 4B2YA 1DNPA 3WMGA 2L18A 2NZVG 2BR4A 1I1NA 3VKVA 5LWQA 2D2VA 1P7VA 1QUEA 3R40A 3D0OA 3WK9A 1V5EA 1MFPA 1V5IA 1ONOA 3QLUA 1PWZA 4FHCA 4Y2XA 3MB8A 2QVZX 5CG1A 3HJHA 4NYMR 1F8YA 1NBWB 3EISA 1E2HA 5HUHA 1SUPA 3HHEA 2ZRMA 3I30X 4ZOBA 3H42B 4J94A 1CB7A 3EEQA 1CR2A 1X0XA 3R7NA 4NL4H 3U39A 1N7GA 4JZYA 3D1LA 2CXTA 4S05A 5JFGA 2D3TA 2R7LA 2BFEB 5F1PA 4YO7A 2B61A 4IHJB 2VPYA 2J9GA 1G60A 4YMTA 1WMSA 2Q50A 4RO0A 4UHKA 2CBZA 4Q9IA 3E9MA 4PLWA 4AX4A 4D1YA 3G88A 4I3FA 2CL0X 1R0YA 2PKCA 3ASYA 5IM4F 2BT4A 5K51A 3ZHZA 3M3HA 3PTAA 3EXG2 1T0PA 5HMLA 2PRIA 3OZWA 4EF6A 5EQDA 2HIHA 1NNLA 4GKKB 1TB4A 3BWXA 3QX7A 4MPTA 4AY3A 4B3IA 2O0HA 4X66B 4YJHB 2J0UA 2OK8A 2CE7A 3NM5A 5KNLA 2CV1A 4Y6RA 5LU9A 4X41A 3MPUA 2CXQA 2Q2WA 3C7DB 2JC3A 1L4UA 3FGZA 3LUJA 4MKGA 1ZL2A 3TLYA 4XGKA 4DSNA 2PD4A 1YACA 2YS7A 5BPHA 1IWBB 4L9WA 1OI4A 3H2GA 1PYOA 1E66A 1CLEA 2CY0A 3WIOA 4M49A 2WJ4A 4XJVA 1EDDA 1VFNA 2AJLI 4NH0A 4JBYA 4GMXA 3KPWA 1J07A 2VDRB 3EIQA 4F0JA 4KQMA 1QE0A 2CZGA 3CE9A 3I9NA 2YN0A 3OT5A 1UFRA 3JQPA 4TXNA 1II0A 3NDJA 3UMYA 1Y1RA 4KO4S 3HTXA 1DEAA 2MYTA 2WPDD 4QQFA 2ZETA 3VO1A 1FXUA 1AN0A 3OOYA 4D3ZA 2Y0CA 4GKBA 5FEMA 4HBZA 1TZMA 2LIPA 3J81A 4RFLA 4RDXA 2HRCA 5KNBA 3UBMA 1XZDA 1ZD9A 2HU8A 2HK9A 3QW2A 1SBZA 5DTJA 3R74A 3RVPA 1QF9A 5AJVB 4E2XA 1SQ0A 2WHQA 1BU5A 4YQEA 7YASA 1ADCA 1PZEA 4KNVA 3GLIA 2C2KA 2VSFA 3KQPA 3CSUA 3GJSA 1C3JA 1UOOA 3AEKA 1TCCA 5K45A 1LPNA 1N6IA 1ZUHA 3DBRA 3H4IA 4ZOQI 2Q8NA 2ATXA 4U2KA 5EJFA 3ABZA 3PVCA 2G9VA 2C8LA 4I9GA 3AXSA 3AJEA 4PAGA 3SEQA 3WRYC 4F5DA 1AU9A 4F60A 5C4IA 4G23A 3OWOA 4II7A 2JIOA 1PFUA 3O3NB 4Y9UA 4EABA 2VATA 1POXA 2XUAA 5BV0A 1BZYA 4HNTA 2AMVA 2O05A 2PPLA 5E6RB 3R7FA 2HPHA 2BEWB 1Q74A 4NENA 4PO8A 2W8ZA 2ZATA 5DGXA 1N78A 3QLEA 5EJ7A 3O2NA 1G8SA 2DVMA 3OMWA 4J4HA 4Q21A 2FW8A 2PFKA 1W87A 3K0HA 1PG0A 1KO1A 4MXDA 3R9XA 1ZXXA 1C1YA 5CIYA 2WHRA 4GNKA 1VPDA 5H3HA 1T4DA 4DG8A 2CXPA 5CEJA 1WP9A 4LYAA 2DXIA 2EJBA 2ZRGA 3LK6A 1D09A 2ENUA 5K05A 1IXZA 1S8NA 2I99A 4QXAA 3WHKA 1ZK2A 3HCNA 2WM8A 4I9UA 1FP1D 4AULA 3B1FA 4ZYLA 4DIKA 2YIJA 3INNA 2IDZA 3IUBA 5CRIA 3WB1A 2GXQA 2X77A 2WYWA 1BEZA 4D4KA 2JHFA 2AI3A 5BWBA 1MT3A 3TUJC 1L7PA 5CFLA 1Q0ZA 2K7FA 1NONA 1M8PA 3NYIA 4BMNA 4DLZA 2Z57A 1N75A 1R8YA 3UMCA 5LMZA 4OJTA 4MVJG 3AVQA 2PWBA 1VB5A 2IZOA 3A1UA 4D4HA 3ZD6A 1YZUA 1N25A 4RNCA 1CBUA 3FKJA 4G9GA 1V7QA 3Q2KA 3ZWOA 1J33A 3IH5A 1FQOA 4MUFA 4MRAA 3GJTA 5JCPA 1QQ5A 4E31A 4CYMA 4FEGA 1IZYA 3TB6A 3GN1A 4TL8A 1Y6RA 1R16A 2IEDA 5ESDA 4DEVA 3ZCSA 4I1UA 1SVMA 2JCVA 5FBZA 1JQKA 4OQEA 5JDIC 2C5EA 4FUTA 4OQLA 5LMCA 3FVRA 4Y2RA 4Z2AA 2XGJA 4ARBA 4BV8A 4HQ0A 4CHGA 3M2TA 1XXHA 3H5VA 4B8YA 1X14A 2FSGA 4IAOA 4R71A 2BKVA 4X8MA 2DCUA 2BP7B 2NU7B 2O7SA 1YI8A 1RCTE 4MK4A 4YBRA 4QQRA 4I5IA 1L3CA 2N3ZA 3TAHA 4B17A 4CF4A 1XU9A 2PUEA 1VJ0A 1XNJA 1A27A 4OKNA 1SQFA 4MWCA 4E32A 4ER3A 3AKZA 2OTCA 3MCZA 4M9RA 4PHCA 2HN9A 4RSMA 3PNKA 1WXIA 2XRZA 1KIAA 3TW4A 4TYNA 1FFCA 1E9FA 4CTJA 1CUBA 3TOSA 3HEAA 1VJ5A 2I8LA 2HLPA 5ED0A 5HKKD 4TKMA 2YY6A 1P1HA 1C81A 1F12A 2EP8A 3Q5GA 4N01A 4NULA 3RNOA 3UV3A 1WSBA 7GPBA 5JISA 3CVYA 2AHRA 1DHRA 4KHPB 3T0FA 2QJTA 4KBFA 4DANA 4UQLA 4KXLA 4K05A 2C4KA 2BGJA 1VPEA 4B6SA 1TJYA 3E7FA 4R2KA 4MV5A 1M7BA 4MVJH 4XIYA 5FPQA 3C3XA 5JS8A 5KU7A 2F2TA 5C5DA 4EYEA 2P2SA 4D8YA 1YULA 2EGUA 2XAUA 3G9UA 4DLNA 4MWDA 1S1CA 1W88A 4G5GA 4AECA 1ZY2A 3QVJA 3DWGA 1H2ZA 4AKHA 4QUDA 2C3UA 3FFTA 1U2QA 1ZVMA 1N2BA 4RF5A 3UJ9A 3R7WB 1O77A 1YBFA 4P7FA 4DCSA 2BFBA 2HHJA 3EOBI 3D8SA 3R3YA 4HDOB 4EA7A 1T8RA 4ZOCA 4EF4A 2MIIA 2OZPA 3UG6A 3D0RA 1QQ7A 3E82A 2RAVA 3CZAA 3Q40A 4KJXA 1WTAA 4IXTA 4F97A 2C57A 1YOVA 3R5JA 4QEZA 4H4DA 1IC6A 3DL2A 1CQIB 4HMPA 1T91A 5DZSA 3TLGA 3VR0A 3ZDEA 5JYCA 4YAWA 2QTVA 2AEEA 3ESCA 4HXFB 5TARA 1C4XA 4DLRA 2PLRA 4S1PA 4ZAFA 3O0TA 1SKUA 3DMYA 4LZZA 3WLOA 1T5BA 4PLPA 4WBNB 1Q12A 4H7FA 1LZLA 2J7PA 2D2EA 1I6LA 4CM1A 5A7GA 2R79A 5DJ5A 5IJ9B 5HOQA 2PAFA 1UXKA 1IM8A 2P2YA 3EN0A 3AP2A 3QBVA 4UTZA 1T9BA 4Y6QA 3SYRA 3TMAA 1CZRA 2R8EA 3K70D 4LJ6A 3CJTA 4LQLA 2PRKA 2W2PA 1TJ5A 4DXHA 2Q0XA 2DHQA 1J5XA 2FETA 1FSZA 2ZUVA 4YRJA 1FYXA 2OAQ1 4U6SA 2FU5C 2D5LA 1T5DX 4F6RA 4R8SA 1RP1A 4AAYA 1YB4A 1ZINA 1ML3A 3DQQA 4X20B 5EIFA 4PQGA 4HT3B 1C9DB 3P9PA 1SRRA 1KI6B 1NBHA 3BMQB 3V6LA 2XLBA 1BVUA 1RAGA 2YWGA 3KVOA 2PS9A 4NEGA 1POWA 4G5YA 2O7VA 4RZUA 4YGYA 4A4DA 3RRBA 4TMKA 1P2SA 2WF8A 1DAKA 3GAMA 4BO5A 1DXYA 3LHDA 2EF1A 2Z3VA 1NQUA 2OFXA 2OSBA 1CG6A 1Q3KA 2A5GA 3GUYA 4L9RA 3R7BA 5FFFA 4AJKA 4HLNA 3L18A 2ZT6A 1YIDA 1FYEA 1J06A 1OZFA 1BVHA 4AKSA 1LTHR 1VB3A 2GN6A 1QZTA 2I6QA 1SKQA 2PGDA 1KVQA 1RQGA 2AEJA 2PH5A 3PR1A 3CY6A 1BRTA 1FDOA 4CM9D 3JATB 3B60A 2RHRA 3IV9A 5TXGA 2OCPA 1PI3A 1GFSA 3DL0A 2FJUA 1C0PA 1XB2A 4RY8A 5JI3E 1CP2A 2HRDA 3IP5A 3SD7A 2F3QA 1G1AA 1FPQA 2VXCA 1WTCA 3EOAI 4OUDB 4EB8A 5B7NA 2O52A 3HCAA 4RTJA 1PUXA 3B6IA 1U0SY 2XUIA 3HCCA 3G8AA 3IVGA 3PJDA 4G89A 4GQAA 3UQZA 3EFOB 2F8TA 4LCJA 3ZZ1A 1LY1A 3W05A 1ZGJA 1R3DA 2ZB4A 2IHTA 3HP7A 4TMXA 4WX2B 5EHQA 1HZJA 4BLOA 5J4YA 4EI2A 3U5TA 2NSHA 1FP2A 5ERYA 2V3CC 2ZI9A 4MCAA 3UJBA 3N58A 3HVKA 4JMLA 1LW6E 3F8TA 2R8OA 4HGRA 3FB1A 4QYTA 1QFJA 3OE5A 3AI3A 3PITA 1B00A 2VRWA 1V26A 4QVIA 3DPSA 4XX0A 3P2IA 2PUJA 3KV1A 1M33A 2WJZB 4J0FA 4JJGA 1VSBA 1K5HA 3JTMA 4GBGA 4LBWA 3RSGA 3R3XA 1ZHHA 2IW1A 3NU1A 3TLCA 4DC9A 4TWAA 5A7FA 4XGRA 3K9BA 3ZCQA 3GY0A 3NG1A 4WN9B 3DTTA 1RRFA 1IQRA 2SKEA 3ETEA 5B36A 1ZRMA 5IULC 5LNK6 2YV5A 2QB5A 4EW1A 1IH8A 4W5QA 1FVOA 1FPMA 2AX4A 3Q9SA 3QVLA 3RUPA 4XGQA 2W2TA 1JWBB 3S1AB 4IHQA 3MCWA 5C51B 3AR8A 3O75A 1EKXA 2VLBA 3ZHSA 2P0AA 4R05A 1NI3A 1JJFA 4YJFB 4CW7A 1Y5NA 2JGMA 5JDCA 3WGUA 1Z56C 3QE2A 3L06A 3H9BA 5DNVA 3QV2A 1NX9A 3M82A 2ZIGA 3A11A 3N8GA 2PT9A 4FKZA 1VRVA 3GL9A 4PYKA 1TIKA 1H9CA 4QT0A 3BYZA 5LOVB 4B40A 4XCXA 4BVBA 2F48A 3UW3A 5EIXA 2G5GX 4EG4A 3BTOA 5AKZA 4R1LA 1N6KA 3MSXA 4J16A 3COPA 3LVRE 4MUHA 1RT9A 3GLRA 4UHFA 4RIIA 2O9JA 3ST7A 3A6JA 2JZNA 1RXSA 1JXAA 5EZ5A 1D9XA 1I3LA 1KJZA 3DEAA 3ZEAA 3BMNB 4U5XA 3IR7A 3CB4A 3FVVA 1N3BA 1U0TA 1RI4A 2LPMA 4DVGA 4LTDA 5DASA 1VLZA 3JAKA 4CMKA 3OIUA 1CWUA 1ZXBA 1BFDA 2O2XA 1QC5B 5F2NA 1ZH4A 3A25A 3O1HB 1GTG1 4G65A 5CNMA 4WZBE 4E1VA 3QPCA 1C30B 3G5MA 1IMOA 3LP5A 4YNBA 3E9CA 4RK1A 3AX6A 5GGXA 5BYAA 1NIJA 3R8CA 1P29A 1M6HA 2NVOA 3JQAA 4DNPA 1F7VA 1ZI6A 4HNVA 3Q3VA 2ZR0A 4HRXA 4RLFA 4BB5A 1TYZA 1DO2A 1UK8A 2IZ1A 3VR2D 1Y4DE 3ILSA 2II6A 3IUPA 3ZDXB 4CLOA 1QE3A 3FYUB 2B9EA 4EIWA 1KAMA 3JARA 5BN1A 5MF6A 2PWZA 2J30A 3RARA 2ALJA 3KVRA 1XEWY 4FW9A 4DIMA 5IT4A 3NYQA 1E3DA 4PIVA 5KDDA 2VAVA 5E38A 4A73A 4OBXA 1JLLA 4BN4A 1ZI9A 3T4XA 4AWXA 5JXGA 3RS4A 1ONBA 4D9NA 1HG1A 2CJFA 3CNHA 3KWJA 4CT5A 4XD7D 1XHFA 3W5UA 3GQVA 2NQ2C 1VXOA 5AHRA 5DNCA 5JNRA 4IRUB 4JI5B 1G3RA 3AFMA 4E2WA 3PQ2A 3S8YA 1PHRA 4C7OB 1UWVA 1KAEA 3IV6A 5ECYA 4BXOB 4N4AA 1UZMA 4PHFA 4U7HA 2VI5A 5F4ZA 1XV5A 4NNJA 1ZITA 1EFRA 2AK2A 1SOVA 4NBTA 4GVPA 5ALQA 1P0QA 3SYLA 3DL7A 2H1VA 1XUOA 2QLTA 2W0MA 2GPNA 4TWRA 1JJBA 2HSZA 1R6BX 4EFMA 1AQYA 1G41A 1R6AA 1Z2OX 4BFVA 3KKLA 5DB4A 2KMLA 5EMLA 4UBOA 5K3AA 1HDEA 5EJMA 5B3JA 3WYAA 2VF5X 3L6EA 3K8YA 3W3AA 2P4EA 3EEOA 4GR4A 3STVA 1TMGE 2HTEA 1RQ2A 1TKBA 5H80A 1Y4UA 3PXBA 1I9GA 3AHFA 2G04A 3DMNA 4R40A 4RELA 1BC5A 4RV5A 3K0CA 4EVSA 1U0FA 1EVIA 3QXGA 2M32A 4IJQA 3WLRA 3TTYA 3CV3A 4D56A 1KZ7B 4TVOA 4TKZA 3GJ7A 1FFYA 3RU3A 3ZLVA 4RJJA 1B41A 1OV4A 2CUNA 4I55A 2X8BA 3H5TA 4Q12A 4ZU3A 5HIJA 4BNXA 1C3OA 3MF4A 2VNKA 1VL5A 2IYXA 1UBNA 1VQ1A 1V3TA 4GZ5A 3FTFA 1Z5UA 2Y93A 2Z2YA 5LPNA 1MCZA 2R11A 4I1YA 3T3DA 4V1CA 4GSKA 4F5WA 1TT5A 3TW8B 2ZBGA 3QWIA 3IJRA 3VSEA 2RH4A 1LI7A 3DEIA 1E9VA 1YQDA 4KPUB 1G6Q1 1T15A 5H7XA 2PBFA 2VUTA 4G8DA 4HNGA 4RHXA 3L92A 3T5BA 3TX2A 4PZCA 5B2EA 3RQIA 1NWHA 2EP7A 4MW1A 2WTEA 4JT9A 2PRZA 2VLIA 3A3KA 1ECGA 2DPMA 1E18A 2NXJA 5L8VA 3KU4A 1DEHA 1EGMB 3SHFA 2NADA 3CNBA 3D64A 3WLIA 1WUHS 2F43A 3H2KA 2CT8A 2QTZA 4HJRA 2FSUA 1MAAA 3KHSA 1EWRA 5T3UA 2DECA 2X0RA 2B34A 4MWOA 3RRJA 3HY6A 3EVGA 1KYZA 3I76A 1C0KA 4DPMA 3KZMA 2V7EA 2NZ2A 4BJ6A 5IWAB 1WOYA 3HYCA 3CT4A 2C5HA 4DZTA 5BV8A 4HX2A 2JLYA 3ILVA 1NN1A 1VHLA 2AW3A 1GSHA 5KC9A 3WIVA 2FMKA 1Y6ZA 1M75A 3HL0A 4TQGA 3WQHA 4ESHA 3RBAA 2M1XA 4DMMA 1IEQA 4Q7JB 1M2FA 1G63A 1XZPA 3DKIA 5EEGA 4ZMBA 5B2FA 2YZGA 4CMGA 2TMDA 1DKMA 3ZQUA 6PFKA 4HQOA 1SOAA 2UUAB 3MRVA 2CWDA 4G1FA 5IC5A 1QH1A 3IMEA 2ODEA 1NVTA 4LWZA 4LJSA 4Q1DA 1IJEA 4JELA 5G02A 4ZT4A 2P90A 1R8JA 3OKFA 3QYJA 1X39A 1AA9A 1N6PA 1JQJC 2QZ4A 4XR9A 5JJKA 2WZBA 2EF0A 2XOEA 2OZLB 3GOHA 5ELLA 3ZGXA 2QLLA 4MIKA 3FDFA 2RARA 3QNMA 3UB3A 3VVLA 3ZZUA 4RL6A 3I01A 4FW8A 4WBSA 4L5BA 5CX1A 1CJBA 3QU2A 4QWWA 1UQTA 1UR5A 3C3WA 4JSRA 1GQYA 5AHWA 3L43A 2EQ5A 5D85A 10MHA 3ZWVA 2X5XA 2CDCA 2O8DB 1OXKB 3CSSA 5KNDD 1PTKA 4MV7A 2Q2VA 3TRIA 1SKMA 1EP1B 1I6KA 1UZAA 1P45A 5C3UA 1P0IA 2SHKA 1M2WA 3QK7A 4CL0A 2XTAA 1H3NA 3DBLA 4F38A 1A8QA 4GI3A 1FNMA 2GXAA 1SPBS 3O8OA 2RHMA 1I13A 4PWYA 4YXFA 4HWPA 2FI1A 2K7ZA 5REQB 5LYJF 4JJEA 4JLJA 5K6AA 4K46A 4LY6A 3ZUGA 3IDFA 1E3SA 1FUEA 2V7WA 4YN3A 1K2WA 2J0EA 2JVIA 2YFHA 3LY5A 5CFMA 2QPTA 4GPEA 3ZZNA 1PFVA 2GBIA 4IHAA 5CT4A 1BHO1 4F4HA 3R3SA 1TJ4A 2JASA 2V97A 5AM5A 3GV0A 5A3JA 2O8FA 4Q34A 1GAXA 4R2HA 5C8YB 1ZVVA 4QBTA 5I7FA 3K8OE 3BHJA 4KNWA 1TQ4A 2FSHA 4HUJA 3PPYA 2B6HA 1ZD5A 2EOAA 2X5KO 4KITB 4K9PA 3IKMB 4MYUA 4DM3A 4DR6B 5JTUA 2C2WA 4JNCA 3WAJA 4RVSA 5JAZA 5JAHA 5DN9A 2HW8A 3QUAA 2QX9A 2ZRFA 2BZSA 4M6WA 3AERA 3TSWA 3VNAA 3WLNA 2CNWD 1XP5A 1EFVB 1XHEA 1BWQA 5HKLA 1ZU4A 2DH5A 2B7LA 2BEUA 4XQEA 5ALGA 3OQHA 1P5FA 2IIQA 1T2CA 3WHPA 1KH2A 4BZZA 3HSYA 4RHUA 3GJ8A 2IRWA 2OYSA 3NHUA 1ZGAA 4LXHA 3E5RA 4C7KA 1PT8A 1R74A 1NV8A 1VGQA 3CGWA 3TD9A 4B32A 2WUDA 1RMYA 5AXBA 3CZPA 3UMRA 1CS0B 2A3RA 4JC8A 3FFWA 1NULA 5K0ZA 4UOQA 4MV1A 3B3JA 2X0IA 1BVYF 2FPPB 3DE2X 2P30A 4K1XA 2PSFA 3WP0A 1YRHA 2HYIC 1J9ZA 2VJYA 3I34X 4BB0A 1EMDA 3CUTA 1JDVA 3AEQA 1ZGGA 4P4GA 3IOCA 5J59A 4E11A 1MV5A 3LT4A 3GVIA 1KZ4A 3NEPX 5ICSA 1Y7PA 1ODIA 1KY5A 1SB9A 3EXEB 5L3QA 2FQ1A 1YAJA 4D80A 3RSHA 4YCJA 2ZB3A 4H2DA 4ND4A 4JDUA 5K8LA 1IDN1 3AU9A 3VR6H 3OJLA 2QWXA 1HEYA 2ZRNA 5JHGB 3I6IA 3TQSA 2J46A 2GX6A 5DTRA 4BKPA 4MMXB 3IHLA 2OEPA 3L6UA 3AOEC 4KRYA 4CUJA 5FR1A 4EVIA 4Y2GA 1YUBA 1U7WA 3IERA 3UJ6A 3VHXA 1YMUA 4LN1A 2BZ1A 3MGBA 4BNLA 4D99A 1HLGA 3H5WA 2ZCVA 3AILA 1DWUA 2JATA 3BMCA 4C0BA 1FNNA 1JFFB 4J0CA 3UHFA 3V97A 2KBFA 2XWSA 4JBIA 5EKDA 3NOVA 4L9SA 2B30A 1T6YA 3EASA 3G2KA 4LGVA 4C4YA 3OEWA 4ESEA 4RHFA 2J6CA 5KVVA 2ENWA 1B6RA 3BF8A 2D74A 1VLMA 2BUCA 2IXAA 3PEVA 5FXMA 1IVNA 3W6OA 4A3SA 3MHTA 4PCVA 2MWMA 3W4IA 1SKAA 2W6IA 3REQB 3NUQA 2LRHA 4CKEB 3DTNA 4K3UA 4GQIA 1KMQA 2FSVC 4LJ9A 4B3CA 3EB9A 4B2LA 1EYZA 4QZVA 4DR1B 1Z34A 3HJAA 4HBGA 1KDZA 1AGXA 1UC5B 1DOZA 2PAAA 2R5FA 3C5CA 3PUVA 4DRZA 3PFIA 5CLQA 3QPUA 3U31A 4LQCA 2BMAA 3OVMA 4O1IA 2PEZA 2ZJZA 2KJQA 1GYPA 2FWJA 2QUBA 5HMMA 2CNKA 5B6JA 1E1KA 3IRVA 5KUTA 3Q8WA 1U4NA 3WRXA 3CKYA 3RANA 1SU7A 3BWCA 4HH3C 3IAHA 3OD1A 5TQ2A 2HBYA 4QDKA 3E8SA 2XXBA 1JEYB 3WYEA 1YQ9A 2GK7A 1V95A 2KQUA 2VWPA 3OZIA 4BO0A 7MHTA 1MAWA 4Y6GB 2PNJA 1I3KA 1TIBA 1P2UA 3GCGA 3GAZA 2QLFA 3O03A 5ALYA 4X84A 1S8AA 1ECBA 1Y3FE 3NETA 5KYKA 2G5PA 3QEOA 2A92A 1J2UA 4S12A 3ER8A 2GPAA 5J2UF 4E7PA 4ENWA 1Q1QA 3ABIA 4JUIA 5AHKA 2IZZA 3TQIA 1CUZA 1NW4A 1PG5A 4LVUA 4TRRA 2ZB8A 5KMGB 1NNEA 1R27A 5FPKA 1L6IA 4AJ9A 4AICA 1L8XA 1FBTA 4MARA 4EG6A 1UJNA 4A2WA 2XUQA 3L4EA 2HQBA 4EM6A 5T41A 2EIXA 1XZQA 2VK1A 1XRRA 1HSOA 1O6GA 2WNSA 4PXAA 1SVIA 1FX0B 2IYSA 4A82A 5GM1A 2B83A 1UAAA 3UBTA 1M0WA 4PC6A 1T2NA 3RU7A 3AVPA 3OKAA 1NG9A 3HJCA 1MOPA 4MWZA 4DYDA 3WY9A 3QMMA 3UHJA 1H85A 3AF5A 1J8YF 4HYTA 2V7PA 1RLJA 4YMVA 1DQNA 3SS7X 4ZVMA 3RYCB 5M34A 4UXIA 3GLFE 1G3MA 3KJNA 5HTOA 3WWDA 1K4YA 1MJNA 4RIGA 3H6KA 1RYNA 3JRNA 4JODA 5J1TB 4IL5A 5LQJA 5DCLA 5LP6C 3ZXUB 1WNFA 3GFBA 4JYZA 2H00A 4OHUA 3NPAA 4WBXC 4ARVA 2ZB2A 1I8TA 2VSNA 3BE8A 3L0BA 3NM6B 4JVLA 2XODA 4YUZA 1JAIA 2HZ7A 1P4AA 1ZJ6A 2GDZA 1R0ZA 1ZOSA 3MJ4A 1BJRE 3P52A 5KYYB 3C15C 1VHJA 1VL1A 1XZNA 3F6SA 3T94A 1K7XB 3LFHA 4Y6PA 3CPJB 3WGKA 3IIMA 4ZRDA 3RUIA 1THMA 1F8GA 4C3UA 3HXOA 1O8CA 5FWXA 5C1OA 1JI3A 1HMYA 3COSA 1XWFA 4NBWA 1U02A 3RGGA 1SGWA 2VP4A 2ODPA 2OLKA 1HL3A 4S1TA 3VOBA 4EW2A 4Q6BA 2X0DA 1MEJA 1K27A 3WV5A 3DWIA 5FQOA 2WPNA 2PMWB 4UARA 1OLUB 4DT1B 2JFVA 3N6RA 4GSLA 4IUYA 5DBEX 3V1UA 2ADFA 4AJOA 1OYVA 5DBGA 2FB9A 1XQ6A 1E6KA 4RCZA 5FOSA 3TZCA 2C1ZA 3ESQA 1R88A 2DPHA 3AMVA 5H0IA 2C7OA 1BD4A 2IDKA 5LB4A 3VH4A 3ZTTA 3CLSC 4HQKA 2MSLA 2X8JB 3N5KA 5H9WA 1I5EA 1COZA 3O0DA 4GOXA 4DRXA 2FP3A 3VNQA 4R2JA 2FLWA 5JSFA 3VKWA 3ANYB 2HXYA 5EG5A 2OSVA 4OJKA 3DHWC 4DDVA 1U7DA 1NOKA 2XVXA 1Z5PA 4EZIA 3RYIA 4QC2A 3N76A 1FEZA 1OAAA 1QIEA 4FSDA 2RIPA 2PS1A 2ZIEA 4FZVA 1ZEJA 5BWMA 1YDHA 3CA8A 3QYPA 2UVPB 3MWGA 1KTVA 4B85A 4H1UA 1Z2DA 3OJCA 1KNQA 1LGYA 1XELA 3NW9A 3TI7A 1TMOA 5JMOA 3MLAA 1RJ9A 1M1YE 3HYNA 1YZ3A 3HWSA 4K6MA 3MT7A 3DCIA 4JT8A 4D7AA 5AUOB 3QGMA 4U7PB 3IPYA 4JMPA 2Q3EA 3SIWA 3F5MA 1X1EA 2H51A 2HQSA 4XB6B 1BKYA 1SVOA 1PNOA 3NJ4A 1S1MA 2VQDA 2CLSA 3NXKA 2M6LA 3GFQA 1YVPA 5IJ0A 1XMJA 3AG5A 4HDNA 5ILQA 1K6JA 1A88A 2VJNA 3LLCA 2HT6A 3ZY6A 5DT9A 2F3SA 3PGKA 1QTRA 4ZARA 4DMCA 4OA5A 2HTFA 1XPJA 3GQBB 4GP6A 4A1OA 3JYHA 3GGJA 1THTA 3IJ5A 3TQFA 3WIDA 2NO7A 5CB6A 1L5ZA 1SQ6A 2XYVA 1E1RA 1HBJA 1EBBA 1QHIA 4G01B 1UUFA 4QUIA 1SZDA 3FVWA 1WA5A 1FUIA 4I99A 1OWNA 2O8EB 3W5AA 4BN5A 3JQCA 4M8SA 3DZ8A 4EKYA 4KUHA 4YV7A 4CIYA 3D2AA 2EJVA 2IIVA 3X43A 4F5ZA 2YOGA 2FWIA 3M3DA 4D9FA 3I9OA 5K0CA 2CYCA 1LH0A 2RKBA 5I9MA 4QJBA 5EEHA 1V47A 4PS0A 4A03A 2GCOA 4PRYA 1MMFB 3AEZA 4R8VA 3AR9A 2UZIR 4UZEA 3OZFA 4LYGA 4YRSA 3AGPA 5KEIA 3M33A 3FOFC 4LXUA 1KJIA 4PHHA 1U2SA 3LK7A 1GGEA 4IIJF 3BQNB 3QWHA 2DKFA 4BNWA 9MHTA 1Y1LA 2ID9A 5JZ9A 4JLWA 5B1HA 3WRYA 5IZCC 3KELA 1WZNA 3K35A 4ZPJA 3BRCA 3TX6A 1T25A 2A59A 1B0ZA 2ZM5A 1T3GA 4Q4JA 4KSYA 5BV2P 2BFNA 3SWWA 2E82A 2YJGA 1ISSA 3X2EA 1GV1A 1W5AA 3IS3A 1E2FA 3V55A 2PGJA 2A1IA 2QRNA 1FFSA 4FFDA 1E2GA 3MJCA 1Y7HA 1EPUA 1FJ2A 3JXEA 4PW0A 3FBWA 2YHIB 4WY5A 1OROA 1H42A 5EZYB 5HBRA 1SD2A 1DUIA 1WDMA 3PNVA 2AFIE 2PD6A 2EGGA 1HURA 1GNQA 3E4DA 3ZHXA 1GJRA 4RFVA 4C3VA 4BQNA 1G2PA 1HRDA 3T99A 3GMDA 1QF7A 3RAEC 1KA9H 1KHTA 2ECPA 1DX9A 3VR5D 3ZI0A 3ANXA 1JILA 4HLUA 5IAEA 4YDSA 2WG1A 4OMUA 4EARA 2BMVA 1UKZA 1Y1SA 1D7AA 1PQWA 3PC8A 5TS3A 3WGQA 4LF6B 1TU3A 4NXMB 1GPKA 4C4AA 4X64B 3F6RA 5LYJA 1YUNA 3N74A 3PIRA 4B6QA 3OUZA 3QXXA 1YCGA 3SQOA 3MGAA 4BVKA 4DIUA 5F7OA 3V1MA 1DG3A 2H2FA 4I4TB 3WIBA 2GEUA 1SCDA 2J3JA 4FYPA 1ICEA 1Z29A 1TQ8A 1LWNA 3B6MA 3EIEA 4RLHA 3CF4A 3T1OA 4FCVA 4EI8A 1I7SB 4C87A 1JX6A 2QK4A 2JLXA 4IR7A 1L4YA 3TTSA 3WZLA 5CXQA 1OBCA 1HYQA 4OL0A 5LMUB 2JK0A 4HDAA 3GVPA 1ZC3A 4JBNA 3WVNA 2F4VB 3VDRA 4FMCB 5K3DA 4HPWA 4Z7JA 1DKRA 4TGLA 3MILA 4KH1A 1IEVA 4JLUA 5EWJA 3TB4A 3ICCA 3FX2A 1AURA 4K6OA 3VAZA 1DRWA 1U3WA 2OXCA 3R41A 1N2HA 2VTVA 2AOUA 2P0EA 4EB6B 2NZJA 1F0KA 3AEUB 3K0FB 4FT2A 3NHWA 3OTGA 1CNMA 3Q5DA 3CTPA 2FYTA 1VLLA 3EQ9A 2VL7A 3LYUA 5CIWA 4BGEA 1W30A 3DNMA 4GLLA 4BMOB 3TTTA 2F00A 4EECA 2EJUA 2GO1A 5GM2A 1G66A 3VM6A 3A6PC 2XAAA 1JUDA 2G5TA 4AY2A 3V8PA 4J0HA 1ORWA 2P6UA 4P80A 3AKCA 2RGWA 4WKPA 4FMPA 3TQRA 4FWTA 2O14A 2Q3JA 5IABA 2GN9A 4EYSA 4QBGB 1RAHA 3PCXA 1E7QA 5B30A 5HRCA 2YZNA 1PQPA 3E3NA 3PL1A 4FDLA 4KXMA 3GBSA 4YTEA 1A9YA 1O6CA 1XCBA 3LLSA 5D7BA 5HFJA 5IBQA 2FFBA 4L28A 4DWJA 4HDQB 2HCTA 5DN6A 5JD5A 3KZ1E 4DB2A 1M6NA 1CXZA 1XBTA 1R5JA 1J6UA 2WUWE 3GCDA 4OJYA 1RQ7A 1TCAA 4KLNA 3PQ3A 5LZ5A 3TBKA 4AP5A 3EBLA 3WGGA 4B43A 3L4BA 1IIBA 1LNQA 3BFVA 3VPGA 1L8AA 3GU3A 2FWAA 2OV1A 3W2EA 3SFTA 1ONPA 4FINA 1BFUA 4GM1A 3GZNB 3FJYA 3I73A 3NHJA 3NCHA 4OM7A 4P36A 2E48A 2HF9A 2WU3A 1MB3A 4XDYA 4DCNA 4XVRA 3RRXA 2FPWA 5C9ZA 5KQSA 1LDEA 4I1OA 4BNDB 4J1NA 3SF8B 3IFSA 3HLYA 3HCRA 4OL9A 3WWPA 1DQRA 5JXHA 3KAJA 1F38A 1UKYA 4RXTA 6AT1A 5HUQA 3PPIA 2GRJA 1U3UA 4EG1A 3CVOA 3UATA 5DWVA 3JQ8A 1O96B 1QHSA 3GZJA 3L8EA 1SELA 4L8GA 2P3QA 3B1WA 4ZAVA 2XXAB 1QP4A 4IYJA 4KZKA 1UQUA 4G2TA 3LW8A 4LK3A 1ONNA 3GNQA 4KP7A 2C7QA 4IQGA 3DCNA 3OZUA 1U11A 3DEJA 2WD7B 1N77A 3HHPA 4FDAA 3CEPB 4J91A 3ADCA 2QENA 3L79A 3RIEA 3IODA 1WBBA 2NACA 1HOTA 2VT7A 3GUZA 3ZY5A 4BGIA 2J4FA 5BMOA 3R2JA 5CLFA 4J3JA 3QKSA 1S3SA 4KGVA 5LKRA 2INGX 2VQ3A 3KT8A 4AXXA 2G07A 3TEMA 4MVJA 4N7JA 4P0TA 5B7PA 4Z86A 3DVSX 4WV3A 3ANLA 3RM3A 1DTWB 3L02A 1Z38A 1EK1A 1DRVA 1XAJA 3GJ4A 2FTKE 3L6CA 4OPMA 5JAIA 3FMFA 4KIUA 4UAGA 5E6SA 3T34A 5FADA 1DEXA 3RSLA 5B6PA 1X15A 1BCRA 2V6MA 1T0IA 1CIJA 2O23A 2C97A 2QUZA 3MJEA 3NGMA 3J81k 1VBFA 2P5SA 1DDGA 2BKAA 2VTDA 4W5HA 1QHEA 4MHOA 2JFUA 2BRUA 1RM5A 1F8UA 3KYJB 3EF1A 3JQGB 2HEGA 4OQNA 4PYOA 4IVNA 3WWYA 3LCCA 1SWWA 2C1EA 1DRUA 3PVZA 5IT9A 5DGDA 1U9JA 2R60A 4V0RA 2QMUA 3WP1B 4NATA 2QRGA 1R4NB 3H8SA 5ENDA 5J2UA 2W4QA 3A1CA 2WG2A 2HSGA 3HDJA 4LZAA 4ME6A 1BTOA 4C7VA 2JF0A 3NTQA 2CEKA 3CUWA 5ES3A 1R1DA 5KYWA 3TOVA 4G0UA 4CEIA 2KI5A 2VDJA 3PHHA 3RHTA 2WMYA 2DETA 5JNWA 1D5CA 2N9UA 1COWA 2Q8QA 3V48A 3ISJA 3HP4A 3QBTA 2JNWA 4H27A 4Y2PA 5IBCA 5MGBA 3K70C 1OD6A 2W42A 1QAQA 1VHWA 2BFAA 4IICA 1OYWA 3C3CA 2B6NA 4FYWA 4XIIA 4LDNA 5CCDA 3VYTB 3HI6A 2KBEA 2B25A 4LWQA 1ILWA 1JPUA 2IYEA 3E3OA 3PFBA 5DBFA 4MH0R 1R4AA 2FEXA 1LI5A 2R1UA 4MW6A 1LS6A 5EJAA 3SKXA 5AQEA 1IL0A 3TCKA 4WOCA 1FFDA 3F5FA 1LUAA 4X61A 3LDAA 3QPAA 3CYFA 4BIMA 2PZJA 3I5MA 5D8DA 2PMEA 1OGYA 2QV7A 1NVEA 4O5AA 2JFHA 3QG1A 4QFCA 4UU7A 4WFQA 3D8UA 5D87A 4HS4A 3JZMA 1KQNA 4KDRA 1Q1ZA 3UT6A 1RU3A 3LOUA 4X5OA 1RM4A 1XDSA 1C1DB 1PEDA 1SCUB 2J9RA 3C5VA 3V8BA 1D1QA 1NMEA 5IANA 1PGNA 3K0AB 3LRTA 2PXCA 5AMXA 3ZBUA 1JFLA 2CFRA 4AMGA 1E7SA 3HKCB 5CFRA 5JO0A 3IQGX 5JI2E 3A37A 3H3FA 3I05A 4JP8A 5GP1A 3K9GA 1K7FB 2VJMA 1ADGA 2AFHB 4KXQA 2FMIA 4MYSA 4LNHA 3PT5A 5GAJA 1TKCA 1W1IA 5JQGF 2OM2A 3HXLA 4WNAB 1LK5A 3GNTA 5KIAA 5C81A 1J4AA 1E5QA 4OP1A 2VA9A 3CNNA 4EJSA 3UFXA 1G21A 1JGTA 4TMVA 2C9MA 1GEEA 1FLNA 1ZUNA 2HRQA 1YE5A 3LCJA 3VR3A 3HA7A 2FHPA 3O4HA 1IZ7A 2I5PO 1LB1B 2BE7A 5KPDA 1VPVA 2Z09A 3AEXA 2UZAA 5L53A 2Z8YM 1WG8A 2YFYA 4KMRA 4Q37A 2YDXA 4RKWA 3MJFA 4DJJA 5EL0A 2GYYA 1DQPA 3B5JA 5AUQA 1QJ4A 2DX7A 3ND9A 1E9CA 4F8EA 2FFJA 2ONKA 1E96A 4C0AC 2OBMA 2RFLA 3G9TA 3OECA 4XCQA 2EFHB 2YWRA 3R76A 4AK9A 4AZ0B 2RK6A 4A0HA 2SBTA 2V5AA 1BDIA 1L5MA 3EJ6A 1DTSA 1X8LA 2RCNA 2Z43A 2B0JA 3CH4B 5H9VA 4UVEA 5FX2A 5JXIA 3LOPA 4E6EA 1DLJA 2P8JA 3AM4A 3FE2A 3IAEA 2REBA 3UKOA 4MUEA 4RVOA 1DKNA 4G25A 4REQB 1VG8A 3EUAA 4IX1A 4JKOA 2YOFA 4WACA 4X7BA 2VPQA 4HGOA 2R65A 3GLSA 1U5BA 1KYXA 1XKLA 2G8LA 4OJMX 1SIWA 2JFFA 3NAMA 2CD7A 1GL6A 4FX2A 4WPGA 5DHTA 1E4EB 3TL2A 5MN5A 4JD5A 3B5EA 4AKTA 1XQYA 2XQKA 1ZEMA 2BGNA 3NWPA 5IH3A 5FF9A 1OUMA 4EGSA 1O94A 2E89A 3E7XA 1ULUA 4OHFA 5FOUA 5AXAA 4HHEA 4DUYB 5FLXA 4CF5A 2R86A 2YXLA 3NHYA 4R5HA 4X92A 4L0QA 4LV8B 5LP6F 3QA9A 3U3XA 3IE2A 3B52X 5CDSA 5F98A 1U1FA 1D8AA 2IYNA 2RGDA 1JIVA 1XPOA 1BE8A 3RCBA 4WZ6A 1ATZA 1MNQA 2CNOA 4BYGA 1ORRA 2YVLA 1NQTA 1Y80A 1EA5A 3KPUA 4JR0A 1PFGA 1LPSA 3VU0A 3BXFA 3WGLA 3AEYA 2D2IA 4WCFC 2XCUA 3LIPA 1ZP6A 5CD9A 5D84A 2P1DA 4U1RA 4GRDA 5CJPA 4UHDA 3H2IA 2W43A 1U4SA 3D4PA 4Q05A 4RTOA 1V7CA 1PGJA 2AJCA 1YA4A 3G1TA 4WUVA 3HI4A 1MZPA 4BE7B 1EM8A 3D2LA 5J9FA 2UZ1B 1UXGA 4TYYA 2Z30A 1JU3A 1Y8AA 4HFJA 1JR6A 4OATA 3C70A 4R8MA 3AIKA 4YRBA 1OH6A 2ISQA 5BMVB 3GOQA 5K8JB 4IO1A 2P4SA 2WJHA 5FBKA 3RJ5A 4LEIA 4ZANA 1GG2A 2WVAA 3KG2A 3OJ0A 4L22A 1ZCBA 4FNOA 1FVFA 4QFBA 1RMTA 2BGIA 1H8HA 1NJFA 1TVEA 3GMSA 4YPFA 3GPDG 1TX4B 1CUDA 1S2MA 1CDZA 3A4NA 4HATA 3UGJA 2OQIA 3QU4A 4ESOA 1P1FA 3RYTC 2VRCD 3LF2A 1Z9BA 4M1SA 1KH1A 4MP8A 3MB5A 1OPXA 1T6XA 4WZAB 4AF7A 3MWLA 1XJQA 4MULA 3AK4A 3ZX5A 1C9EA 4R9NA 1JDTA 3QUCA 2XMZA 1I10A 2QRVA 4CQLB 4HRAA 2FPSA 3MT9A 3PBKA 1MQ9A 1P2DA 1GZHB 2DLDA 2GYWA 3O2SB 4KN9S 5ALUA 2B2CA 4O63O 1E6EA 2WU1A 2GGSA 1N0WA 1GL9B 1Q0SA 1ZZGA 4OTZA 3T3PB 4TV8F 1KEUA 4P5PA 3Q9UA 4W7HA 5EHNA 5GV7A 2FJ0A 2HBQA 1FYFA 5KTNA 3NMUF 4JVNA 1L7AA 3H4MA 2GHRA 1X7XA 3BQ9A 5KJCA 4KR9A 4XUEA 1RXWA 4PPYA 5B55A 2PQ2A 2Z95A 5TQVA 3IPAA 3UWDA 1N4DA 4ETWA 5JQWA 2HHLA 1E9EA 1UQRA 3LGSA 3NBYC 2NXNA 1N0VC 1QTIA 1BXRB 1P18A 1UOQA 3O3OB 4HNRA 1GZSA 3W1EA 3R0ZA 3RQSA 2HFKA 1RXIA 3L7JA 1TM4E 4WZZA 1GVNB 1FP4A 2WSSD 4ZVRA 4IH9A 4XWGA 4F86A 3GA5A 3PQ6A 4MGHA 1XJCA 2OHVA 2QW1A 2VDMB 4O4IA 2YXBA 3EZ9A 3ELBA 3E1KA 2XMQA 4QDOA 2A7XA 1N1GA 1AY0A 2XYQA 4FU0A 1YAHA 3B12A 4WH0A 1SCBA 3S2UA 4JT4A 3AL3A 1FIUA 3COVA 5EKXA 4W5TA 4DOMA 5H68A 3A2MA 3SZUA 4C29A 2QVGA 4H6XA 2Y4OA 2P3OA 1PYDA 3G3EA 1TLLA 3H17A 3MTJA 4XPZA 1L5QA 1WY7A 3KB2A 5LYYA 3EGXB 2CUZA 2X9GA 2GTPA 5JMTA 4RANA 4CN8A 1PGQA 4P5DA 3SXJA 1PFQA 4H7JA 3ZNPA 1K06A 1T5SA 1T3ZA 1EI9A 3OTOB 4F04A 3P0IA 3LXRA 4FFBB 1NZJA 2QXYA 3FCAA 2QRPA 3PLRA 4UREA 3TUIC 2MINB 3GROA 3VC2A 4ALLA 1M9NA 1JHZA 4WNIA 1YZLA 1QQTA 3OU7A 3VC3A 3E5HA 3UTCA 4B83A 2YVQA 4CETA 4DV4B 2P8SA 5EPEA 3IEMA 3PQDA 1JG7A 1XRLA 1YVUA 4P7JA 4UMFA 4V1CI 4YY3B 2NYVA 3O1IC 1V6CA 3I5AA 1A2OA 2Z9CA 1PX0A 3DVRX 2NZUG 3FGNA 3AETA 3FPEA 3PDIA 4J9VA 3C97A 5TDHA 3TCXB 2XCIA 3OPVA 2C4VA 5CDYA 2GD1O 3IUYA 3T7DA 2AOWA 4KQHA 4BFZA 2QZ9A 3S2ZA 4P93A 4BJ1A 2OAEA 4IXNA 4DCTA 2JLZA 3UG7A 1NP7A 5KKCA 1UDBA 4RPJA 5A2GA 3QFCA 1ZA1A 3CBQA 4P3XA 3L4SO 4U6NA 1TZBA 4ZTBA 4D79A 2WJYA 3FYDA 2D13A 3O74A 3RTBA 1F2UB 2C88A 4UVHA 1KI9A 3H4TA 4BWGA 3VA7A 1FSPA 2QJWA 2W8BB 2ZW9A 4M7RA 2ZTVA 1W2HA 3LX4A 3RV3A 4V0SA 2Q5CA 3WO1A 1NUTA 3RUEA 3NWBA 4KQ9A 3KT6A 1W4CA 2CVZA 3OX2A 1HLDA 2HYDA 8OHMA 1C80A 3G2OA 4HXGA 4AG6A 1C8KA 5AVTA 1TM2A 1NZDA 4I4LA 4FK8A 1EFPA 4MWEA 4I2NA 3FPKA 4CTOA 5CB4F 5ADVA 2VSQA 3K32A 3K4PA 1IQUA 3I6ZA 2YMMA 5JSYA 1NDHA 1ZESA 2RK4A 3JTEA 3SJCA 1D8TA 3VU1A 3IURA 3TINA 1JHUA 5G4KA 1F6BA 2A2ZA 1VGVA 4U8GA 5ITVA 5ELXA 1SVSA 4BMXA 3OEEA 3RU9A 1U99A 1GA4A 5DVZA 4BO3A 4RS3A 4GGPA 1YFZA 4NU6A 1DCKA 1GVHA 2GXSA 4OQXA 4RPLA 2HJRA 2ROQA 3QV1A 3WICA 3NV7A 1Z6XA 3DBHB 4HO1X 3WMFA 4YJ3A 1KO4A 5JNTA 4NEHB 5K4HA 1F2TA 3S55A 1RW4A 1XCGB 3DO5A 2IEAA 2OLEA 2PLAA 3EGWA 3QVGA 1JR2A 4ID3A 4OYLA 5EKSA 3JQEA 1IEWA 1JFTA 5AOVA 1U8UA 1T6NA 3NTUA 1VMEA 5HYVA 1I4LD 3KYDA 3PXUA 4M1OA 2PZBA 4PVCA 1XVLA 5LXTB 4FHEA 2OBLA 5BT9A 1WD7A 5KJFA 4FIDA 3WS7A 1OFTA 1CDDA 3RREA 5L4LA 4IUCS 4G26A 3JQ9A 5HRAA 5F1KA 2P1RA 3OX1A 3ORRA 1LNZA 4HB2A 2ZROA 5BVHB 2AG8A 4XAQA 3VX4A 3OCCA 2X6RA 4RTQA 5ICCA 2PYZA 4HH0A 1BA2A 1LJLA 3VMFA 3RHZA 1NBEA 3A26A 3R4CA 1ZS9A 4DV2B 3KDPA 2RGEA 1EUDB 3IALA 5A6SB 1KK2A 1DQZA 1U28C 3EPKA 2BMEA 4GX0A 2QUJA 4KAAA 2XUFA 3ESXA 5IVDA 3FYHA 3KQLA 1CQZA 2FXVA 4X9XA 1O2DA 1TI7A 3W9SA 1BG6A 5EINA 4AQ7A 3NOXA 1JQLB 3SSAA 3HBNA 3BL6A 4F7WA 5A2QA 1SOMA 4H15A 1EGHA 5I7OA 5C8XA 3W6UA 1GY8A 3BCHA 4CFYA 5IFLA 4D3DA 3QE0A 5K03A 5GJVC 5GADl 4LOHA 1RIIA 8ABPA 1ZR4A 3GDWA 3K94A 3ZJ4A 1KVUA 1H94A 4PXYA 1A9TA 2QRZA 3L7KA 4FNAA 2REQA 2BZ0A 1TQDA 2IPAB 3VTFA 3ZH9B 3I1YA 3W6ZA 2ZP1A 2FX2A 1N5RA 4IDPA 4LBZA 2HQ1A 4NOJA 4P84A 1DE0A 4RDCA 4G1UC 3IUQA 4JLOA 3MWJA 3OU2A 5B1IA 1N1EA 1SUFA 4N41A 3TQTA 1RAFA 3GLGE 2JFQA 3EDQA 3IP7A 2VCYA 4CU5A 1U3DA 1EK5A 4REMA 3G89A 3TRFA 1L4LA 3UUFA 2OBFA 3N7UA 2PCLA 3Q9NA 4MR8A 3ZJ5A 2E4VA 4L78A 4J1QA 4MUBA 2WAYA 3VTKA 1VMIA 4W9NA 3SE7A 3SJBA 1N5IA 1ZWLA 4F8JA 4ZCRA 1I1OA 2RGAA 4M54A 1JH9A 3O21A 4I9HA 3HG7A 2F17A 2Y0DA 3BMXA 4OY3A 3V00A 2BFWA 4BO8A 5LP1A 2H1WA 1WIWA 5BYBA 5D1HA 4X8LA 5EKUA 1C8BA 2GCEA 3VR6A 1G64A 3ZKWA 3H2YA 3A3PA 3DT8A 3N2GB 1H5QA 3O9MA 1LBQA 1N3YA 3PVSA 2XCSB 2WWXA 2P9YA 1E0DA 2IKQA 4GBMA 5LA6B 2QLJA 1FS5A 4XYEA 1SC4A 2BTQB 3OZRA 3FYSA 1ZJJA 2JLCA 3SM9A 5IYZA 2UYGA 3HVHA 4C7OA 2Q3HA 3F3YA 5ENZA 3TSOA 5JZOA 4ZALA 1TZKA 2FUCA 3T9DA 2ODTX 1Z13A 4JL8A 4JUAA 2WF7A 1WMFA 5EE5B 1DKOA 1XROA 3JW8A 2GTIA 3JWHA 1QQ6A 1ULBA 3W5JA 2Q46A 2BM1A 2ZPTX 3DTVB 1M2VB 1D6NA 1N57A 3OPMA 4FC7A 4RJIA 3TTXA 1OSNA 2HMAA 4LHVA 4UHEA 3WAKA 4MR9B 2VUIB 4IJ6A 1M34B 2RHBA 1BN6A 1U9ZA 2FUNB 4K9NA 5LZ7A 5EJ8A 3HXKA 5BSUA 5C32A 4KX5A 3K2QA 2XDAA 3A0RB 2QW0X 2DB3A 2H63A 5AJZA 2JG3A 3GFOA 1Z0SA 1SBNE 2WJPA 4EDFA 2BSAA 2OHHA 5JG7A 5CDFA 4M0PA 5C0OE 1FNDA 3CISA 2FQYA 3UC9A 4FGSA 4EEXA 5SV2A 1D1PA 5EMJA 1MA0A 1KMHB 5DWQA 4A8JB 2GFHA 1Y1QA 4AO8A 3BJMA 1OI3A 2VCHA 5AJTA 1TMYA 4R0NA 2AHOA 4PXSA 1B2LA 2XB8A 4GVXA 1A4XA 5IMBA 2MSNA 2I4OA 3KETA 3DEKA 4LZWA 3W5VA 1XL1A 2P41A 4PEVA 3RI3A 7REQB 1IAQA 2FPRA 2BGUA 3FCEA 4JXJA 5H3CA 3F6CA 2CLMB 3H7AA 4LY0A 4NYJQ 1ZNQO 3HCEA 1QTQA 2XZDA 4HNSA 1JEQB 5FUBA 5EC8A 4LYFA 1VPWA 4Q9DA 1VKZA 4ZO6A 2WW8A 1G20B 2W37A 5B2ZA 4CIDA 4R8LA 4E2FA 1UKCA 2KLBA 5JTTA 4MUXA 1ZH2A 3E58A 3NJRA 1J8FA 5H70A 1JKFA 2KYRA 1GFZA 5EWLB 3ZZ0A 1G291 2IYRA 3T7KA 5JLJA 2DY1A 3B1KA 3G2QA 4FYXA 4NMHA 3DYBA 4LZJA 4ND8A 1DT3A 1DQSA 4HADA 4M98A 1DAOA 4N3BA 4TXJA 1LSSA 4X62B 1LLQA 2B3DA 2HNKA 3F7MA 3ZHUA 3O8QA 4ER6A 5CHYA 1AHNA 1C8LA 3BBLA 2FN4A 4LG1A 4M0MA 4JI7B 4RUKA 2GKOA 3D81A 3H3JA 5HCNA 4B48A 3HXMA 2GCNA 3N7TA 4PS1A 3IDQA 3L40A 3DTVD 3WNBA 4N5HX 2EL9A 5ETJA 4C5BA 4FEAA 4ZI5A 5FIUA 1Y3DE 1RYFA 2BEVA 3BFXA 1X7ZB 4MZDA 1QXSA 3ILYA 1Y42X 4TKLA 4WI1A 5AP9A 2V6BA 4JS0A 5KOJA 1NW5A 2QBYA 1RP7A 4IKPA 3RJ9A 1ACJA 3HRKA 1D7OA 1P5ZB 2BFPA 4RKQA 1OLSA 2ABWA 2PX0A 4DDHA 1RTTA 1N4AA 1CY4A 4BWFB 4DUGD 1YQQA 3A04A 5AI4A 1JVSA 1FMJA 2ZIUB 4L3WA 4ENPA 1Q2UA 1HDCA 3DE6X 1CIPA 3IIEA 4D4JA 2OOKA 3QQPA 4RYLA 3ECCA 1KXZA 3I0MA 3JD2A 2XKAA 1RM0A 4TV8A 3RFCA 3AI1A 3E22A 4E2ZA 4EPWA 2FMUA 1XU4A 4A15A 4Q1EA 2BBTA 1N92A 3GD7A 3ZOZA 3LF1A 3PPWA 4A27A 4U2FA 1QKIA 2X6QA 2XVYA 1LPAB 3FPCA 3R20A 3CTMA 1SUWA 4HZUA 1SCAA 1O54A 4MRMA 4QECA 1XKXA 1PGPA 2H2DA 2UZ4A 1RXVA 3WGVA 3M6IA 3NWOA 2JAWA 2JGLA 2W6CX 3O38A 3IMCA 4I08A 4DMFA 3UAGA 5E9WA 4J7UA 1RRCA 2YWEA 1IEXA 1T8SA 4BCCA 1OHHA 2I78A 3BXEA 5CFZA 5DIFA 3QPWA 2XCTB 2FPGA 3E7DA 3RKRA 3ZGOA 1DBQA 3D4LA 3AH8A 5BR7A 3RWMB 5IJAA 2G71A 3OZEA 4NZ9A 4CVNA 4HRVA 3UOWA 4ASUA 4DIEA 2QAGC 3ZNQA 5CB0A 3H9UA 1UZLA 4BFLA 4ZJYA 1RLUA 4XX1A 5JWOA 5JT1A 4OHBA 3RTDA 2IH2A 2VT2A 3D4IA 1E2LA 2PZGA 4R3NA 4RPIA 2XKJE 3QLJA 4MMZB 1JB9A 3O7MA 3ADPA 4CR6A 3RKUA 2MR6A 2HXGA 1XJ0A 1ZSVA 1J0AA 1PD1A 1WXWA 3AKEA 3FKQA 2ERXA 4EY5A 5HGXA 5FBRB 5KYGA 3E9ZA 4EW6A 1GG9A 2OG2A 3C5EA 1PT9A 1AKQA 1CJKC 3I39X 4MI3A 1TF5A 3FSGA 3B36A 4GRIA 4J43A 3FCYA 2R00C 5L4SA 1BGXT 2A5FA 4LHXA 1WMBA 3BRQA 4BLSA 3T3HA 1M1NA 2FFHA 1E5VA 1QPBA 4KN8A 4EX6A 1OA0A 1EWVA 1OFIA 3PWZA 1RZ3A 2B21A 1SAYA 2JPDA 3AEKB 5DM4A 4PX2A 3USES 1JDNA 1U3VA 3CLTC 3DBRB 3DUWA 3LYLA 1QU3A 2EX4A 3TD6A 1VKOA 2WWVD 2VJPA 4YRFA 3LYHA 2D1TA 3S81A 3ROTA 2QKYA 4H7KA 3A1SA 4EAQA 2VOEA 3KOMA 4L7VA 3DAHA 3PHBE 3GT3A 1YZVA 2J09A 5JS1A 3ACDA 3EAGA 1JRLA 2UVDA 3F0TA 3M4ZA 2V7VA 5ICMA 2OD7A 4HEA1 1KMIY 3CO5A 2DSTA 1CE8B 4NENB 4PAWA 3VXKA 3M6UA 2QTGA 1QG6A 1V43A 3GEGA 3MXOA 4OHWA 3MWDA 2VK8A 3LQQA 4AY4A 5JH7F 2NLOA 1AKRA 2WMNB 2HNBA 3P0HA 1VBMA 4AUNA 3MPOA 1R5NA 1YKSA 2OXRA 1GAQA 4KV9A 3BFJA 5K0EA 3U0VA 3VKHA 1FDVA 2BUBA 4KN6A 2C92A 4BBJA 2IVFA 2WZDA 1W5BA 3L9XA 1UJBA 1Q7BA 2GPYA 2GTHA 2R5NA 4K6CA 4RIHA 4UULA 4OBEA 3B9QA 2O8CA 2C5GA 3VGJA 5IH7A 1YDGA 1MABA 3M1IA 1PDVA 2IT1A 1A2KC 4BE4A 3V6MA 3K73O 4BKUA 1ZG3A 2G0AA 1UKBA 3ND5A 1NY5A 3CX6A 1QB8A 4R9SA 4LDJA 5HBGA 1Y33E 9LDTA 1EXDA 2HDOA 1JKJB 1JR3E 1NJ5A 3WV4A 3HB5X 1ZBQA 3QENA 2BFMA 5IEBA 2C4MA 2RMKA 4C01A 4CKCA 3Q4GA 4ILKA 2AKAB 2EZ9A 1H23A 2I8CA 3I1FA 2XEXA 1TO2E 4NCIA 1E7YA 3AY7A 4FGLA 5F76A 1ZR2A 5I9NA 2OR3A 3CLHA 4PZLA 5KNBD 2R1TB 4UHBA 4Y2JA 4W6QA 1M2HA 2HMUA 1T13A 2R47A 4H35A 4M9SA 4W82A 2JANA 3RR2A 4E12A 2ZAMA 3EVBA 3D3WB 4O08A 4P2BA 4FR5A 3OQVA 5H02A 1KPIA 2CUKA 4O02B 1DRKA 2ZBDA 2Q7XA 3W2FA 4KRFA 2JLRA 5T6MA 1Y63A 1HTWA 3B48A 1ZMBA 3CN7A 5JZVA 3UQYS 4J9UE 3AQ4A 3AHCA 3A10A 4XCVA 1H05A 3E3LA 5D3KA 3PHJA 1R66A 2WT8A 1Y6QA 1XXHB 5KHAA 5LSAA 1MB9A 1ODKA 2FZ5A 1ZOPA 4GDMA 1DX4A 4IJMA 2OFPA 4M0UA 5TE9A 2RH9B 5C8DA 4KXVA 1WB9A 4KQEA 1TD9A 5FB3A 3PFWO 1DAFA 2BI8A 4F3KA 4I14A 1P9LA 2IE0A 4JN6B 3U4CA 3K16A 4UPVA 4EQ6A 2POCA 1QRUA 4W8HA 1CFZA 3MWEA 3NHMA 4C0HA 4ZCMA 4FYHA 2DP4E 1U2DA 3V4FA 1XEWX 3K0SA 1ZIDA 2JIBA 4MO2A 4M86A 1OZ0A 1XA4A 4GPIB 4IEEA 1XT6A 4IGEA 2CXOA 4RAOA 3O8RA 1IHUA 2FK8A 3GP5A 1DDIA 1SUIA 1U0LA 3TLBA 2YHBA 2P4HX 3W8EA 1VIYA 2BISA 5HM6A 5KO2A 1SVNA 4DXDA 1VG0B 3STYA 5G1PA 2D4AA 2ZWOA 1DBSA 1RPZA 1G6OA 3BE5A 3NHLA 3TZQA 5PGMA 2BFCA 2DPGA 2RC6A 4TL9A 1G3IA 1IVYA 1W88B 3UY4A 4PGGA 3CXUA 3KU1A 4GU5A 4E5DA 4FE4A 2PZ8A 2JRLA 4YAOA 1YBAA 2PXHA 4ZVUA 3IMKA 1GZUA 2JEYA 4F9FA 4KR3A 2BFBB 3FAZA 5FNZA 1X87A 3O2JA 3RFVA 4DCJA 2RK3A 4FN4A 3MG9A 5KTSA 4ZGWA 2NMVA 2ZBQA 4ENTA 2LNDA 1FW6A 4V0OA 1QGDA 1FP7A 3DZCA 1UMCA 5F7JA 1Y81A 1Z88A 1DDOA 3ENWA 3G0OA 4TQ9A 1H66A 2V7GA 5DH9A 3TLGB 4D97A 2H5EA 3P2OA 3F6EX 3K1YA 5DCWA 2A94A 3KQQA 1QNLA 2P9BA 4BLQA 2C5BA 3JRWA 3I2YX 3ASVA 2EHDA 3K05A 2G40A 4RVCA 5AK6A 3WHIA 1WDTA 4UNNA 4XIGS 2Q0HA 4DLBA 3AF2A 2BEJA 4R6WA 1CJMA 1A4RA 3K4QA 3BM5A 4GEKA 3K0BA 3IEVA 4LSMA 5CH8A 1UOPA 1HA3A 4UHHA 3W4KA 2H06A 4N5MA 2ZR7A 3RG8A 2I1VB 4B31A 1WPRA 2ZI7A 4O2BB 3CM0A 4C08A 2OENG 2PT7A 4F6RB 5JMWA 5IVHA 2EG5A 1EVYA 1GITA 3F46A 4BUZA 4RACA 4I4IA 2XF8A 3NUGA 3EQ6A 5TPZA 4W4TA 2X58A 3THYA 1ZNWA 3ABQB 3JQBA 3BCSA 4HXYA 4S0XA 4ZOLF 3LWBA 2EIHA 1GRVA 5CJ2A 3HA2A 2WYHA 1Z35A 2DT8A 2FPIB 3QEBZ 1RKQA 3K09A 2MU1A 2H57A 3O82A 1FLVA 1VGRA 3L4JA 2FRDC 1GNSA 1CIVA 1XIVA 2J5QA 2BMJA 3PA6A 4CG3A 1RNLA 2WUGA 4ZZIA 3A1FA 1IONA 4LX0A 5JZSA 4KC0A 2PUTA 4J7XA 3TNYA 3TR0A 5C7YA 3KQHA 1R0XA 1XLUA 3G6KA 1ISJA 3I6YA 1M7GA 1W0JA 4YMLA 1Z16A 3IYLW 1ODJA 2GJ9A 1IXSB 4XDHA 3BD6A 1T9AA 1M2JA 3W8FA 5F77A 2FOIA 2HJGA 3OCUA 4NDNE 4URWR 4GM0A 4BEWA 1P73A 1XEAA 4P98A 1JYSA 1CZKA 3FNHA 4DMGA 1MOSA 2H4ZA 1VYHA 3KXKA 3TNDA 1U7UA 3SSNA 1GZ4A 4MVJI 4TTSA 1CUSA 4O3MA 2ET6A 2PH3A 5EQJB 3S0JA 4ZVKA 5DM2A 2ZRPA 3ZY3A 3W9UA 2HQOA 4CCYA 1G2IA 4L8WB 5KX5A 1E4OA 2DUMA 2GBLC 2Y3IA 3BRSA 1E62A 3RJMA 5HDBB 3TGPA 1F5NA 4Z0NA 3H87A 3WLLA 2B8NA 2G4VA 4PO1A 1FQJA 2J7PD 5EXSA 4F11A 4DDWA 3DDUA 4LHZA 5IJXA 3MUOA 3FDZA 4MUJA 4V0QA 3VDMA 3ZVMA 4XX0B 1KS2A 1VE9A 1ZQ1A 4COOA 4BPBA 4N76A 3L8MA 5JBNA 3HU5A 1J09A 3HMKA 3RFUA 4ZO4A 3SBOA 3ZWNA 1T3HA 4MV3A 3I5XA 4KQCA 1Y98A 1H3FA 1IWOA 4NEQA 3GRFA 1WL8A 1XYVA 3WYBA 3IAM1 4L8YA 4Q03A 3KKEA 4PLFA 3ONVA 4PZDA 1P31A 5AUNB 4HAUA 4WNCA 3GG9A 1Q1AA 3F5SA 3S68A 1UWCA 3BSYA 2NO0A 1O5OA 5JASA 3V4RA 4EHDA 3PKIA 4F4CA 3ORFA 3Q1KA 2W6ZA 4H9GA 4OK6A 2HV8A 1XFDA 3LFUA 3EPPA 2DTDA 4K87A 5DLQC 4S04A 2XXJA 3RK4A 4LS3A 1CYDA 1ZGHA 3C14C 3CLUD 3QKTA 4K26A 1S01A 4LZOA 1YZQA 1J99A 1GGVA 3NX4A 4AMVA 2E6KA 4JBXA 1G2OA 3NQ41 4YALA 1JBKA 3IPXA 3RVBA 4WGGA 3FMOB 4QELA 5E6UA 4B87A 1N7JA 2ZRIA 4N47A 4NTZA 4E5MA 3ELUA 2ZBPA 3QNUA 3KQOA 4C06A 2Y1DA 4YJ2F 4QG7A 3REFA 4FHFA 2YWDA 3VKGA 4CMEC 3ITNA 4XPIB 1EB8A 1U1GA 1A9PA 2BFFA 4ZCLA 2V7XA 3FZQA 1KAQA 4KQWA 5FOXA 2R5WA 4RD0A 4YUWA 2ZRHA 3JAKB 3L01A 4U02A 2BZGA 1NBAA 3RHFA 4GO1A 2I7VA 4OHYA 1HI9A 5HM8A 2AYYA 4QNMA 3WIUA 3ZHOA 3I45A 2WA1A 3K72B 2VPZA 4U7JA 4MDYA 4CG1A 1L5VA 1CRLA 2VBGA 5DNEA 2GJAA 3IJPA 3MTQA 4BNFA 1QZZA 1H1DA 3LUPA 1A8UA 1E1MA 3LVQE 4RQAA 3JQAB 1EGVB 3W5IA 2VWQA 1FZQA 1N9GB 1RTKA 2O3SA 4XE5A 2VHTA 2GFQA 1OILA 1HV8A 3F7OA 4CLOB 1YQXA 4HQNA 2PR7A 1U8AA 2QGZA 3JQ6A 4FFWA 4WOPA 3NCTA 4DQKA 1ZK0A 3JQFA 1KWKA 4M9ZA 5GY7A 2Q8PA 4NMLA 3D6UA 1HYBA 1PR3A 1JTFA 3DO8A 1JLLB 3DMTA 1CCWA 1KZGB 5CTJA 3UK2A 1VL2A 3EIFA 3HB9A 1C7IA 1YIAA 3FJ1A 4CLRA 4WKOA 1LDYA 1E3WA 4L76A 1I01A 1D2AA 1PT6A 2OL4A 3FCOA 2G9NA 3RSFA 4FD2A 3NZEA 2PX3A 3I6QA 2GILA 2UZ0A 1X1AA 3D3QA 4LX8A 4TKVB 1BHJA 4FDUA 5COAA 1IMJA 1RXUA 1U0EA 3GLTA 3V32A 2L0XA 4JJ4A 2ZBUA 3UUWA 1P2VA 1P1IA 3UFBA 4PSUA 4DN6A 1XQWA 1QDEA 5KSZA 3BWMA 4WLNA 3G5LA 3TLAA 3TMKA 5IP5A 2V03A 5T8KA 4BQEA 1KBOA 2OB1A 2B4RO 5AI8A 2ASEA 1N1MA 2WV7A 1GNVA 1KMCA 3ZCXA 1K89A 3DUFB 2NW6A 4I46A 2QT9A 3GEBA 1TO1E 2EKZA 4N6GA 2OXIA 1DIBA 2WD9A 1ZN7A 2XTZA 4EJMA 3OM0A 1IXYA 4HDMA 1MOQA 1NI4A 2V4MA 1A5TA 3D6TB 4YRTA 2E85A 3HCPA 5LLSA 2BDEA 4DQUA 5JRZA 2DHRA 1Z4QA 2FGKA 2O0JA 4RHCA 5TGDA 2Q0SA 4OKIA 1K0FA 1WY5A 2JLAA 4CQMA 3BZBA 4JSTA 4H77A 5KAMA 1Y8QA 4Y2TA 3TBHA 2XQVA 4DR3B 1N2OA 2XUPA 3U17A 2ONCA 3CWZA 4MGYR 3BVPA 1DARA 4N7MA 1UODA 2ZR8A 2AJ8A 3DDSA 2PLNA 3K6RA 5JH7A 3PJFA 4A91A 3WSWA 4MWSA 1I33A 2IBSA 3JQAD 2E4WA 3N2KA 1EG7A 3AINA 3A1VA 3AHDA 3CUEF 3HZZA 4NCNA 4H1WA 1OU0A 1TT5B 1U1IA 4GM4A 4UE6A 3TOCA 1UT6A 5DGIA 5EPOA 5TF0A 5ARBA 3PA8A 3HO8A 1XCLA 1YR3A 2EWMA 4AZVA 2DM6A 1RQLA 3HGMA 3NP9A 1V6AA 1FUKA 3DE5X 1BA3A 3PDWA 1WZIA 1R50A 4Q3AA 2FFRA 2J6HA 5H4GA 3C1UA 2QU7A 1X2EA 2W90A 3R6TA 4E33A 1LPPA 2GPSA 3DYIA 5EP1A 2HL6A 4PE5B 4HVCA 4I9NA 3G85A 4DLAA 1PJAA 1Z4LA 1SXJB 2HJHA 4G67A 1Z82A 4QICA 1WPGA 1EFRD 1Q16A 2EKBA 1E5LA 1SJ9A 2MT9A 3OQNA 2XZLA 1XQ9A 4MPJA 5AVJA 3V1NA 4KQIA 3WNQA 1KI3A 1TA9A 1ZVJA 4OAPA 4K2AA 3D8NA 1VP3A 2IGBA 2YN2A 2Q9BA 1BOOA 2D0DA 1WU8A 2GHIA 2ISCA 3E48A 4AB1A 4WASA 4YT8A 3CIFA 4NPAA 3FFXA 3W3AD 1M5RA 4AJLA 1B0AA 4AY6A 3AFIA 3EGDA 4M7WA 4L51A 2W6QA 1JFSA 1C9YA 4OU5A 2HJSA 1QH1B 1P9WA 2N1BA 3H86A 1HO3A 1LX6A 3O4GA 2GWRA 3UWPA 1QGAA 1ZRHA 3EQ7A 9ABPA 1JYFA 3GJ6A 4GZ3A 1JHPA 5E7IA 3UZUA 4IV0A 5FOVA 3K6KA 1EH5A 1USVA 1HM5A 1QIHA 1RQRA 1GA6A 1X86B 2FEKA 3CUYA 2E49A 2XD4A 3OTIA 3PSAA 3H16A 5H59A 1NL3A 1SFRA 3EFHA 4RVDA 2AN1A 3HDTA 1JYEA 1YMQA 1BDMA 1ZN2A 5YASA 2PPVA 5CFPA 1Q0TA 4O4HF 4MUYA 2ZSKA 3UN1A 1G6HA 1WS6A 1WEKA 1YHYA 2PMDA 3KUCA 1A5ZA 3ONFA 1M1XB 4DA7A 3BXPA 4GX1A 4RSRA 2V7BA 2UVQA 2VPIA 3AYXB 4QOHA 1J0EA 2AFHE 2DC1A 3D5EA 2ZBEA 3CVVA 1GPDG 3QE3A 1S9DA 1UADA 3AFHA 3NDRA 1RWPA 4FCCA 2PSEA 2JCYA 5K3FA 3KQTA 4D0NA 1X9IA 3CNLA 3LA6A 2VP5A 3MLEA 1SVUA 3KOUA 4YMSA 4Z6KA 1QS0A 1TUEA 1UBSB 1XZCA 3I6MA 3MQFA 1SEPA 4RQBA 4RY2A 5TQ0B 5JJLA 1C4WA 1C7JA 2FGJA 5BR1A 3H1EA 2VZ9A 2A1UA 1R6VA 5B7GA 1S2LA 2WA2A 3BN3A 4TXMA 2BLLA 3H19A 1RJEA 1EVLA 1YQGA 3LT0A 5JW6A 2O8FB 2HSJA 3PXDA 4ZA2A 1XF1A 2FX3A 3IXMA 4CBVA 2IHBA 4UVGA 4JC5A 5I7EA 1JIJA 3KKKA 4MB2A 1JN0A 1LK7A 5IARA 5K0GA 3NNNA 1Q20A 3TECE 3KQUA 1FYDA 3COYA 2DG2A 3TR5A 4DBVO 1I0ZA 4MRPA 4ZKDA 2HA0A 1JG4A 2BF4A 2EBWA 5CYGA 2OD2A 3FWNA 1P39A 3ORYA 1E9BA 1JMYA 5ALVA 3MTBA 3BKWA 2RHJA 2ACVA 4M6WB 1M2GA 1K3TA 2FLKA 2QPAA 5K0JA 4PQRA 3CX7A 4LKRA 4BV3A 1GUAA 4PYMA 3DOOA 1QFXA 3FIUA 1TDJA 2AI1A 3C3DA 4IOJA 5L3RA 4DXAA 2IZ0A 4I1PA 3VH1A 1NSYA 2P62A 4AD8A 3ZHBA 2L17A 3PXGA 1P2FA 1ID1A 3A6DA 3Q88A 2DWOA 5C1BA 3PXAA 1BDBA 3BD9A 1PJRA 2HLHA 4PSCA 4YMGA 5EOVA 2FN8A 1DOHA 3SDZA 2DLCX 2QRQA 3QVVA 1HT3A 4ZOLA 4G9BA 5FI5A 1UIMA 1LC3A 1W36D 1ZMXA 4PSVA 2B1IA 1QIMA 2RHHA 3VKUA 2WV9A 4KSBA 4EY8A 3TLEA 3JAWA 3MINB 4C7BA 4BBZA 1M2NA 1MVOA 2ZKLA 1FFHA 4PZ0A 4R2IA 2Q2QA 2ID7A 2GPBA 3FZEA 4YDRA 2HBZA 3LVBA 1RFGE 4WE3A 2V98A 2PSJA 4LDZA 3CFYA 5BOVA 3B70A 3K1JA 1UJ4A 3Q7PA 3T3EA 4AURA 1F4PA 5B58C 5L3QB 4ZQBA 1A8IA 4UM7A 3SVLA 3TPFA 4L4ZA 5LJLA 3WGNA 2WSIA 4RK5A 1I7QB 2NIPA 4GYKA 2CJWA 4D92A 5FL7A 4Q4HB 2EXXA 3ORQA 4X1OA 2J31A 1UFKA 1PJ3A 1ZH6A 4ZYUA 3CPHA 3HMQA 4US2R 2B8WA 3DLCA 4ZV7A 4P7BA 5FKJA 1TUGA 3DAFA 4ZXPA 1EDBA 2C98A 3R0JA 4P3YA 2JFBA 3TL3A 4IF6A 4NU8X 3GFGA 2YWHA 4PTLA 1RYDA 4XRRA 4C76A 4YIKA 2YASA 1VLJA 3C7CB 4ZQGA 1U1CA 5IC6A 3P2JA 1NHWA 2QTCA 4PPQA 2FEWB 3HZRA 1FRQA 2F4NA 5CT6A 1D4ZA 1HR0B 3C41J 1A5BB 1J2TA 2CCGA 3EDOA 4L4XA 4JXZA 1AQNA 1O5IA 2WNIA 4PO3X 1ZSNA 5J23A 1XC7A 3KWFA 4B3XA 1N5DA 3PXCX 4ZOAA 1HE2A 1U5CA 1MENA 3Q10A 1TKRA 1HRKA 3OE7A 1Y9ZA 2BDUA 3D4NA 2OG1A 2Z6AA 4WOJA 5AQ1A 1AZTA 4QM6A 1DAGA 2DKNA 3ZVLA 1GLGA 2H31A 3G0CA 1C3LA 1VCHA 3C6ZA 1TMKA 2GD0A 2HGSA 4HAWA 2J5BA 1ZPDA 1WDLA 4N8DA 5GJWC 4EHFA 1EB9A 2Q5QA 6ADHA 3W34A 3DBOB 3RFFA 1S3GA 3DZGA 1LEHA 1OFUX 2AOTA 1PK9A 4MR7B 2YHAA 3HA5A 1L3IA 3T5AA 2FEMA 5F21A 4QDZA 1A76A 1MVLA 4FNMA 2IF2A 3TXAA 4OI0A 3F4BA 2G1UA 3RBVA 1YJ5A 1TU0A 2A4MA 3V3TA 1DMSA 2W2OA 2ADOA 4N6NA 1WXGA 1QORA 2GF2A 4LVCA 1YZFA 4LPSA 4LCEA 3TCNA 2OFFA 2CFCA 4WXYB 5K1ZA 1TUIA 3AXTA 4NE9A 2ZVQX 3DE7X 5FTMA 3FF1A 1A1SA 3H9CA 3I8OA 4H4CA 1OPRA 3T54A 4BLPA 2PZFA 4Q4AB 5K3OA 2WJ6A 3GVCA 4F12A 5K8UA 2ZJ4A 4YJ2A 1UBKS 2ODQA 3SSOA 3A9CA 4KACA 1JFRA 3VNRA 4DADA 1Z8DA 3P0JA 2W00A 5DK6A 1S8OA 3ONWA 5DP1A 4JVOA 3H5NA 3SY8A 1FK8A 3TIIA 4OGWA 2GBCA 3SR4A 2AG5A 2W4MA 3WQRA 4MGKR 1NUPA 5CGQB 4ZZ2A 2XYGA 2LGJA 4XUCA 1SZJG 3EXFA 4RTPA 1LVUA 3GRUA 1EJ6A 1NNSA 2P78A 3WGHA 3HYTA 4ZO9A 5DLEA 3IKVA 1T3SA 1RWOA 3GH3A 2F6RA 1XZBA 1WHSB 2C00A 4LPKA 4RZ3A 2D3WA 5IBPA 1FTWA 2CN1A 4HD8A 4GBJA 4KGZA 4E5KA 2JAXA 3K15A 1UWKA 3FUCA 4H3SA 4NFSA 3QU7A 1T2VA 1O6BA 1IHYA 4CG0A 1NXQA 2W6ID 4XZ3A 4F93B 3TFOA 3HRIA 4OD0A 3SZRA 3QJYA 5FTLA 3AI2A 2YVKA 3S99A 2FDCA 4BMPB 5BQFA 2EU8A 2PLWA 5CLHA 4AP6A 3ZWXA 1QGOA 3BSSA 4DZZA 5JPCA 4QA9A 4JJFA 3KJQA 1BS9A 4HWKA 1RHJA 4IYRA 5AI0A 2RG1A 2DR2A 1GRCA 3DV9A 5DEOA 1R9JA 5FWYB 3NASA 4X6UA 5DSZA 1OT3A 1GILA 4QPNA 3SGLA 1E99A 4J2HA 5HPYB 2ZGVA 4TV9F 2XWJI 1L7OA 4L08A 1Y1KE 3N2ZB 3NHZA 1KFJB 4LGYA 4WZBA 3TRDA 5KSWB 3INGA 1CVIA 4CODB 1V7ZA 3P20A 3UKDA 1KK1A 4JOCA 2XTMA 4XQGA 2QI9C 3K6JA 2FOLA 3TXXA 3D7RA 4RFSB 2NSYA 3KTAB 4PNPA 4JLPA 3KZKA 1PG2A 1MF7A 2I1QA 4HWRA 3B53X 3JY6A 4KO1S 2F62A 3K9HA 3KE9A 1ZNYA 1H2HA 4L72A 1FA9A 1P7CA 5D01A 4DNXA 4ZAYA 2I2XB 5TF4A 1KKLA 2J0VA 3J7TA 2GERA 2C03A 3T4EA 1O58A 4C4ZA 3OETA 1NRWA 3TTWA 1ODFA 1PQUA 1XQXA 2X8WA 1B73A 4NONA 4F21A 1EJ0A 4Q5IA 1UT5A 2W9XA 5HF5A 2VC2B 3S2FA 4DPKA 1IUKA 2I3DA