3JVEA

Crystal structure of the sixth brct domain of topbp1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
b'APKPLHKVVVCVSKKLSKKQSELNGIAASLGADYRWSFDETVTHFIYQGRPNDTNREYKSVKERGVHIVSEHWLLDCAQECKHLPESLYPHTYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA topoisomerase 2-binding protein 1
molecule tags Protein binding
source organism Homo sapiens
publication title Insights from the crystal structure of the sixth BRCT domain of topoisomerase IIbeta binding protein 1.
pubmed doi rcsb
total genus 34
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3jveA00
2COUA 1WF6A 4BMDA 1KZYC 3L46A 2ADOA 2M2IA 2WT8A 4JLUA 1IMOA 3QVGA 3HUEA 3UEOA 3L41A 5ECGC 3K15A 2K6GA 3K16A 3PXAA 3PD7A 3PA6A 3SHVA 2INGX 3L40A 1IN1A 2XNKA 2COEA 1T2UA 4BU1A 2EP8A 2LE0A 1OQAA 3PXDA 3I0NA 1Z56C 4Y2GA 4N40A 2L42A 3HUFA 3OLCX 2VXCA 2XNHA 3AL2A 3II6X 3PXBA 3PC8C 4BU0A 4XQ0A 3QVGB 4IGKA 3T1NA 4OFBA 4ID3A 3PXCX 3EF1A 1T2VA 3T7JA 3EF0A 3K0HA 2K7FA 3JVEA 3PC8A 3T7KA 3T7IA 3UENA 3FA2A 1GZHB 2EBUA 3PC7A 3KTFA 2E2WA 2NTEA 3PXEA 4XPZA 2ETXA 4IFIA 1N5OX 2D8MA 1L7BA 2COKA 1CDZA 3K05A 4Y18A 3SHTA 3SZMA 1JNXX 3SQDA 1Y98A 2AZMA 3PC6A 3AL3A 2VXBA 2HTFA 4BMCA 2JW5A 1T15A 1T29A 3K0KA 3COJA 1L0BA 2EBWA 4U4AA 3U3ZA 2DUNA 3I0MA 2R1ZA
chains in the Genus database with same CATH superfamily
4LHEA 2Q2OA 3VH3A 3WK4A 2Y1WA 4TWIA 1JVNA 5CDTA 2Q4TA 1AS3A 2R6R1 2VNIA 1SKBA 1Y9AA 4TTRA 2GTHA 3DV2A 4MIYA 3HI4A 1A2BA 2E18A 2IXTA 3CZMA 3G2HA 2H2WA 1QTNA 1CEQA 5I7OA 4TMKA 5ECWA 2PUEA 3PQEA 3WGVA 3B6IA 1DOHA 1IQRA 2V54A 4URYR 4PRLA 1XNJA 3ETDA 3OEED 5DI3B 1Y7LA 2IGTA 5A62A 3BMOA 4QRHA 5E6UA 4NLLA 2WEKA 4QDZA 3PDWA 5EJ8A 1WD7A 2ZRQA 5D51S 2RGUA 5FBHA 2NUAB 2PZKA 1YOVB 1E9DA 3ACCA 1KFBB 1P0FA 1PVDA 2XTMA 2ZE6A 3QLJA 1NOKA 4ONEA 5BN3A 4UVIA 1NSFA 5KS2A 1JHOA 1DIRA 1G4HA 4LSWA 3TXAA 1LDBA 4UAJA 2BR4A 4PZAA 5FWDA 4B3DA 4OL0A 3LBFA 1YAHA 1GARA 1CQPA 4JEHA 3MXTA 4OHPA 4QRIA 3TGPA 3DEZA 4YP6A 3UA4A 3I0NA 3OPYA 3THXA 4K03A 1H2EA 2Y9PB 3DDWA 3Q5EA 3RAJA 1X8LA 3RAEC 1G6Q1 4HSEA 1XPJA 3RIHA 2GN4A 4B84A 2W0SA 3LT1A 4BJ1A 1P0IA 4D8UA 5EKUA 4DDVA 3T1HB 2I22A 4YK7A 2QRVB 1P6UA 2YJ6A 2GJSA 1M1XB 1CEEA 2J6CA 5JH7F 4JEIA 4O2AF 4JL8A 1XNHA 1SQGA 1XMIA 4QTYA 2V7XA 5KYUB 2ZZNA 4GUAA 3EF0A 3SZGA 3JQ6A 4AROA 3KKOA 4XVHA 5F2OA 1JYFA 1GQYA 2BJVA 3CJRA 3VM6A 4B8YA 4C07A 3OQVA 4NU0A 3AT1A 1SCKA 3TQOA 1W87A 3SEFA 1MDBA 3A36A 5AESA 3DHYA 5KQLA 4KO3S 1G8PA 2WE8A 1I1QB 4BATA 3HUTA 1GKIA 3L6RA 5L3RA 5DM4A 1LNSA 4K40A 3L1IA 2BTQA 2XAAA 4LWZA 3S2IA 3P4XA 4YPVA 2XXAB 1B0PA 2D8AA 3R44A 1L4YA 3TLCA 2H4ZA 2Z0MA 5AVZA 5JOQA 4C14A 4LVCA 3E5MA 1KR5A 2BELA 3H1GA 1LC0A 5I4CA 4ZFNA 3JD2A 4NAHA 3JRWA 5CAEA 1Q0SA 4N6NA 5C1IA 3U6BA 1TPZA 5HE8A 1RXSA 3A10A 3CRRA 3KPVA 3ZD8A 3MJEA 3I92A 4OQZA 4BEBA 5IEJA 4B6JA 3W9SA 1Y1LA 4N49A 2GB4A 5JLAA 2VXBA 4JVMA 1JHRA 2FLKA 4JGIA 4N5IX 4FHDA 1KRHA 4NR0A 4O33A 3IP3A 1YFKA 1EYZA 4MR9A 5EIWA 3MCAA 5FLKA 3K1AB 5CVTA 1EK6A 2XUFA 4MGYR 4X93A 4I5DA 1JAXA 3HR4A 3OIFA 3RTEA 5A2QA 3LUGA 3JVDA 3JWHA 1P2TA 3QVKA 2FXVA 1YUNA 2O50A 3KYDA 3I2JA 3O47A 3DW1X 3UOAB 1V1MA 3NHKA 4NTZA 5EP1A 1TGYA 3BJZA 5EOVA 1BDJA 2E5FA 3FI0A 1DAPA 4WX2B 1D2CA 3EEQA 4RVOA 3AV0B 2BFMA 3A31A 1W59A 2CXQA 4YGYA 4RJKA 2UVDA 4KEAA 3JATB 4GNRA 2G9QA 3L41A 2BEVA 1JQJC 3JASB 5KVSA 1UZNA 3UWMA 3TLXA 3Q2IA 4J0FA 4HDRA 5A5VA 1SCJA 1GTSA 3ND8A 4NFLA 2ZITA 5K3OA 4OFZA 3L02A 1IJBA 1YS1X 1V26A 1C2TA 2HA5A 1K2WA 1KORA 4V0KA 4F91B 3HDTA 2FWBA 4RHUA 4KZPA 2OM2A 5D3MA 3MWEB 3BL5A 4Q39A 1JMKC 3RKSA 1Q3TA 2OV2A 4N18A 2H92A 5I5EA 1IAVA 1VBKA 4YMTA 1UBNA 1OZHA 2ZJ2A 2GESA 3FXAA 1K5DA 4HQOA 2CSXA 1PR0A 2LNDA 2GVNA 3EEYA 3AFNA 1SCIA 4IXDA 2JGAA 2W2LA 5H81A 1LPNA 1PR5A 2WIBA 3DL7A 2IIBA 2F90A 2IH2A 1A27A 3C7TA 3Q87B 4MV1A 3KR9A 3QKRB 2HK7A 3DTNA 4QDUA 3JD4A 5D01A 4V1CA 1JFSA 1RZUA 5A9RA 5CA0F 1J25A 2XQKA 2KWIA 4N40A 4WJKB 2I6SA 3KUUA 1DQYA 5BQFA 2D1SA 1YH3A 3A4NA 1V5FA 2VTEA 3IQDB 1U3UA 1BO6A 4TRJA 4C6TB 1E9CA 4BVAA 4D4GA 4M1MA 2K7ZA 1STOA 2DPYA 3NFRA 2ZJ5A 4DILA 5JTUA 3H42B 3S2UA 5DBFA 5EJFA 1GWNA 2X9NA 2GD0A 2FOLA 4ER0A 4KVFA 5EG5A 1WZEA 2LIPA 4KAJA 4TTTS 4HAZA 5DNWA 1GV0A 1I8TA 4MV7A 4AB1A 1BKDR 3AKYA 3EQ9A 3ZW7A 5C4GB 3HDYA 4C6TA 2AEFA 2R84A 1CTQA 2Z98A 2WWWA 1TOAA 2TMKA 1RQNA 3ZWXA 4EO9A 4MTCA 3CT4A 1RM5A 5LWQA 2PD3A 1ECGA 4U63A 2Z8ZA 2B3DA 2ES4A 1XQ1A 2JZOA 4PZ0A 1CUBA 4R9VA 5KO2A 2JIOA 2F3RA 4HVCA 1BX3A 2JHPA 3BA6A 2OE2A 2M1ZA 1Z29A 2BE7A 3TX6A 2E87A 3ZE7A 4BXOA 1YFLA 3PI6A 3CWZA 1IG3A 2CUTA 3TTXA 4H6WA 1R0SA 1RLTA 4PYQA 1EGVB 3LWNA 4NBUA 2W4MA 3AY0A 1U7WA 3FF4A 2H5JA 2QT1A 4OBXA 1IL0A 3KAKA 4XOUA 1NRJB 1Q3KA 1ULSA 2JRCA 3F96A 5DO9A 1WUJS 5FPKA 2JAHA 3ESCA 2GEBA 4FD3A 2QYTA 1UK8A 1Y1TA 5ALXA 4AL4A 3WG9A 1BJTA 1NBHA 4MV3A 1EVLA 1HQCA 1N6OA 3VPHA 1UJNA 3BRCA 3ZY4A 1BMFA 3ZJ5A 5BVHA 4Q4LA 4IGAA 2O05A 2XHEA 1AXGA 2GO7A 4BMZA 4N39A 4E4YA 1AU9A 2JGRA 4U39A 4H15A 4GAEA 2BEUB 2O8CA 5ELMA 1SHZA 2I03A 3GGJA 4RTNA 1M76A 1N2IA 3EG9B 5J2TA 4XXHA 1W5FA 1R3UA 2QRUA 5HKLA 4AG3A 2QTHA 1R88A 1QP7A 2QX9A 4TZTA 2W6JA 1HPLA 4BMVA 4EABA 1XNRB 1X6VA 3AINA 4FUQA 3A6KA 2G1AA 1UEIA 3DTVA 5C7YA 3GLIE 3HXKA 5E1OA 1V8PA 2JKVA 3IMKA 3OLZA 3RBVA 1NR7A 2BD0A 1A5ZA 1CVIA 2DPMA 1JPUA 2LKDA 1TLTA 3EIEA 3L4JA 3K9WA 5C1DA 2OXTA 4BHTA 1YQDA 1Y1SA 4FDUA 5D7NA 1K88A 4FSXA 1CQJB 4LRSB 5HEKA 5JXGA 1HTTA 4HZUA 2VTBA 1KH3A 1XO1A 2CLKB 1AY0A 1PEDA 2ODEA 3OIGA 4JBXA 2XYHA 3BGIA 3HLTA 4CEJB 2JLQA 1Z0UA 1DB3A 2FFJA 2XBUA 4L15A 2PKWA 3LMKA 5DGCA 2Q62A 3CR7A 3D4BA 3HFGA 3O74A 4RK7A 4RL6A 4M38A 3VZRA 4UEJA 4UHKA 4A2PA 5CXSA 1QYDA 4UE6A 2BAGA 1A9TA 1LK7A 1WE2A 2V9CA 2Q5OA 3A0UA 4G5GA 1JLSA 1NVVQ 3I1YA 1NF9A 4YN3A 4D0SA 3ZD6A 4AY6A 2D0IA 1QG2A 3BIXA 3W2IA 4F5DA 3R6DA 3GPCA 2ZTUA 1QIGA 4H59A 3WB1A 3OT4A 4Q9DA 4QPZA 4IDCA 1KZ7B 1ZN9A 1RQ7A 3MUFA 3IB3A 4PG5A 3VX4A 1W7AA 1ODIA 5A06A 1XK6A 1V35A 3G8CA 4WXPA 3DB1A 1G7TA 1PUXA 2RGXA 2RGWA 5DX1A 5AUQA 5KX5F 4AX4A 3EVAA 3KQKA 3QX7A 4BLUA 3DGFC 3SVLA 1F2UB 2EIXA 3CW8X 4PQRA 5T57A 2HHAA 3V33A 2CCJA 2QN3A 1DI0A 1VHJA 3N2GA 4F45A 2RD2A 2YZ2A 3TUIC 1DAEA 1W49A 1HR0B 2FJUA 4UNRA 1KAMA 4B73A 1NBOA 1ZGBA 4ZCPA 1CF4A 2I87A 3T7IA 3CVXA 3ENNA 1K7EB 2ZYDA 3OIUA 1KKUA 4JSYA 1K5GA 1OR8A 3O3NB 3NTRA 1MRSA 1WUTA 3R6LA 4Q7JB 1YJ5A 2H7VA 3I6ZA 1G5QA 1WEKA 3B82A 4LIPD 1LF5A 4INAA 1ZD2P 3AU8A 4HFJA 1Q7GA 3Q12A 3PGMA 4FYYA 2SKEA 3GEBA 4NYIR 2H85A 4X6UA 2C2HA 1NDUA 4ZWNA 4A4DA 4DZTA 1NI4A 2B5OA 4JUIA 5KVVA 2QOEA 3FTCA 3AI2A 4YV7A 5CD1A 1JFFA 4MH0R 3RVDA 4YBRA 3HU2A 2QSUA 4K6HA 4CL8A 2DUUA 4LRTB 4ALLA 1RE1A 2PQMA 3W6UA 1ZWLA 2ZWOA 1J2TA 1QTIA 2VDVE 1OJLA 1YQQA 2AA3A 3K8OE 4URWR 3ZV3A 1B43A 4WXMA 5DTRA 3H18A 3QG5A 4IF6A 3KE9A 3WWCA 4U5XA 1L5HA 3V4ZA 5DGXA 1JFFB 1QWOA 2HIAA 2GBLA 1F5SA 2D62A 1DKPA 1G3MA 3E7XA 2C9DA 4P7KA 2VUTA 3QJYA 1GAXA 3MRSA 4RANA 1KMHB 3O93A 1FNCA 2PUCA 5GJCA 5KC8A 4BQOA 5K8CA 2ATCA 1IEVA 4WAUA 2ZRDA 4OQEA 1KY3A 1N6KA 3H9QA 1FFCA 4HB2A 3RW9A 2CFSA 2PCJA 4R81A 5C46F 4NCXA 5IF9A 3BTSA 2Q0SA 4HWSA 3VU3A 1G4UR 1RSZA 4LDAA 5C9ZA 3C4JA 4WUVA 3UMJA 3B7GA 2AOWA 4DJTA 4EX7A 1FJ2A 2FSVC 3ZVRA 2KBEA 5AKGA 5JCZA 1EB9A 3F90A 1XCPA 2I71A 1KO5A 4HG2A 1E2FA 3GIDA 1B6GA 4R9UC 2VHYA 3WQBA 4FX5A 4M0UA 4KDCA 1HNXB 1FMLA 4NENA 2Y68A 4FKMA 4M8IA 9GPBA 1UPAA 1V71A 1ZWKA 4W6ZA 2QXYA 1KDOA 2WYOA 3EQ8A 4WPGA 5D1HA 4TTQA 2EW2A 1WHTB 3A9CA 4ZVRA 3TOVA 1XU9A 4BUZA 2F4VB 4ADSG 4YONB 4Z4CA 5ESRA 3EPJA 1EFPB 2QGFA 4P3XA 4X1IA 3WKCA 1MU0A 3B7WA 1LBEA 1MO4A 1Y4UA 1HE4A 5HXAA 4MHOA 5GV8A 2C5AA 2IHBA 2P77A 2C2WA 3ZTYA 7REQA 2FPIB 1UUFA 4KIFA 1KC1A 3IMGA 1HL3A 4J4HA 4FGKA 4I50F 4ME6A 3G5TA 1E3LA 5L8VA 5AVQA 1XYVA 4YALA 4UBNA 3SEQA 4XFJA 1CJUC 1N8TA 1M1YA 1TF2A 4GQIA 1CB0A 2W2QA 4TS9A 4X1IB 1GILA 2WFZA 2ZXFA 3VU1A 3WL8A 3IODA 1NC1A 3F98A 4LYFA 4HFRA 1PQYA 4BQIA 1TUIA 1AJEA 4WKPA 3Q7EA 4Q7EA 4RZ3A 3K94A 4BGUA 1FNBA 1PR6A 2DC1A 4DR1B 1HT2E 1P2FA 2OCBA 2MSNA 1EB8A 2YWCA 1IXRC 4FFOA 4KDRA 2HLHA 1EX6A 2ODNA 3IP5A 3CT6A 4Q4HA 2C8LA 3INYA 4TT3D 4UKDA 5D5QA 5I5GA 4CFZA 4LF7B 2C9CA 1TA4A 3R3UA 4O0LA 4TUYA 4MV5A 4UDOA 4ZZ3A 2YIJA 1SCAA 2WWRA 2Y1XA 2QP4A 4AIIA 3BERA 4GRDA 3GAMA 4V0LA 5K3FA 4INJA 4D9EA 3SS7X 1JSZA 1EQ2A 1M34B 1T0UA 3OKPA 1X19A 4GXRA 2A84A 2ZYIA 4J03A 2VZ8A 2VHTA 2PZFA 1DRVA 3WLKX 4EPRA 3JWIA 2D74A 3CFYA 3D0RA 3EBLA 4JUAA 1RPAA 1NASA 2F00A 3JWJA 5C3MA 2QMOA 1ZVKA 4Q37A 1CDDA 1ML3A 3SG0A 4B17A 5B30A 2K87A 2O3QA 2YDXA 5JVDA 5F35A 5CA1B 2WJZB 3P19A 1QR2A 1Z08A 2HIGA 2O0JA 5ALYA 4JDPA 2JD2A 1V9LA 3GDGA 3OESA 1UQRA 1M66A 3ZHQA 2RONA 6ABPA 1N6HA 4LQLA 1QYIA 4E09A 2C4MA 3O8OB 2OBFA 4OJKA 1MB4A 1HORA 3E9MA 2O8NA 4J0GA 4YRFA 5IVPA 1MVLA 3I6QA 4E22A 4TQAA 1EA5A 2VDLB 3UGJA 3PLRA 1N0HA 1NXWA 1SFRA 4QGAA 3KEMA 4PG6A 2J31A 5FFFA 2B25A 5FYQA 3WADA 1XSEA 1WUHS 3ZGYA 3PDCA 2JBHA 4MWTA 1UDBA 5KCZA 3ZI0A 1XJWA 2I3GA 2J4DA 2F62A 1IXKA 1X7ZB 4G9GA 4ZT6A 2D4HA 3H3FA 3MRVA 4NMLA 4YBZA 1ZK2A 3QEKA 2IBSA 1KVTA 5HBGA 3ZV5A 1ZIPA 3A2LA 1J39A 1JEOA 3KJNA 4RX1A 4B87A 4DCTA 4PVDA 3AU9A 2JJ1A 3TX2A 3PPVA 3QZUA 1BS1A 1YCGA 2NPIA 3QPBA 4Z7JA 1RJ9A 1YJXA 1R9MA 2OBLA 3Q7QA 2GRJA 4HNAB 4UFNA 3RBXA 4ZOBA 3RWOA 1NLUA 2P4EA 3NIDB 1EFLA 5A0TA 1M1NB 1W88A 2XEDA 3HNPA 3LSTA 3PNLA 3DM9B 2L19A 3IULA 4EKYA 2WNIA 2NVWA 4DA9A 2DETA 2JIQA 2O2XA 4EY4A 3EIFA 5CNJA 1FIUA 2NVUB 4DIKA 2CJWB 1QO0D 2FN8A 5TMBA 1K0FA 3IESA 3PFKA 2V45A 3AHDA 3TECE 2HKIA 3CSDA 3IAM1 3VPFA 3IDQA 3ORRA 3FVVA 1YA8A 2AZTA 1P39A 3UUEA 1XVIA 4GSKA 4JJEA 4ECAA 4TN1A 2WHEA 3KOZA 4J2HA 4GVPA 4JLSA 3RYFB 1GUAA 1RCTE 1U7XA 1ZJ5A 4G84A 4MARA 3ZDRA 4P54A 4QD3A 1T2NA 3SKVA 2CUNA 2Q2WA 3T4EA 1XRMA 1UWKA 2ZSDA 3IMCA 1W36C 2RK6A 3IVXA 2XNHA 2H0AA 3MVEA 4I1RA 3SZLA 2AW5A 5CFNA 3SU8A 3THXB 4Z51A 4E3WA 3LT4A 3QE4A 1QANA 3UW3A 3MS7A 1RT9A 1KMIY 5CDFA 4NU6A 5L4LA 3T1NA 4RHEA 3DMNA 2H8KA 2QE7A 5DM1A 4EKNB 3GRRA 4FZ5A 4LOLA 4C9BA 5A1JA 3MD9A 4LVOA 2KI5A 3VGJA 2ZBEA 3T5AA 4FJ2A 1L5GB 4DDTA 2PWZA 4WVFA 5GONF 1P8AA 4L9RA 5KDLA 2FUKA 4F3YA 4DSZA 3MTJA 1MRNA 3C3AA 5JSYA 3T5TA 5HW0A 3KB1A 3F9IA 2GNAA 4IAOA 2QZ4A 5AM3A 3IOBA 2Y4NA 1CB7A 4JEUA 3KHSA 4XQEA 3ZR4B 1FYVA 3Q3EA 5IJ9A 3O9VA 2APJA 3D3JA 3FCYA 1XAGA 4IDOA 2OFFA 4CV1A 3VUFA 4YCCA 1WMFA 3HXQA 3Q2KA 3B9PA 2XB4A 3MXOA 3UFXB 4G0ZA 5EJ2A 4ZKEA 2Q5IA 3ET4A 3NV7A 4E0BA 4KGZA 1WCXA 1YBVA 4FFMA 1U7UA 3FIJA 2OXIA 5BUQA 5C8DA 4PX9A 1G7SA 2BI4A 3CRMA 4M53A 3UT5A 3CVUA 4QFMA 3M1YA 4PGHA 4EZIA 4E6PA 1Y81A 2NZUG 3OIWA 2ABWA 1FYFA 2NOAA 4ND2A 1IY0A 5BWOA 1F0PA 3AETA 4FYKA 5AM5A 1JQBA 1GDDA 1X1DA 1ZNXA 4I5GA 1F6DA 2Q0HA 3NEPX 1RI1A 2PUFA 1PGQA 2HAEA 2H1VA 3TJZA 1TD9A 3U3ZA 3ZHRA 1PR1A 4BCBA 1RI4A 1Z4KA 2O7VA 4BO2A 1CVLA 4Y2HA 4EKGA 1JEYB 4OPMA 3WB0A 1MX3A 5DV9A 4AWAA 1DBPA 4TT3A 4DWVA 5K8LA 1WP9A 1SN7A 4CI9A 5AJUA 1SO8A 3IT1A 1Q92A 1GZ5A 1ONOA 2WUDA 3P2OA 2JLAA 2QIPA 1COWA 2YXBA 4TWRA 4DLSA 4DV4B 4F3RA 5A4KA 2OAQ1 1N0IA 3X44A 4YRZA 4IIUA 4JLPA 4KZKA 1J0BA 1UBRS 3A1TA 4GDFA 4PTYA 3WKEA 3GFGA 3O75A 4QNNA 3DMYA 4CIAA 1GQFA 3LPDA 4FB5A 1EVEA 2YMQA 4UM7A 4UNIA 3TZHA 1I2MA 2VDKB 4H35A 3FLMA 4WJZA 5FBRB 4NYJR 1SUSA 4JFRA 4NCIA 4BVKA 1JLLB 2V9PA 3ZI4A 1E4VA 1AT1A 2PU5A 4MK4A 3RC3A 2N9UA 1ZINA 2PHZA 3L1JA 2QW1A 3RYHA 2W6PA 1QIMA 1I1NA 1S7CA 1FPQA 4B5LA 5HOEA 3EW7A 1W0JA 2BGUA 2H48A 3AG6A 2GHIA 3I05A 3K5IA 3GN2A 4KG7A 3RSLA 4QE3A 3WL4A 3HBNA 3STXA 3HM9A 1ZRSA 2WJWA 3EEIA 1I5EA 3GI1A 2WSYB 1ENPA 3OZ7A 1E1NA 1PBNA 2DWPA 3GY0A 4DXDA 3HO6A 3K5WA 5HF8A 3IDOA 4AZVA 4QVIA 4A0QA 3RU3A 4MKIA 1XALA 4Y1GA 1G8MA 1PQPA 1QOZA 4DQUA 3RS2A 4IIYA 4OHKA 1DIHA 1NX6A 2XOXA 3QBVA 2WAMA 4LA4A 4RA9A 2G4VA 3WBBA 4PW0A 3G0BA 1CRZA 1E9EA 1TVKB 2LR0A 1T9DA 2QRMA 3AOGA 3ZJ4A 4PZZA 5FULA 2HMWA 3PUXA 1O6CA 1Z68A 4J0HA 3D5TA 1XP5A 5GZ6A 4H60A 4ASUA 4MKXA 5JNTA 4OH7A 2G88A 4JC5A 1YZHA 3ZUGA 2PEZA 2B8EA 2FF7A 2HBRA 5AKEA 5T6BA 2BGNA 1BD4A 3CG0A 3DZHA 4IVRA 4RD6A 1Z8NA 2A88A 3QLTA 4CV3A 2WFMA 5HK8A 4JLBA 1UEJA 3ZH9B 4UAVA 1ETUA 5REQB 2JKZA 3FWPA 5BSEA 5DYGA 3PXEA 3LX8A 2NZYA 3ROEA 4RF2A 1L6IA 2D2XA 1NXQA 5JAIA 1MC5A 3I72A 1HMYA 3D02A 1W4CA 1CY2A 4EQ6A 3FCEA 2DQYA 5LPNA 3DZJA 2QVYX 1N6PA 3G2IA 4M0CA 3LRPA 2MCFA 3K1JA 3UPUA 2NNLD 2HU2A 1SRRA 2JLCA 2Y0DA 3KQNA 2J6BA 4EZEA 5C34B 1MJFA 3QELA 4HS9A 4TYNA 5JZVA 3OZUA 1E1CA 3CTMA 1EK0A 1Z83A 5DASA 3CF0A 4P7GA 5AKJA 4TL7A 2DPHA 1KI3A 4YRRA 5GWXA 3W34A 2O2CA 3JQ8B 3LNTA 5ALWA 3KVYA 5D6NA 5AW6A 5EQDA 2QVLA 5AXDA 2BMWA 4FIDA 3K31A 3ADCA 2DFDA 3B1VA 1DKNA 4AFNA 3N58A 4RGQA 5MN4A 4L6IA 3OQ6A 3GT3A 3I39X 3CF6R 4HTFA 3LC0A 1JEQB 4QOIA 2I7VA 3K32A 1F51E 4JKOA 4XVUA 1HQDA 2CXSA 4MW5A 5FUVA 2EJTA 1WHSB 1Y9DA 1QX3A 1UXIA 2AUTA 1HRDA 1U31A 3M4JA 1IB0A 3L0PA 5HP4A 3U09A 1N1DA 4U7FA 2BTEA 2HGSA 4G5OA 3W5JA 1F9AA 3VR5D 3M6VA 3MTGA 3F6CA 3C7CB 4MUJA 2J0EA 2C9OA 4KIUA 4U6NA 5GIPE 1UM9A 4U7JA 1GTRA 1TO6A 3S2SA 2QJWA 4JB2A 2YN4A 4N12A 1TQ2A 3GZTB 3JX9A 3CNBA 4YT8A 1WHSA 4Y2PA 4Z2AA 4D3FA 2FDCA 1CUDA 1U28A 1KWGA 3WYBA 2P0YA 4J76A 5ALOA 1YJBA 3O6VA 3TQTA 4ALKA 4PO1A 5JMOA 1QO7A 3FNFA 3CB2A 1RRGA 2POCA 2Z3VA 3O91A 3MOGA 3HPRA 5G4LA 5JZMA 1PT5A 2ZXUA 1VCHA 3TZBA 3HCCA 3WGJA 5K0SA 2UVPB 1KR2A 1P6XA 4IHJB 2J48A 4URXR 5J5CA 3L0BA 4KSCA 1X7HA 2JAUA 3ZH2A 4DCJA 5JS7A 1FRQA 4CG1A 3E48A 3OLVA 3Q0EA 3CURA 5F3RA 3AZQA 2AR9A 2ZYWX 4UXIA 5CJPA 1NQ5A 1GDHA 4HDAA 4I3GA 3SDZA 3OC0A 2Q9UA 2WM2A 3DDUA 1N92A 2QK4A 4Y9DA 4JI6B 3P2MA 3K70D 3X1YA 4ZZIA 2FMIA 3QPAA 1VE1A 5F76A 1S2LA 4P35A 1OBHA 1WRBA 4MO9A 1P61B 1XZKA 3IEVA 4PZ9A 4Y6SA 1TVMA 2C9MA 1NONA 2H54A 2PN1A 2XTAA 1A69A 3OP4A 1Y3HA 1E3MA 4F7DA 1D7OA 4MP8A 1K8QA 2WHPB 3GMTA 3KX2A 4PLGA 3T15A 1AD2A 3ZY2A 2N1MA 4ZIRA 3S3TA 3M81A 3AVQA 2R6ZA 2M1XA 3TD2A 2R9VA 3TZQA 1KDRA 5BP7A 5CJJA 4LZZA 4QUKA 3ZBPA 3ZJTA 5LP6B 4DKJA 3M83A 4X64B 4FWIB 3GFRA 4LE2A 1JGTA 3K2QA 1CEXA 4HVLA 5GV7A 2IJGX 4XTRA 3K0AA 3NANA 2AJBA 2YYAA 3GG9A 4HADA 1JV2B 2Q5FA 5KAPA 1GUFA 1RP7A 1AS0A 4BO0A 4EW2A 4AI6A 2F64A 3MK31 5B58C 4UNPA 3PWZA 2D8MA 3FOBA 1XA3A 2WM9B 3KUDA 3QLEA 3RV3A 1KJ8A 4D8XA 3KWLA 4ICIA 3KDPA 5FUXA 1VE6A 1RRKA 2IV2X 3OF5A 3REFA 5LQKA 1SOAA 2X9GA 3GVIA 2XZTA 3AP3A 4L9SA 4PTLA 2PSHA 4W63A 2O7QA 5IUKC 3VH4A 1RLOA 2V7GA 2X7HA 1D9ZA 2EWWA 1H69A 2ZWMA 3IBSA 2REXB 1XJ0A 3FUTA 4IX1A 4IYRA 4AS2A 3ZOZA 3M33A 1R6AA 4LDPA 4MKZA 3VZBA 4MI9A 3QE9Y 4Y30A 2I67A 1V6CA 2Z2KA 2JPDA 1UR5A 4A26A 5IZ4A 5C5EA 2ZS7A 1DTWB 1VMEA 4GOMD 4O5OA 13PKA 4IJVA 2OGUA 4C0XA 1EIWA 4AJ2A 3LLMA 5CB4B 1E1KA 2W93A 2PXHA 4A8JC 1K6EA 2ZZKA 4LKOA 3VPCA 1L9XA 3SE0A 4O1HA 4CIDA 3BDIA 5BMVB 4G0WA 3GJTA 1ZBQA 3I5XA 1CJCA 1P7WA 1UBKS 3EN0A 4FT4A 5AI6A 4ZAVA 3RG2A 3L18A 4UUMA 5FAKA 2JDID 1D5WA 4KQ9A 3ZZMA 1QQ6A 2IZ1A 3EC7A 3LPLA 4WCFB 3FFAA 2RHCA 3P2YA 1WU8A 1ZJYA 3B20A 2VJOA 5EZYA 4FLFA 1GG5A 4MQ5A 4GLJA 1A7UA 3ABOB 4RVUA 3S7TA 3ZBUA 4Z7OB 3O38A 2EFCB 5BMVA 2Q29A 1QCZA 3QVWA 1L5KA 3RRMA 4YCNA 3C5VA 1ZC3A 5IJAA 3A1DA 3ROKA 3RH0A 4AD8A 4CTMA 4FFVA 1U1DA 2AHOA 3ND5A 1E18A 5H7XA 3BX1A 4S2EA 3VOBA 2A58A 2Z6AA 1V41E 5COAA 4EPXA 3QSYA 1Y82A 4BKRA 5FTLA 1SA0A 2PZBA 1JSLA 1DAHA 1DX4A 5F64A 1TCVA 1OC4A 2FX5A 4D3YA 3R7LA 3P9NA 1ZI6A 2OO5C 4Y2SA 5BV0A 2I4OA 5K3CA 3GU3A 3A3PA 4QYMA 3ER8A 3EGVA 3LPAA 3AIIA 4GR5A 4WCFC 3PQFA 3AFMA 1BCSA 1GTJ1 4AQDA 2IZOA 3NHPA 1PCXA 3QPWA 5P21A 1RMYA 1CZUA 2ET6A 1H2RS 2VT6A 4EPYA 2EZTA 1BCRA 1BXGB 2BJWA 3SHQA 3DW3X 3PFNA 9LDTA 3T9AA 3N0VA 3LC1O 1UIRA 2RBGA 3NONA 4Q48A 3EVDA 2PMEA 1ZVJA 4KMSA 3U4QB 1WCYA 1E5DA 4X1YA 1Z2EA 4WJLA 5CITA 5KQPA 1K7YA 3DONA 2ZTVA 5FR2A 3W2FA 1EK1A 4QEZA 2HLDA 1TTQB 5T8KC 1XAJA 3OO0A 3HKEA 2A4MA 3EWAA 3IXLA 4LHZA 2DY1A 3WIEA 1TCUA 4OLAA 1WW8A 2NZ8A 2X23A 4TMTA 4E11A 3WFZA 1YS2X 2AYXA 3AM5A 3W6OA 3FNGA 4ZVNA 1D2RA 4HXFB 4CBVA 1FP4B 1ZMXA 4KWEA 1JKJB 5B36A 5DDIP 3OTWA 2CNWA 3G2JA 5CTAA 4C3OB 2LGJA 4Y2QA 3JAKA 1VYHA 2J9FA 3IQXA 1X80A 4HMPA 4F1KA 5AXCA 3IUSA 4MW4A 3RKUA 1G20E 4I4TA 3N8NA 4XH9B 5TGDA 2X5OA 2ZIFA 3CU5A 4W5TA 1RZRD 3BD8A 4X45A 3HKCB 1N6NA 1FZQA 1WZCA 1V4BA 2ZRIA 1KI6B 1UAYA 1Z62A 1VC2A 3AUTA 2HXSA 4B6QA 3Q9NA 3D7RA 2QPOA 4HSGA 4JL6A 2PUJA 2W71A 3NOXA 1J49A 4BXOB 3DSRA 4GI3A 3GC6A 2QGZA 5AWFC 4YPFA 4J91A 2CSUA 3KHUA 3L04A 1GFIA 1WNTA 2CEAA 4N3GA 2AZ4A 3IYLW 4I4TB 4R4JA 2EGGA 1L5RA 2FQXA 1U9IC 4DC9A 1SCQA 2YWDA 3Q9SA 4DLZA 1HNNA 3ZQ6A 1D5CA 1TL7C 4QLOA 1JHZA 1KO1A 2G70A 4DCOA 3THOA 2PSDA 3SVTA 4ENUA 3NJ8A 1ANKA 2FPSA 1RJGA 2IYPA 4ARVA 5C1BA 1D6NA 3T5DA 2A67A 4G24A 5CVVA 4EJ2A 4B9EA 3B5JA 3ZWVA 5DGHA 2UZ0A 1LY1A 3A6PC 4G23A 2ZIXA 4OHXA 4LJ4A 4J16A 5BSTA 1PIWA 4NOLA 5TB5A 4BP1A 2YRXA 1L5QA 1X70A 3TR5A 2Q3LA 3IP6A 1YVDA 1T1JA 4UU1A 3LXUX 1SKYB 3GH1A 4IMPA 2TYSB 2G08A 2VK2A 4R1OA 3GNLA 4NBVA 4D9GA 3G0CA 2X14A 4KFUA 5I47A 2QI9F 1VXOA 4RD2A 3RARA 1CHNA 4MCJA 3ZPXA 2E5WA 1IB6A 1OTHA 1FA9A 1PDVA 2VJYA 1GKLA 3SE7A 2DWUA 1X7YA 1A8QA 4NY1A 4QREA 4YRJA 5KVCA 4ZYTA 1H85A 1EVYA 3L93A 5JYDA 2GM5A 1UKCA 4OHRA 3KG2A 8LDHA 1Y5IA 4OQ4A 3BB4A 3WBKA 4GQAA 4PPYA 1P5FA 1I2CA 1VLHA 2VQ6A 2FFHA 1TGVA 3CRVA 1LH0A 2BEKA 2HRCA 3KQLA 4IZ6A 1X2EA 3ANYB 5F77A 1E1MA 4OB7A 2REQA 3OQIB 3HU5A 1F60A 5LQSA 4R01A 3SYLA 3MTEA 3OLQA 3ENVA 3FCUB 4DABA 5GIOE 4OQXA 1Q16A 3R0QA 5B1EA 5LNK6 4QOSA 1XA0A 5SYNA 2VUSA 3M3HA 4DMRA 1W35A 2FA9A 3K5PA 1WKCA 3VAYA 2X8JA 3G6WA 4JJ7A 4YUAA 4MAAA 1UMBB 3UJDA 1T6YA 1DT3A 1GQQA 4A10A 3OWOA 3R2JA 3ESYA 3FMFA 4G63A 4M89A 3FPHA 3EXFA 1PL7A 1LV8A 2JLSA 2JFYA 3LKBA 5EL0A 5H3CA 4B79A 3FPGA 1U1IA 4H0CA 4ZAXA 3ZWYA 3ZOKA 4KR9A 5KNLA 2FW8A 2VZEA 3ZLTA 4NBKA 2ZSIA 2BGKA 1DDGA 3HYSA 3VOAA 2YJ3A 2GI4A 1BFDA 1E3IA 2ZSUA 3WIVA 3K9HA 4JCOA 4H7KA 4N0QA 4C1BA 1RHUA 2V7TA 2OMKA 2TMGA 3G8BA 5ESDA 2R1VB 3WZ2A 4D80A 4Q4DA 4BLQA 4ENSA 4HWTA 4D43A 1A4IA 5BR7A 4QBHA 4FP9A 1BVRA 3DFZA 1MAWA 3I2KA 4R16A 4BEWA 2Q28A 3E6AA 4L4RA 5M3BA 4OK3A 5TQ0B 2R4QA 4GYJA 2XGJA 4NOKA 3RADC 1LVUA 2W8BA 1OH5A 3BWVA 1K4KA 1M0WA 3JQRA 4P38A 1USIA 3BGDA 4FCVA 5JO9A 4PWZA 2XY4A 3DKVA 1V3TA 3AOEA 1YZYA 4YRTA 4AMGA 4BNXA 1EIZA 2IA5A 4OAQA 5KTTA 2RI0A 4M9ZA 1R6TA 1UC5B 2GCIA 2YJNA 3L8DA 3OM9A 4G85A 5IXYA 4JQOA 4X6YA 4QQKA 4RACA 3CH7A 2IZ7A 2FEMA 3O92A 1PUJA 1XDWA 3UWSA 4BJ5A 5JT1A 4X3OA 4ZVVA 2B5VA 3EWSA 3KTAA 5HJEA 3FHOA 1CV2A 3WQHA 1NOIA 1EAYA 4FWTA 3ZLBA 5JPCA 1Y1RA 1P62B 2W6JD 1H1DA 4C29A 2XQGA 2VHEA 2AS0A 3LGAA 4BNUA 1VRVA 2XIQA 2YXPX 5J43A 2O5VA 1UKZA 4JZKA 5JIBA 1Z2DA 4IJMA 4EUKA 1N6RA 3I9NA 5FLEX 5C81A 4N48A 1DCMA 1ZXBA 1OT3A 2OQIA 3PA8A 1JXOA 3FRHA 5D2CA 1MRZA 3UHFA 5IK2D 4DIUA 3EPLA 3D3QA 5JJIA 5CGQB 5KQMA 3P0FA 4YJ2A 3GEEA 3PUIA 5HGXA 1Y6JA 3P2JA 4DUGA 2GHRA 2LPMA 4JBNA 1QB7A 1R0CA 2YQZA 3I1IA 1S4QA 1DRWA 2FF5A 5FJJA 4C4RA 3RFVA 3ITKA 4IH9A 1KHTA 4YR9A 3EDMA 1Q1EA 4LFAB 1MAUA 3CGGA 4TTIA 2P3OA 1FTWA 3M34A 1Z2AA 2AKEA 4EJ0A 2BI7A 1E9SA 4NONA 3BWEA 4QU5A 4MR9B 3EVTA 4KQ1A 2PYZA 1C2YA 4RSMA 3VZSA 4MDHA 5EEHA 5HF9A 5LD2B 2O4UX 2UKDA 2DU8A 2B34A 3FPSA 4UW9A 4NZOA 2HLPA 3DG9A 3FBGA 3CISA 3NHSA 3TSOA 1XCMA 1NUSA 5CJ2A 3CRNA 3LW8A 3IVMA 2BCJQ 5ALRA 5C4IA 1E69A 4XYGA 3KR1A 4F4CA 3AO0B 1J0XO 4EI8A 3U1TA 1R3DA 3ZCUA 5JXWA 5L9AA 2H17A 5B6JA 3S81A 4OEHA 4KR6A 2VNSA 2FKAA 5AK0A 1Z0DA 5CT8A 1QGUA 1KEWA 2IHZA 4CTKA 1I5RA 2PJZA 2O7NA 1GKUB 3P4UA 2J0QA 3GDFA 1Z25A 1YVEI 3UCEA 1W9HA 4HC4A 3P4YA 2WJYA 4KSYA 5SV2A 2H4JA 5LYJA 1Q50A 2XDQA 4K9DA 1HYGA 1A9RA 1ZSNA 3FMGA 5CVUA 3T5MA 3HU1A 2PLRA 3GLSA 4Z4IA 5B6PA 3V34A 4TKVB 3NVKI 1BVUA 4PNHA 1OPXA 1XVVA 3MRTA 4CMEC 2B4YA 4BASA 1CR6A 1EXVA 4U2CA 2HUNA 4RDCA 4WEQA 2CYBA 3V8EA 1HY3A 3IIEA 1PNOA 3E3LA 3GPBA 2WJPA 3QNUA 4XVQA 3V1UA 3MWEA 4MWOA 4Q5IA 3PR3A 4CG2A 5JSFA 3HBFA 3GMSA 4H7JA 1PQWA 2RHOA 4UQOA 5J2TF 4CM1A 3FFWA 4IWXA 5K0FA 3EZ6A 1MHTA 3KV1A 3LCVB 1IJKA 1G8YA 1C0EA 3NRJA 5KQGA 2C7GA 3EZFA 1KRWA 4FZ3A 2SCUB 4OVKA 1QHGA 3GDHA 2C99A 3C2QA 4BC1A 2X2FA 2CV0A 1J99A 3I76A 1RBZA 4P4GA 4CV2A 4EB3A 3THWB 1A04A 4LMPA 3RYIA 1THTA 2VHUA 4P83A 4W7HA 1HOXA 3EK2A 4CQMA 1F3OA 2CBZA 2GFHA 1FSSA 3JARA 4ESEA 4B6EA 5B3KA 5AM0A 2EZUA 2GGSA 5LBUA 3J81A 1T9CA 4KYUA 2AFRA 4LHSA 1AA9A 1U8FO 1WXEA 4GWLA 3SJZA 1NVXQ 4NYMQ 1RZVA 3M9LA 3ACDA 3E5NA 3QUBA 1S8AA 3R5KA 5JJBA 1GTVA 3BFPA 3CO0S 5L3ZA 6LDHA 3HVHA 3GD7A 4ZYYA 5LQNA 5G02A 3PQ3A 4MYDA 3HV0A 5JBNA 1I9GA 2BE9A 4C2UA 2D59A 4W1PA 5JCOC 1K9VF 4W82A 4V24A 5KMGA 3JY6A 1KQFA 2D13A 2DTXA 3WK6A 4LXIA 1CJMA 2G80A 2ISSD 3KJQA 4HHEA 1VE3A 4MQUA 3G89A 4MLCA 4US2R 5G0VA 1K3TA 4MWZA 3SPXA 1WDWB 4JSTA 8MHTA 1Y7IA 1J56A 5LU8A 3LVQE 2YIVX 3JTMA 1U8AA 5AR1A 3R24A 7ADHA 1FXUA 5K4HA 2WB4A 1K86A 3PJDA 4CRWB 2BKXA 2ANCA 1HFWA 1MOSA 2EFHB 4D02A 4DVJA 3TO5A 4R7TA 4JBHA 4OOFA 3QHQA 5FBWB 1E59A 3SAJA 4H1HA 2VJAA 4CLRB 4PSVA 3L6BA 2J7PD 3IBGA 3OPYI 4HLDA 5AJYA 4B6PA 2PRIA 4IM7A 1M6HA 1RWKA 4ZICA 1FSZA 2UYQA 1LNZA 1L6RA 2VDRB 4IQ8A 4PG7A 2F4NA 1NQOA 3K9CA 1DKMA 1IQUA 2VTKA 3O8QB 4HDNA 1AKEA 1B0UA 1AXRA 2FHSA 2VHVA 3X1JA 3JD1A 4CKXA 4IZOA 5DOVA 2WU3A 1Z6XA 4S24A 2QW0X 1BMQA 4K3UA 2B2NA 2HA3A 1P8JA 4IQFA 2P2DA 3SN6A 2AI2A 2CKMA 3DNMA 3PK0A 4UFPA 1VSTA 4ECEA 1GLVA 1N5RA 2W2TA 1QVRA 1DCFA 2IODA 2ZJAA 3WWPA 1UXHA 3OBIA 2IH5A 3EJ6A 1GPAA 4PYMA 5J2TB 2F48A 1H0SA 3P9PA 4PLVA 3C6YA 1RYBA 3DAYA 3HYRA 1JU3A 3M6LA 4HR7A 1JDJA 3B51X 3IOCA 4DLWA 3S8YA 3LTNC 2PSFA 4X95A 1Y89A 1QRDA 4IIXA 1NBAA 2OFWA 2B2XA 3NT4A 2NU8B 3UGQA 2AF4C 5TEVA 5J47A 1BEUB 2OUKA 1NJ2A 2P69A 2YN2A 3NT2A 4HUJA 1SC4A 4TM7A 3TPCA 5SY9A 3F0TA 3EDYA 3C6XA 4C21A 2FZ5A 1CUWA 2D5BA 2J5XA 2NZXA 3EFHA 2ZSAA 1QFXA 3IV6A 3R4CA 4GXTA 4IBOA 2VAVA 3C3PA 5A02A 1PLJA 5THXA 3WLJA 3L2OB 4KXFB 7MHTA 1VJ1A 4XGNA 3CYFA 1U8YA 2P9TA 3TOXA 3GRVA 2F8SA 5EYPA 5I48A 1M67A 1U7ZA 2WA1A 3ITEA 4BIMA 3BMCB 4C5CA 4D5EA 5G41A 4DBVO 2GZMA 4C3ZA 3GLUA 1ZSYA 4BO3A 2NVOA 3PV0A 4ZU1X 5IAEA 1S6YA 1YFJA 2P4SA 3K09A 3GYGA 4DLTA 4AAYA 4IZHA 2OWDA 1P4RA 1Q6ZA 3AXTA 3AILA 3OX2A 1JHPA 2MMGA 4MRSA 4PHFA 4Q7MB 1T25A 2OGZA 4B3GA 1W25A 1SIOA 3JZDA 3AL0C 5IFLA 4OOEA 3UWPA 2ZM6B 1GEGA 1SEVA 4D8YA 2HTEA 2IEBA 2PO5A 1M5UA 4HWGA 5K9ZA 1SZDA 3AEKA 4HAWA 3S2ZA 3EAFA 3PZBA 4TKZA 2H9AA 2RK3A 3CM0A 3F6PA 4NBTA 2VJCA 4R6XA 4KTTE 1XZCA 3EGWA 3MWKA 5A5DA 4WFQA 2XGOA 1ZM7A 1U3TA 2JB9A 3HRIA 3SWWA 4YMGA 5FR1A 3PFIA 1XG5A 2HUPA 3HCAA 3KKLA 1BG6A 2YHIB 3L7LA 4O2RA 3AVPA 2EFYA 2F1KA 2HK9A 1RXWA 4U7GA 3ID6C 3WDSA 3L79A 2RE8A 1P18A 1H42A 4GP6A 4NE2A 2SECE 1DNPA 1KVRA 1N2SA 1S1MA 3HCEA 4F2WA 1GZ6A 5KTOA 1G98A 1RAHA 4OGLA 4TV8F 5DCWA 3NHZA 3OJWA 3TL6A 4LI0A 3CPHA 1XXLA 2VUUA 3KQHA 3SYNA 2RG7A 2DG2A 4ENWA 1GG9A 2R5WA 2WMYA 1PR9A 3WIOA 4CT5A 4LNHA 3CLKA 3LWDA 2EEPA 3MUNA 1MZPA 1FFXA 4B09A 3X2FA 5ITVA 5EGSA 4EI9A 3G6KA 4C0AC 4XCQA 5B2EA 1FP2A 2JLRA 4ER7A 1J97A 3DPUA 1G7RA 4RAQA 1W9MA 3C15C 4EUSA 3A4VA 5KHAA 1UAAA 2HNKA 1NHWA 2Y3IA 4Q6WA 1Z74A 5BNFA 4NHEA 3ZDQA 1P1KA 4ARAA 1XEAA 4BN5A 1HA3A 3MSCA 3OUZA 4W5JA 4NZPA 1ZHFA 4DRZA 2QPLA 3N2ZB 2ZDGA 2ZVPX 3FN4A 3O8CA 1HX7A 3VR4H 3EQZA 3GWGA 3UAGA 3SOZA 4V0ME 2ZT7A 5TT1A 2EQAA 3QYPA 2F8MA 4U2EA 5FNVB 2XKBA 4O4HF 5YASA 3OQMA 1T3ZA 1A1VA 1ZL0A 1A72A 3M6FA 1DJNA 1OVGA 1T5SA 2RJOA 2WAYA 3UM9A 2IEDA 2HY7A 4YJKA 2CDAA 1YASA 5KJFA 4PSCA 3U3RA 5AQEA 4F04A 4RPKA 3ACBA 4JLMA 4GKVA 4II3A 2H4FA 4M9XA 4BBZA 5BSUA 5JECA 1IN6A 1U99A 5F3DA 3RBAA 3RFFA 3AHCA 3GX1A 4Q12A 3WGQA 2ZLBA 3ZDXB 2Y1LA 1MFZA 2A9PA 4II2A 1GQSA 2PV0A 2H11A 1ISPA 4V0NA 1D2AA 4IDFA 4OQPA 3ET5A 5KHLB 2CL0X 1C3OB 1OUMA 3ZWNA 2XCQA 3QMVA 1P45A 3B1ZA 3KETA 4NQZA 3T95A 4GM4A 2QVGA 1FVXA 1T4GA 4DT1B 4FSDA 2P9GA 1JPVA 1G1AA 2H1HA 2VJMB 3EHDA 3SR3A 3U7JA 1JTVA 4IOJA 1EP3B 1T5DX 2VJKA 4NHOA 5ALGA 3O90A 4ND3A 5ALZA 3R7BA 3V2UA 4BNIA 4C05A 3C98A 2YW9A 2AR0A 4EG5A 4CIWA 2BSQA 1IHUA 2QN6A 2BEWB 1C3OA 1GZSA 3Q15C 1GCOA 3OIYA 3IURA 3WHKA 3U7FB 1YJQA 3LYAA 2QTWB 1AZLA 3GN1A 4N0EA 2AQIA 3O8NA 1DBRA 4QIHA 2ZUUA 3HVIA 1ZBDA 2C5BA 2RIRA 4QGSA 2OV6A 4PF1A 3E3NA 3IQWA 1Q2UA 4LOHA 2JS7A 1AURA 2J0VA 2Q46A 1F9EA 4NMHA 4UE3S 4BP3A 2LCIA 3H5IA 5FWYA 3AERB 3HDVA 5HRAA 1L4KA 1QCDA 2EP5A 5FAXA 1EGQA 1QAMA 3WLTA 2AXQA 3ODPA 1IM8A 1GQ2A 4IINA 4BWYA 5HWSA 1ZJWA 4EENA 2VHWA 3IUEA 1JIQA 4L4SA 3N8KA 3ZZ1A 1D04A 2M6SA 1KQNA 4PNZA 4CKWA 2FEPA 1XTSA 2AI1A 3F7MA 4G89A 3AW9A 4AJEA 1PSZA 3GUUA 1G7CA 1A9XA 1TMYA 3LO8A 1TF5A 1FYXA 4G01B 2B21A 3AB3A 4F4FA 1KQPA 1W2HA 4NMXB 4EGCB 1O8BA 4LRWA 5GONA 3H0EA 3LKZA 4RULA 2I78A 1KOFA 4I4NA 2OHOA 1CC1S 4NS4A 4O4HB 4U3JA 1HDGO 4AECA 2LDBA 1P9RA 3PX7A 3FYTA 4RD4A 3GCWA 2MSWA 4O4JB 3SYKA 1U0LA 5HKKA 3B8HA 5THKA 3U16A 3H8WA 2QP9X 3N9IA 4H77A 4A0FA 1KZYC 2L18A 1E32A 2D5CA 3GGDA 4KV9A 1CP2A 3MCZA 5TNXA 1Y8QB 4WLEA 3ZZTA 4C20A 4IF4A 1ZMOA 2HLDD 3KYCB 3C48A 1DAGA 1TM7E 4MWGA 2OWEA 1QDEA 3QOYA 3UK6A 5KYWB 1KKLA 1GR1A 2VUHB 1QZZA 3MJTA 2OGSA 4FE3A 4HTFB 2F7SA 1ZUWA 3SC3A 2WJHA 2P3SA 2QRLA 2JL1A 1TYCA 3RVBA 4DV5B 3BSFA 1VPDA 1DUIA 4EDHA 2P9YA 1GP2A 1I3LA 4OSPA 5LUAA 3QUCA 1NBIA 4YH1A 5ALNA 4P8RA 3PQ5A 4DUGD 2COEA 4ZMRA 3EIWA 1NY5A 1TYAE 3OZCA 1WW3A 4NULA 4LFCB 1UDXA 5T5QA 4KR0A 3HXMA 3AHJA 3Q7SA 1K6IA 2QSYA 5IDVA 1KBZA 1TM5E 2XQIA 3AJ9A 3BB3A 3PWKA 4ZOLF 3TLYA 4LX0A 4IV5A 2V3CC 1UBSB 2CHUA 4NNPA 4IG4A 1E6KA 1VKOA 3A28A 3WDKA 5K03A 2ZATA 5BR4A 4YROA 3A7EA 1Y9EA 2XMQA 5TT0A 2AMVA 2YQ4A 1EUZA 3OU6A 5KQSA 1PVOA 2PGDA 3F3MA 1CY8A 2REQB 3OQIA 4HNAA 4KQEA 2ZAGA 4R2IA 5FOWA 1QU2A 4ON9A 1AK1A 1FMCA 4JUCA 1J09A 1RQ2A 1Z0KA 5FUQA 1RPNA 3N3BC 3W5IA 4TLAA 5EIFA 2IEIA 4DLPA 5ERXA 4WSOA 4BO7A 2NVUA 3GRYA 2CLIB 4PIPA 1IBKB 4KXXA 1KOLA 4FHGA 4KXVA 5IARA 2W2KB 3LUAA 3N07A 5F1YA 2EKQA 1V7PC 3EISA 4PO9A 4EVIA 5CFPA 3ZBQA 2WVAA 3U7GA 4BB0A 3CR8A 3B2EA 4ML3A 5FIUA 1FUEA 2IUYA 2CFCA 2EGUA 2X0EA 1T2AA 5JS2A 2H59A 1GRRA 4BL5A 2HXYA 4LI3X 1H6AA 4TKMA 3TKAA 4AJNA 2DWOA 1LFAA 3NDPA 2PR7A 5HJ7A 2WPDD 4W5QA 3SBEA 5CEEA 3ZX4A 5TR9A 1ADBA 1KH2A 2B20A 2XWPA 2YICA 3VR3D 1XTTA 2ID8A 2O1XA 2O07A 2ATVA 4M8SA 5BOVA 3PC6A 3UXYA 4RTJA 2ZUBA 3C97A 3ZVLA 3KK0A 3R5SA 3W8NA 1HDOA 3BD6A 2Q3FA 1GA1A 4TWJA 5J3JA 2C0PA 3GYBA 1UKVY 1HV8A 4MVJE 1J24A 2JFPA 1V25A 2F8TA 1C81A 2ZJ1A 1RXVA 4B44A 4PPGA 5IVDA 4QRDA 1E2HA 2H2DA 3ZK7A 4DQXA 3BXGA 1M74A 3V55A 3RHFA 2VQDA 3WMFA 3GLHB 2Z4SA 1WXXA 1ZISA 2ZIEA 5B2FA 1LLQA 3HRHA 1JHXA 3TM4A 2BMVA 3URKA 3R0IA 3WO1A 1EEHA 1WY5A 2X8WA 2Y2UA 3JQFC 4NEHB 4UXHA 1SVLA 1ZQ1A 4OKIA 4UPVA 2I2CA 4J75A 2VRNA 2GDJA 1J2YA 5HZHA 2XTZA 3BKXA 2BR5A 3E9DA 2I7CA 5IH3A 1WB5A 1JZQA 4BE4A 3IEMA 2PMCA 1F0NA 1TM4E 3DT9A 3CCBA 4JLOA 1QF6A 1JJIA 4HV4A 4LK2A 2LRHA 4GPIB 5EQJB 1ZEJA 2B0JA 3VR2A 2O3TA 1SVOA 2XECA 1CUHA 1B1AA 5EHZA 1X9GA 3UJ8A 1FMJA 3CZPA 5M04A 5DBOA 1V45E 2I8LA 1KNXA 3QKTA 5C8ZA 4YFYA 3LG2A 4YP7A 3UAWA 3M2TA 4QJIA 2PRKA 1MH1A 1U80A 3F6BX 3NYWA 1G18A 3VR6D 2D5AA 3TTSA 5JSZA 1FE8A 1N2JA 5DHTA 3S5UA 4ND8B 1EJ6A 2F43B 3AYXB 3O7MA 3QYJA 3TWOA 3OPNA 3W3ZB 5AQ1A 5CDYA 1QU3A 4TTSA 3K9LA 5SZKB 3SC6A 1PZMA 2WFLB 4B74A 4AG5A 4UCXA 3FBWA 1GTMA 1OLUA 2Z8YA 5KJ1A 1ZJ4A 3LXXA 3HY6A 2HEGA 5DN6A 4BDTA 2Q3MA 3MN1A 4CW7A 1BTOA 2BGWA 1PNTA 4F3TA 4IRUB 2BLNA 1ZKMA 3TKYA 4US0R 2X0NA 1CRQA 3RSOA 1M75A 1NLFA 4TSFA 4LOKA 2OV4A 1R18A 3PNKA 4AURA 3AI3A 1UJ5A 1RLUA 3A2NA 2MYTA 4KAAA 4WT7A 4KL8S 3QHPA 5DNEA 1AQYA 2VH2A 1LUAA 4P36A 4OMCA 5DNUA 1RBMA 1XX6A 4W9NC 4OCZA 1NQTA 2O4CA 1E3TA 1L8XA 5K4AA 1BMFD 2C8VA 3I3SR 4YRDA 2XDQB 4YRPA 2XNJA 2WUEA 3JRNA 1A7JA 4UQPA 5C8YB 1DBQA 4K9MA 4AC9A 5LVAA 2XLBA 1PK7A 1UKEA 1XT6A 1JDBC 3IBCA 1ZU5A 2NSJA 3QK7A 3FZEA 2Q3BA 4IHJF 4DDHA 1TYEB 1UBLS 4Q00A 4HNQA 3H4MA 3SC2A 3UCXA 1QVVA 1GZHB 1CCWA 4ZT3A 4ROSA 1KEUA 1ISRA 3QMMA 4ID9A 4TRMA 2VF2A 5IN5A 5DHUA 1F4VA 1DINA 2VVTA 4B8ZA 1X7WA 1H2HA 1ORIA 2X5XA 4IQ4A 3A4LA 4IP0A 4ER3A 3TDKA 1MOQA 1XTUA 1RZ3A 4UU0A 3WLMA 3ZY6A 1Z6ZA 1KU0A 4LK3A 4O2LA 3K71B 1RWMA 4F3NA 1ZR4A 1PZGA 1CUFA 4OQNA 1NGSA 3HN2A 3NHBA 3KPWA 3NH9A 4IKOA 1OW3B 4P4TA 2DERA 3RK4A 1Q1BA 5K4GA 1DC4A 1Z13A 3EW9A 3KXPA 4H17A 3CZQA 3VYTB 2BR3A 5BSFA 1G2QA 2ZB2A 2C0CA 4NBRA 1E2PA 1N1MA 5DGIA 3RK1A 5C8VA 8ADHA 3ZGZA 4WL0A 1DJLA 1AQLA 3U19A 2HJWA 4B46A 1YGYA 2JJ8A 1JFLA 2IV7A 2RGCA 4J0EA 5FV4A 2QM8A 1ESDA 3RT9A 1SG9A 2MHCA 1TM2A 1VJTA 3KD3A 2ZROA 1T0HB 3LXMA 3O8OA 4OHUA 3ZU4A 4JQCA 2ODQA 1OHHA 1QYVA 2Q6TA 1E63A 4H7HA 4MIOA 3IHKA 1JZTA 3DFIA 3NBKA 1UMCA 3ICVA 2IEAA 4V03A 5EUQB 3ZHCA 1BOOA 1GQOA 3HA5A 2OC9A 2ZOSA 4JB0A 4PRKA 5FTKA 3T0IA 1AA6A 1VXRA 2QMZA 3IDSA 2R00C 4KXWA 4PS0A 4QDTA 5IBQA 1CIJA 4OGKA 4QNRA 1PTJA 2OKCA 2ZT6A 2AXEA 2XKAA 3UJNA 3K6RA 4DIOA 1O08A 2M6RA 3GLQA 1ZRHA 4BNZA 2ACVA 2WR8A 3CSUA 1P2DA 5KDDA 2BBSA 3QQ5A 4PLCA 3C8UA 1J42A 4JGGA 3L7OA 1ZOOA 3M8KA 1O54A 4OUDA 2WM8A 4C4TA 5JYCA 4EX6A 1AZWA 1QV9A 2YUTA 2WPDA 4FU0A 2J59A 1ZPDA 4MQEB 4DAEA 4N6GA 4Y1EA 1K63A 2P4HX 5EQTA 5IJ0A 5EQFA 2ZE8A 4Q4JB 2QN9A 3VVBA 5JZ9A 1V96A 3PNSA 1I36A 1NDHA 1OXVA 2B37A 4RLHA 2EYUA 4WE3A 3RVQA 1W36D 1QIIA 3MWYW 3EFOA 3L8YA 1S2OA 5FPHA 4YQEA 2C4NA 2DEUA 1XEXB 4JOSA 1U2DC 1XDGA 2H00A 3B1XA 4P2BA 4XI9A 4YI5A 3SEZA 3WA6A 1VI6A 1ADJA 5FNVF 1QFJA 3DBRA 1Q0HA 5DM2A 4WN9A 3KSAC 3TIVA 2PQ0A 1TKCA 2M6KA 4MPRA 4DMLA 1KAGA 2VI5A 1PT8A 1GITA 1MAHA 1KVUA 2JEOA 2F1OA 4IWNA 3LLCA 2ZAYA 1Z6PA 3OSUA 4B4OA 1CZHA 2O0MA 1QUFA 2YVAA 3A6EA 1AQUA 3VHXA 3F71A 3EUFA 5LOVF 3I5YA 5AT1A 1KAHA 3NEJA 1C1DB 3TB6A 5KHOC 3WJAA 3ZE9A 1WXWA 2WJ4A 4JLDA 5IJXA 4MCHA 3RNLA 1EFHA 1TDJA 1VI5A 2VNKA 1EINA 2ZR8A 1LBHA 3R0VA 1XZPA 1I13A 3MWFA 3H0CA 3WRYC 3KB2A 3RRFA 1XU4A 3QEJA 3VHXB 2CUZA 1VYTA 3D7MA 2FQWA 2P7IA 2XJ4A 5FQNA 1F2TB 4EHAA 3AR2A 4KJXA 4L51A 4KR3A 4G0YA 2HB6A 1IDOA 2VJQA 1VJ5A 3GXOA 4HI0E 1Z0AA 5CDGA 4ZGGA 2JI4A 2ZKIA 5F7ZA 3EE6A 5CIYA 1B8NA 1U2GC 2EARA 2JIDA 1DP4A 2Y76A 1G21E 4BNHA 4LJKA 2ID7A 5JROA 4GC5A 1YVPA 3O7WA 1UBOS 2OECA 5E95A 4D81A 3TQCA 3QU5A 1F4LA 4U7WA 3SM3A 5K0EA 2PGNA 4ARSA 4RFVA 3QWAA 2V7PA 4KRGA 2B9VA 3PC4A 5FUWA 3PDUA 4KTVE 1E2DA 2H16A 3H1PA 3I5UA 1Z37A 3LX6A 3U37A 5CNMA 2X22A 4LJ7A 4IDPA 1U7PA 2XQVA 4WNYA 4DBLC 3CEJA 4XX0A 4XUEA 5DPMA 3DULA 4LDJA 3C3JA 4Y98A 4HAIA 2J32A 3AIOA 3FYHA 4AP6A 4Z5XA 3H65A 4YAGA 1NRWA 5JASA 1NUHA 4U9HS 5FWNA 1XTPA 1IN8A 5ILGA 1DFHA 3LQKA 3AETB 3UANA 4BMSA 4CLOA 3A4TA 1P4JA 4HPXB 4PYKA 4WY8A 5G0UA 1A4UA 2WF6A 1IY2A 2XGGA 3K35A 3S68A 1T34A 1U8UA 1VHQA 4DPLA 1E2BA 1P9OA 3CRW1 5LQDA 3ZY5A 2KB0A 3DMDA 5CBPB 4KR2A 2CN1A 3VAAA 1MXHA 3CXRA 3NTUA 3BA1A 3JTEA 1GCUA 2RCYA 3D7LA 4KYVA 4YI3A 2A3RA 2BHLA 2P41A 2I7DA 2VR1A 1NXSA 2WP8J 2XE6A 1NURA 2ZJYA 2YXLA 3K0CA 4KO8A 5FPQA 3TJMA 3WWOA 4B45A 1SIBE 2EOAA 1ZVVA 4J0QA 4OBEA 2QYSA 4A82A 1TADA 1NULA 3GFTA 4I4TF 3S8MA 5HBRA 1WLSA 2C7QA 1R2QA 1Q11A 4YUVA 1IN1A 4RMIA 4NFYA 4ENRA 5INTA 3GVPA 4PN3A 2O8DB 4RV5A 4XDGA 4W5RA 1WTCA 2PL1A 1RC8A 1ILWA 1AG9A 1R6DA 3NUGA 1QRTA 3N8IA 3ZK9A 1Y8RB 5E4FA 5J63A 3ANNA 3CH5A 4D3SA 1QH1B 4FXPA 1E99A 4IRMA 4A23A 3BZWA 1SXJC 1G21A 2XR1A 5ALTA 2ODTX 2WJJA 3W6NA 4MPDA 5U1PA 3DXYA 3P1JA 3DZFA 1HG1A 3EAGA 4CN8A 2NV0A 3EVFA 1ISFA 1MJHA 2MSEB 3LM8A 4QJ5A 3OP1A 2Q6VA 2EU8A 3HKDA 4BNVA 1URPA 1WL8A 4WCVA 3OF2A 4G3XA 5E4TA 1NW7A 3M1LA 2BEVB 1A7AA 3Q7IA 4F3CA 3QVGB 4MUYA 1U8EA 4G9BA 4LF4B 5JI3E 2GN9A 2XMPA 4B4VA 2OHXA 4U2KA 4RWEA 1GLGA 4KWCA 3ZKWA 4Q21A 1R10A 4B40A 3MHPA 1QK3A 2W98A 3MAGA 3RNOA 2PM8A 3T35A 4U5QA 2DF8A 4QXMA 5D87A 3EVEA 3UKDA 4D74A 4MQLA 1VOTA 4BBJA 4DV3B 1NATA 1JIVA 3GQBA 4I5IA 1Y7PA 3X0DA 2OHVA 1H8EA 3W7BA 3GLKA 4ZYUA 1T4CA 1EWTA 1AN9A 1F2DA 3FNHA 4OIFA 1C3XA 3BMNA 3KLBA 1Q14A 1ZCAA 3Q72A 4WNAA 3ZXXA 1NQWA 1OXXK 2DLNA 3RSSA 3Q3VA 4AJIA 5JNLA 2WG1A 2C7OA 1B6RA 3DAHA 5IT0A 5IP5A 4JGBA 1SUEA 4PZDA 2AE2A 4MUMA 4H7FA 2HSDA 2Q6LA 1YA6A 4ZAWA 3R7WA 4LPSA 3SZMA 5CXUA 5H3LA 4FFRA 3BG5A 2BT4A 3I6BA 4PLWA 2ZYAA 3OMXA 2GK7A 3UBMA 2GK3A 3QIAA 1GG8A 4GR4A 4UAGA 5EVJA 4X1YB 5FWYB 4J1SA 2YMLA 3P0EA 1PTJC 2PNFA 3QV2A 1SULA 1LX7A 2VN8A 1KEVA 5BQOA 1GNVA 1YRQA 3JQDA 2E1PA 4JVLA 3R7WB 4ESOA 1KPHA 2RGEA 4F0JA 2RI6A 3NORA 3CJTA 3QELB 2EBFX 3MJVA 2ZRHA 3PT9A 3QM1A 1QP8A 1VKZA 2Z3WA 3OBBA 4L50A 3KD2A 3OTGA 4D41A 5LOVA 3ZVKA 1L5YA 1NF3A 1MC4A 2CKDA 1QHXA 4X44A 4L7VA 5CMLA 3WNBA 4DDUA 4WBSA 3FOEC 1E4EA 2VRCD 2WPNA 3NVDA 4PGFA 4WIAA 1SG0A 5G3ZA 1SY7A 3TTWA 1U8CB 3IQIX 3IV9A 4EHBA 5IVIA 2C3PA 4RQBA 1CR0A 4OY3A 4UE2A 4YAWA 3DDHA 5JAZA 2PQ6A 3EA5A 4EHLA 2A30A 1GCIA 3KELA 1F5NA 1XQ9A 2Q4DA 3ZDYB 2HX1A 1H3FA 3RWBA 4UAUA 3PFFA 4UZSA 4B7AA 5DBEX 1GU7A 5DN6D 1JR2A 5BUSA 1GFWA 4GPZA 5H80A 2KHZA 2AH5A 4WW0A 1A4XA 3RT1A 3CLRD 4BOYA 2FMKA 4FBMA 4C4PA 4TS1A 3VKHA 3CG4A 1BD3A 2F2TA 3EDOA 3CMCO 3K1TA 3KJFA 3NRBA 2OD7A 3OVMA 5D1NA 2WINI 2HM7A 4KIWA 3LF1A 2PX5A 2AN3A 5L4SA 4EG6A 1SHUX 3OTHA 3LZ6A 1U3FA 5AVYA 5E8RA 5K51A 1RAGA 2QX6A 1MIOA 1IHXA 2CD7A 4LCJA 3RC7A 2AFHE 1JDVA 2CHQA 2L69A 1ICEA 3DTVB 1TA9A 2A92A 2ZUDA 3DVAB 3MWJA 2CLHB 3FGNA 1NJFA 2W6NA 3HV2A 4PFJA 1SHKA 1DMRA 2B3TA 2W2LD 2XKJE 2QROA 3ZIDA 4ZJUA 1CR4A 1UF9A 1EUCB 4N76A 2J46A 1KBOA 4TXJA 1C0PA 2FVYA 4HH1A 5AUNB 5K5EA 3S1AA 1VLMA 2XI4A 2HBZA 3FHTA 4ZT5A 3FDXA 3R23A 2OYCA 2GMWA 3KEOA 2NTJA 3L7DA 4P1ZA 2J3KA 4RMJA 4JHLA 2Z58A 4GW3A 4QATA 3I61A 3GEMA 1VMDA 4F56A 5KUTA 4MICA 4K1XA 5DNAA 2XXJA 5HDBB 5L3SB 4BWGA 2OD2A 3PYLA 1T0BA 1A9ZA 2C8JA 4GMDA 5DYNA 1NYLA 4NCNA 3PTLA 1ISSA 4AY5A 1FPMA 3WSVA 3B9QA 2EX1A 4KPFC 3RVKA 4L4YA 3IEKA 1TD1A 4Y9TA 3IDAA 2Z9CA 4MVJF 3BDAA 4GR9A 4BVBA 4XGKA 4QFCA 1TUGA 3W7AA 4E30A 1OFVA 1UBUS 1JWLA 3FOWA 1Y4SA 5LP6A 3LLVA 3QMWA 1UDAA 4CKCA 2A1UB 4S2UA 2COKA 2Z2JA 5DB4A 2BFEB 2VTDA 2ZYHA 4NYMR 2HA7A 4OYHA 5B7NA 4ZQBA 1TLFA 1N3BA 4S05A 1OILA 2QLFA 2X0RA 3ILSA 3ZD7A 3DUFA 5GGXA 4FFBA 2C3UA 2YV1A 4RZSA 4I1UA 3EEFA 3QTTA 2FZLA 1DBIA 4ND5A 1S2NA 3JPYA 5ICMA 4E08A 4DB2A 1IHOA 1VLZA 5BV7A 5HSGA 4COKA 5CXQA 1UT5A 5LKRA 2RHJA 4L6AA 5IG2A 3VKUA 5HIAA 1AKVA 2G8NA 4NE7A 4NCHA 4Y1FA 3L6CA 2JVIA 1H5NA 3VYWA 4A0SA 1B93A 2R8PA 4X3CA 1IH8A 5CLFA 2W7TA 2HC9A 4FMCF 2O5RA 5DP2A 1EP1B 5EWMA 1DWPA 3IR7A 4QDXA 4E3ZA 3FWKA 4BX9A 4ZT7A 1ZU4A 2HZBA 2VP0A 5IBCA 1RVDA 3NALA 1FQJA 3EZGA 3EY9A 1GPMA 1GGFA 1RW4A 4BMDA 2GCOB 4EHIA 1VYVA 2R44A 1Y9JA 2FG6C 3MSXA 4UUPA 4BFWA 3FG9A 3TZCA 2GARA 2W42A 5GJVC 1CQIB 4HTAA 2F3UA 3OF3A 4J7XA 1GT6A 4UUOA 5JZBA 1YB5A 5FWAA 5GOTA 5A9SB 1CIPA 1E1RD 5I9LA 3FRIA 3BMXA 2CNBA 4G36A 2C2ZA 2AN1A 2BIFA 1XEWX 4Z1MD 3X43A 4G4GA 3S2YA 3TLBA 3QOWA 4OI0A 5C31A 1JHYA 2FMHA 1SMKA 1GL3A 4MV9A 3OX1A 1IATA 4X84A 4B4UA 3BBLA 4E5NA 2BFFA 3W2GA 5LDGA 4F8JA 1HSZA 1Z8DA 4LC1A 4BNWA 2IS1A 1E2UA 4IH1A 2E4WA 2P3LA 3NDIA 2FHPA 3TIXB 3MJSA 3HU3A 2YV2A 1L5HB 1WV1A 1CJTC 1Z33A 1Z45A 4FC7A 1ZITA 4QUBA 4ZAYA 4AZSA 4ACBA 4B82A 1Z2NX 2B30A 2VT2A 3A6HA 1CETA 1EVJA 1PX2A 2HSEA 4Z0HO 4G9EA 3N1UA 1BNCA 1EWVA 1P2GA 3NEYA 1R64A 4HNSA 1WDKA 3SQMA 3CUYA 5EJGA 1ZH8A 1Y1KE 1GV1A 3AJ8A 1R0LA 4TS4A 4GM1A 3U5ZB 3BH0A 3TDNA 1L1QA 4WKOA 1CRPA 1E2GA 2IOQA 1R4MB 3ZCPA 4XLZA 3HY3A 3ADOA 4H3SA 1WPGA 1O94A 3JR3A 4LEIA 721PA 3U6KA 3G5AA 1RKUA 1AGYA 4M7WA 4TLMB 3FZNA 3OE5A 4GUDA 1UQUA 4BE9A 4JLJA 4BUCA 4CE6A 4XYLA 1ADGA 2HADA 3O4VA 1PR2A 3PFCA 2GX6A 2DT5A 3ABQB 5CYGA 2PGXA 1P0PA 4P3OA 1XYGA 1UKAA 1XMJA 1U2RA 3LHSA 3GDWA 3OPXA 4PSDA 5CHYA 3FUWA 1CJKC 3MQ2A 1JBEA 4CMAA 3TLKA 1M8JA 1Q17A 3PTAA 2ZJFA 1E8DA 1RCUA 3EIOA 2E85A 1P91A 2F3PA 2VJMA 4GYKA 2IV3A 2O5CA 4U2GA 2JRLA 4X62B 1G0OA 2B36A 2ZVJA 1NY6A 4IFIA 3SQWA 4I9GA 1MGOA 1QJ4A 1LDEA 2BF4A 1XTBA 2ZTMA 4MP3A 4OF4A 1PV2A 1P77A 4N5LA 3Q0TA 4QUHA 1E9AA 1PDWA 2CNDA 5AJWA 1R4AA 1YR2A 4KKXB 4URZR 3SHTA 4HRVA 2AD5A 1ULTA 1U5AA 2YZMA 4HN2A 4QBGB 2YWEA 2CDRA 1L3BA 3D4OA 3I37X 3ZHOA 3I6IA 3D3WA 4N3AA 9LDBA 1MOZA 3WQRA 2Q3DA 1W5TA 1AGXA 3O2JA 2H07A 2YCBA 3IGFA 4YCBA 3ANXA 2ORIA 2QTVB 2AOTB 3OU7A 2PVPA 4XGRA 4D0GA 3RPEA 4BB6A 1H2XA 5JE8A 4WLOA 4DREA 2QLNA 1J23A 2DLCX 5FA8A 1X1AA 1U63A 3TSCA 3W5CA 3V2IA 2ADMA 2VKTA 4UDXX 4ZI5A 4JD5A 2C20A 2HDWA 2WWVD 1RQXA 5TVKA 4ROTA 4CQNA 2QX4A 4AY2A 2QTVA 2P6PA 1YCDA 1DRKA 1SG6A 1Z3IX 2ORYA 2WYVA 1IZ7A 4X7MA 2CLOB 4GWGA 2OLKA 2QI9C 2OCLA 3HCRA 1LRLA 3ED1A 3QKSA 4MEJA 3AZPA 5CK5A 3EPKA 1YQ9A 1FS6A 3GLRA 3OT1A 4F4DA 4XB6B 5F2KA 1CERA 2PIAA 5KWJA 2WICA 1QVAA 2IEYA 1N3YA 2CYAA 2J9FB 1PFKA 2UYHA 5AVUA 3PC2A 1K08A 3V9AA 1MQ9A 1SQ5A 2RGDA 4JT9A 5EIHA 3FAZA 3PEWA 3Q3IA 4L2IA 5U9CA 1TEZA 2F3SA 3I52A 4Q4HB 3D7KA 1PNRA 4RHYA 3OQNA 4AJKA 1FVHA 2CD9A 2CFIA 2QLBA 4MWEA 5HFAA 4WK6A 3CBGA 1T3LA 1MJ5A 1PN3A 3DM5A 4K7JA 3SHWA 2V0GA 2QM0A 4LDRA 3AKDA 5IAGA 4GXNA 5TSDA 3E22B 1SC3A 5LQMA 3GEDA 4RK0A 2ZBRA 1UC9A 1I2DA 2CXNA 2JIBA 3D2BA 1HE3A 1RMTA 4TSKA 5DH9A 5FFMA 3TUJC 4A91A 4RQAA 3H4TA 1WR8A 3E27A 1EX9A 4QHTA 3EGDB 4LVNA 3U62A 3U44A 2OP0A 1G42A 4IJUA 3U9TA 2NLOA 3VRHA 4N0DA 4RTQA 2PPLA 5K7SA 1EM6A 3LWZA 1P4HA 1O6BA 3F5DA 4G25A 2HIHA 5BQ5A 3TVYA 5ED4A 3SHFA 4F93B 1BXRA 2WP0A 2XOEA 3II6X 4EB6A 4KK4A 2YMPA 3ZXUB 2J5QA 3AQIA 4D7AA 5J2UA 4EWLA 3PQ7A 1HZJA 2V59A 3C3EA 1SVIA 8AT1A 1PR3A 3U3OA 1L7DA 1TYZA 3U44B 1UBTS 4J90A 1WBDA 3B85A 1JKFA 5IDYA 5AMXA 1KJQA 4BNJA 1OH8A 4I9UA 1QBKC 4CR8A 1S3SA 2C4HA 2MR6A 4DN6A 2VYNA 1T8SA 3CWQA 1G3IA 1OROA 2PH1A 3DHWC 1JHAA 2PVCA 3GRFA 3L6UA 3ZGVA 3FJ1A 1QO0A 4M3NA 1QZTA 3UHPA 5A6SB 3WLQA 1UADA 4IS2A 3QKUA 2O2EA 4KXLA 1MG5A 2EJCA 4XPIA 2OEPA 3L3BA 5KB3A 4C3UA 2DWCA 2IIQA 1YKSA 2R6FA 4JQYA 2VUIB 4EG0A 3AEQB 1KIAA 2WQ7A 4MWSA 3V8PA 1ADCA 1A88A 2A0UA 1HUQA 1LSOA 3UUFA 2HCTA 4U7HA 2H57A 3HFJA 3ADKA 2NU6B 5EJEA 3AW8A 4YLGA 3ZCQA 4GP7A 1YHYA 4PSKA 1KGDA 2W2KA 5E9QA 4CIXA 3HDJA 3GV0A 1Z8FA 2FZWA 1G6HA 5JAOA 4P3YA 5E6UB 1F2TA 1HC7A 1CEYA 2V4UA 3AONB 3NB0A 4FX2A 3GNTA 3LT5A 3HN6A 5ALEA 1GXSB 1H93A 2JG3A 3N2NA 3SSOA 2GN1A 2DWQA 3G1WA 5LA6B 3AR3A 4U6SA 3K09C 1S7GA 4U9UA 3K0KA 4QUGA 4RZQA 3ZDZB 4MJXA 1Q1ZA 3BMCA 5COQA 1E79A 1T4DA 1L7VC 4E21A 1GY8A 4M86A 1PQUA 3S27A 2GRAA 2VBCA 4HATA 3EIHA 5G0TA 2BKEA 3N2GB 1KZGB 4ZEOA 5BSKA 1H3NA 1FSPA 5J1SB 3EODA 3RYFA 4R3NA 3EDCA 4YCDA 3E1KA 1JWBB 4ALNA 4BV3A 1W1IA 4BYMA 1YB1A 4ZCLA 5EC8A 4MRNA 1RKBA 2JEYA 1K9SA 3PHIA 2Q1XA 5AJXA 4DC1A 4RE5A 1JB9A 3PENA 4EHJA 5TXGA 2J8ZA 2Q1TA 2JK1A 4QM7A 1LQUA 3CUEF 3ZLJA 1XZHA 3RIGA 1NVKA 1OI2A 4RQUA 3WGMA 2G9RA 3MMXA 1NIJA 1VFPA 4LJAA 3ITNA 1SBNE 2Q5QA 4OLFA 4P7BA 4Z9AA 4B76A 4YCAA 2N3ZA 4QEKA 2P2CA 1MO6A 2AE1A 4GG1A 3S1LA 2R4TA 1VQ1A 1ZUNB 1P0QA 4EY8A 1Z4NA 3JQ7A 3N0TA 4OHWA 4DV0B 1WJGA 4FNMA 1WB4A 2ZTSA 3OJFA 2Y77A 2H2GA 3H6KA 2JFXA 1L7RA 1LVHA 1UXJA 3ELWA 4LYHA 3T54A 4A2WA 4LX8A 2VF8A 5AM4A 5CA1F 1G2IA 1TU0A 2IYQA 2IY8A 3L8GA 2AMYA 3P97A 3C1TA 4FOLA 4FVTA 1GQRA 5CLHA 4I1OA 3AESB 4YDRA 2I6FA 1MX1A 3A1SA 2XYQA 1KU6A 1KE2A 2JANA 2QB5A 4MGHA 3TK1A 2C9BA 1JIIA 3FW1A 2H2AA 4MHSA 3WNDA 1KBQA 2W6CX 1U2ZA 3COVA 3FPAA 4XIIA 3ZHVA 4CR6A 4ZCRA 6NULA 2OUIA 1AZSC 1ZGHA 2I3ZA 3E8SA 1XTVA 3P9QA 2B1GA 3IUBA 1C3JA 3DMHA 4X1KB 4YJ2B 5TV2A 3FCCA 2NT3A 3PCTA 5A6VA 4DV2B 1M2KA 1Y63A 1ORWA 1XXHB 1C1HA 5BNZA 3AVTA 1Z5OA 5DLYA 1X2BA 1YTUA 1EDOA 5ARBA 4FCWA 3ZV7A 1FFDA 4XYMA 4HYYA 2OLJA 2WD7B 5KAMA 3ILYA 3YASA 3GLTA 4FGZA 3HABA 1MTOA 1SQSA 2PZ8A 3H7AA 4Y67A 4CEIB 2VEDA 2V03A 4L76A 5KX5B 1GU0A 1LTHR 5EUCA 3TMYA 1WQ1R 3DZGA 4TKUB 3UV7A 1AS2A 3TI9A 3H9UA 4AK9A 2R11A 3HM2A 3KZXA 3HXOA 3ABZA 2DFNA 2BL4A 3H75A 1C7JA 4TWAA 5T3UA 1F12A 1P5ZB 2ZTHA 3X1KA 4RE6A 4O4IB 1JIXA 4HDRB 4TT8A 3ICCA 2GLTA 5ED0A 2J7KA 3P96A 3JQCA 1EUDB 3KJEA 4H16A 5TF4A 2YWJA 3TW4A 4JT4A 5TGTA 4MA0A 3FSRA 5LMNB 221PA 1W36B 1VLVA 1PVVA 3ELBA 4Z8YA 1J2RA 3ROFA 3G49A 1F14A 4OXYA 1VMKA 2X0KA 3OFND 4XM0A 3ZBTA 3QEBZ 2NO0A 5G40A 4Q19A 1X1QA 5H4HA 2QTMA 1M1YB 2B5WA 1JJFA 4U8GA 1YAJA 3CNLA 2ZXEA 2ILTA 1F7VA 1TB4A 4DGQA 1ML4A 1ICIA 2RH8A 2VP6A 4D6YA 5THQA 3WRWA 4C01A 1VCMA 4F6RB 2FRDC 2V7WA 1XL0A 3MW8A 3GJ7A 5LXTA 2JH8A 2P62A 3L7CA 1Z5VA 3LH5A 4DADA 1R6BX 1E3EA 1H0KA 1R74A 4YIHA 1LI5A 3A04A 4UUNA 4Z49A 3F67A 2BGJA 4M0PA 4ZO7A 3AI1A 5DHQA 1BWPA 5JRZA 4D4MA 1MJGM 3IOMA 2O57A 3DEFA 3I01A 1XZBA 4KB5A 4MVYA 2P6UA 3D1LA 5C37A 1N2OA 3BMQB 4HY3A 1ECLA 3CKYA 4CDRA 5EWJA 4EYKA 4G6ZA 1II9A 1UWVA 2I4MA 3H2ZA 4L5CA 1X1CA 2Q2QA 2FQ1A 3GJ6A 3K4PA 4W1RA 4BP9A 4HUTA 4YRNA 4D9BA 1XCLA 4UOQA 1TZKA 4NBLA 2Z57A 5KIAA 3UJAA 1E1LA 5IZCC 3PQ6A 2HN9A 2PX8A 1E1CB 1RWQA 4FINA 4HGRA 1OLXA 2CMHA 3LP5A 5LQRA 2J3IA 3PB3A 1U2TA 3A6GA 4RZHA 1RQPA 2WQZA 3TSAA 2FMTA 1XJCA 2GVDC 1KY5A 1UZMA 1A9QA 5I4BA 2G1KA 5BW8A 5GONB 4HNUA 5HTOA 2H1SA 5KNCA 1FNDA 1SXPA 4CM9A 3D8BA 3EYWA 4E2WA 4LHXA 2AXNA 2WJ3A 3LBYA 3DT8A 2VSQA 3NZEA 4U6QA 1NWHA 1K4YA 2ATIA 3LAWA 4KUHA 3BXOA 4FMBB 4XDZA 4S04A 4AKHA 1Z4LA 2RMKA 2A57A 2ENWA 4JLNA 5F7XA 4DG5A 1U7DA 2NIPA 1ISHA 2BZ1A 5DBGA 2JKYA 2PZGA 3Q41A 2R8ZA 2VPTA 2PL3A 1FRNA 3LI2A 3QKIA 4KBFA 4X00A 3W90A 3TLGB 5TS2A 1NJ1A 1P5JA 2JHCA 4OJTA 4KLNA 4FEEA 5FB3A 3VTZA 4F97A 3MINA 4EJSA 4UJ3A 5LZ9A 4FW9A 1E9RA 2R25B 1ITZA 1RAIA 4QHYA 4H7EA 3RTDA 3IAS6 3BUSA 3VR6H 4IFBA 5F9HA 5L3QB 1Q12A 4L6CA 1E2IA 4KO4S 3NDRA 2XCUA 5CX1A 5AW7A 1GNTA 4EA8A 3O8QA 1JQLB 4HOYA 3NH6A 4DQ0A 1IOZA 1WQ4A 4F21A 2VOJA 3HA2A 3UA3A 4C0JA 1Q7BA 4BNTA 4NECA 3TGWA 3IVRA 1OFHA 1DC6A 2VPXA 2EVWX 2XUOA 4W8GA 5DJ5A 1Q77A 5L3QA 4BKMA 4RELA 5MN6A 2NSYA 3UICA 4LFBB 5JWHA 3VR0A 5C80A 4F5EA 2YWGA 4MUHA 1J0EA 3T3MB 2EWVA 1ZZGA 2P11A 3HACA 1SKMA 3VQTA 4CWAA 4G86A 3MS2A 2Y66A 4IUCS 1P80A 2FSVA 2IYLD 3ZHBA 2C97A 2FFBA 3M4YA 4EGJA 1KFCB 5CG1A 2ILVA 1XLTA 3LHKA 5B4TA 4XRGA 4X61A 3VU0A 2JC3A 1CS4C 4S1VA 1WM1A 1YMQA 2Z5LA 2PUDA 1H23A 2NTNA 1U8TA 4MV0A 4Y6PA 2Z3ZA 3U0BA 5AK3A 3N70A 4GLOA 2JLXA 2IYZA 3DOCA 5TPZA 3K70B 1M2GA 3JVIA 3C3XA 3ZCRA 1JDZA 2QTFA 2QKYA 4Q3OA 1MB3A 2C5LA 3H1FA 3UMFA 5BSWA 1Y6ZA 2GKSA 3FPLA 1UH5A 3CR3C 3OOSA 1BE0A 1VCNA 3CZ9A 3I2GA 1RYHA 3HB1A 1W5BA 4RZUA