3JVEA

Crystal structure of the sixth brct domain of topbp1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
APKPLHKVVVCVSKKLSKKQSELNGIAASLGADYRWSFDETVTHFIYQGRPNDTNREYKSVKERGVHIVSEHWLLDCAQECKHLPESLYPHTYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords DNA topoisomerase 2-binding protein 1
publication title Insights from the crystal structure of the sixth BRCT domain of topoisomerase IIbeta binding protein 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3jveA00
1N5OX 3AL3A 3PXAA 2K6GA 3PXDA 4N40A 3EF1A 3UENA 3T7IA 1L0BA 3SQDA 1T15A 3FA2A 2NTEA 3OLCX 3SHTA 3PD7A 1IN1A 2ETXA 1Y98A 4OFBA 3HUFA 2EP8A 3PXEA 3K05A 2XNKA 3U3ZA 4U4AA 4BU1A 3T1NA 2XNHA 3L46A 3JVEA 2D8MA 4IFIA 3EF0A 1T2VA 1Z56C 3L40A 3I0NA 3PC8A 2R1ZA 2EBWA 2WT8A 2K7FA 3SHVA 3L41A 3PA6A 1L7BA 5ECGC 4BU0A 3SZMA 4Y2GA 1T29A 1OQAA 3AL2A 4Y18A 2M2IA 3COJA 2COKA 2COEA 1T2UA 2COUA 3UEOA 2HTFA 2EBUA 4XQ0A 1WF6A 3PC7A 3K0KA 1GZHB 3PXCX 2ADOA 4XPZA 3K0HA 2VXBA 3HUEA 4JLUA 2INGX 4ID3A 3II6X 2E2WA 2VXCA 3PC8C 4BMCA 1CDZA 3QVGB 2DUNA 3K16A 2LE0A 1IMOA 4BMDA 2AZMA 3T7JA 1KZYC 3PXBA 3I0MA 2JW5A 3PC6A 2L42A 3QVGA 4IGKA 3T7KA 1JNXX 3K15A 3KTFA
chains in the Genus database with same CATH superfamily
1XQ1A 1KI4A 2B61A 2QXYA 3FVWA 1IK4A 1YMUA 3OH8A 2F8SA 3A1EA 2IGBA 5T4FA 5JC8A 3A0RB 5CBKA 5DLYA 5C7IO 2RH5A 4M83A 4DRXB 1QLHA 4UCWA 1LZLA 2HDHA 4UHKA 2WYVA 2A5GA 1MOQA 3FX2A 3RVQA 3ZV7A 2B99A 3ZVRA 2WTAA 3PUHA 2XNDD 2ZIZA 4BNZA 3MG9A 4BOYA 7YASA 2C9YA 1ZN7A 5SICE 5K0FA 2WY2D 4UHHA 1RBZA 1IN1A 2PWYA 1E1RD 3MUOA 4ON9A 2OMKA 1UAAA 3QUQA 4KPEC 2QLMA 5ALPA 2XUAA 3COZA 3N8KA 1WUYA 2Z6AA 3PKIA 4HHEA 5GPBA 5A5FA 3FB1A 1RI3A 4M9XA 2XECA 4AMBA 3FRHA 3I8OA 2UVPB 4TN1A 1NHWA 3ZVNA 4W8GA 2GCOB 4Z2YA 3TNYA 1C9JA 3NLLA 1KDRA 3IIMA 2BFBA 2C61A 1DC8A 3H6HA 1REQB 4KBYA 1NQAO 3SKVA 3RFFA 2J5QA 2C2BA 4IH4A 2GHQA 2WIAA 3KOXA 4F6RA 4LDNA 5DASA 1JLSA 3OSUA 4JL8A 1GAWA 1H66A 4I1RA 2VJBA 5FTMA 2HK9A 2EZTA 2YWGA 3BREA 4M1ZA 2QPLA 4DLZA 2CYAA 5T7BA 2BAGA 5JZMA 3GQBA 4UXIA 4BASA 1EHYA 4HP8A 2WFLB 2OORC 5AICA 4CNBA 3AJ9A 1JTEA 1AVTA 2CBXA 3QUBA 2Q5QA 3MXTA 4OBEA 1R3DA 5CFRA 4RHFA 5ITZB 2WTMA 4FYVA 3MJCA 1H85A 2RFLA 2WIFA 3Q5GA 3OLQA 5C35A 2FA9A 1JFVA 1P60A 3GARA 1T2UA 3C8ZA 3L06A 3M7IA 1NP3A 2ZROA 4W6ZA 3EIHA 3HTXA 3JW8A 4I36A 2P9TA 3O8BA 2YR0A 4JT2A 1DAMA 3G2JA 1I4LD 4MUBA 2WVAA 1OSNA 3VVBA 3UWPA 4ZPXA 4QU0A 3M3PA 1N2ZA 1T3LA 4A8HA 4Z6KA 3HU3A 1GTJ1 1SXHA 2QRGA 3B53X 4ZV9A 1Q84A 2PSSA 1JQJC 1LBQA 1M2FA 2XH8A 3F2VA 2CV0A 2FZLA 5J4YA 1CQPA 1VE6A 5MN5A 4B80A 1V41E 1O6FA 1VBFA 3QPUA 4AJOA 1K0FA 1UMDA 5IVDA 4FOLA 4HQ0A 1DTWA 1PJZA 1T43A 2NOAA 1T8RA 3DVRX 3JQBA 4ENQA 4YMUA 1MO4A 1DSSG 1Q14A 2ZXFA 1I6LA 2GFIA 4WDRA 2P9GA 2QX7A 3N7UA 4FW8A 4PHHA 2G0TA 4BUCA 3A7DA 4AJ2A 4DLNA 1SC3A 2HADA 1K97A 1ZOOA 2BZ1A 3Q3VA 1RTTA 1B00A 2JW5A 4V2UA 1H2BA 4WY2A 5ARDA 1NW4A 1C8VB 1YZNA 2PPVA 1ZGJA 3OOEA 4UUPA 3ZWDA 4QJ3A 4IFTA 3CUTA 1V39A 3AFOA 3HZRA 1MT3A 1MPTA 3NUGA 4QGGA 4YIKA 1H2WA 3IP9A 4L9WA 5U4XA 3PIRA 3IOMA 1QX3A 5BN4B 2EFCB 3KJZA 4URHA 1K7SN 3I6YA 4G4IA 4CKBA 3Q41A 4HWRA 4DG9A 1H4SA 3OETA 2RI0A 2XJ9A 1KSJA 1S3IA 3R0ZA 5TQ2A 4BB0A 2ZAYA 5L3QB 4ARZA 1UJ2A 2X5JO 4ZYLA 1XLVA 5H7XA 1XD9A 4JXXA 1HDZA 1EWKA 1SQ0A 4IIXA 4L75A 3DE3X 1JFFB 4FK8A 1GTL1 5BN5B 2PAFA 4BDTA 3DAFA 1R4MA 1C0EA 1E79A 3LHIA 4MUHA 3WICA 2OAEA 2YHAA 4ODIA 3SX2A 2FWPA 2G1UA 4ZI7A 3SLKA 2V6JA 2DT5A 1N2BA 5D7BA 4ZVSA 2UYYA 2F3TA 1CP2A 3ET5A 3TOXA 4CKCA 2C20A 4MLPA 3W7BA 4MVJI 3EGIA 4FS8A 5AWFC 5BSKA 5FLKA 4MLCA 2VZLA 2ZUTA 4M99A 4CI9A 1ZVVA 3L01A 2ZBQA 4JYZA 2CFRA 1XKLA 2CNDA 3G8DA 4TM7A 4JNCA 3ZY2A 2VPXA 1OF1A 2M6RA 4Z9BA 3ZOZA 4ACAA 2QDXA 3G0GA 2I4MA 5F9FA 3PQEA 3BH7A 3LVQE 2CJFA 1MVLA 3RRZA 1Y1LA 3AMVA 4B82A 2ZSBA 3DMGA 1QJ4A 3KSDO 4RMHA 5GONF 3SZMA 4BHTA 3SKYA 5M2QA 4YQZA 1OXTA 4BB9A 2Z9CA 1UXKA 5KOHB 1USWA 3UV7A 1PJBA 1EUDB 2V54A 3DEKA 2IWHA 3AR8A 4FT4A 1IHDA 2HCTA 3E15A 2VJMA 5LXTA 5CIYA 3COJA 2RI1A 3VKFA 3FTQA 2WA1A 5G1PA 1PVDA 2JS7A 3NIWA 3L02A 5AI9A 2GEVA 4RCYA 1E9SA 3ENWA 3JXEA 3UJPA 4F97A 1MIOA 4D9MA 3RYTC 2XI4A 5AKEA 4KL8S 2MCFA 3IUEA 1ONNA 5SY6A 4LMAA 2B8TA 4QICA 4WY5A 3ILXA 5F7JA 3RFTA 2JAQA 2KS6A 4DPLA 4ARAA 2NUBA 1QUEA 3U3JA 4GIBA 5KYVA 2NPIA 4XQ9A 2YHSA 1U3TA 3R3JA 1J2TA 1NZJA 4UBJA 4CT0A 3ZW9A 2ZYAA 3BULA 1Y34E 1H9BA 4FX2A 1O0CA 1B8OA 5F4BA 4C88A 5KNDA 4TYQA 1BMDA 1T6NA 2R1TB 4INPA 3WLKX 3LXMA 3QGMA 4O08A 3U7IA 3FZEA 4YXWD 1PWYE 4FIZA 3WBBA 4DSUA 4KE6A 5BSRA 3BICA 2JLUA 1NBAA 3LUDA 4MWBA 1FYEA 2QENA 1E18A 3DHYA 1PV2A 4U8GA 2R9VA 5AR1A 4PC1A 2D4HA 1U0OC 5FBKA 5LXTF 3UW3A 1XCMA 5JWOA 5DM1A 1PFVA 1FU8A 3G5LA 4ZCIA 4EA8A 4OAOA 1L4HA 1R6BX 4XWYA 5LQMA 2QTRA 3RVPA 1VJRA 5F5LA 2ABWA 3JZAA 2CLMB 3ICEA 2JJQA 2NV6A 3VO9A 4B0OA 3PDJA 4R3WA 1F2VA 3VKWA 1AGRA 2EAUA 4LMRA 2OP0A 4A0FA 2A78A 3QWBA 2X7HA 5I48A 2QRNA 4X24A 1YTLA 3GFOA 1K9SA 4PC6A 1PFKA 3NT2A 4KPUB 4WA8A 3SEFA 5HS6A 1XNQB 2E55A 3FWPA 1IE3A 3H2JA 3LECA 3AH8A 3WK6A 3TOVA 1NTRA 3W5BA 4LZJA 5K0BA 2QVZX 4C29A 4KITB 1TEZA 2EKLA 3AB3A 5FP0A 1QH8A 1RQ2A 3S44A 1JHUA 1LTQA 2WJ4A 3RARA 4DADA 5JCXA 5EIXA 4KYIB 1WXFA 1ZC4A 1XZFA 3BXZA 5FUXA 3BWEA 1T6XA 4DKJA 2QJTA 3TW8A 1DIHA 5E9WA 1FVOA 3DMTA 4JX8A 2DLNA 2Q4TA 5FIUA 5CXQA 3PEFA 2H5LA 3DAPA 4RDIA 3VZPA 2FPPB 3QOXA 1DXHA 3UAZA 1YK1A 2DH6A 2FFJA 2G67A 1KY2A 4H0NA 4UFNA 1QHHB 4I55A 3MOSA 2HRCA 3CIOA 2YS7A 2ZU0C 3PFCA 5KDOA 4D6PA 5I7OA 1YO6A 3B82A 3PHCA 4JQOA 1YMVA 3TTTA 4N41A 5AW1A 1MDFA 3JTMA 3L8FA 4A5SA 1JG3A 1YS9A 2ISQA 4I1PA 3AYZB 2P9BA 3CUVA 4FDMA 4GOND 1WQ1R 4HDSA 1GA6A 4RVHA 4AG5A 3HJFA 2KB0A 2VDMB 1WLYA 2P8JA 3U3DA 2Y0BA 4QE3A 4HYTA 4G0PA 2R8XA 4LXGA 3K31A 1F7UA 2WSIA 1JQ5A 5KOIA 4HRVA 1RKUA 5IS2A 4EI2A 3HXMA 3V1NA 1U7XA 4MCAA 3N76A 2VDPB 3UHPA 2PGDA 3EGWA 3BIXA 4L6CA 2YMLA 5I7VA 3FPFA 4H4CA 4JI1B 1EK5A 1GZDA 3UJ9A 3K70B 1R2QA 3CWZA 3LQRA 4HQNA 5AFSA 4XGQA 4CF5A 4GP9A 1CJUC 3W90A 3SR0A 3IT1A 3JATB 5K20A 1GRNA 2ZDGA 4DLTA 3FM9A 3FCCA 4FKMA 1SOUA 1I8TA 4NNJA 3GOQA 2H1HA 3UFXA 3R5XA 4EHAA 4I55F 5EWMA 3B9RA 4Z86A 2BI8A 4BNDA 2K4MA 4IHQA 4JLDA 4E5KA 1FFWA 2ZJZA 4MPJA 1X8LA 1MEOA 2IVZA 2DWQA 3G8CA 3FCXA 5AI5A 5AKIA 5LKRA 2XZOA 1E99A 3DZIA 4Q7QA 3T7DA 3GIWA 4B3HA 3DUFA 4B46A 2PGAA 4M1WA 3FWYA 5A6SA 2P35A 3GT4A 3GNSA 2Y05A 3IKJA 2UZAA 1XEWX 2VJOA 4YAFA 2CLCX 3TFQA 5KHOC 5H3LA 4UAUA 4FOOA 5CLGA 4M8IA 5K3EA 4LTMA 3ZBTA 2PUFA 1HDCA 1MENA 3N0RA 3KU4A 5FA6A 4I99A 4PBSA 4QYIB 3ZS8A 1ZRMA 4C6RA 3D8HA 2VF7A 2YXEA 2DX7A 3EXFB 4G0XA 3M9WA 5CLLA 1LDYA 3FTDA 4AFNA 1YAJA 3C3PA 3THXB 4B71A 1FNMA 1RPTA 1SC4A 1G6OA 2V55B 4L3WA 1V96A 2QP4A 3OJXA 5CFPA 5BW4A 2PLRA 3UHAA 5BN3A 3FHCB 5EN4A 4C1NA 3FGPA 4L0QA 2JFHA 5FRDA 3IVXA 1AUVA 3WSTA 2P30A 5ALSA 4PZPA 1TVCA 2PL9A 3MS2A 5IT0A 4P92A 3K94A 4R8MA 4V0LA 2V3WA 3P2JA 3MWLA 5I9MA 5JS7A 5IZCC 2GCPA 1A1SA 2VSYA 3PGMA 2P62A 5IYZB 1PR0A 4XSVA 3L05A 3HKDA 2BKVA 3LZCA 1QV9A 1JPVA 2ZAMA 1DWPA 1ZW1A 2O6HA 3CBGA 5TS2A 3RVKA 2ODPA 3V6MA 3VU0A 5JAHA 4ZCSA 4XJXA 3LT4A 3G13A 4OCZA 3VX4A 3N8DA 4FGWA 4EYGA 3EDMA 1RHJA 2QLFA 2WT9A 3ADCA 5EWLB 2PG3A 4OXYA 1QQ7A 3ZGNA 2OBNA 2DBVO 1WSAA 1G0OA 4NG5A 5A7FA 1YJCA 1WCXA 4NCBA 4IGEA 3RLFA 4PEVA 4A4DA 1Q3TA 1ZR2A 1KXZA 3L7BA 2HRBA 5FF9A 4NDZA 3OOJA 1XEFA 5EYPB 2BYTA 2FSSA 3AKEA 1BXKA 2IXFA 4RY9A 1IDOA 1PK8A 1U2ZA 2P41A 2XNDA 1MD9A 4CTNA 3A31A 3Q15C 4KMRA 1TCVA 4GC9A 1E1RA 2QL9A 4DFDA 3KZ1E 2OV6A 3JQ8B 1W52X 5SY9A 4CMKA 4IGFA 1OFTA 3NATA 1SELA 3IUNA 2RAUA 3G8YA 3MINB 1YC2A 4CLDA 2VO1A 3P19A 2YBDA 3VR5H 3PLNA 4A6DA 1NYQA 4IZ6A 4B3BA 4E7OA 4KRGA 1IJEA 3WL7A 1HTWA 3U7QA 4ESVA 2RHRA 4F5DA 3QVSA 4DLAA 1HE8B 3W2TA 3IV6A 4C89A 2IODA 4RZQA 5JD5A 1VXRA 4WLFA 1DAOA 4ETNA 3MT9A 4WKNA 1OX4B 5JNWA 1LNSA 2HPVA 3ZHBA 1EI9A 3QEOA 4CQJA 1KBOA 1DFHA 3FLAA 3NTXA 1UP6A 3KE8A 1G7RA 5HDBB 3TLAA 1RZRA 4G97A 1TQ6A 2ZG6A 1Q0RA 2WZQA 3IUQA 5A0FA 3NJ8A 5H80A 4ZOQI 3UMJA 1KAMA 2D5CA 2PV0A 3QU9A 3W2GA 1Z29A 2VWPA 4HJRA 5LM3A 1U3FA 4F2HA 2VZ9A 4LC0A 5KZMB 3BKWA 1Z26A 3DXYA 3AY0A 3GJQA 4X85A 3MPUA 5DHFA 1ISGA 4US1R 2VH2A 4C0KA 1BE1A 2O2XA 4WNAA 2AZ4A 4FQ5A 3LFUA 3MJHA 4PFSA 2G9ZA 1MH9A 2QXUA 1EDBA 2GBCA 2IBMA 1M2VA 4DMFA 2VIIA 5CDHA 2Q4RA 4YT2A 1Z2NX 5CDFE 4CEHB 3H17A 4HNGA 3OEWA 1XUOA 2GZHA 3M1IA 2DY1A 4NAHA 2R6HA 3DV0A 4BKQA 4L3OA 4ZXFA 3WRYA 4D3ZA 1G1AA 2YUIA 1VZ3A 3FYUA 3JQ7B 3OPYI 2XLCA 4S2EA 3UK7A 1YU6A 1R4NB 2F3QA 1G66A 4FFVA 2YV1A 1Z5WA 4HC4A 4BX0A 2AFIA 1GGHA 2G6BA 3HM9A 2YW2A 2WV7A 4RTQA 3O8QB 3IOBA 2G77B 3MQFA 2B35A 3GPDG 2O5EA 4XI9A 3M4NA 5EQTA 5CVJA 4EJMA 3KEGA 2B9VA 2QMEA 5BSGA 2YBEA 5C1DA 1UINA 3ZG6A 3HA3A 2A3RA 3EQ9A 4FMDB 4CM9A 4ESEA 3NV7A 3WOVA 4F4FA 3DVAB 4GC5A 4IFEA 1JLRA 1PFUA 2GN0A 1E62A 4G8JA 3UWOA 1DOZA 1J97A 4Z8XA 3RJ9A 1DAIA 2W22A 5DW0A 3NWEA 1YQEA 3CT4A 2NNLD 2V0CA 3PITA 5EMJA 2HJVA 2ONJA 2R3SA 4RMNA 4TL6A 4MPPA 4H18A 5B6JA 4E31A 4XLLA 3H0KA 4IJMA 2F9LA 2W7TA 3AP1A 2PSFA 4RS4A 2LD4A 4BO5A 4MDYA 1KR5A 2C3OA 4R16A 3WX0A 1KF0A 2FOLA 3AM3A 4U0KA 4YROA 2X8BA 3K05A 4DZZA 4K0KB 3LBAA 5CLIA 2PH1A 2XYRA 3KPJA 4KQIA 3P9NA 4HYEA 3UH1A 2FSFA 4DW8A 2HMSA 2I55A 3A06A 1QXSA 2V58A 3HCNA 3PUWA 4R2MA 3H1PA 5E7IA 3LG2A 3O0DA 4EO7A 4A2CA 3CE9A 1W49A 3RUAA 1QAMA 1HL3A 3MTIA 3BRSA 3D5EA 1F12A 2ERCA 2EBWA 4KRYA 1D1TA 2ASVA 2JHCA 3SQWA 2PV7A 4MWCA 3TOSA 1GT91 2HIAA 1K88A 4Y6OA 4IHJB 4YGYA 4LF7B 5FL7D 5CAEB 4LG1A 1ZIDA 1GRCA 3PNPA 2Z3ZA 1RABA 3F0TA 1P1HA 2FK8A 3ZHYA 3K0FA 4RXUA 1OMOA 5CPBA 3ZI0A 4CQMB 1PK9A 3T5MA 4C0LA 1P2SA 3DC2A 3EOZA 4Q3AA 5J1SB 1KS9A 4NENA 4KCGA 3ZNNA 1L1QA 3G5AA 4OAQA 4PTYA 1WXQA 1JHMA 2C5HA 3MYRA 2VAPA 3E82A 3JYNA 5BPHA 2H1VA 3JZMA 1CSEE 1MV5A 4P4SA 1SUDA 4NBWA 3B7PA 4RV9A 4XYBA 1L3BA 2JEOA 3BIOA 3LX4A 4TTAA 3R7AA 4EGCB 2NP7A 4KXYA 4N0PA 1A9XA 1L5VA 1JXAA 4N3AA 3V7NA 2JLXA 5I7HA 1HR0B 5KEIA 1D4OA 3FG9A 4MMXB 4URUR 5TQ0B 3CISA 1N1GA 4AL4A 3NU1A 1Z0IA 4HLCA 5YASA 4H7HA 2BFWA 3HR4A 3AM5A 4OA5A 3M3DA 2QM0A 1P6UA 3KWMA 1WZ2A 4KDEA 1TTQB 1D2NA 2ADOA 2XDQB 1RXEA 3HUEA 4XE5A 4ZQHA 4ZYVA 1DQZA 1V43A 3F8WA 1VIMA 4HWTA 2DUWA 1HWYA 4DLVA 3ETNA 3UBTA 1B43A 1CDZA 2J46A 1JH9A 2I2BA 2GN9A 3ANLA 1UPFA 3Q72A 2JGAA 3ER9A 1BCRA 1D1PA 4Q37A 3CCBA 4M1EA 2F8MA 2FAXA 2ZWAA 3AG5A 2J0QA 4DA4A 1RXSA 3G85A 4PSKA 5LR6A 4HF7A 2C2GA 1ZMRA 3VU9A 5AVQA 4NJEA 1XKQA 5KTMA 4A03A 2ARKA 3KR1A 5C32A 4GX5A 1LU9A 2FXIA 2AHRA 4U7HA 2HQSA 1H5NA 4X6YA 4RE5A 1MJGM 4AK9A 2OCYC 2B37A 1DDIA 1NATA 3QXHA 3DAYA 4RKQA 5DIFA 1QYWA 3AF5A 5K05A 2PX6A 3Q0EA 4YXWA 4OTZA 2UUAB 5AHRA 3LVRE 1U63A 2IOHA 5EMNA 2VUSA 5BY2A 1LX7A 3GVIA 5FWYA 4WA7A 3O38A 4LA4A 1XZGA 3DKKA 4QNMA 2PT9A 2HPAA 4P7KA 4XVCA 2CV2A 3DQZA 4R2WA 3MMZA 3TOCA 4NDNE 4IDPA 2AXEA 4KXMA 4B34A 1SULA 2FR8C 2WG1A 5HKOA 1PZNA 3NPMA 1XMVA 3LDHA 1PG2A 4TL8A 5KNLA 3SIXA 3K71B 4B35A 1XZHA 3W9SA 3IAM1 4G1FA 5CXXA 4C1BA 5BVGB 3QX8A 3T5TA 4CUZA 3Q3IA 4NJMB 5HF6A 3A4IA 3IDQA 3M70A 4OUDA 4AS1A 1MB9A 3N2LA 1XAIA 4QUGA 1Q2UA 1U90A 2FQWA 4D02A 4DMUB 4PFJA 3CUYA 4JP1A 3DWIA 2LUOA 2P9EA 3PJRA 4RX1A 3ZLTA 3S5UA 1PZMA 1ZMXA 2QD2A 3W7VA 2DJIA 4GLFA 3DR3A 1IZZA 4AX4A 3D4OA 3WGNA 4J07A 4PSDA 3ZJ4A 3LUKA 4IPTA 1DAHA 1W4RA 3KYDA 1KAOA 1MA3A 2Z3VA 2A94A 1PJTA 3W06A 2JLBA 2BWJA 5AK0A 2QRVB 2BKLA 2IDMA 1N3IA 3DDUA 4UU1A 5F1OA 3NM5A 1NJ2A 2BF4A 2EKZA 4IIJA 1BGXT 1KI1A 1DB3A 1U2DA 5D01A 5A4JA 2A9RA 2H1LA 5JDIA 4F6RB 4DLSA 1VG9B 1NJ8A 2BFMA 3EVBA 4QAJA 1N7HA 2H5IA 4XIIA 5BV2P 4JH0A 1A9TA 3EIEA 3H0CA 3FOZA 3HRHA 3K7EA 3PE3A 1WXHA 1CQJB 5B3AA 3RWOA 4N5LA 4C0XA 3LOUA 5FI0B 1M83A 2DG2A 3SJBA 5PNTA 5AH0A 1J8YF 3LC7O 4EWLA 3MCTA 4GVLA 4NECA 4V03A 1ZSNA 3S2GA 5KVCA 3FXAA 3A6PC 1H05A 3OZIA 5BMVA 1O4VA 4MITA 5FNVA 1GPNA 2C8JA 2EWMA 2A5FA 4FONA 4HBGA 3AUAA 4ZC8A 4U5XA 4LF8B 4QFCA 4RY2A 3NIDB 2V6BA 2JCVA 4F4DA 3NHPA 4J1TC 3H1EA 1A96A 3KR0A 4XM0A 5DT9A 2EZ4A 3M34A 2O8FB 3TLXA 3FETA 4HAXA 4ND8B 3IAS6 1KI3A 3OQHA 2I7CA 4J0KA 4DQUA 1Y3CE 1L4BA 3BXHA 5F7ZA 1BKYA 1RIFA 1RM3A 4LHVA 4IIJF 1GPMA 4UBLA 4UBMA 1HH4A 1UBJS 1QIIA 3QQPA 3DXZA 4PNPA 1QYIA 3V48A 3RE1A 4DCUA 1H6AA 1COWA 1Y8ZA 4AWAA 4O6VA 4GZ6A 4P3NA 3SR4A 5E6UB 4J3JA 2AG8A 4ZOLB 2HWYA 3MRVA 2E37A 3GD5A 4N6OA 1DVRA 2VHXA 3YASA 5IDQA 3KIPA 3K4HA 2AG6A 4CM6A 4PXAA 4PYLA 2A9QA 1POXA 2FP4A 1U0FA 1IPFA 1OTXA 3T3IA 2D0OB 4I3FA 2XTAA 4HWKA 3DL7A 1OX6A 1GD1O 1ZH2A 3KAJA 1KMHA 4REMA 5FNVF 5BMVF 4IICA 4REQA 3HA5A 4UZSA 1XTRA 4KLZA 3AUFA 3CKKA 2RJ3A 2M6SA 3EHEA 4JK3A 2C03A 2JZOA 2QM8A 4X1KA 1UPTA 4A1OA 3A3KA 1JIXA 4JSTA 1UBTS 1HOTA 3BB3A 4BP3A 4BMSA 5FBLB 5HZMA 1SUEA 3D6TB 2YZMA 4HGZA 4F72A 2VJKA 1YCHA 4P83A 3MCZA 5GGYA 1BEZA 3ZZ0A 4BE9A 1T2FA 1RKVA 5B3KA 1SHKA 4Q47A 1KARA 4Q18A 3ZGYA 5BWNA 4JUIA 4BY9E 2BFFB 3X2FA 3EGXB 2J0UA 4BNGA 5CXUA 4MTLA 4Y9TA 1KI6A 5BVHA 3AHFA 4N82A 2MYUA 4Q16A 1SZDA 4PCLA 2ZB8A 1JHXA 1NQUA 1JBQA 1DIOB 2QY9A 3E6AA 3RYHA 3STUA 5C4IA 1BDIA 4BO6A 3R3UA 4YQYA 4NR0A 5A4KA 2C7PA 3SG0A 4ENPA 3UY4A 4YLEA 3B6ZA 1EHCA 3KQQA 2P68A 2C3MA 3P9ZA 4NE7A 3BWYA 2NXCA 4ZGBA 1TO1E 2NZWA 3EGOA 4QTXA 4OXKA 2LXNA 1K5HA 1VIVA 2D0PB 2PFGA 2VXYA 3QLVC 5TQVA 4OVKA 4UTNA 2H06A 3PC8A 1NM5C 4IZHA 4URZR 1E8MA 4ZT2A 5HOQA 2OSVA 3AP3A 4F06A 2NZXA 2VPIA 1WZCA 1YFZA 5AHXA 3PZBA 1PSWA 1SCAA 1VSBA 2DR0A 5DCUA 4I9HA 3P0FA 4EMTA 2I29A 2M32A 3WK9A 5JYCA 4EY8A 4TTRA 4GNKA 1ZX1A 4D0LB 4LZOA 4YJGA 3L0PA 1DLJA 2PO7A 2PRSA 3VDNB 1LDBA 1SEVA 2C8VA 1RRGA 1X7DA 4HO1X 3OP1A 1GTSA 1PLKA 2O05A 2OHJA 2YH2A 2ZRJA 3JR7A 3RVMA 3OPVA 4UBKA 3VGJA 4B9AA 3IP1A 4E94A 3QMVA 2R11A 4KDCA 4PBTA 1YL5A 4C2AA 1QO0A 2BMDA 1T3GA 4F8YA 2QMYA 1JALA 1W25A 1YCGA 1DADA 1TGYA 2J3LA 2R25B 3FNIA 3RUFA 1SUWA 4RVUA 1OH5A 2F8TA 1OILA 5LJLA 3C14C 1B4DA 1Q1BA 1CHNA 1YI0A 4UM8B 2RGDA 1FW8A 4I7EA 1JKJB 5ABPA 1WX1A 4FNGA 1SD2A 2WD9A 3G8BA 2R7NA 4KO3S 2PYDA 4L74A 4HPWA 2J9FA 1I0ZA 1Z5OA 1J9EA 1YA8A 1LW6E 3H9JA 5DBEX 3EGDA 4BQEA 1MW8X 1MQSA 3CNOA 1QP7A 1UMCA 2R62A 3LFHA 1NQXA 2KLBA 3W5IA 2IL1A 1ISFA 2W0SA 3OM9A 4B45A 3OWXA 3OX4A 1KDPA 1RLIA 4ND1A 5KI6A 4MRMA 2E5LB 1N34B 1HOXA 1HE3A 3OQMA 1MNQA 4EHJA 2R5WA 1PS9A 3LWNA 3F90A 4IEIA 1GP2A 3BAFA 3MQ4A 4MLDA 1L8QA 3LC2O 2WMYA 4L78A 5COAA 2NAPA 4CGYA 1GAQA 3AVTA 3AOEC 4JSRA 3NS7A 4RF2A 4U2DA 2WJAA 1WULS 1U8UA 4ZK6A 3ND5A 1ACMA 4CJXA 2OZKA 4L1KA 3VZBA 4KYUA 1MJ5A 1GQOA 2BHSA 2NP6A 3EBPA 4KX3A 4PLWA 4R83A 3RYCA 3GRCA 1XPUA 1RRFA 1ZUD1 3QUTA 1SXJB 3DS8A 4EMBA 2WBLC 2JCXA 3SZLA 1QV7A 1H8HA 1ZCJA 1ZICA 3V4SA 1KFBB 1HGXA 4MS1B 2X0FA 2HMWA 5FEUA 4AO6A 5LYYA 4AP5A 1U1EA 3ZDYB 3W7AA 3EVFA 1MHPA 2QT9A 2WMOB 3LWDA 1EUYA 3AY6A 3QA9A 4UU0A 4LCBA 5IJ9A 5H8WA 1ONBA 4OQDA 3X1WA 3FPLA 5B30A 4DJTA 3DPUA 5KTNA 4CMEA 1XB2A 3IOEA 3UJ3X 4NYIQ 3R0XA 4E5VA 5ICCA 2ETXA 2OGWA 3G7NA 1I3OA 3IIIA 4L57A 4QO7A 3HI4A 4DSAA 2VWGA 3TMKA 4YPVA 1OZGA 3MJVA 4D56A 2D00A 2ADMA 3U4GA 2CUNA 3ABSB 3O8NA 1G20B 1BDMA 1JUDA 1RHRA 1CUFA 3HLTA 1ZHHA 2CXRA 2B2CA 4OBWA 2XB9A 4PE5B 3R9KA 4KFCA 4DR2B 3DWEX 2WAXA 3DLIA 3RHTA 1XMQB 2I6TA 3TBHA 4TKZA 4AIRA 5MF6A 3FVQA 3UO8B 3Q6NA 4I2NA 1PVVA 2EGGA 3OPNA 1NFQA 2FN9A 4DVGA 4FFBB 4LHSA 2P2YA 3VC1A 4GPIB 4F91B 4MEAA 3AVVA 3GHYA 5JIBA 4CLRB 4PLHA 1JPJA 1M54A 1PP4A 3ZY4A 2ID8A 2TYSB 2VJYA 4HAOA 2VK4A 2WM9B 1JTFA 2QUJA 4JB8A 2O7RA 4LF9B 3HDTA 4MDEA 4G5FA 3D0RA 4NDAA 4D3DA 3BD7A 4D98A 2AN9A 2XOKD 2QJOA 3TJMA 5KTSA 2VHZA 1TF7A 5I5GA 3A3PA 3JQCA 5FI5A 3BK7A 4O4IA 1AIPA 1ID1A 3ZU3A 1GPAA 4LPKA 4DMHA 1JZSA 4Q4CA 5KJ6A 2I65A 3NEAA 4XJSA 3L2OB 3HB9A 3WIUA 4F4UA 3DBLA 2WWYA 1OXKB 2CLSA 1AS3A 4QPPA 4JKIA 3NC4A 5FL7A 2LP4Y 5EIHA 1QQ5A 3ESRA 1C7ZA 2VHJA 4HADA 1ZK1A 5IARA 3WYEA 1DJQA 1UJBA 4O2BA 2ORYA 1UT8A 4FYPA 1BMTA 3RJTA 1UDCA 1VL8A 1BJKA 2NXNA 1OVGA 2X4DA 2OFFA 3PLAE 1OIWA 2C4UA 1NBMD 1NVXQ 1QFMA 1FB5A 4QEDA 3T6KA 1MCZA 4B7AA 3D6UA 2VL7A 1NYLA 1TLLA 2J0VA 2NADA 1P3DA 2WILA 2XADA 4XGRA 3I9OA 4RW0A 3LP5A 4MVJH 1C41A 2ASEA 4N39A 4INAA 1CB0A 1JEQA 3AJRA 3S28A 5EIWA 4BJ6A 5PGMA 1E1YA 5AI6A 2GASA 4BGEA 3LV8A 4F84A 2P2CA 3PQ7A 2X0EA 4EITA 2CYBA 1ZGBA 1T4CB 2O8EA 2JCYA 1JT9A 1JHOA 4HDAA 5D5PA 4Z4GA 1XRRA 4P5EA 4YJKA 2WLTA 3TSOA 2FHPA 3E1SA 1DT3A 4OH1A 4G0MA 1YB1A 4O4IF 1YF3A 5BSVA 1E66A 5FTLA 3KYCB 1Y6FA 4ZPJA 1FEZA 3ZE9A 1N5JA 1XEXA 2V4MA 3A6JA 4RVSA 4X93A 3T7EA 4RGVA 4HSEA 4MVJP 4E30A 4M76B 3EG5A 4WADA 5TV2A 1WA5A 3VPBA 1YU9A 1DCKA 3KVVA 2PH7A 1KDVA 5IWCA 1VPWA 4MUEA 3G9UA 2VYVD 3GJ3A 3Q0TA 5KPJA 1ZJJA 2WB4A 3SKXA 3F6YA 1TF2A 4N40A 3I5XA 3QNUA 2H2IA 5IW8A 1QHFA 4QELA 1VECA 2ECOA 4OYYA 4XFKA 1T3SA 3QLEA 2FXVA 4RHEA 2WQ6A 2NUPA 5KKCA 3H16A 1VTKA 1YXMA 1JIIA 1SHLA 1UL1X 1Z68A 2AN4A 1UBRS 2EARA 2FZWA 2I1VB 3G5TA 3KJEA 1XJWA 1DEXA 1P5FA 1CUEA 1QNFA 4WJZA 4IMPA 1ZD5A 4Y2PA 1FFGA 1MRZA 3TUZC 4O33A 1I3CA 3GFTA 5AUOB 4LWPA 1Z0KA 4R1TA 4TX1A 5IN4A 5EJ9A 1L3CA 3F6PA 1R88A 2WW8A 2GWHA 3E3MA 3ED1A 4XRRA 5ESDA 3R75A 1U9IA 4FR0A 2Q9UA 4FHFA 2PBZA 4PF1A 1OU4A 2ZJ7A 5E38A 3ANYB 1X0VA 1GPYA 1SBYA 4KWEA 5A62A 4U3JB 2Q4OA 3OQJA 5AM1A 4AZSA 1XK7A 1ENOA 3AI7A 1T9BA 2ZUFA 2ILVA 2WSSD 4IXNA 3ZEIA 1XO1A 1DCFA 4J0CA 2QORA 3TMAA 3ZIAD 2P0EA 4LISA 3QEMA 2L0XA 2DHQA 2X2PA 5T67A 5KYWA 3D0KA 1L5HB 2IOQA 2D7DA 1C0KA 1FDTA 3D8UA 2H11A 1TZJA 3U1VA 2GKOA 3FGOA 4PTLA 3TW4A 3U4CA 2VTBA 2NO1A 4E1BA 3ND9A 2NG1A 3EXG1 5JW6A 1IJBA 2ZSAA 3JALB 4J91A 4RHTA 3G0HA 3P2OA 3W8FA 5DSZA 3HP1A 1TKRA 4HH0A 4K05A 3E18A 4C4AA 1EFRD 3FTEA 2ZUUA 1JDJA 3IEXA 4H1VA 2DERA 2YVKA 4WZBA 4K3VA 1EA5A 4INZA 1FS4A 5ALNA 1UWVA 2QJWA 2VT2A 5LNK6 4PV7A 2H17A 1ORDA 1L5YA 4MPRA 1FTYA 3AINA 5CJJA 3U37A 5IH3A 2R84A 2H2WA 4F7WA 4O0MA 1DRJA 3GUHA 1GPJA 4QBFA 1GWNA 3CLSC 4P3OA 5AK4A 1QWOA 4LYEA 3S7TA 3LQQA 3IBSA 4H60A 4N6GA 3BN3A 5ALDA 5DGXA 4CR7A 5KYYA 3CG0A 3U7GA 4QPNA 2PT7A 2I33A 2H07A 3OEHD 4JGIA 4JLUA 3UA4A 4B8YA 5H16A 4RPLA 1M8KA 1E6LA 1T1GA 1TB4A 5LDGA 1XIVA 3N39C 1I33A 4PQRA 4L8VA 4QOJA 2M1XA 4OJYA 4RBNA 4WCDA 4KO1S 1X9HA 4PIMA 1ULZA 4YB8A 3AF0A 1G3IA 4LUCA 1LSJA 4Z51A 1CV2A 1HNXB 3JQGB 1O03A 3BMNA 4X3PA 5AK5A 3CN7A 3Q6MA 4XVHA 1PT9A 4RULA 3PYLA 1LGYA 1O5TA 1J24A 1XG5A 4B4KA 2Q1UA 5IVKA 2F43A 3PX3A 3OCVA 2BC9A 4HX5A 4ZMSA 1KRWA 3EYWA 1CR1A 2ZU6A 3WLEA 3BE6A 3W3AD 4F3RA 1OLSB 2PQ2A 1R8QA 1TUBB 3K6JA 4GUAA 4ZDJA 3DV0B 2XMPA 4NZMA 3HY3A 1FNBA 1FMLA 4GFDA 4WXHA 2ZTHA 4QGBA 3RUPA 3K73O 3V80A 1HKUA 1NW6A 5FOUA 1EVQA 2V9CA 3WNZA 3FPKA 5JATA 3QLTA 1YS7A 3AJDA 3AL3A 2YASA 3G23A 4Q24A 3C45A 4Q5IA 4FMPA 4KYVA 4YMLA 2AKEA 2HM7A 5D5HA 2RHTA 3FCAA 4I6JA 4K88A 2YIDA 3UJ8A 4PGMA 3CMCO 4QASA 4KSCA 5CH5A 3BG5A 4BFYA 3S1AA 4DT1B 2ZWIA 3AJ8A 4M89A 3MFYA 3WL8A 4TL9A 5FV4A 1NVEA 3DEYX 3F5FA 3LW8A 1SXJE 1VPLA 2WZBA 4HWGA 4W7SA 3KP1A 3RIMA 2R0QC 2NTJA 3O4FA 4GBGA 1P0IA 3OFKA 2ERYA 1NA5A 4J43A 4R1NA 4C21A 4V39A 3V42A 1C1DB 2XE7A 4L7VA 4TXLA 1WHTB 1NQTA 4KE9A 4C43A 5LYJB 3PPVA 2ETVA 3N8IA 1PJLA 4RL4A 1LVHA 4IDOA 2O0MA 5DWDA 1BHJA 4DEVA 1GSOA 1LDNA 4RIIA 3VR4D 4LDPA 5FTKA 3JQBC 4F2GA 2IXTA 4L9SA 1L7EA 1J0BA 1JDUA 5TVGA 2FEXA 1UQUA 3RS5A 4CG2A 4Y2VA 2CVHA 5K4AA 1ZHOA 1ULUA 1T6ZA 4XFDA 1Y1PA 2AK3A 3SXUA 3W5CA 5IVHA 4MR7A 4M1TA 1QZZA 3GBSA 1L4FA 2V7TA 2IZ7A 4MHTA 1G20E 3NGMA 2IX3A 4HWOA 3WLTA 2VQFB 3FNBA 3WMGA 5KHAA 1R50A 1B7GO 1YHNA 1YUMA 1YOVB 5G40A 3WWOA 4DCTA 1JIJA 4K46A 3LOPA 4P22A 4P5PA 4GSKA 3D6NB 4J0QA 5JU6A 3PV0A 1NWCA 1QFYA 4UC0A 3PFKA 4HUJA 3G9XA 1UPBA 2B7BA 3R3SA 1RXVA 1DDOA 2HCRA 1IHPA 3M4XA 5CT5A 3MT0A 5K0CA 3HN2A 5AESA 3C74A 1T1JA 1ULTA 3K0FB 3T94A 1XA0A 3DV9A 1RRMA 2UZ0A 4JITA 1VYHA 2ZWPA 3WL4A 4N12A 3GP3A 1QC5A 1XCOA 1KO8A 2WD7B 4NQZA 5LJIA 4PZAA 3UPTA 4PZDA 3AEKB 1XQWA 2FPGA 3HU5A 2ZUWA 4IZOA 4R6XA 5EZ5A 4I2VA 3SJCA 3ZXSA 2PGXA 5DNDA 2C9DA 1CY4A 3WC4A 1SCBA 4KOAA 4RQAA 5C34B 1FBTA 1NPTO 3IERA 3K0KA 4DAOA 4GXQA 4IXTA 1SD1A 4Q4HA 3BCSA 1GAEO 5REQB 1PWEA 1JA9A 3UICA 1IRIA 2D1YA 1FQWA 2AOVA 2QYTA 3ESQA 1VJDA 3BGIA 5JSUA 2JFQA 4MW0A 3HKBB 3VHRA 4BMYA 3CLRD 1J8FA 1SKYB 1Y63A 3GA5A 4MXDA 4PHFA 4YUAA 3AUXA 1IBMB 2DUNA 3AEUA 1XK6A 2IIQA 3IR6A 1XTPA 4E1AA 4YCNA 1U99A 1VE5A 2FEMA 1NY6A 1ZCBA 3KG2A 4G5OA 1PTKA 3BFXA 3QJYA 4TKLA 4U7WA 2OQRA 2QHXA 3BHJA 2PKWA 2B1QA 2BFCB 5FBWB 3IP7A 4BECA 5DXAA 1YD7A 5K8TA 3B1FA 4BTEA 5DISB 5B4VA 2A57A 3IV7A 2CXTA 1U9ZA 1CUYA 2JD0A 5AW0A 3AC0A 3ZJTA 5KKNB 1T1EA 2OZEA 1NDQA 1S3FA 4EOGA 1NT4A 2XWSA 4EY6A 3RVLA 4N5DA 3JAKB 4QDZA 2XVMA 1O89A 1JA1A 4HNTA 4RU1A 5ESXA 2CCGA 4FE4A 5IEJA 5KYKA 4Z1OA 3L4SO 4D41A 3IP6A 4M86A 2C57A 2QIOA 3WZMA 2AXNA 3L4KA 4YRSA 3O4IA 1KBZA 1JJBA 2DFNA 3OQPA 4C06A 3SWWA 4D4IA 5JUWA 1E2KA 4AKHA 5J59A 4TVBA 1MX1A 3IQEA 3KDSE 3R76A 2J6HA 4Z9FA 2JFOA 3HCCA 3UHOA 3N5KA 4LCEA 3TI7A 1VRWA 1WU7A 4ISBA 4B43A 1I7QB 5HIMA 3IL2A 3C85A 3TVTA 1G19A 3H2GA 3JX9A 2W00A 4PPFA 3VOSA 5HM8A 3WLLA 2P2LA 5BO5A 2OFOA 2HH9A 4B6JA 4X61A 2P1ZA 5KYNA 3DCJA 3QHPA 4RZUA 4LGCA 4NATA 4M1KA 1NLMA 1QR6A 1UMBA 3N7AA 4U7TB 2QKYA 3FFXA 4MV0A 3TUJC 1NXTA 4BX3A 4EVRA 1H1LB 4YWHA 1X86B 2HMYB 4C4XA 1Z8FA 2JI9A 2V7QD 3SI7A 3U44A 4S3MA 3FZYA 3ETLA 5B36A 3DBHB 2OVFA 3D3EA 4E2XA 2QK4A 3WYCA 4AAYA 3D7LA 3DMPA 5IKMA 1YR9A 5E1BA 1RVV1 1VRVA 3WJ2A 3CE6A 3L0BA 5JS6A 3T9FA 3ZDCA 3RVSA 3T3MB 1U5AA 4POAA 3R24A 1ONSA 1T5SA 2WWGA 3ABQB 3O2SB 2ZSKA 1O94C 1ZM9A 3V8MA 3QI2A 1DX6A 1VLZA 3KT0A 5CHYA 4XDYA 1V5WA 4ES6A 5A02A 4CR8A 4M88A 4ECEA 1I10A 1CY2A 3QM1A 1SXGA 2ZSDA 3MIIA 3F9CA 5IHXA 4G1VA 1Z6TA 2OENG 3K0AB 5ESWA 1X7ZB 3LTNC 4RPIA 3DMTC 4JLNA 4R1UA 4OLBA 2O2DA 2XOKA 2B78A 1KVTA 4UFOA 2XR1A 5KOJB 2JFUA 2PX3A 3DOUA 3UXMA 2XTZA 4IYJA 2Z1DA 2OHFA 1XBTA 1N2CA 2PGNA 2IW1A 4NS4A 3GAMA 1TYZA 2Z9BA 1KE1A 3QFHA 1Q20A 4CUKA 2GKSA 3AY3A 4WFKA 2VPYA 3QKRA 3N53A 4D9KA 2KSQA 5BV7A 1NF8A 3VYTB 4YNBA 1RYBA 2JBHA 2P5UA 5EIBC 3NP9A 3ZY6A 2A35A 5CD9A 1YB4A 3IUBA 5SV2A 2UUOA 5HFNA 2VDOB 5IF9A 1CDDA 5A05A 2E3JA 4UNQA 1XWIA 4GOKA 4M46A 2JHFA 3TRHA 1V5IA 2W6OA 3AEQB 3GUCA 1IY0A 3LDFA 3P8ZA 4H7IA 4QQKA 5K1ZA 2J48A 1EB8A 1U2TA 3UAVA 4AU1A 4L5JA 2VLBA 4TVKA 3WNVA 4LYDA 3P1JA 3GLVA 1LXCA 4N01A 5DI9A 2WE7A 5ENVA 2VYND 1EJ0A 5B7NA 2BFAA 3NDJA 1PJ2A 2ANBA 4JBHA 4XM1A 1C7JA 1CZNA 3TR6A 3V1TC 3ZBUA 1JNYA 3TD6A 3Q9LA 5JNSA 1GGJA 1UH5A 4N18A 1CKEA 2D7JA 4G5SA 4MIOA 5AJXA 4CIXA 1OC2A 4D43A 5LMCA 3TRKA 3INNA 3COSA 3OLVA 2Y4OA 1PU2A 4YJ3A 3WGKA 3IPAA 3OIUA 4LJAA 4G9EA 3VJMA 1E9RA 5JROA 3E9DA 3F73A 1T5IA 3QIAA 1YNOA 3OO0A 3SX4A 1N6OA 4CKWB 3ZR4B 2ID7A 4LDJA 1JSCA 1Y6RA 3GGDA 3LT1A 3MVEA 4V1CB 2UYOA 1PSZA 2QW1A 1NLYA 5C1BA 2VYVA 3S27A 2B82A 3BRQA 3CZCA 4Q3NA 1M0WA 1G7CA 2AFIE 3DTTA 1X3LA 2JJYA 2WWFA 4FNAA 4J7CA 2HQRA 3U3ZA 1F60A 4J90A 4JSYA 3U5TA 1ZUHA 1RD4A 4HG2A 1U98A 4ED9A 2Y67A 4NBKA 4J7AA 1IWBB 4BRZA 5JNVA 3B89A 1F48A 1WBJB 1QF6A 1Y6QA 4LV8B 3B48A 2IS4A 4EB8A 1KTVA 4Z3OA 3NTOA 3L93A 3W05A 1DDGA 1C9YA 3F1LA 3QHQA 3EFEA 3F49S 3IDZA 3MILA 3MMXA 2IOFK 3SQLA 2VNHA 1PR2A 3PYMA 3U3XA 4COOA 4XUDA 3FTNA 3E9YA 5JALA 1Z36A 1OI3A 2J1LA 4ZT3A 1VL5A 1A76A 4EPTA 4HZUB 3T41A 2YN2A 1U8XX 3HBAA 4OLJA 2EJCA 4B81A 1BJTA 4IDAA 3R0JA 4TM8A 8GPBA 2PVSA 1IUNA 3LM8A 2VP2A 1L4EA 1O5IA 4KHPB 1MQAA 3KAKA 1G0NA 1RKBA 4AB1A 4IY1A 1OQAA 3ZWCA 2O0HA 4DA0A 5KHLB 3BXXA 3NOQA 1E7WA 2CXUA 3SR3A 4IO1A 4R2HA 1TJNA 3ZIAA 2I4RA 5BQXA 4B40A 1NNLA 2WU3A 1TMYA 3KKPA 1Y7TA 2O2CA 1JB1A 4YGXB 3KU1A 3TIXB 3U39A 3TQTA 2I8AA 2FPIB 4DWOA 1T8YA 5M34A 4LOLA 3K5IA 1IB6A 1Z7BA 1OFHA 2H7XA 3BT7A 4LNUA 4I4TA 5KVQA 2QG9A 1IQRA 4KR2A 1X7WA 5HK8A 4E14A 4JLSA 1EFRA 2Q2QA 3D4PA 3O84A 5ITVA 1M6VA 2Z8XA 2G28A 2H7CA 4I14A 5FTJA 2AG0A 1S6YA 1E2HA 5CRIA 3KFLA 1Q15A 1AOXA 1NUPA 3HSYA 3IUMA 4TSFD 5E1OA 4ND3A 2ZE8A 4LSGA 4XD2A 3TPFA 2WSLA 2CVOA 2ZCVA 4EW1A 2WABA 5F7OA 1NT2A 1JP7A 2QRQA 1MOSA 3AFIA 4KR0A 2F55A 4E6EA 2REOA 4WY8A 3KT3A 2DQKA 1E8DA 1PR3A 4O4HB 3A25A 4C7KA 3JD2A 4JJ6A 1XV5A 2Q28A 2X0NA 3JD3A 4RM3A 2FFBA 2HC9A 1FJGB 2PDAA 3R6LA 4YMIA 1EBBA 1XRLA 2XRFA 4K3UA 5DZSA 3QXJA 1SKYE 2BM1A 1PW7A 1G4AE 3EQ7A 4RZSA 4LJLA 5JRDS 2VSQA 1EVYA 4WAUA 3GN1A 4CBVA 2RG7A 2O0KA 3LQKA 4I4TF 1EE1A 2AHOA 3NHLA 3KB1A 3W4JA 3ZQJA 2EJWA 4RACA 3ZVKA 3FSEA 1DBQA 3CZ9A 4U2EA 2E4UA 1JEOA 4RJIA 1MG5A 2ZYIA 3T1HB 4WRRA 4JLMA 4N65A 4UVHA 3ODPA 4OHRA 1TVKA 1GG8A 1NUSA 5LZ7A 2E4ZA 2Z4RA 3AESA 1UWCA 2QLTA 3D2AA 4PLCA 4XR9A 1FL9A 3RU7A 2A0FA 3I2JA 4P2BA 4D0NA 1UR5A 1YK0A 5ALGA 3WJ1A 3ZW7A 3ZJUA 5HS4A 1NUQA 5DNCA 3CR8A 2H1WA 3TVYA 2Q3EA 1WTAA 3PFHA 1RDFA 1SQFA 3QELB 3B5EA 4IVRA 5AVJA 4NS1A 1FMJA 1TD1A 2RGEA 4F86A 1KNQA 5JSHA 3NIBA 3WRYC 2PWPA 3FYUC 3S99A 4C14A 3EARA 4B2IA 3JPYA 2V7WA 3OPXA 1XR3A 1ETUA 4PYRA 4UM5A 1ZQ9A 2A58A 2JIBA 5LQCA 2OCLA 3DMDA 3M9XA 1NBIA 1YZGA 4BWFB 4JIMA 2QVBA 3U2QA 1Q17A 4YCSA 2E1PA 1XNHA 4RH0A 1MFZA 1UK7A 2CMFA 2H3EA 2Q7OE 3VR4A 1QRTA 1GG5A 2R8PA 2YZ7A 3N3AC 1SCQA 1ZPDA 4QDTA 4HSGA 4R7GA 3TSYA 3ZN2A 4KH0A 4BFLA 2Q6KA 3ACBA 1RSZA 2MSWA 4IFBA 1E98A 4DQXA 5BNZA 3ORYA 4CWAA 5J4VA 3W5SA 5BR8B 2YHUA 3C5CA 1FRZA 3KLBA 2VBFA 3P5SA 4K9OA 1D8TA 3C6BA 3PR2B 1P2BA 3QI7A 1OGJA 2ZI4A 4C76A 2ZPTX 1L9KA 2ZDHA 4R2JA 3O92A 4J0EA 5J2TA 7GPBA 2I80A 5F2NA 1CIPA 2FPKA 2K5UA 4L85A 2OBXA 2IZ0A 1YRLA 3H1BA 4IQ4A 2IUFA 2IEGA 1ZD3A 4MWSA 1LPOA 1KC1A 1J7KA 2J3HA 3OJLA 1EAYA 1T9HA 4EGJA 4L15A 1AUPA 2PA3A 2ATXA 2CDRA 4ABTA 4KP7A 2X9QA 2ST1A 4CGZA 4DUGD 1ZH8A 1VDMA 4N0DA 3ASVA 2JNWA 3EW9A 1KOGA 2INGX 3GFPA 4ZZ0A 2FZKA 3A4TA 3ZU2A 4D4LA 3NRJA 1OAAA 1LD3A 4Z99A 3VKHA 3GXOA 1QHNA 4M6WB 2JLVA 1Y8AA 1JDZA 2C4TA 3FY4A 1XSEA 4OI2A 1M2JA 3ESAA 3VTZA 5DHTA 5CG1A 3VJLA 2AL7A 1I1HA 4W7HA 1D1SA 1ZNQO 3ECCA 1J5EB 1ICEA 2PO5A 1XN4A 5H70A 3PXXA 1TUEA 1BJRE 1JLLB 1K8XB 3B85A 3KJQA 1GTMA 4L8YA 1WB6A 4L6IA 3TGWA 1TCAA 1VL0A 3T9EA 2BBOA 2HD4A 2NU6B 1OJLA 1X8XA 3A14A 3N2KA 1P74A 2O8EB 4X60A 1Q1NA 3R8CA 3M6FA 5IUNC 2LWIA 1FS6A 2P5YA 1L5MA 3IIKA 2PZAA 3KPVA 3LLMA 3G59A 3IMCA 2W2KB 4RFSB 2MYNA 4M0DA 3BMQA 1SVKA 3LCRA 4DLWA 4ASUA 1PGJA 4YRRA 4LCJA 5LVAA 3KJNA 1DFIA 3D9QX 1M1XB 2VQSA 2XVYA 1QF9A 2CXPA 2WJWA 4ERNA 5KYUB 1F8YA 3R6GA 4IUCS 1EVZA 3DNPA 4N0EA 3ZX4A 2JI7A 1RM4A 1NJFA 5AM3A 1EGMB 3UK2A 1JI3A 3I39X 3GJ6A 1CY0A 4FYWA 2X8AA 5GADl 4B7XA 1IATA 4K2HA 2QZZA 4KBFA 1D7AA 4LVCA 4XDHA 2WU4A 1V71A 4F3NA 3KOMA 1JHRA 5JJIA 2AT1A 1TUGA 2DHRA 5MFPA 1Z34A 1EFAA 1CZUA 4Y2XA 1KGSA 3NDRA 4N03A 2C5AA 2CCKA 3D7SA 4CLOA 4YP6A 1IOWA 3E7FA 1CUZA 1CTQA 1IG3A 1TM7E 1KI2A 2H2GA 2ZRBA 1GKIA 1Z2AA 4RIFA 5CJPA 2DULA 2NQ8A 3ECSA 4HAYA 2QR3A 1E4OA 2V96A 1LQ2A 4O4LB 2ZUEA 3AX6A 1OXSC 3I83A 3OU6A 4B76A 3D3JA 4F5EA 5A0VA 1LC3A 2CJYA 1LNQA 2ZTUA 2G7ZA 3AIKA 2FEKA 5GP1A 5TF0A 1D6MA 1ZXLA 5KQPA 5LDHA 5LL6P 3ZH2A 2DGDA 5ED4A 5DGIA 5E9JA 5F35A 4O8ZA 1EP3B 3CRZA 2XD4A 5A4IS 3CCFA 1IM8A 1PT5A 1ZGGA 3OMLA 5HZGA 1F5NA 3SHWA 5D3MB 3TRIA 3A58B 2XXAA 4KMOA 1OU0A 5EE0A 2H0RA 5E8RA 4YPOA 5DXFA 2VYCA 3GC6A 3KZCA 4DLLA 4A0RA 1M0TA 2I6FA 1Q6ZA 4QGFA 5JWRA 5ICMA 5K4GA 4F4JA 3MUNA 4RV4A 1YVUA 2G80A 2YXNA 3HKEB 4F3CA 1IXZA 2HQ1A 5DI3A 3AETB 3O4HA 1UAYA 1NUAA 2YVUA 4G1UC 2I7XA 1XRNA 3EIQA 5F3RA 4NBUA 1JL3A 4IRXA 5E1DA 4ITUA 2CBZA 1VYTA 1A8QA 3PGLA 4JFAA 1NQWA 2FRDA 4RLSA 3IQIX 3RVNA 4Z0HO 1KYYA 3C43A 3VR3D 4KFSA 1GCAA 3PCRB 4XCQA 3LFTA 4F11A 3FMOB 2AOTA 3EG9A 1R0ZA 4BKMA 2FEAA 2XW6A 1UAGA 1HEUA 1X19A 3H75A 5SYMA 3R8XA 1ZVQA 2J3QA 5JSZB 3SAJA 4L4SA 1ZD8A 3CUWA 4TLEA 2A67A 1G291 2CV1A 4E46A 1YRBA 1ZUIA 3DYVA 4MV9A 3PKJA 1V9LA 4HVLA 4Z4CA 1G2OA 1RJ9B 2FMKA 3GRKA 3PUXA 1RVDA 5JI2E 1W29A 1DT5A 3K9GA 1GU0A 1QMPA 2EFEB 4MRSA 3BILA 2OMEA 1PT7A 3VH3A 2UXCB 1I32A 3OZTA 4G24A 4XWAA 3C1UA 4JI4B 3NBZC 3KTAA 3OIFA 1U2DC 4A16A 2JL1A 5JDIC 3AFMA 1P4GA 2HMUA 3CX4A 3NH6A 1GVNB 1M75A 2C4HA 2JHGA 1XD2B 4FCVA 4D99A 2VATA 5GVSA 1JHDA 1J07A 5A5VA 1JRLA 4YAKA 1YQWA 2REQB 3FNEA 5JRJA 2WB2A 3K72B 3I1FA 4RMIA 1TPYA 1JZQA 2OCAA 2VHYA 3UWDA 4BQOA 1NVTA 4DDVA 1W2HA 4PR0A 1GGMA 4BFXA 2ORWA 4NFYA 1K06A 4LIPD 2I78A 1E2IA 5B5SA 4BGIA 1G16A 1BMQA 2H7YA 1NW8A 4P0QB 4TWAA 2KE5A 4P31A 4TV8B 3AU8A 2VOJA 1G8SA 2VYNA 3LY5A 3ZHSA 2BCJQ 4O2LA 5CX1B 2RK4A 2Y2VA 2I5PO 1ZJ4A 1ZO8A 2OKGA 2YQ4A 3KCQA 1DARA 2D0DA 2O1XA 2GXSA 5LBIA 4D4HA 4DS3A 2V3CC 1DX4A 4NZZA 3WGMA 1BU5A 1WMAA 2I4IA 2WOJA 3GF4A 4F21A 1A2OA 2O7SA 3AT1A 7MHTA 1FVHA 3WGTA 2G40A 1G8HA 4RY0A 2W8ZA 3LWZA 1TADA 3FNFA 3G49A 2XNHA 4HZIA 2F1KA 2HZBA 2GJ4A 2X5OA 3HJGA 5F3WB 3WK8A 3T34A 4P4LA 4ZOEA 2Y1FA 1N0UA 3V8QA 4DBLE 4Z4FA 1HDOA 1VL2A 3R7BA 4AY4A 121PA 1PCXA 2G5CA 4JQYA 1BD3A 4YRCA 1L5SA 4NZNA 3C8HA 2M6LA 4EY5A 1O0BA 1T5TA 2ZRKA 4TV9A 2EJVA 3OD1A 3RRYA 2HAEA 2G08A 4S1WA 3SM3A 5KJFA 4L0MA 1Y0BA 1CJBA 3HVJA 4AF6A 5DHAA 4P84A 2O0JA 2I2AA 1O6GA 4O2AA 2J0SA 3H1TA 3HCPA 3RT7A 4B2YA 1S02A 4AROA 1GT6A 1CIJA 4HAIA 1U1IA 1D0VA 4J1SA 3E9MA 2I54A 3NBUA 1AV6A 1T26A 5JECA 2ZYHA 1CDOA 1NU6A 1V3TA 1PO7A 3QKTA 3HVRA 5F5NA 1FFAA 3CS3A 5U9CA 2ZXEA 2ZP1A 1F8UA 4N0QA 3THWA 5CFQA 1CJMA 1G7SA 1ZK2A 4ZJUA 4YJ2B 4KR3A 1BZYA 2XB4A 4ZAXA 1SOWA 3SXJA 4FFMA 4DC9A 3PDIB 3EA5A 3NWPA 2JH9A 3LHSA 2PSEA 3ZE8A 1FSFA 3ZZTA 5JYDA 2H4XA 3TOZA 1ESNA 4PAOA 1V8DA 1TLTA 3M3HA 2XKAA 3HGMA 2EGUA 3AO0B 3RGGA 1VL6A 2QYHA 1BOFA 3OTHA 2W5UA 5EC8A 3HXKA 3B6JA 2XJ4A 4MQEA 3VR6D 5JZ9A 2E18A 3A7EA 1XTZA 4TV9F 3EAGA 3BRCA 4COKA 1O95D 3RO7A 1YRYE 3E22B 4ZZ2A 3HBJA 1CNFA 1RFLA 1XMPA 4WN9B 4C5AA 4LYFA 4MHSA 3P9PA 5AVWA 4AMUA 3OKFA 4O2AF 3JASB 3PC8C 3PYXA 2H85A 2GESA 1RXUA 3GEMA 4OGLA 3LCCA 3N3BC 3SHQA 1KY5A 2KJQA 3NHSA 3B5JA 4K26A 3LGAA 4PZ9A 1EWTA 3LK7A 1KY4A 4MO9A 1B2LA 2GHRA 3HGQA 3IQFA 1Y5RA 3QXXA 4UHCA 5EEGA 4DDKA 1ECLA 1FFYA 3CH6A 4U1RA 4NICA 1YE3A 4WV3A 5BWCA 3C7KA 3FD8A 1J2RA 2RIPA 1JG6A 1XRJA 3FJ1A 2PZKA 2G82A 1I7PA 2ZUBA 4KOEC 4KNYA 4LRWA 2ODWA 3JARB 4MJ3A 2FZVA 5B1HA 1V9SA 3IAAA 2F64A 4WXPA 4DJDC 1R4AA 2OG1A 1XCBA 2X86A 4CKYA 1GCGA 1LFDB 5D2CA 4C78A 5K5EA 4TSFA 2CJPA 1PFYA 2JFYA 5LD2B 5KU7A 4S1TA 4TTSA 1CJTC 1D5CA 2JFGA 1ICIA 2Y2UA 4L02A 1M1ZA 3SLRA 3DFZA 1GRRA 2VRCD 2LKDA 4OXRA 3WMEA 4I8IA 5HTOA 4BFZA 4DV3B 5KU1A 2RMKA 1F8FA 2Z0MA 3NDBB 3IAM6 2ZRHA 1NNEA 4IDQA 1SVMA 4HYYA 5ALIA 4CCYA 3BX1A 3BMOA 3DDOA 3NOOA 4X7MA 5FADA 5LQAA 1Q7CA 4FEGA 5AVOA 2EHJA 3F8TA 2HLNA 4Z54A 4F46A 1FYWA 2F7SA 4WLUA 3IAFA 5JXHA 2FV8A 2IITA 3CVYA 1Q74A 3GJSA 2ZGVA 1V1RB 1JMKC 2VA9A 3JQFA 3S4YA 1Y7PA 4PG6A 5JBQA 5I8WA 2VN8A 4J9UE 1X94A 2B1GA 4LNAA 5BSUA 1T6YA 3DL0A 4NU6A 5SYAA 3WIEA 4MI6A 4EKNB 1S7GA 3BS4A 1TK2A 2WJIA 4P7GA 3FROA 3GEDA 4EECA 3UWSA 1IJFA 3P0EA 4L50A 2GERA 4GAEA 2IF0A 1QE3A 4A92A 4FGZA 1L7AA 1HDEA 5ILQA 2C97A 3S8EA 3R9WA 1NDUA 1B6TA 4IW3B 5MGBA 1L7OA 5AMXA 2BFEB 2EFGA 1FUKA 1PQPA 3V97A 2HHCA 4DBLC 2QM7A 1KORA 4DWJA 3SX0A 1UBOS 2PUBA 1TEVA 2WEKA 1UFOA 1L1FA 1VIAA 1W0KD 1SB8A 2FJ0A 3PEWA 2W0MA 3DGEC 2MYTA 1YB2A 4E2YA 3T1OA 2OB2A 1YS6A 5IASA 1U5BB 4JZKA 3T5GA 1BC5A 1EUQA 3M5WA 1E2NA 1Q7GA 1SKBA 1ST3A 2X8LA 3KB8A 4IGIA 4LY0A 4RD2A 1J09A 2A1IA 4CMEC 4YUYA 3UCEA 1FSSA 1WMDA 3MNFA 5F9HA 1QG2A 2XKJE 1U7TA 2HKIA 2I4LA 2XRYA 4RWZA 5FUVA 4NOJA 4DQDA 5A1TA 1DE0A 1ISRA 3V1KA 1P5JA 1TIPA 4RF5A 1SK8A 2NU9A 5ICFA 4GR4A 4W5TA 3OTWA 5CW2A 1R9MA 1XYYA 3N05A 4Q1DA 4HNAB 3LXUX 4JJGA 2OFWA 3RKRA 1NVVR 1OT3A 1SIUA 3I2HA 3LCMA 3T5DA 4UPEA 3JV7A 2H1OA 3NONA 1IYZA 3LS2A 2ON6A 1ZS9A 2Y0DA 1AKWA 3L0YA 4KUHA 4UARA 5IDVA 5SY4A 3UK0A 3CFYA 4KODA 5FX2A 5FLXA 4EQ6B 1PD1A 2NVUA 3VU1A 1CB7A 4XEUA 5F76A 1J39A 3BWCA 3JSAA 1LPPA 3QU4A 1IMOA 1ZNYA 2CLOB 1XZMA 3DTVB 4RIGA 2RH8A 2HF9A 1RQGA 2EOAA 2AH5A 3BH6A 4BP1A 2IOYA 2WU1A 4WZBE 1L8AA 3L6CA 5HRUA 4A23A 3OZAA 4W1SA 1UJ5A 5H59A 3U56A 2DWOA 1P1KA 1S89A 2X7JA 1VLLA 4C0AC 3GPBA 4O29A 4GKAA 4QUKA 4Q1AA 1AKYA 1K3FA 4FOTA 3K0SA 3H13A 1OV4A 1FFXB 4YCMA 4DJ5X 1ZNXA 1ZY2A 1KIMA 3VYSB 2I2DA 5JSYA 3RSCA 3KV1A 3Q7IA 4ZI7F 1JPNA 3WYFA 4EHLA 2OXIA 1W44A 2AWNA 3EC7A 3GG2A 5FUBA 3BGWA 3T4UA 4QDOA 3UGTA 2BF7A 1SVIA 1BS2A 1CY6A 1H2XA 1Z6PA 2F1HA 4NYMR 4RJJA 4CQLB 4TYPA 5IVPA 4MV1A 1K63A 2MSCB 2ZPUA 1ZGZA 3L0ZA 2IPNA 1OPRA 1MU0A 4YJ3B 1G9XA 1OYYA 3RKUA 4F4CA 2FI1A 1XC7A 1N7GA 3HC7A 4K9NA 5IDYA 2PY6A 5CDYA 3NAMA 2CXQA 1WIWA 3BUSA 2R87A 2H8KA 4G81A 3OF3A 4ZK2A 2CFOA 2VBGA 1S8NA 5CLJA 1O97D 2FWMX 4MQBA 1L5KA 4PYOA 4J76A 5JNUA 5HZKA 1LQTA 1TXGA 1X39A 3QLJA 4I4LA 3LXXA 1W0CA 2QMQA 1EFPA 2WT8A 1XDGA 3HRIA 3EZ2A 1SA0A 4QA9A 5BSTA 1CEYA 3SPXA 1YQDA 3G68A 1DWQA 2JFBA 2NU8A 2OAGA 1ES9A 3WTBA 5KB3A 1EWVA 2I4TA 1JLKA 2I99A 4LOKA 3E9QA 4O02B 4NAVA 5K0GA 5DNWA 1Q0LA 1E1CB 1VJGA 1UBUS 1KK2A 2OG2A 4P4NA 4CEIA 1I4OA 4D46A 4IS2A 4TYYA 2I6GA 3VTAA 5J23A 2JFVA 2W6ZA 3EASA 2KBEA 2XZDA 4GMDA 5IJXA 3KXDA 2XYVA 3SSOA 3RC3A 1ORIA 1Q22A 2BM0A 2Q41A 2XUKA 1KFEB 2HT6A 1R0LA 2BEWB 3B1VA 3Q3HA 4MUKA 3ZQ4A 1UKCA 3WWCA 1KY3A 4LWQA 4QL3A 1CULC 2CMKA 3CXUA 3WKEA 4HD8A 2OPHA 5CDTA 5CYGA 1A2QA 1O9GA 1VLHA 4MW6A 2NT3A 5EZYB 3AVYA 4PIPA 4F4HA 1HEYA 4BYGA 3QUCA 2HL6A 1P81A 2GCGA 2IU3A 4EL5A 5K99A 2A9PA 4HX2A 1J9ZA 4PG5A 2NO6A 1CCWA 3N6RA 1U9IC 3ELWA 1S2MA 1K68A 1G2PA 2UUPA 1K6IA 3FOWA 2H18A 2QQFA 4LECA 4R1QA 4EG7A 3ABRB 2WKSA 4K03A 1PFGA 3TE6A 2KWIA 4HH4A 3TLZA 1A0OA 1T2DA 5F1KA 1VB5A 1GKYA 2XQGA 3A4NA 3PFNA 4R7ZA 3QVGB 4UCQA 4TTIA 5A6VA 2OXRA 2JGDA 3DLPX 3UNXA 2IJGX 3LUCA 1NI4B 4JB2A 4JOBA 4UPVA 3WYBA 1PBTA 3EPHA 4NQRA 2B94A 5JRZA 2ZSJA 3USES 4ENRA 1TK3A 5FFMA 1G6Q1 1XFDA 2JJ8A 4OGGA 4DXHA 1J2EA 1KJZA 1AB6A 4XVRA 1TYEB 2GZAA 5CNJA 5A3SA 6YASA 5L40A 2BP7B 2QUBA 5EZ6B 3VSEA 2L42A 2FDRA 4BLWA 3OIYA 1MOZA 2C95A 1QB8A 3LF1A 4JN6B 3PCTA 1HEIA 4QT4A 3OOWA 2ZI9A 2HLPA 3BTOA 3WLPA 2P6RA 1E9BA 1U2GA 3DZCA 3JQ9A 4EHDA 2F3PA 2PKXA 4FU0A 4HUTA 4E07A 2HIGA 5A9SB 4PTZA 3Q3GE 3WGYA 1N1DA 2BVNA 2PGJA 1WCWA 3N8HA 3AV3A 3OLCX 3ZK8A 1PNRA 5DN9A 3UAXA 2YDYA 4GF5A 3K1AB 1GUBA 3ZZMA 3MLAA 2B4YA 1HMPA 2BEVA 3TN7A 4EFMA 5KVVA 4CR6A 4DG5A 3K96A 1JEYB 1EFLA 3GJTA 3FF1A 4HRXA 4H3VA 2WTUA 2EDCA 3QYPA 1IUKA 3HQ4O 4QHSA 1JF8A 2GXUA 1NIJA 2CDBA 3NKFA 3GN2A 5FFFA 2SCUA 3HB0A 2QB5A 2QTVA 2B1IA 1B16A 1P19A 2YC2C 2GZSA 3O9MA 3N58A 4OHUA 1GM5A 2P2ZA 3DZGA 4HDKB 3ZDFA 4QOEA 4R54A 2NV0A 3VC2A 3SU8A 3ST7A 1ZUNA 3ICPA 2XOXA 1G9SA 4IOKA 1XFAA 4DCOA 4FJ2A 1JMYA 3DM5A 1T2VA 1FTQA 2H92A 3L40A 4WSOA 3SQOA 2AXPA 1U0JA 1U02A 2CUKA 2ORIA 5JZBA 3PGKA 1PUIA 1RZ3A 4G5GA 2R1ZA 1TZMA 1VMKA 2ZJFA 1NFRA 3A0UA 2X5NA 2WM8A 1QAQA 5JOQA 1OWLA 3A6LA 4DPKA 4TSRA 1LTKA 4WASA 1PL7A 2YN4A 4CG3A 1POWA 3HB5X 3I2YX 3C7AA 4QOHA 1XTQA 4RKYA 1E4EA 2R1UA 2ACWA 4ALJA 3GFSA 4EA7A 3K53A 1E3LA 4G23A 2YNMD 3PS9A 3ABZA 2QVGA 3E3OA 3H2ZA 1JAHA 3QPAA 3R41A 4K6KA 2GLTA 5IDWA 2X3YA 3F46A 2I3BA 1XXHA 4R9SA 1JILA 4JUFA 2IYEA 2IYOA 4HR7A 4U9UA 3U80A 1FU7A 5EL0A 2IU4A 5LMUB 4GYKA 3U4AA 5I47A 4HVCA 1AQUA 1RXWA 4KN5A 1NMSA 2GF9A 4I9GA 1K86A 2A7XA 4QFMA 3TXYA 1G2QA 1YR6A 3K9CA 5F2EA 4CMJA 4D42A 2VT3A 1DO0A 1LRJA 4MARA 1WNFA 2ZWVA 4PCUA 2B8WA 5LA6A 3ZQ6A 1QU3A 4YYEA 5WRFA 1E0SA 2AFRA 1M8PA 1BH6A 1GQYA 3AZPA 4G0NA 3UAYA 2C5LA 2GGSA 5BRJA 5J2TB 1FX0B 1N7JA 2ZR7A 3QTTA 5K6RA 1RXYA 2FEWB 2FRVA 3NWJA 4D4KA 1W5EA 2QTLA 1V8BA 3GGJA 6GPBA 4H4EA 4WMLA 1BS1A 2GA9A 2Q5OA 4I81A 3U9SA 4CPDA 4RM2A 4DM4A 4EVQA 3CPJB 5K8LA 2X9GA 3T0GA 4MX8A 1TK9A 3KVOA 3FRIA 1VB3A 3KKOA 4UDYX 4RVNA 3EXIA 4UE6A 4EA9A 4Z7JA 5E6RB 2BUBA 3OTQA 4RQUA 3WTCA 4X8MA 5ALUA 5LZ9A 5EIOA 1KRHA 1O95A 13PKA 4KLRA 1UFQA 2BKEA 2VSFA 3CPEA 4DIOA 3QWHA 1FYDA 2R4TA 4FZ5A 4OGFA 4DSNA 4QBIA 5L7TA 2P4QA 4PFKA 4C0JA 5EPEA 1NR7A 4LFCB 3B9BA 1GPLA 2ONYA 3E9NA 4MQLA 3EPKA 4UVGA 2VEDA 1TM5E 4YR7A 2WTNA 2HBQA 2OV8A 3LPCA 1PL8A 2BEJA 1E3SA 2W4IA 3PJDA 4G5QA 4HAWA 4OQFA 4PR3A 5L51A 4JC4A 1BXRA 4U5QA 4Y1RB 5LA6F 3FOEC 2CD7A 1P62B 4WBXC 1RRCA 1BVHA 1FFSA 3SQDA 4YV2A 2IEAA 5DX8A 1RKXA 2I1WA 2BBSA 1T2CA 2TS1A 1XMXA 1NMQA 3CQ9A 3MTDA 4LC9A 3LQ4A 4CDRA 4GVPA 1XVAA 5AJYA 3BM5A 3VZQA 4AD8A 4LDRA 4KC0A 5KUTA 1D04A 3VA7A 4FDVA 1KI7A 1RJWA 2BEKA 2PGIA 4MIYA 5EQDA 3HCOA 3U31A 3INGA 4XPIA 2R8EA 4LY3A 2VRCA 1T35A 4GQBA 2WAYA 4ZOBA 2IZ5A 4KDRA 3F97A 1DPFA 2HV9A 4JI6B 4D5GA 4DJJA 2G9VA 3H9CA 1X8KA 4MRNA 5HJEA 1YUNA 4JBXA 2NGRA 1PDOA 4OYRA 5GMOA 2YJ5A 3IMEA 3FCYA 1T5DX 4O2RA 1KWKA 3GCDA 3HHPA 2IV7A 3RU3A 4LJ5A 3CRW1 3CEMA 1SG6A 1WXWA 4LOAA 1V6AA 4D8UA 4MP6A 3FZNA 1VG0B 3BMXA 3Q8XB 4GLOA 5TE9A 5I45A 4JDUA 2Q2VA 5TR9A 2FPXA 4UNIA 3ZXUB 1AB5A 1Z33A 2YWEA 3H4MA 2F48A 4MCHA 4MPTA 1OYOA 4G56A 1LF0A 2RHCA 3U40A 3OA0A 3TGLA 2HREA 1JW9B 3K9FC 3NP7A 3GAAA 3DPIA 5JTUA 2IE0A 4I1UA 5ALRA 1EVKA 4XR4A 4GD3Q 2QTTA 2CLLB 4ITVA 4MMZB 1F6BA 4HTAA 1WL8A 2EJUA 4ZMRA 2ZDQA 3ANNA 3JR3A 1VPTA 3KKQA 3OQ6A 1BCSB 3K6SA 4KO2S 5CCXA 1E61A 1ZMTA 3BIJA 3BBLA 3VC7A 5HE8A 4HK4A 1ZJYA 2J3DA 1DZ3A 3CTPA 4KSBA 4WEOA 5HE9A 2DJ5A 1YA6A 1W0KA 1JDPA 3E81A 3RUHA 4F1WA 3BA6A 1BQ4A 3EZ7A 2FJPA 3RS2A 1JKMA 3D3NA 3UK1A 3UMYA 1A8PA 5CA0A 1ZN8A 4KV7A 4UEQA 3A6ZA 4FSHA 4FHZA 1MRNA 4OKSA 1UIMA 4H0FA 1EK0A 1S2OA 4ZO7A 2JJ2D 4P58A 4AT1A 5KNDH 4OXNA 2IP2A 6AT1A 4WZAA 1KOLA 2OORA 3DL4A 2A7QA 2GM9A 3HB7A 3D6MA 1QYRA 2ZQZA 3WBKA 5I7RA 4IXDA 4O4JA 3G0IA 3OX3A 4DM3A 4EMSA 1H69A 1Y8CA 1PNQA 3KVYA 2Z2XA 5CIQA 3W0LB 1J0XO 2GD0A 5I7UA 4XIFA 4GSLA 4DCNA 3L4JA 1ZMOA 1CW2B 1ELOA 1GZVA 1QGZA 3V1LA 8OHMA 4HB3A 2GFHA 4B33A 1SBZA 4AMGA 1G9TA 3MCAA 1U6IA 1Z8NA 2ROQA 2AS0A 2ZAOA 3WB9A 1L9XA 3WYNA 4UUOA 5ECYA 2PJZA 4RMGA 1B74A 1A9ZA 5TT1A 4V0QA 2X8JB 3SBEA 3WWPA 1T1IA 4FBMA 4IDHA 4AF8A 1EMDA 1CXZA 1VYVA 4D8XA 3V2IA 5EOVA 3IO3A 1PGOA 1IBCA 5B7GA 1V1MB 5LUBA 1YULA 2C00A 4L4YA 4X3CA 4F6CA 1IXKA 4BFSA 1RHQA 1EFCA 1PAUA 3SP1A 5CA0F 2PLNA 1AZTA 2EFHB 4E5PA 1Z6YA 2NAFA 3TVDA 2NSLA 4MB0A 3AIOA 4BC1A 1I4WA 1TTHA 1OZFA 4IOJA 1Q83A 3ZGLA 4Z3DA 3AHHA 1V35A 3H9BA 4QBTA 1BX3A 4N47A 2JIQA 4O4JF 4UQOA 1PZGA 5AKXA 5DHQA 3ZNPA 1WY5A 4Q3OA 4RK5A 3IAHA 1RU3A 4UUBA 1G5QA 3D0QA 2XF8A 3MN1A 4Q02A 3CWCA 1I6WA 2G3YA 3HKCA 3L46A 1GPUA 4JLAA 4M2LA 1KYVA 4RPKA 3THYA 4YJFA 4Z4QA 4NXMB 4B47A 2PLWA 1ADYA 4YCAA 3VUEA 4B6SA 2HW8A 3A1SA 3NJ4A 4MR9B 4LQCA 4YP5A 4BLRA 4GUDA 1WP9A 4DDTA 4ZCRA 1O8BA 4WN3A 4DJFC 3N1UA 1G38A 2A1TS 2GEFA 2DAPA 3H3XA 3KT6A 5AHOA 1HZZA 3I9MA 3MA0A 3GLRA 5GOTA 1XX6A 1C9KA 2M1ZA 1DAEA 2A9JA 2DPHA 2SECE 3OQIB 4FEEA 3C8DA 4URYR 2HJHA 2OWEA 2F3RA 1Y3BE 3BJIC 3I09A 3MHTA 1QIDA 5G1NA 4FB4A 2BE9A 1ULBA 3PXGA 4KW7A 5L4NA 2O0LA 4HAVA 4R5HA 2DFDA 3HO8A 4EB0A 1UKVY 3KM0A 1XTJA 3S40A 1NNSA 4O8CA 4FC6A 5CEFA 1BVUA 3K2EA 1H42A 5IH7A 1JDBB 2X13A 1Z74A 1Z3CA 5F21A 3OKPA 3VTFA 4CW7A 2Y0PA 1L8OA 2V6IA 4E13A 4U2KA 2ZWMA 3I64A 3P9KA 1CY8A 2IKQA 2C2ZA 1SG0A 3WKBA 4MYHA 3HXPA 2I67A 2SKEA 1UFKA 2IQ5A 3KSUA 1PG0A 3QFCA 4HMQA 4OHFA 2P9QA 1OKKD 1NQVA 1MTZA 4QJ4A 5DBFA 3WJ7A 1TAGA 2PH3A 5HYVA 3QKSA 2SICE 3ESZA 4RO0A 7MDHA 3THWB 3RRNA 2BBTA 3LLUA 4CMCA 1MN6A 1ZFNA 3KEFA 3ME5A 5AW3A 5FOWA 3SQXA 4NPAA 4BZXA 5ICGA 2PMCA 2Y9MB 1SVUA 1W76A 3A32A 2AG5A 1ZZGA 2E21A 2VQ3A 1KK3A 4OSPA 1BS9A 1TJPB 2JKYA 2HNAA 5AKHA 2HDWA 1E3MA 4C3OB 4P82A 4V24A 1P9OA 2NO9A 4L95C 1E3WA 3PNQA 3U4HA 2BFDA 1OH7A 4JCCA 3T95A 5DM0A 3OFSA 3DM9B 4P8RA 3AF4A 2OYRA 4C30A 4E21A 3ZXYA 3Q9NA 4DTCA 4PX5A 2F4VB 4P7BA 3W4IA 4ER6A 3PWZA 2HRZA 4TV8F 2VPWA 2QTAA 3UAOA 2ISSD 3AERB 2VP5A 1LK5A 2V4ZA 3NAGA 4FJ1A 2YZ2A 4TWJA 4W99A 4E0BA 4Z4IA 1NXWA 3OZUA 1Q0QA 1THTA 3GRUA 4LJSA 4WUTA 3IJ5A 4LOHA 4YAJA 2IY8A 4X20A 4QQFA 1RYZA 4LHZA 1IJKA 3WDLA 4DGQA 4I1YA 1PX0A 1XTVA 1LJLA 1AGNA 4JKOA 5ENDA 3SGLA 5D87A 4BNIA 3HCEA 4KRFA 1N0IA 2HSGA 1OR8A 3LOQA 5T4HA 2QGNA 5GY7A 1XCGB 4R0MA 3Q2KA 1S3GA 3KPWA 4MKIA 2G0AA 1ZKMA 2DY0A 5B2ZA 2YJTD 4JLPA 4KU4A 4QU8A 4ZO9A 3I5AA 3PE6A 4HQOA 1BG6A 1M5TA 2PUEA 3G2OA 4Y2TA 2J45A 5IK2D 1WF3A 3MJFA 3UT5A 5EMMA 2PX4A 4ND5A 3O1JC 3JQAB 5J5VA 4IQ0A 2UZ3A 2XODA 5KAMA 3QFFA 3RVOA 3EODA 3FJYA 4C3ZA 1ZKDA 3ADPA 2OZVA 3V34A 1YIAA 3W8NA 4LK2A 2WWXA 4TUYB 1VSVA 3DDNA 4H15A 3SICE 4C3VA 1M2OB 3BMOB 3LVFO 2H6EA 5GJCA 2HTEA 3N2GA 1Z56C 1MABB 2HN9A 5DBHX 4YJ2F 3I0NA 2J9GA 3E1GA 3E7WA 2HHLA 3PPYA 4TMWA 3SZOA 4FXPA 2VJPA 2WR8A 1AZSC 7AT1A 3JRXA 1W581 4HY3A 1YQTA 4NBRA 5J4HA 4F9FA 2ECKA 2LV8A 3ZWKA 4IH9A 4EB3A 4CMAA 1GRQA 1T2EA 2FPRA 4IP0A 5L45A 4ETIA 3DHEA 3PNLA 4KIUA 2Y8EA 2FW9A 1H2YA 3WMXA 1ORRA 1PDWA 4HDMB 4Z3KA 5EEHA 3K35A 2R6CA 1JQ3A 3WLIA 1WO8A 3R0IA 2PYIA 2BM9A 4F7DA 3MMNA 3FIJA 3U48A 3UT0A 3A11A 1GGEA 4YFVA 2XDWA 4X5OA 1UC9A 2N46A 4Y18A 1K4KA 1V16A 2VVTA 1GHTA 3IFSA 3ZIDA 4OLFA 4RK4A 4X1OA 5H3HA 2I4NA 3HVUA 4I50B 5FWNA 3H6GA 4GBMA 1D9XA 4RTJA 3QE9Y 2AUTA 4XB6B 4NTZA 4GMXA 4BKOA 1DJNA 1RC0A 1Y1SA 4NU0A 5JZVA 2J30A 1VSTA 5ALEA 1P7CA 1OI4A 2C3PA 3ODGA 2P2SA 1OFGA 1JSRA 1GKKA 1FUEA 5D86A 2Q5HA 1UM8A 3UBMA 1DV2A 2RJNA 3GLHB 4IXWA 5FO1A 5AM2A 4C01A 3L79A 1Y42X 2PNJA 4EATA 1HXHA 4GEKA 1GO2A 3IDOA 4CKEA 4MB6A 1J1UA 1HLGA 1KKMA 3AEZA 4E70A 4A8JA 2CWWA 2HXGA 3DZKA 3MRXA 1OE0A 5CIWA 2VTEA 3FZQA 3FLBA 5L3SA 2XCOA 1BXGA 1U3VA 2FLWA 5BXQC 4AW9A 3R44A 4N8EA 3FDXA 3T4EA 4BIIA 2W2VA 4TMXA 4FLMA 4O3MA 5HUQA 3QKWA 3FCUB 1WXDA 2Q0QA 3R5JA 3VHXB 5DWVA 1IDN1 1SUIA 1YS1X 3VPFA 8ATCA 5DOVA 2BFOA 1EA7A 2C84A 3P2MA 4ISCA 1XJ5A 4UBNA 2YWCA 2NVUB 4MLZA 2AQHA 4JJAA 4O5OA 5T3UA 4ZQFA 4QZVA 5HR5A 4LV5B 4H0CA 4UMVA 2P4HX 1RWKA 2IEZA 2VDRB 1GGVA 3BE5A 4W1PA 3SYNA 3TQRA 2FPLA 1Y80A 4YXFA 2ZTMA 3A05A 3DTYA 3N75A 5FQOA 3E8MA 1A27A 1OLXA 1Z12A 4GXTA 4PN3A 2WSMA 2PKCA 4HI0E 3AL0C 3AHGA 4D44A 2J3KA 3OCXA 2XE6A 3CO5A 3KQWA 2PRKA 1K27A 1XZIA 3RJMA 2OBBA 2Q3MA 1ZOIA 3O8OB 1AQLA 1RCTE 2CE2X 4JT4A 521PA 3FSGD 4DPMA 2AFVA 2DH5A 1XELA 2O8CA 1SURA 1GG2A 3NEYA 4R68A 3EWNA 1K8QA 5B6IA 3NHKA 1JIKA 2XIJA 4TXHA 2Z6UA 3K9NA 3TD2A 3S7ZA 1LK7A 1CUGA 3FYSA 3FOBA 3IMKA 3U5ZB 1DAGA 1DXOA 3DFIA 3DKIA 4HN9A 5CT9A 4Q7JB