3UUEA

Crystal structure of mono- and diacylglycerol lipase from malassezia globosa
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
279
structure length
279
Chain Sequence
b'GRGGSSTDQPVANPYNTKEISLAAGLVQQTYCDSTENGLKIGDSELLYTMGEGYARQRVNIYHSPSLGIAVAIEGTNLFSLNSDLHDAKFWQEDPNERYIQYYPKGTKLMHGFQQAYNDLMDDIFTAVKKYKKEKNEKRVTVIGHSLGAAMGLLCAMDIELRMDGGLYKTYLFGLPRLGNPTFASFVDQKIGDKFHSIINGRDWVPTVPPRALGYQHPSDYVWIYPGNSTSAKLYPGQENVHGILTVAREFNFDDHQGIYFHTQIGAVMGECPAQVGAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIP1, secretory lipase (Family 3)
molecule tags Hydrolase
source organism Malassezia globosa
publication title Crystal structure of a mono- and diacylglycerol lipase from Malassezia globosa reveals a novel lid conformation and insights into the substrate specificity.
pubmed doi rcsb
total genus 97
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uueA00
3DJYA 1TRHA 4OU4A 1E3QA 1ZJ4A 4OSEA 1KU6A 3S2ZA 3AIOA 5HFNA 4YX9A 2Z3ZA 2PPLA 4CIBA 1W6RA 1F8UA 2XUDA 1ODSA 4ZV7A 4C87A 5ALMA 1EINA 1ZD2P 4UHEA 5JYCA 1Z68A 2ZJFA 1FFEA 1ODTC 4UBLA 2D0DA 5HF5A 1XZIA 3W05A 3UMJA 4ARBA 3CN7A 1C4XA 3E4DA 1E5TA 1MX5A 3DEAA 3WWDA 2AJ8A 4Y2PA 4HZGA 4O08A 3H19A 3ZWQA 2BUBA 4J0DA 4M0MA 1QFMA 3RARA 2HFKA 2FX5A 3H2IA 1QTRA 1CPYA 5HKBA 4ZXFA 4PSUA 5T4BA 1NX9A 4Y2YA 3R41A 1CUGA 2GYVA 2QT9A 5LZ2A 1OXMA 4GI1A 1EXWA 2VF2A 3EF3A 3WYDA 1CUSA 2XMGA 1ORWA 4PQEA 4Y2XA 1HKHA 1JJIA 3DD5A 4QZVA 4BB0A 1CV2A 1GQSA 4K5QA 2VAVA 4G5XA 3KDAA 5ALNA 4N8SA 4DIUA 6YASA 4BP9A 2HU8A 4OB6A 2PUJA 3QMWA 1ZIYA 1W4LA 2XUGA 4X3CA 2R8BA 2IITA 2HFJA 4JEIA 1VLQA 3G9ZA 2QXTA 1LZKA 4W1QA 5BWBA 1AUOA 2Z8ZA 3BWXA 4QWMA 1TCAA 1K4YA 3W2TA 5AI0A 4ZRDA 1AQLA 3WKBA 5EHQA 4BCBA 1Y7IA 5ALUA 1VXRA 1ZOIA 4FBMA 4AO6A 3KWFA 1XRPA 4H7FA 2GBGA 4X97A 4ZV9A 1HL7A 4FOLA 5K3CA 3VJLA 1W75A 3GZJA 1QO7A 1DINA 4H7IA 4DGQA 3FAKA 3WWOA 2BKLA 1JMKC 4KE6A 2BUCA 5C8XA 3D59A 4EY4A 1UK9A 2WM2A 5AM1A 4FLMA 3UUEA 2PSFA 2ONCA 3IVMA 1J1IA 2WG0A 2O2GA 5CURA 3WYNA 1F0PA 2HA6A 3A2MA 3A2LA 2ZVDA 2QUBA 3CN9A 3WK5A 5AKKA 4LYDA 3WKDA 4GHWA 2HHAA 4J0KA 3FVRA 2AJLI 2RGUA 2PL5A 5CH8A 3U0VA 4BP8A 3D7RA 4DNQA 2ZSHA 3WWPA 5CMLA 4AX4A 3I2IA 2WSLA 4EB0A 4BDTA 3WK8A 3M82A 1BEZA 3BIXA 1HQDA 1AKNA 2EDCA 3DOHA 2C5GA 5JATA 4FWBA 1YB6A 3C5VA 2AJDA 1TKRA 1Q84A 2OQVA 1MU0A 4H7HA 5DNVA 1ODCA 5CT8A 3PICA 4LKOA 2ORYA 3O4GA 1W1IA 2PKYX 4KAAA 1E89A 4IHAA 2BJHA 1KEZA 2OGZA 3G0GA 4INZA 1ACLA 1SCIA 2BUAA 5IH7A 5EFZA 5AH0A 1YR2A 2WTMA 3A2NA 3C8HA 4AZ3A 1UKBA 2WIDA 4L72A 3BJMA 5JARA 4U2DA 1DTEA 4G4JA 1WCYA 1WOMA 4Y2RA 4IQ4A 5EIAA 2O7VA 1XLUA 5LKAA 3TGLA 1EX9A 4EA6A 1USWA 2AXEA 3OOSA 1UZAA 4H77A 3SK0A 1P0PA 3DOIA 4G9GA 2OG1A 2XUJA 2OAEA 1AMNA 2PX6A 3N2ZB 5AOBA 3C70A 4DLNA 4MJ3A 1JT2A 2B20A 2QJWA 3T52A 3WQHA 3OTQA 1TQHA 2GBIA 4C01A 4B7ZA 5CT4A 5A62A 1S8OA 4BZZA 4FLEA 4N5IX 2H1IA 1JJBA 3PE6A 2YXPX 4UHDA 3DL7A 2Z5GA 1UFOA 5BWCA 5ALOA 2WIFA 2WU4A 2OCIA 1JFRA 1ZI9A 3V1LA 1WHSA 4OYYA 5FP0A 3DS8A 3KXPA 5BOVA 5ALXA 3OURA 3RK4A 4H0CA 3HRHA 2WJ4A 2R11A 3IIIA 1LBTA 3I2FA 4V2IA 4BYMA 1GPLA 5JD4A 2XQIA 1XQYA 3E1GA 2FJPA 3H18A 3LS2A 2V98A 1XKTA 3TRDA 2VAXA 3O4JA 5ALTA 2ECFA 3WMRA 2GYWA 1OCEA 4C4XA 2WFMA 4I4CA 1P0IA 2RIPA 4UFPA 5DYTA 2WHPA 2XLBA 1XRNA 4NS4A 2WTNA 1EI9A 5DYYA 2OCGA 3PFBA 4P92A 5J3JA 3BIWA 2XUPA 2ACKA 3FSGD 2Y2VA 1XZHA 3O0DA 4BCDA 4BRZA 1TIBA 5LLSA 4BVLA 1YA8A 5K5EA 2B4KA 5CTAA 1CUBA 4DNPA 4CCYA 2GZSA 3ZPXA 2UZ0A 5AKXA 1TCBA 4HXEB 1VZ3A 3ESCA 4AB1A 1WM1A 3M81A 1XFDA 4H7KA 2P8SA 5AI9A 3PUHA 2ZYIA 3K2IA 4KYVA 4WY5A 2WHRA 4KEAA 1LZLA 4GDMA 1SCKA 2H7YA 1QOZA 3Q8WA 3WA7A 2V9ZA 4B85A 3PF8A 5AI4A 5HCUA 3HEAA 5EHXA 3VDXA 5EIEA 1EDEA 2LIPA 5ALJA 4HRXA 1CUAA 4IO0A 2PUHA 1BCRA 4MYDA 5C7YA 5AK6A 4G4IA 3DL4A 3IB3A 1T2NA 1DU4A 2VEOA 1CFJA 4DNOA 1N1MA 1XRMA 2VSQA 1CRLA 1Y7HA 1O6GA 5JIBA 1GPKA 4A16A 1XLWA 4WFKA 1NU6A 4OYLA 5D3ZA 3FLBA 1GT6A 4CI9A 2WLSA 3R3UA 2VATA 3IUMA 3I1YA 4W1SA 2WJ6A 3F8SA 1SOMA 5KWIA 5AI5A 1BCSA 4FBLA 3WL6A 4M0FA 4QDXA 3FCYA 3AUKA 4E14A 2FUKA 3L1IA 3EQ8A 1A88A 3A6ZA 4H7DA 1GPNA 4K6HA 4N5HX 1MNAA 2C5FA 1CLEA 5CRIA 1A8QA 4GXNA 4PO3X 4BVKA 2JF0A 1HPLA 4JYPA 3PI6A 4DNFA 2O2HA 1E8DA 1QIKA 4Y9SA 1QLWA 4W1PA 1ORVA 1A8SA 2HA5A 4GECA 2XUQA 5AK4A 5IVIA 4BAZA 5ALVA 2C58A 3LCRA 3WKEA 1XZMA 1XZGA 2XMCA 5ALRA 5A71A 5D3KA 1F6WA 3WL7A 5CXXA 2PSDA 1NU8A 4CFSA 1IUOA 5IKXA 3O9MA 4NZZA 2Z3WA 2XMDA 4M0EA 4TGLA 4KRXA 3VVMA 1JI3A 3V9AA 3STVA 1DX4A 1XZKA 4GEGA 3QH4A 1JU3A 4AXBA 1P0MA 4B9AA 3HACA 3IUNA 1BU8A 1LPPA 3PFCA 1U2EA 1EB9A 2G5PA 1CUVA 3IURA 4W1RA 3P2MA 1FFAA 3H1BA 4LYEA 1UT6A 1ZIXA 5C8VA 4DMCA 1H2WA 1W52X 2AJCA 1HLGA 5AI8A 1FJ2A 1YCDA 2WFZA 3QVMA 3TEJA 4YASA 2QKYA 5K3FA 2B61A 3BDVA 3QYJA 4BC1A 3UUFA 3MUNA 1AGYA 2IX9A 4S0XA 2JEZA 1LPMA 4N8DA 4ITVA 2VJDA 4X6YA 1H2ZA 1K5PA 3D2BA 4CG2A 4NMWA 2RAUA 4AN1A 4DSAA 5HFAA 2BGRA 4AMYA 1RWQA 2VJBA 5LZ8A 1VJ5A 3QZUA 4FKBA 5AM3A 4UFOA 2WU3A 4BZWA 3ILSA 3MGAA 4OB8A 3W9UA 2XQFA 4AQDA 5EHZA 5SYMA 2QOEA 4QA9A 3QPAA 3V1KA 4FMPA 2OGSA 3AJAA 4LHEA 3CCBA 2CJPA 5T4EA 4JUIA 4RNCA 1MPXA 5DYWA 2HADA 5CH3A 1MX9A 5AKGA 3VJMA 4KE7A 4C88A 3T4UA 4UBNA 1CUFA 3QPCA 3QMVA 4H7EA 1UKCA 2Y1KA 1WHTA 5CBKA 3JYHA 4EY5A 3I6MA 5IVKA 4UBMA 5AKLA 4L9AA 4BATA 3C45A 4YK7A 2I78A 1RP1A 3X3HA 4LXHA 2HIHA 4K6GA 3DLTA 4U2BA 3STWA 5KWJA 3FBWA 4G9EA 1XRQA 1EDDA 1EHYA 2ACEA 4XJVA 4E15A 2GBFA 1K8QA 5FLKA 5JAUA 1EK1A 5CT9A 1Y37A 4J0GA 1X2BA 2ZJ7A 3RM3A 3V1MA 2K2QB 1THGA 3AZQA 2RHWA 2J3DA 3AIMA 3ICWA 4IH4A 2JGFA 4KRYA 1DQYA 5AM5A 5AOCA 1CUJA 4C6HA 2XMBA 2CMFA 5DLPA 2QXUA 2OXEA 4X90A 5AO9A 2JGKA 1BROA 4F0JA 4XX1A 1HBJA 1DWPA 3WZMA 4BTVA 1ZD3A 1VA4A 4HAIA 2WUEA 5HKAA 3I2HA 2JGEA 5ISMA 3K6KA 2QVBA 3BJRA 3C43A 3AZOA 3VXKA 3WWEA 4UBJA 1MT3A 1ZGBA 2XQKA 2YH2A 3FLAA 3EQ9A 1IVYA 4WCVA 3PUIA 1AZWA 1YB7A 1CUUA 4BRSA 3KSRA 1XZDA 1CEXA 4FDMA 4HRYA 5K3FB 3STTA 4JNCA 3M3DA 1ETHA 3HABA 3FYUB 1Q83A 1UOQA 2NW6A 2ES4A 2WJ3A 1JJFA 2X76A 1U4NA 4ZI5A 1XZFA 2RI6A 1CUYA 2WQZA 3IDAA 2JEYA 5AIBA 4X00A 4FLFA 1UOOA 5AKHA 2QRUA 4BC0A 4K2AA 4F21A 4U2EA 1LPSA 5JZBA 5ALLA 3SWWA 4B6GA 2HU5A 1TK3A 5CW2A 4FHZA 3DNMA 4UBIA 4U2CA 4GW3A 2XUKA 4X85A 3G0IA 4RPCA 1CQZA 1T4MA 3HYSA 3C6BA 2DHDA 2VTVA 1JU4A 3H2KA 3I2JA 4E46A 1SCQA 2ZYSA 1YS2X 3V48A 2PSEA 2W6CX 2HA3A 2QMQA 4EY7A 2D5LA 5H3HA 3GROA 3QBJA 3G02A 1L7RA 3WL5A 1THTA 4ETWA 2CZQA 4UUQA 2HL6A 3B5EA 1Q0ZA 1TAHA 3FSGA 3B12A 4Q1VA 2PSHA 3G0CA 4ZGBA 3ZV7A 4GBGA 4UHBA 5LZ7A 3D5EA 5FDFA 4B83A 1ZICA 1UXOA 2OAGA 4UBOA 3VISA 1MNQA 3BDIA 4DMHA 1GKLA 4CCYB 1B6GA 3NUZA 3QITA 1VE6A 1FFDA 3QM1A 1LGYA 1GXSA 1MO2A 4B0OA 2E3JA 3SC2A 3D0KA 2J4CA 1HDEA 4OUKX 1XRLA 3GFFA 5ALQA 3FVTA 4HXFB 2CBGA 4HXGA 2WFLB 1PFQA 1L7QA 4MWSA 2ZJ6A 4X95A 1QIGA 3ED1A 3OC0A 5BV7A 2FJ0A 2WUGA 1QFSA 5AOAA 4NVRA 4B82A 1LNSA 3H2GA 5FKJA 2XE4A 1ZJ5A 3O4HA 5EGNA 5FPQA 1J2EA 2G5TA 4MQMA 3FCXA 2CEKA 2ROQA 2W22A 3BF8A 5AM0A 1R4ZA 3H1AA 4QE3A 3O4IA 4EY8A 1R9MA 5A7GA 4ARAA 2VJCA 3I6ZA 5JZSA 5JZ9A 4XWGA 1K6EA 2JGIA 1E8NA 1DWOA 4MXDA 5DTIA 1SC9A 2QR5A 1QIEA 4OU5A 2ZYRA 5ALWA 1X2EA 4X91A 2WIJA 2Z8XA 1EK2A 3WWCA 1GQRA 2PM8A 5T4HA 5JAPA 1C7IA 5HQ3A 1N5RA 4I19A 1WPXA 2XUIA 1CUEA 4E11A 5ALPA 5K3AA 4CIAA 1BRTA 3MUOA 3SX4A 5JADA 4C89A 3C87A 2DFPA 3BL8A 5E4YA 3KD2A 3E0XA 5AM4A 4B84A 1EVEA 4N8EA 1UK6A 4FFVA 5A7FA 3HI4A 4Y7DA 2DCMA 1A7UA 2PBLA 4XIIA 3D3NA 1YAJA 2G63A 1ISPA 5AIAA 3PF9A 2WIKA 2HM7A 4AZ0A 2PSJA 1XKLA 4J03A 2XUAA 4HTAA 3PDCA 4F5ZA 2BFNA 3OPMA 4QDTA 5FUMA 1OILA 2V97A 1I6WA 3GUUA 2DHCA 4MEAA 1CVLA 3ICVA 3HLKA 4X92A 1LPNA 2I3ZA 1ZD4A 4PW0A 4RGYA 2C7BA 3R3XA 3D4LA 2YASA 1MTZA 4KJXA 3DDUA 5LP1A 2RONA 2VJAA 4OD0A 4Y2TA 1LPOA 2JGJA 3LIIA 2C0QA 4BAGA 1X70A 4KAFA 4QLOA 3IBTA 1BN6A 1VOTA 4AMZA 4EY6A 4WY8A 5D7BA 4J0HA 1J07A 3Q0TA 2Q0XA 5YASA 4FFWA 5AKYA 4EBBA 1VXOA 4UHCA 4Q3OA 4HVTA 1VA5A 1A8UA 3DQZA 2HA0A 1XZBA 4U2GA 4Q82A 1G4HA 4AN0A 2CUTA 1G66A 2XB6A 4UHHA 4H18A 3TJMA 1U8EA 4K6KA 1DWQA 2DQZA 3G0BA 1YAHA 2XQGA 4G8BA 4AO8A 4MEBA 4UBKA 1KU0A 2WIGA 3VKFA 4A5SA 4X6XA 3AFIA 3NOXA 3R0VA 4KE9A 3AZPA 4TVKA 5CT6A 4PF1A 4A23A 4XVCA 3JW8A 1UWCA 5ALHA 3EIOA 2RHTA 5AKIA 5ALDA 2Y6VA 5D6OA 1UOPA 1QONA 1MAHA 1RYYA 4AO7A 4BCCA 4P08A 5JD5A 4P9NA 5CXUA 5FXMA 1IMJA 3CCCA 4YPVA 1UKAA 1XZJA 4DYHA 3WLAA 1R1DA 1QTIA 4JYMA 1QIIA 1AC5A 5JASA 1LPBB 4MQLA 1H2YA 1CUHA 4P93A 1YA4A 1IZ7A 1BEEA 4BAUA 2XMQA 4QDUA 3H17A 2XMSA 3L1HA 2XQJA 4Q3KA 4QWWA 5ALGA 2O7RA 3WIBA 4B80A 1R88A 3C6XA 3HSSA 5DNUA 5ALKA 1CUDA 3BXPA 4IH9A 2I3DA 5AHXA 4DMKA 1DX6A 3IA2A 2QZPA 1DQZA 3QPDA 2C0PA 3V1NA 4UHFA 4WFJA 2XT0A 4J3JA 3FYUC 2OCKA 1QO9A 2ZSIA 5HK8A 3I1IA 2JIDA 2WHQA 3HJUA 1DT5A 2CKMA 5DNWA 2HA4A 1TCCA 3WI7A 5EI5A 1WB4A 2G4LA 5I8PA 3S8YA 4QEKA 2VA9A 4CG3A 4OCZA 3DYIA 4DSZA 5FOQA 4GLBA 4FTWA 4WDRA 4Y2UA 1EB8A 4W63A 5ALFA 4Y2QA 3I6YA 4G8CA 1JKMA 4B9EA 3HXKA 1BE0A 3N0TA 5DJ5A 3YASA 5CT5A 3FWHA 5ALYA 1C7JA 5AK5A 2B9VA 7YASA 1B41A 2DR0A 5KREA 3ANTA 4QDZA 1MAAA 5E4JA 4I3FA 3G9UA 4Z49A 2HDWA 5HK9A 5LZ9A 1D07A 4EZIA 1U65A 1G5FA 3STUA 3G0DA 3JWEA 3F9CA 2VQ6A 3W06A 1N5MA 5CH5A 3QMMA 1ACJA 5A2GA 1R9NA 3I2KA 3H2JA 5FV4A 2XUHA 4BTLA 4CG1A 3HZOA 3BF7A 5C8ZA 4HS9A 3R3WA 1GGVA 1FFBA 4DMFA 2JGMA 3OM8A 2WILA 5FRDA 1QIFA 1FFCA 4QLAA 5C81A 3GBSA 2OPHA 3H04A 3ESBA 4L0CA 1BN7A 3W9BA 3EBLA 3RLIA 4PSCA 3WL8A 4QNNA 5K3EA 2WHPB 3D2AA 4DM7A 5A6VA 2CB9A 3F97A 4KAJA 1YASA 4LIPD 2QS9A 4H35A 4UPDA 3RKSA 1CQWA 4J7AA 5IVHA 1XROA 3LLCA 2OGTA 5IVDA 1P0QA 3WK6A 3C6ZA 2O2IA 4KACA 1DT3A 3OG9A 1EA5A 1VZ2A 3CXUA 5HF8A 2GBCA 1WPRA 2DSNA 1VE7A 1W76A 1R50A 1M33A 3O95A 3LP5A 1MN6A 5E4TA 3GELA 2QJRA 4PSDA 1J06A 1XQWA 1CUCA 5JAOA 1XZEA 3R3YA 5AKJA 2C4HA 5LZ4A 3NWOA 2QTBA 1QIHA 5HF6A 2VT7A 3DCNA 4W9RA 4ROTA 2OQIA 3WKAA 1CR6A 4PNZA 4Q34A 2IIVA 2DQYA 1QZ3A 2I03A 4OB7A 5F4ZA 1R3DA 4U2FA 1F0NA 4D9JA 2H9YA 2HA2A 3WZLA 3LIPA 4WDQA 2VT6A 2X8BA 1FSSA 4C4ZA 3WK4A 2WG2A 1QE3A 1JMYA 1UK8A 1Q0RA 1K63A 1QGED 4DTCA 3F96A 1N8SA 2EEPA 4RE5A 3STYA 1E66A 4C4YA 2WKWA 3F67A 2JGLA 1BS9A 3FYUA 5E2IA 4LXIA 1EH5A 3FYTA 3WJ1A 5LYYA 3ZLTA 3A70A 3ZI7A 1ZGCA 3I2GA 5JALA 2H7CA 3EQ7A 1QJ4A 3U1TA 1XZCA 2XMZA 1IUNA 3AILA 3C5WP 3C8DA 3WJ2A 1QIJA 2QM0A 4OPMA 4PV7A 1VKHA 1GKKA 3WA6A 3AIKA 4Y2JA 4L3WA 1LLFA 4ZWNA 5A7HA 3G7NA 2HU7A 4CCWA 3I28A 5AKEA 3STXA 4EUSA 3IUQA 4EHBA 3E3AA 3NGMA 3WKCA 5AICA 4TPKA 1CUIA 3GA7A 2H7XA 1XQVA 5T4FA 2PVSA 1O6FA 1E8MA 4FNMA 5AP9A 2XUFA 3FNBA 1PV1A 2J4FA 5EIHA 3KOOA 1IZ8A 5ALIA 5HF9A 4F60A 2QUAA 3BE8A 1QIDA 4G8DA 4UFNA 5I9IA 3WK7A 4RE6A 4MYSA 2EDAA 5AI6A 5LIPA 2ZYHA 3G9XA 1EVQA 2XUOA 1IUPA 1L7AA 1XZAA 2XI4A 3K9BA 3FLEA 4G1FA 4MWTA 5AK3A 4JH0A 2WUFA 1YSCA 1SFRA 2WFLA 3ESAA 4ZREA 4X7BA 4BE9A 5EHNA 4B0PA 4GWLA 3R3VA 3AINA 5LKRA 2BCEA 5LZ5A 3R3ZA 3D2CA 5FPPA 2X5XA 3H2HA 3FOBA 5JD6A 2JBWA 4IH1A 1LBSA 1XZLA 1XQXA 3DKKA 5ALZA 2PU5A 1MJ5A 3DYVA 4J0IA 2WUDA 1ZI6A 5KBYA 4BE4A 3G8YA 2BAGA 2XMRA 1AURA 1LPAB 3C6YA 3M83A 4BBZA 3O9VA 4X94A 1H2XA 1CUWA 3VVLA 2OLEA 5AM2A 2HA7A 4LXGA 4WFIA 3MVEA 1ZI8A 3ESDA 4X93A 2AJBA 5ALSA 3ZLUA 1H23A 2YYSA 3ZLVA 4KE8A 2WG1A 1GZ7A 5DTJA 5ESRA 1WB6A 5AKZA 4QDOA 5K3DA 1CUXA 1EDBA 4Y2SA 2BGNA 5AJHA 2GZRA 3B3QA 2DHEA 3F98A 3H0CA 1H22A 2HRRA 2PU7A 3WK9A 3WIOA 1G42A 4FNGA 2XLCA 1CIJA 2V96A 4Q3LA 4X6UA 3VJKA 3IULA 5SYNA 3G9TA 2GYUA 3ANSA 3R40A 2Y6UA 3KWJA 4B81A 5HZGA 2J3QA 2Y2UA 4WJLA 5I7UA 5ALEA 1UK7A 2HRQA 4J0JA 3IUJA 5K3BA 3W04A 1QIMA 5JANA 4J0CA 1MX1A 5DWDA 4X71A 2OCLA 1WB5A 1CUZA 4G4GA 4KR0A 4Y2VA 4Q05A 1PJAA 1XLVA 1AX9A 2XDWA 1ZD5A 3HC7A 3DKRA 4H7JA 5HQ3B 1YS1X 5JAHA 3L1JA 4BVJA 4BDSA 1XRRA
chains in the Genus database with same CATH superfamily
1F8YA 5HZKA 5H81A 2GZ1A 2GB4A 3PTZA 3SU8A 2N42A 4DEVA 4QO8A 1U04A 3L4JA 1XTZA 2VDWB 3HPQA 3LPMA 3CEMA 5JO9A 3LXUX 1P6UA 4M38A 1M5UA 2Z56A 3AF2A 4QU0A 3S2ZA 3T94A 3ZBPA 1NVVR 4DR5B 3E1KA 4H1VA 1EP9A 1U98A 1HQCA 4D57A 5JBQA 2XXAB 4GOXA 2PPLA 2E49A 3DE5X 4YJHA 5ETJA 1ODSA 5JVDF 4ZV7A 4I6JA 4MCAA 5ALMA 4E5UA 2FP4B 4RC9A 3QUSA 3T6KA 3WO1A 4C76A 1NXOA 4Q6BA 1SUWA 3P0FA 3ETLA 1Z68A 2G8LA 1WO8A 4NV0A 3RPEA 2ZJFA 4LDJA 2VDKB 3PPIA 1EFKA 4HUJA 4ICIA 1GZ5A 1KVSA 3BEOA 4L78A 4WTOA 3V8EA 3T3OA 2PT6A 3H2ZA 2VPPA 1N6LA 2AMVA 1H6AA 4C2TA 1Y34E 2C7VA 4ARUA 3AM5A 2QHXA 1P2UA 4YACA 1NP6A 3FWZA 3DEFA 2OLKA 2IZ7A 4UAJA 4RVFA 4G5SA 5FLEX 2M6RA 3E4DA 2FPPB 1FFXB 1E5TA 1NX6A 4OFXA 2XYQA 3H9QA 2HJRA 4YAEA 4LTNA 3VO1A 2II6A 3B1XA 3D4NA 1ILEA 4RV5A 1Q7CA 1A76A 2AJ8A 1E98A 3L9WA 4BOYA 1C9JA 2ZUCA 4IXTA 5KDDA 1F60A 5G40A 3C3BA 4B3RB 3T7TA 1Z7BA 4EF6A 3H19A 3ZWQA 3R3HA 1YXMA 2B94A 4CIDA 4M0MA 2BRUC 3A26A 1R6AA 1DBRA 1PUJA 3EZGA 3LZ6A 4M0UA 4OBBA 1QFXA 4WUTA 2YY6A 4ZVQA 2HFKA 1V6SA 1JHYA 4W7SA 1T3ZA 1FFXA 1S2NA 2V3WA 4MICA 1QS0B 2UVQA 1FP4B 5HKBA 1P73A 4ZXFA 4B8ZA 3CKMA 3T0FA 5I9NA 1U31A 1JLKA 3UCXA 4BUZA 4OQFA 5KTKA 3R0QA 5JXJA 1GFIA 2VK2A 4DXHA 1QR2A 1WNFA 2PJZA 1O57A 3D1LA 4G1VA 4KG7A 2VH5R 4QYSA 4Y2YA 5BPHA 2KX7A 1ZDMA 3QGMA 5DLEA 4B6PA 2HK9A 1R0LA 4ZHQA 3HEMA 4GI1A 1E3TA 1MRZA 3F1KA 1KIAA 4P82A 3E4CA 4WJZA 5C7OO 2B92A 3LO8A 4JJZA 3WYDA 1T91A 4X7MA 2G0TA 2XTNA 4PXYA 2ZVPX 1PK7A 1EWTA 3W8NA 5TQ0B 2W37A 4EDHA 1E59A 1T10A 1SR8A 1IZ0A 1QYXA 4QU5A 5JJ5A 2F9FA 4P53A 3E3LA 4MNTA 1R7RA 2JI8A 4RK5A 1XCLA 1GDHA 4Y2XA 2ZKLA 5KKNB 4YECA 5FBKA 1NJGA 5KVSA 4QZVA 4BB0A 1B23P 2VAVA 4LYGA 5EYPB 3UATA 1GSHA 2C4VA 3FOCA 3N28A 2J48A 2OTCA 5K03A 1G21E 1A0OA 4K6FA 2G9UA 4HXYA 3O7MA 4OOFA 5AW0A 5B3JA 2IH2A 4FDTA 3OQNA 4DIUA 3THSA 6YASA 5CCXA 1US8A 1PX2A 2V7QD 4MPTA 1U0OC 1U1IA 2ZM5A 3O92A 4P0PB 1WUJS 1LTQA 2HU8A 2PUJA 3HR4A 4XEHA 2ODAA 1VB3A 3SC6A 4C0JA 2XUGA 2PT7A 2XZLA 3JYLA 4LZWA 1UIRA 4ZU1X 4E70A 4BMVA 1YA6A 5F77A 4DQUA 1KYXA 1QHNA 2AH5A 5DNAA 2GAFA 1CSEE 4RL4A 1CU1A 4YAIA 1GSIA 3KU1A 2QXTA 2Q99A 1RI2A 1DJQA 4YCCA 3F78A 2G1AA 4WJKB 1FDTA 2Y0CA 4RXMA 2XB9A 3KR1A 3CX7A 1AUOA 2RGWA 2C7PA 5C7IO 1EUDA 2EC5A 2Z8ZA 4NBLA 5L4SA 3BWXA 4E4TA 4EYQA 2WJGA 3UOWA 3IUSA 4ZRDA 3HO8A 3BB3A 3I4CA 4MWDA 4PZLA 3ZBTA 4BCBA 4E2WA 4OBXA 3CNQS 4WQMA 2B1JA 1ZOIA 1I36A 3EW9A 4UUBA 2B8NA 4I1OA 4N7RA 3WZ2A 1B8VA 3RC8A 3EZ9A 3A1FA 3KWFA 1EIWA 1XRPA 2AD5A 4R2LA 2G06A 2P4HX 1RJ9B 4QBIA 4H7FA 2PH5A 4IINA 2CVOA 1EJBA 5TY0A 5K3CA 4ARZB 1PWEA 4ZI2A 1HL3A 3T9CA 4J4BA 3ONDA 4A8HA 1HRKA 1V48A 1W75A 1RWWA 3GWZA 5JSUA 2BYTA 1PNTA 3DVAB 3U4IA 2CXRA 4GZ5A 4E5SA 5BR8B 3LCVB 3OO1A 3DE0X 1NXQA 5DGCA 3DF7A 1KP3A 1JMKC 1QZUA 4NR0A 3LHSA 2WTUA 4KE6A 3TTVA 2PTHA 5LB2A 2OFOA 2BUCA 3OTGA 1UL1X 1SXJA 4GP7A 1PT6A 4W6QA 1F2UB 3A04A 4WNYA 3D59A 5A9TA 3RTAA 2FW7A 1QPZA 1VG0B 4KXLA 1JR2A 1WSAA 4NOMA 2ZITA 4JBWA 4RH0A 3CIFA 3JARA 5EWLB 5AM1A 5C5EA 1NURA 3UUEA 5CG2A 5IUJC 3TCNA 2C7RA 2W6JD 1DDGA 4HWPA 3VU8A 4II2A 3B7PA 5IWAB 3OT1A 1CJKC 1XL0A 4ZV4A 4FGSA 5A0TA 5J23A 2JCGA 3ZKAA 4G1UC 1FP1D 5GAJA 3LD9A 1F0PA 4L9WA 3A2LA 1E9RA 3IQHX 3E0QA 3JWJA 4QOIA 3IEKA 5HIMA 3CN9A 1Q6YA 1DAMA 3WK5A 5KDOA 3BXOA 1FQJA 1S8AA 3VH3A 4GYJA 2J0VA 2ZR0A 4MR8A 3Q2OA 5FA8A 1NSTA 5DBGA 3CUVA 1EHIA 2L0XA 3JYQA 3Q7EA 2AJLI 2PL5A 5CH8A 1VPVA 4NJOA 4I8IA 4MS1B 4BMSA 4BP8A 3D7RA 2DBRA 3JQ8B 1JHUA 2FUG1 1COWD 3FNEA 5J5VA 2D1RA 3KDPA 3IRVA 2H7VA 2AZDA 4JODA 4RQAA 2XCOA 5CMLA 5K09A 5LOVB 2XYGA 4DF3A 4KWHA 2YXEA 4TV9A 2C4TA 1VHLA 4AX4A 4U0JA 4YRKA 1GZ6A 3NIWA 1SZPA 3TZLA 2GMWA 3NASA 4EB0A 3NV7A 1W88B 1J97A 3BA6A 1FRVA 4OF4A 2YVQA 2ZWPA 1C1HA 5HX7A 3L6BA 1X13A 5FOUA 3SF8B 1RWNA 5BSTA 2IRWA 2C98A 4CM3A 5I45A 4Z4EA 4ZVSA 1CJSA 1B1CA 3LBHA 1BEZA 4PR3A 3BIXA 4C6TA 3AKEA 1E2BA 3E8XA 1I4EB 5LUBA 2WJAA 4KQ1A 1Z13A 1U3CA 5DBHX 1OTHA 1RXSA 3CEAA 5FQNA 4C0HA 3L8FA 3R5JA 1G6HA 5KHOC 2EDCA 3OY7A 4UTRA 1AMUA 3V4OA 1KJQA 4FWBA 3HVRA 3QU4A 4R9NA 2PJDA 1RI1A 4LFAB 4IZHA 1E7RA 4B6SA 1XTIA 3KO8A 4BMOB 2HHJA 1K3TA 1SUIA 1UPFA 3GRUA 4DA9A 4PNPA 2PNJA 4ABTA 1T4GA 1T4CB 2ZIUB 2C8VA 1R5OA 3FTNA 5DX8A 1MJNA 1MEOA 2OFPA 4EJSC 2ZRQA 3SIRA 1R0ZA 1I7QB 5SYAA 1LUAA 1FP2A 1ODCA 4MS3B 5LUAA 2Q5LA 5CT8A 3O2SB 2O7QA 4LKOA 3K4PA 4QOSA 3O4GA 4LJKA 5EXTA 3SN6A 3I5YA 4O2AB 2B8JA 4ZGWA 1P9NA 5B36A 5HIJA 1L5NA 1OASA 2GPNA 4JGGA 2BJHA 2DPXA 4Q4HB 2RC5A 5K8TA 4HMQA 1AKYA 5FUVA 3T4PA 1ULHA 5DBEX 4P2GA 3CLSD 4HN2A 2QVCA 4LSGA 3MMZA 4XOIA 3OKAA 3SICE 2OGZA 3G0GA 3FFTA 3IAM6 4FINA 4LY0A 1US8B 5LQNA 3PSAA 2BUAA 1JXMA 3FOWA 3ETNA 4HDOB 2LCIA 4DB2A 1DPFA 2CVQA 1Z7WA 1YR2A 2EAUA 2YWJA 3H5LA 1P4HA 1UXJA 4AZ3A 4DQ0A 3PNPA 3QHPA 4KZKA 1UKBA 5GGYA 4XM2A 3X1WA 4JV5B 1OH5A 5BW4A 3JAKB 1IIRA 1KSGA 2I9KA 3FHCB 4DWJA 4CMIB 3BJMA 2JLYA 5KYXA 4U2DA 4AQYB 4J9UE 2LV8A 4G4JA 5HYVA 2PUCA 4Q1AA 1Z37A 1P33A 1WOMA 1W1UA 4BLPA 4IQ4A 1GR0A 1XLUA 2JFHA 1WDLA 5J1TB 1CBUA 1VRCA 4ML3A 2QM3A 4FFBA 1A98A 2H57A 1M1XB 1USWA 3LRTA 2BGLA 2AVDA 4BJHB 4DAOA 1UZAA 3SG0A 1JZTA 1THMA 4HJXA 5AHRA 1P0PA 3H11B 5F3DA 5F7JA 3EGVA 3NYQA 5DLQC 1DEOA 4KTVE 5EKXA 3HYNA 4OA8A 2ZUVA 4XVUA 2G36A 3N2ZB 5AOBA 1RQNA 2Q7DA 2JLRA 1CG6A 4TMZA 2W4IA 3C70A 4PLHA 2IELA 1E3DA 4W8HA 3DEJA 3VOTA 1JT2A 5KX5B 2NO9A 1LU9A 4FX2A 1RE1A 2EIHA 3O8CA 1LWNA 1I6MA 1T6NA 3I5XA 1TQHA 3HKBA 1YS4A 2JCYA 4NSNA 4PO1A 2Z6VA 2NU8A 4V1CI 5FPKA 3M6FA 4ZKEA 5CT4A 4KVGA 1GUZA 3PFNA 3J7AC 4EW1A 2QMYA 3P9SA 1EZ4A 1ZH2A 1SPXA 2GKGA 4FLEA 1FMTA 3RK0A 4BZZA 4FYHA 3GJ8A 4Q93A 1L7BA 2P62A 3QFRA 2Y67A 2AG1A 2H1IA 2FLWA 2QTTA 2X2OA 3GZNA 2F59A 4W5RA 2XNJA 1RKQA 2CDRA 3LC0A 3L79A 3SM3A 3PE6A 2GERA 3R7NA 4D4LA 1RBYA 3SS9X 3R6WA 3V8PA 4UHDA 3TLAA 2XZPA 4MW9A 3GLHB 3RVDA 1SZCA 2WIFA 1OY1A 4O5OA 1S4MA 1JFRA 4MS3A 4DARA 1ZI9A 1O96B 1NXXA 1WMBA 2YHSA 2Y1DA 1UAAA 5C0OE 3T5BA 1Z4KA 4D3YA 4B48A 3E2IA 4QG3A 2IW1A 2WKQA 5KU1A 4BE7B 1G9TA 2Q27A 3VBEA 3CO5A 1WZNA 3DVSX 3K1YA 3DLBA 1TB4A 1E6LA 3L7MA 4KO2S 3OURA 4RHXA 5ALXA 3RK4A 1USIA 3TBHA 4YR7A 5L53A 4TL7A 2PJRA 4JLDA 4PAGA 3E35A 2HRDA 1ZL2A 1IBSA 1WCXA 2O52A 2YV1A 3H16A 1NVGA 4E4YA 2QA5A 1Q7GA 2R11A 2BDUA 3P9QA 4EPRA 3VKHA 3G13A 2P4UA 3I2FA 3AG5A 1U3FA 4GKBA 3WB2A 4ESOA 3VDQA 4LOKA 3IKLA 3UGTA 1EVYA 1JA9A 1XQYA 2X9GA 4M46A 1YE5A 2UVDA 1H5QA 1E4EA 1S2GA 3E1GA 5HRUA 3KBBA 1Y7LA 1QHYA 1UPUA 4DJEC 3TDNA 5FO1A 3OM0A 1A4IA 4BB5A 1TNDA 4MX8A 1O6CA 2P9YA 4J4HA 4OG2A 4FOTA 5ALTA 1OGIA 3RUPA 3LDHA 3ZDEA 5LP6C 4HZUB 1NIJA 4EYSA 1VLVA 1B73A 2JLAA 1BGVA 4IMIB 9GPBA 4CF5A 3PDJA 4OHXA 4ZEOA 4CIYA 4TL9A 2BELA 2LWIA 5J5AA 4ND2A 4UFPA 2QTRA 3CPJB 1S8NA 1EFVB 2AG8A 2ZCVA 4ZKDA 5CEJA 1E3MA 1U1CA 4TYMA 2XLBA 1WCIB 2C94A 4NS4A 1TPZA 4LUCA 1NG1A 1GTJ1 2WTNA 2Z09A 2R8OA 3PIRA 4I9FA 4G0ZA 4TZTA 4XGNA 3A2KA 3MGCA 2YOFA 5DYYA 4DUYB 3HBMA 1UBMS 3A28A 3FIUA 3T41A 3G1UA 2NT4A 3RADC 1I2DA 5HE9A 5CDFE 3CWZA 1PFYA 2G9NA 5BNTA 1ZIPA 2HSGA 2Y2VA 4F5YA 3TEMA 4B6OA 3AW9A 4GS5A 4ZJPA 5M29A 1KZYC 2HCFA 4HF7A 2W42A 3NETA 1KE1A 4RHYA 3ENKA 1D04A 5BN4A 4BVFA 4LMAA 4EA8A 4HGYA 4UTNA 2YOHA 5F2KA 4URXR 1CF4A 3EYWA 5CLHA 4GBMA 2W6NA 3LT0A 5BOSB 3Q72A 2HBQA 1I7DA 4JQOA 5KWVA 2G9VA 2WV9A 3OCVA 1DIAA 4BYGA 1T36B 1QHHA 1QRUA 1NPTO 1CUBA 2VN8A 4KDEA 3FCCA 3WMXA 4I50A 5ELXA 4KQMA 1ZIOA 3OE5A 5LU8A 2EJWA 2UZ0A 2QQEA 3Q3EA 5AT1A 3BFPA 5I5EA 4NFYA 4LVUA 5ITVA 2HSWA 2Z6AA 1RZRD 4HXEB 1SCUB 2R62A 1VTKA 1BVRA 1IBKB 2PD6A 3ZYZA 1BQ4A 1T3SA 2HF9A 1JLHA 4BNVA 3ZK7A 1TEHA 2AXQA 4RA6B 4ENQA 3AVPA 4JB3A 2P8SA 1T2VA 2PFSA 4MJXA 5AI9A 3EH2A 4OA5A 3WRYC 4XQCA 4WZAE 4YCDA 3T9BA 2P4QA 3K2IA 1EVLA 3EGWA 3LGXA 3MERA 4KEAA 4BO7A 1JYEA 4RIIA 5FTWA 1KDPA 5DXAA 1L5FA 3JRNA 5B6IA 2O0JA 1LZLA 3GLFE 2AFRA 2VQ3A 3ZDZB 1GNVA 4D81A 1NA5A 3IIJA 2YHAA 2RAFA 1QOZA 2EJTA 3ETCA 2AYXA 4LCJA 1BO6A 3M4NA 2SECE 4R54A 2AYYA 1KI8A 2PX4A 3F2IA 1JR6A 3VNVA 2V9ZA 3BGDA 2YRFA 4OHZA 1GPUA 2QLMA 3DKPA 2X7JA 5H7XA 5KNBA 2JDIA 4D9KA 3JR7A 5HCUA 1E2UA 3HEAA 1Y8QB 3M2PA 3RVMA 1F8XA 2NO6A 2VHXA 4QUDA 3W4KA 2B7BA 2JJ1A 3QE2A 3VDXA 2WFAA 2AOUB 5BXQC 5CEFA 4BXOB 5CDHA 1MENA 3BL6A 5KKCA 4LBZA 1Y6FA 1Z2PX 4GZ6A 4YY3B 2JL1A 1Z17A 3TOCA 3K9LA 1HTBA 2AG0A 2FFAA 3GXOA 3O1IC 7GPBA 3FHLA 3QE9Y 1V16B 1CUAA 4QHYA 4IO0A 3KKEA 3P0HA 4UDXX 5L7YA 3U44A 4DJ5X 3KOMA 4NCXA 4EYOA 1KP2A 1Q17A 1QYDA 4P0QB 2QRGA 4AFNA 3S2IA 5AK6A 1V47A 3GJ7A 3EY9A 4I9GA 3U3RA 4XUDA 2ENWA 1L5GB 3SYLA 4ECAA 1NASA 2LW7A 1B3RA 1X1QA 1J8VA 2IQ5A 2C4MA 3A6GA 4E3ZA 5DTQA 4ETIA 4PZUA 5E1OA 3ZLJA 2QGFA 2X40A 4RJKA 3Q41A 4H6XA 1E69A 3PBKA 5KYWA 1O6GA 1I5RA 3TRJA 3T1OA 5IKPA 2R65A 4N12A 4A16A 3K09C 1TYDE 1TD9A 6GPBA 5HKLA 1W73A 1IULA 4OAOA 1JBQA 1E2MA 2PXHA 1PR2A 2NYRA 3CX6A 1XEAA 1NVTA 3LOPA 3B1JA 3R3UA 1E96A 2H1CA 4KQ2A 5GPBA 5IDWA 5IFLA 1NNEA 2Y1GA 3Q87B 3IUYA 3LY9A 4A15A 5I4IA 4DR7B 4AICA 1PJSA 1JFFA 1R4NB 2XF8A 3GOHA 3I6QA 4XYMA 2R4QA 2MINB 5AI5A 4DWWA 2EFEB 4C4SA 4AJJA 4D4HA 2H2FA 1N36B 2X14A 3NHUA 2ZCJA 4BPRA 4IG9A 1JNYA 4CN9A 1W1WA 2R7AA 4M7RA 5FJJA 4QDXA 2ZATA 4IFTA 3ROPA 1PAUA 2IH4A 3H9CA 4E14A 4I99A 1YKGA 1Z5NA 2FUKA 2LZ0A 3H7AA 1QVZA 1IXSB 2QD2A 1G19A 3PX3A 3C4VA 4K6HA 2BTOA 2WF5A 5CFZA 4FEYA 3TRHA 4EGAA 4RVGA 3CG4A 2AZTA 2JBAA 2WHYA 3EQ2A 4G84A 4HH1A 4BNFA 5AW8A 3SYRA 1CS0A 4PO3X 1RAEA 4KBFA 4QOFA 4G5FA 4BLTA 4BVKA 2BF4A 1HPLA 1P7YA 1VYHA 4F93B 3ZHSA 4B32A 1JWBB 1ADJA 5LPNA 1E8DA 2P8JA 3QA3E 1ZHFA 4N40A 1Z8FA 2HA5A 2WP0A 1WNTA 1YL7A 2APJA 3NGXA 2VSOA 3P1JA 4PNEA 2QEQA 3H87A 5IVIA 3ZDRA 3KSAC 1GTRA 5COQA 2FWJA 5ALVA 2XZTA 2J0QA 1FZQA 1XZ8A 1FYXA 1L8LA 4X61A 1SZJG 2CNDA 1X87A 2VYFA 3IOEA 4LYHA 4MW1A 4L07A 4O4HA 1KI1A 1G21B 1PGNA 2XYPA 2WE7A 4RMJA 5H70A 2EHJA 5ALRA 4AUNA 2NNLD 4EFNA 5D85A 3NAGA 3FKSD 2PK3A 1F6WA 4NH0A 3JD3A 4YXWD 3UNXA 5AUQA 4YV0A 2PSDA 1NU8A 1DOHA 1EIZA 5FUWA 4O3MA 3HKDA 1YB1A 4OHMA 3DE6X 2H4XA 3T5MA 4DCCA 4AJEA 4F5EA 3LBYA 3EXIB 5DIZA 4CFSA 3GFTA 4ZI3A 2QRNA 3TNDA 3IXLA 1KYWA 1ID8A 3EEFA 4L95C 2Z3WA 5B1SA 4KPUA 4DKXA 4ZMRA 1D6NA 4F6RA 4HDKA 4L15A 3U49A 2LCFA 2VF7A 3B1FA 5TEVA 2C07A 1JI3A 1U0GA 3DEYX 5EZ6B 4WZBB 2GEFA 3FLMA 2C20A 5JJLA 3JQEA 3BCRA 2QW1A 3K1ZA 4A8JB 4ECEA 2GK4A 1I14A 1Z8DA 4PXSA 1WXHA 3CUSA 3GFRA 4J29A 4CIBA 2F8SA 3NHSA 3QWBA 3AFMA 5F2NA 5KYYA 3UMGA 2V5VA 6ADHA 2Q3JA 3QH4A 4MVYA 1JU3A 4WOJA 4JQSA 3CVYA 5EZ5A 4C0AC 3I9NA 2QTVB 3RE1A 3TRKA 4JXXA 1N2SA 1BSVA 1P0MA 3F5QA 3KKKA 3AR5A 4MZXA 5IK2A 1FRZA 4NHOA 4B9AA 4BMCA 3SR4A 1ULTA 2H08A 2BFEB 4Z7OB 3IUNA 2Y92A 5DPMA 4AI6A 1REQB 4O2BB 3BL5A 1JE1A 2CLMB 4UPVA 5DYGA 3CVXA 2ZJ4A 1BS2A 4ZCSA 3ROKA 2G5PA 1HWYA 4JKOA 3HYTA 4DAEA 2G3YA 5TF4A 3GDOA 1GAWA 1UFRA 3Q7PA 4BV8A 1KI9A 1NUPA 4QX6A 4PTYA 1N0VC 3SSAA 2WRZA 2K87A 4RHEA 1QBGA 1ZA1A 4W1RA 3ZH2A 3ABRB 5B2EA 2IDKA 3A6KA 3A25A 2FUG6 1AQ6A 1UT6A 4JN6B 3TL6A 2GK6A 3PPWA 3E9EA 3JQBC 3M89A 3MTDA 1UM9A 4DMCA 2B98A 3K9NA 1SPBS 3ONFA 2AJCA 4LY6A 5AI8A 5ED0A 3JSAA 2WWRA 5FPHA 1Z0SA 2PIDA 1PNQA 1U8FO 4K05A 5EEGA 5FWXA 5HNKA 2OWEA 5CIQA 3OBBA 3TEFA 4AD8A 1OI2A 1SIUA 4RULA 3PTLA 2NXWA 2MR6A 4JXZA 1KXJA 4YASA 4MRMA 1GTVA 4O2RA 5B5SA 4XTCS 5JFGA 5DI3A 4KXWA 1QQ7A 5AXDA 1T3HA 2B61A 1CQPA 3QYJA 4BC1A 1IXYA 2KLHA 2MWMA 4QGGA 3FUTA 1RYHA 4TSFA 2C8JA 1C3VA 2H5LA 4HDRA 2PAFA 2TMGA 4YJ2A 1EP1B 2HHLA 3C3DA 4GM0A 3RFCA 3VC2A 5E9JA 3ZBQA 1YHNA 2VJDA 3H7IA 1JHRA 4CM8A 4AURA 4X6YA 3NO4A 4DFDA 3KT0A 4CG2A 4U39A 2NSLA 4NMWA 2YKGA 3GEMA 2BDTA 4DVJA 1EQ2A 2BF7A 2R6GA 2VJBA 5B2ZA 1I3NA 1PYGA 4DB4A 2VJMB 2ACWA 5LYJB 2QENA 3CISA 1KH2A 4MW2A 3TGPA 3EGXB 5J40A 4D2IA 1A9ZA 3BWVA 4UW9A 3P9NA 3UCFA 4Q4AB 1DG3A 4FHEA 2GPAA 1NR7A 2WU3A 1AUPA 3FDZB 1SXQA 3L0SA 4OB8A 2E6KA 2F4NA 2HSEA 3A37A 4KBYA 4YP7A 3ND6A 2L2QA 3DO8A 3R7AA 1YFLA 5SYMA 3GV0A 3V1KA 2FSVC 3GT0A 5KQSA 2W0MA 1SXJE 1JSXA 1U3DA 1VG9B 2QAJA 1SHLA 3K8QA 4FMPA 1C9YA 4LHEA 2IKSA 1KWKA 4A6XA 1PE0A 4JUIA 1E1CB 4BNUA 3QHQA 1WUTA 3LY8A 5DYWA 1F0YA 1ZS9A 3RUAA 4BBAA 1UXIA 5DE3A 3LQ1A 4BX0A 5KWSA 3O3OB 1MDBA 3WBBA 1OXKB 5FYQA 4NXMB 3WLHA 1WKVA 3QPCA 1EUCB 4RZ2A 4NJEB 3S68A 1K1EA 1VLJA 2QF7A 4MI3A 4Y2HA 3SCZA 3OQPA 1BHO1 2Y1KA 1Z36A 1WHTA 5K4GA 5MGBA 2QQ0A 4I3GA 4QXQA 2HLPA 4EY5A 5I9TA 2XODA 5EIBD 2QTMA 2VG8A 3UPTA 1F2TB 1RHRA 1NUAA 3QVSA 3ZD6A 4COKA 1JLLB 1KC3A 4BTEA 3N2YA 2O07A 4HEHA 4FZ3A 4DDTA 5KHLB 2O14A 1O95D 1SVLA 1ESNA 5ICGA 1CJMA 1D8TA 5GP1A 3DYBA 3WGKA 4CT5A 1SQGA 3FZQA 3RUDA 1Q7TA 4WEQA 1XRQA 3ASUA 4F8EA 3K71B 1FTWA 2QK4A 3K2BA 2PZEA 3ZY5A 3K1TA 2ODWA 5LL6P 1QE5A 3K72B 2JD0A 5IU6A 5H82A 4JQCA 3SHFA 1VBNA 2M6LA 4ZYLA 4H6WA 4PG8A 4RWZA 2GBFA 5E7JA 5CX1B 3GZTB 1XZPA 1T8UA 3FPSA 4MV4A 3E70C 2JS7A 5FLKA 1E1RA 3A9UA 3FH0A 5DXFA 3E22B 3RASA 4MI1A 3UHAA 3VPSA 2BFBA 4KSYA 5G53C 1IQRA 1F2UA 1J2JA 1XMJA 1LNZA 1YJQA 3T1YB 1X2BA 3HJTA 1Z4NA 3IP8A 3IP6A 3PS9A 4JR1A 1GGFA 3UUGA 1IVSA 3F6YA 1THGA 3MF4A 1Y7PA 2QN6A 1XB2A 3ICWA 2ZIXA 1F4VA 3RJ5A 3QEMA 3JRXA 3HZRA 4KRYA 4MQFA 4JLAA 1DQYA 4RACA 4M7WA 2R6HA 1FDSA 1GRNA 2O06A 1WSBA 5K0JA 2RGYA 3ZWMA 3RQSA 4C6HA 2FWIA 4GE0A 4Y6SA 1VHTA 2OBNA 3AESB 4PFQA 3QSYA 1ZAYA 3ZJUA 3EMDA 5H68A 2A7XA 1WXGA 4NHEA 1AXEA 3E7XA 5DLPA 3TFQA 5A3QA 3U5TA 4CLEA 4X90A 5LQUA 2JGKA 2Q1UA 1XQ6A 2P4SA 3BXGA 4BKRA 4DTIA 2JLWA 3A1WA 3HJRA 3WZMA 3RYFA 4D9MA 4DZZA 2YMLA 1E79A 3SAJA 4OEHA 5B1EA 1ORHA 3TX2A 3WHPA 1NN5A 1RAFA 2Y0EA 3L4EA 5C3MA 1JXOA 1DMRA 3F9RA 1QKJA 1T9GS 2HGSA 1O6BA 1UC5B 2C9ZA 2JGEA 1RLOA 1U1EA 3HA3A 3CZ9A 3E7DA 1Q2XA 4LN1A 4NENA 4XIJA 1Q20A 1J90A 4MARA 3UMFA 2GHTA 4DMLA 1TF5A 1JZSA 5DV9A 3C43A 4HDCA 3F7MA 4BNKA 2OEPA 4BV9A 4ZMSA 3AWDA 1X9IA 2G9ZA 3WWEA 2NXEA 1ZKMA 4I9NA 4C2AA 1YZLA 5JMPA 4CW7A 7REQA 1ZGBA 2ZRAA 3RD5A 4U3JB 1J22A 4RVDA 3SE7A 3PR1A 2UXBB 4IKOA 1IVYA 4FIZA 2AR9A 3PUIA 5CLJA 3K0AA 4DLTA 2C5HA 1V3UA 4HDRB 2NUTB 2PZAA 3DDSA 4O0MA 5E6SA 3SMQA 4B74A 1U5BA 3CHYA 3ID6C 3JPWA 1WW3A 4YAFA 4R0VA 2YXDA 4JYAB 1JL3A 2G5GX 1I7PA 1O95C 1OLSA 4RXTA 1T9GR 3STTA 3M3DA 1ETHA 2ZI4A 3WG9A 4TN1A 3LQQA 1QGDA 2UXCB 1XWWA 1Y33E 3K4HA 1KRWA 1TT5B 2ADMA 2EP5A 2P9CA 3FYUB 1MQAA 1V1MA 2R5FA 2ZFUA 4G4SO 4NCKA 1Z6TA 2VZ0A 1Y63A 3VNSA 4BQRA 4BEVA 1H1LB 3I04M 2WJYA 1SU8A 1KRXA 4C3ZA 1MOSA 2WJ3A 4U9IS 4YRAA 3GUVA 4LZZA 3W34A 4G67A 3H6HA 3S5UA 1GV1A 4NBKA 2WQZA 4UTPA 5C9ZA 2Q0QA 2W93A 1UBHS 5B4UA 2IBMA 2Y05A 3CFYA 1ZUNA 2QTGA 1IHXA 3VI4B 3EVNA 4GSLA 2BI8A 3FRIA 4W5TA 3NCHA 2O8FA 4HLCA 1ADFA 1V8OA 5A05A 3QEAZ 5BMVA 3CU5A 4HQ0A 4OV6B 4PAOA 3V4ZA 3WV5A 3N2LA 3JS5A 4LXTA 2K4MA 1MC8A 1I33A 1RHMA 1G2IA 2ZRKA 3PQDA 4MWOA 5SZJA 4F21A 2QBYA 2VC2B 2XH8A 3K6JA 1MAWA 1XD8A 1CY4A 1VECA 4Y67A 4S1TA 5DHRA 3Q8MA 2B4RO 2QZ4A 3WVNA 3MT9A 5IP5A 5DGIA 2IEIA 3GOQA 3IIKA 2HU5A 1QH8B 2QU8A 3MTEA 4ALMA 5HTKA 4XVHA 1WEHA 1AZLA 4AZWA 1J21A 2NAPA 3DKVA 3LVRE 4L9SA 1JE0A 3E9QA 2OP0A 3RVBA 3SEQA 3UHPA 2DYKA 5H9WA 3C4QA 3DZFA 1SY7A 3UA4A 4EJMA 3BIJA 2SNIE 2D2XA 3PWKA 4WAUA 2H2WA 3GHYA 5GMOA 3GLIE 3ZVLA 4JJGA 3I5AA 1A82A 1PK8A 4TKVA 2SBTA 2W2LA 4C5BA 2YW9A 3ZN2A 4C1BA 1T4MA 3G2IA 3EG9B 1AQYA 3PPYA 1P7ZA 1UBEA 3E53A 4KLNA 3AETA 3LQ4A 3UOAB 1ZSVA 4FS3A 1DAKA 1OVGA 2MYTA 3B1YA 3CVOA 4HPWA 3BWBA 3DNPA 3I09A 1BVUA 3CUUA 3M49A 3M6LA 3P32A 3I2JA 2IHYA 1YVPA 1U8CB 5CU7A 2G82A 1L5OA 3L82B 3DDHA 2GF2A 1AU9A 1COWA 1Z88A 2PDAA 3R76A 3BRCA 1NJSA 1VSUA 3K0EA 3HB9A 2XGOA 3RG8A 4ZDIA 1KSJA 2HA3A 4AKTA 3SVTA 1HNZB 2UZ1A 1FVOA 2QMQA 3LG2A 2C2HA 3UK0A 2AA3A 1E94E 3KB8A 5TS2A 1A04A 3AM1A 1NLFA 1Y1LA 5H0IA 1RLIA 3QVOA 2EZTA 4GDFA 3GROA 1KSHA 1Z25A 3PGKA 1AUQA 1YQWA 4FFSA 4NCJA 3QBJA 5HJ2A 1TC2A 3SSMA 5DW0A 3QVWA 4QTUB 1THTA 1LLUA 2JA2A 1DJNA 3CBGA 4RCYA 4U8HA 4WLOA 3KLMX 1FNNA 3ZWVA 1YZHA 4IEIA 4EPWA 4ETWA 2NXCA 4RELA 1G1AA 3CUEF 1AY0A 5D1HA 1Q0ZA 1W96A 4KMSA 3RFXA 1VJCA 2HN9A 4RD2A 3CMMA 1Z9BA 3Q2IA 4LBVA 4DLKA 3I0NA 1IOWA 3AEUA 4NBWA 4QREA 1FUUA 2PIAA 3GX1A 3ZIUA 4ZGBA 4TKVB 2C3YA 4GBGA 4K9PA 3OHSX 1GN9A 3BTOA 2AF3C 1KFCB 1PZHA 1ZP6A 3SC3A 1K8YB 2QYTA 4FOOA 4RJ2A 3ZDXB 4B83A 5IC4A 1ZICA 2I33A 4A1FA 4YCLA 2E4AA 3CRZA 3KEQA 3NFYA 3QBTA 3DULA 4AK9A 5K0FA 3AF3A 4S1VA 1X42A 3LV8A 4TMWA 3ROGA 3PUXA 5JRJA 4HVAA 1PG2A 3V5NA 5L3RA 4R2KA 1QZXA 4D8TA 1UQRA 2OXIA 1AE1A 1FFDA 1FPMA 1SKQA 5H9VA 1NHWA 4N3GA 4Z8XA 5DNUA 3LNTA 2JANA 3CNOA 3SR0A 3U48A 5JY1A 1RYZA 2YS7A 3TRIA 8OHMA 3VH4A 1E3WA 4LOIA 1UT8A 3TNFA 2E3JA 2JLQA 1PW5A 3V6LA 3WGTA 5C1PA 5KMGB 3AUJB 2O7NA 2J3JA 2GD2A 3A31A 3FMFA 3D0KA 1RYEA 4BMPB 2FCAA 2X4IA 4CV3A 1WLYA 4O4JA 3EOBI 3FTDA 3EXEB 2J85A 5C51B 1DARA 2V7VA 2CJXA 5CVVA 2IXTA 4HATA 1AVTA 4OUKX 1XEWX 3ZY4A 3GFFA 5ALQA 1YO6A 3QEBZ 3ZU4A 2CBGA 4HXGA 2A0XA 4GPBA 4ZQCB 4C0XA 3NTUA 4R0NA 2FZCA 4UXIA 1WKBA 2ECOA 4NU0A 5JE8A 4ER3A 1I7SB 1E5QA 1I2CA 3MN1A 1LDMA 3QV1A 4JOCA 4MWSA 2ZJ6A 3FY4A 2F3QA 1O4WA 3PGLA 1I0ZA 2C97A 1JXQA 2AI3A 1R0XA 2XVYA 3OC0A 1GLVA 3NHYA 1XA4A 1JIKA 1P3JA 2UUOA 5CAEA 5EL0A 1HMPA 1H9AA 3EH1A 1UJNA 4UU8A 2TYSB 1WMSA 4G63A 4GPZA 3VR1A 3VTZA 4D92A 1ST3A 5JFTA 1ZBQA 5TX7A 4B82A 3L8HA 1IMOA 1TT7A 5TRTA 4RDXA 1VFNA 1T5DX 5ADHA 2XAAA 4YRDA 5EG5A 1FXUA 1SUAA 1X7ZA 2A0FA 1G55A 3FDIA 3O4HA 3OF5A 2C03A 5DRYA 1WETA 2AZMA 2QMUA 3B36A 1J2EA 5FPQA 2QDXA 3FCXA 1V39A 2X6TA 3EXG2 1ZC4A 3AHGA 4YCMA 3I01M 3CJQA 4KFUA 4D6YA 1YVUA 2W22A 2GI4A 4J1TC 5AM0A 4CV2A 2R1VA 2V3VA 3Q1KA 3WQQA 5JCJD 3SZUA 5KSZA 4FK8A 1WZCA 4B4OA 3SKXA 3VR6H 4DJFC 3OQHA 1POXA 3O31A 2YS6A 3KL2A 3IR5A 4MLZA 3MCZA 4L5BA 5ERGB 1XVVA 5EIWA 1R9MA 1RZUA 4A2PA 2B69A 2VUTA 3B89A 2VKQA 4L4UA 2W6PA 1CY8A 2NT3A 2IP4A 4MVJA 4TM8A 4YFYA 3U7EB 5A9RA 5TARA 1K6EA 1U2QA 4MMXB 2CSUA 5EESA 4DR3B 4BNWA 1DSSG 1E8NA 1XFAA 5BSUA 1M6HA 4LFCB 1YI0A 1MF7A 4NE9A 3QBDA 5IJAA 2QR5A 3RFUA 4KX5A 1XVLA 4G65A 2FZEA 2VQSA 2VYND 1BXRA 1X2EA 2XADA 4XD2A 1ZUHA 4CKWB 3LHIA 5AFSA 5HZHA 4RHCA 3VGJA 5K6TA 1K9SA 1PT8A 3D7LA 1WJGA 1N2XA 3QELB 3CB2A 2W48A 2CXXA 2CLDX 1NMSA 3LCMA 1AM4D 3WWCA 4IJKA 4BZXA 3CLRC 4BS9A 1KZGB 4LAFA 2WMNB 3SYMA 4KPFC 4LDPA 1YE8A 4HRVA 4L7VA 4YMLA 4EEXA 3O8QA 5KYNA 1JVNA 1YTUA 5CDSA 2XWPA 3FDXA 4C22A 4B4WA 1NLMA 4NWIA 5FAKA 4RF5A 5DCUA 4DBLE 5FBZA 4UCQA 3GF4A 3LPCA 2PS3A 4I19A 1WPXA 1NWHA 4P4SA 1HORA 5LXTF 4DSOA 1W2GA 4F72A 5HUQA 3THRA 5L7TA 3CONA 4E11A 1V8PA 4EBFA 1R3UA 1PSZA 1Q3TA 3EXHA 1IZ9A 1XCJA 4G5GA 4XWTA 3ZZTA 1VBFA 4DUGD 1DVRA 1UBUS 2WDPA 4KP7A 1LTHR 4K88A 4G26A 2C9YA 4J6FA 2AZ4A 3EBOA 2BJVA 5JADA 1U80A 4N9WA 4P4UA 1HOTA 5TS3A 1FRFS 1L5HA 4ZPJA 1S7GA 1WSWA 1X1EA 5E4YA 2V0NA 3EDOA 2IF2A 3EIWA 2PZBA 3TLYA 5JCOC 3TE6A 3Q3GE 4WKGA 4BNXA 4ZCRA 1E0AA 5HRCA 3PFHA 5ECYA 3LZCA 4D7AA 4NH4A 5CXSA 1JDVA 4C4OA 3QJ5A 1W0KA 3ST7A 5DM0A 4LFBB 4X64B 2YV4A 4HX9A 1JLLA 1SVUA 1L4NA 3JQBA 5CB4B 3WGMA 3GQBA 3LK7A 1C9KA 4A6DA 4CL0A 4DW8A 2DCMA 2PBLA 4J0QA 1FMFA 4R1PA 1ZCZA 3D3NA 3BMQB 1M2VB 5ENDA 2WICA 3DLAA 1R0BA 5AW4A 1MG5A 3GGCA 1KY4A 4DBVO 1MIHA 3L43A 4Q9AA 3KTAA 2Y77A 1E58A 3DPUA 3HKCA 3L49A 3OC6A 4ZT6A 3ZNPA 3W5HA 2HMYB 2WIKA 3IE2A 4QFDA 5FUQA 4PZZA 5KUTA 1YR1A 4MGIR 4AWXA 1G64A 5BSWA 4YIKA 3IP7A 1PFKA 2HZ7A 4GZ3A 1YI1A 2QE7D 2O9JA 2PSJA 3PPXA 5GM2A 4RTNA 3ELYA 2Q1SA 3H2SA 1XKLA 4JGIA 3TLMA 2V6GA 4HTAA 5JCJA 2R44A 1X7YA 4F5ZA 1AKUA 3D54D 5EXPA 1Y9ZA 3DZGA 5FUMA 1NUSA 3HNPA 4YHBA 5JQGA 4JR2A 3QXCA 4JBYA 4TUYA 3DFUA 3EC1A 1OILA 2CLSA 3DZDA 2JFFA 3OFJA 2QVYX 1JDZA 4XGRA 1H9BA 3ROMA 5AVQA 2D4AA 1P4SA 2GN4A 5ITZA 5KQRA 3O74A 1AK2A 1W85B 3CX3A 1P1CA 4KQJA 4U9UA 4MEAA 3VFDA 1CVLA 1ZMXA 1GDDA 2QRMA 2Z2XA 3RIXA 3VDNB 4I2NA 3HLKA 3RANA 3FDZA 5BT8A 3GJRA 1XPJA 2DETA 1UPBA 1ZEMA 3JZDA 5HKKD 2ZIWB 4U02A 3UB2A 3MFQA 4PW0A 4O59O 4HUQB 1PJ2A 2CNBA 3FMVA 2ZBEA 4UJ3A 2PS9A 3AR3A 2C7BA 1Y89A 3CZ5A 4I5DA 3HM2A 5GZ6A 4WOBA 2YASA 2QSZA 4IJ5A 2ZETA 1YV9A 1J8QA 2QGNA 3KJZA 4YMSA 4D4GA 5CXQA 4KRGA 3WGLA 2IYTA 2CFIA 2IXFA 2HCBA 4EB8A 4RORA 4MQ4A 1NVBA 1BYUA 2RONA 2B83A 1TVKB 1UBTS 1YACA 2JASA 3DFMA 4TMKA 1LFAA 3NXKA 1T9KA 3N5CA 4GOKA 4EO9A 3PEFA 1C1YA 1SUEA 3BRWD 4RS4A 1FMJA 3G89A 1E9BA 1H4VB 1CK4A 1II9A 2XVAA 3B53X 3QBVA 4BO4A 3T5PA 1HSZA 5LBUA 5DGXA 3ECSA 1NF9A 4QLOA 3IBTA 3K0CC 2A78A 4HX2A 1IBLB 4UXHA 3GCWA 1X0XA 3MCWA 4LY3A 4PHFA 4TXJA 2ZKIA 1H0HA 2C2XA 3KWMA 3D43A 1M73E 1P2FA 2G83A 1J07A 2NV6A 3O4RA 4S24A 2E5WA 3CT4A 2Q0XA 3KYDB 2P6PA 1D6MA 4FFWA 4TROA 5CFQA 1YQEA 3VPGA 4PRZA 4RGVA 4R7TA 3IIMA 1XXHA 2OBBA 4MV0A 1W2HA 3IMFA 1P8JA 2BKXA 2O57A 4HVTA 1N6PA 4ZK2A 2HOQA 1LI7A 1A8UA 4JSTA 3LRXA 2ZSAA 3MJEA 2OECA 1XTTA 4S0ZA 4EO4A 2IU4A 1U9CA 4WT7A 4D4KA 4NNPA 1HG0A 2HEIA 1O2DA 3I83A 3NT2A 5FFFA 2KBEA 5H8WA 2P77A 3R7FA 1XZBA 2D62A 1CRZA 3DDWA 1O8BA 4LSZA 4U2GA 1M2VA 4DA0A 1YZTA 4Q82A 2HLDA 5BNIA 1PR1A 1PV4A 1XTJA 2FX2A 3D3WA 4Y9DA 2H0AA 2H4WA 2WMDA 1A2OA 1N6IA 4IX1A 5JBNA 2PUBA 3LMKA 4L3OA 2D8AA 1DBSA 4R3UC 1SELA 1SQ5A 2WT8A 4EVSA 2HXGA 2WZQA 3ME5A 2OP1A 1C7FA 2ZS7A 4WW0A 4UHHA 5CM8B 3KS9A 4K6KA 3EVAA 4FYMA 3T54A 1ZCAA 3KFLA 2H9IA 1TVKA 1N4AA 5BORA 4NIMA 1C2TA 4HNGA 5AHKA 1GNPA 3U7JA 4TMFA 1YQDA 2WIGA 2XDQB 2Q5IA 1JQEA 4R5HA 1T2DA 3QYPA 4X6XA 3IPRA 3ZD9A 2MSEB 3B60A 2CHUA 4TVKA 3B9BA 1MP0A 4A23A 4XVCA 3HDQA 2CLKB 3JW8A 3M6XA 3X2EA 3ZGXA 2X5JO 4TKLA 2A30A 4CRWB 1TGYA 2YNMA 3EIOA 2HAEA 4EKGA 2JHPA 4F3TA 5ALDA 3UT5A 4ON9A 2XOXA 1II0A 5B64A 4ZZ3A 3K2QA 3I53A 1M2FA 1ECLA 3FB1A 4LZPA 5F33A 4F84A 1SHTX 4ZYUA 2P9JA 3H9EO 4LGVA 1QZZA 2WOJA 4TV9F 1RI3A 1JG6A 1OIXA 1B43A 2JA1A 3EUAA 4ZCPA 5NULA 2J7PD 3ZCPA 5FXMA 3PHBE 1ILWA 1AUVA 1H6BA 1NT2A 4EM6A 2Z4SA 2YMQA 3PGXA 4BU0A 3WE7A 1JECA 3IQWA 4Z2YA 4BGDA 1TQ6A 4R2IA 2W9XA 1NGSA 1I1NA 2V9PA 1HQYE 3KE8A 2RI1A 3WLAA 4JYMA 1QTIA 4DYHA 4B3MB 1QIIA 4P35A 3T12A 2J59A 2YWGA 1KH3A 4JFRA 5E9QA 3A4MA 3DMNA 1G8SA 4KXXA 2IZ6A 1C81A 2FZ4A 5HTOA 4XJTA 1FLAA 2Z57A 1CUHA 1T1RA 5FD8A 1H05A 1YA4A 1H9CA 1BEEA 3COPA 3H8JA 4HT3B 4X5OA 2ZRCA 3ZQ6A 3EXFB 2FZ5A 3C85A 3E5RA 5T6MA 4DIFA 3CLSC 2ZQYA 4QWWA 1P1FA 4O2BF 2VDRB 3WIBA 5I4CA 4B3BA 1R88A 2A1UB 4M4SA 2QP9X 3FF1A 3C6XA 1YQUA 3HSSA 1SKYE 3QY9A 3VR5A 3MK31 4D9HA 8LDHA 5JJBA 1SXGA 3EPPA 4DRXB 3GNQA 4B2LA 5AHXA 4MR8B 5E1DA 4Y3UA 5DZSA 2Y9PB 3VHLB 4C78A 1YBAA 3IA2A 1HE2A 1DQZA 4KN9S 4X8HA 3GGJA 3BSWA 3NM5A 1BW9A 1VLHA 3KVNA 3Q6MA 3HUEA 4JVOA 1W8DA 1Y42X 4NZOA 4S3MA 4EG0A 2PWZA 2C0PA 1T43A 1ZNXA 2PNFA 1TIPA 3NATA 4KN8A 2F4VB 5AR1A 1NY5A 3C8ZA 2WHEA 3DQQA 2G4VA 3BS4A 2QN9A 5AJTA 4UHFA 2PN1A 1IEXA 3NONA 4WFJA 1O3YA 1OF1A 3DSRA 3I32A 2HMTA 2HJWA 3UAZA 1UBRS 2CLLB 3N74A 1GL6A 3JARB 1W29A 2QG6A 1P4AA 4QYWA 4FW8A 2YYAA 1UWLA 1JYFA 2W2QA 3ZE2B 3OE1A 2ZAOA 3RAGA 2XRMA 2A33A 3ZHYA 4DC1A 1N6KA 1WHTB 3BN3A 3CS3A 2BFAA 1VJTA 3MIZA 2YINC 3DPSA 2P69A 1XF9A 2ZSIA 4PIVA 3CNEA 5MDHA 1MJGM 3IH5A 4XIYA 4KR3A 4N7MA 2O8DB 3RHZA 5DNWA 2N75A 5TE9A 5J1SB 2QZJA 1TCCA 1XKQA 2GT1A 2HO4A 4ROSA 1N77A 1WB4A 1ZXXA 1IK4A 1P19A 2AE2A 2FF7A 2G4LA 1A8IA 2R2AA 3OIGA 1KRHA 1XLTA 3L8MA 3M7IA 5KQPA 4QEKA 3S2SA 1RJ9A 2QM7A 3FWPA 1BMQA 1JEQB 1RJFA 1Y1PA 4N5DA 1SJ9A 3Q3HA 1G3QA 5EE1A 1SVSA 5E0OA 5AQEA 1BX3A 3QF4A 5TT0A 5ITWA 1TMYA 2EJVA 3DYIA 4DSZA 1XU9A 3CJRA 5FOQA 1ZOLA 4NPAA 2RBKA 3NYIA 2ZE8A 4LV8B 2WF9A 4JLOA 5C46F 4JP2A 4WDRA 2EX0A 5ALFA 4OLJA 1I4OA 4D5GA 5K9ZA 1UOEA 2RFLA 3O21A 4QNRA 2RH4A 2YHIB 1JKMA 4G8CA 4ZQBA 2R25B 3NIBA 1XPRA 2WV7A 1SUPA 3EZFA 3FJYA 1CULC 1G16A 3GNTA 3P2OA 2CMDA 3Q3JB 3JQ6A 2PTGA 4CETA 1SU7A 2DKNA 1XZNA 2HWXA 2W4MA 3N1UA 3NQ41 1YB2A 2DQKA 3FWHA 4KV7A 1TYZA 1E2KA 3GAZA 4NESA 4WV3A 4GLJA 4MKIA 2QTHA 4RK4A 3JV7A 4F45A 5JW6A 2VRBA 3BWEA 5DCWA 3WP1B 7YASA 4MGYR 1RBQA 1VDZA 5KREA 3ANTA 5LYJA 4M88A 4QDZA 1KZHA 3L4BA 3E03A 1Y1KE 3GD5A 1BYIA 1D2GA 3HBAA 4I3FA 4MYUA 4PLZA 2K7FA 3VR4H 2VTBA 4LQDA 4QUIA 3PCRB 4UPEA 4Q0MA 1UJ6A 3UB4A 2FPGB 4N41A 4PS0A 1D07A 2LGJA 3E9YA 5T41A 1V45E 4GMGA 5EC8A 3H3FA 4KUEA 4LGMA 4TMTA 5M5BA 1E6WA 3BQMB 1DAFA 4G5QA 3VZDA 1E2FA 1CJTC 3JRWA 3COJA 4RJLA 4NATA 3JWEA 3F9CA 3RV4A 2A86A 2CK3A 4OLAA 1K7CA 1TZCA 3CLRD 2IU6A 1N5MA 4CMCA 2ZJZA 1SU4A 1E9SA 5EZYF 2KBFA 3QMMA 4NOKA 3RUHA 3BSYA 3RQIA 2ZJ8A 4MGHA 1T36A 3H5IA 2G67A 4BLOA 3MW8A 2Y1XA 3H9UA 3P0JA 3VNRA 4PFKA 3HZOA 2UUAB 1L8QA 1USUA 2G40A 5C8ZA 2ZTSA 3BORA 4D3FA 1M0SA 5I7EA 1YGYA 2PBFA 1L1QA 2C57A 4P3YA 2NPFA 3ADOA 1DFIA 1T0JB 3E82A 4Y6LA 5CBPB 1A5SB 2B3TA 3GP3A 3OM8A 4GO1A 5TJ9A 4F3KA 3PR2B 2J6BA 3OZRA 1OI4A 2WILA 4YTEA 4LI0A 2E37A 3GNLA 2QAGC 2EWVA 1XV5A 3OJEA 2CFRA 3UICA 1NT4A 4QLAA 5L6MB 4LRQA 3IQIX 1APBA 3A27A 3BHIA 4EEZA 1NDUA 2O3TA 4V0KA 1ZRMA 1VSQA 2GDZA 2UZIR 4PNHA 4IVQA 4L4ZA 2FI1A 3NC0C 2P67A 2SHKA 3FGPA 2JHGA 3ESBA 4Q1DA 2HD4A 3IDZA 1QU3A 2E85A 3IRUA 3RRMA 3W9BA 4I9UA 4DABA 3OECA 1PW7A 5D8DA 1OXTA 1D1PA 3EF0A 3RLIA 1CQIB 4DA8A 1LW6E 4PGHA 5FV7A 4QNNA 4JI6B 4F8YA 4BJ1A 5C3UA 4RU1A 4EWLA 2AF4C 3T7KA 2QW0X 1T9AA 3FPGA 3JQ9A 1FYDA 3JWGA 3M5DA 4LF4B 1B1AA 4LIPD 3DE1X 4REMA 3TD6A 3ZWAA 4ENSA 3K8OE 4H35A 4CDMA 4D42A 3KJNA 3O3NB 4MQUA 4Z0NA 1EK6A 2IIPA 2R60A 3V4FA 4AG6A 4X20A 5KYYB 4ZEWA 5T64A 1CQWA 5F35A 3ZDFA 2ZAGA 4RV9A 1KOJA 1U3TA 4G0PA 1P29A 5LD2C 1XROA 2P0AA 2BT4A 3V8MA 4K9DA 4XI9A 8ABPA 5IVDA 1VE1A 3A1DA 1DO8A 5TV2A 5GQSA 3SC2B 1ECGA 3C6ZA 4F3NA 2O2IA 3L41A 4KPEC 2J3LA 5B1DA 2V7GA 3U9TA 1EA5A 2GBLA 1VZ2A 1TQ2A 2W2KB 2JLZA 1GXSB 3ETGA 5KSOA 1B26A 1EBUA 4CQMB 3CVWA 4IMRA 4UVHA 3R44A 2ZRIA 3CURA 5IK2D 3OCYA 2DSNA 1ONOA 1TADA 3UAXA 4DC9A 3IFSA 1VE7A 1MO5A 2ZRFA 3KV1A 2K5UA 5BSKA 2OL4A 1C14A 2Q6TA 2VHYA 3FTFA 1G8YA 1Z0ZA 2VZLA 2P9HA 3UKJA 3AVUA 2IS1A 1JILA 1RFGE 2QJRA 3KCNA 4EGJA 3UB3A 4DV1B 4JU8A 4NYMQ 1J06A 1AKVA 1FX1A 4I4TF 4RENA 1ENYA 1GGMA 2BHTA 2BC9A 4N48A 2C4HA 2I80A 5LZ4A 2ZU0C 4KK3A 3NWOA 2QTBA 2Y27A 4ZCMA 1C3JA 2PGDA 3CLVA 1CDZA 3NHAA 3Q0EA 2HDNB 5IBRA 5K0LA 3TW4A 5JSQA 5LFAA 1IBCA 3TQQA 1HX7A 3FZYA 3MWYW 3ZVMA 1FW6A 5HF6A 1Z35A 2VT7A 3L40A 4GBJA 3NDRA 5FBLB 4QBGB 4W9RA 4HVCA 1NXVA 1J24A 1KGSA 2GKSA 3RC3A 3VI3B 1HR0B 3R3JA 4PC2A 2AX3A 4YRRA 2ADOA 2Z08A 4TT8A 4IICA 3UJ8A 4B3FX 1ZGGA 4IW3B 1DIGA 3R74A 1KK3A 1JQ5A 1OPRA 2V0CA 4QDJA 3OICA 2QN8A 5JSKA 3BOSA 3HZHA 2P3SA 3NC4A 1RPAA 2I03A 3NBQA 2QLNA 2REQB 3OEEA 5DBIA 4QUBA 2I2DA 4LZOA 4UNSA 2YFHA 1CKEA 3LWNA 1PDWA 4H4CA 1RRVA 4U2FA 5F4ZA 4D56A 5FPYA 4RTPA 3EZNA 2OKCA 1M7GA 4MV1A 1DCFA 2PUWA 3JD2A 1ZZGA 4YRTA 4KXNA 3WYEA 1B0UA 4V3CA 2Q3BA 3ZW7A 3AVVA 2ZBQA 4IAOA 2V7XA 2WU1A 4X3PA 3I76A 3HKEB 2R7MA 2E5FA 2I76A 2QB5A 2QX8A 2WAYA 4UM8B 2NZVG 4A03A 4XSVA 5HP4A 3UTCA 1LCIA 1EQUA 2WG2A 4KU4A 3V3TA 1TAUA 1CLUA 5A5DA 1QOPB 3LQRA 4S12A 5K0EA 1RABA 4II7A 1RC0A 5JJKA 2H2GA 4Y30A 2R86A 10MHA 4LJSA 4LOAA 4IUYA 2JAUA 3AM3A 3ANNA 1C4KA 3QLUC 5DOZA 1MZVA 3V7WA 5EIXA 2DLCX 3N3BC 5JXWA 3OWHA 2EEZA 1MB0A 4QOHA 3F96A 2Q3LA 1N8SA 4NEHB 3P45A 4ZQFA 4FD3A 2J0UB 1KY5A 2HLHA 4TZ0A 3EMKA 5GY7A 4R71A 3ICQB 1CRWG 2RCNA 2O8CB 5FA6A 2VJYA 3TNJA 1KZ7B 3WO0A 3RAFC 3VR6A 4HVLA 2MDTA 4X63A 4MVJP 2ID8A 2ABWA 3BMQA 4I4TB 5EJEA 1WY7A 4GPD1 3F8TA 4AY4A 1HNXB 3ZJYA 4LPSA 3PC6A 1L7NA 3OD1A 4YRGA 3WJ1A 5LYYA 3K9QO 2C9BA 1D09A 4ZOLF 4G6ZA 3GPIA 2PA3A 2WYWA 4R8KA 1DOZA 1PFGA 2NUBA 3A70A 3OJCA 5T8KA 1X8XA 5DCLA 3ZI7A 5A03A 1NLYA 1OH6A 4WESA 2NZUG 4EX7A 2AOUA 1ZH6A 3E18A 1X14A 1Y80A 2Q9UA 2Y8EA 4QPZA 3WMGA 4AYTA 4CF4A 3PJRA 1S3IA 1F38A 3VDRA 4RZ3A 2X2FA 2ZSJA 2P2ZA 1H0SA 5IC5A 1IUNA 3RCBA 4C7MA 1A96A 4D9FA 2RHMA 2DH6A 4Q9KA 1XNRB 3H4VA 1F2VA 3PXAA 1N0IA 3LBAA 2B0CA 2Q3EA 3ONWA 4JGBA 3WGHA 4EPXA 1OIVA 2BKVA 5JCZA 1GTZA 1GPAA 4QYXA 3OZFA 5KX5F 4BFXA 4JAVC 1P45A 1FNCA 3U56A 3RYHB 1GZDA 2DUNA 2IQIA 1GTMA 1I2ZA 1XVIA 3CW9A 3UG7A 2RHCA 4BU1A 4CF7A 2HPHA 2F3RA 2ZYGA 4DCUA 1IBRA 2HGZA 3IUQA 3VR4A 1QHEA 1V5IA 3L7YA 2QJFA 5E7IA 3MD0A 5AICA 1J0DA 1E1KA 2HNKA 3VYSB 4ERNA 3OLXA 4OHKA 1XMXA 3T35A 1O89A 1TX4B 4POAA 3LY5A 3EFHA 3PC7A 3PXDA 3PD7A 2UVPB 3P96A 3QELA 3W79A 4F4UA 2HJGA 1W47A 2YY7A 3QEMB 1PR6A 1O6FA 3WDLA 3WMFA 4F71A 1AB6A 3V80A 3ZDAA 1QOQB 3I12A 5TPWA 5BT9A 2DPMA 2BM0A 1DAEA 3WGYA 3PQ8A 3PA6A 2GSDA 1N0UA 4N5LA 2GTPA 4EG4A 4XCVA 1N32B 1GYQA 1Q7EA 3KYCA 1F9AA 1V2GA 1OX4A 1PV1A 3RRYA 2QIPA 1MMFB 3E23A 3VKVA 1SKMA 3K94A 4FJ1A 2ZR7A 3TH5A 3WL3A 4D8VA 1IZ8A 3K6SA 1NQWA 4Q3AA 1F7VA 1L1EA 2WW8A 2FEPA 3UAWA 4BO0A 3FJ1A 5LMUB 3HUFA 4OLHA 4MW5A 3ND7A 4IOMA 1M8PA 1V5FA 1AKTA 1JR3D 2G17A 2F9LA 2HIAA 5FHQA 4ALKA 1T2EA 4DSUA 3UXYA 2CDAA 4YIHA 5I9IA 1MXFA 3Q9NA 4QXOA 3RREA 4IUCS 3WK7A 4UHJA 4DGSA 1W19A 3A3OA 1KSFX 1Z6PA 5KOIA 4QJ4A 2BPOA 5ICEA 4P4GA 2GAOA 2VPWA 1L5QA 3FPJA 4QVGA 2A3NA 2QPOA 3HPRA 2ZYHA 3DGFC 3PDIA 2HIMA 1EVQA 5I7FA 1P9OA 1G7TA 1GVNB 2YQ5A 5FBRB 8ADHA 5FLXA 5TVGA 4QXPA 1YZGA 3C6MA 4WGGA 1WG8A 1IUPA 2G1KA 2BFOA 2VHVA 2JH9A 3E3OA 5G4KA 4CM9D 4DCNA 2D7DA 3AY3A 3R6GA 1J70A 4YRIA 3PDHA 3V34A 1V6CA 2QI9F 1L6RA 1HFWA 1CY7A 3K9BA 2IUUA 1BNCA 4JWTA 3VSAA 3QVJA 3CIOA 3I45A 4ZZ2A 5CG1A 4MWTA 1KEKA 4NQRA 5AK3A 3FA2A 2DTEA 3U39A 4PIPA 4PR0A 1N1GA 2WMOB 1KAMA 3C4JA 4E31A 3F73A 2O8CA 4XASA 1KDYA 3ZE8A 3AUYA 2J0UA 4HPJB 3G9QA 4TYQA 4F6RB 2BMVA 2V58A 2OYCA 1KQOA 1MC4A 3IGFA 2R96A 2BR4A 2IYSA 3EIFA 3HY6A 4BE9A 4DDWA 3KFVA 4JC8A 2VP5A 2I4NA 1EFAA 1W34A 4FKZA 1A9TA 4P33A 5E1MA 4ACBA 2D5CA 2FPSA 3DWGA 4GOMD 4K9LA 1GUAA 1EFDN 2HREA 1NBEA 3N8KA 3I92A 3OJ0A 2DFNA 4RGQA 2CF6A 1OFVA 2FLVA 3ET5A 3I42A 4EVIA 4RY0A 3RTDA 1UZUA 3H2BA 1OUMA 4MVJD 1FSZA 4J9VA 4NCNA 4EH1A 3CYFA 1K66A 3GPLA 3H2HA 1NVWQ 4MHTA 1ZO8A 2XRFA 3FOBA 5JD6A 2X42A 2JBWA 3WAGA 3EAGA 1QLHA 4QGSA 5F7OA 3NVKI 3KPJA 1JEDA 4EJSB 4F1WA 1PZXA 2HB6A 2Q7OE 2CLEB 3HGTA 4YRMA 2COEA 1XQXA 4D4IA 3TECE 5ALZA 1SA0B 2PU5A 1MJ5A 2IOHA 5ECDA 5FNZA 3M4JA 2GXUA 1J00A 2P1ZA 2HRZA 1DBIA 2XNCA 3DW3X 1PUXA 2HMUA 2W2PA 2OE2A 1GYPA 2A0UA 4BE4A 3QX9A 3KT8A 2ODNA 5L3QA 1Q1EA 1ZNQO 2H2AA 2XMRA 5L3SA 1TVCA 5C1OA 2OOKA 2IL1A 1UBSB 2Z5LA 1JJAA 3OFSA 4QGAA 3KAKA 3TAUA 1LPAB 4O4LF 3VPCA 3EXIA 1TECE 4CNQA 3CUKA 1EWVA 2ZR8A 5J4LA 3A6LA 3U3DA 1QAOA 4YPOA 4AP9A 4CUZA 4GZMA 3O9VA 3DEKA 4DZRA 1GM5A 4CU2A 1H2XA 3GPDG 4NMXB 3TZKA 4MJ7A 1RACA 2RD2A 4G24A 1WX1A 4HLNA 2WYUA 4EMSA 4DUGA 3ADCA 1V8ZA 1X1SA 2W6OA 2QSYA 3QU9A 5GV8A 4HAWA 1D1QA 1NOIA 1EG7A 1ZMTA 4G86A 1QHSA 4X93A 3ZV3A 1SQFA 2V7BA 5T3UA 3S40A 5JVDA 1RLUA 1UBOS