4A8JA

Crystal structure of the elongator subcomplex elp456
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
350
structure length
277
Chain Sequence
b'GLDSSHVGVRPSPATSQPTTSTGSADLDSILGHMGLPLGNSVLVEEQSTTEFHSILGKLFAAQGIVHNRIRNGDTHVIVLSLNQMFAKELPGIYYKDYNHQFDITTRLMPAPIASELTFIAPTQPVSTILSQIEQTIKRNDKKLIRIVIPSLLHPAMYPPKMFESSEIIGLMHGVRSLVKKYYERVVLFASISIDIITPPLLVLLRNMFDSVINLEPFNQEMTEFLERVYKSQPGKIQHGLVHILKLPVFTDRGEMRVLKSEWAFKNGRKKFEIEQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELONGATOR COMPLEX PROTEIN 4
publication title The Elongator Subcomplex Elp456 is a Hexameric Reca-Like ATPase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 84
structure length 277
sequence length 350
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a8jA00
2BJVA 3SI7A 2OV2A 4C0AC 8OHMA 2J45A 5J5CA 1UKEA 4ARZA 3SQWA 3ZVMA 3EC1A 5FPKA 3HR8A 1ZMXA 3KQKA 1KYIA 1D9XA 2QP3A 3ETLA 2G9NA 4G5SA 3THXA 3AUXA 2ZM5A 1U0LA 4NH0A 1ZM7A 2IEZA 4ZKDA 1NSFA 4Q1EA 3QKSB 2O8EA 1II9A 2IYTA 3L8YA 2RGNC 2H7VA 3BGWA 3CKLA 4NONA 2CMKA 4DCSA 2WKPA 2J0SA 3ICQB 1R0XA 1UEJA 1XCMA 3LLUA 3WYAA 2V55B 5B30A 2G77B 2PLFA 3DM5A 3GJ7A 3NHBA 4HLUC 1JBKA 2VO1A 4LPKA 5DHAA 3WNCA 3A58B 2J7PD 2REOA 4Q4HA 3TGPA 3OE7A 4E22A 4JLDA 4JIMA 4ZIRA 1D2EA 1P7CA 1AM4D 4GOJA 4DVGA 4LK2A 2WJHA 3RVBA 1AQYA 5K8UA 1PLLA 2HJVA 4EFMA 3IGFA 1L2TA 3CX6A 3VR4A 1RRPA 4D0NA 1E9DA 4M9XA 3L82B 1WMSA 2YKGA 1CLUA 5CITA 4RZ2A 4BLTA 4KVAA 2NIPA 2ZRFA 4I4LA 3BB1A 2O8FA 5E7JA 1YRAA 3KZ1E 3D7MA 4JSTA 3AH8A 1UEIA 2CCJA 2VF7A 3I8SA 4TLBA 2F3TA 3UATA 4QM7A 4D25A 2XB4A 3RS2A 2OLJA 2JA1A 2Q3HA 2ZSEA 4G1UC 1BKDR 1SXJC 4PSKA 4QBFA 2WTUA 4IVRA 3CR8A 2QPTA 1J90A 5DSZA 1ZC3A 1ELOA 1N6OA 5DI3B 1N5KA 4G01B 2WMOB 3HYRA 1A5TA 1KI6B 2GAOA 2HF8A 5JWOA 4FMDB 2XOKD 2N46A 4Q7MB 4KFSA 2RGEA 3B7GA 5K8LA 2BM0A 1JJ7A 5J4LA 3KTAA 3DMNA 1COWA 5GJWC 2J9RA 1M7HA 2JATA 3NVAA 4BFXA 4UNRA 4BLSA 2QORA 2NO7A 2V1XA 1KAGA 2BEJA 2DPXA 2OCBA 3ZZ0A 4ZDJA 3W5JA 1TU3A 3ADKA 1QG4A 4JJZA 3WBJA 3FHOA 2OFOA 3K70C 1S9DA 3E70C 4GRAA 4EDHA 1PLKA 4JMPA 1K8RA 3GMTA 3C7KA 4W5HA 1MO6A 4MKHA 1DAIA 4Q1DA 2HXYA 4GPTA 4B6FA 4Y0AA 3ZLJA 4BLQA 1E0AA 4QOSA 4YMTA 3U3OA 3QENA 1C9KA 3DHWC 3ADCA 2O0HA 5KPDA 4A2QA 1DAFA 3GFOA 2ZI5A 3KKPA 2JCSA 1P60A 3ZIAA 1L8QA 1RW4A 1G17A 1XEWY 3QY0A 2ECKA 5IK2A 3X1YA 3AVWA 5A5GA 2DYKA 2EW1A 2X8AA 4M9SA 2HCBA 2GJ8A 4QNRA 4RY2A 3LBIA 4WBSA 3I4LA 3SEAA 2C95A 2ZI3A 5KNDA 1P9RA 3EA5A 3AEZA 3GLHA 2ZRLA 4M1KA 2BBTA 2R65A 2YINC 4DSNA 4GT1A 1GRRA 4XVQA 1UM8A 4NCIA 1UKZA 3RYTC 2W2VA 1UPTA 1XTIA 2ZR7A 3LWNA 4DWJA 1Z3IX 4UKDA 2ZPTX 4LJAA 2DHRA 3PUYA 2V8OA 3TJZA 4KAXA 5JZVA 1JR3A 4QL3A 1G18A 4OI2A 4CEIA 1HT2E 5E7MA 2FGJA 4S2EA 1P2VA 2B7BA 2G1JA 3GD7A 4QGFA 1IQPA 1Z28A 2FZLA 3H4MA 1Q3HA 4GMDA 5IHPA 1Z6GA 1ZAKA 1YR7A 1B23P 2QPOA 3F0TA 5FOSA 3OIWA 3REFA 5DN6D 3P32A 4NCKA 4HYYA 4NKRA 4B3GA 4HZUB 2J0UB 1XTJA 3WBKA 3Q72A 2P3SA 4BQSA 2KWIA 3P1JA 4BRWA 5FL7A 3TE6A 4PQRA 4ABYA 2P5TB 3L0PA 1CRPA 5KSOA 3ZZUA 3MJRA 5J40A 4JVSB 2O5VA 3AVYA 1NVVR 1DOAA 2I1QA 3I73A 4WZBE 4UNSA 4G5GA 4C3ZA 3PG5A 1G8HA 2CL0X 4CDGA 1E2KA 1XPRA 1R0YA 4I81A 2FFAA 3C5CA 1H8HD 4HAZA 1NN0A 2CE7A 2FPLA 2R6AA 3UPUA 3NWJA 1UKYA 3QKUA 1F2TB 4PO8A 3LLMA 2H92A 4HLDA 2AN9A 4ESHA 3NC0C 3VU9B 3IBYA 4C0BA 1WBBA 4PTLA 5CLLA 3SYNA 4JL8A 3DOFA 2LWIA 3TLXA 3D3QA 2V7QA 1X86B 3PEYA 3KJHA 4IDQA 1N6KA 1KIMA 3MD0A 3SHWA 2PCLA 1ODFA 1XCGB 1S1CA 1AZTA 2GAAA 1NF3A 2ZJOA 4M1SA 2KE5A 4M9ZA 4M21A 5F3WB 2ZRBA 2H18A 4Q66C 4IDPA 2MSCB 3PITA 5TXGA 1H8ED 4LI0A 1UF9A 5DI9A 3K70B 2QQEA 2BMDA 2VRWA 4BEJA 1SQ5A 4O2LA 3S1AB 4LC1A 1OYYA 1YR6A 1NY6A 2AD5A 1U0JA 421PA 4MRNA 5C18A 1XTKA 2ONKA 1G1MA 3BK7A 2RGDA 3QXJA 1Z83A 2GTPA 2P65A 2WPDD 2OCAA 2OILA 3NH9A 4NL4H 1TADA 1FNNA 3L2OB 4LHWA 1CBUA 1VPLA 2JLZA 2AXPA 2FSFA 2WAXA 3CRQA 2WOJA 1JALA 3KFXA 4Q48A 4A0RA 3EIEA 3OESA 3N2EA 1PZNA 2VYFA 3NDBB 1E79D 4ASUD 1V5WA 2FU5C 4E07A 1SKYB 3UK6A 3K0FB 4DDTA 3B6EA 4PSVA 5TMPA 3GLGE 1GFIA 3Q5EA 4TQAA 2O8DB 1NMXA 5EXSA 3I3SR 2WKQA 2ZITA 5FI0B 3PQCA 1JQJC 4W7SA 1D6JA 2XSZA 4GSYA 5FFMA 4BFYA 5J4YA 1SVIA 3GLFB 1XNJA 1Q12A 2H8KA 1JI0A 2KI5A 5TARA 5L3SB 4PR0A 3U44B 4PHGA 5CDFE 2PZFA 2ZRMA 2AFHE 5EE5B 4NYMQ 3GPLA 2BV3A 2AD1A 1Z2CA 2GNOA 1G7CA 4JT4A 2DWQA 5FPSA 4GDFA 1EK0A 4V0MA 1P6XA 3MMPA 3M0EA 1W46A 2JLWA 3SQXA 1RE0A 1HT1E 1S9HA 5DI3A 3OAAD 4OI1A 3VQTA 4YXWD 2CHVA 4EPVA 1KI6A 2X2EA 1L4YA 1MABB 1GRQA 4RD0A 1T4GA 2IS2A 3ND8A 2CK3D 4EKDA 1XZPA 3PUXA 1QVAA 1E4YA 2VSXA 3QXCA 1KI4A 4U02A 3E1SA 1OXVA 4AC9A 3Q5DA 1E0JA 4QGGA 2FSGA 3X1XA 1II8B 2N1BA 5F9FA 1KO5A 1KJYA 1ZBDA 2E87A 4DXAA 2WAYA 4TL8A 1WRBA 4DCNA 4C0QC 2FEMA 1KI1A 1AS3A 2JDIA 5JWHA 3UG7A 4KFTA 5AJZA 1XMVA 3GJXC 4NYJR 3K0CA 3WHLA 4OKSA 1SVMA 2OZEA 1UAAA 4JLJA 1Z47A 2A5DA 3OEHA 2UZ3A 2WWHA 2QSYA 2OLKA 821PA 2I3BA 4KLZA 2AHOA 3IIMA 3T5DA 2JLVA 3ZS8A 3K0AB 5J4HA 3D8BA 1U90A 3GEHA 3GJ3A 2ZAOA 4YC7A 5HCNA 1HA3A 1ZM9A 2FN4A 1DAMA 4D4LA 4OHWA 4BEBA 4OHYA 4TLEA 1CJMA 1K5GA 1VYTA 1R6BX 1IN4A 4IOMA 4OHVA 4B35A 3GP8A 1W49A 2HEIA 3C5HA 4JKYA 4D80A 5A4JA 1NMZA 1GL6A 4K8OA 4LC0A 5FUWA 1XBTA 2Z0MA 1MKYA 3KX2A 4NE2A 4GNKA 1OIVA 4P0TA 2D74A 2ASEA 1KK1A 2FF7A 4IDHA 2VHCA 4URVR 4PC3A 1GG2A 1T8TA 1SZPA 4HB2A 2QAGB 2P2LA 4Q4LA 4H9GA 4PZYA 1XCPA 4P4SB 2RGNA 4PO9A 4A6XA 5AUNB 1GZSA 3PUWA 4Q47A 2WWIA 1OV4A 5B57C 3R9WA 4TQ9A 5JHGB 1OFUX 2A5YB 1NNEA 1W0KA 4X8HA 3PFIA 5AUQA 2JJ2D 2CL6X 2IYVA 2KSQA 1AIPA 5TVKA 1G4AE 2GK7A 4KJZA 4DLXA 3OEED 2GILA 2ZRDA 4IFEA 3MRSA 4EPXA 221PA 1Z0AA 3OE7D 4JJKA 1BOFA 2QRNA 1E9RA 4I1UA 3HJNA 1VYUA 1XFAA 1KSJA 2W0MA 4Q9KA 5LDDC 1XP8A 2D7CA 4WOPA 2ZS9A 3RRZA 5FTJA 3G82C 1DELA 2O52A 1CU1A 2AKYA 3EX7C 1D8TA 1YHNA 3AV0B 5BN5A 2QL6A 1LNZA 2ZEJA 2ZVQX 1G291 3KKNA 2FFHA 2J0UA 3A1UA 4HZUA 2IYZA 3FKQA 1SULA 2DFNA 2OAQ1 4RD1A 4UNQA 4FW9A 4WW0A 4XSGA 4C30A 4EJSB 3P4XA 1W4RA 3SU8A 4B76A 4V03A 5EP1A 1DARA 5JEDA 1R8QA 2IW3A 5GJCA 4NTZA 1QHXA 2XX3A 3A1SA 4Q5IA 3LQQA 3QPVA 4JLMA 5SZKB 4C9BA 1WDTA 2NMVA 3LW8A 1NSTA 4CYMA 1SXJA 2FSIA 1IN7A 1K6MA 2G3YA 1NLZA 1T5IA 1ZNWA 3KXKA 5EUMA 1FQKA 4TN1A 4QGAA 1YZTA 4EPTA 3U7GA 3TRFA 1N5JA 2IA5A 4TT3A 4AURA 1R8SA 1J8YF 3TVDA 3SFVA 1QDEA 3VU9A 3A8TA 3B5JA 4M1OA 5JCZA 1L7VC 2IYQA 4C2TA 4FMCB 2OE2A 5BQ5A 2QP4A 4KLNA 2YC2C 2J41A 3QSYA 2EFCB 1XWIA 3B1WA 5J4VA 3X1ZA 2O8CB 2A5FA 1AS2A 1T3HA 2P5SA 3A6PC 1FZQA 1GL9B 1E3MA 1COWD 1ZUHA 4RZUA 4KSBA 5AR1A 1ZW6A 2D06A 2CHGA 5KNCA 4JLKA 2IXGA 4G0NA 2XJ9A 3T06B 4M1YA 5FR2A 4EFLA 1N2CE 4LYAA 1TU4A 3RRNA 3H1TA 3S1AA 4C0LA 4JS0A 4LGMA 3N2IA 3OIYA 3B85A 5KNBA 2ZYUX 2BKUA 3EC2A 2JJ1A 4TTQA 3QKTA 3RABA 3ZZTA 1T3SA 5KO2A 2ZE7A 4XTCS 4AYTA 1FMLA 3AGPA 3BFKA 3WRXC 4ERNA 1NIJA 4V0NA 3LX8A 2OSBA 2FG5A 2A5JA 3EASA 3GLIB 4GZMA 1DE0A 2ZJYA 1KO8A 2BEKA 3AP2A 1KDTA 4A0FA 5AJYA 2FNAA 2W6JD 4EIWA 3A4LA 5J4KA 3TBKA 2VHQA 4NU0A 1Z0FA 1VIAA 4G5OA 5IK2D 3U5ZB 2Q9CA 3K0FA 1QHNA 3IKJA 1PUJA 1VTKA 4KODA 4BWYA 4QHTA 5M04A 1Q1BA 1U98A 2Q9BA 4LYJA 1FTSA 4AY2A 3BIFA 4TMZA 3DDCA 1EXMA 2B7CA 3I61A 5AJWA 4MITA 4C2UA 5HE8A 4X8OA 4QXAA 3DKVA 4Q1FA 4AIIA 4BLPA 3L43A 1JR6A 1CTQA 1TX4B 4EPRA 1XTRA 5L3SA 5D3MB 1CEEA 2QN6A 3U44A 1G20E 3B82A 2D7DA 1KHTA 4F4JA 3PENA 2PH1A 4NBSA 4ZCMA 4CIDA 2NGRA 1W36D 4OK6A 1G6OA 4XVUA 4PHTA 2RGGA 1CJVC 1XZQA 3LRPA 1IXZA 2OHFA 4OBEA 1HEIA 3TW4A 3THOA 2HDNB 2QEQA 2CNWA 3CRVA 1MABA 4F4IA 2QUZA 1OSNA 2ORVA 1NVXQ 4MGZR 3I5XA 3NBXX 1ZM3A 4CEHB 1ETUA 2DR3A 2EYUA 1NVVQ 5H68A 5LPNA 5IT5A 3TMKA 4DSOA 1GSIA 1II8A 4RCZA 1KK2A 4BZPA 1IJFA 4YQFA 1RRFA 3CR7A 1S3GA 3U3JA 4FMBB 1IXSB 4ZI2A 3QVVA 1HV8A 1N6RA 1OH6A 1W2HA 4RSGA 5FL7D 3EWSA 4PHFA 4CT5A 2OBNA 1Z0KA 3CB4A 1US8B 4C4PA 3PEUA 5CYOA 3PVSA 1Q20A 3L8ZA 4ESVA 4KHZA 2ZJ2A 5JEEA 3T1TA 4F91B 1ZM4A 2ODBA 4YLGA 3TUIC 1N0UA 5HCIA 3U4QB 2IYXA 3Q85A 5DGXA 3K0AA 3PXGA 1T5LA 1E2JA 2F1JA 3KKQA 4AKEA 4XD7A 1N3BA 4HAVA 5HR5A 3SBEA 1ZD8A 2ZSAA 3LV8A 2BCGY 3GJ6A 2JIZA 4FD2A 2QMEA 3MFYA 3G5UA 1OKKA 2ORWA 4YDHB 2VQSA 2P67A 3CRMA 3WXMA 2B21A 1GL7A 1P62B 5ANRB 2V7QD 1JNYA 4RKEA 5FPHA 2HLDA 2IC5A 1GTVA 2GEVA 4GP7A 4BECA 4TMXA 3VR2A 1P2TA 1W0JD 4W9MC 2ZE5A 1GNQA 2IS4A 2OBMA 1HUQA 1KOFA 4TMWA 2GWHA 4ILEA 4U00A 2IUUA 2XTMA 5H8WA 2QAGA 5B2ZA 2XB2A 4P4SA 1CF4A 1MO3A 1DS6A 1SHZA 2GKSA 1XF9A 2F9MA 3HR7A 1HY3A 4R2IA 3CX8A 5KTYA 2VBCA 4V0KA 3TIFA 4QBHA 1IXRC 1AKYA 2R6GA 4DLWA 1RC8A 3P4YA 4DLZA 5F9HA 2ANCA 2UVQA 1NJFA 2F43B 1SVLA 1KO7A 1GKIA 1OIWA 2QI9C 3CF6R 5FR1A 2ZIAA 3VR1A 1BIFA 2C77A 4KVGA 1F60A 2D3WA 4FN5A 4HB3A 1RRCA 4A6PA 3U6KA 1EGAA 4MDFA 2OO7A 4ZCLA 3OZXA 2VPPA 3CH4B 1IN5A 1TQ6A 2PEYA 3K09C 3GJ5A 5GVSA 2GESA 4DUGA 2BDTA 1ZRHA 1JR3E 3CLVA 5L3VA 3IIJA 1RFLA 2AL7A 4QG7A 4URWR 1V43A 2XSZD 3ASYA 4A36A 2FE4A 2UZIR 1O3YA 3ND9A 3NH6A 4RVCA 1BYUA 1MO5A 2ERYA 3AKCA 4QC2A 1G6HA 4Z1MA 5FPYA 3EG5A 4LX0A 1XEXB 3P26A 4MQBA 2GF0A 3SDZA 3RSLA 1IY2A 1MV5A 3H2YA 4V0OA 4B43A 3OHMA 1E2GA 1E2FA 1LF5A 3FB4A 3HWSA 4B74A 3Q7PA 1HE8B 4MH0R 2OCPA 3R9XA 3T12A 4I1VA 4URYR 1XMIA 4Y0VA 4EQ6B 3BC1A 1ESMA 4B32A 2BMJA 3CPEA 4A15A 4W5WA 1LB1B 1YU9A 1E2IA 4PQYA 2O8CA 2YOFA 4Q19A 4NYJQ 3HPRA 4HSEA 1CR1A 4OK5A 3JVVA 1ZM2A 1KAOA 3QKRB 2H16A 5SZIA 5DNYB 4RKFA 1KMHB 3TR0A 2JDID 3BJIC 4HI0E 2BHRA 3KB1A 1D2MA 3L0SA 3QI2A 1Z63A 3L0IB 2BBWA 2H1LA 3RS3A 4MYCA 2Q3FA 4RD3A 4DZZA 3A1VA 3AVQA 4EPWA 2ZROA 2IBMA 4JVNA 3OEHD 4LYHA 3X1WA 4HUTA 1LV7A 3GLIA 4AKGA 1FP7A 1ZU4A 3T34A 2EFEB 5EP4A 3FFAA 1JAHA 2PLRA 3IUYA 1YZUA 1XJCA 4JYBA 4Z8YA 1GNPA 2JAQA 1RPZA 4OI4A 2XNDA 2DFTA 5H70A 1FP6A 2IUTA 3ZVLA 2GJAA 3W9YA 1OFTA 3SJBA 4B47A 3TNFA 4DRZA 4U5XA 2ZTSA 4C0HA 2AWNA 4MRVA 3B1VA 1DO2A 1T6NA 2EU8A 2QTFA 3FGNA 2OT3B 1CRQA 2NO6A 3OIVA 4IEIA 4LJ8A 2QZ4A 3IPXA 4DSUA 2XGJA 4KI0A 2ZSFA 3DKPA 4PFSA 1WA5A 1XPUA 5CK5A 4CZ2A 4TZ6A 3VNVA 1VDZA 2BM1A 3AKEA 4LY6A 4LBZA 3EPJA 4HAUA 1C1YA 4MGYR 4UQOA 1SVOA 4BLOA 2IYSA 1W0KD 3VAAA 4DCVA 4PX9A 2LCFA 1KY3A 2QROA 1VG1A 4JLPA 4G5QA 3CRRA 2GXUA 1ZCBA 4R98A 1KK3A 4QBIA 1Z08A 5JFGA 1EFCA 4TYWA 2GCPA 4AG5A 4M1WA 5J47A 2ZXUA 4LUCA 5EP3A 4I1OA 4HUQB 1IAQA 1W2GA 1MRNA 4JVLA 2HJGA 4CEHA 3U60B 1EFRA 2REBA 1ZNYA 2P0EA 1SVWA 3IPYA 4A0HA 3LXXA 5CB8A 521PA 3K0SA 1QHHB 1KJWA 3TR5A 2D4HA 4Q03A 3VR6A 5AWFC 3OIUA 1US8A 3RS0A 2DCUA 1PLJA 1S96A 4O2RA 4BUJA 2ZI7A 1DO0A 3EARA 4EAQA 1CKEA 1R5NA 4DCTA 1SKQA 4PAQA 5FTLA 1E9FA 2QRZA 2YHSA 1LY1A 2WKRA 1JXMA 4Q7LA 1YJ5A 1SXJD 1UDWA 1Q1ZA 3VTKA 4QHSA 1Z0IA 3U4QA 2FOLA 2BCJQ 4PZZA 4TT3D 1HTWA 4FCWA 5FL3A 5FUVA 2R9VA 2ZRHA 3RHFA 2Z4RA 4DEYA 1Q1EA 1VIYA 3NBYC 2F1HA 3W3AA 4GOXA 1T0HB 3WHKA 4CGZA 3AF3A 4IW3B 4TYNA 5SZHB 3LFUA 3Q9LA 4L4UA 4AK9A 4PC6A 1D5CA 4POAA 1ZD1A 4JBYA 1NL3A 1RYFA 2FV8A 2YV5A 3C14C 4TTRA 5KDDA 5CYPA 1KJZA 2CLDX 1NVUQ 3JVUA 3RNLA 2RGXA 1CJTC 3GEIA 2NPIA 1OLOA 3M1IA 3HU3A 2CJWA 3T15A 5EUQB 3T61A 3VHXA 3X2SA 3K70D 4TSFD 4C0JA 1GKUB 1ONBA 4IVQA 4LCBA 1QHYA 3E2IA 4GP6A 4BASA 2A5GA 2JJ1D 2GCOB 1AKEA 2EFDB 4LJYA 2XNSA 4PAMA 2VP2A 4M1MA 2LKCA 2C78A 3CUEF 4DLUA 2R62A 2YYZA 1E94E 3D31A 3Q8XB 2JLRA 3GEEA 2F43A 1NG1A 1E2EA 2JLYA 1DADA 2B92A 4BZQA 4PPQA 1IM2A 1J99A 1Z0JA 2GJ9A 1Q1QA 2O0JA 4Q7KA 1WQ1R 3BFVA 1Z07A 4K46A 2CLCX 4IOLA 4MYUA 3ZQ6A 2HT1A 3GLGB 1YZQA 1XMJA 4TLCA 2GVZC 1F3OA 2FWRA 3EIQA 2AK3A 3ADBA 2F6RA 2N42A 3LO5A 3IILA 4MRRA 3U2QA 4RD6A 1E2LA 1TUEA 4LJ5A 4JBWA 1W47A 3EZ7A 1JECA 2QAGC 4M0LA 1M74A 3QKSA 3QVUA 5F98A 2DWPA 2RAPA 1KK0A 1VG0B 2XTNA 2JLQA 2MSEB 4N0DA 4O25A 2Q21A 4BRUA 1ZNZA 2OXRA 4G5RA 4MGKR 4A4DA 1PV4A 5AUOB 3AF2A 3B78A 4XSHA 5FBLB 5G3YA 4UXJA 4EQ6A 1OB5A 1W7AA 3CNNA 3AKDA 2QNRA 4LBYA 3EZ6A 1KI8A 3SBDA 2C03A 2QA5A 3CWZA 1WXQA 4QJ3A 1Z6AA 1U8ZA 1SXJE 2HUPA 3UMRA 3TH5A 4KXFB 3VMFA 4J0QA 3KJIA 1Z29A 3KJEA 2VP0A 3QKRA 3AVVA 3NEYA 2IT1A 1P72A 4EJSC 2IWHA 4AI6A 1KMHA 1TQ4A 4A9AA 4JKIA 4TMKA 4A92A 2XZPA 2YWEA 1E1RA 3V00A 4FWTA 2V6IA 3R8CA 4Q9IA 2VL7A 1P61B 5EP2A 2ZETA 1T9HA 3DOEA 4A8JC 2PEZA 3DZ8A 4D4JA 5JJLA 1CXZA 3LAWA 1NRJB 2VP5A 3MAAC 1E9BA 2EWVA 2FZ4A 4NDZA 4G3XA 1DAGA 3TKLA 4XD7D 2JJ8A 4B3BA 3ZS9A 3O8DA 1F48A 4ACBA 5C46F 1OKKD 4M9QA 2NO1A 3WNBA 4LV8B 2WWYA 3UIEA 3ZD7A 3KJGA 4L16A 1U9IC 4XH9B 4ITRC 4E09A 2HLDD 1X1RA 2JLSA 2VP9A 4ZV4A 4KV9A 4HDQB 2DY1A 3E5HA 3MWKA 2QE7D 4B3CA 1ZC4A 5LBIA 3A36A 3W90A 1DVRA 1I4DD 1KKMA 2AFIE 2Z4SA 5TV2A 4AYWA 1R0WA 2J0QA 1G3RA 3DMDA 3FFBA 4QKQA 1J70A 5L8VA 1LS1A 3FMPB 3FMIA 3K1JA 1IY1A 2A78A 4XIGS 4L8GA 3TQCA 1QHGA 1WCV1 2EYQA 1IY0A 2W83A 2XZOA 4LJ7A 5CJPA 2RMKA 4FCTA 4H1UA 1E0SA 4BFWA 4O0MA 1Q0UA 4HUQA 1S2MA 3PJRA 1E1QA 1N6HA 1AN0A 1XTSA 2D62A 3QE0A 5JWRA 1ANKA 3K09A 5KSPA 2PT5A 5LD2C 2IHBA 3SJAA 4DBLC 4BFVA 1FUUA 4BPBA 4LHZA 1S4QA 4DUGD 1QHHA 1M1YE 1TF7A 1BS1A 2ANBA 4MYTA 3IDQA 3K8YA 4M53A 4DEXA 3ZQJA 1G19A 1NKTA 5JRJA 2J1LA 1XTQA 1OXXK 4QNMA 3C8UA 1G3UA 1P2UA 5LB2A 4QM6A 1VCMA 1X8JA 2A30A 1E98A 2KB0A 4Z1MD 2Z5FA 3SR0A 3LD9A 2ZANA 1XD9A 3B2EA 2DFLA 2OXCA 1A2KC 2JLXA 4HDCA 2W0SA 2QQ0A 4PSAA 5AJXA 1G7TA 1Z22A 4ZDKA 2R6FA 1GAJA 1HQYE 1KNXA 4D6PA 2HT6A 3I5YA 4TYPA 3ICEA 2ONJA 3CPJB 2FFBA 1LW7A 1ESNA 3FMFA 3ZJYA 1OE0A 3OF5A 4PZLA 4US1R 1D2NA 4IOKA 2ZYTX 1TPZA 3M6AA 3TSOA 2G83A 2NO9A 1M34E 4NCJA 2QM8A 1FUKA 2I1VB 2QP9X 1YQTA 1G7SA 4I99A 5TDHA 1ZNXA 1A7JA 1LTQA 3PEWA 3K9HA 2F7SA 2CXXA 1CJKC 1A1VA 2QSZA 2GCNA 4EPYA 4N0EA 4TQUS 4CT4B 1EWQA 3ZVNA 1G8YA 2GVDC 3JZAA 4D2IA 3FPAA 3HYTA 4A8JB 2GCOA 3NEJA 1UDXA 5BXQC 5JSZB 1XXHE 4DHEA 4Q1AA 3SNHA 1U94A 1VYVA 3UKDA 4Q9HA 2XXAB 2XEXA 5EXXA 1TUIA 1F2TA 1U8YA 4TMVA 2QM7A 2ZE8A 3H86A 5KPJA 3NTUA 3AKYA 3AB3A 2BMEA 4LZZA 3SYLA 2Q9AA 2FH5B 1XB2A 4IKEA 5L3RA 1ZIPA 1U99A 1VHTA 2O0KA 3V4RA 4B44A 1F2UB 2R6DA 3BB3A 3DPUA 3KKMA 5FUXA 1T0JB 3CIOA 1ZIOA 4F38A 2A7QA 1OXTA 2D2FA 2A2ZA 1H65A 1EFHA 2C96A 2XITA 3QEOA 4M22A 4Q4HB 4S35A 4B73A 3HDTA 3TUZC 3U61B 4XWKA 1Z0DA 1BMFA 1JQLB 2ZU0C 3EPLA 2F1RA 3TW8B 1R5OA 3MCAA 4KCGA 4OQFA 2ZUBA 4AD8A 5KHOC 3NKVA 5DN6A 4LDJA 1ZUNB 4FMDF 3RAPR 3T1VA 4ZCIA 4JVMA 4OJQA 3R7WB 3RSOA 1G4UR 2R2AA 4TYQA 3SHFA 2BVNA 2TMKA 1ZJ6A 2RGBA 3LVQE 3KB2A 4XTRA 3B1YA 4FCVA 2WM9B 1MH1A 4IOJA 4L5BA 3PR1A 5CJ2A 5LD2B 2F3RA 4Q4JB 3THWB 1FX0B 1VECA 2QTHA 2X19A 3ZIAD 4YMUA 2BIFA 1EX7A 3H0KA 3OFNA 3QPUA 1OIXA 4OQXA 2IYWA 5P21A 4JLOA 2O8DA 1YKSA 5KUTA 1HH4A 3DO6A 2UKDA 3IHWA 5CB6A 3GLFA 1M2OB 1OHHA 1EG7A 1VCIA 1XD8A 4X8LA 2C8VA 4YMSA 2QMOA 3IQXA 1YE8A 5DO9A 4KFRA 5E4FA 1I4TD 3LH5A 4Q21A 2RKOA 5CIWA 3W8RA 4E03A 2IS1A 3J81k 1BO6A 2IK8A 4URXR 2HCJB 2X2FA 3GQBA 4P33A 4BFUA 5EXPA 1TAGA 1AQUA 1JR3D 1NG9A 3VNUA 3QXHA 4GBMA 1LF0A 3KTAB 1TQDA 4EFNA 4DT1B 2QBYB 4D82A 4IRUB 4HEJA 5DYGA 5EZ6B 3SN6A 3X1DA 3MG9A 5BN4A 4QJ4A 1KI3A 2JGNA 4YMWA 1H8EA 1EESA 2C5LA 2ORIA 2W6IA 4FXPA 4D26A 1WF3A 4JLVA 2WWGA 1IBRA 4ZKEA 1E9AA 3CBQA 3IO5A 4MYHA 4OQMA 5D3QA 4HDOB 1E2MA 1T8UA 2NQ2C 4W5JA 2YC4C 2ZJ5A 1IN6A 4ZDWA 2F55A 3BORA 5G53C 4HATA 3KDSE 5JMTA 4WZAE 4GOKA 2D2EA 2Q6TA 4MKGA 1HQCA 4LBVA 3W6PA 1Z2AA 1OXUA 2VHUA 1XX6A 2YWHA 4A2PA 1AS0A 3MUFA 4WVFA 5L3QB 1YVDA 2RCNA 2WVJA 4Q02A 3VR5A 5KSYA 5JS8A 3LBHA 1E9SA 3LXRA 1W5TA 2SHKA 1TQ2A 3LW7A 1VCOA 3BE4A 2DBYA 3HPQA 2E1RA 1JPJA 2FSHA 4B71A 1G5TA 2KBFA 1TMKA 3TSWA 2WJGA 3CX7A 4A82A 3IEVA 3PV0A 2IYYA 3ZDQA 5JRZA 1PJRA 3IQWA 1R0ZA 4UJ5A 2BWJA 4NMMA 1GUAA 3GJ8A 4PO1A 2C2HA 4I1SA 1XD2B 2GEUA 1VCNA 1W36B 4DIDA 1W44A 2WICA 5AK0A 4Z51A 1TL7C 2QGZA 3SOPA 5CK4A 3EAQA 3OAAA 3KKOA 5JS7A 4YXWA 1CIPA 2CBZA 5HZKA 5GJVC 3KQLA 1KKLA 2CK3A 1ZYUA 2FA9A 2GK6A 3BXZA 2CCGA 2R44A 3A1TA 2BJWA 5KU1A 2I4IA 5FUYA 1T3LA 4WXRA 3O8CA 3N5CA 3AVTA 1YZNA 4P4TA 2ZRKA 2IL1A 2GJKA 3FKSA 4DLRA 1OYWA 4BFTA 4TWZA 1MRSA 4IDOA 2X77A 1CP2A 3GLHE 5E3HA 3RDPA 4BLRA 4B75A 3AM1A 3CNOA 3G0HA 1W5SA 1NLFA 1PUIA 1KSHA 3U7EB 2P6UA 2IF2A 2FJUA 1KSFX 1LS6A 1DBSA 3BD9A 2P6RA 2BOVA 1W4CA 1GILA 1NLYA 2IHYA 2ZJAA 3QG5A 4LBWA 3SJZA 4BFZA 5BYKA 4D81A 1FQJA 1G5PA 2VH5R 3DZDA 4E5UA 4EJSA 3KXIA 4UNPA 2E9SA 3RWMB 2WIBA 4NHOA 3NHAA 2FPKA 2PX3A 3AGQA 3BB4A 4JZKA 3VX3A 2MMGA 4PPFA 5EJEA 2GDJA 1G3MA 1O87A 2ZREA 1E1RD 4N1AA 3NIBA 4A8JA 4TL6A 5UKDA 4CVNA 3PUZA 5JSZA 4JLAA 1JXOA 1NJGA 2RH5A 1GVNB 4JLNA 2HYIC 1HURA 2QU8A 3K53A 5JBQA 3NXSA 2GHIA 2R8RA 2YJTD 4Q1BA 3V4FA 1OF1A 4KBFA 1OFIA 1FFHA 2IXEA 1DPFA 1I2DA 3CF0A 1KDRA 3A4NA 5BYJA 4WAUA 4US0R 1A82A 3SZRA 4D4KA 2XJ4A 3AVPA 1KTVA 1NBMA 1U9IA 1F2UA 2XAUA 4DLSA 5GJBA 3MWYW 1KDPA 1RKBA 2ZYWX 3HU1A 3KQUA 5HE9A 2GXQA 1KO4A 121PA 2WWWA 2JEOA 2OUKA 5HKKA 1BYIA 2JJ2A 1R7RA 5FOXA 2GRJA 1AJEA 3FHTA 1UKVY 3OEEA 3CONA 2AK2A 3AQ4A 3K0EA 5FTKA 2G0TA 2ODNA 1Q57A 3AVXA 3AF1A 4NYIR 4P3YA 5BWMA 1FMJA 3LDAA 1G21E 2PJRA 1DG3A 2ZU6A 3RS4A 3KL4A 2W2TA 1M6NA 3R7WA 4Q01A 1J7KA 2PX0A 3BS4A 2GZAA 2QT0A 1IN8A 4GZLA 4GFDA 3UWKA 1ZU5A 4Q4JA 3THWA 3CO5A 4LV6A 1FX0A 4D0GA 3DVLA 4DJTA 1E1QD 2PCJA 2H5EA 4Q1CA 4R7ZA 4JSYA 1E96A 4HB0A 1J8MF 3BH7A 4JYCA 4M4SA 3RRMA 5EE0A 3RANA 3CH5A 4MGIR 4YONB 1G8GA 4LYFA 5DHFA 5EE9A 5HTKA 1QF9A 2EFHB 1U0HC 2VTKA 5D3MA 4Z54A 1GKYA 3QEJA 4L9SA 3WMGA 3PCRB 1EX6A 1DTSA 1GITA 1N0VC 2WV9A 2QG6A 3MGCA 1FNMA 1P9NA 2QAJA 2ZSDA 3EZ2A 5K8IA 2HXSA 3BAFA 3BWDD 2YZ2A 2WJIA 3NBZC 1JJVA 2PMKA 2ZYVX 5EE3A 2MMCA 1VHLA 1YZKA 4DT1A 4QFMA 2QBYA 1C4OA 2J0VA 2GBLC 5EE1A 2IEYA 4GL2A 2FEOA 3EPKA 3UANA 5FH9A 3GFTA 1OH7A 1TNDA 1XJQA 4NP6A 2GEDA 2GZHA 3MSXA 4OI0A 2WSSA 3W34A 3T5GA 1I4LD 3EWAA 2G1KA 4DKXA 4B2PA 2HF9A 3DL0A 2B8TA 1W4AA 4V0ME 4JLBA 4XVRA 5ELXA 2K5UA 1G8FA 3QBVA 1QBKC 3CF2A 3QXXA 4OL0A 1Y3AA 2EVWX 1B0UA 1II0A 2WJYA 1Q3TA 4KBGA 2V3CC 2ZQ5A 3A1WA 2HV8A 1I2MA 1Z5ZA 1Z6XA 2W6JA 4US2R 4B48A 5L3QA 1GP2A 2GA8A 5KSZA 1NN3A 2AWOA 2C04A 5JJKA 3B9PA 4Q9LA 5TY0A 3SE0A 4R71A 1FL9A 4UXIA 2PBRA 1G16A 1TEVA 3CZPA 3ADDA 1XU4A 3HP1A 3IEUA 1E2NA 4IHQA 1NIPA 2C98A 3GFPA 3RRYA 1QVRA 3W3ZB 4RFSB 3O47A 1CS4C 4QRHA 1N5IA 4PHHA 4TLAA 2PJZA 2YWFA 4MKFA 3RWOA 3T1OA 4PANA 4RD2A 4RJLA 3EZ9A 1FW6A 4URUR 4DIEA 2J5XA 1XD2A 3CM0A 4TZ0A 5JJIA 3I92A 1N6IA 4HZIA 5FOUA 3LNCA 3I1FA 4MKIA 1QRAA 2G6BA 1S1MA 1KY2A 2ZRNA 2BBOA 2OEPA 1Y63A 3AP1A 4OQLA 4B6EA 1KI9A 1RYHA 1NN5A 4HAYA 2ZS8A 2CL7X 4TMTA 1LVGA 2GXSA 1BMFD 621PA 1CJUC 3K9GA 4DLTA 5JECA 4OHZA 3HU2A 1IJEA 1VMAA 1E6CA 2WWXA 3CNLA 4DCUA 1WBDA 1M7BA 3GCGA 4FMCF 3QBTA 4XJXA 5G40A 4NCHA 3U7FB 1OB2A 2CVFA 2IUSA 3VKWA 5FBWB 1KZGB 3KXLA 3DEFA 3EZFA 1M7GA 1N0WA 4PPNA 3GJ4A 3QUSA 4Q18A 2AX4A 3RLFA 4MA4A 4LJ6A 1X8LA 4ZDIA 1E69A 5H1YA 3FMOB 3ONWA 1YR9A 5KOYA 3OFND 2NG1A 2PZGA 1SXJB 2W2XA 4OHXA 3LBNA 1OT3A 3ZD6A 5K8TA 5CM8B 5JCPA 1XMSA 2O8FB 2VHJA 4C7OB 3TAUA 1OHHD 3QNUA 4HB4A 1GOTA 1NKSA 2OESA 3F5FA 1XPOA 4F92B 1HYQA 1SVKA 3W8NA 1XEXA 1R2QA 4IEEA 4B3FX 4DSTA 5HPYB 4AKIA 5B58C 1KDOA 1E32A 1UJ2A 1Q22A 3LVRE 1ZVQA 1E0KA 3B1XA 4HLCA 1W0JA 3C4JA 3CW2A 2J46A 2CNWD 5F2EA 721PA 4FIDA 1F5NA 4CEJB 1UBFA 2CVHA 4IFBA 2ATXA 2IXFA 2ZI4A 1SGWA 2W6ID 2ZRJA 3QOFA 3U3MA 1OJLA 2GXAA 1VG9B 2OFXA 2CEAA 2ZUDA 1UBGA 3NC1C 5AUPB 3ZYCA 5TB5A 2IWRA 4F7WA 3U3RA 4QGHA 5DLQC 3L0OA 4KU4A 2X1VA 1OW3B 2REXB 3K9LA 3BH0A 1XEFA 1AA9A 4Q00A 3RC3A 3TUJC 1QHIA 2KJQA 2V54A 4BZXA 5HZHA 2Q3MA 1DAKA 3TQFA 1P2SA 5FBRB 4O3MA 1K5DA 5IDVA 3EA0A 2RHDA 1G64A 4V0LA 1OXSC 5E7IA 3I72A 1UADA 2QMUA 1KGDA 4HLQB 5B64A 5JHHB 3QPWA 4RFVA 4DLYA 2EWWA 2JIZD 3I32A 1ZD9A 2NZ8A 1GNRA 1F6BA 1DAHA 3MWJA 4X8MA 1RIFA 4IXNA 1XRJA 5DIFA 4AWXA 4MRPA 1L4UA 4LHVA 1N25A 1S8FA 1E99A 1UBEA 2W00A 4OJKA 3UXMA 2ZR9A 4B3XA 2RGAA 2QT1A 3TVTA 1W1WA 3A37A 3CPHA 4ZO4A 1QHSA 2OCYC 3B60A 4LJ4A 2V6JA 4LWZA 2FX3A 2J7PA 1DAEA 2W58A 4NPHA 1NN1A 3BERA 3AF4A 2VF8A 2H17A 3VKHA 1U2RA 4M2LA 1CR2A 3UMSA 1PVOA 4PC2A 1FTNA 3RS5A 1MOZA 1XEWX 1YZLA 3TSZA 1AGPA 1SKYE 2KBEA 4TL7A 3VR3A 1N6PA 2ATVA 3BFXA 5DISB 4L9WA 2YOGA 4A1FA 3BOSA 1U81A 4RD4A 3FKSD 4CW7A 5FTNA 4WXPA 2ZI6A 3THYB 4C0SA 3GLFE 2QY9A 2VP4A 1OPXA 4P32A 1Z8FA 1E9CA 4B2IA 3QF4B 4DDUA 4D4MA 2A9KA 4MUBA 1E9EA 1OH5A 4EUNA 3CRW1 1GIAA 1YZGA 2ZSBA 2ZJ8A 2ERXA 2HYDA 2ZRAA 2L0XA 3PEVA 3H84A 5LB4A 2IYRA 1HE1C 4U7DA 4FWIB 4AG6A 4QBGB 1M8PA 2VSFA 5FOTA 2YWGA 1P73A 3V9PA 2WZQA 3SS8A 1JB1A 2XOKA 2ODWA 4JT2A 3NBFA 3FVQA 4AKHA 1E2PA 4UXHA 3KQNA 1A2BA 1XDBA 2FFQA 4JL5A 4XWOA 1YR8A 3I8XA 2OFWA 2V4ZA 1XXHB 4NZYA 2F9LA 3UG6A 3W6OA 1Q21A 2ZI9A 1CR4A 3W6NA 5E95A 2ZRIA 2ZVPX 4Q7JB 2ZRPA 4RFSA 3VKGA 4BGDA 2AKAB 1N6NA 1S0UA 2QGNA 4OK3A 3ZH9B 4BFSA 2O8BB 2H57A 4TLDA 3RS7A 1T91A 3UWOA 3ZGXA 3IHLA 2PZEA 1NBMD 1X6VA 5C2JB 2IYLD 2CDNA 4NYIQ 2IYUA 1E2QA 1EWRA 4QJ5A 1N5LA 3LX5A 3K9NA 4HLUA 5HKKD 2ZJZA 3GJ0A 2ZR0A 4A0GA 3VX4A 2GETA 1RJ9B 4N3NA 1TTTA 4P31A 3C15C 1DEKA 5JLJA 2YNMA 3NDPA 5CIQA 3ZVRA 4UNNA 2DWOA 4KYIB 3QG1A 5SZJA 4AYXA 1TF5A 4MRSA 2FDCA 5FBQB 1Q44A 1ZP6A 2QMHA 3AVUA 2EFGA 4V02A 3LY5A 5C4GB 2J3EA 5BW8A 3FWYA 1KZ7B 2G88A 5KDOA 1KI2A 2BKEA 3O8BA 2WJJA 1R5BA 4MDEA 3AVOA 4Q4AB 4KYUA 3SYKA 2C9CA 2RGCA 1IOZA 4XWAA 2WHXA 2CHQA 4F93B 1VKJA 3WNDA 1E2DA 2A3RA 3FYHA 3LQRA 4OYHA 3P20A 4ARZB 3JZMA 1S3SA 4LJ9A 1UBCA 1NP6A 1WB9A 1Z6YA 1G9XA 3PUVA 4OQNA 3MLEA 2WMNB 2XNDD 2J87A 3QIAA 3FE2A 1WE2A 1X1SA 4LSGA 3THXB 3FOZA 2NZJA 1P3JA 4PC1A 2O8EB 5BN3A 4ZI3A 3BBPA 3GLGA 3R9IA 3IIKA 1W36C 1G3IA 2B8WA 2PL3A 1CULC 3Q3JB 3SFZA 4C7OA 4DLVA 4RZXA 4DDVA 2P6NA 1OFHA 1MT0A 5IF9A 2VA8A 3VFDA 2QENA 1UFQA 1AZSC 4B34A 4ZIRB 1GM5A 2OG2A 4B33A 3WRYC 1W4BA 4NCNA 1NMYA 5CDFA 3T1QA 1YRBA 1JPNA 2VEDA 2GBLA 3REGA 4F4CA 2MSDB 2WBLC 2WIAA 2ZJBA 2J59A 4CEJA 1SHKA 2IF0A 2VIIA 2WSMA 4TTPA 1IHUA 5FPTA 3WP0A 1G5RA 2NTYC 2AXNA 3M4YA 2BC9A 3WYFA 4KFUA 1RRGA 4DDWA 2ZS7A 2VHTA 4TSFA 3N70A 2VLIA 4UJ3A 5C1BA 3BRWD 5EQTA 1A4RA 2EQBA 3A4MA 2WSSD 1ZINA 5KYKA 2PT7A 4IXMA 2Z43A 1G7RA 1EFRD 3FDIA 5DYIA 2LKDA 4ZPXA 5G3ZA 3WMEA 3MJHA 3C41J 1D9ZA 2Q0HA 2NO0A 1H8HA 2ZAMA 5G41A 1EFTA 1P4SA 2FGKA 4IDNA 2JLUA 3IBGA 1FOEB 4MUAA 4PAOA 4RCYA 3F8TA 4XOIA 1TF2A 4TL9A 1FPMA 1VG8A 4LRWA 5FTMA 1LFDB 1NBME 1ZCAA 2OM2A 3CZQA 4CRWB 1P75A 1Z6TA 2GF9A 1P5ZB 4KSCA 3CWQA 2GJSA 2R6CA 3F3YA 3R20A 4GMXA 1XJ0A 2Z83A 5C4MA 4BE7B 1CR0A 2XTZA 3AP3A 3ASZA 4ON9A 2ZRCA 3KFVA 5AJVB 3DM9B 3WYGA 3KUDA 3AF0A 2AR7A 2Z6VA 1ZUIA 3KUCA 1R4AA 5EZ5A 2V9PA 3QQ5A 3TAHA 2CLSA 1NY5A 3BH6A 3WY9A 1BH2A 2F1IA 4II7A 4PC7A 4R2HA 3B1ZA 1RZ3A 2PMDA 1KMQA 2ZUCA 2WPDA 3PIRA 3EPHA 3GLIE 4KITB 3MWLA 4IJMA 3RC8A 1GRNA 3QF7A 1NI3A 4K81B 1GWNA 3U3KA 3UMFA 4ACAA 3EIHA 3KQHA 1QZXA 1R10A 1MO4A 3SJCA 2XZLA 4YMVA 2ZRGA 1E79A 4ASUA 2C9YA 1IONA 1N6LA 2BMFA 2VP6A 3NG1A 4QHYA 2YOHA 4R9UC 3SC3A 1RVDA 4LHXA 4URZR 5FBVB 3IO3A 2OBLA 5DH9A 3THYA 6Q21A 5JI2E 2WJVA 1QG2A 3FTQA 3T35A 3FHCB 2NPFA 4A2WA 3U6BA 1JAIA 5GADl 3QF4A 3GLHB 1OH8A 4DB2A 2QTVB 2IX3A 2GZDA 3VHLB 5FOVA 4LHYA 1NVWQ 3LA6A 1KNQA 4CF7A 3QXSA 4GI7A 3C16C 1DG1G 2ZE6A 4JL6A 1G8PA 4Q9JA 4FI3C 1Z06A 5EXTA 1W48A 4LOAA 1JEEA 4CEIB 4HAXA 5FI1B 2DB3A 1EFUA 2RHMA 4L15A 1KI7A 2J7KA 3U7HB 2CE2X 3B13B 2ODEA 4D0LB 1KO1A 5IRCD 1TEXA 3ECCA 4PQFA 4NYMR 4WIAA 3B8HA 4H1VA 4IVPA 2B6HA 2BBSA 2RB4A 2NOAA 3B9QA 4M8NE 1XXHA 2V1UA 3TK1A 1AGRA 3R8FA 3EW9A 3O8RA 4PXAA 2G0NA 3P27A 5GVRA 4B3DA 2QE7A 2VSOA 2OAP1 4LPSA 4KO8A 3QJYA 5CLQA 3WP1B 1X8KA 2O8BA 1G3QA 1E2HA 2CJWB 4HAWA 2C99A 4Z8XA 5A0FA 2YVUA 5KDLA 2FMXA 5DE3A 5CM9C 1G41A 3Q7QA 1X3SA 4WZ6A 4C0KA 3K0CC 1JEDA 1J2JA 4WA7A 4FINA 4DC9A 2CCKA 1RJ9A 4LV5B 2C9OA 4YDSA 3AUYA 3W5IA 1GDDA 4DB4A 2JASA 4B2LA 4M1TA 2Y8EA 4TYYA 4JBXA 1MR3F 2WWFA 3D6TB 3EXAA 3WMFA 5JI3E 2IS6A 4PPGA 3I62A 1P9WA 1AK2A 2QPAA 1KSGA 4P4UA 2WOOA 1E4VA 2DFKB 4Q4AA 5FOWA 2FPMA 2XXAA 1WP9A 4RZ3A 1U8AA 1SVSA
chains in the Genus database with same CATH superfamily
4CN8A 3KBBA 5B1SA 5ITZA 1EFLA 3RKRA 2DC1A 4YV0A 4M8KA 1JLHA 1W52X 2A57A 4H3KB 3EC1A 3HDQA 2XQVA 4LE2A 3HR8A 2QLBA 1DEAA 3OZRA 2BHLA 1KYIA 4LGYA 4DTIA 3I34X 3FR7A 1Q7BA 3THXA 3AUXA 4J4BA 5F77A 1VL2A 2BRUA 4Q1EA 4C0WA 3NUZA 5BVHB 4EB6B 5KTOA 1II9A 2IYTA 4NONA 2RGNC 2WTNA 3I9LA 3CKLA 3AUSA 3NEPX 4ZEWA 3USZA 1LK5A 3ZGNA 4ZCTA 1R0CA 2GD6A 1UEJA 4ZHQF 2B8EA 2GX6A 5B30A 3EYWA 1LV8A 1HMPA 2E2WA 2OHHA 2PLFA 4HLUC 5DHAA 1GY8A 2QZJA 4LPKA 4LZAA 5CGZA 1MJGM 4JEIA 4MDHA 1KAEA 3JALB 3P8ZA 4JLDA 4TUYF 1N34B 1OC4A 4JOQA 4GMKA 2V4UA 4BC1A 2WJHA 2O0MA 4W8HA 5K8UA 1GVHA 3NUQA 4FYPA 3G59A 3O73A 3GGJA 4CM1A 1L2TA 1L7NA 3VR4A 2GD2A 2HHHB 1LW6E 3L82B 4XLLA 3IERA 1R27A 3AI7A 4JZYA 2YKGA 1CLUA 4FZ3A 1C8VB 3SDBA 5LZ9A 4BJ6A 1N77A 4M3NA 4LDPA 3G2JA 4BLTA 2PFGA 3WKDA 4KVAA 3B53X 2BFEB 4BC0A 2E89A 3U31A 2ZRFA 2WZCA 4F12A 1NPYA 2Q5LA 1N3LA 1QGUA 3DOHA 4BDSA 5E7JA 1KWKA 4H7KA 3AH8A 3INTA 2VF7A 3KHSA 4B17A 5LIRA 1P91A 3A9WA 3BJMA 3U1BA 4QM7A 4UTPA 3JQ9C 1ZICA 5FFFA 4C3VA 1AF4A 2JA1A 2F3QA 2ZSEA 4C4YA 1SXJC 3I5UA 4PSKA 4QBFA 3TM5A 2WTUA 4PG8A 2M1ZA 2QPTA 3CR8A 3OQVA 5DSZA 1ELOA 5DI3B 1N5KA 4TWIA 5DX8A 4OP3A 2YHIB 1JEYA 4KN8A 2FRVA 1QF6A 5AKLA 5IXSA 1VLHA 4MICA 2I3ZA 4NNOA 2FE1A 1JDZA 3AJ9A 4P58A 1DOZA 3A1EA 2X2OA 3L8GA 3PHCA 4ZTUB 1OWOA 1P8JA 4LC9A 1ZCJA 2XV1A 5AI6A 4RTMA 3O8QA 1U2DA 3IT1A 2NZ2A 3DMNA 3ZK8A 5HGXA 3N2LA 1R16A 3KJXA 1SVNA 4NAUA 2QORA 3N6XA 2DPXA 4NK5A 1B4DA 2OCBA 2WSIA 1QMGA 1AF7A 3W5JA 5AOVA 2ODPA 2LIPA 4F45A 3QVLA 4XEHA 1JHAA 1XWFA 2ZGVA 4NE9A 4BAZA 4NNPA 1YC2A 4E13A 1J56A 1F3LA 4GRAA 4GVLA 2C0CA 2RHWA 1PLKA 2C2WA 2WIKA 2ZUVA 3GMTA 4RVFA 5I7AA 5CDYA 1U2GC 1VFPA 1QE0A 3ANMA 4Y6GB 3W2TA 3LXUX 4IQGA 3D54D 4UATA 2H5JA 1DAIA 2HXYA 1OGJA 3UJDA 4L0DA 5KOHB 5AVZA 3ZLJA 3ZKWA 4YMTA 1X14A 2YY5A 2XT6A 1TLFA 3QENA 5I8ZA 3V6MA 1KFCB 1BCRA 2J3LA 3M2PA 4FZRA 1P1JA 2NW6A 2C5HA 2UUOA 3G9QA 4MAAA 4MMXB 1UT6A 3GFOA 3EFBA 4UUOA 4YJ3A 1LC3A 3WB0A 4RS4A 4A2QA 4EY5A 3VYSB 5MN5A 3IPCA 1P60A 4KH1A 3GJTA 3GARA 3KIPA 3L7CA 4H77A 3OTQA 1GADO 3C7CB 2FWNA 3AVWA 4QIHA 4XLTA 3JAKB 1X80A 3KP1A 1R00A 4JR1A 1C7ZA 2A8YA 4E31A 2EW1A 1CSEE 3AM5A 4Q6BA 4LZWA 4M9SA 1KS9A 2CXNA 4QNRA 5H82A 5LZ5A 1U3TA 3KXDA 3SEAA 4FOLA 5FBKA 2WJWA 3C8DA 1KZ4A 2A58A 5AJTA 5KNDA 2VDWA 1P9RA 3D2LA 2WF8A 1V16A 1N7HA 2IODA 2YINC 3B6KA 5LP6F 2YASA 3G0GA 4KO2S 4GT1A 4ZXPA 3UMBA 1UM8A 2W2VA 3DE5X 2XE7A 1T34A 1WM1A 4IL5A 3OKPA 1DFHA 2WHPA 2DHRA 3QP9A 1K2WA 2HL6A 1UODA 2V8OA 4KQJA 5EG5A 3HKDA 1JR3A 2REQA 4GMHA 4CKXA 3C5WP 1G18A 4G24A 5I9BA 5IZ4A 5ES4B 1X7ZB 2FGJA 2PMBA 2AE1A 1P2VA 2HO4A 1O95D 2VJYA 2BFCA 4QGFA 1T3TA 4FFDA 4RHTA 4F1KA 1BWSA 4A0SA 1T1SA 4JU8A 2CF5A 3GN2A 4F6CA 4GMDA 1A7KA 3T99A 2PGNA 1Q74A 2QX4A 3GGDA 3A06A 5IDWA 3CZMA 4CLOB 1P4GA 3MJDA 5AMXA 2RAVA 3JQFA 3UUWA 2J0UB 3LRXA 4I55F 2QYHA 2QM3A 4KWCA 1L4MA 4BQSA 3MJEA 3A3YA 3M6UA 3MS7A 5KOJA 4FC6A 5FL7A 3TE6A 4ABYA 2FHSA 5A9TA 2P5TB 5F64A 4OLBA 3OECA 1Z2EA 1E2UA 2OV8A 1A5AB 5AW8A 1TK9A 2O5VA 3AVYA 1IIRA 3VDRA 1JFRA 2AMFA 2EL9A 2G71A 3I73A 3F7NA 1HG1A 2PV0A 2Q07A 2VDLB 2RDMA 4ENQA 2CL0X 3OCWA 1R74A 4CDGA 4MV5A 1J09A 1E2KA 4MRAA 1YQDA 1XPRA 4EL0A 4R40A 4IX1A 1MC8A 2CE7A 5LQSA 1KE2A 2FPLA 3QKUA 5AP9A 5KKNB 1BXGA 1F2TB 4Y0NA 3WBFA 4X0EA 3FUCA 2CFIA 2HBRA 3INRA 3LDFA 2BTQA 1EEHA 4QDXA 5BWCA 1CNFA 4ZCSA 4PTLA 4JL8A 4S1VA 3NAGA 4O63O 3TLXA 2XKKA 1JJBA 3FPBA 3ZVKA 2BZ1A 5AHWA 3VR0A 4YRZA 4TV9B 1P80A 1L7XA 3FY4A 3DC2A 3WAGA 5JXWA 1BQ4A 3FUVA 1J2TA 1NF3A 1Y7TA 3FI9A 4M1SA 4OQQA 3UQZA 2FPRA 2QF7A 4M21A 2QN7A 3PPYA 1Y5LA 2O7QA 4IDPA 3PUIA 3PITA 1JFTA 2ZJ7A 2BEVA 3K6RA 4X63A 4YRAA 1FBTA 2YYSA 2WA2A 5DI9A 5A4MS 2QQEA 1SQ5A 2OUIA 2O5RA 1YR6A 3D6MA 4P3OA 4KN5A 2H2HA 2JB9A 4XRRA 2QTAA 1JIXA 4TOIA 4J1TC 5FWXB 3RVJA 5C18A 4I1RA 1GDHA 1ADYA 1HE2A 1XCJA 2DLDA 5A1JA 1C8LA 5LOVB 3AUTA 3I30X 4M0CA 2P65A 1DC8A 3D4NA 3E9ZA 4UCXA 5THQA 1M8KA 3NH9A 4QXOA 3O90A 4LHWA 1RJDA 4AKSA 4B8ZA 3R3VA 3JAMA 2PLAA 2WAXA 3KAJA 3P19A 4N18A 3RODA 4P83A 1DFGA 1QS0A 3LQYA 5JNSA 2HQSA 5JJ5A 1R15A 1XTPA 1ECJA 4OGWA 1SO8A 2WG1A 3KT0A 4E07A 5GINE 3S5UA 5K2MA 3K0FB 4X41A 4AW9A 2FEKA 4BWVA 3GLGE 1GFIA 1JSRA 5EXSA 1PGQA 5JO9A 2QZSA 1E6LA 1F5SA 1W94A 1MT3A 1JQJC 2WKQA 2ZITA 3PQCA 3R7BA 3ENZA 1SKMA 3VOAA 1RTTA 2MYUA 3GLFB 2UXCB 4BATA 4JC5A 3OCZA 1I6KA 2LUOA 3O1LA 1JYSA 3PHLA 3QW4B 4DG5A 5C5DA 5JOQA 5L3SB 4JA2A 3DZIA 4WDQA 3NO4A 3PPIA 2CY0A 5IJXA 3ADOA 3A6ZA 7MHTA 5HVNA 4UBKA 3T94A 1J9GA 3QVOA 1L5VA 2AD1A 5FPSA 1G7CA 1J9ZA 2DWQA 3I4CA 1H3EA 3EXFA 3ESRA 3IPRA 1W46A 2JLWA 3DP7A 4M1EA 4AUEA 3HBMA 3BTUA 4LKOA 4OI1A 3VQTA 2PUEA 2FPOA 3L8DA 4DQVA 3V8RA 1R5JA 1ZDMA 3B52X 3Q10A 3PICA 1CE8A 2CK3D 3QGMA 4FOTA 4FSXA 5E4JA 5JJCA 1XZPA 3K1TA 5HW0A 3VZBA 3JYNA 2WP8J 1SD2A 5EIFA 1E4YA 2VSXA 4GBJA 1KRWA 3QXCA 2L19A 5E9AA 3LUCA 2CV2A 4IWNA 3OZWA 5KX5F 4ZAWA 1J2RA 2OAEA 2R6HA 4KRGA 5IBQA 3AFNA 5A6SB 4GI3A 3RS9A 1JT2A 1V47A 3ABSB 5CUQA 1KJYA 1ZBDA 2E87A 1DXHA 2RIPA 1KEWA 2HD4A 4Y6LA 4B6QA 1YQQA 3QZUA 4DCNA 1Z12A 1BX0A 1DKRA 1GKLA 1DCKA 2Z04A 4NDAA 1KQNA 1KI1A 1AS3A 2RH4A 4BWFB 3UBMA 1XNRB 4BV2A 1GA6A 3UOAB 5JWHA 3UAGA 4KFTA 3R7AA 5KU7A 3ESAA 1Y5RA 4PGGA 3BMOA 2HC9A 4P82A 1SVMA 3R5JA 4MJXA 1LGYA 3KOMA 5JARA 1O0BA 1UAAA 2A5DA 2WWHA 4I1IA 1C3OA 3V2UA 2AHOA 4HQ0A 4MVXA 5KB3A 1M34B 4Z4FA 1B8NA 1WSDA 3VPXA 1U90A 3HN2A 1B7GO 4YC7A 1ZM9A 3C3KA 4MW5A 1EM6A 3I6ZA 3K6JA 3FCAA 1TM3E 3G9UA 4BEBA 4E21A 4AICA 4OHYA 3GQVA 4IOMA 1UKBA 1IN4A 3DZCA 4KIJA 2QR3A 1F6WA 2HEIA 5A4JA 1GL6A 2Z3VA 4K8OA 4YVFA 2I7VA 4COOA 5AKYA 2F48A 1VXOA 1OIVA 3QH4A 4NBKA 4QWWA 3THSA 5J2TB 1LI4A 2XBLA 5G1PA 1U7HA 3U1VA 2ASEA 4LDNA 3QQPA 1GCUA 1KE1A 5KCZA 5AOBA 1GG2A 1HPLA 2LBPA 2AX3A 2HWKA 3EWIA 1GKKA 2A84A 2QAGB 1E6EA 4BNDB 1PCXA 2NZWA 3ODGA 2RGNA 4G4SO 1QCYA 4M37A 4A6XA 2H1RA 1O5TA 4AMYA 3C3MA 3R9WA 3MJCA 4D9FA 5D7NA 1K97A 5AUQA 5ABPA 3RIXA 2OVFA 1KMIY 2XDYA 2IYVA 5DNCA 4JBHA 6LDHA 2HQ1A 2DUNA 3DYIA 3QYFA 4WXYB 1CUIA 4PLHA 1YFKA 4D5EA 4EPXA 3NWPA 221PA 2FWPA 2WP0A 3OE7D 2QRNA 3E82A 1E9RA 4RK1A 1NUQA 1WS6A 1XFAA 1KSJA 3WA7A 5LDDC 4AY5A 3A4YA 1E3WA 3RRZA 4D8TA 1DELA 1W6UA 4ZAVA 4M76B 2A0YA 2QL6A 3OEYA 5DZSA 3A7EA 3E27A 5A2GA 2J30A 2IYZA 2W8BB 3SHQA 1D6NA 2E4UA 1VBKA 1E3IA 4NS1A 1PL8A 4WW0A 5CMLA 1E3SA 3TQTA 4F8YA 5C81A 2B78A 3DEHA 3P0JA 4J2OA 3HLKA 3PNYA 4RQTA 2BY4A 3SU8A 3NTOA 1XF1A 3ROMA 4Z9BA 1FE8A 2AJCA 5CX1B 5GJCA 1QV9A 2JIQA 1JJFA 3G7SA 4N01A 4NTZA 1QHXA 2J85A 4DJAA 2VHXA 3JQ9A 3PNLA 4LISA 4IHJA 3HZZA 3LQQA 1LWOA 3GP3A 3QPVA 5SZKB 1T29A 2OCDA 3SZMA 4PLGA 4RGBA 2NMVA 3JS5A 1C81A 3I42A 1FSGA 4CYMA 1SXJA 2XYQA 3A10A 1FYFA 3AI2A 4OO3A 4PCUA 4QJIA 2QSUA 5CPFA 3WYBA 5B37A 4QGAA 1CCWA 4FIZA 4MQEB 3TRFA 2R47A 3TVDA 2V6FA 3KEGA 3EF0A 4WXMA 3VU9A 4JBNA 4M1OA 3QUAA 5JCZA 3WL4A 5TQ0B 2WR8A 4JB2A 4C1BA 3DOOA 4LQLA 2QP4A 5G1OA 4C29A 5KI6A 2EFYA 3K6KA 3QSYA 4RDCA 1XWIA 3TTSA 2O8CB 3TSCA 3H3FA 4IIHA 3TIVA 4UUBA 2P5SA 3E9DA 4PBRA 1COWD 3ELUA 4TWRA 2P4QA 4TRRA 5AR1A 2NVBA 2D06A 4GYWA 1JFFA 4WV3A 1R8YA 4F4FA 1JIUA 5J5VA 1M1ZA 5DGIA 1DJNA 2C2MA 4JLKA 1YU6A 2XJ9A 4G0NA 2OD7A 3KYCA 4M1YA 2XYPA 5FR2A 2FHPA 3EXHA 1GA1A 1VSQA 2UVPA 2FLWA 3QFHA 2YFQA 4C05A 3R76A 1TU4A 3Q98A 1U2GA 2PHZA 5BT8A 5JD5A 1OD6A 3ETNA 4GYKA 2GRUA 2WM8A 3EC2A 3RABA 3ZZTA 5CD1A 4BNJA 4XTCS 5FAXA 2OC4A 2G36A 2OO3A 5C34B 3TD2A 1OX6A 4BGUA 4UFPA 2HZ7A 2FG5A 3RJMA 3GLIB 1TM7E 3AP2A 1KO8A 1A50B 2FNAA 3S29A 4S12A 5E3JA 2Q41A 3A4LA 4Q7QA 1R6UA 1T9GR 5J4KA 3TBKA 4UDXX 1A8UA 3FTFA 1BDMA 1PKXA 1NVFA 2OBBA 3GP5A 3ZCXA 3U5ZB 4XQ0A 2PZAA 5M04A 4ZTZB 2VSNA 1VTKA 1DLJA 3V1LA 1TVCA 5F9MA 4LYJA 4L4SA 2QX7A 3KCNA 1R0RE 5DASA 4BL5A 4P7JA 5KTSA 4K9MA 1OROA 1DC7A 3U26A 3U16A 1C3VA 2B83A 2QE6A 4ZD6A 4QXAA 3SMVA 2V7VA 1ML3A 4O3FA 3WYCA 2GPSA 4GZ5A 4C5AA 1P4RA 3MWGA 3S2IA 2P27A 4HWGA 1G20E 2X9NA 5KYYB 2JEYA 4F4JA 5TX7A 1TM2A 2PSDA 1KJ9A 3PHBE 4MUXA 2NTNA 5DLEA 2VT7A 1LJ8A 3HBFA 4PLTA 4OK6A 4XVUA 3UAZA 1NSYA 1XZQA 3L7NA 1RQ2A 4OBEA 2WABA 4AJ4A 1SXIA 1TMGE 1BWQA 2GVNA 2PRIA 2HDNB 2WFAA 5DNEA 4AJKA 4CNBA 3LUGA 3D7SA 3E0QA 4Y1RA 2ZTUA 3NJRA 3HP7A 4F4IA 1I4WA 3IOEA 3N2YA 4Y2RA 4YPVA 2AOTA 3ZXYA 4LGCA 5IUNC 1X7YB 2ORVA 1NVXQ 3UA4A 1ZJYA 4ZZ3A 3E9QA 1ZM3A 3OT4A 1LI5A 4HNRA 1ZRMA 1AKUA 1ETUA 1W2WB 1NVVQ 2EYUA 3PQ4A 4NZNA 2P62A 1F9EA 5IT5A 4C4XA 3COJA 1PJSA 1II8A 5ALKA 3K9WA 1N2ZA 1S3GA 3KD2A 1J5EB 1B1CA 4OH1A 1HDOA 5DF1A 3U3JA 1IXSB 3JSAA 2IVFA 4YFVA 4NZYA 3QVVA 1HMYA 1RXWA 1W2HA 3IEPA 1K7SN 4RSGA 4TS4A 2OBNA 1MIOB 2B0CA 1GN8A 2VWHA 2NU9A 2VPYA 3IKTA 3EPRA 2Z56A 3TL6A 1Z4QA 2XE8A 2VZLA 3M4JA 3PVSA 5IAEA 5SV2A 2J9GA 2X0DA 4O2AF 3WGKA 5JEEA 1JMVA 5E1DA 3TO5A 4B3JA 2VYVD 3OPVA 4JQSA 2VUUA 1KDYA 4R1PA 2PZ8A 4UDYX 3T0GA 1KMNA 1GPH1 2IP1A 5TF0A 4DSAA 1E2JA 2BLNA 1BX3A 1U0FA 2ZCUA 3ETHA 4LHSA 3VMMA 3NHRA 3SHOA 1ZD8A 2QG4A 2VJCA 2BCGY 5DXJA 2JIZA 3UOWA 1Y42X 3MFYA 4R8SA 5K0ZA 2ORWA 3UH0A 4PX5A 2VVTA 4OHBA 1Y37A 2AG5A 1P62B 1U3VA 1JNYA 3EVEA 3RO7A 5GZ1A 2AJTA 2B5OA 2JKVA 5E3IA 3RRBA 3G85A 1W0JD 2C5FA 3GZNB 1SAYA 2VXYA 3P2OA 2Z95A 2X0NA 3DFMA 4TMWA 4BNIA 1TI7A 2VTEA 4Y8VA 1EP9A 1ND6A 5FP0A 5I47A 2IUUA 5AK3A 4DILA 2M9MA 2XTMA 3D9QX 4G9GA 3RARA 3VSDA 3VHXB 1A2OA 1DJLA 3ZNNA 4FYYA 4P4SA 3A05A 1CF4A 5DTIA 5J1TB 4J1TA 3LHKA 2GKSA 1XF9A 2F9MA 4OQYA 1HY3A 3IRUA 2J9XB 2P69A 2O05A 3DLAA 5DCLA 5ENDA 4CIWA 1ZVKA 1XRRA 2BN4A 1RQRA 4V0KA 2HMVA 3KVRA 3ASVA 4RPKA 1AKYA 1XFDA 2R6GA 5LWQA 2BELA 1CQZA 3HJUA 4UOZA 1JQKA 5CFMA 3WJ2A 2GM3A 2PQ6A 2UVQA 1JILA 2B61A 2F43B 3AFGA 2DKFA 5FR1A 1I5EA 1T1JA 2I33A 1FQWA 1WNTA 3VR1A 5IX8A 5F78A 3DV0A 3STWA 4FN5A 4YAUA 2HMYB 3DZBA 3V2HA 5F23A 5LQKA 4MDFA 2D00A 1ADBA 3OZXA 2NVUB 1MDBA 2AZDA 2KPOA 1IN5A 2GPTA 2VRBA 3P2KA 2ZBQA 4XX0A 3K09C 1BTOA 1KARA 2GESA 1DNPA 2CLKB 2BKVA 3BHIA 3H6KA 3P9SA 1NASA 3EIXA 4TXJA 3UJAA 1JFVA 3VHQA 3IIJA 3WZ2A 1YDGA 5L3VA 2O54A 2WD7A 3T7AA 1M54A 1V43A 2X8BA 3DV2A 3RU2A 4A36A 1T10A 1O3YA 2O3SA 3QTTA 1BYUA 2ERYA 3A32A 3AKCA 3V2IA 4QC2A 1KYZA 1G6HA 1WWKA 1YDFA 3FPFA 3OVMA 2GHQA 1NFRA 1KYTA 4MCJA 1XEXB 3P26A 3URMA 3EXEA 3LUFA 4RL4A 3WLNA 1BS9A 2X58A 1B6GA 2F8TA 1JU3A 2EKDA 1IY2A 4KZKA 3KOOA 4IFTA 3ICOA 1Y4UA 2I7CA 2JCGA 5HIAA 4MWEA 3VPFA 3B1KA 4C7VA 4DMLA 9MHTA 3AR5A 1Q0LA 2G67A 1E5LA 5ECGC 3W77A 1XMIA 4ZEMA 5B6IA 3BC1A 1PP4A 3TKAA 1IPFA 2DUMA 4ZJYA 3LPNA 1WKCA 7ADHA 5KTKA 1YCDA 2H54A 5EIBC 1E2IA 3DKRA 4CMEC 3LDHA 2YOFA 4Q19A 4UD2A 1APBA 1XHFA 4GLOA 3NGMA 2JC3A 3HPRA 3X1MA 3VTAA 4EEZA 1A9XB 4ZT5A 4N8DA 1NONA 2FSPA 1KTIA 3RIEA 2XMGA 3U3DA 3ST7A 1UWCA 3UCXA 4OM7A 4RJIA 1KAOA 1F7VA 1PW7A 3VVLA 2YS7A 3TECE 1SPBS 3LUJA 3HZHA 4OU5A 3IXLA 2JDID 3UCFA 3RVOA 3HADA 3K30A 4HEA1 1V1MB 3QI2A 4G23A 4OP2A 1JHVA 1Y5MA 4LXQA 3RS3A 1YJXA 4C7KA 4I46A 4AX4A 2EP7A 3PFWO 4DZZA 3UGJA 4N12A 2IUEA 5KYNA 3AVQA 1E1DA 3UJ3X 4GC5A 4RCVA 5JJBA 3VSBA 1LRJA 3O84A 3X1WA 4HUTA 2TRSB 4UHDA 2W93A 4PHCA 4WX2B 4KRXA 4AKGA 2EFEB 1EGQA 1LPSA 2H4JA 2ABWA 4K9KA 3C1OA 4FT2A 2HA7A 1JDSA 2PLRA 4BQFA 2AR9A 5ISMA 2O1SA 2A4KA 2JAQA 1IVSA 3N7AA 4OI4A 2DFTA 3BEOA 3ZU6A 2PIDA 1XMPA 2IPOA 1HSZA 2R8XA 2YV4A 1NXXA 2XMSA 2NXJA 3W9YA 3IP5A 3SJBA 2V58A 4DRZA 4D44A 2GSDA 4C0HA 3AO0B 4EG3A 3B1VA 1DO2A 1T6NA 1R37A 1UMDA 4M38A 5AJHA 5KTNA 4FE3A 4DSUA 3IPXA 5IUJC 4KI0A 2I6FA 3DKPA 1EA7A 3EEBA 4CKBB 1OLUA 3CZ5A 4RTSA 2H4FA 1C3XA 9GPBA 3F3MA 3HO8A 4BNUA 4I8XA 1Y9AA 3VNVA 4RDHA 2AV6A 2HK9A 1H85A 2VKQA 4LY6A 2VNJA 4HAUA 4I4TB 4U9IS 4UQOA 4BLOA 5IULC 2IYSA 1W0KD 1HT0A 1QFXA 3I2HA 4DCVA 3KK0A 1MP0A 1RI3A 2QROA 1PJ8A 2PD6A 1VG1A 4N4AA 4EZEA 1M8GA 1M75A 4BGEA 1ZCBA 3L0ZA 1KK3A 1E1YA 1E7YA 2CNLA 4O1HA 5KREA 5J47A 4YIKA 3RC2A 1SJ9A 1JTEA 3TTTA 1RWXA 2BHSA 5EP3A 2G09A 3ZGZA 1VRVA 1UAGA 2C2XA 3OLWA 1AKNA 1W2GA 4KQXA 1M8JA 3GG2A 1UJNA 4KXLA 2C4VA 1QZZA 2I2XB 2V4MA 1VKHA 5EGNA 4PS1A 4EB8A 1EFRA 2E55A 5IHXA 5KQSA 3LUPA 4DAEA 1SOWA 2EBWA 3IPYA 4KGDA 4E70A 1HE3A 3LBFA 521PA 2ID8A 1RXSA 3QWAA 4RF5A 4RANA 5CNJA 1KJWA 1CNEA 4LF7B 4RQAA 1T4DA 2CNNA 4R0VA 1JS1X 3JW8A 5AWFC 5CTAA 2AZXA 1RAIA 3C39A 2Y0DA 3HJRA 3GLTA 2LD4A 4KWIA 5TPZA 3RS0A 3WB1A 1U6IA 1NUHA 3F4BA 5G0TA 3C3DA 3OJOA 4EA6A 4YUXA 5A0VA 5T64A 1QVZA 1E5DA 1E9FA 2KW5A 2ZAGA 1NULA 3NFRA 4GE0A 4NBWA 4Q7LA 1YJ5A 3ZXUB 3NHMA 5LNK1 4TQGA 4RESA 5EHXA 2FOLA 4PZZA 1MJ5A 1H1LA 1FFWA 1K6JA 4TT3D 2Z4RA 4IZOA 2Y67A 2Q8NA 4AZVA 1WB5A 2AZMA 3WHKA 4YCNA 4Z99A 3SEZA 5LXTB 3BXGA 2VXCA 4W6ZA 4L4UA 2DQSA 4BV3A 1NOIA 3AJAA 3EWNA 5AHXA 3KZMA 2DEUA 1ZD1A 4JBYA 1NL3A 3H2HA 3TOZA 4PRZA 2ONCA 1SHUX 1YCHA 1E3DA 1EJ6A 4TTRA 3UUFA 4UFOA 1WHTA 3AW8A 3PK0A 2WHYA 4HQFA 4QARA 3I8OA 3EF1A 4YT2A 3AL0C 2ZBFA 3WNVA 2J08A 2NPIA 1OLOA 2O50A 3M1IA 3QPBA 3T15A 5EUQB 1WXDA 3V8BA 3X2SA 4IIDA 6GPBA 2XWPA 3K70D 3WAJA 2IV2X 1UJMA 3FR8A 3I45A 4DRXA 4BO7A 4O08A 1Q19A 1J97A 1QHYA 1UMBB 4OBBA 1YI0A 2NU7B 4S1OA 3PGA1 3TNYA 1OAAA 2IU3A 3H97A 3PXXA 1IXKA 4IS3A 1SWVA 5F52A 4BZZA 2OMEA 2VP2A 2FWBA 4M1MA 4XX1A 3CUEF 4DLUA 4Z86A 5IZCA 2R62A 1YL7A 4ZU6X 1MB9A 2C42A 1NVBA 2AC4A 3D31A 4MMZB 4UZEA 3DBOB 2ZFUA 3KR1A 3VZDA 2WF6A 2E5LB 3G8DA 1LLDA 3JAWB 1J99A 1NMQA 1Z0JA 1EX1A 3UM9A 1USIA 3JASB 1CY1A 1Q1QA 1GQ2A 3RUHA 1LCIA 4HGRA 4CL8A 4KXWA 1UKAA 1WQ1R 4KPEC 1PJLA 1Z07A 1EWTA 3IXMA 5FB3A 2CLCX 4FSHA 2FEAA 4YRNA 4RHFA 3OX1A 3QU9A 1MTOA 2WI8A 3W5VA 3CNEA 4TLCA 1OWPA 4MPPA 1IUPA 2IXDA 2DM6A 3ADBA 2F6RA 5CURA 1FJGB 3IILA 3DT8A 4KWEA 4LJ5A 4JBWA 2V6BA 3HA2A 3EZ7A 3IBFA 4GE3A 1JECA 1PV2A 2QAGC 1VI5A 1MXHA 4M0LA 1C9NA 4NBUA 5F98A 4IH1A 4QPPA 3UHJA 2J0EA 1CERA 2JFFA 4WKPA 2GHTA 4O25A 2D1YA 4KXQA 4J6FA 3Q9NA 3ZEIA 1PR3A 1ZNZA 2OXRA 1RLJA 3NHFA 3JALA 2JAOA 4A4DA 1UFRA 3AF2A 5AUOB 3B78A 4XSHA 5FBLB 5G3YA 4UXJA 4ND4A 4ZVRA 1W7AA 5KHLB 1NTOA 4GICA 3FJ1A 3VJLA 4WACA 4LBYA 3ES9A 4LXXA 1L0BA 2IP2A 4LXGA 1IK4A 1KI8A 1ZUWA 5HZMA 3CWZA 3JQQA 1WXQA 4DC0A 1P1KA 3RFTA 1SUDA 3TTYA 3VMFA 4KXFB 1F51E 1EBBA 2H31A 3KJEA 3QKRA 5B2EA 4KMOA 3EIOA 1GGNA 1B76A 2B8JA 2PRKA 3I2JA 4CHTA 4AI6A 2A0XA 2ZWVA 3PHJA 3ODPA 4MEBA 5DDIP 1I5RA 4A9AA 3PYMA 1Q15A 2XZPA 5H02A 2X5XA 3RT9A 4X60A 4TTVA 5EOVA 4YAWA 2DBVO 2ZBDA 3PQ5A 4FWTA 4LJSA 5CXXA 2VL7A 1P61B 3CN7A 3H9CA 2GLTA 4JDUA 5G0VA 4OMFG 1T9HA 5C8YA 1G0OA 3TNJA 4EEKA 2HPVA 4UBOA 1NRJB 1M6VB 2GR9A 1E6UA 1DKUA 3AHGA 2FZ4A 4KK4A 4RLQA 3FOAA 4G3XA 3MEQA 5LBTA 4MWCA 2G07A 4U7PB 4XD7D 2NSHA 4CNQA 1XYYA 3V6LA 3X2EA 1F48A 3ZS9A 5C46F 5KTTA 3B6MA 1FXWA 4YRPA 2EKZA 2NO1A 2DXIA 2EJCA 4LV8B 3A3KA 3EHDA 4ZVKA 3ZD7A 4L16A 4ZVMA 1DWUA 1N33B 1QQ5A 4NAVA 3TKYA 3ZWBA 4ECEA 3ZDRA 5KHAA 4MR9B 1X1RA 2VP9A 3VR2D 4ZV4A 4JGIA 1FUIA 1PJTA 5IM4F 1BS2A 3AXSA 1ENZA 3DWFA 5AXCA 1O97C 3A36A 5LBIA 3OZGA 4W8GA 1Z4MA 5ALJA 1PBTA 1DVRA 1EP2B 4R84A 3ZUPA 4BNZA 4P0PB 4AF8A 3QX3A 1PWYE 2AFIE 2V03A 4AYWA 3CG4A 2WEKA 2WHEA 1G3RA 4WLVA 3LK6A 5A4FS 2WV7A 3PQ3A 4DEVA 2YVAA 2ZATA 2R11A 5CRIA 4ZOLB 5ES3A 3HI6A 3OLQA 3OM9A 5HKAA 4MOWA 2I2CA 1WCV1 4ER0A 5KOHA 2G1UA 1RAEA 4J76A 3H8SA 3B6ZA 1X1EA 4P4GA 2XZOA 1ULAA 5CJPA 1SUBA 2ESRA 1GYQA 1U8TA 4BFWA 2W2PA 4O0MA 1Q0UA 1TFUA 3L4BC 1ILEA 2OAGA 3H1AA 3WIBA 4N9QA 3DKIA 2BFFA 1YIDA 3LGAA 4M9CA 4HH0A 4Y1EA 3PJRA 1AN0A 2FPIB 2O8VA 3K09A 5KSPA 3JD1A 1T1EA 3EVFA 4RYDA 2FSUA 2QZPA 1PDOA 2VP3A 3SJAA 4BFVA 1FUUA 3PRJA 5IH7A 1O08A 4RPLA 5IC4A 1TB4A 2ANBA 4BWGA 4EELA 3WYDA 3BMQB 3K8YA 4M53A 2XRZA 5LSAA 1N1EA 2QDKA 2FW7A 4OH7A 3T7JA 4P7KA 4BO5A 3DNPA 4DW8A 2V7WA 1G3UA 4I0WB 5LB2A 2PS3A 1K7CA 3E6AA 3EMDA 4IWYA 1X8JA 4QM6A 4HTFB 2A30A 1Z5UA 4N5LA 3SR0A 1GSHA 2ISQA 4RVSA 2I71A 5EINA 1RP1A 1YRHA 4IGIA 2H06A 3BVPA 4K8RB 5ECDA 4BN0A 2X0KA 3B2EA 1JBQA 2OXCA 5AH0A 4U9UA 1Q0QA 3BILA 4RADA 2JH8A 2Z2ZA 4OGFA 2O2EA 1X7ZA 2QQ0A 4XUGB 5LZ7A 5NULA 3F9RA 1G7TA 2PUHA 5F1OA 1GZ4A 1Z22A 3PDIA 3V46A 4BVGA 1HQYE 3MD9A 4EG8A 4KRFA 5EY5B 4D6PA 3MCTA 5BSMA 3GZJA 3B2QA 4YGYA 3ZC3A 2HT6A 4GMGA 4DV7B 1X7GA 3CPSA 3LHIA 5CCBA 4CMEA 1DUSA 5IXJA 2OENG 4DTCA 4EMTA 5AM2A 4NH4A 2YJ4A 3FSRA 1JB9A 2ONJA 3X43A 4B09A 3ZHUA 2FFBA 2HKIA 1ESNA 1NP7A 4GPZA 4N03A 3OF5A 4CLOA 3UWMA 4US1R 4X91A 1AMOA 2QRHA 1RWWA 2XUQA 4HFRA 1X9IA 3I76A 2BMAA 1ZEJA 2PBFA 1M34E 3A2MA 4NCJA 3HCDA 3DBVO 3SGLA 5BURA 3IQGX 2HLHA 3DFFA 4XDZA 3AR3A 1LTQA 1KP9A 3IAUA 3K6SB 3PEWA 2F7SA 1A1VA 1Y33E 3OZBA 1PE0A 3C3WA 3E8SA 3WMRA 1WZIA 3ZY6A 4QUIA 3N0VA 1U4OA 5IT0A 1DDGA 3PNMA 1N2CB 1EVEA 4BFLA 3JZAA 1CEYA 3V8NA 4UUMA 3SFTA 3FNQA 2XDAA 3GZTB 3WLAA 3FNBA 3NRBA 4FYMA 4CM8B 4DANA 4DHEA 2PTGA 3UKDA 1CC1S 1UBOS 2VOJA 4PG6A 2XXAB 2XEXA 1F2TA 5JSUA 4KX3A 3SQMA 5T7BA 2QM7A 4KIUA 2PWBA 1JVNA 3H86A 4E14A 3AKYA 3IJEB 2TSYB 1U0OC 4MHOA 1XB2A 2PZLA 4RK6A 2O0KA 1U99A 1V48A 4DQ0A 2WWVD 3VYTB 3NPAA 2X42A 1OOEA 3NHJA 4XW2A 3CIOA 1Z38A 1L7RA 5G2OA 3VKFA 4EAAA 4F38A 4GHWA 1MH9A 2A2ZA 3OP4A 3QA3E 3LPMA 1ABFA 2G6TA 5JAPA 1Z25A 2ZB4A 1BCSB 3BDIA 3N28A 4GO1A 1YWGO 2VZ0A 5A62A 1RQNA 5FXMA 2UYOA 4YJ2F 3FSGA 3U61B 1JQLB 3PZBA 3NAQA 1IZ8A 2FZKA 5IARA 5C1OA 2D8MA 3I04A 4PNEA 4L4RA 2F1RA 3DD1A 4PO3X 4J07A 1JSZA 1OZ0A 1TIKA 3RAPR 3RS8A 4KR3A 2FRXA 1GQQA 4JVMA 1WMFA 1G4UR 4TYQA 3FTEA 2BVNA 4PLWA 3SE7A 4WUTA 2QUBA 3GFQA 2P9YA 3K15A 3P9XA 1PR4A 1JSLA 1MH1A 4L5BA 1ISSA 3PR1A 3TQOA 4Q4JB 3THWB 5CNIA 2H3EA 1FX0B 1VECA 2X19A 3EH1A 1EB9A 4YMUA 3FBGA 2TECE 2ZZKA 3NRJA 4E32A 2IYFA 1H6DA 4WKOA 4S1PA 5A4DA 1Q2XA 4LSZA 1OIXA 2O8NA 2VJMA 3ZY3A 1ISHA 2WYOA 3AR8A 4HTAA 1Z63A 2EGUA 2WE7A 3TINA 3GLFA 1NNLA 1OHHA 4RQUA 1VCIA 3W7VA 1MD9A 2C8VA 4FEGA 1M66A 4NY1A 3CNBA 4H4DA 2B6NA 3OQIA 4WLUA 4ZHQA 2DR2A 1I51A 5CIWA 4C1NA 4LHEA 5C1DA 3WE7A 3CW8X 2O5EA 2ZJFA 3U4IA 5KJ1A 2HCJB 4RDXA 1QP8A 1RWNA 3LPAA 2DUJA 3OF2A 4BFUA 3CZ9A 1I8TA 4TUYA 2BDEA 2AMVA 4X7MA 2UYQA 1Z5PA 1SCKA 4IDBA 1LSJA 1SN7A 4DT1B 4EA8A 2QBYB 1FP4B 3SN6A 4HEJA 3PX7A 3I01M 1YNOA 3MG9A 1JKIA 4QJ4A 3TRJA 3OURA 3WGIA 3HCFA 2DGDA 2FDXA 3GUCA 3PF9A 4ZA2A 3V4ZA 2Y76A 5CVCA 4K9DA 4BO4A 4C7JA 4D57A 1EESA 1UZUA 3MUNA 4ZKEA 1FTQA 2I5PO 1E77A 1DQPA 1V9CA 3JD4A 4EP1A 3LLVA 3LPDA 5CHYA 2QYOA 1QVVA 2NQ2C 5B1HA 2BKLA 4W5JA 1GA4A 4ZDWA 2AC7A 3BORA 4D8YA 4ONEA 2YY7A 2HH9A 3RLIA 4MUHA 4EI8A 1Z13A 2NUPB