4A8JA

Crystal structure of the elongator subcomplex elp456
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
350
structure length
277
Chain Sequence
GLDSSHVGVRPSPATSQPTTSTGSADLDSILGHMGLPLGNSVLVEEQSTTEFHSILGKLFAAQGIVHNRIRNGDTHVIVLSLNQMFAKELPGIYYKDYNHQFDITTRLMPAPIASELTFIAPTQPVSTILSQIEQTIKRNDKKLIRIVIPSLLHPAMYPPKMFESSEIIGLMHGVRSLVKKYYERVVLFASISIDIITPPLLVLLRNMFDSVINLEPFNQEMTEFLERVYKSQPGKIQHGLVHILKLPVFTDRGEMRVLKSEWAFKNGRKKFEIEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Elongator Subcomplex Elp456 is a Hexameric Reca-Like ATPase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords ELONGATOR COMPLEX PROTEIN 4
total genus 84
structure length 277
sequence length 350
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a8jA00
1FFHA 2PLFA 3KJGA 2QBYB 3AVPA 3P20A 4MKIA 4Z8YA 3OIVA 4RVCA 2ATXA 2P67A 3QENA 4EKDA 3L8YA 1COWA 4I4LA 3LVQE 2F9MA 1AS3A 3I5YA 1U81A 1E79A 3WXMA 4CRWB 4PC6A 3AKEA 2WJHA 3OHMA 1MV5A 1UKYA 2CBZA 1G3MA 3ADKA 3AF2A 3OFNA 4EPTA 3ASYA 3KKQA 2J7PA 4OI1A 3AGQA 1TPZA 4A0GA 1TU4A 4C2TA 3CM0A 1W44A 4LI0A 3NH6A 4EJSC 2GDJA 3KJIA 2ONJA 4M22A 4TLCA 1DAEA 4Q21A 1HA3A 4DJTA 1RJ9A 2AKAB 1G7CA 2GJSA 4V0ME 1JNYA 5EQTA 1HV8A 2JCSA 3NEJA 4DBLC 2KBFA 4QRHA 5IRCD 1OFIA 2XNDA 3WP0A 2OBNA 4PZZA 1EG7A 1SXJC 4BASA 4D26A 1QVAA 2JLXA 3LH5A 1W4AA 5BYKA 2ZAOA 1VHTA 4TMTA 2XXAA 1X1RA 4OKSA 1YZTA 3THXA 1JB1A 4IDOA 1UEIA 1XEWX 2HYIC 1E9EA 3DZDA 4BEBA 2RMKA 4PHGA 3IBYA 2AFIE 2ANCA 1QG4A 2PEYA 4PAQA 5CIWA 4BFUA 1AQUA 5EXPA 2XSZD 2VO1A 1G18A 1JJVA 5C1BA 2MSDB 4DDTA 4X8LA 1XPUA 221PA 1EX7A 4UNNA 3BRWD 1LB1B 1D2MA 2ZXUA 2OEPA 1SKYE 1KIMA 2CVFA 1Z6XA 5ELXA 4TZ6A 2JGNA 3MFYA 3SYNA 3X1ZA 2WWHA 3NXSA 3AF1A 2EQBA 5H68A 1KNXA 1UKVY 1XEFA 2ZVQX 1P2UA 1AN0A 3OE7D 2BMJA 4Q5IA 4URUR 2ASEA 2Q3MA 1L8QA 3WRYC 1L7VC 1GKIA 2QMEA 3QF7A 3K09A 4E07A 2XZLA 2ZJ8A 3ICQB 1Z6TA 3L43A 3T34A 1OXUA 2BMDA 1E1RD 4OHVA 4A6PA 4FWIB 4PO1A 3I5XA 1LS1A 5J4KA 4BZPA 1A2BA 2HT6A 3QE0A 5HR5A 4X8HA 2N46A 4Q4AB 4Q7MB 3MSXA 2GETA 4P31A 3QEJA 4JLVA 3ZS9A 3P26A 2IK8A 3KJHA 2BDTA 1ZNWA 1BIFA 4A36A 1YZNA 4LBZA 2C99A 5FUVA 2C9YA 3IHLA 3AVQA 4CEHB 2F55A 5E95A 3U7FB 2ZJ2A 2V54A 4GOKA 4KBFA 5EXXA 5G53C 5KNDA 4TTPA 4LC1A 1YZKA 2XOKD 1KK0A 1DO2A 1F2TB 5AR1A 1WA5A 1G8GA 3VQTA 4BE7B 2I1QA 1FTNA 4PHTA 1HE8B 1X8KA 4RJLA 1WCV1 1IY2A 3L0OA 5FI0B 3E5HA 2GILA 5KO2A 1MR3F 1UDWA 2RGNA 4G5OA 5J5CA 2ORIA 1BMFA 3B78A 2DHRA 2D2EA 1WBDA 4D4MA 2AX4A 1EK0A 2J46A 2QBYA 1KJWA 2QPOA 2Q3FA 2IXFA 2ZROA 4JBYA 4OK3A 3T1VA 1CR2A 1KI6A 5E4FA 4BLSA 1KMQA 3Q7QA 3P4XA 3Q3JB 2B21A 4MYCA 3H1TA 3T06B 2CLDX 3GLIA 1OYWA 3FFBA 2V1UA 2CE2X 1UBCA 5HPYB 2JLQA 1W0KD 2ZJBA 1VG8A 2NO7A 4LJ9A 1ZM4A 2Z43A 1DAMA 4LDJA 3I62A 1DVRA 2B92A 2EYUA 2GJKA 3G5UA 2O8EB 2XZOA 1VMAA 2IYUA 3KJEA 2OCAA 4TSFD 3TSOA 2XXAB 1T3LA 1D5CA 2J0UB 3DMDA 5HE8A 2FE4A 2EFDB 2GXQA 4PZYA 5TY0A 1E2IA 3IEVA 5C4GB 2O8CA 821PA 4EPVA 3TQCA 1X6VA 1MABB 4AD8A 4RFVA 1CTQA 2HJGA 1E4YA 1OIWA 3AF3A 4ESVA 2IA5A 5K8IA 4IRUB 2Q9AA 3LO5A 3RHFA 3OZXA 1IN6A 2ZI7A 3OF5A 1ZMXA 4TT3D 4JLJA 3VU9A 2WJYA 3TNFA 5AWFC 3U6KA 4LBWA 1DAKA 1NMXA 4GMDA 4QL3A 4IOMA 2P5TB 2FF7A 4TMKA 1KO7A 2W2XA 3UMSA 3IIKA 1KI8A 1R5OA 2R62A 1MRSA 1CR4A 2G1KA 3ZGXA 5DO9A 1US8B 3DM5A 4TLAA 5JWHA 3VFDA 3ZD7A 1XMIA 4C2UA 3K0CC 4HI0E 4JJZA 2JLRA 1OLOA 1OKKD 2IS1A 4F4JA 2QZ4A 3OAAD 5H1YA 5IK2D 3K0SA 4AKHA 1YQTA 3LVRE 1SHKA 4GBMA 5SZKB 4BPBA 1OIXA 4LK2A 5L3VA 5LBIA 4JLPA 4G01B 3SDZA 3ADCA 1ZVQA 3PFIA 4JVMA 4BLPA 3L0SA 2RCNA 4KFUA 5G3YA 4LHZA 3U3JA 3DKVA 4A0FA 2PZGA 3P32A 1N6PA 3C15C 1S1MA 3SYLA 4US2R 1DPFA 1UM8A 2QP3A 1MH1A 4IOKA 3SEAA 5IT5A 1HY3A 2W2TA 3TSZA 2QMHA 3CPJB 2WV9A 2A5GA 2ZREA 1KZ7B 4HLUA 4GDFA 5CYPA 1JR3E 2GZDA 3W34A 1M74A 2AXNA 4X8OA 5FOSA 3RSLA 2ODBA 1G3QA 2IXGA 2RGBA 4O0MA 3ZIAD 1U99A 2ZRMA 3CH4B 4FCTA 4I1UA 3FHTA 1P62B 1CBUA 2XX3A 2J59A 2CK3D 4O2LA 5KTYA 1IY0A 4HATA 2ZVPX 5JWRA 2VA8A 1GNQA 3VR6A 1W36C 2J0SA 1W1WA 5DI9A 2ECKA 3QKTA 2RGXA 1W2HA 1R0ZA 2QAGA 5JI3E 1O87A 3U6BA 3K9HA 4Q1CA 4CEJA 2WIBA 2GCOA 2P6NA 1HYQA 4K81B 2HCBA 2OCBA 4JLNA 2R6CA 3SS8A 4JS0A 3KQNA 1A2KC 5GJWC 4MGKR 1TF7A 2SHKA 3HYRA 4NE2A 3KUDA 2JLZA 4QHTA 1AQYA 4FMCB 2CLCX 2YZ2A 3BH7A 4D82A 5KNCA 4G5SA 2FSIA 4P4UA 4ARZA 1EX6A 5M04A 3GJ6A 4A2WA 2Z4SA 5L3RA 4F38A 3CNLA 1DAGA 3J81k 4TQUS 3T15A 2ZRPA 4YMTA 2GHIA 4XD7D 2OSBA 5P21A 3QPWA 1Z0JA 2XB4A 2VL7A 4QNRA 1R5BA 1KGDA 1GUAA 1XCPA 2AD5A 2BBSA 2X77A 2EWWA 4NYMR 3HDTA 4O25A 3REGA 2FG5A 4URWR 4V0KA 4EJSB 4GP7A 3K1JA 2F6RA 2REBA 1G7RA 1G8FA 5F9HA 4N0EA 3SR0A 3TVDA 5FBVB 4WXPA 5JI2E 2OXCA 1W0JA 3DKPA 3OIWA 2GXUA 2MSCB 2ONKA 4G0NA 2BBWA 1EESA 1FUUA 4DIDA 4GPTA 2J3EA 4XWAA 1RYHA 2QG6A 1U98A 4TMZA 5FBLB 2X1VA 3RC8A 4LUCA 1IN5A 1I4LD 1NMYA 3TW4A 1OSNA 2QPAA 4B71A 3U7HB 3B1VA 2V6IA 1B23P 2NIPA 3ZVNA 2H17A 3C4JA 3SFVA 1CJVC 2R65A 1G41A 4A15A 2ZTSA 3AF0A 3KQHA 1G64A 4DSNA 2IF0A 2ODEA 1XJ0A 4OYHA 4QHYA 5DHFA 1Z8FA 4R98A 4JLBA 4JMPA 4RFSA 1CJUC 4HAWA 1NBMA 1UFQA 5CB8A 3CBQA 3KB1A 2J9RA 3B9QA 3EA5A 2ZE6A 4B32A 4IXMA 4YC7A 3CUEF 4BFSA 3B1YA 3KDSE 4FMDB 1XD2A 1NY5A 3V00A 3MGCA 2E87A 4TN1A 4PX9A 2WWFA 2VSOA 3SN6A 1R8QA 4LPSA 2LKCA 5J4VA 4IEEA 1S0UA 4QGAA 3SJAA 2R9VA 3AVUA 4JLMA 4JSTA 1QZXA 3ZVRA 3CIOA 2GEVA 3K70D 1F2TA 2A7QA 4GT1A 4QJ5A 3T12A 2IYTA 3GJ4A 3MCAA 2OHFA 3EIHA 1FL9A 3NH9A 3EWSA 5EXSA 5BN5A 4V0NA 3PR1A 2OUKA 1P2TA 2VP2A 1YR9A 1ZINA 4M1YA 1ANKA 3PENA 4B44A 1WF3A 3LQRA 3MLEA 3RANA 2EU8A 3AF4A 5L3SB 2VTKA 2WHXA 1Z2CA 3MRSA 4TQ9A 4WA7A 3TLXA 3UG6A 4AYXA 3QKRB 3LXXA 3A1VA 3OESA 1R7RA 2YWGA 4R7ZA 4UKDA 3AVOA 4AG6A 5CDFA 4EDHA 1II0A 1W36D 3B85A 3CKLA 4NZYA 4DHEA 3RABA 3CB4A 3WHKA 4Q1FA 4R9UC 2FWRA 2CE7A 5KNBA 4RZUA 2LKDA 3CR8A 1FP6A 4MKGA 1EWRA 4Q03A 2JLVA 1SVIA 2ZSEA 2BJVA 2F1RA 5JBQA 3THWB 5IHPA 1DADA 2QA5A 2DFNA 2G3YA 3IQWA 2V7QD 1Q1ZA 2QGZA 4TL8A 1U9IC 4QOSA 1E1QA 1U0JA 5EZ6B 5AUPB 2N1BA 3N2EA 5JLJA 4GOXA 4LYJA 3PV0A 1T0JB 2J45A 5DI3A 1UBGA 1VYVA 3B9PA 4KHZA 4CT4B 2HXSA 3UATA 3QNUA 5AJZA 1JEEA 4B3GA 5DIFA 2RGNC 3MJRA 4NH0A 3GLGA 1X86B 5GJCA 3SI7A 2B8WA 4KFTA 4NMMA 4BLOA 5FH9A 3U44B 3C5CA 4L4UA 2HLDA 1B0UA 1NIPA 4M1WA 4Q4HB 1KJZA 2ZIAA 4ASUA 4YLGA 2ZRFA 1LF0A 1QBKC 3N70A 5F98A 2NMVA 1XPOA 4M21A 1N6KA 2C5LA 3LAWA 3EZ9A 4CGZA 2ZSBA 4KVAA 3LBNA 1OV4A 4TYQA 1N6NA 4C4PA 2DWQA 5HCIA 3T5DA 3BH6A 3BB1A 3CPHA 3PUYA 2WSSD 2V55B 3U3KA 1RJ9B 2FJUA 4A4DA 3AQ4A 3BFKA 2P2LA 3M1IA 1VYUA 3UMRA 4DUGD 4M9QA 2WOOA 3KX2A 4C0BA 3ONWA 1PVOA 2JJ2D 3Q85A 4LY6A 4C0LA 2AK2A 1WDTA 3NDBB 1GILA 4URVR 4NU0A 1E32A 1Q1EA 2VP0A 2WWIA 1N5LA 4L15A 4ZCMA 1XTKA 1XU4A 3GLHB 4KCGA 2JASA 4AC9A 5DN6D 4U7DA 1E9FA 1T8UA 2ZPTX 2XEXA 3I1FA 3U44A 2IUTA 1LS6A 3A4MA 2ZYUX 1OH7A 4ZIRB 1G291 1UJ2A 5CM9C 5CDFE 3AH8A 4DLTA 1E2KA 2C9OA 2F3RA 4QGFA 3PIRA 4TYPA 2L0XA 4F91B 1UAAA 1TUIA 1VG0B 2XNSA 3V4RA 2BBOA 2AN9A 1ZUHA 4Q4HA 4B47A 1RYFA 3W90A 4TLDA 3FGNA 2J7KA 3AVTA 3WMGA 3RWOA 2CCGA 4LHVA 1LFDB 1KOFA 5H8WA 3ZLJA 2JLWA 1IN8A 1LNZA 3BFXA 1NSTA 2CHVA 1AK2A 1RVDA 4HB3A 3EC2A 2Q6TA 1YR7A 1XTSA 2A30A 1AS2A 1XJCA 1OIVA 4BLQA 4C3ZA 2H57A 4HDCA 4LJ7A 3AVVA 1NSFA 2QGNA 2O8FA 1P3JA 2N42A 1II8A 2PLRA 2R8RA 2QE7A 2D74A 4FMBB 5JZVA 4DEYA 5EXTA 3U4QA 2RGCA 1TEVA 3U3OA 2Z4RA 1PUJA 3VNUA 2PCJA 2OM2A 5C18A 3R8FA 2IWHA 1NN3A 4K46A 1VCMA 4URYR 3FVQA 3CLVA 4M4SA 4MH0R 1RC8A 3C8UA 4RKFA 3GQBA 1IN7A 1YKSA 5KSZA 3UPUA 2AL7A 2D62A 4POAA 4I1VA 5KSOA 1VCIA 2WKRA 5KHOC 3EZ2A 1EXMA 2YVUA 3TSWA 3BORA 1GWNA 1JBKA 1LV7A 4TMXA 2NPFA 1JQJC 1OYYA 2IYQA 3BE4A 3BIFA 1TADA 2OAP1 4PTLA 1FW6A 1L2TA 3CO5A 4EPXA 5TMPA 1FMLA 2WM9B 3PITA 2ZS8A 3P27A 4AI6A 2WPDA 1E96A 1R0XA 1S1CA 2QENA 3PUVA 2NTYC 2IYSA 1QRAA 1X8JA 3FKSD 2XTZA 2QTVB 2VQSA 3IGFA 4BLRA 3AB3A 1U90A 1UF9A 2IEZA 2ZU0C 1GVNB 2ZI9A 3LX8A 5EUMA 2CCJA 3SBEA 4P4SB 1BO6A 5JS7A 4II7A 4TTQA 1ZNYA 4HUTA 3I32A 3NVAA 1NL3A 2OO7A 1M7GA 5GVSA 1O3YA 3W9YA 2CJWB 4WZ6A 5E7IA 1W0JD 3SJCA 3AVXA 1A82A 1XD8A 4JLOA 421PA 4LV8B 3C7KA 4PO9A 4D81A 4MKHA 3Q5EA 1XWIA 5B30A 2GKSA 1UKZA 1Z6YA 2REXB 4JVLA 2QUZA 2IYVA 4I99A 1KO1A 3HPQA 3GLFE 1LY1A 5J40A 3ND9A 3WMEA 1CLUA 1P4SA 2W6JA 2Z0MA 2WBLC 2C78A 4LRWA 4IVQA 1GRQA 4ZKEA 2QAGB 5A4JA 1Z2AA 4C0AC 1EFCA 5FL7D 4QBFA 2P3SA 4DLZA 2GK6A 3PJRA 4DB4A 4PAMA 3EA0A 1KKLA 4CEIA 4B3FX 1CS4C 1Y3AA 1UADA 1P60A 2A2ZA 1E94E 1W2GA 2XB2A 1H8HD 4MGIR 2BMFA 2ZJYA 2PEZA 4ABYA 3BGWA 1FZQA 4TLBA 3IIMA 3B60A 4OHXA 5CM8B 3GJ8A 1N0VC 3RRYA 1XEXA 2GTPA 1NVVR 3EZ6A 1I2DA 3K9NA 4LX0A 4JYCA 2ZI5A 1W4CA 2WVJA 4P0TA 3AUYA 1SVWA 3SOPA 4PQFA 4MDFA 4EPRA 3H2YA 4U5XA 1Q57A 3T5GA 4Q9LA 4RZ3A 4LYAA 4XIGS 1T3HA 3EPJA 1QHGA 1ZAKA 1WP9A 1FUKA 3DVLA 3ETLA 1TQDA 4JKIA 4BFVA 1P61B 6Q21A 3X1DA 3NEYA 5HTKA 4LJ5A 3GJ7A 2CK3A 2QN6A 4P4SA 1JJ7A 2H7VA 4QHSA 4DB2A 3A8TA 5FOUA 3QG5A 3A36A 5HZKA 1E0KA 2OFXA 3CZQA 3A58B 3OEHD 4QJ3A 5EP4A 2VRWA 4QKQA 5DNYB 3IPXA 4B2IA 1GM5A 4KU4A 2ZR7A 4B3XA 2DYKA 2GESA 4GI7A 1ZM2A 1TX4B 5IDVA 3TR5A 2ANBA 3GMTA 3SFZA 2DWOA 2Z83A 3H84A 3JZMA 3K9LA 4LSGA 2FGJA 2QM7A 4US0R 2Q9BA 3CX7A 1QHXA 1U2RA 1YJ5A 1Z08A 621PA 3WNDA 3TVTA 4AYTA 2BBTA 2J0UA 1TNDA 3QPVA 2CDNA 3ZD6A 4CIDA 2J87A 3QPUA 4A0RA 2IYLD 2ZM5A 5FL3A 4JL5A 1KI9A 1HH4A 1GL6A 2JA1A 1DG1G 3IQXA 2J1LA 5EE0A 3A4LA 2GAOA 3CH5A 4D4KA 4Z51A 3R7WA 1XTIA 2H16A 2ZRHA 3NBFA 2BMEA 4HZUA 4U00A 4E03A 1KZGB 2VHQA 3TGPA 4C0SA 2DWPA 2QORA 5HCNA 1HE1C 3VAAA 2D7DA 2QMOA 3A1TA 3PG5A 3GEEA 4NYJR 4XSGA 2AWOA 5CK5A 3TMKA 1AGRA 4O2RA 2NPIA 4C9BA 5JWOA 1S4QA 2I1VB 1C4OA 3N2IA 4LV5B 3W6OA 4MUBA 2RHDA 1Z07A 3U61B 2CEAA 4S2EA 1HTWA 2DR3A 4UNRA 3U3MA 3GD7A 2HF9A 1MT0A 2C96A 1JAIA 2XJ4A 2NQ2C 1KSFX 1R0YA 1S96A 2WKPA 1HT1E 3CX8A 4XVRA 3PEUA 4NCIA 5TXGA 3UXMA 1EWQA 1JPJA 2QY9A 1NVVQ 2CMKA 3QSYA 4W5WA 2YOGA 5GJBA 3D6TB 5CLLA 5TDHA 1NN0A 2B7CA 2NOAA 3VU9B 4HLCA 3A6PC 4WW0A 1AIPA 2C04A 2VF7A 2R6DA 2KBEA 4NCJA 2MMCA 3CRVA 1N5IA 2F1HA 3NKVA 3B1ZA 3PEVA 2LCFA 4OBEA 1CR1A 2AHOA 5F3WB 2ZRKA 4MA4A 1P75A 3PEYA 2EWVA 3CPEA 4HEJA 3GLIE 4M0LA 3Q7PA 3OIYA 1PV4A 3DPUA 3PQCA 1KHTA 4MQBA 2OXRA 3QBTA 2IS4A 1XMVA 2PCLA 1XCMA 1TMKA 4PO8A 4A9AA 3DHWC 1SGWA 1I2MA 2VP9A 4IFBA 4QGHA 3BFVA 3RS2A 2GVZC 2WJIA 1GRNA 4NONA 2HDNB 4OQMA 2VHJA 3VR5A 1SQ5A 3FHCB 4NCHA 1U8YA 4IFEA 4JZKA 1VIYA 1Q22A 4D2IA 1YU9A 3LW8A 4Q4AA 5EE5B 2QEQA 5FOXA 1G16A 1R8SA 4XD7A 2RGAA 1Z22A 2W0MA 1KDOA 2W00A 3NC0C 3SQWA 4CDGA 4Q4JB 2OILA 3QKSA 5SZHB 1CP2A 1XEWY 1E2EA 1M34E 2EVWX 2DFKB 4KYUA 4OI2A 4YMSA 4ZDKA 4DCTA 2WMOB 2O8BA 2ZUBA 4GNKA 1XBTA 1G21E 3MG9A 2P6UA 4NL4H 5FPSA 2BEKA 4W9MC 2UKDA 3F8TA 4OK5A 3I61A 3CRW1 3QUSA 4BFZA 3KB2A 3QOFA 521PA 5JHHB 4HDOB 1W36B 2BWJA 4KXFB 1E9AA 4XTCS 5FUYA 1K5DA 1H65A 4PAOA 1D6JA 2V9PA 2ZSFA 3BXZA 4A1FA 4HAZA 4YDSA 3UKDA 4F7WA 1J7KA 4D6PA 1FP7A 1IXZA 3FTQA 3QY0A 4S35A 4BRUA 5JEDA 3X2SA 3ZJYA 4KSCA 2ERYA 2CHQA 1DAHA 5AJYA 4EFNA 3LD9A 5G3ZA 1M7BA 3W5IA 4Q4JA 3OE7A 2CL6X 5J4HA 2Q3HA 3UANA 3R20A 1Q21A 3ZIAA 2A5DA 4CEHA 3RRMA 1OE0A 5JJKA 2R2AA 3EARA 4FCWA 4IW3B 1KO8A 3QG1A 3Q5DA 2ZJAA 5L3SA 2ZU6A 1I4TD 4QC2A 2BKEA 4LJ4A 2I3BA 1ODFA 2HEIA 5F9FA 3K0AA 4LHXA 5L3QA 1Z0DA 3RLFA 1VPLA 1WMSA 2W6JD 4FXPA 3TUZC 2ZSDA 1SULA 3DEFA 3DZ8A 5FBWB 4LPKA 2JLUA 1AJEA 4JT4A 3I3SR 3JZAA 1T91A 1D2EA 3CWZA 5FR2A 3ECCA 5JEEA 4MYUA 3WBJA 5HZHA 4EIWA 4DLXA 1NG1A 1CIPA 4FD2A 4PANA 2IEYA 3OAAA 1OKKA 4B73A 4DWJA 3BB3A 2H8KA 2A78A 1SXJE 2CL0X 4IJMA 4Q1EA 4ERNA 4ZV4A 1U8AA 4DZZA 3WYFA 2FPMA 4V0LA 1N6HA 2BM1A 2HXYA 2X2FA 4IDNA 3SBDA 4Q47A 1J90A 1HQCA 4DSOA 2FN4A 2QP4A 3NDPA 4NYIR 2GJ8A 3CONA 1E79D 5KSPA 1G9XA 2GEDA 4TT3A 2FEMA 1KK3A 3TE6A 1J8MF 2AXPA 1W7AA 2RAPA 4LBVA 2PZFA 1Z06A 2BIFA 1XPRA 4ZI3A 3EIEA 2YOFA 4TL7A 1GL7A 5F2EA 5GADl 2XJ9A 1W47A 3QBVA 1FNNA 3LV8A 4M1SA 1PZNA 3UK6A 2VHUA 5JCZA 3CW2A 3LRPA 4Q7LA 4OHZA 3WYGA 3I8SA 4FINA 1NLZA 1ZNXA 3QKRA 3SJBA 1ZD1A 1FNMA 4B6FA 1CRPA 2VH5R 3IDQA 2ZRCA 4GP6A 4L5BA 2IHBA 3EWAA 3KUCA 3HWSA 2F43B 1K8RA 4LGMA 3TUJC 4MYTA 3GJXC 2PH1A 4LYFA 4E5UA 1ZC4A 3VMFA 4AIIA 1Z6GA 3WYAA 1GRRA 2HUPA 2ODNA 4C0JA 2KSQA 1Z29A 2G9NA 1ZW6A 3S1AA 3K70B 5CJPA 2FA9A 3KQLA 4ZCLA 1T4GA 2F3TA 4OJQA 2OAQ1 1FQJA 3A1UA 3W5JA 5B57C 4RCZA 4LYHA 1XXHB 3BK7A 4M9XA 4RD2A 3V4FA 2B8TA 1OB2A 1QHSA 2VLIA 4WZAE 1BKDR 1YZUA 2PJZA 2QSYA 3SZRA 2WTUA 2NZ8A 3PUXA 5EE3A 1T0HB 2ZI4A 4C0HA 3BD9A 4NYMQ 1XTJA 5DE3A 1XEXB 4IXNA 3T1OA 4PPGA 4KFRA 4QJ4A 4W5JA 4HAUA 2R44A 2AFHE 3K0EA 1MO6A 1T9HA 1JPNA 3NHBA 4X8MA 3PCRB 3LA6A 3EG5A 2XITA 2V8OA 3OEHA 2ERXA 2QQ0A 5FTJA 5GJVC 1F3OA 4F93B 3O47A 3VR4A 4BZXA 4RSGA 3A37A 1XMJA 4N1AA 2PT5A 3FMIA 4LHYA 1OXSC 1T5IA 2GK7A 2WKQA 4FMDF 3GFPA 4RD1A 4TTRA 5D3MB 3X1YA 4ZDIA 2GNOA 4C7OB 1E6CA 3SNHA 1Z0AA 4TL6A 4W7SA 2IWRA 1QHYA 2G0TA 2WSSA 3IO5A 3GP8A 1EFTA 5AUOB 4GMXA 4B6EA 3FPAA 4PC2A 1BYIA 4EUNA 2GA8A 1RZ3A 4RD3A 2CVHA 4Q02A 4BEJA 4O3MA 5K8UA 2KE5A 3HR7A 4A2QA 2IHYA 2QQEA 1H8HA 4UNPA 4CW7A 3I92A 4US1R 4GSYA 5JSZA 2QROA 3IKJA 1IONA 2OCPA 4Q7JB 1VYTA 1N6LA 3F5FA 3ICEA 2WAYA 1KSHA 2ZRIA 4N3NA 1NKSA 2JLYA 2Z6VA 1A5TA 3M4YA 4UXJA 3TKLA 1XFAA 3LLUA 2VIIA 2WWXA 5FL7A 2G1JA 2GWHA 1VTKA 1WE2A 2H18A 4ZKDA 1LW7A 2ZQ5A 4URXR 1PUIA 5EP2A 3EX7C 5L8VA 4Q9HA 3A4NA 2PL3A 3B8HA 1HQYE 4DLVA 4M1KA 1Q12A 3KXKA 3P4YA 3REFA 2V7QA 3HP1A 2QTFA 1Q3TA 121PA 3ND8A 2FOLA 3HYTA 2ZRAA 3MWKA 4A2PA 3KQKA 1IJEA 1GKYA 1QHHB 5JS8A 3DO6A 3UMFA 1Q0UA 4NTZA 3I8XA 5E3HA 1GTVA 3L8ZA 1Q3HA 3A1WA 4BWYA 3B1WA 2QRZA 3CX6A 2ZAMA 1GITA 4OQNA 1DEKA 1N3BA 2A3RA 3A1SA 3K09C 2GCNA 3KL4A 5BQ5A 3U3RA 2W58A 3FKSA 3ZH9B 2ZYWX 3QXSA 2GRJA 4XOIA 1K6MA 2IC5A 3RS7A 4H1UA 3MWLA 5DYIA 1GP2A 2REOA 2WPDD 2IS6A 2O8FB 1ESMA 3BB4A 4HSEA 5DGXA 4CEIB 1I4DD 1G3IA 1DO0A 3CRMA 4KAXA 4Y0AA 4JT2A 2CCKA 4LJAA 4DLWA 1COWD 1A1VA 2Z5FA 1QG2A 1G6HA 1A7JA 4Q7KA 3IILA 2A5YB 5H70A 3GLIB 4TMWA 5LD2B 4TYWA 3B5JA 2FFHA 3BC1A 3L0PA 1Q1QA 2WZQA 3W3AA 2J5XA 1U94A 5FTNA 4Z54A 2IF2A 2XGJA 3L0IB 3GEIA 3M0EA 5D3QA 3ZVMA 1ZIPA 1GNPA 1RIFA 1X8LA 2FZ4A 1E69A 1OXXK 4B48A 3SE0A 3KKOA 5JHGB 3GJ3A 3OEED 1KKMA 3GEHA 4IEIA 2R6FA 3DMNA 4I1OA 3NHAA 4PHHA 5AK0A 5EZ5A 1RFLA 2BVNA 1CJTC 4DLRA 1US8A 1E2PA 3OIUA 4LOAA 2QE7D 1P72A 3BAFA 4XVUA 3B2EA 1P9NA 3AKDA 2HCJB 4QM7A 2JIZA 4HAXA 1W4RA 2FX3A 4QXAA 1XB2A 5JRJA 2AKYA 4GL2A 2GBLA 1S2MA 2ZE5A 4TYNA 4LZZA 4YXWA 2QT0A 1IBRA 2NGRA 2J41A 1OFHA 4OJKA 1NP6A 2CNWA 5KSYA 3WY9A 4DDVA 1G7TA 2B6HA 4Q19A 1U0LA 3SHFA 3CNOA 1Z63A 2CXXA 1CKEA 1SHZA 4PHFA 1P5ZB 1JR6A 5FOWA 2ZRNA 3EASA 1OXVA 4ACBA 4FN5A 2ZRGA 1BH2A 4RZ2A 2ZJZA 3HU2A 1AGPA 3KQUA 4Q18A 5BWMA 5IF9A 5JRZA 1ESNA 2IYXA 2XTNA 1M6NA 3NBYC 4UNQA 3SHWA 5FPKA 1OJLA 5AUNB 5DN6A 1ZM7A 2BM0A 2BOVA 2ORVA 2WWWA 5UKDA 3F3YA 4L9WA 4R2IA 1GNRA 1Z5ZA 1DAIA 2A5FA 4M53A 3ZZTA 5KU1A 1II8B 1G19A 2WWYA 1E2GA 2JJ2A 4YMWA 4HUQB 4DUGA 3DL0A 2ZETA 2O8DB 4RCYA 1DG3A 1MO3A 3U2QA 3VKWA 1F5NA 4GRAA 1LVGA 1NN5A 4JYBA 2EFEB 4ZIRA 4B3DA 3DDCA 4D0GA 3DOFA 3MWYW 2F9LA 2WICA 3FMPB 3MUFA 1XZPA 1AKYA 4ZDWA 2AD1A 5FI1B 1XD9A 2CHGA 5FBQB 2F1IA 5TV2A 2BCJQ 2FFQA 4UXIA 4M8NE 3GLGE 4ASUD 1F48A 1S3SA 3FB4A 1GZSA 4KI0A 2FSFA 2HLDD 1K5GA 3QVVA 2F43A 4G1UC 3UWOA 3RWMB 2DPXA 2QPTA 3IUYA 1GL9B 2H5EA 4FIDA 4WAUA 1R2QA 1ONBA 2JLSA 1TF5A 3EW9A 4B2LA 1H8EA 2JJ1A 2IW3A 4PZLA 4MRNA 1E3MA 2I4IA 2NO1A 2UZIR 3VTKA 5EJEA 1CR0A 1KI4A 4DCVA 2YINC 4L9SA 1SXJB 3VKGA 5FFMA 2ZI6A 2QRNA 5EP1A 1XCGB 1E1QD 2FFBA 5KDDA 3FOZA 1OFTA 1TQ2A 1NMZA 3VR2A 4HAYA 721PA 1SVMA 1VHLA 1UBFA 2GXSA 3HJNA 4Q00A 3ADBA 5TVKA 4RD0A 1E2NA 3TIFA 3HU1A 4ZPXA 3HR8A 1KDPA 2YC2C 1JEDA 3KKNA 1D9ZA 3LBHA 1T5LA 1AA9A 2JJ8A 1QF9A 4LCBA 3GLGB 1DE0A 3B82A 2ZJ5A 1NI3A 1CRQA 5C2JB 4P4TA 1OW3B 2NO6A 3K53A 1VDZA 2ODWA 1FPMA 4AYWA 2D7CA 3QKSB 2RHMA 4LC0A 3T61A 4BUJA 3U7EB 5EE1A 3TUIC 2DBYA 1TQ4A 5IK2A 4DEXA 2A5JA 1Z0KA 4FI3C 4XTRA 2O0HA 1N5KA 1XNJA 4PQYA 2JAQA 2VP4A 4BZQA 4AURA 1Q20A 2IYRA 2IT1A 3C5HA 1CULC 2ZJOA 1NLYA 2OE2A 2ZUCA 2JEOA 2HF8A 3R8CA 2W6IA 3R9WA 1MO4A 1XD2B 4TWZA 1N5JA 4A82A 3WHLA 1Z6AA 2OG2A 4JLAA 4A0HA 4JL6A 1DS6A 2WJVA 1KI3A 4UXHA 2WAXA 4I1SA 4GFDA 5ANRB 1ZM9A 3AKCA 1V5WA 3BS4A 2P6RA 4B43A 3KKPA 1E2LA 2HJVA 3KXIA 4RKEA 5E7JA 3AVYA 5E7MA 2FSGA 1ETUA 2KB0A 5G40A 3AKYA 2FPLA 2V3CC 2RGEA 4V03A 2F1JA 2O0JA 2GBLC 1NBMD 2BV3A 3LX5A 1CJMA 4IVRA 3EZFA 4JJKA 4OQXA 4CYMA 1L4YA 2QL6A 1SVSA 3K0CA 1PLJA 2DY1A 2EFCB 3LDAA 4OL0A 1E0JA 4B74A 5HKKA 4IVPA 4NYJQ 4PR0A 2W83A 1YRAA 4YQFA 3FMOB 3QXXA 4YMVA 1G5PA 3THOA 5A0FA 2PX0A 3AGPA 4TYYA 3AP2A 4ZCIA 1ELOA 4WZBE 3FKQA 2YYZA 4AWXA 3C41J 4WVFA 4DRZA 3QJYA 2IL1A 1E2QA 4OQFA 5FBRB 1XTRA 1W49A 1ZU4A 1YHNA 1D8TA 4IKEA 3ZDQA 1VIAA 4CVNA 4D4LA 1W5SA 1KSJA 1X3SA 1G20E 1NLFA 3QQ5A 1XTQA 3TW8B 3IO3A 4TMVA 3LLMA 4XH9B 4EFLA 3PXGA 4KLNA 5SZIA 4M2LA 4MRPA 3LQQA 4MGZR 1UKEA 3EPLA 1DAFA 4NYIQ 4AK9A 2OCYC 5J4LA 4RFSB 4V02A 1IY1A 5HE9A 2GJAA 1Z28A 2KJQA 1R6BX 2YNMA 3Q9LA 1NG9A 2K5UA 4HZUB 4NDZA 5KOYA 2YKGA 3H0KA 4H1VA 4JBXA 3M6AA 1WBBA 4MRSA 5EP3A 1JXMA 4NKRA 1T6NA 4JL8A 4B3CA 4D80A 2GXAA 1ZD9A 3ZS8A 1IHUA 2NO9A 4FW9A 3T1TA 5B58C 4HLUC 1N6OA 4RD4A 5CIQA 3RRNA 5FOVA 1CU1A 1JAHA 1KMHB 4WXRA 4R2HA 1NRJB 2IYWA 3LW7A 4PSKA 3PVSA 4DLYA 1E1RA 4DCUA 4EQ6A 3THYA 3KTAB 4AKGA 2FZLA 2BKUA 2ZS7A 5KPDA 1KK1A 2YC4C 2ZYTX 4PFSA 4Q9KA 5CYOA 5JECA 2KI5A 4ARZB 3CZPA 1FQKA 1KI2A 1S8FA 4YDHB 5BN3A 4KSBA 5CITA 1E4VA 1A4RA 4PC1A 3WP1B 1ZP6A 2EFHB 2RGGA 4PPFA 1JR3A 1M7HA 5FUWA 3KXLA 5LB4A 4CEJB 1NVXQ 2EFGA 2ZYVX 1YRBA 4B33A 2BJWA 1SVKA 3CF6R 2QU8A 1DOAA 3VX3A 2W2VA 1N6RA 1U9IA 2G6BA 4Z8XA 2VEDA 2OBLA 1E2HA 1L4UA 1ZU5A 2YJTD 1N2CE 3BH0A 4V0OA 4Q9IA 2OT3B 2C2HA 3RS5A 3RS0A 3AM1A 2XSZA 3RS4A 3TJZA 1XZQA 4KBGA 5DYGA 4PC3A 4MDEA 4HZIA 3D3QA 2WWGA 3W6PA 1EFRD 5J47A 1OHHD 3PUWA 3U7GA 1CEEA 1P73A 1TF2A 1EFRA 2O0KA 5SZJA 1V43A 1YZGA 4NBSA 1GSIA 4KYIB 2X2EA 1M2OB 3CF0A 4AKEA 2AK3A 5DLQC 1EFUA 2QMUA 2XNDD 1X1SA 4HDQB 4J0QA 4JIMA 1PJRA 4EQ6B 4EPWA 1KO5A 3THYB 1MOZA 3CWQA 2PZEA 4UNSA 2OLKA 1U8ZA 4RZXA 4TL9A 4D0NA 5FPHA 1GKUB 5LDDC 1W4BA 1NKTA 5A5GA 1GDDA 3SC3A 1IAQA 3IHWA 2GVDC 1XRJA 1G17A 1II9A 2F7SA 4C7OA 5JFGA 5D3MA 2J7PD 1VG9B 3IPYA 1E9DA 1YR6A 3BWDD 4GOJA 1MABA 2IX3A 1Q1BA 1OXTA 4M1OA 4U02A 3NWJA 1NJFA 2OFOA 1RRPA 4JVNA 4ZO4A 3TAUA 1G4AE 4MYHA 2V4ZA 1ZYUA 1EFHA 4ITRC 4FCVA 1WRBA 3QIAA 4UJ5A 1OPXA 3I72A 1F60A 1JXOA 4JSYA 3B6EA 4UQOA 1IQPA 1DELA 3AUXA 2ORWA 2UVQA 3LY5A 2FNAA 4DLUA 1ZNZA 1G3UA 1XDBA 3S1AB 4TQAA 5C4MA 1UEJA 4A6XA 1ZUIA 4B76A 2GJ9A 4DC9A 3GPLA 4D4JA 3QVUA 3LBIA 1W5TA 3FE2A 3NC1C 4P33A 3EXAA 1ZCBA 4TSFA 2AR7A 4Z1MD 4C0QC 3CR7A 4KVGA 4M9ZA 5EUQB 2WOJA 4YMUA 5FTKA 2J0VA 3UIEA 4BFXA 3SYKA 3K70C 5L3QB 2BHRA 3TK1A 1W0KA 3VX4A 1TU3A 1G8YA 2G77B 5FPTA 1E9RA 1TTTA 2D06A 2NZJA 2XAUA 1XF9A 2OLJA 2W0SA 1FX0A 2NO0A 3KKMA 3PUZA 2P65A 5AUQA 3LNCA 4IOLA 4Q4LA 2PMKA 3RAPR 3SQXA 3R9XA 3RC3A 3FWYA 1G6OA 2CL7X 2YHSA 4URZR 4JLDA 3EZ7A 4PSVA 4C0KA 1Z3IX 1IN4A 1BMFD 2BCGY 4M1TA 5BXQC 4BFTA 4F4CA 1N25A 1N0UA 1PLLA 4MUAA 4DDUA 1OH8A 4A8JC 1TQ6A 4IHQA 1VCOA 4DDWA 5CJ2A 1Z0IA 4GZLA 2XOKA 1OB5A 4G5RA 1WQ1R 4Z1MA 4OI0A 2QM8A 4QNMA 2J0QA 4CT5A 2ZR9A 2PMDA 3NIBA 1JECA 2GF9A 1E98A 2O8EA 2QSZA 3X1WA 1E2MA 1S3GA 3WNCA 4W5HA 4HLQB 3NBXX 1JQLB 2QP9X 2IUSA 3IIJA 3QXJA 4QFMA 2D2FA 2UZ3A 4P3YA 1OFUX 1Z47A 4OHWA 3DM9B 2PX3A 3KFXA 4JLKA 3GFTA 5LPNA 1UDXA 3P1JA 4HAVA 4H9GA 8OHMA 1Q44A 3W8NA 4EFMA 5FPYA 4HB0A 1NF3A 4V0MA 3EIQA 1Z83A 3GLFA 3CRQA 3GLHA 3GCGA 4XJXA 4KITB 5JCPA 3G0HA 1R4AA 1GAJA 2VSXA 5JJIA 3LWNA 4OK6A 1P7CA 4WOPA 5FOTA 2ZR0A 1UPTA 2R6AA 3JVUA 3QEOA 3RS3A 1P6XA 2P0EA 4IDHA 2FPKA 5CK4A 3R9IA 4NP6A 1ZM3A 3Q72A 2QI9C 4ESHA 1YZQA 1CJKC 4K8OA 2FU5C 1E2JA 2CLSA 1NY6A 1AM4D 4BFYA 4HLDA 3QI2A 4PSAA 1NJGA 1LF5A 3AV0B 2IYZA 1OF1A 4IDPA 1KYIA 2YWHA 4JBWA 1XXHE 3GJ5A 3K0AB 2ZI3A 1GOTA 1OH5A 1YZLA 4Q48A 5DH9A 1RPZA 3ZYCA 3QXCA 4LBYA 1WB9A 2E9SA 4QBHA 1CF4A 3CF2A 1IJFA 1OHHA 4XWOA 4DKXA 2IYYA 3X1XA 1RE0A 3WBKA 3K0FB 3O8DA 4EPYA 2YV5A 1KDRA 3VR1A 3GLFB 4PPNA 1HUQA 3W6NA 1R10A 5KPJA 1G8PA 1KTVA 1KI7A 1ZIOA 1G7SA 2RKOA 3L82B 4HUQA 2FEOA 4BRWA 2ZE7A 3RVBA 3QXHA 3UWKA 1IM2A 1YE8A 4YONB 2C8VA 2GEUA 3AEZA 3ZZ0A 1JI0A 2FSHA 2O8BB 1KNQA 2OFWA 1JR3D 3I4LA 4LJ8A 2D4HA 4LJYA 1IOZA 2GAAA 4XVQA 2ATVA 3TH5A 1H8ED 2JJ1D 1J99A 4LJ6A 3AP3A 1D9XA 1SVLA 1HT2E 1VG1A 3AVWA 4MRVA 3OFND 2VPPA 3MJHA 2R6GA 3GFOA 4LWZA 4MITA 3T35A 1AS0A 1MKYA 4M9SA 4G3XA 3R7WB 1KJYA 4DIEA 3K0FA 2HV8A 2WMNB 5K8LA 2ZITA 1SVOA 3U60B 2WJGA 4B35A 1BS1A 2C77A 4LHWA 5EE9A 2QTHA 1J8YF 2HT1A 4XSHA 3THXB 2RB4A 4DLSA 2Q9CA 1GIAA 1SKYB 2FDCA 1J70A 3QF4B 2VYFA 1SXJA 4KFSA 2BC9A 4P32A 4JVSB 5AJVB 2BEJA 1XMSA 3CRRA 1AKEA 3PEWA 4B2PA 1KO4A 4E22A 2Q0HA 1M8PA 4MGYR 5C46F 1TUEA 4F92B 4DSUA 1E9BA 3CNNA 1HEIA 1FOEB 4I81A 3C14C 2ZSAA 4M1MA 2O8DA 1KDTA 3IBGA 3E2IA 2C98A 4D25A 2C03A 3H86A 2DFTA 1FMJA 3VR3A 5KDLA 4BLTA 5J4YA 3I73A 4F4IA 2QNRA 2X8AA 2MMGA 2KWIA 5BN4A 5JJLA 5CLQA 4IDQA 1QVRA 2YOHA 1SKQA 4NCKA 4BQSA 3MAAC 3ZQJA 2CNWD 2YWFA 2JDID 1VCNA 1ZC3A 4WIAA 2QAJA 3VHXA 2DB3A 5DHAA 1GG2A 4L16A 4G5GA 3UG7A 3EPKA 3K9GA 2VP5A 4Y0VA 1DBSA 3TR0A 5FTMA 4QBIA 4AKIA 1UBEA 5DI3B 5KUTA 1P2VA 1ZRHA 2JIZD 3TAHA 5BW8A 3NG1A 3TBKA 4Q01A 1MO5A 4Q9JA 5HKKD 2ZS9A 2VF8A 1P9WA 5DSZA 4RY2A 2EW1A 3WRXC 2VHTA 4QG7A 2PT7A 3THWA 2A9KA 2IXEA 2G83A 4DVGA 4RD6A 1ZCAA 2B7BA 2QT1A 2ZANA 3FFAA 5B64A 1ZUNB 3Q8XB 4PQRA 5TARA 1KAGA 3OEEA 3JVVA 2H92A 3TQFA 3D7MA 5FR1A 4OHYA 1SXJD 3QKUA 4FMCF 2G88A 4NHOA 5DISB 2O52A 4DXAA 2V6JA 1G8HA 4LV6A 1S9HA 3D8BA 3W3ZB 1G5RA 3NBZC 1JALA 1LTQA 1C9KA 3NTUA 4A8JA 1FX0B 1Z0FA 1E99A 1KAOA 4PPQA 5GVRA 1F2UA 3E70C 3SJZA 5LB2A 4XWKA 1YVDA 2GF0A 1KY2A 4BGDA 1QHHA 2W6ID 4GZMA 3VHLB 1XJQA 3H4MA 1IXSB 3B13B 3KZ1E 1OH6A 4QM6A 2OV2A 3FYHA 4B34A 2WIAA 4ZDJA 1W48A 3D31A 4C30A 2CJWA 3EAQA 1RRFA 4HB2A 1AZTA 5JSZB 3DOEA 1M1YE 3FMFA 3VNVA 3SU8A 2GZAA 2VSFA 4KO8A 3K8YA 3L2OB 4PXAA 1TAGA 2H1LA 2IBMA 3ASZA 1NNEA 4R71A 2IS2A 4AY2A 4AG5A 3B7GA 1PLKA 4KLZA 1P9RA 1CXZA 1U0HC 3GLHE 4UJ3A 2MSEB 3IEUA 1E0SA 4A92A 3O8RA 3RNLA 4B75A 4NPHA 2ZRBA 5CB6A 2WJJA 4Q1DA 2GCOB 2WSMA 5TB5A 2C95A 3KTAA 3RRZA 2RH5A 4DT1B 1KSGA 4DSTA 4NCNA 1F6BA 2VHCA 2XTMA 5JMTA 4ILEA 3BOSA 3LFUA 2EYQA 2FV8A 3HU3A 3MD0A 4PC7A 1J2JA 3TRFA 2OESA 2GCPA 1MRNA 1ZD8A 2OBMA 2ZEJA 4FWTA 1AZSC 3ADDA 1NN1A 4ON9A 4TLEA 1IXRC 2XZPA 5BYJA 1R5NA 1NBME 1DTSA 3WMFA 4BECA 1BYUA 1NVWQ 3V9PA 4DCSA 2YWEA 1W46A 1XP8A 2JATA 2PBRA 2PJRA 4HYYA 4ACAA 4EAQA 1KY3A 2DFLA 4D0LB 1BOFA 1E2FA 1RW4A 4EJSA 4WBSA 1NIJA 1N6IA 2LWIA 1VKJA 1C1YA 2TMKA 1KK2A 3HPRA 4G5QA 4QBGB 1S9DA 1FTSA 4KV9A 1ZJ6A 2QAGC 1HURA 5AJWA 5FTLA 1G5TA 5FUXA 4CF7A 3GJ0A 2C9CA 1WXQA 1QHNA 3FHOA 4DT1A 1T3SA 1R0WA 1VECA 2NG1A 3T1QA 1QHIA 4OI4A 2DCUA 4BFWA 4OQLA 4MRRA 1N0WA 1G1MA 2ZE8A 1XXHA 2Q21A 1OT3A 3U5ZB 4L8GA 4Q1BA 2RGDA 2Y8EA 1YR8A 3W8RA 1G4UR 4E09A 1E2DA 3ZQ6A 5KDOA 1P2SA 4IOJA 3RDPA 3ZVLA 2FMXA 2OZEA 3BERA 1SZPA 1D2NA 2ZUDA 3EPHA 4N0DA 3AP1A 5KYKA 1KI1A 1EGAA 4KODA 1ZBDA 1KMHA 2JDIA 3O8BA 4Q66C 1E9SA 2HYDA 1T8TA 3O8CA 2VP6A 3MMPA 5K8TA 1F2UB 3BBPA 3ZZUA 4A8JB 2FH5B 3WNBA 4YXWD 3E1SA 1E0AA 4KJZA 4DCNA 3G82C 4Q1AA 4B3BA 2VBCA 4ZI2A 1Y63A 1E9CA 5AJXA 2O8CB 2AWNA 2P5SA 1TEXA 3QF4A 2D3WA 4MKFA 2FFAA 3B1XA 4JKYA 4TZ0A 5G41A 1TL7C 1KI6B 4CZ2A 1G3RA 3EC1A 3MWJA 3KFVA 1GFIA 2O5VA 3RYTC 2GZHA 5B2ZA 2ZRJA 3LXRA 1NVUQ 2V1XA 4HB4A 2X19A 3F0TA 1RKBA 2G0NA 3U4QB 3C16C 1RRCA 2ZRLA 3VKHA 3FDIA 5LD2C 2IUUA 1RRGA 3N5CA 2E1RA 4QGGA 1XX6A 1DARA 3RSOA 2ZRDA 3BJIC 1QDEA 2FGKA
chains in the Genus database with same CATH superfamily
1UKCA 1C1HA 4M89A 2K6GA 1O5OA 4EA8A 1FTQA 2HTFA 3AVPA 3OMXA 3P20A 5JSKA 5HIJA 2V74B 2ATXA 2P67A 5IFLA 2X2OA 3L8YA 1COWA 1G9TA 4I4LA 3VRHA 3WE7A 2B8NA 4U63A 1U81A 1E6LA 4RS3A 1BX3A 3JALA 3ABRB 3NW9A 5CP8A 1R0RE 3U9LA 3OHMA 2ID4A 3HY4A 3BUSA 3RYIB 2JH8A 4KXVA 4L8WB 4C2TA 4UTRA 1ODIA 1BC5A 1UJ4A 2CUKA 4ZEOA 2VUIB 3UJ3X 4XQ9A 2GDJA 3ODGA 1DAEA 5H02A 4DJTA 4U1RA 1X77A 4HH0A 1NBOA 3KQVA 3WL7A 2ZZMA 4O4LF 1XZBA 1JNYA 2BW0A 4EDFA 2I8CA 2PFGA 2CXSA 3QTBA 1ZGGA 4L22A 4DBLC 1IHPA 1QE3A 4EA6A 5HS6A 3WP0A 1J8QA 1K8YB 3F7OA 3N3BC 3OG9A 2DZDA 4Y1GA 4YAWA 3HXPA 4EF6A 4RTNA 1QVAA 3EVFA 1W4AA 2PRYA 4FFVA 3RIXA 4TMTA 4BLRA 5BYKA 1JQ3A 5CVVA 1X1RA 2JHPA 1U04A 4IDOA 1UEIA 3UJ6A 4WXEA 4K87A 3RFXA 4A7PA 1ADYA 4Q4DA 1QH1B 1Z25A 2I87A 2JIMA 4WECA 4PAQA 4ARIA 1NYRA 2PEYA 5JVDF 1RRKA 2XSZD 3QITA 4N41A 3K0HA 2XWJI 1MG5A 4X8LA 3IBCA 4M6WB 3JQCA 3DFMA 1P29A 2GX6A 3CUVA 4YRRA 1Z4IA 1Z62A 2CXNA 3BRWD 3BQMB 1LB1B 3VZSA 1D2MA 6REQA 5JQGB 2WTBA 3D2AA 1Z6XA 3VTAA 1NZFA 1AHNA 5IAOA 3NV7A 1NJSA 1EVJA 1E8NA 1B76A 3RVSA 3NXSA 5CG2A 3PTZA 3OJ0A 5H68A 3WQRA 1AHHA 3D3WA 3C3MA 1XEFA 2Q0QA 4PPYA 4KMMA 4YS6A 3H9CA 1N9KA 1ESZA 1P2UA 1AN0A 1VJRA 1EFKA 2VNAA 2VNKA 4V3CA 2ASEA 4H35A 4B3SB 3PC3A 3UJ8A 1QANA 3M6XA 3WRYC 1L7VC 2HA0A 2QMEA 3K09A 4BQEA 4E07A 4Z3OA 2XZLA 2BHLA 2QMQA 1TCUA 3VNRA 4I5IA 3E9QA 3SM9A 1SUWA 4X7RA 5FQOA 1Z17A 2BMDA 1I4OA 3T34A 5I7VA 1E1RD 4OHVA 5FA8A 2GD6A 4MDEA 2EF1A 1BJTA 3AZQA 2AUNA 2JJMA 2F3PA 4IX1A 4RPKA 3QMPA 1Q7RA 4X8HA 4AW9A 4Q4AB 5JC1A 5HTOA 1JLKA 2P79A 1D0SA 1TW2A 4FD3A 2NU7A 3QEJA 4G9GA 4HCJA 4MW6A 2ZBEA 1GSAA 1LVUA 4HY3A 4AECA 3E5NA 4PIPA 4I14A 5B6PA 4QU5A 5D7NA 3S1SA 2R11A 2Y0PA 2F55A 2OV8A 3CUKA 5T57A 2VT3A 5G53C 1FJXA 4TTPA 4LC1A 3SKYA 1TC2A 1DO2A 3NT2A 3EXEA 3CZRA 1KEEB 1K08A 1Y3HA 1O0SA 1J49A 1WOMA 2I1QA 3CWCA 3DAFA 4ZT3A 4BVFA 3SJUA 3OHSX 2L19A 1S2NA 1VMDA 3LUAA 1E3WA 2RGNA 1I3CA 3B6ZA 1R3UA 3RW9A 5CFPA 2Q6KA 4CM8B 4NBVA 2ZCVA 4PSUA 4AS1A 1WZCA 4WY5A 1Z5PA 3W3AH 2DHRA 1EE9A 4XGKA 1A9OA 4D4MA 3JRXA 1QK4A 3KM0A 1DLJA 1SUSA 1UK8A 1ATZA 4MB2A 4OK3A 1GQFA 2JBHA 3RYCB 5REQA 1DNPA 5E4FA 1IWBB 4A0SA 2FRDC 5K0CA 3GUZA 3DZIA 4LX8A 5ECYA 4OFZA 3HO1A 1EU1A 3RVDA 1YO6A 3UHJA 4AJOA 4MYCA 3H1TA 1EM8A 4IPTA 1FBTA 1I36A 1RI5A 1BD4A 2CLDX 3FFBA 3H3XA 3O4JA 3OOEA 4DC1A 1XLTA 3LRXA 2JLQA 2HHAA 1SRQA 4HAOA 3PD0A 1UCFA 1HORA 2GBPA 1BVHA 1QKJA 4AWBA 1X7GA 1XKTA 2NU9A 2GJKA 2GLUA 2H4YA 3G5UA 4ZT2A 4RHXA 5KWIA 2XZOA 1VMAA 3PGKA 1H5QA 4I50F 4TZKA 2QRVA 1T3LA 1D5CA 1HDOA 4LF9B 3DMDA 3KKEA 5TY0A 4ROSA 1EBUA 4D98A 1EEXB 1CFZA 1E2IA 1LV8A 4PZYA 5C4GB 3RQIA 3I3OA 1L5KA 3O4IA 3U7IA 3AHJA 4O2AA 3L8DA 1X6VA 1CB0A 1ZQ9A 4RFVA 1ZUD1 5DXAA 5BNWA 3KEFA 5K09A 4JXZA 2HJGA 3E48A 1OIWA 3JYPA 3NASA 1WBJB 4OAOA 4ESVA 2W90A 1OTXA 4LSWA 5K8IA 3PSAA 3RUEA 3GN1A 4JR0A 4MIKA 1LCIA 1F0NA 4LYDA 5IC5A 4N40A 2BZSA 1Y89A 1ZMXA 2R1TB 3K8QA 3VYUB 2LTAA 4O4HA 4PTZA 3CGGA 3TX6A 5IS2A 2Q4RA 3AONB 4WRRA 1DEAA 3TNFA 2O4UX 5AWFC 1XHLA 2HK8A 1DAKA 1OR8A 1UT5A 1O54A 2PQ2A 3DWIA 4QL3A 4P0PB 1XMPA 1CY1A 5HXAA 1CNMA 1R5OA 4GKAA 3AWDA 3ZCUA 2G1KA 1BDMA 3FBWA 1KU6A 1S2GA 3HTXA 3DM5A 4CKCA 1QF6A 3VFDA 4H60A 3UYLA 4TLMB 2EP5A 4ZT6A 1LZKA 2Q7OE 2Y05A 1SM4A 4D9MA 2FVXA 1KJ9A 1Z39A 4F4JA 5IK2D 3OAAD 5H1YA 3LPMA 5AESA 3LVRE 5CFQA 1Z4OA 3W5CA 4LKOA 3GQVA 1O5TA 1YL5A 1SN7A 4JI8B 3PFGA 3L5KA 2VYQA 3AR4A 3H4VA 3HJBA 3HSSA 4BPBA 3RYFB 1QVZA 1SCBA 1YD7A 2NTJA 1O95A 3W2GA 4N76A 3FDZA 4M86A 4KFUA 4YFVA 4A0FA 1ZAYA 3PGA1 4DOMA 1WTCA 3T3HA 4OLBA 4L5YA 2JFZA 2DKFA 2IOFK 3COYA 5LM3A 1S1MA 3DF9A 3SYLA 1DPFA 2QP3A 4Y6OA 1VP9A 3ICWA 3ZCTA 3AT1A 4EL5A 1GLVA 1P0QA 3WI7A 5IT5A 2RG7A 3VR2D 3JR7A 1SBNE 1AB5A 2X7HA 2AI2A 1JG4A 1YONA 4N5DA 2CSXA 3LT2A 5IT9A 4RK1A 5CYPA 1C8LA 2GZDA 2JGMA 1CK4A 3CCFA 3I01M 1MEOA 2RHWA 5HIIA 3JWHA 5A4FS 5CNMA 1V7PC 5ITWA 3SMQA 2RGBA 4O0MA 1PJ3A 1Q50A 2I7VA 3PP8A 4RQTA 4ZOAA 2C2ZA 3FHTA 1CBUA 3SQNA 1QMGA 1SB9A 3ON5A 4RZIA 1A3CA 1R9JA 1YQWA 2XXBA 4JC5A 2B7LA 1DQRA 5THXA 5JWRA 3A4TA 5JJBA 3NTVA 4KE6A 5KWEA 2XW6A 4OM7A 1V3VA 1K9VF 3VVBA 4R83A 2J0SA 1ZRMA 4NNOA 2X1LA 4ML3A 5I7AA 3GNSA 1W2HA 3T06B 1O87A 3TG2A 3VDMA 3DB1A 3PXUA 5FJIA 4CEJA 2WIBA 2P6NA 4FYPA 4WKBA 1DCKA 4MS1B 1CUFA 3P9QA 4JLNA 4X95A 1J2EA 2HK6A 3KQNA 5ALIA 1VPDA 3V4OA 1XRQA 2Z2YA 2SHKA 3PWZA 5I47A 3ONNA 1Y5NA 4J90A 3EZNA 3D2BA 4IV5A 1QLJA 3X44A 4BVAA 4ZYVA 5BN3B 2XKKA 2FSIA 1TM5E 1EHIA 3E84A 5E4TA 3CUYA 2PRSA 5JE8A 4A73A 1JF8A 2Z4SA 4F38A 2ZIXA 1QX4A 4KK4A 3PVZA 1DAGA 4MV8A 5TX7A 2EJUA 3PF8A 2A9JA 3OOWA 3D6UA 2C4KA 1PKEA 2BDUA 2ZRPA 3HCWA 4L07A 5P21A 1RYEA 4RJJA 2FSUA 3QPWA 1Z0JA 4I19A 1JLRA 4H7KA 5EIOA 1XCPA 1X1TA 1T9GS 2AD5A 2BBSA 4ZAYA 3NHUA 4NYMR 3KVVA 1ICIA 4QYIB 1M10A 2ZBPA 4V0KA 3KEGA 4EJSB 1KKUA 2R8BA 4IUYA 1G7RA 3N2GB 1L4KA 3DUFB 1FYFA 5A1JA 2X9GA 2E21A 3RWBA 2OXCA 2IOQA 4E11A 3DEAA 1R27A 4NIMA 3VMMA 4JA0A 2B8JA 2HQOA 3KUUA 3C4QA 2BBWA 3IB3A 3LL7A 4H7FA 4QUDA 2QOEA 4BVGA 4DIDA 3O2SB 1CJBA 1NLUA 1X39A 2AUTA 5K05A 1XSEA 4WOJA 2FOXA 4TVOA 5FBLB 1DQYA 1PJLA 1I4LD 2VA9A 3D4LA 4G0MA 4OJYA 3I9NA 2PWZA 3KNZA 5KYWA 4B71A 3QSGA 3WYBA 3V1NA 3UICA 5T3YA 2NIPA 2FI1A 1NVTA 3SFVA 1CJVC 2I5PO 1G41A 4LDZA 3SQDA 1JVSA 2ZTSA 2ZT6A 4N01A 1SU4A 4KQ6A 2JHFA 4MIEA 4ND8A 4G81A 4YN3A 3TQIA 3KQHA 4OYHA 5DHFA 5C9ZA 1OD6A 2H5IA 2P0AA 4GZ3A 4JLBA 3N8IA 1OXBB 3GEDA 1IM8A 1WULS 2CLKB 3FOWA 4FYHA 1H4SA 3OZSA 2J9RA 4B32A 2ZE6A 4XSVA 3ZY4A 4YC7A 3CUEF 4BFSA 3B1YA 3V00A 2PGJA 4NECA 1UBSB 3ZJUA 3ZOZA 4NZZA 2WWFA 2O2XA 1GT91 5IAEA 3SN6A 4EM6A 4LPSA 3UXHA 3VC7A 5J4VA 4QGAA 4F5WA 3SJAA 2BUBA 1OPRA 1Y3IA 2YHIB 3NTXA 5CGZA 5I7WA 4HMOA 3TDKA 4DR1B 2OB2A 2VJNA 3BQ9A 1B2RA 3S81A 3AETB 1WY7A 1OVMA 1HDGO 1JFFA 1T1EA 3CIFA 4DY6A 5AHOA 2QXYA 3O92A 2H8GA 1AK9A 1PUXA 1FL9A 1KBQA 2XVXA 3NH9A 4HZGA 4RVHA 3EWSA 2Q2NA 4U3JB 3T9EA 5BN5A 1ZI9A 4K6GA 1U28C 2H1CA 2WLSA 1SO8A 2A0YA 3SIRA 2OUKA 2VP2A 1ENYA 1YR9A 2ZB4A 4M1YA 3RFUA 4IX9A 4CWAA 4WZBB 4FOPA 5INTA 2AMLA 3AEUA 3DE7X 3H1GA 3H3JA 5JQGF 3TLXA 4AT1A 3LXXA 2A14A 3CZ5A 1R7RA 4R7ZA 4UKDA 5TRTA 4CN9A 3EXEB 1ECJA 5H59A 2ZWVA 1W36D 2DC1A 3AK4A 3F6RA 4CLXA 4NZYA 1I2CA 4C21A 4BNXA 4BLVA 3TW6A 1YI1A 2P40A 4KVZA 3ZU4A 1J6UA 4UPEA 1G20B 4RLSA 3ZHBA 5KNBA 4D3FA 3CR8A 1FP6A 2CD7A 1EWRA 3H5LA 1B14A 4JYAB 5TS2A 1PCXA 2VWPA 1RSZA 2JF0A 2Y1WA 3BVPA 3O9ZA 4GPZA 4F5YA 2ZSEA 2FYTA 4HP8A 3JD0A 4NNPA 1Z5NA 4A91A 1GAXA 1HQKA 1WKCA 3GVIA 3ZTTA 3QI7A 4LQ4A 4ZQIA 2ZIFA 5B55A 4JCCA 3UAZA 4IGFA 3T7KA 2X4IA 1KAMA 2V7QD 3BL5A 3PCTA 4ZYYA 5EZ6B 4TL8A 3UJPA 1E1QA 5FPQA 1I5RA 3PV0A 1H2XA 4YROA 4WX2B 3UNXA 1OGJA 4KHZA 4M98A 4CT4B 4MPRA 1RKQA 2QIPA 1YCGA 3UATA 1S01A 2X40A 3W5SA 1CUAA 5AJZA 2PSEA 3OX3A 4G4GA 4BQNA 3UBMA 5DIFA 2BI4A 1IDN1 4JQZA 3VH1A 3GLGA 1Q1GA 1SCJA 2P2CA 2W6OA 2CXUA 2B8WA 1EUCB 4BLOA 1KY4A 4JQCA 3C5CA 1S8NA 4L4UA 3UV7A 4M1WA 4CU5A 3LHSA 1M2KA 4ASUA 1HEYA 2ZRFA 1QBKC 3N70A 4GRDA 3K6KA 3BGIA 5CNIA 1P7WA 1XQ6A 1VLQA 1Q83A 2I4NA 1ND5A 1XRPA 3L9XA 3E5RA 4BZWA 1OA0A 3EZ9A 3ZH2A 4CGZA 2ZSBA 1YC5A 4Q37A 4F85A 1TZMA 3LBNA 3EPRA 1N6NA 4AZSA 2R4QA 5L9AA 3G89A 3UK6A 1DQPA 1KERA 4P4LA 1QH1A 2V55B 1POWA 6NULA 4E1AA 4L6CA 2WUGA 4L8YA 1VA4A 1JBEA 2MIIA 2WOOA 3DBLA 1BQEA 2YZGA 3KLBA 3L9WA 3ONWA 4LY6A 1GPKA 3JQDA 2HCTA 1WDTA 3ZZNA 1GZ7A 1A9YA 4AFNA 1NZJA 1U1IA 4UAJA 1PRYA 2V7WA 1E0DA 3D3EA 4AXBA 1N5LA 5H9VA 2ONYA 4ZCMA 3GLHB 3ZU6A 5EMHA 1LGYA 1F9EA 2ZSJA 1E9FA 1JKXA 2VFAA 5AOBA 4GZ6A 4MCHA 4CIWA 3U44A 1C0KA 1BVRA 1LS6A 4FBMA 4YPFA 3DV2A 4L6IA 1KEZA 2W2NA 2NAFA 3FCAA 3PHBE 4F60A 2D59A 4IS2A 4Y6GB 4CLRA 3L1VA 4TKUA 3ZUPA 1YFZA 3SHQA 5JY1A 2B78A 2DBQA 3SF8A 3V2IA 3EVTA 1CJSA 2C9OA 4QGFA 4BAGA 3NDIA 2WUWE 2REQA 5B5SA 1E7RA 2F1KA 4B87A 3QW2A 3VGJA 4CDMA 4CTJA 1IUOA 2UVPA 4ZARA 1VG0B 1EVYA 4B84A 4RULA 3QEBZ 3S55A 2PKQP 1AN9A 2HX1A 1W19A 2YVAA 3G2MA 1CNEA 3P4UA 2JCBA 3AY3A 1LFDB 3HFSA 4RC9A 2Y99A 1NW6A 3LGXA 2AG5A 3D5EA 2CHVA 1NUUA 5DM2A 2YFQA 3EC2A 5B1EA 4LN1A 4PLHA 3SDSA 2CFCA 4GNRA 4F4FA 4B3JA 4MKXA 4JJFA 1RM5A 2A30A 2B2NA 4KN6A 1XJCA 1OIVA 1YB2A 3P0RA 4AZVA 4XUDA 4K05A 3BXEA 2O8FA 1B42A 2N42A 2PLRA 1KGSA 2QE7A 2D74A 3U1BA 3CCCA 4BZZA 3TCNA 4DABA 1PJ4A 3U4QA 2RGCA 3ESZA 4KLAA 4RYLA 1BXRB 2Q5FA 1TEVA 3F96A 5GP1A 1DQNA 2HY7A 4D3DA 4P4GA 3HMQA 1NX9A 2Z4RA 2F64A 1U3CA 1FSGA 1PUJA 1EZ1A 2PCJA 3R8FA 1NN3A 2C1XA 1MF7A 1QK3A 1KMMA 4IVNA 3GC6A 3CLVA 4M4SA 4MH0R 2QRJA 2QTGA 5EMNA 3VH4A 3GA5A 2YNMC 1IN7A 2WRZA 5EXEA 4MI6A 4OSEA 5J2UF 4RA9B 2Q1YA 5JMWA 1CUGA 3W3AD 4UTPA 5THKA 3CV3A 3DD1A 4QDKA 1VCIA 1C3VA 1DAOA 2WIDA 4V2UA 2HU8A 5CYGA 4XWWA 2R00A 2CNNA 1APBA 1GWNA 3HDHA 1JBKA 2FQ1A 1S8AA 1FUIA 3ME5A 3PU6A 5CAEA 3BIFA 3CBGA 4P7FA 1I80A 4MP3A 4PTLA 3VR5H 3DCYA 1A8IA 1L2TA 5HA5A 3GAZA 4J0IA 2ZS8A 4CQLA 1GHTA 4BQQA 2QENA 3ZKWA 1S1CA 4OM8A 4DWVA 1DCMA 3IEKA 1JDBB 2X0NA 1F14A 2FPRA 3ETJA 2G1UA 2C3PA 2NTYC 3DE6X 1J0XO 1OXMA 2DR0A 1T15A 3DT9A 1QH0A 4JLSA 5B58T 2RBKA 3ZY5A 4YAGA 5EJ8A 1N8TA 3FKSD 4IGKA 2RC6A 2JPDA 2C5HA 2VQSA 4XR9A 2VPQA 3IGFA 3ZX5A 5JCOC 2Q49A 2HIGA 2JBWA 3P9ZA 4Q9AA 2QL9A 1DQZA 2ZU0C 3AB3A 1CQWA 3H5AA 2ZI9A 4Q15A 2CCJA 4P4SB 8ADHA 3PKJA 5JS7A 5DP2A 1T5SA 5K3EA 3EAFA 3C6MA 4X41A 3IQEA 4B7XA 5I7EA 2G25A 5E8JA 2HL6A 3MSCA 5E7IA 5LP6A 1W0JD 4Z4EA 3AVXA 1CE8B 4JLOA 3ZV5A 1DJQA 1IUPA 4EEKA 2OLEA 5JDCA 3IE2A 3KKKA 4BNLA 5I7RA 4LMBA 1USWA 4IYJA 1T0IA 3IQIX 4PO9A 4MKHA 4YRTA 1XWIA 3LT4A 3I6QA 1P44A 2REXB 4AKTA 1AGYA 3HPQA 4I99A 1P91A 4UAGA 3TQHA 1CLUA 1P4SA 2XB8A 5KYXA 1OBOA 3TOSA 1FP4A 2OO5C 2C78A 4JN6B 4LRWA 1GRQA 4LZWA 4NX2A 4ZQCB 4F71A 2A9RA 5B1DA 4UTXA 1HNZB 2ATIA 1WCYA 5FL7D 3ZW9A 3H04A 1BXGA 1WF6A 2FXVA 3HYLA 1B8VA 4MQMA 1K3FA 4KWTA 5EHXA 4N7BA 1JUDA 4CEIA 4B3MB 2I9PA 1U2DA 4OB8A 4XOUA 3ABIA 3HGMA 1JZQA 3FY4A 3JQGB 4Y8VA 5EKTA 3TTUA 1RYNA 3EUAA 1E94E 4CIBA 1H8HD 3CLRC 2VJLA 2BMFA 3AI3A 3VYWA 3VNBA 1MC4A 1MORA 3BGWA 1MQSA 1MOPA 4BWVA 3P9CA 3ROEA 3OKCA 4UCFA 2J6HA 1N0VC 1PJQA 3KTOA 3A6FA 2P9CA 3EZ6A 1KJQA 2AQKA 1Y9DA 3GT4A 3O3MB 3PQ6A 1JHRA 4LX0A 3LUJA 5ALXA 1M2VB 5AM0A 1SVWA 3SOPA 1L4BA 3FPJA 3T5GA 1Q57A 1UUFA 2XCRB 3GP5A 3D6HA 5BQ3A 4LYAA 4ITVA 2VWHA 4W9MC 1GNTA 1IBSA 4PINA 3RC1A 1TAHA 3OZGA 1FUKA 1EJBA 3VJKA 3GRFA 4JKIA 4DV3B 4BFVA 1P61B 4OFXA 2FR0A 4YASA 6Q21A 4IDCA 4IWNA 2PR7A 4OXXA 3X1DA 1Y9AA 5LKRA 5HTKA 1XG5A 3GJ7A 1TOAA 2QN6A 2VDQB 4P4SA 1GADO 1JJ7A 4KQMA 3OZIA 2QTNA 3QLVC 3EGDA 4QHSA 5BMVF 5KKNB 4DB2A 1GARA 5FOUA 1BCSB 2XT9A 4R84A 5B4TA 1LJ8A 4KQKA 4OA8A 4RBNA 6CHYA 5HZKA 5JDIC 3LT0A 3CZQA 3G1WA 1UK7A 1F6WA 4RJIA 3FGOA 5D87A 5H82A 5B37A 2HU7A 4F2WA 1RWVA 3A1EA 4DMMA 3P2MA 2ZR7A 4B3XA 3UPTA 3ZWDA 1FDVA 4EA7A 2D00A 1DT5A 1YULA 1N2HA 3KOMA 3QVSA 1JSXA 3H97A 1PK9A 1UBKS 1Z8DA 2ANBA 1V6SA 1T2DA 3K9FC 5CPBA 2V7PA 3FUXA 3JZMA 2LNDA 5DULA 3K9LA 4LSGA 5KNBD 2Q9BA 4JBLA 5F35A 2FWBA 2EGGA 3BWXA 1QHXA 3PDIA 1Z08A 1ZIDA 3TCXB 4HNAA 3L6BA 4J91A 2BBTA 3A4VA 3LUCA 5C37A 4NBLA 1I3OA 4DMLA 5IJ9B 2HA4A 1EDOA 1OGYA 5EG5A 3E53A 3ZGOA 5CA0B 1RWBA 1OI2A 2HNBA 4FBLA 4R16A 2O20A 4M83A 2QLBA 2X9QA 2X4DA 3PZRA 5FL3A 5AVTA 4O4JA 1VSTA 5KVCA 1E60A 3NJ8A 1P4HA 1BOOA 2PRZA 2Z2ZA 3BWYA 4W9NA 3QEAZ 3NHWA 3IR7A 3WGNA 4RK6A 1XTIA 2VZ0A 5TQ2B 3NBFA 1AXGA 2BMEA 2F9FA 1IMOA 2NM0A 3U4GA 4E03A 1KZGB 4DBLE 3ILVA 1E3DA 4CL3A 3Q4GA 2HMVA 4R1NA 1C8VB 1ZXBA 2IXAA 5H16A 4BNDA 2UXBB 4NYJR 5TMEA 2A33A 2AWOA 3G9UA 3TMKA 4O2RA 4GL4A 3BDVA 1X0XA 3FYDA 4MPPA 4TUYA 5CEJA 3AF6A 4KSYA 1PNVA 3E3AA 2NW6A 3N2IA 1Z0SA 3ABQB 5T7BA 4FHCA 1Z07A 1K66A 2GAIA 2GI4A 4QEKA 4TRJA 3CHYA 2WSIA 4K2HA 5DW0A 4F56A 3GD7A 5IBCA 5IJ0B 1PL7A 4XVRA 1S96A 2FCRA 1HT1E 2P4EA 3MOGA 4OGKA 4PX2A 4ZYLA 1JPJA 3USZA 1ML3A 2EZ8A 5CLLA 2B7CA 1GQ2A 3AUUA 4HLCA 3VU9B 4X90A 2O1EA 3UM9A 4CLRB 4EATA 4EG4A 2JVKA 2R6DA 3H19A 5L6LB 3NKVA 2F1HA 2RDMA 3UWDA 3HLTA 4D9KA 2P3QA 1IQUA 3G17A 4HNSA 3S4YA 4BATA 2BM9A 1ILEA 3IURA 1DBIA 1VKZA 1NVDA 1U0NA 3KUKA 2FB9A 4KMSA 1P75A 4IDAA 4LMAA 4TTVA 5BN4B 1D6NA 3NHLA 5K3AA 1VDMA 4UNIA 3DL4A 4M0LA 2B3DA 3COWA 3HKCA 3M5PA 1PV4A 3AIIA 1KHTA 3TGWA 3ZV4A 1WDMA 2IS4A 4QO7A 4DM7A 4I3HA 1J22A 1XCMA 1PTKA 2LIPA 5JH7A 4BMPB 1WB4A 3FPBA 2P9ZA 3C6QA 4HS9A 2Z9DA 3CPSA 3DHWC 3OTWA 3Q1LA 5D5HA 1I10A 4YGXB 4YAUA 3O8QA 3I4FA 3JCZA 3BFVA 2GVZC 5DK4A 1RZUA 1GRNA 2YL2A 4NONA 3IC5A 2OYCA 4LRUA 1OZAA 2AW5A 3DULA 1K4MA 4NCHA 2WHEA 5CG1A 5JSYA 1H2FA 2X0IA 1U8YA 4JZKA 2ONCA 2JKYA 1QQ5A 1YU9A 3A3PA 3LW8A 4JOBA 3ZWPA 4ES6A 4QSMA 3ZPXA 1UL1X 1C29B 3EVEA 4MI1A 5C3MA 5FIUA 1G16A 1GCIA 2GN8A 4QGSA 3IAXA 4KLCA 1UJ6A 1UFOA 2RGAA 1OI4A 3NC0C 3M1LA 3O26A 1R64A 4NBUA 4P38A 4Q3CA 1VBKA 1Z18A 4Q4JB 4E5DA 3MMNA 3T7AA 1G4HA 3QKSA 4RK5A 3EIXA 1CP2A 5CA1F 1XQWA 1TECE 2XVYA 1E2EA 1NYLA 4XASA 4C5BA 5ABPA 1N9GB 3V1TC 2Z8ZA 5CB4F 5I8WA 2UUAB 1U65A 4IZ6A 3PC2A 4M55A 3U1VA 2UXCB 1XBTA 2YFKA 1ID1A 1W36C 2V6GA 4G5XA 4ZZ3A 4QYWA 4RY0A 5FPSA 6AT1A 2QE6A 2UKDA 4MA5A 5F5NA 9GPBA 3HC7A 1TYCA 4HNHA 5ESXA 3QUSA 1DKOA 3QOFA 521PA 5JHHB 3HB9A 1QP4A 3IOEA 1K5DA 5IHXA 1Z0ZA 3HZRA 1D6JA 2V9PA 1KBZA 3HHPA 1VLZA 2X6TA 4EGSA 3WIVA 1PO7A 2B36A 3JWPA 3TZQA 4GO1A 3K1YA 2WT4A 5KNBH 4OLJA 3D8NA 5EJ5A 4ZVOA 4WADA 4YRZA 5B3LA 2R7NA 4EFNA 3LD9A 3B3JA 1M7BA 3W5IA 2W2PA 2JFWA 3KPWA 4Q4JA 3OE7A 4ZYZA 1FIUA 2CL6X 4E6EA 3I61A 1J4AA 1X38A 4Y2TA 3C48A 2QDKA 5MDHA 1A97A 3RRMA 5JXJA 2QL7A 1LBEA 3ZXYA 5BYAA 2FPPB 4UCXA 1KO8A 2VPYA 5CT8A 3UT5B 4B31A 2M1XA 2ZJAA 2XA1A 3VUFA 4BMDA 3UH1A 1I4TD 4ZZ2A 1A96A 5ALZA 1DJMA 1LK7A 3KD2A 2BKEA 4BN5A 1CFJA 2XD9A 1ODFA 1PNTA 3KJXA 3CG0A 1TUBB 3K0AA 3PBKA 3TJRA 4A6EA 2J67A 2IP4A 3DEFA 5AVQA 1XEAA 3E8MA 3ROMA 4AY3A 1KEUA 2RHLA 1ORHA 3EZYA 3NHPA 2JLUA 2A9FA 2OHVA 1BWRA 3L1JA 5DTEA 1DUVG 1ZITA 5EKSA 4GBJA 3WHIA 4JT4A 1XZLA 3NFRA 2UYHA 3I3SR 3PNQA 2OMKA 2DTEA 1H4VB 3CWZA 3MCUA 5FR2A 1H1LA 1VJ0A 3ECCA 4Q16A 3WBJA 3NAGA 5JEEA 1MEEA 1NJ1A 3I28A 4QFBA 4RL6A 5TPWB 1SIBE 5HZHA 1CIPA 3ISVA 2IEYA 1W85A 3OAAA 1J8VA 1OKKA 4DWJA 4X1IB 5AM5A 4RDXA 5HIAA 3PDWA 2H2HA 1UH5A 3KDAA 1X2BA 1G8JA 4IJMA 4Q1EA 1A4IA 1MQAA 2HA2A 5AW8A 4DZZA 3R5FA 1WVMA 1UWVA 4V0LA 4B3IA 1QV7A 2BM1A 2X2FA 4EF5A 5KQMA 1A5ZA 3SJ7A 4KUGA 1PBNA 1ZHHA 2PGAA 2ZIVB 3Q2OA 1CEXA 1EE1A 3KZOA 3A1NA 3FJOA 4U9UA 5EJGA 5HKOA 4IIVA 3ER8A 2RONA 1USGA 2C83A 4EW3A 4EI9A 2FN4A 3NDPA 3RC2A 4CG1A 4M0CA 5FV4A 1C7JA 9LDBA 4CM9A 1RAAA 1NPDA 2IYEA 1P74A 2RKBA 2FEMA 1KK3A 2EAUA 1J8MF 3Q7SA 1W7AA 4LBVA 4MGEA 5B6JA 3OO0A 2PKXA 1DC4A 4RS4A 3W4KA 3Q40A 5F2EA 1T1GA 5GADl 3AEQB 3R5KA 2YUIA 3OPVA 3QBVA 5KTKA 1R37A 3LV8A 4Y6QA 1TLFA 5IVHA 4YRKA 4LF4B 2JFPA 3LRPA 5E4YA 2NXJA 3RVLA 2WYWA 4B6SA 1J42A 1L7PA 2GMWA 4AF7A 5G0TA 4BL5A 1NTOA 3GRCA 1RKVA 3OKPA 3WXBA 4Z2YA 4YV7A 1Q95A 1IEWA 3SJBA 2FHSA 2A0XA 3DAHA 4L5BA 2ZRCA 5EYPA 1F7UA 2F8SA 4I5FA 2GZRA 2HM7A 2ZTMA 3KUCA 2IY9A 4UHDA 1QZUA 4J0KA 4EYSA 1UOQA 4C3OB 2QNIA 3L7MA 5DOVA 3UHPA 3WQBA 3CYFA 5DLDA 1HGXA 2DH6A 2HUPA 3V34A 3AY0A 1MTZA 2RHHA 4FC6A 4C0JA 4DADA 2X76A 3ICVA 3E8SA 1ZW6A 1JKJB 5CJPA 1LSSA 3C1OA 3VSAA 4ZCLA 3OP4A 4K6OA 1JA1A 4WXHA 3NIFB 4OJQA 4RENA 1Q92A 4RZQA 4BNZA 1XDUA 3DZGA 5LDGA 1QRRA 1YUNA 5TT0A 4RCZA 5EWLA 5LUAA 1XXHB 2X6QA 3T52A 2ZXEA 3TDNA 1YF3A 1GFWA 1PZGA 2H51A 1OB2A 3D6MA 1WY5A 1YK0A 2VLIA 2SKDA 3A6GA 3Q3IA 2PJZA 1Z7BA 3SZRA 1VJ1A 1J25A 2PY6A 3MNFA 4LW8A 4L5IA 4PIMA 5EE3A 1EK6A 2ZI4A 3BD9A 1U0BB 3AJRA 2E55A 1X15A 5DE3A 1H3EA 2A1TS 3T1OA 1TEHA 3HN6A 1U7UA 4G2NA 4MQ6A 3ROGA 4MVJA 2V7GA 2Q6OA 3M83A 2YXBA 1RPAA 4F4UA 4GYJA 1RYDA 1TVCA 2ECPA 3EXIA 3HE3A 1XO1A 2V8OA 2QQ0A 2GLXA 3BRCA 3HA3A 4X20B 1F3OA 4F93B 4DR3B 3IBFA 1PDOA 1Y4AE 1T9AA 2PXHA 3VR4A 5B6IA 5JS6A 3IV6A 3H5RA 4RSGA 1A2OA 3A37A 3JQ7A 4LHYA 2P7HA 2WKQA 4PGAA 2Q4TA 4CG2A 1V8ZA 2Y1EA 3CX4A 2FX2A 3EVBA 3X1YA 4ZDIA 4G84A 3NAMA 5G1PA 4EZBA 1ULZA 2GN1A 1Z0AA 3JXEA 2G0TA 2FUG6 2Q6LA 2UDPA 2JZNA 4NPAA 4X9XA 4KUEA 1KP9A 2BTOA 4ZVVA 3R44A 4C1BA 1QCDA 1VHWA 4HVCA 4HRAA 4B6EA 4RJKA 3FPAA 3MYRA 5JAIA 2XXJA 3P0EA 4AO6A 2QAIA 1Q1NA 1B43A 1RZ3A 4W1SA 3ELUA 4BEJA 4B9EA 3CNHA 1X80B 2GLTA 3DDUA 5K8UA 2X4GA 4OHPA 1OXKB 3DXXA 4H08A 5CM2Z 5JARA 1TM4E 1WUTA 2EKBA 5F1YA 1HMYA 1M34A 4OBBA 5F51A 3C74A 1C9NA 1DO8A 2PUDA 2QQEA 2WSBA 2QK4A 3USES 3HKDB 3OF2A 3T38A 5ADVA 3F1KA 4GSYA 2PH5A 4LYEA 2QROA 1Z82A 1V7CA 1UAGA 1YGPA 3SC2B 3IOYA 4Q7JB 2WMYA 3BICA 3F5FA 3ICEA 1TMYA 2WJWA 5CA0F 1KSHA 1C81A 1NKSA 4PLWA 4XM0A 2GBIA 4EHIA 1EAMA 4E0BA 3M4YA 3CJQA 3WGQA 3LP6A 4JBHA 3EQ7A 3LLUA 1XZCA 2NUBA 3PE4A 1VTKA 4MB6A 4N0QA 4ZKDA 2QS9A 3JTEA 2J5RA 5EP2A 3INYA 3A4NA 5KOHA 3DC2A 4GX5A 4ZYXA 3B8HA 3ORYA 4EB3A 6PFKA 4HDKA 2JVIA 2YDYA 3KXKA 4RM2A 1SG0A 3HP1A 3N0WA 2JD2A 3QTLA 4DV2B 2A9QA 1KYTA 1JP7A 121PA 3SG0A 3WB1A 4F1WA 5LOVB 3GLIB 2ZRAA 4A2PA 2Y4OA 5IMSA 2Z2XA 3KQKA 2PE5A 3DHVA 2D6FA 3QZUA 2BGGA 4HEA6 1TLLA 4LY9A 3MERA 1QHHB 1JJBA 4C20A 5JY6A 3PTLA 1QIFA 2Y92A 3A1WA 3B5IA 1GR1A 4GUAA 4TSKA 2ZAMA 1GITA 1DEKA 1N3BA 3KBOA 4ARSA 2WF6A 5EIFA 1KR2A 4DNXA 5ALVA 3BWCA 4X71A 5JNLA 3KCNA 3L7NA 2GRJA 2QRVB 4W1RA 4H1UA 3MWLA 1QTNA 3OJXA 3R3UA 1OAAA 1SBQA 1WW3A 3NGLA 4ALNA 4HWOA 1Z4PX 3P2IA 4KQ9A 3E4CA 4U6QA 5JPCA 1L4EA 2G1AA 4CEIB 2NU9B 3JSAA 1G3IA 1DO0A 3JAKA 3HCNA 4Y0AA 4F9EA 1GYRA 2RIRA 3OMLA 4ND5A 1I1HA 3LZ6A 4JT2A 1PVDA 1IAVA 1N8NA 2CCKA 3L0BA 4PRLA 4DLWA 1A1VA 3F6CA 5TQVA 1B2LA 4QVKA 3W5UA 4DR6B 3AESB 5DNVA 3MCTA 2CMHA 5H70A 4TMWA 1JN0A 1ZN9A 5LLSA 2FFHA 1Y6RA 3UJDA 5MHTA 1V47A 2QVZX 1DT3A 4IMRA 3WGKA 3QU5A 4HTFB 1NNI1 4L75A 5DT9A 1XT6A 2RIPA 1DKUA 4P58A 1GA6A 2BLLA 3M0EA 3S2EA 4E31A 3ZVMA 5DRYA 4LYYA 2BD0A 1RIFA 4B45A 1OXXK 2Y71A 3U4MA 3QEKA 2KPOA 1UP4A 3F1LA 4FGZA 3OEED 4OA5A 4PHHA 2R6FA 3DMNA 3NHAA 3O74A 3DXYA 4G25A 1AQNA 3U1TA 1NJ6A 5LVAA 1JH9A 1RFLA 2WDPA 2BVNA 3ONEA 4OUKX 3CEMA 3LPDA 3UA3A 4BRZA 5A04A 1US8A 2J30A 1E2PA 4Y9UA 4E2ZA 3ZDCA 5CTJA 2BYTA 2B2XA 2JI4A 5JMPA 3RRXA 5IT0A 2Y76A 5DEOA 2IIVA 1AHIA 2HCJB 1NR5A 2JIZA 1DTEA 2A9VA 2FX3A 2PM8A 3FRIA 4PYJA 4S24A 3L92A 2ZIEA 3QE3A 1VI5A 3P9RA 3OP1A 4A5SA 1S2MA 2DJIA 1KPHA 4ZVLA 4MVCA 1IBRA 3NHZA 3CVUA 3ZHOA 2GK3A 4NFSA 4WKPA 2PAAA 1OFHA 4OJKA 3WB9A