2E5WA

Crystal structure of spermidine synthase from pyrococcus horikoshii ot3
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
280
structure length
280
Chain Sequence
MRDMEFIEWYPRGYGVAFKVKRKILEEQSEYQKIEVYETEGFGKLLAIDGTVQLVTEGEKSYHEPLVHPAMLAHPNPRRVLIIGGGDGGAIREVLKHEEVEEVIMVEIDKKVIEISAKYIGIDGGILEKMLSDKHEKGKLIIGDGVKFIEENSGFDVIIVDSTDPVGPAEMLFSEEFYKNAYRALNDPGIYVTQAGSVYLFTDEFLTAYRKMRKVFDKVYYYSFPVIGYASPWAFLVGVKGSIDFMKVDAEKGKKLGLEYYDPDKHETLFQMPRYIVQML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable spermidine synthase
publication title Crystal structure of spermidine synthase from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 85
structure length 280
sequence length 280
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 2e5wA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2e5wA02
1R6AA 1P91A 4PYMA 4MHTA 2FRXA 5GM1A 3GRUA 2O07A 2PV0A 3BKWA 3OU6A 2OO3A 1RJDA 2JHPA 3P97A 3LDFA 3BWCA 5FTWA 3NMUF 4PYQA 2XYRA 3HCBA 1RI4A 3DR5A 4R8RA 5ICGA 1YZ3A 4RTKA 3THSA 5H02A 5GIPE 2V74B 3DMFA 1ZQ9A 4QQKA 1RJGA 4AZSA 4RTSA 1Q0TA 3T7TA 1P1BA 4EK9A 2P3QA 2PX8A 1NV8A 2FCAA 3G88A 3GIWA 4PNEA 3SSMA 5DRYA 4O29A 5E8RA 3SXJA 4AUKA 5CUQA 1EJ6A 5T67A 5EHGA 3GCZA 2PT6A 3FRIA 4EQZA 4A6DA 2I62A 1QAQA 3AJDA 4ISCA 3MQ2A 1KXZA 3RW9A 4AZVA 1SQFA 3JWJA 2VP3A 5DTQA 3K6RA 3P2EA 3BGVA 4IWNA 4QDJA 3UWPA 5K8VA 4YV1A 2O57A 1FP1D 3DLCA 4CKCA 4PCAA 4FT2A 2ZZKA 2FYTA 5DM0A 1DUSA 3G2QA 1DCTA 3G2MA 4POOA 1BHJA 4R6XA 4YV2A 3FUWA 1FPQA 3E05A 4RYLA 5F2OA 3KQYA 3VSEA 5LQUA 3EEYA 2I7CA 3SGLA 1KP9A 3CJTA 1OR8A 2GAFA 2NXJA 3AXSA 2ZZMA 4F84A 5CVEA 2ONYA 3RIEA 3G8AA 5T64A 1JTFA 4M36A 4B17A 1JG3A 5GIOE 2PKWA 3V97A 4PYKA 2AS0A 1G8SA 1XDUA 3ID6C 3E8SA 1RJEA 3FYDA 1V39A 2ZVJA 4R6WA 2OY0A 3DP7A 4YUVA 3M33A 4Y2HA 5FCDA 5HIIA 1G55A 5HZMA 2YXEA 2XBMA 3CKKA 1N2XA 1JQ3A 3DXYA 3GO4A 1PJZA 4P7JA 1EJ0A 2BM8A 4PYNA 3LCUA 3M6XA 3LBFA 2PBFA 1JG4A 4YUYA 2GS9A 5EZQA 1WS6A 3BZBA 2AN3A 3UJCA 3CGGA 1R18A 5HILA 2JHCA 1JSZA 3TKAA 3HNRA 2ZIEA 4Y30A 5GWXA 2H11A 4BP1A 1O9HA 2QRVA 1AF7A 1D2HA 1BKYA 2Z6UA 3C3YA 4RVFA 5EEHA 1VQ1A 5EMJA 2EJUA 3UJ9A 2BM9A 3KQPA 3LDUA 4PGHA 2ZW9A 1RJFA 2WK1A 3HA5A 3KQMA 3LCVB 1F3LA 5K0EA 2FHPA 3HVJA 2GB4A 3QOWA 3B7PA 3THRA 5GM2A 1SQGA 2R6ZA 3PX2A 2OYRA 2QYOA 5EC8A 3P9NA 2G1PA 1ORHA 2DULA 2GA9A 4BLWA 1M6YA 2AOWA 3F4KA 3LL7A 4CKEA 3MGGA 2QM3A 3B3GA 2Y1XA 2NYUA 4FSDA 4KRGA 2PX4A 4PYIA 2G70A 2ZWAA 3SSOA 2ZZNA 3GRYA 5E1DA 5M5BA 3DTNA 2I9KA 1ORIA 1R00A 2YUIA 2IDJA 4OA5A 4WVLA 1XTPA 1BC5A 3SR4A 3GU3A 1NW6A 2NXEA 4QTUB 1D2GA 2K4MA 4R8SA 3SM3A 4DA4A 2PXXA 5K03A 5LQKA 3ERCA 1ZKDA 4OA8A 3EVDA 4DCMA 3REOA 1UFKA 4QQNA 5E1OA 1IXKA 4NECA 3ME5A 2IBTA 4MQ4A 1RI5A 5FWDA 2CMGA 3OFKA 3CVOA 3OZTA 4X61A 1G6Q1 5EKXA 3FPFA 4FSXA 4XUCA 4HG2A 3I64A 4XUEA 4U7PB 2PVCA 4RTOA 3I5UA 4U7TB 1VBFA 5BXYA 2Z6QA 1U2ZA 3EGEA 3EGIA 4EKGA 4F86A 3KR0A 1IM8A 3HCAA 1JR4A 2ZCJA 9MHTA 4FGZA 4RTRA 2P35A 4G56A 2PT9A 5FQOA 3EVEA 4KW7A 2VDWA 3DH0A 3MCTA 3TM4A 2IBSA 3ANXA 4DKJA 2BZGA 2YXLA 2R3SA 1TW3A 3M70A 2QY6A 3A25A 2NXCA 4OBWA 1SVUA 5DM4A 3EMBA 3TRKA 1KR5A 4X60A 2P7IA 1ZHFA 3L8DA 2EJTA 2UYQA 3FTFA 3HM2A 3PB3A 1AV6A 7MHTA 4C03A 4V0QA 1XXLA 5DSXA 1NT2A 4GBED 1M0EA 3HCCA 1YF3A 1G8AA 3O4FA 4GOLD 1P1CA 1T43A 2HWKA 2C7OA 3FTCA 3TQSA 2AOTB 4PWYA 4DCGA 1P39A 3TLJA 4E2ZA 1X1BA 2O06A 2CL5A 5CVVA 3R6TA 3DMHA 4FR0A 4HGYA 5KVAA 2P41A 3LKDA 2BR5A 4KWCA 3P2KA 5CVUA 3R3HA 2P3LA 3CJQA 3PT9A 4M38A 2PY6A 5DM2A 5LQRA 5DX8A 4ER3A 5IKMA 1R8YA 2FPOA 3ORHA 3KPWA 4IV8A 1KPIA 4X1OA 3VC2A 4OQDA 5DLYA 4DF3A 3H2BA 3MB5A 5LSAA 2KW5A 4LG1A 2P7HA 3T0IA 2VZ9A 4RWZA 4F85A 3BKXA 4PYLA 3EVBA 5EG5A 2BR4A 3KPVA 2B78A 3GNLA 5DXAA 5K0GA 3KQQA 2HR1A 3MAGA 3UJ8A 3PLAE 4HC4A 1Y8CA 4AZWA 2IH5A 1VL5A 1X1DA 1X19A 4K6MA 1QANA 2YXDA 5EEGA 4EKIA 5T6BA 1VP3A 1INLA 1L9KA 1NKVA 4EMSA 3HA3A 4Z2YA 4FT4A 4PGGA 5FA8A 3ELWA 3UJDA 3GGDA 3NTVA 2ZIGA 2ZULA 3E23A 2Z6AA 5K0FA 4ZTBA 5DPMA 2AOUA 5CCBA 1YB2A 3HP7A 3KQOA 1YZHA 3BGIA 1EQAA 5EVJA 3OZRA 4X41A 3A7EA 4MIKA 4GOMD 3BWMA 2QE6A 2YVLA 3SX0A 5ICEA 1N7JA 2B25A 4PCLA 3IYLW 4M37A 2UYCA 4QPNA 4GF5A 2YX1A 2OXTA 2O05A 4BY9E 1JQEA 2ORED 3FPHA 2ESRA 2P8JA 4HH4A 3MCZA 4YV0A 2Y1WA 3DUWA 4HRAA 3T7SA 4E30A 2ADMA 1TPYA 4GQBA 3BXOA 5EPEA 5ERGB 3FUUA 3C0KA 4M7RA 5LR6A 4RSRA 2OBFA 5E9JA 2VDVE 3GRZA 3HCDA 2IGTA 3KQVA 1D2CA 5G02A 2IDKA 3EVAA 3A27A 3C3PA 3KU1A 1L3IA 4CTJA 5E1MA 3AWIA 3DMGA 3G5TA 4MTLA 5EZSA 3AXTA 5K0JA 3R0QA 2AN4A 2PGXA 4JXJA 3IV6A 2YTZA 5K0LA 4KIGA 3TFWA 1ZGJA 1QAMA 2EFJA 5EIFA 5E9WA 4C4AA 5HIJA 5DRTA 3IHTA 3KPJA 3QV2A 4P7GA 4E32A 2G71A 4PYJA 3FTDA 3KHKA 4PIMA 3TKYA 3LECA 2CKDA 3R24A 3DXZA 4OBXA 3X0DA 3VC1A 5EGSA 1AQIA 1Q0SA 5CVJA 3NJRA 1SG9A 4RV9A 1XCLA 3LHDA 2ZIFA 3K0BA 5GOZA 1I1NA 3HVKA 3BGDA 3T7RA 5KQSA 3UJAA 5DSTA 1FBNA 1RI1A 2E5WA 1VLMA 3M6UA 1FP2A 2ERCA 3OZSA 2AOVA 3ER8A 1ZGAA 4A6EA 4FZVA 4E2WA 3JWHA 3LBYA 1X1AA 4KDCA 2ZSUA 1XCJA 3FRHA 2AN5A 3OPNA 1EAMA 1TW2A 3G5LA 3MERA 1NBIA 3FPGA 4FP9A 2PWPA 3CJRA 3OCJA 3BT7A 1L3BA 5EIWA 8MHTA 3HVHA 4QDKA 2PSSA 5FA5A 3LKZA 3B3FA 2ZFUA 3HCFA 3B5IA 3DXXA 1X1CA 4QTTB 1SKMA 4DMGA 3G89A 3EEOA 1Z3CA 2FK8A 3NW9A 3RODA 5DX1A 1HNNA 3OFJA 4P58A 4V0RA 3KR2A 5E1BA 3UZUA 4C08A 2DPMA 5E9QA 3NDJA 2PX5A 1QAOA 2QRVB 2ZBPA 5E2AA 3GRRA 1JG2A 5BW5A 5ICCA 5F2NA 3UJ7A 3HTXA 3OU2A 4P7FA 4OX9Y 2VS1A 3EVCA 4C05A 4C04A 3PS9A 3LX6A 3MTEA 4H0NA 2NXNA 5DX0A 5C1IA 2IFTA 5K0CA 3FPJA 3MTIA 4GC9A 1I4WA 1YFJA 1XJ5A 2NP7A 1SUSA 4MWZA 5FULA 1NE2A 1HMYA 3UJBA 4RTQA 2OB1A 4ER0A 3Q87B 4BP3A 3A26A 2VDUE 4GEKA 5LQJA 1XDZA 1G60A 2ONZA 2XVMA 3GDHA 4E2YA 3V8VA 4BLUA 4YMHA 2BH2A 3ELDA 4RX1A 3TMAA 5JUWA 3UJ6A 2YQZA 1MHTA 2V7EA 2OPBA 4C07A 2I6GA 3KKZA 5IH3A 1QZZA 1M6EX 2ZWVA 4P7KA 3NVKI 4RTPA 3KR9A 2H1RA 4ER7A 3TOSA 1UWVA 2EG5A 5MHTA 1R74A 2JHAA 4GOND 3CC8A 2AVNA 4RTMA 1YFLA 1WXXA 3JWIA 3P9KA 2ZBQA 3KQTA 2P1DA 1UIRA 2B9EA 4PYOA 5DTRA 1NV9A 2OB2A 3S68A 3DLIA 3LCCA 4CKBA 3BUSA 1AQJA 1FJXA 3UFBA 4KDRA 10MHA 2PX2A 5DTMA 4LECA 5LQCA 3CBGA 3FUVA 4QVGA 1F38A 1ZG3A 2GPYA 1B42A 3P9IA 4FS8A 4L7VA 3UA4A 2P40A 3UA3A 5JR3A 2G72A 5HFJA 2A14A 4KVZA 2LD4A 5FWAA 3HCEA 4E33A 3GRVA 2HV9A 3G2OA 5EQJB 3BWBA 3NVMB 4GC5A 4GOOD 3NDIA 3EVFA 3M6VA 3OE4A 5HIKA 4EVIA 2N47A 2B2CA 3U81A 4YMGA 1JSXA 4HTFA 5BW4A 5EHIA 3M6WA 5ICFA 3GJYA 5FADA 1NW5A 4YUWA 1NW7A 3FUXA 3FYCA 3IEIA 3OU7A 5HEKA 4DQ0A 5GP1A 1VP9A 4E31A 1NW3A 5DWQA 2NP6A 3EGVA 2C7RA 2OZVA 5CVDA 3LPMA 3NWEA 2C7PA 3FUTA 5CIYA 2HTEA 3D2LA 1JQDA 1SUIA 2ZTHA 3AY0A 3BWYA 3KR1A 5C9ZA 4RTJA 4IV0A 2UZ4A 4IKPA 4AX8A 2JH9A 4HSGA 2P3OA 2NNWB 4RVDA 4AZTA 2UYHA 1EG2A 4PINA 5HIMA 2FK7A 1PRYA 3FPEA 4X63A 5D1HA 5K01A 3Q7EA 4ER6A 2B3TA 2EX4A 2IP2A 3EVZA 5EOVA 5KYGA 2Q41A 3M4XA 3LDGA 1WG8A 5KQRA 2PJDA 3HA7A 3I53A 3QOXA 3O7WA 1O9GA 4XCXA 2ZLBA 1VE3A 4HGZA 1I9GA 3SVZA 5CM2Z 5GINE 1O54A 4UOEA 3SSNA 5FHQA 1JTEA 1MJFA 3R9XB 3A4TA 2AVDA 1L1EA 2F8LA 1WXWA 2XYQA 1WY7A 3JWGA 3TPZA 5EMKA 4ATNA 3OE5A 5K09A 2IPXA 1KIAA 5FUBA 1KYZA 3KQSA 1N7IA 1RI2A 4C06A 5EKUA 3EMDA 5K05A 2GH1A 2UYOA 2XYVA 3CCFA 3E7PA 3ELYA 3P2IA 4YUXA 3B3JA 2H00A 4YUZA 5CCXA 3KQWA 2IH2A 3VYWA 1H1DA 1R8XA 3P8ZA 3FZGA 1KYWA 4PONA 4RVHA 1BOOA 1KHHA 2PWYA 5C0OE 5E8JA 5K0BA 4R05A 2PLWA 4KIFA 5EMLA 5FQNA 3A7DA 3LSTA 3NWBA 2AOXA 4HTFB 2OKCA 2C7QA 3PFHA 2PXCA 3ELUA 4QVKA 5U4XA 3O31A 1DL5A 2AOUB 4E70A 5KS2A 4RTNA 4OQEA 3TR6A 3PTAA 2AOTA 3HVIA 2JJQA 2JH8A 4WXHA 1NBHA 5B1SA 5FHRA 4CXMA 5F2KA 3TM5A 2AR0A 5LQNA 1L3CA 3G2PA 4E2XA 5CD1A 3C6MA 3I9FA 3KPYA 2GLUA 5K0NA 4DM3A 4DZRA 1NW8A 2XVAA 1IY9A 5HOQA 2JG3A 1YUBA 3DOUA 1KPHA 5P8WA 2WA2A 2IIPA 3B89A 5BP7A 3GWZA 1XDSA 3UBTA 3DULA 2WA1A 3EPPA 1KPGA 3SMQA 3PX3A 4CWAA 1JG1A 2HMYB 2HNKA 4BLVA 3LGAA 2BR3A 3P9CA 5E2BA 3I58A 2CWWA 3ER9A 3KPUA 1RI3A 3PVCA 1G38A 4ER5A 2AZTA 3HEMA 4GUAA 3G8BA 2YR0A 2CMHA 1XVAA 3EVGA 3GXOA 4RTLA 4LWOA 4RVGA 5DXJA 3P71T 4PIPA 5EMMA 3FTEA 4QPPA 5LQAA 1VPTA 5D1NA 5DT2A 4LWPA 1EIZA 2PXAA 3G7UA 1WZNA 3PFGA 3WSTA 3C6KA 4CTKA 3MHTA 2IH4A 2ZBRA 4XUDA 1QYRA 1VIDA 5DM1A 2G8NA 2O0LA
chains in the Genus database with same CATH superfamily
1DJQA 1MW9X 2AJTA 2C2BA 221PA 4TV9B 5FNVB 3ZXIA 6ADHA 5LL6P 3I5XA 4ZRNA 2Y1LA 1ATZA 1X74A 2G09A 3RUDA 3S2FA 5AI6A 3ONEA 4R2MA 4OATA 3M1YA 4F4CA 1RM3A 1Y80A 5A0VA 3AO0B 1CJTC 3H87A 2VRCA 2ZRCA 4JA0A 4W8GA 4QBIA 3DMFA 3IGFA 5IJZA 1I51A 1G3RA 1W9MA 2EKLA 3DVLA 1Z73A 3H84A 3KYDB 5FBHA 4JJKA 4EK9A 4EUKA 5BUSA 1FDIA 1UOPA 2GHIA 2PMFA 3A0UA 4ZHQB 3CVXA 4I4LA 1OWLA 3SSMA 1RLIA 3ZW8A 3F97A 1P3Y1 4TLCA 2FZGA 4Y1FA 1PUJA 1TGVA 3OQ1A 2E4XA 4M0DA 1NE7A 3ZJVA 2QUHA 1SURA 3K6JA 2O50A 1YRAA 1COWD 1USUA 4H3HB 1G2OA 2YS6A 4RKYA 2HLHA 3I4CA 3G1WA 3JWJA 2YJNA 4EA6A 1SJ9A 2EDCA 2I3DA 3L05A 5LD2C 3A05A 1HDCA 4QQRA 2ERYA 2PDAA 4O4JB 4WNIA 1FQOA 1OLSB 4I2VA 1GRNA 2E4YA 5IC5A 3G2MA 5ENZA 3EIEA 3LRXA 3EGXB 4C7OB 4D6XA 3ZE6A 1B8OA 4Q1VA 2J85A 2W2PA 1LPAB 3AXSA 5K7SA 1E1DA 5SZIA 3KQUA 2JIQA 3AKCA 2H8KA 4WESB 3AVOA 2FX2A 5B64A 4MV5A 2PKWA 1ANKA 3H9UA 2VT3A 4GP7A 4Y0VA 4EG8A 1GGMA 1V48A 1A9OA 2JDID 1K9VF 3PL1A 5E2IA 1NU6A 4EG6A 1SUAA 5JPDA 3UGJA 3WWZA 3TF5A 2PD6A 1GG2A 2DFVA 2WF9A 3HKDB 1B76A 2J67A 2PKYX 2YMMA 4Y1GA 3AR9A 4HPJB 5KWSA 2XBMA 3G2KA 1E8MA 2HDHA 3WLMA 1XEWY 2XMPA 1W1IA 4Q47A 2BM8A 4PYNA 4HDNA 5I7FA 3IBCA 3OTHA 3FYUC 5AK0A 1HZZC 2FSPA 5ADVA 2XBLA 1ZNYA 1QGOA 2FPMA 2IXDA 1XZEA 3RPEA 3I1JA 2BFBA 2CBZA 4G3XA 1Z45A 3OECA 3VHQA 2ZQ5A 1UF9A 4FGWA 1C1DA 5SZKB 3DTYA 5CMLA 1XKLA 2A59A 5HDQA 1MN6A 4O5AA 4F1WA 1DIHA 1TRKA 2WIFA 4MQBA 2C8KA 4TVOA 5DN6A 1BRMA 2HBRA 3KT8A 2BEVA 3PCRB 1ISGA 4RJTA 3CRRA 1F0PA 2Y8EA 3ET4A 2B9VA 5H9VA 1QU2A 1ETUA 5F78A 2BUAA 4H9GA 4N6NA 2GB4A 3SN6A 1I4LD 3MMXA 1ZUNA 1ZNZA 4ND7A 4A6XA 3DEZA 1ZU4A 2PKQO 3KUCA 2D06A 2OXRA 5AW6A 4ARCA 2Z1DA 1B0ZA 4IZHA 3UAZA 1RJWA 1L5KA 1Z35A 1CDEA 1Z0FA 3P9NA 1V8FA 4YQYA 1EFRD 4BU0A 1M2VA 1ZK3A 1Y8ZA 2H17A 3GIDA 3ICPA 1TYEB 2P79A 2Y1XA 3AEUA 3KDSE 5HF5A 2G70A 5DGIA 2O8BA 1T10A 4K6GA 3DPUA 3PNOA 2CEAA 1LTKA 4IP0A 3MAJA 3Q0TA 2JJ2A 3BWEA 2HEIA 3BCSA 3QX7A 4CEJB 2RHLA 1P17A 1Z37A 4ZI2A 3T3GA 1RXCA 1L7QA 5A5FA 3DFIA 1MFZA 1YDEA 4MSUA 2QHXA 3HMKA 2ZJOA 1XVVA 3ZNQA 5FPPA 1RTKA 1MRSA 4JVNA 2OCXA 2EX1A 2C0PA 4ZI5A 1GT6A 4H7IA 1GPUA 4JBXA 1JEYB 1Y1RA 1ZO8A 1U2PA 3VKVA 4BNIA 3L4SO 1TYAE 2XZOA 3BHIA 3N2NA 5KAPA 1XL1A 1ZGZA 4MHSA 3I76A 4LA4A 3IALA 1HUQA 2Z3VA 3DNFA 3HNPA 4MVJH 4AN1A 4EVRA 4WERA 2QP9X 1VG0B 4DRYA 4PC6A 3ZJYA 3KBBA 3WLKX 1YR7A 3ZDFA 4EM6A 4WKOA 1JSRA 3NXSA 1DHTA 4CW7A 1XU9A 3IOYA 4JS0A 4EKGA 2VAXA 2YV3A 4RVNA 4X1IA 4U5QA 3R76A 4DV5B 2MCFA 2ETVA 1NF9A 2J09A 5FEMA 3V8EA 5C37A 4IIGA 2FZVA 2A0WA 4YJ2F 2LWIA 2R3SA 4TROA 2QY6A 5CB4F 2RKWA 1Y81A 5DM4A 1P3JA 1RD4A 3QBEA 1KEEB 2LIPA 4HAZA 4G8DA 5HKKD 1XD8A 2NYVA 1H0HA 2OLEA 5ECWA 3CX4A 3QWFA 1QVVA 4HWSA 5G2OA 4PQGA 4TL8A 3FYUA 1GP2A 2IYUA 1DUIA 3UNXA 4JXXA 1B26A 1HZZA 4XQGA 3ROPA 1U9CA 3MUEA 3NV9A 1KJIA 5KYYB 2IYSA 1WIWA 2COKA 1KJWA 2IXGA 4CI0B 4I8IA 2PH7A 2NAPA 2OAGA 5SY6A 3E18A 3ICCA 3QNWA 4MW0A 4KZPA 1BNCA 2IXFA 4DAOA 4HGYA 4D8VA 1MOPA 4Q05A 3W8DA 5BWOA 1NUHA 4HBGA 1MBZA 4YJ3A 4AL4A 1I94B 2ORYA 2AFIB 3P2KA 3P20A 4JB2A 1PHRA 2WHXA 4HV4A 1V37A 3C5WP 5CX4A 5DM2A 2A0UA 3T1TA 2Z58A 4TTTS 4Y2VA 5IFKA 5AW7A 2XOKD 1RXWA 1THMA 3L0DA 4ZN6A 4CF3A 3L8FA 2PVSA 2RKBA 4BEVA 2C4UA 1Q0UA 3HB9A 1MLDA 3CH7A 3TD2A 4LG1A 1P1RA 2VZ9A 1WHSA 3RE1A 3R7DA 1VHQA 3KQQA 2ECOA 2QX6A 1L7XA 1W93A 4XE5A 5IRCD 3GUUA 3I2HA 3BIFA 4AZWA 1KQFA 4IFTA 1X1DA 2QMHA 4RMIA 5JVDA 3H2IA 4COOA 1BX0A 2ZRLA 3NIBA 1QO0A 3ZLVA 2CK3D 4YHBA 2WJWA 4Z2YA 4EPYA 3V4ZA 5FI0B 3ELWA 5BNTA 3GVXA 5JQGA 1BROA 1D7AA 1QDUA 3AU9A 2PH1A 2QAIA 3FKQA 1UP7A 2D7JA 4MVJG 2HK8A 1RZVA 3C7CB 4GKAA 1R7RA 2GBLA 3KT6A 4NJOA 3O2QB 2YCBA 4XDHA 3U17A 4RGYA 1T9ZA 2W98A 3GAZA 5TMEA 1DDOA 3MYRA 3WGOA 1GYPA 1AN9A 1IM5A 1E2HA 2I2FA 5CJPA 2PTHA 3HKCB 4QDUA 3TUZC 4G5FA 2IVFA 1CSEE 3DHEA 3HR7A 1TLTA 2HA0A 2PEYA 2CDCA 2RGBA 3M4NA 4KJXA 4P4TA 3O4JA 1L5VA 1U9IC 2I2DA 5AVSA 1GZ6A 3DUWA 3IP8A 4L75A 5FL7A 3C4QA 4TXLA 4MYSA 1K0FA 1G2IA 1ZS9A 3A4NA 2XRFA 3V33A 3FMPB 4NU0A 3WMXA 4TXMA 1DKLA 1Z2NX 2G7ZA 2P91A 3ZHTA 4HVCA 4CEHA 4D5EA 2ZRDA 2HIHA 1QIMA 3MWEB 1L7PA 3U4AA 2ZIAA 5B5SA 4IIJA 1QQ5A 2GCIA 1YZKA 2RGNA 4CTJA 1MUUA 2WUDA 3GZNA 3INGA 3FNRA 1TTPB 1Z4NA 4XIIA 3WAKA 4MUNA 3DXFA 4RMJA 1N3IA 2OHHA 3K73O 4V3CA 3SKYA 4UTVA 2R6HA 5JBNA 1ZGJA 1LNQA 3HI6A 5AM5A 2C98A 2C3MA 3PXAA 4GPAA 1C80A 3WXMA 5HIJA 1TA4A 4N4AA 3C5EA 3KHKA 1YDFA 5KEIA 2RAFA 3LXXA 3E7FA 1A77A 3EA4A 3AW8A 4XVQA 2PO5A 2G08A 2R1UA 2JHGA 2IPNA 3UMFA 3GVCA 4Q3OA 4B79A 2H1CA 1U99A 2R87A 1BGVA 5K2MA 3IEVA 3NRJA 1E6KA 3K1JA 4FILA 5EAIA 1Z2PX 1R6VA 3ER8A 3AEZA 5BW6B 3ANSA 3DE4X 4ANFA 5CLFA 3OPXA 1JAXA 3D8UA 5TEVA 1FTWA 3D9QX 4X54A 4AMVA 1A04A 2CLLB 1KEKA 4FP9A 1WF3A 3AUJB 1ZINA 3C15C 4H7EA 2TECE 4N39A 4OL0A 4RJ2A 4EBFA 2ZYTX 1N5OX 3N2EA 3I2YX 2WJGA 2PSSA 3O8BA 1XA0A 3B3FA 4N03A 3T1VA 2OHOA 2VH5R 1CUGA 2BRUC 4BMZA 1M66A 1U2DC 2VNSA 2JAHA 2UZ0A 3S2GA 4S3MA 1XDBA 5I4IA 2FWRA 4MP8A 2HF7A 3TLEA 2OEPA 2REOA 3FSEA 1AHNA 2FMUA 4BHTA 4J76A 2GJ9A 4UATA 4G63A 5A6SB 4MWZA 4MGIR 2OD2A 4PBSA 2I6QA 2J3HA 3L7YA 1D4FA 2D8MA 3UK2A 2ENUA 1BX1A 4RY9A 4RDHA 8OHMA 4BE4A 3W4JA 4G65A 4DDHA 5FPKA 3T5MA 2VNHA 1AV7A 3V7WA 1EXWA 4L8WB 1U9IA 3UMGA 2CVQA 1VE1A 3D5EA 3RKUA 3OUTA 1KP3A 4XWOA 3RSSA 3FFTA 5A71A 5KMGA 4XB2A 4M6WB 4ZEMA 4L0MA 1Y0BA 3NVDA 3QU9A 4DJTA 1R5JA 4BZPA 4E5DA 2EJWA 2HC9A 4EAQA 2IU0A 5JI2E 3LIPA 2UXBB 2GSWA 4C7BA 1LC0A 2WPNA 5KYKA 2EWMA 2YIJA 1PT7A 2H2AA 2QL9A 1Q19A 4YC7A 3ZWXA 1ESNA 3ILHA 2P6UA 4MCAA 4RM3A 3DQQA 1UKBA 1Y9JA 2E55A 3JSXA 4DMLA 5IAOA 3UUFA 5FOVA 4LJYA 3OPVA 1Y1LA 2XNCA 4JX9A 1LLCA 2ZANA 3OFSA 4R1MA 3UMYA 4JZYA 1CDZA 4YONB 2FF7A 2HV8A 4GOOD 1BHQ1 4KX5A 3GZTB 1M83A 2B2CA 3TGPA 2QTMA 3U7QB 1YASA 1W4RA 4FN4A 2BEUB 3TTXA 1Z0UA 1MX1A 2P2CA 1LUAA 3HFSA 1CUSA 2QJWA 3IUNA 2Z3ZA 5E6RB 4BX3A 4FDLA 2IYAA 3H86A 3CIFA 1GPJA 3PHBE 4QNNA 5HE8A 3KKEA 4TYWA 4NP6A 3FBWA 4F96A 3K53A 1JPJA 4DQ0A 2XE7A 4R1SA 2H06A 1N6PA 1NW3A 2YXPX 2O8EA 2XA9A 1P0MA 1VMEA 2Z04A 1OZGA 1H2FA 2RC5A 2HDNB 3ZJ5A 4BZQA 2HTEA 4JLPA 4FC7A 3UFXB 5CIQA 3BK2A 5HJ7A 4DIDA 4B6PA 2I54A 3I9V1 4NYIQ 1T9AA 3E0QA 4D44A 5JS1A 2N1BA 4JLWA 4E07A 3S27A 3C98A 5HIMA 1PRYA 2WIDA 4ESHA 2VDPB 4H2DA 4CDRA 2IP2A 3RIXA 1U7UA 1B14A 4ZQGA 2EQAA 2BRUA 3THXB 1QTIA 4OX9B 4MDFA 1U2DA 2E5FA 3TLCA 3W78A 4EW1A 2CCKA 4PQFA 4X3OA 1M33A 1XX6A 4MUXA 3OEHD 4Q48A 2HSZA 3WKCA 1FFHA 2I8LA 1XT6A 5CDFE 2JFUA 4UBLA 1XPRA 3WMRA 2JJYA 1WOYA 2XOXA 4B6FA 4N8EA 2FUCA 1XTRA 1N9GB 4EL0A 5KDLA 3WGZA 4GX0A 4A0HA 1F20A 2XA1A 3STVA 3R3UA 1XB2A 2VQ6A 2PUBA 3TG8A 3A04A 4XOUA 3TBHA 4F3CA 3QVUA 4D9NA 2GH1A 4HAUA 4NQRA 3A1TA 1EFPA 1E9FA 4ZQBA 4UHDA 3T12A 4B7CA 4HNTA 1Y4UA 2DFKB 5CCXA 3NM4A 3FLMA 5I4KA 4P0TA 3L4JA 2J5QA 1CCWA 2XVZA 3QYFA 1J2JA 4RVHA 1W4ZA 3PZRA 4ZK6A 3JVEA 3M83A 3H2HA 2Q5OA 5LC1A 1T0UA 3PUWA 4BE9A 4HTFB 5IBPA 5A2GA 3EDQA 3OQNA 2QVCA 1G41A 1UANA 1JLSA 4FIDA 1GKUB 1Z6AA 5BSTA 3CLTC 4B48A 3V1MA 4FQ8A 4Z7NB 1XFAA 3GFVA 3WBBA 4GPBA 3DNMA 4JYZA 1BDHA 4D99A 3L43A 1JJAA 4M1YA 1ECBA 2C5FA 2JZNA 4O02B 4XA8A 5FPYA 2Z4RA 3SC2A 4C0SA 2IXTA 2JJ1D 5EIOA 4TS3A 4NTZA 3RLIA 4MR8B 5IJ0A 5IN4A 1VGVA 3P9SA 5K0NA 3CVUA 2WWTA 1LTHR 3E3NA 2AG8A 2VQSA 1OJLA 3FDFA 4RAOA 5DU2A 3UENA 4X3PA 4C78A 4QG7A 5I48A 1IEVA 1O6CA 2YHBA 2ZBEA 4PWZA 4D9GA 3PX3A 1N2GA 3OSZA 2M98A 3HM9A 1W73A 2XTJA 3VKUA 2JCXA 2Q2QA 3N6XA 2B3DA 4KIWA 5AQ1A 3IUYA 3PVCA 5D7BA 1V9CA 2NXWA 1YS7A 2VT6A 2XB8A 3EW9A 3ZXYA 5CFLA 1LCIA 2IYEA 4I3HA 1NJ1A 4RTLA 2HJHA 3RFFA 3TNLA 2WWGA 4ETMA 4DXDA 4LJRA 3R8CA 4FEAA 3AFGA 2Q4DA 1ODCA 2JGKA 3BJMA 3WSTA 3E2MA 2JGDA 2HK6A 3S28A 5EHXA 4NU6A 2G5GX 5K8CA 2OYCA 2QTLA 3GRUA 1NF8A 1TK9A 2CXSA 3HA2A 4PVCA 1JE0A 4Q24A 4TTAA 4CL0A 3CSUA 2F1RA 3CV3A 3QKUA 1ENYA 1W47A 1Z2AA 3JZAA 3LDFA 1KS9A 3GDFA 3ZGLA 1XNJA 3X1JA 4G0ZA 2Y3IA 1ZH8A 1W6RA 3B8HA 3E58A 3PRJA 3DYBA 4IOKA 2PX0A 5ENVA 2B8NA 2ILTA 1NSTA 2P3QA 1YBHA 4PG7A 4ZRMA 4O8CA 3GIWA 2QVZX 3U7FB 6AT1A 4Q82A 1CR4A 2W2QA 2QP3A 1KJJA 3CEAA 1H8EA 2FOLA 4HDSB 1M1XB 4J0JA 3GYGA 3AINA 2YZKA 2J9GA 5CUQA 2WINI 2HIMA 5IN5A 3LBAA 3L0BA 1MF7A 1RKBA 2R86A 1TM5E 3PGXA 1JR3E 5EKSA 3WLNA 4AKHA 2V98A 1VRWA 4J7XA 1SQFA 4F9EA 1EGAA 2QLFA 1Q15A 3BK7A 4LHYA 3MT8A 4N5MA 3SIWA 1H9BA 4YCLA 1I7DA 3Q5DA 2PD4A 5AKEA 3MTJA 2AFHB 1BJRE 5FB3A 1PJ8A 5KYWB 3RAEC 4R6XA 1VL1A 2WILA 3S44A 2W58A 4H7DA 4YX9A 5C35A 5F2OA 5FORA 3I9LA 3EBOA 5LQUA 5AHWA 4FFBA 4I5GA 2PCLA 1KP9A 3OMWA 1QHGA 3GLSA 3QTLA 4OSOA 4EKEA 5JNLA 1G59A 1NLYA 1OBHA 1VE6A 1D2RA 1QS0A 4GDMA 4W5TA 5F4BA 5LMNB 1IN4A 1HLGA 3T3OA 4KDFA 4KAXA 5ADHA 1C3XA 1MZVA 3KOMA 2ZSBA 2ZWMA 2CLCX 1R0WA 4Y8VA 1GTMA 2WHEA 1GVNB 4ABTA 1XZQA 2OY0A 2PT7A 1TT5A 4HOYA 5TIIA 1DSSG 2ATCA 1NBEA 1L4FA 2J5RA 3D3JA 3UC5A 1UOQA 4DWOA 1ZM4A 3NBQA 1L5HB 2H31A 2PZLA 4U0JA 1A9ZA 4YP5A 1QOZA 4YALA 4JQCA 4CYMA 4FONA 3LPNA 2H0RA 3LVBA 4NE7A 5HK9A 1DIGA 5EHNA 1ZRNA 2CHFA 3ESAA 1JEDA 3CF4A 4MA0A 4XIJA 3UJCA 1KI6B 3HJHA 3WNVA 4BN5A 4CKBB 1J8FA 2YV1A 3D6MA 3UGQA 3KYCB 2VJMB 3W7VA 4ZICA 5AOVA 3PNMA 3GQBB 1HTWA 4CV3A 4MEAA 5IBQA 3WFJA 2YWGA 2Z6UA 1XZNA 3OQPA 3SD7A 2IZ5A 5IDYA 3PE6A 3WZ2A 1VJRA 1AKMA 2BM9A 2WC1A 1DO0A 3B1KA 3GFFA 3LUDA 5K0EA 1NI5A 3ZXSA 2CNKA 3C6XA 2CXPA 3C6YA 4FFOA 2DFNA 4JU8A 3U4QB 4NCBA 3QFSA 4X92A 1OB5A 2K7ZA 2QIOA 1GUFA 2WFMA 3I72A 2DWCA 3QKSA 3ZNPA 1KBZA 4J9UE 4HT3B 2CXRA 2HGSA 2KLBA 4LVNA 3FPLA 4JASB 4Y1RB 2XMSA 3KWJA 1EK1A 4UM5A 2C2HA 5TVGA 2UVPA 3CX8A 3SSOA 5LDHA 1ONSA 4B40A 1KZ4A 2HYDA 3M1LA 3OHSX 4DIFA 3ASZA 1NOKA 1UXHA 2YV4A 1NRXA 4BL5A 2ZQZA 1LDMA 1RKXA 4N01A 1ORRA 4TTPA 4Z8YA 3IP7A 2IF0A 1X3SA 4UQOA 4EEKA 4ZOQI 5JJCA 2XXAB 2VF4X 1IXZA 3UHJA 4B82A 1YC5A 2GM5A 3COSA 1GAJA 2IBTA 1ZZGA 1KIMA 3IIEA 2DFDA 3FI9A 1DOZA 4JGGA 4WN3A 1Y8AA 1G98A 2BCEA 2BFDA 4WK2B 3ZLUA 1Z6QA 3JQCA 2AMVA 3OEEA 4LUCA 4CM6A 1U2QA 4RTOA 1A9RA 1NTOA 1U0GA 4TMYA 3BPSA 1PE0A 3DBLA 3F71A 3UKOA 3OI7A 4LBVA 5C5CA 4XQ0A 1VLLA 5J4KA 1RYMA 1C3OB 2Q1SA 1MJNA 3MGKA 4ARAA 2P2LA 3NRBA 4LZWA 2Q7DA 7REQA 3LC2O 1OLUB 4LJ6A 4O2BF 5BQFA 1G5RA 4FX5A 2ATVA 4I5FA 3ZH2A 3FNQA 3CNQS 4K6CA 1SVUA 3RHTA 3GLFA 3ZWAA 2HHJA 5FWXB 2EHJA 2ZAYA 3PYMA 3SJBA 4FWIB 4YLEA 4I6JA 3GPDG 2AQ8A 2VP5A 3GOQA 4ZAZA 4EJFA 5CVTA 1V16B 4AP5A 5K8TA 1U4SA 2GK4A 2YFKA 3HM2A 5AJHA 5CITA 3U6KA 1VJCA 1XZIA 4RA9B 4RKQA 3JWEA 1IQ0A 2YWHA 4D9EA 2QQEA 3FFAA 5JRZA 2RGRA 4KMMA 1P1CA 2HWKA 3E22B 3LFHA 4CTNA 2R96A 3OPYB 5C8YA 1SHJA 1W76A 2YH2A 4PXYA 3TQSA 3HXTA 4QULA 3QEAZ 1YCGA 4O4IA 4RVUA 4Z9BA 4BFWA 2C5AA 3S70A 3IOCA 2X4LA 1EWRA 3I5MA 3IMEA 3O38A 4A8JB 3TX6A 2Z4SA 4OQPA 1ZSNA 3TNDA 1FZTA 4GX5A 4CN9A 2XCQA 1P0IA 4ZYLA 3R9XA 1SCBA 3AIKA 1C8VB 3EWNA 4P5DA 3VZSA 4DSTA 4ALNA 5IWAB 2QBYA 2Q1UA 2FPOA 4XD7D 1X92A 1UFQA 4Y2SA 2I2WA 4WT7A 3WG9A 4KDEA 4L7QA 4OQDA 1MV5A 2H7XA 4QX6A 1R3UA 1F2UA 1L1FA 3U1VA 5KBYA 4QYTA 3EWIA 5DXAA 1HFJA 1X80B 3OJEA 2W4MA 3TCKA 3ODPA 1E63A 4JYAB 1RPNA 1VKHA 1DIRA 1QYWA 5DYNA 1PF7E 4BIIA 3PTZA 5AT1A 3OE7A 2WW8A 3IXMA 2PS1A 4WXYB 2Y1GA 1RPAA 4H7JA 1SUCA 2XY4A 3A6KA 4FI3F 3A37A 5EP2A 5K0FA 1TAGA 2J08A 2FPPB 3QPWA 1EESA 3HP7A 3C87A 1PI3A 1BTOA 5KPJA 4LOKA 5JEDA 1MIOB 5JZVA 3HXLA 3OE1A 4AYWA 1SC3A 2JLQA 5ESWA 3ZCRA 5DOZA 2Y9PB 2JC3A 1KFBB 3K15A 4NYIR 3QVMA 1JZSA 1ZRMA 1U9JA 4Q34A 3FPHA 5H82A 4O08A 1GPLA 2CD9A 4H6VA 1UC9A 3GLHA 4PQRA 4JGBA 3L01A 5ERGB 2EW8A 5TQJA 5JAQA 2IDZA 3TPCA 1U7ZA 4AYXA 1E7MA 5BXQC 1LLFA 1H66A 1G20E 2BGTA 2B7LA 4LKOA 3GRZA 3N8KA 3DE5X 4RFVA 1OJ7A 4E2FA 2FZKA 2G9RA 1EVIA 5F35A 3STYA 2CHGA 2HD4A 2PVPA 4MTLA 4S1OA 2PHZA 2RC6A 4TKLA 5B3KA 1BE0A 2C59A 4CETA 4FFDA 5BSWA 4GWKA 5EP4A 1MORA 2IPLA 2Z5GA 3BCHA 1WPXA 2EFJA 1RWMA 1PD0A 1ZK1A 2YWEA 4TWZA 4WAUA 1E2NA 1PWXA 1TVMA 2PA0A 1FC0A 3CH5A 4RPHA 3MLAA 5E7MA 2YWJA 5F64A 3ZDQA 3LECA 4R81A 1V5FA 4MVJM 1DADA 2OESA 3MB8A 1GRVA 1NNLA 4MV0A 2CJWA 4WASA 5HMLA 4NQZA 4IIXA 4PSVA 4L08A 1UBGA 3IUBA 2WKPA 1RI1A 1TM7E 2K2QB 3CN9A 3OZGA 1JHPA 2A3RA 3PWKA 3TNYA 4H7PA 1A9SA 2PRZA 4JOQA 4XB6B 4ECAA 3DUFB 4K03A 2FWAA 5EWMA 1LPPA 3IJRA 4ZYZA 1E9AA 4DY4A 1X70A 3KZOA 4GE0A 4RHUA 2ZPTX 1F3OA 2GO1A 3ZS9A 2IHYA 4NV1A 4IUDS 3A9CA 4PO3X 3GRCA 3D2AA 1A97A 3P2MA 2IYFA 2XQFA 1UJBA 4NMXB 3DVAB 4URHA 2X1HA 4B3IA 4QJBA 4PU0A 1P2GA 3SHTA 2C5SA 1J7KA 1GOTA 2Q27A 4KN5A 4UULA 3W3ZB 3ZQ4A 3ZNNA 1CEXA 2PS3A 1DAEA 1IBCA 3IRUA 4PZAA 4U39A 1Z15A 2VYVA 3T4PA 4M8KA 2C94A 4BO4A 3EEOA 3D6FA 3PUYA 1QFJA 1D2MA 1U6IA 2NUAA 1WW2A 4OL9A 3IUSA 4P58A 4V0RA 5E1BA 5EE0A 2CHVA 4OHKA 4CNQA 5IVKA 4UNIA 1Y5RA 1A4XA 3QUAA 3MBIA 1RKQA 4EP1A 2VPQA 1E5QA 4TV9F 3R5TA 4IUBS 4TMKA 3LX6A 2C7VA 5IF9A 1GKKA 1WP9A 1MB2A 4DR7B 2YV2A 3RC9A 1A4UA 4YMSA 3G0BA 3ZCQA 1KH2A 2E37A 2YJ4A 4K8OA 3VYUB 2C9CA 3IOEA 4KG7A 4LDZA 4ER0A 4BWVA 5C8ZA 4S04A 4RXMA 1RJ9B 1FP7A 3D0RA 3STTA 1N1DA 2I76A 1D2EA 5E0KB 2X5KO 2QE7A 4D80A 4ZHQF 4QPDA 1QNLA 3C8DA 4YBZA 3L6CA 4DCTA 3SZRA 1T9KA 4AS1A 2B4RO 2ZRJA 2NO9A 4KXQA 1Z8NA 3U56A 4RKWA 1KI1A 1Z07A 4L8VA 4DBLE 4XGNA 5TY0A 2F00A 2IYYA 1VYVA 2AFRA 2G4VA 3EAFA 1WBBA 5E7QA 2RFLA 4JJEA 1Z16A 4MV4A 3VGJA 1TUEA 5U9CA 3R40A 4BUCA 4JR2A 5FUXA 4MWCA 1PIWA 3T7IA 2CFRA 3SXPA 3PSHA 3DLIA 1UQTA 3LCCA 2AK3A 1NQTA 3BUSA 5CNMA 2ROQA 3HJTA 1N0UA 3D4IA 3WX0A 4RQTA 4QZVA 2GAJA 4YQEA 3X2FA 3FUVA 3RS7A 5A62A 3KK0A 4FS8A 5HF9A 5JR3A 4XM1A 2NU9A 4YT4A 2I33A 3OEYA 4BJHB 2MR6A 4R54A 1FFAA 5EQJB 5FLKA 4AUNA 3D7MA 1V7CA 4EZIA 4OQZA 5JD4A 3SF0A 2V1UA 5HIKA 4AZ3B 3WQQA 2AHRA 5EZYB 3ZDXB 1O95C 3JD4A 5FOSA 2EEZA 4WI1A 1JSXA 2D59A 5FT9A 3U81A 5ICMA 5KX5B 3MWDA 1VLHA 3PQ6A 1UPXA 3UOWA 1CRPA 1L5QA 4XPZA 1PL8A 3KZXA 4KQMA 1Q1NA 2QOEA 4GO1A 2X4GA 3G5UA 3PD1A 4FYXA 1ZD2P 4NHOA 4DR1B 4X1YA 1X1RA 2IYTA 2UYYA 2YHSA 3KB1A 2ZKIA 5G40A 4BGUA 1BE8A 1UBJS 4PG5A 5EXTA 4PG8A 4DNOA 2H59A 3DV9A 2X6QA 2FWMX 1ORTA 1AKEA 4W5JA 1Y6RA 3OA0A 3V8BA 3KVOA 2P3OA 3MN1A 4ZAFA 1XL0A 2W90A 1UK8A 2V6GA 2ZT5A 3HTXA 3ORYA 4YIKA 3EVZA 1ZL0A 1XXHB 1T3HA 1SKYB 1D04A 1FDOA 2AIRA 2C31A 1S2GA 2EKZA 3LSYA 3MOIA 2W6QA 3EQZA 2ZLBA 2D1TA 5ITZB 4DHWA 5EIXA 4EELA 5K3EA 2GBGA 2O3UA 3SSNA 1BD4A 3PIDA 1QHNA 1UMCA 1QKKA 3WDSA 2LR0A 1COZA 2RK3A 2BEWA 2I2AA 2UZ3A 3G85A 5EWLB 3ZW7A 4KSBA 1G19A 3ZYZA 4EHHA 3LT4A 2RK4A 5BQXA 3OE5A 1NWCA 3LX5A 5FNVA 1M1NB 4A91A 2R6JA 3U1TA 5BNWA 1QPBA 1J21A 1N6HA 2J6CA 3ENNA 3IAM1 3P2IA 3TQQA 1DWOA 2JLVA 3FGOA 2P1RA 1YDWA 3F2VA 3PBKA 3WK9A 2WD7A 4U7DA 4X8HA 4ITRC 3KQWA 5TX7A 3TOZA 1G0NA 2CFOA 4X20B 3W6ZA 4JT8A 2KPOA 3BMOB 3MJHA 4D3FA 4CKWA 1DELA 2FZ4A 2WU3A 3KTFA 4HLNA 4ID3A 1KYTA 3PJGA 4QD3A 4H6WA 1Z5VA 2EF1A 3MINB 1RPZA 2NZYA 2IW3A 3HXMA 1OX4B 2I6SA 1KO7A 2FEOA 3I6BA 4G0XA 4CMCA 1FXWA 3F96A 1XYYA 4PYQA 5GONB 1BDIA 4LAFA 4KU4A 5AW9A 2XB9A 5K45A 2F17A 2PWBA 4BN0A 4EO9A 1WZ2A 5JCPA 2J46A 1G8PA 3GCWA 3DLBA 1LK5A 4G0WA 2FA9A 4RIEA 2E4WA 3CPHA 3U39A 4CMHA 4J0HA 2OXCA 4BZXA 2PYIA 1D1TA 3N59A 3N07A 4ZOBA 4JSYA 1NW8A 1CY6A 4XYGA 5IP5A 5LB4A 3SJ7A 4AF7A 3ON5A 3WZMA 1U02A 2A58A 2FX3A 5TT1A 2V0CA 2X5NA 1N25A 2FPGB 4KQWA 4E5KA 1JG1A 1O95A 1E4EA 2Q3DA 1HURA 4R2WA 1L4HA 3F90A 4MEJA 5ITSA 4UE3S 1LVGA 3ER9A 1XRLA 3PNSA 4Y6QA 1KDTA 1PSDA 4EL5A 4XEHA 1Y8RB 2LKDA 5JXIA 4Z0PA 4RVGA 3TXYA 3J80A 3KJEA 4KQ1A 3D8NA 3L8GA 1LVUA 6ABPA 3RYHB 5JRJA 3SDBA 1RWBA 3EY4A 5TQ0B 4MRMB 3EOZA 3GUVA 4KPFC 1AMUA 2WKWA 3FGNA 4BMCA 4CQMA 4PQEA 3MQFA 4TLDA 4WFIA 3QX9A 4KV7A 2FRXA 4KQEA 3FWKA 4E14A 5DLEA 5KIAA 2ASEA 1XRJA 2RGWA 1P77A 3VSCA 1JT2A 1Z0KA 4L0QA 4QO8A 3BXZA 4DDKA 1M2EA 4EMTA 4Z7QB 4CT0A 3K71B 3FJOA 3BWVA 3K1AB 4NMMA 2VJPA 4ZT2A 3BXPA 2PQMA 2YFYA 4IMPA 1AJEA 1WUIS 1S3SA 3HYSA 4B1FA 3V8RA 1V11A 3L7OA 3H1TA 5DRYA 3JYOA 5E8RA 4ZA2A 4HGPA 2LZ0A 3NHKA 1H05A 4RZHA 3RLFA 2OBBA 2AMYA 1UJCA 4BX2A 2ZP1A 4UUPA 1AOXA 4A6PA 5M2QA 2G9VA 1KXZA 1GQSA 2DY0A 4LSZA 5BWLA 1M73E 5J43A 3P2EA 2WBLC 4D4JA 1PL7A 2W43A 2O57A 3I28A 1KOLA 1IM2A 2Y99A 5BMVF 4FT2A 3ABZA 2NO1A 4KVFA 1DWPA 1QGDA 1JU9A 1TGYA 4GMGA 4HVLA 2A0XA 2FSVC 1SA0B 3TEFA 2HHAA 4RORA 2VBCA 1EA5A 3KQYA 2XGSA 3EEYA 3C74A 4WBXC 1FYWA 1YXMA 4GGOA 2AD5A 2P2NA 4NBUA 3I1YA 4WOBA 3TB6A 2J1LA 5KC8A 2I1VB 4M0KA 4AWAA 4CEJA 2Z30A 1O6GA 4NXMB 3KKKA 4LXIA 3D4PA 1WXGA 3QEKA 4BRZA 2X42A 3IUEA 3AFOA 3KJZA 2CE2X 3EC2A 4MS4B 3U4MA 4MW6A 2JBAA 4BZZA 3KLNA 2B98A 2CVZA 4RH3A 1JP7A 2MSWA 4O2AF 4W5OA 4B85A 1US8A 2IXAA 2PM8A 3LUBA 1SB9A 1OH8A 2FFRA 1UOOA 1L4GA 4P7JA 1XAIA 5AW3A 4EO7A 4ENRA 4RBNA 3M6XA 1IHUA 4A5OA 2HJRA 1JG4A 3U9SA 2X40A 4AMYA 2H1WA 1SCKA 4R41A 4DNFA 4IAOA 2ZR7A 5C81A 1PQWA 3WA7A 3G68A 2VK1A 3DV0A 3KOXA 1PFWA 1GRCA 2AEMA 1SC1A 3TSOA 4B3BA 4GX1A 5BVGA 1YS6A 1XBTA 4BZWA 1IK4A 4HH3C 4QBHA 3W8NA 1AGRA 1NNSA 2HIGA 4I1OA 4MW5A 1RLOA 3FNEA 3AG6A 1YU9A 3N5CA 4NU5A 4PICA 1JDBC 5KQPA 3K70D 3UJ9A 3EWSA 2HFJA 1EI9A 1QV7A 4QYIA 4YRTA 1JAIA 1F3LA 4I4CA 2C4KA 2UZAA 4MLCA 1P2TA 3JD3A 3QOWA 5HF8A 3UG6A 4E5PA 2DFPA 3GHYA 2BVNA 2D2EA 3ESQA 2WJVA 5JSKA 1W44A 4JOCA 4M2LA 3HSYA 4W1SA 3HJNA 5EJGA 3PDCA 4R2XA 1G9TA 3MGGA 1FQKA 4EBBA 4KRGA 1WMBA 5K3FA 3QF4B 1QB7A 3GLIA 2VHCA 3DKIA 3VV3A 1H4SA 2HLDA 4N0QA 3FMGA 2AFIA 4BEWA 3HR8A 3NG1A 2ATIA 3H2ZA 4MOWA 2HYIC 1G64A 4FB5A 2Q8NA 3R75A 3GU3A 4YP9A 2HO4A 3JQ9C 2W6CX 1B1CA 1UBEA 3QA9A 1OBFO 2IZOA 1Y4SA 2X1VA 3UJPA 5E1OA 5LZ2A 4KEAA 5ELMA 2ENWA 3UMSA 3ZE9A 5AICA 2J7KA 1X8XA 2ABWA 3OTIA 4XFKA 2ZSIA 3JWPA 2FSVA 3RKSA 2OCGA 2CNWD 1BA3A 5BN5A 4KBGA 3QELB 5J2TB 1SG0A 1L4EA 1I8TA 4MCIA 1RT9A 2HWXA 4HRVA 1W581 3AG5A 3NBYC 5K6AC 2D13A 3CWCA 4QBGB 3JQ7B 3OLYA 4KWIA 1IM8A 5BV8A 1YHYA 1RWVA 1V96A 4JJFA 3VH2A 4UXHA 4NS4A 3FSGD 2Z4TA 1TO6A 1GGNA 4IILA 2BELA 3EGOA 5JSUA 3UAOA 1U04A 4KJZA 4RPLA 2NXCA 4ZOLA 1LSJA 1E9DA 3T5PA 1GO2A 1KXJA 4HJRA 3HRHA 3UIEA 1CF9A 1SGWA 1FTGA 1L5SA 5INTA 1ZHFA 3OAAA 2YJ6A 1FF9A 2IPMA 5CX1A 5TVKA 3F0TA 3I83A 2Q6VA 3S1AA 3C3EA 3FTFA 2NUPB 3D7KA 4G97A 3RJTA 2SHKA 1R6UA 3H8VA 3ZH9B 4IDNA 3ZQJA 2YOHA 5CK4A 4KE8A 4GOLD 5JDCC 1RWWA 2A84A 4KR0A 4Y2TA 3SJAA 5A6VA 2ZRQA 3JASA 3REQB 2YN2A 4PWYA 1V1MB 1XLTC 1KTIA 2XIJA 4L15A 5D85A 3QU5A 3OM0A 2YY6A 1DVRA 1DHRA 4LXXA 4O2BB 2QROA 1ZN2A 3B12A 4O0LA 2FZLA 5EUBA 1A9YA 2QENA 1SXQA 1D1PA 3EY9A 2OQVA 1PGOA 2XUDA 2J7PD 1RCFA 4OMUA 2GPAA 2RG7A 2FSUA 4I3FA 1E58A 4F56A 5LDGA 3EN0A 4IV8A 1WZIA 5IABA 1OH7A 3A4YA 4LZAA 1K8RA 2KW5A 1U2GC 1MIHA 1YS4A 4ZO9A 3L4KA 1Y4DE 1GT91 1Y8CA 3TLGA 3L7KA 4Q19A 3W90A 3WIOA 4H1HA 1ZOOA 4FR2A 3AEQA 3RBXA 3TW0A 3IKVA 1E2MA 4BNVA 2G25A 3IT3A 5JMTA 3QLVA 3IPYA 1DARA 3P52A 2QX7A 3L8CA 1C8LA 2ZWOA 2I4TA 3ZHYA 2NPFA 2NZJA 2WG1A 3FI0A 3ZYCA 2BWJA 3JQ9A 1ODKA 2I7VA 4JYBA 1ABBA 3JPWA 4X41A 1EWKA 2JFXA 2R7LA 2RH8A 3DVQX 2KI5A 3WLAA 4JP5A 4X0EA 4BUZA 1CP3A 1LRJA 4GU5A 2Q0SA 3BBLA 3NWJA 1YT5A 3ZY6A 2B25A 2QUJA 3JAKB 1PT9A 1ADFA 3H5IA 4GF5A 5K99A 2O05A 1FRZA 4L02A 5ALKA 5JXHA 2XZPA 4U9IS 4X1KA 4DUPA 3UF0A 4M1MA 2WT9A 3PUIA 1QC5A 4JMLA 3OD1A 3V1KA 1UC8A 1UJNA 3C0KA 3IOBA 3IAXA 5AI8A 2VT7A 5K6AA 2XX3A 5FR2A 2LDXA 1HDYA 5F9FA 3O03A 2ON6A 1M34A 3A27A 5ALDA 5J5VA 2MDTA 1SAYA 4IH1A 4EEZA 3B2EA 4D9CA 1SD2A 4P8RA 3F6YA 4BGIA 2GARA 4YHHB 3ZEAA 1U7TA 3IMGA 1OC2A 5CPBA 1P7CA 5G1OA 5JCJA 3T54A 3BHJA 2QUZA 1XHLA 2VDKB 4GZ3A 3S55A 1CU1A 1XD2A 2GF0A 3AFHA 3BTSA 1KO4A 4C6HA 2I1WA 1MEEA 1VJ1A 4ZGGA 3MJ4A 1EUYA 2G4LA 3P9RA 2F8TA 4ZCTA 2OK8A 2QN6A 1QHHB 3EIXA 3VC1A 1GRRA 3BWDD 4DSZA 4EHNA 4PLWA 4PLTA 3PNYA 5IDXA 1JPVA 4LPSA 4V0KA 2G40A 4AU1A 3GEHA 4LC1A 1Q77A 4BTLA 3EDRA 2J0SA 3RRMA 5JDCA 1T2UA 2ZB3A 3BGDA 1G7RA 1QP8A 1ZMRA 1PZFA 1XLTA 3D6HA 3C1OA 1IONA 1D7OA 1TA9A 2PU7A 4GGPA 3AF4A 1SU6A 1HX7A 2AOVA 5DYIA 3G59A 2R0QC 5TXGA 2YRFA 1BZYA 4US1R 1EBUA 2BL4A 1J2RA 3IPCA 5ALUA 4G5GA 4PAGA 4JOBA 1T9BA 3OOJA 3ADBA 1ISPA 1Q20A 1F4LA 2VIIA 2OM2A 1Q95A 3ABSB 2VJQA 3DO8A 1QIIA 5LPNA 4RJKA 3DF9A 4J4HA 3VVLA 1U2GA 3A31A 4PNPA 4OB6A 2F7SA 4TN1A 5ILQA 3MPOA 3RM3A 1R4AA 1SWWA 1IOVA 2KMLA 1KMQA 3C6ZA 3HUFA 3D64A 5GMOA 1UH5A 4OFZA 4JLDA 4ZOCA 2X0NA 2BEUA 3U7QA 4K88A 4OJMX 1QUFA 2WVJA 4UREA 5FPQA 1EFUA 5AMXA 5A9TA 3GUZA 1RC0A 2FU5C 4LFCB 3ZJ4A 5KHAA 5LBTA 4O4HB 1ICEA 4EY7A 3BWXA 5JAIA 1SBTA 4CG0A 2XDAA 1Z2EA 3CLRD 4TUYF 5KOJA 5LU9A 3DOOA 3S8YA 4G1FA 1WDMA 3WIBA 5K0CA 1QZTA 3NWOA 4WMLA 2QQGA 4QT4A 2A9RA 4TKVA 1WNTA 4LC9A 4EENA 4EW6A 3UJBA 3PFNA 4GEKA 4L6CA 2A1UB 3LIIA 3EEIA 4AJ4A 1G1AA 1AKTA 2JAQA 4G5HA 3ZWDA 3V8VA 4ZKEA 3WK8A 1DIAA 3A1CA 2YRWA 4HLQB 5AHKA 2PUAA 4LYHA 5EJEA 1U0BB 4B6OA 4DLRA 2G36A 1A96A 3P0IA 1ZD5A 2PRSA 2YMLA 4LDRA 3A28A 2XOKA 2P27A 2H3EA 2ZR9A 1QMGA 4NFYA 5TC4A 5K0SA 5MHTA 4UW9A 3RJMA 1J99A 2AC2A 2FV8A 3E70C 3VNBA 4DSUA 1T8YA 2JHAA 3TSCA 4JLMA 1UJ5A 2A5LA 4NDZA 1SCDA 3ZCSA 3QUSA 4ZI3A 4ONEA 3BFPA 4TMZA 5WRFA 3S68A 1JKJB 2O23A 3GA7A 4KFUA 2SICE 2F3TA 1XVIA 4KCGA 2GEJA 4KXUA 3O4HA 3RHSA 1Z5UA 3I37X 2FFHA 1QLHA 2LD4A 1L5YA 2V7XA 1JT9A 3DO6A 4OI2A 3DM9B 1SC9A 1HSZA 2QSZA 3G2OA 3LVQE 1DIBA 3BWBA 2Z5LA 3L0PA 5FD8A 4FW8A 3M6VA 3H9GA 2J5XA 4OJKA 1W5BA 4ROTA 1ZYUA 3QPVA 4HTFA 2DUUA 1GL6A 4QOHA 2PZFA 4XM2A 3M6WA 1CRLA 2MYUA 3GJYA 1KY3A 2VYND 4OUDA 3U7IA 1KMIY 3K6SB 4AQ7A 1KR2A 1MA3A 3TRJA 1VZ3A 1E0KA 2BCJQ 3HWRA 2RGAA 4MQMA 5HEKA 3A9VA 4LXGA 3VAAA 2FHSA 3EGVA 3ESYA 1Z4QA 2J3DA 1QIDA 5CVDA 3NWEA 4AROA 5LJIA 3FUTA 4OO3A 4EGSA 3LJKA 1RWNA 1UEXC 1MD9A 2FN9A 3H1EA 4JI7B 1OTHA 1W0KD 1DBSA 1M10A 2Q5EA 3TTTA 1PFGA 1H2BA 1SQSA 4D6YA 1OGJA 4TV8B 4N5DA 3R7WA 3CF6R 2FX5A 2VI5A 4IOLA 1V5WA 4OQYA 3DGEC 5DSZA 1KMHB 1PG2A 3GG9A 1BDJA 4NEGA 4EWLA 1N7HA 1LD3A 1ZMXA 1P2SA 4RANA 3ILVA 5KQRA 2A9VA 2VEDA 2WZBA 1UPTA 3V3TA 3X1YA 3AGQA 4MQ6A 1BU5A 5CG2A 5M3BA 1WCYA 1YQQA 2VH1A 2QD3A 3ABIA 1ZI8A 3V4PB 4PZCA 4FNAA 5JVDF 3VU9B 3A4IA 2AG0A 4LMRA 2NZXA 1DXYA 1S2DA 1U2RA 2ECFA 4ZVUA 4B31A 2YKGA 1XTBA 1BFDA 3K0AA 1NKSA 1EXVA 4EUNA 1B6TA 2X3UA 1WPQA 2A78A 1KOFA 3OZWA 5DHRA 1QVAA 3LY5A 5JJKA 3D3WA 5L3SB 1PR1A 3JYQA 4HWOA 3RI3A 3AKZA 4CV2A 1H1DA 1C30B 1Z4JA 2GGSA 1L1QA 3P8ZA 5BYJA 2XRYA 3B9PA 2QI9F 4PONA 3LS2A 4HDRA 1O9BA 4LJ5A 2F1HA 3PWZA 4M7WA 4PVDA 4F1KA 3V4RA 1IATA 1YOVA 3EZNA 1GAQA 5EWJA 1K89A 3T0FA 1I5OA 1A1SA 2O7VA 4FGUA 3BFVA 1M67A 2GRAA 4MMXB 5LQDA 1M5UA 2QEQA 2YJZA 3PHIA 2AX4A 3CURA 5EXDA 1NDHA 4KPEC 4CXMA 4OP2A 1I36A 1QORA 3IBGA 4OB7A 4JUFA 2D62A 1U9ZA 2O2CA 4LRSB 4IIJF 4NZ9A 4QOFA 2OMKA 4YMWA 1FU7A 2AUTA 4DQDA 2NU8B 5JATA 1ZM7A 4TXHA 3VMFA 2PZEA 5AUNB 1KOJA 4M1OA 5HM8A 3I9FA 1H2YA 1OI2A 1WDTA 2R8YA 2GHTA 3C85A 3VPBA 3KETA 4LMAA 3CMCO 1CJKC 3ZNOA 1U0LA 2ZJ8A 4YCJA 5F1OA 1UKCA 1Q91A 1XZ8A 3SJCA 4FYHA 1IZYA 1Z08A 4HDOB 1QBGA 3MTBA 2BEKA 1NVBA 3TMKA 1N5KA 1BE6A 1YR9A 3Q9NA 1U4OA 3ESDA 2JJ8A 1YMQA 3T3NA 1NJ8A 1T0JB 1KSJA 1WAMA 4BNLA 2HDWA 4Y3UA 2IELA 3E0XA 5TQ2A 4CMKA 4DWJA 5ALTA 4EG1A 1JFFA 2WFAA 3QFFA 4OGLA 3T5CA 3SEAA 3SYRA 1T5OA 3G7UA 5KPDA 3YASA 4JEIA 2FEMA 2Z98A 4B6SA 2O7RA 3U37A 2YHAA 2H4HA 1I4EB 1TM3E 1UFRA 2G17A 3B38A 4XIYA 2SNIE 2J30A 1DPGA 4PPYA 1HT0A 3NQ41 4DIUA 1C2YA 3KJFA 2WMOB 3WJ7A 3PWTA 2YZ2A 1I24A 2JLWA 4ZZIA 1KYXA 1S89A 3HLKA 3RVOA 2HT1A 1K9SA 1XR3A 1EM6A 1XMSA 1YZ3A 4O1IA 4RO0A 1A9XA 3ED1A 1KJ8A 4R16A 5JWHA 5KU7A 1Z17A 4RU1A 2WABA 1T9GR 3FY4A 4RTSA 1CY0A 4E4YA 4RL4A 3K96A 1X42A 1T8WA 3G88A 3HKEB 4Y6LA 1P5FA 5A03A 3UMJA 1U1GA 3AP2A 2JANA 2P0EA 5BMOA 3QSYA 3BH6A 3R7LA 3U4DA 3DBHB 5LOVB 5EHGA 3LK7A 3NHLA 2PKRA 2IW1A 1GR0A 1PG5A 3VH4A 3VDQA 3M9LA 4BFTA 3S8EA 1QAQA 3MQ2A 1TMKA 4DLXA 5JHHB 4K9DA 5FUQA 2XWJI 2ZK7A 3WI7A 1HT1E 4FOSA 4NYMQ 5DTQA 3UN1A 4DQVA 5FO1A 3U5TA 3ZD9A 2M6SA 2X77A 4OEHA 4Q4DA 4WA8A 4IBOA 3AL3A 1UDRA 3PU6A 4KN9S 4MGHA 4I1RA 2E87A 2QQFA 3PXXA 3A6EA 1E0AA 3CLUD 3R6LA 1BHJA 2RCNA 1Z6TA 1LY1A 2ZYUX 2BFPA 4RDXA 5HR5A 4G0PA 2ZE5A 5KOHB 2N75A 5LWHA 1LVHA 3ANMA 1CC1S 5EQTA 1VL0A 4B73A 4BV9A 2DMRA 2GAFA 1OXVA 3BD9A 3Q88A 4OQNA 1YVRA 6REQB 4F0JA 1CUZA 2J0UB 4QLBA 4TQ9A 2FKAA 1EP2B 2MJLA 2VCHA 1XCOA 5BUZA 1YONA 2HQSA 4MA5A 2XXAA 4R6WA 2ZVJA 1QQTA 3M33A 4MGEA 5FX2A 4I9FA 2FWJA 3K9CA 2ZUDA 2BOVA 1XN4A 2XTMA 4XWKA 3DXYA 1P61B 3PITA 1AGYA 2FWNA 4Z0HO 1EJ0A 5BQ3A 2D1SA 4AG6A 4AF6A 4F9TA 2OCAA 2YIVX 1M2GA 5THXA 2I4OA 2W6JA 3DE2X 1LDYA 4UVGA 2PS0A 2B8JA 4FX2A 3AI3A 4PS1A 1KP2A 3WYGA 1BWSA 2JHCA 4CIWA 1N2SA 2X6RA 2XUIA 3G1TA 1C3OA 4YT2A 5HWSA 1K27A 5JO9A 4FGSA 1V6AA 2RHDA 4RLQA 1OLUA 1HO3A 2YBEA 4BQSA 1YBMA 1VJDA 2ZBGA 1TQDA 1TZMA 4R0NA 1P7YA 3MTGA 2PLAA 2PZJA 2EJUA 3DO5A 2BMAA 4GR9A 4U2BA 1ILEA 2H4WA 2M6LA 1UT6A 2ZWPA 1XNHA 3KQMA 4Q9LA 1CV2A 3Q0IA 2IYZA 5KJEA 2AI2A 1XZCA 4LISA 3WWDA 3QYAA 4JX8A 3BFKA 2AQKA 3GV0A 3HB1A 5H3LA 4C43A 4YQFA 1PV4A 3GRAA 1JLHA 3H5AA 3BN3A 4U6QA 1XF1A 2XR1A 4UPDA 4B0OA 2GKOA 3A14A 4X90A 1GG8A 3TW6A 2XNJA 3UYKA 1E69A 1E66A 2J5BA 4KI7A 2D2FA 3KSAC 5KNBD 1ZOPA 1AQNA 3THYA 2E89A 1BXKA 2HA2A 3GK3A 4JDPA 2YWCA 2PSFA 2IZZA 4A8JA 1ZICA 2D7DA 2P2ZA 3GP5A 1BC5A 1SBYA 4OH1A 4EKYA 1XZHA 4HHEA 1VJ0A 3HWWA 2DCUA 3OOSA 1K68A 2CNOA 3SC4A 2QY9A 1JFVA 4UAUA 2EC5A 3CY6A 5A02A 5K4HA 4RELA 1B8PA 1IXKA 2R1ZA 2V4MA 5IARA 3RBAA 1Q1EA 4QFMA 1V1RB 3KOZA 3KSUA 3UYLA 1H5NA 1RYYA 4M0CA 2IEGA 3MQ4A 2GJKA 4H0CA 2VHYA 3NHUA 5JSYA 2X14A 2ZUCA 1TYCA 3ZZUA 4QJ3A 3BA1A 5IKMA 1N34B 1IY1A 3DAGA 4HG2A 4XUCA 3ROXA 3GLQA 5JT1A 2VRWA 2EW2A 4U7TB 3W5VA 1UDAA 5A9RA 3R9IA 3EZ9A 1WXEA 1U2ZA 3DBIA 3DEFA 1Q6YA 3OUUA 4D2IA 1DAFA 1OTXA 3G9XA 4NCXA 1LDNA 2DR3A 4Q3EA 1NUAA 1VPLA 3AUAA 1A72A 4OQLA 2V8BA 4DCPA 2I91A 4JV5B 2W83A 1YAJA 5EE5B 1PNOA 3DH0A 3KKQA 4AJ9A 1N2CA 4R3WA 3JARB 3NEJA 1JMYA 4JUIA 4D9MA 1Y9AA 3VFDA 3AM5A 3JD1A 3KTAA 1Y4AE 3EGWA 2X8WA 3KYIB 2R6FA 1E6WA 3E1GA 4QREA 4B4UA 3HJAA 2HW8A 2YVAA 1YOBA 2L2QA 3D5TA 1WCXA 1E6EA 1NDQA 3DZIA 5T3UA 3T4UA 1OH6A 3U1BA 2G1KA 1N3LA 4IFIA 5CT5A 1QRUA 1RWKA 1XDDA 3FE2A 1M0EA 1Y7TA 3FBGA 4B6EA 1Z5ZA 2PKXA 4W5HA 4L5AA 4M89A 2W2MA 2ID8A 3INTA 2Y1CA 1V4VA 3FLEA 4GP9A 3ZIUA 3VR5D 4KR7A 3R4CA 2HCTA 1S7GA 4EQ6A 2A9JA 4OQFA 4ND5A 2R48A 5ED4A 1OA1A 1EBBA 1E1QD 1X7WA 3LKDA 4CBVA 5AM2A 2IS6A 1MKYA 4J1QA 4Y6GB 4JSRA 1SU7A 1J5XA 3K5IA 3T1OA 4WZAE 2WAOA 3ZZ0A 5C4GB 3TUJC 4ZI7A 1E64A 4Q4AB 1AB5A 2BFCA 3P5BA 2EJBA 1L5WA 2YHIB 2JW5A 3CHYA 4X7MA 1THGA 1D2NA 1LX6A 2P7HA 3DDZX 2DT5A 2WDZA 3BERA 3R41A 1SXHA 3NNSA 2IY9A 3EVBA 4FE4A 4PYLA 3RO7A 2X23A 4LDQA 2VA9A 2H29A 3EFOB 3MAGA 3CCBA 5AVRA 1G20B 2OPHA 2PUCA 1X19A 1OXSC 4K6MA 3CPSA 3EBLA 1P1HA 1KU6A 1UADA 3IA2A 2EGUA 4HNAB 4XWYA 4E15A 2AEJA 2C7GA 3EIHA 1OFUA 3M6IA 5T6BA 3SX4A 4YRJA 4EMSA 4C7MA 1O89A 1TUBA 3KVNA 1VSUA 4OQMA 1S6YA 4ALIA 1GUAA 3GGDA 3CT4A 2JI6A 4ZT7A 3DDNA 2M1ZA 4DADA 3O82A 2PO7A 2P6MA 3BGIA 1EQAA 3DVAA 5TEWA 2B0JA 1LI4A 1YK1A 2E18A 1HYGA 4HZIA 2ZWIA 1VJTA 3AERB 3OY7A 5F3RA 3TO5A 3ZVRA 1KY4A 4KRFA 2PUJA 4NY1A 3RIGA 3WGNA 2CLMB 2XXBA 4AF8A 1T1GA 3GI1A 4L4ZA 1GN8A 2W70A 4BNDB 2H2WA 1J7JA 3DG9A 3RU7A 3DTTA 1QP4A 1YKFA 2PTGA 5IU6A 1DCFA 1PEAA 4WY5A 4JJGA 3JR7A 3V1YA 5FOTA 1FS4A 3IHKA 2BHSA 3IPXA 3AIIA 3EVAA 4KITB 4UHFA 1M2HA 4TVKA 4YQZA 2FFQA 2XWSA 3TCNA 1KVRA 3UV6A 4FGKA 4ZOAA 4NZPA 4V03A 3LQ1A 3Q41A 3GEPA 1ULSA 4KO4S 4XAQA 4BMXA 1HSOA 4CKCB 3B53X 5COQA 2YHUA 5ICSA 1G8GA 2BV3A 4E32A 5IC4A 3A2LA 1B3RA 2HGZA 4LZNA 1JWBB 2A6PA 1ENOA 4J7AA 5I9MA 1GRQA 3SZ3A 1HDZA 2AMFA 2B6HA 1BWRA 2HQBA 5DBFA 2OZPA 1BG6A 1CUVA 1V5EA 5GONF 4KUEA 4D42A 5KWJA 1YIOA 4MRPA 4FOLA 2VXOA 1VRCA 1FUYB 2CE7A 4HEA1 1WHTB 1FTSA 2C29D 1EXNA 4UNSA 1EFTA 3LH5A 2BF4A 1WDLA 3OZDA 1J09A 5C1PA 1PGPA 1PZHA 1FYVA 2MYNA 4GT1A 1VOTA 1G6HA 5ED0A 3WL8A 1HXHA 1XYVA 1YI8A 2JB9A 5D3ZA 1M2KA 2H1HA 3KX2A 4GYJA 3SHWA 3TEJA 1PYGA 1CS4C 1NC1A 1YJAA 3FRHA 1WW8A 2NO5A 5CG1A 1NG9A 3K0EA 1L7VC 4QU9A 1H6AA 5BN4B 3OCJA 3CJRA 4Y18A 5EINA 2YW9A 4AO7A 5EMHA 3ORRA 1ZI9A 1L6IA 1TVKB 1E2KA 4IIHA 1PNVA 1DQYA 5F77A 1UZNA 3OUZA 4YDHB 4UBOA 3UANA 4ZMSA 2H4XA 1B6SA 1F48A 4HEQA 5EZYA 4EG4A 1BXZA 2VUHB 4YO8A 4ZXFA 2NPIA 4I50B 1RRMA 1Z3CA 2FK8A 4PZEA 4RF4A 4UU0A 1U1EA 2V5AA 4B33A 1YCHA 4K9SA 2F9FA 1XVUA 1WU7A 2FVYA 5BW5A 2C2KA 2DPLA 3NKLA 4FMDF 3EVCA 4C05A 3U19A 1U28C 3Q8XB 4H0NA 1AXRA 3VTAA 1D5CA 1ZW6A 2IPOA 4E7OA 2IFTA 3WO1A 4C6RA 2DKNA 4B3HA 1VLJA 3WLRA 1YRYE 1ZH0A 1XWWA 5CM8B 3QBJA 4CCSA 4RTQA 1HQCA 1A7KA 3BDAA 4DB4A 2AG5A 1G4AE 5CD9A 4UBJA 1TO1E 3KEGA 5J40A 4B3DA 4YMHA 4BLUA 3AESA 4PYRA 5C80A 3WA6A 1AUOA 1O8CA 1Y7PA 4JJZA 4E5YA 1RQ2A 2OWEA 3O3MB 1PGNA 4OI1A 4RS3A 1JPUA 2WZDA 3HH8A 5REQB 3GFQA 2SBTA 2BFEB 2H85A 3AC0A 3I04A 3ZCPA 3N6VA 4ESEA 3V5NA 1UWVA 3W3AA 4IMRA 1HF3A 3QTBA 4DA7A 1YR2A 1WX1A 4DDWA 4BECA 3GD5A 3P9KA 1QBKC 4K05A 2ZITA 4G8CA 4MVJD 1A5BB 1GUDA 1GZVA 1HMPA 2RHJA 3IDZA 4G09A 1DDIA 4I4NA 4FN5A 1KWKA 3AVVA 4RD2A 4ZAXA 4B4VA 4HQ0A 4WCFB 3EODA 5TPZA 1BVHA 1S02A 2AXEA 2H65A 4N40A 4YYEA 4BQIA 3JZDA 1QRDA 3P9QA 4EO4A 1FX0A 5KHLB 5H5JA 1KQOA 1P19A 1LPMA 1U7DA 1Y82A 3O83A 4NYMR 4WK0B 3S2ZA 3MZ0A 1H94A 2P4UA 4OG2A 5SY9A 2ID9A 4FBMA 2GLXA 2XCUA 2WQ6A 3DOCA 4WD3A 4YJGB 5DHPA 1TT7A 2ZE7A 3MINA 4ZU3A 5A7HA 2Q6OA 1XMJA 3CEMA 2R8XA 2VCYA 4BKOA 2PRKA 4Y9SA 1PEKE 2JGLA 5EHIA 2OZLA 3PUJA 3QRWA 1SCAA 4OVKA 4Q9JA 4RJLA 4ALLA 1GADO 1G8MA 3ITKA 1NW5A 4PIVA 1AGXA 2Q8PA 4R98A 4HXEB 3AUTA 4JJ8A 1MO5A 1I32A 4C4YA 3BXXA 5DWQA 1MVLA 1W4BA 1TL7C 1RS0A 2GCOA 1Y63A 4HNHA 3SIPA 3S81A 3P45A 1MP0A 2W2TA 1RHQA 2HPVA 5F1PA 4DC1A 4FOPA 2CNNA 4DLSA 2OAEA 1QX3A 1CQWA 1JFLA 1I4TD 3C16C 4IKPA 4IV0A 1E3LA 3AYZB 3OFND 4MPRA 4KRXA 1SZCA 5DO9A 2Y1EA 3GX1A 1XU7A 5ILGA 4JL6A 3DP9A 3GGGA 3H8WA 5G0SA 4B7UA 1NI4B 1PNTA 5AIAA 2ZI5A 1JF8A 3B60A 3BD7A 3HY4A 2II6A 4Z3DA 4DLTA 1HK7A 1Y37A 3R9KA 2X15A 1ZH6A 1O9GA 4ZQEA 1FIUA 1PO7A 3NDBB 3U7HB 4HGZA 1HOTA 1Y8RA 4IIBA 2BMVA 1GYQA 3U7RA 1EJ2A 3N2KA 4P4UA 4DC0A 1P31A 1Y5LA 4LS3A 4PRZA 3PQEA 3RS3A 1I0LA 2PLNA 4MS3B 5CCDA 1XZFA 1U28A 4O4LB 5J63A 3A58B 2WEKA 3B1YA 4HAOA 5F3DA 5TQ0A 3RYHA 3UB3A 3W06A 1U1FA 3ZHXA 2YS7A 4KV9A 2R6GA 1BEUB 1Q21A 2XNDA 1NFFA 1NN3A 2YZNA 4ZAYA 2IPXA 4ATNA 3QWAA 2ZT7A 3WKEA 3S1SA 3HDHA 4RY0A 3R23A 4UBMA 1DQNA 4Q4HA 5EKUA 5B7QA 1F7UA 1S8NA 1QWSA 2HB6A 2X5JO 4YUZA 2VK4A 3DW3X 4Z9XA 2HU7A 3VI4B 3F6EX 3NOOA 4DM7A 2YJ3A 1XAGA 3W5HA 3D6JA 4REQB 4MZXA 4A92A 4EB8A 1Q7BA 3ND6A 4CM3A 1QH1A 3ICVA 2VCEA 2FB9A 3LSTA 2G83A 3L7BA 1S2OA 1HL7A 3VJLA 5AUOB 3VOAA 1TVFA 2HKIA 2P9BA 4BCCA 3UAYA 5B1SA 1G21A 4RE5A 3TM5A 3Q8MA 1UBNA 1KU0A 2B4AA 1K0UA 2FWIA 1WSAA 2GESA 5LQNA 4DT1A 1I6KA 4D4IA 4IHKA 3GEEA 4N65A 5L3QA 4LNUB 3JX9A 3QSGA 4B5LA 3KFXA 2NN3C 3X44A 2IYQA 1FP4A 4EUFA 4BLOA 2BGMA 2HFKA 1ZNXA 1I1OA 1ZIDA 2RBKA 1SCQA 4RK5A 3P9CA 3I01A 3PR1A 1R4ZA 4LV5B 3H13A 4XH9B 4Z4EA 4RPCA 4H31A 4ZVVA 4R68A 3T9BA 4GD3Q 1Z0SA 4Y2JA 5EXEA 4A23A 2CMHA 4AECA 2XQVA 3EDYA 4L5YA 1PBNA 1JECA 5JCZA 2JFHA 1UBLS 4XWAA 1W88A 3ZDYB 4GSLA 1T29A 2ZRBA 1U4NA 2GTIA 1AXEA 2P9EA 1A7JA 5LZ8A 3AY7A 5KCMA 3IAM6 3DB1A 3M49A 4RPIA 3S2SA 1NJ5A 5C31A 2QUKA 1NBWB 2D7CA 2G9NA 2CXNA 4Z8XA 4MHTA 4BN4A 3CBQA 1QG2A 3OU6A 2J6IA 3B1FA 4TXJA 1MQSA 3SDZA 1FDTA 1YTUA 2IA5A 5CA1B 4UZEA 3FKSD 1RI4A 1LJUA 2IYOA 3DR5A 4INZA 4R8RA 2ZJ1A 2D2XA 3Q72A 5FYQA 5H02A 3RNOA 2VZLA 4TRNA 2PSDA 2P4HX 4A2CA 1L4BA 3MS7A 4L4YA 5J59A 3C5HA 1GLNA 2ACEA 3NFYA 1HQKA 1NM5C 2JI7A 1VE5A 4AUKA 2JFYA 2FPUA 4GPD1 4WUVA 2VTBB 4DA6A 1UBSB 3VHXB 4BLQA 4ZRDA 1JAYA 5K9ZA 5FBLB 3BTOA 4DS3A 1MDFA 2FW9A 1IG0A 3JATB 1TD1A 4GVXA 5TNXA 3E2IA 3HGMA 3IXQA 4G07A 4LCJA 1X7HA 2ZIXA 3QE0A 1FNCA 4GS5A 1U1CA 5CEEA 4LN1A 2QTVA 5JAMA 3RS2A 3AB8A 4CCYA 1M75A 4HX9A 4JLAA 1PFKA 2ZZKA 2FYTA 4HMPA 1I01A 1QH8B 3TTYA 3WLIA 4F7DA 4XB1A 1S5PA 3HU1A 1CZNA 1SXJC 2ZIWB 4G36A 4LX0A 3OIVA 1OT3A 1ZUHA 5AR1A 2Y9MB 5HJ2A 4KH1A 5ERXA 3UPUA 2I80A 3PV0A 1N6NA 1W5EA 3QF4A 1GNTA 4NG5A 2WY2D 1RLUA 3ZGXA 3DYIA 3O47A 4GR4A 2PJUA 4M87A 5F5NA 3M9WA 3U48A 4EF4A 2G8LA 3EXHC 5CW1A 1EUZA 5F5XA 2LVBA 3G8AA 1E3EA 1A9PA 4F3YA 1JG3A 1ZPDA 1XTTA 4OB8A 5C18A 3RK4A 4F5EA 2O2JA 3C70A 4JYPA 3HN2A 3PC6A 1RJEA 1OI3A 1PD1A 3V2GA 3FYDA 4TZ6A 2HJVA 2FZCA 3DAOA 2FQYA 4UUAA 4AY5A 4QHSA 4PLHA 1XELA 1Q1QA 3E81A 3UHAA 1N2XA 1RXVA 4WFQA 3WIUA 3L6EA 1MQAA 4LRQA 3WDMA 4B8WA 2BKAA 1G5PA 1F12A 5IPFA 1NPDA 1AKYA 4HSEA 3WL5A 4AJOA 821PA 2M32A 4EAAA 5JV5A 5JSZA 4E5NA 1WQ1R 1U8ZA 4BO3A 3HL0A 4YRNA 1BMFA 4U9HS 4WA7A 2FZWA 3RWMB 3FTQA 3FETA 4HQRA 3H1BA 3WKBA 1DNPA 3KD2A 1H3EA 1CIJA 2DF8A 2JAOA 4JN6B 4DTCA 1AF7A 1E1YA 4IUCS 3ICEA 1YHNA 3W2EA 1XJCA 1O96A 1S2NA 4RVFA 4UNNA 5EMJA 4C6SA 4GXTA 5H80A 3PR2B 1PFQA 3LDUA 4IHQA 3JTEA 4MWEA 1DXQA 2WK1A 3GZ4A 5CEFA 3VRHA 1TX4B 4YYZA 4MKIA 5KTMA 4HR7A 4TTJA 4RMNA 2OZEA 3U31A 2WTEA 3KL2A 4G2TA 3VH3A 2VKQA 2Q1TA 1BD3A 3IP6A 5JZSA 1E2FA 4O0MA 4HDQB 4EB6B 4P38A 3R2JA 2DAPA 2MINB 1PJRA 4FD2A 4IQ8A 1ZVKA 2QD1A 3LL7A 4I8DA 1FA9A 1SC6A 5I7AA 1WF6A 3B3QA 3BILA 2Y6UA 4P92A 1WDWB 2D5BA 4YAKA 3EIWA 1NM5A 3C24A 4EJSC 1IUOA 1C0EA 4POAA 3KKOA 1E79D 1NBAA 4TTSA 2I9KA 3SS9X 3R7AA 1O97C 1CLUA 2QV0A 1UIMA 1IQUA 4INAA 1GZSA 3PQCA 2X9LA 2O0MA 4B43A 3IL2A 1GCIA 3JR3A 4DA4A 1Z88A 3NHBA 1TECE 2PZKA 3AH8A 1JEQA 4OA8A 3F8SA 3VBEA 3LZ6A 5T41A 5LN1A 3K9GA 5M34A 3ADKA 4MJLA 4BC0A 3T61A 1Q12A 5J4YA 2ZAMA 1F5NA 4BNXA 4Q7JB 2QPAA 4LQLA 3V55A 5AVUA 2XGOA 3ND5A 2CMGA 1Y48E 1A8HA 1SXJA 4NULA 1MDBA 2JD2A 3EF3A 2XMDA 4FSXA 1G1MA 1D9XA 1FDRA 4BATA 3K70C 1OAAA 3QU4A 1ZLXA 2QJTA 1J00A 3A3NA 3CRNA 1DLJA 3GELA 4HWRA 4OKSA 4XUEA 1NY6A 3COZA 1YB6A 1YS1X 4IG4A 2P11A 4HFMA 5KINB 3D8BA 3EXHA 3KFVA 3ZHUA 2P35A 1SVSA 5HBRA 4N0MA 5BVHB 1UBUS 3O75A 1ZJ4A 3CRW1 1FYDA 2HK7A 2NWQA 2WYUA 4XSHA 1FXWF 3KSZO 3RT7A 3AR5A 4HTAA 1SOWA 4N7BA 1D0VA 2J32A 2QTGA 3A25A 2WAAA 2LBPA 5DYYA 3JAKA 2CJFA 3OOYA 2HA7A 4X60A 1MT3A 4C3UA 1TUIA 3W7AA 2V3VA 2IF2A 2RI0A 3E5MA