2E5WA

Crystal structure of spermidine synthase from pyrococcus horikoshii ot3
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
280
structure length
280
Chain Sequence
MRDMEFIEWYPRGYGVAFKVKRKILEEQSEYQKIEVYETEGFGKLLAIDGTVQLVTEGEKSYHEPLVHPAMLAHPNPRRVLIIGGGDGGAIREVLKHEEVEEVIMVEIDKKVIEISAKYIGIDGGILEKMLSDKHEKGKLIIGDGVKFIEENSGFDVIIVDSTDPVGPAEMLFSEEFYKNAYRALNDPGIYVTQAGSVYLFTDEFLTAYRKMRKVFDKVYYYSFPVIGYASPWAFLVGVKGSIDFMKVDAEKGKKLGLEYYDPDKHETLFQMPRYIVQML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable spermidine synthase
publication title Crystal structure of spermidine synthase from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 85
structure length 280
sequence length 280
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 2e5wA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2e5wA02
3R0QA 3GCZA 3KQVA 4YUYA 3NW9A 3K6RA 3T7TA 3ME5A 2PXXA 3R9XB 2AR0A 5H02A 1U2ZA 3S68A 4MIKA 4DZRA 2Y1WA 3UZUA 5LQRA 2G72A 5B1SA 2IBSA 3B7PA 2PT9A 4CWAA 5DLYA 3I64A 5HIJA 2NXEA 3FRIA 2XYQA 2GS9A 4DKJA 3FUTA 2ERCA 2PJDA 5CVUA 4C07A 2JHPA 4YUVA 2F8LA 1QAQA 3DR5A 3HEMA 2K4MA 1I4WA 4KW7A 2UYOA 3E7PA 3MCZA 5DWQA 4DQ0A 2P8JA 8MHTA 2FYTA 2O57A 4PYOA 2O0LA 2EFJA 2P3QA 3LX6A 3NWBA 4WVLA 5K0BA 1RI5A 2ZVJA 4FP9A 5E1MA 3KU1A 1X1AA 3DH0A 1AF7A 3HVKA 1IM8A 3NWEA 4PCLA 4FSXA 4RX1A 5FA5A 2PSSA 2H00A 3G5LA 4XUDA 1JTFA 2AN4A 4P58A 5BXYA 1D2HA 3P97A 4FR0A 3DXZA 1M0EA 1JG4A 1XJ5A 4YMGA 4KIGA 5T6BA 1WY7A 3BGDA 1AV6A 3X0DA 3LECA 1KHHA 4X41A 4OBWA 5M5BA 3A7DA 5EIWA 2Z6QA 4A6DA 3FUVA 5IKMA 5GIOE 1RI1A 3BWBA 2JHAA 4L7VA 3P9NA 3UJ7A 4BLUA 4EQZA 5KYGA 3EEOA 2VDWA 3R3HA 1RI4A 1BHJA 4QQKA 2AOTA 4BY9E 3PFHA 5EKXA 5FUBA 3E8SA 5HIKA 1FP2A 1SVUA 5DSXA 2PLWA 1YFJA 5LR6A 1R74A 3PLAE 2B25A 2HR1A 2Y1XA 5EMMA 3GWZA 2IH5A 1P39A 4E2YA 2JH9A 5IH3A 5G02A 1P91A 2PBFA 4RTJA 4ER5A 5LQJA 2AOUB 5EOVA 2OB1A 3GO4A 1WS6A 3RODA 5D1NA 3VC2A 1QYRA 3EVEA 2ZZNA 3B3FA 3MHTA 4Y2HA 1EIZA 5EGSA 2PWPA 1JG3A 3FUUA 3RW9A 2G71A 4E33A 3HVJA 2YR0A 4RTOA 4RSRA 3I5UA 1M6YA 3M4XA 4U7PB 5DRYA 4PCAA 4PYIA 3B3JA 2P3LA 3M6WA 5LSAA 4GEKA 1ZKDA 3HP7A 1WXWA 2IGTA 3FPFA 3LDGA 5MHTA 3EVGA 2PXCA 2I7CA 3KQMA 2FRXA 5EMJA 5FWDA 1YFLA 1RJDA 3LBYA 2FCAA 3K0BA 1NT2A 2H11A 5DTQA 3CGGA 3UA3A 3ELDA 3M70A 4CKCA 4HC4A 5GP1A 3MQ2A 2ADMA 3LKDA 4M38A 5E9WA 2OKCA 3SSMA 2BH2A 2LD4A 4MQ4A 2BR5A 2AS0A 4M7RA 4O29A 5DM1A 1MHTA 2B2CA 1QAMA 2ZZKA 5K0JA 5GIPE 2O06A 2VP3A 3SVZA 1RJEA 3G7UA 2H1RA 5EIFA 5LQNA 4R6WA 2P40A 1L3IA 5HEKA 1ZGJA 4XCXA 3LCVB 1SUIA 5GM1A 5FQOA 1TW3A 3EGIA 1ZQ9A 3BZBA 3L8DA 3VC1A 3HCCA 2BM9A 1NBHA 5KQSA 4X60A 3M6UA 3Q7EA 3P2IA 2V74B 4AUKA 3EMBA 4NECA 3BGVA 4CXMA 4V0QA 1JSZA 3SMQA 2B3TA 4GOLD 2QM3A 3WSTA 3MGGA 1G8AA 2QY6A 1KPGA 2ZCJA 1YZ3A 3DMGA 3KR0A 4ER3A 2EJUA 3F4KA 2ZIGA 5K03A 4C04A 1M6EX 3BT7A 1Q0SA 3T0IA 3TOSA 3AY0A 3DP7A 3I53A 4FGZA 1X1BA 3DXXA 4POOA 3P9IA 5DM4A 4AX8A 2QRVB 4F86A 2HNKA 4QTTB 2ORED 4GBED 3DLCA 2AVDA 3I9FA 4BP1A 3THSA 1IXKA 2B9EA 3O4FA 3FUXA 3GDHA 4QDJA 5DX0A 1YB2A 2YX1A 1L3CA 3LKZA 5HIIA 3DTNA 4PYNA 3SXJA 3AXTA 3GXOA 2UYQA 1YUBA 5HFJA 1BOOA 2R3SA 3LBFA 5P8WA 3I58A 4EVIA 4WXHA 5F2OA 5DM0A 5BP7A 3BWYA 2UYCA 5KQRA 1JQ3A 3SR4A 1NBIA 5E1BA 2AOWA 2PGXA 1SG9A 5E8JA 3C0KA 3HVIA 2WA2A 3VSEA 4F84A 3A27A 4ISCA 2QYOA 4PIPA 1UWVA 4U7TB 3SM3A 5CCBA 2I9KA 1R8YA 1DCTA 2BZGA 2FHPA 3UJBA 2ZW9A 2G8NA 5FWAA 4PGGA 3CC8A 2IDKA 3HNRA 3GRYA 3E23A 2ONZA 4KWCA 4QTUB 4RTMA 5K0FA 2IP2A 2EJTA 5FQNA 1T43A 4HTFA 4BLWA 1KR5A 3AWIA 5DTMA 3REOA 3CBGA 1B42A 1R8XA 4GC5A 3OE5A 3VYWA 4ER7A 3P2EA 2JJQA 3KQYA 3G8BA 1NKVA 2P41A 2PX4A 4LWOA 4RVGA 2ZTHA 3TM5A 1RJFA 5BW5A 3IYLW 4X61A 7MHTA 1P1CA 2NP6A 2AOVA 5FHQA 4AZTA 1XVAA 1QAOA 1L1EA 1WXXA 1JSXA 3KHKA 5DPMA 4OA8A 2HTEA 3NMUF 3SX0A 3UJCA 1F38A 9MHTA 3TMAA 3B89A 4QDKA 2V7EA 1JG1A 4RVDA 4XUCA 3C3YA 4JXJA 4E30A 5HOQA 2OB2A 3ORHA 4GOMD 4K6MA 3O31A 4M37A 1Y8CA 2ZBRA 3BKXA 4QVKA 2GH1A 3FPHA 1RI3A 3FZGA 3HCBA 3P2KA 4P7FA 4RVHA 2CMGA 3FPEA 5EHGA 3HCFA 2OBFA 4RTKA 4ER0A 3UBTA 3LDFA 3P9KA 1F3LA 2PV0A 3UWPA 2R6ZA 3KQWA 2A14A 5K8VA 2PY6A 4QVGA 3THRA 2P7HA 5E9QA 1WZNA 2JHCA 4QQNA 4RTLA 5DM2A 3EGVA 2PX2A 5ICGA 5GM2A 3PTAA 1NW8A 5ICEA 2E5WA 4PNEA 3HA7A 3MERA 3EEYA 4IV8A 3BXOA 4DF3A 1L9KA 4PYKA 5GINE 2Z6UA 3BWCA 2NXCA 1XCLA 3OFKA 3IEIA 3UJAA 3EGEA 4E32A 3HM2A 3A26A 1VP9A 3NVKI 2BR3A 2QE6A 3CJRA 3TFWA 4IKPA 1JG2A 1NW7A 1AQJA 3G88A 1D2CA 1G8SA 4PYJA 4R8RA 3OFJA 4DM3A 2OY0A 2ONYA 5K01A 2AVNA 2NYUA 3QV2A 4HSGA 2ZULA 5DX8A 3GRUA 3HVHA 1OR8A 5CVDA 1KYWA 3C3PA 2C7QA 1X1DA 2I6GA 3LL7A 5K0EA 5E9JA 1NW3A 2PT6A 3RIEA 5LQKA 2AN5A 3EVCA 1ORHA 3OZRA 5DTRA 2CKDA 3MCTA 4R05A 3LHDA 3Q87B 5CVJA 3UJDA 1DL5A 2P1DA 3LSTA 3FYDA 2AOTB 4QPPA 2KW5A 2OPBA 4OBXA 3A25A 2JH8A 3ER9A 3C6KA 3G2QA 1YZHA 2IPXA 4GC9A 3HCAA 4GF5A 5E2BA 1KIAA 3HTXA 2YQZA 2YXEA 3CJTA 5EG5A 3FTFA 2NXJA 4HH4A 3OU7A 1NE2A 1N2XA 3PB3A 4MHTA 2NXNA 5EKUA 1G6Q1 4HG2A 3BKWA 5F2KA 2DPMA 3GGDA 4IV0A 3P71T 5EHIA 5EZQA 5EMKA 3DULA 3E05A 1IY9A 3D2LA 4LWPA 2PKWA 4DA4A 4OX9Y 2VDVE 1VP3A 3U81A 1R6AA 3DUWA 3TM4A 4F85A 1XCJA 3OPNA 3LCCA 4FT2A 5C0OE 10MHA 1NW6A 1N7JA 3FPJA 3G2OA 3GJYA 5EC8A 3EVBA 2NP7A 2OYRA 3NDJA 3B3GA 5FHRA 2Z6AA 5FTWA 1I1NA 1P1BA 1NV9A 3FRHA 5DSTA 5CCXA 1TPYA 2PWYA 5CIYA 5LQUA 2GA9A 3LDUA 5K05A 4E70A 1ORIA 3EVFA 1ZG3A 3V8VA 4RV9A 1SKMA 4OQDA 2HV9A 2ZSUA 4C4AA 3LCUA 1SQGA 3PT9A 3TQSA 3JWIA 2FPOA 3O7WA 2GLUA 1VBFA 3A7EA 1HMYA 2IIPA 4BP3A 3HA3A 4PWYA 5HZMA 3KPUA 5FADA 1FPQA 3KR1A 4EK9A 3ELUA 2JG3A 1N7IA 3GNLA 2IFTA 1DUSA 1NV8A 2OZVA 3R6TA 4LECA 4Z2YA 4A6EA 2CWWA 3ANXA 1G38A 4MTLA 3M6VA 3ERCA 4V0RA 4EKGA 3BUSA 4GOOD 4GOND 1KXZA 3EMDA 4B17A 5CD1A 2C7PA 3GRRA 4HGYA 5DRTA 3T7SA 2O05A 3M6XA 5U4XA 4RTQA 4RTSA 2IDJA 5E2AA 2OO3A 4UOEA 2C7OA 5EZSA 3A4TA 1UIRA 4PYQA 5KS2A 4HGZA 3OU2A 2AOUA 3FUWA 3IV6A 2XVMA 1FBNA 2HWKA 1RJGA 1PJZA 3ID6C 5EPEA 3DXYA 5E1DA 4OA5A 3KQQA 4CKEA 3FYCA 3CCFA 3OCJA 3TPZA 2ZBQA 3M33A 2WK1A 2ZZMA 2ZLBA 5EVJA 2XBMA 3KQOA 5F2NA 4DCMA 3DMHA 4YUXA 1FP1D 2IH4A 3V97A 3ELYA 4KRGA 1R18A 4CTJA 2P7IA 3UA4A 3HCEA 1HNNA 4CKBA 4RTNA 3NJRA 2ESRA 3EVDA 5EQJB 4AZSA 2GAFA 4MWZA 1EAMA 3KPWA 3AJDA 5HILA 1V39A 4ATNA 3TKYA 3TRKA 2FK7A 3BGIA 1QANA 3CVOA 2IBTA 1PRYA 2XYVA 5FA8A 1G60A 4X63A 5K0NA 4PONA 5HIMA 4AZVA 3FTEA 1L3BA 1R00A 2CL5A 4AZWA 3MTIA 5T64A 4RWZA 4RTPA 3BWMA 5K09A 1JR4A 3OZSA 5JUWA 5LQAA 4OQEA 1SQFA 1XDSA 3GU3A 2VS1A 3EVZA 5DXAA 3G89A 5GWXA 1Q0TA 4RTRA 1RI2A 2ZFUA 3KPVA 4KVZA 5BW4A 5C9ZA 4PINA 1VPTA 1D2GA 4HTFB 5K0GA 3NVMB 2BM8A 3UFBA 2PVCA 1EJ0A 1X1CA 3LGAA 3TR6A 1YF3A 3NTVA 4C08A 2HMYB 2VZ9A 3UJ9A 1MJFA 5JR3A 1FJXA 2QRVA 1BKYA 2PX5A 3KQPA 3MAGA 3PFGA 5CVEA 2YUIA 3TLJA 4DCGA 4EKIA 2GPYA 2UYHA 1SUSA 1UFKA 2I62A 3HCDA 4YMHA 3KR9A 3UJ6A 4H0NA 3MB5A 4R8SA 1VL5A 1I9GA 4E2ZA 3JWHA 5GOZA 5EMLA 2YXDA 4E31A 5DX1A 2PXAA 2P3OA 2ZBPA 4EMSA 5K0LA 4PIMA 5FULA 4FS8A 4QPNA 3PVCA 4PGHA 5E1OA 5T67A 3SGLA 1KPIA 4KIFA 3KPYA 3C6MA 1VLMA 2ZIFA 5FCDA 4DMGA 1XXLA 1EJ6A 3KPJA 3OE4A 4LG1A 4BLVA 1NW5A 1O9HA 4YV2A 3FTCA 2C7RA 4FT4A 5E8RA 4C06A 4E2XA 2O07A 1VIDA 4PYMA 3OU6A 1XTPA 3G2MA 3EPPA 4FSDA 4PYLA 3UJ8A 3KQTA 3R24A 3DLIA 3EVAA 1EQAA 1KPHA 2G70A 4YV1A 4YUWA 3CKKA 1XDZA 2ZWVA 3GRVA 3OZTA 4YV0A 2VDUE 2YTZA 2OXTA 2AOXA 2AZTA 5EEGA 4C03A 3TKAA 5ICCA 1VE3A 1VQ1A 1INLA 1G55A 4R6XA 4ER6A 2PX8A 3FTDA 2YVLA 3DOUA 5D1HA 2N47A 3ELWA 4KDRA 1H1DA 4RVFA 1JQEA 2P35A 5CM2Z 1JTEA 1O9GA 3HA5A 4FZVA 2B78A 5DXJA 5ICFA 2ZWAA 3SSNA 3NDIA 2IH2A 4ZTBA 2UZ4A 2CMHA 3G2PA 4HRAA 4KDCA 2EX4A 1TW2A 3GIWA 1ZGAA 5EEHA 5K0CA 2G1PA 3ER8A 3FPGA 1KP9A 2XVAA 1O54A 2YXLA 3G8AA 3G5TA 3H2BA 3P9CA 4G56A 1KYZA 2FK8A 4P7GA 4P7JA 4X1OA 1JQDA 1EG2A 1ZHFA 3JWJA 2BR4A 1Z3CA 5CVVA 4YUZA 2XYRA 5C1IA 3T7RA 3PX2A 3KKZA 3PS9A 4Y30A 4XUEA 2AN3A 2GB4A 2Q41A 4CTKA 4GUAA 3GRZA 4M36A 3MTEA 3B5IA 4P7KA 3QOWA 3KQSA 3LPMA 1XDUA 2DULA 3JWGA 4GQBA 4RYLA 5KVAA 3DMFA 4IWNA 2WA1A 1WG8A 3QOXA 3P8ZA 5DT2A 1QZZA 3AXSA 2EG5A 3SSOA 2ZIEA 4E2WA 3IHTA 1X19A 3PX3A 1BC5A 5ERGB 5LQCA 1AQIA 3CJQA 5CUQA 3KR2A 2NNWB 4C05A
chains in the Genus database with same CATH superfamily
4DZTA 1UP7A 4LF5B 3QNMA 4IW3B 1YZLA 1H2WA 1XEWX 2BTQB 2WJVA 1E69A 1U2ZA 2Z0MA 3BB1A 2Y1WA 5T8KC 3IPXA 2ZJ6A 2EAUA 3GFVA 3Q9SA 5LQRA 1TCBA 2GNAA 2LP4Y 5KSWB 1D0SA 5DLYA 4E1BA 3I64A 5DGDA 2Y77A 4JUAA 3RT7A 3FYUC 4XWOA 3H5NA 3KHSA 4KC0A 3FFTA 3ULKA 3ML1A 3N3BC 2V6FA 1I2MA 4NNOA 3EIOA 4WY2A 1T2AA 2I65A 4V3BA 4J0KA 1U6IA 1JDUA 2PJDA 2Z4TA 5CVUA 4RY0A 3W78A 1QAQA 1NQVA 3DLTA 1NFFA 1CBUA 2HEIA 2LW7A 4NU0A 2HREA 4TLLB 3DYBA 5JCXA 4TKUB 3D1JA 4B4UA 1BCSA 5EIHA 3NDPA 3RVDA 5K8UA 3DCYA 3ZOKA 5AW3A 5EL0A 2FZEA 5BPFA 1FSZA 1UKCA 1SQ5A 5B30A 3HVKA 1KK3A 5BQOA 1PT7A 2YJZA 4XDGA 4JP8A 4C4SA 2F48A 5A03A 3CR8A 1CUZA 2WV7A 1U2PA 3JQGB 4Y2JA 3KELA 3AZQA 2VRNA 1Z2OX 3LUHA 3NPAA 2MIIA 3T35A 2NZ8A 2YWXA 4GH5A 3C8DA 5BQ5A 3ZS9A 4EF6A 4MX8A 9ATCA 4NZMA 5DHUA 3X0DA 3K5WA 3IB6A 3P0HA 4WCVA 2JLUA 4OBWA 2HBRA 4X20A 3ESDA 3USES 1MU0A 3DC2A 2ECKA 3LP5A 3OCUA 3UJ7A 2JHAA 4L7VA 2Z6QA 1BJRE 2DGDA 1TTTA 3M9XA 2HF8A 3EOZA 1JE1A 1BHJA 1E1RA 3GLHB 3PFHA 1QCCA 3TRJA 3GHYA 1U98A 1M72A 4TM7A 3RASA 5BNTA 5EMMA 2YWCA 2IH5A 2JH9A 3AP2A 3A1FA 4Z4QA 2GPBA 2Y9MB 2ORYA 2FF7A 2PUWA 3JZFA 1NRXA 1QCYA 1TVKB 2HJSA 3B1WA 3G3EA 4J16C 1K88A 2VIIA 1WQ4A 3EA4A 2IYYA 2VTDA 4DLBA 1QG4A 1DJQA 2QLNA 4GM1A 1PL0A 1WXGA 1OA1A 4RENA 5I6DA 3B3FA 3STYA 3D54D 4JLPA 1FVFA 3NC1C 1NUQA 1RMYA 5TJHA 4DMRA 2V9ZA 2VEOA 4KN8A 1F2DA 3SQOA 4Z4CA 1BX0A 2Y2VA 3B6IA 3B48A 4GPBA 3VR5D 5BOSB 1V1MA 2XGSA 2QTWB 1PUXA 5HA5A 4DTIA 4G8CA 1GQSA 1EM8B 3EEIA 3RC9A 3UIEA 3K0BA 4PG6A 3CGGA 4P8RA 2PVSA 2R4UA 1Z56C 5LQDA 3EARA 4RIGA 2ZBEA 3I05A 1P7VA 3MK31 1N3IA 3Q7RA 4LX8A 4MW5A 2VK8A 1Z12A 3O4RA 4RVNA 3K9FC 1JIUA 2FEKA 5K3DA 2IXTA 4BC0A 2P3SA 4UM9B 2OMEA 2WFZA 4YN3A 2HUNA 3KD2A 3MUNA 4EYGA 4IHJF 4IIXA 4UTVA 1DWPA 3JZIA 4JBLA 2ZWMA 5FIUA 5FQOA 4ETMA 4BLRA 2A7QA 1GWNA 5TMEA 1K5GA 2ID9A 2QQ0A 2AKYA 3O21A 4AS3A 4BKUA 2BM9A 4DB2A 4LDAA 2BH9A 1JR2A 1G7CA 1PUJA 1YR7A 1N6IA 1OKKD 2IX9A 3K0CA 1XALA 1JWLA 4NYIR 2NSHA 1IZ0A 4GSYA 1H2HA 3A4IA 2ZJ5A 4Q4HA 3FGOA 5A7HA 3SBEA 1HSZA 2EFDB 1EFHA 4G0UA 3QLTA 3RKRA 3GARA 3SN6A 6PFKA 2H4YA 2B3TA 2C2YA 1BE8A 1BYIA 1M1XB 3QQPA 5ALIA 4WLVA 4G81A 4D3FA 3GRCA 4XM2A 3C1TA 1A7AA 1A4XA 2FSUA 2QT1A 2HU2A 3A4NA 1UPUA 3DP7A 3DXXA 5L40A 5LLTA 4AX8A 2QRZA 2QRVB 2D59A 4QTTB 4L8FA 1U7UA 2O3QA 1GHTA 2C1XA 4QPZA 3WQSB 4X6LA 3PC7A 1VECA 2B9EA 5FOUA 4C0WA 3VNUA 3TSOA 1TM5E 5AW8A 1M2VA 4YRJA 3I0NA 1QV6A 1U8YA 5HIIA 3I37X 1XAHA 3D2CA 1E3QA 2VUTA 1HE2A 4B40A 2JFPA 5JQWA 3H1EA 4EG3A 5BQ3A 4JJKA 5HYVA 2EEZA 3A6ZA 4XVQA 2WF6A 4RJTA 1IY8A 2IYEA 4G3XA 5BP7A 3G6KA 4C3VA 3R6LA 3KDPA 1JEDA 1NBIA 4E3ZA 1QOQB 2B8JA 2CLEB 2IJGX 5F9FA 5A5EA 1CLEA 3VSEA 3RFUA 4UTXA 3TTXA 2V7TA 2PUJA 3A27A 3AO0B 3KC2A 3SM3A 3L8YA 5KAMA 3ZCXA 4ME6A 5JYDA 1GGEA 2GM9A 4KHPB 5ARDA 2H2IA 4MV0A 2AW3A 3HYCA 3NFRA 2CV0A 3O84A 5CGZA 4US2R 1XNGA 2EDAA 3U16A 2RI0A 4BNLA 2KYRA 4JJ6A 4KITB 2ZRNA 4ALLA 2H1OA 2CK3D 3CZAA 3IBTA 6ABPA 4P38A 2Y6UA 4N5IX 4QTUB 4HNAA 5BQFA 2XKBA 3AWIA 4ZQIA 1ZR2A 3ZS8A 1VG8A 2OGWA 1F7UA 1NXWA 4ZANA 1R8XA 5IULC 3OIWA 3Q3JB 3B9RA 2OBNA 1SZCA 2JAXA 3IKVA 3DOEA 4Y6SA 4C3OB 4JT2A 2G9QA 1YSCA 4BNVA 4L8LA 2CFOA 2I2CA 3DC7A 2HBQA 3T1QA 3L6BA 2GESA 4R2WA 1O89A 4AU1A 2WD9A 3MRSA 1T2DA 1H94A 3SSAA 5C80A 2ZQ5A 4IX9A 4D9FA 4N76A 2WD7A 1V5IA 4ZAYA 1RZRD 2HI0A 3OOSA 3OQIB 2RI1A 3PXUA 4UAJA 3LAWA 2QSJA 1YL7A 3CX4A 2NM0A 2EBFX 4XUCA 1PD1A 1T13A 1VC2A 2CLCX 3KSUA 1RJ9B 1N2OA 4H9KA 4PPGA 5G3YA 1XHEA 4DVGA 1L4KA 4RVHA 4R0NA 4U2KA 4H1WA 1N2IA 3ZGNA 4RABA 4NAVA 3WB9A 2O4UX 1PW7A 1S2DA 2A3NA 4OXIA 2EOAA 4OK6A 5KYVA 3SR3A 1N5JA 1L5YA 3FKSD 1CFJA 2OCIA 3L6EA 3M1YA 1Z33A 3OZXA 1YD7A 1P9RA 5BYKA 4NPHA 4NYIQ 4F5DA 2XWSA 4EKDA 1EVZA 1Y1QA 2IHZA 2EZUA 4YT5A 4PHHA 5BRJA 5ICEA 5CU7A 1U2TA 3KKPA 4KVFA 2JASA 3NR2A 3W2GA 4OAQA 2I2WA 3V5NA 2ECFA 2FFBA 1CRPA 1MPTA 1Z0FA 1OZGA 2BEJA 3RTGA 5GINE 3ZH2A 3EXG1 5JYCA 2IITA 1XCLA 3AKDA 1BCSB 3WKCA 1L4MA 3IQIX 4Y6RA 3UJAA 1W93A 2BISA 3UUWA 4ARIA 3ZHBA 3GI1A 2JFNA 1EE9A 1XRSB 4UEJA 2XGOA 2O2ZA 4DPKA 4P5DA 1KDOA 3GP5A 5BUZA 4GOXA 4R1QA 1Q7CA 1VLJA 1QNLA 3CONA 1PHPA 2OGUA 3IURA 3TBFA 3S44A 5JJ5A 2QBYA 1F8XA 3SOPA 3KDSE 4WH0A 1IHYA 4HSGA 2HJRA 3PL1A 2VHUA 5FNVF 3ZV3A 4EHFA 2P0AA 5CNIA 2D7CA 4JI8B 3IIMA 4Q66C 1UPBA 2EKBA 2I6GA 2J4CA 4LC1A 3WJ2A 3VPAA 3X1JA 1NW3A 2NSJA 4MXDA 3GUHA 2A5FA 4J6FA 4X20B 2ZYIA 2BKXA 3EVCA 5FI5A 3U7RA 2CDCA 4W5RA 3M9WA 3ESAA 1P2DA 2CVZA 1IIBA 4MR8A 3G9UA 1RHQA 4N82A 2ZYRA 3O7MA 2X0RA 3VOSA 1JG7A 1UBNA 3B1ZA 1QIEA 3KD3A 3AVUA 2OCDA 2I7VA 2RI6A 4HZIA 1SXQA 1QUFA 3HTXA 5JXGA 3TMKA 3CJTA 3K0KA 2A5LA 3OF3A 1U3WA 2J32A 2V0CA 2G0NA 3C1AA 4RHFA 2NXNA 4TMTA 2G63A 2ZE8A 3KXLA 1LBIA 3W2HA 5C53B 5L4SA 3R9KA 2X7JA 4KPGA 1JAYA 2WMDA 2DPMA 3WRWA 1IE3A 4H4DA 2LZ0A 1GXSA 1IY9A 3F7OA 1K98A 1RVV1 2QRPA 4XSVA 1XMQB 2CVHA 1UXHA 4H7DA 4KV9A 1K9VF 1PR2A 2LDBA 3WKEA 4YUAA 4FGSA 1XCJA 3MLEA 3C7TA 3ED5A 4II3A 7MDHA 4WBNF 3L8GA 1NJFA 3BE6A 3EVBA 5CT8A 4DCPA 4EW3A 1CZUA 5DBHX 1MO5A 2MSDB 1A9TA 1V1MB 1OROA 4YRFA 5I7UA 2P5UA 1DAIA 1SXJC 1GYRA 4DY4A 4QBFA 1FTQA 2WSIA 3IPLA 3D3QA 2XZTA 2RAPA 3CH5A 1J0CA 2TSYB 1Q11A 2WWTA 2C54A 2AMYA 5D00A 4LHVA 1H22A 4U2EA 2J8ZA 4KQFA 4J0HA 2X23A 1M7GA 1U0JA 4H31A 1GA1A 3NNDA 3RAGA 2Z2KA 4JVOA 4CF6A 5FUVA 2NVOA 2EGGA 3O3NB 3AZOA 3IC5A 5FFFA 2WIAA 3FWPA 3K53A 4MRRA 1ZNYA 3KOYA 4ASUD 4MYRA 3PV0A 3JYNA 3GW8A 4MLPA 1WQ1R 2P68A 4GOOD 1JPJA 3TQRA 3WLQA 3P27A 3BK7A 1WW2A 1R9MA 1T8TA 3NALA 821PA 1M5RA 5EHNA 5G4KA 2VXOA 4BJ3A 5LWHA 4W9MC 3BX1A 3AR2A 2HCJB 3KK0A 4A5SA 1EK2A 3O3CA 1AXRA 5CB6A 4PYQA 5EXXA 1XZBA 2WG1A 3RB8A 2PUFA 1XZAA 4OVKA 4H35A 3S7TA 1IBCA 5KU7A 1RRPA 2AMJA 3DDWA 3P0FA 4CDNA 4P3YA 3ASYA 3KQQA 3RJ5A 1ZOLA 4NEGA 3P0JA 3MAJA 5E9AA 2OXIA 2Q0HA 2FEWB 2VSYA 1SXPA 2D2XA 4HNQA 5H4GA 1XZKA 2YINC 3F6EX 1GFIA 1MVOA 1V9LA 3IJPA 5KVCA 5C7LO 4WBSA 2PL5A 3RUAA 2PZKA 4YAKA 1YRWA 3U61B 4N8SA 4FFLA 3RAFC 2DFLA 4WX2B 4X7BA 4XWTA 1GZ4A 1M2VB 3I6IA 1S01A 1JLLA 4K46A 1E7MA 3W5AA 1N8TA 1KS2A 4ZZ2A 3LNTA 3SIPA 3S8YA 1JU4A 1QF6A 1QHHA 2BGNA 4REMA 3AJDA 4DJTA 2VPTA 1C1YA 3ACBA 3WB0A 4DR7B 1PWEA 4C4OA 4ECAA 5JAZA 3PI7A 1I4EB 2J31A 2ZYUX 5D6NA 3SEFA 2HLDD 2Z1NA 5HIMA 3ZHZA 5AKXA 2E18A 5JAUA 2E0IA 5ALSA 4ZZ1A 1D09A 1ID1A 5P21A 4PG8A 3V55A 3Q5GA 4BMYA 2PN1A 3AEUA 3BGWA 1P4GA 1O1YA 2AE2A 3Q2OA 4OG2A 4PN3A 2PRYA 2YZ7A 3H7AA 5BSHA 1X0XA 3EUEA 3PFWO 1GAEO 3AUJB 3CRNA 5AK3A 1JWAB 3RS2A 1IAQA 3ZIUA 4KXFB 2QN8A 5C9ZA 4HNAB 1XCMA 3H5LA 3T5BA 2Q9BA 3T4PA 4AFNA 4MW4A 5TMPA 3VAAA 2PUBA 1VXRA 3CUSA 4GGPA 1DUIA 1OZ0A 1J0AA 2XQJA 2YUIA 3CNQS 3FX2A 3L7DA 1BEUB 4C7JA 2UYHA 2E4WA 5HK8A 4X9XA 1FFSA 1PZHA 3UJ6A 4EELA 4BMZA 3TCKA 5DNCA 4PG5A 2F55A 5GOZA 2GAAA 2XIJA 1ZMBA 3QUSA 4XQ0A 5DX1A 1P1JA 2WD7B 5BRNA 5BOVA 3HPRA 2W71A 4LDPA 3HLKA 2J9XB 4R4JA 3SGLA 2F9MA 3I04M 5D3KA 2NWQA 4C6TA 2QJTA 1PFUA 5L4LA 5IBPA 5B2EA 1ZHHA 1DAHA 1Q1BA 3OEHD 4WACA 1UKZA 4M53A 4F91B 3EIHA 3Q98A 2H1WA 1BQ3A 4PYLA 4V0MA 4TYQA 1G2OA 1PGJA 3BHNA 3EGCA 3I04A 1G21A 2Z95A 4FW8A 4UPVA 1GZHB 5CM9C 4CEHA 2VDUE 4LV8B 5T41A 4UDXX 3A0RB 1EGMB 3AF5A 2H2WA 3IP6A 4DJEC 4PLPA 5SYAA 2H7YA 4MHTA 2VOJA 2JHGA 2RGGA 3TLGA 4M9XA 4Y18A 1TB4A 3LVQE 4HXGA 1GZ7A 1RXUA 2RAVA 4HNHA 2NYAA 3NNSA 1R1DA 2X8WA 2XTMA 4HEA1 3ZFTA 1ZCAA 4MVJI 4YRPA 1YBMA 4LOKA 1ZEMA 2JAUA 4J4TA 4MWZA 1VIMA 1FNSA 4HWOA 2VQDA 4ZOEA 3VNAA 3ZZTA 3HFSA 2WM2A 2ZIVB 1JQDA 3W9SA 5JUWA 3KEMA 4D3ZA 1AK2A 4BCCA 1KO1A 2JBHA 3DEZA 3KE8A 4H0CA 5C3UA 4B7UA 3JU3A 2B6NA 3JVDA 4FI3F 1D8TA 1Y8AA 4QREA 1GR1A 4JI3B 4AMVA 1RQ7A 1P4JA 4DNFA 2QBYB 3ASVA 5CXUA 4P7KA 3IAS6 1KETA 5I3ZA 2HQSA 2GF9A 1FRVA 1ATIA 3BYZA 3HO6A 1L5LA 1COWD 4YRIA 1U7ZA 2FG7C 1GGVA 2FMHA 5AOAA 1TVFA 1RYFA 2P0YA 4AP5A 4DSOA 1ZFNA 1LY1A 4LF8B 4F92B 4JVSB 4HLCA 3ZVLA 4MR8B 3KQVA 1NMSA 221PA 2FH5B 3AIMA 3BERA 4HRVA 2VUHB 3ZVMA 4LF6B 3MTBA 4MVJD 3LV8A 5T3UA 4DZRA 3Q0TA 1Q7EA 5THXA 2G72A 2ZRHA 4WRRA 1U2DC 4U2GA 3THXB 1RC1A 1DO2A 1BEEA 1C3XA 4LXUA 3ZY3A 1AGYA 7ABPA 2OD2A 2XXJA 6REQA 2ZB3A 1XIVA 2ZR0A 4UFOA 4LSGA 2RKWA 1GXSB 2FEAA 3KUCA 3QWBA 1N6PA 2CLHB 3EIFA 2OV1A 4KW7A 4CIVA 1JH9A 2FYTA 5LMZA 4ARVA 2XJ4A 5K0BA 5J2TA 1IFXA 1NC3A 2GFIA 5ALDA 5HJEA 4ZGBA 2QOEA 2NU7A 1GZSA 1KORA 1A96A 3DTYA 3T7KA 1ZWKA 3H2HA 3ADCA 1W5TA 2VJOA 2WSBA 4MCIA 3L93A 3AFIA 5ALVA 1NR1A 2EKZA 4PZEA 1WY7A 5IVKA 1ZJ5A 2XMZA 2KHZA 3RUCA 3WRXA 5EIWA 3GROA 3IVMA 5GIOE 4PO3X 4NG5A 4V39A 4FU0A 3WV5A 4CMBA 2BFFA 3KT6A 2PJUA 4PNZA 4HAVA 1XZHA 3Q2KA 3ABZA 5DE3A 4LI3X 3P5BA 4BNXA 3ORYA 4E2FA 1YCGA 3L8MA 5EJ8A 5JAIA 3DBRA 5G4KB 3HY6A 2ODPA 3GVIA 1MPXA 2IHTA 4QC2A 4PSAA 4PM4A 1W87A 2XTJA 2VQEB 2RMKA 4B85A 4HWPA 2YIDA 2P2YA 2JD0A 1DRJA 2QUAA 4A16A 4HKTA 4JD5A 1JDJA 4R54A 1SUDA 4OHUA 4Z7OB 5I9NA 2DFKB 4HAWA 3I5UA 1M6YA 3CT4A 1B41A 3QEMA 4MCJA 4U7PB 4W7HA 4CCSA 1PVOA 4PCAA 3IAM6 2F7SA 2GT1A 3EW9A 4G5GA 1T35A 5CLGA 1RKQA 3EZFA 3LCJA 3M5PA 4IIVA 1B6TA 1Z4MA 4MVJF 1E0KA 3UTCA 3WLEA 4TLBA 3FNFA 3I52A 3PE3A 4BNJA 4KKVA 3DPSA 5EVCA 1JLLB 1O2DA 4G86A 4JLVA 4Z9AA 3L49A 2IUUA 3SHFA 4GQIA 2K5UA 3UA3A 1QHHB 1H6BA 1RRGA 1AURA 1YDEA 4HC4A 4RY9A 5DHRA 5E9WA 3TIVA 3QWAA 4ZVTA 5TS2A 3VSCA 1C50A 3BDIA 4O29A 3P4YA 3PXAA 3NBQA 4HJXA 2NVWA 1PZFA 4O5OA 1YS2X 3MS4A 4GVLA 4NWIA 5EIBC 3ZV7A 2SICE 1UZMA 1BU5A 4OQNA 1R10A 2QD4A 4PLCA 1RQLA 3H5AA 1U28A 2IHVA 4BQIA 1ESMA 2JGEA 5B2FA 2AXEA 4KN5A 2O1WA 4PSVA 1RBMA 4CM7A 3PR3A 5CB4F 4AKGA 3FTQA 3N8IA 3U49A 2RGDA 3AEUB 3PNQA 4BNWA 3MS7A 4FW9A 2YDYA 2QGNA 2XITA 3RAEC 3RSFA 4H9JA 4D8XA 1PQWA 2CXSA 1G2IA 1P3Y1 5F4BA 4JMPA 3WIOA 4C76A 4BHTA 1WZUA 1A88A 1DIGA 4NECA 4AUMA 1JI3A 4EUEA 4GNKA 4JCOA 4MAFA 2WNIA 4FMDF 4MUIA 1DP4A 1EVIA 5B36A 2C7VA 2Y1CA 3GOHA 3AHJA 3OJFA 3OM9A 5HM8A 1VMDA 4TWJA 3TECE 4PZYA 2GXUA 4YHHB 3IHLA 4D44A 1FTWA 3BDAA 1AGNA 1VE1A 1A8QA 3H5OA 5DNAA 5HF6A 1PR1A 4KE9A 1QFZA 1J2TA 2X58A 1LSUA 3QYPA 4EHIA 4AT1A 2I8LA 4EEXA 4KMOA 1UK8A 2EWMA 6CHYA 4QDJA 4W82A 3WDMA 4MJ7A 1CJBA 4JBXA 4I1OA 3VR6A 1FS6A 3VXKA 2W2NA 1U4NA 2Q7XA 4EGFA 5JRJA 2ZTLA 3E3OA 4G2TA 2AMLA 2G28A 1UKVY 1WZEA 1TD9A 4KQXA 3TRDA 4C6TB 4COKA 5EIAA 4AJJA 2YNMD 5BSFA 4TV8F 4J1TA 3UMJA 4Z0TA 4BXOA 3A6PC 4C1NA 1F12A 1LDBA 3SR4A 1ELOA 1ZD4A 2HW8A 1WDLA 2YIVX 3LS2A 3FZEA 3WGLA 2OYCA 4NONA 1RBQA 5E8JA 2XZDA 2BHNA 4EHNA 2UZ0A 3R3ZA 4ISCA 3B7GA 3TAXA 3EJ6A 1QO0A 1WAMA 2CZCA 3L7IA 1NJ5A 4MITA 5LWQA 1G21B 2ONKA 2R751 2WF5A 1O58A 1ECCA 1B8PA 2ZWOA 4CEHB 3EPLA 3BGSA 5GOTA 3IE1A 3O03A 4TVBA 1F3OA 1UPCA 2BJVA 3WLMA 1DC5A 4DYVA 1SUWA 3TLGB 3GRYA 3SPXA 2H8KA 3FDFA 4B76A 2ONZA 2CLOB 3QUTA 4ADSG 4F6LA 1V26A 1BCRA 3KQLA 3V6MA 3VI4B 1NM5A 3KKNA 1U2QA 1YQ9A 3EMKA 1HG0A 2OC4A 3L7KA 3GLTA 4NMLA 1HBJA 5CDUA 1AKRA 2E6KA 2PZEA 1HA3A 2GXSA 2R86A 1U1DA 3DXFA 4MLDA 2GPTA 2QR2A 1WP9A 4D6YA 1IVYA 1X39A 4I0WB 1FVHA 2HJWA 2XKAA 1B2RA 4J0JA 4UNIA 3V8NA 4DR5B 2G5CA 1Q0HA 2WT8A 2ZTHA 5DDIP 5BW5A 1PJ4A 3H75A 4LE2A 1EP2B 2AOVA 1HDXA 3HP1A 3IUPA 1XVAA 2ZT5A 1QAOA 4QUKA 4AZTA 4Z6KA 3IP7A 3INNA 3Q3CA 1GPH1 2DFVA 4RIIA 1XMPA 2XQFA 4KR3A 2Y1KA 3HABA 4QDKA 3ZY5A 4GXQA 2XEXA 3M1LA 4MQUA 4EI7A 2C7BA 2G5PA 4F8EA 1QP0A 2QWXA 5GPBA 3VOBA 3CX8A 1HEUA 4FNMA 4P7FA 2A9FA 2MMGA 2MINA 3AQ4A 4TMKA 3S99A 5A7GA 3FRJA 3P9KA 1M7BA 1MQ8B 2PV0A 2PRSA 3DAPA 2Q4EA 3EODA 4L4SA 2IYQA 3Q6MA 4YJKA 2ZE5A 2IF0A 2PZMA 1E66A 1T9KA 1VCMA 3A11A 3QHPA 5DP1A 1CQWA 4IHJA 2FUG6 2RBKA 4Z4HA 3PGJA 3RUIA 3N6RA 4M1OA 1VYUA 4Q3LA 4S1OA 2W6OA 3UEOA 6LDHA 5IN4A 3GFOA 4J9UE 3SBDA 3SIRA 4FCTA 4EI8A 1UJ2A 4P4TA 3EEYA 3TVDA 3OEED 1ZQ1A 1M2GA 4NCXA 3V8PA 4OGLA 3NTLA 5J40A 2ZJ7A 3T95A 4EG6A 1C14A 4IDOA 1A9XA 1XRJA 1UBCA 2I03A 3F6RA 5F9MA 1JMYA 2X5XA 1T3HA 1NPYA 2FW1A 4IKPA 1HE3A 1NW7A 3QWHA 4C20A 5J2TB 5EZYF 3RRYA 2NU7B 3AIIA 1PS8A 3T1VA 4PYJA 3LPAA 4CLRA 3NIBA 5EHXA 4OLFA 5JZMA 5M7EA 1AC5A 1XROA 1YMVA 3I1FA 2JLBA 2KE5A 3D59A 3OQJA 3EIWA 2WUEA 4MA0A 2J59A 3B13B 4MOWA 3S70A 1W52X 1XDGA 2PU5A 2WU0A 1O97D 1X1DA 2WYHA 3HB5X 3KX2A 1OYWA 4DLZA 2PT6A 1D2MA 4MS4A 5BVGA 2GPJA 3L2OB 4ND7A 2WSMA 3B6JA 2NOAA 3CF4G 3I23A 3K32A 2BFFB 3PVSA 4RHXA 3IULA 3G5UA 1OVGA 1CEXA 2ZB4A 1QONA 4KQKA 3QSYA 2R1VA 3A28A 2GZRA 2H7CA 2IPXA 3HCAA 2PKQP 3N2ZB 5E2BA 4ZVLA 5H16A 2COEA 5F9HA 1WABA 2JFWA 3DBRB 1NURA 2HXSA 3OU7A 4RO0A 1JHAA 4DA7A 1G6OA 3V6LA 1YBAA 2QQ5A 3D4PA 1TCAA 2CV1A 1USWA 5D2CA 3P71T 4H1VA 1YHNA 2OP0A 1DBIA 1PLJA 5IZ4A 2D3TA 3O1LA 1ZU5A 2H2DA 3COWA 2DPLA 2W83A 3EA5A 4PQYA 3S2UA 2H29A 3VR5A 4QUDA 1T2VA 1TMYA 2A5DA 5ENDA 2YYSA 3QEMB 1OI3A 4E5KA 3UB4A 1MBZA 3R7SA 1NP6A 3JATA 3T9DA 2VQSA 4Z9BA 2ZPAA 3KKQA 5FHRA 2Z6AA 4OOEA 1LQTA 4KCGA 1TPYA 3EQ9A 4NFSA 2IUYA 3ZE1B 4DNXA 1XTSA 2C99A 1R4NA 1JZQA 3BFVA 1H0KA 3KOZA 3PGMA 4ID9A 4MPTA 4E70A 3HXQA 1TADA 5BWCA 3DOOA 1MH9A 5HJ5A 5TQJA 2VVTA 3LU1A 4IUBS 3ZLBA 1SQGA 1FMJA 3VAZA 1GKLA 3ZDBA 3KT0A 4HV4A 2GLUA 4UJ3A 3PQ5A 4ZI5A 1RDFA 3LQ1A 1GCIA 1NVTA 1OKKA 1WULS 4IVRA 4AMGA 2N75A 5A5DA 4BCDA 1N7IA 3IKTA 1QFSA 1ADBA 4PZDA 4GI5A 3HN2A 4JAVC 2D5CA 2CWWA 3IMFA 3Q3VA 2QVGA 5AJUA 5HQJA 3ECCA 3GYGA 3NG1A 1U5CA 2R1TA 4PFJA 3H2SA 5A4JA 3NTOA 5DRTA 3B1FA 1QHGA 4BFWA 1YHZA 4RTQA 7GPBA 5E2AA 2BD0A 5JDIA 1O8BA 3OT5A 4RFVA 2HPVA 4RD6A 1G8GA 5FBZA 1Q0PA 3RYCA 3WLLA 3NONA 2UVPA 2P2DA 2VLBA 3P94A 1ZSNA 4Q18A 5CW2A 3HVUA 1YZNA 1AQ6A 1I2AA 3OCJA 4A23A 4PANA 4MK4A 4EPXA 4C2TA 1JIQA 4A26A 4HAOA 2P4UA 1PG0A 3S2EA 3RCBA 1LKZA 5SYMA 1HOTA 4N39A 1Z2EA 3E3LA 3QI2A 3VTKA 5JRZA 5FTLA 3URKA 1XN4A 4F04A 1MXFA 1N3YA 2NU6A 3BG5A 2XHZA 3JV7A 3HJGA 3ZWVA 1QDEA 4B3JA 2HA5A 1EAMA 1MO6A 3A6GA 3OQ1A 3GLVA 1SUAA 1OXSC 4S1VA 4Q1FA 4Q03A 2V4MA 4BRWA 1KQPA 4TS9A 3NJ8A 4BXOB 2P90A 2FFJA 3KAQA 4NYMR 3BXGA 4ZCPA 3DCIA 4F4IA 5FA8A 4O2RA 3KAKA 4W5QA 3DJYA 4KJZA 4PONA 4Q6WA 3VU3A 4KR7A 2CL5A 1YONA 5FNVA 4HD8A 1EFCA 1PYOA 4EBFA 3P45A 4MYTA 4R1PA 5AVZA 3EZ6A 5BSMA 2XMGA 2CK3A 2EL7A 1JHQA 3QVTA 5JLAA 5L4NA 3A05A 1ZSYA 3DZCA 4EOGA 1CUUA 3CZPA 4BO7A 3PQCA 4LYJA 2QSUA 5HBGA 1A1SA 3L7BA 3ONEA 4PHGA 1FU8A 1O0SA 4BMXA 1BOFA 4MUKA 3AOEA 1B43A 3LZCA 3K3PA 5I7RA 3V33A 1EX6A 2P9ZA 1BCRB 4OAOA 1D2GA 3VNBA 2ZJOA 1OXBB 1VLHA 2BM8A 3FCXA 5J5AA 3T1NA 2JFVA 3EEFA 1YCFA 3GEIA 1UFQA 1IB0A 5HJ7A 2OGSA 4F71A 3H4IA 4BMCA 1RZRA 1G7TA 3OZAA 1D4AA 4MV4A 2HCTA 2RGBA 4TT3D 1NXSA 1L7QA 5KDOA 2FLKA 2JAWA 1BFUA 5ETJA 1QZ3A 5A6VA 1VL5A 4HQ6A 1KL7A 3AVPA 1J5PA 4KU4A 3KAJA 4TZ6A 1IK4A 3UT6A 3BA6A 2M6LA 2YS7A 2P9QA 3O0DA 2E6UX 2X4IA 2ZR7A 3E61A 1T9BA 4FS8A 5ALQA 3UJHA 4UTPA 3WFJA 4RPKA 5K7SA 1NDHA 3L1VA 2EFCB 2J3LA 3CQ9A 3KPYA 1Z35A 4HZGA 4J0GA 3FKSA 4GXNA 4OO3A 3I0MA 3OE4A 4BVHA 2CV2A 3H6HA 4IFTA 4RGQA 2MINB 1KO5A 1LJ8A 2DJIA 3F74A 4IXDA 4B6PA 2QY9A 3MWJA 3BIJA 3R0VA 4CL0A 3UJ8A 2UVDA 1T6XA 2ZJYA 4UATA 3R24A 3DLIA 4UCFA 1KPHA 3GL9A 1JI0A 2B7LA 3OZTA 3BIWA 2QQFA 4LYAA 4QGHA 4UHDA 4EA9A 1V1RA 1ZLXA 1ECJA 3WJAA 4IHJB 4KB5A 5IKOA 2XUFA 1EA5A 4R6XA 2CLDX 2ZUFA 2BHTA 3AP3A 3FMIA 2N47A 3M4JA 5AKLA 5DNWA 5CM2Z 5AICA 5SY4A 3ER6A 1BA2A 1SKUA 1Y9EA 5E2IA 3H11A 3AUKA 5DXJA 1B1CA 1ZUNA 5FOQA 1JQ5A 1XMIA 1X7GA 1JHRA 1A9XB 1ZGAA 2BFEA 2QX4A 3CY6A 1MFZA 3OJWA 3OMXA 5JAOA 1FK8A 4GKVA 4A7PA 4RDXA 2O8EA 4YAFA 3TD6A 4JL6A 1KYZA 2YN0A 2HXYA 3ORQA 2IV3A 1EWQA 4HF7A 3HUNA 4EGSA 1ZESA 3PD1A 3LCRA 3PX2A 3KKZA 4BFTA 2WUGA 1KMCA 2I4NA 4CLRB 4JOQA 4FGKA 2OT3B 2AN3A 4JLOA 4AL4A 4A0HA 4CTKA 3K0FA 3HDYA 3M6LA 1FB5A 2VHVA 4JJAA 4A27A 1RABA 5AXDA 1OAKA 1DOHA 1OGJA 2YW9A 5IYZF 4GQBA 4LXIA 3EDMA 4Z8XA 3GJ8A 1SC4A 4Q4HB 3WYCA 3KZMA 5KWEA 4I4IA 1SVWA 3RYIA 4MS4B 2ZIEA 5BVGB 1TM1E 2Q7DA 2B8WA 3U13A 4NYMQ 3M1AA 1AQIA 2JVIA 3NC4A 5AJHA 4ZT5A 4WE3A 3GCZA 4YMLA 4LCEA 2CUNA 3ME5A 5EFZA 4ZALA 5MGBA 3LO8A 2AFHA 4UAVA 1R6DA 4YPFA 2A4MA 2R1VB 3WBKA 5F1PA 1YIOA 1VL8A 1FCJA 4AWAA 4D43A 3FCEA 4CWAA 1WD7A 1F20A 1G20A 3GAAA 3LY8A 4NEQA 3K8OE 3C6YA 1IBSA 3DYVA 4JKIA 5FUXA 4ZP1A 1FLAA 4BNMA 4MROA 3ABIA 1E8NA 3FMFA 1BA3A 1XLWA 2CNWD 4E1VA 2JHPA 5HGJA 3SQMA 4LVCA 1KE2A 3TL2A 5D6OA 2OLEA 2ACVA 4RD0A 4YMIA 5DLQC 2UYOA 2XQIA 4Y2TA 1T8WA 1TCUA 2E37A 3KTFA 4HLDA 1UBKS 3ROFA 3TLZA 1TTHA 1ZC3A 4FUQA 2EFJA 3JATB 3KOXA 4NQZA 3WFIA 5AFSA 2ZVJA 1R0RE 5AK6A 5EKSA 2ZCUA 5AQ1A 2NYRA 5J1TB 2XOXA 4BFZA 2H00A 3GEHA 4UBMA 5H59A 1R4NB 2O8BA 4DUZB 4F0JA 1DHTA 3LY7A 4OY3A 3H4MA 4OQLA 5K0SA 2PGNA 3RK1A 3JD2A 1OXVA 2PQ0A 3NM5A 3Q9LA 4ASUA 4KR9A 1BVHA 3VR4D 2DUJA 4CR6A 4UBLA 4OATA 4GS5A 1LFDB 3LRPA 1VPEA 4BNUA 4MHSA 4YDQA 4KGVA 4NF2A 2EKDA 3ZE7A 3BWBA 2H48A 2JJ2D 4FVTA 2VKTA 3L82B 5IKPA 3SZGA 5MFPA 1GSIA 4H4CA 4XPIA 3F6CA 4R51A 5J23A 4XIIA 5LR6A 1MJHA 1YFKA 2R1TB 3PRKE 4RHEA 2B4QA 1IXSB 3NHSA 4V0SA 2D0PB 2IYPA 3NEAA 2MTBA 2CLSA 4RKFA 1KTIA 2WPNA 1D8AA 5HWSA 1OB5A 3L5KA 4RTJA 4OP1A 1KDRA 1G4UR 4F2PA 3RYCB 1PDOA 1WUTA 2XE7A 3PEVA 3RODA 4XGNA 3CLVA 3EFOA 2CNBA 2FN8A 2UVPB 2VWPA 4E5DA 2XVXA 3EOBI 1MEOA 1NXOA 2AQHA 4JP2A 3CISA 3MRTA 1Y4AE 1JG3A 3HG7A 1Z8DA 3QJYA 4OJQA 1M6NA 1OXKB 2PX0A 1AQLA 1N57A 2AG6A 3N6VA 3G6WA 4P2GA 1C9YA 1WDKA 1MR3F 1IHXA 4TWAA 5B3AA 1UBRS 5A5VA 3PPXA 1XPOA 3AM5A 4HDNA 3IAFA 4WEOA 4B47A 1W44A 3LDGA 1I4LD 2UZ1A 4MDHA 1QX3A 4KXVA 5ALHA 4UNRA 2E82A 2V7BA 2FRXA 2NU6B 1K5HA 2DBYA 3OKPA 1QK4A 1R4AA 1R6TA 3JQFC 2HLDA 4MAMA 4ZOLF 4RNCA 5TEWA 5DFAA 1U8CB 3W2FA 4B4KA 3ELDA 2Z43A 1O6GA 3LGSA 5AVUA 2FN4A 1BDBA 3N58A 3AI7A 4IUDS 3UXHA 3UY4A 4GEGA 3EGWA 4J0QA 1EXMA 2WB4A 1DI0A 4RULA 2P27A 1P8JA 1AZTA 3ADKA 3UV6A 3GIDA 2W98A 2PSJA 4FNAA 1RJEA 4HWGA 1MG0A 3SVZA 1QP8A 2BW0A 3PHGA 4RMGA 4IZIA 1XRPA 4MWEA 4XCXA 1J56A 5FNVB 1BE0A 4HLUA 5JCJD 3NASA 3LWNA 3L77A 1NBWB 4I1YA 1TI7A 4JX8A 4XCQA 4F60A 4NG4A 1KSFX 5CDFE 1G3MA 2I4TA 4LMBA 2NU9A 3OKAA 5H68A 3RSQA 5JMWA 1KOGA 4GWKA 3ZWNA 4ZODA 3CRRA 1P7WA 4IH4A 5DOVA 4KRFA 4BLOA 4JBIA 1YL6A 4FNGA 3USCS 4RPHA 2Z5VA 3ND5A 4ER3A 3TNFA 4D9BA 1A8SA 1CJCA 1TT7A 2ZIGA 3BBPA 1WR8A 2O2EA 1M6EX 4FDTA 4J7XA 1KSGA 2W2MA 3AVTA 2WWXA 5GJWC 3CINA 1MNAA 2DX7A 3LYLA 3UN1A 4DA8A 1T3ZA 2O14A 1HDYA 5LA6F 1NUSA 2FSHA 3O95A 2C94A 3TTSA 4DM7A 2B35A 1Y7TA 2IHUA 3W8FA 1YAHA 3WGYA 4XJSA 1Q77A 3GDHA 2WQ7A 3UBMA 4JC8A 4N9QA 3RUFA 2XUPA 1RMQA 2Y76A 3OEHA 1HLGA 4ZI2A 1A8IA 4JP5A 1T1RA 3HU2A 2QL7A 5CLIA 3Q72A 1O03A 1SG0A 4LYEA 5JNWA 2BYTA 2W2LD 4OQZA 1U1IA 1FUKA 3S8EA 1KFEB 3MAAC 1Q7GA 2BKEA 4C2AA 1A0OA 3DD1A 2VJQA 3AVQA 1B7GO 1YBVA 2FN9A 3KQKA 1Z5GA 3CV3A 1H2EA 3CLKA 4DMLA 1FVXA 3CR7A 2IZ6A 1CUVA 2DBRA 2EZ4A 3A3NA 5C1BA 1V1RB 2A9QA 2R8XA 3L8ZA 2XHEA 3SYLA 4EKNB 1C8KA 3IV7A 1YGYA 2I2DA 3BORA 2MSEB 3FOWA 4BB6A 3E23A 3H11B 4JHLA 2Q1YA 4D3DA 4DAOA 2Z04A 2NO9A 1ZUNB 1T43A 2A92A 3F7MA 4J8PA 1MX1A 1TGVA 4X5OA 2BFEB 1RS0A 2DP4E 1LK0A 1G5FA 3R4CA 3RE1A 4BN5A 1H1LA 2XX3A 3HH8A 4DANA 2O8EB 3AKCA 1UAAA 3OZVA 1NKVA 3ODGA 3ZY4A 3JYHA 4TTTS 3U09A 4JBWA 2AEFA 1OF1A 3G0CA 1PT5A 3R7AA 1YR2A 3UCXA 1COWA 3RJZA 3Q12A 4JXKA 3THOA 1IATA 4YCMA 1CQXA 1I2CA 1ZUD1 2QD5A 1ODJA 2Y0DA 4RU1A 2JFXA 3K0FB 4DCJA 5B3JC 2IP4A 1WXXA 2WJZB 4KQGA 1CJUC 1LK5A 2CJFA 2FA9A 3GRPA 1RPNA 4L5BA 4MKRA 3DNFA 4MVJA 4IJQA 2V7EA 1Z37A 5AK4A 3RYIB 3WMEA 2VHXA 3EC7A 3EXFA 2DBQA 2Y27A 4IJMA 3EUAA 2RGXA 3ZIAD 3MT8A 4KX3A 4AQYB 1CDOA 2W93A 1G6KA 2AFHB 1A5AB 3FMGA 5JRDS 4DA9A 1MAHA 1MC5A 4ARCA 3FDXA 5DTQA 2LNDA 1N2BA 3R6WA 2HRDA 1RLUA 2X0KA 1CF9A 1Y3DE 3AFMA 1XP8A 2XMSA 1G20B 4BX3A 3ADOA 1WMAA 3ROKA 1X8XA 2PGOA 4WKGA 3V4PB 4OD0A 3PTAA 2QV7A 1CR1A 1NW8A 1LFAA 2OP1A 2PIDA 4PC1A 2WB2A 4K0RA 2DLDA 3MERA 4ZRMA 3C8ZA 3KAPA 2ZJBA 3BXOA 3LUFA 1VCHA 2GFQA 4HYTA 2CF5A 4Q3KA 3UXEA 4QQ8A 3T9BA 3HSSA 1UFVA 3H1BA 4FIZA 3M34A 1P77A 4ZMBA 3IEIA 3ZDDA 5HF5A 2NV6A 3QE2A 2C58A 2WWRA 3DKKA 4BJ1A 2RARA 1QQBA 1Y63A 1Z83A 4JQSA 4IGFA 5AMXA 1IDOA 4A15A 1II8A 1G8SA 4NCHA 1D1TA 3UANA 4B48A 2O8BB 3VSDA 3NBFA 2ONYA 4IPTA 1B0PA 2CMFA 2RGNC 2IU0A 1E3EA 1F2UA 1VHDA 1VE7A 2AV6A 1EE2A 2Z8YM 4MB6A 4X54A 1PNVA 4JIMA 1VCNA 2DQYA 3VKWA 3IDSA 2EC5A 5L8VA 1LLFA 2JLQA 2CL7X 4A1OA 1QIKA 4LFBB 4MMYB 3I01M 4L28A 4L2IA 1KDZA 5LN1A 5INTA 3W3AD 3QPDA 4YY3B 1QU3A 3ZKWA 4F4UA 2Z8YA 1EEXB 5LP6A 3JPYA 4XPIB 3VJMA 4BX2A 4DDMA 3JRNA 1VMIA 2OD7A 1WEHA 1TDJA 1S1MA 2H59A 3CZMA 2BZ1A 2HIMA 1T0BA 2X2EA 4JBGA 3T0GA 1FTSA 2YOHA 4TLCA 1A9YA 3I01A 2B7BA 1DLJA 1VSUA 1KY5A 2N1MA 4IV0A 3WK6A 1ZAYA 2PG3A 2PEYA 3B78A 3EFOB 1HSOA 1L4FA 3D2LA 4R7GA 3V1KA 1RXVA 4YRBA 3CUYA 3LMKA 5LD2B 3H99A 2QKYA 1VP3A 2VDPB 1HY3A 3U81A 3ZXUB 1KIFA 2RIPA 1NVBA 1M2FA 2M6KA 4BRZA 1NBME 3OT4A 4JEHA 4DMFA 3A36A 2FX5A 3V32A 1N7JA 3EZYA 4IIEA 4TUYA 1I6LA 1GPMA 4BV8A 4C89A 5LDDC 2OYRA 1Z7EA 4CMKA 2X7HA 4HDNB 5IXYA 2L0XA 5CCXA 4IEFB 2P9EA 2UZ1B 3PSHA 3EXHC 1WSDA 1LQUA 2C59A 3RIHA 4EJMA 1A4RA 4QELA 4DDUA 4DL9A 4LHXA 2JJ1D 4RLQA 4C4AA 5DK6A 5SV2A 4A4DA 1Z07A 4JXZA 1JAXA 3B2NA 1GZUA 3WNVA 5C1PA 2AE1A 4QUJA 5JAHA 3W6UA 4HADA 4ZCIA 3B6ZA 3KM0A 1PT8A 3MPUA 4KAJA 5LZ9A 2ZREA 1E6UA 3AR6A 3TIXB 1JG6A 1WPRA 1GTJ1 3HACA 4TM8A 5HKLA 2H54A 5E4YA 3ZCTA 4NS4A 4DGSA 3N5CA 4I9GA 4FD3A 1GNSA 2BBSA 4RLSA 1YVRA 3ZZMA 1KC1A 2H7VA 9LDBA 1E79D 2BELA 2JS7A 3GRRA 4YVFA 2NU9B 5B53A 1MO3A 2I6UA 3Q7PA 3D0OA 4JGBA 3W77A 1YFZA 2RB4A 2C61A 3R0ZA 4ZEOA 1E6LA 1VG1A 2IYWA 4X8MA 2WW8A 3DKRA 1V6SA 4INZA 1QYVA 1G17A 1PWXA 2XRYA 3VHXA 2XIQA 1MXHA 5CDTA 3D3EA 2FR0A 3UUGA 4HH0A 4A2WA 1P1IA 1D3AA 1W1WA 4RZSA 2FEPA 4EIWA 4Y9UA 3RS8A 3M33A 3SKVA 4Q24A 3E9ZA 2GYWA 3QY0A 1EZZA 3KBBA 4MSUA 3PRYA 5C34B 3DMHA 5HJ2A 4AURA 5F2NA 2GBPA 3RNOA 2PMDA 1HURA 2P30A 4ENWA 1WUJS 2YNMA 3D8RA 2XA1A 3W6ZA 5LOVA 2D5IA 3UOWA 1QPZA 1EM6A 1TUEA 3F5DA 4ZQBA 1L5NA 2RONA 2DT8A 1H5UA 2DFNA 1AXEA 1TO6A 2B94A 3GCWA 3M3HA 5CFNA 3ZJUA 4MO2A 1SHKA 5EZYA 3QU2A 1PRYA 4FBLA 2DHEA 4CN9A 5AKJA 1G60A 3FTEA 1ODCA 3U7HB 1M66A 1N36B 3ZZ1A 5EJFA 3EZLA 2VYND 1KDVA 3RR2A 1Z4OA 1KTVA 4OQEA 3WQHA 3EWIA 3UYKA 1ITZA 3EVZA 3S55A 1P2UA 2OWEA 4K6KA 4W63A 4KBFA 1E0DA 4XFJA 3WADA 1L4UA 1OU4A 1SXHA 2HRQA 1GA4A 1WP4A 4RTRA 4HMOA 1N9GA 3PHLA 1ZGGA 3D8NA 4DEYA 4LF9B 3CF6R 2AEJA 3T5DA 2XSZD 3GBVA 3PA8A 1KYQA 4QPCA 2QSYA 1NPTO 3COZA 4ZHQB 4L15A 4A8JC 1S2GA 3I9V1 3ROMA 5T4FA 1H1LB 3TD9A 2R00C 4MJLA 2GN4A 4O6VA 4FD2A 2QU7A 5TT0A 3V4FA 2FEMA 1WNFA 4TLMB 3Q8WA 5HOEA 3B6EA 2O2SA 3EH2A 2H2AA 1WXQA 3IPYA 5IP5A 5B6JA 1I9GA 3DPIA 1VCOA 4ZAZA 1W1IA 5EMLA 3HUFA 3VZPA 2UZAA 1OJLA 2X9QA 4EJSC 4P3XA 3CMMA 5C2JB 5FBHA 4KKXB 3BCRA 3VAYA 3R3UA 1WMBA 5A6SA 5E6UA 1QE0A 1OFIA 3EXFB 1KI2A 2VDQB 5CNMA 4RF3A 3A1TA 1OTXA 2CEAA 5K3AA 4B4DA 1JV2B 3KUDA 2B3DA 1O9HA 2WYUA 4YV2A 1YI8A 2ZGVA 3UFXA 2XMDA 2W2XA 4MUGA 4C2BA 1IMJA 2GJSA 1JR3E 4QXQA 1S2LA 2W0SA 3KQTA 1IQUA 5GZ6A 4JL5A 1F0PA 3PC8C 1P7ZA 3OEEA 1FSSA 1FMCA 1U6KA 3STXA 1X7YA 2DCUA 4ZRDA 5CT6A 1W8DA 3U48A 2XTZA 3PC6A 2GZMA 5EY5B 1WL8A 4I9HA 3ROXA 4J75A 2YVLA 3QGMA 4OOFA 1OH7A 5DTEA 2IX3A 2M1XA 4CV2A 1BDHA 2YHBA 1PYGA 2F00A 3C2QA 5ICFA 5ER6A 4YQFA 1RC0A 3PPVA 1C9NA 2NN3C 1OWMA 2WP8J 3AF3A 1S3SA 4MUYA 3SZUA 3U3OA 4CZ2A 4UBNA 4DV3B 1O0BA 3PG5A 5JTUA 2YXLA 1QFYA 1U94A 1VJ0A 2J0EA 3H2BA 2YC4C 1SIWA 5EPUA 4Z53A 2DWQA 3CH6A 4ZC8A 1OD6A 1X1SA 1WCXA 2OV3A 2PKQO 3PFIA 4FMDB 1EIWA 2A9PA 3A1CA 1II8B 5DULA 1OU0A 1UDXA 3D6FA 1XTTA 2OV8A 1CP3A 4KIWA 5GONA 1NWHA 3TXXA 3UAZA 4URXR 4I1PA 2PUDA 1UKBA 3WZMA 2OMKA 9ABPA 3DOHA 1IBKB 1Z2NX 1F2UB 1R0LA 5AI5A 1GGJA 1YIDA 1MJNA 2QDXA 3WOHA 4FLMA 1PJ2A 3D31A 5J5CA 1JMKC 3DL0A 3QE9Y 2ETVA 3PX3A 3SI7A 5CDSA 1ENOA 1Q6YA 2FHSA 1MA3A 3Q0IA 1HE1C 4L2IB 5U4QA 1JLMA 1E3DA 4M1SA 3LVRE 1W47A 2GERA 3ZKWB 4R01A 3UGKA 1G66A 5IZCC 5LP6B 5ESDA 1I32A 1E32A 4J9VA 2H4FA 4JROA 3RFVA 1VHJA 1XD2A 1A3CA 5HIJA 2GVDC 1OMOA 2QN2A 4C7VA 5DO9A 2BAGA 4G84A 1FS5A 2TMGA 4DLAA 3FVTA 4HNGA 4DIFA 3CEMA 1E9DA 2R8RA 521PA 2WKRA 1YL5A 5KDLA 1WW8A 3BE4A 3KYIB 4YUVA 5DK4A 2I80A 4FMPA 3IRVA 1G63A 3S4YA 3W6NA 5BO5A 2O57A 4TUYB 4AF7A 4GZ3A 4QT0A 1RCTE 2HJ9A 3VYTB 1RWMA 1T4MA 2GPSA 1KDTA 2OHXA 4GR5A 3BQ9A 4GVPA 4BPRA 4N48A 1THMA 1V2HE 1PZXA 1XJWA 2G7ZA 2FFRA 3FCOA 4H2DA 4WESA 5EUQB 1PTJC 5ADVA 3CYFA 1XPUA 1PS9A 5H1YA 1E3MA 2YV1A 3TGWA 2XTNA 4PR3A 5JSZA 2G82A 1D0IA 1UEIA 3O8NA 5JXJA 1YZGA 3GD7A 6ADHA 1B8VA 4D3XA 4JH0A 3VO2A 1Z3IX 1L7BA 4YMWA 7ADHA 3EEOA 1NVDA 2FW8A 1KMNA 3V4VB 2VDWA 1RI4A 5JAPA 3E1SA 3FHLA 5EMNA 3PLAE 1DELA 1KFKB 1OXUA 1JDVA 4WOJA 4YPOA 3MNFA 1RM4A 1L7OA 3C3CA 3VTZA 2EV9A 2LRHA 3I5AA 3K4QA 3NH6A 5DYGA 3L46A 4F4CA 3CLUC 1CK4A 4XVCA 5TIIA 2VPPA 3BHJA 1QYRA 4C0KA 4TLAA 1ULTA 2AZDA 3VHXB 4Z8YA 1T6ZA 2ZJZA 3DWEX 5JT1A 3K1TA 4CCWA 1ZMTA 5JXWA 1RP7A 2EJBA 3ZVKA 4LRXA 3OD1A 4MPRA 3T3OA 1UCFA 1V37A 5B1DA 3M4XA 3MYRA 3LNCA 4UVDA 3KJXA 1DTEA 2XWQA 3WYBA 2VT3A 2GKSA 4IYJA 4DV7B 1P72A 4DLSA 1NZJA 2D62A 2OKGA 2BZSA 2ZROA 5FORA 4BCBA 2P9FA 2WQZA 3L18A 3MWFA 5FWDA 5LOVB 4IV5A 1C8BA 3S7ZA 2DKNA 2OBBA 3NHUA 1SBCA 5CLQA 5BN4A 3BQNB 3RSLA 1BVUA 3GA0A 5EZYB 2LD4A 3MFDA 3DQPA 3BRQA 5ALKA 4JFRA 2ZYAA 3BSYA 4KN9S 5DV9A 4Z1MA 3BXEA 4BMSA 2DQSA 3T7EA 5GIPE 4ZVKA 3MOGA 3IDOA 3S8MA 5EIFA 3VR6H 4RS3A 2H18A 3DF7A 3KJIA 1XA3A 3HUUA 3NHRA 2ZUCA 1KVUA 3ROPA 1ZQ9A 3N05A 3C70A 3D6VA 2YZNA 3MMPA 2P9HA 4ND3A 4H59A 2R7MA 2JCGA 1ZCZA 4BLTA 1XB2A 3H5TA 1HRKA 1PJCA 1N9GB 2CUKA 2HK7A 2VN8A 3HNOA 3MBKA 5BYBA 5G53C 5FP0A 4QQFA 2YXNA 2M6RA 1D9XA 1UM8A 3K35A 2AG8A 5DGIA 1KI1A 1UINA 2VJBA 3KYBA 3PJFA 1QHEA 4KN6A 4OIMA 4TT3A 3UMRA 3AILA 3ON5A 1E1LA 5CX4A 2IS2A 5AM4A 1AU9A 4A73A 1DADA 1EGHA 2B34A 3P9IA 4JJIA 2C2BA 3WHLA 5HKKD 2C3UA 1M1NA 2PBRA 2F3PA 2I8CA 3RBVA 1E5LA 3AHFA 2VK1A 2LDXA 1DRKA 4EG5A 2PTGA 4PZ9A 1D4ZA 1JAZA 1NJGA 3PGKA 2QTMA 2QVLA 4WXEA 5TQ0A 4A0GA 4BGEA 2HF2A 3MJEA 5DXFA 4Z4FA 1SPBS 1VA4A 4MUEA 4PAOA 3W1WA 4AIIA 3F9RA 5A6SB 2QTHA 5E6UB 3BWYA 3VU0A 1QORA 2X2OA 2V0GA 4H3VA 1Z36A 4D0RA 3WA7A 3FYTA 1T25A 2JVJA 3K94A 5LZ2A 3UFXB 1NPDA 4EWLA 2H1IA 2INGX 3JSAA 5AKGA 1U0SY 2FPUA 4MI1A 3K20A 3BSWA 1WZCA 4R2HA 3SNHA 1R6BX 3T7CA 1TQ4A 2E4VA 3N0TA 5I7VA 2PE5A 2PLNA 2HYIC 1AH2A 4UM8B 2RGEA 3UMMA 3L43A 4CL2A 2WHEA 1X7YB 1KWGA 1KERA 2RCNA 4K9NA 5FWAA 1COZA 3D2BA 2FP3A 4I1UA 2AN1A 3PXCX 5K1ZA 3WBJA 3WO1A 2F90A 5FBVB 4LJ4A 4ZU6X 3M3DA 2BGWA 3K5HA 4DWWA 1DG9A 4XB1A 1KO4A 1GVHA 2C8VA 4DT1A 4IVNA 3G9TA 2CXOA 3RSCA 3PHHA 4M87A 1TKRA 3G8BA 1EGAA 1TZJA 4KOEC 3T3NA 3AB7A 1RIIA 4MKHA 1EFRD 1OFVA 1OWOA 1SVMA 2JIZD 2QX8A 2PYIA 2W5UA 3OJXA 4GDMA 4IRUB 1T3LA 1VKRA 2JA1A 3HDTA 4KWHA 4QULA 5GONB 2WWYA 1QDUA 2IKSA 1DXHA 2Z4SA 2PUHA 3T3HA 1GSOA 3DOCA 1XYGA 5BYAA 5FFNA 3KZXA 2GDZA 4LDZA 3I09A 4KR2A 2AYYA 4CIXA 4EYOA 4JXJA 1M10A 4INOA 2G4LA 3VJLA 2J33A 4NJMA 4W1RA 4QVKA 4PXYA 4ZOLA 2JKZA 2XTAA 4OGGA 4HR7A 1OBCA 1W5EA 1C3VA 4BP8A 2YC2C 3L6RA 3SC4A 1GRQA 2Y1LA 1IG3A 1OZHA 1ADGA 1TRKA 1R7RA 1ZN2A 2CHFA 3R3WA 1C4WA 4BQNA 4YCLA 4TS3A 5K8VA 1NFQA 1XD2B 3OCWA 3PDHA 3PPYA 3PUJA 5G1PA 3SD7A 1PNQA 2JHCA 3VPHA 2A9KA 1AZSC 1NAHA 1Q20A 2I3ZA 4OQXA 2NNLD 5CIWA 1K7CA 1YR8A 4NE7A 2W9XA 2QZZA 2EFGA 2FGKA 3MJDA 5G41A 4OP2A 3CUEF 2VA9A 3SZRA 3VJKA 5AI0A 1L9KA 3R76A 4NKRA 4IWYA 3L7MA 4FFDA 5DCYA 3AY3A 3T7IA 1XT6A 4S0XA 1KVRA 2IUEA 2N46A 5K8CA 2D2FA 4TQAA 1XXHE 2XMBA 3WA6A 3U3ZA 1K63A 4MI9A 5J5VA 5JCOA 4FOSA 3VR4A 3G2IA 4H1TA 3K0EA 2CXPA 4F9FA 3WR5A 1J90A 1WZIA 4PGFA 4TTRA 4WESB 4B3BA 1RPAA 4YECA 3T5TA 5GTDA 1VKZA 3WWPA 1A2QA 1QBGA 1BQEA 1JP7A 2J85A 2JJ2A 2ZULA 1QQ5A 3HVHA 1OR8A 3Q3EA 4KWEA 5CITA 5JSZB 5HUHA 3TGLA 3C3PA 3GFTA 3KSZO 1XJ0A 2PR2A 2WG2A 2ZUUA 4M22A 1NIJA 1V7QA 3O93A 3VSBA 3NUQA 2PXHA 2EARA 3QLUC 1NIPA 4HRXA 4LTNA 2AN5A 4EJ6A 1ORHA 2BHSA 5DTRA 1L0BA 3Q87B 1RQGA 4YYEA 5LCXA 4CCAA 2QRNA 2VDWB 4RJIA 5IDQA 5IG2A 5JXHA 2F1JA 3I30X 3U9TA 3INRA 2OPBA 5TVKA 3ER9A 3CE6A 2I2XB 3KLMX 4FX2A 3TK1A 1MAWA 2YBDA 2V0NA 1Z88A 3I32A 3NFYA 4Y8VA 1JW9B 3PB3A 4EL0A 4ZGWA 4G01B 5EKUA 5DN6D 3BKWA 5LVAA 5L3ZA 2ZJ2A 3Q8XB 2BV3A 1KKLA 4H7KA 1LVUA 1OT3A 1OI7A 2O5VA 3C15C 2SHKA 1ZLYA 1T2UA 2UYYA 2GKGA 1ZINA 2V4ZA 1WDTA 2UYGA 4OH7A 1RHMA 4L4RA 4B09A 1XMSA 1Y4DE 3B70A 4ZQHA 1JRLA 4HDKA 1XFDA 4ZGGA 1EJBA 3DMYA 2Z5LA 3DV0A 2R8YA 2CHQA 4A2QA 1GPJA 4Z4IA 1LWNA 2HA6A 3ZI4A 1BRTA 4CT5A 5LFAA 3OTWA 2FUCA 3DZKA 1Q50A 3VM6A 5BN4B 1ZAKA 3MGKA 1K68A 3F1LA 2G5GX 4B75A 4CYMA 1RTKA 1Y4SA 3JWIA 5JCJA 2FPOA 3AC0A 1RHRA 2GUGA 4S3MA 4DHEA 4K1XA 1WETA 1Q1AA 4L0CA 4FYJA 1KP2A 3I92A 4JA0A 4S2EA 3V80A 2VBIA 1OGYA 1J49A 2XYGA 4Z2YA 3WLJA 2FRDA 1Q3KA 3EH1A 3G79A 1L5MA 2R9VA 5H9WA 4AC9A 3QMMA 2RB5A 1PU2A 1UANA 3M6XA 5DBIA 3WWYA 2JARA 2JKVA 2PQMA 3R75A 5LB4A 2VG8A 3E7XA 4FGJA 2ZYSA 3CLSC 5DYNA 4YIHA 2OORC 1L5GB 4KVAA 4B3MB 4EW1A 5IHXA 5JBNA 2FPGA 2MOKA 3IQDB 4FN5A 1Y82A 1G42A 2V7VA 3WLHA 2VYCA 4QGGA 5C7YA 4OHOA 4RD1A 4RY2A 4PRLA 2ZZMA 5TQVA 1D5WA 1FEZA 1GDDA 1M1NB 4J1SA 2EIHA 2ORIA 4QXMA 4YK7A 4ESHA 2DETA 4K40A 1M2HA 3V97A 1ZD3A 3WYEA 3Q5DA 1H9CA 1CUXA 1E63A 4LJ9A 4UU1A 3BBLA 2NZXA 2JGKA 1QOPB 3TZCA 2NGRA 3I2YX 2PKXA 4I1RA 5IDVA 3DHEA 5TQ0B 3TX2A 4DSUA 7REQA 5FBWB 2XGGA 4EF5A 2DJ5A 2P11A 1UT5A 2FX3A 2ILVA 3PEUA 2NZ2A 4OHYA 1STOA 3ESRA 5AD1A 1KAGA 4I08A 4Z5XA 4YC7A 5GZ1A 1JBEA 2KI5A 3Q11A 2FR8A 1R00A 3U9LA 2CJPA 5AJYA 5T64A 5K8IA 3RHTA 1IJFA 1ZD5A 5D7BA 4C22A 1DBRA 1KVQA 1RZVA 3ZHVA 1B3BA 1SZJG 2VS1A 2GTPA 3E70C 3O2SB 3FAKA 1BXZA 4KTTE 4IDBA 3AM4A 1ZH2A 1EBFA 4C6HA 3NXKA 1RYHA 4DLUA 3STHA 2QL5A 3A70A 1IL0A 3CIOA 1E89A 3H7IA 1OWPA 1YDHA 2WRZA 3HBFA 1LC0A 3TJMA 4B31A 2VZEA 4BNYA 2NUAA 4EEZA 1QCZA 4I2NA 4PY2A 4WW0A 4ZAXA 5TPWA 4DCNA 2PVCA 4Q3OA 1ZRSA 4DT1B 1M73E 5JNRA 1LZLA 4I5IA 4X45A 1AHPA 1JBKA 1U7PA 2AC7A 4O02B 1FJXA 2AXNA 3LY5A 1UQTA 4V24A 9GPBA 4DCGA 3L8CA 1KH2A 2W2QA 3RROA 2YWHA 2JLWA 2JATA 1JIVA 2ACKA 2OUKA 5KNCH 1GIAA 4XJXA 4C0QC 1C29B 3AI1A 2FPIA 4E31A 4F1JA 3CUWA 3DZHA 2GEKA 1QF7A 1C0KA 3ZIAA 3RJTA 4YRAA 5IPFA 3SQXA 2CVOA 1I14A 4US0R 4PGHA 1JL3A 3GNSA 4Q05A 1EJ2A 3AHDA 2F1RA 3NHMA 5KWVA 1ZRMA 2B4RO 4NABA 3C6MA 1S3IA 1VLMA 5LZ4A 1OXXK 5KZMB 4NJMB 2OBYA 4RUKA 4ZOLB 1C5KA 4BZPA 1PDVA 1T5DX 3S1SA 1NP3A 2MSKA 2O07A 4G2NA 2H4ZA 1C9MA 1SOAA 2IHYA 4PU0A 1XQWA 4Q9NA 3ZW7A 5K05A 1QKIA 3OECA 2C2XA 1QIHA 5HE9A 1EINA 1M2WA 2DEUA 3BSSA 1XLVA 2V8OA 2ZBUA 3E4DA 4LVUA 2UV8A 4C03A 1B15A 2ACEA 5JZ9A 1XCPA 4JIGA 4ARZA 3QSGA 2I1LA 2BMEA 2PKEA 1NVKA 5KSOA 3CW2A 3BS4A 3TN7A 4ND1A 5IM4F 1GQ2A 3AFOA 2HBYA 3THXA 4WCFA 3RVSA 2VHTA 3ZV4A 2XCLA 2Q1SA 2QW8A 2K2WA 4RACA 5EJGA 4EHAA 5BV1A 4G56A 3IL2A 2FK8A 5B58C 5C3MA 2PS9A 1KK2A 2SKDA 5JO9A 3IHWA 1RXYA 1RT9A 3RARA 3WMRA 4EFNA 1ML3A 2JCSA 3M83A 3JYQA 1VJCA 4L9AA 2Q41A 1KQNA 4ZDWA 3LQFA 4ZI3A 4LIPD 2R2GA 5B4VA 4R16A 1PL6A 2EP8A 5BSRA 2QTZA 2OSBA 1NXQA 3E48A 3E5MA 4E22A 1Y4UA 1VLLA 4PZUA 3P8ZA 4PZ0A 2WFAA 1ZM2A 4S1TA 2CBZA 4E5VA 1C8VB 5I48A 1GU7A 4L5IA 3UMBA 5JYEA 5LQCA 2I2BA 2J3MA 5HIKA 3JY6A 3NW9A 4HVCA 1LLUA 4HGPA 1FU7A 4AKIA 4NENA 4EFLA 3LT1A 4DCSA 5FAKA 5FR1A 1V4NA 1H5QA 2AR7A 2Q4BA 2W2PA 5KJ1A 1KC3A 3SX4A 2JFBA 1JFLA 3CW9A 3FRIA 3MSXA 1GEGA 3RWMB 1JHDA 1KY4A 3FNHA 5IBRA 1ABBA 4RE5A 2C2OA 3SFZA 4E11A 4LBVA 4MUMA 3HGQA 3GC6A 1OW3B 4W9NC 5TC4A 5E7QA 3FWKA 3IUNA 1DJPA 2J7PA 4G8JA 1VL2A 1N2JA 4HO1X 3HV0A 2REXB 1OHHD 2E4YA 3GVCA 1NNI1 2D1SA 2V6IA 1PJSA 3QV1A 5BV7A 3FFAA 3OVMA 1NUTA 3C4JA 4LXHA 2FSIA 2JJ1A 2WBLC 2GK3A 4FCVA 1MDFA 1JDPA 1T2FA 2P75A 2PQ2A 4GX2A 4HDKB 3BZUA 1ZVKA 3DH0A 2ZB2A 4M7PA 5FA5A 1I7PA 1ZNWA 2GJKA 3D7NA 3DV0B 4JYMA 3P9RA 3UMVA 1XZNA 3QPBA 4EPTA 2FSVC 5JD5A 4EX7A 1KK0A 2I29A 3D6TB 3U19A 5BXYA 4TL8A 4W5OA 1SVKA 2H9YA 3GVPA 1R64A 4TRJA 1WKCA 5BWNA 3R7LA 1OI2A 2Z9CA 5HS6A 4MICA 1XZPA 2I1QA 3BE8A 2ONJA 3OKFA 1ONOA 3BRWD 3DEAA 1M33A 3A7DA 1SCAA 4MQFA 4B6FA 1E79A 1SEPA 3FUVA 2BGMA 2HK8A 3DE6X 4IZOA 3T1HB 2HT1A 3FLMA 5BSUA 3ZHYA 1DOAA 4HBZA 4D0LB 5IHPA 4I36A 3VMFA 3NM6B 5BQPA 4XYLA 4D25A 2GLTA 3FW1A 2PZGA 1LBQA 1W6UA 3UWMA 3F6YA 2B1GA 3LC7O 4FBGA 4F4DA 5L7WA 4HATA 4CLEA 1CULC 2ZI3A 1F8YA 1KGDA 1P2SA 1P39A 2QROA 4HFJA 4P80A 1FNCA 2GX6A 4H27A 4PLZA 2JAPA 3IDZA 2R85A 1LH0A 4KXMA 4RHYA 3I45A 5I5GA 3ETNA 3R3XA 2QLTA 3D3JA 1RCUA 1FDTA 4TYYA 2H0AA 4PS0A 1Z2PX 2FPGB 3KXPA 1NLYA 2I78A 3TZLA 3UAGA 4ZJUA 2PCLA 4FCCA 1VI6A 1P2FA 1JIIA 3QA9A 4KP7A 2PT7A 4P54A 5KOJA 3H2IA 4M1WA 3SYNA 3DE0X 4B3IA 2UDPA 4AD8A 4HQKA 5T6MA 2EWVA 2C29D 1M34E 2OV6A 3H9QA 3R5TA 1EBBA 2IGBA 2VSXA 4HPJB 4B71A 2CLFB 2WAXA 2FZKA 1AZWA 5MHTA 1SCNE 4L73A 4HWTA 1EFLA 4DG9A 7REQB 5F1KA 3ZCVA 1R5NA 2OAP1 1LBEA 3ZGYA 3NHLA 5KNLA 1A71A 3CVYA 3CNHA 3CRMA 2D5AA 1MT3A 5ED0A 1H69A 4J7CA 2J0SA 4P3NA 4ENRA 4X62B 2VYNA 2N42A 1YRBA 4EY3A 1HQYE 2CNNA 4M7RA 1SKYE 4U9UA 3QUAA 1CUEA 2XRFA 5AKHA 1P9LA 4YAGA 1V96A 2P40A 5DWVA 3I8OA 5H0IA 1W2WB 3OSUA 1GNRA 1E94E 3NANA 3M82A 2H4HA 3TFOA 2TYSB 2FR1A 1JHZA 4CM1A 2XB4A 1EMDA 1QIMA 4Q9HA 1L5KA 2E89A 4LNHA 3SIWA 2C7QA 1U8UA 1EHCA 1QYIA 2J0UA 4V0KA 3ZWQA 2QY6A 2NUAB 3UW3A 2P91A 2I34A 3BIOA 5TPWB 3V48A 4M55A 1OBHA 1DX4A 1TUBA 3O2NA 1SKQA 4KLAA 4NDAA 5ADHA 2DBZA 5LBTA 2EHDA 2IXAA 3ACDA 4Q1AA 4UHBA 1ACLA 4GXRA 4HGQA 2ZVDA 4NEHB 3ZTWA 2VAWA 4F86A 1JFFA 1QYCA 3GQBA 2HNKA 2ZRMA 4Q37A 2HC9A 4KPUA 3MTQA 3IHKA 4MULA 5GVRA 1FNNA 4YRKA 2ECQA 4CF7A 4ZICA 4ZDKA 5D3ZA 4BMOB 1E1NA 4WN9A 2C4HA 2IYXA 3TLKA 5HVNA 1L3CA 1FPMA 2FPIB 2XCQA 2FQYA 2YVKA 3LKZA 1KFCB 4TTQA 1FSPA 3SXJA 5AJTA 2R5NA 4PTLA 1J9EA 1QWSA 1T2EA 4JP3A 3TTYA 1PWHA 3SHOA 1BOOA 3QLVA 1DMRA 3EQ7A 4HDOB 5B6PA 2EQAA 5KNBD 5K99A 4XKJA 2NVBA 4ENTA 1OI4A 1R6XA 3UXYA 3VPDA 3WYFA 3C48A 1LBHA 1EUDA 4BTVA 2ORVA 3PDUA 2FP4A 1CIJA 1WTAA 3OLWA 1NBMD 4L4YA 2A3RA 4RLHA 5C7IO 1CR4A 1UWVA 4B3FX 1F6WA 4IQFA 1EQUA 2AF4C 3FJOA 3QTBA 3W5JA 2ZCVA 4DR2B 2BZGA 3P2OA 1KFBB 3OI7A 2ZT6A 4GIBA 5F5NA 3P2JA 2IS4A 3A58B