4A8JA

Crystal structure of the elongator subcomplex elp456
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
350
structure length
277
Chain Sequence
GLDSSHVGVRPSPATSQPTTSTGSADLDSILGHMGLPLGNSVLVEEQSTTEFHSILGKLFAAQGIVHNRIRNGDTHVIVLSLNQMFAKELPGIYYKDYNHQFDITTRLMPAPIASELTFIAPTQPVSTILSQIEQTIKRNDKKLIRIVIPSLLHPAMYPPKMFESSEIIGLMHGVRSLVKKYYERVVLFASISIDIITPPLLVLLRNMFDSVINLEPFNQEMTEFLERVYKSQPGKIQHGLVHILKLPVFTDRGEMRVLKSEWAFKNGRKKFEIEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords ELONGATOR COMPLEX PROTEIN 4
publication title The Elongator Subcomplex Elp456 is a Hexameric Reca-Like ATPase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 84
structure length 277
sequence length 350
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a8jA00
1KYIA 1E2GA 1PLLA 3AF1A 2D2EA 4IDPA 4JL6A 2O0JA 3LX5A 4MRVA 2BCJQ 4MRSA 4JLJA 3FDIA 4DBLC 4V0KA 4JLMA 4NBSA 5GJWC 5P21A 3NG1A 1C9KA 4EKDA 2BDTA 5HZKA 4O2RA 3T1QA 4D82A 4RZXA 2NOAA 3GLFE 3CNOA 3RSLA 1OH8A 3HDTA 1XB2A 2D74A 4FW9A 3ZS8A 4DCTA 3ZLJA 4HAXA 1E0KA 3KDSE 1Q20A 1E9AA 3MD0A 2IYQA 4D0GA 1R5NA 3LLUA 4DEYA 1NN0A 1UBEA 3BAFA 1KO7A 5G40A 3TGPA 1ELOA 1TU3A 3RSOA 1GAJA 2R6DA 3ADDA 1NI3A 1IN6A 4OKSA 4TLEA 4CVNA 3TSWA 4LYHA 3BXZA 3DM5A 4Q9LA 4PPFA 1GWNA 4FWIB 1S8FA 1XD2B 1ZYUA 4QGGA 5JFGA 3GEHA 3RS2A 4QGHA 4C0HA 5J4LA 4TL9A 4FCVA 4XJXA 3UWOA 2O8EA 2E1RA 3QXCA 2DYKA 3V00A 3ZDQA 1C4OA 2CCJA 4FI3C 2ONJA 5EE1A 4U7DA 3BD9A 1GL9B 1E0JA 1FPMA 1WE2A 4NHOA 1TPZA 1ZUIA 1J8MF 1NKTA 2FPLA 3DKVA 5FUWA 5E95A 2IEZA 2NMVA 2QAJA 2K5UA 2OCBA 4HAVA 1N5JA 3VMFA 3KQHA 1OYWA 2EFCB 2YC4C 2BV3A 4M1SA 4DC9A 3EZ9A 1HYQA 1KOFA 3KKMA 4EFMA 3T1TA 1BS1A 2LWIA 2RGAA 3P20A 2V54A 1UDWA 2DWPA 4RVCA 3SQXA 4P3YA 1MOZA 1A4RA 4C0JA 2ZTSA 1NMZA 2BJVA 2GA8A 1U9IA 2XAUA 3GP8A 4ACBA 3CZQA 3GLIE 4TYNA 4PTLA 3V4RA 3X2SA 5FOVA 3O8RA 1WBBA 1LF5A 3S1AA 1IOZA 2OBLA 3AVUA 4Z1MA 2OAQ1 1U90A 5AJWA 3QBVA 1KI2A 2XOKA 5EXPA 2EWVA 3AKCA 2AHOA 1VG9B 4BPBA 4KBFA 2JJ1A 1TUEA 1AIPA 2YWGA 2Q6TA 4KSBA 2ZXUA 3NEYA 4NYMR 2ATVA 1G5PA 1DAGA 1XCGB 5H8WA 1ZVQA 1FFHA 1QRAA 3A37A 2J0UB 4N3NA 4RKEA 5FTNA 3VNVA 1DAEA 2JAQA 1NIJA 4JVSB 1OIXA 3SJCA 1CJMA 1IHUA 2GJ9A 1FTNA 1XU4A 3TR5A 4LX0A 4QKQA 1AS2A 4LJ5A 4KLZA 4URYR 1E4VA 5AUOB 4KFSA 2Z83A 3R9WA 4TMXA 2NO6A 1K6MA 3WBJA 5G41A 1JEEA 5JCZA 3SE0A 1VIYA 1XTSA 1QG4A 2OLJA 2D7DA 1M7HA 3BFKA 1QF9A 1W49A 3AF4A 1UEJA 3NTUA 2ZR7A 5DO9A 4OI1A 2IYUA 1G9XA 2GEDA 4GOKA 4MKHA 1WRBA 2NPFA 4GBMA 4TLBA 4TLCA 4BECA 1ZU4A 1JQJC 4EAQA 4M1WA 3OF5A 4K81B 3K0FA 2FOLA 4NYJR 4BLOA 821PA 1RKBA 4JVLA 1U2RA 1HUQA 5JWOA 3C14C 1XDBA 1G41A 3G5UA 4YXWD 2V6IA 1DG3A 2FJUA 1NBMA 5L3QA 3TIFA 3REFA 1QHXA 5CYPA 5KHOC 1KJWA 3PCRB 1FP6A 4Q47A 3AGQA 2WJVA 3BB3A 1RC8A 2BCGY 2AD5A 2FPMA 1VCNA 4D4LA 3U3MA 2H92A 4G1UC 2ZQ5A 1CEEA 3WYAA 4KODA 2J46A 4M1MA 1G7TA 4PHTA 5FR2A 5FBVB 1GTVA 4KO8A 4QOSA 4Q7MB 3UANA 4AY2A 1WQ1R 2QMUA 4B3BA 1N5LA 1D2MA 1W44A 2H7VA 4HLCA 2OEPA 1P62B 4FINA 2IW3A 4NCNA 2L0XA 1LS6A 1VMAA 1TTTA 3IDQA 4JLAA 4DLYA 4B6EA 1P2UA 4AG5A 4ERNA 1XD8A 2B92A 3R7WB 2V6JA 4GSYA 4EUNA 1II0A 2P5SA 4ZI2A 3DKPA 1I4DD 2IYXA 2QRNA 2XITA 2RHMA 3LBIA 1P2VA 1U9IC 3F3YA 2H5EA 3HPQA 3KJGA 4B43A 1ZMXA 2QP3A 1Z06A 3W90A 1RRGA 3W6OA 3X1XA 2YOGA 1VCMA 3TRFA 3D7MA 3I92A 1TMKA 4WXRA 3W9YA 2CLSA 3U7HB 1BYUA 2ERYA 2UVQA 2G0NA 2GAAA 2YWEA 3BBPA 4JLOA 4L16A 3ZZ0A 4A8JB 5KUTA 3PEWA 2A5GA 2R2AA 1R6BX 4OJQA 1NSTA 5BN4A 5E7IA 3CRQA 1XBTA 2R44A 1X6VA 1R4AA 1XD2A 5J47A 2ZIAA 1CR4A 2B7CA 3CX8A 3D31A 1E1RD 4M2LA 1KDOA 2JIZD 4MKFA 4OQMA 1SKYE 1PLJA 4EQ6B 1E9CA 4HB2A 3QG5A 2RGXA 2KSQA 2G0TA 4LJ6A 4E09A 2D06A 3KQNA 3VHXA 3PJRA 4FXPA 1JBKA 5C1BA 2IS2A 1XWIA 1KY2A 3LLMA 3EIHA 4ZI3A 3B1XA 3SBDA 5D3QA 2J7KA 3EAQA 3WP0A 4LPKA 4OJKA 1HE8B 1XPOA 5LB2A 2HYIC 1ZC3A 4LV8B 2PX3A 5BYJA 1C1YA 2QQEA 2XB4A 2ORIA 3PENA 1ODFA 5GJVC 4YMUA 1IJEA 4KXFB 2DPXA 1COWD 2X2EA 2FWRA 3QKSB 3BJIC 3RYTC 3PV0A 1FZQA 2PL3A 5FPSA 1KI1A 1NL3A 3T34A 1CTQA 4QFMA 2CVFA 2D7CA 3LBNA 1F6BA 4Q19A 2HCBA 3EPHA 5DYIA 2GCNA 4PO1A 4AI6A 2ZS7A 2FX3A 3L82B 3M1IA 2ODWA 2ZJ2A 1HT1E 4TT3D 3BS4A 2YV5A 4NP6A 4YMTA 5CLQA 4GOJA 3D6TB 3N2EA 3MCAA 4TTRA 4Y0AA 1OW3B 4YXWA 8OHMA 3NWJA 4QHYA 1UADA 1Z3IX 2VHUA 3CH4B 1GRQA 2KJQA 2J0UA 4YONB 4CIDA 1FP7A 4EDHA 4KSCA 2WWGA 1GRNA 3E2IA 4I1OA 5IRCD 2OFOA 3QPUA 1OXVA 2VQSA 3AF0A 5CJ2A 1H8HD 1OPXA 4NDZA 2EWWA 1PV4A 2R6GA 3NXSA 2ZRMA 2WWHA 4ZKDA 3LQQA 4E07A 5BN5A 1LFDB 3IBYA 4DIEA 2F7SA 4B48A 1AZSC 1Z6YA 3UG7A 2ZSBA 1NLFA 3R9IA 4LBZA 3DMDA 2G6BA 1MRSA 1YR6A 4V0OA 5HCNA 1E98A 1E9RA 1NNEA 5B30A 4TMTA 2VHQA 3W6PA 5EE3A 5IF9A 3GJ4A 1SVIA 2P6NA 2SHKA 3H0KA 1US8B 3B6EA 4PR0A 4B74A 1Z6GA 3IIKA 3VAAA 4Q4LA 2ZU6A 4ZPXA 3K70B 2ZAOA 4XWOA 1MO6A 2VPPA 1VHTA 1Z8FA 3DPUA 3K0AB 4BZPA 1HA3A 2H17A 3I8XA 2GZAA 4R98A 3U44B 1NRJB 2ZI4A 2MSCB 1XFAA 1W4AA 1IN7A 4I99A 3ZGXA 3PEYA 2X2FA 2GJSA 1NVWQ 2ZUCA 2VHTA 4D0NA 1DAMA 4JSYA 2OHFA 2CE2X 1M7GA 2AFHE 3PR1A 1KI4A 4P33A 1SVMA 1JXMA 2LKDA 3QBTA 4IFBA 1DEKA 5C2JB 2GCPA 3ZZUA 5KYKA 2FE4A 2QUZA 5FBWB 2H1LA 1E94E 4RD4A 1G8FA 2OCAA 5KNBA 4EPWA 3X1YA 3VKHA 4TQ9A 1A82A 1E1RA 3BE4A 4C3ZA 4MGKR 2JIZA 4B35A 4QJ4A 4D2IA 4IVQA 5FPTA 1CP2A 3CR8A 4LJ7A 3FMOB 1SVSA 2AL7A 4URXR 4YDHB 4JLPA 4Q1AA 3V9PA 3R7WA 1A2KC 1E79D 4LI0A 4QBGB 2B6HA 4NL4H 4CRWB 4PC1A 5K8LA 2FFBA 5HPYB 2HUPA 1XMIA 3LX8A 1JJVA 1MO3A 3KB2A 1KK3A 4WA7A 4B33A 4N0EA 1K5GA 2KWIA 4UJ5A 4XVUA 1YR7A 3K70D 2J59A 2OILA 4UNRA 2RGGA 1ZNXA 4DDWA 1JB1A 3VFDA 4EPTA 2BMJA 4V02A 1UEIA 2Q0HA 4N0DA 1YJ5A 1U0JA 4IDNA 1CJUC 4CZ2A 3AUXA 1SVOA 2Q9CA 2NO0A 4A8JA 1E2JA 1COWA 2HV8A 4IRUB 4BFUA 4ASUD 1GKIA 1XEFA 1X8KA 2ODEA 4EJSC 4IVPA 2GF9A 3CKLA 3MSXA 1T8TA 3HWSA 4ESVA 4M1OA 1GM5A 5AUQA 5CJPA 4A0FA 2NPIA 3EIQA 5IK2D 2PCJA 2QSZA 3PXGA 1D8TA 2OXCA 3PUYA 2HJVA 1PZNA 2YWFA 3K09A 4EQ6A 3TK1A 3ZS9A 4ARZB 1XZPA 3EIEA 1EFUA 3FE2A 2WJIA 2WICA 2FPKA 3BH7A 5DYGA 2FN4A 4QM6A 4RD2A 2IC5A 3THOA 4AKEA 3SR0A 3GQBA 2XZPA 1KY3A 3GPLA 1AGPA 3KL4A 2BMEA 5CDFA 3VKWA 1HEIA 2A5FA 3W3ZB 5A0FA 5EXXA 3NEJA 2E9SA 1N0WA 3T06B 1TQ6A 1OH5A 2X8AA 1ZJ6A 3OEHA 1GKYA 2OLKA 4TN1A 1VDZA 5HKKD 2GJ8A 2OBNA 1H8HA 1XJQA 2VHCA 3AF2A 5C4MA 3L0IB 4M1KA 3EZ7A 2P2LA 5E7JA 2ZRNA 4CDGA 4DDTA 3KKNA 3KXIA 2G77B 1E2DA 3RANA 3QVUA 2OAP1 2UZIR 1F5NA 3QKSA 5J4YA 2VP6A 4Q66C 3U3OA 1U8YA 4LC0A 3SHFA 3O8CA 1S0UA 2ZE8A 4JBYA 3GLGB 5LDDC 4OI2A 2D2FA 4MH0R 4HI0E 3EG5A 2C78A 3OESA 1UKZA 2O8DB 4U5XA 5EE0A 2BKUA 2ZEJA 1YQTA 4DJTA 3LO5A 1KDTA 3EA5A 5IT5A 3C7KA 4OHWA 3OAAA 2WJJA 1DAHA 3UPUA 4BEBA 4PAQA 3DO6A 1TQDA 4PPNA 3B2EA 1H8ED 2Y8EA 1JPNA 5TY0A 1S4QA 1T3SA 2GRJA 3KXLA 5HTKA 3SJZA 3B1YA 4IKEA 4LHYA 5JJKA 3P27A 3CRRA 1VCIA 1W36D 1ANKA 2KE5A 1E4YA 3THWB 3U3JA 2IX3A 3ADBA 3Q3JB 2C9CA 5AUPB 5AUNB 5EXSA 5M04A 2P3SA 3TUZC 4A0GA 4C2TA 4IDQA 3MWKA 2HCJB 2OE2A 1G7SA 1DBSA 4O25A 4LHWA 2BC9A 2Z4SA 4A1FA 3KUCA 5GADl 4NCHA 1GUAA 3B85A 1A2BA 2ASEA 1KSGA 2DY1A 4I1VA 2QP4A 2QM7A 4Q4AB 1US8A 1DOAA 1L4YA 1RJ9B 4A8JC 5KDLA 2VYFA 1R10A 3CUEF 4GP7A 3FMPB 1J70A 3SZRA 3C8UA 3K0AA 2EYUA 3U44A 1DO2A 1NVVR 2O5VA 4NE2A 2IT1A 1CJKC 4JL8A 4LK2A 5DN6A 2QY9A 4PHFA 4XTRA 1E1QD 3AP2A 5JI3E 3T12A 1J7KA 1QHNA 1MR3F 4BFZA 3FMFA 2ZUBA 2XNSA 3DDCA 3I73A 4ASUA 4A2WA 2Z43A 3F8TA 5FI0B 5J5CA 3OIVA 3T5DA 1EX7A 1NBME 2ZVPX 5DNYB 3DZDA 4B75A 3TSOA 1AGRA 3EWSA 3SDZA 2GHIA 3T61A 3AV0B 3E70C 5BXQC 1NLYA 5FUYA 3LRPA 1IM2A 1Z0KA 1P9RA 4Q9IA 5EUMA 4BQSA 4DLVA 5FI1B 3SI7A 2OUKA 2CNWD 3H1TA 4OQXA 4LCBA 4C0AC 3L8ZA 3RS3A 4KFUA 4M1TA 2V55B 4B34A 1GG2A 1CR1A 4C9BA 1HE1C 2HDNB 2AK3A 3SHWA 3LH5A 4M4SA 5FUVA 4ZCIA 1T6NA 1Z07A 3OIUA 3ICQB 1XJ0A 2QZ4A 2ORVA 2KBEA 4II7A 3REGA 3QQ5A 3K9GA 2QMHA 3W6NA 2ZRDA 4LHZA 4ZDKA 5HKKA 2VH5R 1R5OA 1U94A 3GJ5A 5HCIA 3U5ZB 2IXEA 4I81A 2YKGA 2QSYA 3E5HA 1XEWY 3SU8A 2A5JA 1KMHB 2QBYB 1P75A 1P72A 4FMCF 3WMFA 3DVLA 3EWAA 3ZQJA 1FUUA 2MMCA 4KJZA 4W5WA 5AJZA 2A9KA 1YU9A 2IUSA 1CRPA 2YVUA 4RD6A 1AQYA 3LDAA 4LJ9A 3RRZA 1EWQA 1JPJA 2EYQA 3TR0A 2QQ0A 3K53A 4YC7A 5FBQB 5EE5B 3T1OA 4Q02A 4LYJA 4M21A 3G0HA 1JEDA 3ZZTA 2ZJYA 2G88A 4ARZA 121PA 1N6OA 3O8BA 4TYPA 3T1VA 4RD1A 4G5GA 2FGKA 1SXJE 4A0RA 2IS1A 1UM8A 2XTMA 4MKIA 1G3QA 4MQBA 4Q18A 4BFTA 3M0EA 2GILA 4V0MA 4D0LB 2FG5A 2P6UA 1G8PA 4B3DA 1KO8A 5EE9A 5KDDA 4R7ZA 1N6NA 3NH6A 4LYFA 1S96A 1H8EA 1KDPA 3X1ZA 1FMJA 1G19A 2FSGA 2GZHA 3AB3A 4KYIB 1FX0B 4NZYA 3ND9A 3RS4A 3PEVA 2P65A 1VIAA 5BQ5A 1TADA 1VYVA 1GIAA 3CB4A 4RCYA 3W8RA 1JNYA 1G4AE 4A2PA 4JLBA 3GLHE 5KOYA 3KB1A 1V43A 1B0UA 1VG0B 4PSKA 1L4UA 2VSOA 1NKSA 3GLGA 1W5TA 3K70C 1TF2A 2C95A 3FPAA 4CT5A 4PX9A 3B1WA 1E2IA 2V3CC 3RS7A 4W7SA 1XMJA 2QM8A 4DB4A 1GL6A 1E9DA 1T0HB 1IXZA 4UNPA 2O8DA 4B3GA 4G0NA 4HEJA 3EPKA 3VNUA 4KFTA 2NO7A 1W5SA 2VEDA 2CEAA 1G6OA 3NBZC 3B9QA 4PZYA 1QG2A 1Z0AA 3UXMA 4DZZA 3QPVA 2D62A 3TW8B 2WSSD 1ETUA 1N6LA 3ZJYA 1U8ZA 4RKFA 1S9HA 1DAFA 1Q1BA 2QPAA 3AVOA 4MRRA 1WCV1 2REXB 2FV8A 4X8HA 1OLOA 5JECA 2KBFA 1S9DA 2GCOB 2OO7A 1XEXB 1R2QA 1E6CA 1G8GA 4C7OB 4UXHA 3WNBA 1OYYA 3THWA 4O0MA 1XXHB 3MMPA 4P0TA 1E2EA 3TBKA 1S3GA 1W4RA 3IBGA 4A36A 1YVDA 1X3SA 5KSPA 4FN5A 1T3HA 4IDOA 1YZQA 4DSNA 4TZ6A 3VR3A 2R9VA 2F3TA 2ZI5A 2QENA 3UMSA 3PVSA 5EP2A 2C98A 2XXAB 2VSXA 5EZ5A 4F7WA 3IIMA 4NKRA 4BZXA 2AD1A 3NH9A 4LJYA 4PZZA 1XTRA 2O8BB 4Q4AA 4EJSB 4QL3A 3TSZA 1RJ9A 2Q3FA 4JBWA 4DIDA 2DBYA 1NF3A 2V8OA 2WPDA 1IQPA 1OHHD 1W0KD 1V5WA 3C15C 3TVTA 5CM9C 3LAWA 4M53A 4C4PA 1YHNA 3K0EA 2CLDX 2X19A 1RYFA 2AXNA 2I1QA 1E2KA 3WMGA 2OZEA 3A1UA 1D9XA 5FPKA 4Q9KA 3ASZA 3HR8A 1G20E 2GXQA 2OCYC 2QRZA 2ZAMA 3OHMA 4US1R 3MWYW 3GLIB 1W4BA 2P0EA 3FMIA 4HB0A 2ZPTX 2HT1A 1KTVA 3OE7D 3IO3A 2ZRKA 2PZFA 1IN8A 3WHLA 4KV9A 1QHYA 2VP5A 3QENA 4C0SA 1E2MA 5LD2C 3ADCA 2VRWA 3UIEA 4A0HA 2Q3MA 2BM0A 3FYHA 3NDPA 2JLSA 1N3BA 1PVOA 2W2VA 3LXRA 1XF9A 1R0YA 2JEOA 1MABB 1KNXA 1W36C 4TWZA 2EFDB 4DLZA 2R6FA 1KKLA 5FUXA 2LKCA 3QI2A 1MKYA 4NYIQ 1Z0FA 3LVQE 2ZR9A 4HDQB 3GFTA 2LCFA 3CLVA 1PLKA 3QPWA 2AXPA 3SFVA 1Z6TA 2W6JD 4QRHA 4E5UA 3AP1A 5JS7A 5DISB 2XSZD 4OHVA 4WBSA 2CE7A 1KMHA 1DAIA 2OM2A 4KYUA 5GJCA 3T15A 1XPRA 2QBYA 4C0LA 1KSJA 2ZI3A 2ZETA 3H86A 1KI3A 4UNNA 1FUKA 1LB1B 4X8OA 4AK9A 5FOWA 4C30A 3HU3A 4FIDA 3CF2A 3P1JA 2PT5A 1P60A 4GOXA 3FB4A 1N6RA 3AKDA 2QMOA 2QTVB 2ZU0C 3IQWA 5JWRA 4KLNA 2XGJA 2WJYA 3KFVA 4BE7B 3L43A 4IDHA 2ZJZA 1J90A 1G64A 5FOXA 4JKYA 2ZR0A 1HH4A 4IOLA 5JRZA 2IHBA 1E2HA 3KXKA 3EA0A 1RE0A 2VA8A 2BM1A 4QGFA 1QVAA 1KHTA 2WSSA 5FL3A 5F98A 3BERA 3IUYA 2I3BA 2N46A 2V1XA 1CKEA 2VF8A 4FMDF 4N1AA 3B13B 1XMSA 2BEJA 3L0PA 4R71A 2BWJA 2IL1A 3RABA 1UKEA 5CIQA 1FX0A 4A15A 3BB1A 3C4JA 1KO5A 1G7RA 2ORWA 4QJ3A 3U6KA 2DFKB 3Q5DA 5F2EA 4L9SA 1DE0A 3SYKA 2ANCA 3QXHA 4XH9B 4XD7D 1XZQA 2B8WA 5KSZA 3FFBA 4O2LA 4KVAA 3A36A 3MFYA 4HAZA 2A3RA 4UNQA 1CR2A 4HZIA 3LA6A 1H65A 3JZMA 4JLDA 5EP3A 2J5XA 1XTKA 4Z51A 3K9NA 4GT1A 1J8YF 3CX7A 2ONKA 4NU0A 1Q1ZA 2REBA 3AQ4A 4LV6A 5DGXA 3QIAA 1KZ7B 1WBDA 2GDJA 4EPVA 1QBKC 1R0XA 1E9FA 3GJXC 2GBLC 3DHWC 2GK6A 3U2QA 2XB2A 1NSFA 4MA4A 3RNLA 3GLFA 4ACAA 4ZV4A 4M9XA 4LRWA 1JXOA 4U02A 1Q3TA 1OHHA 3EZ2A 4JYCA 1W0KA 1ZBDA 1RZ3A 4LZZA 2V1UA 4G01B 1MV5A 4IOKA 3AKEA 3ZD7A 2ZANA 1ZM3A 3VR5A 5EP4A 4FWTA 4TYQA 4Z8YA 1KJYA 2IYVA 4IHQA 5FTMA 1JAIA 2GAOA 2GCOA 2QEQA 3N5CA 1XEXA 2FSFA 1ZRHA 4JYBA 2RHDA 3ZQ6A 3MGCA 4QNMA 3I61A 4C7OA 4WW0A 2ZRPA 1XXHA 4OHXA 4BFYA 4BGDA 3OE7A 2F1JA 4DLXA 3IO5A 3DL0A 4HB4A 4TMWA 1ZP6A 2R65A 5FL7D 2PZGA 4NPHA 2XXAA 1SKYB 3C16C 1G16A 4GP6A 5FOSA 1YZGA 5CB8A 1OF1A 4HYYA 4BEJA 4HZUB 1KK2A 4KFRA 3N70A 1ONBA 5KU1A 4M22A 2TMKA 1ZCAA 3KQUA 4CEJB 4EJSA 2O8BA 4V03A 2A5YB 1XJCA 4BFWA 3EPJA 4AKGA 3CNNA 2OXRA 4NONA 5DLQC 3NHAA 3I5XA 1UF9A 3DEFA 2W6JA 4B73A 2XJ9A 2ODNA 4MRNA 1YZTA 4Q4HB 2XSZA 2Z4RA 4DDUA 4ZCMA 1M7BA 2OV2A 3ZVLA 1Z0JA 4AG6A 3VQTA 4Q7JB 2RGCA 2QAGC 3LFUA 3CWQA 3PUZA 4LDJA 4AIIA 1YZLA 5KTYA 1GNRA 2FSHA 4D4MA 3EX7C 3GLIA 4TQUS 3LW7A 1OT3A 1JR3E 2CXXA 4PC2A 1ZU5A 3U3RA 2ATXA 4BWYA 3BH6A 1M74A 2QNRA 3QJYA 2YWHA 4P32A 3PQCA 2DFTA 1QHGA 2OESA 4RFSB 4KAXA 1HT2E 2BBWA 3KFXA 2R6AA 4DB2A 3CM0A 3DOFA 4DEXA 2FEOA 3W34A 2ZREA 2WOOA 2RCNA 2DWQA 4Q7LA 3TNFA 1FTSA 4LWZA 5FBLB 4ZDJA 2OG2A 1MABA 1AK2A 2Q9BA 2XX3A 4NYJQ 1AA9A 1GDDA 1U98A 4D6PA 3KJIA 2J3EA 5C4GB 1R8QA 2GNOA 1AKEA 3AH8A 4JT2A 2F3RA 4LGMA 4MDFA 4GPTA 4URWR 3M6AA 2ZSAA 2MMGA 1Z83A 2W2TA 3TVDA 4HUTA 2CL6X 2HF9A 3PG5A 2PLRA 2DR3A 2VSFA 1M34E 2G83A 4XWKA 2VTKA 1GOTA 4QHTA 2Z6VA 5KO2A 1JALA 4MUAA 4XD7A 2X1VA 5H68A 1II8B 1FMLA 3H2YA 5D3MB 4IVRA 4BRWA 4OK6A 1E9BA 1WMSA 4OI4A 1KI8A 1LF0A 4D80A 1G21E 3IIJA 3I8SA 3UATA 5JSZB 2YOFA 3OEED 1VYTA 2UZ3A 5EUQB 3O47A 3RRYA 2QGZA 1P5ZB 4KCGA 1PUJA 3SOPA 1ZNWA 3U7FB 1JJ7A 5SZJA 5B57C 3AGPA 3QXSA 4Q03A 4MYCA 2WHXA 1KNQA 1VG8A 4GMDA 4AURA 3KKOA 4AYWA 4M9SA 3QVVA 4PANA 4NCJA 4PPGA 2DCUA 2V7QD 4JVMA 2ZJAA 2GKSA 4R2HA 3RWMB 5J4VA 5KPDA 3BWDD 3AP3A 3MJRA 1EFTA 2ECKA 1JR6A 5KPJA 2ZS9A 1SQ5A 1X1RA 2F43B 5SZHB 2YYZA 4YDSA 4F4IA 5CYOA 1G3MA 1DVRA 3B9PA 3ECCA 3EPLA 2ANBA 4M8NE 2XTNA 4BRUA 1L2TA 4R2IA 2WKPA 4MUBA 3TQFA 4Q00A 2JJ8A 3TUIC 3A4LA 4E03A 2EFEB 3QKUA 2H8KA 4Q01A 4CEIB 4PO8A 4B2PA 5FL7A 3KQKA 4DLWA 1BYIA 2EQBA 2C9OA 2WWFA 1U0LA 1CIPA 3LBHA 3QY0A 4TT3A 4X8MA 5CIWA 3CRMA 5LBIA 5CITA 1X8LA 4F92B 3IHLA 2GEVA 1CR0A 1Y3AA 2FF7A 5K8UA 1N6IA 5LB4A 3RS5A 1DARA 2ZRBA 2X77A 3FKSD 1NN1A 4PQFA 3KQLA 2C03A 3KKPA 5AJXA 1KI6B 5JCPA 1FQJA 1YR8A 4AC9A 1MO4A 4TQAA 5LD2B 5LPNA 4PSAA 4O3MA 2V9PA 3AUYA 1E2NA 2H57A 2W2XA 2QGNA 3A1VA 1IY0A 3H84A 3MLEA 4UXIA 1IAQA 2CLCX 3C5HA 2R6CA 3HP1A 3KJHA 3WY9A 3HU2A 2ZI6A 1IBRA 1L7VC 1W47A 3OFND 1W36B 1KO1A 4R9UC 1LTQA 2B8TA 3BRWD 4TMVA 5EXTA 2IWHA 1P4SA 4A6XA 1G6HA 2B21A 4A2QA 1G8HA 2J45A 4XSGA 3FTQA 4L15A 1IJFA 3UMFA 4U00A 5G3YA 3SNHA 5H70A 2QE7D 4DHEA 1XTJA 5FTKA 2GJAA 3VR1A 3QXXA 4TMZA 2REOA 3X1WA 3CIOA 4GMXA 4IOJA 3PIRA 1F60A 4HZUA 1FOEB 2WJHA 1W1WA 4QG7A 4DCSA 3I5YA 2N1BA 3I62A 2PEYA 1DTSA 3B7GA 1D6JA 2A5DA 1F2UB 2AKAB 3EZFA 4OK5A 3DMNA 3UG6A 5C46F 4CEJA 4HUQB 521PA 3ZH9B 2FNAA 4A4DA 4G5OA 4NCIA 5AK0A 1W4CA 3U61B 2ZRAA 2QA5A 4LHXA 4AYTA 1OB5A 1QVRA 4PQRA 4Q4HA 2OT3B 2FGJA 3F5FA 5L3SB 4TZ0A 5DHAA 1TEVA 1GL7A 3EXAA 4LUCA 1E0AA 1BKDR 1E0SA 4QBFA 1AM4D 3CPHA 5B58C 1UKVY 3ONWA 5JLJA 1K8RA 3KTAB 2CHQA 1E32A 5K8IA 2PH1A 2ZVQX 4RFVA 4D25A 5KSOA 2AFIE 3GLFB 3OEEA 4RFSA 1ZNZA 5AJVB 1D2NA 5EQTA 4QM7A 1Q21A 2W00A 3IQXA 3CPEA 3NBXX 1ZM9A 2CCKA 1XCMA 4US0R 2QMEA 1E79A 3THYB 1SGWA 1W46A 5CM8B 1CS4C 1E9EA 3SBEA 2ERXA 4B32A 3BH0A 1GITA 1TX4B 721PA 1MO5A 1XD9A 3K0CA 1ZW6A 4DSUA 3SYLA 1VG1A 1Z2AA 2PJRA 3WP1B 3RC8A 3R20A 2CHGA 2ZRHA 4EFLA 1E3MA 2GTPA 5DI9A 3MAAC 4YQFA 2VP9A 1FW6A 5KNDA 3K0SA 1FNMA 2YOHA 1OKKD 3KX2A 2WKQA 4JSTA 2WSMA 3B82A 1XP8A 4RZUA 1A7JA 5JS8A 4G5QA 1E2FA 1II8A 5D3MA 4ILEA 1GSIA 5HE8A 1U99A 2O0HA 2ZJ8A 3D3QA 4C2UA 3SN6A 4B47A 1LV7A 2J1LA 3MJHA 1Q44A 1RRPA 5IK2A 2F9LA 1XX6A 5JSZA 2JDID 1ZUHA 3GJ7A 3CO5A 1P61B 4B44A 1P3JA 4XWAA 4M1YA 4KI0A 2A30A 4WIAA 2KI5A 4DLSA 1U0HC 3AVXA 2C8VA 4JJKA 4BFXA 2ZRJA 1G17A 4RD3A 4WZAE 3NDBB 5DIFA 4P4TA 1M2OB 4Q1CA 2CCGA 3FKSA 5EZ6B 1ZC4A 4GDFA 1AKYA 3A6PC 1TF7A 1DAKA 2HLDD 1TU4A 3KKQA 1SHKA 2J41A 3VX4A 1E2LA 1P7CA 3HYRA 3TKLA 4DXAA 1CULC 1Z29A 4JL5A 1CJVC 1IY2A 2JLUA 421PA 1KGDA 1S3SA 4PHHA 4EFNA 2RMKA 3IKJA 1JAHA 2N42A 3LQRA 2WAXA 2F43A 1NN5A 3RS0A 3WMEA 4MRPA 4L4UA 2V4ZA 2WWXA 1NVXQ 3K9LA 3EC2A 4XVQA 5DI3B 5FOUA 2WTUA 3ZVNA 3B1VA 4AKIA 3PUVA 1EK0A 4ABYA 5CK4A 2QE7A 2Z0MA 3L2OB 2FZLA 4QBHA 2OCPA 1NIPA 1YKSA 4CEIA 2ZSDA 3R8CA 2ZRCA 5G3ZA 4FMCB 3QOFA 4XVRA 2CL0X 4Q4JB 4ESHA 1SVLA 4OHYA 4HAUA 1YZNA 2QAGB 4LSGA 1OXXK 1BMFD 2VP2A 4BLSA 1RVDA 1VHLA 3RWOA 4OL0A 4W5HA 1KI6A 1OFIA 4HAYA 5SZIA 2ZI7A 5CB6A 1OXTA 3QF4B 5KNCA 1OH6A 4TL7A 1S1CA 5J4KA 4HLUC 1NP6A 3F0TA 4P4UA 2GETA 4CF7A 5E4FA 4Q9HA 3LVRE 2IA5A 3MRSA 2CDNA 2GVDC 3AVWA 1F2TB 4LHVA 1HY3A 1NJGA 4LJ4A 1Q1EA 5HZHA 5JI2E 2BVNA 3RRMA 2F9MA 3EZ6A 2C04A 3CBQA 1O3YA 4UXJA 4TMKA 5F3WB 3CW2A 5JWHA 1NBMD 1SULA 4LC1A 1OFHA 3NVAA 2HT6A 3EASA 3TAUA 4PHGA 1J2JA 4Q21A 1Z63A 5FBRB 621PA 4URUR 2P67A 3K0CC 4DCNA 4AKHA 2VBCA 3VR2A 5EJEA 1IN5A 5BN3A 2BEKA 2JA1A 1D5CA 4K46A 2HXSA 5FH9A 2WIAA 2HF8A 2GF0A 3Q85A 4E22A 1SXJB 3DM9B 1IXRC 1KKMA 1F2UA 2DWOA 3CF6R 3Q72A 4TLDA 5FTJA 1MRNA 1T8UA 4HUQA 4BZQA 1VTKA 3HU1A 2AN9A 1E2PA 4OQNA 4UKDA 1XXHE 1HTWA 5E3HA 4QGAA 2YZ2A 2PBRA 4FCWA 4LBWA 5E7MA 2MSDB 4GNKA 3SC3A 1TF5A 3ADKA 1IXSB 1Z28A 1DADA 4FD2A 3LNCA 1QDEA 5L3SA 1E1QA 4PSVA 1OKKA 2C5LA 3AVVA 1KSHA 2GXUA 3Q7PA 1N2CE 2R8RA 1KO4A 3L0SA 2GJKA 1N5IA 2QPOA 4I1SA 1W7AA 3A4NA 3GLHB 1EX6A 3NBFA 2J0VA 5JJIA 4AYXA 2O8FB 1WXQA 1TL7C 2AR7A 2E87A 3KTAA 4PPQA 1EFCA 1XRJA 3ZD6A 5TARA 1KIMA 1U8AA 1EWRA 2ZYTX 4DT1B 1Z0IA 1W2HA 2JDIA 4XSHA 1RW4A 2JCSA 2C9YA 5GVRA 2GVZC 4BFSA 4MITA 3Q9LA 2CNWA 4Q7KA 4RY2A 2BMFA 5FR1A 1NJFA 2G3YA 4D81A 3U60B 3THYA 1NN3A 1SXJD 2WAYA 3Q7QA 3J81k 4TTPA 2HLDA 3L8YA 4AWXA 1XMVA 2QROA 4DDVA 1VCOA 1OSNA 2F6RA 1FL9A 4M0LA 3A4MA 3QE0A 4JLVA 5C18A 2WWIA 3IHWA 2ZRGA 3MUFA 3TUJC 4DLTA 1YRBA 3QXJA 3A1WA 1YZKA 1ZNYA 2C77A 2CBZA 1BOFA 2ZM5A 1TAGA 2YNMA 2ZE6A 4ZO4A 2O8CB 3FWYA 2GBLA 3C5CA 3OIYA 3BC1A 4S35A 2A7QA 1X8JA 1QHSA 1NVVQ 1Z22A 2Q9AA 2Z5FA 2VP0A 5DSZA 2RGEA 4IFEA 3FOZA 2XZLA 1E96A 3W5JA 1NMXA 1Q3HA 4MGYR 4TTQA 3WXMA 3SFZA 1E69A 2G1JA 2CMKA 1N6PA 2QT1A 3I72A 4ZDIA 5HR5A 2RGDA 2IYLD 1BMFA 1ZM4A 4L5BA 2FA9A 3OZXA 4IW3B 4UJ3A 2QPTA 2EVWX 3DZ8A 4EIWA 2CVHA 2IYYA 3TLXA 1GVNB 2XJ4A 1RRCA 1LY1A 2BOVA 3GMTA 4DKXA 1QHHB 2GEUA 1CF4A 3CH5A 2CL7X 1IONA 5BW8A 1I2DA 4FMBB 2IUTA 3TW4A 2CK3D 2JLRA 2WV9A 2XTZA 4MDEA 1XNJA 4K8OA 3DOEA 5AWFC 2ZJ5A 3SEAA 1G8YA 2W6ID 2G1KA 4XTCS 1VPLA 4P4SB 4WVFA 2FFAA 3CRVA 5JHGB 4M9ZA 1BIFA 5A5GA 3TE6A 2W0MA 3A58B 1ZD9A 2GZDA 5JEEA 2FDCA 2NIPA 4LV5B 4LPSA 5DI3A 1KI7A 4GFDA 3LV8A 4KBGA 2QTHA 3BFVA 1S2MA 2D3WA 4JVNA 4JKIA 2ZRIA 2RGBA 1KAGA 4WXPA 3VKGA 1E2QA 4Q4JA 3AVTA 1L8QA 2QAGA 1CU1A 3P26A 4D26A 4TLAA 4XOIA 4QNRA 2NO9A 2QTFA 2GWHA 1ZUNB 1GZSA 3QUSA 4C0BA 2NZ8A 2HEIA 2WBLC 4B71A 1P6XA 2HJGA 3FHCB 5GJBA 3QF4A 1KK0A 4H9GA 1NY6A 2ZUDA 2ZYWX 4WZBE 1B23P 4PAOA 1RRFA 1XTIA 1P9WA 2C99A 5FOTA 1N0VC 5AR1A 1OIVA 1G3UA 1Q0UA 2ZROA 1F2TA 1EFRD 1W0JD 2BKEA 2IWRA 3K9HA 4ITRC 4QXAA 4HLDA 1T5IA 1R8SA 3TQCA 3N2IA 3THXB 2W58A 3UKDA 4GI7A 3HJNA 2IYSA 4FMDB 5BYKA 1OXUA 2FFHA 2BBOA 1OB2A 5CDFE 4JLNA 2PLFA 2VL7A 2XEXA 3B78A 1P2TA 2PX0A 4HB3A 4ZIRB 1N5KA 4EPYA 2OBMA 1W48A 1JQLB 5ELXA 1P9NA 1YZUA 3WYGA 5DH9A 1LVGA 4W5JA 3BFXA 4A9AA 1FNNA 4Q1FA 1WB9A 3I3SR 3AM1A 5BWMA 3EW9A 5B2ZA 1KMQA 1SXJA 4NTZA 2J7PD 3FVQA 2WMNB 2VO1A 4Z54A 1NG9A 4B6FA 2F55A 2IK8A 4F93B 2PCLA 1ZIOA 3QEOA 5H1YA 1UBFA 4MKGA 2JLWA 4G3XA 2CJWB 2IYRA 3MWLA 1OV4A 3VU9B 1Q12A 2WOJA 3JVUA 4PC6A 5IDVA 1OFTA 4TSFD 2IHYA 3IILA 1JECA 1R7RA 1TEXA 1YE8A 5JEDA 2FH5B 2G9NA 4W9MC 1OXSC 2ZYUX 2IYTA 1I2MA 2P5TB 4RD0A 4A6PA 1G4UR 4V0NA 3GLHA 2VLIA 3KUDA 3NHBA 3QKRB 4CYMA 4DSTA 2O8FA 1Z5ZA 4OBEA 3SYNA 2ZRFA 4B3XA 1ZD8A 2BJWA 4DT1A 3GJ3A 2BHRA 4MGZR 1M6NA 3IPXA 4MYTA 4DSOA 1LNZA 1QHIA 4QC2A 2YJTD 5B64A 4Z8XA 4LJAA 1IN4A 3CX6A 4BLPA 2WMOB 4H1VA 3K1JA 4JBXA 2J9RA 2O0KA 3CZPA 4JS0A 3SJBA 2VP4A 1N25A 3GFPA 4QHSA 3T5GA 1OFUX 4Q1DA 3BB4A 4FCTA 3RHFA 4LJ8A 3WYFA 2ZE7A 2ZS8A 3GJ8A 2CK3A 3ETLA 4ZKEA 1DELA 2ZJOA 2ZITA 1I4LD 3NKVA 5DE3A 1X1SA 4PXAA 2JLXA 4G5SA 2W6IA 1TQ2A 1VKJA 4URVR 4NYMQ 1G3IA 3Q8XB 2O8CA 3P4XA 4B2LA 2IS4A 4Y0VA 2I4IA 1UJ2A 1Z2CA 1PUIA 2ZSFA 1CRQA 3QNUA 4I4LA 4DLRA 2JLYA 3BK7A 3WHKA 1ZM2A 1AN0A 1BO6A 1Q57A 2ZJBA 2FZ4A 4M9QA 5TVKA 3RRNA 2C96A 1NG1A 1Q22A 1T0JB 4B3FX 3FFAA 2GXSA 2R62A 2H16A 2W83A 3GEIA 4Q1BA 3WRXC 1G5RA 4A82A 3OEHD 4YMWA 5KDOA 1RIFA 3JVVA 5CLLA 5ANRB 4C0QC 2EW1A 2XZOA 3ICEA 1OIWA 1ESNA 4J0QA 1DS6A 1MH1A 3CNLA 1P2SA 1EGAA 2Q21A 1A1VA 1QHHA 4LYAA 4P31A 3ZVRA 5A4JA 4L9WA 1DO0A 4BLRA 3TH5A 4B76A 5TMPA 3BGWA 1KI9A 3CF0A 3W5IA 2QP9X 3GJ0A 3NIBA 3RC3A 3TJZA 2I1VB 4DLUA 4P4SA 4F91B 1EFRA 1W0JA 3FKQA 2YHSA 1RPZA 1TNDA 2JLVA 5G53C 3U7GA 3IPYA 2ZRLA 3ND8A 3SQWA 5FTLA 3SJAA 2PJZA 4OHZA 4NMMA 1SXJC 2BIFA 3CRW1 4TYWA 3PUWA 1LS1A 4EPRA 4YLGA 1KJZA 4V0LA 5J40A 2B7BA 2FEMA 3TAHA 4CGZA 1HQCA 1KDRA 3OAAD 1Z6AA 1XCPA 3O8DA 1EESA 1M1YE 3A1TA 5JZVA 3LD9A 4KVGA 3H4MA 1UDXA 1OJLA 3QKTA 4B3CA 2FU5C 3NBYC 2OSBA 1Q1QA 5SZKB 2J7PA 2C2HA 4UNSA 4A92A 4ZDWA 3SS8A 4BUJA 3U4QB 2RKOA 1T9HA 4F4JA 4KITB 2WWYA 1BH2A 1YRAA 2HXYA 2WM9B 1G3RA 2RAPA 4HAWA 5GVSA 1WP9A 3WRYC 2WJGA 3OIWA 1GFIA 221PA 1SVWA 1GP2A 1UBGA 4PAMA 3RLFA 4IEIA 5EP1A 4TSFA 3U7EB 3AVPA 3I4LA 1GRRA 1DG1G 2H18A 4PZLA 1DPFA 3B1ZA 1OE0A 1AS3A 5FPYA 4X8LA 5JJLA 1Z08A 1T5LA 2AWNA 5CK5A 1AZTA 1XEWX 3GJ6A 3THXA 3W8NA 1KSFX 3FHOA 3AKYA 4HDCA 4V0ME 1JR3D 3P4YA 4ZIRA 1GNPA 2FFQA 3VR4A 5JHHB 1T91A 3ZIAD 1MT0A 2Q3HA 3HYTA 5L3VA 1G18A 1T4GA 4PC7A 1E99A 1IY1A 4C0KA 1KAOA 1T3LA 2EFHB 5JBQA 1NMYA 2F1HA 1WA5A 3IGFA 3I1FA 2RB4A 2PMDA 3I32A 1U81A 2RGNA 4DVGA 5DN6D 2F1RA 3LWNA 4IJMA 2ZYVX 3WBKA 4WOPA 4MYHA 3PITA 3PFIA 3D8BA 3GEEA 2WKRA 3CR7A 3WNDA 2PZEA 4QBIA 1S1MA 4D4JA 1KK1A 2PEZA 4PFSA 2ODBA 2JGNA 1UFQA 3IEUA 2UKDA 3EC1A 4JMPA 2IEYA 1A5TA 3RDPA 3R8FA 1G5TA 1G291 1ZINA 2F1IA 3G82C 4BASA 1ZAKA 1XTQA 1CXZA 2CJWA 2GESA 4G5RA 4DUGD 4CEHB 2IBMA 1Z0DA 3VU9A 4F4CA 3GLGE 2MSEB 3B60A 3ZYCA 2QU8A 1UBCA 1HQYE 2NO1A 4ON9A 2IXFA 1O87A 2XNDD 2JJ2D 2JLQA 2OFXA 1HV8A 2QG6A 4IXMA 4NH0A 3C41J 3QKRA 1UAAA 3CONA 3U3KA 4I1UA 1NY5A 3VHLB 4DRZA 1VECA 2O52A 4IEEA 4EPXA 2BBTA 2QN6A 2NZJA 1KZGB 2ZSEA 2DFNA 4RCZA 2P6RA 4GL2A 1E9SA 2NGRA 2EU8A 2HYDA 3K8YA 3FHTA 3AEZA 2D4HA 4DCUA 4LY6A 1ZD1A 1TUIA 4JIMA 3AVQA 1ZCBA 1CBUA 1D2EA 1EG7A 5JMTA 4PQYA 4Q48A 1G7CA 1R5BA 2IUUA 2J87A 2PT7A 2YC2C 3IEVA 4LBYA 3JZAA 3NC0C 1NVUQ 4B2IA 2DB3A 1LW7A 1QZXA 4PO9A 2QI9C 2VHJA 1SHZA 4ZCLA 3LW8A 1I4TD 1R0ZA 3CWZA 4PC3A 4MYUA 1F3OA 5TXGA 5J4HA 1II9A 2A78A 3B8HA 4LBVA 2O8EB 5L8VA 3A1SA 3MG9A 1SZPA 1P73A 4HSEA 1ESMA 4GZLA 4D4KA 3P32A 1YR9A 2A2ZA 1RYHA 4Q5IA 4AD8A 3QG1A 4OQLA 4HLUA 2IF0A 1D9ZA 1EFHA 1M8PA 5IHPA 4RJLA 3CPJB 2QT0A 3B5JA 3PUXA 4UQOA 1UPTA 5F9FA 4GZMA 2DHRA 2AWOA 4Q9JA 3X1DA 2QORA 5JRJA 2NG1A 3V4FA 2RH5A 1GNQA 3VTKA 2AX4A 1K5DA 2V7QA 3QEJA 3GFOA 2JATA 1VYUA 3RAPR 4WZ6A 2IYZA 2PMKA 4URZR 3T35A 1AJEA 5F9HA 4Q1EA 3TMKA 2J0QA 5UKDA 3S1AB 1WF3A 2FMXA 2VF7A 4F38A 2ZI9A 4TYYA 2WIBA 5TV2A 3QSYA 2CHVA 2BBSA 1OH7A 5FFMA 3WNCA 2BMDA 1CJTC 2YINC 4XIGS 5KSYA 3UWKA 1WDTA 2RGNC 1Y63A 3NC1C 2GXAA 2EFGA 3HR7A 4CT4B 3UMRA 4BLQA 3VR6A 1JR3A 1UKYA 2WVJA 4L8GA 4BFVA 4CW7A 1JI0A 3RVBA 4POAA 3ZIAA 4DWJA 3AF3A 4WAUA 1ZIPA 2JLZA 1EXMA 2W0SA 4KHZA 5DHFA 2QL6A 4OK3A 3U6BA 3Q5EA 4RZ2A 4OYHA 1HURA 1NLZA 2JASA 3W3AA 4YMVA 3R9XA 6Q21A 3BORA 2KB0A 1XPUA 1TQ4A 3KJEA 3K09C 3GD7A 3U4QA 4BLTA 1ZM7A 4HDOB 4HLQB 4QJ5A 4JJZA 4GRAA 3KZ1E 1Z47A 4DUGA 3ZVMA 3PEUA 1PJRA 3LXXA 2GK7A 1F48A 2WZQA 1W2GA 2IYWA 4KU4A 2WWWA 1RFLA 4Z1MD 3BIFA 2XNDA 2OFWA 3E1SA 2JJ2A 1J99A 3MWJA 3AVYA 2XOKD 4S2EA 5HE9A 3K0FB 3OFNA 4NYIR 1SVKA 1FQKA 2NTYC 3UK6A 4LOAA 3BOSA 2JJ1D 1X86B 2ZE5A 1GILA 1R0WA 2FSIA 1SKQA 5L3QB 3L0OA 1AS0A 5K8TA 2WPDD 4JLKA 3HPRA 3M4YA 4US2R 4NCKA 1N0UA 4IOMA 3FGNA 4IXNA 2DFLA 3ASYA 2IXGA 4DCVA 4YMSA 3LY5A 3A8TA 4HATA 2IS6A 3QF7A 4TL8A 4JZKA 5AJYA 1G1MA 2VIIA 4H1UA 3VX3A 4JT4A 5TDHA 1Z6XA 4RSGA 4RZ3A 3EARA 1AQUA 5L3RA 2IF2A 2AKYA 4MGIR 1GKUB 2NQ2C 1CLUA 1N6HA 5FPHA 2AK2A 5TB5A 1N6KA 3GCGA 4OI0A 4TL6A 4OQFA 2J0SA 4CEHA
chains in the Genus database with same CATH superfamily
2V58A 1JDNA 3RYFA 3SSAA 1KYIA 1YTUA 3AF1A 1C7EA 3R44A 3RVPA 3VTZA 3LK6A 1FU4A 3KU4A 4CQMB 1RXIA 5J2UA 2QYHA 1ESCA 3GEBA 1PYDA 1HE5A 2I1LA 4R69A 2JRCA 5GJWC 4NBSA 4UPDA 4I55A 4GXRA 1PD0A 1NLMA 2HHJA 3NG1A 1X80A 3FYDA 4DV4B 4KC0A 4KOAA 2P6MA 5HZKA 1HDEA 3T1QA 3VAZA 1SC3A 4LOLA 4TV9F 4Y1RA 3WR5A 5BXYA 1PU2A 3CNOA 2JF0A 4M0PA 5E8RA 4DCOA 5AJUA 1WHTB 3KB6A 1ONPA 3U7QA 4QGBA 3WBFA 4J6EA 4Z9YA 2PX6A 3KDSE 4QICA 2QRPA 2H29A 1ZRNA 4RPCA 1NQVA 4DR6B 3ZC3A 1R5NA 4D0GA 3A1EA 3VNQA 4NZZA 1NN0A 3BAFA 4R9RA 4C6SA 1NW5A 4N18A 1ZJ4A 2KYRA 3GY0A 5AICA 1ELOA 1TU3A 2IZ6A 1IG3A 4M8SA 2PL9A 2VRNA 1NI3A 1N2SA 2HC9A 4BMDA 3JZIA 1DJPA 3VDMA 2HMTA 4QPCA 3BXZA 1PFUA 4PX3A 1H5NA 1OOEA 2UZ1A 2YV3A 2ZIZA 3JPYA 3L8GA 3VNBA 4CUZA 1N77A 4FDUA 1N1GA 1S8FA 3GO4A 4MA5A 3K6SB 4N7MA 4QGGA 5TLSA 16PKA 5K0ZA 3K2EA 1LI4A 4C0HA 2QZPA 1OU0A 1RHQA 3UC9A 3Q7IA 3R5FA 4FCVA 4YJ2B 3E9DA 4TWBA 4XJXA 2ZUFA 1ONNA 3U1VA 1JFRA 5EE1A 4TKMA 2A7XA 2QKYA 1AMOA 3BD9A 2Q8NA 3LRXA 2HMYB 2O5RA 3MCWA 4QVGA 1FPMA 3UF0A 1WE2A 2AW3A 2G6TA 1N4AA 4G5XA 4EKNB 2FPLA 3F6RA 1T9DA 4XGKA 2IEZA 1C9EA 2YQZA 4YJGB 2CNDA 3QK7A 2OCBA 3CJQA 4EYKA 3KQHA 2ODPA 2WWVD 2YC4C 2UZ4A 1SUAA 1I3KA 1Q7RA 3B3QA 2ZBEA 4DC9A 3EZ9A 1KOFA 3G5AA 1R74A 4E15A 5JNTA 1PBNA 4BE4A 2LWIA 3FDZB 2DWPA 1V11A 2AQKA 4ALNA 3PICA 3HBMA 4ZD6A 1BCRB 4CMEC 1A4RA 1TCVA 1NMZA 2AZMA 2BJVA 3CG0A 3L79A 2XAUA 2QG4A 1ZSYA 2RDMA 1E1YA 3GLIE 3LDFA 4DA4A 4XM0A 4ENUA 2PZJA 3JR3A 3UB2A 2QHXA 3P9IA 3V4ZA 5AW2A 4MGHA 3ICWA 5EC8A 2PVPA 1HNNA 4Z1MA 2GBIA 1H9CA 5I5GA 1O9GA 3TD6A 2OO5A 1VA5A 2BY4A 3CX4A 4ZU3A 1YD7A 4RW0A 4QRDA 5CBPB 1QIIA 1MU0A 1Z8NA 4O4LA 3ETHA 3AKCA 3ZUPA 1VG9B 5DGDA 2FLVA 2QUKA 1H2XA 4INOA 4KBFA 4WXHA 1LBQA 1Z56C 1O9HA 1UXGA 4LRUA 5AVTA 2FUEA 5KCMA 2OFPA 3A6FA 3DTVA 4IZOA 5JG7A 3OOSA 1TDJA 2BP7B 2O2CA 1NW9B 1OFVA 2JCYA 4N3NA 2ADOA 3A37A 3NOQA 3VNVA 1Q0RA 3CLKA 4G86A 1IHUA 2I8CA 2FN3A 4OXKA 1HDXA 3UJCA 1VPVA 3VXKA 1W85A 2NYRA 4KQIA 1AS2A 2EDCA 5CFMA 4KLZA 1DKQA 1E4VA 2HQ1A 3SSNA 4C4YA 5AUOB 1P19A 3GELA 2Z83A 4F1WA 3PVCA 4IIXA 4MUKA 2DETA 5AVYA 3DT9A 1HYGA 5DLDA 3O3OB 1CZNA 1K4YA 1IRIA 1D6NA 2P69A 2ZZMA 2OLJA 3H87A 3KT6A 3LKDA 2ZJ4A 3OZ7A 4E13A 1L5MA 2WJ4A 2H08A 1CYDA 5DGHA 1JLHA 4LOHA 4RXUA 2GEDA 3P45A 2CZCA 2A0FA 4N7JA 4DDHA 4MKHA 4GM0A 1NX9A 1L3CA 4BO4A 1JQJC 1V2HE 4S2UA 3H13A 4M1WA 1OYVA 4YRZA 1SA0B 3AHJA 3WLJA 1H0KA 4BLOA 3O1LA 3N2NA 1IHXA 1NJSA 1AF7A 2QUAA 2QN3A 1HUQA 3IKTA 1XNRB 4MWBA 4F8YA 4M3NA 2WWTA 3O7MA 2PUCA 1OTHA 2FJUA 4K03A 5BSUA 3A9UA 1X13A 3N8IA 3REFA 3RJ9A 3TIFA 5KHOC 1U02A 1SBYA 1O6CA 4BUCA 1FP6A 4J1NA 4S1WA 2G25A 3AGQA 3TJRA 5DCYA 7AT1A 4PYMA 2VUHB 1VCNA 4B85A 2NSYA 2H92A 2X8BA 5B3KA 2BTEA 4OUDA 4FCCA 4JNKA 4CN8A 2ZCJA 1T8SA 1FUEA 4YB8A 3JATA 5D6NA 2J46A 4R1MA 5SYAA 1RHUA 5DBIA 9MHTA 3IB6A 1A3CA 3OUTA 3THSA 1C1XA 3KQPA 4IFTA 2Y0DA 4Q7MB 3TG2A 4QWWA 4J94A 1WQ1R 4B3BA 2IZ5A 3EVEA 1QKJA 4HLCA 2GDZA 4PSDA 3OT1A 2DTXA 1A76A 3GF4A 3ZQUA 1KRXA 1NVGA 1GL3A 3FTCA 1Q14A 1VMAA 1TTTA 5AW6A 1QWOA 4GYJA 3G2QA 4XR9A 3HSYA 3ZV3A 1CLEA 1KBZA 4DLYA 1P2UA 5D01A 5G1OA 4AG5A 1VPWA 3QHPA 2V6JA 2ZQYA 2WYHA 3H5AA 1J0CA 1II0A 2ZXEA 3WLEA 3ZWVA 5BWLA 4ZI2A 2B1IA 1W87A 4GPIB 1I4DD 2IYXA 1TM1E 3RJTA 1MAUA 4N5IX 1BWQA 1OILA 3VVLA 3ZV5A 3E23A 3FNGA 4UUAA 1HLPA 4UZEA 3F3YA 1U0EA 3FAKA 4IINA 5BSGA 1FFAA 1VMKA 2XB8A 4X54A 2BMVA 2REQA 2Y66A 3JD1A 1FC0A 1RRGA 2E4WA 3W6OA 3W90A 4RKYA 5CX4A 1FSFA 1J8QA 1M54A 2CJXA 2FPWA 3D7MA 3F4BA 4YCJA 2NTEA 3TRFA 1U6KA 2R11A 3I92A 4WXRA 2CLSA 1IRXA 1MT3A 3W9YA 5LXTA 1B3RA 3IVGA 4JLOA 4JDPA 4L16A 4D3ZA 4MQ4A 2XMZA 5U4XA 1AN9A 6CHYA 4HYEA 5B4TA 4G1CA 4QUKA 1SXPA 5E7IA 1XBTA 1HWYA 2YH2A 1R4AA 1V47A 3I23A 1FRZA 3IIEA 4ALMA 2XTAA 4JGBA 5J47A 2OY0A 3H65A 1C1DA 1KBOA 3D3EA 3KOYA 3NJ8A 4H18A 2B7CA 2P9BA 3GAFA 1WPQA 2V3WA 1WMEA 3C6QA 5HYVA 1MQSA 3DLIA 4OQMA 4X20A 4DSZA 5B7NA 5BORA 3QU7A 2Q4BA 1YDWA 4CN9A 1SCAA 5L40A 1E66A 2ZZNA 4CKBA 4KQ9A 4FB5A 2P11A 3QG5A 1XROA 4OMCA 5EKXA 5AVVA 3GQBB 5B2EA 4I4TF 4KH1A 5ALGA 1JZQA 4Y6SA 3COVA 2IE0A 2AOTA 2ZBFA 5GGYA 1DIGA 3DXZA 4KDFA 2ZQZA 1SQFA 1JBKA 1KOJA 2DHDA 1XWIA 2W11A 1Q50A 3RIEA 2QY6A 3PNMA 4CKYA 4ZI3A 3SBDA 1CDDA 5D3QA 1LK7A 4M46A 5FIUA 2CSXA 2POQX 4MV5A 2OHVA 3DTYA 2J7KA 3EAQA 3WP0A 5C37A 1HE8B 3WKCA 4L0MA 1VE9A 2W2QA 1ZNQO 5ALFA 2I91A 4AO6A 3E3MA 2PX3A 3UZUA 2WF6A 5HXAA 5LKAA 1TJPB 3QVGB 1CY7A 1XTUA 1IJEA 4FIZA 1COWD 2WZDA 1QFSA 2X2EA 3QWBA 5HGJA 4BVLA 3RYTC 4ZO7A 2WUWE 1FZQA 3ENWA 2WYIA 2QQGA 3V1NA 5FPSA 3VDXA 4YBZA 2QXUA 3RFCA 3LBNA 3I6QA 5KS2A 1SCKA 4M36A 4Q19A 3PPYA 3MBKA 4HXFB 3AFGA 4UFOA 5DYIA 5BSFA 1ZGCA 5TQ0B 1N2CA 1Z13A 2E1PA 2ODWA 4OKNA 2YV5A 4NP6A 1EGHA 2JZNA 3GWZA 4YMTA 3SHOA 2H4HA 3MCAA 3SMQA 1LWNA 1OW3B 3D7SA 3F8WA 4Q9NA 4YXWA 3UAGA 1QPGA 4F6LA 1XMQB 4C43A 4F6RA 2VHUA 3HEAA 2KJQA 1BNCA 2FMIA 2J0UA 2X5KO 3O8OB 3QOYA 4LN1A 4YONB 4J0GA 4AZ0B 1CZOA 4BBJA 4IJUA 2VQ3A 4AG3A 7MDHA 1WVIA 2FHPA 3OCVA 4LJRA 3P0EA 4K9OA 1K0FA 1KYZA 5KYYB 2OFOA 1GNVA 2JFOA 2XVZA 1OXVA 3O2NA 4TWIA 1WXDA 4EVIA 2JI8A 2A1TS 3H2SA 4LI3X 5CVDA 1DKPA 1Z5PA 1RP7A 4MHSA 1RYEA 4JUAA 1L8OA 4KG7A 1TYEB 3D3JA 2EWWA 1C0LA 4H16A 3M4NA 1NW8A 2QL9A 1ZXBA 2O2HA 1CRZA 4HQKA 1GPKA 2IZ7A 2V5VA 5BN5A 1LFDB 2PTHA 1YA6A 4DR7B 5ELLA 4MX8A 1AO3A 4DIEA 3TIGA 3ZXXA 1A88A 5GPBA 1HSOA 6REQA 1Z6YA 3V34A 5JH7A 3T3OA 3WMRA 2COEA 3PRJA 1NLFA 4UUBA 3UG7A 4EX7A 2FZVA 2HU8A 3WHIA 3DMDA 3G3EA 2G6BA 1M5UA 4LKOA 2K6GA 3SYMA 1YR6A 2JFBA 3NVMB 1BXRA 1ODKA 1P2BA 5EIFA 1ORTA 3UT0A 2XA9A 4QLOA 2QRLA 3SQMA 5JSYA 1FNSA 1SVIA 1JEJA 3H0KA 4C78A 3NV9A 2JHPA 1DDOA 3B6EA 4WEQA 1Z6GA 5D1NA 3VAAA 3WK7A 3G89A 3OUZA 4KMRA 3CJTA 5IJ9A 4I9HA 1MO6A 3IMFA 1A5ZA 3GUCA 4B33A 1Z8FA 4BZPA 2SICE 3K1AB 4GKAA 3I8XA 1Y3DE 4GPD1 4NFSA 5IM4A 2MJLA 1O0SA 4KR6A 1EDDA 5EA2A 5HF8A 2MSCB 1SD2A 2JBWA 1W4AA 3CN7A 2OQVA 2QN2A 4WJLA 1PIWA 2PH3A 4Q24A 1TM2A 1KFEB 2NN3C 3OLWA 4MWTA 4G63A 5I7WA 2W8BB 2ZG6A 4D0NA 3IP7A 1LKZA 3VZRA 1Z33A 2QMZA 2ZTHA 3PR1A 1KI4A 3UEOA 2LKDA 3QBTA 5C2JB 2GCPA 3ZZUA 2FE4A 3UAWA 1G8FA 2E48A 5A4IS 2VNIA 2OCAA 4I9GA 4EPWA 1UMKA 1YA8A 2XNCA 1ORDA 3A9WA 4RJIA 2H59A 3CUTA 4TQ9A 1M5RA 1GAWA 1LI7A 3BE4A 2G5CA 4GX5A 2A9OA 1Y34E 4QJ4A 2PIDA 4ZAYA 1BWPA 1CP2A 1FFXA 3CR8A 4HN2A 1TCCA 1SVSA 5DNUA 2AL7A 2PVSA 3PGMA 3TINA 1C0KA 5CDGA 4HRVA 5BR1A 3BULA 1BE0A 3MJEA 4JMLA 3DW3X 4GKJB 1ADJA 1WY5A 3DHVA 4KSYA 1A77A 1E79D 1PK9A 2UUOA 3NRCA 3OM8A 4NL4H 5DWQA 2GZRA 3WGUA 4WKCA 4CRWB 1FFDA 2FFBA 4NR0A 1XO1A 2A58A 2C9MA 1JJVA 1MO3A 2HUPA 3I5AA 3K96A 3PRHA 4GPBA 2XQIA 4KQGA 1T0BA 1KE1A 1GGKA 4EY6A 5C8YB 3BIWA 4AF6A 1N8NA 1YR7A 1O95A 2OILA 3V8PA 1M1YB 1U0GA 5ALOA 4TS3A 1T2NA 3JARB 5CT6A 1TYZA 3NNDA 3R5SA 2RBEA 4WNCA 3CSSA 1KEKA 3K8QA 4KRYA 4MV7A 3TL3A 4LXQA 4MGEA 4UM9B 3FR8A 2J08A 3GJZA 4IDNA 2NACA 4HWSA 5EXEA 5HK8A 5KNDD 5M29A 1DT3A 2WZBA 4Q3CA 4RHCA 1TC1A 2NO0A 1W5AA 4A8JA 2E2WA 1T25A 1BH6A 2RD2A 3F4KA 3QELA 1XEFA 3TEMA 1X8KA 4JI4B 2PPLA 2A8YA 3IV7A 4WZBA 4DA7A 3ZU4A 5AUQA 1SOWA 4TV8B 4HVCA 2R4QA 4CMIB 5IK2D 1J8DA 2PCJA 1J5EB 2L42A 3DEYX 1JHXA 1P0MA 1TA9A 3KP1A 1W4ZA 4MS3B 1XZPA 3KOWA 3ZS9A 5FLXA 1Z17A 1U3VA 2BRUA 3BH7A 1HQKA 1NXWA 1YMVA 2FKNA 4WCFA 3NP7A 4AKEA 3BA1A 3CE6A 3GPLA 1AGPA 3PX7A 4GWKA 1WSBA 3R6WA 1CQPA 4XYEA 3W3ZB 2A5FA 4KR2A 1L7BA 5EXXA 3NEJA 1LI5A 1MQ8B 3DBOB 3OCZA 4MINA 1MXFA 2RH4A 3Q1LA 3R40A 4J43A 3T06B 3W1VA 2V6GA 4B4OA 4L9RA 1QIMA 1KJ8A 1UT6A 1V7CA 1YFZA 2BGRA 3QVKA 2AOUA 4OFZA 4P9NA 2Z3WA 3I39X 4TLMB 3S40A 2M6SA 1PL8A 5E4TA 4TN1A 4DTCA 3RYCB 3MTQA 2HLHA 4IS3A 1IK4A 2OBNA 4P82A 4UM9D 5DHUA 3ZV4A 5KVCA 5LQNA 2OCKA 3WL7A 4CDNA 1ZGZA 3EZ7A 1ECFA 4JFAA 4BAUA 2G76A 2BZ0A 3IX7A 4Y2RA 4D96A 5CDYA 2DM6A 2PE5A 2OAP1 2PYIA 3BDAA 2UVPB 3WLOA 1RI1A 9GPBA 1H6CA 4LC0A 5I9IA 5BT8A 1S0UA 2ZE8A 2C7RA 2YIMA 3LI2A 1FLAA 3COSA 5JYEA 2IH4A 2D2FA 2HK8A 4MH0R 3SQDA 3MJFA 3N6RA 1T34A 3RSSA 1WM1A 4C5CA 1MC5A 4BB9A 3NTVA 3SNKA 3IC5A 2BF7A 1F17A 3SXUB 1ZJWA 4GR5A 3W9SA 3PQ5A 2BKUA 5ENVA 3C7KA 1EX9A 1X7XA 4OHWA 1DAHA 3EBOA 1VMIA 1D7AA 3FDJA 1RRMA 3WWPA 2XMGA 5EZYA 3ROQA 4AJNA 5IVKA 1WMBA 5A71A 3R0VA 5ALRA 4F4UA 3PDUA 1RJWA 1R00A 5LQMA 4G0UA 3LXUX 3RO7A 4OLAA 4ZMBA 1T3SA 2GRJA 1L9XA 1L0BA 4LWPA 3TOXA 4IKEA 4WY2A 4JI0B 2QJTA 1UAYA 3DV0A 3L3BA 5JJKA 3E18A 1E7YA 1F8FA 3CR3C 1PJTA 2E3JA 1J21A 4MLDA 3WB1A 1W36D 4U2GA 4AZ3A 1LXCA 1RHRA 3P2MA 4H4CA 3I4CA 4KO4S 5D1HA 4BL5A 4CKEA 5AW4A 1GGVA 3Q3JB 2WU4A 3QQPA 5AUPB 3ADBA 5AUNB 2G5PA 2QD5A 4DQVA 1NC1A 2IOHA 2MINB 3OOJA 4RY0A 1N2GA 3MCVA 3RAJA 3WQQA 5D85A 1P1IA 4C2TA 3IPCA 1N9GA 4FD3A 5EXDA 1ZH4A 4BV9A 2FF5A 1O95C 3DVQX 1PR1A 1VE7A 3EIXA 3L1UA 2H1IA 1EK1A 1PFKA 2BC9A 4A1FA 3RTAA 3L7CA 1S8NA 1GUAA 5EIOA 5IJWA 3WL8A 1LBEA 3EDCA 5AD1A 1NLUA 3DW1X 2ASEA 3L4SO 1HORA 2RHRA 4JSRA 4PFJA 1US8A 1DOAA 1L4YA 2YWBA 4NZMA 4L8YA 1RJ9B 8ADHA 4LMRA 5EJ5A 3ELDA 4DMGA 4A8JC 3NLLA 5IKMA 4ESEA 3PWSA 1S2NA 1O97C 3HGMA 1R9NA 4MAAA 1UBKS 3UFXA 3SZRA 1F8XA 1CRLA 2VH1A 3UJ9A 4ECEA 5JLAA 4YAIA 4FEGA 4NE2A 2O5VA 2PV7A 3NVKI 1MAHA 1JI3A 3PF8A 3T12A 1F7VA 4PGMA 4BTEA 1E5DA 4R1SA 2XZDA 4U4AA 1AT1A 3I73A 1G0OA 2H7XA 1EVYA 3F8TA 1GQFA 3OIVA 2Z58A 3G13A 1EX7A 1NQ5A 1PGJA 3T5DA 1BU5A 3OH8A 2I4MA 1AHIA 3EWSA 1ADCA 3EE6A 3C3YA 3D59A 5L95A 3K5HA 1RYYA 2XMQA 4Q9IA 5EUMA 1A8UA 4NMHA 3OU7A 3WISA 4BQSA 3E22B 3EVBA 4DQDA 2HMAA 4PVDA 5A4DA 2CXPA 2IOFA 2QLFA 4DXDA 2PWAA 4HQNA 5BSWA 3RS3A 1NWCA 4KFUA 1WSWA 4M1TA 3TNJA 3HB0A 4B34A 5KX5A 3ETNA 4C9BA 2L17A 5ECYA 3RJ5A 1ZISA 2JLCA 4KW7A 2ETVA 4K6CA 4ZCIA 1T6NA 3IJRA 1Z07A 5L51A 1BX3A 5B6JA 1XJ0A 3ICQB 5JW6A 4PX5A 2KBEA 4II7A 2C7GA 2RI6A 3K9GA 3AR3A 1CB0A 2GTHA 2ZRDA 3G7UA 4FNGA 3W6NA 4LHZA 4J3JA 2UUBB 1C5KA 2JI4A 2JB9A 2QYOA 2B69A 4MV8A 2AG1A 1MVNA 5F5XA 5JD4A 2QSYA 4GOMD 2RJOA 1OLSB 1ZEMA 3DEZA 1KMHB 4EA9A 5CG2A 1P72A 3I58A 4FMCF 3HYNA 3DVLA 3EWAA 3ZQJA 2MMCA 4W5WA 5AHRA 5HX7A 2ZR8A 1YSCA 2J8ZA 3PQDA 5DYWA 1NHGA 2VF4X 1MLDA 4RCVA 4R8VA 3MD9A 3HH8A 4JHXA 4RD6A 2I87A 4LJ9A 3LCCA 4XA8A 4DUYB 2XRZA 2G72A 1EWQA 5AW8A 1A5AB 4N01A 4CU2A 3K53A 1NYRA 5B3AA 3IJ5A 5HQTA 4M21A 4CJXA 3G0HA 1JEDA 2ZJYA 4B7XA 1CZKA 121PA 5AVXA 1N6OA 2PL5A 2CXSA 2QAIA 4U7PB 4YTEA 2Q3BA 1GQRA 4G5GA 4PCVA 3L4KA 5JU6A 2C92A 1Y6ZA 4MKIA 2NUTA 1G3QA 1C4XA 1GTG1 4TKUA 4RF2A 3OTIA 3M0EA 4BATA 1KZ9A 2VJPA 2GILA 1YNOA 3KLNA 3L05A 4KE7A 4BV2A 4B3DA 3ZBTA 2PLWA 2XVYA 3C6XA 3NU1A 5EE9A 3HVUA 4QDZA 1N6NA 1S96A 2XBUA 3KO8A 1M1NB 4D98A 4JJFA 4JXZA 4GICA 2FLWA 1FX0B 4NZYA 4BWYA 3OF2A 1ZZGA 3ND9A 3DS8A 2NSHA 5T41A 2CYAA 4CV0A 5HOEA 3W8RA 1G4AE 4PNPA 3G1WA 4JJ7A 5KOYA 4PCAA 1V43A 3VH2A 4J2OA 1VDMA 4R3NA 4E7OA 4CDMA 3LU1A 4ALJA 2N0SA 2P9TA 2VSOA 1CJSA 1DC6A 2AB0A 2VS1A 1M2KA 2Z2ZA 3ND7A 1MXHA 3H3FA 3A6ZA 4P2GA 5A1JA 2YYYA 2UUAB 2GR9A 2PJDA 4OU4A 4P5PA 1TF2A 4ZWNA 4QYWA 5I7VA 4P3OA 5J3JA 2WTAA 3B1WA 4W63A 1H6AA 2YHBA 3Q3IA 3FTDA 2WV7A 1GL6A 5IC4A 4G0MA 1E9DA 1M2FA 2EKLA 1P7VA 3V8EA 2O8DA 2FQWA 2Q8PA 4UCQA 3GNSA 2OGWA 1R0BA 2NO7A 2VEDA 1LK0A 3ZU5A 1VXOA 3NBZC 4I4CA 1WBJB 2IU3A 1Z0AA 4FHEA 4ZT6A 3W79A 1JG2A 4UTOA 1YI8A 2NUPB 1I33A 1XPJA 4Y2JA 2COKA 3TTXA 1CUXA 5A7FA 3HDJA 2A0KA 3DPIA 1Z2EA 3OX1A 3AVOA 4IFIA 3CSUA 5JFOA 1WCV1 5HM6A 1MA0A 1TD9A 2FV8A 2VNAA 2F90A 1L5VA 1NASA 1CS0A 3KVVA 2KBFA 3QNMA 4PEVA 4RIGA 1ES9A 4L51A 3LC7O 1G8GA 4C7OB 1AE1A 4I4IA 3FUUA 4U39A 3WNBA 1OYYA 3K3PA 1XXHB 5KJEA 4P22A 4BGIA 2O3UA 4P0TA 1TFRA 2PDAA 5K3CA 1E2EA 3RCBA 2O7NA 1S3GA 1OBCA 3QMMA 2C8KA 3FLEA 1X3SA 4CMBA 5BVGB 2GVNA 3BQNB 5HIAA 3VR3A 2OXTA 2F3TA 2H1HA 2MYUA 3HGQA 5D5QA 1BDJA 4BC1A 1N5RA 1A7UA 1CCWA 1NUTA 2QENA 1U4NA 3E53A 5YASA 2C98A 1ORWA 5EZ5A 1XQ1A 2PGIA 3DMPA 4TX1A 2X1HA 3WDLA 2EFYA 1WB6A 4BP8A 4DLBA 1WD5A 1U4OA 1DKOA 1I1OA 4PZZA 3MRTA 3NPAA 4WKBA 3D1LA 3HLTA 3IQZA 1DT5A 4PRKA 4O59O 3DEIA 4BWVA 4K9PA 4ZODA 1P4JA 4O4IB 4W8HA 4DIDA 5K0BA 3T1YB 1R15A 2QOEA 2B2CA 2WPDA 4P4GA 3LY9A 1VKOA 3LLSA 2G9QA 4RM3A 4KQHA 1DRJA 2O6LA 3TVTA 3ZJVA 2IHNA 2XYQA 4FZ5A 4M53A 3PF9A 1YHNA 3K0EA 3VR5D 3LX6A 3AHCA 1CY8A 1Y1KE 2GASA 3K92A 1GVHA 5ALEA 3CUUA 2I1QA 3V4VB 1E2KA 5K03A 3BJZA 1TO1E 2OZEA 4X5OA 3ADOA 3UMBA 2WG0A 3ASZA 4Z86A 3L7LA 3F6CA 3RHZA 3DCNA 2FP3A 2ZAMA 3LRTA 3GLIB 1UBOS 3CVWA 3FMIA 2I7TA 4MS4B 3OE7D 1XCBA 3IO3A 3QX3A 5AHXA 4ITUA 3RIHA 1GPLA 1GCIA 5MF6A 1QVZA 1QHYA 2FFRA 2VP5A 4C0SA 5KOHA 3DBIA 2VRWA 5E2AA 4A0HA 2OVBA 1GTJ1 4LMPA 2OZPA 5H16A 2JLSA 1N3BA 1YS7A 2DP4E 2AMJA 2W2VA 3LXRA 3RSOA 1XF9A 1ISIA 4IMJB 3WLRA 1A8IA 3ORFA 1CUDA 3CEJA 1RHKA 4G0ZA 1O9BA 1PR5A 2JEOA 2Y1GA 3AM3A 3NR2A 2EL9A 4IMIB 4Z0TA 5MGBA 1HOTA 1MENA 5A5FA 1KFBB 1W96A 1KARA 4DN6A 5FUXA 1S01A 2Q5HA 2YZGA 4NYIQ 4QLAA 3NHJA 1ESEA 1Z0FA 1B16A 3L04A 4HDQB 2O59A 2LCFA 1NPTO 3DMTC 1N3YA 4BV8A 5JAHA 3SFVA 2CV1A 1Z6TA 1TYCA 1GUZA 4QRHA 5GMOA 3EJ6A 3AESB 4CV1A 3AP1A 2EJWA 4E5UA 1UJ4A 5DISB 5CA1F 1K98A 2HZBA 4IZ6A 4JBGA 4KTVE 3E61A 4MW6A 3ZHUA 1C30A 1Q6ZA 3FZGA 3N8DA 4XWYA 4EG3A 3WA7A 4ZI5A 2QBYA 3T15A 4ETWA 3OQHA 4C0LA 2BLLA 4UNNA 4X8OA 4BAGA 4AK9A 2ZAIA 3U4MA 1PX2A 3N76A 4WI1A 5FOWA 3U40A 3IDFA 4IDBA 4JGIA 3LUKA 3CF2A 2HIGA 4I2NA 1W6UA 4QDOA 1K06A 2GJ4A 1JBEA 3BMXA 1JDZA 1VE1A 3L8HA 1DFGA 3TD9A 3ORRA 1KZ1A 2QTVB 4PZEA 2Z9BA 4QUAA 1LWOA 2AYXA 2FP4B 2I33A 4HG2A 1J0AA 4PS1A 4AZWA 1DTEA 3MRVA 3AR6A 4B0OA 2FE1A 2H31A 4ITVA 4QTUB 3HSKA 4R5MA 3G85A 1PNVA 2WYVA 2BHTA 2ZR0A 1HH4A 3C98A 4IOLA 4KH0A 4OX9B 3LC1O 1KJJA 2H63A 1RE0A 2R1TB 3ELYA 5KJFA 1PJ3A 4EGSA 1OBOA 3FM9A 3OF3A 4KQ2A 4ZXFA 1P45A 2Y4NA 2AFVA 2VF8A 3O3NB 2H2GA 4FMDF 1H22A 4AQDA 1U9JA 4UVHA 4R71A 2BWJA 2IL1A 3L8DA 4FOPA 5D7NA 2EQAA 1OWPA 4QXOA 2YJZA 2WHEA 2WVGA 4UU7A 2EV9A 3I30X 4ID9A 4AJPA 1LPPA 3A28A 1J56A 5CW1A 5JNLA 2DFKB 3Q5DA 1TZBA 3ULKA 2R5NA 2FOIA 4L9SA 4EKGA 1KJQA 3SYKA 5C80A 3EDQA 2ZBDA 3FFBA 1IZ7A 4RZSA 2NV0A 4TTAA 1RU3A 3BIXA 4KXWA 4B31A 4UNQA 4KPEC 4HZIA 3LA6A 1H65A 1Z0ZA 3EGCA 4TQGA 1X9HA 2H4YA 5EP3A 2J5XA 1XTKA 1Y3IA 1RBMA 3Q7SA 1DIBA 2WNSA 2XNKA 3ICVA 4UDNA 4IHKA 2REBA 4LV6A 2RK3A 3QIAA 4IKOA 1RLOA 3GDWA 1Y8CA 3GJXC 4KLCA 1SHUX 2XGMA 4EF4A 2UYGA 4YR9A 1PT9A 1MCZA 2BGKA 2XHEA 1ABEA 2PGLA 3C7AA 4LRWA 3JASB 4W8GA 1W0KA 1ZW1A 4O4JF 1IBMB 4Z4FA 3Q6IA 1TEHA 1T29A 4EFKA 2B8EA 2DAPA 4IOKA 3ECSA 5TS2A 4AICA 3AKEA 2QTGA 4MR9B 2ZANA 2JCGA 4B17A 2DQSA 1SOVA 4IWNA 5A3QA 4MPTA 5EP4A 2GPYA 4O29A 3GGOA 3DE3X 4IHQA 3D3KA 4ODIA 4K9KA 1NRXA 1E1LA 1XEXA 2Z09A 3E9QA 3HB1A 3OQNA 2NZUG 3T5BA 4LCEA 4Y98A 2Z2XA 3IJEB 3L8EA 4WK6A 3PBKA 3ENVA 2ZRPA 2HW8A 4LGYA 3WGVA 4BFYA 4HRYA 5ESRA 4TVSA 2B0JA 3AETB 3AX6A 4KX5A 5LYJF 1NULA 3HABA 4UMFA 3JQAA 4LSWA 3QU4A 2Y05A 3GUHA 4HGNA 3ER8A 5B55A 2J48A 4F11A 2H1VA 4NPHA 2XXAA 3A9SA 3UJ3X 1MAAA 2Y27A 3MINB 1OF1A 2FN8A 4BEJA 3DZFA 3U9SA 4KFRA 2WUVA 2W2KA 5ISMA 2NVWA 5CM2Z 5FYDA 1JLRA 3RRXA 4XCXA 1ZCAA 3VJMA 4DUZB 5H0IA 4DR5B 4CEJB 1JAXA 4O33A 5KJCA 1PG2A 3FRHA 3HY4A 3NM6B 2WE7A 4NNOA 4LFBB 1RKVA 3CNNA 3KYBA 4Q3AA 4NONA 4BLVA 3DB2A 1UF9A 2EKZA 4J29A 5LP6A 3E2MA 2K4MA 2W6JA 2ODNA 4MRNA 4O63O 4F3RA 2XSZA 1PDOA 3LIPA 2C42A 1IUKA 5JTUA 3DFKA 4XLTA 2OV2A 2EZUA 2CJFA 3BWXA 2HA0A 1WMFA 2PJUA 1J07A 2I2BA 3OQ1A 3P8ZA 3PA6A 3QW4B 3OA0A 4N5NA 4WUVA 3S81A 3LFUA 4LDJA 4L2IB 5B5SA 1J9EA 5A0VA 1YZLA 5JSQA 5KTYA 3IHKA 5E6UA 5DMHA 1DRWA 1WY7A 2YBDA 3CEMA 4Q9DA 4CKCA 1RXWA 3UNXA 3LW7A 2C2MA 4CM4A 4ENVA 4YV1A 1PZEA 3N9IA 4F9FA 4ZEXA 5HKOA 2R1VB 3I9V1 4H59A 2QNRA 2YWHA 5HVNA 4BJ1A 5DK6A 2DFTA 1QHGA 3NRBA 4PCUA 4KAXA 4X7PA 1HT2E 2PGXA 1W88B 3KFXA 4MMXB 4I1IA 5D5HA 2R6AA 3VR0A 4HT3B 2JVKA 1QYCA 3DOFA 4XPIB 2RB5A 2WD7B 3Q98A 4NU5A 4TKVB 4E94A 1UBHS 5JZOA 1FTSA 1FMCA 1I2AA 2OG2A 1DB3A 1MABA 3P2YA 4U7HA 1NU8A 2WUEA 3RYHB 3IB3A 4BNWA 3L1JA 1RZRA 4IEFB 4F4DA 2PPVA 2PU7A 2Q2QA 2R7NA 6ABPA 1R8XA 4D6PA 3U09A 2DRIA 2VRBA 1SXHA 2J3EA 2ZOSA 4OHUA 5H81A 5C4GB 3O6VA 3SLGA 2QLBA 1T26A 1FYVA 2F3RA 1U63A 2HJSA 2ZWMA 1KQPA 2GOYA 5CDUA 4ZVUA 2ZSAA 2MMGA 2XCOA 3TE7A 4RGYA 3DP9A 1G55A 4HRAA 3RASA 4U0JA 2CL6X 2HF9A 3LLCA 1NVBA 4I5EA 1LDGA 2VHVA 2DR3A 1Q7GA 3ODPA 4I50A 5F64A 4BTVA 3H6HA 4XWKA 1P4GA 1A8HA 2YBEA 3GRVA 2BFWA 4HH3C 5KO2A 2PBFA 2AHRA 4MUAA 4RPLA 2PG3A 4GX2A 1FMLA 2H3EA 3GVPA 4KR0A 5D3MB 2Q2VA 5CA1A 3LT4A 3K5PA 1TJYA 4LGVA 3UWMA 1E9BA 4K9NA 5I7SA 3OLCX 2DUMA 4J1TA 1ULSA 1WQ3A 1MNQA 3DVAB 4D80A 4JP5A 5J58A 1LZLA 5JSZB 1NW4A 2YOFA 3OEED 4CM7A 2R7KA 2FRXA 3RRYA 3LSYA 5HFAA 4IS2A 1QKIA 1RQNA 3I9V6 1HFWA 3LP5A 3PPWA 2VUUA 4QU0A 2J4FA 4UPVA 4FS8A 4M9SA 1EHYA 2CWWA 1PJLA 2HLNA 1QHEA 3NT4A 4WT7A 4XE5A 4CF3A 1ST2A 2FQ1A 4JVMA 4LTNA 4PQGA 1IHDA 3NHUA 5KPDA 3ZHZA 4DXHA 1Z39A 1UZMA 1FFYA 1FTWA 1O0BA 2YXPX 2G1AA 4MQ6A 5B1DA 1JBQA 4MWGA 3WDSA 2R5FA 4Q05A 5C7OO 2R7MA 1U80A 4YP1A 2A92A 1W5EA 1ZUWA 2F43B 2YYZA 3ON5A 4MW4A 4O5OA 4S1TA 3HVRA 1G3MA 2J6IA 1DVRA 2AEMA 1K92A 2Q49A 4WLFA 4XYBA 2JLXA 4MVYA 5DLEA 3EPLA 2YFKA 3A27A 3WLAA 1GD1O 3WB2A 1OY1A 3GZNB 4FEAA 3VR6D 5L9AA 2WKPA 1EFVA 5JS6A 5GZ6A 1UMCA 2P9JA 3TQFA 2JJ8A 1CP3A 3KLOA 1POXA 2OYSA 3QKUA 2P5YA 3O73A 1P7ZA 4PO8A 1ILWA 1SNYA 3EHDA 5B7GA 4NJMA 1LPSA 1QRUA 2R68A 4CL0A 2I0FA 5DCUA 3ZGLA 1BYIA 1ISRA 1QFMA 2G17A 5LP6C 4S0XA 4I0WB 4X8MA 2W48A 3B1JA 4F92B 1HZJA 3HXLA 2CGEA 3IHLA 4Y2VA 1OA0A 1CR0A 2Q5OA 3QU2A 2XB6A 3STTA 3V2IA 2PX5A 1WBDA 1X3LA 4GSKA 3FKSD 3KS9A 2C03A 1KI6B 1IMJA 3N87A 3KE8A 4AC9A 4MLZA 1MO4A 1JHUA 3W1WA 4L8VA 2CVPA 3OCJA 4TQAA 2OCGA 2H6EA 2YWJA 3EZLA 1IG0A 2I2DA 4O3MA 1WVGA 3A26A 4PSAA 2V9PA 2E82A 3CZ4A 3V8BA 2H57A 3H84A 3O0DA 4GX0A 5KOJB 3C5HA 4MWCA 2R6CA 3MWGA 3B7PA 1JFVA 3EISA 5EEGA 3WDKA 3WY9A 4AJEA 2MYNA 1L7VC 5JUWA 4KREA 3LCMA 4HDAA 2FG6C 3DZHA 4JLSA 5FLKA 4R9UC 1IE3A 4TMVA 3NKFA 3TVYA 1G6HA 1NBHA 2B21A 2PFSA 5EJGA 4EO4A 2J45A 1QH0A 4LXIA 4XVCA 4L15A 4DA6A 2V7XA 2J5QA 2OK8A 5FWAA 2BM8A 1T24A 4HBGA 4ZZ1A 2QE7D 1XTJA 4EW1A 1V37A 3ESZA 2GJAA 3VR1A 5H02A 2I62A 1AKQA 1CUHA 2NVBA 2XRYA 2YYSA 3OC6A 3OKPA 5JADA 1R9JA 1KAEA 3EHEA 5E0OA 1EKXA 2OD7A 3RGGA 4IOJA 2C0CA 1NBWB 2GEKA 3PIRA 3QMPA 8AT1A 4HZUA 3KL2A 4D97A 1FJXA 1QV6A 4IWYA 3AL2A 3B7GA 5C46F 3DMNA 3PIIA 2I2FA 1IEWA 4HUQB 2WT9A 521PA