3UUEA

Crystal structure of mono- and diacylglycerol lipase from malassezia globosa
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
279
structure length
279
Chain Sequence
GRGGSSTDQPVANPYNTKEISLAAGLVQQTYCDSTENGLKIGDSELLYTMGEGYARQRVNIYHSPSLGIAVAIEGTNLFSLNSDLHDAKFWQEDPNERYIQYYPKGTKLMHGFQQAYNDLMDDIFTAVKKYKKEKNEKRVTVIGHSLGAAMGLLCAMDIELRMDGGLYKTYLFGLPRLGNPTFASFVDQKIGDKFHSIINGRDWVPTVPPRALGYQHPSDYVWIYPGNSTSAKLYPGQENVHGILTVAREFNFDDHQGIYFHTQIGAVMGECPAQVGAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords LIP1, secretory lipase (Family 3)
publication title Crystal structure of a mono- and diacylglycerol lipase from Malassezia globosa reveals a novel lid conformation and insights into the substrate specificity.
pubmed doi rcsb
source organism Malassezia globosa
total genus 97
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3uueA00
3G8YA 2O2GA 5HQ3B 4AZ3A 1XZIA 4U2EA 5A71A 1XZAA 5AI5A 1YS1X 1BEZA 1XFDA 5CH3A 1WCYA 4F21A 3WWPA 2QT9A 3ZLTA 3G02A 3WWOA 2HA3A 2XLBA 1DQYA 2I3DA 1FSSA 4AN0A 2QRUA 2QTBA 3WL5A 3R3YA 5AM3A 5T4BA 3V9AA 1ZD2P 3DOIA 5CT6A 3KWJA 2ZJ7A 2PX6A 5HKBA 1G4HA 4X71A 2WUGA 1C7IA 1FFAA 1BU8A 5CT5A 5AM0A 3WIBA 3I2IA 3B12A 1F0PA 2ZSHA 4B0OA 3FBWA 5K3FB 4EHBA 5BWBA 1ETHA 1L7QA 1H2ZA 4YK7A 4V2IA 5ALEA 4A5SA 5ISMA 4P92A 5EHZA 3VXKA 3IIIA 4Q3OA 5DWDA 3ZLVA 4H7FA 5I7UA 5DTIA 2ZJ6A 4AN1A 2BJHA 2HFKA 3D2AA 4H0CA 1K4YA 1QJ4A 3R3VA 5AM1A 2HA5A 4PSUA 4HZGA 1H22A 1TIBA 4DMHA 4OPMA 2OLEA 3K6KA 3DYIA 1ZICA 5T4FA 6YASA 4GWLA 3WK8A 2Z3WA 2V96A 4OUKX 2B9VA 5ALWA 1X2BA 3G0GA 1WB5A 1MX9A 2ACEA 4B0PA 4E15A 3LP5A 1U65A 2XE4A 3V1LA 4B9EA 3C6YA 2XUIA 5LYYA 1XZMA 2JGFA 3VJMA 5K3AA 2ES4A 4KE6A 3FWHA 4L3WA 1SC9A 3F8SA 2GYUA 5HF8A 5LZ5A 5EHXA 4DSZA 3A2MA 2RHTA 1QO7A 2VT7A 2HA0A 1LNSA 5DTJA 4BCCA 2XQIA 1QIMA 3DDUA 1DINA 1OCEA 5AM4A 1CUXA 1UK6A 4TVKA 1XZHA 1Y37A 3FYUA 3ZWQA 3DKKA 1ZJ5A 1MAAA 5I8PA 2C0QA 5LIPA 4WY5A 2IIVA 5ALGA 4H7EA 5AI0A 4OB6A 1MN6A 1ORVA 2ZYIA 4U2CA 1JFRA 5ALHA 3IA2A 4ZGBA 4X94A 1CV2A 5A7FA 4XWGA 2DSNA 1UKBA 1MX1A 1XRLA 4M0FA 4BZWA 1LPBB 3HLKA 5KBYA 2LIPA 4INZA 2QM0A 5JD4A 3E0XA 5AO9A 3DQZA 5C8ZA 4B80A 3NGMA 3HABA 2WIJA 4FFWA 4GW3A 3V1NA 1AZWA 1U4NA 4G1FA 4PSDA 5EIAA 4B7ZA 1D07A 4UUQA 4OU5A 5JADA 3I2KA 2QUBA 1CVLA 5JAUA 1Q83A 2QVBA 1CUJA 1DWPA 1QFMA 4FKBA 3STTA 3QMVA 5AK5A 5AKYA 3WA7A 5D7BA 5DNUA 5AI9A 2XQKA 1XQWA 1K6EA 1OXMA 4BP9A 2WJ4A 4FMPA 2YYSA 4WY8A 4X97A 2VF2A 3AJAA 4AX4A 2PU7A 2H9YA 4UBOA 1AMNA 1ACJA 5DNVA 1L7AA 3B5EA 3BF8A 3AIOA 3ZI7A 5ALUA 1A8QA 1H2YA 4OCZA 3M82A 1SFRA 4BB0A 2BGRA 2WKWA 3H0CA 5BV7A 1EINA 4WJLA 1P0PA 2BUAA 4G4GA 4C88A 2EDAA 4XJVA 3O4JA 1TCBA 4P9NA 3QH4A 3HZOA 3FOBA 1TAHA 4EBBA 1ZIXA 2QXUA 2E3JA 1XRRA 3C87A 1XZFA 4Q34A 4QWMA 2DFPA 4M0EA 2PUHA 3ZLUA 5JANA 4Q1VA 4AQDA 4FFVA 2XB6A 3W9BA 4DMCA 3WA6A 4HS9A 5ALIA 4BDTA 1ZI8A 3TRDA 3IULA 3FLAA 5CT9A 4J0DA 4BATA 5AKJA 2DQYA 2O7RA 1LGYA 3CCBA 1CUGA 4JEIA 3HC7A 2HFJA 1BN7A 1XZCA 1MO2A 1QONA 3BDVA 2WFMA 1QTRA 3D7RA 3JWEA 2CZQA 3K2IA 3ANSA 4H7HA 2Z3ZA 1BN6A 4S0XA 2JBWA 2XQGA 2Z8ZA 4OU4A 4MXDA 2HHAA 3DKRA 1Z68A 4FTWA 4EZIA 4F5ZA 1WPXA 1VXRA 2WHPB 3W2TA 3ICWA 1DWOA 1AURA 1HKHA 1GXSA 5I9IA 4GI1A 5KWIA 5JZBA 4DLNA 1F0NA 2C4HA 2PU5A 1GT6A 4WFIA 3BJRA 3G7NA 1W76A 5AKKA 2HM7A 1W4LA 2WM2A 5CW2A 1QIHA 5FOQA 3PFCA 4IH9A 4BRSA 1GPKA 1S8OA 4X85A 5K3EA 3VJKA 2HU8A 5K3BA 1FFDA 1EDBA 5E2IA 5KWJA 3ESDA 1Y7IA 3ESAA 1ZD3A 4ZI5A 2OAGA 5JZ9A 3STXA 5ALOA 5FXMA 5F4ZA 3VJLA 3F67A 4ZREA 2QJWA 1J06A 3BE8A 3O9MA 3E4DA 1KEZA 5ALXA 2X76A 3UUEA 5LZ4A 2WG0A 2GBCA 5KREA 3WWEA 1CUEA 5HFAA 4BC1A 2WU4A 1LBSA 4MJ3A 2WTNA 2AXEA 4OYLA 1SCIA 2AJCA 1W6RA 3E1GA 1N1MA 3WL6A 3ESCA 5AHXA 1UKAA 2FJ0A 4X6YA 4JYPA 1CUWA 3HRHA 3R41A 3I6ZA 3E3AA 1UT6A 3I6YA 2Y6VA 4PSCA 5HF9A 2P8SA 3I6MA 4DYHA 5AKZA 4AO8A 4NS4A 3V48A 1FFCA 2XI4A 3QMMA 4QDOA 2WQZA 2WFLA 1IUNA 1ODSA 2CUTA 3N0TA 5EHQA 2XUQA 4AO7A 1LPOA 1Y7HA 3M83A 4KE9A 5LKRA 4KAFA 1BEEA 1N8SA 2VEOA 2PUJA 1GGVA 5HKAA 1EH5A 1EK1A 1JKMA 4B84A 2W6CX 2BUCA 7YASA 2ZVDA 1XLVA 3W06A 3IURA 4BAGA 3DCNA 2PM8A 2XUPA 2D0DA 4QDZA 1CIJA 4G9GA 4U2GA 2C7BA 5LZ8A 4B85A 3VVLA 2H7YA 2XT0A 4KJXA 1K8QA 5JAPA 5C8XA 4M0MA 1W52X 3FSGA 2OGZA 4H7IA 1N5MA 3D2CA 2WUDA 1JU4A 1USWA 3AILA 4Q3KA 2PSFA 2FJPA 2BCEA 2WLSA 4UBIA 4EY4A 4KACA 3TJMA 1R50A 1A8SA 2HA7A 4CG2A 4UHEA 4PQEA 5FPQA 1XRPA 1QO9A 1ZD4A 3OOSA 1TQHA 1UOOA 2YXPX 5AKXA 4U2DA 4FNGA 2IITA 2WILA 4BCBA 2HRRA 4Y2RA 1VJ5A 2XMBA 2HA4A 2QXTA 1MTZA 3GFFA 2J3QA 3T4UA 1X70A 3EQ9A 5AOCA 5C7YA 4EY6A 5CMLA 3FVTA 1GPLA 4ETWA 4Y2VA 3WWCA 1WB4A 2XUJA 2I3ZA 4LXIA 2K2QB 4FLMA 4QNNA 3F98A 1XRMA 2DR0A 3X3HA 3A70A 4P08A 5CH5A 3IVMA 3CCCA 3WKCA 1QZ3A 2RGUA 1XLUA 3H19A 2PSDA 4UHDA 1R88A 4WDRA 3I1IA 3GELA 3ZV7A 4C6HA 2XUGA 3O4IA 2JGEA 5SYMA 1UOQA 4Y2PA 1DWQA 3H1BA 3I2HA 2Y6UA 1UK7A 3GBSA 4HXFB 1CUUA 3C5WP 1Q84A 3K9BA 1R4ZA 1XKLA 3N2ZB 2HADA 1JU3A 4UHHA 1DX4A 2GZSA 1QLWA 4QDUA 3DJYA 5LP1A 1UWCA 5AI8A 3EBLA 3PDCA 2HRQA 1FFBA 2HA6A 4A23A 4KAJA 1TKRA 4J3JA 5JIBA 3DS8A 3UUFA 1VA5A 5CRIA 2WUEA 4I19A 5AP9A 3R0VA 2PSHA 4RE6A 1GKLA 1EB9A 3V1KA 3FYTA 4IH4A 2I78A 4LKOA 4JYMA 1VOTA 3WJ2A 3HACA 5DYWA 5FUMA 4KAAA 3BXPA 1BRTA 5EFZA 4BAZA 2PBLA 5HF5A 1RP1A 1YSCA 4FHZA 1NX9A 4BAUA 2Z5GA 1LPMA 1UOPA 1T2NA 4KYVA 1ZD5A 1GPNA 2ORYA 1MJ5A 1PJAA 2HU7A 3U0VA 4H7DA 2GYWA 1UK9A 3WWDA 4K6KA 2C5GA 1ZI9A 4CG3A 3FSGD 3C45A 2O2IA 2JGKA 1QIIA 3I1YA 2RONA 1XZBA 1YS2X 2OCKA 4Y2TA 4LXHA 1CPYA 4U2FA 4J7AA 4OD0A 3FNBA 4GHWA 1UK8A 5A2GA 4G5XA 4X92A 3STYA 5FPPA 3DD5A 3FAKA 3KXPA 4UHBA 3U1TA 2ZYRA 1EB8A 3AUKA 4W63A 1IVYA 2EDCA 1R3DA 3CXUA 1E5TA 5AKLA 2HA2A 5FDFA 1QIDA 4HRXA 4L9AA 4FNMA 5HQ3A 5IH7A 1RYYA 3C8HA 4MYDA 1EVQA 4IQ4A 4HTAA 4GECA 1AQLA 3MUOA 4C4YA 2OXEA 1MAHA 4NVRA 5EI5A 3FCXA 4WFKA 2D5LA 1WB6A 3HYSA 2XMGA 2IX9A 1DU4A 1HDEA 1H2XA 1SCQA 4LYEA 2RIPA 3DEAA 5HCUA 1O6FA 5J3JA 4UBKA 4LXGA 4UBJA 2V98A 3AFIA 4UBNA 2WHQA 1QIJA 5K3FA 5E4TA 4X6UA 3M81A 4BC0A 4QEKA 3LLCA 1QOZA 4DMFA 1CUAA 2VATA 3GA7A 2Y2VA 2QMQA 4HVTA 5YASA 3LIIA 5HFNA 3PF9A 1JJFA 1GQRA 2JF0A 4J0GA 3RLIA 3D5EA 3STWA 1CUVA 3HEAA 4UBLA 4WFJA 4Y2UA 3WK7A 4G4JA 4MEAA 4QLAA 2QKYA 3O95A 3H2HA 1CRLA 1DT3A 3VVMA 4DNFA 2FUKA 3G0CA 2ONCA 3WLAA 4OB7A 2DQZA 1E3QA 5D3KA 2R11A 3DYVA 5AI6A 1THGA 4I4CA 3WIOA 4F60A 1L7RA 3WYDA 4W9RA 4EY8A 2QS9A 3F9CA 4B83A 5IVIA 4P93A 2O2HA 3VISA 2Q0XA 4IHAA 5AKEA 5E4JA 1QTIA 4KE8A 5LKAA 5AOAA 1XROA 3QMWA 3WI7A 3QZUA 2XUAA 1VKHA 1CUSA 4Q05A 4Y9SA 3EF3A 2UZ0A 2XUOA 2J4FA 3R3UA 5FLKA 1MT3A 1EI9A 3IDAA 2WJ3A 4UBMA 1GQSA 1XZDA 1AUOA 1KU0A 2XMCA 5ALDA 1EHYA 3WK6A 2CMFA 5EIEA 2WHRA 1FJ2A 3IUNA 1ODTC 3BWXA 4EY5A 5LZ7A 4L0CA 1XQVA 2CJPA 3R3ZA 4DNPA 4Y2XA 3WK9A 5ALTA 4MQLA 5DYYA 1LZLA 1E8MA 3KSRA 4FBLA 4CCYB 4ITVA 2XMDA 3B3QA 1WHSA 1PV1A 1T4MA 2ACKA 2OCIA 4B82A 1BS9A 2WIGA 1WHTA 3G0BA 2QUAA 2CB9A 1F8UA 4PV7A 2VA9A 4AMZA 5IKXA 2X5XA 2W22A 4N8SA 4Y7DA 1P0IA 1ODCA 3AZOA 3ESBA 3IUQA 4EB0A 3RKSA 2R8BA 4AMYA 3QBJA 1CUIA 1LPSA 3AZPA 4BRZA 2WFZA 1YA4A 1E66A 4X95A 4PW0A 5C8VA 5CT4A 2ZYSA 3C6XA 1VE7A 5AI4A 3HSSA 4MYSA 1ZOIA 3SX4A 3O4HA 1J2EA 2WTMA 4B81A 2XLCA 3CN9A 4CIBA 3Q0TA 3DL4A 1DT5A 5JAOA 5ALNA 2B20A 3DL7A 2G5PA 5AKIA 1U8EA 3KDAA 3S8YA 1ACLA 3OTQA 3JW8A 3WQHA 2WIDA 2ZJFA 3STVA 3WYNA 3W04A 3C5VA 3C43A 3KWFA 4J0CA 3H04A 1YAHA 1XZEA 1TK3A 1F6WA 1J1IA 1YA8A 4DNOA 4E14A 4EY7A 4O08A 5ALRA 4G8DA 1QIEA 1SOMA 4K6GA 5K3DA 4IO0A 1AC5A 3GUUA 4X93A 3STUA 3EIOA 1H23A 2WU3A 1C4XA 3OURA 2Z8XA 4QWWA 4RPCA 3IUJA 4GLBA 3OM8A 1HL7A 2ZSIA 3H2KA 1BCSA 3AZQA 5JZSA 2G5TA 1WPRA 3H18A 1P0MA 1AGYA 2VAXA 1ZI6A 1CUYA 4GDMA 4Y2YA 5JALA 4BVKA 1THTA 2YH2A 2AJDA 4EA6A 4I3FA 4LYDA 3EQ8A 4C4XA 3WZLA 2GYVA 1BCRA 4UHCA 2QOEA 1LLFA 5LLSA 5IVHA 4AZ0A 5DJ5A 5AKHA 2PL5A 1X2EA 3C70A 5EGNA 4KRXA 1XZJA 2OQVA 1Q0RA 5LZ9A 3QPAA 4FDMA 3R3WA 1UKCA 1VZ3A 2WG1A 1GKKA 1JJBA 3FCYA 5ALLA 1CUCA 3W05A 2Y2UA 3FVRA 2VTVA 3BIXA 3QPDA 5JASA 2DHCA 2AJ8A 3FYUB 1W75A 1QGED 3ED1A 1ORWA 4FLFA 4N8EA 5ALMA 3BJMA 4UFPA 1MU0A 3NOXA 5CURA 1R9NA 5AIBA 2ECFA 5CT8A 4KR0A 1JMYA 2J4CA 2WHPA 4W1SA 4B6GA 3MGAA 2ROQA 3G0DA 4LIPD 4A16A 2VSQA 2PSEA 1UZAA 5K3CA 4UPDA 5AJHA 5DYTA 5IVKA 3Q8WA 1MX5A 1AKNA 1O6GA 2XDWA 5A62A 5HK9A 1BROA 1E89A 3D4LA 1YR2A 2DCMA 5AK3A 1ZGCA 1E8DA 3LCRA 2WG2A 3WK4A 2AJLI 3OG9A 4X6XA 1OILA 4UFOA 4DTCA 2XMQA 2C0PA 3H2IA 5A7HA 1YCDA 1YAJA 1G66A 1TRHA 4PO3X 1LPAB 1CR6A 1AX9A 5ESRA 2QR5A 2XMSA 1CQZA 1ZGBA 5FKJA 1JT2A 4BVLA 3ZPXA 3IBTA 1K5PA 1XZLA 2AJBA 3IUMA 4ARAA 3G0IA 1JI3A 5JATA 1IUPA 4CFSA 5AK6A 4C01A 1EA5A 5D3ZA 4ZXFA 2XMZA 3HI4A 4KE7A 1DQZA 4X7BA 3H2JA 1MPXA 3A6ZA 3DLTA 4CI9A 2GBFA 3KD2A 1VE6A 2QJRA 2JEYA 4GBGA 5CH8A 3C6BA 3D0KA 3F96A 2XUFA 1MNAA 3G9TA 5AKGA 1CUZA 3M3DA 3WL7A 3I2FA 1CLEA 4BZZA 4CIAA 3TGLA 3PUIA 2FX5A 5JAHA 3RM3A 1VLQA 2XUHA 3IB3A 3V1MA 4EUSA 3T52A 3L1JA 2VJDA 3ILSA 5T4EA 4RE5A 4ZWNA 3H1AA 4MWTA 4ZRDA 3WK5A 4Y2SA 3PF8A 2YASA 4H7KA 4DM7A 3P2MA 4JUIA 4BCDA 3PE6A 2ZYHA 4YPVA 4CG1A 1IUOA 1XZKA 2RI6A 1K63A 1A88A 1U2EA 3BIWA 1A7UA 4XVCA 4E11A 5BWCA 5AOBA 1ZJ4A 1LPPA 4KRYA 3BF7A 2Y1KA 1E8NA 3H2GA 4OSEA 1EVEA 4RNCA 2JEZA 1TCAA 1UFOA 1M33A 1XRQA 2JGMA 4XIIA 3PI6A 4G8CA 4BBZA 2I03A 3WL8A 4DMKA 3L1IA 2GBGA 3ICVA 1WOMA 5LZ2A 2QZPA 3AINA 1YASA 1GZ7A 3G9XA 3QM1A 2HU5A 3QYJA 2H7CA 3ANTA 3O0DA 4RGYA 2OCGA 3L1HA 1CUDA 2C5FA 5K5EA 4BTVA 1VA4A 1UXOA 4D9JA 2NW6A 3WKDA 5CXXA 3TEJA 4NZZA 3MVEA 5DLPA 1ZIYA 5AICA 3AIKA 4BDSA 3A2LA 1J07A 5CBKA 4DSAA 2O7VA 4Q3LA 4HRYA 2JGLA 4CCWA 1PFQA 3R40A 2WJ6A 1QIGA 1RWQA 2PPLA 4IH1A 2PKYX 5FRDA 5AM5A 4BYMA 2WUFA 3NWOA 4PNZA 2VAVA 3FLEA 4HXEB 3RK4A 4H77A 3QITA 4BE9A 2B4KA 3G9UA 5A6VA 1R9MA 2CKMA 4FBMA 2BUBA 3WZMA 4W1PA 1W1IA 4YASA 4MEBA 3YASA 4X91A 2BKLA 3HJUA 1BE0A 5ALPA 1XRNA 4HAIA 4J0JA 5AH0A 3OC0A 5HZGA 3WKBA 3SC2A 1LZKA 1XQYA 2JGJA 3QPCA 4QE3A 1B41A 3PUHA 3PFBA 5H3HA 1G5FA 4J0HA 4Q82A 3S2ZA 1NU6A 1A8UA 1SCKA 3WJ1A 2WFLB 4ZV7A 4BTLA 5JYCA 5AK4A 1QIFA 4Y2JA 2VJCA 1IZ8A 4BVJA 2X8BA 5ALSA 4ZV9A 4J03A 3FYUC 5CTAA 3A2NA 4QDTA 2OGSA 1HQDA 4K2AA 5HK8A 4GXNA 1IZ7A 4QDXA 2H7XA 2G4LA 5D6OA 4HXGA 1EX9A 1QIKA 5ALFA 5JARA 5ALJA 3D3NA 3AIMA 2OGTA 1WM1A 4JH0A 4Z49A 2B61A 2HIHA 2V9ZA 1YB6A 1HPLA 2OCLA 1ISPA 5IVDA 3LS2A 1IMJA 4E46A 1B6GA 1NU8A 4H18A 3D2BA 5E4YA 2JGIA 4FWBA 1CUHA 4X90A 4BP8A 1CQWA 2XMRA 2XUDA 4KEAA 1DX6A 3BDIA 2C58A 4N8DA 3MUNA 3DOHA 4XX1A 4J0KA 1DTEA 4DGQA 1YB7A 3JYHA 4TGLA 3I28A 3FLBA 3WKEA 4QZVA 5FV4A 2OAEA 2HL6A 4H7JA 4AO6A 5DNWA 2VQ6A 2OPHA 4AB1A 1QE3A 2EEPA 5AIAA 2VJBA 2WIFA 3H17A 3CN7A 1MNQA 4G4IA 1JMKC 3SWWA 4K5QA 4TPKA 5A7GA 4FOLA 3UMJA 3PICA 1XZGA 2XQJA 3WMRA 3W9UA 4L72A 4BE4A 1CUFA 5ALVA 3R3XA 3HXKA 1LPNA 5ALZA 3LIPA 2V97A 1EDDA 4NMWA 2VT6A 4DIUA 4C4ZA 2PSJA 4U2BA 1G42A 1LBTA 5CXUA 4W1RA 2GBIA 3KOOA 1XKTA 5HF6A 4N5IX 4K6HA 3C8DA 1N5RA 4WCVA 2H1IA 2HDWA 3VKFA 4C87A 1C7JA 2OG1A 1TCCA 2BAGA 2XUKA 4YX9A 4H35A 5ALKA 3C6ZA 3G9ZA 4Y2QA 1HLGA 4OYYA 3WKAA 3VDXA 5ALYA 2DHDA 4MWSA 4G9EA 4LHEA 5SYNA 5T4HA 4F0JA 2RHWA 2JIDA 2PVSA 4GEGA 3NUZA 1CEXA 2CEKA 4ROTA 1KU6A 3RARA 2DHEA 1R1DA 2OQIA 4WDQA 4ARBA 4OB8A 2WSLA 1VZ2A 2BGNA 1EDEA 2RAUA 1QFSA 1VXOA 3EQ7A 4UHFA 1EXWA 1CFJA 3OPMA 3I2GA 2WIKA 2CBGA 1HBJA 3D59A 5ALQA 1FFEA 3GROA 4MQMA 4AXBA 5JD5A 5EHNA 1Q0ZA 2G63A 5JD6A 4FLEA 3GZJA 1I6WA 4JNCA 5C81A 4J0IA 3DNMA 4N5HX 3O9VA 4QLOA 1CUBA 4UFNA 4QA9A 4X3CA 1P0QA 3I2JA 3SK0A 3O4GA 4B9AA 4C89A 4PF1A 2XQFA 1XQXA 3F97A 2J3DA 4CCYA 1EK2A 1JJIA 4G8BA 4X00A 5AM2A 2GZRA 3BL8A 4DNQA 5BOVA 1H2WA 1XLWA 4W1QA 5EIHA 5FP0A 2BFNA 2VJAA 3QVMA
chains in the Genus database with same CATH superfamily
3ZGLA 2RAFA 3VYVA 1EQAA 1Z6AA 3WXMA 1VIYA 2PS9A 4YCBA 3F4KA 1RQGA 1XZIA 2YZ7A 3LXUX 4U2EA 3IE0A 1Y3AA 2G80A 2O6HA 3IJRA 3ZDFA 1VG8A 3I8XA 1PK7A 3BBLA 1FTYA 2FFAA 3MF4A 1XFDA 4OQNA 5CH3A 1W35A 4QU8A 1VRCA 4JI5B 4CM6A 5HG0A 4F21A 1ZCZA 3WWPA 2QT9A 3PFIA 3G02A 3GG9A 4M83A 1FFGA 1VG0B 1C8VB 2X3FA 4WD3A 1RI1A 2HBRA 4S2EA 2I3DA 2J5XA 2PT9A 2RHHA 3CLKA 5EKDA 5KPDA 1T25A 3I0MA 4JT4A 5ENVA 4AN0A 3L04A 4BFTA 1H1DA 2X3YA 4HEQA 3VU8A 4RD3A 5J63A 1ZNXA 3E8XA 2CL6X 2QTBA 2VUSA 4OGKA 3LLVA 4KXYA 4TQ9A 1AKTA 3S5UA 5I7RA 3MGKA 5JVDA 1L9KA 2Z04A 3DE5X 3EQ6A 5HMMA 4IJ6A 2I99A 5HDQA 1CDDA 3DOIA 3OLVA 3IQIX 1A96A 1RM5A 1RWWA 2BC9A 2FG6C 2G71A 4RZQA 1SULA 1DARA 3FPAA 3PHBE 2PX6A 3HVIA 4N1AA 4OUDA 5JXHA 5HKBA 4IDNA 2B78A 2O4UX 4N82A 3HBAA 1SEVA 3J80A 1AUPA 4BO8A 4Z7JA 1E1RD 3SHTA 4FJ0A 5JI3E 2ZCJA 1C7IA 1W48A 2H2HA 5FL7D 4OAPA 1DCTA 1PNTA 2FN8A 2Q41A 3W6UA 3I9FA 1JIQA 2WIBA 3A6DA 4KQ9A 3WRYA 1E4OA 4MUJA 1WLYA 4F8EA 1CEQA 4FMDB 1XCJA 5TRTA 1F0PA 3I3OA 1QO0A 1IZ0A 3JSAA 4GMFA 4OGFA 3W6ZA 4B0OA 4CKEB 3SZGA 2IV3A 3FBWA 1EAYA 5HWSA 2FE4A 2C82A 4Q19A 4HN2A 1D6MA 3PXGA 2QGFA 1BYUA 5TB5A 1MXFA 5A3JA 1KERA 1U1GA 4NATA 5E9WA 1H2ZA 1E98A 5HA5A 3ORYA 4YK7A 4F9EA 4BXOB 4A5SA 3H4IA 4YXWA 1LEHA 4H6XA 2A9PA 1YFKA 4LDAA 4QODA 4DMUB 3WIEA 3B7WA 5KU7A 2VJLA 3L0SA 4V03A 1KKMA 4DDHA 4X65B 3ANXA 1F6BA 1HQKA 4LFBB 3TBKA 5CDUA 2PXHA 2J0SA 3CUKA 4H7FA 2FX3A 3W2FA 2PQMA 3COWA 1KYQA 3N2NA 3Q85A 4TSRA 1USKA 2J33A 5ECWA 3QP9A 3HEMA 5I7UA 1CQXA 2ZJ6A 3AG5A 3EDRA 2D7DA 3AX6A 2V45A 3CUWA 4FYJA 1PKXA 4AN1A 3NQ41 2BJHA 2HFKA 2G88A 3LBAA 5J2TF 4BV9A 3FYCA 2O2DA 1M5TA 2ILVA 4G63A 2RJ3A 3BMOA 2CV1A 2ZXFA 5KOYA 3MWKA 4PSUA 4EGSA 1C9KA 3ZWXA 4LDPA 5KYXA 1UBSB 4GRIA 5HZKA 4DPKA 4KOEC 1AF7A 3BCUA 1HE8B 1ABEA 2W6QA 1KOLA 3F6CA 3SQOA 4GYKA 1GT91 4M8NE 1NN3A 4GEKA 2O14A 3TIGA 3U19A 1XJCA 3K9WA 3VNSA 2I7TA 1TLFA 4Y6GB 4HWTA 1OTXA 1RKVA 1E7MA 3VHRA 2JAOA 1LFAA 4TWBA 4O0MA 1EWKA 1HT1E 3JRXA 1NY5A 1R0YA 3EMKA 3N07A 3Q7EA 1N7GA 2B9VA 1AQUA 3BE6A 3N87A 1S2OA 5FNVB 3EF1A 3PCXA 4QAJA 5AJYA 5ERGB 3SXUB 5I7FA 3PXAA 1WSDA 1T9BA 1OBVA 3KZMA 4L4RA 1OHHA 1KXZA 4V2UA 4C08A 3BGDA 3QWAA 4JVLA 5LSAA 2IC5A 4D8UA 2J5RA 4TMZA 2PMEA 4P58A 4RHTA 4C7BA 3FHLA 1GDTA 3OJ0A 4TS1A 4L3VA 2HUNA 2XTAA 1AKVA 5FF9A 1B4DA 1O97C 1XZMA 3M6WA 3SOPA 4UD6A 2EKPA 2ES4A 4BJ5A 1EXNA 1IMOA 5U1PA 3U48A 3IT3A 1UDBA 3OMLA 4RNDB 3VI4B 3AR4A 1SC9A 4M0KA 3F8SA 4DR4B 4D8TA 2BR5A 5EQJB 4CNQA 1WBJB 1Q7GA 1R0CA 2B4QA 1A27A 1RLOA 1E2BA 3HYNA 1M1ZA 1Y6ZA 4ZYLA 1QUFA 3DXZA 1C3VA 4DQLA 4OLJA 3IUEA 4M9SA 4CBVA 4NZPA 4P3KA 5TPWB 4QU0A 1IAQA 2P5UA 1Q77A 1LNSA 3RSLA 2IV7A 3AHCA 2XQIA 3I6BA 1QIMA 4B74A 4IVPA 3ES9A 4TROA 1S96A 3I4CA 4YRZA 4J9VA 5CXSA 4P2BA 5DKFA 5JC8A 1CUXA 2AGVA 1E64A 4PYIA 2HSWA 1OWPA 1JAHA 2E37A 2H3EA 3T7AA 1TMKA 3H13A 4DE5A 5MHTA 4IZOA 3Q3IA 5JC1A 3DKKA 3RJMA 3H2YA 4YQEA 5BNZA 3N5KA 1KY3A 2C0QA 2BI8A 3MMPA 3OZRA 1YD7A 2JATA 3NEJA 3LUGA 3P5SA 4Q47A 3D3WA 4CG0A 2PS1A 4WY5A 1T91A 3TLYA 3BWBA 1MV5A 2ZBFA 5ALGA 4BX9A 4H7EA 1SJ9A 5EZSA 4WCDA 4AZTA 3LKVA 3Q3GE 5HJ7A 4R71A 3ETGA 5M34A 1YA6A 4YAGA 1NHWA 2C9YA 3DD1A 2WA1A 3BD7A 3GLQA 3NKLA 1PZGA 2PFGA 1KEKA 2VWQA 3VO1A 5ALHA 1XA0A 3KXIA 4XD2A 4DMMA 1NYLA 1TVKA 2C83A 1XLTA 1DKUA 4DIDA 4ZGBA 4IKOA 3DPSA 3VGJA 2FETA 2JJYA 3A06A 3IQFA 1VFNA 3NPAA 2VSNA 3D4NA 1UKBA 1IM5A 1ZRMA 2VSYA 3WB2A 2BBOA 1KAHA 4LWZA 1Z33A 4RHFA 4V02A 5G1NA 1G64A 3ZU6A 2FQQA 3JU3A 3NTRA 1LPBB 1YRLA 3HLKA 4NNOA 4D9EA 4ZO7A 3IO5A 4D3DA 1BAPA 2F2TA 2Z57A 4WLVA 5KVQA 5I47A 1OZAA 4UEOA 3K92A 2HJSA 2ZJ1A 5AXBA 3VPBA 2JGDA 3RT7A 1HNZB 2V1UA 3DJFA 1GA6A 5A3VA 1T2DA 3E82A 3HBMA 4IWXA 1X7GA 5AO9A 1KE2A 3VR4A 4B6SA 5IANA 2IEAA 2ZJZA 3T7CA 3ZXYA 4ZALA 5B1YA 5EYPA 3OCUA 2R84A 5CNJA 2J1LA 3NGMA 4B80A 3QGMA 4G5FA 3VZCA 2ZSEA 3BEDA 3HABA 4YJ3F 2V6GA 1R8YA 2FK8A 1Y4SA 5TMPA 3IIMA 4I1OA 4H1VA 3CX4A 4JIGA 1I2ZA 3Q72A 1AIPA 1QAOA 1UPXA 4GW3A 3LE8A 3AUYA 4JX8A 4TQGA 1HSOA 2W6IA 3U0BA 2FSVA 3V1NA 3KKPA 3WG9A 2XNDD 4BS9A 3OTHA 2CUZA 4I4TF 4GOKA 5LYJF 2ZIEA 4OM7A 4B7ZA 1D07A 4LBYA 4UUQA 4F86A 3H5AA 4KPYA 5ERXA 2G9NA 1V7ZA 1PS8A 3FUCA 3GPBA 1KBQA 4OP2A 2QUBA 4UNRA 2JFOA 2X8JB 4G0OA 4MAMA 5JAUA 2WTUA 3E7WA 2ZWOA 4GRDA 3QLVC 5LB4A 2CMKA 1NQXA 4MARA 1XA3A 2QVBA 2VG8A 4PO1A 3NDBB 3MWJA 2EFCB 4BUZA 1G98A 5AW6A 5EPOA 2I67A 1G59A 3QOYA 1DRKA 2IHKA 1P7VA 2RIRA 3AOEA 2A7XA 1GPMA 3RRNA 1M34B 4GX1A 2V58A 3UAOA 5TF4A 3EVDA 4AFNA 1LBEA 2X6QA 5KS2A 1RYNA 4COOA 1A5TA 1DAPA 3PLNA 4KXUA 3UO8B 1NE2A 3SHVA 3DCIA 3TH5A 4JGGA 1M2NA 3K72B 3SIPA 5HZHA 4QGHA 2EJTA 1GPYA 3KQWA 2Q3HA 4R2LA 3WYBA 4MI9A 3V00A 2P2NA 1BXGB 1QQBA 4UBOA 2W2TA 1I0LA 4EYKA 3WRXC 1KI4A 2E9SA 4D9HA 5KNCA 2IL1A 4KV9A 4RVUA 5HKOA 1B16A 1JKJB 2P7IA 3ZK7A 1L7AA 2JJ1A 3B5EA 3N6VA 4DFDA 4KTVE 5FYDA 4BMVA 1X14A 3I8SA 4K1LA 3B9QA 4HDKA 5EWLB 3RPEA 1AHHA 3IUSA 3Q6MA 4CQMA 4Q7KA 3IUYA 4E32A 3GI1A 1ODJA 3M82A 1YACA 1SBIA 3CPJB 2R6JA 4LGCA 3B2EA 1ZVMA 2EBHX 2FUCA 4JB3A 3TFQA 3WDSA 4WJLA 3SLGA 1P0PA 1FPQA 2HC9A 4I1UA 1T5OA 2A5FA 2AOTB 3KB1A 4M86A 1H8ED 3M4YA 4GSYA 1VFPA 4OIMA 4XB2A 3BL6A 3IAHA 1R4NA 4P4UA 3H6HA 4PCAA 4A26A 1TCBA 4FQ8A 4PR3A 1E62A 1Z6GA 5LXTF 5ULLA 2A3NA 2IIBA 3LGSA 3LYUA 1TCUA 3FNGA 4REMA 4ZXPA 3WB1A 1ZH2A 1VP3A 4GC9A 4G1CA 5JCZA 1XZFA 1EBFA 1W6UA 4K1XA 4Q34A 1M2WA 1EWVA 2NO1A 1DHTA 2NQTA 2PZEA 3NCHA 4KDRA 1JF8A 2PUHA 3VZBA 4HLNA 4IFTA 4CVNA 2HV8A 5BWNA 4CMJA 5JANA 5HHTA 1R18A 3AC0A 2IYLD 3VR6H 1H4SA 2VLBA 2HRDA 3N8GA 4AQDA 4CL3A 3HU5A 1OH7A 1NSTA 2NP7A 5JNTA 3FD8A 4FFVA 3TUIC 2OILA 1FFSA 4WV3A 1UDRA 4KXQA 2Z8YM 1JAIA 2XB6A 1KS2A 2YC2C 3UYKA 5I9LA 3RK0A 3B8HA 5DOVA 4TMFA 3OVMA 3WA6A 4U39A 1VMKA 4HS9A 1MUUA 4A36A 4GL2A 4QBGB 1ZH6A 4AZ0B 4BDTA 1GZDA 1G17A 2EKDA 1JEQA 3RYIB 1E7QA 3BD9A 4JLVA 1SO8A 2EEZA 5JXWA 1KO7A 3K4PA 5CT9A 3H84A 5JHGB 4DB4A 4MV0A 2ZRCA 3NXKA 4CM8B 4KQCA 3LPNA 2PGJA 2Q5EA 1ISIA 1WUHS 4MGZR 1JE1A 2BEWB 1X92A 3UBTA 4FXPA 3JQ7A 1DC8A 2X41A 1BH2A 2XVMA 5AJTA 4ARZB 3HC7A 1YC5A 5CLIA 5TMBA 4PC3A 4K26A 4RANA 4GPD1 1PTJA 3IDZA 4RHCA 5H0IA 2QI9C 3RVDA 3BDVA 2DEUA 1QONA 5IFKA 3A4IA 2DR2A 4GXQA 1C9JA 5EXTA 5DIZA 4F91B 1IC6A 1K7XB 1O9BA 9ABPA 3LC2O 1W0KA 4LNUA 4RIHA 4WT7A 3K70D 1W4RA 1JGTA 1TYBE 4R5MA 2XYQA 1PHRA 3IX7A 1JLLB 3OQVA 5CA1F 3Q3EA 3UTCA 1NVKA 1T2VA 4UARA 4LEIA 4ZZ2A 2FQYA 3EC7A 4M1KA 3M9WA 5AXAA 2PKCA 3L0CA 2Z3ZA 2ZE5A 4YRAA 3A3NA 1WDLA 4X8LA 1M0SA 3STHA 2MSLA 2HN9A 3EGXA 4BMXA 2JBWA 2DFLA 4HFNA 2Z8ZA 4OU4A 5CBPB 4HNVA 4HTFA 3PUKA 4H15A 4MXDA 3LPCA 2ZUTA 2HHAA 4Q00A 1MRZA 3SQNA 3USES 1NQOA 2A0XA 3M1LA 4DJDC 1FX1A 1KDOA 1QRAA 4URZR 1SC1A 3W2TA 1K4KA 2XCQA 4UTVA 3OF2A 3GRYA 1NDQA 4YMLA 5BQXA 4XKJA 3K0SA 3PPYA 3AVVA 3QW4B 1DL5A 2HO4A 4JGBA 1AURA 1HKHA 1GXSA 2XA1A 3DPIA 5AUQA 5I9IA 3LY9A 1IOZA 3ZHXA 2GSDA 4NCIA 5LDDC 1NZJA 2J32A 1CIVA 3EA4A 4MNTA 1YUMA 3REOA 3ZE6A 4O25A 2O2EA 4DV1B 1BQ3A 5KQSA 1LJ8A 3LDUA 4WFIA 2YC4C 3BJRA 4WEQA 3AJ8A 2EWMA 1UKYA 3A3KA 1W76A 3AF0A 3LYHA 1SKYB 3Q12A 1W4LA 2V6JA 4TLLB 3EARA 1FNDA 1G20A 2XE6A 4B44A 1W5SA 4NHEA 2O2ZA 4TVBA 4D96A 5CW2A 1LLQA 4KBYA 1E6MA 2YBEA 2C00A 3Q5GA 1T2AA 4C6TB 3C3JA 1GUBA 2GPSA 5K8UA 2YTZA 4MUMA 5J40A 4WA7A 1ZSNA 5BMVB 3DVQX 1KQOA 5SYAA 4X85A 2EZTA 3VJKA 5H70A 1KMCA 3PQ6A 1PZFA 5JDIA 1FFDA 3K0AA 4LZPA 3GB9A 4G8JA 1V41E 3SBDA 3AEXA 2A58A 5JH7A 2H3HA 2OAGA 2OZEA 1O5IA 4XGNA 3RGGA 5JS8A 3DC2A 3PEEA 3I09A 3ZLBA 2FN4A 5AHWA 1N9GA 1T5BA 1UFVA 2Y0PA 2BZ1A 3E9YA 3F9IA 4S1TA 1BE8A 4Y98A 3P0FA 1TQ2A 3IAEA 3LYAA 2C20A 3OLYA 5EHGA 3SBXA 3PEFA 3TFWA 1F0KA 4OQYA 1KJ9A 3SLRA 2BISA 2D1YA 3W1WA 3LPMA 4LYYA 3FSJX 4LY6A 3IE2A 3O2NA 4BLQA 3HV2A 1DG1G 3Q15C 2FHPA 3EXFA 3INYA 5HRUA 5KTMA 4L50A 2V6MA 1M73E 1DKOA 3LO8A 2BMEA 2O8BA 5A5EA 2H51A 3VKUA 2BGLA 3SKYA 4FB5A 1YVEI 2A9JA 1E2GA 1M6NA 5FAXA 3I61A 3EEBA 1GYRA 5KCZA 5KREA 1RLMA 2EHDA 3DV9A 2QMEA 3BB4A 2C5EA 3A8TA 5HFAA 2D0PB 1KEVA 2VDVE 1I2DA 3PVCA 5TMEA 4WSOA 4YCSA 4RPKA 2I7VA 2WTNA 1AN0A 4LJSA 3RWMB 3ONFA 3QUTA 4OYLA 4QFDA 1LSSA 3MUFA 5COQA 1OIVA 3KUCA 1OREA 3QIVA 2LBPA 2VWPA 4OL0A 4V38A 4ECEA 2J59A 7GPBA 4GKJB 2TSYB 1W6RA 3E1GA 5C4GB 3WL6A 2X0IA 1MKYA 3CO5A 3ENZA 1PX0A 2BMJA 4JR2A 4L0QA 5DHRA 1GV0A 1OX6A 1SVKA 2VDLB 1EK6A 1S2MA 1L7PA 1UWVA 3NU1A 4QT0A 4X6YA 5BN4B 4B3FX 5A9TA 4Q3EA 3HCAA 2REBA 1REQA 1PV4A 2JRLA 2WVGA 5FHRA 3WYCA 4RF5A 1FFWA 3TOXA 3L8MA 4CT0A 4HNQA 3QIAA 2P8SA 1NW8A 5AKZA 3QNUA 4NS4A 2YVUA 4K9NA 3RUPA 1Z2OX 1EG7A 3IQDB 1GL3A 3MXOA 3T4XA 1QHXA 1RIIA 1YNSA 5DGXA 2WFLA 3ANMA 4D02A 3P0JA 4B6FA 3MERA 3UMSA 5CA0B 3K9FC 4V0RA 2CUTA 3VH3A 1DKMA 1Q3KA 3RYHB 1JSCA 2PG3A 3JARA 5EHQA 4AJ1A 2ORIA 1JXQA 2ZR7A 3MGBA 3QFHA 3QU9A 4YRMA 1Z35A 1KXJA 2XUQA 4UNSA 4WKCA 3ZLJA 2HCRA 3DGEC 1E2DA 1Q21A 1Y7HA 2OMKA 2WRZA 1RIFA 4N7BA 3TL6A 1V8FA 2NU6A 2Q2WA 2W0SA 3EXIB 1HDXA 1N8SA 3MCVA 2HSJA 4TL8A 4NULA 5GQSA 4TL6A 5ENDA 3ZWAA 1KRXA 1FTWA 5CVUA 4DUGA 2XB9A 4TV9B 1VKZA 3FUTA 4C2TA 3PIDA 1DXHA 2BTQA 1EK1A 4JAVC 4WXMA 5FPYA 1C7RA 2GWHA 5AVXA 1P9LA 2W6CX 2OCBA 1OY1A 2BUCA 1WKCA 7YASA 5B2ZA 1NLZA 3W06A 3NALA 2UYYA 4NP6A 3VZDA 4CCSA 4Z99A 3CZ9A 2Y0DA 2NU7A 2J3KA 5BN3A 1JG2A 2YYAA 2HLDA 3UT5A 3D7LA 1U0LA 2A0YA 4JR0A 2GLXA 1FXWA 1RQ7A 1NNEA 2XR1A 5TX7A 4IIFA 3HA2A 4B1FA 3B2NA 4DZRA 4CEJB 1XVIA 1ZJ6A 1JZTA 2F8LA 1CZLA 3VVLA 1DFIA 1I6MA 3IDSA 3Q2KA 2LWIA 2FLKA 1P33A 2RGCA 3R77A 1KP3A 3CR3C 821PA 2J3HA 3N76A 5C8XA 1ZOLA 1DEAA 4FIDA 2AQKA 2CZGA 1NF8A 1X1BA 2GAFA 4PYRA 4PAWA 1XMPA 3LHFA 3QXXA 5CDSA 5CG1A 5EJ9A 1L7XA 3AO0B 3IKTA 1YBMA 2Z5FA 1USWA 4CTJA 4MRSA 3PEVA 4PWZA 4JVSB 1SZJG 5FFFA 5I3ZA 3A4NA 3H9GA 2IS4A 1F8FA 2FOIA 2FJPA 2BFFB 1MJNA 5CHEA 2IZZA 2E55A 3KV1A 2BL4A 3Q40A 1M2JA 3V32A 1NIJA 3V8RA 2FW9A 4IDBA 4AECA 4DADA 2JI6A 5KOIA 4TUYB 2HA7A 3GYGA 4IDDA 4BMYA 5AVQA 3A36A 3VC7A 1CBUA 2ZWPA 4OQFA 3WLMA 2NXNA 4BNDA 4F96A 1XRPA 1KTVA 4NCBA 1NJSA 1E32A 4JCCA 1ZD4A 2I80A 4NS1A 3GH3A 4N03A 3WGOA 3PZRA 3W2EA 1RWNA 1RZ3A 3FETA 3IBSA 4B75A 2ZITA 4X66B 2QRJA 4JEHA 1V0JA 3HP4A 1Y7PA 4YRCA 4BCBA 2EERA 2RGGA 1PCXA 1YJQA 1C9MA 4M9CA 1VJ5A 5F73A 1KR5A 1UM9B 2FPMA 2XMBA 4FD2A 1R5BA 1ES9A 2QXTA 1KMNA 2QP3A 3BSWA 2E6KA 1VB5A 3CIOA 3PR1A 3Q87B 3BREA 1Y6JA 1WZUA 4NBSA 3KJFA 5F3WB 3A1DA 5CX1B 5AOCA 1NMEA 3GK3A 5H68A 2NXWA 3ACBA 1L1EA 1XDDA 3FVTA 3BRWD 3K0HA 4ETWA 4LE1A 1Y3FE 2QY9A 4NPAA 3RANA 3S1LA 2V7QA 1DS6A 1JW9B 4O29A 1EUQA 1GSIA 3KL2A 3U3DA 2FDCA 2XUJA 2EGGA 1M0EA 2YR0A 4R01A 5A4FS 3KIPA 2KSQA 1WUJS 4HNAB 4BNWA 2K2QB 1YR3A 3CRZA 4A6EA 1IY8A 1KK2A 3F98A 3IOYA 2NSYA 2RGXA 3BSFA 3CRNA 4RETA 1Z0UA 4YJ2B 4EYSA 4U02A 2Q46A 1WX1A 4RLFA 3I42A 4RW0A 3GRAA 4WK6A 1Z8HA 2DFDA 4HEA1 2HJGA 2PSDA 3QTBA 3VPDA 4I50B 2HGSA 2TMKA 2BGIA 3HJRA 3P0RA 3I1IA 2GZ2A 3D8SA 4EUFA 5A6SA 2CB0A 3ICOA 1XEAA 3IVGA 2COEA 2PT5A 3P9NA 4HQLA 3EZ9A 3RVSA 4KPEC 3ZV7A 3SQXA 4JLPA 5IX8A 5LOVF 2HSEA 1ZG3A 3HPRA 4BN0A 4BQSA 5SYMA 3BGVA 121PA 3THXA 3ABIA 1XKXA 2CVFA 4Y2PA 4BVAA 5LMUB 3DQQA 3EE6A 3H1BA 1J0CA 1PFGA 1GRQA 1S8NA 1CUUA 1Q0UA 3C1UA 3LZDA 3R24A 4IXWA 4M54A 4M37A 1VKRA 4LRYA 5JCOA 3N2ZB 1UDXA 1X7HA 3UFBA 2VFAA 2QSZA 1CCWA 5HIMA 1RJGA 2IHNA 1U7OA 4QJ3A 3CB2A 5F64A 4MRRA 2WE7A 4CF6A 2Z1DA 1W36C 3B78A 4QDUA 1E92A 2A9VA 4KU4A 1FNSA 4N18A 1KJNA 3TQTA 1GHTA 1EE1A 1ABBA 2ATCA 1VPDA 3T9DA 3NTVA 3SSNA 4JI6B 2BW0A 2ALJA 2C95A 1PZXA 3K6RA 2PUAA 2RCYA 2REQA 3MRXA 3AHDA 4PG7A 2FZ4A 5FOUA 1XXHB 3SR4A 2ZPUA 4NYIQ 1TKRA 2CLSA 3JYQA 3VPAA 5KEIA 5LP6A 1A5SB 5FO0A 4NOKA 1YI0A 3QVXA 3DS8A 3KJGA 3BFVA 1OXUA 4P8RA 1KJYA 1QYRA 5FULA 5JYEA 3KOZA 3EZNA 1E5LA 3KVNA 2KE5A 5CM9C 1ZWLA 1UUFA 1LWNA 4UUMA 3GNSA 4B5KA 1BVUA 3GY0A 1K06A 1O1YA 4US1R 4YHBA 1DO2A 1MO5A 1FP4A 4AKTA 4RE6A 4FMCF 1P5HA 1GKLA 5JBIA 2R1VB 4LZOA 3ROTA 3GT3A 3T3NA 4WGFA 1E9CA 1XTSA 1FDTA 4BBAA 3QUQA 1KO8A 2BEVA 2BFEB 2I78A 3FAZA 4PSKA 3W6OA 5KNBD 4JYMA 1VOTA 1J5EB 1P1IA 4BKPA 4DQXA 2WJWA 3C5EA 1HOXA 3RIEA 5FUMA 1BO6A 3R6DA 5ABPA 5KWJA 3MT9A 5EFZA 4KR9A 1T9AA 4AD8A 2ZTLA 2IPOA 5HF5A 2WF7A 1JPJA 4ISCA 4U0JA 2QRQA 2GASA 4FHZA 2X2OA 3M1YA 4DILA 1ZXBA 2HW8A 1JA9A 1ZM3A 4R40A 3VPGA 1QXSA 1TB4A 3QHAA 4KYVA 2GZDA 5KINB 2GEJA 2BFWA 4JU9A 3P9XA 2V3CC 5CEFA 5JEDA 3H86A 3HCCA 1PJAA 2YZGA 4AJLA 2AFIA 2QW1A 4WKPA 3S99A 3KXKA 4JUAA 3U0VA 2JHCA 2YV1A 3TQHA 5BSUA 3HJAA 2OAP1 1M83A 3DFKA 3W3AH 1Z47A 3DZHA 4H9GA 4RYLA 2WD8A 4G0ZA 1WV1A 3FPEA 2ZUDA 3ZUPA 3GGOA 1N1DA 3O1IC 2J7KA 3TSYA 1ZI9A 1SQFA 1M2KA 3TR0A 3TTWA 3QX7A 4DAEA 3FSGD 1GKIA 2O2IA 1D1TA 4LGYA 2GXAA 4BY9E 2JGKA 3UY4A 1P1RA 4HPWA 2J0VA 4EKDA 2BMVA 4U00A 3TECE 3IIJA 1KGDA 4KQEA 4RSHA 1F4VA 1NBMD 3TQCA 3SNHA 5FUBA 1E0KA 4O59O 4F93B 3IILA 1ST2A 1KZ7B 2WJJA 4YRIA 1YZUA 4N4AA 3D1LA 3M89A 1US8B 3JYNA 1T9DA 3CNBA 2OCAA 2ZBEA 4MUBA 1NSYA 1E9DA 3VYSB 2B8EA 2C5SA 1Y9EA 3E27A 3OY7A 2LE0A 2C8VA 4AJOA 1GITA 3JATA 4G5XA 2I66A 1TM3E 1HDRA 2DZDA 5FTWA 4PS1A 5TQ2A 3DSRA 1QFXA 4UEQA 3SQDA 4MICA 1RHRA 1H9CA 1NNI1 2P69A 3U3KA 4CETA 2APJA 2W2QA 4IF6A 1I2AA 1SZDA 4HBGA 3OQOA 1RQXA 2AVDA 3HA5A 1T8YA 3WFIA 1FMLA 1P1HA 2IZ6A 3OE1A 4JP5A 2Y76A 4LX8A 1HT3A 4PGAA 3QVGB 2ZQZA 5LLTA 4B48A 3A7DA 2NT3A 2KLHA 2Q28A 5ELXA 1EB8A 3ZGOA 4EW6A 5BNTA 2CNOA 5T7BA 4YT2A 2R62A 3IH5A 5FOWA 1RI2A 4MQ4A 2A0KA 4D8WA 4KO3S 1R3DA 2QF7A 4EITA 1ZJWA 3E9CA 5KPJA 5EZYF 1H1TA 1ZKDA 1P1BA 4F2HA 3NFYA 1RAIA 1QIDA 4ZV4A 5B12A 1XELA 5FDFA 2UUCB 1PK8A 1M1YE 1NXVA 5L51A 3CX8A 2NUTB 4H60A 4M9ZA 5LPNA 4GX0A 1TU0A 2AX4A 4FNMA 1J2TA 3JVUA 2P41A 1XEXA 3C8HA 4MYDA 4HH0A 1KFKB 2C9DA 4AT1A 4QHSA 1IQUA 2QBYA 1E69A 2PBRA 2Q1XA 3DOOA 5I7SA 4QQFA 3FZGA 4NF2A 1HURA 3PYXA 4C4YA 2ZS9A 3R8XA 4PRKA 3ZV5A 4LXXA 4RIEA 5D3MA 1DKNA 2H1HA 4TS9A 3KFLA 3UMFA 5EI5A 5EINA 3RUDA 3TG2A 4GI5A 1X6VA 1J9EA 4CLEA 4X3PA 3T9EA 1VB3A 4M98A 2Q6OA 4KN6A 4GKBA 4BX2A 4X7RA 3I9V6 1L7NA 2HYDA 4X84A 2XMGA 5JY1A 3EQZA 5KYYB 1QYIA 2ZBGA 4UATA 4Z9AA 3V4PB 4FD3A 1CE8B 1H2XA 3AUSA 4OXQA 2GS9A 4B3JA 1ZIOA 5J2TA 4Q15A 4D82A 4YXWD 2QE7D 1NUTA 2C94A 2I62A 2I4IA 2AXPA 3LKDA 4QL3A 4RDIA 3O8QB 5JCJD 2G17A 4GFDA 5JQWA 5FORA 4URUR 5HS6A 2EZ4A 1YU9A 5KSZA 3PEYA 4F1KA 3ND7A 4MRAA 2PA3A 1ZVJA 1QPGA 2P2YA 1QIJA 3KYJB 5ILQA 4HQRA 3ZG6A 2YXBA 4CM4B 5K3FA 2JLCA 4HEJA 2WJHA 3DDSA 3JTMA 3W90A 4P4SB 4X6UA 3M81A 1QAMA 2NUPB 3L7JA 2YOFA 4YAOA 2D0IA 2HK9A 1Z25A 1IHUA 1PUJA 2AI3A 2Q27A 3L4JA 1NTRA 4JY7A 5KMGA 2VAMA 3L6OO 1GGMA 2JJQA 2WD7B 2VATA 4FZJA 4IKEA 1VGVA 5LDGA 3K16A 1I80A 1UBJS 2NACA 4OLFA 4Z2YA 2AIRA 3EIFA 2O8CA 1G5IA 2MTBA 4B2IA 4X1OA 2IZ1A 1EX6A 3LIIA 3SF8A 1MG0A 1NV9A 2SKEA 1USIA 3DXYA 1P4HA 4OKNA 3ISTA 4XGIA 4YJGB 5DF1A 5E1OA 1U4SA 5FBWB 2I9KA 3RYFB 2JIQA 2XNJA 3B1WA 4F5YA 4O8ZA 2X5KO 5I5GA 1TA0A 3THRA 2WJZB 1CUVA 4BGUA 1Y8RA 1NX6A 2O8DB 3QVVA 4JI8B 3LDGA 4G4JA 1J5XA 2NVBA 3NNNA 1E59A 4M8KA 4QLAA 2HOQA 3W9SA 4BMOB 3THYA 3HXMA 1ESCA 4GVPA 4LHXA 2Y27A 1WU7A 1U99A 3FMPB 3OWHA 4P0PB 2PGLA 1CB7A 1L8AA 1TU3A 1OI4A 1P7CA 1JLMA 1WUKS 4WA8A 2QD1A 1V39A 1QFZA 2JH3A 3VC2A 3G0CA 3MRTA 4GIBA 3BIJA 3SN6A 2QB5A 4ND8B 3EXG2 2O0JA 5K9ZA 3TTSA 2JNWA 1NM5A 4JENA 4OXRA 4E5SA 2IT1A 4UVEA 4ZK6A 1H1LB 4DQKA 1GVNB 2QDXA 1RMTA 2ZAYA 2R11A 5CLJA 5KKNB 1I4DD 2ONYA 2JCXA 3ELBA 4F2DA 5LJLA 3T1HB 1J0DA 4GOXA 4KC0A 3WNZA 1TL7C 2XV1A 5K0EA 4GGOA 1F2TA 3D54D 4W9RA 1CNFA 1ZHFA 4ZD6A 4WASA 4HCJA 1U1EA 1ZL2A 3DDNA 1CK4A 1YONA 2NXCA 4Q4HA 4JWKA 2XYVA 4MB6A 3VISA 1ULHA 2Y1LA 3CG4A 3UJ6A 5EJ2A 4ZQEA 2Q0XA 1GUAA 1SUBA 2AFIE 5A0VA 4F7DA 3KEQA 1NXPA 3BUSA 2FV8A 5K0ZA 5AOAA 5LKAA 3M2PA 4X6LA 1IRIA 3WI7A 7AT1A 4GLJA 3R1IA 4IJWA 3UMMA 1VKHA 4Q05A 3LXRA 5TQJA 5FWXB 1TCVA 3VPXA 1FE8A 1L5ZA 1P5FA 3C48A 4MMXB 2BIFA 3UK2A 3WBJA 4EJSC 4PC1A 5LQCA 2J4FA 4I46A 3QELB 4E88A 2X0NA 2M9MA 3NBMA 5FBQB 4BVFA 4D9IA 2P6UA 1GPUA 4J16C 5C32A 1TTTA 3S7TA 5BPHA 1EFVA 4YRNA 4ZVSA 2W6MA 1S5PA 2ECQA 7REQA 2JCYA 4F1WA 1N9KA 1E4EA 1Q7TA 2I8LA 4BWFB 5TQVA 1U8FO 3KYIB 1YUBA 3JAWB 4PC6A 5JROA 1ECCA 3N53A 4KL8S 3ANYB 4O4LB 5H80A 2J31A 3BC1A 3WK6A 5A9SB 5EIEA 3COJA 1UBCA 1G3IA 1MJFA 4LDNA 1WG8A 4RKQA 4RLHA 1UBOS 1C5KA 3RLFA 2XDAA 2ZI6A 4K6FA 1FJ2A 2PL3A 2PLRA 4ZQGA 6NULA 3PK0A 1TJYA 2DHQA 4W5HA 4HN9A 3AJDA 2YIMA 1G8AA 2WR8A 3VU0A 2H6EA 2N9UA 2PNJA 1E99A 3WK9A 4R3UC 1QDLB 1LJUA 2OD9A 3DULA 4QEZA 5ALTA 4Q1BA 1R6TA 4E6PA 1G21B 1NTOA 4YJ3A 1LZLA 4HNSA 2F3UA 1E8MA 2NSJA 2QHXA 2CLKB 2FUG6 4G24A 1U9CA 2G4VA 3QU2A 3EZFA 4PYKA 3UXMA 5IEJA 4FT2A 1PP4A 2CL5A 3B3QA 3R74A 1QG4A 4KR6A 4P4NA 2A9RA 1X19A 2PT6A 4K05A 4JITA 3ICPA 4GAEA 4CMEA 2AF3C 2X8LA 2VPQA 2XYGA 2DVMA 2VYQA 4I4TA 4GOMD 2ACKA 3LUFA 1SZCA 4NCNA 5LYJA 2F1RA 3BOSA 3ENWA 4LHVA 4M49A 1PNQA 1R0BA 5FFMA 3K6JA 3OLXA 4PIMA 3U4GA 3U4AA 4CN8A 1P5JA 4YA6A 2O8FA 1S8FA 5JS2A 2LKCA 4JI3B 1F8UA 3AB8A 2VA9A 3JALB 3X2EA 3RUAA 4TSFD 4AZ3B 4MVJP 4DJEC 5IKXA 2MHCA 4H4CA 2SKCA 4WE3A 2W22A 3RIGA 2Z9CA 1UODA 2VKQA 2WDPA 4RSRA 2PWZA 3UJ3X 1P0IA 3ESBA 2XKKA 4EPRA 2R1UA 4OMCA 1PJQA 2R8BA 3L0YA 3RFXA 3U4CA 3AESA 3E2PA 1ZN9A 4GR4A 3VR4H 4AS3A 1LPSA 2BZSA 2R8RA 1EVZA 2EIXA 1DJPA 2Z56A 1IOWA 4IDQA 4ID3A 4KGVA 1AQIA 2H1VA 1HZZA 1UJ4A 2WFZA 1H0RA 3UAWA 1VHJA 4E5UA 1UAAA 1YA4A 4RD4A 1LDGA 3CGWA 3M6IA 3T3EA 2OBBA 2WZQA 5C8VA 4G5HA 4LY9A 2OWDA 2WINI 5JVDB 1JPNA 1SELA 2PTGA 3KE8A 1VE7A 4I6GA 2DQ4A 4F71A 2OLJA 4ONEA 3LBFA 4OUDB 4IZ6A 3F5DA 3KU4A 3TIIA 3CT6A 2R6R1 2NO0A 3L4BC 1BD3A 2XLCA 1NN0A 2L2QA 2KW5A 3QKSA 2II6A 3COYA 4CIBA 4A0QA 4ED9A 1BQ4A 1WETA 3ZJ4A 1BVRA 1XMXA 4KV7A 1ECBA 2FHSA 1OA1A 3HXPA 4G5OA 4GF5A 2XD4A 4GZ3A 1KZ6A 1P4AA 1QB7A 1ZHHA 5JAOA 2FWRA 1A9PA 2QVGA 2UVDA 1ZD8A 4LTMA 5JNLA 2JLQA 4WERA 4DDVA 1VJRA 1M2GA 4MCAA 1JDTA 1KAEA 4L9SA 1T4BA 4LDRA 4EAQA 4MRPA 4OJNA 1JZQA 1H8HD 5EUBA 4AG5A 1NW7A 3RS9A 3CVJA 1CQPA 3V3KA 5FBVB 1FSZA 3EUFA 2QWXA 4OLBA 4FEAA 1BYIA 1X0VA 4LWQA 3FHOA 2E0IA 3CPSA 3PNSA 1CY4A 4Q9AA 5DPMA 2EZ9A 4ZVKA 5LXTA 2ZRAA 4R1LA 1XNHA 4C3UA 1OFHA 1Z3IX 4RS3A 1VDMA 2PX2A 4S1OA 2WIDA 4Z7NB 3OP1A 4DB2A 1PEKE 5JI2E 2ZJFA 3F8WA 4IDOA 4P35A 4YONB 4LVCA 4IFEA 3KJNA 2WPDD 3AP2A 3C43A 4MPDA 4UVHA 3O2JA 4ZVMA 2VBGA 3U7JA 3C5CA 5KNCH 5KQLA 4J0CA 4HBZA 2Y67A 3FHCB 4MVYA 5EMMA 3ROXA 3ENVA 3L8FA 1SBNE 1AMUA 3G1TA 4J7XA 1ULZA 2FP4A 3H04A 1DEXA 4JUCA 4KZPA 1X8XA 1U9YA 2HIGA 3A6FA 1TK3A 4R2MA 4LW8A 3CBGA 4C2AA 4BPBA 3GJSA 3IYLW 4NK5A 3PYLA 5K0JA 1KMQA 1AOXA 1OWLA 4PLZA 5AW2A 5ALRA 3SC3A 2H57A 1DFGA 5C4MA 2OXCA 3BMOB 4QQNA 4B09A 1FRVA 1OPXA 2X15A 3G8BA 1Q1EA 3GEGA 3RVQA 1N2ZA 2PGNA 5KYXB 2XBUA 2BHSA 4RVHA 3D2LA 2IHVA 1OWMA 4XYBA 3ENKA 5TMDA 3EXHA 4S04A 2ZUFA 3BFKA 1Q92A 2QSYA 3STUA 3BXZA 5IJ9A 3IQGX 4RC9A 4FKMA 2FFQA 1C4XA 5C4IA 3RTBA 1DDOA 3ZOZA 1ZAKA 4NL4H 5DN9A 3OM8A 4GPAA 4YFVA 1I7PA 2JZNA 2ZSIA 1WPRA 3SYNA 3UWMA 3MLBA 3BJEA 1Y1TA 3ST7A 4D4HA 4B2YA 3K94A 3L7MA 1I7NA 1FYFA 4RH0A 2E49A 1H69A 2EW8A 3BAZA 4Q9KA 3SQLA 1JDSA 2F8MA 2INGX 1BMQA 1SVOA 3SXPA 1YS7A 1I4OA 4YWJA 2AJDA 3C7AA 4FWIB 2CXTA 3KKQA 3EQ8A 1B76A 4YRBA 1H3NA 5EE9A 3WZLA 1MEJA 3GPDG 2I29A 5FNZA 4HKTA 3PXBA 1GN9A 3PX7A 2N1MA 4XJSA 4H6WA 4Q93A 1W1UA 4CKWA 2X4IA 5JALA 1R16A 4OHPA 2HMUA 1NRWA 2VUIB 2FSFA 4U6QA 1V7CA 4F84A 2CCKA 2FRDA 5AKHA 1W0KD 3EEOA 1LF5A 2XWSA 5A05A 4C07A 4CUZA 1CZKA 4XJTA 5EGNA 1V5GA 2UZ1A 2YMQA 3NETA 4AZ3A 1J42A 5ADWA 1EE9A 2I7CA 3W8EA 2BFPA 4JLOA 4MRNA 2NO5A 2OQVA 1DBVO 2Z2ZA 3ASVA 1JIXA 2CC2A 3PE3A 1U2ZA 1XO1A 4K8OA 3UKJA 2ZPTX 2FA9A 1U4OA 4OQEA 1ISSA 1QE5A 1VZ3A 2EZUA 1Y4ZA 2M98A 4LGMA 2GHIA 4Q48A 4TXHA 2YJ6A 1GKKA 4YJHA 1JJBA 1TIKA 5E4FA 3U26A 1R0LA 5JW6A 1HMYA 2SICE 3A14A 3CINA 4HWOA 1Z2PX 5BR7A 3CIFA 1Y6RA 5EIBC 3RFVA 4N6OA 4DAOA 2VTVA 1I4LD 1FVHA 1NZDA 1SHUX 4D97A 1D0IA 2DHCA 1ZGGA 1XTKA 2J5BA 3DBOB 5E8JA 2QL7A 3WLRA 2FFHA 5D5QA 2IYOA 3IJEB 4FGJA 2AOXA 5IASA 1TJ5A 4Y3UA 4CPDA 1HTBA 3SX0A 2R6GA 3ED1A 1FP2A 1ORWA 5IJZA 4B3SB 2P0AA 5ITWA 3OUUA 3GO4A 1WXEA 1X1RA 2BELA 3AXTA 4MIKA 3D3WB 2Q5JA 3PB3A 3ZDRA 4BQPA 3GCWA 3GJ6A 5GJVC 4J2HA 1WZNA 2OHHA 2YHSA 3N8DA 2ILTA 4EGAA 1ZK2A 3D6HA 4JX9A 4KFRA 2AN1A 4HVAA 4LBZA 4BEBA 4PQYA 1RRMA 2EBFX 4I9GA 4JWTA 4Y0AA 3E48A 1KY4A 1A9RA 1NC1A 2RB4A 2WHPA 3NIGB 4TTIA 2DUNA 2VDNB 4N3BA 1Z6YA 4TVSA 1F5NA 3WWYA 1HE3A 4DYVA 3ESQA 5LU9A 1HFWA 1KP9A 1XTIA 2AKYA 2VSQA 3A9UA 4ZO8A 1TVKB 2CLFB 4A16A 2GHTA 3RR2A 1ZGAA 1I7SB 5IVKA 4M9RA 3QE3A 3Q8WA 2H08A 3JS5A 1AKNA 3WOHA 3ZWVA 4WXPA 5M7EA 2DT5A 1E89A 2BSAA 4A1FA 1CYDA 2VLIA 2DCMA 4HQOA 4TLMB 1ZGCA 3HY3A 2QR2A 1QTNA 2E7ZA 2OV8A 3C7CB 4X8MA 2ZYDA 2FG5A 2BONA 2VVTA 4B4KA 2WG2A 2P11A 3CYFA 1USUA 2JGDB 3LZCA 4P38A 5FA6A 5H3LA 2J09A 3LJKA 4ZVTA 4QUJA 1OE0A 1YB5A 4EUKA 3EVTA 3CVUA 1YJCA 3H2IA 1POXA 2EKBA 3MGGA 1M8KA 1ECFA 3JD1A 3MCTA 3N8NA 2J3EA 3DPUA 2AMYA 3CJQA 5TSDA 3UXHA 5EYPB 4PPGA 2A7QA 4D0RA 3LPDA 1LPAB 2NTJA 2Q3LA 5AK0A 5HGJA 1FYVA 5F7JA 1A76A 1G5QA 1ZX1A 3L1VA 2GGSA 4FCTA 4NENA 3SZMA 5FWNA 2IEIA 4TTPA 5H7XA 4QDKA 5KYTA 1JHUA 2FOLA 2R5WA 3FPJA 1KETA 2I4RA 3ZDEA 2EU8A 1YO6A 1U9IC 2KJQA 3TDMA 4ES6A 2A14A 1OU0A 3EF0A 1ZGBA 4QPZA 5EY5B 2BGGA 2OWEA 4YV7A 4RQBA 5FKJA 1N2HA 5JAIA 2ZWAA 1JDPA 1JT2A 2DUWA 2FEMA 3MLEA 4IOMA 4PG5A 3K8QA 4IY1A 4RWZA 3LQFA 5E2BA 4JDPA 3WC4A 4Z2AA 4FR5A 2Z6AA 5JR3A 3PBKA 2L18A 3KJXA 1IJEA 1HO3A 5CX4A 4C4RA 3MOIA 1J9GA 1TA9A 4MULA 2AOUA 1LDBA 4P5EA 1DFHA 1E3TA 2FEXA 3U1VA 1BX3A 1TRKA 3BJIC 5GM2A 4DEYA 4JI7B 3CWQA 1YR1A 3K09C 3RUEA 3E6AA 2QI9F 3QBVA 2PV7A 3ADPA 5ARBA 1J2JA 4MVWA 1TUGA 4R8RA 3LQYA 1TTQB 5LBTA 4EMBA 1OV6A 3OA0A 5ER9A 4RTNA 1D7AA 2GOYA 1YU6A 4IV8A 5D3ZA 1VJTA 3QV1A 2W2KA 4CMIA 2ZSAA 5DP1A 4D46A 4KE7A 1DQZA 2ZIWB 4X7BA 2Y71A 3RSHA 4B8WA 1MPXA 2F8SA 4H3VA 1O0SA 4N3AA 4O1IA 4RDCA 4UQPA 5FO1A 1DV2A 3EW9A 4MAAA 4JI4B 3EIHA 1BGVA 1CJUC 1DNPA 3QPUA 1K0FA 5JMWA 3PSHA 5L40A 3EEFA 2WYVA 2G1AA 3FXAA 3I9V1 3CEJA 5KDLA 4B5LA 1IATA 4FC7A 5K0NA 2GBFA 3UMCA 2O0HA 1BS1A 2Q5IA 4QOIA 3AQIA 3RBZA 4MR9A 1UC8A 2EXXA 1E5VA 2QJRA 1KI3A 4HDKB 3ROZA 4BECA 1R27A 1FW6A 2DP4E 1GRVA 2KQUA 4CQMB 5CH8A 3GLGE 1WMEA 3UMVA 3CUUA 3HB0A 5JOQA 5JPDA 2R6ZA 3AB7A 4XYLA 3AVTA 3MD0A 4ND1A 2IUTA 3G9TA 3SNKA 1RWOA 3FPCA 3H11A 1F6DA 1TLLA 2ZTSA 3CEPB 4DCSA 3M3DA 2Q3BA 3FM9A 1Z13A 1MB4A 3I2FA 4LWPA 4UZEA 4EL0A 2MIIA 1FU7A 3FFAA 3T4EA 2Z4SA 1IBSA 1T1IA 3TSOA 3RTEA 4WKOA 3TGLA 3PUIA 1KSHA 1R4NB 2YX1A 2FWAA 3EEQA 3NBKA 2P75A 3R3HA 4FR2A 4URFA 4ZCQA 1IULA 1NPTO 2Z8YA 1EUDA 3UAXA 4Y9DA 2JANA 3BPSA 3V1MA 5HOQA 4HC4A 4XZ3A 1E60A 2B83A 4EUSA 1T8UA 4KRFA 1WY7A 3ZDBA 4HAUA 2VJDA 3GF4A 2O4CA 3ILSA 1L8QA 4RE5A 3JR7A 1Q1AA 2HLDD 2OMEA 3GP5A 3HNOA 4ZAWA 4COKA 4RA6A 2ST1A 1V8PA 4MW5A 2IBSA 3TF5A 1U7XA 4EG1A 2Z6VA 3L6UA 3TZBA 4FSHA 2RAVA 3WK5A 2I0FA 3S1SA 1AKMA 1N3YA 4OO3A 1HOTA 1RBMA 2M2IA 2R66A 4PYOA 3L9XA 4S35A 4EGFA 1WA5A 2DT8A 4G84A 4RS4A 3PF8A 5F2EA 5B4VA 4MGIR 2YASA 3NVKI 5IK2A 4XOUA 2R4UA 1GNRA 1W46A 1DO0A 2C0CA 2QLJA 1NHGA 3CURA 2DPMA 4JXKA 4CUJA 4ZZ0A 4LUCA 1JEQB 4L28A 3PE6A 2BDUA 3R6WA 4L07A 4A8HA 1H5UA 4QBTA 4CF3A 3AKYA 3FKJA 4ENSA 3T94A 2YOHA 4YDSA 1MB0A 1JDBC 1MOZA 4D1YA 2VPXA 3SQWA 3EGDA 3B2QA 2QTCA 4PLWA 3TOCA 3VYWA 5KHOC 3DMDA 2Q7DA 3JQ7B 2P4UA 3I76A 1CHDA 3KR0A 5DO9A 5FEMA 1MC1A 3RT1A 2VXBA 2G07A 4L76A 3R7FA 4B2PA 1ND6A 1EFHA 1MA3A 4G0YA 4PNPA 1NP6A 4E11A 1NBME 1NRIA 1ZJ4A 2G5GX 3FTDA 3IP5A 4JT9A 1U6JA 3CM0A 3DC7A 3ML1A 4DLYA 2Q9UA 1WB9A 1L4GA 1NVVQ 4NBLA 2AWNA 2PUGA 2WP0A 4IX9A 4LNUB 1FDVA 3ZJYA 2N75A 1B74A 2FLWA 3JPYA 4AJHA 5AXCA 2FY8A 3H2GA 4BO2A 4DCVA 1IHXA 4E1VA 4G89A 1EVEA 3DP9A 4QXAA 2P77A 4RTOA 4OHFA 2F00A 2JEZA 1J2YA 1M7GA 4OI4A 3SE0A 1A4XA 1NW6A 2AUTA 4TMVA 2VO1A 1I7LA 3BMNA 4XCQA 3SI7A 2JIZD 2JGMA 4QYSA 1M6WA 3HP7A 4E5YA 1NWHA 4BHTA 5CDFA 3EGXB 4CL8A 2I03A 5BRJA 5DBIA 1XXLA 2QTGA 1YFZA 4HTFB 5DYGA 3PTZA 2X4DA 2Z9BA 3O5AA 4LDZA 5DBEX 1LK5A 4MUXA 3VR5A 3JYPA 3TLCA 5JHHB 1BX1A 1WOMA 4CHGA 3P9CA 4P53A 2OFOA 5EL0A 2ON6A 5BRNA 4C0SA 1QMPA 2QZPA 3UJDA 2EIHA 3B6MA 1TAQA 3G9XA 2W93A 3A10A 3ZCXA 4DG9A 1GXSB 5LOVA 1VMAA 1NXSA 3Q8MA 1AV6A 3ANTA 1V5IA 2Q62A 3GWGA 3PC3A 4G0QA 1B6TA 2XPCA 1OBOA 4F56A 4Z9FA 1CC1S 1K8RA 1J25A 1RDFA 1WHTB 2CJYA 3FRJA 4R51A 5BW8A 4KPUA 3WRYC 3ZHYA 3TX2A 1GQ2A 1A4IA 3F8TA 3GUYA 3N3BC 1GGEA 4JSYA 2IFTA 5TGDA 4WOKA 4D8YA 3R44A 2WNHA 3A6PC 1G20B 3CT4A 1PJRA 4RESA 2BVNA 3FN4A 2YYYA 1N6PA 2G28A 4CF4A 1L8OA 2PFKA 3EIUA 4GYJA 4RPJA 3ND5A 3WIVA 3W1EA 4G5QA 2NN3C 4PLYA 4D4MA 3L8EA 1U1DA 3OJCA 3I52A 1OASA 2Q4EA 3WKDA 5JSHA 3T1NA 2TRSB 4QUEA 3PDWA 3BWDD 3I5AA 4XIGS 2DB3A 2IQ5A 4EG6A 3NZEA 2JH9A 2Z1NA 5KTSA 4X1KA 1X9GA 3V9PA 2FWIA 2FUG1 5HNKA 2GR9A 4P2GA 5EMHA 3UCXA 1LC3A 3IMFA 2F17A 3OPQA 1QGYA 1RQNA 2O7VA 2MSEB 4KGZA 5JLAA 3RGWS 4EHFA 5HJ5A 4MAFA 1N9GB 1OFUX 1OAAA 2XX3A 4FINA 3HYTA 4WUTA 4CCWA 1PFQA 2GSWA 1FUUA 1SXGA 4EELA 4O33A 6ADHA 4I5FA 1OTYA 4M4SA 4N0MA 3AYXB 1QIGA 1RWQA 3KFXA 4UM7A 1SIUA 1NIPA 3H9QA 3ZWOA 1UXJA 5KYKA 5AW8A 1KJWA 1W5BA 3LY8A 3OZ7A 4K9RA 1Y3CE 4RGQA 2HT1A 3GLHE 2DAPA 2VAVA 3EXEA 3FLEA 1WZIA 2JFHA 3EXFB 3FUWA 1Z0DA 4J6EA 5CLGA 1S02A 4BFLA 3RRJA 3HBNA 1NQVA 4TWRA 5EJ6A 2O8BB 5A0TA 1K8XB 1NG1A 2FZ5A 3HRIA 5F7ZA 3D7NA 3KPVA 3ZHBA 4IHJF 4WLOA 1DQSA 4A03A 1XHFA 3P8ZA 1QLJA 3EA0A 4EF4A 4YY3B 4R2JA 4B4DA 4JVNA 3BTSA 3RHTA 3PR3A 1D04A 4JLKA 2CKMA 4FBMA 5EWJA 4ZEOA 2PYZA 1B42A 3BXXA 4JJIA 3FVVA 3PQ3A 3CA8A 2WSMA 2YQZA 3ET4A 4QO8A 5LDHA 2C88A 5GZ3A 3E9ZA 5TEWA 3H5RA 5JMTA 1OTHA 1T2FA 4HATA 2QK4A 3N8KA 3PX2A 4AURA 4G0XA 3ZWCA 2QLTA 3EVNA 3UB4A 1N5IA 1V1JA 3ABSB 2Q2VA 2F3SA 3IC5A 4R3WA 3OC0A 4LQDA 5CDYA 2GJ9A 5HZGA 4KIUA 2OZPA 9GPBA 2JGJA 3T9CA 4YYEA 3BGOS 1REQB 3UPTA 4DCCA 1RRVA 3MHPA 2GUWA 2GYYA 5IMSA 1RFGE 2FH5B 2C96A 3EOBI 3GFGA 1KR2A 1QX3A 1DDGA 2VIIA 3G2NA 4JQZA 3P26A 1XVLA 3INTA 1PR3A 4I1RA 5H3HA 2H4YA 4B71A 2IZ7A 1Z0JA 2ZTUA 3T7JA 1RAEA 1QRRA 1X7WB 3PXXA 2WFLB 1WDKA 4RVDA 2WY2D 2DJ5A 1YJ8A 4FIZA 4ZOEA 1QIFA 1R4AA 4IUCS 2BMFA 2H4FA 3JARB 1AGNA 4PX5A 3GRCA 2VL7A 3CUTA 3FUUA 2X8BA 4BVJA 3MHTA 1T3SA 3BZWA 3V1YA 2ATIA 1UZLA 3L93A 3EVZA 3PS9A 2NU6B 4DN6A 1J9ZA 1M67A 2PMCA 1U02A 3OZVA 3UAZA 3O1JC 3W1VA 4YRJA 3DEKA 4RPIA 1SC3A 2I2BA 3X1DA 1NI4A 1SNYA 3BXEA 3K20A 3AIIA 1K9VF 1SG9A 3CG0A 4QDXA 2BTQB 2ZCUA 1EFRA 3SG0A 3OCCA 2NV0A 1FSGA 4N12A 3WSWA 5ALFA 5JARA 2I5PO 3AM1A 3LVFO 4L7QA 4M8LA 3QPBA 4V0SA 3SIXA 5CGQB 4DNXA 3ZQUA 2EKZA 3MMZA 5BN3B 2NU7B 3NHMA 5EZYA 3QTLA 3RE1A 2B61A 3UT5B 4DLLA 5CFQA 4P7GA 3DUFA 1G7TA 1LKZA 4GZ5A 2ZJ0A 4QARA 4KX3A 3AR6A 5JSZA 1MW8X 4BKUA 2ORWA 2I3BA 2AD1A 3A0UA 3V4ZA 1N7JA 2QYOA 4QQ8A 4W8OA 3EPKA 1GAXA 2IVFA 2RGBA 2A59A 5IVDA 2PDAA 3E7PA 3S1AA 1OBHA 3I23A 1PGNA 2BM8A 3NHYA 3ZGNA 3BJZA 5CVEA 3FTFA 6PFKA 3AJRA 5E4YA 2JGIA 2JRCA 3JWGA 2ZB2A 4QBFA 1CVRA 4RCYA 4X90A 4WNCA 5EWMA 3CGGA 1SUFA 3VVCA 1UKZA 1ZMOA 1RLIA 3L92A 4OFXA 4B6JA 1WULS 4P3NA 4B7UA 2PSSA 5K8VA 4FEYA 1ID8A 5K3OA 5CDFE 3LAWA 1ZINA 2WKSA 2H18A 3ZH2A 4N8DA 3AUTA 3PGA1 5EQDA 4G0WA 2R5NA 2P67A 2ZIGA 4F4CA 4PX3A 1N1EA 3L18A 3VBCA 4BNDB 2ZRFA 3PRHA 3K05A 1DTEA 3G7UA 4P5DA 4DW8A 4OG2A 4DGQA 3WIUA 4Q1AA 1E4YA 3CZCA 3ZY4A 4BYGA 1YB7A 5CPFA 1FSFA 1KY2A 3DZ8A 2VHVA 3PL1A 4QZVA 1Z07A 3ROFA 4R9UC 3N9IA 3RABA 2X23A 3B60A 1OFVA 3BXHA 1IPEA 4D3YA 1H9AA 4TTRA 1UQTA 3FMIA 5F76A 8MHTA 2XNHA 2A9OA 4RK7A 3UJ8A 1Q0TA 4H7JA 3T3PB 2CLDX 4AO6A 3KBBA 3ACCA 1WSBA 1XA4A 2H5JA 1QHEA 2V6FA 2J3JA 3OI7A 1YOBA 2ZXUA 3R9KA 2K7ZA 2I33A 2AMVA 4EI2A 1Y0BA 1J8YF 2HWKA 1OFUA 2WIFA 4QG3A 2OV6A 2ODQA 1O89A 5DGDA 3R5HA 2A2ZA 1CJCA 1SCDA 3RKUA 1JMKC 1ML3A 3RSQA 2NO4A 4AF6A 4B4OA 5C53B 2IP4A 4KBGA 2FXIA 1F4PA 1JR4A 1ATIA 3GRFA 3P20A 3QKUA 4N3GA 5IDXA 4TZKA 3UMJA 1B26A 1YFJA 3PGXA 4RY8A 4X5OA 3HNRA 1KI9A 4EL5A 4EPTA 3PENA 3SC6A 4EEZA 4MGHA 3KE9A 4MPPA 1D2AA 4LRXA 4L72A 2FN9A 4B8ZA 1G8JA 1EXDA 1Y3HA 5E6RA 2Q2NA 4NMLA 1E2PA 3SICE 4P7FA 3R3XA 4RK6A 4QYWA 5I7EA 3CKMA 3RU2A 2GK3A 1HH4A 1AHIA 1GA4A 1EM8B 3IKJA 4IAOA 1I1NA 3BWEA 4U6SA 4LZLA 5DRTA 1EDDA 2RI0A 4TN1A 5IAKA 3W8NA 1FDIA 1XNJA 5A6SB 5JJKA 1X94A 1G5HA 2NXJA 3GQBA 4Q39A 5EIOA 5C31A 3V7UA 5AUOB 2QN6A 3EOZA 3FMOB 3SYTA 4MS3A 3IR5A 3VOBA 3F9RA 1T8WA 2OCXA 1MIOA 4H3KB 2XGMA 2AA3A 2PGAA 5DHUA 4DDMA 1ZRSA 3BWYA 5IT9A 3THXB 4B17A 4PZYA 4BNYA 5KQRA 5REQA 1G42A 3HCBA 1KZ1A 1SB9A 2MOKA 2ZIZA 5K0GA 4RV9A 4G0MA 3K15A 5CXUA 2B2CA 4QGSA 4HF7A 3EULA 5DSTA 1KMIY 1LVUA 3HXOA 3G88A 1VYUA 2VHUA 1XKTA 3HRKA 4KIGA 4PLPA 4ZVNA 2ZJ5A 1TZMA 3WMFA 4E2ZA 3LW8A 3OE4A 4EDFA 4OHUA 3H3FA 5EIWA 3FROA 3ZDDA 4ZN6A 4W4TA 1CY2A 2H1IA 4DWJA 4EI9A 1J49A 2EF0A 2HDWA 3MWFA 3DWIA 3T1VA 3VKFA 1RYFA 3DHNA 2Q9AA 1IEVA 1NULA 3DT6A 1SD5A 2ERXA 2ZT7A 3G1WA 3PKZA 4Q01A 4RAQA 2REQB 3EWIA 2BAGA 2XUKA 3GFBA 4IEFB 3TBHA 3MAAC 3OHPA 1ENPA 1W0JA 2GWRA 4FDLA 4ZQHA 3TWOA 2CV2A 5LP6B 4NYMR 3G9ZA 1WD5A 2DMRA 4JP8A 3WKAA 1EG2A 5ALYA 4LMAA 2VOJA 5JFGA 4C3OB 3A1NA 5J4LA 2UYQA 3C6MA 2FVXA 2OESA 5FI3A 5LQNA 2C2MA 4IIDA 1T5HX 2RSLA 5HBGA 2HJ9A 1MC5A 2ZR8A 1FP4B 4X60A 4ZANA 2G6TA 3VJRA 2V7VA 1C30B 3MCAA 2QIOA 3GDOA 4ZRMA 5F35A 3TZHA 2EL7A 2NNLD 3KK0A 4GEGA 1R6BX 4J4BA 2OO7A 3RVNA 4C6RA 4UEJA 2BGKA 3NUZA 4U9HS 3O3MB 1CEXA 3LDAA 2PEYA 3AMVA 3LSYA 4YYZA 5IBQA 4A3SA 4EWLA 1U9ZA 4B3TB 4W7HA 1KO4A 4RFLA 3OECA 1XDSA 2PZAA 3LFTA 4KQJA 4L5AA 4MZDA 4XGQA 3V2UA 1NR7A 3R0QA 4OB8A 2PWAA 1V1RA 5IXJA 1PTJC 2WSLA 1VZ2A 4CUKA 4EW3A 3L8YA 3B6IA 3DWEX 3PIRA 2ZRKA 4CEIA 3AB3A 4WECA 1NBHA 2B8NA 1EJBA 3EQ7A 1CJKC 4UHFA 5L3SA 2E5LB 4XDHA 1OXXK 3FH0A 1AZSC 1HRDA 5HSGA 1P7WA 1J5PA 3GQVA 3A6KA 4NZMA 3C3WA 1A1SA 4IWYA 3SJ7A 2ICAA 4R2IA 1K7CA 1FBTA 1G7SA 1FCJA 3NDIA 1RKQA 4IZHA 3GLIA 5LWHA 1L6IA 1TPZA 3KQMA 2OPBA 5ALQA 1FFEA 3GNTA 3VR2D 3GROA 1XC7A 3LLUA 3TZ6A 2GJSA 4WL0A 4RVFA 5DBFA 2CXQA 4RADA 1TJNA 5GJWC 5LQDA 3KQPA 4J7UA 2G63A 1DBIA 1ML4A 4RFVA 4EM6A 2DFTA 3V97A 1CDZA 1X74A 3JRNA 3G85A 5CM2Z 4JNCA 2D8MA 1E2JA 5E7IA 4IP0A 4ZAXA 4N5HX 1ZZGA 5TJ9A 3QYAA 4MZXA 4C4TA 3WYEA 3U39A 1G0NA 1LVHA 1Q16A 2FRVA 2QMOA 4IICA 4LF8B 5U4QA 2B4TO 2GEDA 4EIWA 1L4LA 3AR7A 3JATB 3ITKA 1T24A 5BN5A 4JI2B 3H8SA 5TQ2B 4LVNA 2JLWA 3PWSA 2B34A 3VSEA 4B43A 1AB5A 1P3DA 3TQRA 3ZCTA 3PD1A 4LV5B 1DE0A 4I99A 3O4GA 4R8KA 5TGZA 5BYBA 4RWEA 2YV5A 1K66A 1D3AA