3UUEA

Crystal structure of mono- and diacylglycerol lipase from malassezia globosa
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
279
structure length
279
Chain Sequence
GRGGSSTDQPVANPYNTKEISLAAGLVQQTYCDSTENGLKIGDSELLYTMGEGYARQRVNIYHSPSLGIAVAIEGTNLFSLNSDLHDAKFWQEDPNERYIQYYPKGTKLMHGFQQAYNDLMDDIFTAVKKYKKEKNEKRVTVIGHSLGAAMGLLCAMDIELRMDGGLYKTYLFGLPRLGNPTFASFVDQKIGDKFHSIINGRDWVPTVPPRALGYQHPSDYVWIYPGNSTSAKLYPGQENVHGILTVAREFNFDDHQGIYFHTQIGAVMGECPAQVGAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIP1, secretory lipase (Family 3)
publication title Crystal structure of a mono- and diacylglycerol lipase from Malassezia globosa reveals a novel lid conformation and insights into the substrate specificity.
pubmed doi rcsb
source organism Malassezia globosa
molecule tags Hydrolase
total genus 97
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uueA00
5AIBA 4HS9A 4H7IA 4TVKA 1TQHA 4MYDA 3VJMA 3F96A 4G8BA 1JT2A 3C8DA 1S8OA 4U2BA 5EHXA 5DYWA 1A7UA 2JGJA 1CUSA 2Q0XA 5ALUA 4OYLA 5AI9A 5CURA 4B9AA 2WG1A 5BOVA 4I19A 4BC0A 1CV2A 4UHBA 3G7NA 5JANA 1VZ2A 2O7VA 5ALQA 1YB6A 4YPVA 3EF3A 5AKGA 1EDDA 3L1IA 3AZOA 1TCAA 4DGQA 5ALHA 1QIKA 5IVHA 2DR0A 1SFRA 5AM0A 5CH5A 2ZYRA 3ZLUA 2HA6A 5JARA 2PUJA 3EIOA 4E15A 5HK9A 1VJ5A 4RGYA 4WCVA 5K3EA 3H17A 2ZSIA 3N2ZB 4QDZA 1BROA 5AICA 2PSJA 4FWBA 1UOQA 4QDXA 5CT5A 1CR6A 2BGRA 5LIPA 2HA5A 3ZWQA 2V96A 2I78A 1EA5A 3O4HA 1LNSA 3N0TA 1YA8A 1H22A 1XZBA 3OOSA 1JKMA 2PUHA 2JF0A 1XZLA 2ZJ6A 3OM8A 2GYUA 2JGIA 3H1AA 3O95A 1DU4A 2QKYA 5HZGA 2WJ6A 1HPLA 1UXOA 2H7YA 3F98A 4H7DA 5HKAA 2BFNA 4ZI5A 1QONA 5K3AA 5ALJA 3V1MA 2JEYA 3IIIA 3STYA 4ROTA 1J06A 4J7AA 4QA9A 1SCQA 3WK9A 2XQFA 3WA7A 5CT8A 1JI3A 4B9EA 4Z49A 2OCIA 1DQYA 1VOTA 2QT9A 1HL7A 2WUGA 5AP9A 2H9YA 3G0DA 5DYYA 1U65A 2J4CA 5ALTA 4BP8A 3F97A 1T4MA 4Y2YA 1CUFA 4MWSA 4EUSA 4X94A 5JYCA 4BP9A 3G0GA 2WKWA 1DT5A 1WB5A 4EZIA 1LPSA 1GKLA 3DD5A 1VA5A 4LXGA 1QIEA 5ALRA 1UOOA 4PQEA 3TEJA 2OLEA 3ANTA 4UBMA 5LZ7A 4HXFB 3K6KA 4X85A 1THGA 3DEAA 3MUNA 2GZSA 3V9AA 3A2NA 2VJAA 3SX4A 2PSFA 5EIEA 1NU8A 4QEKA 3ESCA 1E8DA 4P93A 4JNCA 1CUUA 2AJBA 4EY6A 2JGFA 2XE4A 4QWWA 2C5GA 3S8YA 4LIPD 4C89A 4Y2TA 3IDAA 3H2JA 4MQMA 1E8NA 2VTVA 1SCKA 5IVIA 4BBZA 3IURA 1X2BA 1YAJA 4UHHA 4MQLA 4BRSA 2HRQA 4JH0A 2WSLA 3FYUB 5LZ4A 3FSGA 4E46A 3QMWA 3BDIA 2GYVA 1EDEA 1FFEA 2QXTA 4A16A 3U1TA 1QTRA 1CQWA 2G63A 2ZYHA 1FJ2A 2WHRA 2J4FA 4QWMA 1G42A 3EQ8A 3FVRA 1X2EA 1HKHA 1QIGA 3D2AA 2C0PA 1CUHA 4Y7DA 2QUAA 5AK6A 1OCEA 3ZLTA 3R3VA 4W63A 4GHWA 4ARBA 1VXRA 1XLWA 1XZCA 1G5FA 2CBGA 2H7CA 1L7QA 3WK4A 4ETWA 4AXBA 4J0IA 4HAIA 3VXKA 1E66A 3GFFA 2VEOA 1LPBB 1N8SA 1W6RA 3IULA 2QVBA 4Y9SA 1CPYA 4ZGBA 4H7HA 4X7BA 2HA3A 4P92A 3STXA 5A2GA 3BE8A 1CIJA 4KE7A 3C5VA 5AI0A 4E11A 3HABA 4BDTA 1GPNA 2E3JA 3AIMA 3AIOA 3PFCA 3PDCA 1DTEA 2DHEA 1CUXA 1UOPA 3DS8A 4OPMA 5H3HA 1ODSA 3BL8A 4EHBA 4M0FA 4OYYA 3WJ1A 1DX6A 3EQ9A 1EK2A 2CUTA 3E3AA 2IIVA 1Q0RA 4CG1A 2QTBA 4EA6A 3DKKA 4FNMA 4OB6A 2X8BA 2V9ZA 3GA7A 4FHZA 1CUVA 1CUZA 1R3DA 4N8DA 3G0CA 3H18A 3QPDA 5AI4A 3IUJA 3D2BA 3IVMA 1U8EA 5BV7A 1K4YA 2VA9A 4V2IA 3WK8A 5JASA 4BCDA 5EIHA 3ZPXA 1DX4A 2FJPA 4CG3A 1TAHA 4X92A 1IZ8A 1K6EA 4MEAA 4DNQA 3BIWA 1FFBA 4F0JA 3C45A 1R1DA 1XQYA 3IB3A 1EB9A 2XLBA 1WHTA 7YASA 1GPLA 3I6MA 1EB8A 4H7KA 5HF5A 5AI6A 3ESBA 2PX6A 2RI6A 4C4YA 2WFLA 2ACKA 4K5QA 3QPCA 1QIMA 1L7RA 3G0IA 2K2QB 1D07A 1RWQA 2JIDA 1BEZA 4MWTA 2VATA 4EBBA 5AKHA 3F8SA 3TGLA 1ORWA 4KRYA 1ZI8A 2WFZA 3LCRA 3PE6A 4CI9A 3HEAA 2I3ZA 3WL6A 1ORVA 2OGTA 6YASA 3WKDA 4B84A 2C0QA 4X95A 1P0IA 5CTAA 1PFQA 4BZWA 3T4UA 1F6WA 1QIJA 2RONA 1UK7A 1QIDA 5D3KA 2JEZA 5BWCA 2IITA 2PU7A 2XUIA 1XZMA 2B20A 1QFSA 4K6KA 2VAVA 4J0KA 1XZFA 4BCBA 4GLBA 4Y2PA 4X6XA 4UFPA 3HZOA 3HI4A 3ZV7A 3DL4A 2VF2A 2Y2UA 1IZ7A 2RAUA 1VE7A 3B3QA 2XUQA 3KOOA 4H7JA 4YX9A 2VAXA 5HF6A 5SYMA 2YASA 4RNCA 1JJBA 4L9AA 4WY8A 1W52X 3O9VA 4Q05A 2CMFA 1HQDA 1R4ZA 3AINA 3PI6A 3KWFA 1XZEA 2XUKA 4B7ZA 4PV7A 1G4HA 4P9NA 5F4ZA 3BXPA 3C6ZA 1PV1A 5CW2A 1TCBA 3KD2A 5DTJA 2WFLB 1IUPA 2YYSA 4N8SA 3WJ2A 5DTIA 2JGKA 5DYTA 3D0KA 5IKXA 3SC2A 1Q84A 1AZWA 2RIPA 2WLSA 4GXNA 4DNOA 2HL6A 1FFDA 3DYVA 5FPPA 1LPOA 5FUMA 2R8BA 1GQSA 2GZRA 3KDAA 1CFJA 4HTAA 1R9MA 3H2GA 5FKJA 4LYEA 1ZD5A 3BJMA 3LIPA 4I4CA 1N5RA 1AX9A 3OC0A 5ALZA 1LZKA 4Y2SA 3G02A 1AMNA 2HM7A 2HA0A 4GW3A 4IH9A 1ETHA 3WIOA 2XQIA 3RLIA 4BRZA 3I2FA 2OXEA 4BAGA 1EK1A 4EY7A 1QLWA 5AI5A 4J03A 3AZPA 2WJ4A 4ZWNA 4AMZA 4H18A 3F9CA 4K6GA 2X5XA 1EHYA 4QDTA 1H2YA 4INZA 4X93A 4X90A 4J0GA 2ORYA 5JD5A 4PW0A 4UBJA 1LBTA 4HZGA 1FFCA 1OILA 5JD6A 4G4JA 2ES4A 4CG2A 4F60A 1UKCA 5CRIA 3HACA 1OXMA 2VQ6A 4DNPA 5CH3A 1XQVA 5K3CA 4IHAA 3KXPA 3C6XA 4H7FA 4W9RA 2D5LA 4UBLA 2CKMA 3FCYA 3K9BA 3U0VA 5FV4A 5DNUA 1UT6A 4P08A 3W06A 4MJ3A 1WHSA 3DCNA 2QMQA 5DNWA 1CUAA 2XUAA 1QO9A 3FAKA 1R88A 1IUNA 2WQZA 3G9TA 5AOBA 3ED1A 2VSQA 4WFKA 1CUWA 1CUDA 2J3DA 3WWCA 5HKBA 4N5HX 1TIBA 4G4IA 2QXUA 3BF8A 2GBCA 1P0QA 1AQLA 5ALDA 1W1IA 4B0PA 1G66A 3FLAA 5HQ3A 3NOXA 1LPMA 4J0CA 4QLOA 2RGUA 2XMCA 1E8MA 1YA4A 4QDOA 3WWEA 1YS2X 1R50A 3VKFA 1GPKA 2OQIA 5YASA 1JMKC 1ZIYA 3GELA 2XUHA 3FVTA 2FUKA 1ZJ4A 5HK8A 5AKKA 2WU3A 4B82A 5AK4A 4OB7A 3P2MA 1QIFA 1HBJA 1MX9A 2J3QA 5EGNA 4F5ZA 3WWDA 3GBSA 2CB9A 1XZKA 4DM7A 1VKHA 2DSNA 3HXKA 3CN9A 5CT6A 1MPXA 4BATA 3R3UA 1EI9A 3I2JA 2FJ0A 4H35A 3W9UA 2H1IA 5KBYA 4W1PA 1WPRA 2Z5GA 3FYUA 3KSRA 3V1LA 1CRLA 3L1JA 3I1YA 4UPDA 4Q3OA 1XRQA 2XDWA 4G1FA 3C6BA 3EQ7A 1F0NA 4LKOA 3R3XA 3K2IA 3AUKA 4J0DA 4FLEA 4Q34A 2WUFA 3FYTA 4KAFA 5C8VA 1BEEA 1QFMA 1TRHA 1W75A 4A23A 4UBKA 4FFWA 3RK4A 1X70A 5HQ3B 2WM2A 4DSAA 2D0DA 3HSSA 2O2HA 4PF1A 1LPPA 4BTLA 3B5EA 5FLKA 4E14A 5EIAA 1L7AA 4Y2QA 3STTA 1SC9A 4L3WA 1LPNA 3IA2A 3DJYA 4DMFA 1ZD3A 1MNQA 5K3BA 5DJ5A 1R9NA 2GBIA 5I8PA 1EINA 3C6YA 4U2GA 3DOHA 3ESAA 3ICVA 5FDFA 1Y37A 3QM1A 2OGSA 1TCCA 3H0CA 1BCSA 4YASA 4IQ4A 2QS9A 1AKNA 5JZBA 5AI8A 4G5XA 5FPQA 4NZZA 2HU5A 2QRUA 4X6YA 2C5FA 5ALOA 2ZYSA 4IO0A 4A5SA 3I6ZA 2BCEA 2GBGA 5C7YA 3QITA 5ESRA 3CN7A 4AO6A 4CCYA 4GI1A 3FLEA 3WWOA 5EHZA 2BAGA 1QE3A 3I2KA 1FSSA 2C7BA 4M0MA 5EHQA 5FOQA 2HFJA 5AIAA 1DWPA 1RYYA 3I2HA 3HLKA 5AM4A 5AHXA 2XMSA 3O9MA 1BRTA 5EI5A 3TJMA 1Q0ZA 4KE6A 3ESDA 4FTWA 2XMBA 2AJCA 1ZD2P 2HFKA 4KEAA 5A71A 2W22A 1EXWA 3W2TA 4JUIA 2LIPA 2JGLA 5AM5A 4G8DA 1CUGA 4WFIA 3IUMA 2BUBA 1Y7HA 3MVEA 5E4YA 3V1NA 2R11A 2DFPA 1QTIA 3DNMA 1BN6A 1VE6A 2EDCA 3KWJA 4Q3LA 1MT3A 5ALMA 1JU3A 1GGVA 2QZPA 2OCKA 5AKLA 4DMKA 1KU6A 2BGNA 3WMRA 2Y2VA 2WHQA 2DQZA 2PM8A 2G4LA 4AO7A 3DDUA 3UMJA 4XX1A 1XQWA 4BDSA 1LLFA 4BC1A 5JAPA 4B83A 1TK3A 3MGAA 4CCYB 4UBOA 5ALXA 4ZV9A 2JGEA 1O6FA 4XJVA 3NUZA 4UFNA 2Z3WA 4DSZA 1C4XA 3H04A 4FDMA 4C01A 1QO7A 1UZAA 1XKTA 2PU5A 3WWPA 2WFMA 1F0PA 3WKCA 1KEZA 3C87A 3IUQA 1WCYA 5IH7A 2OCLA 4KR0A 4BVJA 3PF9A 5IVDA 2XUOA 1GXSA 3LLCA 4WY5A 1A8UA 2QM0A 4UHEA 2O2GA 5JAUA 4L72A 1QZ3A 2WILA 5D3ZA 4Q1VA 3HJUA 4PNZA 3JW8A 1YS1X 5FRDA 2WIFA 5J3JA 3CCCA 1DT3A 1E5TA 3YASA 3OURA 4FLFA 4ZV7A 3QH4A 3WL8A 2HHAA 2VJCA 1DQZA 4D9JA 3H2IA 4LYDA 3ZLVA 2XB6A 3R0VA 1JU4A 1YB7A 1UK6A 2VT6A 3BJRA 2OPHA 3PFBA 1XZAA 3I2GA 5CT4A 2C58A 1RP1A 1HDEA 4WFJA 3H1BA 1MX5A 1ZI6A 3VJLA 2XLCA 4ITVA 4AO8A 1AURA 2YH2A 2PPLA 4Y2XA 1SCIA 1DWOA 5FP0A 5AOAA 3D3NA 3AILA 5JAOA 1CUEA 1UKAA 3JYHA 2ZSHA 4CIAA 4H0CA 1T2NA 1LBSA 1QIHA 1K5PA 1XZHA 5D6OA 3A2MA 3FLBA 3WIBA 2O7RA 3WLAA 4WJLA 4OSEA 2WUDA 3LS2A 3ZI7A 3AZQA 1W76A 4XIIA 4KE8A 3X3HA 5JALA 3QZUA 4FBLA 2XMRA 2B4KA 4KE9A 2YXPX 1UK8A 4CIBA 3VISA 2PVSA 4AQDA 4EB0A 3I28A 4W1RA 5C81A 5AJHA 4TGLA 3E1GA 3WL5A 1NU6A 2WU4A 3HC7A 4B6GA 1BU8A 3WKEA 5ALFA 4PSUA 4FNGA 3WYNA 3GROA 3PUHA 3SK0A 3QYJA 5K3FB 3W9BA 2PBLA 4IH4A 1XROA 4KRXA 1ZIXA 5CMLA 3O4JA 3PICA 2B9VA 5IVKA 3RM3A 3OG9A 1XRNA 5ALIA 4N8EA 2JGMA 5ALNA 5E4JA 1ZOIA 2C4HA 4MEBA 3D59A 4U2DA 1IUOA 1M33A 5ALYA 1QIIA 5AH0A 2OQVA 2VJDA 1XRMA 3F67A 4X6UA 3OTQA 1XLUA 5LKAA 4ZRDA 2WHPB 2I3DA 4C88A 3D5EA 5AK3A 1XRRA 1CUYA 2I03A 4UFOA 1I6WA 4RPCA 4XVCA 2BUAA 1BS9A 2WG0A 1BE0A 4BE9A 1A8QA 2FX5A 3TRDA 3FWHA 1B6GA 1EH5A 1J07A 1WB4A 3UUFA 2PL5A 1EVQA 5KREA 5ALLA 1A8SA 5D7BA 3W04A 2QR5A 1J1IA 1E89A 2HRRA 2V98A 2AJ8A 4BVLA 4Y2JA 2EEPA 2WJ3A 1XRLA 3BIXA 2WUEA 4BE4A 4M0EA 5JAHA 3G9XA 5ALVA 4RE6A 4AMYA 1QGED 4HRYA 2Z8ZA 3M83A 3WK7A 3W05A 3DQZA 4L0CA 5LZ9A 1IMJA 3AJAA 2W6CX 3A2LA 1EDBA 2GBFA 5BWBA 4DMCA 1JFRA 4PO3X 1U2EA 3DLTA 3MUOA 5I7UA 1XZJA 5T4HA 3H2HA 2V97A 3ANSA 4OCZA 1Z68A 5HFNA 1CUCA 1XZDA 4QDUA 2HIHA 1CVLA 4AZ3A 2WIGA 5HF9A 3R3YA 5A7HA 4XWGA 2DHDA 2XUPA 1E3QA 2XMGA 3E0XA 4DMHA 5ALEA 1XZIA 2WIKA 1PJAA 4C4ZA 5CXUA 2VJBA 4X91A 4B85A 4ARAA 2BKLA 1ISPA 4GWLA 3BF7A 5KWIA 2ACEA 4BZZA 4TPKA 3PF8A 2ROQA 5EHNA 3VJKA 1XKLA 2UZ0A 4FOLA 1A88A 2G5PA 3PUIA 3AFIA 3V1KA 5AO9A 1LGYA 4C6HA 4O08A 5K3DA 3D7RA 5AM2A 2OGZA 4QE3A 3DL7A 3RARA 5JZ9A 3WL7A 1GKKA 4QNNA 2HA7A 5AK5A 3IBTA 1CUIA 1UK9A 4C87A 4UBNA 3A6ZA 4MYSA 3QPAA 3G9UA 2ONCA 1AUOA 5KWJA 5SYNA 5T4FA 3T52A 4NMWA 5CBKA 4RE5A 1Q83A 1ZD4A 2WTNA 5AM1A 1VA4A 2X76A 4AB1A 4BB0A 4DYHA 3AIKA 1H2WA 5AKEA 5T4EA 2AXEA 5AOCA 2EDAA 5C8XA 2HADA 4IH1A 5CT9A 1BCRA 5ISMA 5ALSA 4LXIA 1ZGBA 2OG1A 4UHCA 3VVLA 1J2EA 5C8ZA 4X3CA 5AM3A 4HXGA 3EBLA 2QJWA 4UHFA 1N5MA 1CQZA 4QLAA 3NWOA 1UWCA 2VT7A 3WKAA 1K8QA 2HU8A 4Q3KA 1YSCA 2IX9A 4GDMA 2ZVDA 3WA6A 1H23A 4JEIA 4S0XA 5AKJA 3VDXA 5CH8A 2WG2A 2WTMA 2ECFA 1AGYA 1MAAA 4FBMA 1ZICA 4EY5A 2QUBA 5HFAA 2Y1KA 2XUGA 4W1QA 3FYUC 2Z3ZA 2CZQA 5ALKA 3H19A 3DKRA 4B81A 4KAJA 4OB8A 2XI4A 3DYIA 2ZJ7A 2PKYX 2HDWA 1WB6A 4LXHA 4GEGA 5A62A 1XFDA 3HYSA 3R40A 1ODTC 1MTZA 2XQJA 5A7FA 4K2AA 2P8SA 4Y2RA 4J0HA 1CLEA 1MO2A 5A6VA 1HLGA 3D4LA 5LYYA 4Y2UA 4OU5A 4PSDA 2Z8XA 4X00A 4GECA 1USWA 2XUDA 5ALWA 2HA2A 2QOEA 4YK7A 4X71A 4U2EA 2XUJA 3LIIA 5JZSA 2XMZA 4FKBA 5ALGA 4X97A 3WK5A 1U4NA 1XZGA 1MAHA 3Q0TA 4H77A 3JWEA 3G8YA 3M82A 4NVRA 4I3FA 3A70A 5HCUA 4WDRA 1KU0A 2XQGA 1LPAB 4CCWA 3IUNA 1YCDA 4AN0A 2G5TA 2XQKA 3CXUA 2JBWA 1QOZA 4Q82A 2HA4A 3VVMA 2GYWA 3CCBA 1QJ4A 3OPMA 3R3WA 1YASA 1O6GA 3I6YA 3H2KA 3R41A 2XT0A 4BTVA 4Y2VA 4BVKA 3D2CA 1Y7IA 2PSDA 3WZMA 4GBGA 1EVEA 2BJHA 5ALPA 3Q8WA 1WM1A 2H7XA 1CUJA 5JD4A 3SWWA 1CUBA 1ZI9A 4OD0A 4OUKX 5LZ8A 2WIDA 5JATA 3ILSA 1AC5A 4B80A 1TKRA 3WQHA 4CFSA 2OAGA 4LHEA 3QMVA 4WDQA 2B61A 4DNFA 1UKBA 4FLMA 5LZ5A 1JJIA 1XLVA 3V48A 3UUEA 1CEXA 5DLPA 4FFVA 1VLQA 3WYDA 1GT6A 2ZYIA 3FSGD 3QVMA 3S2ZA 1LZLA 1VZ3A 5HF8A 4AX4A 4C4XA 3C8HA 2RHWA 4HRXA 5A7GA 1FFAA 5AKZA 2CEKA 3NGMA 3O0DA 2RHTA 3GUUA 1MNAA 4OU4A 4H7EA 2QJRA 5K3FA 3O4GA 5AKIA 4B0OA 1N1MA 2O2IA 3C43A 1MU0A 1F8UA 3ICWA 1WOMA 3WI7A 1GQRA 4FMPA 3C70A 3G9ZA 4KYVA 2XUFA 1ZGCA 4PSCA 2OCGA 1P0PA 1XRPA 2PSHA 2ZJFA 2AJDA 5E2IA 1ODCA 4NS4A 4KAAA 1K63A 3R3ZA 3I2IA 3L1HA 4BAZA 5DNVA 4G4GA 2BUCA 5LKRA 5T4BA 2WHPA 4U2FA 1WPXA 1GZ7A 4KACA 1EX9A 1YR2A 1BN7A 1C7IA 4J3JA 4UHDA 1JMYA 4U2CA 2Y6UA 2XMDA 4EY4A 1MX1A 4JYPA 4J0JA 1THTA 3LP5A 3STUA 1DINA 4N5IX 5I9IA 3FCXA 3BWXA 4F21A 4MXDA 4QZVA 3QMMA 3RKSA 1MN6A 2OAEA 5JIBA 2CJPA 4AZ0A 1MJ5A 3C5WP 1ACLA 4G9GA 4KJXA 4G8CA 5CXXA 5FXMA 5AKYA 1VXOA 5LLSA 1H2XA 5EFZA 3QBJA 4AN1A 4HVTA 5AKXA 4ZXFA 2Y6VA 1H2ZA 3WKBA 3GZJA 2DQYA 1YAHA 4ZREA 2WIJA 1IVYA 1NX9A 4K6HA 1UFOA 5K5EA 3HRHA 4DLNA 4DTCA 5LP1A 3B12A 3FNBA 1JJFA 3M81A 1B41A 3FBWA 4BCCA 1C7JA 4JYMA 2XMQA 1SOMA 5E4TA 3G0BA 4G9EA 3STVA 4W1SA 3O4IA 4DIUA 3STWA 4BAUA 1P0MA 1XQXA 5JADA 4HXEB 1DWQA 2DCMA 4BYMA 3WK6A 1W4LA 3E4DA 3BDVA 3M3DA 3DOIA 1ACJA 2HU7A 2DHCA 1ZJ5A 3FOBA 5DWDA 4UBIA 2AJLI 2NW6A 5LZ2A 2PSEA 3I1IA 4UUQA 3WZLA 4EY8A
chains in the Genus database with same CATH superfamily
4D43A 3JQDA 1R12A 3QKRB 1X6VA 3FR8A 3ACBA 4TVKA 1KZ7B 1TQHA 1RI1A 3QFSA 3GARA 1GA4A 3P27A 4MS3A 4RKWA 3SC2B 1Q92A 4AG3A 4YJ3B 5BSTA 2Q2VA 2JFWA 1HDCA 3F96A 3RS4A 4QGGA 5ENZA 2WJWA 3ITDA 1GKYA 1JPNA 1GLGA 1NMEA 1V7ZA 1T1JA 4IAOA 2CXHA 2HJSA 2CMGA 3L0CA 3L1VA 2BM9A 3EXEB 1CF2O 4IUBS 1ZGAA 2O2JA 1KEEA 5A0VA 4ZCRA 2H0AA 4FILA 4DSNA 1S8OA 4U2BA 3T5BA 3CJRA 5CD9A 1M34A 1QG6A 1W2WB 2C4KA 3K53A 3MMNA 1NN5A 3OQJA 3QP9A 4XX0A 4IUCS 2JAUA 5GJVC 4LEIA 1L7VC 1QOPB 3T1NA 3W2IA 1P4GA 1SB9A 4OYLA 1I8TA 3H11B 3Q3JB 3R5JA 3G1UA 2ZSKA 4L08A 1NZJA 5AI9A 2HCJB 3KPJA 3T0IA 4YRIA 6LDHA 3K71B 4C29A 3U5ZB 2RHMA 3I39X 2WUVA 5DNEA 2WG1A 4ZICA 4K8OA 1LQUA 4I19A 1A9YA 4F1KA 1A4UA 5C3MA 3GLUA 2PKXA 3I64A 3JQ9A 5B3AA 4YYEA 1FOEB 4F4CA 5JANA 3RU7A 2YTZA 4C7MA 4OP3A 4B3HA 3WGQA 1GDTA 1UCFA 2ZWIA 3CVYA 1LVUA 1YB6A 1N2GA 1KJIA 1KY3A 2P90A 1SBIA 2ZWPA 4LXYA 3KKLA 2JI9A 2AC7A 3IPRA 4TMZA 4Q9KA 5CLIA 4MOWA 5LDGA 1TCAA 5HM6A 3WNZA 4C0LA 1NOJA 1ST2A 3EVEA 3F2IA 4GP7A 4MV6A 3WGKA 3OTIA 4I4TB 2G07A 4QXQA 5HZMA 3GLIE 4I4IA 4KO4S 5C0OE 5DF1A 5JU6A 1H2FA 5BWMA 2ATEA 2EFYA 4W5HA 5E95A 1FU8A 1FU4A 1KKMA 2ZYRA 3WG9A 4EJ6A 4UREA 2HA6A 3OZUA 4CV0A 5JARA 4YJGA 4QUHA 4DWOA 5HK9A 3EIQA 4LMAA 2D1FA 4F11A 1AKEA 1XO1A 3P20A 4RGYA 3VDRA 4AVYA 3FFWA 3ND9A 2Y4OA 4UE3S 1GOTA 1H5QA 1MDBA 2B8WA 3AESB 4LDRA 1BROA 4B34A 1LTQA 2VK1A 1GPDG 1RJ9A 2E6KA 3G85A 3NH6A 1DIHA 4ZPXA 3AI3A 3AUUA 3T95A 1N2CA 1P60A 4FWBA 4FE7A 2JPDA 1CS4C 3UG7A 2WTUA 1DFIA 1URPA 2JRLA 2OYCA 2PRIA 4LYAA 4OHXA 3ED5A 4KN5A 1W0KA 4RQUA 3RSHA 4ESVA 1JA9A 5LIPA 1QVZA 3CRVA 1UWLA 4JUBA 4X45A 4KWHA 3ZWQA 3IQWA 2Z6VA 4RK1A 4BNDB 3NT5A 5CB4A 2EBUA 3PNMA 2JIPA 5JI2E 3JQAD 1XZBA 2E89A 1R6BX 3KZXA 1OFVA 1RXSA 1W35A 5EJMA 1JKMA 1E3JA 1XMIA 2ZUVA 1GL9B 4KQ9A 3TINA 3I62A 1QCCA 2O48X 5EHGA 5AK0A 5AVZA 4MP3A 1XJQA 1GPYA 2YHIB 4FJ0A 1ZY2A 1O8CA 1A9QA 2GYUA 4CF6A 1DELA 1QYDA 2GEUA 2JGIA 1FYFA 4C21A 4FT2A 2PUVA 1FNMA 3O95A 2ZG6A 3G9QA 5EWLA 5HZGA 2WJ6A 4NJOA 4H7DA 3ZWAA 4WTOA 3OJLA 2EKQA 2EBHX 4FFMA 4EB6A 1FP6A 2BFNA 4NYJQ 4LMBA 1HT2E 4EEZA 3Q8MA 2WSMA 3KT0A 5ADUS 3GL9A 3V1MA 3OE1A 3DQPA 3NETA 3ZU3A 3R44A 4B33A 1WW3A 4DCCA 1VCMA 3D0OA 3GW8A 2WHYA 4M76B 3T34A 2H11A 3KEFA 3U3OA 2AMLA 2X2EA 1CTQA 1J06A 1VG0B 1R6UA 5JDIC 2IE8A 4YVFA 3ZHZA 1EVZA 4O5AA 1DDOA 2HPAA 3BK2A 3WK9A 1ZQ1A 4BZPA 2KX7A 4ISBA 3B2EA 3LRXA 5CW1A 4DF3A 1IUKA 3ONVA 1VOTA 1PAUA 2C7OA 4UM5A 4CZ2A 1L1EA 1T4CA 2UUOA 2ZAGA 5AP9A 3FJYA 4LTDA 5KNLA 1U65A 2A57A 2NUBA 4JLAA 3RJMA 5KVVA 1RHKA 1NFRA 2OB1A 3QTTA 3GFVA 1CJBA 1F4PA 2I87A 5KVSA 1N34B 3RJ5A 3GLQA 1JDJA 3R7WB 3DZFA 3D6MA 5MF6A 3MPOA 1CUFA 3IR6A 4HC4A 4YQYA 1PTJC 5KJ6A 1TL7C 5TF0A 2YUIA 4GMFA 4RJJA 1TT7A 2E4XA 2F9LA 2IUTA 1DRKA 3FUWA 4R9SA 4X1OA 1H69A 7REQB 1T9KA 2BHSA 1NT4A 5BMVA 2QRGA 5EESA 4ZDJA 3ZD6A 2QQ0A 3PUWA 1OTHA 1SA0A 3KD3A 1GKLA 3O1HB 4EZIA 1F06A 2GESA 4IDEA 4QPDA 4LXGA 1OXSC 3IAFA 1KE1A 3UKOA 4EHIA 1RRPA 2BRUC 1F12A 4ABYA 1QIEA 2OP1A 2FMKA 3OO0A 4MZXA 5ALRA 5E2BA 1ADBA 3SDZA 2W42A 3FTFA 5F5XA 3ZJTA 2RDMA 2XXBA 2HQSA 2QRMA 2GZMA 2C2GA 2NZ8A 2G7ZA 4FFRA 4KMOA 1F2VA 1CZNA 1KI7A 1UQTA 3RVMA 4NYMQ 3DEAA 1LK7A 3O74A 4NZOA 4KFCA 3MUNA 3V9AA 1L4GA 3HKCB 1XZPA 2WZBA 4OHWA 4RHTA 5BNFA 5SY6A 1DXHA 1DWUA 2E49A 2MINA 4KI0A 4LOAA 3RFXA 1X0XA 4AN4A 2V65A 1ZH0A 1PZFA 3BGVA 2IUFA 3OE5A 5DX0A 1E7QA 4KZKA 2FEWB 3VSDA 1HT1E 4QEKA 1V11B 1Q3TA 3ESCA 3GBVA 3H5WA 3VNSA 3KYDA 3RRNA 2FKAA 4RHCA 2CB0A 3SZGA 1Z6GA 3PHIA 4V39A 3TDMA 4Q39A 4F9EA 3OF2A 4JOQA 4L50A 1V7CA 4TS1A 1XNHA 5JCZA 2YWJA 2C5BA 3HFRA 3M5DA 3KT8A 3VR0A 3LKBA 3D31A 2I7TA 4PBRA 4AAYA 1FSZA 4C2BA 3H2JA 3N8NA 5K03A 4NNJA 1L5QA 4PC6A 1QJCA 1GQFA 2ATXA 1KK0A 1O95C 2VRCA 3FD8A 1OXKB 3DGFC 1X2BA 3IAEA 4BBZA 1DKNA 4B4UA 2V7QA 4Y1GA 1EXNA 3FDJA 2HRQA 1VKZA 3E61A 3FB4A 4M8SA 1G8SA 1UH5A 5F51A 1UUFA 2FZGA 4RLHA 2UZAA 3FYUB 3QXHA 3FSGA 4E46A 4HDNB 3GYGA 3QMWA 4KKVA 1IH8A 4Q48A 1KO8A 2FSFA 4E4RA 4IMPA 2LCQA 3A6KA 1HC7A 1ZUNB 2YC4C 1COWD 3U1TA 5CVJA 4C0QC 1NVWQ 3ONDA 4GNRA 3FTQA 2UZ4A 2FPWA 3MSCA 1G8AA 1PZEA 2G63A 3W7BA 1PUIA 2HN9A 3I6QA 2C78A 1PVVA 5HBRA 5KYNA 2WHRA 2G1JA 3FRJA 4WNIA 3RDPA 1I7PA 5KAPA 2EAUA 3ZS8A 4MDEA 2Q29A 2C0PA 3BGSA 4RKQA 1CUHA 5JCPA 1VYTA 3VPCA 5AK6A 1IB6A 1OCEA 3FPEA 1JLHA 3M2PA 3CKYA 5IDXA 3E0QA 5EGSA 2C92A 2ZYGA 3PHJA 2BBOA 4TSKA 1Q1ZA 1Y4AE 1ID8A 2C82A 5ETJA 2GJSA 3SNKA 4CV3A 5J58A 3V55A 4ARBA 1R9JA 4A10A 3O2JA 1SBTA 4GLLA 4ARUA 3EC7A 1P7PA 1ZVMA 2VBIA 3COSA 2CBGA 5C8YF 2H2HA 4ETWA 3FCUB 3WK4A 4A92A 1JTEA 2G8LA 1KYVA 4CUZA 3HY4A 3V4ZA 4ZYZA 2A0UA 1E66A 1WULS 3E9MA 4YALA 1ZK2A 3ADCA 4KR6A 1LPBB 1N8SA 1CCWA 2I2AA 2WYVA 5FQOA 4EG3A 3T15A 5B7GA 3TUZC 4Y9SA 2OORC 2YVQA 2ZKIA 4FDTA 3SKXA 1GPAA 2VYQA 4QT0A 2ZBFA 4FSDA 1XZQA 1GGKA 3MJEA 3STXA 1UFVA 3WO0A 4HQ0A 2CXUA 1CIJA 4UCWA 1PL0A 3MTEA 4OSPA 3SC3A 5B58T 1E59A 3HABA 1U6JA 1VSBA 2E3JA 3VC1A 1JBQA 3VR5A 4RKRA 4BX2A 1GKIA 1TA9A 2ACWA 2PUEA 1QQTA 3HVIA 3NHJA 2JD2A 5E9AA 2AR7A 2WEKA 2BM1A 3CR7A 4D92A 1RZUA 4FGJA 2CVPA 1L9KA 2IW3A 5GONF 1EK0A 1U80A 4EUNA 2FFBA 1E3WA 4FINA 1T3GA 5D7NA 1DBQA 1O97C 4GD3Q 1PL7A 4OPMA 5IBPA 4KQXA 2OZKA 4P81A 5H3HA 3BL8A 3DKVA 2ORED 1SC6A 3FM9A 5LP6B 4C2TA 2CLSA 2BI7A 5DLQC 2QLFA 5JCOA 1DX6A 1DAPA 3REGA 2CUTA 3PXUA 2C3UA 4F1JA 1E6CA 1DXYA 2CK3D 2FK7A 2YY6A 3E3AA 3N2KA 3OE4A 3ZCSA 4H3SA 2J0QA 1UC9A 4NFHA 3AM5A 2FSPA 1QKKA 5JMOA 4RPJA 5MN5A 3BCHA 1QK4A 1WG8A 3PC2A 1EAMA 5A5DA 3QOWA 3DOEA 1D03A 1R8XA 3G0CA 2H6EA 4XD2A 2CFIA 3HHPA 2AWOA 2NNLD 1D1PA 1J7JA 3JRNA 4RVDA 5BV7A 3DW1X 2NT4A 4TYQA 4GDFA 4LN1A 1ITZA 4D99A 1XQ9A 1KVQA 3H5TA 5CXSA 1YS9A 3P9ZA 3QFCA 6REQA 5JASA 4G2NA 2JC3A 4RV9A 2X0FA 2QTFA 2DUNA 3ON5A 3GLRA 4M9QA 5IASA 2P62A 1GILA 4PG4A 2NUTA 2G71A 1WDMA 3K2EA 2FJPA 2PT7A 4CG3A 5K6TA 2AHRA 2J6HA 4PTYA 3AGPA 2VK4A 1IZ8A 1K6EA 3R5HA 2WLTA 3TTSA 3WNQA 2WR8A 3LZDA 2AEMA 4WV3A 1NLMA 3ICOA 3ZWDA 1UZNA 1TPYA 3EPPA 1RE0A 3IP3A 4IF6A 4UC0A 4BP3A 5JISA 3GJ4A 3C45A 5F2KA 4UOZA 1KMHA 2PUBA 3T1VA 4LI0A 3RF7A 2PV7A 3ISJA 1QQ6A 1XQYA 3OPXA 5K0FA 2CYCA 1RQLA 2ST1A 2Q0QA 4IG4A 4FOTA 1EB9A 3RJ9A 4HGZA 1QS0A 3EOZA 1VGVA 4TKVA 2X8JB 5CIQA 4DQLA 5LD2B 2HH9A 1DRVA 1P3Y1 4H7KA 4UEQA 4OJYA 3WGTA 5AI6A 5B1EA 1G17A 5CB4F 4L73A 2IJGX 2BC9A 2HQBA 1OU0A 1V5EA 3MERA 3LNTA 2N75A 3ESBA 3UK6A 2CFRA 4BQRA 3AL2A 4JY7A 2PX6A 2RI6A 2XB2A 1D2CA 2KHZA 4NBTA 1C4KA 3X1MA 4GIBA 4JSTA 2PXCA 5JWHA 2QTHA 1RHRA 1VP9A 4K5QA 1EUQA 4X0EA 4GL2A 2H4HA 1V7PC 1F4VA 3HUTA 3ZV4A 2PYDA 3FSJX 1UBUS 2A86A 1FP1D 2V4MA 3A06A 2WMOB 3HNPA 4M0LA 3RHSA 4BQSA 1OU4A 4HH1A 1BEZA 4JQYA 2VATA 1Z4LA 3KE9A 1MRZA 2ZJAA 2A0YA 4I9GA 2HYDA 4HY3A 5G2OA 4YRKA 3MF4A 3TGLA 4KRYA 821PA 2WFZA 1IJBA 3ZY3A 4HGQA 3KJHA 4LSGA 4LF4B 2GK3A 4PO1A 1R8YA 4LYFA 4MPJA 4QTZA 4QL3A 4G8JA 1G8JA 2C07A 2FZ5A 5FI5A 5BQFA 3RVOA 4KO2S 3HCNA 2EEZA 2J6CA 2BKUA 2O2EA 4X1YB 5T8KA 3T38A 2OV8A 4CI9A 1FA9A 4AJ1A 1HLDA 2P41A 5MFPA 2ZE7A 3SIXA 2DH5A 4PTLA 3SYLA 2OHGA 2C0QA 3D8UA 3G0HA 1JHMA 1PFYA 1K7XB 1W5BA 1V3UA 4OREX 4A8JB 2R1VA 1V7QA 1F6WA 5KSYA 4IEIA 2R0QC 4W7IA 5E1DA 4ANFA 2X6TA 2JEZA 3O83A 1ZJZA 3IV9A 5BWCA 1LSSA 2YYAA 4MRAA 2IITA 4LZLA 4AP6A 4JT4A 3LBYA 4EI9A 1IIBA 3I4FA 3LKDA 1HR0B 5FWXB 2FRVA 1NULA 1V48A 3JR7A 4XUEA 4J0KA 4RACA 4BCBA 1JN0A 3RKUA 1ZOLA 1D2NA 1V41E 4GLBA 3HO6A 2HJ9A 4AQ7A 3SZUA 2JFYA 1X8JA 4FBGA 1WDKA 4L8VA 4PR0A 2WU1A 2HF2A 1AK1A 2YJTD 2ZU0C 3B1XA 3CRMA 3CLKA 3NAGA 4M53A 4UCQA 4RJTA 3V1TC 4YMTA 1WXIA 1GLVA 4G5OA 5KKNB 3Q3HA 4QT4A 4DA4A 3MWGA 2PD3A 1PF7E 2VVTA 2VWGA 4Q19A 5BMVF 1UDRA 1VE7A 2F59A 5JXGA 4JI1B 1YFLA 4HGYA 3AERB 2EU8A 5LLDA 2FR1A 1KERA 1TNDA 2FEKA 3GIWA 4DE5A 4YRCA 4D4IA 4F4IA 4H7JA 5TLSA 1SU7A 5I7HA 2BGMA 3ROZA 3UAYA 5HF6A 3PKZA 5C5CA 2YS6A 3KQUA 2H1LA 4BNGA 1BOFA 5KQMA 1JJBA 2X2PA 4L9AA 3KS9A 3ENVA 2M6SA 3ZH9B 4DLPA 1IZ0A 1BXGB 4EVIA 5D87A 1PT8A 2G06A 2I62A 5TS2A 4CTOA 3AINA 4RMGA 3KWFA 3GLTA 3C4QA 5JH7A 2XDYA 3R6LA 4HJRA 2CJWB 4J91A 3ECCA 4PV7A 2J59A 1E5XA 3M6VA 4Y6SA 3V8PA 4BGEA 1I2DA 2DP4E 4DSTA 3BE4A 3JZMA 2IOFK 1BWSA 1XVLA 2CBZA 1LV7A 5CW2A 2J5RA 3AH8A 5EAIA 4YQEA 2HLNA 3TJRA 4K3VA 3DUWA 1EFAA 1DQSA 5DTJA 3TMYA 1EM8B 1LFDB 3A9VA 3HS3A 5DGXA 5DOVA 2BI8A 1Y48E 3ZE1B 1SULA 4HDRA 1IUPA 1NI3A 3SDSA 1OLUB 5IUNC 5DTIA 2GASA 3K92A 1BHSA 4L16A 5DYTA 1WZIA 3IQHX 3D0KA 4IWYA 4P1ZA 5AVVA 5IKXA 3SC2A 4W5RA 1NQOA 3UH0A 4CLHA 3HL4A 5JO9A 1X8XA 1ABEA 4GXNA 2DWPA 1OR8A 3MOSA 4WACA 4YO8A 3SF8B 5A4JA 5ER9A 2BFCB 4WKOA 1QGUA 4WLUA 5L51A 4H31A 2YXBA 2RAFA 4DR1B 1FU7A 1PLJA 1XNJA 2GZRA 2H2DA 3KDAA 2V03A 3EMVA 4JLPA 5GV7A 2O5RA 1BYUA 3ZWKA 2J31A 3G79A 4G01B 4PU0A 2V7WA 3VX4A 1DJNA 2YCLA 5FOTA 1EE2A 3JASA 5KI6A 1B7GO 5ARDA 3M2TA 1SEVA 5KNBA 5IC5A 1RQGA 4RFSB 3LIPA 3LKVA 3EC1A 4Y0AA 3LOUA 5ALZA 1Y5IA 1AHPA 3JWHA 4Y2SA 4R1TA 3G02A 3AOEC 3UXMA 5TDHA 1B74A 1Y1SA 3HCFA 4RD0A 1N0VC 1K97A 1W88A 4GW3A 4GWGA 4NH0A 2C8LA 4WZ6A 1PD1A 4YP5A 3S4YA 3U26A 4HR7A 5JTUA 4P6VF 4US0R 2RCYA 3EEBA 3PD0A 4P5DA 4BRZA 4L9WA 3QKUA 2O57A 4LRUA 1JDPA 4F3KA 4C4XA 1U2ZA 4AUEA 1K06A 3ACCA 4ZCPA 5MDHA 3DOJA 1IXZA 2IXBA 2JFOA 4IIJA 2B25A 4BECA 5E7IA 3UMGA 4YV7A 3S29A 1FUEA 4ZCIA 3E9YA 3AZPA 1Z26A 4JB0A 5DMHA 1X0VA 3ROPA 1IK6A 2XCRB 1C8BA 4RVFA 3IOEA 3CGWA 1OPRA 4HLDA 4NU0A 4N7MA 3DVLA 2G76A 3WIDA 5G0WA 4OBXA 3CFYA 4R0MA 3CZQA 1EHYA 4J7XA 5DMXA 3RRZA 2O5VA 1A9RA 3GLFB 1BWRA 4PZAA 2HD4A 4RJKA 1XYVA 5IKOA 3N2GA 3O92A 4P7JA 1CFZA 2CNLA 5FNZA 1HA3A 2I7VA 5FH9A 1K4MA 3UKJA 2BT4A 3QX3A 1ZHFA 3I8SA 3PV0A 2ORYA 4URHA 5I4IA 2LDBA 4RY8A 3RI3A 4NYIQ 4K6OA 2NPFA 3BQ9A 2FW7A 1YOBA 3R5TA 1PV2A 4MW4A 4UBJA 3U4DA 3UPTA 4BNDA 4F06A 4WLVA 4BO2A 3KHSA 3U7EB 1X38A 2PJRA 3BHIA 4YGXB 5L6MB 2HHLA 4W7SA 4XD7D 3ZZNA 4C3OB 4QJ4A 1JQEA 4CKBB 3T1HB 4F60A 2DQSA 3E8SA 1UKCA 2Q2WA 1WKVA 4B31A 4D9HA 3AQIA 5CLJA 3K6SA 4GI2A 3CUUA 5CH3A 1KP2A 3RHTA 2QPOA 3W3AH 3JALA 4NJEB 5IVPA 2WC1A 1FP4A 2VYCA 4RWZA 3QXGA 4EW1A 1NBHA 3D3EA 3QLJA 4R05A 3RVRA 2CCGA 3O26A 1PQUA 3GRUA 4IEEA 4MYCA 4IHAA 3CKLA 2WY2D 2IIBA 4XUCA 4MRVA 2OV1A 3FETA 4EX7A 1ZBQA 1PLLA 1X1AA 2D5LA 4AZSA 4GBED 4AICA 3JR3A 4UBLA 5C4MA 4O2BB 1VC2A 4RU1A 5LUBA 2CKMA 5FPKA 1D2RA 1G5QA 3FCYA 5DYNA 1DBVO 2VI5A 3K9BA 4H6VA 4K87A 1PD0A 4M7RA 5EG5A 1JR3D 3KSBC 1S6YA 4ZO4A 4BOYA 4P08A 1IN1A 1M2HA 2WU8A 2X15A 4FR0A 2PHZA 3MMSA 1N2EA 4MJ3A 4XXHA 5A3RA 1EFVB 1PWHA 1RKQA 1A8PA 1WXGA 2HMVA 2Z58A 2LKCA 1DLJA 2ENWA 3E15A 2QMQA 1ODJA 3L04A 1QCZA 1OZ0A 4YO7A 3D3WB 4XVHA 3FAKA 1R88A 2VCYA 4MP6A 5IANA 1IUNA 2FUG6 3GUCA 2WQZA 2DX7A 1WP9A 4I2NA 2YMMA 4FN4A 4EA8A 2XZLA 3ED1A 4BU1A 2A1IA 4MKFA 2O2SA 3UJDA 3KZVA 2AG8A 1W73A 3NATA 1EVJA 3TNFA 3WJ7A 1L8QA 1SCJA 2GNOA 3JRWA 4ADSG 5HKBA 4HN2A 4KQ6A 4XSGA 4G4IA 1ISJA 3JQRA 4ZKDA 2JI6A 2MT9A 4ZARA 1GHTA 1FMJA 4ETNA 2X0IA 1NLFA 4F6CA 5FLXA 2NSYA 3H7AA 1NM5A 1R0RE 2Q3EA 3OHSX 1W1IA 2YWEA 3INTA 1Z0AA 2JA2A 2G3YA 5COQA 4F71A 2J0SA 3BK7A 4KH0A 6Q21A 1NN1A 1G66A 5TGTA 2VJKA 1PS0A 5IM5A 3FLAA 2FF5A 4XB1A 3SHVA 4JC8A 4BPRA 3B8HA 5E0KB 5TVGA 1LPMA 4JIMA 2CV1A 1E1NA 1N5KA 4QLOA 1Y6JA 3ZXYA 1YBFA 2NXNA 1MV8A 1SUSA 1E8MA 2QE7D 3A9WA 3G2PA 3U4QA 5I8ZA 1XXHB 5M29A 2R68A 4Z51A 3L4EA 1KJZA 4NIMA 1S1CA 5HSGA 2V7TA 1Q0UA 3LY5A 3H65A 1GIAA 1S2MA 1YQEA 3UFBA 5CM9C 2OQIA 2ID9A 3HKCA 3N75A 1ZIYA 2O2DA 3QPBA 4UZSA 1GUAA 2FRDA 1EXVA 1F6DA 4H1UA 5JNVA 4J1QA 3KG2A 5F9FA 2FUCA 4RH3A 2WAOA 4ZI2A 1P3DA 1WL8A 4HQFA 4CIXA 3TLBA 3WFZA 5AK4A 1GVNB 1Q0QA 3RKRA 1VB3A 1Y8RA 2H16A 3WIUA 4AZWA 3K9NA 2XXAB 1QIFA 2OGWA 2ZLBA 4Z54A 4YIKA 4N03A 4ZT7A 4J8PA 4C4SA 2JBAA 3H0EA 3ABRB 3I34X 4HNUA 4N4AA 4X44A 2CB9A 4NL4H 1XZKA 1DTWA 2IEDA 1LC0A 1UBMS 4HYEA 5CG2A 1N0WA 1Y0BA 4K88A 5IN4A 3D0RA 5I01A 4CM3A 1WX1A 2VDOB 2GCPA 2VHVA 3CYFA 4Q7JB 1MPXA 2OQRA 2QTVB 5FF9A 3LUCA 4BATA 1C1XB 3JXEA 3WDKA 3BICA 3DNPA 1A72A 5ARBA 4QXAA 1GZ4A 3AX6A 2XBMA 1XF9A 2IYEA 5DX1A 3K32A 4H35A 3W8EA 4EPRA 2LPMA 3FX2A 2PZAA 3DDCA 3MBOA 3RSZA 5KBYA 1JVSA 4W1PA 1ULSA 3VU9B 3G5UA 4WXMA 3R5XA 1WS6A 3O3OB 2Z5GA 1KH3A 1WSWA 3FYUA 1FMCA 1NLZA 2AN4A 2M1XA 3I8XA 4HDNA 4KXUA 5B1DA 3DQQA 3HV2A 5EE1A 3OHPA 1XUOA 2GPWA 3AP3A 1ZUNA 1ZA2A 4FOSA 2IT1A 1ZH6A 5I9SA 2AZ4A 4KDRA 1YV9A 4V0LA 5I5GA 3M6IA 5J59A 1BVRA 2GRUA 1T1IA 3VKHA 3C6BA 1P4SA 1UZLA 3SEZA 3W8NA 1O57A 4JJ4A 2P8JA 1EKXA 1RACA 1BU5A 1CQPA 1F8XA 2J48A 3H1FA 5D8DA 2PMWB 5KOJA 1GNLA 2TECE 3BMNB 4HLCA 3BD9A 5BV8A 1OH8A 1OD6A 3D6HA 4KN9S 2F9MA 4IIGA 4Q18A 2BKEA 2GI4A 1PNRA 2FPPA 4J0DA 2NO5A 1N3IA 1SXJB 4Y6OA 2HUPA 3VU3A 3WLSA 2G40A 2WUFA 4TS9A 3OQBA 4EENA 1T9ZA 3IE2A 5F2NA 1KEPA 5K99A 2VTBB 1D5WA 3ZHOA 1UBCA 1Z7GA 2FVXA 3N6VA 2VN8A 4IOLA 3C7KA 2ZWOA 3SFTA 4DQXA 4TWIA 4Q9IA 4KWIA 1E9FA 2ORVA 2XNSA 3CEHA 3MNFA 1X70A 2XIJA 3IYLW 4FW8A 4UPVA 1MXHA 4D0LB 1A1SA 3AV0B 3GDFA 4FGUA 2D0DA 5GM1A 2R8YA 5BN4B 2VHJA 4DBVO 2QM8A 4QQNA 3GMSA 3VPXA 4D82A 1QFJA 4FFDA 4BO0A 2A4KA 3TLGA 4R41A 4I36A 4YPOA 3DEZA 2Y3IA 2AW3A 2YXEA 3UJBA 5KHLB 3UT5A 5DI3A 2ZDGA 4PF1A 2X7HA 3P1JA 4OBWA 3RS8A 3P9RA 1UBHS 4LZPA 3K4PA 6ADHA 2A5GA 4BTLA 3UZUA 4K0RA 3UV7A 3RC7A 1IULA 3R9XB 5F76A 4RVCA 3PPWA 1BKSB 3E84A 2RSLA 2NPOA 2RH8A 3W4JA 4A0FA 1AXRA 5EIAA 4YJ3F 3OZRA 3H5VA 3BFJA 4DCUA 3OLCX 5HW0A 3TBFA 4A26A 3IOYA 2A5DA 1GEEA 2B7BA 1KNQA 3HDGA 3TOCA 3HDQA 5F4BA 3HB9A 4WN9A 3FPHA 4EDFA 4FYHA 1U3UA 2IZ0A 2FPGB 3IA2A 5MHTA 5AQ1A 4S24A 3WP0A 3DJYA 4MGZR 1J9EA 2L2QA 4LBYA 2NN3C 1P2DA 1JFFB 3B52X 4MWGA 4WESB 4CM8A 4GX5A 1PJRA 1TA4A 3BTVA 5DJ5A 3DDNA 5LP6A 4IYRA 1AU9A 5LOVB 2QVCA 1HDZA 1EINA 1WXHA 1TUGA 2WHEA 1H9BA 1U0FA 5EERA 2B8NA 2PGIA 3ESAA 4C4TA 4EB3A 4EHNA 1E4VA 1ZXXA 4UDNA 4HUQB 4M9RA 1E3TA 3MCTA 4KDCA 4BWVA 1AJEA 2NSLA 1IEQA 2JDID 1B6SA 4PYJA 1RM3A 4I4NA 3BSWA 4RULA 1AZTA 1JYSA 1BCSA 3PDHA 3K9CA 4B4VA 1PNVA 1DHTA 2I3BA 3CRNA 1GN9A 2VJQA 1P5HA 3EMKA 3K0CC 4RTKA 5JROA 3EOAI 5FPQA 5AW9A 4GZ5A 3A28A 1FL9A 4C6TA 5JCJD 4X6YA 3SIRA 2R79A 4FWTA 4YMHA 4JR2A 5DM1A 4I4TF 5ALOA 3UXYA 4OXNA 4B2YA 4D42A 2VHQA 4ZAWA 3U4AA 2FQQA 4CLRB 5A5EA 1I7SB 2XCQA 2YY7A 2GBGA 3DZKA 3I5MA 5J4LA 5EP3A 4Z4GA 4YV1A 1DC6A 1QGDA 1HNNA 4GI1A 4DLTA 4Z0PA 3ZTYA 5NLLA 2P3LA 5DSZA 3I2KA 2C5EA 4IINA 4M60A 4INAA 3THSA 5COBA 1BO6A 1NHWA 1F17A 1QH8B 1UBKS 1VBFA 5CYGA 2WDZA 3KOXA 4M0MA 5FOQA 2IL1A 3AHJA 1U8ZA 1Z6XA 2AOUB 2F3UA 1DWPA 1R3UA 3LRTA 4BFZA 1PNQA 3LX4A 2IYVA 1GJRA 2VP6A 1JG1A 3GUVA 3SICE 3KB6A 4H3VA 1I3MA 1L5WA 2CXQA 1NXTA 8ABPA 1G5IA 1NP6A 1E2QA 4C5BA 4B3MB 1PHRA 3MMZA 4BY9E 2IW1A 1O95D 1ODIA 4M83A 4CQJA 3SBDA 2N1MA 5FWAA 4BLTA 3PYLA 5DRYA 3GDHA 3ITKA 4PQFA 3HJFA 2WWIA 5EI5A 4PRZA 4C4AA 2OSBA 1M6HA 4JI2B 4KE6A 3GRRA 4A8HA 3L8CA 1VDMA 2WVJA 5G0UA 4CEHB 3ZJUA 4GLJA 1GZDA 1VSUA 2DR3A 4YNBA 5BNIA 4N49A 3R5SA 1I0IA 1BJTA 4GOMD 3V4LA 2OQ2A 4KEAA 1DE0A 4B75A 1T36B 2WF9A 4F2WA 3MINB 3VOAA 3KFVA 1CE8A 2ZJOA 2JLSA 2HZBA 3B51X 4DG5A 3ZDDA 3CPHA 2R8PA 1VLHA 4WFIA 4CODB 4DPLA 1I4OA 2IHKA 3W0LB 4PZCA 2Q46A 3B6KA 2AZDA 1GG5A 4G81A 4OJMX 4X1YA 1FBNA 1SXIA 2ZIEA 2IKSA 3CT6A 2DY1A 4ZYVA 4LDNA 1R0BA 5FCDA 3WDMA 3EMDA 4MA4A 2CXXA 1LB1B 4A8JA 3WAJA 4O4JB 1WF3A 2JRCA 1W4CA 4UPEA 3OTHA 3SQMA 1YBHA 1QTIA 1JNYA 3QVXA 1JG3A 1NYLA 4POOA 5EJ7A 2ZBPA 5JYDA 3BCUA 3OOWA 1PZNA 5FWXA 4RSRA 4GX1A 4Q3LA 3DAPA 4Y3UA 3QV2A 2PANA 1L5SA 3Q5EA 4ZQIA 3FMPB 4JOSA 2QRPA 4DMKA 2IPAB 3O1JC 4LE1A 1M5TA 3BRWD 2BH2A 4EJSA 4EKGA 2EKBA 1BMQA 4LE0A 1YDWA 2IELA 3GCDA 3BTOA 1RT9A 2YN0A 4ZOLA 3W1VA 4HQRA 1P4RA 4MYUA 2Q9AA 5CHYA 3PDIA 3EF0A 4IV0A 4GLFA 5SYAA 3UMJA 3KXKA 4C0KA 4DV0B 2ZUDA 1YR1A 3M1YA 3SJCA 2UYGA 2Q3MA 1LLFA 1POWA 2BL4A 4B83A 3KETA 3QLTA 5AUOB 1TK3A 3CR3C 1QV6A 3QVOA 3IEPA 1NTRA 4KJZA 1RQ2A 1NVXQ 4C7OB 1CZRA 5KMGB 1X9HA 4M0UA 4YCBA 1T1SA 4XJVA 3UJ8A 4A2WA 1M2OA 1PX0A 2H06A 4HYYA 1TE2A 3RODA 1ESDA 3AMVA 4XQ0A 2VAMA 4UJ5A 3T5DA 3NNSA 3EOBI 1KIMA 1O97D 2VPZA 4DSZA 4J6FA 2I22A 3ZI4A 2RKOA 1M1UA 2B83A 4FDMA 1KMNA 1QO7A 2PFSA 3EZXA 4JUAA 4RW0A 4TN1A 1CRQA 2WPNA 1UZAA 4YRAA 4MAAA 3U4MA 1VHQA 2PU5A 2J67A 3WWPA 4GSKA 3GOQA 1K08A 2QRHA 1Q7GA 4LJYA 1EXMA 4PYOA 4RF3A 4TMVA 4RHEA 2GPJA 4FHFA 4UM8B 4ZVUA 1YFKA 1I1QB 1QSGA 2UYOA 3F1KA 4DC0A 4DZTA 1A5AB 1TFRA 4IVPA 5H4GA 4AY6A 1KEZA 3MJDA 1CQJA 2JLUA 4CWAA 5IH7A 2OCLA 2Y1OA 3D6TB 3UJ6A 1OLUA 5JDCC 3K0HA 3QEJA 5FUXA 2NZUG 5JPIA 5TV2A 3TI9A 2MOKA 4PYNA 4UOEA 4H0NA 3IT1A 4F3RA 1DO8A 1LKZA 1I6MA 1XN1A 2QTGA 3H75A 4ZOEA 3PFFA 4HVCA 3LLCA 5BY2A 1W581 1ZXLA 4PRKA 3W77A 4PCAA 2BFCA 1A8UA 3A37A 3R7FA 4QODA 1L3BA 3HLTA 5JE8A 2J0VA 3M9XA 1U8YA 4W9NA 3WLMA 1YCFA 1DVRA 2XRMA 5FTMA 4L72A 2ZUCA 3UHPA 2VDQB 2VSNA 1Y3IA 3OZVA 5TNXA 3MQ2A 5D3ZA 1QE0A 3QRWA 4OGGA 4X3OA 2EGGA 4UTNA 3KDPA 1TEZA 3R8CA 1TGYA 3JW8A 3U62A 2DWQA 3H3JA 4Q4DA 1XVVA 2HY7A 2YZKA 2Q5CA 3FOZA 1GNRA 1ULAA 2YZ7A 4RIFA 5BR7A 2AEEA 5I7VA 4KVAA 2NQTA 1QQ5A 1BDBA 2W8BB 3EHEA 1E5TA 4PEVA 3M70A 1R10A 4Q7KA 4UUOA 3DB1A 3OEHD 4FKZA 4G0PA 5EE0A 4ZVQA 5KPJA 1WXWA 1XAGA 1UT5A 2C8KA 3EG9B 4MR8B 2GUGA 1SQGA 1WMFA 5DP1A 4IGFA 4OLFA 4DQUA 4EJ0A 1K3FA 1U5BA 4ZOBA 2TS1A 3ER8A 3TLXA 1RU3A 3QH4A 5DSTA 4C05A 2YRXA 2ZT8A 3F3MA 3WL8A 4DDVA 4A6EA 4Z3DA 3QOYA 2WE7A 3FDZB 4XLTA 1DQZA 1XF1A 2GX6A 2WIAA 2PZGA 5IAJA 2XB6A 3R0VA 3RYIA 1YB7A 3QVSA 1UK6A 2AN1A 4ZVKA 4KUGA 2YFQA 3KAPA 3O8NA 4ER6A 3MAAC 2I4MA 4E32A 3BJRA 4BVBA 4CTMA 3UK0A 1YF3A 3OAAA 3PFBA 4KITB 5C46F 1K4KA 4US1R 1XZAA 3K7EA 2XR1A 1X14A 4N9WA 3HCCA 1HZZA 1IM2A 2IODA 5CT4A 2C58A 4D25A 5P8WA 4K86A 1RP1A 1AZLA 1GZVA 3CUEF 5FTLA 1XQ6A 1CLUA 2VLBA 4PYLA 1FYXA 5DHSA 5I7EA 5DHTA 4Q4CA 4XUDA 3GJRA 5L7TA 3U44B 2WF7A 1DJOA 4OHPA 3F7MA 3QG1A 4Z3KA 3IHLA 2WJVA 4PQYA 4DIBA 1UQUA 2VH5R 2YH2A 4RXMA 4PIVA 5I3CA 1CW2B 4JVLA 4URWR 3L8GA 2AE2A 3VR1A 1N2BA 1KXZA 5HG0A 3ZN2A 1W96A 4XFDA 1VL0A 4E13A 5FP0A 3A0RB 3GXOA 2FEXA 1VL1A 4S1OA 1IXYA 5B12A 1ZAYA 5JNWA 4HNTA 3RYCB 4JV5B 5JAOA 1X1DA 5J1SB 1V1JA 3MXOA 3O3MB 3HADA 3Q6IA 4ZZ3A 1S3IA 2ZFUA 3JYHA 3ZD8A 2ZSHA 5LP6F 2ON6A 4EVQA 4F2HA 4CIAA 5JHHB 1TO1E 1QHHB 4HDQB 3THRA 4CE6A 3TFWA 2JEOA 4M99A 2X9VA 1DP4A 3D6JA 4PFQA 1KWGA 1K5PA 3CTMA 2VUHB 1N1EA 3O8OB 4QFMA 1G9SA 5JWOA 1JJ7A 1A5BB 2ETXA 1O0SA 5C9ZA 1EGAA 3FLBA 4G6ZA 5E2AA 3UJCA 5IKEA 5LQUA 1K6IA 4MV3A 1E0AA 3WIBA 1N25A 1DAHA 2IEBA 2FSHA 3QEOA 4AY2A 2O59A 3NT2A 3AXSA 1N5JA 4OSEA 3W4IA 3GGOA 4DIEA 2DMRA 2PMCA 1I4LD 2W6JA 1NBMA 2WOOA 1YBMA 1VJTA 2I4TA 3K15A 1VMKA 3NOQA 4PY2A 4HUTA 1ATZA 4L5BA 1GCAA 2JARA 4FBLA 2XMRA 1EFVA 2B4KA 2CLMB 2H2AA 4MPDA 4CIBA 1A95A 2VCHA 4RV4A 5LR6A 3VNVA 1LI5A 1AQIA 3O3NB 4EB0A 4QIHA 3I28A 1DUVG 3D3WA 2QSZA 5C81A 2ZSBA 1N36B 2J3LA 4TGLA 3HSKA 3E1GA 3GWGA 4MIKA 1J9GA 5LMZA 1O77A 1G6HA 3WL5A 2GM3A 2ZTLA 1ZRHA 2AXNA 3FWYA 3HC7A 1QRTA 1TKBA 4B6GA 2PIAA 2PLFA 1O03A 2OGUA 2YIMA 3E1SA 1KYWA 3MGCA 4LY3A 4IZOA 3VUEA 3NJ4A 4RFVA 2PXHA 3U09A 3CF4G 1HRKA 1JQBA 5IAGA 3OJCA 3E9DA 4YRRA 3PGA1 4P4GA 1PWYE 1FDWA 1ZK4A 4AJ4A 1IONA 5CYOA 3QYJA 4CW7A 5KS2A 2A94A 1XEXB 4IH4A 3VH3A 1XROA 3HU2A 1Z38A 3HBNA 5CA0A 4I14A 1GU1A 2I29A 3H1PA 3VH2A 4B71A 3O8RA 2GF2A 2NGRA 1ICIA 2PO7A 1ZIXA 4YUAA 1JKFA 5CMLA 2Q5HA 4EO9A 3V4PB 3VYSB 4BQOA 1WU7A 1YJCA 2COKA 4Q7MB 3GMIA 3HB4X 4K9KA 4JELA 3SOZA 2HCBA 3A6EA 4DPMA 1Q16A 1OKKD 4BKPA 2E37A 5FI3A 1XXHA 4MNTA 2XGOA 1SQSA 2YJ3A 3HB0A 2OD7A 4XLZA 3ZG6A 5HS4A 2BLNA 2NAPA 3WGOA 2NWQA 3D8TA 4GMKA 1VDZA 2Q5JA 3KJQA 4I55B 3D6UA 5ALIA 1YB5A 1BDHA 2P7HA 1YKGA 2X8WA 2XAAA 3PXCX 3BSYA 2JGMA 3ZDBA 4AU1A 3RC9A 1PZXA 4UMDA 2UVPB 2ANBA 1Y6QA 3OI7A 4M1KA 4C0JA 1DZIA 4D3FA 3LT2A 4ZFNA 3A6JA 4U2DA 6CHYA 1FUKA 3C7AA 1BS1A 1WB9A 3FHTA 2R3SA 3RFUA 5AHWA 4YRPA 5IAAA 2J9RA 4ECEA 2WYUA 4EHAA 3OQMA 4NYJR 1FIUA 4MITA 1YL6A 2I9KA 2W37A 1J9ZA 1GTJ1 1N2HA 2M6LA 1Z0KA 4EGFA 1YZFA 2YIDA 1N9ZA 5CPBA 1ZIOA 3KTDA 5FPTA 1U2DA 5AK3A 4D9FA 2QTVA 1XRRA 3M49A 1T0IA 3E6AA 3L7KA 3PGMA 1J4AA 4UFOA 4HN4B 4ITRC 4PNEA 1IN7A 1DC8A 4XVCA 3S7TA 3GJ5A 1DOAA 3FF4A 2XX3A 1G8GA 3M33A 4B5LA 5JS6A 2YWRA 1FNCA 3VAZA 1SELA 3J7TA 3VU9A 1ZGJA 3QLUA 2JLVA 5BYAA 1DTSA 1PJQA 2FX5A 2YN4A 3QVUA 4CMIB 1AXGA 4FYKA 4F46A 1D1SA 2APJA 1C3OB 1LFAA 4YECA 3GLIA 2QIPA 2WTEA 1B6GA 1S8FA 2BH9A 1YB2A 3O3CA 1J07A 1W5SA 1A9XB 1WB4A 1ZM4A 1GNSA 3W7AA 2L0XA 4DLLA 4BZXA 3AEXA 1IBKB 1G5TA 4HX2A 3R3SA 3ZV3A 1EVQA 1S2NA 1XEFA 5ALLA 1FLDA 2ZCUA 2TMKA 5LYJB 1L7MA 2HSDA 2MHCA 2QMHA 3BMNA 1SVMA 3ZHTA 4LXQA 4P83A 4IDDA 5A6SA 2XKJE 1GARA 1E6MA 1YZUA 1IDOA 2Q6VA 4KVGA 5FPYA 2LWIA 5JSZB 3UCXA 3ADKA 1KVTA 3IE1A 2JJ1A 2Q5OA 3ANLA 2ZT7A 1ZEMA 3HDTA 3KZCA 4M0EA 4J90A 3RSFA 4L4UA 2E85A 1U7OA 2H18A 1E9DA 2XB4A 3W90A 3ILHA 4AURA 1KEWA 3G9XA 2IF2A 3CC8A 5FADA 5ALVA 4RE6A 4F3NA 4OIMA 4AMYA 4GSLA 1NXVA 1EX7A 4HRYA 1YB4A 4BNVA 5BSFA 4RDXA 1MQ9A 4BMSA 4GOKA 5G3YA 2ZM6B 1ORTA 3U13A 3WK7A 4W5QA 1KFBB 2JVIA 2A2ZA 4RVNA 1RQRA 3W05A 1ESCA 5CB0A 2LW7A 2J1LA 2QG9A 3DQZA 1ZS9A 1YR3A 3A4NA 4Z9AA 1IMJA 1E18A 3H0KA 5IP5A 2ZI3A 4MARA 1Q7RA 5CCXA 3OZIA 5J5VA 3AJAA 2W6CX 3GHYA 1EDBA 2QTTA 3MWDB 1P9WA 2XNJA 3WV4A 2FR0A 4AMUA 5DU2A 5I9LA 5IHXA 2GCOA 2Y0CA 1G4AE 4D5EA 4NCBA 1JFRA 4NE7A 3T4PA 3M1AA 1U2EA 2KQUA 3R9XA 1A0OA 1E79D 2QK4A 4G5GA 4OGLA 4V0RA 3MUOA 1I9CA 2X41A 1KOJA 3QQ5A 2VKQA 4O3FA 1YXMA 1BOOA 1EP1B 4ZTZB 2VBGA 2V97A 4X61A 4PG5A 3MCVA 4P4SA 3D1LA 2YOFA 3B8EA 2YDXA 3BB3A 5JNTA 5KTPA 3ABIA 2C7GA 1SG6A 5CR9A 4O4HA 3V2UA 4UULA 4MUXA 1VIDA 1B16A 5HVNA 3CSSA 3KOUA 3QVKA 4AZ3A 2NUPB 3L93A 4MW6A 3HWWA 4WESA 5HF9A 1K27A 1TLFA 2EBFX 1C29B 1ZNZA 3G8DA 4JLKA 2F3TA 4XVRA 1KSJA 2J3HA 5LOVA 5K8JB 4QBTA 2XUPA 2EKPA 4CQMD 3JYPA 1YR6A 4MB2A 5H4HA 4EHDA 4RVSA 1G6KA 3WV5A 4BMDA 3GGDA 4XFJA 3HGQA 4PC7A 2JFBA 2Q8QA 2ALJA 2W90A 4C2AA 1U0JA 4TV9A 5IM4A 1U0BB 1F3LA 1HG0A 1KBZA 1RYFA 1S7GA 1YUMA 3K9HA 4FHGA 4QU9A 4ERXA 5CXUA 3CV3A 5LQAA 1QV9A 4KHZA 4BJ3A 4TMWA 4YP9A 5HRAA 6ABPA 3KBOA 2C1EA 2XD4A 3MAJA 1E2HA 4ARAA 3FSRA 2FN3A 4C4RA 5TEVA 2KI5A 3KP1A 3UPDA 4AS2A 4E1VA 4HXYA 4BO8A 1IAQA 1GQOA 4KQMA 3UTDA 4EELA 2A0KA 2GPYA 1XI2A 1DIBA 1E5VA 1E9AA 2EP8A 2ROQA 1Z3IX 3KLOA 2EFHB 2II6A 3IIKA 4RDCA 5GIOE 1XKLA 1GRRA 3AF5A 3P0JA 4KFRA 2P77A 4V0ME 2O8EB 1B2LA 1UMDB 2YL2A 3BIOA 3BREA 3TD9A 7ABPA 4M8IA 2GNAA 4EK9A 3V1KA 1TZCA 2VZ0A 4GRIA 4WL0A 2QU8A 2X0KA 4AECA 3P0EA 1V35A 2FGJA 4FZRA 5KVQA 4C5AA 1LGYA 4E5DA 4UU1A 4RTQA 4BZQA 1T9AA 3K72B 4WBNB 1NJ8A 2B4TO 2QJTA 3IJPA 4OHYA 3CR8A 4ISCA 4DSUA 3RIEA 2ZWAA 1Y5RA 4EQ6B 3SIPA 4Y1FA 1BXZA 2IOYA 4QE3A 5DBGA 2Z1NA 1U3TA 4EUFA 3LX6A 3T3DA 1JZSA 3WL7A 1ADFA 3P19A 1JKIA 1PJBA 3R3HA 4JUCA 4S1TA 3GJ6A 1IWPB 1NGSA 1CUIA 1UK9A 3QNUA 4E22A 4C87A 4Q01A 5AJXA 1VG9B 3NYRA 4O1HA 2FN7A 3QG5A 4HWTA 2G6TA 4YXWA 3A6ZA 2JHPA 1GTSA 3HDVA 3JQ9C 5CDTA 3QPAA 1CXZA 3AFGA 1WV1A 5DX8A 4Q66C 5SYNA 2R6FA 3V33A 1ENOA 1L5GB 3VAYA 2ODAA 2Z2KA 4RDIA 4I9NA 4HEA6 1QP7A 2BTQB 3NHAA 1MHTA 3IT2A 3OTGA 4FI3C 4NMWA 2DTXA 1T36A 4ZCLA 1OH7A 1BXKA 4Y6PA 2RCNA 3ZWBA 1SQFA 1DPFA 4HV4A 5TGZA 5IG2A 2UVDA 4CMCA 2G5GX 1G16A 3ZGYA 5A1JA 2YR0A 2VNSA 4BB0A 4XVUA 1H2WA 4WKBA 2R87A 1JDBB 5CDYA 4JOCA 4O2BF 2B82A 3CA8A 3U48A 5JOQA 1QRSA 1GAJA 2B6NA 1QO0A 2H54A 2NLOA 3A14A 5C5DA 1EVKA 4IH1A 2HC9A 5ANRB 5CA1A 4RTMA 3RC8A 3S2UA 3DLIA 5EWJA 2DY0A 4NATA 2HK7A 3ABSB 4MAMA 1PHPA 3F6SA 1ZGBA 4J4TA 4O4JA 5KDOA 5E9WA 5AVXA 4NBNA 3A32A 4MV5A 2X40A 2O0MA 4ZYWA 1NRJB 3JS5A 1OB2A 3N53A 3H5OA 2CLIB 2GPBA 3NBXX 3FUTA 5BNTA 4JL6A 1P1IA 3P32A 5IARA 5AM3A 5A3VA 1QPZA 3MW8A 2HNKA 4K1XA 1KQNA 4R3UC 4N1AA 3FYHA 1QORA 1YQWA 1YZTA 2EWWA 2QJWA 3NWOA 3WFIA 3VPGA 3ZWVA 2VT7A 2Y77A 5G0TA 1K8QA 1I4WA 1YSCA 4Q3KA 2IX9A 3E53A 3E9CA 4GOOD 5U1PA 2W2QA 3EQZA 4U9IS 1RRGA 2A0XA 2C4NA 3X2FA 1HNWB 4YRSA 2K4MA 3AL0C 3NDIA 4UZFA 4E2XA 4CMHA 3RUEA 5AKJA 3ZNOA 1ZL2A 1UMCA 2GFHA 3B38A 4G9BA 3S2SA 1WCIB 1R5JA 3KZNA 2QZZA 1C7FA 1QH9A 3AF6A 1XC7A 5AVWA 1NMQA 4AYTA 3JAMA 5D00A 4ZEWA 1T8SA 5GAJA 5KMGA 3BE5A 2QUBA 1QRAA 4PZ9A 2DAPA 2RGNA 4WN3A 4ES6A 3JQFA 1W4ZA 2Y1KA 1P45A 2PMFA 5H81A 5BUSA 2VT2A 2SICE 2IY9A 3D43A 5D2CA 3NUGA 2IYUA 2CZQA 4KPUB 4MVJP 6PFKA 5AW3A 2D5IA 1BQEA 4B81A 4HN9A 1JEOA 4KP7A 4BNUA 2G82A 4OB8A 5E3JA 1FJXA 1D04A 1Z63A 2YCBA 1C1DB 2I4IA 3AKZA 3W2GA 4MUJA 2HDWA 1TYZA 3VHRA 1PEYA 2UZIR 3SBOA 5BNZA 1MBZA 3HN6A 2PAFA 3GFTA 4LXHA 2JK0A 1M6NA 2Z5FA 1UM9B 2BFBB 5A7FA 1GGJA 5BXQC 3SIWA 3SOPA 1XD2B 3DE1X 5FIUA 3W6UA 1UFKA 1US8B 2YZ2A 3QF4A 1HSOA 5K8IA 3GMDA 2Z4TA 1C80A 1V16A 4ERNA 1SBZA 1TJNA 1CLEA 3GNLA 2F7SA 3VYRB 1T35A 3L79A 4F56A 2ZZMA 4UTRA 3UFXB 3SPXA 1UPCA 1MOQA 1KTIA 1RPNA 3D4LA 5ERXA 3SYKA 2QD5A 3FMFA 4G63A 2VOJA 3MS2A 4W99A 2C94A 5JCXA 4C4OA 5CBPA 4NFSA 5I51A 4LHYA 4KIFA 4PSDA 3FKQA 1PK7A 5BV0A 3NGXA 5CJ2A 2BFEB 1ZN2A 3PGKA 3GJQA 4GECA 5KZMB 4P7BA 4W8GA 2OR3A 4WKCA 3TTWA 2I7DA 3Q41A 3B1KA 3NR2A 1BD3A 3ZY5A 2WJIA 1JAHA 1GG8A 1JZTA 2JD0A 2XUJA 4OHMA 3SR4A 4KO8A 3OLVA 1UFRA 1U02A 4FKBA 3KAKA 2FZLA 4B6RA 2W8BA 8MHTA 1Y4SA 2ZJ3A 2ZYUX 4OMDA 2PAAA 1UMBB 3PQEA 1Z13A 3PHHA 4ZAGA 1EBFA 2GBLA 3A7EA 1EFPB 3S27A 1F7UA 1UF9A 3LHDA 4LSWA 4MR8A 2FQYA 2VDVE 5EZSA 1U28A 2JLRA 3JWIA 1SNYA 3G8YA 2FZWA 2WF6A 9ATCA 4BRWA 7GPBA 5K4GA 4EF4A 5KVAA 1R7RA 2BHRA 3ZY2A 3EISA 2D6FA 2CUKA 2X22A 5AJZA 4B5KA 4R0VA 4CCWA 3OICA 1P7WA 4UU8A 1Q15A 1K9VF 1OIVA 4Q3NA 3RVQA 4CHTA 3AR6A 1WXFA 2IEAA 3VTKA 4OL9A 3AF0A 3WVNA 1JDSA 5ICEA 3PQ2A 4X54A 4MPRA 1QOZA 5LMCA 5CFZA 2HSWA 4TL7A 2I1VB 2K7ZA 2PH7A 4NHEA 4UE6A 4RF4A 4XR9A 2DF8A 3ZK8A 3EPLA 2WAXA 4JKIA 1WLYA 1YI1A 4C03A 2YV1A 4YCAA 4TVBA 4MUMA 3S0JA 2NO0A 4EFMA 1Q57A 1QBKC 4B6SA 3S99A 2EJCA 3I6YA 1WO8A 4OGWA 4MUHA 3UMFA 2R84A 4II7A 4Y2VA 3IV6A 4JBXA 3EA5A 3OUTA 4INOA 4YUXA 2PSDA 1LNQA 1NNI1 5E6UB 3U44A 1PLKA 4E09A 4QOGA 5CGQB 4ZQHA 1EVEA 3CHYA 2WSSD 4I1RA 2OBNA 2CNWA 3NNDA 3ASUA 4ZEOA 1JFTA 4D4LA 4AUMA 1JDNA 1E2EA 3MPUA 2C9YA 3N2EA 1WAMA 4Z1OA 5J2UF 4RZQA 3L92A 1RYZA 1CUJA 3ROQA 1YZLA 3SWWA 4CLOB 1CUBA 4WVFA 5AQEA 1TU3A 1NR7A 1ZWLA 3BFVA 3DF7A 2BMFA 3WHPA 3LF2A 3HU3A 1ECBA 3RAPR 1R0CA 3SYNA 3ZW7A 4EYSA 3WC4A 1QNLA 4ER0A 2F4NA 5AMXA 2FEAA 3L7IA 3MG9A 1JHAA 1G0OA 2JAOA 1DJPA 2R47A 2NO9A 5FT9A 2WIDA 1AKTA 1YTLA 5A04A 2E4YA 1Y98A 2D0PB 4O4IA 4OI2A 5JATA 1L4YA 1G2QA 5K20A 4L4SA 4N3AA 1T5IA 5LOVF 1MIOA 2JJ2D 5LWQA 1S3SA 3EXHA 1B73A 3NRBA 1GPWB 4H1WA 3WQHA 1U04A 4NR0A 2H2IA 2OAGA 2N42A 1JHVA 3QGMA 4I50B 3FPSA 5FPSA 1VM6A 4YMVA 5GOZA 4U6NA 4ESEA 4OYHA 3WLEA 2ZIGA 3HH8A 1C3XA 3KCNA 1RJFA 2ATVA 2X5JO 4IXMA 4FLMA 2W2PA 1ISFA 4LC1A 5IAKA 3ROGA 1DCKA 2B4QA 5LPNA 5A06A 1OH6A 1XLVA 3B7GA 2CVOA 3NAQA 3TNDA 3ZDFA 2HGSA 1H2RS 1ZEJA 3PZRA 4GPZA 5DLPA 1D4AA 5G4KA 1KAMA 2FPRA 3DMYA 1GT6A 1TKAA 2OMEA 2ZYIA 5F1KA 1HT3A 1Y63A 4URVR 4Z6KA 5JWRA 3AUTA 3S8MA 1CQIB 2FRXA 2Q3CA 4PZLA 3B1ZA 2R66A 2CHGA 4KXYA 4XH9B 4YP6A 2GHTA 4CVNA 1EDZA 3B7WA 1BAPA 1J42A 3KSAC 2X5NA 2QY9A 1N0UA 4OVKA 1KI4A 1XVUA 3C8HA 4Q9AA 4A6PA 4CKEA 2Y1GA 1G20B 3FKSA 4G1MB 1M83A 4ZI7A 2BD0A 2OHVA 1Y6RA 4BIIA 4LISA 4OX9B 2RHTA 1CD5A 5TF4A 3BZUA 1K0UA 3MGGA 2GF9A 2J5QA 2WWTA 3IH5A 4UM9D 4H7EA 3GRCA 3ORYA 2QJRA 1Y6FA 1A7JA 1H2HA 3LO8A 4MTCA 5BN3B 4NG4A 4MHOA 3LBAA 1N1MA 2C59A 1RCFA 4OM8A 1UAGA 2D3TA 4U0JA 3EPHA 2A9PA 4P0PB 2HSZA 4KAXA 4MVJF 2V6IA 3OCUA 1LCIA 4JP1A 1MU0A 5K4AA 4DG9A 3WMEA 2Y66A 5EIBC 5JCOC 3S1SA 4NYIR 3ROKA 1COZA 3WRWA 2YY5A 3AI2A 3SFZA 4ZVOA 1MB2A 1NBEA 5KTRA 2R2GA 1CZLA 4ML3A 1TQDA 4MQ5A 3ET5A 4KYVA 5G1OA 2V6FA 1T2EA 5I7OA 2XCSB 3KKKA 2YWCA 3ZHBA 1ZPDA 4NP6A 2X0JA 3QYAA 4ZVRA 1PZHA 4MV0A 1P0PA 2HXYA 2QPAA 2FY8A 2QNIA 2ZR7A 1LLUA 4EKNB 1XRPA 4CKWA 4ND3A 3HFJA 5HXAA 4M3NA 2AJDA 5C31A 2JCSA 2AOTB 5BYJA 1U2SA 5I4BA 3EDQA 4FW9A 1J7KA 1VCIA 4QBIA 5BSGA 4JVMA 1YQXA 3WL4A 1HNXB 2Z57A 3HB1A 5F5LA 1K63A 3MWJA 3NBZC 1PFVA 2EWVA 1ULTA 2H4FA 2UKDA 3I2IA 2AG6A 3L1HA 4H2DA 4TSFD 5GVRA 3RUPA 5CFPA 4M8NE 2HDHA 4M86A 3JTMA 5KNCH 2GFIA 3AM4A 4HG2A 4ASUD 1K6JA 1EVLA 2BUCA 4ZODA 5LKRA 1BMDA 4U2FA 2C61A 1RAFA 1MFPA 3U39A 2RBEA 3DP7A 1NNLA 2PS1A 2WTAA 2BF4A 4ER5A 3M5PA 1ZZEA 3IMCA 3U7QB 1D2AA 3KQTA 2Q3FA 4JZYA 4YJKA 2NSHA 2J85A 3H16A 4JQCA 4WVLA 4O4JF 5ICGA 3QVTA 2ATCA 2XKKA 1WY5A 2QX7A 4DDHA 1NDUA 1WHTB 4N65A 1FC0A 1M2GA 4Q1CA 4X3PA 1BGVA 1MW9X 3GJYA 4QQ8A 4S2UA 2BM8A 2R44A 2VDWB 4UQOA 2IU0A 4B3CA 1IYZA 1DINA 4MJXA 2BMJA 1C30B 4OHUA 4IW3B 2YUTA 1E2IA 3BWXA 1L9XA 2H8GA 1UDWA 3VGPA 2QLMA 2CNNA 5C51B 4G84A 4TT3A 2Z8YM 4MMXB 3KUCA 3WE7A 5M2QA 1JLLA 3DEYX 3FOAA 1ZFNA 3PDWA 3F49S 1JR2A 4Q03A 5AWFC 4C0AC 1WY7A 3M6XA 3RKSA 2PWAA 4AWXA 5GV8A 3Q98A 4ER3A 1B8PA 4OJTA 2J3MA 1W30A 1UP6A 1X1TA 1AKRA 3KT6A 4NJMA 3KHTA 3K0FA 4GFDA 4I6EA 3C5WP 1ACLA 1DOHA 2GAJA 2J30A 4G9GA 3V6LA 1BX0A 3MHPA 3ORQA 5KYVA 1U3FA 5G53C 1EEHA 4L78A 5AKYA 1SKYE 1GRNA 1O4WA 2B2XA 2XNCA 3DMHA 1TEXA 2G1UA 1PT9A 3WYCA 4DRXB 4IV8A 5AKXA 4KR7A 4EUHA 4YC7A 2PFGA 3WKBA 1GUBA 2P9FA 1XA4A 2DQYA 4N82A 4F7WA 4AKIA 1YAHA 4N9QA 3BM5A 2VZ8A 4JJZA 5TPWB 3W9SA 3OE7A 5JG7A 2ADOA 3QE0A 3AFNA 4ZHQB 2C20A 2Y76A 1P2VA 1OROA 3A58B 3GEGA 2VYVA 2ZBQA 1IATA 2WIJA 3ZEAA 2E48A 1U3VA 4TXJA 1IVYA 5MFZA 2JLCA 3EEYA 4JS0A 5B53A 1USGA 4F3YA 4B3DA 3C7TA 3GT7A 2Q0HA 1UFOA 2QY6A 3E7FA 2B7CA 3WOVA 3T3GA 4FEAA 1JGTA 3KXDA 4M7WA 3ZWWA 1ZVQA 2GN9A 5K5EA 3HRHA 1P4HA 4HB3A 2BFFB 5LP1A 4LWZA 3GVPA 4FDLA 3COZA 1LSUA 1NN3A 2POCA 1B41A 2A78A 3UK7A 1RXIA 4QUBA 3LPMA 4D3SA 5AVRA 4L5AA 4G5RA 4D9NA 1C7JA 3BRSA 1U0LA 1NHGA 2VSXA 3F2VA 3GFOA 1I2MA 4QSHA 3EZNA 5JLJA 5F7OA 3I05A 3NP9A 4YI5A 1R5NA 3BMXA 1QB8A 1HM5A 5TC4A 4C76A 5TARA 4NEHB 4R1LA 3UQYS 3B9RA 2WTXA 2NUPA 3GZNB 1LK5A 2WYIA 3CVJA 4BNXA 4DIUA 4R31A 3SKYA 1J6UA 4BPBA 4B3FX 3SHWA 5CLFA 1NBWB 1OBVA 4IGKA 1FLAA 1I5RA 2W0SA 4GSYA 1HKUA 1P0MA 3BK1A 4FMBB 4M87A 4QYTA 4TKLA 4LUCA 3W5IA 1Q0SA 1NF9A 2VRWA 4E5PA 3N86A 2PBRA 4DCMA 5KO2A 1DWQA 2RHCA 3E3NA 3D54D 4TQGA 3PUVA 1DMSA 3WNDA 3WLNA 3BDVA 2C3OA 3B5IA 1NUQA 2VPIA 1ACJA 4QM6A 2IXTA 4D4HA 1R6TA 1JR6A 2B8JA 1CJVC 3LYUA 1T3SA 4C7VA 4NECA 3RRXA 3ESRA 4D8XA 4P2BA 1XP5A 1E7MA 3TL2A 3MCWA 3DE7X 2ZE6A 2PSEA 4HB4A 3IKMB 4NMLA 4OQ4A 4TMYA 3VU8A 5A3JA 5ESXA 3L8FA 4Z1MA 1JLRA 3EIWA 4Q16A 3GC6A 1HRDA 3RTBA 1U6IA 4BO1A 3OESA 4CDMA 2PT6A 1E4EB 3NU1A 4HLUA 1E3LA 1QLJA