3JVEA

Crystal structure of the sixth brct domain of topbp1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
APKPLHKVVVCVSKKLSKKQSELNGIAASLGADYRWSFDETVTHFIYQGRPNDTNREYKSVKERGVHIVSEHWLLDCAQECKHLPESLYPHTYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights from the crystal structure of the sixth BRCT domain of topoisomerase IIbeta binding protein 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords DNA topoisomerase 2-binding protein 1
total genus 34
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3jveA00
2COUA 3PC6A 2XNHA 1L0BA 1Z56C 3L41A 2EBWA 3SHTA 3PXDA 3PXAA 2R1ZA 3T7JA 3U3ZA 3JVEA 3T7KA 2ADOA 3UENA 3T1NA 1CDZA 4JLUA 4BU1A 2VXCA 3HUEA 3PXBA 4BU0A 1KZYC 2HTFA 4BMDA 2COEA 2M2IA 3PC8C 2EP8A 2EBUA 3HUFA 2VXBA 3K05A 3PC8A 1JNXX 4ID3A 3PD7A 3PC7A 3T7IA 1T2UA 3EF0A 3QVGB 3FA2A 3K15A 3QVGA 1IN1A 2AZMA 4OFBA 3AL2A 3K0HA 4XQ0A 2WT8A 3COJA 2NTEA 1Y98A 2D8MA 1L7BA 2L42A 1N5OX 2E2WA 2K6GA 2DUNA 4BMCA 3OLCX 3AL3A 2XNKA 2LE0A 3I0MA 3SZMA 1IMOA 3EF1A 1T15A 3L40A 3II6X 4Y18A 3PA6A 3I0NA 3SHVA 1GZHB 5ECGC 1WF6A 3L46A 2COKA 3SQDA 3PXEA 2JW5A 3PXCX 2ETXA 4XPZA 1OQAA 3UEOA 4IGKA 3K16A 4U4AA 4N40A 4IFIA 1T29A 4Y2GA 1T2VA 2INGX 2K7FA 3KTFA 3K0KA
chains in the Genus database with same CATH superfamily
4PRKA 2X42A 3ADPA 3CEMA 1I1NA 2ODPA 1P0PA 2F64A 4XPIB 3VU0A 4U7JA 1U0HC 4WZAA 3HC7A 4RK1A 3WK7A 1E1CB 1JAYA 1QB7A 4FFRA 3IEPA 4L5CA 3RVBA 4M0LA 1M6VA 3BL6A 4HS4A 1YRYE 3SSMA 1QP7A 1H5QA 1O5IA 1S3FA 4YROA 1YL6A 4J7CA 4UU1A 3CZ9A 4Z0PA 1ZKDA 1IQ0A 1U2QA 4HS9A 3ZWXA 2AF3C 5LJLA 3M9LA 5AW7A 3L05A 3RADC 3TOSA 1VPWA 3CO0S 4YT4A 1IY0A 1RCTE 4QX6A 1J2RA 1PZMA 5JROA 4UOQA 5K01A 1OH7A 2GRJA 4R2WA 4AJJA 2MINB 3HDJA 4QTTB 4V2UA 3E7WA 4ZI7F 4K2AA 1ZCFA 3QKSA 1K0FA 4EY7A 2Z1DA 1SCAA 5D3QA 4J16A 4DMCA 1BWSA 4D4JA 3QFRA 4NHEA 5E7MA 2FFRA 5G3YA 3AHCA 2EZTA 3CF6R 3VKHA 3JRXA 5LA6A 1TCAA 5FFMA 3ZGYA 1DJMA 1XRPA 3SM9A 4JBXA 4OXNA 4ALLA 4UUQA 4JAVC 4XUCA 4Q82A 4INAA 4BHTA 3AETB 4CM4B 2XUZA 3BE5A 4FCCA 2DSNA 1QIFA 2H18A 5K6RA 1SOWA 3VJLA 4LXHA 2DP4E 3PXXA 1NLZA 1OAOA 5D6NA 5ITZB 3PUJA 2O8BA 1KETA 4FMCB 3W6NA 5CB4A 1DKMA 4YJHB 1E2JA 1K6EA 1MD9A 2YINC 2IW1A 4QU5A 1P6XA 4GC9A 3NHRA 3WLHA 5IJ9B 1R3DA 4H3VA 3I83A 4HNHA 3C6YA 1WQ3A 4F5YA 5JZ9A 4DCSA 4ZVSA 1C3EA 2YASA 2ZIFA 3H2JA 4ODIA 1LBHA 2JEYA 4XCVA 3ZCRA 4NE9A 2JGRA 2EP5A 4OHUA 4ZVTA 4N8EA 2H1SA 1IOLA 3UUGA 1XZGA 1QB8A 3E2PA 4HH1A 4ROSA 1JG1A 2VYQA 3W7VA 3D8UA 2XI4A 3FRHA 3I58A 4QRDA 1VECA 4Q39A 2BGWA 1I3KA 2J9FA 3SOZA 2JKZA 1XZKA 3R41A 4RGYA 5I8WA 3R9IA 2HMVA 3V6MA 4PTLA 4RPKA 5FEMA 3RVDA 1HE8B 3L40A 4IXDA 4EFKA 1DDOA 2G25A 4IS3A 3RU2A 3UOWA 1SKQA 5JDIA 3DBHB 1A27A 3H7IA 5JD4A 4XLZA 2WM3A 3KZOA 2ZT7A 2DY0A 2V54A 3MJCA 5JAQA 3GRYA 3MS2A 1I2ZA 2IVZA 2O1XA 3LQ1A 2FUG6 1QXSA 3QK7A 1PW5A 3TO5A 4ACAA 2WMYA 3HZZA 1P7VA 3IESA 3H9UA 4GYJA 5CR9A 4C05A 1EUCA 5JEEA 5J58A 4CLRB 3DAPA 1W2HA 3K6JA 3AHEA 3RYHB 3FTDA 2FY8A 5K0GA 1F2UA 1X86B 3OPVA 4LE1A 1Z68A 3HCAA 5H7XA 1AA9A 1ZA1A 2H1CA 4RKWA 3WYAA 1OT5A 5I51A 1YULA 2IDMA 2R68A 3AZQA 4Q3EA 1NJFA 4IZOA 4UNIA 3GF4A 2GVDC 3VKVA 2I7CA 2QN9A 5B1IA 4F06A 3BMNB 4Q4AB 1X1AA 4R83A 3WKBA 4QDKA 1XRLA 2WQ7A 2BC9A 1GEEA 3ELWA 4XDGA 1V9CA 2XMDA 5JE8A 5DB4A 5JDCA 2G5TA 3BK1A 2HHJA 4RLHA 1H1TA 1KU6A 3DM5A 2OL4A 4RZSA 3K1YA 1DC4A 1L2TA 1E6UA 1Q92A 2R4QA 3A1FA 1DOHA 1Y8ZA 3AI3A 1SIBE 3T54A 3T3IA 4R51A 9ABPA 1FVFA 4AMZA 2AFHE 4EEZA 5BV0A 2XBUA 1IWOA 1ODCA 1SCBA 2PGNA 4G24A 4ZCIA 1VG1A 3DNFA 3WWDA 4EA6A 2ASEA 1FQKA 3KR2A 1G66A 3TL3A 1W0JA 5H4GA 2UZ4A 3DMDA 4RKFA 4Y2SA 3UENA 2CZCA 1T1GA 4YECA 5A6SA 2Z6VA 2FMKA 3K0SA 1FYWA 2YV5A 4ZOEA 3TR5A 1JDNA 3P94A 4AQDA 2AS0A 2NQ2C 2RB5A 1VIAA 5LP1A 2Z0MA 5JCOC 3GRFA 2RC5A 3QLUC 4KI7A 4F6LA 4EH1A 3G79A 1CZNA 3KSDO 3NUQA 4FEEA 3NTOA 2RKBA 2P69A 3BHIA 3H6GA 3O8LA 3QEKA 4PIMA 1YJ5A 1EX9A 2CJWA 2IUSA 4PHGA 1WZCA 5LOVF 5DHQA 2I29A 3MWKA 4B3JA 5K2OA 1TJ4A 1YE5A 3G2JA 2NO5A 3I1JA 2JI6A 3L4SO 4GECA 1XRNA 3NBYC 1ISGA 3GLGE 3SXUB 2PV7A 4A8PA 1Z18A 3TK1A 1N1DA 1Y4AE 1QO9A 1Q1GA 1JDUA 4TS1A 3ZTTA 1CY7A 1MFZA 5JDIC 1PUJA 3IMKA 3X1JA 3JQAD 4WRRA 3ORSA 5JI3E 2GEFA 1QV9A 2PX0A 4QG7A 4INZA 1EK1A 3OCXA 2DRIA 2ZBFA 4IWYA 4IJMA 4R5HA 5AKLA 2OZEA 4ZQIA 2XGJA 4I50F 3OFKA 1KS2A 3GT7A 1Z7GA 3PBKA 4CCSA 3U44A 5JQGA 3STUA 4O1HA 1ZU5A 2EX1A 2JHAA 1L4EA 3WRWA 4E1BA 5J4HA 5FP0A 4WN9A 4TT3D 4YJGA 1ZQ9A 4IIJB 4XQ0A 2F1OA 2FSVC 2CBGA 4S2UA 3CC8A 1EFRA 1C7EA 1X87A 3A4NA 4U8GA 2Z4SA 3CLTC 5HKKA 2JKVA 3A9VA 3LIPA 3PF8A 2QX6A 3QBJA 2GM9A 4HVLA 3UMYA 3SFTA 3R7BA 1DAPA 3CNHA 3RM3A 1KK1A 1MX9A 2J9XB 3I4FA 4WXEA 5DSZA 4XYMA 2J3HA 3S2YA 4B47A 1HZZC 4IEEA 3T5AA 3C39A 3KT6A 2WF8A 2HXYA 3DFKA 3QSGA 2C3OA 3EMBA 1GPWB 1H3FA 3BKWA 4DR7B 1K1EA 2FN4A 3QXXA 1G9SA 2PH1A 2R62A 3LW7A 4LJSA 4M0MA 4UHFA 4YRRA 1C80A 1F2VA 1OBVA 3ILVA 1VCNA 3F6CA 3THWA 2NWQA 3KHKA 4OU5A 5LBTA 3CEPB 5BSFA 1FBTA 2RHOA 4M1ZA 2B21A 5HVNA 3LXXA 3WAGA 3ZDQA 1J0XO 3M6WA 1YZHA 1EWQA 2XB8A 1WS6A 4RZQA 3WJ1A 1P0CA 4TQAA 2X0JA 4WKGA 5ER6A 3TD9A 4NH4A 5JSHA 1E4VA 4N40A 5K0TA 3I8SA 1SB9A 2F48A 3KJZA 4L3VA 4NCIA 3PUZA 2ZI4A 5CTAA 1X1SA 2HBQA 3X3HA 3GLQA 3JQAA 3GOHA 4JNKA 1TEVA 4I1PA 4NAVA 4Y2VA 2R8PA 2AC4A 1DNPA 5D3ZA 3KQYA 3KETA 1WZIA 1DZIA 2H6EA 2AYYA 4K3UA 1TO6A 2IHTA 2VCHA 1EFKA 4Q48A 3M81A 1NQ5A 1QK3A 4XJSA 2IDKA 3UV3A 4BCDA 3TX6A 4IIGA 1E66A 1W85B 4LPSA 1XEFA 3C98A 2C4NA 2B7BA 2FQYA 2P4EA 3F5QA 1ABFA 2AMJA 1E0SA 1U8CB 1T1SA 3BOSA 1N34B 1TTHA 3ENZA 5C0OE 3ADBA 1M6EX 1NIJA 4IIFA 2XECA 5I7AA 3OE1A 4BJ1A 1KDYA 4TUYA 2NU8A 1ILWA 2YNMD 1V4BA 4FCVA 3LPNA 1U0LA 4UTVA 5CDHA 2JFHA 4M54A 2TS1A 1N2CB 4LUCA 3VPDA 4TTSA 4KTVE 1MT3A 1G5FA 2JD1A 5J40A 5JSFA 3NT5A 4BE7B 1NXQA 5EE5B 2QAGC 2GKGA 1PL6A 5C8YB 1MHPA 4IDNA 2DYKA 2X8JA 1AS0A 4TWRA 3U4MA 2YS6A 3CF2A 4QBKA 2PT6A 3ZYCA 3PC8C 4Q02A 1EP2B 5L95A 2BPOA 3HACA 4M8KA 3KQQA 3H3FA 4OSOA 3ETJA 4ZAFA 3HJFA 1YTUA 1G5HA 3S2FA 5IAJA 4V1CA 2O7VA 4DT1A 2MWMA 2VDPB 4EHDA 2J7PA 4ILEA 5L7YA 3CCFA 4Q3OA 1SK9A 1W34A 2R8XA 3KX2A 5F7OA 1KTVA 1TRKA 1YRWA 2QSZA 1EAMA 1ZRSA 4AULA 3LA6A 1M66A 4RIGA 1YB7A 5IHXA 3OX4A 1V3QE 2MYNA 3PQ5A 3VZPA 2B5VA 3ZHQA 3P4YA 4MV9A 4ZAXA 5MGBA 1A8SA 2IZZA 2QSUA 2VA8A 3O92A 1KTIA 2WINI 2ATCA 3OUUA 2JDID 1M8GA 5KBYA 1X0VA 2QDKA 4RYLA 1E9CA 1BXGB 1TKAA 3U7QB 3L7IA 4QRHA 4DR6B 5JAIA 3FFTA 4HZUB 4O4IF 4EUEA 1GZVA 1OLUB 1VXRA 2WUFA 1I2CA 1KVUA 2QN8A 2ZRBA 1EVQA 2WSBA 4LS3A 4MW4A 5G1OA 4TTIA 5AK5A 4Z7OB 5CG2A 2CYCA 2VRNA 3ZDRA 1O3YA 3QY0A 4AUEA 6YASA 1U5CA 3OPXA 2YHIB 4B3XA 3C8HA 4CCYB 2HU5A 4BO4A 3NPAA 4NJMA 3M2TA 1U11A 3M6MD 4CL3A 4DXHA 5BQFA 3BT7A 3KVOA 3MT0A 1L7NA 4O1IA 5G53C 3N2LA 3NTQA 4D82A 2I2XB 1VSUA 3AUFA 5IWAB 2BWJA 4QOEA 1S01A 1CEQA 3ZJYA 3N8IA 2FPLA 4QQFA 3MUNA 3CLTD 4QVGA 4CUJA 1ZOLA 2HA4A 4OQFA 4U6QA 4Z3DA 3RYFA 4ZMBA 3L1VA 3H5WA 1OILA 1AGYA 2FR1A 2X1LA 3P9CA 3OBBA 5TQ2B 1EIWA 1R9NA 4MRNA 2YWXA 2YR0A 3NRBA 4KSBA 2PMFA 3AJ9A 1M0WA 3AKDA 1A9XB 1OI4A 4I99A 4ZVPA 1OAAA 2UKDA 1ZQ1A 1EESA 6REQA 3KJNA 1DFHA 2B8WA 4NQZA 3L2OB 3JZAA 4P93A 3AW8A 3UT5B 3K9QO 1W6UA 2WWFA 2EVWX 3NDIA 4B7CA 3U44B 2O4UX 4L57A 2OV3A 2YYZA 5KQRA 5EP4A 5CDFA 5ESRA 4JH0A 1J20A 4AM8A 2K5UA 4HLNA 3D8NA 4G0ZA 2QRNA 1SG6A 4P32A 1T10A 4Y9RA 3ZX5A 5BN3A 3SLRA 2Q3LA 3H1BA 1SXJA 1OTHA 2FN7A 2PLFA 2X9QA 3I1FA 3MUOA 4IHKA 4X7RA 2PLNA 5ELLA 3VTKA 1LGYA 3M89A 3RT9A 5DLYA 3IKVA 5GJCA 3TTUA 4WZ6A 5FR1A 3V1YA 1Z7BA 3WMXA 1O6CA 4FFWA 4NJEA 4CIWA 1R5OA 5HMLA 3KR0A 1Q7BA 1HH4A 1ZLXA 4PS0A 3GA5A 1AKRA 1IPHA 2AE2A 4GM0A 1Q44A 5M29A 1EZ1A 4G0XA 1NNI1 2OTCA 4ZWNA 5TT0A 1E77A 2QTVB 4BBJA 2V7QA 1N4DA 1T2EA 2QZZA 1QRSA 2ZRHA 4X8MA 4J3NA 4C4RA 4JWTA 2FQWA 4FPXA 4K40A 2WFMA 4P7GA 3U4GA 1QUFA 3VHQA 5CEJA 1LBIA 4DSNA 4U2GA 3ETLA 2D5BA 3K0BA 3B1JA 2ZS8A 2WAOA 2XCIA 3L0SA 2YRFA 4B80A 1MXHA 3KLMX 1RACA 2HJWA 4H7HA 4PAWA 5I4KA 2VP9A 5CLHA 3VZQA 1GNQA 2KLBA 1OPRA 3B82A 4JDPA 3WNVA 1QANA 3ZGOA 2EZUA 3GC6A 2P0AA 3EVCA 4NEGA 1RJGA 2EG5A 2IP1A 1GCGA 2WPDD 1R3UA 4Q1AA 1DG1G 2GFHA 3VTAA 5K8LA 2HNAA 2EYUA 3T3GA 3WO0A 3OLZA 4YJFA 2Q3FA 3NBXX 5JHHB 5KSYA 4FLEA 4A10A 1QP4A 3TPFA 1E9SA 3VDMA 2C0QA 3EF0A 2PGLA 5IMBA 2GOYA 2I2DA 1DT5A 2RKWA 1C9KA 2YXDA 3JD2A 4KO3S 2I62A 4ZCRA 4IINA 4OMDA 1TEZA 1PJ4A 2C95A 5D87A 4R9RA 4MS3B 3R20A 4OBXA 4Q9AA 1M1UA 1Z62A 4O0LA 4Q3NA 4JKIA 4ZD6A 3UAOA 1WM1A 2C29D 2PL3A 3EWSA 2XPCA 5EVJA 3HJUA 3D43A 2QV0A 3WMRA 4QOIA 2MSLA 3VQTA 1AHHA 4LE0A 5K7SA 2NAPA 1QGUA 3KQUA 2C7BA 2GJ8A 4IS2A 5LZ2A 2J9FB 2L69A 1LK0A 4AX4A 4Z6KA 1WZNA 3GPIA 1H4VB 4HCJA 1Y5LA 4JS0A 1O95D 4NH0A 4B7XA 4AKEA 5C81A 3FTCA 3I2JA 4DKXA 4O8CA 1G6Q1 3DAOA 1ZOIA 1ZW1A 4HLUC 1NMSA 2UZ1A 1CR0A 3ESBA 3GYBA 4IVRA 1QZXA 4UQPA 5TJHA 2W2LD 3HN6A 4PAOA 4NV0A 1OOEA 2SCUA 3NH9A 3RH0A 3RVMA 4D8YA 4HHEA 1N5IA 1D2HA 2IYLD 3HL0A 5C4GB 2IEZA 2GERA 3KLPX 4R16A 1L7DA 3I30X 1F8GA 4NPAA 4E88A 3EG9A 4LDAA 4A0HA 4MKRA 2XQGA 1T8WA 3MCAA 4ZC1A 3T94A 3DFMA 1EBUA 3LCVB 3I9MA 5H0IA 2VHVA 4B6OA 2Y8EA 3G0CA 3PR1A 5DX8A 3VOAA 4QDOA 1JQJC 3WYBA 5A03A 1CF9A 3LY8A 4E15A 1UPFA 1A69A 2AJ8A 3CQ9A 1DUSA 1YDEA 1MG0A 2QSJA 2YOHA 3RABA 1P4RA 1E1NA 1JWAB 1M6VB 3QPBA 4DAEA 3C3JA 1ZEJA 1A97A 3K4HA 4CMKA 2AFIA 4OQ4A 1T5OA 4OLBA 4Y98A 4NMWA 1IRXA 3ZHUA 3AU9A 3M1AA 3P52A 1QCYA 5D00A 1WR8A 4DABA 1C29B 3G8CA 3LUCA 4MGIR 4EITA 5H16A 2XUGA 1OFIA 3CW2A 3L1IA 4YASA 5EZYB 5BSRA 2PZGA 3WA7A 2WSYB 2ID7A 1XI2A 4GAEA 1K66A 2PRYA 4MIOA 5EHZA 1LRLA 1O4VA 4AO7A 4CLEA 2L2QA 3RSGA 2GS9A 4IWNA 3X1DA 4B3RB 1QKIA 3IERA 5LZ9A 1LDYA 2IOYA 4N3GA 4UVIA 1JDBC 3LCMA 2QVZX 1U99A 4N6NA 3MMXA 1VCIA 4BLRA 4C76A 1FYDA 1HO3A 1N5DA 2A88A 2HPVA 4U2BA 5IULC 2XCQA 2PBZA 3DVRX 1M74A 1NFRA 4R40A 5KTTA 4OGKA 3ZBTA 1WY7A 3FPHA 4MDHA 4A0SA 3F0TA 2FP3A 3E0QA 2IZ0A 1XMQB 1OX5A 3IIKA 3P97A 3OT1B 3I2GA 2VHQA 1IZYA 2BFCB 2AMLA 4ARZB 2OHOA 2P4UA 4BECA 2C4TA 3QFCA 4BXOA 1E1KA 2VC2B 5CMLA 4D6XA 5HNKA 3LQ2A 3DTYA 1QLWA 1F0PA 3UAVA 5K4GA 5CLIA 4BNTA 1THZA 3RS2A 4HQ6A 2HCTA 2Q5OA 1CJCA 4AUKA 4MKGA 3JSAA 2CXOA 2QMHA 5ALZA 1ID1A 3E27A 4UBIA 3KB2A 1SQ0A 1QK5A 3UWPA 1N92A 2AW3A 5IM5A 1P1CA 4NMHA 1RRFA 2BF4A 3UT0A 5DZSA 3WYDA 3Q8WA 3WXMA 3ROXA 5A5FA 3WL6A 3DMTC 5TGDA 3TPCA 1KBOA 1DKOA 1UMKA 2E55A 5HJ7A 2VNSA 2JATA 1D3AA 2EU8A 3ED5A 3OQNA 5G41A 1N7HA 1J39A 2VBFA 1RPAA 3CRVA 4RADA 1PJLA 4CCAA 2VRCD 4O2AF 3BQMB 3HG7A 3KJQA 1L4MA 4FFDA 1VTKA 4OJQA 4Z9XA 3IEMA 1JPJA 2Y1EA 3FNIA 3ZC3A 1DB3A 1GQRA 3KTOA 5FI3A 4BS9A 1HQDA 4KR7A 1CRQA 1KARA 2EDCA 2PJZA 3X43A 3ONFA 3REQB 3NOQA 3H5TA 2ZANA 4FDMA 1A9SA 4D2IA 1YE8A 1BVHA 3QIVA 2X7HA 4ZVMA 2WWXA 2GCEA 2GEVA 1UEIA 4PSKA 5H70A 2QAIA 3UW1A 4FGUA 4BO5A 5F9MA 3L8EA 3PNSA 1JVBA 3PD1A 5KMGA 3AUKA 4EZEA 2YNMC 3OLXA 1R5NA 2H3HA 2JLSA 3FVQA 3VNSA 5KWEA 1E8MA 2Y2VA 1I33A 1O94A 2XITA 3G9QA 1J99A 4IV0A 1ZESA 5IU6A 2NAFA 5HIMA 3M4NA 3N0RA 3WV4A 2HMTA 1GITA 1RHMA 1VL6A 4CF6A 3BK7A 2PWZA 3QI7A 4FE3A 4DNOA 3RS7A 2VNAA 1QIEA 2VJMA 1GYRA 4OHWA 4NMLA 4JUBA 2PJUA 5ELMA 2MYTA 1YGPA 4K87A 2WKPA 4X97A 3U49A 2VO1A 5IDYA 4NU8X 2OVFA 3GLVA 4WOCA 2PWBA 4Z0TA 4JVOA 3KXDA 4NZNA 4KZPA 3GHYA 2OV4A 1TMYA 3KE9A 5C7IO 1RBYA 3QF4B 3FTPA 4QGBA 4YCAA 1KFBB 3BGVA 3H2BA 4H4EA 4AYXA 5DX0A 3TZKA 3VR2D 3EEOA 1ZGBA 2QQ0A 1PLLA 3D1LA 4YMWA 3LGSA 2EATA 1OYOA 3RS4A 1PK7A 2RH9B 1Z4KA 3LT2A 3I6QA 1VZ3A 3BMOB 4LHEA 3DR3A 1YBVA 5TV2A 3WK5A 2A84A 1WZUA 4X6XA 4KR9A 5HF9A 1TLFA 5EJ7A 3V32A 4A9AA 3CX4A 5DWVA 4C04A 5IYZA 5A2GA 1RQNA 5C31A 1V4NA 3ROMA 1E5TA 4QD3A 5GZ1A 3IQFA 2GPSA 3DTTA 3HFJA 4R2IA 2OC9A 5FWNA 4GR4A 1LFDB 4AD8A 4LW8A 2BGIA 4BMSA 2R6CA 4JNCA 2V8OA 3OQVA 3AHDA 1XZPA 4G5XA 2JB9A 3RRBA 2Y9PB 3U26A 2G36A 2ZYSA 3HJBA 4AY4A 4YV0A 5HPYB 2ZK7A 1U9ZA 3KYIB 1O57A 1PCXA 2LKCA 1OGYA 1I4LD 1NJ2A 2RG7A 3B3JA 4V0ME 3ELBA 4C7MA 3A0RB 5HHTA 3DO8A 2RI6A 3HBLA 3PVCA 4DA8A 1KO1A 2VJKA 4OX9B 5C5IA 2FEAA 2O3RA 2PX4A 3IH5A 4NBVA 4URYR 4HR7A 4IIJA 2VCEA 4WNCA 1L5RA 1A4XA 5E7QA 4BCBA 2F7SA 5AJUA 1OAOC 2VLBA 2XDWA 2QUJA 4LGYA 1UT5A 5T8KA 3TWOA 4EG3A 3FNGA 5F3DA 3LH5A 4DJTA 4OJTA 4IHJB 4C01A 3SK0A 2DERA 1AS2A 1ZMXA 4AMBA 2QJRA 2GK3A 3FB4A 3P2MA 3OD5A 3T5BA 1JECA 2ZKLA 4JQOA 3K73O 4QNNA 3BTVA 3E5NA 3DWEX 1PTKA 1KY5A 1QZZA 2JGDA 3DUWA 3CR3C 4LVOA 1NHGA 3KEGA 4NFYA 4PHTA 4RS3A 4EJ0A 2NU7B 4ERXA 1ATIA 5KJFA 2ZZNA 5CCXA 3JCZA 1X77A 4ZYZA 2DPHA 2C84A 2X6RA 3FF4A 3QVSA 2P8SA 2QPOA 1KFCB 5EINA 4LGCA 1TJNA 1QVAA 1E92A 2B8EA 3OT1A 1HKUA 4L9RA 4D9BA 2WFZA 3HVJA 5KJCA 3AR8A 2YVQA 3L9WA 3PFGA 2VUTA 1NMXA 2DHQA 5AM4A 2D7DA 1CNFA 1GUAA 1QORA 2AXEA 3R3WA 4NBTA 4XW2A 3DH0A 4PSUA 4XE5A 4QYTA 5FQOA 1GXSB 1U63A 3F4LA 2XVAA 3GPDG 3K2BA 4LMPA 3NBQA 2DPYA 1U8AA 3M7IA 1P2VA 3P0EA 3QMVA 3FSRA 4OUKX 1IOVA 5BR1A 2R1TA 1XU4A 1OFTA 3IE2A 3JD1A 1EQUA 1ONPA 1ZZGA 3LLCA 3WKEA 5I7HA 3GJ0A 1ZM4A 2C2YA 5JNTA 2IYRA 4W99A 3E9CA 1C4OA 1HG0A 4QPNA 5IH3A 2XIQA 3G2IA 1TQ2A 1S6YA 1EM8B 1FSGA 4XEUA 4DMGA 1QH0A 4Q47A 2IV3A 3JX9A 4HZIA 4EY8A 5EZYA 1IIBA 1WTAA 2G63A 4YCLA 2AEFA 2RCYA 2VUSA 2ZCVA 3VAZA 3R6TA 1S8OA 4AS2A 5JNRA 1WCWA 2XADA 4TQGA 3T3MB 4AUNA 1FBNA 2BR3A 1C8BA 4QECA 4BVBA 2P2CA 2WHPA 3AG6A 4TTVA 1QYIA 5AKZA 2JIMA 3G2NA 1EFCA 1Y9JA 4DY6A 2OHFA 1HEYA 1XELA 5K20A 2ZQZA 2X5KO 3RKUA 1DQSA 3NV7A 3HUDA 3ZI4A 4M1TA 3OSUA 3P2OA 3VR5H 1KQ3A 3B53X 3HHEA 1C0LA 2WBLC 2A57A 1SGWA 2DT8A 2ZDGA 4KH1A 4POOA 1BWPA 4WDRA 2QRVA 5J59A 2VHEA 4ABYA 1V5IA 5AFSA 4WCDA 1PTJC 1RFGE 1V1MA 2XKJE 3DMGA 4DNQA 2C88A 3ME5A 5DF1A 5KYUA 2HIMA 1V16B 5CYFA 1OTYA 2BHTA 3QOWA 4RZ3A 3TW0A 4YMTA 2BKVA 3DEIA 2AIRA 3MTDA 1FXWF 2UZ1B 4XIJA 1SVLA 3PUHA 2WQ6A 3H4MA 5T6BA 2YHUA 4F9EA 4RL4A 3MGBA 4TXHA 4ZJZA 4XQCA 2IEAA 4HC4A 1L7VC 2Q5CA 3EHEA 3H2ZA 3UFXA 1E9AA 3BWMA 3UK1A 5I9NA 2WHXA 3EXG2 1B93A 2WYOA 1P0MA 1W88A 3DDNA 3BTUA 3LHDA 3F4BA 4MVJG 1FS4A 1R15A 5JNVA 5FLKA 2PZ8A 4HWRA 1FJXA 1Y82A 1ABEA 3ETNA 1A04A 4B3MB 2Y0EA 3QJGA 3WE7A 1MG5A 4KO8A 2OCXA 2UUCB 2P41A 1N1EA 1XD2B 4LSZA 1GZ6A 2QRGA 3RFTA 2IGBA 2XMZA 1LLUA 4KDFA 4NNPA 1J1ZA 5CIWA 4YP1A 5H81A 1S9DA 3N87A 4RY2A 1HDOA 1ZMBA 2JHCA 4Z53A 1CRPA 2BM9A 2GBCA 2XKBA 1L7PA 2HWWA 1YA8A 1ESNA 1DFIA 4UD2A 4Z8YA 5F9FA 1WA5A 3GJ7A 1P3Y1 4PR0A 2D8MA 4MA0A 1OFGA 1U3FA 4UUPA 2HF7A 1ZXLA 4J90A 3ZJUA 1RZVA 5BSWA 3MYYA 3T5PA 4J7AA 4B71A 3PHCA 4WLEA 3SEQA 2B83A 2WSMA 3I12A 1QV6A 4L73A 3RFUA 5CLGA 3KQMA 1ETUA 3PWZA 1U3TA 5T4HA 4WVFA 4BMVA 2EAUA 1JZQA 4NYJR 2R66A 3HU1A 1RM3A 4IDCA 3HJTA 5IVHA 1P2SA 5HFJA 3HS3A 2V74B 3B8HA 5DNUA 4BQQA 1P29A 1WOMA 3WP1B 3DKKA 4DJEC 1M2GA 2FRVA 2B1JA 2XCLA 2YCLA 2P78A 3UAZA 3N6XA 2OEPA 2V4UA 3W8DA 1A1SA 2KM1A 5DGCA 1M1YB 3MLBA 1UFQA 4RD0A 1QQ7A 2P35A 3RJ9A 4AS1A 1A77A 1ESMA 1Z4LA 4KMMA 4OHXA 4WZBB 4E5VA 1W1UA 3P0RA 3WQSB 1B16A 3NJ8A 4MYTA 1U65A 2B5WA 3EW9A 3NUGA 2PR2A 4NG4A 2C9CA 2X8BA 1XMOB 1JLHA 2C0CA 3NOVA 3S27A 4MB6A 1KZGB 2FZLA 3O1HB 4MQ5A 1TM1E 2ADFA 5JD6A 4OXQA 9MHTA 2K2WA 3AJDA 5IJ9A 2ZE5A 1KXZA 3DA8A 2EJTA 3HR4A 1IM8A 2ONJA 1WHTA 2QTVA 3MJDA 4WA8A 4DM3A 3TG2A 2ZUUA 3M4JA 4EPRA 2BBOA 2JGJA 5KSPA 2R00A 2XE6A 1CUGA 3UB2A 3PPWA 1YC5A 1ZRMA 2IEDA 3I92A 4EZIA 1MXFA 3M4ZA 4AURA 4C0XA 1Z8FA 3AUAA 1OC4A 1V5GA 1GPMA 2E49A 3RHZA 2DOKA 1GAWA 4QTZA 5H4HA 1TM7E 3VXKA 2IIQA 2CDNA 4E09A 4OIFA 3CMCO 5CW1A 5B57C 1P4JA 3GFOA 2PRKA 4TQUS 3EGVA 3LDAA 4NULA 1X6VA 3D7KA 4HNRA 4JJEA 6ADHA 1JPUA 1P0IA 4EUHA 1PQWA 3ICCA 1AQNA 4HADA 1ILEA 3GJRA 1GTSA 2OO5A 1ZITA 5HJ5A 3KQHA 1U9YA 1JQLB 2AR9A 3GJ5A 3INRA 4GUAA 3D1VA 1T9HA 4KKXB 1ZSYA 2SBTA 3B3AA 4S0XA 1N9ZA 4HH4A 3V8RA 1D2MA 3LX8A 3C24A 3K71B 2XMCA 4AZVA 3RWBA 1WXXA 2HZBA 1EUCB 2OCAA 4D3SA 3Q7SA 1TA4A 1AH2A 4QU9A 4TWAA 4Y8VA 3VSEA 3D2LA 4Z3OA 4ZXFA 1T5LA 4FVTA 4CT0A 4MS1B 2WILA 1GN8A 1I7NA 1T9KA 1SXJB 3EZ2A 2M6KA 2YDXA 3CM0A 4Z1MA 1GA1A 5AXAA 4B4WA 4B4UA 2ZE7A 4K9NA 1ZCAA 5A4AA 4OL0A 5KYYB 1TC1A 2QTAA 2P9FA 3D4IA 1Z5PA 3D1JA 1Y3HA 1UKCA 2F62A 3O7WA 1Q0SA 1G19A 2BDTA 1IEQA 3U4DA 4OQMA 4IZHA 4OFBA 1E5QA 3FBGA 4MZDA 4F86A 1EINA 3OZSA 3U17A 2XA2A 4AFNA 3HADA 1U94A 3GIDA 3TVDA 4AZTA 2VSXA 2O7SA 3GT0A 5AD1A 1ZJZA 2GBLA 2HQRA 1ODSA 1DO0A 4FMCF 1BMQA 1CTQA 4GDFA 4PNEA 2XCUA 3I01M 1VLQA 3ZW7A 1JJVA 2MMGA 1Z06A 2AX4A 4OYHA 5T7BA 2FSIA 3KOUA 5LYJF 1OSNA 1UK7A 2Q4OA 2P90A 2BEVB 3DAGA 3E1SA 5J2UA 3CN9A 3ZV6A 3SZOA 1JJ7A 2WV9A 2FR8C 5LQCA 2MU1A 5TQ0A 3KLNA 1DBQA 1CUHA 3IQDB 3QQPA 4DBZA 2QL9A 1RQ7A 4GMXA 3BJZA 5CCDA 3Q8MA 1M75A 1CY1A 1D8AA 1YB5A 1Z22A 2R85A 2YWEA 3ZGZA 1NUUA 2BKLA 5I7OA 4RTRA 2V0GA 3EOAI 1HL3A 1C4XA 2DLCX 3T5MA 4LY6A 1Z4QA 3AJEA 2ZRFA 3DYBA 3HWX1 4GMFA 4MVJD 3EPLA 1TZCA 1KOFA 3PRKE 2EERA 1PR3A 4LZAA 3KQKA 1KK2A 1RP1A 1WVGA 2J9YB 4H16A 5AM5A 4DBLC 2HA3A 1XC7A 4BGUA 1U8YA 2OHGA 1V26A 3C5VA 4K9MA 3K0KA 2ZATA 4A91A 1X2EA 4BPBA 1DG3A 2PGOA 2QTMA 3E1GA 3I45A 1WD7A 3K8ZA 3URMA 2F9LA 3K92A 2VUUA 1A50B 3ICPA 3ED1A 4MUIA 2O8FA 3PC6A 1LDEA 1B3BA 1C1HA 4KN9S 4HMOA 3AVVA 4NIMA 4Y3UA 5DMHA 2PWAA 3BFXA 2FN9A 4X20A 4CMIA 2Q29A 2BEWA 5KEIA 4RTSA 1YJCA 1HL7A 4JLKA 4YJ3F 3JQPA 5FTNA 4E51A 2JD2A 3G2LA 3N8KA 1JXQA 2VWQA 3DE4X 2G0NA 4IDDA 4KWHA 4LXTA 4N3BA 2Q3BA 2GPJA 5IC5A 3LD9A 3S28A 3T1NA 5LPNA 4RTLA 1QLJA 4AI6A 1WKCA 4ZVQA 5L4NA 1DKUA 2RHWA 5TX7A 1GKIA 4C14A 4HDNA 4BX8A 3ZY5A 3L01A 3HA2A 5BWLA 1BRMA 5K0ZA 1KJ9A 4JJZA 5JI2E 1KKLA 1XD8A 3PHGA 1XPJA 2CHVA 3IUYA 2DFLA 2VSOA 1N9KA 1NVXQ 1C41A 4AWBA 4NZPA 3RRJA 2Z6AA 3DCNA 1Y0BA 3DL7A 4LBYA 5JAUA 2EBUA 4BPRA 2JIZA 5KOJB 1E2LA 2QRJA 4OYYA 5GONB 4HGZA 4US1R 1YRAA 1KJ8A 2FP4A 2LUOA 3KOWA 4WXMA 3MJRA 5C1IA 1KVQA 2HBYA 4J0QA 3SWWA 4V0QA 3W4KA 4L72A 4OTZA 2QXYA 4O8ZA 5EWJB 5JU6A 4BE4A 4G4IA 4KLZA 1DWOA 1P17A 5AK0A 5EIEA 2D4AA 3DKRA 1IG0A 4OK3A 4F72A 2OAGA 5A4MS 3AHHA 3ZHBA 3ZWWA 2CB0A 3R7FA 1ZIXA 4Z7QB 5B2FA 5DNYB 1C50A 2FSPA 3TQSA 3SC6A 4BTEA 2P5SA 4B32A 2A86A 1KYTA 3T7DA 5CB0A 1U3VA 5LNK1 1F7VA 2DVMA 3DLTA 1CS0A 3K9GA 3INTA 1U3UA 3HV0A 3NOOA 4R7ZA 4DLUA 3ROGA 1PVVA 3SX4A 3VR6H 4BO1A 5F64A 3LI2A 2IZ1A 3IQXA 1CNEA 2R11A 3L4BA 5AJZA 3FYTA 1OYYA 2EW2A 1U3GA 4KU4A 4PYNA 4AW9A 4F3NA 3SOPA 2XOKD 3IQGX 5KNBD 4WBXC 1CHNA 1VYHA 3LUFA 2X1VA 2ZIXA 1KYIA 3EODA 2QRUA 3QFFA 3VHLB 2BFCA 1TO2E 1JHVA 3T7TA 3VI3B 1W19A 3BGDA 3HU5A 4RVDA 1OIVA 1G3QA 1KH3A 1UM8A 4AZSA 1TW3A 5EZSA 3CZQA 2Y76A 3JV7A 1V8DA 1J2YA 1YJQA 3OHMA 3T6KA 4DWOA 1N7IA 1UH5A 3UAGA 1NPDA 3OF2A 4FDVA 2H5LA 4BRUA 4H2DA 1L4YA 3ND6A 3R8FA 7REQB 3HZRA 3ZW8A 4ZHSA 1B00A 1WD5A 2Z3ZA 3HRIA 3LZCA 4JL6A 1DU4A 4KAFA 1A95A 1C0KA 3CPSA 1RLIA 3SYNA 4QHTA 5JO9A 5L6MB 3HI6A 721PA 4QYXA 3MZ0A 2B3DA 2WYIA 2Y05A 1H42A 3T99A 4BDSA 4JUAA 1Z26A 3DDSA 4FBGA 4M3NA 5CDUA 2QM0A 2XDQB 1GT91 3DZKA 4I36A 4J43A 2QTTA 1ZUD1 2FPWA 2GXQA 3DFZA 3DXXA 4G5RA 2DLNA 1MRSA 4KFTA 4FIDA 4Q6WA 5CGQB 3IP7A 2DWOA 2YJ5A 3H5RA 4MQFB 5KVVA 1TUGA 4BWFB 3RGWS 4C0BA 2IHJA 2FPGB 3P0IA 1ORRA 2FETA 3HKCB 2FOIA 3G9TA 3CLRC 4ZOLB 4TZ6A 2H85A 1PEAA 3MJSA 1KI3A 1W44A 1NUQA 1XKQA 1Y4UA 2QVYX 5JDCC 1KJYA 1VYTA 1KYQA 2IHVA 4KJXA 2A5GA 2WKWA 4RD3A 4TV8A 3ZY4A 2DFPA 4K6MA 4XUGB 2ZT6A 2E4AA 3T7EA 3KKEA 4KYVA 5IZCC 1M8JA 5IARA 1IH8A 6LDHA 3SLKA 3G5MA 4MULA 3U4HA 5GADl 3SHOA 1ZD5A 4G97A 3DBHA 4JUFA 2JJ8A 4I7EA 4KV7A 4WVLA 4YI5A 5C80A 4R1OA 5AHXA 4YRAA 2K7ZA 5KSOA 1QFXA 1H4QA 1MQ8B 2VPWA 2JFBA 3I6BA 3ZHVA 2CUZA 2GI4A 4K7JA 1LBEA 3JU3A 2BKXA 3F97A 4JT8A 4AY3A 2O59A 4M98A 1J0BA 1PV2A 3C41J 3K6KA 5KNCH 1XK6A 3AEKA 4RHEA 4OOFA 4DB4A 4ND1A 1PR0A 3I8OA 2PU5A 4AUMA 5LQKA 1USUA 3UGKA 3QHPA 3W9YA 1IL0A 1GGKA 3A36A 5BQ5A 3UCXA 2CUNA 5AQ1A 3QUCA 3N2GB 3RIYA 2JA2A 1FCJA 2XA1A 1UDWA 3QP9A 4LI3X 3NVAA 3UJHA 1UMDA 1B8OA 1MBZA 2FUKA 4Y7CA 2C2HA 3GUUA 2Q2OA 3Q2OA 4Z54A 5J9FA 4UATA 2ODBA 1KVSA 2BH9A 3DHNA 4DSAA 4F2DA 1AD2A 2ZEJA 3H9QA 3RS3A 1BVUA 4FWBA 4K9LA 1UZLA 3PQ6A 1G8PA 2G67A 4BKPA 1Y3CE 2O8NA 4O4LF 5DLPA 4PLHA 5DYWA 4HQOA 4C22A 5C4MA 3HXQA 3RC8A 3AVXA 2O8EB 1ONNA 1KAOA 1GGVA 3CGWA 3JQ7B 4TWJA 3TSYA 2V7UA 1U0TA 3OI7A 3PE3A 4D9EA 3JATA 1DL5A 1U1CA 2FZ4A 4MP3A 4YWHA 2A0YA 3K9HA 1N8KA 1F2TA 1QGAA 2R6JA 1XV5A 4UOEA 4GKAA 3NETA 3K5WA 4OHFA 2WWHA 1HE2A 2PUHA 4GXQA 5MN6A 1E59A 2ANCA 1B0ZA 5B1EA 3UPDA 3D02A 1SBHA 2G76A 3H04A 3JQ6A 1QAMA 1T0PA 2HH9A 3EQ9A 4HBGA 4KQXA 3DLAA 3WL8A 1O96B 5JSUA 1N5LA 5M5BA 1MZPA 1IN5A 1K3FA 2DR3A 2FW7A 3TGLA 1CR4A 1YONA 2AFRA 4FOPA 3HJNA 1M2WA 4BVJA 4TX1A 3V9AA 4EGSA 1N2XA 3U7FB 1X3LA 2WB4A 1ZD3A 2ZU6A 3AY6A 4FSXA 4GSYA 4MR9A 5IEJA 1N0IA 4MINA 4RTPA 3Q1KA 4ME6A 2IS1A 5CX4A 3X2FA 1E3JA 4EKDA 5HKOA 4MUMA 1ZRHA 2Q49A 1A2KC 5TMDA 3V48A 3PKZA 5IM4F 2WY2D 3KKLA 1TD1A 5C35A 1KH1A 1E2UA 3KDPA 5HYVA 4G25A 1UZAA 4MQEB 3T5TA 5ALPA 4A27A 1NM5C 4OFWA 2AEMA 3BMCB 1ZFNA 1KAGA 4KXUA 4AIRA 4TVOA 4PXSA 4I8XA 5TMEA 4NENB 3L8ZA 4LDZA 2XE4A 4QYWA 5HZGA 5FOXA 4XPIA 2OCGA 4D9FA 3O8DA 2CFSA 4RK7A 1L7QA 4IQFA 1Y1SA 3IPRA 3WYFA 2FRDC 1X1QA 2H2FA 2O8BB 1X74A 2WIBA 3LFTA 3TTVA 4QQKA 4WZBA 4TTQA 4WHMA 3E1KA 3JWEA 1FY2A 1FYEA 4RVHA 3H17A 1ZUNB 5JZVA 1NUAA 3SQLA 5IRCD 1QH9A 2B1IA 4P4SA 3SBDA 1DPFA 5K8UA 1YBAA 1NAIA 4YMGA 5I7EA 1ZJ6A 2H3EA 5IFLA 2BP7B 2QJTA 2ZSHA 2O20A 4UE6A 1WF3A 2Z56A 3M9XA 2P3SA 3BBPA 3VR4A 4REQB 4YP6A 4DCCA 1NG9A 1H2RS 2J7KA 4ASUA 2CNKA 1QZ3A 4AJIA 5TQVA 1NIPA 5G0UA 4PCVA 4TT3A 3TI9A 1EFUA 1DE0A 2XZTA 2FRDA 3ILSA 3U56A 5HQ3B 2ZYAA 5AHKA 2W71A 3LYLA 3DTVA 5TMBA 5EJ8A 1P31A 2W6CX 3RAGA 3FXAA 4ECAA 4MWTA 1M5UA 1NWCA 1P39A 4IGIA 1DELA 1NSYA 4CPDA 3CVUA 1BX3A 3HKBA 1DTWB 4YYEA 5ITZA 4B6FA 4WFIA 2RGAA 2XMGA 3VC3A 1DAGA 3ANLA 3DHYA 4OGFA 1G9TA 4RH0A 3NTUA 5CNIA 3IAS1 4BBPA 4GZLA 1L7AA 2Q5EA 3E35A 1PYDA 2ZWMA 3NHZA 4GI7A 1XZLA 1J2JA 2A5LA 1NMZA 2R6GA 3IIJA 4I1IA 1K0UA 4WA7A 3JQFA 1IQPA 5GQSA 2GQ0A 2A9VA 3PGA1 4E32A 5EXSA 3GJTA 1AQLA 2Y1KA 1H8EA 2GHTA 3ASUA 2WFAA 4US2R 4UMFA 3VR0A 2IYZA 2QM8A 3FFXA 4UTOA 4NOLA 3USCS 1W5SA 2PU7A 4MQ4A 1EG2A 3HCBA 3LLVA 2J87A 2ORWA 5C53B 2WUEA 4MS1A 4TMZA 3HXTA 4G86A 4G85A 4JSTA 3LCCA 3PUYA 5IEBA 1QK4A 4C0JA 1G59A 4RDHA 4XLLA 3IYLW 2ZAYA 2FMIA 1T5SA 2AEJA 2QM3A 1N2GA 3PHIA 4I50A 5EUBA 3K9FC 1WCIB 1IJFA 4JA2A 1JLMA 3KZNA 5FI1B 3DBIA 4KPYA 1I2MA 1WW2A 2NT3A 3G5TA 1I36A 1P7PA 5HIKA 2PDAA 3GCWA 3OCZA 4GOMD 2J85A 1V1JA 2Q3HA 2V65A 3FBWA 4FYXA 2NPOA 4RHXA 4CIDA 1ZH6A 1TL7C 3NI2A 1PK8A 3OX1A 4OQLA 1YQQA 3KOOA 4S1OA 3TOZA 1MAAA 1X15A 2RONA 4DM7A 1EM6A 3K9BA 1WWKA 1R0WA 2QJFA 3L0DA 1J09A 1LPAB 3O9VA 4PWYA 1J24A 3C7CB 4V1CB 3WAJA 3PU6A 1C9YA 1G1AA 4DGSA 1NTOA 1YQUA 4B44A 3VISA 2XOEA 1TB4A 3MCTA 1SUWA 1H0KA 2Q62A 5DHPA 1JILA 2B4RO 2GNPA 2H1LA 3ESZA 1BRTA 5IAEA 3SZLA 5ILOA 3LBAA 1VJ5A 4NCNA 4DMMA 5AHWA 4RTOA 3PJDA 5IC4A 3D4NA 2AX3A 1P1RA 5GJWC 1XYGA 1ULHA 2PT9A 1PJCA 2HGZA 1N0UA 1LU9A 1RKBA 1U9JA 2GBFA 2R5WA 4K8OA 3FVTA 3QVXA 1OZGA 4KKVA 2D6FA 4IIVA 1Q11A 2C8JA 3RTGA 3Q8KA 2NIPA 4I14A 4B2YA 4AAYA 3WGZA 1K3TA 2JIZD 3HJRA 3N58A 4AG6A 1CEEA 2WRZA 1EVZA 3I2KA 3BXEA 1OXVA 2P75A 4K9SA 1BZYA 4PONA 2GZMA 1IXSB 4WTOA 1CZUA 3EVTA 2YHIA 4GP7A 4PYOA 3O8QA 5FUYA 5LWQA 2CB9A 2YQZA 1E5DA 1ZD9A 4PX9A 5LN1A 1RZRD 3LWZA 2GSWA 4MVJA 2Q50A 3OQ6A 1GAQA 5E3JA 3A3PA 4XM0A 1VMEA 2IIBA 2O50A 2DPXA 3WB2A 1DMSA 1DKNA 4EQ6A 1KMNA 2BW0A 3A6JA 1E99A 3G8AA 1LPMA 2H08A 2AYXA 2Y4OA 2O3JA 4R9UC 1SH7A 1N7GA 1D2RA 3DLPX 3LF1A 4WLOA 3Q7EA 1FTNA 5ILGA 4JLPA 4W7IA 3AR4A 2VHXA 4PO3X 3WDSA 1CR1A 1I2AA 5J23A 1W36B 3T1TA 5JXJA 1A4RA 2GN6A 3ZV3A 4DIEA 5BOSA 2IEYA 2AA3A 4A15A 1XRRA 3MTBA 1AKNA 2NO0A 5EWJA 3BHNA 4GP6A 4C1NA 4LG1A 2N42A 3FKSA 4RPJA 5CFZA 3G23A 4YRCA 3NJRA 2RI0A 4ARAA 6ABPA 3KUKA 4JI8B 1O7JA 1RQGA 3KVVA 5FF9A 1QHSA 4FILA 2I54A 1N6HA 4EG6A 1IM2A 2ZRAA 3ZCQA 3UMFA 4AIIA 1OV4A 4NS1A 2R3SA 5JQGB 2FK8A 2CKDA 3N7UA 3NQ41 3IT2A 3UMRA 2GPAA 4YRSA 2GZDA 1L3BA 3PEVA 3N1UA 3NYIA 3VR5A 3A6LA 3QLUA 1QV7A 3I1YA 3P2IA 1Q19A 2NV0A 4J16C 4B8WA 1WG8A 2C2OA 3RNOA 3W5SA 1L7BA 1Z0AA 3FCUB 1L5ZA 2O52A 5JISA 1G18A 2GCOA 2YTZA 5FFNA 3KU4A 3BMXA 4MHTA 2QMZA 2YMPA 3KDSE 2R1UA 2HBZA 5TEWA 4YAFA 3HVUA 3V55A 4KQ6A 1C1XB 3PQ3A 3RVPA 2VS1A 5B3LA 2FJUA 3PQFA 4HRXA 2ASVA 5IN4A 3OTGA 5D85A 2ZZMA 2XGGA 3KAKA 4G4JA 4CMCA 1M8KA 1TUEA 4LRXA 3C15C 4PPNA 3KOXA 3ELUA 3IHLA 1HA3A 2JGEA 3C3MA 4JC5A 4B6JA 1HDZA 4MITA 1LDBA 4HWGA 4Y9UA 1CVIA 1ECLA 1E6CA 2A9KA 3PWTA 5CLQA 4IUDS 1E94E 1XRQA 4F0JA 2QT0A 1WU8A 4O29A 5JWOA 1DBIA 2FSHA 3TBFA 4F46A 8ADHA 3SXPA 1AZTA 3FCXA 3Q3HA 3GLGA 3JAKB 3RG8A 1BFUA 1UPTA 2G5CA 1D5WA 2NU6B 1YZLA 3PCRB 1CUVA 4EFNA 5BWOA 2I03A 1X19A 1XN1A 1NR5A 1R8SA 1WULS 3PD0A 3V7FA 2ZIVB 1PL8A 3H1TA 5U4QA 5KTNA 2D2FA 4ACBA 2KI5A 1XXHB 3DOCA 3DB2A 4A8TA 1HK7A 3AW9A 4YB8A 3KKOA 1Y5NA 4ZODA 1T8SA 2ILVA 1GPNA 1NBAA 1ECJA 3L41A 4YAEA 4JYCA 1ABBA 3IB6A 3RVKA 4AJ1A 1GL3A 1PWEA 3EEQA 2X9GA 3HA5A 1O97D 3A9CA 3NXSA 1G4UR 4JOBA 4DR5B 3EVDA 4BNNA 4RSGA 4BMPB 4FDAA 3ZVLA 4XD7D 1NJGA 4CR8A 4TV8F 4MVJH 3C16C 4J1NA 1LRJA 5G0SA 3I61A 4UTPA 1P9RA 1QRTA 3MUEA 1JI0A 1DKPA 3HUEA 3KO8A 4RAOA 1MEOA 2ARKA 1E2HA 5INTA 4RW0A 5C5EA 3JQBC 5BMOA 3RANA 1JPNA 2E5FA 3REQA 4KLRA 2NVUB 3FYSA 1JR3D 2APJA 1QFSA 2DCMA 4AP6A 2GKOA 3FFWA 4RK4A 2FHSA 4R8KA 2FMXA 4WADA 5AVUA 4JJAA 4M7RA 4OI1A 1SRQA 2TMDA 3F9IA 3TIGA 2DPMA 1CJKC 3QPAA 5K4AA 1FFYA 4KIJA 2CBZA 1QWSA 3EUFA 5B4UA 1VKJA 4CN8A 2R8BA 4N6OA 2RGGA 3BK2A 2HJVA 3ZS8A 1KQPA 3ZIUA 3A58B 4ZYYA 3M6FA 4PXAA 4G67A 1ZN9A 2CHUA 5ICFA 1MU0A 3OA0A 4Y0VA 4DQXA 4TLBA 1PL7A 3U0VA 5KOHB 1TK2A 2WVJA 3M2PA 1Z6ZA 5B2ZA 1XMJA 2HT6A 5BXYA 3ZD6A 3IBYA 4GI2A 2Q1YA 2CXNA 4QBHA 1MC8A 1USGA 4GOOD 4Z86A 2PSHA 2H17A 3OQPA 1Q74A 5F2OA 4O4LA 3DEJA 1SKAA 4RJIA 2B9EA 3DUFA 5IWCA 1WU7A 2O57A 1R5BA 3RSCA 5AVYA 3OPMA 2VEDA 2V7WA 5E9JA 4D9IA 3KS9A 4LJ4A 1GPUA 1GGMA 4KR2A 2DR0A 2VJBA 1EX6A 2N75A 4XX1A 2PVSA 4LPKA 3KD3A 5DH9A 1Z36A 4CM8B 2H63A 1A72A 2J30A 2IH2A 4CEJA 2EOAA 3AGQA 4TMVA 3DZDA 1LSUA 2RSLA 3T61A 2BEKA 1AUXA 1TK3A 4CIAA 4JEIA 4MV3A 4WXYB 5LUBA 2AKEA 4AO8A 2QVGA 5KYGA 1EJ6A 4X54A 2PS0A 4FZVA 3BEDA 4L6AA 3L5KA 4OOEA 3C4QA 3LKBA 1SCQA 2N46A 1QZUA 2X19A 2G0TA 3EAQA 3H1AA 4G9BA 4XIYA 4ZIRA 3K0FA 3NDBB 4Y2GA 1LNSA 3FTNA 1P2TA 4D3FA 4HTAA 1ZS9A 1J21A 3DTNA 3LOQA 4JB8A 5AJHA 1P1JA 4KXLA 3WLPA 3AP3A 4K88A 3GGJA 3WIEA 1XNGA 1NQVA 4YP0A 4F85A 1HRDA 4Z4GA 5BMVB 4KN8A 4OLHA 1Y6GA 3EFEA 3B8EA 4PLZA 4MQBA 2O8VA 4BQRA 1DQYA 2DH5A 1UMBA 2BI7A 3FNRA 3MT9A 3RU7A 1OROA 2HT1A 1SY7A 1MKYA 4K9QA 4J76A 1ZPDA 2EZ8A 1GRQA 1QWOA 2JHGA 1S0UA 1I4TD 1SHKA 3CFYA 3G0GA 3TOXA 1A3CA 3B70A 4BZWA 1GGNA 4F4CA 2H1VA 2WMNB 2A9PA 4F4DA 2BKUA 3FLBA 1M8PA 1R0SA 4I6EA 4ND3A 2WKRA 1C7QA 3WRVA 5HF6A 1E9EA 4PO8A 5EE0A 3MBKA 4MJXA 4PY2A 1JVNA 1K8ZB 1ESEA 1X94A 3DNPA 3CIFA 4NYMQ 1T43A 1NULA 1YVPA 2BMWA 2FFAA 4E14A 1C81A 2WJIA 3Q85A 1SHUX 2AJLI 2JH8A 2VL7A 4WLFA 3SQWA 2H4JA 1EB8A 1JA9A 3KXPA 2POCA 1K75A 2H2GA 4KBGA 1OWLA 2EC5A 2WJJA 4UU0A 2YS7A 4B75A 1HYBA 3DC7A 1YS9A 4CIYA 5TQ2A 4C7OB 4W4TA 4QM7A 3EXFA 4CF3A 4WKOA 3MOIA 1BOFA 3EZ9A 4DIMA 4WACA 3EHDA 3U4QA 5C8ZA 4G56A 1R50A 3AEYA 3OZFA 4MKFA 3FZYA 4WNYA 4UUAA 5CA1B 1S2MA 1BWRA 4DILA 3FR8A 1MNAA 4GMKA 2P9CA 1EE1A 3MAJA 3RNLA 2E3JA 3JYPA 5KQLA 4E12A 1DV2A 2UYOA 2VJDA 5CAEB 4NFSA 2YW9A 5FUBA 4B85A 4L9SA 4OK6A 5CYOA 2GTPA 4H7PA 1L5YA 5TDHA 1RXUA 4XB1A 1NW5A 2Z2ZA 3EE6A 3AINA 1CY6A 3UXHA 3L02A 1YU6A 5DW3A 3ER9A 4GPD1 4I2VA 1LX7A 4MR9B 1Z6PA 3QYAA 5K4HA 4ZT6A 1YI8A 1VLZA 1XT6A 1T3HA 2YZGA 3I0MA 1UBEA 2WU0A 4KQ9A 1KP9A 3P9PA 1G16A 1LF0A 5EWLB 1C0EA 3D6HA 3DP9A 1JEOA 3H87A 2C5AA 1DX6A 1COWA 1FP2A 1G8SA 3NGMA 4FFOA 4J91A 5SZJA 4ENPA 1LV7A 1FRNA 1RXSA 4NCKA 5BMVF 2AZXA 2ZPUA 3FHTA 1UC9A 1RC1A 4RPGA 1O89A 3T1QA 5HS4A 2W6PA 5KTKA 4EKYA 3MMPA 2J4FA 4M76B 3KQTA 1INLA 2OD7A 5JSZA 4YQZA 2PRIA 2RH8A 4F3TA 3PTAA 1DIHA 4UEQA 3VNQA 3Q4GA 4M0KA 2J46A 4KI0A 3UJBA 3ZZTA 1YZUA 3G9UA 5HA5A 1PKXA 4MW6A 4Z9YA 4MZXA 2ZW9A 4IYJA 1HLDA 5KWSA 4ZU3A 4Z7NB 1KEWA 2QR2A 3IILA 3FB1A 4RETA 1KE2A 1E9VA 3O26A 1MJNA 4EUNA 1NFQA 4URFA 2XDQA 2ERYA 1T5DX 3LG2A 5TEVA 1E2BA 2F9MA 4F5ZA 2VDOB 1GUBA 2R6HA 5J43A 1JQDA 4K81B 5DM60 4L07A 2VYND 1KDOA 5AK4A 3B13B 4LEIA 2IHNA 1D4ZA 5FORA 2QTWB 3A8TA 4N7RA 4J29A 1W4CA 1X7GA 2EV9A 2XWQA 4MUAA 2LCIA 4Y2UA 1XX6A 2DT5A 4L8WB 3OTIA 3OO1A 2EKZA 5JRDS 3TGWA 2CFIA 3EIQA 1IXRC 1RQLA 2CLDX 2OG1A 2IEIA 2XYRA 4JLUA 1T4DA 5LXTB 3OUTA 4L75A 3BXXA 1ZVMA 2Z58A 3VVBA 5JCZA 1M1XB 2OHVA 3O83A 3NHKA 4X9XA 4DRXB 4CQNA 5FBHA 1CY8A 3MERA 2B2CA 2E4WA 1A4IA 1M2KA 2PKXA 1QE3A 2VQ3A 2BISA 1FP4B 3PIRA 4UULA 4RM2A 2O2XA 3REGA 4A6PA 5B1YA 5C8VA 5GTDA 3N59A 5JECA 2LPMA 4IHJA 2XYQA 4IILA 5ICCA 5KDDA 2P6MA 5H3CA 1JB9A 1CSEE 3OKFA 3OU7A 1QJ4A 3OPYB 4MQEA 3VDNB 4YIHA 2VNKA 1BHQ1 3FMPB 3PEFA 4J6EA 4NAUA 3ZQ6A 3IELA 1R0YA 1SR8A 2X0RA 1CKEA 4QBIA 1T5TA 4BLOA 1R64A 2VHWA 3F6BX 4A0FA 2NU7A 3A6GA 2VPPA 3D81A 1R0XA 2QWXA 5CVDA 1VBMA 4HN9A 2WWYA 1E5LA 2QPTA 3TIXB 3U7QA 1QHHA 1G8GA 2WNSA 3INNA 3L1JA 1ZD4A 1XZIA 3BZBA 3MTAA 3HR8A 3RS0A 3WKCA 4C2AA 4B84A 3GLSA 2DBRA 3LUJA 2FEPA 1CPYA 1K4KA 3AT1A 4P38A 4XWAA 1Y34E 4YV7A 4F7DA 3L84A 3U3MA 3JAWB 4Y6OA 4S1WA 3OLVA 3VV3A 2F90A 3PPVA 3ZWDA 4C4YA 4RSHA 3OZTA 5BSVA 4NJMB 1SN7A 1WJGA 4WLUA 3I6IA 3JZIA 3A1CA 1D6SA 4CMHA 3HVRA 1VHJA 2EP7A 4M6WA 1S7GA 1SWWA 2QX8A 1NW3A 3MB5A 4JJ4A 4MWDA 1LS1A 2XGOA 4UVHA 1E2KA 4EX6A 2X0NA 3PCTA 5CM9C 4A16A 1JR6A 4F4JA 1OD6A 4M55A 2J6IA 4IIBA 3D59A 1BN7A 3R0IA 1N75A 4QARA 3DEYX 4I9HA 4J4TA 4PHCA 5HTOA 3HRKA 4BNJA 2H52A 3ZG6A 3BDAA 4MVYA 2Y4NA 3WWEA 3UG7A 2NUAA 1UQRA 4Y1RA 5CIQA 1UZNA 2VYCA 4Y2JA 5BN4A 5JJBA 3FRIA 4G4SP 4IJQA 1ODIA 1N9GB 3NFYA 1Q1QA 3KEMA 3RROA 2G70A 2JVJA 4ZALA 1KVTA 2JAPA 1CJTC 5IAAA 2N1MA 5LOVA 2LW7A 5EFOA 3S2ZA 1EFHA 4QGGA 4NMXB 2CE7A 2ZJ6A 2OFOA 3HN7A 3IALA 4AU1A 2P1RA 4F6RB 3TTYA 2Q4RA 4H0CA 3UT6A 3SFVA 4UMEA 4BV8A 5ABPA 2BIFA 5M2QA 2B37A 2X4DA 2IPAB 4JYBA 2QD2A 4HDRA 4I8IA 2ZXEA 3IUJA 3NNDA 1O2DA 5BURA 5DM4A 4IOJA 2PTGA 5A5VA 4F1KA 4QYIA 1EHIA 4EB0A 2IODA 3KFXA 3ZD7A 1DIGA 1LWNA 4UPEA 2FPKA 2XA9A 4UAVA 5TF4A 1S3SA 1I2DA 4YWJA 1OI7A 1TLLA 2GH1A 3OIYA 3B7WA 5JYBA 3AKEA 5F5LA 3DP7A 2A78A 4RMIA 3CZCA 1KO5A 4YAKA 1T9CA 2C94A 3L4EA 1NR7A 1JDVA 1R0CA 2H00A 4L2IA 4A1FA 4EFDA 1SURA 1W85A 2IHZA 4QVIA 2CVZA 3GEBA 1F17A 3NORA 4IJUA 2WICA 3AU8A 2EFYA 4GC5A 2IXDA 3AIIA 2Q3DA 2IYAA 3ZWMA 1FRFS 3EA0A 3F78A 3RIMA 1FS6A 4EKNB 5I7FA 1XCOA 2GZSA 1N8NA 2Y0BA 4AF7A 1RYFA 1Z4MA 2OY0A 2XB6A 2ZUWA 4HJXA 4Y2HA 1ND6A 3V1TC 1V3UA 1AUQA 4TYPA 1NYRA 1MJGM 5CBPB 1MO4A 3RAFC 5DI9A 4CODB 1D2NA 1GILA 2NXWA 4AKHA 5FA6A 1SCDA 5KOIA 5U1PA 5KYTA 2CWDA 5L4SA 1RI5A 1O5OA 1JEQA 2ZI6A 4RORA 5AW4A 2KW5A 2J32A 3F90A 4WPGA 1A9TA 2QAGA 1XTRA 2DPLA 1ORWA 3ASVA 5CEFA 1IG3A 1PJ3A 2WIJA 1CUZA 1GR0A 3WADA 4UM9D 1ZYUA 1T6XA 4G5SA 1KFEB 1RBMA 4G07A 4OSPA 4OXKA 2OFFA 2ZTUA 3RUEA 3WOVA 4GI1A 3U6BA 1APBA 3EBLA 1DAKA 3IURA 1RXCA 2J3LA 3KAQA 5ENDA 1CUFA 3WZ2A 2QLFA 4G26A 3GP8A 3AL2A 5KO2A 5EXEA 3AQ4A 1GU1A 4MV4A 4RBNA 1ZSVA 2WUGA 4Q1VA 4E1VA 1ZLYA 3N2KA 2RARA 1V7PC 3RRZA 4AZ0B 5FOVA 4WJKB 4U7HA 2VH5R 2IX9A 4PZCA 2RJNA 1Y8CA 1VPDA 4EUKA 1QMGA 2YBDA 3KRTA 4O1MA 1MN6A 4HDQB 4QJ4A 3SNHA 3OG9A 4HLQB 4BV3A 3OA2A 1JJAA 1PFQA 4JQSA 3H86A 1XZEA 1Z6YA 4XA8A 1KJZA 4OBWA 3A9WA 1RWVA 1W4AA 2D2EA 1UBGA 1CE8A 1N2CE 2DUWA 4KDCA 4PZYA 4S24A 4ER7A 4ZT7A 5HUQA 2HSGA 5EHGA 2C9DA 4XR9A 4Q1CA 2HLPA 1HBJA 1SHJA 1I0ZA 2A8YA 4WXPA 3VX4A 4EBFA 3W5IA 1TYEB 4GMDA 4J2HA 3KIPA 1TT5A 4QSMA 1JP7A 5FPHA 1G9XA 5FNZA 2QENA 1P9WA 1RWQA 3KBBA 2JI7A 3PXCX 1QFMA 2ZDHA 1VLLA 2V3CC 1Y8QB 4CUZA 3EZNA 4MCJA 3HDQA 3PGXA 1DDIA 4IUBS 4P4TA 5AW6A 1DBWA 3IR5A 4MDFA 5TJ9A 2CF5A 4DRYA 3OQMA 2VF2A 4O3FA 3X1MA 1ECBA 2QP4A 3B6IA 2JFQA 3SX0A 4F96A 3GCZA 4MUGA 3D8HA 3OIUA 1EJBA 2DBYA 2HM7A 5I9LA 3GK3A 1UQTA 4GOLD 4C87A 1E3TA 1G6KA 2Q5JA 2HA0A 2YXPX 4KO4S 1CQJB 4HAVA 5EIHA 5AUQA 4A23A 2X23A 2XW6A 3L6OO 1VL0A 4FN4A 4JK3A 1PJZA 2AI3A 4LBWA 1YAHA 1AXRA 2Z4RA 5AJTA 4UHJA 1AK9A 4H31A 4UEOA 5EHQA 2BE7A 1PUIA 2CVOA 1EVIA 4BNVA 1W1IA 3WDKA 4D97A 1N6LA 2I8CA 4F56A 3PX7A 3J7AC 2GNOA 2G17A 2ECPA 5DDIP 4HWKA 3K8OE 3PFNA 1RC0A 2ACKA 1PZHA 2ZAIA 4NI5A 1DUVG 3SHVA 1SUIA 1FDIA 4CM6A 4X0EA 3EPJA 4PC6A 4N3NA 2YBEA 4UNQA 2AWNA 4BJ6A 2PV0A 3BCUA 1DHRA 1YK0A 4G8BA 1BQEA 1HDRA 1TNDA 3E2IA 3FPAA 1TK9A 1VG8A 1FYVA 2ZR7A 1Z75A 3O4VA 1OH5A 1GM5A 4YXWA 2CLEB 3BHMA 2HRRA 1Z16A 1Q5PA 4GM4A 3E81A 1JXAA 4KAJA 4NK5A 3EPHA 1E2IA 1KERA 1KI2A 1QYDA 1FYXA 2LIVA 1DIAA 1U04A 1U3WA 5IUKC 2PSJA 1T5BA 3IUEA 4OU4A 2W6NA 5FI5A 3UYKA 6REQB 3V2IA 2XRMA 3ICEA 1J7KA 1VHDA 1AUVA 1K63A 5F5NA 3WTBA 5JFOA 2Y99A 5MN4A 1M2EA 3KB8A 4MTLA 3S70A 2VH1A 2E82A 4MVCA 4YAUA 2FSUA 4F4IA 4JI2B 1WZ2A 2NUTB 3CE6A 2V3WA 3BSYA 4J1SA 1TEHA 3EEIA 3W5JA 2HGSA 3V6LA 1I3NA 3HN2A 2JIRA 1VM6A 1VKZA 1XWFA 2Q4EA 1CFJA 5CURA 4E5DA 1H2BA 2IOQA 3JRNA 1EHYA 1W9MA 3LRXA 3PDIA 3DCIA 1GA6A 1VDZA 3UXMA 2AZDA 3IUQA 1KS9A 3IODA 3KL2A 1TQ4A 2AYZA 2GK6A 1M3SA 2DFNA 1UK8A 3T0FA 2XGMA 3FYUB 2G1KA 2JH9A 1Z07A 3IOBA 4XARA 1LJLA 2OHIA 2P6UA 3F7OA 3RSFA 3C5WP 2SECE 3CG4A 3M1YA 3M1IA 2FMTA 3HDGA 3MRVA 1D1TA 4EY3A 2Z5LA 5I7RA 3QEMB 2OLEA 4R0MA 3FDZA 1PG2A 2OK8A 2XQJA 5IASA 1KI9A 2XYVA 3U1TA 3NH6A 1LK7A 1PBNA 2IVFA 4BLQA 4ASUD 1UJ2A 2VHTA 3S7ZA 4G1BA 3WMWA 1YB1A 3UGQA 4DN6A 3DYVA 4D9MA 3VGJA 1QHFA 3I0NA 3CG0A 3SHFA 1ICIA 1REQA 1N0VC 3GP5A 2NUPA 3E15A 4GW3A 3P9XA 2CXUA 3HGQA 1ZNYA 2E85A 5DGHA 5TY0A 4D98A 2ZUEA 4ZQHA 2AZTA 2CBXA 4RXTA 4YHHB 2OENG 4PF1A 3RSHA 2JAWA 1OQAA 2O3QA 1DAFA 4Q3AA 1BNCA 4ZXPA 3PICA 5JAHA 1ISRA 1UPBA 3AUTA 1KMIY 2FR8A 2ID8A 4UCWA 2G9QA 5IXYA 1GCIA 4TZTA 1T9GS 1RKUA 3AFIA 4EG5A 1Y8QA 2OC4A 1LDGA 3LK6A 3SLGA 3G3EA 1B2RA 4L0MA 2Y1XA 3HFGA 2AG0A 3NP7A 4GQIA 3OHPA 3UUWA 1ZGCA 4R2HA 4Q15A 5KVAA 5FPQA 3WWZA 2DHDA 1QCCA 2B92A 4ZYLA 2C7OA 1AS3A 1XNRB 4LV6A 4GS5A 4ID9A 4EHHA 1VE5A 2PYDA 1L5OA 2FI1A 3BJEA 5FJJA 2HCBA 2LCQA 4FI3C 4KNVA 3ZD9A 3TW6A 4EGCB 2GF2A 1HX7A 1JTVA 2IX3A 3DM9B 8AT1A 2VKTA 2CWWA 1ONBA 4CM8A 3B6MA 5I45A 3IHWA 1NJ6A 5DHTA 3WRYA 1H3EA 1QPBA 1D6JA 3IDQA 2NNWB 1EDDA 2QYOA 3QWBA 5HS6A 4AMUA 4DADA 2XCRB 2FN8A 5EXXA 1RWMA 1FFWA 3HCWA 3PNLA 3OFVA 4GLBA 4YO8A 4BX0A 4YUXA 4M88A 3AZOA 3AZPA 2GEKA 4LYYA 2AOVA 3H84A 3JQDA 4C30A 1SD1A 2ZUTA 4D57A 3CVWA 4M1OA 2PD3A 4ZRMA 5J4VA 1YQXA 1I3OA 2QVBA 3T06B 3ZXXA 2JARA 3ZCVA 1ML3A 5IX8A 1N6RA 5HKLA 3W6PA 1XVAA 3A3YA 2P6OA 1ORVA 1ZM2A 2GZ3A 2N0SA 5BW6B 2NN3C 2FFHA 4TYQA 3K0FB 4G4GA 3LAWA 2Q3EA 5DOVA 4GOND 2NPFA 4ZOLF 2W2KB 1FUUA 3F4KA 5DM1A 1IWPB 3PD7A 2IQ5A 2H7YA 3U7HB 2OM2A 3ISTA 3NB0A 3BN3A 1JL3A 3DO5A 5CFMA 2BHSA 3CJRA 4K0RA 4N0DA 3Q0EA 5J5CA 4L8YA 3ABSB 3ESCA 4BJ5A 5CEEA 2ZAGA 5L3QA 1M67A 2IE0A 2VYVD 3JWPA 2XUKA 3X1WA 1EP9A 3UUEA 2P68A 4BO2A 1G0OA 1OGJA 1PR6A 3DE7X 1FNDA 3C85A 3AJAA 3CKMA 4PLTA 1YS7A 2BEJA 1GO2A 4UTZA 3IV7A 1AMNA 3VDQA 2J3MA 4R54A 1JDPA 3GP3A 4GZ5A 1C3LA 1PBTA 1QTNA 1XVLA 2MYUA 4LOJA 4M6WB 5B1DA 5JSYA 3WL3A 3ZKAA 5CFNA 1ODLA 2OYSA 2R60A 2B1QA 3Q88A 1E1LA 3N6VA 5GJBA 1Y9AA 1H0HA 4URHA 3KUDA 4NDZA 3B6JA 4LRUA 2DUUA 2EFCB 3OLCX 3H5IA 3I37X 4HFMA 1SUPA 1JB1A 1AKQA 1J5PA 1KI4A 2WWVD 4PPFA 1LRKA 1DEAA 1HNZB 3C3EA 4AWAA 1N36B 5CIYA 4LMBA 2OAP1 4JOQA 5DEIA 4QFMA 2FLWA 4EABA 2LBPA 5F2EA 1P9NA 3GDWA 5MF6A 3AVYA 2W90A 4LZWA 1U0SY 2P91A 2VP3A 3NGXA 3ORYA 1TA9A 2I87A 2OBYA 4A0QA 2JNWA 1IU9A 2ZR0A 1N33B 1JWBB 1KZ9A 4Q3DA 3GHHA 3EVEA 2HR1A 3CN7A 1XN4A 5F3RA 5F1YA 3LYAA 4ZKDA 4NEHB 3NHAA 2IYXA 3H5NA 4HKTA 1UBOS 3BXGA 5DNEA 4DVGA 4UQOA 4YJ2F 4P5PA 4YP9A 3UKJA 2JI8A 1TVCA 2A5YB 3FKSD 4F9GA 4DV3B 3WGTA 3G5LA 4WECA 5K51A 2O8DA 1VRWA 2ATIA 5IXSA 3ZE6A 3O1JC 2Q21A 3LJKA 1P45A 1OU4A 1PX0A 1GGJA 2W2QA 1FMTA 5F7ZA 4EJMA 3GFBA 3K0CA 4EF6A 2O2EA 1WP9A 4YX9A 1RMQA 5AKKA 3TR0A 5ALKA 2X9LA 4DLSA 4ENQA 3AM1A 2I6GA 1L7XA 3FE2A 4DV2B 4KK4A 2P4QA 4C7VA 2RGNC 2Z3WA 3COYA 2YHSA 1XF1A 1JMKC 5DBFA 3NYRA 4BGEA 5BVHB 4HTFB 1G17A 4K86A 3RT1A 3ZYZA 1J8DA 2PHZA 1ZZEA 1G5IA 1W87A 5HSGA 1NN3A 2XXJA 3ID6C 5B37A 3UT5A 1LQTA 4EVQA 5GIPE 4UCXA 5DGIA 4LRSB 2G28A 3B78A 3MTEA 3RKSA 1TF7A 2HDHA 3VI4B 2FN3A 4ZO7A 3LT5A 2D5CA 1UEXC 5C8YF 3HWSA 1GWNA 4W5OA 3WGMA 5BSGA 2AR7A 1TJ3A 4KO2S 4R4JA 4YA6A 3T1VA 1MC1A 3G1TA 4ALMA 1H05A 2VTVA 4PGMA 1E1QA 1NUSA 3H05A 1Z47A 2IQIA 3CJTA 3DEHA 3DZGA 3HBFA 5IVIA 1WABA 1TMGE 3G6KA 3QG5A 2V0CA 4RY0A 2YYAA 3T0IA 1KOJA 4MUHA 2YWGA 3KP1A 1IZ9A 4D9CA 5EMLA 4W9NC 1F2UB 3GCGA 4K1XA 1BXRB 3O5AA 4C6TA 3F7NA 5KHOC 5FH9A 4V3CA 1H69A 3ND7A 3NIDB 3T9EA 2QT1A 1O95A 2YZNA 4RCYA 4B1FA 2GLXA 3IVCA 3LYUA 4D0SA 2CVHA 1GV0A 421PA 3OFJA 1IATA 5I47A 5DYYA 1DADA 4ROTA 4ZP1A 1RIFA 3ND9A 3NMUF 2V6GA 2W22A 2IPXA 3F5DA 1O8CA 1Q0RA 4O4JA 4JMLA 2BTQB 5DOZA 4EECA 3R6GA 3AWDA 3RSSA 2H48A 4LF9B 3BILA 2PGDA 3BIXA 5PGMA 4MDYA 4P31A 4L4YA 3IRUA 1CY0A 3K5PA 1Y6JA 1GNSA 2R6DA 4N12A 3DR5A 3HYLA 1A9PA 2JIDA 3Q3GE 4DA4A 3HLTA 3FPBA 1SPXA 3IKMB 4ZVKA 5LXTF 4EDFA 3FZNA 1FYFA 5LXTA 1MA3A 5C7LO 4IH4A 1LZLA 3MIIA 3EEBA 4N0PA 1XMIA 1CS0B 2O2CA 2HPHA 2I4NA 1OT3A 2OILA 5IZ4A 4JASB 1GUYA 4QE3A 4DDVA 4EENA 5BPFA 1RM0A 3MFQA 4H1WA 3ZJTA 3WNDA 4FGLA 2X8JB 1H6BA 1R6VA 1FVXA 3KG2A 3OM0A 3S8YA 3Q9LA 1PT7A 4PG7A 3TOVA 4FKMA 3E8SA 3RCBA 1R6BX 1YT5A 1Z9BA 3V2HA 5J47A 1U2SA 4WL0A 1EQ2A 3R24A 2C77A 4KRYA 2VJPA 1M6WA 5KNDD 5JJIA 3PFHA 3WIUA 2MSWA 1E3DA 3VSCA 3W4JA 3A1TA 4XI9A 1Z2OX 1M1ZA 4QGFA 3S4YA 4B5KA 5DK6A 4EQZA 4GPBA 2OSBA 1RDFA 3E5RA 3FKQA 2BTEA 3WJ2A 4MCAA 3UMBA 4RHYA 5B58C 5AVZA 5IN5A 1GUFA 2WJVA 3ZJ4A 4C20A 2DTDA 4YP7A 3WWPA 3HY3A 3B1XA 4XR4A 3J81A 4JP3A 3TLEA 2C2GA 4UOZA 2JBAB 4KPUA 1WCXA 1NVDA 3ZWBA 4ERNA 4URVR 5FBZA 3ONNA 1DEKA 1GQ2A 3DXFA 3EGOA 2HJHA 3P9ZA 4UU8A 5I4IA 2AN1A 1NP7A 2RHMA 1NVVR 4LJAA 4B6EA 1G60A 3J7TA 4Y6RA 3I2HA 5A4KA 2PKRA 1KPHA 2ACWA 4TSFD 2I9KA 3BRWD 4XX0B 4XFDA 3VO2A 2F43B 1L9KA 4IHQA 4EVIA 4EG8A 4UZSA 8ATCA 4EOGA 3Q3JB 4CETA 1PR2A 4KLCA 3MTQA 3ASYA 3FMOB 2BZSA 3ECCA 4I3FA 3OECA 3PKJA 4R7GA 5ESWA 1F1JA 1H2AS 3IGFA 3LXMA 1NUPA 1EDEA 3ES9A 4JKOA 5G02A 4B6SA 3I9LA 3LWNA 3WAKA 3R0QA 5KX5A 1JSCA 2I1VB 3I5UA 4HB2A 4LZLA 1PEKE 2F67A 2ROQA 3KZVA 2BUAA 4TKZA 4E6EA 2A0KA 2ZBEA 3BQ9A 2J3EA 4DEVA 4EAAA 3HBNA 4YDQA 4P34A 5FL7A 1CNMA 2EXXA 1O0SA 3DV0B 2NZJA 4R3UC 4C3OB 1L6RA 4NZYA 4UM9B 2P1ZA 5C18A 3QKUA 1EGVB 3EFHA 2OXEA 3FPEA 3IEIA 3OLQA 4FONA 3A1WA 4MJ3A 4B43A 4G36A 2IUEA 4PSCA 4X63A 4B6RA 4AY5A 2WSSA 3FYUC 3PCXA 3QX7A 1Y5RA 5ALJA 1L4NA 3H8JA 4C78A 2CLSA 1M34B 3AILA 3AR5A 3U37A 1TU4A 3OCCA 3OCJA 2WKQA 3OIGA 1G98A 3HKBB 3KSUA 3P27A 5IANA 16PKA 4G9GA 4ESOA 1N8SA 4CM9D 3HR7A 1WPXA 3CLVA 2GN4A 2X13A 2CE2X 1HFJA 2Q4BA 3HP4A 3N3BC 4TGLA 2IXGA 1F6DA 4C2TA 1XA4A 1RFLA 4YBRA 3VKUA 5IT5A 5C1OA 4LIPD 1LI5A 1XD2A 1YVDA 2GETA 2JGLA 3IL2A 4EGFA 1Z6QA 1ARZA 5A5EA 3T7RA 4OH1A 1X8KA 3KQLA 4EKGA 2NUTA 4CQJA 3GO4A 4BVFA 3BRWA 2PRZA 4Q9JA 3BJMA 3GFVA 4FKZA 4CF7A 4Y2PA 2B5OA 4JI3B 3G13A 2IZOA 3K70C 4LWZA 4D5GA 2ATXA 2WHRA 2FSGA 1O4WA 5LDDC 3G2HA 3GZNA 3IOMA 4RS4A 3S1AB 3ZQUA 5HG0A 1ENZA 3EXHA 3CCCA 2X14A 1D9ZA 1T4GA 1VXOA 3RJTA 3SY8A 3W0LB 5A3QA 5T4FA 5L7WA 1FOEB 1Z5OA 3IMEA 3RQSA 3ZNOA 4NDAA 1KSGA 3GGSA 1E3QA 3AEZA 3HB1A 5JPIA 1MQSA 3D7RA 5U9CA 2JW5A 4EJ2A 1J6UA 2QQ5A 4HGNA 4FTWA 2I71A 4MLDA 4XJXA 1PR9A 4N0QA 5H83A 4EBBA 1T2CA 3LC0A 4Z9AA 1QTQA 4B4VA 2PEYA 4UE3S 3Q5GA 2QOEA 3DTVB 2ZBQA 5H5JA 4ND8A 1DPGA 3OOJA 2IH4A 1CUIA 2GAJA 3FJOA 5KQPA 1XCPA 1TKCA 2FWIA 1RYMA 4IIUA 4ARIA 1UKZA 4JT9A 1RCUA 1P9LA 3IP8A 5JMPA 3CUWA 5TT1A 4DS3A 4OGLA 5K6AC 2YIJA 4AP9A 1FX0A 4Q4JA 3L8MA 2PZMA 4Z0HO 4IQ8A 1VQ1A 1SUCA 5JARA 4RGBA 3A26A 5JLAA 1E89A 2NV2B 1ZL0A 3EYAA 4C43A 1EFRD 1FUIA 4RKRA 3WL5A 1HDEA 2I1LA 4MCIA 1JU3A 2NSDA 1Z88A 2ADOA 4Y2XA 3SYKA 3PWKA 1VSQA 1IK6A 3H0CA 2JFFA 3QVUA 3ZE9A 1MABB 4LOLA 4AT1A 1ZUNA 4ZZ0A 5JS7A 1VHQA 4ENSA 5FUMA 5DT9A 1IYZA 3OJXA 4TWZA 1KR2A 3ET5A 3O47A 3SF8A 3SMQA 5FBVB 1PZFA 4DLZA 2XZLA 2PMBA 4OI4A 1J9EA 2FZVA 4Q93A 2VP5A 3FG9A 1EVLA 3HZOA 3HJCA 1LNQA 4YREA 4OHPA 5CYGA 2HWUA 1M2HA 4W5RA 2C4WA 5LMNB 1TMKA 2R7LA 1WXHA 3ML1A 3EVGA 3I6MA 4Y9SA 2QD3A 1W29A 3FSEA 3FMFA 3O8OB 4DRZA 3GLFA 4XQEA 3PXUA 3ZHRA 4DIKA 1QHYA 5KYKA 4F5EA 1R10A 2C54A 3SS8A 3H8SA 3EIHA 3TNDA 1UBJS 2J09A 2I1WA 3AR2A 1JT2A 2OV1A 2P3QA 1YNSA 3SKVA 3CKLA 2PL1A 4UVGA 3O2SB 5IAGA 1LPBB 2CDRA 1NNUA 3E03A 7YASA 2VP6A 3OWXA 4HVCA 3FWZA 4ER3A 4G23A 1EFDN 1F51E 2NP6A 4RZ2A 3HYCA 3R5JA 4NZZA 3TRIA 4CDRA 2IBSA 1JN0A 2BMFA 3UK6A 1A82A 3ZZNA 3I6YA 4V1CI 4OG2A 1MW8X 3EVZA 4P3XA 4EK9A 1JIQA 4MS3A 4Y6QA 3W1VA 1E7YA 2LD4A 2R6FA 3BD6A 1RXYA 1EFAA 2GUWA 2ZRCA 1IJKA 2GDJA 1CU1A 1NA5A 1SC6A 1ZBDA 4IXTA 3CRW1 4MQMA 4EI2A 2DY1A 3B36A 3W3AH 2Q2WA 3FWYA 4KXXA 1A88A 3ZZ1A 3PYLA 2C57A 2ZS7A 4JUCA 4QTXA 4RENA 5LQDA 2A35A 2IPOA 2V8BA 3EUAA 5LLDA 4J94A 1NOJA 4WOJA 1AQIA 1QCDA 1GOTA 1T9BA 1F4PA 1SXJC 3JALA 2CMDA 2PQ6A 4GGMX 3JVIA 4NZ9A 4GL2A 4LN1A 1NW9B 3ISJA 2C9OA 4FR0A 1EK5A 4P7BA 1XQ9A 3OE7A 1QPZA 5LA6B 1DXYA 4OP3A 4YV2A 5EAIA 4OY3A 3W78A 4ZFNA 2VN8A 3MT7A 4YDHB 1VJDA 1GQOA 2E4ZA 3DGFC 2FHPA 5LFAA 2W4MA 3E3MA 2OGUA 5KKAA 1K6MA 4HAIA 3SDBA 3F3MA 2CXQA 3ECSA 2PJRA 4M49A 4XB6B 1S3GA 3ESRA 1GRNA 1K7YA 2X7XA 3OIDA 3VO9A 4DIBA 1V37A 3UANA 4DOMA 2J7PD 3HGTA 4XGKA 1PQYA 2EEPA 2EARA 4NYIQ 4DPKA 2CNDA 2BM1A 1JJIA 1O08A 1R6UA 3G2MA 1GTVA 1JFLA 3HABA 5ALOA 4DARA 4ER6A 4B48A 2IPNA 3PNOA 3GEPA 1JLLA 1YRBA 3G7SA 4U6SA 5F3WB 1W94A 3B5IA 3PGVA 3FYHA 2QUZA 2XYPA 4WNAA 4PZZA 1J8YF 1QX3A 2C42A 2QE7A 1OMOA 2FGKA 2QNBA 3G5UA 3OKPA 2IDZA 4FFLA 4UPDA 2RH5A 5F1KA 3SDZA 1XDZA 1O8BA 1BH6A 5CPFA 4O2RA 2W93A 2WIDA 3SG0A 3OZBA 3P5BA 5C1BA 3MTIA 2OFWA 2QI9C 3KPJA 4ENWA 1R37A 2I55A 3HH8A 4A2PA 2WAMA 1YVUA 3D3WB 3AFMA 3KKQA 4KGDA 5EPEA