2E5WA

Crystal structure of spermidine synthase from pyrococcus horikoshii ot3
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
280
structure length
280
Chain Sequence
MRDMEFIEWYPRGYGVAFKVKRKILEEQSEYQKIEVYETEGFGKLLAIDGTVQLVTEGEKSYHEPLVHPAMLAHPNPRRVLIIGGGDGGAIREVLKHEEVEEVIMVEIDKKVIEISAKYIGIDGGILEKMLSDKHEKGKLIIGDGVKFIEENSGFDVIIVDSTDPVGPAEMLFSEEFYKNAYRALNDPGIYVTQAGSVYLFTDEFLTAYRKMRKVFDKVYYYSFPVIGYASPWAFLVGVKGSIDFMKVDAEKGKKLGLEYYDPDKHETLFQMPRYIVQML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable spermidine synthase
publication title Crystal structure of spermidine synthase from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
total genus 85
structure length 280
sequence length 280
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 2e5wA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2e5wA02
4KIFA 4V0QA 1R18A 1UFKA 4DCGA 2P41A 3GU3A 3BKWA 3OZTA 3Q87B 3DLIA 2OB2A 4OA8A 4XUDA 5DM0A 4AUKA 5HZMA 2Z6UA 3KQVA 1AQJA 1BOOA 3JWJA 1KYWA 2PLWA 1KPHA 4QQKA 4RTLA 1JG4A 3HVIA 4ISCA 5JR3A 3V8VA 3OZRA 2HWKA 3FYDA 2ZZKA 4RSRA 2I9KA 3FTFA 1L3IA 3TOSA 4OQEA 5DXJA 5EMJA 1XDSA 3GRYA 3K6RA 3RODA 4ER6A 4X41A 5P8WA 1Q0TA 2IH5A 3TFWA 3UJAA 5E2BA 1SUIA 4PYQA 2AN3A 5GP1A 3M33A 2B9EA 4ER0A 1SG9A 3A7EA 1YFLA 4E31A 3P8ZA 5EC8A 1QAQA 1ZGAA 3A4TA 3S68A 2PX2A 3P9IA 4E2WA 2AVNA 3ER8A 4PWYA 3GRZA 2FYTA 2O07A 5DTMA 3DMFA 4F84A 5FHRA 3U81A 4JXJA 3HEMA 3G7UA 4CXMA 1PRYA 2NXJA 4LWOA 3MERA 5CVUA 5ERGB 1XVAA 5E9QA 4YV1A 3TKAA 5BW4A 5CD1A 2JH9A 1BHJA 2QRVA 2GAFA 5DTQA 2K4MA 3LSTA 1KR5A 5EMMA 1QAOA 1VP3A 2V74B 3QOXA 1P1CA 2H1RA 2YXEA 1RI5A 1HMYA 2YX1A 3EVBA 3AWIA 3KQYA 4LG1A 5DX8A 2G72A 2IIPA 2CWWA 1JR4A 1O9HA 4PCAA 2O05A 4CKCA 5E1BA 3UJDA 3EPPA 5K0CA 5CCXA 5EQJB 2JG3A 4QTTB 3DLCA 2JHCA 4C03A 5KS2A 5U4XA 3UFBA 1NKVA 3OFKA 4ER7A 1R6AA 3OCJA 4QVKA 1EIZA 1DL5A 2NNWB 1R8XA 3M6VA 1IXKA 3I5UA 3OE4A 3OU7A 5GINE 3SM3A 5DM2A 1EJ6A 5BW5A 5DX1A 3HCDA 2G70A 2PBFA 3TPZA 2AOTB 2ZBQA 4GUAA 4QDJA 3T7SA 1FP1D 1JSXA 1NW3A 2I62A 1JTFA 2AOTA 2AVDA 2ZIFA 1QZZA 1NV9A 2BZGA 4KWCA 1SVUA 5EMLA 4AZSA 1G38A 1Q0SA 2XBMA 5LQRA 1NW6A 4YUXA 1NE2A 1DUSA 4FR0A 3FUTA 3LDFA 1YZ3A 2O06A 1I9GA 5E1DA 2AR0A 5EKXA 1M6EX 1Z3CA 4X63A 1EG2A 5LQUA 4AZVA 3UBTA 4E70A 3HNRA 4FZVA 1SQFA 4BP1A 4IV0A 3NDJA 3GIWA 1JQDA 5EG5A 2R6ZA 2H11A 4C07A 5EZQA 3SMQA 3JWIA 4RX1A 3MGGA 5LQAA 3KHKA 4HTFB 5G02A 5K0BA 2E5WA 3GGDA 2HMYB 3G8AA 4HTFA 2PX4A 1EAMA 4C05A 1XDZA 1IM8A 4ZTBA 2BR3A 4O29A 3QOWA 4OA5A 2AOUB 3HCBA 1BC5A 9MHTA 2AOUA 3BWCA 2Y1WA 2VZ9A 4PGGA 4R6WA 4R8SA 2VDWA 1XTPA 5MHTA 2V7EA 3G2OA 3AJDA 2ESRA 3HCFA 3LBFA 2IDKA 4OQDA 3THSA 4F85A 5LR6A 5CVVA 3ELYA 3NMUF 4KDRA 5EOVA 3BXOA 5EZSA 3EVGA 4GQBA 2ONZA 5DWQA 3IHTA 3ELWA 1JG2A 1R8YA 3UJ8A 1KHHA 5DTRA 1G8AA 2H00A 4RVGA 4RVDA 1PJZA 3A27A 2WK1A 1VLMA 3UJ7A 3LL7A 4K6MA 5LQNA 1X1DA 2PKWA 4MWZA 2G8NA 4BY9E 1ZG3A 5H02A 3GDHA 2VDUE 1YF3A 3DULA 5CVEA 4PYJA 3MHTA 4ER3A 3G2PA 2JHPA 4R6XA 4E2ZA 4X60A 2FCAA 1F3LA 4EKGA 4H0NA 5F2KA 1L1EA 3UA3A 2EJTA 3KKZA 4G56A 4NECA 4C08A 5EHIA 2Q41A 3MAGA 3EMDA 3TKYA 2CL5A 3JWHA 1N2XA 5KYGA 3I58A 3FPHA 2EG5A 3KQMA 2XYVA 3SVZA 1XDUA 3ELUA 3GNLA 3C6MA 1TPYA 3GRVA 5EVJA 5DLYA 3VC2A 2FHPA 2VDVE 4X61A 3EGVA 3FPFA 2OBFA 4RVFA 2GS9A 2ZIEA 3B3JA 3UJ6A 3HP7A 4YUZA 3IEIA 5EMKA 3GO4A 2O57A 1NW8A 2I6GA 2Z6QA 4M7RA 1JSZA 3I53A 3T7RA 4B17A 3I64A 4AZTA 1UIRA 2PT9A 4PINA 2ZFUA 3FTEA 4M37A 3CCFA 3BKXA 3EEYA 5IH3A 1VP9A 3PLAE 3X0DA 3B5IA 2ZCJA 3L8DA 1XXLA 2IH2A 3RW9A 1G55A 3DOUA 3FYCA 3NDIA 3P71T 3FRIA 2OY0A 4IV8A 1OR8A 2ZTHA 3BGDA 3EVZA 3LHDA 1O54A 3PX3A 4E32A 2UYCA 2FRXA 3LCUA 2OPBA 3NWEA 2R3SA 2F8LA 5CM2Z 4BLWA 5M5BA 1M0EA 2JHAA 2ONYA 4R05A 4PIPA 1RJFA 3GCZA 1YZHA 3HCEA 4C06A 3FPJA 2IBTA 5FA5A 3LECA 2VP3A 2QYOA 5KVAA 2ZZNA 1L3CA 2AS0A 1P39A 4MQ4A 5CCBA 3HVJA 10MHA 3Q7EA 1M6YA 1XCLA 2PXAA 5K0GA 1X1CA 4KIGA 5DRTA 2FPOA 3GJYA 2QRVB 5E2AA 3TR6A 3KQQA 5DSXA 5CVDA 3RIEA 3QV2A 4HC4A 4DQ0A 3UJ9A 3ID6C 2GLUA 3BGIA 2C7OA 3LDUA 2XYQA 2ZBPA 3FUVA 3P2EA 5FHQA 3JWGA 2BR5A 1FPQA 1SQGA 3PFGA 2WA2A 4FSDA 4A6EA 4RTNA 3MB5A 4V0RA 4RTOA 2OZVA 5EIFA 5K0EA 1Y8CA 3MCZA 4FGZA 2NXNA 3BWYA 3HCAA 3MQ2A 3PB3A 2FK7A 3G5TA 2BR4A 3LGAA 3KR2A 2AOVA 1VL5A 3P2IA 5GIOE 4GOOD 1WXXA 4RTSA 4A6DA 5F2NA 2IGTA 3PVCA 2Z6AA 2WA1A 4E2XA 1V39A 3DXYA 4POOA 5D1NA 1NT2A 5E1OA 2PSSA 1N7JA 2HNKA 2PT6A 3KQPA 4OBXA 2PGXA 4YV0A 3E05A 3G88A 5ICFA 2GPYA 1AQIA 3DXXA 4FSXA 4KRGA 5K0JA 3NTVA 1VQ1A 1RJGA 2NXCA 4RWZA 3B3FA 2ORED 4YUWA 3FPGA 5FADA 4CKBA 3FZGA 5K03A 5D1HA 4C04A 3B3GA 3SR4A 2C7QA 2IBSA 5FA8A 5KQRA 5DRYA 1G6Q1 1KPGA 1WG8A 4RTMA 3BUSA 4C4AA 3PTAA 1VE3A 4PYLA 3KQOA 1AV6A 3CJQA 2P8JA 2B3TA 3EEOA 2UYHA 2OKCA 4XCXA 5B1SA 3OZSA 1NV8A 3KR1A 3EMBA 3C0KA 3E7PA 1D2GA 3DMGA 3NVMB 4GOND 2PVCA 4RTRA 3BWBA 3V97A 5JUWA 1YFJA 1DCTA 3E23A 3BWMA 2PX8A 3GXOA 5C1IA 3SXJA 2PXXA 3R0QA 1I4WA 3KQSA 1NW7A 3KR0A 3MTIA 4QPNA 5LQCA 3HA3A 1QYRA 4YMGA 2ADMA 3BT7A 2UYQA 2P7HA 3CJTA 1RI1A 4RYLA 3B7PA 5HIMA 4FT2A 4MIKA 1P91A 4DF3A 1L3BA 4QTUB 2IPXA 2AOWA 4KVZA 4OX9Y 1YUBA 3ANXA 2NYUA 3MTEA 3M6XA 3ORHA 2YXLA 3EVAA 5FULA 3NWBA 4GF5A 1HNNA 3A7DA 4OBWA 4CWAA 3TRKA 5BXYA 3C6KA 3GRRA 4DKJA 3NW9A 3VYWA 2AOXA 2P7IA 4ER5A 3LKZA 1JQEA 5BP7A 3EVDA 3H2BA 3CVOA 3KR9A 4GC9A 2IFTA 5HIKA 4PIMA 1G8SA 1RJEA 2NXEA 4BLVA 5GIPE 4HGYA 3G5LA 5DX0A 8MHTA 2BH2A 3CKKA 4HG2A 2GB4A 3D2LA 4FS8A 3SGLA 3SSOA 1ZHFA 1G60A 3GWZA 4DMGA 2ZZMA 5IKMA 1TW2A 2JJQA 3LCVB 2BM9A 3ELDA 3ERCA 2ZLBA 5EEGA 1FBNA 5C9ZA 2UYOA 3HA7A 3G8BA 4HRAA 5ICCA 3EVFA 3A26A 2DPMA 3CC8A 3ME5A 5K09A 4WVLA 2PWPA 4LWPA 5T6BA 3HVKA 2PJDA 5LQKA 5DPMA 4Z2YA 4E30A 4P7JA 1JTEA 1NBHA 4DA4A 1JG1A 3FTCA 3NJRA 4DCMA 2OB1A 3DMHA 3LBYA 4EK9A 2G71A 2A14A 4PYKA 3DTNA 4GC5A 5HIIA 5K8VA 4E2YA 4CTJA 3UWPA 3FUUA 4EMSA 4YV2A 2IDJA 3OU2A 3BGVA 2HTEA 4CKEA 2QE6A 3TMAA 2YQZA 3NVKI 7MHTA 4QPPA 3SX0A 2AN4A 5DM1A 3E8SA 3EVCA 4PYMA 3TLJA 5EPEA 4DM3A 4WXHA 2I7CA 2EX4A 4RVHA 2KW5A 2YUIA 5K0FA 4RTJA 3LDGA 5FWAA 1RJDA 2NP6A 2GA9A 1U2ZA 4KW7A 5FTWA 5F2OA 5E8JA 3O31A 1P1BA 2OYRA 3CBGA 2P40A 3I9FA 4UOEA 4P7GA 2PXCA 3HA5A 5EGSA 1AF7A 3IV6A 3TM4A 1SKMA 1UWVA 3P9CA 4CTKA 3SSMA 2JH8A 4U7PB 4PGHA 1WXWA 5FWDA 4FP9A 5T64A 5CIYA 4P7FA 5HILA 4YUYA 2VS1A 3HCCA 2IH4A 5LQJA 3P9NA 3UJCA 3DH0A 5KQSA 2P3LA 4YUVA 1KXZA 3KPYA 2ZULA 4IKPA 2ZBRA 3T7TA 1R74A 3C3YA 4GEKA 3FPEA 1VIDA 5HOQA 4MTLA 4QVGA 3UJBA 2B25A 3SSNA 4QDKA 4GBED 1ZQ9A 1NW5A 1QAMA 1FP2A 3FUXA 3R6TA 4HSGA 3G89A 1ZKDA 1L9KA 2PY6A 3AY0A 1N7IA 2ZVJA 3PS9A 2AN5A 3CGGA 3KPWA 1JQ3A 3REOA 3KQWA 2YR0A 3KPUA 5HEKA 4R8RA 2XVMA 2FK8A 4QQNA 3MCTA 1WY7A 5LSAA 3BZBA 1JG3A 3C3PA 5EHGA 3P97A 3HTXA 3LPMA 5DT2A 2CMGA 1X19A 2HR1A 3OE5A 2C7RA 3CJRA 1VBFA 3AXSA 2P3QA 3LKDA 1EQAA 5GOZA 3B89A 4PYNA 3VSEA 2XVAA 3R24A 3DUWA 2ERCA 4FT4A 3UA4A 2ZIGA 3EGIA 3KU1A 3TQSA 2N47A 2QM3A 3GRUA 5CVJA 1B42A 1X1BA 4ATNA 5EKUA 3ER9A 4P58A 1KPIA 2ZWVA 4PNEA 1ORIA 3M6UA 3OPNA 1RI3A 4F86A 4Y2HA 5ICGA 5K01A 1FJXA 4KDCA 3EGEA 3R9XB 1MJFA 1RI2A 3T0IA 2QY6A 2XYRA 2PWYA 1WS6A 5EEHA 1MHTA 3A25A 4PYIA 1R00A 2Y1XA 3LCCA 3PFHA 4AZWA 4Y30A 1XJ5A 1X1AA 1H1DA 3DXZA 3G2QA 3VC1A 3DR5A 2NP7A 1KYZA 3OU6A 5DSTA 1TW3A 1BKYA 2EFJA 5K0LA 2UZ4A 1YB2A 1IY9A 1VPTA 1EJ0A 4RTQA 3O4FA 5K0NA 5K05A 4EQZA 4GOLD 1QANA 5EIWA 5E9WA 4HH4A 3FRHA 3EVEA 2B78A 3M6WA 4RV9A 4XUCA 3KPJA 4BLUA 3KQTA 4RTPA 5DM4A 3O7WA 2OXTA 2O0LA 1F38A 4E33A 3M70A 4M38A 1RI4A 4PCLA 5C0OE 2P3OA 3P9KA 5FQNA 4EVIA 2G1PA 4XUEA 3M4XA 4GOMD 1INLA 5HFJA 2B2CA 4EKIA 1WZNA 4PYOA 3G2MA 2ZW9A 3AXTA 2PX5A 5E1MA 3F4KA 5DXAA 1T43A 5T67A 4AX8A 4RTKA 2YVLA 3K0BA 3PT9A 5ICEA 1SUSA 1ZGJA 4U7TB 3WSTA 5GM1A 3HVHA 3FTDA 3P2KA 1KP9A 3FUWA 3KPVA 5FQOA 2DULA 5GM2A 5CUQA 2GH1A 5HIJA 1XCJA 2IP2A 2PV0A 3LX6A 4P7KA 3THRA 4PONA 3OFJA 1D2HA 3DP7A 3IYLW 1KIAA 2P35A 2ZWAA 5E9JA 1ORHA 2YTZA 2ZSUA 5E8RA 4X1OA 1NBIA 5FUBA 4DZRA 2AZTA 3UZUA 1D2CA 4MHTA 2P1DA 2YXDA 3PX2A 2BM8A 1O9GA 3TM5A 5FCDA 2HV9A 4LECA 4BP3A 2C7PA 2LD4A 3R3HA 2CKDA 2CMHA 1I1NA 4HGZA 4M36A 2OO3A 4IWNA 4L7VA 5GWXA 3HM2A 2EJUA 4YMHA
chains in the Genus database with same CATH superfamily
4ZYZA 2C0QA 4KDFA 4JBWA 4J4TA 4R1PA 5KPJA 1MFZA 1YULA 1RWMA 3ADKA 1ZC4A 1NSTA 3BKWA 4PO3X 2Y1CA 1G5IA 3RHZA 1FTWA 3EFHA 3L7CA 3F7OA 4FJ0A 4OOEA 5CDHA 1KI9A 1BOOA 4JL8A 4D82A 1EFHA 2H59A 3BK2A 3C5VA 1PG5A 2IU3A 3DBLB 3FAKA 5FNVF 5BW5A 5AW6A 2V9ZA 4PFJA 3EYAA 4RZUA 4K3VA 1JAXA 1M6VB 3BMCA 1M0TA 1Q0TA 4X41A 4TTRA 2QR2A 5FBQB 2JVKA 3EWSA 3PDWA 1DAFA 2VKTA 3VR3A 3ZHSA 1SK9A 1TGYA 3A7EA 4Q6WA 5JSYA 3MT9A 4GKKB 2BY4A 3ENNA 4IJQA 5KJFA 2QXUA 1ZCJA 1XZJA 3NBYC 4Y2SA 1FDRA 3I9MA 3DEAA 2HPZA 3OQBA 4D81A 5FHRA 1KOLA 1CVIA 2EYQA 3VR4D 3L6CA 2QVLA 5CLFA 4WESA 2XGJA 3ZQKA 4DLXA 3ONWA 2HV8A 1IM2A 2ILTA 4QDXA 5JCJD 2PZEA 4MYUA 3HBFA 3UJNA 2J8ZA 4QQ8A 4WK0B 2NYRA 1D8AA 4U6QA 4F4DA 1KR5A 4XWKA 1QAOA 1HNZB 2WVGA 2Y1DA 1Q1NA 3GBPA 1P1CA 4RFVA 5FBWB 4C0HA 1IN6A 1RI5A 1HMYA 1KOJA 2P9BA 4LG1A 4RPIA 4TMTA 5ERYA 5ADVA 3CLVA 1Y89A 2XR1A 2GKOA 2G25A 4IEEA 1ZY2A 3U17A 4G6ZA 4AICA 2O05A 1C8BA 1WETA 3BDAA 3CZRA 1QG2A 3VVMA 4QU8A 4HDAA 2JLRA 1LK0A 1RRPA 4MQFA 5IC5A 3I76A 4X71A 1NKVA 3S2UA 2XWPA 1UBHS 3FCAA 5IANA 4LYAA 4JITA 4RPHA 5A3VA 3WGYA 4ARCA 1Y42X 1QNFA 4B9AA 2GTPA 2WWWA 2PKEA 4Q00A 2YS6A 2AK3A 5A6SB 2G70A 4CFYA 5IVPA 1NJ5A 2GILA 5K6AA 1VLZA 3ZXXA 3MGBA 3JATA 2IYNA 1Y1KE 3JRXA 4OXYA 1KOGA 1NBMD 1W85A 1X1QA 2ZRAA 1EGMB 3V4ZA 4AZSA 1BEZA 2XBMA 4IG9A 3VQTA 3N2YA 1WDTA 1CX9B 1WZCA 3I2GA 4K1LA 2AR0A 3PD0A 1Z3CA 2IYEA 3AEKB 2E87A 3U44A 1E3EA 5DGTA 2OGUA 3BQMB 1O94C 1ZDMA 5DMXA 2FEPA 2FOXA 2GEBA 2B92A 3BL8A 2XUKA 3F6EX 4GSLA 4RHTA 4FOTA 5IULC 5IM4F 3KHTA 5CXSA 4CV1A 5KSOA 3NO4A 2O2ZA 2UUAB 3AC0A 3UKDA 4IJKA 2NZYA 4BFZA 1K2VN 4N01A 1QTNA 1S2LA 4MR7A 1I6MA 1NRJB 1Y48E 2D3WA 3OQIA 3V7YA 3WYGA 3ZR4B 5ICMA 3EHEA 3BTUA 4U2CA 3C4QA 3QIVA 5DIFA 1Q7GA 4S2EA 2DUWA 3GOHA 2AC4A 4KR9A 2G9VA 4DR3B 3HCFA 1QH0A 2C54A 3LBFA 3LQFA 3OHPA 4OQDA 3VR2D 4Z5XA 1WA5A 1PNRA 3CUYA 4YP0A 1GTG1 3IE2A 5DP2A 3ELWA 2HPVA 3OZGA 1MW8X 4YP6A 4ZHQA 1P81A 3KSUA 3NNDA 4MQEA 2GYUA 3EF0A 1P2BA 2RH5A 4IRUB 1K6IA 1IN7A 1XK7A 2XHEA 1JEAA 1G8FA 4CQLB 2Q29A 4NENB 4XPZA 5H02A 2VDUE 3MQFA 1NVAA 3R8XA 4FKZA 3B82A 5CVEA 2WJAA 2HLHA 2FW7A 3RVDA 2E7ZA 5GZ6A 4QZVA 2JHPA 3Q3HA 1LBSA 1N2CA 4MQBA 4MV6A 3ZHVA 5CXXA 4EKGA 2VFAA 3FRJA 3SIPA 4UUOA 3G1WA 2QTMA 2W6ZA 4JP1A 1QLHA 3VAYA 4KXVA 4PANA 3PUVA 3IQDB 3L0ZA 5JD4A 2ZE7A 3A6FA 1XDUA 1NN1A 3V8QA 1R4NB 5BT9A 2DVMA 1B26A 1UK8A 1LDBA 3EGVA 4LRWA 5J5AA 4AB1A 1B0PA 1BHQ1 1WEHA 2AHOA 2HUPA 2Z8YM 3I1FA 4IIJF 3RVKA 3WL4A 4ZEMA 1GDTA 1NBAA 1E0DA 4OBBA 1DO8A 2O57A 2UVQA 2R25B 3A0RB 3IX7A 3NEJA 1SH7A 3IVCA 3ISJA 1AUQA 1GFWA 1TK9A 1UIRA 2PT9A 3O03A 3NYRA 4NCHA 5AJWA 3RSQA 3H8WA 5C52B 4AO6A 1VP9A 2QN2A 5C7LO 3PLAE 1IJKA 5CTJA 4MOWA 3GB9A 3B5IA 3L8DA 2EBFX 3DFFA 2IWRA 4F21A 1P4RA 2XDQB 1Z6QA 5ELXA 4HWOA 1VCIA 3R3VA 3JD4A 5D7NA 3LHDA 2BP7B 1DX6A 3ILVA 4HMQA 3BJMA 5B64A 1ZD9A 3JTEA 3GRCA 2RHHA 1RJFA 1RAIA 5CLHA 2Z2IA 4MSUA 4CDNA 1K4YA 1NL3A 1MQ8B 2A5LA 1L3CA 1A8UA 4UUQA 2BZ0A 3V3KA 1U3TA 4PZ0A 1YNOA 3RUEA 4AS2A 2XCQA 4IQ0A 2JC3A 3FR8A 1YZTA 4PLZA 2XSZA 4Q9KA 1XT6A 1PYDA 2XE4A 2G5CA 4KQXA 3WQBA 1LDMA 1AHPA 3ADDA 1F8GA 4X62B 3EOAI 1TQDA 4DLAA 3DG9A 3MNFA 3E7XA 3FNBA 1TU0A 3LXRA 5IZCA 2IKQA 1J8VA 2SCUB 5FR1A 3B13B 1G1AA 2VEOA 2R6GA 2YL2A 4JBNA 5JH7A 1MO6A 1JIQA 3QU2A 3ZYZA 1TTTA 4Z53A 4Z4IA 3K0HA 1EXNA 4KG7A 4ALKA 1AS3A 2YIMA 3ZE6A 4TSRA 5FHQA 5D3MB 3DLPX 1L7RA 2X8WA 4Q47A 2IK8A 2VHCA 1WF3A 1BOFA 4CR6A 2RGDA 4RTOA 1N75A 4ZQFA 3RJ5A 3O1JC 1JEOA 3C24A 4HBZA 4IJWA 1J0DA 2GFQA 2PJUA 1L1QA 4MHSA 1Q7BA 4V38A 2B9VA 4KRXA 2J3DA 2PRKA 4WD3A 3PIIA 5GGXA 1U7HA 1V26A 3RJTA 4AN4A 4HX9A 4NK5A 5G41A 1Q44A 4YJFB 1G3RA 1Z2PX 4LCJA 3RS5A 3V4FA 4P4LA 4EKNB 4KPUA 4FMCF 2HWYA 4GECA 4TV9A 2RAVA 4BZXA 4F12A 1OYOA 1T3TA 5AKGA 3IS3A 2IY9A 1IEQA 1VJ1A 1XLWA 3QVGA 5FR2A 3UV7A 5IJ0A 3OM0A 5LBTA 3LY5A 2RCYA 4OK3A 5I8ZA 1SBCA 3K31A 4IHJB 3IAM6 2B1JA 2FXVA 1T91A 2YWBA 2VXBA 3ICEA 2QTVB 1KVQA 1M33A 2OD7A 3GLKA 3E15A 3HJUA 3MTGA 4RWZA 3TTYA 4A8PA 3CRRA 5KCZA 3AEZA 2QJRA 3DMPA 2CDCA 3O38A 2ZK7A 4YRKA 4GAEA 5U4QA 1PQPA 4HNAB 1EUCB 2EWVA 2W8ZA 5DRYA 4ZK6A 2BEVB 4KXXA 3RFUA 1PEYA 2VKQA 1BGWA 3FHJA 3PGLA 1SXJA 3AW9A 2SNIE 3EF1A 3WL7A 4D79A 3HXLA 2FPLA 1RM5A 1VC2A 3DEIA 4BO8A 5IXJA 4XAQA 3ZWOA 4YJ3B 4BLPA 1WOMA 5J58A 2AFIE 5CJJA 4UE3S 2ZR8A 1E9AA 2D7CA 4RTRA 3IOCA 2FUNB 5IWCA 1YFJA 4QYXA 1D3AA 4LI3X 3D3JA 4QPNA 1SQ0A 4MKIA 2D1FA 3GH3A 4GBJA 2HQ1A 1AVTA 3N75A 1X7YB 3AUFA 4OQ4A 4R3WA 4G01B 1CY8A 3S27A 4Q7KA 1L3BA 3VX3A 1PZHA 4WEQA 3H6KA 1QLJA 1PGJA 4MEBA 3AX6A 2YWEA 1U8YA 2C5AA 2WF8A 2ZSEA 3C45A 4OHUA 4Q0MA 3WDKA 4Q7QA 5FULA 5JY6A 4A91A 3O0DA 2QAIA 4DFDA 1Q84A 5TPWA 3T4PA 2ZRKA 4EB3A 1L5HB 3NU1A 4PZYA 2AOXA 2P7IA 4LY6A 3D2CA 3LHSA 1MX9A 3EFBA 4FFVA 1RLMA 3VO8A 2X3FA 2QV0A 3NM5A 1EZZA 4J94A 3HRHA 4MWSA 3QUQA 2WLSA 5BSHA 2WUGA 1PL6A 1ZN9A 1I33A 5DX0A 2I8LA 1QGOA 1U1CA 4UCQA 4PPGA 3QVMA 4HN2A 3OZVA 4DMGA 1AQ6A 2GEUA 5ALXA 4WY8A 1H65A 4N18A 2YJ3A 2KBFA 1GFSA 3S5UA 1JXOA 1IBSA 3M4ZA 2CK3A 1Z6TA 2W2LA 4WKBA 4DJDC 1R8JA 2QF7A 1K89A 2C9BA 3ZCUA 1WZ2A 3I3SR 2WUDA 4C3ZA 5K09A 2QT0A 4C2TA 4ETNA 3THXA 1KAQA 3WV4A 2OESA 3GT4A 4EUFA 1RZVA 2D54A 3KRTA 1A7UA 1RXCA 3O8OB 2HQBA 3GHYA 5IDXA 1D4AA 1WB5A 4Y6GB 1SCUA 4QICA 4Q4CA 1EB9A 2HSDA 2WWHA 4NFYA 4EMSA 1G4AE 4QUAA 2RH8A 1VPLA 4PHTA 1O57A 1K3TA 4M46A 2V5AA 3QWHA 1N2HA 4IIVA 2C4MA 2V1UA 2VF8A 3PK0A 1P60A 4DTCA 4XSVA 3GFSA 2INGX 2ZDQA 3DTVD 3IOMA 1XYGA 4WXHA 1UC5B 3W05A 3OMLA 4W5WA 4LGMA 2DWQA 2CV0A 1TO2E 2JEOA 2JAHA 5FTWA 1XRSB 5AVWA 3HSSA 2VRCD 3R7FA 5CD9A 1C29B 3CBGA 1RRMA 4UOEA 1GQOA 1T9ZA 2HU5A 3D02A 3PGJA 5G0VA 3WK9A 5J2UF 1QHEA 1DELA 3FCYA 5J63A 3BL6A 1E18A 3B9RA 1LD3A 3IUSA 5G4KB 4L8YA 3WLKX 3H13A 3SYNA 5ALMA 1N34B 4ZVVA 5CFPA 3VR5H 2W93A 2LIPA 2BHLA 1MTZA 2PQ2A 5KNBD 4DCUA 2Q0SA 1PFKA 5I7AA 4DOMA 3CXUA 2C83A 1MIOA 2CLMB 1XCPA 1TQ4A 2GCGA 4M1EA 4QBTA 4V0OA 1VIDA 2JI8A 2FVXA 4MTLA 2QRMA 3VPBA 2GXQA 4H9JA 1DDIA 3E9YA 3IERA 3Q5EA 1V7PC 1XHLA 2CC2A 4II7A 2GEFA 1RQGA 3G89A 1FLDA 2W0SA 3OZXA 3EXG1 2XMCA 4NTZA 4F4JA 1B74A 1XZAA 2Q2VA 2DMRA 1QO0A 1M2WA 1IC6A 1N5JA 1VM6A 4B6FA 4FDTA 5KQPA 4RTSA 4FR5A 5G3YA 3BCUA 4EHJA 4YWHA 4K6KA 1HDGO 4R8RA 2XVMA 3G23A 5ESRA 4L6AA 4BO6A 4IVPA 3MF4A 2H48A 3T1NA 5KC9A 5EWLA 1JV2B 3OJXA 1YKGA 4B80A 1X9GA 1GFIA 4MVJE 2DWCA 4E94A 3SEZA 3UHOA 1P5ZB 2RJNA 3FKSA 2ZRFA 1UM8A 4ILEA 2HQOA 3B6IA 1DJMA 3WKEA 3NNSA 2J9YB 2R85A 3RYHB 4E4RA 4B5KA 5DYIA 3NGXA 5GOZA 4WV3A 3GROA 3BPSA 2J87A 1X80A 4PXAA 1Q1EA 1NYLA 2MOKA 1XZBA 3HEBA 4MAFA 2VP9A 5ARDA 1Z6XA 2ZJ0A 3SIWA 5ITZB 4WTOA 4ANFA 1TCUA 1CQIB 1L4HA 2WOOA 3ISVA 4M8KA 1U8AA 4NFLA 4B6JA 3ER9A 4PNEA 4L5AA 3UAVA 3ZUPA 4JJFA 1NW4A 1NMQA 4CG2A 2ZETA 2ZTSA 1RRVA 1LEHA 3RKSA 3L49A 4OI1A 4NEGA 2P2DA 3CISA 3FGNA 4TLBA 4HX2A 4K6HA 2XBLA 3HU2A 1XTSA 3MTBA 4CIXA 4ESOA 4HDSA 4UTRA 4DBLE 3A1CA 3GWGA 1NOKA 2TYSB 2WIGA 5DTJA 1YKFA 1LI5A 3ZJ4A 1B4DA 1T15A 2ZYIA 1GTJ1 3G8DA 3GLSA 1T9AA 3I1IA 3OF3A 1UBGA 1W35A 3H19A 3QEOA 1FYXA 2AWNA 4Q3DA 2QMHA 1TMYA 3TVDA 3ZGOA 4EG1A 4F6RB 4IDQA 3GV0A 3KT3A 3Q0TA 2JGFA 3PXDA 4YXWD 3WLOA 5AW3A 3RV4A 4G9GA 2FSGA 4HQKA 3PXGA 4ZOCA 4QHYA 4BDSA 3N2LA 1NX6A 2FW1A 3E9QA 5JD6A 2H29A 2BEKA 2FDRA 1CUJA 1SUWA 1BFUA 3KT0A 1LBTA 2G1PA 2O23A 3HRIA 1QK5A 3ABSB 5ALUA 4ZI3A 1INLA 2FGJA 2QE7A 3O8LA 1YK0A 1RBMA 1VL0A 1JU9A 1RWKA 4OCZA 3LZDA 1JWBB 3RWOA 3II6X 2Z9DA 3SBOA 2HSZA 1JXQA 3N5KA 5IYZA 3MWEB 1YQEA 2XA9A 2PT7A 5L3RA 2LCIA 3W5AA 1AF4A 3MIIA 2G17A 1ZK1A 1V1JA 1B1AA 1YJXA 2IXDA 1EVKA 2YZMA 3KVVA 3NWJA 4M7PA 4WKOA 4YJGA 3RRNA 1QNLA 1QRTA 1DPFA 1GGEA 4NMMA 5ECYA 5ESDA 1ZJWA 1EDBA 1K4KA 1QE5A 4AWBA 1C41A 1FTSA 4O33A 4CM9D 5FUBA 1OB5A 2F55A 1CQJA 2AZTA 2IHNA 1NULA 3VNRA 2FI1A 2XTMA 3N39C 4ZTUB 2ZJ5A 4C7OB 9LDBA 1MP0A 4B3IA 5FCDA 2LCQA 4JA0A 3R20A 2ZVDA 2VAXA 2B8EA 2Q8NA 4J3JA 2Q5HA 3T0FA 3ROGA 3TAXA 1U7PA 3DE7X 3GBVA 3Q8MA 1MLDA 5JADA 4S1OA 2A9KA 3IQFA 2O5CA 1GL7A 5BN4A 3I6BA 2H51A 1C8KA 4PBSA 4TQAA 3A37A 3ZWKA 1J07A 4AUKA 1W73A 1E2KA 1L8OA 3TBHA 2X23A 5KTKA 4YAJA 1JKMA 1JPNA 1V3VA 2LDBA 1QB7A 1DIHA 1YRWA 3RSZA 1FTQA 1MAWA 1Z4PX 2EXXA 4ABYA 1C3OB 1E7QA 2JNWA 4XI9A 5A71A 3QFSA 3V8EA 2L19A 2ZBGA 2BHRA 1H6BA 5B55A 1YGPA 1X13A 2NADA 3BJRA 2UDPA 3GRYA 1VSUA 5ANRB 4CCAA 5KPDA 5LQDA 1SUIA 2NVUA 1TVEA 3H05A 5AKXA 4D3DA 1E2DA 4D4HA 1PQWA 3JYLA 1AKRA 1R0WA 1QZTA 1UMDB 1ZITA 1NMYA 3IAHA 3KLOA 4IOKA 4J0EA 1RXEA 4I81A 1Z5ZA 4ZQGA 5JC1A 4AJIA 4IEFB 3GRPA 7YASA 2QROA 2FSIA 3RABA 2FGKA 3T3MB 1DQRA 4CXMA 4BFLA 2H2IA 4L5YA 4Q3AA 4U7GA 4GYJA 1SCQA 3F3SA 3GFFA 3UFXA 2WJHA 4RHFA 1RFGE 4JSRA 3RVQA 5CD1A 2P1ZA 5AKJA 1LK5A 1PR2A 3ZFTA 1BHJA 4MX8A 4ROSA 2IYAA 1E1KA 4YRTA 4QTYA 1GQQA 1ZMBA 1ZNQO 3H5RA 3X2FA 3K9GA 1SC6A 2ZI5A 1H5UA 4I66A 4W5HA 2L17A 3SC2B 3GJ6A 3CE6A 3CIFA 4WZBB 1OMOA 3T34A 3WXBA 1REQA 4RO0A 1Z6GA 4F3CA 2GQ0A 1XQYA 1W4LA 5CW2A 3Q3VA 5EQJB 5EFZA 3DOCA 2II6A 2R1VB 4B6EA 3RFXA 3RVRA 3JX9A 2VNHA 1R5JA 4D3ZA 5FTMA 4KFCA 1FE8A 1UPFA 2EG9A 4B82A 2REBA 3R5TA 3OOJA 3SM3A 4CNQA 1W4BA 4L4UA 3TPZA 3DMRA 1IUOA 4QGSA 4YP1A 1FXWF 5B1EA 3GK3A 1JTFA 3I45A 1QFYA 3GJ8A 4LZLA 4N6GA 4J7UA 4RLFA 2TMYA 1TUEA 4HTAA 4WDRA 1I7QB 2I9PA 3IEXA 1A1VA 2H1OA 2YCLA 5KJCA 1VE7A 1NIPA 1SIBE 1KI2A 3QP9A 3WAGA 1D4ZA 1XQ6A 3D43A 2W2OA 3NOQA 4TLAA 3AFHA 1WZUA 2QEQA 3OZFA 5IAJA 1K5HA 2JIMA 5AM5A 1CEXA 3GA5A 1YUMA 4XVUA 2OORC 2R6ZA 3BE8A 4NICA 5KYTA 2ZRQA 3KSAC 5L51A 4RABA 1U0NA 1Z4IA 1KI8A 2HYDA 3MYRA 1K8QA 4TXNA 5G02A 3WKDA 5BVGB 2GN0A 1EWKA 5E0OA 1DINA 3ZU5A 5CFMA 1ZI9A 1DRKA 2PTHA 4E3ZA 4IDBA 3F6YA 3BYZA 2H9YA 3CM0A 3OTHA 5CT9A 3P27A 1N2GA 5IN5A 9MHTA 3K2QA 2ISCA 2EJVA 3G0BA 4R8SA 4E0BA 4R71A 1T3SA 1H05A 2WF7A 3L8YA 1GUAA 3WFJA 4MAAA 2IHKA 1EDZA 3ELYA 4KDRA 4U3JB 4UM8B 3M7IA 3EPHA 4Q3OA 1T0IA 4O5AA 5IAKA 2OD9A 1X1TA 3AR4A 3IUEA 4HPWA 3ZQUA 2MCFA 5G1OA 3G1TA 4L5BA 3IUMA 5EJAA 4U39A 4XYEA 4KDEA 4IMRA 1ARZA 2ZI3A 4BWVA 2GBIA 2WIBA 4PS1A 1VLMA 2R79A 2H0RA 2PKWA 4QNMA 3L7NA 1P5JA 2D1QA 2QTGA 4LZNA 3GLHE 1NXVA 3CUTA 2DT8A 1Q7CA 1K75A 2A9RA 2VZ0A 1JILA 1LWNA 4ND8B 2EIXA 1N2BA 1TMGE 3SEFA 2I7DA 5CDTA 4Y2GA 1E3IA 1AIPA 2QX9A 2QSUA 2YCBA 3GLTA 3FMPB 1N7HA 1YIOA 1YS1X 5EN4A 2HA5A 1UR5A 521PA 1Z8DA 2XE6A 2A9JA 3T54A 5KYGA 2QVYX 3KQMA 1AURA 1GR1A 1C4WA 1HQYE 1OYYA 4BE9A 2HIMA 1ULSA 3V7FA 1U0EA 3U9SA 3UW3A 5L6LB 2XRYA 1SOUA 2QN7A 4XSHA 4DLPA 1NJ1A 2WPDA 3TRDA 2KYRA 3LA6A 4C0BA 3G9QA 3UW1A 1NGSA 2X5OA 5JI2E 3HP7A 2VJMA 3GLIE 1O7JA 3SQMA 3L6RA 2FDCA 4JT8A 1QPGA 4B17A 4B3HA 5L95A 4TLDA 3KXIA 5JJBA 3OT1B 4QVIA 3NHPA 4QM6A 4M37A 4H1TA 4TTQA 2CF6A 3NYQA 3TLCA 1QRAA 1CQWA 3OJFA 4ENVA 1GL9B 3ROKA 3UIEA 1QC5A 2ZVPX 3X0DA 2WJGA 3ZE2B 1N4AA 4W5NA 1T9BA 2XUDA 3KV3O 4DXAA 4K46A 5LZ7A 1FZQA 1NXSA 4RMGA 2LE0A 3H1FA 2YWCA 2OHXA 3SYRA 5AW5A 4ZI7F 4HGRA 2PMEA 2A1IA 4DLLA 1CP3A 2BFNA 4RA9A 2H1LA 2CHGA 5FUYA 5IF3A 1OT5A 3W04A 2J08A 3JQCA 5FORA 1V7ZA 4GMHA 4PICA 4B3FX 2RBKA 5K4GA 4FFSA 4FEEA 1CD5A 1ODSA 3S6JA 3SS7X 5CG1A 4HWKA 4WW0A 3QLUA 1SCAA 2FP4A 3I6YA 4G8JA 3AFIA 5T4EA 1TJNA 4KKVA 4XGIA 4YRFA 3U4CA 2H65A 2R1UA 1NRXA 1KSHA 2XI4A 1X1CA 2C2ZA 4M0DA 3MRSA 3NEYA 4TV8A 1JDBC 5BSWA 1Y8QB 3MQ4A 1P8JA 2QP3A 4U5QA 3KD3A 3SPXA 1W8DA 2QW8A 1DIGA 3QV2A 3ZIAA 5TMPA 1JAYA 4E6EA 4DADA 2RH9B 2CEAA 1UPAA 4XQEA 3J80A 3DNFA 4GO1A 4JD5A 1GNPA 2IUFA 4D9JA 2W42A 3FHOA 4IZ6A 4JJGA 4ZOBA 2VPQA 1IU9A 1CLEA 1FPQA 4JQZA 4M8NE 3RYCB 3EZNA 1FUKA 3ZOKA 4UHFA 2OZVA 4P3NA 3MCZA 3ZQJA 3IGFA 5IT4A 2FPXA 2GA8A 4NV1A 3GGCA 4B84A 4CL3A 13PKA 2VHXA 4C5CA 1ZAYA 2FK7A 1GNSA 3G5TA 1QTRA 1AQLA 5EZYA 3MTJA 4ZCLA 5JPDA 1OPXA 1USKA 2I67A 4BGUA 1DWOA 4K9RA 3CZPA 1LF5A 1QYIA 1HTTA 4NJEB 1APBA 4CPDA 2WU4A 3OCUA 1FX0B 3TXAA 2CT8A 1LSUA 1XCOA 3AI2A 4WCDA 4WXPA 1XRMA 3VI3B 4DA8A 5KMGB 2HEIA 1CY7A 1LVUA 1TAHA 4JELA 2H6EA 3DZ8A 2QUIA 3NTRA 1UMCB 3LUPA 4G4JA 4MR8A 4JHLA 4RJJA 4Y2RA 3SE7A 3VZRA 3WMEA 1BXKA 1EQUA 2WYOA 2XMZA 4CKBB 2B4TO 1OXVA 1H8ED 1O4VA 4N3AA 3TG8A 2ORIA 1CY0A 4LVCA 1HG0A 3PNOA 3WX0A 4DIEA 2ORED 2W6MA 2FFJA 1W47A 3FBGA 4EJSA 3D7RA 5IMSA 4C04A 3W79A 4BQQA 4FGKA 5CAEA 3BFVA 1ILWA 3E0XA 3C3CA 3AFMA 1XXHE 3ESXA 2GJ4A 4DC9A 4EY8A 3WRWA 4YRGA 3KSBC 4P98A 3RS7A 3ZBUA 2R8ZA 4US1R 4XEUA 1S9HA 3GUHA 4QC2A 2Q1YA 3K7EA 3WLRA 3A9TA 4XCXA 4G25A 3FLBA 4R9UC 3TQQA 4Y1FA 1Z4KA 3DL2A 3TIIA 1DOZA 2BDEA 3E7PA 3PHBE 5C8YA 2R8XA 4CNBA 4UQLA 4MWOA 5K8LA 3FWNA 1OFTA 1DCTA 1FNDA 3GAFA 1Q11A 3MAAC 3O2NA 4X1IB 5LQCA 1P45A 4JYZA 3KKLA 3N2KA 4YMGA 2DOKA 2C20A 3B3QA 3CNOA 3FHCB 1TC2A 3UXHA 4INPA 3U6KA 4M1SA 3TNYA 4BZZA 1ECBA 4K9SA 2AV6A 4URZR 1X9IA 3PEWA 1KZ1A 2IF0A 3DW1X 1US8B 4RK7A 4K0RA 3H6HA 3RBAA 1FU4A 4DDKA 1ZM7A 2JLUA 4EG7A 3QZUA 4IQGA 5IF9A 4RFLA 1N3BA 4MGIR 3U3OA 4TZ0A 5BN5B 2GZ2A 1Y37A 4YHBA 4FYPA 3TRKA 5CA1A 5C34B 2B1IA 2BELA 1NIJA 3Q9LA 1RAAA 2HO5A 3G6WA 5CITA 1O87A 4DNPA 1G8SA 2VJOA 4ZFNA 1C4KA 1Y5MA 1UJ2A 2PBZA 2HNBA 1UZUA 3C43A 3CKKA 3ENQA 3B6JA 3PTZA 2FLWA 3FVVA 4FS8A 3W1WA 4EYSA 1UCFA 2UVPB 2WE8A 4WLNA 2D1TA 2XOXA 5DHPA 1OIXA 1QSGA 2MT9A 5IKMA 2C9DA 3IAXA 3UYLA 1F5SA 1ATIA 1PWHA 4RA6B 1V4NA 4AX4A 3I1JA 3DBRB 4D42A 4DILA 5KWJA 1CXZA 1E8NA 1C30A 2WG1A 1L5OA 2DKNA 2Y05A 3P2OA 3VMFA 3A6PC 5KSZA 4TPKA 1YA8A 2AJDA 1S6YA 4NBKA 5ABPA 3F6RA 2WP0A 4WN3A 5K6AC 5KAPA 2E0IA 3CUWA 1Y9ZA 1BNCA 3FFTA 1WR8A 1V43A 3I9JA 3TI9A 3RYIA 2C8VA 4RDIA 1PVVA 3BXGA 1BKSB 3LXXA 1JQJC 3OUZA 4ESHA 4ZZ0A 2WIFA 2N0SA 2AFIA 2XUPA 4QPPA 2F59A 3IUPA 1YB5A 2IA5A 3LM8A 4HYTA 1J0BA 1R0XA 4PYMA 1RQ7A 3TLJA 2JGIA 2EX4A 3RTAA 5K0FA 4BASA 2RE8A 3VPSA 1DC8A 1DJNA 1H2YA 1KJQA 1RJDA 2V54A 2ZJ8A 3IUBA 3QPCA 4MUKA 5E8JA 4OIMA 1ORVA 3DEYX 2E18A 2OXRA 3T5MA 4YQYA 2R65A 2EU8A 1IHPA 3EZYA 4RK0A 3DCYA 2JAQA 1E58A 4BNJA 1NSFA 1KH3A 3K1AA 3S7TA 1Z4MA 2RHDA 4G5QA 5IXSA 2FQYA 3HVUA 2GFHA 3KCNA 2FMKA 4UC0A 2A5JA 2PYZA 4CM7A 3IV9A 1VB5A 4XD2A 1ELOA 3P0RA 2ZANA 4FU0A 2DHQA 3EXEB 4BFUA 5AWFC 2ZR9A 2ZJ2A 3AESB 5BXQC 3B7GA 3DE0X 4I8IA 1TZBA 1QTQA 1I3KA 1R4AA 1B2RA 1WB4A 3SSNA 1ZK2A 3R5FA 4INJA 1KR2A 5CX1B 3U3KA 4QJIA 4YAEA 3G2JA 1ZKDA 1P2SA 3BRSA 3OZUA 4EA7A 4PPFA 3SDZA 3C6YA 4ERXA 4B32A 4V1CA 1M3SA 4NNJA 2JFHA 1ZZGA 3F49S 2O7NA 3K5HA 3ZI4A 4AXBA 4DR6B 2WM9B 2YR0A 2WHRA 1RPJA 1OLUA 4JI8B 1JHQA 1OVGA 1S7GA 2FK8A 3DXFA 3IA2A 3MCTA 2OV8A 2G36A 3GARA 4CF5A 4FW8A 1B0ZA 5EXEA 4L02A 1D7OA 1Y8ZA 1E96A 1HK7A 4A4DA 1PR4A 1GGKA 2JFQA 1ZM9A 3EDMA 4YRNA 1FX1A 2OZPA 3BFKA 4XR9A 3ZHCA 4A92A 3MWGA 5BYBA 3HCRA 2GPTA 4OJYA 3AXSA 3HS3A 3OWHA 5ALFA 5FI0B 3S4YA 3ZE7A 1P9LA 1M66A 4AJ4A 4EHBA 1MG0A 3U3RA 2O2DA 4MUEA 4A10A 2VTBA 4TMKA 1N2IA 3HB4X 3W3ZB 3PD7A 1YAJA 4DN6A 1ZJ6A 5I3ZA 1XTVA 5KNCA 5DF1A 4A6XA 2HOQA 2MYNA 1W0JD 1ESDA 1X1BA 2ZU6A 3KLBA 4KHPB 2HIGA 3KB2A 3JQGB 1KTVA 2FETA 2G08A 2IEAA 1CR1A 2QBYB 2GCEA 3I34X 5C51B 1N6KA 3R9XB 5KTNA 1KJ9A 2QZSA 5LN1A 3HVRA 3TQIA 4B71A 4XPIB 3AUUA 3QYAA 5FUVA 2ZSAA 3VVCA 3O3MB 1OWLA 4M6WA 4XB1A 4Z1MA 2BZSA 1PLJA 2C8KA 5LDGA 2ZB7A 4ZRNA 1HZZA 3TNFA 3I1YA 3MUOA 5DSTA 5ELMA 3R09A 3W5VA 4OHMA 2O5EA 4L75A 5CTAA 3K53A 3OESA 1JDBB 1IY8A 1DO2A 2QXTA 1E1LA 1T0JB 2ZJOA 4U8GA 5EHQA 4EQZA 4CLOA 4DBVO 5KKNB 2G77B 3SIRA 5JZVA 3KKQA 2G06A 4Z4GA 3NXSA 4J9VA 2QRZA 1GG2A 4TYYA 5IZCC 2JIRA 2XMSA 5A7GA 5DM4A 5JQWA 1P2GA 3IAUA 2J6HA 2CUZA 3TQOA 4Z86A 5BV2P 1PLLA 1YASA 4FOOA 4H1VA 2F90A 2V58A 4KGDA 5FQNA 4K8OA 3CR3C 1T4BA 1FRFS 3O8QB 1DOHA 1GZ6A 4BKQA 2AXEA 4PYOA 2BMJA 2OP1A 2BFCA 1YE3A 2QM8A 1SURA 1ZJ5A 2PX5A 4G4SO 3Q8XB 4I0WB 4OXIA 5DXAA 1I1QB 2ZUWA 5JG7A 4EVRA 2RHTA 4MVJA 1D6SA 5ESXA 1BH2A 1HORA 2C2MA 1MZVA 2HAEA 3HYNA 4U7TB 1PR1A 2L2QA 2WUVA 4C21A 5MN5A 2ZSDA 1H0SA 1Q1BA 3D6HA 1O96A 2DULA 3H2KA 1VSQA 3FLAA 3I9V6 3KPVA 3KOWA 3PC8C 1XALA 1SEVA 2DFKB 1IG0A 2PV0A 1QK4A 1YUNA 4TS4A 4KLAA 3OFJA 2DT5A 5EIHA 1YZQA 2ZWAA 2O8EB 3QPDA 1ORHA 1Y1PA 4GL4A 1HRDA 2HMUA 1RABA 4QODA 3RD5A 3D59A 3VH1A 2EX0A 2GN8A 1V5FA 2HK9A 3IXLA 1HDYA 4NU8X 4ZYUA 4Q3NA 2CV1A 2ZRDA 1RKQA 2YFHA 1TLFA 3N0TA 4J1TA 3VUEA 1M5RA 5JJ5A 1CUDA 1ZNXA 5ECDA 4BVAA 2C7BA 1JEQA 2JW5A 4NI5A 3OQPA 3NBQA 2X0FA 1I1NA 3WIBA 1Q3TA 3A9CA 5KTRA 1YR3A 3BAFA 3S2EA 2FTKE 4EJ2A 1H0HA 3LT2A 1B8VA 3WGGA 3WZMA 2P41A 3TZ6A 3VPDA 3E9MA 4WOBA 1TI7A 1WCWA 1YQQA 4YT5A 4AUNA 4DVGA 2IS1A 2CHEA 3ANTA 1GL3A 1X7DA 2HB6A 1XZPA 3HVIA 3A6HA 3OSZA 3UMBA 3UNXA 5KTMA 3BMCB 1OLXA 3IP9A 4NCJA 1JSLA 2A0YA 1IAVA 3IAEA 4NJMA 2BZ1A 2OCDA 1A7AA 1YFKA 3K6RA 2EZTA 3RODA 2F8SA 3Q0IA 4HAZA 4ZU6X 1O9BA 1RAHA 2P9TA 2B9EA 3D31A 1SG9A 4H3KB 2XWBF 1EX1A 3PQ4A 3W3AA 3SZ3A 3UK7A 1KVUA 2XE8A 1VJTA 4E2WA 1I32A 3KO8A 4PRKA 3CPHA 5EKTA 3WKCA 1U1EA 3NI2A 1PL0A 2ZI7A 5ALJA 3I6ZA 1XNJA 5EY5B 3LC7O 2F1RA 2VHJA 4PHCA 4WESB 1IY0A 3OKPA 2ZSJA 4MKZA 2X3UA 3L4BA 3MSXA 4XIYA 2DBYA 2XZDA 3STXA 3EAGA 2D8AA 1SZDA 4UM9B 3RSCA 4AVYA 2VUTA 4TTAA 4D99A 1GRQA 1UQTA 1XZ8A 4FGJA 4MYCA 4OSPA 4Q02A 4Q3CA 5TDHA 4R2LA 3LD9A 3G5UA 3EG9A 4WFQA 4WKGA 5DZSA 1YMUA 4AD8A 1HETA 2CFIA 2J09A 1TCAA 4XXHA 5ADUS 3D6UA 4EPVA 3JYQA 1KDTA 2VRNA 3NX4A 4MQFB 4EI9A 4GSKA 1GCAA 2JG3A 3RT1A 2Q0QA 3TOCA 2G7ZA 2IRWA 2M9MA 4Y7CA 4BVFA 1UOEA 3FCCA 5KKCA 2DLNA 4KZPA 4ARIA 4ZYVA 1W34A 4GIBA 2C1EA 5SYAA 5AK4A 1B2LA 1P9RA 1ZNZA 2WBLC 3N5CA 2YOGA 1XZGA 4ZVQA 3H3JA 3JATB 4NS4A 4GUAA 2YYZA 1JLSA 1KZ9A 1G4UR 3V6LA 2H5IA 2AOTA 4M21A 2P27A 1YQWA 4LF7B 2Z5GA 1LPBB 2VJBA 3K0EA 3U44B 2FZKA 2ZYTX 5B4TA 2O06A 3OFND 5EKXA 4FN4A 3NR2A 3RRXA 3UB4A 1ATZA 1PU2A 2P2CA 4I6JA 5K0ZA 4E70A 2FPIA 2V9CA 4KO2S 2HW8A 3VISA 3E70C 5A5FA 2HCTA 4C07A 1T5OA 3SMQA 2F8TA 3LBAA 4KK3A 4R0MA 1W88B 3PE4A 3UG7A 4HAWA 4J7XA 1GA4A 1ZIYA 2IE0A 4MR7B 4CIAA 3OQIB 5A1TA 2H16A 4FI3C 2ZEJA 3KTAA 5A0TA 4W5RA 4HWGA 5ECGC 1TF5A 1USUA 4NBRA 1OI7A 1GG5A 3T6KA 3MPUA 2CW5A 4WNIA 5D01A 4QPZA 2PKRA 2C59A 4Z9YA 4JI1B 3S2FA 2CV2A 4IQFA 2RDMA 4MI9A 4FGWA 1QR6A 1A96A 5DLDA 5EZSA 4Z0NA 5JAPA 1GAXA 3PE6A 3BMNA 4HQRA 4OM7A 3IP6A 1R8YA 2M98A 4ARBA 4N3GA 4ZHQB 1TVMA 5DWVA 2A33A 1G8AA 2VF7A 3AP2A 3DZKA 1FNBA 3KS9A 4LMPA 4MQEB 4TRNA 3ZHBA 2WF5A 4UBIA 3UK1A 4DA6A 4DEXA 4M1MA 5FYQA 3K9HA 4K6MA 3FDXA 4MQ5A 2Y27A 1F5NA 3HY3A 1O8CA 4PEVA 4IH9A 1JDJA 5IM4A 3BZUA 1R0SA 3G2NA 1N2CB 2JK0A 2UUPA 1H94A 3MHPA 4Q9JA 1KEVA 3WMWA 1NXPA 2FRVA 4E2ZA 3ANNA 3GUVA 4YDSA 2B21A 2O2EA 3GMTA 4RHYA 4JB3A 5EHIA 1I5EA 3GJTA 4QE3A 4Z7NB 4B48A 3U3JA 3WZ2A 1P6QA 4B2LA 3B48A 3Q85A 3Q15C 4DLVA 4G41A 4GR5A 2EKZA 3TTVA 1NBME 4OP3A 4BX9A 4JP8A 5FPSA 5EQTA 2CLIB 3TZLA 5AW0A 3VU0A 2L18A 5EWMA 1HFWA 5KNDD 3ZWYA 5JXIA 4OQQA 3OJCA 5ELLA 1VSTA 5DYYA 3G13A 3VC3A 5JSFA 3EX7C 4G3XA 2HLDA 4D0LB 4MROA 4AZTA 1ONNA 1L7PA 3CCFA 1AJEA 1CRPA 4LDZA 5J2TF 2NX2A 5FTKA 2AZMA 4DJAA 1TDJA 4FEYA 3TCXB 1OBOA 1PLKA 3M1AA 2IH2A 3RW9A 3ZDAA 2RKOA 2CHUA 3FOZA 2GZ3A 3DKKA 3IIJA 4IV8A 1OR8A 2VXYA 1ODTC 4QDOA 4D2IA 1KI4A 2JCSA 2W7TA 5IKPA 2YFYA 2OPBA 3F90A 3ZWMA 2V7WA 5M5BA 2W2KB 4BB6A 2VDOB 4GLJA 3TB4A 1DNPA 1W5BA 1X8JA 1OWNA 4H27A 2IBTA 2R8YA 3D1LA 1ENZA 4I9FA 5F78A 3HVJA 1A71A 4NYMR 1QRDA 3QU4A 1D7AA 4LX8A 4Q1AA 4TWZA 4DQVA 4N48A 2FNAA 1A9PA 4XQ9A 1MEEA 4IIJA 4NL4H 1YE8A 3INYA 5KYUB 1BDMA 1TFUA 3GLHA 3KQQA 4RD2A 5A3SA 4C0QC 3I28A 1KWGA 5JH7B 1FUIA 2EHJA 3WO1A 3H1BA 4YIKA 5HCIA 5LZ5A 1FDOA 1E2FA 3O26A 4DJTA 1XLVA 4EA9A 4F2PA 4DUGD 1Z16A 2BJVA 2Q21A 2ZBPA 3VNVA 1D2AA 1VSVA 2VC2B 4R1MA 1NLZA 3KZ1E 3PJFA 5CB4F 1PFWA 1XKQA 4M9CA 1IOWA 3Q3GE 1ZPDA 4ZT3A 1EWYA 5ER6A 3UV3A 1Q2XA 2VT2A 2YW2A 3K4QA 4EJ6A 3DDUA 4I5GA 1T5LA 4FFNA 2EDCA 2QTTA 3FVTA 3TECE 1XEWY 1E7WA 1I3CA 5D2CA 4ZU3A 4B7UA 1BA3A 1X1EA 4LAFA 3JS5A 3BA1A 4KPUB 4TV9B 1A2BA 4DRXA 5M2QA 3GLIA 3W2EA 2FF7A 3JD2A 3EYWA 4LXYA 1R8QA 3WWEA 4C87A 3QVGB 5I7VA 1QWSA 5AT1A 3ROQA 3WTBA 5H70A 3DFKA 1WULS 3CG4A 3OE7A 4N5MA 3ZCPA 2OFPA 1NT2A 3OI7A 2P0YA 5DU2A 1T3ZA 3T7JA 1S8AA 1SPBS 4ZEWA 5DDIP 1DMSA 3C1AA 2E55A 4LZOA 4PHHA 4PO9A 3AY3A 5BSFA 2GPYA 2AEJA 2PZJA 3PDCA 1N92A 1UXIA 3GY0A 4HWSA 2CLEB 1M2KA 4I08A 1VJDA 3F4BA 4RKEA 4YAFA 4NH0A 1GKKA 2XZLA 4DB2A 4RU1A 3BSSA 2CXSA 3IULA 3SICE 1K88A 3FDJA 1NKSA 1OF1A 1SXJB 2HK8A 2W6IA 2YUTA 3TLEA 3FOWA 4BMXA 4Z4EA 3TO5A 2O59A 4LCBA 3ETDA 1WUYA 2WJWA 4E88A 2AK2A 4NMXB 2FFHA 3AERA 1SCIA 3AU9A 4UNIA 3V00A 2WF6A 1L4BA 3DDNA 3M4NA 3EMBA 4XIFA 3U5ZB 3WE7A 2BONA 1PS8A 4OI0A 4F98A 4ZO9A 2V3CC 1ZBDA 1M76A 2CCJA 5CHYA 1NF2A 1EK6A 1RQNA 2LW7A 3DKRA 3Q1KA 2DR2A 1G21E 3GGPA 5EHNA 5AVTA 4DSTA 3B7PA 4RF5A 1PSWA 2KM1A 2VBFA 5FLKA 5AJYA 3GFVA 4H08A 2YMMA 3P7MA 4DWOA 1NAIA 5T8KC 1Z0AA 1H2BA 2H5LA 1I6WA 3BH7A 3AR7A 4X65B 4GPTA 1VPEA 4GGPA 1LLUA 1T0BA 2A1TR 5TPWB 4LSWA 4BV3A 2QD4A 2WKPA 1W6RA 3L04A 4CWAA 5HVNA 2NUBA 4HGNA 1CUBA 4YFYA 3RWBA 2AI2A 1EP2B 2I87A 1E0SA 4DV2B 3JVDA 1R16A 1YOBA 4IY1A 1NVTA 3FF1A 4EW1A 1RE0A 2IYSA 1JZSA 1AQNA 4NDAA 5GVRA 5AVUA 1I4LD 3MEQA 3SZRA 3D2LA 4KO3S 1X74A 3GWZA 2Y76A 2PGIA 2XYGA 4L4XA 3WRYA 3R75A 2OGZA 3ERCA 4FVTA 1HGXA 1FBNA 2PD4A 3SZOA 1E59A 2XMQA 3G8BA 3PFFA 2XNDA 2IUYA 4RVCA 3THXB 4FYIA 3UO8B 4A2PA 3EEBA 3AM1A 5ALNA 5T6BA 2Q1TA 3NPAA 3TI7A 3MUFA 3ANSA 4Z2YA 2I99A 1VTKA 1V7QA 1SCUB 2OFOA 3MK31 4HAYA 1U3DA 3UVEA 1WUHS 1IZZA 1JG1A 1XXHA 1DC6A 1SKYB 1U4OA 2VNAA 2XOEA 3DMHA 3HJCA 3LBYA 3RF7A 3W2TA 1MB3A 5A4DA 4MYDA 3QTBA 4W5OA 1PZEA 2B3DA 4EFDA 1FA9A 1UXKA 2JIOA 1WCIA 2HIHA 1VIMA 1T2UA 3I9NA 3T99A 1P2UA 4JNCA 7MHTA 4RY8A 3C8UA 4C01A 3HBJA 3VPFA 4LDRA 4TKLA 4DM3A 4J90A 2F9LA 2YUIA 5KYWA 4RTJA 5FWAA 1JNYA 1Z88A 4Q1EA 5IXYA 4CV2A 2OAP1 4C88A 1HI9A 2YKGA 3CUUA 5LZ8A 2X1HA 2BDUA 1RU3A 3BWDD 2OV2A 4U6SA 2HH9A 1ZSNA 2D0DA 4CMKA 5DNUA 3GUCA 3L0BA 2Z04A 1AF7A 3HN6A 1JKFA 2IPLA 4WBXC 3LUFA 3H7IA 4P83A 4Y0NA 3DCJA 3SSMA 4DLZA 1NU6A 4G0XA 4FDVA 4GNKA 5HRUA 2CLHB 2PE5A 3DHEA 1Z45A 5ES4B 4J0QA 1XTZA 3NHLA 2B7BA 2ECOA 3GIDA 1IRIA 1XMPA 1GYPA 1NYQA 2DPLA 4K2AA 2IEIA 2WU3A 3P9NA 4LNAA 3UJCA 1JWAB 2VT7A 1MIOB 1NVEA 4A36A 5BURA 3EFOA 3OICA 3OOEA 5ALIA 1XF1A 1G7RA 1C9JA 2F3RA 4PQFA 4WADA 3GGSA 4HSEA 1NHWA 5AVQA 4DCNA 5BSEA 1LBHA 1UKEA 4DJEC 4BXOA 5JZBA 2ET6A 4DCPA 1T5BA 3M89A 4KQKA 4M1QA 3JD3A 3N86A 1IG3A 3QE9Y 3GMIA 4PQGA 3I8SA 4NRDA 4FBGA 3NONA 3T5CA 1LK7A 2DLCX 1F1JA 1K6EA 1LZLA 2QRNA 5FFMA 1E1NA 2X4IA 1A9OA 2ZOSA 5EWLB 2BHTA 2B6HA 4BN0A 3AVOA 3T4UA 4DBZA 4H6VA 1M1ZA 1T6YA 5EHGA 5BNIA 5DBOA 3EG5A 5J2UA 4RQUA 4J3FA 3LQ4A 2CMGA 1GL6A 4FBMA 1QP8A 4FHGA 2YNMA 3TEFA 1STOA 1TLLA 3OE5A 5B7GA 1Q0HA 1Q50A 1VBFA 4W1SA 4CFZA 3BTOA 1A4IA 5C2JB 4P81A 1X80B 4PYNA 1MJNA 1Y4DE 1V4BA 3UA4A 2ERCA 3LQRA 4X6YA 3V4OA 2QM3A 2XD4A 4LBWA 1FFXA 1LLFA 4LYHA 2RONA 4EA6A 3WC4A 2ZWVA 4HH1A 3TW8A 3N0XA 1ULZA 2CVOA 4IFIA 4RPKA 1UBJS 3O2QB 4E5VA 1HR0B 3ROPA 3CE9A 3QX7A 5GVSA 2OOKA 1EFUA 3KNZA 4JU8A 3FLEA 5K6TA 2W83A 2R6DA 4HDSB 2GJSA 3LQYA 2ZYRA 4O2LA 3ZCXA 4Q48A 4RVOA 3BE4A 3KLPX 1ZUD1 1TQ6A 4LXTA 4D45A 2B20A 4V1CI 1U4SA 2ZJ7A 1CF2O 2Z2XA 2W5UA 1BKYA 3WWYA 4EATA 5LQMA 1P7ZA 2VH5R 2HK6A 3KYCB 3PHIA 4RF4A 3QM1A 1XZNA 1QANA 3D6FA 3D81A 4X8LA 2O8BA 4GWGA 2HU2A 5A02A 4Y1RA 1KQGA 1V2HE 4S1WA 3TOXA 3LHFA 1Z0UA 4Y2PA 1CU1A 1JECA 3HMKA 1E6KA 3M70A 3NRBA 1JKJA 3KBOA 3BIJA 4IOMA 1OCEA 2H57A 2X0IA 4U0JA 1JFRA 3HUUA 4W7IA 3QY0A 1HC7A 5CCDA 3O75A 4C2UA 5JAQA 4HFNA 5CFZA 4P32A 3GVIA 4ILKA 1UBNA 4QSMA 4PAWA 2REXB 3MS7A 4H59A 3VZQA 5B30A 1E8MA 2XQJA 5IYZB 5AVRA 3PT9A 1J90A 2B98A 1PS0A 2BVNA 1SIOA 4JYMA 1ZVKA 4LJLA 4PN7A 5ICEA 4A0RA 4KPFC 1BYIA 5TE9A 1T5IA 3AM3A 4XFDA 3FUWA 3WBJA 1Z6ZA 3LPDA 3OEHA 7REQA 4YJGB 1XDDA 1I24A 2PRZA 1I01A 4GYKA 5CLLA 1WTAA 5F5LA 1CQJB 1X39A 4MCAA 1RPZA 3AMVA 4H4EA 1NUAA 2JEZA 2X42A 1TB4A 3AHGA 3DAGA 4XM1A 5BUZA 3GDOA 2IYVA 1C7FA 4FFDA 4BP3A 2UYYA 4TZTA 1HEUA 2FUEA 4OYHA 3UPDA 4EJSC 2TSYB 1DTWA 5BN4B 4NIMA 2CHQA 3IEUA 3LT5A 5AVYA 1IRXA 3K4HA 4MR9A 3TSOA 4JLPA 5DULA 4D5EA 2YHBA 5KDOA 3M6FA 2IITA 1OB2A 4GPBA 1PUJA 2JGLA 1YQTA 4K9NA 5KJEA 3CX7A 4RH1A 4LDNA 4LOLA 3PQ5A 1IN4A 2COUA 1J0EA 3SQOA 3I01M 4QQKA 3C4VA 2F6RA 1ETHA 1M2JA 3E3OA 4W8HA 3W8RA 3NBKA 1CUAA 5C4GB 4M0LA 4OFBA 1XDSA 2NVUB 1K7XB 4ER6A 2PMFA 2ZBVA 3WIVA 4ENQA 2GXSA 2V1XA 4EB6A 3EZXA 3S68A 5EC8A 1ZVQA 4PNHA 1CZUA 3C3BA 1P3Y1 4G1BA 5J9FA 3EUFA 4BAUA 3W5UA 1JHPA 3ER8A 3RF6A 2A4MA 1PJQA 3AR2A 5DTMA 1C5KA 1LQUA 1E9RA 1JVBA 2BMAA 2FWPA 5KB3A 2CLDX 3PKZA 2I2AA 3BCHA 1CUWA 3UFXB 3GPIA 2PGDA 4C0JA 2LGJA 1Y6QA 2M6LA 1JDVA 3GR6A 2P2ZA 2P5YA 4IHJF 4CJXA 3W5JA 3FFBA 1M8PA 3UMVA 4LJYA 4B4WA 3FNQA 2GZSA 4FHFA 3GX1A 2MSKA 3PNLA 3WS7A 3KYBA 3E9EA 2B2XA 3NP9A 2JIPA 2XD9A 4ZVRA 5DBFA 1EK2A 1REQB 1IWBB 4FYKA 1QVZA 2DAPA 2L0XA 2O2GA 1PJTA 4Y6QA 4EL5A 4Z7OB 5ILOA 3RADC 1O9HA 1PVOA 1Y4UA 1RVDA 3PJEA 2XB6A 1E60A 2ZRJA 4PZUA 4GH5A 2JI9A 3IA7A 4M86A 4P3XA 1FW8A 1H2XA 3RBZA 1XN1A 1EPUA 4G5GA 3VR6H 4YJ3F 1R8XA 5GINE 3BZWA 2AN1A 2XQKA 2XRFA 2Z1MA 4LW8A 3HCDA 5I7FA 1BDIA 5AUNB 1GADO 3R9KA 2TMKA 5B1HA 4YAIA 4NH4A 1KMIY 1AKNA 2PR2A 3QOYA 4BFCA 1LNSA 4TS3A 3JYNA 5CFRA 1THGA 3LDAA 2W98A 1DUSA 4XEHA 2HWXA 2QL6A 3EIXA 4XLZA 5CFLA 3FUCA 1EG2A 2NV6A 2JLVA 2PO5A 2IE8A 4YRQA 1RLOA 1T4DA 4CT0A 4BP1A 121PA 4D0SA 2XADA 4OB8A 1JHZA 5FTNA 1ZIXA 3OP1A 2IC5A 1MB9A 3QIAA 3OY2A 3CNQS 4YRAA 2G63A 1HT3A 1BSVA 1XDZA 2JANA 3I4CA 1EK0A 3LVQE 1YZLA 2BR3A 2P77A 3KJHA 4AECA 4PG6A 3PUWA 4Q15A 4FCVA 5SV2A 1MOQA 1PT6A 1KFCB 4XASA 2F1JA 1OX4B 5BW6B 3AJDA 3DE2X 1IATA 3O9ZA 5LR6A 1QYXA 2D1SA 1ADBA 3DB1A 3OQ6A 2NN3C 2H8GA 1FXWA 1G98A 3C3JA 4M1ZA 4B7AA 5CYOA 4DDVA 3ZDRA 1ZICA 2A6PA 4DG5A 2FFQA 4CN8A 1PVDA 1I10A 1FYFA 2RAFA 1QIKA 1U3WA 4IIGA 4PYRA 1G5QA 1CWUA 1M2EA 1WXHA 3RH0A 3GDHA 1VE5A 2ALJA 4K6CA 3RNLA 4IJUA 1FFDA 4PC6A 1A5TA 5JROA 2XODA 3GRFA 3NUZA 3ICQB 5F2KA 2QJTA 2BUBA 2YN2A 3B1VA 4QRDA 4R8VA 4HS9A 3RK0A 4D9EA 3KWMA 3GJ5A 1B14A 5AHKA 3A4LA 5H9WA 1XMSA 5C7IO 3UF0A 4QKQA 1ZOOA 4FE3A 1JKIA 2Q3MA 4IGAA 1R6TA 3TRHA 1VBKA 2FHPA 3GPLA 4AJNA 3FPFA 5K51A 1BN6A 1PL8A 2QRLA 4YN3A 1D04A 1I2AA 2VJMB 4A6PA 2NZVG 5IDWA 2IUEA 1SBIA 3MFYA 6LDHA 5BOSA 2JCGA 3GO4A 4GE3A 1DADA 1Q7EA 4L4YA 3OCCA 4ZQIA 5EE3A 1JIUA 4DABA 3I53A 3NAZA 3NGLA 1HDOA 1NXQA 1VKOA 5K3FA 3EZLA 3JPWA 1XTUA 3P4XA 2JFVA 4RDHA 2V4MA 3BKXA 1QC5B 1YL6A 3PGKA 3U9LA 1BS2A 1C1DA 1U6KA 2WM8A 5DM70 1WB9A 1B0AA 4DA7A 4YRSA 2MYPA 4EG4A 4RY0A 3RRMA 3SKXA 3BBLA 2BLLA 3I2FA 4JR2A 2QTHA 4M1YA 4BHTA 5FH9A 4WBSA 4LF8B 3THWA 2UYCA 1L9XA 3SHWA 1Y3CE 5LM3A 2IW1A 4H4DA 5IU6A 2PWZA 4JJKA 1JMYA 2DUUA 4RA9B 3VR4A 2LP4Y 5FTLA 5JMOA 4LFBB 5AI9A 1GG9A 3H86A 2QPTA 5JCJA 3PWZA 5CT8A 1WMEA 3F96A 1MPXA 1YQUA 3L9WA 5IT5A 2W00A 2FP4B 2XCLA 3LECA 3LQ2A 2BOVA 5ALSA 3S28A 1HZZC 2V7UA 4AAYA 4CTOA 821PA 3B70A 3F9IA 5HBRA 2I7VA 2P2NA 2AJTA 4WJZA 3SI7A 3SLGA 4YV7A 4TV8B 2VATA 2X3YA 3PR1A 4KIGA 2VXOA 1N9GA 2FUG6 2QRVB 1W76A 4FZJA 5DSXA 3WYBA 4HEQA 3UGJA 3CVUA 3QUSA 5CVDA 2YZGA 4HC4A 4DIOA 2YHAA 5L3QB 2NVOA 5IBRA 3PC3A 2DQZA 3F7NA 4HNVA 5CLQA 2Z4TA 5ALEA 5JT1A 4KIWA 1L7EA 2AYXA 1HO3A 1ZUIA 3QA3E 4O63O 4E08A 2OBXA 2XDAA 3THOA 1WMSA 2DQYA 2J32A 2V7TA 1SPXA 2FVYA 4YUAA 3ODPA 3O7MA 5U9CA 5EZYB 1NBMA 3JQ7A 3L77A 3PB3A 4LSGA 3STWA 5L45A 3EARA 5LL6P 2P2YA 4BPRA 4HD8A 1IEXA 3ZCTA 1OU4A 1Y7HA 2A0FA 2NM0A 3QV1A 3R4CA 4JUIA 4BNUA 4C6TA 5BPHA 1XHEA 3QA9A 4X90A 2WHXA 3D8HA 3OZIA 3TL6A 1ZK3A 5F2NA 5EKSA 3STHA 1SU4A 5D1NA 4MR8B 2ZP1A 2PT6A 1E99A 3H75A 3PPYA 3V8RA 3CCBA 2W2XA 3H1AA 4Z49A 2XGGA 3MRXA 3S2IA 4JEMA 1TF2A 4J1TC 3FF4A 4I6EA 5CDFE 1RJGA 4EJSB 3TGLA 5K03A 4JOCA 3AKEA 5CAEB 2WHYA 4MPTA 4C5BA 2B36A 4MKXA 1QIDA 4BMNA 5CLJA 2VHQA 3HLTA 1P31A 4FLEA 3VR2A 3DE1X 2C2XA 1LRKA 2QTBA 4PLHA 4R7ZA 1R0BA 1VLVA 2H7XA 3FPSA 5KYVA 4DBLC 2HFJA 5B2FA 1VG0B 4OAPA 5LP6A 1BJTA 5LMNB 5I9NA 4QYIA 1N6OA 3KWLA 2B3TA 4WECA 2VTVA 5JAMA 2WD7A 3RDPA 2CJWA 5ES3A 5C8YB 3GQBA 1ODLA 2C5EA 3DEHA 2P9HA 1D2GA 2QWXA 2QYHA 3FCUB 3NVMB 4H7PA 4UVEA 4ZQBA 4CKWA 4OL0A 4AQYB 4ZVSA 3Q2IA 4I4LA 3N2KB 4JSYA 4O5OA 5LLSA 3WVNA 3L0OA 3PNVA 4ITUA 5KWSA 2PUEA 3Q2OA 3W78A 1YDWA 2HRDA 2Y9PB 4IZIA 2APJA 2FX3A 2IKSA 5LU8A 3I5AA 1SU6A 1HNWB 1T1RA 4DF3A 4IH4A 1RQ2A 4M54A 4ZT5A 1FTGA 3AONB 3ZGLA 4IXDA 4WLOA 4COOA 3OQNA 4FD2A 2CJFA 2PAAA 3AJRA 3MUEA 4CM1A 3L4BC 4MQUA 1IWOA 4TT3D 1WXQA 2VAVA 3CA8A 1XD9A 4QNNA 4GLOA 3VU9A 3IQGX 1QF7A 3CN7A 4Q4HA 1GPJA 2EARA 3DLTA 3H2BA 2PN1A 1EUZA 2DHCA 3IUJA 2V0NA 1E2UA 2WJZB 1XFDA 3UHJA 4BKUA 5H3HA 1XP5A 4Q93A 4E12A 2O20A 1M6HA 4ZQHA 1HLGA 2GRAA 4NMWA 2YZKA 3B5JA 1RCUA 1CCWA 1SVWA 2PMDA 2A30A 5K2OA 1R5BA 3K0SA 3PDIA 2V7BA 1C30B 4I8XA 4BO2A 1P2DA 4KLNA 2ODTX 4RHUA 5C5EA 5EJ2A 1YDGA 4GI7A 3C8ZA 4P0QB 4RBNA 1TD1A 1JSCA 3O94A 3DV2A 4QATA 1NQWA 3ND9A 1PF7E 4TZKA 5JSKA 2ZQYA 2HMAA 3KTDA 1TYBE 2OB1A 4X20A 3RYIB 1MB4A 5EJGA 2D5BA 2OA0A 3OBBA 1Y7LA 4XWGA 1TKBA 2AFIB 3HXTA 4Y2VA 1LFAA 2YQZA 3OM1A 1T0HB 5HKBA 4DR1B 2WJYA 1RLUA 2AN4A 1GITA 4MKGA 1KMHA 3H83A 4UHKA 1TM5E 2ZYAA 4HK4A 3P2MA 1CPYA 1OBCA 1WKBA 4S05A 4M99A 2GA9A 4EPWA 1YC2A 1G21A 3PEFA 4NDZA 5H3CA 4HQFA 5AXBA 1B3RA 1Y8RA 2HBRA 2J5RA 2JZCA 2P40A 4GI3A 3WGLA 3K1AB 4OV6B 3DAFA 5KBYA 1T1EA 4LRUA 4L4SA 5EJFA 1G8KA 3W7BA 1HG1A 3P52A 1XL0A 3WICA 4OJTA 3EZ7A 1N8TA 2UZ0A 5L3SA 2QL9A 1GGVA 2FAXA 3ZHXA 4UBLA 4MUGA 3V1YA 3USZA 4M98A 3S40A 4BP9A 1W2WB 1CK4A 2VS1A 2EFCB 3T12A 4B3SB 4XVRA 5LQJA 4D0NA 3IAM1 3KPYA 1EBFA 3I37X 4PX5A 3UANA 2C29D 2PSJA 3AR3A 3C3YA 3TAHA 4D6XA 3PFWO 5HOQA 2F9FA 3UJBA 1O58A 5HX7A 1NVVR 1QP7A 1MJGA 3NTOA 5EJ4A 1QE3A 2G9NA 3M5PA 1R88A 4AXXA 2ST1A 2ZXEA 2DKFA 1L1FA 4KJXA 1J56A 4EFKA 3TXYA 1R0ZA 1U1GA 4C4YA 1OLUB 2H06A 3FWKA 2V65A 4KHZA 2NZXA 4YCDA 1X14A 2X5JO 1VKHA 3VX4A 4H9GA 3EGDA 3PSAA 1Z6AA 5THKA 1RWBA 2MWMA 5CH8A 2PH7A 1OC2A 3AK4A 3WJ2A 4C0LA 4MVXA 2FU5C 3AHIA 2OHVA 4KPEC 1TK2A 1RS0A 3PPWA 3C6QA 2J3HA 1ESZA 2PA3A 2Y0EA 3H2IA 5JLAA 1XVUA 1BXZA 2PANA 3BE5A 4U0KA 2VTBB 1QS0A 2DFDA 4CBVA 1SBYA 5CEJA 5I9IA 2AL7A 4FYXA 4LPKA 4DMMA 3L6BA 4KK4A 3SMVA 2E4WA 2SHKA 3DUWA 1IMOA 1KJIA 1E77A 3LF1A 2C9ZA 3EXFA 4FIDA 4LFAB 1CYEA 2E21A 3E53A 4I36A 7ADHA 2HF2A 1PT7A 5HTKA 1A2OA 1EWTA 5K01A 1JQKA 2YWHA 4DM7A 1QPZA 2H7CA 2P0EA 1PDOA 2FG6C 1KZHA 2VBGA 3L8HA 4IIHA 3EXIA 5KQLA 4NATA 2WINI 3ZVRA 5DTEA 4M6WB 3EZ2A 3IO5A 4W6ZA 3EA4A 3A25A 1L7MA 3QXJA 3UB2A 4PF1A 1CIPA 1JN0A 3DXZA 3S2SA 2DFLA 3MG9A 4ARVA 2BV3A 3H5TA 3WY9A 3ORYA 1Y80A 5K0LA 1E6CA 3DF9A 4CLOB 5TX7A 2Y66A 3B51X 1W36D 2XTZA 3IXMA 3F7TA 4Q4JA 3U1TA 2FSHA 5EHZA 5E9WA 1GQRA 1LSOA 1YB7A 2DHEA 3VDQA 4XUCA 2DXIA 4A0SA 5T7BA 3REGA 1JRLA 1SUBA 3O7WA 1QHHA 1SD1A 1R66A 2AEFA 2OXTA 2XZPA 1KBZA 1CULC 4EF4A 1XZIA 3NM4A 1HRKA 4FYWA 4EG5A 3L0PA 2BFCB 4TM8A 4FHDA 4P3OA 3M3DA 4EZEA 2O1EA 5CNKA 5E1MA 4BQSA 2AZ4A 1PJAA 4UPDA 3L7DA 3EXHB 4K40A 4NV0A 1ESEA 2DH6A 5DN6A 5BQ5A 3GYBA 1L8QA 2A1TS 2Q2NA 3LUGA 3WSTA 1O96B 3KKEA 2QP4A 1PD0A 3N8DA 4N9WA 4BEWA 5IK2D 1Z06A 2ZIXB 2JDID 1PZFA 1XCJA 1DAIA 1KQNA 1R6BX 4QASA 3IESA 1TAUA 1KO8A 4R54A 5E9JA 3FR7A 1QIFA 3HCWA 1KFEB 3OCWA 3LDHA 1P33A 1TIBA 1J7KA 1JFFA 4R5MA 4UAUA 5E2IA 3VOAA 1POWA 3ICPA 4DIUA 3JZMA 2VRCA 1JEQB 5HZGA 3QX3A 4F93B 2BSQA 3NJ8A 1LPNA 2XAAA 3AGQA 1U0BB 4RV4A 2OXIA 5AW1A 4Z3OA 4NYJQ 2E37A 3JW8A 4F9FA 1V5GA 4XYLA 4YMHA 1IIRA 4IDGA 4ISBA 421PA 3FYUA 3GJRA 3OUUA 1QIHA 2C2YA 1OJLA 5HJ5A 4MQLA 2D5AA 4XUDA 1ZRMA 1YBFA 5K0SA 2WUWE 3NUGA 4QUGA 5KNBA 1DAGA 4HHEA 2PLWA 1EM6A 1OLXB 2AMLA 2PG3A 3OO1A 5JWOA 1J8FA 3UMJA 4NJMB 3HB0A 4FNMA 3AL3A 4INZA 2ZUSA 2WYIA 1NQVA 1JTVA 1YS2X 1YBHA 2CKMA 1VIAA 2WJVA 2CJYA 3HJBA 2VNIA 4KWEA 1XKTA 1HE5A 3NHJA 5HFNA 1GZ3A 5CDUA 4TS9A 1NOJA 2WKQA 4JUFA 1TM1E 1JFLA 5JS8A 4QBHA 1ZMTA 3QTLA 4OQNA 3AO0B 1YXMA 3RTDA 4KU4A 2XXJA 3IQHX 2IVZA 3BDIA 3GEIA 3I9OA 4KLZA 4LWOA 4ZJUA 2HRBA 4R2HA 1T1JA 2A9QA 1DIRA 5K9ZA 2VA8A 4N6OA 1TUIA 1O97D 1S01A 3U37A 4EY5A 2MDTA 2HBZA 1A7JA 3CO5A 5TEWA 1G64A 3MTQA 1VMDA 2GM3A 3EG9B 1N5DA 3CZMA 1AM4D 2V5UA 3I6IA 2IIBA 1A9QA 2YH2A 2YX1A 2RGXA 3JQBA 5TR9A 2RHBA 1DIOB 1CDEA 3SVTA 4PRYA 1XZHA 4PNPA 3EPPA 4RQAA 3KHSA 3K6SB 1HUQA 4CCYA 3LH5A 3OMXA 3WRYC 2EZ8A 3DLCA 3KK0A 2C03A 3S2YA 3K1ZA 2VQFB 2VJLA 3QX8A 1DKMA 4AMGA 4RMHA 4A2QA 1EJ6A 2VCYA 3KSMA 3LC0A 2CVPA 3ZKWA 3PF8A 1AU9A 2AOTB 1LGYA 5AK3A 4INAA 5IJWA 3CIOA 4I9NA 1CZOA 3L1UA 1L8XA 1VA4A 3HDHA 2DQSA 1WPGA 2CD7A 3IKVA 3T1VA 5EYPA 2P9QA 1NW6A 2JA2A 4IIEA 1DRJA 1LJUA 4NCAA 4PPNA 3UAYA 4URHA 1M8JA 2OHOA 4HO1X 1OC4A 2FPIB 2KLHA 1YR9A 5TNXA 4BFTA 2QQ0A 3HNRA 3L92A 3W9BA 4CU2A 2G4VA 5SZIA 4BNKA 2I4RA 3FCXA 2VPWA 3SU8A 2V7QD 5CRIA 4YXWA 2Q9UA 3WNBA 3DMDA 3A2LA 1DQSA 4XWYA 1FRZA 1XQWA 1TQ8A 4HTFA 1LV8A 1B8OA 1XZKA 3EW7A 3KTAB 1J5PA 4URYR 4F3YA 1BRMA 3ZWVA 4BRZA 2ZRPA 3QUAA 3VYVA 1JZTA 1D8TA 1KK0A 4EABA 2JGKA 2PYDA 1KEZA 3DTYA 2WOJA 3BWCA 1EX7A 4F2DA 2Y4NA 4R81A 3O1IC 4L78A 3QG1A 3EIHA 1GEEA 2FSFA 2HDNB 1BVYF 2IDKA 3JZAA 5D5HA 1M9NA 2P2SA 3BMNB 1D9ZA 4BIIA 2PUGA 2I1WA 3BULA 4N7BA 3S99A 3UJ8A 1JG2A 5C3UA 3KFXA 3FROA 3NTLA 4REQA 3NOOA 5DTRA 2QG9A 2Y67A 2ZWMA 3F1LA 2OG2A 3BWXA 4Z0HO 3OQVA 4IIBA 4QDTA 3VAZA 3LL7A 5G53C 2I6XA 3C3AA 1GO2A 3HU5A 1B6GA 1YZGA 3R7WA 1L4KA 1Z13A 2HZBA 1MOSA 4JI6B 4CM9A 3RLFA 2BFPA 4PYJA 4V0SA 1EZ4A 1SKUA 2R8BA 3CYFA 3ZZMA 2ID9A 4ZA2A 4X60A 4BKPA 4IWYA 4I1RA 2WFLA 1JA9A 3H84A 3DF7A 3KKZA 3D6TB 1C9MA 1WABA 1GZ4A 4DANA 4N0MA 2R9VA 2O3RA 4GRAA 1LTKA 5CX4A 1W1IA 3EC2A 3HUDA 1CW2B 1Q7TA 4LRQA 1U1IA 3A6EA 4KXMA 2YJ6A 1RHKA 3EQ6A 2XJ9A 5EWMB 1WSDA 2YNMC 1VLQA 3CLSD 3RSSA 2ZVQX 4EH1A 1QZXA 5F77A 1V47A 1TCVA 4O0MA 2FW9A 4BQIA 5L4SA 4Z4HA 1FVXA 2VDLB 3GJ4A 4M7RA 4FLMA 3I64A 1M2FA 4YRDA 4PINA 3COSA 1VFNA 3DZGA 5HF8A 2EWMA 2JJYA 3R8CA 1JT2A 3RAPR 3T7DA 3DFIA 3URMA 1OH5A 3OQMA 3LOPA 2NU7A