1B8NA

Purine nucleoside phosphorylase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
278
structure length
278
Chain Sequence
b'QNGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESQGKANHEEVLEAGKQAAQKLEQFVSLLM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
publication title Atomic dissection of the hydrogen bond network for transition-state analogue binding to purine nucleoside phosphorylase
pubmed doi rcsb
molecule tags Transferase
total genus 91
structure length 278
sequence length 278
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 1999-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1b8nA00
1OV6A 3PNPA 3KUKA 4M7WA 3NM4A 4QFBA 3KVRA 1OUMA 1PWYE 5CCDA 3NM6B 2XRFA 4BN0A 1JDVA 3UT6A 3MB8A 1PKEA 1RR6A 1XE3A 3OOHA 4WKBA 4GLJA 4TS9A 1K27A 2AC7A 1C3XA 1PR1A 3DP9A 1K9SA 4M3NA 2I8AA 1Y1RA 1Z33A 1PW7A 1TD1A 4K6OA 1T8RA 3DDOA 3UAYA 4D8YA 3FAZA 4QEZA 4BMZA 2P4SA 4OJTA 3C74A 1A9OA 4DA0A 1VFNA 4E1VA 1CB0A 4D8XA 3BJEA 1JE0A 3K8QA 1Z39A 3OF3A 3DF9A 5F77A 1VHJA 5IU6A 1JDUA 1U1CA 1Y6QA 2ISCA 4WKCA 1YR3A 1RXSA 4L5CA 1VHWA 4F3CA 4OF4A 4QASA 4X24A 5F7ZA 1A9RA 1PR2A 2HSWA 4WKNA 4L5YA 3SCZA 2OC4A 5B7NA 1B8OA 4TXHA 2HN9A 1WTAA 2A0XA 1ULBA 2A0WA 1Z5NA 5B7PA 4G8JA 2QTGA 5K1ZA 2HRDA 1PK7A 1YRYE 4WKOA 3BSFA 3OOEA 3E9ZA 4NY1A 1ZL2A 1T8SA 1SJ9A 1K3FA 4BMYA 1Y6RA 1FXUA 2AI3A 4EB8A 4M1EA 1Y1TA 4GLFA 2A8YA 4DABA 1A9QA 1YQUA 4TYMA 2RJ3A 1T8YA 4PR3A 3K8OE 3E0QA 2Q7OE 3OPVA 1OTXA 3P0FA 4LNAA 3OZDA 3EUFA 3FB1A 1ODKA 3FWPA 4LNHA 3LGSA 3ENZA 2PGAA 4TTAA 5CXSA 1V41E 5F7OA 1JP7A 5IFKA 1RXUA 1Y1QA 4TXLA 5CYGA 1JPVA 3EEIA 1QE5A 2ON6A 1G2OA 5CYFA 5F7JA 2BSXA 1OTYA 5JPCA 1JDTA 4YJKA 4U2KA 3ONVA 4G89A 1Z36A 3FOWA 3T94A 1RYZA 3QPBA 3LA8A 1RXYA 1LX7A 1Z37A 1U1GA 5DK6A 1V48A 2B94A 4RJ2A 1RCTE 1A9PA 4MCIA 1TCUA 3U40A 4ECEA 4DA7A 2I4TA 3UAXA 5B7GA 5C80A 4TXMA 1JYSA 5ETJA 5EFOA 1A9SA 3DJFA 1U1DA 4YNBA 1ULAA 4BMXA 4F2PA 1YBFA 4OGLA 3OZEA 3MMSA 2IQ5A 1OU4A 3ODGA 4F2WA 1TGVA 1PK9A 4F1WA 4LZWA 4LKRA 4DANA 1ODLA 4NS1A 3UAVA 3O6VA 3GB9A 4JP5A 4UC0A 2OC9A 3BL6A 1Z38A 1RSZA 1U1EA 4R2XA 1NW4A 1ODIA 3PHBE 1RT9A 1Z35A 4D9HA 1PR5A 3EUEA 1V4NA 1Z34A 4NSNA 5F76A 1V2HE 3TL6A 1TCVA 4H1TA 4L5AA 2H8GA 1SD2A 4I2VA 5EPUA 2OECA 5EUBA 1NC1A 4QATA 3INYA 1Q1GA 1JDZA 1V45E 1OVGA 1PR0A 1A69A 1PR6A 4D8VA 1PR4A 4QARA 1V3QE 4TTIA 3EMVA 4EARA 1PBNA 1NC3A 2QDKA 1M73E 1RFGE 1ZOSA 1B8NA 1LV8A 4LDNA 3DPSA 5KB3A 3F8WA 1ODJA 3UAWA 2A0YA 2GUWA 3UAZA 4F3KA 1CG6A 3KHSA 3OZCA 2OXFA 4GMHA 3NM5A 3IOMA 4OGKA 3E9RA 4WKPA 4DAEA 4TXJA 2QPLA 1JDSA 5CCEA 3KVVA 4TS3A 1SQ6A 1TGYA 1ECPA 3P0EA 4R2WA 4R31A 3D1VA 4GKAA 4DA6A 1LVUA 4DA8A 4JWTA 4OEHA 5FAKA 3NBQA 2AI1A 3OZBA 3PHCA 4YO8A 4IP0A 4MCHA 1Z5PA 1PF7E 1SD1A 1T0UA 2AI2A 3FUCA 1Y1SA 4P54A 1T8WA 3OCCA 3KVYA 5F78A 3LBAA 1RXCA 1VMKA 1Z5OA 4FFSA 4JOSA 1N3IA 4PNPA 5CXQA 4DAOA 1JE1A 5B7QA 1U1FA 4L6IA 1I80A 3BGSA 1A9TA 3IEXA 3GGSA 2QSUA 2QTTA 3KU4A 4G41A 4TXNA 5F7XA 4MARA 4OY3A 4TTJA 4L0MA 3PNSA 1YQQA 5I3CA 5F73A 3O4VA 2HWUA 4KN5A 4YMLA 3FNQA 4QAQA 4DARA 4D98A
chains in the Genus database with same CATH superfamily
1RIIA 3VR1A 1ZW1A 3QA3E 2WPDD 4JXKA 3DZCA 2AFVA 2GKSA 2FQQA 2IEIA 3R40A 4PPNA 5EIFA 4YAJA 4ND6A 2EFCB 1PWYE 2R751 3HWSA 3EDCA 1ZCBA 5JNVA 1N8KA 2ZYGA 4BN0A 2XB9A 4PEVA 2QZ9A 3UT6A 1GKLA 2CXPA 3AHCA 1KI9A 4OA8A 1YB2A 5CTJA 4WZBE 3X43A 1K06A 3RFFA 4IGEA 4D5GA 5K3FB 3EDMA 2W4QA 4FDUA 4WLVA 5HCNA 1QYWA 2FK7A 1IHUA 3GEBA 2JASA 2V7QA 1UC4B 3QM1A 3QXGA 1I7NA 1ZA1A 1N7HA 3DAFA 3HUTA 4U39A 1E64A 4K6OA 1JF8A 4X1KA 4YPVA 1ORIA 3ISVA 4CQNA 4DEXA 2P91A 1T1RA 5CW2A 2YJZA 1G4UR 5E7JA 1GUYA 2GXUA 4TV9B 3WNVA 3IA2A 3S4YA 2VK1A 4FDVA 2UYOA 3GLGB 3MWEA 2JGNA 1CY1A 5ALTA 1Y7IA 3E23A 3Q41A 4EO7A 4PYNA 1JE0A 3UTDA 2IXGA 2GXQA 3RU2A 2AG5A 5E4JA 2JBAB 2J7PD 3GPLA 1ZUNA 3OP4A 2VNJA 4CUZA 3D5EA 1JZQA 4PTLA 2II6A 1DAOA 3B3AA 2G9ZA 4UBOA 2O4CA 1AUPA 5EI5A 4AP6A 3OCJA 1EXMA 4ZARA 3EEYA 1YB5A 4J1QA 3UT0A 1K5GA 3GH3A 2D8MA 1RZRA 4H1UA 3R23A 4OF4A 3TR0A 3GG2A 4MVJI 5LP6C 3SIRA 4BFLA 4DW8A 3E7DA 2D3TA 5C8VA 3K9CA 4Q9AA 3T61A 5TVGA 2I80A 1CZHA 1DO0A 3R09A 1GGNA 1CRPA 1KSJA 2F48A 2Q1UA 2CXOA 3GVIA 3RPEA 4R3NA 4UNRA 1GIAA 2B25A 1SHUX 2QI9F 3OHMA 1IUOA 3DUWA 1WDTA 1KMNA 4N82A 1RJDA 3DM9B 3L0BA 3NTQA 2OLEA 1CJVC 4TXHA 5JADA 1ENOA 1VCHA 3PPVA 2QMEA 2X8JB 5GM1A 1XN1A 1TJNA 1U80A 3CH7A 3C3JA 1CUWA 2V5VA 1V4VA 2YWBA 3KWFA 3GVPA 3H1TA 1IDOA 4MS4A 5IMSA 4AY6A 2WIKA 5FADA 3GNSA 3ZV6A 2YVUA 3OEYA 3ULKA 4TLMB 5BN3A 4EH1A 5JFTA 4G8JA 2ZWMA 4JCCA 5E2IA 5ABPA 5LD2B 3WL5A 5JYBA 1XP5A 5JTUA 3ZKWB 4F4DA 1H1DA 1ESMA 1L7DA 3DWIA 1GNRA 1XXHE 3IEIA 5COBA 1POXA 4M49A 4BP9A 5AJXA 3O82A 3K92A 2DXIA 1DAHA 4MI3A 1Z7GA 3UW3A 3IUYA 2YWEA 1Y37A 3LFTA 5AHKA 1QYRA 4TVKA 3E1GA 1NUQA 5T6BA 1M0TA 1FSGA 3S1AB 1QK5A 3TS1A 2P67A 3IFSA 3LF1A 2YJ4A 4EB8A 3ONFA 3L06A 1II8B 5DF1A 4NWIA 1Y1TA 4FSXA 1VKNA 4NOJA 5KYUA 5FUMA 1ZM4A 3R5XA 1JHMA 3AJDA 3GUVA 2C3OA 1MUUA 2R6R1 3QMWA 2OR3A 2XWJI 1EM8B 4LZPA 4JQZA 3JD4A 3V1UA 1LTHR 4RW0A 1GYPA 1XZ8A 1YQUA 3QVLA 4LXUA 4OHWA 2F67A 4H1HA 4MQ4A 1I14A 4NV1A 4YCMA 4BQSA 4DM3A 4HGQA 4RENA 5DK4A 3ORQA 1XVTA 4CMHA 1FRVA 3JWPA 1FVXA 4X7BA 4HWOA 4YROA 1M5UA 3ROQA 2Z04A 1NGSA 2ZYIA 4OLJA 2I29A 1IB6A 2WAXA 2AC2A 3A06A 4H7FA 3M7IA 4URWR 3A1WA 2ODPA 3OZVA 4TMFA 5KO2A 4QGGA 4DV7B 2FRDA 1K5DA 4QSMA 5IN4A 4O2BB 3WOVA 2LP4Y 1QQAA 2HT1A 2IPLA 1LPAB 2OKCA 2P78A 3RI3A 4LRXA 3JAWA 1FP1D 3H3XA 5EKDA 2XBUA 3VPFA 1CUZA 1RXUA 4GXNA 3DHVA 4QXQA 1GSIA 1TVCA 4OVKA 1ISIA 3UMMA 4MWGA 4WZAA 1E20A 3M4XA 2VYFA 1RHQA 4R7ZA 5JY6A 1F51E 1W76A 2O3RA 2QMYA 4MJ7A 4TM7A 5JH7A 4JAVC 1OHHA 2Q3CA 3P52A 3OZRA 1HQDA 2J0QA 1KWKA 3WMEA 4REMA 3EEIA 2BR5A 3GGOA 1S9HA 4EBFA 1Q0UA 2IPMA 1W6UA 4KN9S 3TEFA 3H4IA 5AO9A 3IB6A 5AVKA 1VPLA 1UDWA 1T0JB 3C1OA 3W9SA 1ZRMA 3E35A 4AAYA 1Z2EA 5IUJC 2FN3A 3A1NA 3K4HA 1NJSA 4JBIA 1QM5A 2DMRA 2CLIB 4LJ4A 4BNXA 2EYQA 4CCWA 1B3BA 1IEWA 5G4KA 3D7RA 4FFOA 121PA 4GHWA 3UY4A 5G1PA 5FO0A 1XMOB 4LJYA 3INRA 2RHGB 5C4GB 2X0DA 5E1BA 3A3OA 2NVWA 5KSPA 4C4ZA 4PLFA 1EJ0A 1T4DA 1KEPA 3IUQA 4HZGA 4K9SA 1B2LA 3EVTA 3QX9A 4HQFA 5K8IA 1E3MA 4ZWNA 1PJCA 4HN4B 1R6UA 3DLCA 1HYBA 3GC6A 1LNSA 3QK7A 3SMQA 3W8NA 5FH9A 2QZPA 1YE8A 4RETA 1ZK2A 4KQKA 3VDNB 4M8SA 1BNCA 1QTQA 2FJUA 3KELA 5TDHA 2PUFA 1V48A 2XDAA 1E3EA 1NQUA 1ISRA 4O5OA 1VHLA 1U04A 1CUBA 4WCDA 3MGGA 3SX2A 3N39C 3H17A 3PL1A 4P38A 4X8MA 4EPYA 1Z63A 5EE0A 5I7SA 2EWMA 2YCBA 3U4MA 1WB6A 4M7PA 1NRJB 1KTIA 3U2QA 3B1YA 1P5RA 3QJYA 2LRHA 5K8CA 2J5KA 5CT4A 5H70A 1KYZA 1FE8A 5JJKA 3LW7A 4OHRA 1E1RD 4B45A 4LJRA 4YA6A 1NFQA 4IV0A 1FRQA 1DKQA 1QH9A 3ZTWA 4CLOA 3AEZA 1IZZA 4N18A 4F3TA 3TJRA 4KPUA 2PAAA 2YS7A 1VGVA 3AZOA 3GFBA 3HZZA 4K0KB 3ZX5A 2P90A 4TN1A 3GT4A 3ZGOA 2OM6A 2RKOA 3V2HA 5EJ8A 3OWXA 4I50B 4NULA 1BWSA 3AY6A 4PIPA 4ZCPA 2W2LA 3I09A 5DJ5A 3OKCA 5TMDA 8AT1A 4LFAB 1XZAA 1R5NA 3A2KA 2PG3A 4OO3A 1H1LB 1VIVA 2TYSB 2G06A 1H5QA 3T5AA 3FSRA 4QWWA 4TLBA 5IKMA 2WWXA 3GVHA 4LXGA 2PMFA 2JCGA 4EGAA 2WAAA 1H3NA 2XCTB 2AR9A 3MLEA 1YB7A 3OFJA 3ZBPA 5EFZA 2R1UA 3GI1A 5AW5A 1T91A 4H0NA 4LQCA 4UUMA 4IOJA 3GPDG 1SXPA 3C41J 1QZUA 3VKFA 4F11A 5CVEA 1PDVA 3CGWA 3R7AA 2J3JA 4A0RA 2UVPA 1UEIA 2IJGX 4JI8B 3DV0B 1V47A 3DCNA 3CLUC 1RCFA 3B2EA 1GTZA 4UC0A 4X97A 2NV2B 2HB6A 5C5DA 4EVSA 1GHTA 4Q9JA 4EDFA 4Z7NB 1XVVA 2IYRA 1EFKA 3GFQA 1MDFA 3KEFA 4FHZA 4NOKA 2NPFA 2PRKA 3IT1A 4Q47A 2HOQA 4Z4HA 1O7JA 1EVEA 2NZ2A 4NH0A 5AKKA 2ID8A 3L4BA 1Z6TA 1B6RA 2F3SA 1QHIA 1XR3A 2BI7A 4LQ4A 2E0IA 3STUA 3LKVA 4NBKA 1SQ0A 1CETA 2GYVA 3EGEA 5GY7A 4D4LA 4DEVA 1ZONA 1JIIA 3AUKA 3KQSA 2GR9A 3A6FA 4IJKA 3T3EA 4HLCA 2J3EA 1N6NA 4TS4A 1H93A 1PR5A 1T3SA 1T34A 2ZYHA 2D5IA 3ADKA 3AVPA 2DFDA 1UK8A 2X9LA 3I2YX 1II0A 3NBYC 4E32A 4XRGA 2OWEA 2Z1DA 3K96A 5JNUA 1GPKA 2AK3A 2ZI3A 1ZN8A 1RPJA 1TCVA 3N07A 5E0KB 3BE5A 4BIIA 4IIJF 5IJAA 4M38A 1Y6JA 4D02A 3W5IA 4I2NA 2EBUA 2HHLA 1IQUA 2GZ3A 5ECGC 1EWKA 3NBXX 3RTBA 4WBNF 3RIYA 1TO1E 1UBLS 3W5SA 3VO9A 4L72A 4BO3A 2ORED 1F38A 4FGJA 2PXCA 4U2FA 3NOOA 4F5ZA 1E4EA 5AKZA 5K6AA 1U63A 2W37A 1BE0A 5HZGA 1RZVA 1B14A 2CC2A 1NF9A 1XTUA 4P80A 3R7BA 2D4HA 3PG5A 3PQ3A 3GLHB 5P21A 6ABPA 4Y9RA 3F71A 4FHEA 5D87A 4A0SA 4R9VA 4ND1A 1K8RA 3TW0A 1H94A 4JT9A 4GLBA 1PR4A 3DVSX 4GI1A 3K71B 2IITA 3PCRB 1SUSA 3MMZA 3WYCA 2IZOA 3COSA 1X7WA 1PNQA 4ZU6X 4QEDA 4XGRA 1T5IA 3RU9A 4C22A 1F7UA 4ZHQB 1OBCA 2CJWB 1FP4A 2QY9A 1M7GA 1UBKS 4ID9A 1Z0JA 2EG5A 1NU8A 4RMHA 1XCBA 1Z0UA 2H4XA 3OU7A 2OAP1 2FEAA 2V7UA 3C6BA 4YCLA 1JLSA 2H63A 2XA9A 4MWOA 2CL5A 1ZOSA 3QGMA 5H7XA 3BQ9A 5KSOA 1CR6A 2PVSA 2P5UA 3HUFA 4QUHA 1ZU4A 5M34A 4D9GA 3H4VA 5IEJA 3E8XA 621PA 3GELA 3DFKA 1JZSA 1TECE 2D1SA 4MIEA 4RFSB 4UU7A 4WXYB 4B2IA 4EUNA 5LU8A 4OATA 3EA4A 4BLTA 4QECA 3CNQS 2IP4A 2VKQA 1UP6A 2J31A 1W4RA 1RHRA 2ZTLA 2Y9MB 3TIXB 3H18A 2CMKA 1QDEA 1CG6A 2FPGA 3EXEA 5F9FA 4TYPA 1TKAA 4J9VA 4A2PA 1ACLA 2QMOA 2KHZA 2QP4A 2XKBA 1KAQA 2OCAA 2FEMA 3CSDA 4FMBB 4GM1A 1UMDB 2DBQA 4RQBA 4BVJA 1ZVQA 5KC8A 3PT5A 2WBLC 2WYOA 4NZNA 1PWHA 2XXAA 4Q4CA 3IEKA 4EJSA 4HY3A 3OMLA 1NG9A 3T5TA 1SCNE 2PUBA 2INGX 1MC5A 3OT1A 4K9QA 4DVJA 1TX4B 3ETHA 3U0BA 1KDTA 3H9GA 3VTAA 5IMBA 2QTNA 4KK3A 5TPZA 2VJNA 3KVVA 3W78A 4RH3A 4OIFA 3WZ2A 2ECKA 1NJ2A 2R25B 3GJ5A 5DNDA 4FBMA 1NU6A 1MB9A 1SCKA 1P2VA 1RIFA 1NW9B 1XZLA 4FEGA 1HR0B 2O59A 2ONKA 4OK5A 2HQSA 3PUXA 4S0ZA 2RKWA 1KP9A 2ZVDA 4A4DA 1KI4A 2VNAA 3P0RA 1ZD5A 1JJAA 5IUKC 4AY2A 5CDYA 2BE7A 1NW3A 4WCFA 5ICGA 2C8KA 3GZNB 3ICVA 2XMBA 3OIUA 2WHRA 3EWNA 3FWZA 1B0PA 4DA8A 2Y1DA 3R8CA 1ZLYA 5AOAA 3NBQA 2AUMA 1VLVA 2IP1A 3UXYA 2AI1A 3U3MA 1HNWB 4B46A 3N0XA 4DSZA 1PV4A 1YR9A 5DFAA 4IFIA 3IMKA 3BBLA 1ZWLA 3P2YA 4Y2XA 1JHOA 4AICA 1CUGA 4CE6A 4Y3UA 1WKCA 1NUUA 4J76A 2QYSA 3BX1A 3E3OA 4KYIB 4WI1A 5DTEA 3LYLA 2YASA 4AJ9A 4ETWA 1WZ2A 1VDMA 4IX1A 2CL7X 5FEMA 4PZDA 5J47A 5LYJF 5A9RA 2PL1A 1C7IA 3B8EA 4RHTA 1I01A 1Y9AA 2RGXA 1SPBS 4H6VA 4HUJA 4XPIB 3ZDBA 4BLRA 3NHWA 2C78A 3DVRX 1BE6A 2GDZA 2I7CA 2WD7A 2WVGA 1O8CA 3EIOA 3CZQA 3B2NA 4U1RA 5MFPA 1V43A 1HT1E 2V0NA 4KVFA 2R60A 2BFPA 3PEFA 4KN6A 4ZAGA 4JA2A 3E82A 2HA2A 2QAGA 4LRQA 1XTTA 1OR8A 3PV0A 2CFRA 1CK4A 4E31A 2A33A 3GCZA 1FDUA 4GM4A 4YAUA 2FR8A 4QDOA 1QV7A 2WHEA 2ZCUA 5EXSA 3KZKA 4FEEA 4NYJQ 3CNHA 3CT6A 4A36A 4UE2A 1ZIYA 4L6IA 4N47A 3EXFB 2JHGA 3Q8LA 2O5CA 2Y6UA 4AZTA 3NBUA 1I32A 4L50A 1AKVA 4ZOCA 1ZBQA 3SJUA 2QTTA 2XGJA 1T2NA 5BV2P 1Q50A 4CM6A 1HORA 2IY9A 4MV9A 1Y6ZA 4ZQGA 2FSHA 4FDTA 4G85A 5FF9A 2RCNA 2QRJA 3HHEA 1SCUA 3VYUB 4H59A 1G1AA 5IDWA 2XECA 4EQZA 1FA9A 1JKXA 2BGLA 4K7JA 4PSDA 4TTJA 4Q4HB 4I19A 2TRSB 1USVA 4WLFA 4AURA 4D3YA 4D4MA 2HU7A 3RKRA 3AHEA 3NCHA 1V1JA 2QVBA 3JQ7A 5JDIA 4DPKA 1TF2A 3KOOA 3JWIA 1M76A 1H0RA 5DNAA 3ND8A 4FYYA 4KN5A 4DLRA 3GEMA 1KI6A 4IH4A 1DCFA 3CMMA 1DKOA 1MVOA 3EVZA 3V7FA 2GPSA 2QR5A 3QNMA 2VHWA 1NBHA 5HE9A 4R1MA 5J4YA 1AGNA 5K8LA 1V5GA 3WLLA 5JY1A 1O77A 1M2HA 3D3WB 4IHJB 4S24A 4HAVA 2RB4A 4COOA 1N1MA 1XU7A 3KZMA 2EBHX 2I7VA 1YC5A 3GGGA 3PQCA 4MHTA 3RS4A 3ZBUA 1ZZEA 1ID1A 2Z2KA 3RFXA 4LYAA 1OUMA 2OO7A 1U7UA 5JLAA 5TMBA 4D25A 3F2IA 3I6BA 2XRFA 3A1VA 1T2AA 5IP5A 3N7TA 1GGVA 4LVCA 4MMYB 5E8JA 5IKXA 3UMSA 5DZSA 1O5OA 2FX3A 2VSOA 3FN4A 1XE3A 3Q3GE 4CIYA 3PEYA 4UZSA 2X8LA 3GP5A 5CFRA 4IHKA 4DLWA 1ZHOA 1CZRA 3K2EA 1X0XA 2GCGA 5HEKA 1RYMA 1QZXA 1M67A 4IXMA 3H83A 4HO1X 3GRRA 1J7JA 4TWJA 4ZK6A 4TV9F 2QTRA 5JSQA 4N41A 2CLSA 1KERA 5GONF 3IEUA 3S40A 3WRXA 1XD2B 1DKRA 1TMOA 2EKPA 3U19A 2HCTA 2ZSEA 1D2NA 1H66A 2ADOA 3LD9A 2FLVA 2R1TB 4CV1A 3M6WA 3VOSA 3TRIA 3BH6A 4P0QB 2GNAA 4BB5A 3GZ4A 3HYLA 1USGA 2PBFA 1HOTA 4INPA 5BN1A 1UKAA 3ZHZA 2UZ3A 3PTZA 4NK5A 2BGGA 2R47A 1OBHA 2JIMA 3SI7A 5IU6A 5E0OA 1K6XA 1RKVA 3ETEA 4RIIA 1GTMA 3TM5A 1H23A 3O9ZA 5TS3A 4BO8A 4MYTA 3GEIA 5HBGA 2A7QA 1MKYA 1I5OA 4MVJM 4PPQA 3VYWA 3Q7EA 4PLPA 4YASA 4MV4A 3T4UA 4IKEA 1SVKA 9GPBA 4QASA 1O95A 2N9UA 4FZ3A 1DDGA 3VR6D 4RSHA 3OCVA 3HC7A 3PUWA 2X22A 3WL8A 4ZDJA 4TSKA 3N87A 1YV9A 4WDRA 3ZWPA 1K0FA 2JKYA 3TMAA 1QORA 1MX5A 2PEYA 4IDDA 1ABFA 1EAYA 3THYA 2H5IA 4PQRA 1ZVJA 3ZR4B 4BVKA 3K6JA 2NO0A 4P0PB 1EVLA 2IVZA 1AS3A 1M0WA 5AM5A 1R66A 5T8KA 5BQ3A 2IIVA 2UZAA 3HSSA 1WTAA 1NUSA 1SMKA 5E4FA 1OA0A 3IIMA 5EIAA 2L19A 2REBA 3SYKA 1QYXA 3O95A 1M8PA 4UPVA 2ZUUA 3OZIA 4LBYA 1Z5ZA 1TC1A 4CKBB 1I7SB 5J2UA 1DEOA 2J6BA 4XH9B 3UJBA 1H6DA 3FCCA 2HF8A 1RTTA 3QFSA 5HPYB 5HUQA 5KWEA 2VSNA 1ONBA 3WAJA 2FOXA 2O48X 3EGXB 3OD5A 4JT2A 3RDPA 1PNVA 2YNMD 3BA6A 5HA5A 2W22A 1LTQA 1XZGA 2YHIA 5SICE 3V8BA 1LBTA 2V7QD 4IDOA 4V24A 1WF6A 2ZT8A 4E51A 4KIJA 3CGGA 3ANNA 1BD4A 4XVRA 2YN2A 4MUHA 1SM4A 4QT0A 4GX1A 2JD1A 5C7OO 1ZK0A 2WTEA 3WO1A 1NYRA 1AQYA 1XYYA 4JZKA 2CBXA 1DJOA 3L18A 4ZVKA 3ZDQA 1RXWA 4GUDA 1IXYA 1NVAA 4O4HB 1Z7EA 2BH2A 3KYCB 1NX6A 4Y1RA 1EA5A 1UM9B 1WXEA 1HFJA 5TQ2A 4A03A 4H3SA 4OA5A 2G70A 4K6FA 4OIMA 4OH7A 1KP3A 4RPJA 4FD3A 4WZ6A 1XTVA 2ID7A 4QO7A 5ALQA 4AUEA 2CFTA 5JCPA 1KO7A 4GKBA 2GKGA 4LCJA 4XWYA 5DTQA 3RBVA 3RFUA 2W70A 3H8VA 3IULA 3G88A 4L85A 3CHYA 3FDJA 4BLWA 4Q02A 3LRTA 4C0AC 3PE4A 2ZAGA 4I36A 3T38A 4KDRA 1IVSA 5KREA 1JHXA 1XKLA 2WWIA 2Z9DA 1UMCA 1ZHHA 4FX5A 4M54A 4O2BF 2GRAA 3SHWA 2MSCB 4PC2A 4CQMB 1RZRD 1ODKA 2W90A 4NJMA 4QU9A 4J2TA 2VP5A 4FU0A 2ZYTX 2Q4OA 2NO1A 1PYOA 1NZFA 2PGAA 3OIYA 3I45A 5T57A 3UK0A 4XD2A 4YRIA 1A1SA 1Q7RA 1IE3A 2D06A 4TROA 4GH5A 2FF7A 3CUSA 3JQ8B 4BB9A 3ZUGA 4E2WA 2VRNA 4GBMA 2C7OA 3LZ6A 4CUJA 5AW3A 2PKXA 1AQNA 1SCJA 2A6PA 1JLLB 1J1UA 4W7HA 2I2AA 2ZR8A 5JDCC 5FWYA 1P5JA 3L41A 1FNNA 3M70A 4AI6A 4ZVTA 3IXQA 3TG8A 2OB1A 3Q3HA 5HIKA 3MBOA 4L95C 1PEKE 2LIPA 2N0SA 1V96A 3A1DA 3P9IA 4CWAA 5C8YB 1OTYA 1RM3A 5JPCA 1NPTO 2WTAA 4Y2TA 1AUXA 1PFUA 5B4VA 1YCGA 1LI7A 3N6XA 2XTJA 1DAKA 3PT9A 4JUDX 1JEQA 4HDNB 1EK5A 1ZD4A 4KQGA 4WY5A 3WB2A 4TWAA 3WL3A 4C01A 5BQ5A 2DULA 4BECA 2X0NA 3TLBA 3ZNPA 4CGYA 5EHZA 3T94A 1EFAA 2EFYA 1JJFA 1YRBA 2R6JA 3OTHA 1K98A 4NL4H 4PZCA 2AMVA 2MOKA 3JQAB 3RH0A 4E3WA 4R16A 2DKNA 2EJWA 3KWJA 3NRJA 4OL0A 5D7NA 2R4QA 2WB4A 5GM2A 1C7ZA 5H0IA 1RXYA 4CIWA 1ZSNA 1U3FA 4ZU3A 5A7FA 1GV0A 3A36A 1XAHA 1E6UA 3AWDA 3B9BA 1HDEA 3LE8A 3PQDA 1QFJA 3ABZA 3S2YA 2UUCB 1Y9EA 2KLBA 3ZE1B 1S4MA 2C5EA 2IH4A 3K05A 1MB2A 3LRPA 5D8DA 3UFXB 4QPPA 4BC0A 2AJLI 2PR7A 1R6VA 1KJNA 2A5DA 2VDNB 2ZDHA 1F60A 3OCWA 4GPZA 3WTCA 4N39A 1N32B 3L4SO 3D64A 1L5KA 1VIYA 1JR3D 1TI7A 2E49A 3L6UA 2XHEA 2ZBGA 4LRYA 3EN0A 1XTKA 1A8HA 1W8DA 4WLNA 3Q9UA 2A67A 1GN9A 1IEXA 4LYEA 4S2UA 1E6LA 2PU5A 4ZOLA 1RRGA 2PR2A 3PLAE 1SC9A 1NSYA 1QHSA 1U1DA 2ZAOA 3T06B 1EPUA 1ZBDA 1DKNA 2EIHA 3DOEA 3S68A 3DWEX 1B26A 1QG0A 2BGIA 1CEYA 4WVFA 2GRJA 1E2NA 1VI6A 2ZW9A 1M7HA 2PJZA 5KJFA 1E2BA 3OWHA 1V9CA 1EG2A 1QIMA 1YK1A 3M9WA 4FWTA 4FFLA 4WZAE 5FB3A 3L7IA 1EBFA 1TGVA 3O4FA 4LRTB 3HB7A 1OHHD 1L5NA 1F8GA 2GHIA 1AY0A 2ATEA 3C15C 3LQRA 2XDWA 3L7YA 1KEEA 3OE5A 4Y6SA 4ERXA 2GCIA 5LP6B 2AKAB 4WN9A 1XDZA 3T99A 3ORYA 4DANA 4NS1A 2LV8A 1BMDA 1IVNA 4ETNA 2CHEA 4IXWA 1J49A 4F97A 5AOCA 2Z9CA 2YFKA 1XJQA 3K1AB 2I2FA 4TKUB 4B33A 5MN6A 4DY6A 3C4JA 4GLOA 1ELOA 1JN0A 1FFAA 1N7GA 3B8HA 4INAA 4DLZA 3UG7A 4KI0A 1NBAA 2J9ZB 2B5WA 2ZB4A 2NUPB 3DB1A 1N5MA 2J07A 2JA1A 3E61A 1TIKA 1F0YA 4JJIA 3RRFA 5BW5A 2DY1A 1G42A 3ZWBA 3K70D 5L3RA 5L3SA 5HYVA 4L27A 4U3JA 3H6HA 3G8YA 5JJBA 5E38A 3H9EO 4Y0NA 2JEYA 1PGQA 3O2NA 4ZGBA 3RSHA 4UDYX 1KJQA 1MO3A 3DZ8A 5HQTA 1TXGA 3A6JA 1B16A 2B99A 1TFUA 3ILHA 1NXWA 1RLTA 1UQTA 1S5PA 1V5IA 4GWKA 2YDXA 4Q39A 4W6ZA 1JH9A 1QHEA 1CJSA 4TRRA 1JR2A 1KU0A 3R41A 2C5SA 2NTNA 1ZGAA 2WWWA 5DRTA 4B40A 2ET6A 4CLRB 4CT0A 2DLDA 2HEIA 3I2IA 1MJ5A 1SCBA 1XNJA 3HUEA 3QEOA 4C0WA 3OY2A 3TL6A 2H9IA 4QZVA 2ZIEA 3FNHA 1V71A 4P7JA 4BUCA 1C4KA 3ILVA 1DUVG 4H6WA 4LF6B 2Q3EA 2GAIA 4TTTS 1E5QA 1XWWA 2Q7DA 1GV1A 3IAS1 4A8TA 2Z2ZA 1IATA 1C1XB 3I04M 3QU2A 3JAMA 5ADHA 4YI3A 3B53X 1GLNA 3EGVA 3FRJA 2I4RA 2W2LD 2GZRA 3B48A 2PL3A 1L5HB 3PX2A 2XZOA 1UOEA 5KOIA 1VLZA 1GPH1 1B73A 3VNQA 4TGLA 4F5EA 1GZSA 1ORDA 3O8QB 5AWFC 6AT1A 5AW2A 2IH5A 3V9PA 1BXGA 2BM9A 3F5SA 3Q7PA 4BWVA 2AE2A 1QRTA 4PSKA 5FKJA 4F56A 5LNK1 4YDSA 4RHEA 1CRZA 1K7CA 2ZROA 4MR8A 4G8DA 4YV1A 2PWYA 2WILA 1E1DA 1L5OA 3AF4A 1RXEA 2FZGA 3F8TA 4N3CA 5KYGA 4UUAA 3L1HA 3ZK9A 5L4SA 1X7HA 4UMFA 3DTVB 1Y3AA 5C7IO 4CR6A 1F2TB 2PL9A 4F2DA 5JS8A 2H31A 5CPBA 3ZCVA 4A8JC 2GAAA 3E27A 2H07A 3E15A 4N5DA 4OMFG 3R5SA 4ZYVA 5JT1A 4YREA 1Q3TA 1YU6A 2OY0A 4U2CA 3SMVA 2IPOA 2HPZA 2JJQA 4P5EA 1N2BA 2JGFA 2F3RA 4JJ7A 5D3KA 1E2QA 2H17A 5EC8A 1EP2B 1YKGA 3LXXA 3SXPA 2DWOA 4OUDB 7ABPA 3PD1A 1BDIA 3BIJA 5FUWA 3F47A 5EXXA 3VPXA 4BGUA 4D9NA 1U94A 3K20A 1P4JA 1BFKA 4GP6A 4LOIA 4LSWA 4UVGA 5FPYA 4B1FA 3LPLA 1UDBA 1IJBA 1P9OA 2CCKA 4RLQA 5F3WB 4GMHA 1U0OC 3RJTA 2ZIVB 5FXMA 1YL7A 1Q0SA 3L4EA 5WRFA 3WR5A 3KU1A 2V3CC 2FSVC 2VH5R 5CH5A 1WMAA 2I3ZA 1JQJC 4G26A 4ENWA 4WESB 1Y8QB 1FFYA 2P30A 3PJEA 1YK0A 4KO8A 1SAYA 3AERA 1IQPA 3ELUA 1FUKA 5CJPA 2YL2A 3GFGA 3PXGA 5I3ZA 1VXRA 3KKNA 3H8JA 2IPXA 3SNHA 1HT3A 2IC5A 5JZSA 2ZQZA 1OLSA 3R0ZA 3SJCA 4C0HA 2ZZNA 4H0CA 5GZ1A 1TU3A 2Q2VA 3IMFA 4REOA 2PMEA 5H4HA 1ZD9A 3R6DA 3STVA 2BTOA 3HBNA 2R0QC 5SY4A 3QZUA 4H7KA 2FMKA 5L4LA 3GBPA 3QQ5A 3M4YA 5ALMA 1AN0A 1JA9A 2F62A 3GT7A 4CMIB 2QL5A 1XD9A 1DJPA 1TTPB 4D2IA 2C5HA 1KAHA 2VN8A 4LDJA 2Q3FA 2YJTD 1G60A 5GAJA 4E5PA 3D1VA 1ZVVA 2YMLA 4FHFA 2AYXA 2OHVA 4MLPA 4X64B 5I9IA 4DQLA 1NUAA 3K73O 3L7CA 3N8DA 4G0YA 5SZKB 3FETA 4OV6B 2Z6UA 2LZ0A 1TZ2A 3C1TA 3QVXA 3FFWA 3TDNA 2WJGA 3GWZA 5CLIA 1CT9A 2FG7C 3KLOA 3C6MA 4IKOA 2O54A 3E53A 4EHAA 4YHBA 4JI3B 4Y9UA 2QM7A 1JIUA 1YL6A 4OU5A 1Z5PA 5BYJA 1SZJG 1Z74A 2CLLB 1XCOA 1NVGA 3FKJA 3ISJA 3VKWA 1Z0SA 2CXTA 1P7VA 1R0SA 3D6AA 3GQBB 5EEGA 4ER3A 4DCSA 4JYAB 2GM5A 3FUCA 4XVQA 2GBCA 4KWHA 3RJ5A 3W3AH 1ZUIA 1XNHA 3OE1A 4HNSA 1TMKA 4L4RA 1IBSA 3QOYA 1WHTB 5J40A 4A5OA 8ADHA 4YDQA 3UTCA 3R0XA 4EUEA 5I5EA 4P3PA 3SLKA 3H9CA 2SICE 3OOJA 2BGTA 4DDKA 3L6RA 5BRAA 2YH2A 3L5OA 3GRKA 4ER7A 4ZCTA 5ADWA 5M04A 1JHQA 2P2DA 2XTZA 3QPAA 4KQCA 3IIIA 4B7AA 4V1CA 1TKBA 4B8YA 1QC5B 3UGJA 2IRWA 2QAIA 1UPTA 1PWXA 4DADA 4KRYA 5CG2A 2GCOB 3EIXA 1M54A 2B3DA 3BHJA 4W5HA 1QDUA 2AJTA 2BHSA 2BJWA 1QAMA 3C3AA 4IGFA 4AW9A 3HV2A 3P26A 2F1HA 4HNAA 4YGXB 3C45A 5SZIA 3TXAA 2OD2A 4UEQA 3TVYA 3PFKA 1GWNA 4EG0A 3FMVA 4INJA 4X3CA 4B3SB 4WEOA 2QRGA 3NEPX 2X7XA 4HDMB 3RM3A 4RULA 4TKVB 3DAGA 3EEQA 4BE4A 1RWBA 2R7KA 2RGCA 3G9XA 3LGXA 3SBDA 3ZG6A 5FTLA 5JBNA 2C3YA 5AKYA 4A9AA 4RA6B 5AW4A 3N2KB 1WCWA 1MAHA 1GGKA 1UZAA 1V5FA 2FUG6 2Z09A 3IJ5A 5BW6B 4BY9E 3D4IA 4C78A 1EHCA 4LVNA 3FNRA 4IHJF 4EI2A 4I5DA 4G0MA 1CEQA 1O97D 3WGJA 5LSAA 4C3UA 3T7SA 1TQ6A 2CVFA 2V96A 4BVLA 3H5OA 1CV2A 1GR1A 1LB1B 3OM1A 3PNQA 4FYHA 1JKJA 5F2OA 3IBGA 2O7RA 2YC4C 4EFKA 3KUKA 3F46A 3W2FA 3IDAA 1XPOA 1CNFA 5ELXA 2QMUA 2NAFA 3DZBA 5KAPA 4W7IA 3MCZA 4NMHA 4ECAA 2P0AA 1Y7PA 1LJ8A 3EVAA 3SZRA 1Y63A 1JKIA 3GUCA 3EWAA 3P9QA 1R74A 2RH4A 3E9YA 4HGNA 2D1FA 1TJ4A 1WDLA 5ALKA 4Z9FA 3N2YA 3G68A 4JZYA 2IHZA 5C1IA 4BJ1A 2PMKA 3U31A 2JPDA 2DEUA 4X6XA 5DASA 4ESOA 3K6SB 1DQSA 1U0RA 1IAVA 1LPPA 2WHXA 1DLJA 4I3GA 4C4SA 4Q3CA 3P7MA 4WV3A 4BYMA 2I8AA 1U2ZA 1WULS 1O57A 3PKIA 2WMNB 4ZALA 1D5CA 3DBHB 4TYWA 5BVGB 4J4BA 4ZI7B 3FAZA 1NP3A 3NQ41 5K3SA 2J3HA 5CLFA 4POAA 4XUCA 3UJ8A 2HRQA 3NNNA 3OMXA 4LGVA 2BEKA 2VLIA 4DIMA 2RGEA 1PFYA 3MD0A 1QH8A 1P80A 3KOZA 3P45A 3QMPA 4WBXC 3R3SA 2FKNA 4ITUA 1ORVA 3UB2A 3WZLA 2WMOB 2C2ZA 5I51A 1DXQA 2BPOA 2EZUA 3AG6A 1PX0A 2PZJA 1SBYA 3D0QA 2PYIA 3I52A 3K8QA 1UFQA 5DTIA 4DJTA 4ERNA 5ES4B 4Z1OA 1EVJA 5FJJA 5DOVA 3ZCQA 4MV3A 5H4GA 1JLKA 3AIOA 2OV4A 3DBIA 2UV8A 5EHXA 2Q29A 1U1CA 3QNWA 4ASUA 5HZMA 2R79A 1M1YA 5KDOA 1VTKA 3QSYA 1MN6A 3B5JA 3QXCA 1N57A 3S27A 4NXNB 4MB6A 3FLEA 5G2OA 4DLVA 1OCEA 2GSDA 2IT1A 2VHUA 3L6BA 1Y4ZA 1XI2A 2F59A 3AZPA 4PNHA 1KY3A 3SKXA 2ZEJA 3H5VA 1QF7A 2WF8A 5BUCA 2NM0A 1SZPA 1V6CA 3NIGB 2HLDA 4HLUC 4M22A 4A8HA 4HGOA 3O21A 1OXMA 4XFJA 2HREA 4WXRA 1ZH4A 4UE6A 2G1AA 2V97A 1XCMA 2W2OA 3K9HA 4P7FA 3A6EA 5FJIA 2BRUC 4MGZR 3RWMB 3G1WA 1AH2A 3QW4B 1G21B 2DJIA 4DV5B 4XDHA 3RCBA 3AF2A 4UAVA 3R7WA 1A2QA 1B00A 1B8OA 5DH9A 4YAWA 5AOBA 4URUR 1A88A 3D59A 4IVRA 2KQUA 1I0IA 1HE5A 1VSUA 4IUDS 5JQGA 2UXBB 3NVMB 4RTKA 1G5QA 3DEHA 1MH1A 2AOTA 1Y98A 3B3GA 4TWBA 3CKYA 2JLWA 1Z2NX 1XEXA 1PYDA 3II6X 4KQ2A 1FDRA 3EIQA 5IPFA 3OLZA 3OUUA 2HRDA 3TTWA 1JWBB 1W0KA 5DISB 3LL4A 3W8FA 3PPXA 7YASA 4MQEA 4RBNA 4F8EA 1E6WA 5LKRA 2P6OA 4MB0A 2CT8A 1AKEA 3M6MD 1FLNA 5G0WA 1U6IA 4BRSA 4PQYA 5JHGB 3ROZA 3E9ZA 4NY1A 1HX7A 2PMCA 3GMIA 2WJYA 3JRWA 4Z3DA 4MOWA 1Y6RA 3RYHB 4IVNA 4O4HF 3GG9A 2FPLA 5FCDA 5AQ1A 821PA 1AV6A 1J0XO 5JMWA 1KPHA 1M2NA 4RH1A 1AO0A 4N9QA 2GK7A 1PJSA 4HVTA 1I2BA 5AVSA 2NP6A 3U44B 3TMYA 2B1QA 2ZBDA 3ZI4A 3UUEA 2WU4A 4A3SA 2XOKA 2FYTA 1G59A 3BFVA 3EXG1 2MIIA 4KQFA 2GTHA 4MGYR 3GDWA 4YBZA 3VNBA 1GCOA 1LDNA 4IR7A 1UJ4A 3N2GB 1MC4A 4D43A 4LF4B 2QJOA 1I9CA 5ALEA 3EXAA 1QRUA 5TSDA 2IW1A 1AZLA 4E2YA 4IDAA 1L4NA 4LRSB 5TF0A 2C5GA 3F6PA 3U7GA 2G80A 5EINA 3CRZA 4C6TB 1N2CB 2Q4DA 4DQDA 3KBOA 4FSDA 4BEVA 1DRJA 2B8EA 3IO3A 3BM5A 2PEZA 1UFOA 1O95D 1NX9A 2ZATA 3AUFA 2P6RA 1P1RA 4W8OA 2C95A 1AXEA 3AM1A 1QQBA 3M5PA 3WQRA 1G2IA 1HZZA 2FW1A 3K6KA 3BXGA 1KA9H 5C9ZA 2MSNA 3REQA 1PT6A 3KJHA 4F9FA 5K0CA 5G41A 4Q7KA 5DT2A 2BAGA 2QS9A 2W2KB 2I1WA 2HK9A 5C8YF 2WKWA 1E5XA 1P5ZB 1UPCA 3CZ9A 1I9GA 2JLXA 4R8RA 2X19A 4X20A 3S5UA 3ZNQA 2VVTA 1MO5A 1XKXA 4AMZA 3DKIA 5TIIA 3KTFA 1OVMA 2W71A 3ZCTA 4LIPD 4M46A 3VO8A 5IANA 2QF7A 1GZ6A 3IPYA 3N0VA 3VC1A 3HYCA 2I0FA 4KR0A 5HRCA 4A7PA 3PWKA 5D00A 4WBNA 2C4HA 3EZXA 3QTTA 4O5AA 4EHNA 3MIIA 4BJ5A 2BYTA 1K89A 3OTOB 1F2UB 1GRCA 3FCXA 4PRKA 1JT2A 1WDKA 4BAZA 4Y2VA 2AYYA 4RE5A 3HL4A 5HRAA 3IIKA 2GF2A 4HPJB 1SQ5A 2P69A 2OCBA 3KJQA 4KFRA 1QO7A 5EJEA 4ESEA 1UAYA 4L3VA 5P8WA 4CN8A 1LX7A 2AXQA 1P4HA 1Z37A 4XVUA 5BXYA 4QQNA 1WV1A 5HF5A 2VDRB 1IZ8A 4ZYTA 2P2LA 3HZRA 4DCTA 2P40A 3CPEA 3C4QA 1RCTE 2LDBA 3FPBA 3LT5A 4DHEA 4NS4A 1A3CA 3QW2A 4CCYA 1P1HA 5FYQA 3H05A 4MQFA 2G1KA 4RU1A 5K0SA 4Z0HO 3G0BA 5EMKA 1ZDMA 3TTXA 3UAXA 3DFIA 3W4JA 3C70A 2AN5A 2BMEA 4JA0A 3RRJA 4TXMA 3V7UA 2GJ9A 4R7GA 1H05A 5J4HA 4EATA 3SWWA 3GLSA 5FLKA 3Q15C 4R2MA 1PG2A 4YCDA 1XJ0A 2WU3A 3AHFA 3BL5A 1UBOS 5DEIA 4BLSA 5K0ZA 4YNBA 3M2PA 3M4NA 3ANYB 1XVIA 4OK6A 3O0DA 4EW6A 4O2AB 2FPPB 1T5OA 1YBFA 3NNDA 4ZI3A 5A6VA 1SKYE 4ENVA 1L5MA 2C2HA 1L4EA 2QP9X 4NCNA 2Y9PB 5DM1A 4DNXA 2FPOA 3GDFA 4E14A 5CJ2A 2HJHA 4Z7OB 4HWKA 1B0ZA 2AFIB 3NZEA 1M74A 4OHBA 4ALNA 5KWVA 3H6GA 5LP6F 3UN1A 5JMOA 4MINA 3AVVA 2ES4A 4RSGA 4ZVVA 2HRCA 2ZIXB 4BBPA 4C2TA 2BEUA 2FPSA 3OOWA 5DHPA 1QYCA 2BF4A 2HRRA 3SIWA 3V4PB 1JW9B 2QQ5A 2WW8A 3SHOA 2WJ3A 2QE6A 3LCMA 4LJ8A 4C3VA 1JX6A 1K6EA 3TD9A 3JR3A 4HVLA 4E5VA 4B3HA 2RI0A 5JRJA 4GPTA 1XZQA 3GT3A 1WVIA 3MFQA 3K0BA 2YOGA 2O6HA 1PK8A 1VHTA 4HRAA 3B1FA 4TMTA 4GECA 1MCZA 2Y1GA 3RYFA 3RVOA 1UJCA 1KFCB 4K6GA 4YRNA 2XZDA 2WE7A 1XUOA 2XUIA 4LK2A 3Q98A 4UUBA 5EY5B 3SAJA 1T9BA 2R2AA 3AVQA 3D7NA 4EGJA 721PA 1HNNA 1YJQA 1SUCA 3IAHA 1KVSA 4KPEC 4YJ3B 1YO6A 3KBBA 1QS0A 1T36A 3ENNA 3VVCA 2HA7A 4MHOA 3CZ4A 2JAXA 1B3RA 1TKRA 3PHJA 2QVGA 3HJTA 1N36B 2FZ5A 2M6LA 4HGYA 2XGGA 5DHUA 4E30A 3OQIB 3C24A 5AUNB 3U7QB 1CHDA 4A15A 2C31A 1F6DA 2XF8A 3AR6A 4PVDA 2QGZA 1HLGA 5IRCD 3WSVA 3H5LA 5LYJA 2A7XA 1V4NA 2B4KA 2OAGA 5BQPA 2HYDA 2WKRA 3NKVA 4HDKB 3HKBA 3ELBA 3FSEA 2FPWA 3THWB 4PSUA 4G0UA 2CMGA 4JJEA 2BBTA 1XZFA 2E37A 2GMWA 4E6PA 1G20B 4N0PA 3QKRB 2OFWA 1G8SA 1WXGA 4QRIA 1XTIA 2WIDA 2KI5A 2QTHA 1T5BA 1JFSA 2G8LA 5CCBA 2HMYB 1UP7A 1JB1A 4EHDA 1WSBA 2P5SA 4KXYA 3ROMA 3RJ9A 3WMFA 5L7TA 2FVYA 2WMYA 4PAWA 5KHOC 4Q05A 1FF9A 4KDCA 4IJMA 4D3ZA 3SN6A 4BV9A 2H08A 1CF4A 2IFTA 4WUTA 1T5HX 1TK9A 4J07A 2ZWVA 2PH7A 2VA8A 4R2JA 4B3IA 2XQFA 4MX8A 4H35A 4RL4A 4YO7A 1QQ6A 2BP7A 4DUPA 4QUDA 3UYLA 5DN6D 1KJ9A 3S1SA 5F2EA 2O2GA 1M2VB 3L6CA 2D5LA 2AMLA 1PBNA 2MWMA 4OFXA 3C98A 1ZIXA 1EFVA 1JT9A 1UANA 2ZKIA 1XLUA 3LUJA 4GC9A 1U2SA 3PSAA 2AMFA 3J7TA 4AZWA 1D1PA 2ETXA 3I30X 1B76A 3ZXXA 3U13A 2AHOA 2ZPTX 3W5UA 3VBCA 1SK9A 3AKZA 2GUWA 5HIMA 3JQRA 1M3SA 2PT9A 3PCXA 3QVSA 3QE3A 4UBLA 5TLSA 1ONNA 4LVUA 4FI3C 1EEXB 2R1VB 4UEKA 2J87A 2VO1A 3FGOA 4NU0A 4JI6B 3ZCUA 5E3HA 1T43A 4G0OA 2G5CA 2AQHA 1V95A 4NI5A 1L7BA 1NYTA 1OXXK 3OLCX 2VNHA 5G1OA 5K3FA 5JCOC 3WGUA 3GZJA 4M87A 2EX0A 4PRLA 3KL4A 4B4WA 4RZ3A 3HBAA 3RKSA 3AIIA 3CUUA 1CCWA 2O2IA 5CT5A 2NVBA 3FUVA 3ZCSA 4CKEB 1OYOA 4TKZA 4B3GA 2G9VA 3KJFA 3TFOA 4KR3A 1SBHA 2BY4A 3G2MA 3ANTA 4JP8A 4MEAA 3SQLA 1AX9A 1E2IA 4LWZA 3A11A 1BVRA 2C2BA 4P7BA 5K8TA 3QEAZ 2CBGA 4HB3A 4DB4A 4N7MA 3VNSA 1CDDA 4IH9A 5B12A 4TV9A 1WB4A 3D4PA 3OX3A 4TMWA 1U3GA 5K01A 3GLGA 3ESYA 1XTZA 3MM4A 2PQMA 2ZBUA 4RDIA 3TI7A 3KEGA 1KE1A 4DCNA 2A5JA 2FR1A 2Q3HA 5BYBA 2UUOA 3PA8A 4LFBB 3TE7A 1WOMA 2JBAA 1NOJA 5LA6A 4XM1A 5DI9A 4MGEA 2RGNA 4B09A 4DNFA 1FXWF 2E4VA 3ZLVA 4CF6A 3Q72A 1P7WA 3LDHA 4PTYA 1B1AA 4G4SO 1GJRA 2HMUA 4FOTA 1Z4MA 3RVMA 3F1LA 4QYXA 4HYQA 1GPYA 3FJOA 2R97A 3SZ3A 1EDOA 4OQNA 5HS6A 4ILEA 4LI3X 3ICQB 4RS3A 2J09A 3D6VA 3TINA 2SECE 4NYJR 4II7A 1NY6A 2QLMA 4LDAA 5ELLA 2Y27A 2V5AA 4DDTA 1PJBA 2NZXA 1C3EA 1SD1A 2VBCA 2ZREA 1EFUA 2GM9A 4QICA 2PUEA 1NVFA 2FRXA 3QY9A 2J3KA 1R6TA 3EQ8A 4LE2A 4GZLA 2RHOA 3WQBA 2AN3A 5IBPA 5I45A 3ADCA 2BSQA 2UUAB 3QUBA 1C30B 3C4VA 4WPGA 3V4RA 1IM2A 3H1GA 5ALRA 2X8JA 4BAUA 3BCSA 3MIZA 4FVTA 2ZT5A 1THTA 4ROTA 1IHOA 4ZYLA 4BZZA 4LF7B 1QUFA 3VSEA 2JCYA 5K09A 3I6ZA 3ANSA 2H9YA 4P98A 1ABEA 3BIOA 2A1TR 1URPA 3D6FA 1EVKA 2BN4A 3KB8A 3Q9NA 3QU9A 4RQTA 4A6PA 3ZKWA 2ZYVX 4AULA 2PTHA 1VJ0A 1KSFX 2VNSA 1ODCA 2XJ4A 3BGSA 1A9TA 3I9JA 4RZSA 5AOVA 4LRWA 4Z9AA 5BOVA 3T1VA 5FQOA 3ZH2A 4DMLA 1YZNA 1SRQA 5TVKA 1RHJA 3N2NA 1RPTA 1E9FA 3UJHA 4F4HA 2JVKA 1ZD2P 3BJRA 1ZJ4A 3AQ4A 1YMVA 4R1QA 5IK2D 3JPYA 5KNBA 1NV9A 4LA4A 1OIVA 3L9XA 1IHPA 4U02A 3T1OA 1FX0B 1II8A 1U99A 3EFEA 4H6XA 1YZGA 1ZWKA 3AU9A 4J1SA 4LPSA 1EK6A 1LDMA 2IF0A 2Q6TA 3HP7A 5AVJA 3TTUA 2XDYA 4EYQA 1A5ZA 3MPUA 4IDQA 1Z6YA 7MDHA 1EX1A 2YHSA 1Q0LA 2VS1A 3OECA 2H29A 1EM8A 4NG5A 4UVDA 4C6HA 5F33A 5HX7A 5J4KA 2YBDA 2WJJA 4JOCA 5H1YA 5A1TA 2A9VA 3FOCA 1XLTA 3HZOA 1PBTA 2QEQA 1V7PC 1W5EA 1WUKS 4NICA 1X8KA 5LDGA 2GI4A 3NDIA 4FHDA 5BWBA 2H2IA 2VJPA 4IILA 3PEVA 3DC7A 2IZ6A 1OV6A 3QPWA 3VV2A 3TD6A 2X6RA 1R18A 2VTKA 5JAUA 1YUMA 1C7FA 1V5WA 4YQZA 1KORA 2JLSA 2Q21A 5CCDA 4O2BA 3ORRA 1BE8A 2O2CA 2YWXA 1BGVA 1S01A 2ERXA 2CNWA 3K0AB 3DONA 1RR6A 4AUKA 1RWQA 3Q7TA 2I2BA 1JSXA 2K2WA 4BX9A 4JUAA 3MTIA 4ZV4A 1MJHA 1ZL0A 5CP8A 3FOEC 3JYQA 2AC7A 1GQFA 2Q6VA 1C3XA 1VL1A 3WVNA 3I1IA 4ZI7F 3L92A 2B4AA 3NEJA 4LXHA 1TD1A 5FOTA 1HTBA 2IUUA 3LVBA 3LXUX 1D7AA 2FZLA 3QELB 4GZ3A 5ECYA 4KWEA 3DCIA 3DMHA 3HS3A 1T1EA 1I7DA 4RPHA 3TNFA 2GZAA 1GQSA 2WRZA 1JI3A 4OJTA 2PRJA 5LWQA 4P3NA 3VRHA 4DV0B 1FUEA 2VAMA 4RCVA 2UXDB 1W2HA 1MORA 3IQWA 4NCIA 4BP1A 3HCPA 1SULA 3E2IA 2G8NA 4A8JB 1SKMA 2WNHA 2QGNA 4BEWA 5BVHB 3DJYA 4ZKEA 2O3QA 2BDUA 1UEJA 3WLNA 2ZDGA 3H13A 4JS0A 1PJLA 2O1SA 3JXEA 3AI1A 3EBOA 2X0KA 3AIMA 1JB9A 4X45A 3SXUB 5DTMA 3AJ8A 3T7AA 3WZMA 4CIVA 3OD1A 1DC7A 5ALHA 1LWOA 1WP9A 3DKRA 3EH2A 3F90A 1OASA 3OZUA 3LHKA 3O90A 1CZUA 4YACA 2I33A 1MW8X 2X4GA 3T3HA 4B9EA 3C8ZA 3LUPA 4P33A 4YI5A 4ZMBA 3ZC3A 4HZUB 1DXHA 1UKYA 1OGIA 1YJ8A 1VIDA 2HQBA 5BUSA 2FW8A 4HN9A 221PA 4OBBA 1L7NA 3IMCA 3R5KA 3HVUA 5DBHX 4Q9LA 5JR3A 3WICA 1GP2A 2GBIA 3LOUA 4RORA 1AQIA 2AWNA 4J8PA 4ZVOA 1PJ3A 3ASZA 5GOTA 3EMKA 3DVAA 3UMCA 1HWYA 1ISHA 4GC5A 1L4UA 2QW0X 2B0CA 2RAFA 3ENQA 1E98A 2FPKA 3OX4A 3M6XA 4I4CA 1D2EA 3Q11A 1VG1A 1A4RA 4LV5B 4TPKA 3RQSA 3ZDXB 4EUHA 3QLVC 2CV2A 1EP1B 4EO4A 1CULC 1N2ZA 2M1XA 3CLTC 4DT1B 4I50A 3M5WA 2EAUA 2WT9A 2XNHA 3C8UA 1DAGA 4GPAA 5KQSA 1EUDB 1U28A 1CF9A 2WLSA 4WKOA 2MTBA 3C1UA 5CVDA 4WH0A 4PAOA 3LBYA 5ICFA 3KQUA 1W59A 3HLKA 1Y4DE 3ZVNA 1H1LA 2Q5JA 3P20A 2WVJA 2Z57A 1EFHA 4N3AA 1CLUA 2D0OB 3K9BA 4O4LB 3AR4A 2ONJA 4BVBA 1GDTA 1KK1A 4MMZB 1JQ5A 5DHRA 5EJGA 5AI9A 4D4IA 3LC2O 5KPJA 3AT1A 1YAHA 3IOEA 4PC6A 1K4YA 3SZGA 3TSZA 1SWWA 2A86A 1L7AA 2VH1A 1F4VA 3Q5EA 4WIAA 5A4DA 2H4ZA 2J5RA 3JVEA 3GP8A 2XE6A 3WGQA 4PGFA 2Q5EA 1XZIA 1ZQ1A 3CH4B 2YYSA 4QQ8A 3HJRA 3TMKA 4WSOA 4KDEA 1Y48E 1U2QA 2A30A 5A06A 1GYQA 3HXLA 3QOFA 1XRRA 2P3OA 1VHDA 2P11A 3KNZA 1E8DA 3DV0A 2ID4A 3EMBA 3BMOA 4J7CA 3Q85A 2ZS7A 1UC9A 2WR8A 3PZBA 4LY0A 3L79A 2I2WA 4ASUD 3UO8B 2FHSA 2YWHA 4KQWA 1M1YE 3BKXA 3NHUA 4TT3A 5K2MA 2X0FA 3ZWOA 1DBSA 5H9WA 2AK2A 1KJYA 1SC4A 2XUHA 3IPXA 2IYXA 4EPTA 3D4NA 3FB1A 4L4YA 2GGSA 4DV6B 2PKQP 2A9QA 4PZ0A 4Q1VA 4W8HA 1WSAA 2UYYA 1G3UA 2DM6A 3OFSA 4TWZA 1IWOA 2HLDD 4QDZA 3WIBA 5CXSA 4BKRA 1ZGBA 1GO2A 4A26A 4Q6WA 4H4DA 4RVDA 3UB3A 2CNOA 1WMEA 3MMNA 4LZNA 1PZEA 2VRWA 4F4CA 1A8SA 3UGKA 2DUUA 2H2GA 4LDQA 3KFVA 4C30A 1DWOA 4TXLA 3EIFA 2MMCA 1P0PA 1X74A 4UBNA 4IDHA 4CDMA 1CERA 5FX2A 2ZOSA 2ZWPA 1LEHA 1NOIA 3ETGA 2KB0A 3LY8A 4EGQA 3QTBA 1N2EA 2V6JA 4UZEA 1Z4LA 1T8TA 5D5HA 5CYFA 3HYTA 2H6EA 1E6EA 2EARA 2PCLA 3ESDA 4HWPA 3GROA 1JDTA 1HKUA 4MYDA 3ZXUB 1ZD8A 3HB9A 4P9NA 4O29A 4PV7A 1U2EA 1G7SA 3L46A 4OP3A 2XTNA 1W0KD 4RMGA 5LB2A 5IASA 1OFTA 2YRXA 1OI3A 1NN1A 4WXEA 1G17A 1C9NA 1T2UA 3GLHA 3U7FB 2PH1A 3WHIA 1XAIA 1BYIA 1TOAA 2OORC 4B4KA 4CIDA 2G7MC 4QUBA 3U4AA 1FJHA 1QG6A 4JQYA 5KOHB 4G01B 3LQYA 1GUZA 1LPSA 1A8IA 3GUYA 3JQQA 4LMBA 1SU8A 2AIRA 4C4AA 3ROEA 1X3SA 4FYMA 2ZI4A 3HM2A 4GI5A 4QNRA 2MHCA 1QYVA 3L7MA 1N9KA 1WPRA 3DZJA 5DK6A 2XOKD 4O8ZA 4AG5A 4ZHQA 3V9AA 2VJBA 2CJWA 4F5WA 4E5SA 1HNZB 3F7NA 2RFLA 3U3DA 4EGFA 2GUGA 3P1JA 3O8NA 3DAHA 2BCGY 1OSNA 2PLAA 2ZTUA 3FMGA 1KQFA 2IUFA 1TCUA 1YTLA 2WJ4A 1D9ZA 1G8FA 2WJVA 2XCOA 2XQGA 4OQXA 4K9MA 4NG4A 4D0NA 3RADC 1VCOA 4R54A 4FILA 1U9JA 4PSAA 1PQYA 3M0EA 4RFSA 1ZVMA 3R9XB 3BB3A 4G81A 1GNSA 2A0UA 4PXSA 2H16A 2DFTA 1GGFA 2VYQA 3JQFC 4MMXB 4O2AF 3FTNA 3HA5A 2QRMA 2WOOA 3F6SA 4UJ5A 2G17A 5EFOA 4JB2A 2HJVA 1X7YB 4UUPA 3TXXA 1I7LA 2E5FA 3D1JA 2ORIA 2V9ZA 4N5MA 1JIVA 4Y1GA 4QUAA 1SK8A 5IT9A 1JIXA 1U7HA 3IYLW 3LKBA 1UMDA 2QYHA 4DTCA 4YUZA 5KSZA 5B6PA 2QBYB 4PONA 1KY5A 2I54A 3FZEA 3ODGA 2QMHA 2OBYA 4FCTA 5FIUA 1Z08A 1I0LA 1B93A 4R01A 4AJ4A 5F1PA 2P2YA 3JWEA 3OIVA 4YIHA 3O9VA 3OJOA 5KYNA 4ZYZA 1C5KA 4AT1A 5G3ZA 4MRRA 1X1RA 1U81A 1P4AA 4AP5A 4PQEA 3KT0A 1DDOA 5AVWA 4LK3A 1NSFA 1TMGE 4RADA 1XWIA 4WNYA 5FI1B 2CVHA 1DIAA 4ZICA 2XQKA 1KK0A 5KTNA 1LDEA 2I4IA 2I03A 3GZNA 3HDQA 4KQ9A 2FEKA 3NTRA 4HF7A 1W4ZA 2IEYA 1KMCA 2IYTA 3BWVA 4KWCA 1HRKA 4R9UC 4E88A 4UAGA 2EX1A 3AOEA 4LHZA 4Z99A 1AC5A 1UJNA 3BFKA 3CE9A 3S2SA 1VBFA 4R2XA 5JI2E 3B38A 3CVWA 1MG0A 2AB0A 2BKLA 4KLCA 1PDOA 1UT6A 5FBVB 1DAEA 2BM1A 3HDYA 4AKHA 1PJZA 1Q21A 3U7JA 2WM3A 2V0GA 1JPJA 2FZKA 1WUYA 4KO2S 3PR1A 1NW7A 2WSSA 2JLAA 4I55A 1OI4A 3LX5A 4RF5A 1AGRA 2RARA 4R69A 1NUTA 4WNCA 4XPIA 1HNXB 4JLOA 1M2JA 2JHFA 3R3UA 5I7UA 3K30A 1VPWA 2TECE 1JTFA 3OQ6A 3EUEA 3AVUA 3D43A 3BMNB 3FPSA 3V00A 3N5CA 5FWNA 3ELYA 4ZCMA 1ILWA 1N2JA 4FW9A 2XE4A 5A9SB 4H1TA 1DAPA 1WIWA 1SCIA 2OV2A 2Q62A 3ZWYA 3W5HA 4BNTA 1UR5A 1T6NA 4MUYA 2DQYA 4AC9A 1X3LA 4PBRA 3PF8A 3EX7C 1SHZA 1T24A 1KH3A 1KC1A 1YKSA 3N28A 4D82A 1ADYA 2WUWE 3CKKA 3EXFA 4RPKA 3TLEA 1XA0A 1N2XA 5FUQA 3E81A 3FPAA 5FWXB 3O2QB 3PLNA 3D0KA 3G2IA 4JOBA 4LGYA 5C1BA 3OIDA 5AVZA 3U9LA 3W2IA 3OI7A 1E1YA 2BLNA 2VSYA 2P1ZA 1OFVA 3FHOA 2EG9A 3T7IA 1OFUA 5IKPA 5EJ9A 2X15A 3SPXA 4X6YA 3RARA 5I8PA 4F84A 1I30A 4WGFA 4EUKA 3LX8A 3O9MA 1QGUB 1YRLA 4R1SA 5AIAA 4BMVA 3A04A 5BSVA 3Q0TA 4Q4HA 1JTEA 5AK3A 5LMUB 5IDQA 2HMVA 1N6KA 3MB5A 5CBKA 3M1AA 4IJWA 2CVPA 4I9UA 2XTAA 1PE0A 2XUFA 3CUVA 1AO3A 3IAUA 4ALLA 4N5IX 4AMVA 4GVPA 4JIMA 5IWCA 5JQWA 5K0EA 5LJIA 4XIYA 1M0SA 3BREA 1N4DA 1AK9A 3D3JA 3MYRA 3M1LA 3D8HA 1YVEI 3TUIC 4BMDA 1PTKA 1GG8A 2WTNA 1IK4A 3D3WA 1FP2A 2FOIA 3GUZA 3LTEA 4IHJA 1J0EA 3TOZA 1XRJA 4WXHA 4BNHA 1FSSA 3U39A 3QLJA 2N1BA 3C6KA 4AYWA 2WU8A 5D01A 1YTUA 1CUIA 2UXCB 4HGRA 3HCFA 2O0MA 3LOPA 4YCBA 1Z7YA 2O50A 3NBAA 1WD7A 5DLYA 2D2VA 3TSAA 1VECA 2CXQA 5FI5A 3WRYA 2J33A 3DBLB 4LQDA 4RJIA 4UTXA 4WOBA 4RV4A 1Y3DE 2DERA 1C4OA 1IZ0A 3D6NB 5FTKA 3USZA 5HMMA 2AFHB 3DMTA 4K8RB 5J5VA 2PX0A 1TZBA 3VPGA 1B23P 2VWPA 4DCJA 2JCBA 3MINB 1XD2A 2I6XA 1QJ4A 2R8BA 4F0JA 4IRUB 4JP1A 1W5BA 1AQ6A 1LQ2A 1XK7A 2RBKA 1IXZA 2XV1A 3NT4A 4KUGA 4MEBA 1L0BA 3TEMA 2XF2A 4UARA 4HH3C 1FX1A 2ZYAA 4D9EA 4ZXFA 2YMMA 1DTWB 1Q1EA 1UJMA 2R1TA 4L08A 1SIWA 2O23A 4NEGA 4Q4LA 4US0R 1C9YA 5KKCA 2ATVA 4WASA 3VMFA 2FVXA 1DIRA 1IAQA 1RAAA 3O3CA 1L5QA 5FUXA 1TTTA 3ZY2A 1VYTA 1KNXA 2ZAIA 4R31A 5AIBA 4MUKA 4LOHA 1X8XA 3QU5A 4R1PA 4I1SA 1E60A 1SKAA 1WY5A 4YFYA 4RV9A 5ER9A 3EEOA 3KQPA 3LWDA 3NIBA 4OEHA 2HF7A 1NUHA 4FFBA 4NF2A 2PKRA 5H3HA 5A4MS 2FMXA 1FU8A 4WFJA 1QSGA 4NX2A 1E9SA 5GMOA 2G6TA 1NQAO 3GAMA 1Q84A 3O38A 4FFWA 1MIHA 4DM7A 4KMMA 4RC9A 4B7XA 5FQNA 3UAOA 2R5FA 3STWA 2CUZA 3N75A 4BFYA 3PX3A 4EF6A 3WA6A 2I62A 3G8DA 2WFLB 3AHDA 2GYYA 2JHPA 2TMDA 3PI7A 3EB9A 3O7WA 3UWPA 4CT5A 2VP4A 2DR0A 5IM4F 4IDGA 4E4RA 4M1KA 1KQOA 2HA4A 3RRZA 4AJOA 3MS4A 1NYQA 1WZEA 2GN4A 4CL3A 4KQ6A 4QVKA 5JVDB 1RBQA 2X0RA 2QRPA 4OJQA 1RWOA 2Q45A 1L7OA 4KKVA 5AVQA 1D4AA 2ZSHA 4D42A 4DV3B 3HACA 2ZIGA 1UWKA 2NU9B 3BF7A 3N6VA 4ME6A 2EYUA 5JIBA 3MRSA 1ZICA 5C8XA 1KEZA 1R0LA 1V3VA 4CKBA 4YAGA 2BMAA 2O1EA 9LDBA 1ISSA 3AY7A 3OIFA 5DBEX 3ZDFA 1I4OA 1M72A 5CXQA 3RV3A 5I9NA 5F51A 2P4QA 5DGTA 1I8TA 2PUTA 1LNQA 1MRZA 1SG9A 1D2HA 1K5HA 2V7PA 3MJVA 3EGXA 4ESHA 3B6JA 2DR3A 4ITVA 1IB0A 4LZJA 5EE3A 5CB6A 4CXMA 2ZRCA 5TJ9A 5CFZA 3FW1A 4WAUA 2RG1A 4FKMA 2JL1A 4KLAA 3VXKA 4G41A 1KI7A 4WADA 1R0YA 1ISPA 1VJTA 1YNSA 3EZ7A 4E13A 4L8LA 4DBLC 3UCXA 3GD5A 2F17A 2JHCA 5F7XA 5B58T 4MIYA 4H1VA 1WO8A 1AGYA 1W52X 3PUZA 2C5LA 2CUTA 1W44A 1GPJA 2FFQA 3IIEA 5CH8A 4PWZA 4O4HA 4D8WA 3IHLA 3KYCA 2WVHA 1W47A 1UM9A 1CJMA 1YUBA 4IQGA 3GLGE 4C1BA 1ULSA 3P9PA 1IBLB 4BRUA 2HWUA 2R4TA 3SYMA 2AW5A 2QPOA 5HIAA 1CE8B 3FZNA 3HJFA 1FBTA 3SR4A 3AEUB 5KQMA 3WAKA 3W2EA 1RWKA 3THRA 1HETA 1NF8A 3KWLA 2O2YA 3QLUC 5CVVA 3TKYA 1P3Y1 4TS1A 2HR1A 1THGA 2ZSFA 1PQPA 4GMDA 2QRHA 4MVWA 2OV3A 4ZAVA 3PGXA 4RDXA 4FNOA 4RD2A 3LT0A 2DPHA 3QY0A 5E6SB 1RVV1 2FWAA 3CURA 3D7MA 4ZV7A 3V1LA 4CQMA 3PNPA 3A9TA 4AJPA 4EA9A 4NENB 5SYAA 4P22A 5IXJA 4HB4A 4RELA 3NM4A 1VZ2A 1I1OA 4QFBA 3GFPA 3OSZA 2P7HA 2ZTMA 5DHFA 1M2KA 2XZTA 3M34A 2O8VA 3ME5A 3U4QB 3AGQA 2QL9A 3JQ8A 4ZVUA 4C7OB 4DZRA 3GJSA 3WLIA 3EZ9A 4HVCA 2DRIA 1JLLA 1MEJA 2KE5A 3KAKA 2Y76A 2F64A 1WXQA 3FWHA 3QJ5A 4K6MA 4PNZA 1J06A 1BKYA 4P32A 1XEWX 2FWIA 5JMTA 3RTCA 2JAOA 4BNWA 2DUMA 2GO7A 2GRUA 2G6BA 4WE3A 2EC5A 4D8YA 5IJZA 4PGAA 4XQGA 5C8YA 3IOBA 3I6MA 3ZVLA 2N42A 2PFGA 2GFHA 3WLOA 5LVAA 3X1KA 1YVUA 4UM8B 4BTEA 5C31A 4BRWA 2QLJA 2BEJA 3HY3A 5EN4A 1DCKA 2DGDA 4DYHA 1E7RA 1LLDA 1QX4A 3MOSA 4AMGA 3K1YA 4HDNA 2I7XA 1H2YA 4B87A 5D3MB 2Q1SA 1DKLA 3DZFA 1ODSA 1TJ5A 1VIAA 2Q8NA 3EK2A 3GOHA 3HUDA 3H1FA 3KDPA 4K9OA 3H65A 4NZYA 2Z98A 2Z4RA 5BORA 4GWLA 3DAOA 2CXXA 1HO3A 3T4EA 5CVCA 3W6NA 4QRHA 4FGKA 5EGNA 2VJDA 3JQAA 1EK2A 3DE4X 5KNBD 3DOFA 5HGXA 4EHHA 3H86A 4PAMA 2W83A 5K0LA 2YHBA 4HWTA 4K6CA 1LDYA 4KXQA 4UNIA 2YJ6A 1AUQA 2QUBA 3HR4A 5DLQC 4CF5A 3T7JA 4REQB 1NYLA 3CZRA 4DJAA 4YRAA 1PR2A 2C9BA 3UFXA 4OQQA 1NVXQ 4X91A 2P0EA 3RJZA 3FGZA 3N5KA 4RIFA 4XPZA 2BGRA 2XKKA 3DUFB 2VCHA 4C76A 1F1JA 1N5LA 1QQTA 1C3JA 5TMEA 2R5NA 1NNI1 1G8JA 2XNDD 2QLBA 1SC1A 3JQ9C 3OM9A 2GO1A 2Y1EA 4HC4A 4CUKA 5LKAA 1UPBA 4IFBA 4KAJA 3DXFA 1Z5NA 2CNWD 3HJCA 3KXLA 3STHA 5KQPA 3RU3A 4XRRA 1CIJA 1R4ZA 1E3JA 1F3LA 2CW5A 1LDBA 4MYRA 1A7AA 5FWDA 1NWHA 3SXJA 1EQ2A 1PSWA 4M1SA 2ZJFA 2KX7A 1P91A 1ZL2A 3U3XA 4ABYA 3FR7A 4DLSA 2ZRIA 5AW6A 3QUTA 1GCGA 4HAOA 4BNMA 5JNWA 4DV4B 1CEEA 4NNJA 2BI8A 5LP6A 4FZRA 4NVRA 3UBTA 3BWYA 2C7RA 3AWIA 1OH8A 1PGPA 1YSCA 1FFEA 4P86A 2ZR9A 3IAFA 3O1LA 3OEHA 4DQ0A 1O9BA 1XD8A 3K1AA 4TKUA 5I7WA 4PYRA 1M66A 4YP7A 3D02A 4AK9A 3QE0A 1L3IA 3MILA 1L2TA 4G37A 1Q44A 2GAFA 4RPCA 1KZGB 2NUPA 3WLRA 3EDYA 1T8YA 4XAQA 4MWTA 3RSSA 2ZRGA 4P4LA 4RZHA 5THQA 4MO2A 2I3GA 3QP9A 2JD0A 2Q7OE 3RTAA 3WIEA 4EJ0A 1F0KA 3PDCA 1I2MA 4ZJZA 2R6GA 2A88A 2FQWA 3OPVA 5JSZB 3IJPA 4E7PA 2NVUB 1WVMA 4O6VA 3V6LA 4TLCA 5DXJA 2JK1A 5DNYB 2AFRA 5JNRA 4IZIA 2GKOA 3FWPA 1QHGA 4TQUS 3UKOA 1EX6A 5BN5B 2DE0X 5KJCA 1CJUC 1J9ZA 3D3QA 3RBXA 1MABB 1UQUA 3D5TA 3ENZA 5BO5A 1G2PA 1HTWA 2Z2YA 4IIYA 4YR7A 3MWJA 3ROGA 5F7OA 3FDZB 3ILSA 3BCUA 1RLOA 3G2OA 1UKZA 4IIVA 4JVMA 1YZVA 2J32A 2FZWA 2NNWB 1QTNA 4JK3A 3WC4A 3DA8A 3E9QA 2NV0A 3PDIB 1E2JA 1LRLA 1GZ5A 3WHPA 1P4RA 1R6DA 1XVUA 1XZKA 2MR5A 4XB6B 5B57C 5CYGA 4CLRA 2X9GA 4JLJA 4X41A 2RGGA 2VUUA 4MTCA 5C1OA 3VA7A 2H5JA 2H7CA 3E84A 4E1AA 1L6RA 2UDPA 1FFXB 4PLWA 1MPTA 3UATA 3H5NA 4Z4EA 2GARA 4F93B 5DBGA 2D2FA 3CUWA 4HNTA 2FEWB 5I7HA 2CNLA 3DPUA 1PLKA 4UM7A 4DIEA 1K8QA 2B2NA 1C1XA 2ZJOA 4FS3A 5CDTA 1ZG3A 2OKGA 3TQFA 4RGYA 4AWXA 5CG1A 4D0RA 2WNSA 2EKDA 5A3RA 1ZR4A 3L7BA 4HAYA 4MZDA 2ZYRA 4NCKA 3VR6H 4F4UA 4G5QA 3OBIA 2IX3A 1L5HA 4ATNA 5KPDA 3WO0A 2XAAA 1Y3IA 1PSZA 1U2DC 3O8QA 3OA0A 4FCCA 3HXMA 2W42A 1BC5A 2ALJA 1QP7A 2M6KA 3JZAA 3PUYA 5CK5A 3VSCA 1RYZA 1Z6PA 3EY4A 4M76B 5CGQB 4RTSA 3UBMA 5K03A 2Y1XA 3B13B 3ZU2A 3UHOA 1Y42X 5ICEA 2OQRA 4JY7A 1XB2A 1ZOOA 3G2JA 3LBHA 1W4AA 1AIPA 3TTTA 1W1UA 2DKOA 3HKCB 1RKXA 2JANA 5CA1B 3IRVA 3HM9A 2BISA 3DTVA 1LU9A 4NE7A 5MHTA 4HYTA 1T1GA 1F2TA 4KYUA 3DDWA 4UDOA 5EKSA 2BZ1A 3TB4A 4EI7A 1Z5UA 4EG1A 10MHA 5LMCA 1CHNA 4ZVPA 3ROPA 3TO5A 4YRSA 2PM8A 1FVHA 3QEJA 4WDQA 3PFWO 3RTDA 1E5LA 2QTMA 5J9FA 4GPIB 3RIHA 5KYYB 3IVAA 5ENDA 4TT3D 4DOMA 3R74A 4OUDA 2O7NA 1GAJA 1PEDA 3IAS6 3BXZA 3CPJB 3U7IA 1TAQA 5ETJA 4LVOA 3SHQA 4EZEA 1K4KA 1SFRA 5LXTB 1GLVA 3FUTA 4BMXA 1A4IA 4X1OA 4BFVA 5JC8A 2BGWA 2WHPB 5EHQA 1G291 2OG1A 2GZMA 3A6HA 3KYDB 4HLNA 1J9GA 4M98A 3SM9A 1H6AA 1ZJZA 4ALMA 2G71A 2IYFA 4YXFA 5HUJA 5M7EA 4MEJA 1CUHA 5DP1A 2Z08A 1LI4A 1UINA 1Y8QA 3BF8A 1TPZA 4FYXA 1OU4A 4WESA 5EERA 3SU8A 2GM4A 1J0DA 1ZH0A 3N7AA 1RACA 2DBZA 1MQSA 3EFBA 3G6WA 4ZODA 1N4AA 4DREA 4ALIA 4B34A 1US8B 4C7MA 1KZYC 1XTPA 3UZUA 2XAUA 5L4NA 5FBHA 2ZRNA 2R11A 2G63A 4LZWA 2PAFA 1NPYA 4QJBA 2JF0A 3LLUA 1H9AA 2C8LA 5IFLA 1HYQA 4I99A 3KTAB 3HMQA 3KWMA 2W93A 4TKLA 5FEUA 2OQVA 1IQ0A 4CMIA 4A0GA 2I9KA 5IEBA 3RSOA 3AIKA 3ZQJA 1YJCA 2P68A 4LX0A 2CEAA 2ZI5A 3TVTA 3NT5A 5A4JA 1C8LA 3GLHE 1A8PA 5FOXA 4Q7LA 4X0EA 1SVUA 1EWRA 4MK4A 3CTMA 3TNDA 2ISQA 2XCIA 1FXWA 5LLTA 1KO4A 1AVTA 1OREA 1GA1A 4FLEA 4E94A 3EZ2A 2OBNA 1B8UA 1T6YA 2HQRA 2JLBA 4R5MA 1AMNA 3I2FA 1J2TA 3P4UA 3GQBA 3VYSB 1NPDA 3M8KA 4EG6A 1G3IA 1Z4QA 2ZSJA 2RD2A 1FMFA 2R44A 1ODIA 4H31A 1FDSA 1CEXA 1QLHA 2R6ZA 4P0TA 4OQZA 3X1ZA 2IHUA 1WHTA 3ONNA 4DPLA 3LKZA 2J1LA 3NV7A 3L4JA 1NVTA 4HTAA 2I6GA 5T67A 3PYLA 1SUPA 2ZJAA 1XN4A 3I05A 1GVNB 3LBNA 4Q19A 5EIBD 2HZ7A 4BQNA 4BNUA 1S2MA 2FPXA 4G25A 4K03A 1K8XB 1R3DA 2Y6VA 3EFHA 1VG9B 5K3EA 3EF0A 4Y2GA 5KTMA 2H5EA 1QC5A 2YVAA 1DC8A 5T7BA 1OB2A 2IS2A 2P6MA 3F3KA 1WQ1R 2FR0A 4PRYA 2GCOA 3UOAB 2Y4OA 4P35A 4I2VA 2H0AA 4I6EA 3LY9A 1S0UA 2Y0BA 4LTNA 4GEKA 4U7GA 3TD2A 1AQLA 2GT1A 1V8BA 1IN8A 3OZXA 5FNVB 4AIIA 4F04A 2BMWA 1N5KA 3TZHA 3CXRA 2HMSA 2JATA 4FEYA 4UUQA 3DS8A 4YIKA 3ZDCA 5ED4A 4DFDA 1N6OA 2ZIZA 4DUZB 4JBLA 5HR5A 1QVVA 2BZGA 4HDMA 4PX5A 1Q57A 5K8JB 3HKDB 2GNOA 2QD4A 2EV9A 3QWIA 4RA6A 1JAHA 1P0IA 1WNTA 2QUZA 3AINA 3ET4A 1COZA 2ZJ4A 1K6MA 3N2KA 1ZPDA 1R5JA 2Q4TA 1DJNA 2W6ZA 2Y93A 4IIFA 4QUJA 4FGUA 1WVGA 2B1RA 3SD7A 4BYGA 5D5QA 5LQCA 2PUJA 1J8DA 2XDQB 4NV0A 2EKQA 4C4YA 5K0TA 4QOJA 2ZBQA 3VUEA 3Q8KA 3K6RA 1RFGE 3RLFA 4G0VA 2C4NA 3JPWA 4MGIR 5THKA 3TB6A 1LS1A 2HCBA 3P2MA 1M6WA 2V55B 2QN6A 4X95A 5H5JA 3AEKB 4EHJA 1Y33E 1AB5A 1PJ2A 1M34B 3AL2A 4UHHA 2ZXUA 3UAWA 3S29A 3W4KA 5HZKA 2VH2A 1JNYA 3QKTA 1QCDA 4FLFA 3K9FC 4OP1A 3MTAA 3GRVA 4G3XA 2KSQA 4QGFA 3M81A 2CMDA 2J0EA 2O3UA 3HXTA 4OQDA 3MK31 1HQCA 3NM5A 3LCCA 2FGJA 1NXVA 2WSSD 4PHFA 4C6RA 5FBQB 1K3TA 1FTSA 4DMCA 1A5TA 4OGKA 1X42A 2HZBA 5EQTA 1XXLA 4NAUA 2O2HA 5LMNB 1N6RA 3KE9A 4B6GA 3Q2IA 3K6SA 1XQVA 1GGJA 1ADFA 1G1MA 3QU7A 4F6RB 4HFRA 4G1FA 3G9TA 2YV5A 1W7AA 2X1LA 3S28A 3ZN2A 2BE9A 3T4XA 1YD7A 2FW9A 4X6UA 4X94A 2B6HA 4ZI7A 5BVGA 5EKXA 3TZEA 3W0LB 2NO9A 4FS8A 5KTRA 5DHQA 3N1UA 5B36A 1D6SA 4HJRA 2FZVA 1QK3A 4GR9A 2F1RA 2XYRA 4RY0A 4UNPA 3VR3A 2HHCA 3NNSA 2FFBA 3KQVA 5AJUA 3EZYA 5JLJA 2C84A 2RGUA 4YMVA 5DLDA 4RMNA 2PTGA 4J9UE 2EKBA 1NLMA 1FXSA 1Y3HA 1MH9A 4W63A 4R7TA 1YBAA 1C9MA 4WT7A 3IKTA 1I2AA 1X1AA 1ZU5A 3CF2A 1NURA 4US1R 1EIZA 5M29A 3H3FA 1DWQA 1FUIA 2VDUE 3R7LA 1U2GC 4FEAA 1BQEA 4UFOA 4F3YA 4G2NA 1QHXA 2FWNA 2A2ZA 3OZGA 2C42A 1TM5E 4EABA 5AJVB 3Q8MA 2XUKA 2OGTA 1GPNA 1AKUA 3CIFA 1T15A 2A1TS 4EX7A 4Q9NA 4DWVA 2RHMA 1YCHA 3A9RA 3RC3A 5JVDF 2CK3A 3VKVA 1ETUA 1J5XA 4S1PA 3RABA 4CU2A 4AS3A 1O03A 5LDHA 1G21A 1T4CB 2FZ4A 2QQGA 1M8KA 2OGZA 2V3VA 2GD0A 3L0IB 3SHTA 1VE1A 2V4UA 2C2XA 4JEIA 1E8MA 6PFKA 5LQAA 5D86A 1Y6FA 4KLNA 1JAZA 3M49A 2BUCA 3GIDA 2EWVA 5DI3B 4DUYB 4DE5A 2D54A 5EJFA 4A23A 4YUAA 4XFDA 5JSKA 1LV7A 2G9NA 1LD3A 2I7DA 3EIEA 3QBDA 3HWRA 3OBBA 1OYVA 1KAMA 1MFZA 1Z45A 1RWVA 1P6XA 3AEYA 5IVHA 1A9YA 3KUDA 4QUGA 4JVNA 1QVAA 2AG6A 2BCEA 1GL6A 2XGMA 4MQ5A 1V6SA 4M60A 4OFWA 2HDOA 1LGYA 2WMDA 3N2ZB 5KVAA 1JHRA 1ZY2A 3GRAA 4MKHA 1AMOA 1SBZA 3SYTA 4WFQA 3RYHA 1OX6A 3S7TA 3D2BA 4B3BA 3RC9A 2QRNA 1YQEA 3I0ZA 3UJ3X 1G3MA 4MI6A 5SV2A 3NWJA 3O91A 2ZS8A 4JEUA 1TZJA 5UKDA 1H85A 3NR2A 4OCZA 4KFUA 3U44A 4IMIB 5T3UA 2DETA 1ZNYA 2Z5VA