3UUEA

Crystal structure of mono- and diacylglycerol lipase from malassezia globosa
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
279
structure length
279
Chain Sequence
GRGGSSTDQPVANPYNTKEISLAAGLVQQTYCDSTENGLKIGDSELLYTMGEGYARQRVNIYHSPSLGIAVAIEGTNLFSLNSDLHDAKFWQEDPNERYIQYYPKGTKLMHGFQQAYNDLMDDIFTAVKKYKKEKNEKRVTVIGHSLGAAMGLLCAMDIELRMDGGLYKTYLFGLPRLGNPTFASFVDQKIGDKFHSIINGRDWVPTVPPRALGYQHPSDYVWIYPGNSTSAKLYPGQENVHGILTVAREFNFDDHQGIYFHTQIGAVMGECPAQVGAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIP1, secretory lipase (Family 3)
publication title Crystal structure of a mono- and diacylglycerol lipase from Malassezia globosa reveals a novel lid conformation and insights into the substrate specificity.
pubmed doi rcsb
source organism Malassezia globosa
molecule tags Hydrolase
total genus 97
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uueA00
1WPRA 4RPCA 3OPMA 2D0DA 4OB8A 4MYSA 1B6GA 2YXPX 1GKLA 1P0QA 4I4CA 2BUCA 2OGTA 3PFCA 4KAAA 2OPHA 5ALZA 1P0PA 3WKAA 1JJFA 1CUYA 4PO3X 1ODSA 1ZOIA 2Q0XA 3H2GA 3DL7A 3TJMA 4I3FA 3G7NA 1E5TA 3D2AA 4RNCA 5BV7A 1H2WA 2WKWA 2C5GA 5AIAA 4DYHA 3IUNA 2ACKA 5FPPA 3L1IA 2C0PA 5JATA 1B41A 1QO9A 2HA2A 3R3WA 2OCLA 3F67A 3OM8A 1G4HA 3WKCA 4W63A 2XUHA 3W9BA 2GZSA 4GXNA 2WUFA 5DLPA 2XDWA 4LHEA 1CUZA 5K3EA 1DINA 4AXBA 2OXEA 5AI0A 4UHBA 4INZA 5E4YA 5A7GA 2GYWA 5EHXA 3C6BA 4ZREA 1EVQA 1Y7IA 2VF2A 2GYVA 4U2DA 4EY7A 3BIWA 3AJAA 1K4YA 3G9TA 1VXOA 1WCYA 4DMFA 3C5VA 3G02A 1R9MA 4ZV7A 2FX5A 3L1JA 4A5SA 4U2BA 5ESRA 1THGA 5A71A 3QMMA 3HXKA 2HU8A 1L7AA 2DQZA 3DYVA 3FLEA 5LIPA 2WJ4A 5AJHA 4Y2XA 1FFDA 3G0DA 4BBZA 1AX9A 1U65A 1LPNA 4C88A 1FFEA 1W52X 4JH0A 4HRYA 1Z68A 5AO9A 3H18A 4B80A 4FMPA 1J07A 3VVMA 2RHWA 2VAXA 1XRMA 3PI6A 1CUEA 5JD4A 4WY5A 2B20A 4KE8A 2EDAA 3WYDA 5CT6A 3GBSA 2XUPA 3RLIA 2XQGA 3WWEA 2DHEA 2PBLA 2OCGA 2OAGA 1M33A 1MT3A 1LBSA 3WL5A 5LP1A 4QLAA 3LIPA 1LPSA 4QNNA 1GQSA 2JGEA 3FYUC 4IHAA 3WQHA 4BZWA 4KYVA 4DM7A 4N8DA 3SX4A 5FV4A 1R3DA 1U2EA 5J3JA 5I7UA 2XMCA 5HF8A 4F0JA 1G66A 1R88A 1NU6A 2WIJA 4BAGA 4Y2TA 5CRIA 2AJ8A 2HFJA 1J1IA 3HSSA 3PICA 1XZIA 4U2EA 3H1BA 2OLEA 3LS2A 1FSSA 1CUGA 5AKYA 2DHDA 3EIOA 1W1IA 5C8ZA 3UUEA 5FOQA 1QJ4A 3ILSA 4UBIA 3O4HA 2EDCA 3QZUA 1CFJA 1GXSA 1N5MA 4PF1A 3ZLTA 4X71A 3DD5A 5JZSA 2QXUA 1XLUA 5DYWA 5LZ5A 1BROA 4XJVA 1XZDA 2AXEA 5A7FA 1UOQA 2JGLA 5HZGA 4J0IA 3FYTA 2J4CA 3GA7A 1WB6A 2WUEA 3H0CA 3BDVA 1XZCA 2BGRA 1U4NA 3C6ZA 5CT4A 4PQEA 4XWGA 1VA4A 2HM7A 1QTIA 4UHHA 5AOCA 2ZJFA 3HEAA 3ESDA 3JW8A 3OURA 1SCKA 5SYNA 1A8UA 4JNCA 5E4TA 3DLTA 3V48A 5IKXA 1WOMA 2V98A 4TGLA 4XIIA 1BE0A 5AKKA 5JIBA 1WM1A 5FDFA 4DSZA 1CQZA 1EK2A 3BIXA 3EQ8A 4MQLA 3IUJA 1MTZA 3AZQA 4ITVA 4HXFB 5HFNA 1GZ7A 2JGIA 3LP5A 1QONA 3DL4A 1U8EA 4UBJA 5DTIA 4B6GA 3JWEA 4ZXFA 4WY8A 1EA5A 4FHZA 2B9VA 4X6XA 3V9AA 2DHCA 1JU3A 3VISA 1Y37A 2PKYX 3H2KA 4FLFA 1RWQA 5AM1A 5JARA 3DDUA 3STUA 1QLWA 2G5PA 1SFRA 3O9VA 2FJPA 3FCYA 5FPQA 2GBIA 1DWPA 4B81A 2WQZA 1QIJA 1QOZA 2XMSA 4Q34A 2XE4A 3IUQA 4OCZA 3X3HA 1GT6A 2XQIA 4FDMA 3IB3A 4Y2UA 3F97A 1VZ3A 4B84A 2WHQA 1GPKA 1AURA 1VKHA 5ALIA 3T52A 4MWSA 3O4GA 3VDXA 5ALVA 3WWOA 5ALGA 4GEGA 1ORWA 4J0DA 1TCAA 2XQKA 4WCVA 5D3KA 1THTA 1USWA 4UFPA 2WFLB 3K2IA 3IDAA 1DX4A 2CUTA 5ALYA 1VA5A 1P0IA 5CH5A 4UBMA 1K8QA 1DT3A 3KWFA 3EF3A 5LZ9A 1NX9A 3RARA 4ARBA 5K3CA 3GZJA 4RE6A 2ZSHA 4FBLA 1TAHA 3I1YA 4QDTA 2Y6UA 3D5EA 4BE4A 3Q0TA 5DWDA 3ICVA 2QKYA 1BEZA 3H2IA 4S0XA 1TQHA 4QDUA 1AQLA 4FWBA 1IUOA 3W06A 5IVIA 2BAGA 4E11A 3NGMA 3QMWA 2WIDA 4UBOA 2Z5GA 2WM2A 3A2MA 1LZLA 4N5HX 4UBNA 4PSDA 3O4IA 3SC2A 3FCXA 5DTJA 3BF7A 2QRUA 5HK8A 4X92A 1H2XA 5LZ8A 3CCCA 5LYYA 3FLBA 1WPXA 4C4XA 4Y2SA 4N8SA 5A62A 3ED1A 2JBWA 3C8HA 4BZZA 5DNUA 1AGYA 3PDCA 4CCYB 3C70A 1TCCA 1DWOA 2WTMA 5A6VA 3I2KA 1WB4A 5AKJA 2VT7A 1IZ7A 3BJMA 4OU5A 4UHFA 1QIHA 2GZRA 2BKLA 3EQ9A 4H35A 1QIGA 3IBTA 1CUUA 3QBJA 1XZGA 3WL7A 1HDEA 4BYMA 3GFFA 2XMBA 2Z8XA 2HA7A 4B83A 1EB9A 1FFAA 4PW0A 1JMKC 3CN9A 4JUIA 3KD2A 1XQVA 2VJCA 4FFWA 4W1QA 5K3BA 4MEAA 3G0GA 2IIVA 1A8QA 5EHNA 3HABA 1W6RA 1ZIYA 1QE3A 3K6KA 3F8SA 4C89A 2XMDA 5JAHA 3L1HA 4OPMA 1KEZA 3R3ZA 3GUUA 2YYSA 2WFLA 5ALQA 4BRSA 5LZ2A 1QZ3A 1A88A 3MGAA 4K6HA 5HF5A 1CUVA 2XMGA 1BEEA 2XUJA 2PVSA 2EEPA 1UOOA 2VTVA 3AZPA 4X3CA 2YH2A 1CVLA 4BRZA 5I8PA 4LXGA 5ALKA 3FLAA 4CIAA 1XRNA 4NS4A 4Y2VA 3D2CA 3WIBA 7YASA 4FNMA 4BC0A 1Q0RA 4WJLA 2J4FA 4X6UA 2IITA 4W9RA 5EIAA 3W2TA 5YASA 2I3ZA 4KAJA 2J3DA 3EQ7A 1ETHA 3HLKA 3M81A 4E15A 2JGJA 2XUOA 1Q84A 2JGFA 3HZOA 4H7IA 5EFZA 3ESBA 1YAHA 2W22A 5A2GA 5CMLA 2XI4A 2XQFA 5HF9A 3WK7A 4G4GA 1E89A 4OSEA 3O0DA 4Y9SA 3H2JA 1AUOA 1EDEA 1IUNA 2QR5A 3STWA 5JADA 5IVDA 2PX6A 4J0KA 2FUKA 3BJRA 1PJAA 1UWCA 4UHDA 4DMHA 1LZKA 1DTEA 4FLMA 1K63A 3BE8A 4AN1A 4HTAA 4CCYA 1CEXA 3MUNA 3WL8A 5ISMA 4P08A 2OAEA 3DYIA 2ONCA 5C81A 2O7VA 2RIPA 1BN7A 1P0MA 3ZV7A 3HC7A 4AO6A 3ZLVA 4AZ3A 1YS2X 2O2HA 1EDBA 4BATA 1UXOA 5JZ9A 1TRHA 2HA3A 2VA9A 2OQVA 1ZIXA 4EY5A 4QZVA 2GYUA 2HA4A 2G4LA 4RGYA 2WIGA 5HK9A 3A2NA 3LLCA 1EVEA 1XQXA 4P92A 1LPAB 4IH1A 5JANA 4BCCA 2PPLA 2WHPB 3WA6A 4E14A 2V96A 4G4IA 2E3JA 5AOAA 4B85A 1TKRA 2JIDA 1UK6A 5EIEA 3TRDA 3WZMA 2QMQA 4C4YA 1YAJA 5SYMA 4QA9A 2PSDA 2FJ0A 1F8UA 1MJ5A 1D07A 1EK1A 3V1NA 1R50A 1A8SA 3IA2A 1QIMA 1TCBA 2O2IA 3QM1A 2Y6VA 4B9AA 3VJKA 3KSRA 5CT8A 1T2NA 4A16A 4Y2YA 3C87A 2ZJ7A 3VJMA 2QVBA 1XZAA 1CUAA 4E46A 1JJIA 4YK7A 3WA7A 4QE3A 2HFKA 2CBGA 1DQZA 4GLBA 3OTQA 1QIKA 4TPKA 5IH7A 1QIDA 3STYA 4L0CA 2WJ3A 3G9ZA 4UFNA 5KWIA 3I6ZA 1ZI6A 1Q83A 1UKAA 2C58A 2UZ0A 5ALSA 3FWHA 4TVKA 3RKSA 2PSFA 3DQZA 2Z8ZA 1SCQA 1LPBB 4OYLA 1XRQA 2XUQA 5ALPA 4BVLA 5AKLA 1VZ2A 2CMFA 1XRLA 5IVHA 2CB9A 4DMKA 1L7RA 2CZQA 1MAAA 2WU3A 2BUAA 1CUWA 1OCEA 3V1MA 5F4ZA 4X97A 1CV2A 3ANTA 5FLKA 3STXA 2RONA 2G5TA 3UMJA 5AM5A 4LIPD 4KE9A 4G9GA 4Q82A 3QYJA 3PF8A 4CI9A 1X2EA 3VVLA 2WILA 4BP9A 3B3QA 5D3ZA 1XQYA 2AJLI 3D4LA 4G4JA 2GBGA 4X00A 5HKBA 1ZI9A 3WZLA 1E8MA 2R11A 3ICWA 1LPMA 4EY8A 3AILA 2QXTA 4X94A 5AK3A 1X70A 4K5QA 4QDXA 1YR2A 3EBLA 1S8OA 2WFMA 4U2CA 5BOVA 3A2LA 3SWWA 4UFOA 3WI7A 2V9ZA 4BC1A 5CBKA 4G8CA 1CUHA 5AI4A 5ALRA 1C7IA 3STTA 1EINA 1VE6A 3V1KA 3Q8WA 3AINA 1UT6A 3A70A 2O7RA 5AKHA 5AOBA 4G5XA 1WHTA 1J2EA 2C7BA 3WK5A 1WHSA 3R3VA 5K3AA 2AJDA 3VXKA 1WB5A 5CW2A 2QTBA 4K6KA 4BP8A 2BJHA 1E3QA 2XLBA 4FKBA 1NU8A 3CCBA 4B0PA 1QTRA 1CPYA 2JF0A 5EIHA 3IIIA 5ALHA 1LNSA 4L9AA 2Y1KA 4KE6A 4ZGBA 4HRXA 2Y2VA 4B0OA 3D0KA 3QMVA 2IX9A 2I03A 3W04A 4EA6A 1XROA 5T4EA 1DWQA 3A6ZA 4KR0A 4FFVA 2WG2A 1OILA 5KWJA 4ZWNA 3WK9A 2OGSA 2G63A 3S2ZA 3G8YA 2P8SA 1XKTA 1RYYA 5HCUA 3D59A 4HS9A 2XUDA 4GHWA 5ALUA 4WDQA 1JKMA 4OD0A 1QIIA 3TGLA 3QPDA 4FNGA 3IVMA 4BVKA 1LPOA 5T4FA 3C6XA 2WUGA 3T4UA 3WK4A 4C01A 2PSJA 3GROA 4O08A 4DNFA 3D3NA 2X8BA 3I2GA 2ORYA 1YCDA 4RE5A 4M0FA 5D7BA 2X76A 2WJ6A 1XKLA 4J3JA 2XLCA 1XZEA 4WFJA 3ANSA 4UHCA 1AKNA 1ZJ5A 2GBFA 4GW3A 1DQYA 5JAUA 5BWBA 4P93A 5FUMA 4X7BA 4AO7A 3B12A 3WK6A 4X6YA 5AKIA 4OU4A 1W4LA 2QJWA 2ZVDA 3MVEA 1MPXA 3S8YA 1JJBA 2RI6A 4C4ZA 1XRPA 2VT6A 1ODTC 3DCNA 4IQ4A 1AMNA 3I2HA 4BDSA 4H18A 3H17A 4BCBA 6YASA 4H7EA 3HJUA 4PSUA 4Q1VA 5ALOA 1J06A 4B9EA 4BTLA 5LLSA 4QEKA 2C0QA 2ZJ6A 1QO7A 5FP0A 5ALWA 1AC5A 5AIBA 2XUGA 2VJDA 2XMRA 1CUCA 1ZD3A 3GELA 1YASA 2DSNA 1EB8A 1ZICA 3I6MA 1VXRA 3H04A 4FBMA 3R3YA 1XLVA 2OGZA 3FVTA 2XUAA 5I9IA 1W76A 3I2FA 5ALXA 4UBLA 3E3AA 3U0VA 1CUXA 2B61A 3IULA 4WFIA 2XB6A 3R41A 4AMYA 3M82A 1FFBA 3BWXA 2ZYRA 1LBTA 4J7AA 4CIBA 2D5LA 2ES4A 2Y2UA 1FJ2A 5ALMA 1ZI8A 4JYPA 4C87A 3UUFA 4G1FA 3O4JA 4J0JA 3FSGA 3FBWA 3HI4A 5AI5A 2XT0A 4F21A 2K2QB 3G9XA 1YA4A 2H7XA 1BRTA 2XUIA 5KBYA 1XZBA 1CUDA 1E66A 2HRRA 2H7YA 5DYYA 3AFIA 4DLNA 2HDWA 4PNZA 2HHAA 3D2BA 4ZI5A 3WK8A 1UFOA 1DT5A 1CUBA 4Y2RA 4LXHA 4UHEA 3H19A 2OCKA 4M0EA 3V1LA 1CUJA 4V2IA 3QPAA 4FOLA 1CUSA 4LXIA 5D6OA 3FYUB 3QH4A 4Q05A 1VJ5A 1UOPA 2C4HA 1C7JA 1F0PA 1L7QA 3R3XA 1H22A 2HRQA 4G8BA 5JAPA 3I2JA 1ZJ4A 1JFRA 4D9JA 3DNMA 2WSLA 3BXPA 5EHQA 3BF8A 2PUHA 4ETWA 4BCDA 4J0CA 4AMZA 4OB6A 1F6WA 1N5RA 3DKRA 3R40A 2QT9A 4K6GA 2BFNA 2BUBA 2I3DA 3E0XA 5C8XA 3BL8A 4KRYA 5DYTA 4CG1A 1EX9A 1G5FA 3RK4A 1ISPA 1UK9A 4M0MA 5AI8A 1HKHA 3ZWQA 4P9NA 3KXPA 1CIJA 1SCIA 2VATA 5ALLA 2WIKA 3HYSA 3WKBA 5HKAA 5HF6A 2J3QA 5AM2A 4HXGA 2X5XA 2DR0A 3VKFA 1PV1A 3MUOA 4ZRDA 3QPCA 3G0CA 1TK3A 1XZLA 5CXUA 3F98A 3W9UA 3WWPA 1UKCA 1CLEA 1W75A 1EXWA 1BCSA 2DQYA 4OUKX 3QVMA 5KREA 1O6GA 4DNQA 4ROTA 4N8EA 1LGYA 3WJ2A 5DJ5A 5JYCA 4U2FA 1MO2A 4AZ0A 3DJYA 1EI9A 5K3FB 1HPLA 1R1DA 3DS8A 2QS9A 3O95A 1EDDA 5EGNA 3FOBA 3ZI7A 1ZD2P 2H9YA 5CH3A 3H2HA 4PV7A 5E4JA 4QLOA 5E2IA 1XLWA 3IURA 2VEOA 3FYUA 2GBCA 1GQRA 2PSHA 4X85A 1XFDA 5AK5A 5ALFA 2ROQA 2XQJA 3AIOA 4B82A 5ALDA 1UK8A 4JEIA 1HQDA 5ALTA 1ACLA 1A7UA 3P2MA 4EBBA 4KRXA 4AN0A 5AICA 4W1RA 1UKBA 3IUMA 4MXDA 3DOHA 3N0TA 2QJRA 2OCIA 1HL7A 4X95A 3AIMA 4UUQA 3LCRA 5CURA 2HU5A 2XMZA 2WLSA 1CUFA 1VOTA 3F96A 3HRHA 5LKAA 2V97A 4BVJA 2CKMA 4H7FA 3WKEA 5JD6A 4A23A 4UPDA 1IVYA 1JU4A 3K9BA 5AK4A 3BDIA 2ZSIA 4OB7A 1MX5A 1MX9A 1XZJA 1QFSA 4DIUA 2R8BA 5T4HA 5AKZA 4B7ZA 2WU4A 4PSCA 4WFKA 4JYMA 1XRRA 4DMCA 5AH0A 1UZAA 3AIKA 4X93A 3OOSA 4Y2JA 1YB6A 4IH9A 3AUKA 3N2ZB 4MJ3A 2BGNA 2HADA 2OG1A 2QOEA 4Y2QA 2JEZA 4Q3LA 4J0GA 2WIFA 4FLEA 2PU7A 3G0BA 5AI6A 1GKKA 4NMWA 4EY6A 4MWTA 1UK7A 3O9MA 2WHPA 3WLAA 2YASA 5K3FA 4G9EA 4QWMA 5K5EA 3WIOA 4X90A 4I19A 1GPLA 3F9CA 2HA0A 5K3DA 4LYDA 1EH5A 2HA5A 4HAIA 1JMYA 1VLQA 3VJLA 4MYDA 3LIIA 2W6CX 3B5EA 4HZGA 1LPPA 1DU4A 2VJAA 3OC0A 2HU7A 4W1PA 4MEBA 3NWOA 4U2GA 1MNAA 3KOOA 2OQIA 1XQWA 4WDRA 3C6YA 4LYEA 2H1IA 5A7HA 2CJPA 1E8DA 5CT5A 5IVKA 2JEYA 3U1TA 4CG3A 3ZPXA 4H7DA 1G42A 1C4XA 2CEKA 4BTVA 5JD5A 4KAFA 4KEAA 3I2IA 1RP1A 3I6YA 2XMQA 1Q0ZA 4YPVA 3I28A 2PL5A 1MAHA 4OYYA 4LKOA 2VSQA 1FFCA 1BS9A 5AM0A 4AX4A 4C6HA 4J0HA 3C43A 5AI9A 1LLFA 4XX1A 1K6EA 1QGED 5FXMA 1BU8A 1EHYA 4GDMA 3WJ1A 5DNWA 2PSEA 3G0IA 4YX9A 1IZ8A 2HL6A 5JZBA 2C5FA 4AB1A 1SC9A 2O2GA 4Q3OA 1H23A 5JAOA 1QIFA 5C8VA 5FRDA 1QFMA 2PUJA 3PFBA 2PM8A 2AJCA 5EI5A 3FAKA 5T4BA 3WYNA 1E8NA 4AQDA 5CXXA 3PE6A 4H7HA 1YSCA 1K5PA 5H3HA 4HVTA 4G8DA 5JALA 2XUKA 3JYHA 1DX6A 2JGMA 4CCWA 3C5WP 5FKJA 1I6WA 2AJBA 3C45A 1R4ZA 2RGUA 1ZD5A 2HIHA 4IO0A 3NOXA 4EUSA 1MN6A 5ALJA 1N8SA 1BN6A 4BE9A 2Z3WA 3STVA 4DNOA 1YS1X 5AM3A 2ZYHA 4Z49A 3TEJA 1AZWA 1HBJA 4AO8A 3CN7A 5DNVA 1XZHA 1Y7HA 2WHRA 1ZD4A 2WG1A 3CXUA 3NUZA 1XZMA 4H0CA 3WKDA 3PUIA 1MNQA 5AP9A 4FTWA 5LZ4A 2PU5A 4L72A 1GGVA 5AKXA 4EY4A 4EHBA 1ORVA 4CFSA 3AZOA 3KWJA 3E4DA 4QDZA 3OG9A 5HQ3B 4EB0A 2DFPA 2DCMA 4GWLA 5CT9A 3KDAA 1ODCA 5ALEA 5EHZA 1TIBA 2BCEA 4NZZA 2NW6A 1ZGCA 5HFAA 1YB7A 3HACA 1YA8A 2RAUA 3DKKA 1PFQA 3PUHA 2ECFA 1R9NA 4QWWA 4XVCA 1O6FA 3QITA 1CR6A 5AKEA 5CH8A 1OXMA 1XZKA 1IUPA 1XZFA 4Y2PA 2VAVA 3W05A 1T4MA 5AHXA 2Z3ZA 2ZYSA 3E1GA 2QUBA 4MQMA 1CQWA 2I78A 2H7CA 4N5IX 3DOIA 4GECA 4KE7A 4QDOA 4DGQA 2WUDA 5CTAA 1HLGA 2ACEA 4J03A 4CG2A 4Q3KA 4EZIA 3SK0A 1JT2A 3G9UA 4UBKA 3WMRA 3I1IA 1GPNA 4GBGA 4F60A 4K2AA 4NVRA 3M83A 5C7YA 1ACJA 3D7RA 4IH4A 3R3UA 4Y7DA 2LIPA 4BB0A 3H1AA 5LKRA 4L3WA 1VE7A 4DNPA 4W1SA 5AK6A 3WWDA 4YASA 2QZPA 4GI1A 3M3DA 4H7JA 5JASA 1ZGBA 4H7KA 2RHTA 4ZV9A 2ZYIA 4KACA 1H2YA 2XUFA 3C8DA 2JGKA 1MX1A 1BCRA 1QIEA 2QM0A 4HXEB 1SOMA 2QUAA 1MU0A 2VJBA 1H2ZA 1F0NA 1CUIA 3ZLUA 5ALNA 4H77A 5BWCA 3FVRA 3RM3A 3FSGD 2WTNA 4DTCA 4ARAA 4X91A 5AM4A 1X2BA 2B4KA 1KU0A 3YASA 3PF9A 4F5ZA 3ESAA 2WFZA 1JI3A 3WWCA 1N1MA 5HQ3A 2VQ6A 1CRLA 1IMJA 4KJXA 5AKGA 3ESCA 3DEAA 4BAUA 2HA6A 3WL6A 3R0VA 3FNBA 1KU6A 2WG0A 4BDTA 5LZ7A 4DSAA 4BAZA
chains in the Genus database with same CATH superfamily
5F9MA 3SJBA 1PLJA 3PP8A 3WGVA 3FPSA 3UMVA 2OLJA 3JRXA 3I09A 3RSHA 3ZX5A 1OBCA 3PNMA 2X8LA 1PYGA 2AA3A 3KZXA 1B6GA 4FT4A 2GPNA 3WLFA 1KAMA 3FD8A 1FQWA 1YKFA 2HCTA 5T6BA 4OAOA 1KHHA 3GZNA 3NEPX 1H9CA 3MS7A 4C0HA 8GPBA 2O48X 1LS6A 1SB8A 1TVKA 4RUKA 1NUAA 3ETLA 4KN5A 4MB6A 4Y1RA 1EFRD 3C3MA 3PFCA 4HNAA 3P7MA 2V6FA 2QTVB 3W5IA 3PNSA 5KJFA 5JOQA 2AEMA 3W5CA 2P2DA 1N2OA 2HO4A 4S1OA 5THQA 3TLEA 1G19A 2ZTLA 4ZT3A 4QELA 2GZAA 1U1GA 2QD1A 1JDVA 2YNMA 1Q3HA 3U48A 2P9CA 3H2GA 5TQVA 4P7KA 1FYXA 4PPGA 3KAKA 4R05A 2WE8A 5BP7A 4I3FA 1QR2A 2HDNB 4S2EA 2FCRA 1S2IA 2DVMA 2EGUA 4QOGA 1R0RE 4RNCA 5IUNC 1NJ8A 2WKWA 3ME5A 9GPBA 3TGPA 2LR0A 4G84A 5AIAA 3P9KA 1ZNQO 2ACKA 3OIFA 3C14C 2XCIA 5FPPA 5IAEA 1HEIA 2WQ7A 5JATA 4D8VA 1F06A 1QAOA 3PRHA 4S1VA 1KIFA 1OFTA 2HA2A 2OV4A 3F5SA 3Q3HA 1JAHA 3M4NA 2C4NA 3CZAA 6ADHA 1E7QA 3DF7A 3CUTA 3OM8A 5CVCA 1G17A 3D1LA 1QRAA 3N5KA 4YGYA 3GRFA 1E6WA 2XEXA 4MARA 1EK6A 4RHYA 4BQNA 1MQ9A 1ULTA 2XUHA 3A3OA 4IWXA 1VMEA 5A9RA 1D4AA 3WB2A 1SVMA 2DKOA 2YC2C 3L18A 4LFCB 3UJNA 2GZSA 4GXNA 2ZU0C 3ZUPA 4PIVA 1D8TA 1P2BA 2I76A 2DWPA 2H1VA 1MO3A 4LHEA 3OAAD 1TYAE 2FFAA 3DVAB 4MKZA 4ECAA 2HWYA 4AXBA 4ENWA 2EX4A 2OXEA 2W83A 1CFZA 5LMZA 1HZZA 3BD6A 3ISJA 4DJEC 4OJYA 3AEUA 1HMYA 4UHBA 1JR3E 1VRWA 2SKDA 4INZA 2RHDA 4EYQA 2IK8A 3EIEA 5DLDA 5E4YA 3GEBA 2P91A 3PXCX 4YYEA 1CF9A 5CA0B 2ZI7A 4PZZA 5A9SB 4NJOA 3LPDA 1N3BA 2K4MA 1JU9A 4MYRA 3HBFA 3NDBB 1E3IA 3KFVA 1K92A 1LV7A 4LZNA 1EVQA 5KVQA 4UEOA 4RVCA 2AEJA 1O87A 2GA8A 1WW3A 2FWAA 3KB2A 3RVOA 4P7GA 1FB5A 1NFFA 4PRKA 4B33A 3BWDD 4DDTA 3FTNA 1PSZA 1UBLS 2C3PA 1QHGA 2VF2A 2G4CA 1Q3KA 2PZBA 1VPWA 2Q1UA 4R7ZA 1G60A 3FBGA 3TR5A 2FI1A 2O1SA 2B8TA 1ZNXA 1N3LA 4HH3C 1EPUA 2GFQA 1TGVA 1FDOA 3TLZA 5BVHB 2NNWB 3ORYA 3G02A 3T3OA 3TI9A 4ZV7A 4LVCA 3UHOA 1A5BB 2IOHA 4C7JA 4A5SA 4Q4HA 2D7JA 4X1IA 1RPNA 4LF9B 4ZVMA 5ESRA 4G89A 4IJMA 2BF7A 4M1QA 2NUBA 4N54A 1DQRA 1K8ZB 4OUDA 3FOWA 4Q4AA 4X61A 4WA7A 3WY9A 4KPYA 5GZ6A 2ZYAA 4LX0A 2ZOSA 4GT1A 3GLIB 4GRAA 3JASB 1L7AA 2LDBA 4MVJD 3KT6A 1REQB 1RABA 4N0EA 2AOXA 2WJ4A 5SYAA 2NXWA 1V3TA 1EBBA 1FQKA 1ZONA 3EG9A 2XECA 2PKRA 2XWQA 3VR4H 2VPYA 4Y2XA 3EPKA 1NNEA 1AKUA 4Y9TA 5IULC 3RIGA 2VDWA 2E0IA 5ELXA 1BD4A 3SEZA 2H6EA 4UASA 1FP1D 3LX8A 1NW3A 2GXAA 3J7AC 3W5AA 3VV2A 3PQ5A 4OKNA 5T41A 4PZAA 5KIAA 5LMUB 2J9YB 2NZ8A 5G4KB 3EX7C 1QU2A 4DLSA 5HFJA 2QR2A 3Q7SA 3A3KA 4BKOA 5D51S 2UZ1A 4NEQA 1X7XB 1CJVC 3WICA 2GNAA 2Q3MA 4WACA 1SO8A 1G3UA 4U63A 1HF3A 2GFIA 3RIEA 2J5XA 1P80A 1U0FA 3FH0A 3AFGA 4BOYA 5JMTA 1Z68A 3EFBA 1V45E 2DZDA 2ZTVA 3H18A 3ULKA 1UJ4A 3EODA 4H1TA 4A7PA 3MOIA 4B80A 1FNCA 3UOWA 3IS3A 2DHQA 2BFFB 4FMPA 1P0CA 3PBKA 4QYIA 3TFOA 2ZATA 2XMPA 1VJTA 1HG1A 4JR1A 2A4KA 4OBWA 2C5HA 4QM6A 2VDLB 2OC4A 3OFJA 3BILA 4I50A 3KJFA 3UANA 1KEUA 4LTNA 3FOFC 3SP1A 1C3LA 4JI2B 4OA8A 4OX9Y 4UVGA 1G2PA 1Z7EA 2B0CA 2I7XA 5CFNA 2QN8A 3RS2A 1JTEA 1IPEA 3NH9A 1DQPA 2BRUC 3JZMA 3I5UA 3JQ8A 4WY5A 2IY8A 4M76B 3RC8A 2QWXA 1KO1A 1ORTA 4ISBA 4KE8A 3RS5A 4ZEVA 1E18A 3QUSA 4QLBA 4EB6B 3T5CA 3RF6A 4QBIA 4P36A 3AF3A 5H4HA 4M0DA 4RQAA 4NBWA 3KLNA 5F64A 4EEZA 4LZJA 2IXFA 3NU1A 1U0LA 4JP5A 2WD7A 1E4VA 2FCAA 9LDTA 5LSAA 1CD5A 2PMWB 4AX8A 4B4OA 5LD2C 3QOXA 3AY0A 3DO8A 1AN9A 2ZJ3A 4G5SA 5D2CA 5FQOA 2V7PA 2CUNA 3E05A 4ZOEA 3SJZA 1IXYA 4G9BA 4LE0A 4CL8A 2ZE6A 1ZCBA 4YAKA 4KBGA 2BMVA 2IZZA 3F6EX 3ZHYA 2ZCVA 4QLAA 4J8PA 3LIPA 3M70A 3OP1A 4UNIA 3E1KA 1DEHA 5AHRA 3WV4A 1NVWQ 1GQSA 1JNXX 1M2GA 2A58A 4PQYA 3UNXA 5CVVA 5TE9A 3RADC 3KEGA 3S1AB 4ZTZB 2JGEA 3VKHA 3U3RA 5EPEA 1XNQB 2OXRA 2X1LA 4GH5A 3N28A 3QE4A 2XBLA 3JATA 4HNSA 2IUYA 2O5RA 2Z1DA 4IHAA 4NL4H 3OLCX 4DM7A 2DP4E 5FV4A 1SCUB 2Q3BA 4KGZA 4HO1X 5L4SA 4HI0E 1W35A 4P86A 5HYVA 3JQ9C 2CHQA 4Q1AA 1CQIB 3SHTA 3AM1A 1KDOA 3TXXA 1PT8A 1R88A 2VXBA 4MDYA 5KJEA 1LWOA 5BN3B 1Z7WA 3UV3A 3C39A 4NPCA 3KU4A 1NVGA 3IELA 4FDUA 5CRIA 3K4PA 4JUAA 4OFXA 3RS8A 2CXTA 5FLXA 4KODA 4DLVA 3HM2A 3HSSA 4TTVA 4EVQA 5KTKA 1RAGA 2R3SA 2ZRJA 3X2FA 3I83A 3OSZA 3JD2A 1XZIA 1B8OA 2WU1A 3MD9A 3PDIB 2QLLA 3TSAA 1WV1A 3KWLA 4RPJA 1F51E 3BIFA 3KFLA 3VOSA 3KD3A 1J0EA 2P41A 4CUZA 2CSUA 2NUTB 4PYQA 1RZRA 1YRHA 1PFWA 5CCDA 2BEWA 1W1IA 2JHPA 2VPXA 1M10A 4RSHA 3TXAA 3UUEA 3DEHA 4ED9A 5EJ5A 3A04A 3BS4A 4HWSA 1ELOA 5FOQA 3AHEA 3PQ8A 1QJ4A 2YQ5A 3KKLA 1H4TA 2PJRA 3CEAA 1WO8A 3AEKB 2C96A 4I3GA 2D7DA 3QZUA 1GXSA 4PF1A 3WLIA 4BVHA 1RYEA 3OF3A 5A2QA 1XZNA 1Z25A 5CDYA 3ZEAA 1LK5A 4JBXA 4B6QA 3RTDA 1SQ6A 5LXTA 4CMEA 3TUJC 5TGTA 1XCPA 5DISB 5A6SB 5IK2D 1IBCA 1TTQB 1R27A 1YO6A 1DCTA 2BMJA 1AKQA 2WHYA 1J2TA 5T6MA 2AXEA 4EG5A 2QN3A 1Z5WA 1MVNA 4KTTE 2C7GA 2CNOA 2WWHA 5C4GB 5J5AA 2GMWA 1C4WA 4J0IA 1ADJA 2RKBA 4WXMA 2J4CA 4BE7B 1PHRA 1SZJG 3U6KA 3BQNB 4HKTA 3E5HA 3OX1A 3GLHA 3DAFA 3E35A 3CEMA 2FFBA 4ZHSA 4JBNA 1XZCA 1FFGA 2B1GA 2BGRA 3DBHB 3NAGA 3LMKA 3R1IA 2J6IA 5BQFA 2ZIVB 4YALA 4BHTA 5FWNA 1TIPA 4M9CA 5FBWB 1E2UA 4GC9A 4MP3A 3RYIB 2F4VB 1QZUA 1GFZA 2AIRA 3GB9A 2CXRA 1G59A 3LCJA 2NV0A 3OCCA 5C37A 4UE6A 4U2KA 6REQB 5CT4A 3ST7A 2YFQA 1GGFA 4J9UE 4HX9A 4XWGA 3VU3A 2GZ3A 4JI1B 1ABFA 4GI7A 1QTIA 2A9JA 4N3GA 4OMDA 5KQSA 3HPQA 3V7NA 4UHHA 2BI7A 3X1YA 3KLPX 1FNDA 1BHJA 5IP5A 1OREA 2XTZA 3HEAA 4MHSA 3WRXC 3JW8A 2O7NA 3FTCA 3DD1A 5EZ6B 3BD8A 1BQEA 1SXJB 3UMMA 4R1PA 3RVKA 1P5RA 3FN4A 3DLTA 3G8BA 3V48A 4WWHA 4XIIA 3GGGA 1F6DA 3VH4A 4BFCA 1GPH1 3BGOS 1I01A 3PQ6A 5JVDA 4XAQA 5L7TA 4R2HA 1LNZA 3SJCA 3WIDA 2HN9A 4HADA 4B3XA 2QN2A 1WM1A 5I45A 1M75A 1QKKA 2A35A 1G8SA 2CMGA 2R25B 3K9LA 5EXSA 4YXWA 3MT8A 3ROFA 4ZV4A 5KWVA 4RY8A 1VP9A 2G1KA 4ZO7A 3PQEA 3LC1O 5EPOA 3S40A 4L9WA 1Y6ZA 2NU7B 5HFNA 1A9XA 2C5LA 2PA3A 2Q2NA 4QUEA 3EC1A 2FW0A 3EWSA 3OP4A 3GA0A 2JGIA 2O3TA 4RYLA 3DZ8A 3EIQA 2IU3A 3LT0A 5H81A 4Q3EA 3LGSA 1T8RA 4ABYA 4AAYA 5BYBA 4TLLB 1XT6A 3NWBA 1UPUA 3A6LA 5L3QA 4YRRA 4TQAA 4WY8A 4BQFA 5B58C 4KLCA 3JZIA 1DC3A 4RZUA 4FHZA 4HGYA 4RK0A 4B74A 2B9VA 2GZDA 3GJSA 3KTAB 3UWPA 4FNOA 2AS0A 3IMEA 1XPOA 5KOHA 5ES3A 2FEOA 2PKYX 1VMIA 3GMDA 1JQEA 4JGIA 4KIUA 2RGCA 4TKVB 2O19A 3V5NA 1O97D 4H16A 1CJSA 1R8SA 3C85A 2X23A 4EI7A 3UB4A 2WIBA 1RYFA 3HB0A 1DTWA 1TM5E 5JARA 3EQ2A 3ZIUA 1QLWA 1UBTS 4TKMA 1DJOA 1SHKA 2O8EB 2RCNA 2Y0PA 3QLVC 3R77A 3LK6A 4A91A 3VH1A 1JDSA 1L9KA 3AM3A 4NU0A 5IDYA 2CNNA 3INTA 2UYYA 4GSKA 1W85B 2GZ2A 3DTVA 1X9IA 2D74A 5FO1A 3WXBA 1T1IA 4KUEA 4J7XA 4F11A 2ID4A 4RIHA 3ZJYA 4BN4A 5BNWA 5H82A 2O8BB 1Z18A 3VNAA 4GPD1 4B3IA 5CK5A 1T2AA 2ZRHA 4MKFA 1QIJA 1QOZA 3CUUA 2ZI9A 1L8XA 1COWA 1TQ8A 2P5SA 3DM5A 4J90A 5F33A 3H99A 3VNVA 1UP6A 3TL3A 3ZIAA 4YAOA 9MHTA 1MD9A 2AR0A 1ONNA 4Q1EA 5JZOA 1N0WA 1ZMXA 2J0QA 3BH6A 3GDGA 5KINB 1XZPA 4JGGA 2FXVA 1DRKA 2AOUA 2XGGA 4IX1A 4DT1B 5JS8A 1II8B 1TZJA 1X1BA 1KEEA 3QBDA 3WYGA 2NSJA 5FOUA 1VZ3A 2YVLA 1T5BA 1XTZA 1P0FA 1ESCA 2CC2A 3DV0B 2HK7A 4CLDA 2E82A 3D8TA 3B3FA 1AURA 4L75A 1OYVA 2Q9AA 1RRCA 2XOKD 3VDXA 3O83A 1M5UA 3EXIA 3KFXA 1BS2A 3Q2IA 4O25A 1Q6ZA 5BUCA 1TCAA 2G1JA 5DLEA 1QHHB 1L4YA 5EUMA 1THTA 4K8OA 5FWAA 1USWA 1WXQA 4UFPA 3DDOA 3KNZA 2X0IA 4LOJA 2H2IA 2HXGA 1FXWA 1YTLA 3RH0A 1YJCA 4P2BA 3W6UA 1T36B 2ZI5A 3O8LA 3OO1A 1KI4A 1N57A 2I2DA 3EHEA 2P9YA 3GLGB 1B0UA 4JN6B 4QXOA 5ALYA 2VRNA 1EWRA 4RA9A 4RDIA 4TM7A 4RF5A 3AR3A 3AQIA 5CH5A 1G3RA 2FWBA 2QZZA 2I87A 4RS3A 1K8QA 1ZK1A 1FXWF 1RI3A 3D7SA 3FNGA 1GRCA 2VL7A 3ESXA 4PNPA 5LU8A 4MUJA 4NZPA 3CSSA 3DCIA 3RARA 1NAHA 1PW7A 1P7CA 1LBEA 3ND9A 2ZB2A 5K3CA 2BMDA 3AHDA 4GXQA 3R5KA 3CGWA 4LZWA 5TGZA 4DLYA 1JIXA 4NCAA 2XYQA 3L0OA 3Q88A 4QXQA 1KZHA 4DN6A 2AFHE 4EH1A 1X7HA 1KH3A 2IUTA 2Y1EA 4EJMA 4J3NA 3G59A 5DGTA 4ZYLA 2TYSB 4QDTA 1I10A 4R8RA 5DYIA 4E07A 1EG2A 4PCVA 3COPA 4JOCA 1XEXA 1QHFA 1Z3IX 3NVAA 1JW9B 5D87A 1BEZA 3JYOA 1W0JD 3QEMB 3DAYA 2G36A 2HNBA 2Q41A 4LXYA 4QDUA 4UD6A 5FA8A 3LXUX 3ZNQA 1GYRA 2PT5A 4ZTUB 1U8ZA 2VBCA 1E79D 3VSAA 3HE3A 1IUOA 3SICE 4CNQA 1MMFB 3BX1A 4LVNA 2FP4B 5HG0A 5IVIA 2GVNA 1PWYE 4EABA 3UGJA 3DE4X 1X19A 1DHRA 2IZ5A 3AOEC 3AUAA 3NGMA 1CZNA 4Y18A 3UM9A 3CF2A 1NLMA 3GUCA 4IKOA 5KKNB 3QMWA 1B76A 1WMFA 2HC9A 2V7UA 4ZAVA 4EPRA 4NABA 4US2R 3HP1A 3V6LA 2QY6A 5ITZB 3HU5A 5C8YA 5E9WA 4I4TA 4IFIA 1W4AA 5LUAA 1OLSB 1XP8A 4M1TA 3WOHA 1I6KA 1XFAA 2VP3A 4R3UC 2V4ZA 3CW9A 7ABPA 3INRA 1GU1A 5F98A 3IMCA 3OE5A 1GAEO 2P4SA 4JI5B 3PTAA 1ZK4A 3MS2A 3K1YA 1M0WA 3IT2A 4MR9B 1H2XA 4GZ6A 4X92A 5GV8A 1Y7LA 1X42A 2P3QA 1I80A 1A9TA 1IOVA 1RBYA 1WPXA 3HRIA 2R8EA 3FHOA 4UM7A 5CUQA 3T7IA 2P6NA 3MFQA 1FS6A 2H1CA 4M55A 4XGKA 3KYCB 3ZJ4A 4FQ8A 3VPDA 2CDCA 5DNUA 1A5TA 3PDCA 4D3SA 2PXHA 4RXTA 1O4VA 4UMFA 4C0BA 2GEVA 3BFXA 2OR3A 3CR7A 2Q8NA 1IZ7A 3BJMA 1K06A 2YZ2A 4EYOA 3ZHTA 2I9KA 1QRUA 1S96A 3RGGA 3QWBA 3FBTA 5DM0A 2BKLA 1TQDA 4XYBA 3DF9A 3I32A 1PKXA 3D0OA 1WBJB 1CUUA 1F1BA 2P65A 1Z9BA 2ODTX 4IDBA 5EKXA 3IP1A 2HMSA 4RPKA 1SBZA 2MSLA 3WL7A 1E5XA 1ZJ6A 2I55A 3GUYA 1G4AE 2F1KA 2J41A 4PW0A 3PHCA 5F2OA 5KHLB 4HP8A 4YV1A 3NX4A 2B98A 3CN9A 3KD2A 5BW4A 1LVHA 1YZ3A 3L06A 1XA4A 4O8ZA 4FXPA 3N3AC 2Y9PB 5E6RA 2BMFA 4C76A 2B4QA 1XQVA 1ZLXA 2JBAB 2VJCA 3L7NA 4N0PA 4W1QA 3UJDA 3G0GA 3OPYA 4MA5A 5HM8A 5JCZA 2CLEB 4D45A 4F3NA 1SC1A 1FTSA 4IGFA 4YUVA 5A5VA 5K0NA 2Q1SA 1TA0A 1QE3A 2Y1CA 2XGJA 4F1WA 2XW6A 4IVQA 1ZHFA 2JDID 1NQOA 3KUUA 4TWBA 4XM2A 5CGQB 4A2QA 2PX4A 3L6BA 5BNZA 8ATCA 2Q50A 5JAHA 1FNBA 4MQ5A 4OPMA 1E3SA 3W3AH 3ZR4B 5KO2A 2G71A 1KO5A 5D3MA 3GUUA 3ITEA 1J8DA 5E95A 2OKCA 2OYRA 2XGMA 3W4JA 4FW8A 1OAOA 4BRSA 1QZ3A 3IEMA 1VI5A 3PS9A 2W4IA 5HF5A 1CUVA 1N6IA 1BEEA 3VGJA 3IAM1 4MLPA 3L8DA 3EMBA 1QQTA 3SVZA 2P2NA 1IIBA 5K0TA 2VTVA 5DMHA 1YJXA 4RV5A 1Y5MA 4X3CA 1Q7TA 3UJ7A 2WEKA 5HIAA 1EZ1A 1U3UA 2JRLA 2R7NA 3E48A 4KSBA 5BSMA 3GRZA 3COZA 4FMCF 2FFJA 3E9MA 4RCYA 3C41J 3FLAA 1H42A 1N2EA 1UBNA 3O7MA 4YJGB 3WLMA 4Y2VA 3JV7A 5AW2A 1WVIA 3D2CA 4YLYA 1KIMA 3EVGA 1E5QA 1D9ZA 4LVOA 4MW1A 2QVXX 2YJZA 4BC0A 4QGHA 1Q0RA 1U2TA 1QZZA 3DOOA 4HPXB 3U49A 2J4FA 1F8XA 4Q3DA 4AG5A 1X80A 4FYVA 1PT6A 3TLCA 4GX5A 1DP4A 2GFHA 3ZXXA 4DVGA 1EAMA 3RJZA 5KNCH 2YWJA 1P6QA 2WRZA 3KG2A 2IITA 2B2XA 4NLLA 3URKA 3R74A 3DW1X 5H16A 4BNXA 3ONWA 3GLFB 1SUFA 2AB0A 5DH9A 1R37A 5DI9A 4FYMA 1SBQA 4M0PA 1ETHA 3HLKA 3E9NA 4C7KA 1XVTA 3M81A 1B6SA 5IAAA 1RTTA 4R7GA 4Q1FA 3ENWA 2JGFA 3HZOA 4QSHA 2P2LA 3E58A 3OFND 4H7IA 2GK4A 4AF8A 2RHGB 5B2FA 3ESBA 2WF5A 1JTVA 1MV5A 2UAGA 4IDHA 1E3WB 4YNBA 2FGKA 4O2BB 5I47A 2XQFA 1SXQA 2R00A 1XRSB 3ROKA 1SVUA 2DPYA 1KDPA 2Z5VA 2W9XA 2X6TA 4IRXA 4LRTB 4BNWA 4Q21A 3KO8A 4PG5A 4LS3A 4DKXA 1SNYA 2ZP1A 3F49S 5EQFA 3G1WA 4DBVO 3WNBA 2PSSA 1N5OX 4IIYA 1RLJA 1U3TA 4QIHA 1I3CA 3Q7QA 5B7GA 4ER0A 3WTCA 1N1DA 5D85A 5JBIA 2PYZA 2QB5A 4JJZA 1X92A 5H1YA 2P1ZA 4G1EB 4C20A 4JI6B 4IMPA 4ZAFA 1MQAA 3A6PC 3B1WA 3SBOA 3K71B 1KAQA 1GSIA 3H3XA 3IOCA 1TYBE 4CIDA 1PJAA 4XI9A 4BZPA 2F8LA 1D0VA 4MV3A 4EKGA 2PZJA 1U7WA 2BZSA 3I6IA 3ONEA 4NOLA 1E6LA 1BKDR 1LZKA 4FLMA 1E2JA 4RABA 3F3MA 1E92A 4BNVA 2M98A 4GR5A 4AN1A 4CCYA 4XYEA 4COOA 1O1YA 2VPIA 4KO3S 3WL4A 1CIVA 3I52A 5HTKA 3OAAA 1ZCFA 1RKVA 5HQTA 2L42A 2RH8A 4EF5A 1JDUA 1P4HA 1H0SA 3A7DA 4ODIA 1AY0A 5AUNB 2HHCA 2A9FA 4QBGB 1ZHHA 1NW8A 1X15A 5C81A 3TQCA 4DYVA 2O7VA 4P4LA 3RTEA 2P8JA 5IZCA 5IBQA 1XTUA 2Q0SA 2GCIA 3A10A 3IAM6 4PTLA 4E4RA 3QFTA 3HB5X 2RJNA 1KJ9A 3KK0A 2WMDA 3LFTA 3HXMA 4V1CI 4MYCA 1KPIA 5BR4A 4FFPA 4S2UA 2NADA 4EHNA 3ZV5A 1D5CA 1U2DA 1GRVA 2O2HA 1Z17A 3H6GA 2DKFA 3LXXA 2G3YA 3N7TA 1Z0DA 3QUTA 4DPKA 4YDSA 4R68A 2XCOA 4XW2A 5FTNA 1UR5A 3BWCA 5I48A 2OQVA 5KYWA 4IHJA 4QZVA 2XCSB 3BZBA 2GYUA 4H2DA 4C5AA 1GL7A 1G64A 1QPZA 3AR8A 3E3LA 3TNDA 4KBYA 4JSRA 1XI2A 2WF7A 3MPOA 3SG0A 5E2BA 4RGYA 5AW0A 5JU6A 3U19A 3GJZA 2OO7A 2Q2QA 3S2FA 3X43A 4YH1A 1RMQA 2D1SA 5U1PA 4YQYA 4CQLB 3T4PA 5IBCA 2QW0X 3LLCA 3TVYA 4P92A 4EJ0A 2HWKA 4HPWA 4QICA 4EJSA 4NYJQ 1IYZA 4YB8A 3I5YA 4IH1A 3PLNA 1IRXA 1O9BA 3E22B 3HCRA 4XE5A 1JPVA 2PPLA 5TEWA 4E22A 5BXYA 2CV0A 4LA4A 1N6RA 5TVGA 3OTOB 1RE1A 1XPJA 3EF1A 3N86A 1MOZA 2NPOA 2JJ2D 5GM1A 3WA6A 4MVJA 3E2IA 4E14A 2UUBB 2WWIA 4FYHA 4Z8YA 2LBPA 5J2UB 3TE6A 3QW4B 1GLVA 3OTIA 4NENA 2NO5A 3BORA 3P96A 1SULA 2FUG1 2GDZA 3GGCA 3F2IA 1Q0LA 4G4IA 5F1PA 5IJ9A 3UMSA 3Q9SA 1KOJA 1E4YA 1M5TA 4NYJR 4Q7QA 2QX4A 2ZIUB 4D3YA 3EIWA 1BU5A 4AVYA 5ES4B 5CFMA 7REQA 1SU6A 4EGAA 3K2QA 2QMQA 2XR1A 1A7AA 3JVUA 3LRXA 3WZMA 1I30A 4DV1B 1NN1A 4WNCA 3ZS9A 3ACBA 3DTNA 3IAUA 2SKEA 3WISA 1M2EA 4AIRA 5KB3A 1U8XX 1SCAA 1K66A 2FJ0A 3H5OA 3QU5A 2A88A 3FPHA 3N0RA 2CLCX 4O4IB 1D07A 1HUQA 2EF1A 3PQ4A 4EPYA 1EK1A 3T9BA 4DDKA 5LQCA 4UU0A 2NU8B 1A8SA 2HH9A 1LQTA 1XDBA 3M1YA 3BGWA 3G2HA 4G23A 4B9AA 1S2DA 3N3BC 4CL3A 3CWCA 3G0OA 4A8TA 1T2NA 3IA7A 2Q5IA 3NHRA 4YN3A 3E9EA 3TFWA 2ZJ7A 4KQFA 3T3EA 3D6TB 3M49A 3EEFA 1FS4A 1NOKA 2DR3A 1WEKA 4Z7QB 4KREA 4MV9A 2R48A 4E46A 4TV8F 1JJIA 1U11A 2VQDA 3L7AA 4YLGA 2DWCA 2LCQA 1A9PA 1BNCA 3IQIX 3NKVA 4MMXB 4WBNF 5A06A 3VR4A 3L4EA 1PS8A 5DSZA 5LQNA 3T41A 4O3FA 4DCGA 5HS4A 4IUBS 5FBHA 1D0IA 3I62A 4M1KA 2W71A 4YRPA 3OFSA 1DLIA 3B60A 2P4QA 5J4LA 1IHOA 3BJZA 1QIDA 3FSEA 3EOAI 4KU4A 4K6FA 2VCEA 2YY7A 4G5QA 3HUDA 2WJ3A 4I9FA 1KO8A 2IYRA 3N2EA 4JLKA 2NQ8A 3OKAA 1R4MB 4UFNA 6NULA 4OXQA 3E7FA 5H68A 4UTPA 2TECE 2X9QA 1YJQA 3I5MA 3S2YA 2CUKA 1H3EA 1O6ZA 3B1KA 3K0FA 1J2JA 2P78A 4I55B 4LRXA 3DFIA 1OASA 3ILHA 1QV9A 521PA 3R7LA 1WHTB 3IPRA 1GITA 5DIFA 1U4SA 5AR1A 2FMXA 4OK3A 2OWEA 3G8CA 4LRYA 4OMUA 4CWAA 4JXJA 6GPBA 3ZDXB 3ICEA 4Q7JB 5I7EA 5I4IA 5HXAA 1YMUA 4FZVA 3S81A 3DQZA 2Z8ZA 3M1LA 3MEQA 2PANA 2GBLA 3RBVA 4JXXA 3U17A 3K9GA 4J2OA 3U40A 2YQ4A 1Z5OA 5E6SB 5GOZA 1RXWA 4ABTA 2RH9B 1VKRA 4Q9AA 1DUIA 4B3CA 1FSZA 1Q7EA 1KZYC 3AP2A 2WABA 2VKTA 4WXYB 5KYUB 1EHCA 3GJ3A 4OI1A 3OVMA 3N07A 4MQFB 2CMFA 3AJRA 1NMXA 1XRLA 2VQ3A 1G21E 3NTLA 3PJGA 4MIEA 5DMXA 3GYGA 4DMKA 1L7RA 1IZ0A 3WADA 3E9RA 1UADA 3PG5A 2ZJYA 4WN9A 4W9MC 1IEQA 4IOKA 2BUAA 2PFGA 1SU4A 4D8YA 3NHLA 4EARA 3GYBA 1FDWA 2ZRKA 3ANTA 1CJBA 1PBNA 4GF5A 3FCEA 4XYMA 4MMYB 3LKDA 5B4TA 4QUBA 2G77B 4G0OA 3DOCA 3UMJA 2G5TA 3CXRA 1XWIA 2I2AA 3GQVA 5AJZA 2IC5A 5FR2A 3FTEA 3QYJA 2VHZA 1EK0A 1D6NA 1MC8A 2FZLA 3PF8A 4QGBA 4B31A 2COKA 1X2EA 3DEKA 3PGLA 5D1HA 4NXMB 1C8BA 2OMKA 4YV0A 2PS0A 4FEYA 2B4RO 1PUIA 3SR0A 1L4BA 2PGDA 1QGDA 2AJLI 4EVIA 4DJ5X 2O0MA 2FEMA 2IOFK 3OPVA 3U7QB 1OPRA 1PWZA 2BKVA 2FN4A 2IYSA 2V0CA 2GBGA 3BC1A 1ZOLA 4GYKA 4QKQA 3TEMA 3ZY3A 1FRQA 2NP7A 2H5EA 2I2BA 1CDOA 1LA2A 1Q1QA 3B38A 3CH4B 4RNDB 3BCSA 3L9XA 3TTUA 4A1FA 3ICWA 4N7BA 4AKEA 4C21A 4D81A 1W46A 2C88A 3PUJA 2CL7X 3Q3VA 3OPXA 4YJFB 4CTNA 2QXTA 1ZVKA 5HMMA 4LZOA 3ZVNA 3CUKA 3K5PA 4U7JA 4FFBA 4ZK2A 3T99A 4K88A 2Q6VA 1MRNA 2HIAA 1M2VA 2DOKA 3F8WA 2Z30A 3AM4A 3BMXA 3L02A 4YHBA 4UTVA 1X70A 2P69A 2FX2A 2X3YA 3G5MA 1M2OA 3KQQA 1YR2A 4MLZA 2YHIA 3ETJA 3LUFA 3MA0A 4MZDA 4R3WA 3U7EB 2FPPA 4BO2A 4GWGA 1KS2A 4R2XA 4PYRA 3TG8A 1SCJA 3BREA 4LC9A 1CZOA 3IO3A 2VYVD 3WGHA 1NA5A 1YWGO 3MTGA 4NEGA 4DADA 4UFOA 1D4OA 1QHSA 3OMWA 4RFVA 3SBEA 5LDDC 1F38A 4LK3A 3HMQA 1I33A 1V2GA 3INGA 1RRMA 2XD9A 1MENA 1KP9A 1T8UA 2EP7A 1R0XA 4ARSA 4K9DA 3L7IA 4H17A 2REBA 3W4IA 3PUXA 4K9KA 1JGTA 1LRLA 2V5VA 2FWPA 4MPTA 4MWOA 4UZSA 4Y9UA 3RKRA 4V03A 1OYOA 1IWOA 4B3DA 1J1UA 1KL7A 5L95A 4YMHA 4QTTB 4CKBA 2AJTA 2VBFA 1C7IA 3I8XA 1SVNA 2Q4BA 5JWHA 4HH4A 3K70B 1RHQA 3O8BA 1VL5A 4XTRA 3VZPA 1VE6A 4F85A 1HLDA 2F1IA 2MINA 3AINA 3DFKA 2YWCA 3DO6A 1UBEA 5AJXA 5BMVA 2O7RA 3IBSA 1JDBC 4YRZA 1Q20A 1TRKA 1VJ1A 1GCIA 4II3A 4RL4A 4DIEA 5DHSA 2Z1MA 4KO1S 3RIXA 4DM4A 4BJ5A 4G5XA 1FPMA 4BKMA 3M6LA 3K0BA 2FPGB 1QH8B 4UM5A 5GMOA 3U3DA 1GU7A 2YOFA 5JRZA 2W2QA 4BLUA 1P7VA 1D0SA 3D8NA 3N6RA 3R3VA 1ZRMA 2IHJA 1AM4D 3BAZA 1CVRA 2I1WA 3EVTA 3EXHA 1NMZA 2Y8EA 4U7FA 3I45A 5C18A 4MRRA 5BW6B 5FUQA 4RQTA 3I4FA 4K6KA 4BP8A 4FKBA 1PQ4A 2PAFA 1KXZA 3Q3JB 3CCBA 3JQ6A 4H4CA 4DJTA 4JC8A 3N2GA 4TWZA 5C46F 3IIIA 1XCBA 1JQDA 5DBFA 2GD1O 5ALHA 4A5OA 1QQ5A 4D56A 1DSSG 1E4EA 3R0ZA 1MJHA 5B55A 4ZGBA 1KJQA 2LPMA 4LXUA 4B0OA 5CR9A 4F96A 4ERXA 4XTCS 3VTKA 5KHOC 2ZJBA 4EGSA 5JDCC 4B4WA 1B43A 1RCFA 3B78A 3SDSA 1RLTA 5LYJF 1JNYA 2LNDA 3Q7IA 1ADCA 2AYYA 4FOOA 1KA9H 1DHTA 2ACVA 3G79A 1NONA 3G2OA 4RVNA 4KUHA 5CGZA 5BPHA 4L22A 5T4EA 1K1EA 2QL5A 3A6ZA 1PNVA 4KR0A 1AS2A 1KMHA 4R2KA 1VHDA 2WG2A 3JD4A 5AVOA 1OILA 3RS4A 2XA1A 5HP4A 3ZVLA 2OGSA 2QAJA 1NV8A 1Z16A 1J0CA 1X87A 2G1UA 3AETB 2CMHA 3DJFA 1S9DA 1XKQA 1S0UA 1TGYA 5EJ9A 3LOQA 4EX7A 3QXHA 3EARA 3RBXA 4CMEC 4RTOA 2ZS8A 2KBFA 2HSZA 5IDWA 5HCUA 1A8HA 1SOAA 1L4MA 5L4NA 3CVVA 1MUUA 1KQNA 1G3IA 5HJ5A 2GLUA 2XUDA 2CK3A 2AFIB 4KPUB 2ZIXA 2J3EA 2ALJA 3AUXA 5DRYA 3COVA 5P21A 1JKMA 1J9EA 4N12A 1NFQA 1QIIA 1V5GA 4NG5A 1POWA 4BTEA 5JXHA 4JVLA 3S8MA 3TGLA 4CCAA 3B82A 3NHSA 2XOKA 2Y68A 2BDUA 3LX6A 4FNGA 4QOJA 4QTZA 4Q9IA 4BVKA 5KSOA 1KOGA 3U4MA 2WUGA 4L02A 3T4UA 1Z75A 3WK4A 4ZP1A 1B2LA 4IJVA 5BSUA 3TZ6A 4DDMA 2ZDHA 2PRJA 1M76A 2D5CA 3EXEB 3GROA 1IG3A 4LKRA 2WJZB 2HXSA 2PX3A 3R7WA 4D43A 4L0MA 3VDNB 3LYAA 3P9ZA 3PFGA 1YCDA 4M7RA 3WNQA 1UMKA 3ZX4A 2VPTA 4OSOA 2I0FA 1M3SA 2J7PD 3EAGA 5F12A 1O0BA 1VPTA 1CY0A 3FYDA 2BCGY 4JLDA 1UFVA 3Q12A 3TRFA 2GM4A 4ER6A 2BKEA 3I1FA 1WULS 1XLTA 3HVIA 2GCOA 5CNIA 2XZLA 4QUGA 1V1RA 4BJ1A 3ZN2A 1GR1A 1P1FA 1N2XA 1X7GA 2WJ6A 1U63A 4OHVA 1R5BA 1NYTA 1O8CA 4IL5A 5ICFA 2O8DB 4TS9A 3FVVA 4HC4A 4WFJA 1A77A 2D0PB 4GPEA 1C8LA 2NZ2A 2RGXA 1RWPA 1Y0BA 1PLKA 2W6NA 2PIAA 4D5GA 4GBJA 821PA 2PRYA 5BWBA 4C5BA 2WWRA 4HR7A 1E7SA 4X7BA 2E2WA 5E8JA 4AJEA 3B7WA 3D3KA 2MDTA 3CA8A 1UAYA 1TKAA 1UPCA 1W0JA 4LFBB 4AO7A 4PIMA 2DBYA 2F7SA 4IQGA 1QRTA 1T4GA 1GV1A 4ZMSA 3O1HB 3JRWA 5ENZA 2JC3A 2XA2A 3LUGA 1B7GO 2JH3A 3O0TA 1I7QB 4ENSA 4EJ2A 3M2PA 2CT8A 4BLQA 3OZRA 3LPNA 3GGPA 3NOQA 1Z62A 2PS1A 3DZCA 4LSZA 3AF6A 2DJIA 3ZKAA 1P1BA 2RBGA 3FCOA 3GF4A 5EMHA 2OV8A 4MKHA 1JJBA 4MGZR 2RI6A 1ZGHA 2BEVA 2C92A 3TLGB 3DCNA 3E8SA 1SVOA 3GEIA 1DEXA 1SCNE 4OHRA 4YFYA 3I9NA 3I2HA 3RYCB 3NWJA 2B2CA 3SQOA 1QAMA 4KO2S 4YBRA 4UAVA 1W94A 5EKTA 2N0SA 3NHZA 4O1MA 4BCBA 1XD2B 2YWBA 3TFQA 4G2NA 1VGRA 4Q1VA 5ALOA 4BXOB 1J06A 1ZUD1 4B9EA 3DZKA 1RQPA 1HORA 4BTLA 3BIJA 2C2KA 3U3OA 3VR6H 1Q2XA 2J3LA 3SHQA 4KO4S 5ALWA 3LPMA 3WLJA 4UAGA 3HTXA 5DOZA 1P9LA 2FMUA 1Z29A 1PI3A 2VT2A 4MV7A 5FTMA 1CU1A 5H80A 1Z38A 721PA 4Y6RA 2R7AA 4Y6OA 1TYZA 1ZVJA 1QJCA 2Z4TA 3KLMX 2B4TO 4LBZA 5IXYA 2QEQA 5K03A 3K31A 3C4QA 1SXJD 2VHQA 1RDFA 1VLJA 2YBDA 5AUPB 2FFQA 2X3UA 1T0PA 3AEQB 1O96A 1R16A 1K6IA 2OGZA 2Q6OA 3GAAA 5DGXA 2QQ5A 3FVTA 2XUAA 5DKFA 2JFPA 3G7SA 5LJLA 1CX9B 2G28A 5I9IA 4X62B 1CRPA 2BJVA 1X38A 4KSCA 4JI4B 3GP3A 4DQLA 3BUSA 2A6PA 1AOXA 1LK0A 1Z2AA 3OIVA 2CLFB 3JAKB 4NBTA 3ZGYA 3SSAA 4BO4A 1WA5A 4UBLA 2QU7A 5J2TA 1VKOA 1QVZA 2HJVA 2C83A 3IBFA 1V3QE 3ICOA 5C1OA 1QX4A 2QVLA 5J2TF 1LBTA 4NCJA 3OI7A 1Y6GA 2DETA 5ADHA 4EW3A 2BKXA 3T4XA 4CIBA 3WO1A 4EL0A 3K8YA 4KITB 3GFBA 4PN3A 1RHMA 1U5BB 2NM0A 5ALMA 5TMEA 5LIRA 3T3NA 4LJRA 1RPAA 1SRQA 3PPYA 4Z7JA 4AMBA 4EVRA 3W6NA 4JYPA 3A14A 2VP4A 5CM2Z 2V1UA 1JG4A 4INOA 4J0JA 3RROA 1ZGGA 1GQFA 4LOHA 3RSCA 4AJJA 5CB4F 5I9NA 3WMGA 2B5WA 1AQJA 5LQRA 1EESA 1LVGA 3HI4A 2CJWB 4HN4B 2Z4RA 4YAFA 5AI5A 3VO1A 4DLRA 3BD9A 4GOLD 2XT0A 2QG6A 4TTQA 4F9TA 2NTVA 4IJUA 1PRYA 2O0LA 2YMPA 5H70A 5L3VA 3VR2A 1BCSB 2H7XA 3PR3A 1D2CA 2FZEA 4MCJA 2XUIA 1FLDA 2JFNA 2ORVA 4Q7KA 3AP3A 1GUBA 3NP7A 4P38A 1AZSC 4RSMA 5K6AC 3LZ6A 2GN6A 2GPBA 3Q41A 5F9FA 1S3GA 4KKXB 3HCNA 5IARA 3TR6A 2J5RA 2OO3A 3D81A 2WA1A 3BT7A 4AZVA 5LM3A 1DOZA 3UWOA 4RA6B 4Z2AA 4ZOAA 4MUXA 4KCGA 4F1KA 2AFHA 3CX3A 4PBRA 4QT4A 1HR0B 3MGBA 5LA6A 5F3WB 4RSGA 4P5DA 3VO8A 5BRNA 1E9AA 1IN5A 2DFTA 2QN1A 4JEMA 3Q0EA 4NJEB 4PC2A 1AH2A 2AQKA 2NVUA 4YMGA 2XNHA 4UHEA 1QH1B 2QTRA 4NCNA 1YOBA 4A82A 1P4AA 2D62A 5LA6F 3ADOA 2X8AA 3BHNA 4TUYF 3BB1A 3VDMA 2D1FA 3RKUA 1YI1A 4PFJA 2I67A 4RD0A 4F86A 1Q1BA 2QN7A 2PBFA 4KWIA 3N2KB 4ALJA 4J94A 5A5EA 1FUYB 4ADSG 1J23A 3W3AA 4D74A 2V03A 3I37X 1X3LA 1XAJA 1GL9B 1U3FA 3KJEA 1IXSB 2ZVPX 3LLSA 4JLNA 4ZYYA 3PI7A 2O0HA 1YIAA 3OLYA 3HJAA 1JI0A 3SIWA 2WB4A 3NG1A 4D3ZA 1C7JA 1XTQA 3OC6A 3GFTA 2L18A 4E6EA 1T25A 4EA9A 3N2YA 1NJ2A 1GKIA 1RI5A 4XQ0A 2MYNA 3JWIA 4E21A 1GPAA 2H18A 1N7JA 3KJXA 2CNLA 4E5DA 1L7QA 1G291 1RFLA 1BXGA 5TDHA 4WESB 1AGNA 4CE6A 3KCNA 5LWQA 3O8DA 4ARZB 4C29A 5JAPA 2BDEA 2E87A 2FZ5A 1I3KA 2VZ0A 2JZOA 3SYRA 2ZW9A 4IFBA 5KTSA 1DPFA 5JJ5A 4QD3A 4LI0A 5B3LA 2ZRQA 5EJGA 5KNCA 5E3HA 3BF8A 2C2ZA 2H3EA 3SC4A 3ORRA 5A4AA 1XU9A 2GRAA 4RH1A 2WSBA 5HKOA 1Y9JA 4P5EA 2CLIB 1JHAA 5E6UA 2JLSA 3ZW7A 2QENA 4AMZA 3OEED 2I3GA 2VEDA 2CL5A 1PEDA 1F6WA 2Q0HA 2I4TA 1Z3CA 3KEOA 3RU3A 2XXAB 1NWHA 1SVLA 3VDQA 3G85A 4Q1CA 3DKRA 1T3ZA 3W5VA 4MCIA 3R40A 1XHLA 4OJMX 3HADA 4WA8A 2Q4EA 3HWWA 2J0SA 2EARA 2BFNA 4L73A 2WKRA 1UKEA 3LBIA 1PFUA 3O3NB 3WL3A 3ZJVA 3RVMA 1C0PA 1Z28A 2GAAA 2AG6A 2XTAA 3QVTA 4NBLA 1Z73A 1QFYA 2OCAA 1C9DB 5FLEX 2A0YA 3TD6A 4CG1A 1AMUA 1TJ4A 5FFFA 2CLKB 3D3EA 4M0MA 1UK9A 1GPDG 2P11A 3ZWQA 2E4YA 1FLNA 3IQXA 4E08A 3V3KA 4GMFA 3AY3A 3L05A 3KXPA 2PUVA 2HLDA 1UM9A 3P0EA 5I9SA 2RGAA 3ETNA 1CIJA 4AJ2A 3U5TA 1L4GA 1SWVA 2XD4A 4IR7A 3U62A 5J59A 2P5TB 3D7KA 5ALLA 3S29A 3BSWA 3IVCA 4U39A 4MO2A 1DIAA 4QOHA 4A3SA 3UCXA 1ZG3A 2ZVQX 1C4KA 2C78A 4FCCA 4YDHB 1UL1X 4NBRA 1JZTA 1XRJA 3H9CA 4I9GA 3U39A 1OAOC 3P5BA 4CEJA 4CU2A 3EA4A 2CLOB 2EQ5A 5F1KA 1TK3A 4OL9A 2IXAA 1ICIA 4XPIB 1BWRA 1TYDE 1X7YB 2QD5A 2H11A 3OJ0A 4B76A 1X7WB 1VIAA 5K4AA 2BWJA 3V6MA 5KKCA 1OT5A 1Q22A 1EXWA 1SXGA 4DWOA 1NPTO 3CWQA 5BVGA 2LV8A 2DQYA 1ECGA 2Z6QA 2HUPA 2FAXA 3QVMA 1R2QA 3W5BA 1X1AA 5KREA 3EWNA 4PVCA 1QE5A 2Y99A 2YYYA 2C7OA 3V42A 4KXXA 2A3NA 2J45A 2JS7A 3AUUA 3MTIA 4L57A 5EGSA 3KSUA 3SZGA 1GCGA 4N8EA 1RRVA 2Z8YM 1MJFA 2MYTA 1KSHA 1YFLA 3DULA 3SIXA 2Y4OA 1MO2A 3PXXA 1R8XA 3FMIA 3Q0IA 1VCHA 4AZ0A 1EI9A 1FJXA 1Z15A 3BL6A 1DIOB 1R1DA 2G08A 3CSUA 4FZ3A 4PONA 3WGYA 3T1NA 4DIOA 3WNDA 4LJ7A 4FCWA 4IIDA 2ACWA 3UXHA 1L8OA 5DASA 2P6PA 1FRVA 3VC2A 2J9XB 2FZKA 4FM9A 4O29A 1L1RA 1GKYA 2XHEA 3LTEA 1ZXXA 1VJDA 1MIOB 5JCJD 1JALA 4U7HA 1ZD2P 2XNKA 3CEHA 2RD2A 2XADA 4TKUB 3U61B 4QRHA 2IV3A 4IVNA 5H83A 4FGZA 4RIEA 2HT1A 4KQJA 4PV7A 4Q00A 1YB4A 5E2IA 3NEJA 4BFTA 3SC3A 3BL5A 3I04A 2R00C 3PXBA 3M9LA 5CIYA 4PGGA 4D44A 1Z7GA 2FSHA 2Y0CA 5HR5A 4CBVA 3AC0A 3FFWA 4AWAA 2GBCA 4XUDA 1KEWA 4DHWA 4TYQA 1WEHA 1W36B 4RK7A 3KEQA 1OFUX 1KBOA 3FUTA 4KFSA 3HL0A 4WY2A 4YP0A 2V55B 5ALFA 4B82A 4L15A 3DSRA 1OYYA 2H4ZA 2J8ZA 3M6AA 3M9WA 1TF2A 4TTIA 3N74A 1DMRA 4UDYX 5ALDA 5I8ZA 2RSLA 3KR2A 4JEIA 2P2GA 4D57A 3CNHA 3UW1A 1JB9A 5ANRB 1HFEL 5DM1A 1CZUA 2APJA 5TQJA 3P2MA 4AWXA 4Z9YA 5BSVA 3U1BA 2V8BA 4L4XA 4ND3A 4RKEA 1I13A 2H2AA 4DA0A 4YRGA 3KHUA 5MDHA 3FCSB 2LZ0A 4G09A 3ZYZA 2GUWA 3DEYX 1H69A 4AN0A 5AICA 3X0DA 3QVVA 1ADFA 3IUMA 4MXDA 2EJTA 1SUSA 2H0RA 4MJXA 1WDWB 3VYUB 3ZV3A 1D4FA 5CM9C 4EUHA 2LDXA 5EKDA 1K7FB 4DZRA 3OKFA 3H3FA 2IEYA 5TARA 2Z6AA 2V5UA 1U8CB 3KPUA 5E7MA 4G8JA 4PC7A 4BBJA 4BQEA 1ECPA 4AY5A 4UUQA 3GRCA 3JY6A 1KSFX 1JDNA 2PGLA 3QVOA 4OG2A 1TADA 2K5UA 3SF0A 3WSVA 1E62A 1CR2A 4HQ0A 4PPFA 2DAPA 4PS0A 2HU5A 1GADO 5I9MA 4HDKA 5KCMA 3LPCA 4QAQA 2EC5A 3BULA 1IPFA 5BNTA 3RSLA 4BWGA 1WXIA 4QAJA 4LTMA 4QREA 3IOBA 3P9NA 5IM4F 4KR3A 1VOTA 3L04A 3HRHA 2E7ZA 4G56A 2VKQA 3UK0A 3ZLBA 4BECA 4BY9E 4BGIA 5C80A 3H4VA 4V38A 4H7FA 3WKEA 1CDDA 2E48A 2JFQA 3LA8A 1L2TA 4I5GA 2GJSA 1LJUA 4KG7A 4UPDA 1K5GA 1T3HA 4QPDA 5C5EA 5JI3E 1MQ8B 2FKNA 1E7YA 4FQ7A 4U6QA 2L17A 3FIJA 2YY6A 4WKPA 3DE5X 4ZQCB 5L3ZA 3B6JA 5MN5A 3FDXA 4D6YA 3AEZA 3S4YA 3HA5A 4P31A 4CN8A 3ZHRA 4MKXA 1ZLYA 1AXEA 2GR9A 4GWKA 3EFEA 2NN3C 1J22A 3WNZA 2DQSA 1K98A 3G2NA 2IV2X 2H7VA 3PDJA 1G6HA 1LDBA 3L7BA 2PLAA 4PSCA 5M29A 3I9MA 2EL9A 3DE2X 3IP5A 3N0XA 5F73A 5AT1A 4EJSC 2I1LA 3EEQA 4F2GA 2QVCA 1UZAA 3Q9LA 1Z4QA 3F0TA 3OOSA 3VPBA 5EPUA 4RHEA 4V3BA 4Y2JA 8LDHA 1UQRA 3G1TA 2FQYA 1KQ3A 2JCBA 3UH1A 2ETVA 3WLRA 3N2ZB 4MJ3A 5KJCA 4HWOA 3H75A 1EFVA 2EJUA 2HADA 2BYTA 3T5TA 3T1YB 4Z51A 5B1SA 4QFDA 4ACAA 4QG3A 3O38A 1DKPA 1HLFA 3H8JA 1QB8A 3HBJA 2AKEA 1KYXA 1EVZA 2WIFA 3D6NB 4FLEA 1DG1G 5EZYA 3GAMA 3S1LA 1E63A 1JKIA 3KKZA 1ZH6A 2PU7A 3PNVA 3QLEA 1ULZA 4PCUA 2NO7A 2WI8A 4Q4LA 3VR3A 1JN0A 1H4VB 4FONA 1NXOA 3D8SA 5LOVA 3NVKI 3GN1A 3MWGA 3KIPA 1DELA 1UT8A 2PX5A 3L4SO 2F90A 4EY6A 3DOEA 3JZDA 3CVXA 3R9WA 4PEVA 3WLAA 2FW8A 2YASA 4HYYA 3DUFB 2C7RA 1VG8A 1TMKA 1ZITA 2L19A 2PJUA 2VOJA 2ATXA 3EBOA 3QG1A 3H1EA 1V4NA 1RBQA 1NT4A 2FSPA 1GPLA 2GILA 2J46A 2HA0A 3PQFA 3PWZA 5K3DA 4DIKA 3N70A 1IMOA 3IMFA 5FUBA 2TSYB 1EH5A 4CLHA 2ODEA 2YWRA 3IPXA 5D3QA 3ECCA 2ZRNA 1FMJA 2BSQA 2GPAA 3L7CA 2I33A 1MJNA 2QPLA 1S1MA 4MYDA 3R8FA 2Q4OA 2V7XA 3QE3A 3T7DA 2RDMA 2X4GA 4HEHA 1E3TA 1UP7A 1WS6A 4PYIA 4DLPA 3S28A 4DIBA 4JYZA 2AEFA 1ES9A 5IFLA 1KZ7B 2PH1A 2XF2A 3EGEA 3AVVA 1SPBS 1DGQA 2VJAA 1VC2A 5KX5F 1TE2A 1M34E 3ZVRA 2RCYA 2MCFA 4EQ6B 4ZYTA 4E5SA 5CYGA 1M5RA 2HU7A 2VHXA 2AG1A 1TT7A 4W1PA 3SEQA 5IRCD 4QJBA 2RI1A 3MWDB 4FINA 3QTBA 4UUAA 1A9ZA 1O3YA 4M37A 4OGWA 5DV9A 2CW5A 2C04A 5G40A 4O4LA 5BN5B 4KQGA 3C3CA 2ATEA 2HEGA 4RDXA 5JW6A 4U2GA 1SUWA 2PV0A 2JFYA 4X3PA 3O4VA 5FUXA 4ZAZA 3KYDA 3WQBA 2ZJ5A 4UEKA 3A58B 3L0CA 4Z8XA 4B2YA 5A7HA 1JKJB 2YHUA 4XQEA 1KWKA 4US1R 3E23A 3B53X 4TLDA 5D00A 2VXOA 3VR5H 4XB1A 4HH0A 3V4ZA 4YCMA 4EY3A 2IEGA 2GBLC 1I0LA 5BQ3A 2YZNA 1T9BA 4RORA 1HSOA 1I8TA 4TT3A 5A9SA 1CS0A 3SZMA 4BQRA 2DECA 1S3IA 1UEXC 3CRNA 3Q9NA 1VQ1A 3LBAA 1F4LA 2RJOA 3AG6A 3SKYA 1Y4AE 4Q18A 5I6DA 2FMIA 1UBGA 2ZTSA 2AN1A 3I58A 4FFRA 2J3MA 4LC0A 5DXAA 1IXKA 1IH8A 1MKYA 2X4LA 2Y1GA 2Q8PA 1NJ5A 3CRMA 3G49A 1EM8B 4PYKA 3LPAA 4HV4A 1D1QA 2AL7A 2VP0A 2OZLB 3WGKA 1SMKA 2NU9B 1DZ3A 1OIXA 1ZCJA 5JCXA 4QXPA 1DC6A 2H1LA 5E7IA 4I1OA 3NI2A 3NBXX 2WYOA 3I28A 5GGYA 2ENUA 1SKBA 3NANA 4ZCMA 1TMYA 2VSQA 2V3WA 1HEUA 3NHKA 1O95D 3VHQA 4YUYA 2VRCA 5CA1F 1T4CB 1RXUA 5CPFA 1J2UA 4HATA 4C6HA 3CCFA 3UY4A 1ITZA 1F8FA 1U2ZA 5K0BA 4BGEA 3C43A 5J23A 2EL7A 4KRGA 2Q5FA 1V11B 4NMLA 2LIVA 2NO0A 3QU2A 1LLFA 1KDZA 1WBBA 1CY7A 1T2DA 4BQQA 4C0JA 4XVHA 5T8KA 1AG9A 1YQTA 1A82A 2EG9A 5B1HA 1CJCA 2J31A 1DB3A 1QCYA 3BTOA 4PC6A 1YH3A 2OXIA 4EKNB 5JPDA 2CVPA 4XFKA 4F2PA 4O2AF 3AVQA 1H65A 2C9MA 2W6IA 1EX6A 2IPAB 1HRDA 3R6LA 1P6XA 3L6CA 2EIXA 5DNWA 4Z4CA 1NURA 2QYHA 2YCBA 3GGOA 3FAZA 3G0IA 3WFJA 1RP7A 4JQCA 1P5JA 3LH5A 3LVQE 5LC1A 1EWTA 1AB5A 2C5FA 4ETMA 1VMKA 4M60A 2Q5QA 4AWBA 3ZZTA 1U7OA 2FSFA 2O2GA 3PFHA 3IJRA 4F7WA 1H23A 1M8PA 2Z0MA 1WPGA 5FRDA 4ZZIA 4AY6A 2Z2IA 2GYYA 1EFAA 3ZGZA 3EGXB 3GWZA 5FAKA 1SUAA 1F2UA 4MA4A 3CW8X 5EI5A 5JAZA 5JWOA 1EUYA 3IT1A 5SZHB 1GGNA 1PEAA 2PZEA 3VX3A 4AQDA 1RJ9B 1SUIA 4JC4A 4D4JA 1RBMA 3HJFA 5DK6A 4KI7A 1I32A 2VAWA 4B45A 4H7HA 4R16A 3HDGA 3KSBC 3B5JA 4BX2A 4ZJYA 4HDMB 4WLNA 1WR8A 3N1UA 4ZRMA 3W8RA 1OLUB 1FUUA 2JAXA 4HVTA 3ZVKA 4W5OA 1K6JA 1XA0A 1M7GA 3AR6A 4JL8A 4AURA 4A36A 2RMKA 4R83A 3IXMA 2VZ9A 1EIWA 1IEVA 4Z99A 4G37A 4IMRA 1CEEA 4BFXA 4XCQA 5BXQC 5AVXA 3ZK7A 3QXJA 3F5MA 3MJVA 5BWNA 3WB9A 1YCFA 3ZHSA 4GNRA 3B3JA 1JFTA 2O54A 1B2RA 3ZV4A 1JLRA 4RHXA 4FJ0A 3BXGA 4NONA 16PKA 4HZIA 2WNIA 2UXBB 3W4KA 2XB4A 2XNDD 4DUGA 5KDOA 2JKYA 4GOJA 2HKIA 1UF9A 5JJIA 4EWLA 2A30A 1JVSA 5B30A 2XCRB 4ONEA 2XYVA 2X1HA 1PEYA 1S2GA 1YHYA 2FG5A 4J4BA 3JQBC 4IWNA 1L5KA 5J1SB 1M1UA 2EFHB 3E18A 3S2EA 2O5VA 4DIFA 2GAOA 3OPNA 4ZZ1A 1PBTA 3QJGA 4DC9A 4WD3A 3ADCA 3U9LA 1W6UA 5L7WA 2JJ1D 1DAMA 3A3PA 4DNOA 3F9IA 4RX1A 3TEJA 1AZWA 1O5OA 1Q17A 3AJDA 3RW9A 3TZLA 3V1TC 2B25A 4OVKA 4QXRA 5GONF 2ZBGA 3MOGA 2YJNA 1W73A 3OM1A 1GL6A 4TL7A 2N46A 1I5EA 3HVJA 4DABA 1PX2A 3QVLA 4MS4A 3EXHC 3CXUA 1XZMA 3O8OB 3FXAA 5AVTA 1E2HA 1KI9A 4H0CA 1CTQA 2J9FA 3JWJA 2G9ZA 2YIJA 3QKSA 3R3JA 2B9EA 2OO5C 3HHEA 3NWEA 5KSZA 4M38A 2AZMA 5AP9A 4CM3A 2AE2A 1DIHA 3IKVA 4ZO6A 5EXDA 3RSZA 2BMAA 3T06B 3TOZA 5LZ4A 1E2DA 1LRJA 1NBEA 2SCUA 3ESRA 4REQB 3N59A 4LMAA 1QXSA 1PK8A 4NCBA 4F6CA 4WGFA 3BZWA 4F91B 5KNDH 4MTCA 4OKSA 4BV9A 2BGJA 1LS1A 2QT0A 4IINA 2RHOA 4CFSA 2QRNA 2XXBA 3AZOA 1YB2A 3KWJA 5DPMA 2W2XA 1TCUA 2IYQA 3ADPA 3E4DA 4G0QA 4J29A 3V2HA 2O3JA 2HMUA 3H5AA 2BSAA 1WF3A 3IH5A 4IXMA 1T6YA 5CTJA 3VOAA 1N5LA 4BYGA 4DJDC 2ZZMA 2CVQA 4S1WA 4AYWA 3E3NA 4JV5B 1W5SA 5BQOA 1CERA 3PCTA 4X7MA 4BEJA 1KGDA 1ZH8A 2R5NA 3GHHA 2OOSA 3K70D 4UNSA 4BKUA 4N48A 2O8CB 3UAYA 1ZGCA 2AI3A 3IP9A 1FX0A 1TLLA 4C7BA 2IBTA 4UZEA 2HBQA 2HXYA 4B5LA 1U3DA 4E1AA 3PUHA 4HLDA 2ECFA 3ZDYB 1MEEA 3TTSA 5F5NA 1O9HA 1NLZA 1RLIA 3HUFA 3UB2A 1Z2PX 3TUIC 1J56A 5CVEA 2O5CA 2RI0A 3HCWA 3ZGOA 3EAQA 2IOFA 1CR6A 5J4YA 8MHTA 3M7IA 3H8VA 4C2BA 4EDFA 5ETJA 4A6PA 5LPNA 1OXMA 1DO8A 1GUAA 3A4LA 3EGOA 1MO6A 3JS5A 2FRVA 4FHGA 4KQKA 3ZW8A 1C81A 3AY6A 3QF4B 3O8RA 2VAVA 4RD6A 1QUEA 1T2EA 2L82A 3CY6A 1VE3A 3AKZA 4MDFA 3NIFB 3GZNB 4I6EA 2PMDA 5AHXA 4OBBA 4BWFB 1TVKB 4BKRA 3TPZA 1XDGA 4YUXA 5KYUA 2WWGA 2B99A 2R6JA 4Y1RB 1U4OA 3DZDA 4KMMA 3FJOA 4HNAB 2GVDC 1AHIA 2XKAA 3VR6A 4QDKA 4CJXA 4DA7A 1FP4A 4JMPA 5DGHA 1UDXA 1HTWA 3PNPA 3OQMA 1XMQB 3DOIA 5AW6A 5A9TA 1H2HA 1JPNA 1OWLA 1JA1A 2TMGA 4KE7A 2RGDA 3IKMB 4OXRA 1CK4A 2Q9BA 5HQJA 1U2SA 1EM6A 1JQ5A 2FK8A 3KL2A 4HLNA 3RWMB 2AOTA 1HLGA 1BJRE 1T91A 5DX0A 3RRXA 3M6WA 2XSZD 4I36A 5FEUA 4HDSA 4DWVA 2PYDA 2O2ZA 2PUTA 1KXJA 1M6HA 2Y0EA 3DBRA 1B74A 3N05A 4MVXA 2QLFA 2Y71A 3PXAA 5E7JA 2UVPA 2EFEB 4F60A 4K2AA 2O3RA 4NVRA 4CMHA 3ILYA 1ACJA 1KI1A 4PVDA 3D7RA 4IH4A 1ZEMA 3PLRA 4G0ZA 4AT1A 1ATIA 3J7TA 4UUPA 1R7RA 1Q0SA 4MPDA 4GM1A 2DWUA 4NAUA 1Z5UA 3RVSA 2O2SA 3TRIA 4JT2A 4OP1A 1RR6A 3HJNA 1Z82A 1K8YB 5EHGA 3SLGA 1OV4A 2I34A 3TB4A 4YASA 3F8TA 3B51X 2QZPA 1GFIA 4KBFA 2X7HA 1IY8A 4M22A 5TR9A 3T7CA 3IQZA 4WW0A 1BJTA 5HGXA 1I7LA 1SUBA 1W5BA 1XCGB 1PJRA 1E59A 2Q1YA 2Q2VA 3OE4A 1VSVA 3AEUB 4G26A 4LJ6A 4BNJA 1YDFA 2ONJA 1GPUA 3R4CA 3V7UA 5LNK6 1Y9AA 1OXVA 4AJPA 3DZHA 3L01A 2GPSA 1N2IA 2ZYIA 5CLHA 1SIUA 3U7FB 1MX1A 1PD0A 1VPLA 2PZMA 2EW8A 1SOMA 2XB2A 3BMCA 1DZIA 1TK9A 2ZYTX 1RYHA 3JAMA 1OZ0A 1T9ZA 3MJCA 2CNKA 3GEPA 1UJ2A 4PYOA 5DM2A 1O77A 5DYNA 2HI0A 3ZLUA 4XDYA 1R12A 4H77A 3TNJA 1QHNA 2EVWX 2LWIA 3RYHA 4DYDA 3T1TA 3FVRA 3ZI0A 4R51A