4A8JA

Crystal structure of the elongator subcomplex elp456
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
350
structure length
277
Chain Sequence
GLDSSHVGVRPSPATSQPTTSTGSADLDSILGHMGLPLGNSVLVEEQSTTEFHSILGKLFAAQGIVHNRIRNGDTHVIVLSLNQMFAKELPGIYYKDYNHQFDITTRLMPAPIASELTFIAPTQPVSTILSQIEQTIKRNDKKLIRIVIPSLLHPAMYPPKMFESSEIIGLMHGVRSLVKKYYERVVLFASISIDIITPPLLVLLRNMFDSVINLEPFNQEMTEFLERVYKSQPGKIQHGLVHILKLPVFTDRGEMRVLKSEWAFKNGRKKFEIEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELONGATOR COMPLEX PROTEIN 4
publication title The Elongator Subcomplex Elp456 is a Hexameric Reca-Like ATPase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 84
structure length 277
sequence length 350
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4a8jA00
1AQUA 1N6RA 2ZYTX 3GPLA 2EWVA 2YWEA 4PTLA 4ZDIA 5SZKB 1R0XA 1MV5A 3Q85A 3EWSA 2VHUA 2A5JA 3GD7A 4V0ME 2O8CA 1XPOA 3KX2A 4ITRC 2P2LA 1W44A 5TV2A 3W6NA 2ERYA 1Q21A 1Q3HA 1JJVA 2KBFA 4OI0A 1E2JA 4TLBA 1SVSA 3AV0B 4O2LA 3THOA 1NVVQ 1R4AA 4DDUA 1IN7A 1QHXA 1KIMA 3EXAA 4A36A 4PZZA 2ZTSA 1JNYA 5FTMA 3OAAA 2W00A 1FOEB 1ZRHA 2CE2X 1HURA 2XNDD 3KJEA 1XTRA 4B71A 1BO6A 2GCNA 4DLUA 1G7CA 3RS4A 2P6NA 1S4QA 1SQ5A 4PZYA 3T15A 1M34E 1TQ2A 3MUFA 2V54A 2VHTA 2AFIE 3DHWC 4IDHA 1EFHA 4DDTA 3TUZC 1GIAA 3JVUA 4GZLA 2P3SA 1GSIA 1X86B 1VYTA 3O8RA 3K0AB 2OFXA 2GJKA 3BD9A 3ICQB 1GILA 5JI2E 4HAZA 1GL6A 2VP2A 2ZQ5A 2Q9BA 4A8JB 3AF2A 1FMLA 1JQLB 4V0MA 4UXIA 5G40A 3REGA 4DCUA 2GDJA 4BWYA 1E2DA 4YMWA 2KB0A 2IYQA 1GTVA 4FXPA 1M7BA 1QHYA 3ZYCA 3ZVMA 2B92A 1RFLA 1LY1A 1XCMA 1IAQA 1RYFA 3LY5A 4M1YA 2XB4A 3RRZA 2GJ8A 2FPLA 5L3SA 4ON9A 4M22A 2C2HA 4PPFA 4IHQA 5H1YA 1QDEA 4E07A 4M1KA 3HPRA 1JALA 3VR6A 1OH5A 1D5CA 3HYTA 3N2EA 1KI9A 2IF2A 1W46A 1W4CA 3SFZA 2P0EA 1AKEA 4A4DA 1G6HA 1IN5A 3SYLA 2FSHA 2CVHA 3TW8B 2ZRDA 1II8B 1LS1A 3F3YA 3QY0A 2BDTA 2PX3A 4PANA 1MRSA 3OFND 3P26A 1EFRA 1KK2A 1IBRA 4Y0VA 1NLFA 4GPTA 2JLQA 2QP9X 4LJ8A 3VR3A 2LCFA 4Q9KA 4DC9A 3GJ3A 3VR1A 1RKBA 3CR8A 3GEHA 2PT7A 4JLNA 4KYUA 4AC9A 3A1TA 1DOAA 1E69A 5DHAA 2VEDA 3SJCA 4B33A 2WKQA 4PAOA 4BZQA 4LWZA 4A0RA 4NYJR 4HLUC 3T35A 1PV4A 4TN1A 4CEHB 4LZZA 1E9CA 1SVWA 1KOFA 4QJ3A 3VKHA 1SVIA 1IXSB 1OHHA 1S8FA 2ZUBA 4B3BA 2FFHA 2YZ2A 4D80A 4CT5A 2H8KA 2OBMA 4ZKEA 3ZZ0A 4B2IA 3AKDA 5J40A 5DO9A 1SXJA 2Z0MA 2H92A 3WRYC 2WWYA 1E4VA 2I1VB 1JPNA 2QP4A 4LBWA 4BFVA 1TU4A 2X8AA 4TTQA 5JCPA 4GOJA 2J46A 1OXXK 1XEWY 4DSUA 1KDPA 4NONA 4C2UA 2O8EB 3U7EB 4I4LA 2G1JA 4BEJA 3EAQA 3LBNA 2ZI3A 4G5QA 4R98A 1LB1B 1KI7A 4ILEA 3QBTA 4BLOA 4MYHA 4WBSA 2Q9CA 4BFZA 2QENA 4PSKA 5KSPA 1OFTA 4UNPA 1JR6A 1JXMA 3M4YA 4QC2A 1QHNA 1W5TA 4QL3A 2ZIAA 1KSGA 3GJ0A 3TQFA 3BJIC 2C95A 2AL7A 3C14C 5FBVB 4PC1A 5CM9C 1R0YA 3U3MA 3BERA 4LC0A 1R5OA 1G7TA 3MCAA 4NCKA 5FBLB 2EQBA 2NQ2C 1G4UR 1T4GA 4NE2A 4JZKA 3B1VA 1AGRA 1GKYA 1WCV1 2PH1A 4Q5IA 4BEBA 3SC3A 3CB4A 1G8GA 2H18A 2REBA 1JI0A 2QTVB 4NDZA 1YJ5A 3T5GA 3IQWA 3AF3A 3TUJC 4B43A 5FOUA 4EPXA 4OK6A 3VMFA 2GAOA 1LFDB 2GRJA 2DR3A 3CONA 2V7QD 4WAUA 2XX3A 3KB1A 4D4MA 4ZKDA 1ZCBA 2GF0A 4JLJA 3L0SA 2KJQA 4O0MA 3GLIE 1IY1A 1U0LA 2D62A 2JLXA 1E9SA 3LBIA 4QXAA 4UNRA 3A6PC 1Z6TA 2IUSA 5H8WA 2KE5A 3BFXA 3AQ4A 4JYBA 2XJ4A 3K9LA 1D9ZA 3A36A 3HR8A 4TZ0A 2GEVA 5C1BA 3KL4A 4A2QA 2GESA 1KK0A 2AXPA 2ZI4A 2H5EA 3J81k 1E1QA 5AJVB 4LJAA 3SZRA 3LDAA 4M1MA 1CR4A 1ZJ6A 4CRWB 4CEJA 4B76A 1YR9A 3B85A 4DWJA 4Q4JB 3UANA 4ESHA 3OAAD 5AUQA 4IOKA 4WZ6A 4DLRA 2IWRA 2IK8A 3CBQA 4D0GA 2OFWA 3S1AA 1OT3A 1S3GA 2DWPA 3PCRB 3IDQA 3QXCA 2QAJA 3EPKA 2DCUA 5HKKA 2QQEA 4TL8A 1G41A 1FFHA 1SVMA 1FPMA 3B7GA 4DT1A 4KV9A 1E0SA 1NVVR 5DNYB 1N6HA 2IXGA 3GLIA 3GP8A 4N0EA 1G8PA 1XPUA 2PZEA 3WHKA 1AGPA 4UJ5A 4MRNA 1O87A 4J0QA 2JA1A 2KSQA 4ZPXA 1UFQA 1BMFD 1P6XA 3KDSE 1I2MA 1Z07A 3BBPA 2GJSA 3LH5A 2P65A 4TT3A 3TVDA 3EZFA 3RSLA 2QGNA 3AB3A 3GCGA 3IHLA 1M2OB 1XP8A 4GRAA 1JEDA 4NL4H 2N1BA 1F3OA 4TYQA 2OHFA 4PXAA 4QGHA 3BWDD 5FL7A 4P4SA 2GA8A 2ECKA 2HLDD 3SQWA 2CBZA 1ZU5A 1OYWA 3BH0A 1ZYUA 3QF4B 3RDPA 1E2HA 3PUVA 3WMGA 4DCVA 5CDFE 3ZH9B 3TH5A 2P5TB 5EQTA 2YHSA 2B6HA 4US2R 3L0IB 2R2AA 2GKSA 2FPKA 4JLMA 1KSFX 2OSBA 4TTRA 2Q0HA 1F6BA 3JVVA 3TQCA 3PEWA 4D4KA 1D2EA 5TDHA 2Q3HA 5EUMA 2H17A 3LQQA 5TMPA 3EZ9A 1N6IA 3EX7C 4RD3A 3KJIA 3EIHA 2NPIA 3ETLA 3T1TA 3UKDA 4ZDWA 1G5TA 2JGNA 3TK1A 5FTKA 4P4TA 2YVUA 2JJ1D 4B3CA 1JBKA 1GL9B 1WXQA 4FWTA 2FE4A 4GP6A 3RHFA 3I32A 3UMSA 3MD0A 5LD2B 4U5XA 4RCYA 1E98A 1VCIA 3KKQA 4KFSA 1TQ4A 3GFOA 3O8BA 4L15A 3GJ8A 4EQ6A 5HR5A 2BV3A 5CDFA 3LV8A 1EWQA 1M7GA 1A5TA 2J45A 1CS4C 2BMJA 4FMDF 2GZHA 4RKFA 5EP4A 1W36D 3SU8A 1MO3A 1R6BX 1TADA 1I4DD 4FIDA 5FR2A 2GZDA 2IYZA 2ZUCA 3EA0A 3LBHA 3TUIC 1W49A 1KY2A 1F48A 2ZYWX 4GSYA 2D2FA 1Q22A 2X77A 1U0HC 3T06B 2VHQA 3L43A 3WNCA 4O3MA 1YQTA 2LWIA 1BOFA 4RFSA 4IOJA 5HCNA 1XXHB 1DPFA 3TSOA 2J1LA 3PEVA 4DUGA 5GJBA 4HDQB 3IBGA 2A5DA 4MRSA 2OLKA 1ZAKA 1DAEA 2MSEB 1IXZA 1TX4B 2RMKA 4KI0A 4UJ3A 1AS3A 4ASUD 1ZNZA 5F2EA 1U8AA 4PHFA 5KSOA 3DL0A 1JQJC 721PA 1DO0A 4FI3C 4Y0AA 2PEZA 1UPTA 1JPJA 1QRAA 3ADBA 4V0LA 2J9RA 1MO5A 2QSYA 3V9PA 1MABB 2VQSA 1F2UA 5JJKA 4MITA 2H57A 4KBGA 1LTQA 1T5IA 4M1OA 1PJRA 1N5JA 1F60A 1Z0FA 3LXRA 1NN3A 1U2RA 2CK3D 3AVQA 5AUNB 3C8UA 1FL9A 1EXMA 2NZ8A 1SHZA 2J7KA 521PA 3C15C 2OILA 5CLQA 2A78A 2ZR0A 4DDWA 1II0A 3NEYA 3B5JA 4MYUA 4OBEA 4QJ4A 1P61B 2J87A 2QGZA 5DISB 2EFHB 3VHXA 1Z28A 2WICA 3VR4A 1XDBA 1NN1A 2H7VA 1Q1EA 4E22A 1YU9A 1OFIA 4DLZA 2WMNB 3MLEA 1XD2A 2ZRMA 2FU5C 1OIXA 3FHTA 3OE7D 3P4YA 3RC3A 2ANCA 1GITA 5GJWC 3SBDA 4BFXA 2JLVA 5FTNA 1GM5A 4D4JA 3R20A 2GTPA 4W9MC 5EZ5A 1CXZA 2WWIA 4YDSA 2PJZA 4HUQA 3QXHA 4HDOB 5BW8A 1IN4A 4D0LB 2BBOA 4TZ6A 2O0JA 1CF4A 2LKCA 4YC7A 4W5JA 3B1XA 4NCNA 4JL5A 2IBMA 2OAP1 4IDNA 4QHYA 1JAHA 2ZRJA 3ZS8A 2ZJ5A 2GBLA 4XWAA 3K0CA 4M4SA 4P0TA 4PQYA 2VLIA 3CR7A 3C41J 3PG5A 4IOMA 1QHHB 2EVWX 2FMXA 1Q0UA 5ELXA 3U4QB 3OEHA 3CKLA 5SZJA 4NHOA 1OV4A 1CEEA 4OQFA 5A4JA 2RH5A 1VIYA 1DAGA 2OG2A 5BXQC 1NP6A 1Z08A 2IYUA 2QRNA 4A2WA 2A9KA 2AFHE 1W2HA 4B32A 4D82A 1LF5A 1JR3D 3CW2A 5EE1A 3CPHA 1N2CE 3LVRE 2A5FA 1OIVA 2E87A 2P5SA 2YC2C 3NKVA 1EGAA 1ETUA 4OHWA 1G8HA 3LXXA 2B8WA 1YR8A 1XJCA 2AKAB 2O8DB 3B8HA 2QY9A 1VIAA 1YZGA 2ZU0C 2NMVA 1NG1A 5TARA 1W5SA 2F43B 1G291 2XNDA 3N2IA 4TYNA 2ONJA 3EIQA 2QT1A 1KMQA 2ZVPX 4H9GA 5FBWB 2OBLA 4HB3A 3BFKA 4PHGA 1S1MA 3IGFA 3EPJA 4Q47A 4X8MA 1XZQA 2IXFA 3NG1A 3X1ZA 4URVR 3AP2A 4MRVA 3TKLA 5B64A 2J0UA 4ERNA 3Q7QA 1KMHA 3B1ZA 2XSZD 4HAXA 4LYHA 2OUKA 1SGWA 1COWD 2FOLA 4OHXA 4QGAA 4F92B 5HPYB 1JJ7A 3QBVA 5LBIA 2IYXA 3B6EA 3JZAA 1E1RD 2GK6A 1FX0B 1XTQA 4M9SA 2V55B 2JJ2A 4PO8A 5FI1B 4MQBA 421PA 2ATVA 2C03A 3VNUA 1VG9B 4E09A 5C4GB 1WA5A 4JBXA 5JFGA 1DADA 1N0WA 4TL6A 1IOZA 1XJQA 3X1XA 1DAIA 2ZITA 1ZW6A 1FNNA 2HXYA 3KKNA 3K8YA 4A0GA 1G3IA 2ZE5A 4GL2A 3U6BA 3SQXA 2C98A 4MUAA 5FPSA 4LV5B 4B44A 4YXWD 2VSFA 4I1UA 4QBIA 5AJZA 1Q1ZA 1XPRA 4PPQA 2OM2A 3BIFA 2P6RA 4LK2A 4DHEA 4FMBB 4IKEA 3GJXC 2VBCA 2AX4A 1VG1A 1GG2A 1Z0AA 3BK7A 2DB3A 2ZYVX 1G18A 3CF6R 3HR7A 4M9ZA 2ORWA 4RD1A 2JLRA 1RJ9A 4RFVA 2NIPA 4F7WA 4C30A 3QKSA 2HV8A 3NC0C 2RCNA 5HZHA 1FW6A 1YZQA 2RGNA 1KZ7B 1DAMA 4LJ6A 3THXA 3IO5A 4E5UA 4LSGA 4GNKA 1UDXA 4G1UC 3Q8XB 4LOAA 2GK7A 3L8YA 4US0R 4BUJA 4H1UA 2BM0A 3CNOA 3IBYA 3Q9LA 1XTKA 5HE8A 5LDDC 2ZRBA 1CULC 1M74A 4LBVA 1T6NA 2HDNB 2G6BA 2QTHA 3ZGXA 1Z2CA 4A8JC 4LRWA 2X1VA 2GVDC 5EJEA 3QSYA 4R7ZA 2GJAA 1C9KA 1FQJA 4M1SA 4TSFD 4QM6A 4JLKA 2QPAA 1A2KC 5CM8B 1DELA 1RPZA 1XTJA 2BBTA 2HT6A 2ZRLA 2RHDA 4YONB 5JSZB 2DWQA 1XB2A 2IYSA 2ZE8A 1MO4A 3B82A 4JL8A 2WKPA 1EX6A 3W90A 3THWA 2O8BA 2VHJA 3KKMA 4H1VA 3KB2A 1XMVA 1XD8A 1E0JA 1XTSA 1TL7C 5G53C 4M0LA 3ZJYA 2G88A 1NJFA 4PSAA 2WJIA 1CJMA 1XNJA 1KI6B 2XXAB 3CM0A 4NCHA 1US8A 3IIJA 4U7DA 3ADCA 4UXHA 4XSGA 2WJYA 2ZJZA 5FPTA 3B9QA 2A2ZA 1NVXQ 1OE0A 4TLAA 2ZRFA 4LUCA 2DPXA 4HDCA 4AY2A 4O2RA 4LHZA 4EPRA 3C5CA 1OH8A 3AF4A 2ZJOA 1ZM9A 1UDWA 3UATA 1OIWA 2RGBA 4EPVA 1KNXA 3RSOA 2D7DA 3IPYA 2JAQA 5C46F 5JWRA 2JDID 3LX5A 2F1JA 4RD6A 3F5FA 4HB4A 2WJHA 3EIEA 2OXCA 4JKIA 1Q1BA 2ZE7A 4M53A 4OQLA 4B75A 3A58B 3DEFA 1N6LA 2WV9A 2XJ9A 1ZC3A 3O8DA 5DSZA 2VYFA 2WWXA 5J47A 5JCZA 4BRWA 4Z8XA 1KO7A 1TAGA 4JLDA 4LHXA 2V7QA 2K5UA 4DVGA 2EFGA 4Q00A 1XMIA 2P67A 4TLDA 5JZVA 2NOAA 2D74A 1Q57A 5GVRA 1OB2A 2XNSA 2DHRA 2YC4C 4NPHA 5FUYA 4UNNA 2MMCA 5F98A 2HJGA 4GT1A 4NYMQ 5CIQA 1S9DA 4IFEA 2ODBA 3AVUA 1J2JA 5HZKA 1K5DA 1OKKD 2IC5A 2QMEA 2ZRAA 3P1JA 2FJUA 4HZUA 4Q4AA 3TAHA 3UWOA 3SHWA 5J4KA 4RZ3A 4DSTA 3WBJA 2QEQA 1E2MA 4XH9B 3T34A 2IYWA 2WBLC 2DBYA 4EPWA 4AKGA 4HATA 2CHGA 2N46A 4B34A 1ZVQA 3SFVA 3W9YA 4TMVA 5A0FA 3QIAA 2WAXA 3K70C 2QPTA 2WPDA 3ICEA 2C9OA 5F9FA 2ZJ8A 3BOSA 1NRJB 4MKIA 4TMTA 1BIFA 2SHKA 3QQ5A 1G5RA 5BN4A 2HCJB 5GVSA 1HE1C 3FHCB 3H86A 1X8LA 2CCJA 4U00A 4QBFA 1AZTA 5CK5A 3CH4B 1P62B 4Q9JA 3R7WA 1T9HA 1KJZA 3GLGE 3ONWA 5CIWA 4Q19A 3E70C 4JYCA 4AIIA 4DCSA 2GXAA 2AHOA 1W1WA 2JJ2D 3B1YA 1BMFA 2X2FA 3QENA 3LAWA 4LPSA 3HU3A 1Z6YA 3VHLB 1QVRA 3ZZTA 1G3QA 1P72A 4TLCA 4ZI3A 2FF7A 1HE8B 3SE0A 5JRJA 4CGZA 1IHUA 5J5CA 3L0OA 4C0QC 2Q9AA 4OK5A 4UNQA 1CU1A 3SBEA 1AZSC 4A9AA 4KHZA 2HLDA 4KLZA 1G7SA 5EZ6B 4BFTA 1PVOA 2R6GA 3RVBA 1YZNA 3TR5A 2YWGA 1RYHA 3I61A 4Z54A 2WIAA 4CYMA 2J3EA 4Q1CA 1Z0DA 5K8TA 3SS8A 1P9WA 3TVTA 5FOVA 1FMJA 2BWJA 3QPUA 5FOSA 5G41A 4AURA 3OESA 1IN8A 4WXRA 2A3RA 3NIBA 1R0ZA 1KDRA 3W5IA 3CWQA 4MGYR 1VKJA 3GLGA 1S96A 2IYYA 3KFVA 2QMHA 2FH5B 3CH5A 3Q3JB 5CJPA 1E2FA 5L8VA 4C0BA 3G82C 2HT1A 2LKDA 4RD4A 2XTZA 2ONKA 2VSOA 4L9SA 2DFLA 1O3YA 3G0HA 2ZI9A 6Q21A 2HF8A 4B6FA 1XMSA 5C18A 1GFIA 4O25A 2JJ1A 4Q7KA 4Q01A 2Z4RA 3RS3A 3K53A 5TY0A 4CDGA 1YR7A 2Q3MA 5EE0A 3FHOA 1NF3A 4MKHA 4JIMA 1SXJC 3K0EA 3FFBA 1Z22A 5LB2A 5B2ZA 1KO5A 3QOFA 3VU9A 1TEXA 3K0SA 1PLKA 4TMXA 1WDTA 1QHIA 1OH7A 3QKRA 2IW3A 4B3GA 2VO1A 1NBMD 5EXXA 4NYIQ 2FX3A 4F91B 5KHOC 4D81A 4BZXA 5JJIA 1X1RA 2CVFA 4WVFA 3BB1A 4OK3A 5KDOA 3U7FB 5KO2A 1T3SA 2VF7A 3BAFA 3ND8A 4IEEA 2RGGA 4FWIB 2XZLA 1F2TA 3SDZA 2W6ID 2J7PD 5EXPA 2WWFA 3IEUA 1YZTA 2QRZA 3NDPA 1VTKA 5D3MA 2YWHA 3KUDA 1AM4D 3GFTA 3DDCA 1G1MA 3MJRA 1DBSA 4LHWA 3DOFA 2A5YB 3AVOA 5AJYA 4ZIRA 1N3BA 2DYKA 1I4LD 2WKRA 1P2TA 4PQRA 4TMZA 3R9WA 2QM8A 4AKEA 1R8SA 4MRPA 3U6KA 3K70B 1ZINA 4MDEA 4R9UC 5KUTA 1XEXA 3ZQJA 2RGEA 1E96A 3OHMA 1W0JD 1XX6A 1FUKA 4LCBA 4ASUA 1MRNA 4DCNA 2C9CA 1GNRA 4TYPA 1OXUA 4URUR 3KQUA 4BE7B 1Y63A 3I8XA 1R2QA 4JSTA 4XVRA 4EFNA 1KAOA 1OFUX 4NTZA 5JJLA 4JVMA 1XTIA 2C99A 1GOTA 2ZRHA 4EDHA 5LD2C 4ZO4A 2CK3A 5L3SB 3I72A 1NKSA 4OI2A 4R71A 5JWOA 1E0AA 2IS4A 2H1LA 3FFAA 1MR3F 3QF7A 5GJVC 121PA 2OO7A 2JATA 4PC6A 5P21A 5K8UA 2WHXA 3T1VA 2CNWD 2OE2A 3DVLA 4QM7A 3A1SA 2ZRIA 3U3OA 5JRZA 2PEYA 2GILA 1ZMXA 5FH9A 2QMUA 3IUYA 4JS0A 3KXIA 2XZPA 2FN4A 4WXPA 3P20A 5E3HA 2ZRCA 1XXHE 1IONA 4L4UA 3OE7A 3EG5A 1JR3E 4M8NE 4QG7A 2UZ3A 2NO9A 3PEUA 4TMWA 3PQCA 4QBHA 5KYKA 1Z6AA 1U98A 3SYNA 2GCOA 1DAHA 1VDZA 2BMFA 3VAAA 1N25A 4E03A 3I3SR 4L8GA 4CF7A 2ZU6A 3QUSA 4DLWA 4DIDA 4DRZA 1KNQA 2WPDD 3HDTA 2O0HA 2ZRPA 3NHBA 4AG5A 1NY5A 1VYVA 2ODWA 3KJHA 2PLRA 1AS0A 2RGXA 2TMKA 2VP5A 4C3ZA 1E9RA 2QBYA 1P2UA 3CPEA 3U2QA 2MMGA 1Q3TA 4C0AC 1AK2A 4Q4HA 3UMRA 3W3ZB 2PL3A 4LGMA 5CLLA 1SVLA 4URWR 3IILA 1H65A 3D8BA 3SJBA 1G4AE 1SXJB 2WIBA 1CP2A 1PZNA 5KDLA 3TW4A 2CJWA 4XSHA 3I4LA 3WP1B 2WVJA 2IHYA 1SVKA 1ELOA 3G5UA 4F4JA 2IA5A 3CUEF 1JR3A 4ZCLA 1TF7A 3ZIAD 4A6XA 4BPBA 4P32A 4GZMA 4C2TA 5JEDA 3GLFE 621PA 2UVQA 4CZ2A 1KO4A 2FGKA 4DXAA 1ZD8A 4KFRA 3U5ZB 1I4TD 4KXFB 4UXJA 3NBFA 1QVAA 1G19A 5FI0B 4XJXA 3W8NA 2NGRA 1DG1G 1DE0A 2G77B 1CR1A 1N5LA 1Z8FA 5AJWA 4G5OA 3ZQ6A 5CK4A 4LV8B 5C4MA 4TL9A 4RSGA 2XSZA 1CRQA 2GXSA 3X1YA 1COWA 4KODA 3PXGA 1NVUQ 3GLHE 2Z6VA 1E1RA 2VL7A 1Z5ZA 3K09C 1W7AA 4OHYA 5FR1A 2NG1A 1GNQA 2H16A 4LBZA 3F8TA 3GJ7A 4WZAE 3V4RA 4FN5A 3GLFA 1B0UA 4V0NA 2FSGA 4CW7A 5B58C 4KFUA 3KZ1E 1QZXA 2D3WA 3WBKA 1G3MA 4DEXA 4BRUA 3D6TB 5JECA 2BCGY 2EYUA 3OIVA 4X8HA 5IHPA 4CEJB 4YXWA 3DZDA 1P9RA 2A7QA 3IQXA 2C78A 5TXGA 1EFCA 3KKOA 3QVVA 2Q3FA 2FSFA 1ZD1A 3HPQA 5EXTA 5LPNA 2R62A 4M2LA 3M1IA 4GOXA 4NP6A 4MH0R 1ZM4A 4JLBA 3T5DA 4Q02A 4B3XA 1HV8A 1VCMA 2CE7A 2WTUA 2ORIA 2ZJBA 3KTAA 3IIKA 3W34A 3TBKA 5EE5B 5C2JB 4KSBA 2JLWA 4PC3A 1YHNA 3GLHA 4LC1A 4MDFA 4BGDA 3R9XA 1SZPA 5M04A 3IHWA 5FUVA 3GLIB 1S0UA 1SKYE 2BEKA 3ZLJA 5H70A 2J0SA 2ZREA 4MGZR 3VX4A 1KKMA 3DKVA 2OAQ1 3PJRA 1ZCAA 1QHSA 1E2LA 2W83A 3U44A 3A4LA 1EFTA 4XTCS 2XTNA 5KDDA 2AXNA 2RKOA 4Q9LA 4TYWA 3MG9A 2OT3B 4TTPA 3TMKA 3AKYA 3N70A 3TE6A 4EJSA 2PCJA 2G0TA 4JBYA 4TSFA 1M1YE 3U3RA 2CHVA 4JL6A 4FMCB 2XITA 3MAAC 4P4UA 2QI9C 1KZGB 1UEIA 5FTJA 3SYKA 3RS2A 2J5XA 2YWFA 3LW7A 4P4SB 4A0FA 1T0JB 5KTYA 1CBUA 2AR7A 4FCVA 2HJVA 3AEZA 4AKIA 1Z6GA 3VFDA 2RGDA 1AA9A 4QBGB 4A0HA 3UPUA 4KO8A 5IDVA 2QSZA 1G8YA 3WNDA 5CITA 1HY3A 4BLQA 3H1TA 4DEYA 4QJ5A 1FP7A 2JIZD 5EUQB 5JMTA 5JBQA 4G0NA 2O8FA 4JKYA 2YOFA 3A1WA 2QUZA 3PIRA 1UBGA 1FX0A 2WZQA 3EARA 3U3JA 1HQCA 1TNDA 5E7JA 3TR0A 4B3FX 1L2TA 2O52A 4A6PA 1ZD9A 4NZYA 1NNEA 2BEJA 3MGCA 3UG6A 1E2PA 3K9GA 1E4YA 1E94E 2MSDB 5TVKA 3T61A 2JDIA 1T8TA 1NN5A 3C7KA 3PFIA 2EW1A 2GBLC 3W8RA 3K0CC 1UAAA 4B35A 2BIFA 4D0NA 2F55A 1LVGA 5CB6A 4WA7A 2XAUA 1HUQA 3QE0A 1G20E 3KXKA 1Q12A 2AKYA 4A92A 3KQNA 1E2NA 1H8EA 4TQAA 3R8CA 2ZSDA 5LB4A 3AVVA 4YLGA 4EPTA 2ZROA 2YOGA 3RYTC 5FOTA 1UKYA 5DLQC 2IHBA 1W4AA 4BLTA 1OPXA 3BE4A 1ZBDA 1A2BA 1T3LA 4G5GA 1DVRA 4Q1FA 5CYPA 2XZOA 1LW7A 2OEPA 2J0VA 1OYYA 4C7OA 3HU1A 3KUCA 3GEIA 2BVNA 1Z2AA 4KAXA 3RWMB 1MH1A 1FTSA 3FKSD 3RC8A 1WBBA 2FNAA 4LHYA 1OKKA 1Z47A 2ODNA 2VP4A 4RFSB 5BN3A 1K6MA 2REXB 1GRQA 2E9SA 3X2SA 3PR1A 1OF1A 3FTQA 2HF9A 2HXSA 4D6PA 4BFYA 1VMAA 2GZAA 3ZZUA 2ZUDA 1L4UA 1YZUA 2PMKA 3IKJA 5JWHA 2A5GA 1HA3A 1KI8A 1XMJA 4RD2A 5L3QA 3ADKA 2CL7X 5FUWA 4NMMA 2QMOA 2QN6A 4HEJA 2PX0A 2GJ9A 5E4FA 1CLUA 1DARA 1ZUIA 1P4SA 1U9IA 5BYJA 2I4IA 4XVQA 4G5SA 5GJCA 2B21A 3K0FA 1F2UB 3I1FA 4IDOA 4JJZA 2R6AA 2F9LA 5FOXA 2QE7D 4Q1EA 3B9PA 4MRRA 2YINC 4TMKA 1G9XA 4R2HA 2FV8A 1J8MF 2FG5A 3CX6A 2Q6TA 3CZQA 4BQSA 3WNBA 2ANBA 4M9QA 4ARZA 3AVWA 1E9DA 4S35A 1XCGB 2OESA 3QKUA 1NI3A 1VHTA 3P32A 4M1WA 1KO1A 3I73A 4D25A 2DFKB 3RRNA 2ASEA 2IT1A 2D4HA 2F1RA 4KU4A 2JLYA 1ODFA 3K9HA 4TYYA 1U90A 4IXNA 2REOA 4KYIB 2GXQA 2ZANA 4HSEA 4W7SA 1G7RA 1P7CA 2CL0X 5IF9A 2C8VA 5F3WB 1YR6A 3AH8A 2CLSA 1J8YF 3DPUA 3THYA 2GVZC 3FB4A 1NLYA 3TJZA 1UBEA 4LYJA 3SR0A 1P2SA 2EU8A 1TQDA 4CEIA 4RZUA 1TPZA 3U7HB 1LF0A 1QHGA 1NBME 4JVLA 1A82A 3MWYW 3QEJA 3T12A 2IYRA 2KBEA 5UKDA 4DLTA 4HUQB 5DI3A 4PX9A 2D7CA 4YMUA 1QBKC 4RD0A 3GJ6A 1AIPA 2DFNA 4KJZA 2OXRA 4BLPA 1FQKA 2IYTA 821PA 5JI3E 1R8QA 3VR2A 3W5JA 4YMVA 4ZDJA 2FDCA 3EPLA 4JSYA 2XOKD 2CL6X 1ZM7A 1N6PA 3CO5A 1DO2A 4AG6A 4QRHA 3X1WA 4NYJQ 3MWJA 1TTTA 2VP9A 1D8TA 3U60B 2RB4A 2JLZA 4Q7JB 4P31A 3A4NA 2FPMA 2WSSA 2ZPTX 4HAWA 2J59A 2AK2A 1CTQA 2QA5A 2IF0A 4C4PA 4IOLA 2WOJA 4B47A 4LYFA 2BOVA 5DYGA 1L7VC 3Q5DA 2ORVA 1OXTA 3TGPA 3ZS9A 3BFVA 3OEED 1NBMA 2VF8A 1IY2A 2ERXA 1EG7A 3UIEA 5DN6D 1R5BA 2VRWA 3WMFA 2CCGA 2V9PA 4FD2A 3K0AA 4ZCIA 4C9BA 3AP1A 1Q20A 2W6IA 2J7PA 4KLNA 4OQNA 4AK9A 5IRCD 1MO6A 1UF9A 4OI1A 3OIYA 3K1JA 2VPPA 4A8JA 1E99A 1A4RA 2HUPA 1SVOA 2QAGC 3I5XA 2R8RA 1ZNWA 2GEDA 2ZRGA 4F4CA 3KQLA 3DOEA 1IY0A 2PMDA 4KVGA 3RRYA 2G83A 2E1RA 2C77A 3HP1A 2AWNA 4XOIA 5G3YA 1Z83A 2ODEA 3LNCA 3GMTA 3Q72A 2A30A 1KMHB 4XD7D 4DB2A 1ONBA 4PAMA 3CF2A 1W0JA 4IXMA 3ZVLA 3BXZA 2IEZA 2V4ZA 3EASA 2ZS8A 4Q1BA 4JLAA 4JVNA 1UKEA 4KSCA 2PT5A 3UXMA 4EAQA 1G17A 1EX7A 3TLXA 2OCYC 1H8ED 4EIWA 1IN6A 1GP2A 1V5WA 2QZ4A 2F7SA 1II8A 1KGDA 1R10A 4IDPA 2RGAA 3WYGA 3AVTA 5AUPB 1KDOA 4OKSA 3KQKA 1KAGA 3ZVRA 2B7CA 1LS6A 1BKDR 4DLSA 4NBSA 4ZCMA 5K8IA 3FMOB 4IFBA 2CNWA 4QHSA 2FEOA 1ZM3A 4EFMA 1OB5A 1WE2A 4G01B 4CVNA 3FWYA 1E9FA 3PUWA 2QPOA 1RE0A 3RWOA 4DSNA 4Z1MD 4K8OA 4AI6A 3LO5A 4PPGA 2OFOA 5DGXA 5FPHA 4OYHA 4CEHA 4ESVA 1GL7A 3DO6A 3AVYA 3LA6A 1G64A 1RJ9B 3H2YA 1J70A 2ZI5A 2W58A 3W6PA 5J4HA 1FTNA 3TAUA 4I81A 2CDNA 3FKQA 2ZRKA 4LI0A 2AK3A 3THXB 2ZVQX 2BCJQ 4YDHB 2ZSFA 3LRPA 1RRCA 3O8CA 1KJWA 2ZJYA 3OIWA 3SJZA 1G6OA 2IX3A 4DB4A 1VYUA 2UZIR 1OW3B 4WIAA 1N6OA 2YKGA 2CLDX 1S1CA 2PZFA 1LV7A 1W4RA 1RVDA 1HTWA 1VCNA 4Q1AA 4US1R 1TQ6A 5AJXA 3ZD7A 1L4YA 2Z43A 1UM8A 3PENA 1G21E 4NKRA 5B57C 1HQYE 2O8EA 3QG1A 5TB5A 1Z29A 1ZP6A 1X6VA 4CIDA 1TUEA 4LJ9A 3QJYA 3AGQA 3RAPR 1U94A 1W0KD 3RNLA 4ACAA 1MOZA 3THWB 2O8BB 1PLJA 1Q1QA 2R44A 3MFYA 1L8QA 3KQHA 2OV2A 3EWAA 3FVQA 3PV0A 3VR5A 1YVDA 2WJJA 4QHTA 1XEFA 3M6AA 3UG7A 1F5NA 4AYXA 2FZLA 1KTVA 4UQOA 4UNSA 1US8B 1NMZA 3C16C 5FBQB 2PBRA 4FW9A 3ZIAA 4HI0E 1WP9A 3CNLA 4D26A 1E2QA 3RS5A 2RAPA 3BORA 3I92A 4FCTA 1W4BA 4W5WA 4M1TA 1DS6A 1D9XA 2ZETA 5DH9A 1GZSA 1R5NA 4PR0A 1P9NA 1ZNXA 3NEJA 1YZLA 2JLUA 2VIIA 1E32A 1A7JA 1I2DA 3WP0A 3W3AA 2QAGB 1XF9A 1VG8A 3UWKA 2IUUA 4Q9HA 1OXSC 3TSZA 2R6CA 5IT5A 1IM2A 4DLVA 3FMPB 5K8LA 1CJKC 3U61B 2WWHA 1G3RA 3AF1A 3L82B 2XB2A 3PITA 3SEAA 4Z51A 1TMKA 2F9MA 4RVCA 3LW8A 1E79D 1SXJE 1Z06A 5KNBA 3C5HA 3E5HA 3QXSA 5EE9A 5J4VA 4Q7LA 1S2MA 1GRRA 2QQ0A 3CRQA 2WSSD 1U81A 5IK2D 4MKFA 4PO9A 3UK6A 4C0JA 3C4JA 1V43A 3P27A 5A5GA 3WRXC 4Q4JA 3SJAA 1W36C 4LY6A 2CEAA 4K81B 2QNRA 4GI7A 4ABYA 1AS2A 4B6EA 3QI2A 1OFHA 1Z3IX 3FOZA 3GQBA 4RZ2A 3ZD6A 1Z0KA 3VKGA 3WHLA 4Q4AB 2W6JD 4HZUB 3EC1A 3KJGA 2VP0A 4HUTA 1PUJA 1KK1A 4HLUA 3ASZA 4Q18A 2Z5FA 2ZR9A 1E0KA 2NO1A 1E9EA 1ZUHA 1ZU4A 5HTKA 2V1XA 4IVRA 2QROA 5KPJA 2C5LA 1RRFA 2CXXA 2GHIA 1KY3A 1AN0A 4Q7MB 4OQMA 4XTRA 3NBXX 4L16A 5F9HA 2BC9A 3B13B 2IS1A 5L3VA 2FFQA 1UADA 3R7WB 2GNOA 4PHTA 4Q03A 2QM7A 2PZGA 3MSXA 3D31A 4PZLA 2AN9A 4HLCA 5B30A 3QF4A 4A2PA 5D3QA 3LLMA 1D2MA 2W2VA 1ZUNB 1KI4A 3O47A 2ZSEA 3VX3A 1KSJA 4FCWA 4KITB 2F1IA 2WMOB 5FUXA 1XJ0A 2HEIA 2F3RA 3V4FA 2BM1A 1WQ1R 2WM9B 1P3JA 4V03A 1R0WA 1T3HA 3CX7A 3E2IA 4TQ9A 5ANRB 4BLSA 3MRSA 4D4LA 1K5GA 2DY1A 1K8RA 5JLJA 5KSYA 4BZPA 5G3ZA 4F38A 2BMEA 4JJKA 1U8ZA 3JZMA 3BGWA 1RRGA 4JMPA 2GWHA 3EW9A 1X1SA 2JIZA 2N42A 1KDTA 1ZIOA 1AQYA 2WAYA 5EP1A 1VECA 4GMXA 3SOPA 4F4IA 3GLGB 3B1WA 3QKTA 1NLZA 3TNFA 2IS2A 5FOWA 1J7KA 1ANKA 2VSXA 1DEKA 3AKCA 4RZXA 2EWWA 1E2IA 1OH6A 3EA5A 2O0KA 5KNCA 4KFTA 2OLJA 4NYMR 2QORA 2XEXA 5EP3A 2QL6A 4B2PA 2QU8A 1OXVA 1XFAA 2F3TA 1WF3A 4MYCA 2NPFA 5KU1A 2GCPA 1RC8A 2IYVA 2QTFA 2KI5A 5FL3A 3R9IA 2Y8EA 3A37A 4HB0A 3VU9B 5HCIA 4QKQA 4FMDB 3QPWA 5DHFA 1X8JA 3QKRB 1NN0A 3BS4A 1W36B 4KCGA 2WSMA 4DLXA 2HYIC 3HWSA 2BJVA 1XXHA 4V0KA 3DZ8A 4HAUA 2GXUA 3AGPA 3CPJB 2WOOA 1GDDA 1QG2A 3K70D 3SI7A 1KK3A 1F2TB 2ZI7A 2ZJAA 3FKSA 1XZPA 4N1AA 5D3MB 3N5CA 5BQ5A 4MKGA 3CIOA 2YYZA 2WWGA 2C04A 3MWLA 1JB1A 4ZIRB 5JHHB 4S2EA 3Q7PA 2V3CC 4IRUB 4JT4A 4LJ7A 1MABA 2GETA 3LFUA 3RABA 2JLSA 2Q21A 4ZV4A 3GJ5A 1XEXB 1MKYA 4Q48A 4BFWA 1CRPA 5AK0A 1KJYA 1VCOA 4U02A 3PEYA 3MWKA 4P3YA 2FA9A 2FZ4A 2L0XA 4I1SA 3NWJA 4ACBA 3PUXA 3OZXA 4QGGA 4DIEA 5SZHB 4B74A 4URXR 1XEWX 3GFPA 3K9NA 3QXXA 4POAA 2AD5A 4MUBA 1ZNYA 1U0JA 1UEJA 3L0PA 3DM9B 4DKXA 3CRW1 4HAVA 5EXSA 4YQFA 1FNMA 2QE7A 4N3NA 3H0KA 3VTKA 2ZS9A 4L9WA 4ZI2A 3NH6A 4Z8YA 2JCSA 1EFRD 4A15A 1XCPA 2ATXA 4BLRA 1NMYA 2OZEA 2B8TA 1SKQA 3BH6A 4I1VA 1E6CA 4C0SA 4D2IA 1XRJA 2EFCB 1CR0A 4KVAA 1JEEA 1DAFA 3PVSA 2ZYUX 3FDIA 2VTKA 3MMPA 4IVQA 3BB4A 3EZ6A 2R6DA 5FTLA 4V02A 2G3YA 4Q4LA 4Q9IA 1YKSA 5BN5A 3CX8A 1H8HA 1IXRC 2IL1A 4HAYA 4NU0A 4F93B 3R8FA 3LWNA 2CHQA 5KOYA 4LHVA 1TF2A 1N0VC 2W2XA 4HZIA 4UKDA 3U7GA 1JECA 2XGJA 1OHHD 3LLUA 4QGFA 4WOPA 5AUOB 3A1UA 2GCOB 3K09A 3IIMA 3S1AB 4DBLC 1QF9A 1HYQA 1QHHA 1SXJD 1X3SA 2ZM5A 5DI9A 3U4QA 1PUIA 3WYAA 1M8PA 3CF0A 1XU4A 1RZ3A 2YJTD 4DDVA 4CT4B 1N5IA 4NYIR 1EK0A 4I1OA 2QBYB 4DT1B 5JS8A 2GF9A 3KXLA 2ZSBA 2AD1A 4A82A 4MGKR 4X8OA 2XOKA 3KKPA 4Q4HB 1OJLA 2JASA 2VH5R 2IWHA 2R9VA 4PHHA 4AYWA 4C0LA 3L2OB 4WW0A 4EJSC 3T1QA 4GBMA 3RS7A 5KSZA 1Z0IA 5AR1A 2CJWB 1RIFA 2O8DA 3BH7A 1IJFA 4OHVA 2ZS7A 2R65A 4Q66C 1UBFA 4GOKA 2Z4SA 4PPNA 2F43A 3LVQE 1P60A 4RY2A 1R7RA 3QPVA 3AVPA 5CYOA 1KYIA 1Q44A 1EWRA 2YNMA 3QVUA 5SZIA 3A8TA 3WY9A 3FE2A 1KI1A 4IJMA 2BBSA 3A4MA 2V6IA 3OEEA 2O5VA 3CZPA 1G16A 1NY6A 2EYQA 1SULA 1Z63A 2F6RA 3Q5EA 2PCLA 4IEIA 1TF5A 5DN6A 1HH4A 3CWZA 3OIUA 4EKDA 2EFDB 3DKPA 1TU3A 2FFAA 3B60A 1P75A 1YZKA 2OCPA 3NBZC 4HLQB 1AJEA 1GKUB 2ZJ2A 5DE3A 1TUIA 1UKVY 3DMDA 2GEUA 4NCIA 4N0DA 5E7IA 4AKHA 4XWOA 2BJWA 2NZJA 1U8YA 4II7A 1PLLA 1CIPA 3VQTA 1KI3A 1T8UA 3FGNA 2FSIA 4EUNA 2CMKA 4XD7A 1XWIA 4NH0A 1JAIA 2RHMA 3FMFA 4NCJA 1Z6XA 1VG0B 4DJTA 1E1QD 3AP3A 4Q1DA 4BFUA 3NH9A 2F1HA 1NL3A 1CR2A 2JEOA 3AVXA 4GMDA 2WJGA 1WRBA 5J4YA 4HB2A 4JBWA 5J4LA 3NDBB 3GLFB 1XBTA 1FP6A 3MJHA 4EQ6B 3QG5A 1P73A 2NTYC 3WYFA 4YMSA 1NIPA 5FBRB 4B2LA 1BH2A 1SHKA 1G5PA 2ZEJA 3BB3A 5JS7A 5HKKD 3TRFA 1GRNA 2OCAA 1DAKA 1G3UA 5EP2A 3NTUA 1JXOA 3I62A 4PO1A 4Z1MA 2ZE6A 1XD9A 2IYLD 4JLOA 1A1VA 2G0NA 4B73A 4KBFA 5CJ2A 2ZI6A 1UJ2A 1S3SA 1UKZA 4A1FA 3U3KA 4R2IA 3KTAB 4M9XA 4OJKA 4DLYA 2X2EA 2W0SA 5HE9A 3SHFA 3SN6A 4TWZA 1NKTA 4MYTA 4AD8A 8OHMA 3GLHB 4TT3D 4AWXA 2MSCB 2HYDA 1U9IC 5JSZA 2OCBA 4JT2A 4FMCF 4G5RA 1Z0JA 4TLEA 5FL7D 4QNMA 5H68A 3RRMA 5BWMA 1W48A 1E2EA 1GNPA 1T5LA 3L8ZA 4JVSB 3U44B 2JJ8A 1S9HA 3I8SA 3PUZA 1E3MA 1P2VA 1X8KA 3W6OA 4C0HA 2WWWA 1C4OA 2I3BA 4EJSB 3EPHA 1KI6A 2XXAA 5FFMA 1B23P 4LPKA 4YMTA 2G9NA 1OSNA 1NVWQ 4BECA 4K46A 3NC1C 4TQUS 5FPKA 1N6NA 1CJUC 2RGCA 1DG3A 2FGJA 3GJ4A 3LD9A 1W0KA 2BKEA 4OL0A 2D06A 2W2TA 2Z83A 2YV5A 1LNZA 3RANA 4JLVA 1C1YA 3X1DA 4V0OA 2IEYA 5L3RA 3A1VA 1KI2A 2NO7A 2HCBA 1EESA 1D6JA 1KSHA 3CLVA 2ZSAA 4PC2A 4BASA 2UKDA 4XIGS 2BMDA 4LBYA 4LYAA 1XD2B 4PC7A 1HEIA 1H8HD 3ADDA 1NSTA 2O8FB 2VHCA 2QT0A 3ASYA 3KFXA 1CJTC 3AUXA 4IDQA 1VPLA 4B48A 5BYKA 1SKYB 2D2EA 2BBWA 2J41A 4LDJA 4QFMA 4BFSA 3D3QA 2J0QA 4LJ5A 2QP3A 4EPYA 2B7BA 1GUAA 1FUUA 1YE8A 1II9A 1ZIPA 2G1KA 3EZ2A 3FPAA 2KWIA 4URZR 1GAJA 2VA8A 3AKEA 1MT0A 2RGNC 1WBDA 1W2GA 2YOHA 4FINA 4G3XA 1N5KA 1WB9A 1FZQA 1T91A 3SNHA 4XWKA 2I1QA 5CB8A 1GKIA 1AKYA 1RRPA 1NIJA 2C9YA 2OBNA 3B2EA 3E1SA 1ESNA 3GEEA 3VKWA 4DCTA 4RKEA 1TEVA 1BYUA 4LJ4A 4LJYA 1E79A 2PLFA 4DZZA 3ZVNA 1GVNB 2QG6A 1J90A 5DYIA 2DFTA 2ZXUA 2ZAMA 4WZBE 4PQFA 1P5ZB 3OFNA 1CKEA 1ZC4A 4MA4A 3QEOA 3B78A 5IK2A 5JHGB 4RCZA 1T0HB 1NJGA 3HYRA 4DUGD 2FEMA 3NHAA 3DM5A 4X8LA 3M0EA 1CJVC 4URYR 5KNDA 3AF0A 1ESMA 1G8FA 5AWFC 3V00A 4XVUA 1KO8A 1NSFA 2C96A 3OF5A 4C7OB 1BS1A 1WMSA 3EZ7A 4IVPA 1KHTA 2FFBA 3BC1A 4B3DA 1OLOA 3FYHA 4P33A 2ZAOA 3HJNA 4M21A 2W6JA 5E7MA 2EFEB 4DSOA 5GADl 2BHRA 1IJEA 4RJLA 3TSWA 3FMIA 3CRVA 1W47A 5EE3A 2NO0A 4HLDA 2VP6A 3NVAA 2O8CB 5L3QB 2IXEA 4PAQA 4EFLA 1DTSA 2PJRA 2GAAA 2W0MA 3VNVA 5DIFA 2DWOA 1ZM2A 2IS6A 4AYTA 4PFSA 3ECCA 1HT1E 4GFDA 1Y3AA 1J99A 3F0TA 2V8OA 3QXJA 3REFA 3K0FB 1GWNA 4HYYA 2J0UB 4TL7A 2BKUA 1M6NA 1QG4A 4PSVA 1E2KA 2NO6A 4C0KA 3IEVA 4GP7A 2CLCX 1N0UA 3CNNA 4MGIR 5E95A 3I5YA 2XTMA 3IPXA 2R6FA 4ARZB 3WMEA 1M7HA 1HT2E 2P6UA 1E9BA 3LQRA 4LX0A 1N6KA 1RW4A 4OQXA 3RS0A 1IQPA 4OJQA 3CRRA 3T1OA 221PA 2QAGA 3ND9A 4IW3B 4LV6A 2FWRA 1E9AA 3EC2A 1NMXA 3D7MA 1YRAA 4I99A 3UMFA 1UBCA 3PUYA 1YRBA 3NXSA 3AUYA 2ZRNA 3DMNA 4JLPA 3HU2A 2AWOA 3THYB 4ZDKA 2ZR7A 4QOSA 2V1UA 2IUTA 3TIFA 2CCKA 4CEIB 3ZDQA 2X19A 3BRWD 4QNRA 4OI4A 5JEEA 1EFUA 1NG9A 3RLFA 3IO3A 5DI3B 3QNUA 1VHLA 1BYIA 1KKLA 3CRMA 4L5BA 2WJVA 3H4MA 3P4XA 3OEHD 4W5HA 1D2NA 3QKSB 4OHZA 3NBYC 5KPDA 5FPYA 3LX8A 4GDFA 3AM1A 1E2GA 3H84A 1U99A 4Q21A 2V6JA 3WXMA
chains in the Genus database with same CATH superfamily
1AQUA 3K0KA 4ZEWA 3GPLA 1C3OA 1PNOA 4ZDIA 3KCNA 1R0XA 3Q85A 3WWEA 1VIMA 1XPOA 5TF4A 5LQCA 4FGSA 1JLLA 1L4HA 2JLAA 3EYWA 3NT2A 2HU7A 2VDWA 3PVZA 1W44A 5P8WA 2OV4A 3W6NA 4HUJA 3IV7A 4FJ0A 1TJPB 1E2JA 2FPRA 4PGFA 2Q5HA 3AFHA 5AVQA 1NVVQ 3ESAA 3QM1A 2NUTA 4Z3KA 3DVAA 1IN7A 1B0PA 4LGCA 2BGWA 4HMQA 2C61A 5KIAA 2QQGA 3V3KA 3NXKA 5FTMA 1GNLA 1MIHA 1QO7A 1ZRHA 3RVPA 1UZLA 1XTRA 2WA1A 5EWJB 2I6FA 2GCNA 4DLUA 3ZQKA 3ZU2A 1S4QA 4XFKA 4PZYA 3T15A 1TQ2A 1T9DA 3MUFA 2E4XA 3W4KA 4Y8VA 5CPBA 4D74A 3HC7A 3DHWC 5DNUA 4MIYA 4AJKA 3TUZC 2NVWA 4DDTA 2E4YA 2P0AA 2G82A 3IQHX 2OGTA 5EJ5A 4HNTA 3CBGA 1IL0A 4UAUA 3O8RA 4DV3B 3QPAA 1QCYA 2NTEA 3BICA 3H9GA 2BR5A 2IP2A 4AUMA 3R7SA 1B8PA 3ICQB 1ARZA 1K97A 5JI2E 4KLAA 4AP6A 2YQZA 4HAZA 4O4LB 3QVSA 1LPNA 3UJNA 4QVIA 2CT8A 4A8JB 3QEMB 2II6A 3TPFA 3N2ZB 2TYSB 1J0CA 1FMLA 4INOA 1HDXA 5EZYF 3QYFA 4EMTA 2F64A 2FRXA 3REGA 2QRUA 2ZLBA 1MJFA 4DCUA 1EUYA 1E2DA 1G5IA 4N47A 1OZFA 4J6FA 1M7BA 1QHYA 1IK6A 3B8EA 2B92A 4HOYA 3ZVMA 4QU8A 3AEYA 5G4LA 3BCSA 3DLAA 3LY5A 2GJ8A 1WDWB 4YJHB 1G21A 1RQGA 1RYYA 2XUZA 4O1MA 4FT2A 4HDKB 4F0JA 5INTA 5JISA 1YJXA 4M60A 4E07A 2NWQA 4ISCA 1B3BA 3HPRA 1PK7A 3O73A 3VR6A 2P4HX 3N2EA 1WEHA 3C6ZA 1NQ5A 3JPYA 4MGEA 1FTWA 2Z8YA 2O3RA 4LQ4A 5BSTA 4A4DA 2M6KA 3RTBA 1NOIA 1LS1A 4X95A 2WW8A 4Y2HA 1TFUA 4NZOA 4DQUA 4HDSA 3QVTA 3MBIA 1CZOA 1NVDA 2PX3A 1MRSA 3EXEB 3OFND 1OYOA 2IUYA 3U17A 1K7XB 4Y0VA 4UTPA 1SVUA 5I3ZA 1NLFA 3IA2A 3T3GA 4LJ8A 2G8NA 5A9RA 3WIEA 3EOZA 3NONA 4J1SA 2PWYA 3AR3A 4DC9A 1I7QB 2X4LA 3MS4A 5JASA 2A0WA 1RPAA 2PT7A 3OIDA 3AHFA 3QLEA 4JLNA 3T0FA 4AC9A 5LBUA 1UMCA 3VO2A 1JHOA 3SJCA 2J4CA 2J5KA 4AXBA 4B33A 1SCUB 1ZEMA 2R8OA 3NHKA 4L9RA 3W2EA 3ZCPA 4GS5A 4K6OA 2FPGA 2A67A 3LLVA 1FE8A 5I7WA 1E9CA 4EMBA 4NSNA 1ZDMA 5JY1A 2UUBB 3VKHA 3HXMA 1X77A 1SVIA 3LKBA 1ST3A 4J0GA 4W8GA 3NTVA 1M6VB 3ADOA 4NIMA 3H6KA 4NZPA 3UT6A 4D80A 3ILYA 4BDTA 3W9BA 2W2KA 4IMRA 4ZKEA 1A9YA 2EP5A 3EOBI 1SUDA 2GN1A 4IGKA 4KPUB 4EUKA 4TKVB 1CV2A 3TZKA 1KEUA 1NVEA 3TB6A 5HM6A 1U6JA 4TTQA 1RI5A 5KNLA 1XMXA 4PIPA 4ZAYA 3WIVA 1QK5A 3CEAA 4DSUA 4NONA 4E94A 3X44A 2VNKA 3LT5A 2G1JA 3Q2OA 3LBNA 1I3LA 2V0GA 3AI7A 3BTVA 3QP9A 4KGZA 2ZI3A 4U1RA 2JKVA 4GPAA 4MUIA 4OJNA 4TS1A 2YS6A 5JTUA 2BEUB 2DKNA 4MVJA 1TEHA 5AOAA 1XRQA 3DD5A 3E5NA 1JH8A 4PSKA 2ZVJA 1JR6A 4Q9AA 3GDGA 4RTQA 4BB0A 1QHNA 2ECFA 3HV2A 3TLMA 3WGZA 2ZIAA 4KNWA 1T13A 2A0UA 5E9QA 1QO9A 4DA9A 4XWGA 2AL7A 3VSAA 2AB0A 1WDLA 3PLNA 4F21A 2QLBA 1BXRB 2YVLA 3VAZA 1I1QB 4NE2A 1H4QA 4OMUA 1GKYA 4Q3BA 4JOSA 3Q12A 3RUAA 4BEBA 3HN7A 3HMKA 3RSCA 1Z7GA 2B99A 2REBA 4OHKA 5AW3A 4NDZA 4Q3DA 3T54A 3T5GA 4PYKA 4ENPA 5DBEX 1O5TA 3SF8A 5COAA 5FOUA 4P0QB 4EPXA 3EIXA 1JDZA 3L7IA 4RK1A 1LFDB 2GRJA 1KJ8A 4JCOA 1JLSA 2V7QD 4KAAA 3BYZA 4XWWA 1FRVA 3UAWA 3VR4H 1ZCBA 2NSJA 3EGWA 3KQOA 4JLJA 4I0WB 5DHRA 4DR6B 4LI3X 3IUNA 1X1CA 1U0LA 3WK6A 2OOSA 1O6CA 2ON6A 2D62A 4QXAA 4X1YA 3H5IA 3HQ4O 1Z6TA 3AM4A 3OF2A 3KL2A 3BFXA 2NNLD 3AQ4A 3FHJA 3R9KA 3PQDA 4G89A 4A23A 2GEVA 1D7AA 3FN4A 1XTBA 4A2QA 4C7JA 5J43A 5G1NA 2VHYA 4CEJA 2B83A 3LDAA 1CR4A 4IQ0A 5BSFA 3DAPA 1QF6A 3AUJB 3FI0A 3V9AA 1YB4A 4QPPA 2J3HA 3B85A 4YRDA 2FPPA 6YASA 3OAAD 5AUQA 1SCIA 4IOKA 5TPZA 4YN3A 4HH3C 1L7DA 4MW2A 4P7GA 3NUGA 3ZY6A 4DLRA 5CMLA 1HDZA 1NLUA 3R77A 1DWOA 1PYGA 1J0AA 4YAWA 5FNVF 1QANA 1JJAA 3C4QA 3HA7A 2REQA 4HS9A 4PG5A 5I9NA 3IDQA 2CN1A 4X64B 4CLEA 3NGMA 2I6SA 1K6JA 1J09A 3RC9A 4PFQA 3RAEC 1P6UA 1UOQA 4NAHA 4UTZA 1E6UA 1FPMA 2PGDA 3ABOB 3GCXA 3MPOA 4W1PA 3RYIB 4DL9A 1HYBA 1ZK2A 3LPLA 4JI2B 4H4DA 2IXGA 2VPQA 1Z36A 5TGZA 5JYDA 3GP8A 4JI8B 4C7KA 5IF3A 2OKCA 4JELA 4UUAA 4ATNA 1Y8QB 2YMMA 3DFKA 4MRNA 4UJ5A 5LLSA 1YDGA 3JU3A 4BN5A 1NOJA 5MF6A 1BMFD 1P6XA 4E70A 4U8HA 3WAKA 2EJTA 3ZQUA 4ZHQB 2GJSA 4O2AA 2VNHA 3RSLA 2XF8A 3K6JA 1BMDA 2BT4A 1A2OA 1XP8A 4GRAA 2JZOA 4NL4H 4OAPA 3ANNA 5E6UA 4AQ7A 4TYQA 4UBLA 4V1CA 1KVQA 2OHFA 4QGHA 3IMFA 2MU1A 3O38A 3RRXA 2VQ3A 1ZQ1A 2NVBA 3O8QB 5G0VA 4FX5A 1ODLA 3B9RA 4QYXA 1OYWA 2OCIA 3BH0A 3E15A 3HCRA 1RAIA 3QF4B 4QD3A 3ZWMA 5FX2A 3PUVA 3UK0A 1P1CA 4WKNA 3GGDA 4DCVA 2NU8A 3TH5A 5KYWB 2D1YA 3WB9A 1JDJA 5EQTA 2M9MA 2YHSA 3PC6A 2VDRB 4ZREA 3TZQA 1RABA 4B6GA 2R2AA 4P2GA 5ALZA 3T99A 4DJDC 1R0BA 1KSFX 3WWOA 3KIPA 5AMXA 5ETJA 3G0DA 1X7DA 3FVWA 3IXMA 2AT1A 3CCBA 5C51B 4UM8B 2R8ZA 3W8FA 2PGJA 1PKEA 2O3TA 1YMQA 3PYXA 2PH5A 4JGBA 3EZ9A 2JGIA 2LDBA 2G9QA 1R74A 4FQ5A 3KJIA 1SFRA 4XAQA 4C08A 4WHMA 5A06A 1CEXA 1MAWA 3N75A 1LPAB 1T1JA 2JGNA 2V7UA 4FYMA 1FP4A 4YP0A 2QZZA 3RSSA 4AM8A 5ADUS 2Z6AA 1XVVA 2PPVA 2HO4A 4QUJA 3S5UA 2JJ1D 4B3CA 5IZ4A 2EJUA 1GL9B 2IXBA 2O50A 4NV0A 4AJHA 2AN4A 3GVIA 4DPLA 5LXTB 4FWTA 3HUTA 1LLDA 3DONA 4BJ5A 1CJCA 3PX7A 3MD0A 5LD2B 5LA6B 5ALJA 3RTCA 4PIMA 3IBSA 2VP3A 4CKWB 1E98A 1MB4A 1LEHA 3DOIA 1S3FA 3KYJB 3P2IA 4L15A 2AYZA 2IIBA 3OPNA 3DVQX 1M7GA 2QD4A 4EX6A 2GZHA 4RKFA 5EP4A 3U1TA 1LVHA 2SKCA 3M1YA 3SU8A 2BN4A 3GNTA 1D2HA 1QO0D 4JSRA 1YIOA 3D0OA 2FZKA 5A03A 3R3UA 1Q7GA 1YQ9A 3WI7A 3E4DA 4MLCA 2VRBA 1M5RA 3FDZA 1WCIB 3ITKA 2ZUCA 1J06A 2IYZA 3FX2A 4F4DA 2AMLA 2PBFA 2ZYWX 1B8NA 3H5NA 4GSYA 4RABA 4GHWA 4I9NA 1HWYA 1AKUA 3NALA 3VPHA 3WHIA 4AUKA 7ABPA 3VV3A 1Q22A 3JYPA 4UEKA 4RVHA 1U0HC 2WY2D 1R3DA 3KVVA 3KS9A 3RBAA 2HQBA 1Y42X 1YQTA 1ZD4A 1HG0A 4PZUA 4RFSA 4UATA 4IOJA 2XYHA 5HCNA 2IGTA 1KERA 1XXHB 4F46A 4DUGA 5T4HA 1EZ1A 5GJBA 4HDQB 3IBGA 4WGGA 2A5DA 5C0OE 5IBQA 3M9XA 3X2FA 5ALTA 3H2SA 1A5BB 4P7KA 3WV4A 2Y0CA 5BNWA 2RMKA 5LC1A 5K6TA 4ZT4A 3F5MA 2W2QA 3QYAA 5CVCA 4TYMA 2EXXA 1YOVB 4X6XA 3ICCA 4B6PA 2I03A 2H2IA 5KREA 4Y0AA 3UT5B 3IP5A 3RAJA 3B70A 2X9QA 1JPJA 1D2GA 4BNLA 1V3UA 3ADBA 1RHMA 1V95A 2H0QA 2TS1A 3IQIX 2J9RA 1AKTA 1XJ5A 4MUJA 1SQFA 1G0NA 3A6ZA 1O9BA 2H57A 3A04A 3IEKA 1YZ3A 4M1OA 1USGA 5D00A 3SICE 3HY6A 1NN3A 4ZICA 2Y93A 4NLLA 5HDBB 1EJ0A 1FL9A 3C8UA 1OC2A 2QYHA 5HRCA 4EHKA 1RQLA 1WVGA 4HR7A 4ZVTA 2ZR0A 1AKWA 2OHOA 4MYUA 1YJCA 3VISA 4EYKA 5C32A 5EJ9A 1DC5A 1EP1B 2J87A 1TKBA 3L5KA 2FAXA 5J63A 1TYEB 1MMFB 1ZN9A 2ZPAA 3T5PA 3L0BA 2HXGA 2O4CA 1DCKA 2XMDA 1H2WA 5CVUA 3ZQ4A 1NUPA 5D5QA 1SQ6A 3X0DA 1YQXA 4E22A 1YB6A 3MTDA 5C7YA 5CD1A 4B4UA 1XD2A 2MIIA 1UK6A 3BSFA 4IJ5A 3HJRA 2WHRA 2V97A 3P4YA 5I7HA 1I14A 4FFOA 2ANCA 4X63A 4O8ZA 1HF3A 3DEYX 3KVYA 1Y9EA 4Q16A 3V33A 4BFXA 4XQ9A 5JV5A 2JLVA 1TECE 3U3XA 3R20A 1G38A 5LQUA 1B74A 1E2UA 2R4QA 5E8JA 2I67A 1PT6A 1CXZA 3MOGA 2Z9CA 4TTVA 1O7JA 1RS0A 2OO5C 2QLJA 3WS7A 1RXCA 3QXHA 3SX4A 1IN4A 1FUYB 1KAEA 2Y1WA 1KEEA 3PDUA 3TX6A 4WKBA 4ZN6A 2P2NA 2RC5A 2NUTB 2Y77A 4NCNA 5HYVA 4L5YA 1PJ4A 4PLPA 4L6IA 1XFDA 5JZMA 2OAP1 3I9LA 1FDIA 1JAHA 1HFJA 2JGAA 3H5LA 3EVNA 3DWEX 4M4SA 3ENKA 4P0TA 2R1TA 2AZTA 1L7NA 5CDGA 2VDPB 3D6HA 1VB5A 2RAUA 1QHHB 4Q9NA 3RFTA 1JTEA 5ELXA 3RUPA 4DYHA 3IURA 2P4SA 3U4QB 1FRZA 2X8WA 1ENPA 4BNFA 1A4UA 1Z4PX 1DDOA 5DSTA 2NU6B 5HS6A 3I23A 4OQZA 5DBOA 1S2NA 5SY4A 1VIYA 1DAGA 2QVZX 1JILA 1NP6A 3LGSA 1P0QA 2QRNA 1RWVA 1CLEA 2JS7A 5TC4A 1YCHA 2AFHE 2RB5A 3PI6A 3TNDA 5EHZA 3I4CA 3CPHA 3PLRA 4QSHA 3LVRE 2GRAA 2BI4A 2YIMA 2G5TA 2BGIA 3P2JA 4IZHA 3NKVA 2DBQA 5KQRA 2EKDA 2F90A 1X8XA 3U9SA 5K51A 2CMDA 2YY7A 1ZMBA 4NJOA 1YR8A 1XJCA 2AKAB 1WHTB 2W2OA 3FGOA 1OYVA 4FKZA 4PYRA 1T25A 3OLWA 3U1VA 1CQJA 1MD9A 1SUPA 1W5SA 3AEXA 5E9AA 4O4HF 2F43B 4CLHA 5AD1A 1G291 1Y5MA 2XMQA 3NWOA 1M83A 2ONJA 2H7CA 3HLYA 1QTRA 3DAFA 3MQ4A 4XQGA 1FQOA 4B6RA 2PIDA 3M89A 3ZU3A 2XF2A 5F7OA 2WC1A 2SKDA 3OTHA 4HB3A 3SR4A 5IXJA 4PHGA 2FUEA 1USUA 4TV8F 1PFQA 2OB2A 1ZSNA 3RJ9A 1QP4A 3DAOA 3DE6X 4CETA 4RVGA 4FKMA 2AZDA 3MOSA 4TKZA 2JH8A 4IS2A 4II2A 1FDSA 1OBVA 4BHTA 3AP2A 5L4NA 4REQA 3IVRA 2J0UA 4HYEA 4ERNA 4E12A 1EXNA 1LLUA 2XSZD 3B1ZA 4AJIA 2OHJA 1X9GA 5HPYB 3MMSA 5TPWA 2O9JA 1GTZA 1QIJA 3B6IA 3FCUB 2AFHA 3M34A 1XTQA 3CW9A 3NM5A 3TRJA 3I52A 1P2FA 3PKIA 4PO8A 4DBVO 5FI1B 1HQDA 5CCEA 1F3LA 3LT0A 5CVEA 3T9BA 1RWPA 3JD2A 1XQXA 2VXBA 3VNUA 4TV9B 2WHPB 3MB5A 4N03A 2OBBA 1PRYA 5JFGA 1N0WA 4KQ6A 2WLSA 1DAIA 3SQMA 1FNNA 2HXYA 2YRXA 3KKNA 1TCAA 1G3IA 3OOEA 2CYCA 4LYGA 4A0GA 2C98A 4YV2A 3Q0EA 4MUAA 4KACA 4LQCA 2VSFA 2RH4A 3PKZA 2PFKA 2W7TA 1Q1ZA 3G2PA 2BUBA 4GRDA 4ND1A 1J1UA 4YUYA 1RYDA 3ESBA 1EEHA 4R31A 4QBKA 1IZ8A 3BK2A 1ZOIA 3WJ1A 4LY9A 4UDOA 3VZCA 3PEEA 1VB3A 3ENQA 3QUTA 4L5IA 3RVSA 2R48A 2AX4A 3RJMA 1C3XA 1UZMA 1XA0A 5G1OA 4YX9A 3HH8A 1Z0AA 4AN0A 1G18A 3CF6R 4RFVA 4U7FA 3D5QA 3A1NA 2QGFA 4F7WA 3PDIA 4EB6A 3UJ6A 1FYVA 3JQFA 3VSCA 4AY3A 3G6WA 1KAMA 1VHJA 3GWGA 2R6JA 4KN5A 5DOVA 2WZCA 2OD7A 4ER3A 2RGNA 1KZ7B 2R1VA 3EN0A 1YS6A 3IOYA 3IO5A 2C9BA 2QT9A 3A6LA 3ISJA 1E5LA 4M9CA 4G1UC 4LSGA 5F21A 4LOAA 3L8YA 4US0R 2MSKA 2L42A 5T8KA 5LQKA 3HKDA 5IM5A 3FCOA 3MM4A 3OURA 4DNFA 5LDDC 1PGNA 3L7YA 5JDCC 3CUSA 1RACA 2KPOA 1CULC 2WVHA 1M74A 4OP2A 2YJ5A 1TM7E 1NSYA 1T6NA 1UZUA 3C3XA 4JT9A 4E1BA 4RTMA 3C7AA 4X91A 2XRFA 1CY7A 4Q7EA 4QM6A 1FQJA 1O9HA 2HBZA 4JLKA 2QPAA 1XTJA 2HT6A 3MJFA 1GRCA 2DWQA 1XB2A 3C2QA 2ZIEA 3EWNA 4BJ3A 2CUZA 2CWWA 3FPLA 2MWMA 4JFAA 2O8BA 3CT4A 3PD1A 3AERA 3IUSA 3WGUA 4YBZA 1WU7A 2OCXA 4F3YA 3KKMA 5ALGA 3KB2A 5JANA 1XDSA 1XD8A 4TXHA 1TL7C 3KEQA 4L8YA 1TGVA 2W2NA 4M0LA 3UUEA 4X85A 1F14A 1K0FA 1YVUA 2WJIA 3LPDA 2QW1A 3OIGA 3PWSA 3Q3HA 4UBMA 3VR4D 5C1IA 2XXAB 3CM0A 1WUYA 1DBWA 3IIJA 4E4TA 4YRJA 3TSCA 5CFQA 1UBSB 2B4RO 3UO8B 1L5KA 5IVKA 3E9ZA 2H31A 3EVEA 4FYVA 3RQSA 3B9QA 2R8BA 2Q0SA 3HXOA 2IEAA 4XFJA 1DO8A 1LPSA 1T2NA 2Z9DA 4FT4A 1W34A 2XAAA 4LHZA 4UMEA 5JLAA 5AYVA 3O26A 3V4OA 3PNVA 3NIWA 5KYGA 1JJFA 4EPVA 3EQ2A 4NI5A 2D7DA 3IPYA 5CLHA 1JSRA 2GPSA 1KEWA 1VGQA 5AHXA 1XAHA 4X54A 2F1JA 2Q2OA 3N0TA 1XU9A 3CJTA 4GMKA 2QXTA 4HB4A 4LX8A 1KPHA 2R3SA 4BTVA 4R8LA 3FSRA 2ZE7A 4BMVA 4B7AA 4EHBA 6LDHA 2PE5A 3F1KA 3URKA 1JU3A 1B6GA 2GCGA 3HBJA 2FQXA 3JARB 4CDNA 3CH6A 4WLVA 4D96A 3WFZA 4MUNA 5BN3A 3QU5A 1ZIYA 5DNAA 2VYFA 5J47A 5LOVA 2O48X 1BSVA 4BRWA 4NJMA 2P11A 3GUYA 2BHSA 4Q3KA 4IDFA 1TAGA 4LHXA 2V7QA 5IN4A 1RJDA 4JN6B 3EWIA 3T3MB 2GK4A 3F67A 4CKXA 4UHBA 4EG7A 4B3RB 4J1QA 3ZNPA 2NOAA 4RKYA 1AO0A 1RPNA 2A5LA 2D74A 2FZGA 2HMUA 2Y6UA 3KR1A 4NBLA 3THSA 5ERXA 2UYYA 4QARA 2D5CA 4U7GA 4F96A 1H1DA 3RR2A 4OY3A 4LOIA 4BV3A 3KPVA 5HQJA 3JD0A 4ZO9A 3TBHA 4MWGA 3BIOA 1IC6A 3H11B 4NYMQ 2OK7A 1S9DA 4ZOEA 2ZYHA 2ODBA 2FVYA 1VM6A 4KXMA 4RUKA 1BMTA 1K5DA 1V7ZA 2IC5A 3TAHA 2DZDA 2FJUA 3ZX4A 4BKPA 4EEXA 4Z6KA 1QFSA 2EJVA 4DSTA 4E5KA 3OEWA 4MWSA 5K1ZA 4CG2A 1DL5A 5DMHA 3RYFA 4HATA 2CHGA 1AQLA 4BLVA 4K03A 2XQVA 2BGMA 4TPKA 3D4OA 4R4JA 4QEDA 1ZVQA 3ID6C 2QSUA 3SFVA 3ZE9A 3K30A 4QQFA 2NZVG 2O1WA 1FU8A 4QXOA 1NRJB 2QNIA 2E7ZA 2ZAGA 4L7VA 3MT7A 1Z62A 2IY8A 1SOWA 1HE1C 3FHCB 5JROA 1Z4IA 2CCJA 3PHLA 3CH7A 1IHYA 1L6RA 3PWKA 4WOJA 4KRYA 4LHEA 1ZJ4A 3CH4B 4H7EA 4P2BA 4Q9JA 1GZVA 4AJPA 4YRAA 4ZT2A 4AU1A 1KJZA 1V11B 1ONNA 3ONWA 3AIKA 1NX6A 2VNSA 3K8OE 1EGMB 4UDYX 3B1YA 1LLFA 4JQYA 1BMFA 4E30A 1BDBA 4LPSA 3VHLB 3SEZA 5B3JA 1G3QA 1JIXA 3N74A 4ZYZA 2ADFA 1DSSG 1AHPA 2HL6A 4FONA 4JI3B 3W5HA 4EA7A 4ZI3A 3SE0A 4Z2AA 2CLLB 4CGZA 2JFVA 5A5EA 2I78A 4C0QC 4W5RA 4UNQA 3AEKA 3G7UA 1FXWA 1PVOA 1WCXA 5EZ6B 4BFTA 1NQAO 3U0VA 4EUFA 4R0VA 2WIAA 1XV5A 4L08A 5H9WA 1H3EA 4Q1CA 2JFBA 3SQNA 5F7ZA 5K8TA 1XK6A 5C80A 1P9WA 1H05A 4ZQBA 1YTLA 2ZWMA 3Q8WA 2JJMA 4DF3A 4HWGA 4GPBA 3V4LA 2JAUA 2NU7B 5T57A 5I9IA 4UVHA 3W04A 3QPUA 1O1YA 4JJIA 5J2TF 5G41A 3NAGA 4H4EA 3BM5A 2X6RA 4ZVOA 1KDRA 4CM4B 1JR2A 3WRWA 4MGYR 3ZCRA 2I8CA 5D86A 3TZCA 1S96A 2C3MA 3KFVA 2OC4A 2FTKE 2QMHA 1GFWA 2GZSA 3G82C 2F3SA 1NR1A 2B6NA 2ONKA 2EC5A 4MO9A 2EARA 1VI5A 3IV9A 4EKIA 1GUZA 2NXJA 3DBLA 3RFCA 3CG0A 4C88A 5ALMA 2JJ1A 4QT4A 1QIGA 2Z4RA 3RS3A 4D0SA 3ELUA 4OQQA 3U40A 1V6AA 1JHVA 1YR7A 2D5BA 2GHTA 2Q3MA 2VI5A 2YICA 3D54D 3K72B 4X92A 5KAPA 1X87A 4BKOA 3ZWBA 2ZUTA 4IIEA 1PKXA 3OA0A 4FOLA 4JU9A 3AV3A 3MN1A 1C3OB 3LQ4A 5HDQA 4A8HA 1KO5A 1E3SA 1K5PA 1ITZA 1OXKB 1TCCA 2IXTA 3QKRA 2G5CA 3LZCA 4RNDB 4MAAA 4OUDB 1V1JA 3HY4A 5IULC 3OUTA 4Q9DA 2XT9A 5JRDS 1L6IA 2O05A 4PNEA 3IP9A 1LQUA 5KHOC 2AW3A 3OSZA 4FS3A 1X1RA 2W98A 3DVAB 3BB1A 3VH2A 5KDOA 5KMGA 5KO2A 1T3SA 3ND8A 4YDQA 1Z12A 2OR3A 2RGGA 2NV2B 1MB2A 1E6LA 4W7IA 8ABPA 1DBVO 1F2TA 4IDEA 4OBWA 2VJBA 3A9VA 3WGKA 3GGCA 4FFVA 4HGZA 3BWCA 5CA1A 3UMJA 4JLWA 3SZOA 3R23A 1YVPA 2PQMA 2A5YB 3ILVA 4WY5A 5KJFA 2VCEA 1N3BA 3UCEA 1I4LD 2W2PA 1NJ5A 1P2TA 4MJXA 4PQRA 4QU0A 5BPHA 2AV6A 4BATA 3ZK9A 2QM8A 2YJNA 1R8SA 1QX4A 2AI2A 3CR3C 1TJYA 1ULAA 4AKEA 4MDEA 3CSDA 5KUTA 5CT6A 4U2FA 2JG3A 1Q6YA 1E96A 1RAGA 4LC9A 1WPRA 2PV0A 2XWJI 1RAHA 3HBAA 1NXPA 4R9RA 1SKBA 1E3TA 5DTQA 4AS2A 1PEDA 3QWAA 5J1SB 1XQ9A 1EWYA 3FFWA 4JSTA 4XVRA 4OOFA 2DTXA 4EFNA 2Y0DA 1AN9A 4NTZA 4UULA 5LUBA 5JJLA 1PSZA 2GGSA 4MR8A 5D85A 2ZRHA 4MYDA 4WXYB 4ESEA 2AFVA 3JCZA 4L8FA 1OASA 1G21B 5ICGA 2VC2B 4HK4A 5JWOA 1E0AA 2GBGA 2IE0A 1HNNA 1JVBA 4C05A 3U7RA 2OO7A 5A4JA 4WADA 3UAYA 4GLLA 1ZA1A 3UJDA 1ODKA 4QM7A 3A1SA 3KQTA 5COQA 3S28A 1BDHA 2NW6A 4K9LA 3IESA 1RI2A 2IRWA 2OFFA 2VZEA 2BI8A 1IIBA 4JS0A 3BA1A 5AKHA 2FCAA 2FN4A 2XZPA 1QK3A 1CVIA 2ID7A 1PQ4A 2JBAA 2QX7A 4HDSB 2H65A 2ZRCA 3G85A 2XXBA 1NURA 5I7EA 1IONA 3FNIA 2XKKA 2Y1LA 2JH3A 3G0IA 3PHCA 1VHDA 4MLPA 5LBIA 4AF6A 1QLHA 3JQQA 3FB1A 4M8NE 4X97A 4L2IB 3E7XA 5JVDF 2A6PA 1ODTC 1OZGA 1QPGA 1Z6AA 4ER5A 1YQUA 4CWAA 1Z35A 1V26A 1DAHA 1UMCB 5JOQA 3ZHCA 1N25A 1C3LA 2WU4A 3BD8A 4CF7A 3QBJA 4D8TA 4CV1A 4DRZA 3HDTA 2O0HA 5DNWA 2V0CA 1QPZA 4NU6A 4CKBA 3FTDA 2PQ6A 4YAEA 4C29A 2PLRA 2RGXA 2TMKA 4XLZA 2QBYA 2IIPA 1Q7RA 2B1JA 4CQMD 4WK2B 1P2UA 3U2QA 4CUZA 2MMGA 3H8VA 2VLBA 4WUTA 3N53A 3OEYA 4BP1A 1KXJA 1V1RB 1YK0A 3BL5A 3SJUA 2W2KB 4RVOA 1SVLA 3CTPA 5EHIA 4URWR 4K0KB 1KYVA 3HYLA 4YDRA 1CP2A 1UOPA 3ETNA 4Z4EA 3BKXA 3N2KB 4GICA 5AW2A 2CJWA 3GCWA 3I4LA 1FVXA 2WVJA 3FOBA 2IHYA 1ZI6A 2OGWA 1KMIY 2VQ6A 4MWTA 4E33A 1VLQA 1FYDA 3DE3X 4Y3UA 3DR5A 3OJ0A 3VZQA 4M0UA 3W5VA 3OP1A 1JKMA 1W9MA 1R3UA 2VZ0A 4BPBA 1ICEA 4KXLA 1KIFA 2SNIE 3G8DA 2WD7A 3GBVA 4I3FA 1M0WA 4NV1A 4XX0A 2WF8A 5JEDA 1SU6A 2K87A 1JE0A 2IITA 3H2IA 1ZD8A 3EDQA 1J0EA 1N2OA 1FFSA 3OZBA 1U2SA 3NBFA 4G0XA 5HJ2A 4UMVA 5LIPA 1V5EA 3CQ9A 3DWGA 4J3FA 1BU5A 3AY6A 4UCXA 5FI0B 5FJJA 1Z2PX 4ZCPA 3ZKWA 4TVSA 1F8XA 2IFTA 2GTIA 4XJXA 3OIFA 1P81A 2QMZA 2NGRA 5AXBA 3PSHA 4FDLA 3W2IA 1EHYA 1DE0A 2GN8A 4OLFA 3M4ZA 1E4EA 1BXZA 3C1OA 4BWFB 2MYPA 2XQGA 4I7EA 1CR1A 1Z8FA 3DE4X 4JU8A 1QGED 4NVRA 4XARA 3I83A 3VPXA 2P2DA 5C4MA 4RSGA 2GI4A 2O1SA 2QRMA 1WV0A 3CPSA 2XSZA 3HDQA 3L41A 5EIFA 3U7IA 1Q7TA 3E3OA 5E2IA 3UNXA 2WUGA 5GGXA 3GLHE 3U56A 3ZDQA 4EHFA 2Y1EA 4JA0A 3BMQB 4HH1A 1G66A 4OHYA 1O6FA 1EVKA 4UC0A 5BR1A 1DFHA 2AMVA 4IS3A 4X1YB 4OCZA 3U16A 3GT0A 3LLCA 4NEHB 1QLWA 4DAOA 3ZJVA 4ZVQA 4V0NA 1CF9A 3ZJ4A 3O0TA 4QU9A 4KFUA 2BFBB 2JJYA 1GTG1 3GLTA 2PX4A 4M38A 4GKAA 2JHCA 4O3FA 3WO1A 3N8NA 4GYJA 3OIVA 2BF4A 5BQOA 4CEJB 3I30X 3KBOA 3L1JA 1EFAA 3B48A 1P9RA 4G24A 5AJTA 2I71A 4UREA 4ZARA 5AJHA 2FPPB 5KJ6A 4GI3A 5TXGA 5CEFA 3KKOA 3OOJA 4UVDA 5BP7A 2XDYA 5KVQA 1IHDA 1ZD1A 1K98A 2B78A 1PNRA 2IDKA 3U09A 3NWEA 3DUWA 4GOXA 3HGMA 3UB3A 3V8MA 4BL5A 1Z2OX 2REQB 3E61A 4JLBA 3T5DA 4JEIA 4Q02A 3KE8A 3IXQA 3RSZA 1UP7A 2WI8A 4ZJUA 5C2JB 4QUKA 4R1SA 2JLWA 4PC3A 3GLHA 2FWPA 1DKOA 4LC1A 2Q5EA 4U0KA 5JCJD 4DARA 4MDFA 2H4ZA 1I9CA 3BJMA 1IZ0A 3UQYS 2PGXA 3ZLJA 2J0SA 2ZREA 4MGZR 3VX4A 1E7SA 3SIXA 3DKVA 2AC4A 3KCQA 1OD6A 2FR0A 5F7JA 4P9NA 3TFWA 4H6XA 5U1PA 4CG3A 3U44A 1IZ7A 1ORRA 3B38A 5KDDA 3U26A 2AXNA 2Q3EA 5FUBA 5LMNB 4I4TA 2BFFA 4D3YA 4TYWA 2AG5A 3TMKA 5FV7A 3AKYA 2UYGA 3KTOA 3LE8A 4O2AB 4EYSA 4JHLA 4JBYA 3ETGA 2G06A 5A71A 2PRJA 4JL6A 4KW7A 5E6UB 3MAAC 3ROTA 3KLMX 4V1CB 4ETWA 1A5SB 2EW8A 4Q3CA 4KH0A 3UMMA 2ESRA 3EK2A 1K6XA 2VT2A 2QDXA 4LXYA 3AEZA 2WTAA 5CRIA 3RU2A 1EWKA 4E14A 1H2YA 2QSZA 1N3YA 1G8YA 3I04M 4HQLA 4NBVA 1ODSA 1A1SA 1EVQA 4L0QA 4LY3A 1UWCA 3H1TA 1NT4A 2X5NA 1PR9A 2Y2VA 2B4TO 1PGOA 2EFJA 2JIZD 5JMTA 1W35A 5JSYA 2O8FA 3NHYA 4IFTA 4LF5B 3M6FA 4ZOLF 4EG1A 3EEQA 3OU2A 2I7CA 4F2HA 3KEGA 5E7JA 3TR0A 2H2FA 2CWDA 2GN4A 1V6CA 2XT6A 2RK3A 3LG2A 2H2GA 2IPXA 3O3NB 1MX5A 4L5JA 4IDDA 4MKZA 4NZYA 4HEA1 3CRNA 3UXEA 4FYYA 3IKLA 2C8JA 4F56A 1Z2NX 3FPFA 5EMMA 4PZAA 3G7NA 1QMGA 3T61A 1LDYA 1FP4B 5TVKA 1T8TA 3IKTA 2Z3VA 3IH5A 4RH0A 4WDRA 5CEJA 2EW1A 1AX9A 3W8RA 1I0ZA 1UAAA 2F55A 2BIFA 4D0NA 4YAUA 5TE9A 4GQIA 1LTKA 4INAA 1DLIA 1H6CA 2ATCA 4MV3A 4U2DA 3H5RA 3KXKA 1VLHA 2WG1A 4YJ2A 3G7SA 4TQAA 3HB4X 5LB4A 3TIXB 1F5SA 2BI7A 5F3DA 1VBKA 1ZI9A 3H13A 3R6DA 1U2DC 2YOGA 4FGZA 2AZ4A 5FOTA 3JRWA 4WFIA 3TO5A 2QF7A 2FF5A 1U7PA 3L7DA 2JFOA 1ZAYA 2UZ1A 3MMNA 4JHXA 4AF8A 4YUXA 1Z4MA 1A2BA 3FDZB 1K7CA 5CYPA 1QNFA 1NC3A 4C4TA 4YCDA 3NC4A 2NZWA 3W5UA 4AIRA 1U02A 5IUJC 3HU1A 1Y4UA 3KUCA 4F3KA 3GEIA 2UXDB 3EGEA 4HEA6 4KAXA 3AU8A 2IW1A 1TTHA 3H9JA 3F96A 3NCHA 1FTSA 1WY5A 2HU5A 3B1JA 3FKSD 5M3BA 3EHDA 1TO1E 2FNAA 1Z47A 2ODNA 3PE6A 5F52A 1R6TA 2IDZA 2WU0A 4H17A 1CUGA 4RFSB 1ZXBA 2W6PA 1KC1A 3P9QA 4ERXA 4DMLA 3GUHA 1DKRA 1H1LA 1N57A 2D0IA 2WTNA 1XZCA 1YASA 2V9ZA 1VMAA 3PXUA 2CJYA 5DCUA 4LFBB 4LGVA 2VJOA 2ZUDA 1L4UA 3A1CA 3UWSA 4MVWA 5JWHA 1JG7A 2O8CA 2A5GA 1XMJA 4ESOA 4NQRA 3S8YA 2HMWA 4NMMA 1DJLA 2AG1A 1DJQA 3A4VA 4HEJA 1W6RA 2W43A 3KZNA 4QVGA 3GFBA 4L07A 1ZJWA 1W85A 1Q17A 1QFJA 3DQZA 1LRLA 3GGPA 3GUVA 1C1HA 1AB5A 1P4SA 2FR1A 4R7GA 5HZGA 1MAHA 3FMVA 3K94A 4R69A 3TECE 4RXTA 1BEUB 2LIVA 3IP3A 4OHPA 2ZIFA 3U4IA 5D5PA 3EZXA 4JJZA 5D5HA 1QIDA 2F9LA 4F6CA 1VA5A 2CDRA 4BVEA 4Q1EA 1BH6A 1QIHA 2GX6A 1DC3A 2WSYB 3EQ9A 3JVDA 3OMWA 5ER6A 2Q7OE 3WKCA 4R2HA 2FG5A 1Y8AA 3CX6A 2Q6TA 2XMRA 5DDIP 3WLQA 2JGMA 3WNBA 1X3LA 2ZWOA 1Z9BA 4ARZA 3NHZA 3E27A 3AVWA 1K89A 2Q5QA 3Q3IA 1PVVA 1CJBA 1XCGB 1A77A 2Y99A 3P32A 4M1WA 4X7PA 3JQBA 5C8XA 4Y9TA 3EXIA 1H4VB 1EDBA 3AC0A 4I5IA 3SOZA 2WUDA 3U0BA 2IT1A 2D4HA 3BHJA 4BVKA 4GM1A 3TQOA 5AW8A 3MTBA 4Z3DA 3K9HA 3NS7A 5SY6A 4TYYA 1KEZA 3ISTA 2REOA 3R75A 2ZANA 5T67A 4IHAA 2CL0X 2FEWB 4MCIA 2CYAA 4QQ8A 5AM3A 1E63A 2FWBA 1C7ZA 3HVUA 1TZCA 1YR6A 2V96A 2GNAA 1CQZA 3AH8A 4RW0A 2CLSA 3HJTA 1ADBA 2CLMB 3I05A 4MXDA 4W8OA 2GVZC 4LCJA 5CYFA