3JVEA

Crystal structure of the sixth brct domain of topbp1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
b'APKPLHKVVVCVSKKLSKKQSELNGIAASLGADYRWSFDETVTHFIYQGRPNDTNREYKSVKERGVHIVSEHWLLDCAQECKHLPESLYPHTYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA topoisomerase 2-binding protein 1
publication title Insights from the crystal structure of the sixth BRCT domain of topoisomerase IIbeta binding protein 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 34
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3jveA00
1T2VA 3T7JA 3K15A 3PA6A 1CDZA 4N40A 2VXBA 1GZHB 2L42A 2COEA 2EBUA 3K0HA 2VXCA 2M2IA 4ID3A 2LE0A 3PC7A 3PXBA 2XNKA 4IGKA 1T29A 3PXAA 3T7IA 4BU1A 2JW5A 2COKA 1Y98A 3K05A 3QVGA 2EBWA 2ADOA 2HTFA 2ETXA 3SQDA 3EF1A 1L7BA 3PC8A 3PC6A 3AL3A 2NTEA 2XNHA 3HUFA 3AL2A 3EF0A 3COJA 3PXDA 4BMDA 3T7KA 3II6X 3UEOA 1L0BA 1IN1A 2WT8A 3OLCX 3SZMA 2K7FA 3FA2A 4BMCA 3SHVA 2DUNA 4Y18A 2R1ZA 1KZYC 3SHTA 1IMOA 3L41A 2EP8A 3L40A 2K6GA 3JVEA 4XQ0A 3L46A 3QVGB 3UENA 4OFBA 4XPZA 1T2UA 5ECGC 1WF6A 3HUEA 3PXCX 4BU0A 3I0NA 3K16A 1JNXX 3KTFA 3PC8C 1Z56C 4U4AA 3K0KA 2E2WA 4Y2GA 3U3ZA 1N5OX 2COUA 2D8MA 3PD7A 1OQAA 3I0MA 2INGX 3T1NA 1T15A 2AZMA 4JLUA 3PXEA 4IFIA
chains in the Genus database with same CATH superfamily
4PYIA 3BZWA 4PPQA 1C3JA 4KO1S 4HYEA 3BMCB 1N2GA 4MS1B 4Y1RA 3UJBA 2EW8A 1A8IA 1JECA 1Y80A 1PTJA 1ZYUA 5FLKA 2CLKB 2AOUB 3R7DA 2V9CA 2QLLA 4TLMB 4X1IA 1F5NA 4KXYA 1LLCA 4UBMA 4Y2PA 5BUSA 2GD2A 3P8ZA 5LU8A 2BDTA 3WFJA 2XAAA 1R0KA 4I3GA 4MROA 3NEJA 1WO8A 4IXWA 4EKYA 2V1UA 2JZOA 4IX9A 3FZNA 2QUHA 4R2WA 1TMYA 3VVBA 4A8TA 4P32A 5LDDC 2XMDA 1UPTA 3DE3X 3EAQA 4TMWA 1CR6A 4MCIA 4WKNA 4YP9A 5JI2E 4QYWA 1EFHA 1FUUA 4G4SP 1I2AA 1X1SA 5J4YA 2QRNA 5LP6F 4DIBA 4P31A 1NMXA 5E3JA 4B9AA 4N7RA 5J1SB 1QFXA 1DEHA 2OD7A 3ZDXB 3A2NA 3HJFA 5A4IS 3QV1A 4OAPA 1AUQA 1QHIA 3T7AA 3ZEIA 1I13A 3ROFA 2BTQA 2CBXA 1Z33A 2HXGA 3QOXA 4C1NA 1TYEB 4L72A 5CFRA 1SUDA 3PFBA 3TFOA 3DZDA 4B74A 4RTOA 4M8IA 2NT4A 1A8QA 4K9PA 4TKVA 5KJ6A 2NU6A 5BO5A 2X5XA 4ARUA 3ZXIA 1LPSA 4I9HA 1O9BA 1SHKA 1A9SA 2CXTA 1ZUD1 1C8BA 3PUVA 1JYSA 1DEXA 1FUKA 3UB2A 1SKBA 4YCSA 5REQA 3AVUA 2MR6A 5DNDA 1VG9B 3B48A 4H7EA 4K9DA 4PEVA 3UJHA 5KJFA 3JZAA 3WP0A 2ZM5A 5LXTB 2JGRA 3U9LA 1G7SA 1RHJA 4ZN6A 3KD3A 2ASVA 3OWOA 1N25A 4PCUA 5EHNA 4BX0A 3Q2IA 5FA8A 4AJEA 5BNZA 2H1RA 5AWFC 4BRSA 1TADA 3B6IA 1JQLB 3M4XA 1IVSA 2VDMB 1LRLA 3K94A 2PSFA 1C7IA 3FUWA 4HJRA 4OMDA 5EMHA 5J63A 4FT2A 4JUIA 4OQYA 3SQMA 5K0GA 3WL8A 3KSDO 2UUCB 1BU8A 2OZKA 2QT1A 3MCVA 1IK6A 4YJHA 4MICA 3C6QA 1NZFA 2X9GA 2P75A 1OC2A 5DGXA 5KWSA 4ZYZA 2NUAB 1T3ZA 1PQ4A 1HFJA 2ZYHA 4G67A 1PW5A 1U04A 2SICE 1BXRA 4WADA 2X4IA 3OFKA 2DCMA 1SXGA 1W8IA 2I6QA 3MCZA 4CMAA 4IMPA 2C0PA 2EEPA 3KSRA 2AEFA 2WF9A 3GPCA 2RKOA 4TM8A 5CMLA 1F4LA 1L7MA 2QRJA 3M9WA 3FUUA 4OXKA 2BEWB 2J6BA 4OBBA 4TTIA 1SXIA 4FSXA 2Y6UA 2F90A 2F8SA 2J3JA 4MS3B 4UBIA 3R0IA 4CI9A 3PX2A 1NBEA 1D2GA 3C8MA 2AN3A 1P6QA 4NYMQ 4CXMA 3H5NA 3L0OA 5ALGA 3LS2A 5G0TA 2QTLA 1HYBA 1UK9A 1ZAYA 1FL9A 2XB9A 3A70A 4MYHA 4OQXA 1I14A 4JFRA 1LSSA 2XQVA 5JTTA 2BOVA 3F7TA 5GGXA 4KMRA 1KAGA 3U49A 1JPNA 2B8NA 3AMVA 3BN3A 3HCOA 3TNFA 1QIEA 4TQAA 3ADDA 1VKZA 1QGYA 2FEWB 3ONNA 4LSGA 3DE5X 4H9GA 4Y9DA 3TRFA 3K8YA 3KQPA 5DKFA 3IURA 3P52A 1EDOA 1N9GB 1U7UA 1XZIA 2ZRHA 5FNVF 4BKQA 3EX7C 2XNKA 4YH1A 4YAKA 1C8VB 3HYCA 2VF2A 1V16A 3WQBA 2J7PA 4BU1A 2UKDA 1V48A 3BE4A 4YUAA 1ZQ1A 1XHFA 3ZWNA 3JTEA 4JI1B 1M1YB 4FKZA 3L84A 4L74A 2WV7A 4Q4CA 1XBTA 4IYRA 1TF5A 2GFHA 5HF6A 2BFCB 2MYNA 1L3CA 4J43A 5JYDA 2LP4Y 1W30A 3FN4A 4KR3A 1ZK0A 1RQ2A 2PUWA 2Q0HA 4AY3A 2I29A 3BHIA 1I1NA 4MW0A 3PPVA 2YWGA 4N6NA 1ORIA 3H2HA 4QXPA 1T36A 4R1OA 2CFRA 4L3WA 2XMZA 1NA5A 1RM5A 3I9JA 1JEQA 4IMRA 4GOOD 3AL0C 3FHTA 1CUSA 1RQXA 1GPKA 5GWXA 3W5CA 1UDXA 4OHBA 2R9VA 1J0EA 1KVUA 1XZDA 5NULA 1YQQA 1MC5A 1WJGA 4X3CA 1KI6B 5AIBA 2Y2UA 1JDJA 1HQDA 1VB3A 2WJ3A 4I5IA 3KTDA 3U1VA 3VVLA 2ZT8A 4CUJA 4JB2A 4AKHA 3HB4X 3E1SA 1ZN7A 1EJ6A 5EUMA 5EJMA 5DCWA 3JQFA 3NNSA 1E66A 3WL6A 3TTUA 1KAQA 1NJ5A 2YN0A 3S2UA 1AHIA 2PMFA 1SOUA 3HO8A 3ESZA 4LHSA 4X7PA 5LBTA 3WV5A 5HKOA 1CYDA 1XR3A 2C5HA 3I9FA 4D9HA 3MWGA 4J0FA 3GRRA 4TVBA 4YMIA 2IS4A 2P2NA 1ZESA 2GOYA 4B4UA 3D1VA 3D43A 3OCCA 3LNTA 5LNK1 3RVKA 2YRFA 2EJCA 1YFKA 1U0BB 1EXDA 4WCVA 2NVUA 3KWJA 1U1EA 4S35A 2ZJOA 3O3CA 2A1TR 2TSYB 2Q27A 3PU6A 1RBQA 3ZE1B 1JEYB 2P9FA 4BUJA 4HI0E 4LZLA 1R4NA 1DXQA 2RGWA 1PV1A 4N49A 2XKKA 5B7PA 1WTCA 3D6NB 2CXPA 1GLGA 2P1ZA 3QXGA 4HKTA 3TD6A 1W36D 4OMUA 2QTFA 3I37X 4UARA 3OJLA 4NBKA 5HYVA 5DNYB 1M2GA 2ZK7A 3DTVD 3GGGA 3GLFA 1BE0A 3N87A 3DF9A 3N5KA 4FYVA 2ZBDA 5GVRA 2OKGA 2M98A 3P0HA 1VPVA 4O1IA 1Q50A 3TIXB 3TKYA 1KI3A 4MI6A 3B70A 3PUIA 2W8BA 2QTBA 3RKRA 5JZSA 5H83A 3IPAA 1T9GR 5FL7D 2J0UA 4JDPA 5JFGA 1ZY2A 3MAGA 5HM6A 1GDTA 2DR2A 5IYZB 1VL0A 4ZVTA 2IZ6A 4YFVA 3ZY3A 1DJMA 3NBZC 5CBPB 1OI7A 3G0OA 5EQJB 3GXOA 2R62A 2OV1A 2INGX 4NNJA 3FNBA 5JPCA 4HSEA 4G4JA 1L4EA 2R751 3H6KA 5ETJA 3YASA 1E69A 5TMBA 2JFWA 2KMLA 1MB9A 1DWPA 2R8BA 2XYGA 1OWMA 3EXEA 3FETA 4J8PA 3ZV6A 3T35A 4ASUD 2ZJZA 1P0CA 3T6KA 4GT1A 1LVGA 5EIOA 4D4HA 1ZONA 4PZ9A 1OT5A 1QFJA 2BN4A 5G2OA 5MFPA 4FMPA 5T8KC 1A9OA 5HOEA 3IKLA 4M9UA 4Q18A 5FFNA 2QORA 3K9WA 4PRKA 4EOGA 3NDPA 2D06A 2HA7A 4QQKA 2B25A 1GQOA 2P6PA 2J1LA 3CO5A 3ZIUA 1G8KA 1NBMA 1C3EA 2C3UA 3EGIA 3EQ8A 3QXCA 4HMQA 3VV2A 4A3SA 1PS0A 2Z1MA 4ENQA 4WXRA 2PJRA 1Y6QA 1UODA 4I9GA 4LZAA 4DCTA 3UWPA 2DG2A 1YJCA 5THKA 1UBSB 2CZCA 5F7XA 5IKXA 1UEJA 4RVUA 2I4OA 2APJA 3GJ7A 1H3NA 3A04A 4IDDA 3OUZA 3VR5D 1B14A 2ZUDA 2Q46A 3ZE0B 4OQDA 2UVDA 3EEYA 2ZDHA 1Y3HA 4YB8A 2HMVA 3DFMA 1GG8A 4TT8A 4DV5B 3RAEC 8ATCA 2VYNA 2ODWA 3JATA 3CZMA 3TMYA 3PHGA 3WRXA 4D9KA 5KQPA 2KYRA 4C4RA 1U3WA 3CSSA 3GRZA 3S2SA 1RYMA 1XF1A 3L6OO 1J8FA 1NRJB 4NCBA 4RXMA 4ZOLA 3AB3A 4LXHA 4M1ZA 4RU1A 1E79D 1DV1A 2FEKA 4DMHA 4F6LA 4UHFA 1TJ4A 1E2KA 1D6MA 3RIYA 2UXCB 3LQRA 1N2CA 4X85A 5I7RA 4MWEA 3L8ZA 2D00A 3AB7A 3OEWA 5DI3A 2HIMA 3NANA 5LQNA 1MQ9A 3AY6A 4V0LA 5ES4B 2AJBA 2IPOA 3EZ2A 3DG9A 3D3QA 1EUZA 1RJWA 3JASA 3K30A 4JXZA 5FNZA 1U8YA 2DFKB 1QPGA 4RORA 3EY4A 3KTAA 3WISA 4FLEA 4KDCA 3EG5A 4K2HA 4LJ8A 3ZWCA 2FJPA 1HT0A 4FYWA 3WRYC 2DB3A 3D8NA 3DLHA 1N1DA 2FR8A 1B15A 1CJCA 3QVUA 2NTYC 1U4SA 5B4VA 1DIGA 2VT6A 4F4UA 1ATIA 1OBCA 1X8KA 1A0OA 1U8TA 3L0CA 4KGXA 2C4KA 2VOJA 3THXA 3KPYA 5FXMA 4WDQA 2GD0A 5CIQA 3U3XA 4BO5A 3PJGA 1KMHB 3I01A 2ZJ6A 4NBSA 4QASA 3IHWA 2G4CA 1II0A 2F62A 2ZKLA 1GJRA 4HWOA 2BLLA 5C81A 2DE0X 1T9ZA 1ZP6A 3KQTA 3UMMA 1ONBA 4WTOA 5DYIA 2WHPA 1QKIA 2XE7A 2YNMA 3CH4B 4IXMA 4OV6B 1UFVA 3ZTTA 2OTCA 4Y6OA 1HE1C 3PL5A 4BAGA 4XTRA 3RRZA 4BLQA 4Z2YA 4N8SA 3GAMA 4Q00A 1NW4A 3UG7A 1QBGA 2YS6A 3HVHA 1CETA 3KZVA 3DGFC 3IAFA 1Y8RA 3MILA 1E64A 5HE9A 3FR8A 1MEJA 2EGGA 2GPWA 2YCLA 5AP9A 2QN7A 3CVYA 5JAPA 1T8TA 4PGGA 1GUZA 4PPGA 2ZQYA 3ZU4A 4ZYXA 2EBHX 3ECAA 5AKYA 2WVHA 1K92A 1XP5A 2VXBA 3RK4A 1NSTA 5KYWA 3URMA 2K2QB 4DAEA 5IT5A 1GXSA 4L4SA 3WKDA 1P1FA 4NH0A 3CVXA 4CQNA 2QE6A 2YQ5A 1KXZA 3RVLA 2CCKA 3FF4A 4NENB 4P36A 4WN9A 4RTLA 3VR4H 3KRTA 3OP1A 3ELBA 2FPUA 3FPAA 3CH5A 1HDZA 1PD1A 2PWZA 3Q7SA 1TK9A 1W29A 4OI1A 3W2HA 3AWDA 4BZPA 4QOHA 5L8VA 1JZSA 2GPJA 2QLTA 5KREA 2X9QA 3S8YA 2HWUA 1GSOA 3T5GA 2MINB 2QM0A 1VSVA 1XN1A 5AM1A 2IS1A 2DOKA 2ZI7A 4ENVA 2C1EA 5ER6A 3UAXA 3V1KA 2W9XA 2ZR0A 4DBLC 5AH0A 1WXWA 4H60A 3C7CB 2QUKA 3NS7A 3U60B 3B6KA 1T2FA 3LT0A 1Y3BE 2X1LA 2O2CA 1U8CB 1ZGBA 3K4HA 2LIPA 3BGVA 2IVZA 2V7QA 3OAAD 4TS3A 3WYFA 4FYMA 4MPRA 3GCDA 2JLVA 1N6PA 1VBKA 1P2DA 2YYSA 4BMDA 4HLUA 2GK3A 1FDRA 2Q41A 2X8LA 2GEVA 4JSYA 2XGJA 1E92A 2P77A 4PHHA 1XZBA 4PN3A 4I1YA 2HEIA 1VJDA 2VDOB 4G8BA 5FPHA 2G04A 1WPRA 2NO9A 3FPBA 4FOTA 4NRDA 1NMSA 3CVJA 1IWPB 3EIUA 4YLYA 2J5KA 3Q7PA 3OCXA 4H16A 1XU4A 4MYRA 1NTOA 3L7KA 5JD5A 4FZ5A 4HN4B 2VDWB 4L50A 3R5FA 1ID1A 1UXOA 3OCJA 1O6GA 4N8DA 4CQMB 1SVKA 2R6ZA 2X3UA 3Q41A 4ND2A 1T5DX 3PDHA 3PFGA 3T15A 5GVSA 3KR0A 4KZKA 3UMVA 4LF4B 2W37A 1J9ZA 1RADA 4PXAA 4JI3B 4CEJB 1B16A 1XKQA 3A1UA 3Q1LA 1E2FA 4G0XA 5SYMA 1TQ2A 5KC8A 1DQYA 2C29D 5A6SB 3ZQUA 2WLSA 1YJBA 2BGGA 1OTXA 4MRAA 3ZI4A 1AN0A 1BROA 2P9BA 1XD2A 4Z1MA 3T3PB 2G7MC 3WNBA 1RC8A 1W88A 1YH3A 1BWQA 2IPAB 2ZCVA 3EZ9A 3PGA1 4HSGA 4FR2A 3OM1A 4ZOLF 1WVIA 3AHDA 3I34X 4M1YA 5EFZA 5B53A 2C4UA 3V00A 4F1JA 3QVMA 4A4DA 2NUBA 4U2CA 3BZUA 1ABBA 3IBCA 4JYMA 4CW7A 4HNGA 4RZQA 4QYIA 1NP3A 3UJ9A 1YZKA 2RH8A 5BYBA 2NX2A 1JX6A 1DVRA 1UOEA 5IS2A 2X3YA 2D5LA 3DZIA 2CMKA 1HT1E 4HTFA 3SZOA 3U44B 4LOHA 3OZWA 5CD9A 1LNSA 1PZNA 2X41A 3OTWA 2BTOA 1RJGA 5CH8A 2E6KA 4PX9A 3B52X 2O2ZA 2PKQO 3G59A 1CERA 1ADGA 2ZTSA 4PTZA 3HJNA 1SXJD 1CZUA 2C92A 2KWIA 5FLXA 4RWEA 4XM2A 4C14A 1U7HA 4JUAA 4EY3A 2C82A 3JRWA 1KE1A 2N3ZA 4F96A 1NJ8A 2W93A 3T7RA 2ZFUA 4UMFA 3VR0A 5IT0A 4L02A 1UJ2A 3D7SA 3QK7A 1P2FA 1NC3A 1X7ZA 1MRZA 2QAGA 4RQTA 4WLOA 3IE0A 4QKQA 1JJ7A 2PQ0A 1V43A 2Y1DA 1X7XB 1XFDA 4L8GA 1LBEA 3EN0A 3SQXA 4A8JA 4D26A 2Y05A 2A78A 4JJFA 5J2UB 3H19A 3VTAA 2BGLA 3T12A 2GM5A 5B7NA 2FE1A 3RQSA 1ZJ5A 1M6VB 2HWKA 4H6VA 5D6OA 3S4YA 5FA6A 1W85B 3L43A 1EP9A 2R86A 3ZIAA 4DRXB 4S1OA 3D6UA 5DCYA 3SR3A 3SQDA 3D6AA 4E5KA 5IAOA 1RXYA 3NEPX 1U3FA 1I7PA 2MSDB 3ZEAA 3PX7A 1UKCA 2G80A 1JFFA 4TS4A 5K3AA 4Z4CA 4YCBA 4D8UA 1E7MA 4RD2A 1VIVA 1ZL2A 2IEAA 5AK5A 3ZBTA 3MGCA 1OB2A 4TV8B 2ZS8A 4JYPA 1CRLA 4ZZ2A 2PX5A 1GP2A 1HY3A 2GZSA 5JNWA 4HQKA 2HSJA 3LHFA 3WL7A 4KYTA 4URUR 3C5WP 1HO3A 5HJEA 2F3UA 2VPTA 2XRMA 1W25A 4GI7A 4U0KA 4G07A 5LA6F 4D4JA 5JY1A 2BKLA 4BAUA 2WPNA 5B4TA 4TV9B 1E5LA 3Q2KA 4XQGA 3R7BA 3TSAA 3G0DA 2HLHA 4NJEA 3X1KA 2X0NA 3ESBA 2R7NA 1AXEA 1DEKA 3PKIA 4J0HA 4BP3A 4JV5B 2FWMX 1JHVA 1D2HA 1KK2A 3I9MA 1CVRA 1IXZA 1VL2A 2DLNA 3L2OB 3QVJA 4Y9UA 5B1DA 2HJVA 1IBLB 1QQ6A 3F0TA 3B12A 3UV6A 4X7BA 2C2HA 1YOVB 4PZYA 5JWOA 1QYIA 4DDUA 1HZZA 1V6SA 1R27A 1A98A 2P6OA 4LG1A 4BNHA 1FIUA 3OZXA 2YC4C 3RC8A 5JR3A 3FOEC 2VCYA 3EZXA 2H4YA 3IUQA 2OGSA 3FUVA 4PGMA 4U2BA 3T06B 5HUJA 1ZNXA 3RWBA 4LYFA 5AVSA 1CQZA 2DECA 3CLTD 2ZCJA 3QLTA 1DADA 4AZ3A 2QBYB 3V4ZA 5I4KA 2WRZA 1RJEA 3HUEA 4F3YA 1X92A 3U26A 3WGUA 1ICIA 2IYWA 4Y7CA 1C1DA 1BXZA 1VCMA 4TTVA 1TMOA 2VZ0A 3L0PA 4G5GA 1OTYA 2GRAA 4FGJA 4OP3A 3D3WB 1CJTC 2PYZA 1STOA 2BEVA 2OORC 2J48A 3NW9A 1KY3A 1M6EX 4WKCA 2B0JA 3EVFA 5F4ZA 5JSYA 3VR3D 3KSUA 1FW8A 3ZH2A 4GR5A 1LPPA 4EMSA 1W9HA 2D2IA 4X1KA 2VJMA 3L4EA 3NRJA 4HQOA 4JVMA 4K3UA 4QHSA 4U8HA 5A03A 2CK3D 5HS4A 3AERB 4D4LA 5IDQA 3FB1A 2NTNA 3QKWA 4ZEWA 1F9EA 1WLSA 2P62A 1Z8DA 3MBIA 5E7MA 3C2QA 4UHJA 3F98A 3W4KA 3P45A 5E6SA 4ESVA 3ROZA 1RPNA 1YE5A 4CIXA 1M6YA 2RI0A 1G55A 3C43A 4YCDA 2CMFA 3C3DA 3W2TA 3LGSA 4ZRDA 1XTRA 2QVXX 4YUYA 2A0WA 3ZVNA 1DAMA 4JY7A 3JQ9C 4G1VA 2DR0A 1H9CA 1MLDA 2OZEA 3PNYA 1YR1A 1R3UA 1VJ1A 4RYLA 5K0TA 1FQJA 3N8HA 4LY3A 1XRLA 2YJGA 2F43B 3LCRA 1FFGA 2YFHA 4F45A 1UR5A 3BKXA 4I5EA 4IGEA 3I6IA 4BNVA 3QV2A 4MGHA 1WMDA 1DJOA 4CIWA 4HWGA 4INOA 3IQDB 2VPWA 1BFKA 1P62B 2ZYUX 1N5DA 1Z6XA 3HRIA 3QH4A 3M1AA 5C1IA 1C0LA 3VMMA 2QE7D 1JPVA 2PKEA 2YYAA 4MVJG 3QLVC 1XMOB 1W2WB 3QMMA 4PC7A 2DHQA 4OHXA 5EUBA 3RGWS 2PJDA 1DE0A 4NFHA 2VPQA 3C5HA 4Y9TA 3L7DA 1VXOA 1N6OA 3O92A 1MX1A 1IWOA 3EEQA 4OI4A 2WC1A 4I9UA 3LXRA 4LHZA 2IYLD 4S2EA 3DNMA 4FSDA 5EQDA 4DLVA 3QLUC 4MQUA 3DBOB 4N8EA 3HXLA 4RKRA 5T41A 1R4ZA 2GLTA 5IDVA 2C2KA 1C3OB 3ZDBA 3L05A 4ALNA 1L7QA 1AGXA 3EXIB 2QXTA 2EFJA 3H87A 3OTGA 4FHDA 4JU9A 4WY8A 3PHIA 3W1VA 4CTNA 1UDBA 4PRZA 1F2UB 5KOHB 4Z3OA 2C61A 4GI5A 2R1UA 4WK0B 3TNYA 3B6MA 3VYVA 3GLGA 3VUFA 1ZISA 3PFFA 2G72A 4PGFA 4ZMSA 4JI8B 2EEZA 5AOCA 5C7IO 1BN6A 3KBBA 5CFMA 3RHFA 5HVNA 1AS0A 1Z8FA 4QUGA 1TE2A 4Q7KA 1P75A 3I5UA 1IMOA 5E9JA 1LI5A 2XDQB 3DT8A 4WJLA 1JHDA 1G3UA 1TYDE 1TC2A 4CL0A 4JBIA 1HOTA 3O4JA 1Y1KE 4JB3A 4LSZA 3KFVA 2QJOA 4E32A 5AFSA 3NHYA 4QUAA 3I5AA 3L7JA 2KB0A 3QKSA 1WZNA 1VJRA 2REQB 2M6SA 3A9SA 4OFBA 5ER9A 2AFHE 2W6CX 2P5SA 2B92A 5BSRA 3W8FA 3HV2A 4XWTA 1PSZA 1KZGB 3SIWA 4CHTA 3O9MA 1GUFA 1V6CA 1DRVA 1EWKA 1G6KA 1NE2A 2YBEA 3SYKA 4BN0A 5B30A 4WVLA 7MHTA 1WMAA 3PEWA 3V8PA 3T1QA 4DR7B 1CUYA 4HB0A 4LRSB 4ER0A 1ZJZA 4C88A 3DD5A 3QSYA 3INGA 3E7PA 2E89A 3Q8KA 2LD4A 2UZIR 1LX7A 1XMIA 1K8ZB 3VM6A 4NCHA 3DVLA 3OZBA 1PRYA 3EEOA 3OX3A 1G20E 3DPIA 4OQLA 1BOOA 3A1FA 3IRVA 2C97A 4PWYA 3C1AA 3NPAA 1K3TA 4RTSA 4PINA 2PRZA 2WU1A 5F3WB 2H4FA 4OLHA 5CB4B 1ZGHA 2VH5R 3HNOA 1H9AA 3AETA 5HDQA 7ABPA 1NULA 1X7YA 2FSVC 2A9QA 3HRKA 3I92A 4LGCA 4RWZA 4WFQA 3HJGA 5LLTA 1GV1A 4OKIA 3PQFA 5F64A 4IW3B 1UC8A 1Y33E 4RFSB 5LMCA 4L2IB 1EGHA 2A33A 1X86B 4JMLA 1U9IA 3KT0A 3FMFA 4CCYB 3WAKA 1MIOB 5AO9A 5AW4A 1I2CA 1PJCA 3EOAI 2YXPX 2Q4OA 4OX9Y 2YVUA 3KK0A 3I4CA 2E0IA 3HBMA 3F6EX 1LBTA 5ALSA 2Q50A 3OQOA 4GX5A 1LW7A 1PJ2A 3P2EA 4L4UA 5FTNA 4DV1B 1PFYA 1A76A 2XUZA 1BXGB 1EFPA 1WY7A 1XMVA 1YRYE 4JBNA 1A1SA 1IEWA 3O2JA 1G4HA 1Q0QA 3OFND 2FDRA 3DM5A 4FMBB 4IR7A 2UUAB 4S12A 1YZNA 2COKA 2DQKA 4IIVA 5AHOA 4QPDA 1DKUA 3FMOB 2NSHA 4GRIA 2Q4DA 2WOJA 4OXIA 5LMNB 3KDPA 1EKXA 2RG7A 1TCCA 4KGZA 1R8XA 2VHVA 2WAYA 3H86A 1LXCA 1BQEA 4M6WB 3UC9A 1QV9A 2LDBA 2OVFA 2UZ1A 4P08A 3LK7A 4TWIA 3I42A 1Y6JA 2BP7B 5F35A 1DRJA 2CNKA 1GTZA 2Z9BA 2VQDA 1NNUA 1UDCA 4QXAA 4F4CA 3SX0A 2RAFA 2ZWPA 3B3GA 4JJKA 4UZSA 3VHRA 2NQ8A 2R8PA 1JT9A 1I0ZA 2AZDA 1BMFD 4BLVA 5HRAA 5A1JA 3R0ZA 3KWMA 1ZMOA 1XQ9A 5HA5A 1XHEA 5T4FA 1P3DA 1YB4A 5CDUA 1V95A 4Y2TA 1JR6A 1RRKA 1QWOA 1U2DA 1PR9A 4HVTA 4X7MA 2PJZA 3SXUA 2WJWA 1J8YF 4J7XA 3R7LA 1OX4B 4B8ZA 2O2YA 5BSGA 3DKRA 2JLBA 1DEAA 3U7RA 5IANA 3FBTA 1RMYA 4I6JA 4Y2XA 5CXSA 1SU8A 3C41J 3SKXA 4BNUA 4CBVA 4BO0A 3RI3A 1FOEB 1M34B 1TEXA 3D2LA 1FUYB 5ALJA 3WO0A 2D2XA 5C5IA 6GPBA 3K1JA 1IUKA 2VT3A 3ADKA 2ATVA 2GXQA 3DMNA 2PGAA 3LDAA 2C7PA 3GFQA 2JFVA 1B0ZA 4RS3A 5A4FS 1KU0A 4YK7A 2P9EA 3FCOA 3ZVMA 4ZAZA 2BEUB 4BX2A 5IJAA 5ADVA 4BNTA 1GCAA 1QRRA 3I0NA 5GV8A 4GZLA 1Q1BA 1H2RS 1FTGA 2CN1A 1NYLA 1ZGZA 1KZ9A 5TQJA 2ICAA 4NQZA 3KYDA 3TDKA 1AKUA 3QELB 4TQ9A 3JAMA 4R8LA 1OXMA 1PWHA 1RVV1 1Y6ZA 2A9FA 3VYTB 4Q3LA 1GR1A 2R0QC 5EJ8A 4XCQA 4DG9A 4FUTA 3BH7A 2NO0A 2OECA 2B4YA 2YHSA 3BVPA 3DOFA 4QG3A 3JQAB 4GR9A 5AQ1A 5IDWA 1Z37A 2DAPA 2HNKA 3OEED 4QO7A 1O3YA 1E62A 5DGHA 2VHCA 2DPXA 5LQJA 2HCFA 5CAEB 5FUYA 3Q3IA 2VAWA 1P7ZA 3LSYA 4BCBA 3RF7A 1IZ8A 1QRUA 2QQ5A 3PVZA 4KVGA 4M0FA 3U39A 4J16A 4QEZA 5CRIA 4RHFA 4CIYA 3OTOB 2FGKA 1T4DA 3O82A 4RPCA 3HJRA 5CCBA 5CW1A 3W5SA 1LLDA 5AM2A 4JR1A 3KDSE 1Z45A 1IEQA 1NRXA 3EZ7A 3MB5A 4IDCA 2WILA 3GR6A 5TLSA 2WWFA 2EERA 4ESEA 1Y7IA 4UZFA 2HZ7A 3QFSA 4G4SO 3FPHA 3AB8A 2O3QA 3JRNA 3KJQA 5KYUA 1TGVA 3FLEA 3IMEA 3SP1A 3A3NA 1KJ8A 5FUQA 3B38A 1E6CA 2IYAA 3IOMA 4OH1A 5ICSA 4LZWA 5F5LA 3KB2A 1P2SA 1CDEA 3QVGA 4KK4A 1D2CA 4DEYA 5HXAA 3WMEA 1OFVA 4E2YA 4C2BA 4IWXA 2JVJA 2YWRA 3X1WA 5D6NA 3EA5A 3KUKA 1EGMB 5AJZA 4I1UA 2VF5X 3RV3A 2WF6A 2CXHA 2HU5A 1JG3A 3HCDA 3L7LA 4RSGA 4YIKA 3TB6A 3AEZA 2QM7A 3KS9A 4URWR 1LQ2A 1PT8A 2FXIA 2OC4A 3R5SA 1ONOA 1SC6A 5CNKA 3UKOA 4CM3A 5BP7A 3VNBA 3D3JA 2VHWA 1IM5A 1FYEA 1NBAA 4RS4A 2WINI 5IG2A 2H06A 2IYQA 2GEKA 4C05A 3KYBA 7AT1A 1YB5A 4IIEA 1WD7A 1DARA 1DC6A 2O3RA 4IO0A 4Q7LA 3N0VA 1DAFA 1ADYA 1KJQA 5K09A 2VI5A 3ZJ4A 1ZZEA 2ZSIA 2FPPA 1DIHA 1IM2A 3ND7A 4LAFA 2PL3A 3UOWA 4DMFA 5B2EA 2Z6AA 5AUNB 3KHTA 3EOBI 4N4AA 3NTRA 4BASA 4EO9A 1NXTA 4XH9B 5JD3A 4GKVA 1SZPA 3TZHA 4NARA 1NU8A 3GL9A 4RJLA 3T54A 4BVKA 1E0AA 4GOXA 4MI3A 5JVDB 4CF3A 3IDOA 2BFEA 1IY9A 2UZ4A 2RIRA 1ADJA 4U2EA 1VPWA 3LC2O 5H59A 3ZWWA 5FWYA 4TN1A 4EA9A 4MAFA 2QRPA 5DHAA 3I62A 3VU1A 4CKWA 5DHFA 4RTMA 1PSWA 5A06A 13PKA 1FNDA 2R85A 4O2AA 1JG1A 4ZXFA 2EIXA 4BP1A 1QCDA 4IJQA 4KQ1A 1RJFA 2ZDQA 3QPBA 1KXJA 3KXDA 4PZLA 2WG1A 5F1YA 3E9CA 5E9AA 1GPLA 1VSUA 2DF8A 2R87A 4EA6A 3C16C 4YP6A 2RE8A 2QL7A 3QPAA 3CHYA 1U1GA 3TCKA 2CL5A 1P0PA 1CY8A 3F5MA 1K27A 4BYGA 1U6KA 2Q6LA 5EPEA 4MV3A 1UDWA 5KCMA 5FR1A 3AHEA 2IL1A 4ZYUA 1I33A 3C85A 1SQSA 1T4GA 1QLWA 5KOIA 1OSNA 3GJ6A 1X42A 3KJIA 3S5UA 3NOVA 4ZDIA 1UEXC 1Z0IA 1YRHA 3IUNA 3TD9A 3V7YA 5F12A 3ZYCA 4YREA 3KZCA 4KXLA 4B7UA 3A6LA 2XZOA 1JDBC 3IDAA 2W11A 3A6FA 2WTEA 1KJNA 3HB5X 4MQ4A 4ZRMA 4EG3A 3GEHA 3NUQA 5BQ3A 2XUPA 4D9JA 3GFBA 2BGNA 4OSOA 2P2LA 4DIMA 3P20A 2XTJA 4M0PA 1TZJA 1BC5A 4BXOB 2AKAB 2PWPA 2EG9A 3K15A 5DE3A 2L18A 3KE9A 5TY0A 1QORA 2ZWVA 4YMLA 5HJ7A 4XWKA 2NPFA 2FLWA 5U4XA 4JGBA 4YXWD 2Z8YM 2BHSA 4G24A 5AKEA 1VCIA 5J5CA 1RQRA 4HBGA 1W0KA 3F6PA 1YZFA 1Z7WA 3UUGA 3GFTA 1NW6A 2FI1A 3U3JA 1ZN9A 3ZU3A 1HTTA 2PT7A 5DIZA 2W42A 3LIPA 1ETUA 4ENPA 1P0MA 3FRIA 3KUUA 3BXFA 1S02A 1UH5A 2QL6A 4CDNA 2JW5A 3JQGB 4J1TA 4Z0PA 4EARA 5AD1A 4FWIB 5ALKA 2QD1A 1F3OA 4JU8A 4M1MA 1C4OA 1X6VA 2QVBA 2OILA 2L82A 4PC3A 1BJRE 4DV3B 1NYQA 4FYYA 4MVWA 1C7FA 3G6WA 4QSHA 1QC5A 5T64A 1C9YA 1OILA 4RSRA 5G1PA 2C95A 1R5BA 3PDCA 4DGSA 1KVTA 1RYHA 3DAPA 5ILGA 3JV7A 5D3MA 4ZREA 5HKLA 1R9MA 3WKCA 5IF3A 3DAFA 5MDHA 4CMEC 1FSFA 2C4TA 3IBGA 1GCGA 1VOTA 3PF8A 3OQ6A 4RTJA 3ZD7A 2HMTA 2XOKD 3GA5A 1T8SA 3L1IA 3RSHA 3FIUA 4GEGA 1TYCA 2GBIA 4XSGA 4D5EA 1Z6ZA 2HRBA 3H9BA 4RLFA 2YIMA 3SS8A 5IUJC 5DYWA 4GKAA 1JA9A 1LTKA 1M54A 1JLLB 3LDHA 4U00A 1NFFA 1O6FA 1EYZA 4QGSA 2O3UA 3EHEA 1O6ZA 1WTAA 3GQBA 3IEKA 4P98A 5LIPA 1ZR2A 2F55A 2HFKA 2SKEA 1XU9A 3NYIA 5A02A 4UEJA 5EJEA 2CXQA 4RCYA 1UJ4A 3L93A 3S1AB 1HZJA 1JLKA 2GESA 3W5DA 1I01A 5I9SA 2VT2A 1T6BY 3HU2A 3UC5A 3HN7A 3U4IA 5H80A 4G5YA 2NZUG 1JSXA 3AC0A 4PLPA 3E9YA 4G9GA 3WWEA 4C87A 4CFZA 2ET6A 2FRVA 2YZ2A 2AF3C 4IKPA 2J4CA 1CR1A 2IPLA 4A0GA 3JR7A 5DNCA 4A5SA 4CV2A 4E6EA 3G2PA 2E5WA 3EBOA 3G2MA 2FNAA 3VR4A 3FOFC 3PE6A 5HTOA 2GJSA 5H9VA 2ZBGA 4BBAA 3G89A 1MENA 1AURA 5C51B 3H1GA 1ZVKA 3MWDA 5FBHA 4X5OA 2UYGA 2VRBA 5U4QA 3RW9A 1XVVA 3PEUA 3KXLA 3CCCA 3KYCA 4P4LA 5KHLB 3MN1A 1GPDG 1O95D 4IH9A 3A1EA 4ZJZA 2VIIA 4LXIA 3H18A 3U61B 5A4AA 1Q0SA 1WW2A 2YZGA 2Y8EA 3JD1A 1DRUA 3MTEA 4H17A 4IDGA 5I8ZA 1VBFA 4F5YA 5DMHA 1TPYA 3KSZO 1UAAA 1OR8A 3MUFA 3QM1A 1X1RA 2VPYA 4JJZA 2DQYA 2RGNA 2YRWA 5JDIC 1N0HA 1GU0A 3E4DA 4DJFC 5I4IA 3PQ7A 1LF5A 4GPIB 5B57C 5BXQC 1U7ZA 2XRYA 2QV0A 5M29A 2RJOA 4AYWA 4IMIB 2PT5A 4IXDA 3NTUA 4L8FA 1ML3A 3W0LB 4O2AF 4Q39A 4AVYA 2VNAA 2RHLA 3HA7A 4R16A 3EBPA 1KY4A 2VR1A 3OIGA 2H16A 4QELA 5HRCA 4O0LA 4PLZA 1T6XA 1E20A 1FX0A 1TA4A 2G9RA 2VHEA 2Z5FA 4J0IA 3HCRA 3JYHA 1VL1A 2REOA 3M1IA 2DUJA 4XPIA 3OPQA 1K66A 2DH6A 4FGSA 1QBKC 3WGYA 2JBWA 3SJCA 3U0BA 4LQCA 3V8NA 4JI0B 2WWGA 3DZFA 3EFEA 2VYVA 1F38A 4I50B 4TRJA 4E22A 2ATCA 3CIFA 3M1YA 4F2WA 3QA9A 3OM9A 4FGLA 3ZGXA 3HN6A 3NAQA 3IBTA 4AJ9A 4YRLA 3OLZA 4WOCA 3UBTA 1RMTA 4I81A 4QT4A 2IZ5A 3M83A 2CT8A 3DQQA 2OCAA 2HIAA 3GO4A 2F3RA 1GQSA 4GP9A 4M53A 4QGHA 4D44A 1V11B 2K87A 4RNCA 3EF1A 2B5WA 4FEYA 4I9FA 2CNBA 2Q3FA 4ETWA 3EXFB 1VM6A 1PYOA 5BSUA 1HI9A 2HMWA 3SJ7A 5KO2A 2I0FA 2I3BA 1ZD5A 4H6XA 3RC9A 4D45A 2J0QA 5K3DA 1RKUA 3GCZA 5BYKA 3AJAA 1JTVA 4X84A 5LZ7A 3HI6A 3AHCA 1XLVA 2ATXA 2GSWA 2J8ZA 3DDSA 2XCTB 1OWLA 2ZRJA 3EPPA 1Q77A 1UF9A 2B20A 3ABIA 3HV0A 4HZIA 5TT0A 4WE3A 2OQRA 3O3MB 1TAGA 2QSJA 1WKVA 4RPJA 1P2BA 2Q9AA 3EMVA 5KYKA 2QR3A 1YIOA 1JR2A 2XD4A 3M4NA 5A9SB 2J7KA 3KL2A 3V8VA 1D4ZA 1ULHA 5THXA 4JBXA 5K8TA 4J4BA 1TTHA 1A5BB 1I3KA 1U3VA 2QRUA 2ZRNA 1Y8QB 1J0BA 1Z2EA 1LNZA 5HPYB 2O2GA 2HRZA 4J03A 3GYBA 2WEKA 5KNDA 3HY6A 3AVQA 1LJLA 1A5SB 1VRVA 2F6RA 5MHTA 2Q3LA 5JAHA 3K31A 4H4DA 3HHPA 4I4LA 2WUVA 3B51X 4GUDA 1QO7A 5AJVB 1A7AA 3SFZA 5JS6A 2G17A 4RHXA 3N3AC 4D4KA 4GPBA 4TZ0A 2J9ZB 2FX5A 3JWEA 3VO1A 5TJHA 5J40A 2CFSA 5GZ3A 4G65A 3WZMA 1GSIA 2JFHA 2JEZA 3QMWA 2JZCA 1HYQA 1AIPA 3ETNA 1SUSA 2Q8QA 2EFEB 4KYIB 4R71A 4XDYA 1E1CB 3IUBA 4OUKX 2BI8A 2FW6A 3QUQA 3WI7A 4RFVA 5HF9A 3HJHA 3INTA 4Q6BA 1LX6A 3QEMB 2HC9A 3UIEA 1DMSA 2JLQA 4DF3A 4RVHA 1L4BA 2R97A 3LT1A 1E3WA 8ABPA 3FROA 4GC5A 2IPNA 2D8MA 4PSUA 4Q3BA 3K6SB 3N59A 4OU4A 1EVJA 3I04A 1S2LA 3TLCA 2VAMA 3OFSA 4M9RA 4XJXA 1EK1A 4J94A 1C7ZA 4WZBE 3GVHA 2GVNA 3UUEA 3QEAZ 5JG7A 1DP4A 3H84A 2D1YA 2EYQA 3H5IA 3OPYB 2FPKA 3KZXA 4EFLA 2Z3ZA 4QA9A 2Z8XA 3S99A 1T2VA 4L4RA 3D4LA 5JRZA 4DA0A 3EC1A 1L6IA 1UKVY 1E4EA 5EWLA 1ZD1A 4KQJA 4S04A 4M98A 4DZRA 2IYNA 1VI5A 1K2VN 5AVQA 3LP8A 2DKOA 2OSBA 1AKRA 5K03A 1BD4A 1ENYA 3EZFA 1NT4A 3IQWA 2UZ3A 1RKXA 3C6YA 3RVOA 2Z4SA 1DRKA 1TD9A 4UBKA 2LR0A 5L3ZA 2H5EA 1T29A 1YKFA 3D7RA 2HPVA 3HR8A 3GRKA 5EE0A 3T61A 1HFKA 2BR5A 1E1QA 2VSQA 1PJAA 4I2NA 5K0CA 5CPBA 4RPIA 1E4OA 2WTBA 2WSSD 2QUIA 4TX1A 2ZRMA 2C77A 1DKMA 1QX3A 2NG1A 1GZ7A 2X8AA 4GXQA 3NASA 3O0TA 4G1UC 4RVFA 5DT9A 5J1TB 3ZD9A 1ONNA 4L16A 4C03A 1GZDA 3ERCA 3F8TA 1I9GA 4ZZIA 4CT0A 4TMXA 5LVAA 2PKYX 2YHIB 1DT5A 2IFTA 3G2OA 1FRNA 2XEXA 1I3NA 3ROTA 3U9TA 5K99A 3HB0A 5EKXA 2MCFA 3GY0A 5JAUA 4IIBA 3R6LA 5J2TF 1C1HA 4CLDA 2UXDB 1S01A 1MW8X 4KN5A 1QVZA 2OCKA 3MRVA 2OFPA 4CKBA 1T2DA 5T4HA 4BNGA 2NLOA 4XLLA 2XADA 1IEXA 1U65A 4Q7JB 4ERNA 1Q17A 1M1UA 2WB2A 4U7GA 1DC7A 1MC1A 1NNSA 2V9PA 4XE5A 3KQOA 1DFGA 3WHLA 1KSJA 1O96B 2D3WA 3AXTA 1JR3D 1MOPA 1MJGM 1GPUA 1UWVA 2OQIA 3SOPA 5INTA 1KWGA 4IUDS 2GVZC 2HRRA 1M0EA 3AF0A 4MWTA 4TYMA 3T3HA 4UM5A 2W48A 1Q5PA 3NTVA 1SEVA 1XK7A 3ND5A 4R81A 4HMPA 2BR4A 1D0SA 3SN6A 1G7CA 5EGNA 4F4IA 2SKDA 4F6CA 2YVLA 4CU5A 1Y6FA 5JNVA 2HRQA 1GRNA 2CWDA 4Q4LA 4Q7EA 1THZA 2JPDA 4TS1A 5EHIA 3P26A 1G0OA 5DH9A 5CCDA 3DBHB 3RASA 2PUAA 1FTQA 4Q9AA 4EG4A 1AM4D 5DNEA 1KR2A 1P1RA 1E0DA 2O2JA 2KI5A 4CDMA 4IDAA 5CX4A 2J9FA 3GJ3A 5EJ6A 4OHMA 1QB8A 1GTG1 4XQ9A 2H2DA 1YJQA 3ET4A 4YJ2B 2X5JO 1VPTA 2CCJA 2OG2A 3D2AA 1UBKS 3A06A 4A0RA 3ZHXA 3S29A 2B21A 4PBRA 4QTZA 1OBVA 4CL2A 3Q72A 1JXMA 4IEEA 3OCWA 3WL3A 3CW8X 1FQWA 1U8EA 1TZBA 4Y6PA 1KOGA 3SZGA 3ZR4B 2XQKA 1JQEA 3S3TA 3TLJA 3BHNA 4I0WB 2ZBRA 3E0QA 3O4GA 2H0QA 3FDZB 4K9SA 5C37A 5SV2A 2B0CA 2VJQA 3K70D 1D2AA 4XR9A 2AUNA 2PO7A 3CZAA 3NBMA 4LW8A 3W2FA 4E33A 3ZCSA 5G0SA 2XIQA 3UWMA 2IYRA 3DPSA 1JA0A 1NMEA 2SHKA 5IU6A 4M9XA 1FXWA 4YVFA 1U7XA 1JTFA 3V2IA 1N3YA 1HLFA 3GFPA 3O95A 2I2BA 3PNKA 4QXQA 5E6RA 4ZU6X 3PHHA 5MN4A 3AP2A 1T8PA 3HDTA 1XAHA 4WLUA 2ZIAA 5AVZA 4CLHA 2FMIA 4MLZA 3OSZA 4ZA2A 3CZPA 3EDQA 1T9BA 3KQQA 5FOUA 1QM5A 4N3AA 1BD3A 4HDSB 1NY5A 1DG1G 4R1MA 2R79A 1NW7A 1KSFX 3WNQA 1T91A 1X1BA 5JMPA 3CEAA 1KDYA 2Q6IA 5ALUA 5DNVA 3RU3A 3RV4A 3NFYA 1G3MA 4HB4A 4LS3A 1FSGA 1HL7A 2PBFA 3RTGA 5EJ5A 1AMNA 3UKJA 4X1YA 3IBSA 4JEHA 1S1MA 3CPEA 4CKXA 4ROTA 4HVCA 2YFYA 1EFTA 4N3NA 5TXGA 5JBIA 3K92A 2EKQA 1RCTE 5AVJA 2QD5A 1IJFA 3DKPA 2KQUA 3QYAA 4G6ZA 3ROGA 3GUZA 3AG6A 3PC4A 5HSGA 1EFDN 1G5QA 4JIGA 1EVEA 2FOXA 7GPBA 4M8KA 5CK5A 1J6UA 3ETGA 3PNMA 3ZZMA 3FI0A 221PA 1TZMA 4CGYA 4RIFA 1K4YA 4JP2A 2IY7A 1YS6A 2H3HA 4BMPB 2XSZA 4N18A 4I7EA 2WDPA 1JR3E 3AVXA 3WGTA 1QYRA 1VI6A 3EGDA 2ORVA 1T8YA 2YY7A 4BBZA 4EDFA 4KIFA 3ZHSA 3ESYA 2OD2A 3OQ1A 2OCDA 3F9IA 3G5UA 4W99A 3L82B 4YJ3B 2YXLA 3RVDA 4XWOA 2ZXUA 1F0KA 1COWD 1KDZA 3MGGA 2HSEA 1XALA 1Z2PX 1YI1A 4MO2A 1Q19A 2I22A 3GYGA 2RCNA 2H1HA 4MUEA 5K6RA 4DJDC 4XVHA 1K3FA 3U3RA 1LJ8A 1T9AA 1SIOA 4ND8B 4EUHA 2OK7A 5FT9A 1NDQA 4EH1A 3T95A 3DHYA 3GGOA 3H9UA 5FA5A 4A1FA 4DLWA 1CX9B 6ADHA 4CG1A 1WCXA 1PJBA 1W0CA 4DPMA 1KTIA 4QPCA 1KQPA 2BKEA 4QDZA 3DOCA 2QMHA 4LXTA 1MORA 1FNSA 1IRIA 1V7CA 3CTMA 4CMIA 2IXBA 2CNDA 4FI3C 4HAXA 4KK3A 2RH9B 1W59A 1TUBB 5GMOA 5JW6A 2BF4A 1ZEJA 4EBBA 4OD0A 1I6LA 1G42A 4ZC1A 3LOQA 1NUSA 1EJ0A 1M1NB 2EOAA 3GGJA 3IS3A 4E11A 2Y1GA 3C1TA 4ON9A 1CUXA 4IICA 4TSFD 1U2EA 1UIMA 2I2XB 3OBBA 2Q5CA 2WZCA 3RBZA 3GAZA 3GLHE 3M3PA 3FE2A 3NVAA 3VYWA 4NAHA 4WDRA 1K7SN 1MHTA 2HHLA 4M7WA 3DEKA 2GILA 4B8YA 1M7BA 1A8HA 1XTBA 1H2ZA 4M0EA 4ARZA 2GUWA 1WNTA 4UTVA 1SOVA 1JHMA 3A7DA 3RVRA 4ABTA 2WJIA 1J8DA 1W4ZA 3GEIA 4JLDA 1BMDA 2J9GA 1KZ7B 3SK0A 1P17A 2VA8A 3GT4A 3QY9A 1MTZA 2Y2VA 1KAEA 3GEPA 4NQRA 3CKYA 3N5CA 2DUMA 3G1WA 2QY9A 1YI8A 2O14A 3JD0A 3U31A 3DL0A 1NI5A 1ZMXA 2AJCA 3D4BA 4U1RA 1SZCA 2F9FA 1W52X 3FTQA 3QP9A 4RKYA 4M0DA 5DASA 3RRBA 4B82A 5HZHA 5EIWA 3EGEA 1KYQA 1YDMA 1YVRA 5GJWC 1GT91 2BFWA 4MRVA 4BE9A 3FNHA 3PNVA 5U9CA 4MHSA 4EHHA 3AKZA 4F4DA 5CXQA 1PX0A 2JFFA 2MSWA 5LOVA 2I33A 2ZTUA 2ODQA 4J76A 4M7PA 4ZOEA 1PEKE 3N58A 3P9SA 3EPRA 2OEPA 2QVLA 5LQCA 4H7KA 1DO8A 4D99A 4NL4H 4AZ0B 4OSPA 1CHDA 3CRQA 4UHDA 3VSDA 1HNWB 2GB4A 2JC3A 1LQTA 1AQIA 4O3FA 3KB8A 2O5RA 4X92A 5HK8A 1YBHA 4GPEA 4RGVA 3ZWKA 4ZDKA 3SSAA 1V8BA 3TLZA 1YL5A 1AD2A 2GARA 2YFQA 3PFIA 4YAIA 3VA7A 3H2KA 4GI2A 4Z1OA 4QGBA 4HY3A 2P3OA 4X3PA 4PG6A 5SZJA 1TVCA 4ZAXA 4ZT4A 1ZIYA 3U7HB 2H1SA 3II6X 3AINA 4HFMA 1WE2A 2XB4A 1FVHA 4U3JB 5GOTA 4RK6A 5BT9A 3I4FA 2AFVA 4TWRA 1BVHA 4KG7A 1FXWF 2EGUA 4L4XA 4QDTA 4WESA 1BHJA 3QU2A 1NATA 2BFDB 3KLPX 4MUFA 4X8LA 2ZJ2A 5CJJA 1DAGA 5GOZA 4TTJA 2HCTA 1ODTC 1Q6YA 4II2A 3EH2A 4LHWA 4KRYA 3SVTA 2NYRA 5EA2A 4A82A 5TQ2B 2QTMA 1JDSA 2G25A 1GDDA 2PXHA 1R00A 3PEFA 1KYXA 4J0QA 4P4SB 3BTOA 4G09A 4ERXA 3KQLA 1RRVA 3L7NA 4GPAA 4B76A 3EIXA 2VLIA 1JDTA 1E3EA 2OY0A 2ONZA 1FDIA 1I3OA 1TMGE 1ISFA 2P7IA 2W2KA 4WPGA 1XDBA 1R4MA 2IPXA 1HL3A 3WGJA 1O54A 1R37A 3OE5A 2WYWA 2BMWA 4GRDA 4LNAA 4UTXA 3TF5A 3MA0A 2ZIFA 1UAGA 3CBGA 5ED4A 1FP4B 1AA6A 2NMVA 2QRHA 1SA0B 4R69A 5LB4A 4X3OA 3TQTA 4AF8A 1UFQA 1MABB 1Z5VA 2HY7A 2HF8A 2R00C 2XYRA 5EPUA 1XO1A 2PMCA 2QYHA 3FMGA 1BVUA 1L5HA 3BCRA 3S27A 2XMSA 4CF7A 2CLLB 2IELA 4TVSA 3PXGA 4C0KA 5DGDA 1J8QA 4TWJA 3O90A 1OYYA 4XDZA 4V02A 3VO9A 1JH9A 1U9JA 4GPD1 1WSAA 4HTAA 3IVMA 4GXRA 1MG0A 1U2PA 4MK4A 1E1DA 3W6UA 4TPKA 1UZMA 4NZMA 5IMSA 3B82A 3WJ7A 1AQ6A 4CTJA 1OWPA 3NH6A 5GQSA 4MV8A 3LXXA 4OKSA 5MN5A 4QJ5A 2P4EA 2O05A 2ZTLA 4AUKA 2CDAA 2P41A 3LX8A 2ZI3A 3B78A 3VX3A 4GM1A 3B5EA 4ZQHA 1GSAA 5JAOA 1NVKA 5IABA 5B58T 4KWHA 1HE4A 2A0FA 2G9QA 3OD1A 4RGYA 5ALVA 1T15A 3DZBA 1ZO8A 4JB0A 3G2QA 3P2OA 1G21A 1CC1S 4GVXA 1SUPA 2JHAA 1OOEA 2ERYA 1M2VB 4PYKA 1ZINA 2ZJBA 3PR1A 3ILVA 4IP0A 1TU0A 4QDOA 4EMUA 1KL7A 3HSSA 5K8CA 1C9DB 1CY2A 1DAPA 1SBYA 3NJRA 4FFDA 2EX4A 4I5FA 4LXUA 1GLVA 4DSTA 1GZHB 2J4DA 1T1GA 2XV1A 2PRSA 4C0LA 4DDVA 4RDXA 4H59A 1IZZA 3OQBA 1Y3AA 2A9KA 1VA5A 1ECLA 2ZATA 4XWYA 4BNYA 1GEGA 1QVAA 1QZTA 1XA4A 2J5QA 3AEUA 1A71A 3HUDA 4CG3A 4EG0A 4ZYTA 1JSLA 5C4GB 1XTQA 1WV0A 3TXYA 1TAUA 4ML3A 1ZH8A 4KBGA 4MQMA 3WHKA 1YAJA 4KWTA 3ZDCA 1GTMA 4ZI7B 1R0WA 1RWMA 2NZVG 1MOZA 2BONA 3N0XA 4RV4A 3V8BA 5I7UA 5HZKA 4LC1A 2XZTA 2SKCA 3WDKA 2G4VA 1ODSA 1JXQA 4V39A 3EPHA 1YB2A 2H11A 3T94A 4QOEA 4BLWA 3O03A 4G0WA 4BMSA 3LP5A 2CHQA 3ROQA 4AS1A 2C7VA 1SB8A 3L7OA 3CLHA 1NPTO 1SVIA 3C3PA 4YNBA 4MI1A 4ZAVA 4YMSA 5IDXA 5JNLA 5BOSA 5KU1A 4OHYA 3RNLA 3NOOA 1EB9A 4F38A 1UT6A 2W2TA 121PA 3U6KA 4O4LF 4BVGA 1F6DA 5IBPA 3OZCA 2PZFA 2B98A 4BIIA 4Q1AA 1REQB 5ILQA 3RWOA 5JSZB 3W5UA 4N0QA 2YDXA 2O8EB 2G9VA 3PQ6A 4QUHA 1XXLA 1W46A 3I3SR 2RARA 4OYLA 4UAUA 2K7FA 4MMYB 2I6GA 5LOVF 5FWXA 2K2WA 1PR5A 2PMBA 4G0ZA 1NPDA 4DV6B 3JQ9A 4EQ6B 4O33A 2DYKA 5ALDA 3UYLA 3TMAA 1ZCZA 3RG8A 4UCWA 1P2GA 4MR8B 5B1SA 2NUAA 3L5OA 3NONA 3EHDA 4YAUA 1QQ5A 4JXXA 3G9UA 4ZQIA 2XCOA 1GPYA 5BUCA 3CO0S 1IXYA 1T0UA 2ADMA 3IMFA 3HUTA 5FUBA 1GCUA 2LKCA 1E96A 1GKIA 3UGTA 2RK6A 2Q5QA 3F96A 2W6IA 4F72A 1ONSA 5M5BA 1E7WA 1X94A 3AP1A 1SUEA 1P2UA 1YBFA 3HC7A 2BJVA 1HLDA 3PHCA 3VPFA 2RHCA 4BTVA 4BTEA 3QLVA 1NF8A 1PTKA 4HRYA 5E8RA 3DKIA 4CMJA 3VO8A 4XWWA 1AUOA 4PQYA 2BEWA 5CU7A 1JDUA 3UA3A 4N0DA 4G1BA 3EXHA 3UT5A 4MS3A 4JVOA 2OFFA 2YV2A 4HG2A 4ZALA 1Z6YA 3HWRA 3QLUA 4FKMA 5JO9A 1OD6A 3CW9A 3GQVA 3AIIA 1E6UA 3LKZA 2GCEA 3T7SA 2WZQA 5A3VA 4AG5A 4WBSA 2QSUA 1IQRA 4OAQA 2Q4BA 1JYFA 1THTA 4WVFA 3N6RA 4CM8B 1OHHA 2HF7A 4K6CA 1WCIB 2HLDD 4EJSA 4GBMA 1Q22A 1DBQA 1DC4A 2F9MA 4XVUA 1MO2A 1CZLA 2I4TA 1EFLA 4FGKA 4UJ5A 4BDTA 1EHYA 4E5MA 2VNKA 3GFOA 3BA6A 1NYTA 2A58A 4ZEMA 1C1XA 2FWRA 3KT8A 5TMDA 1S2DA 3U3KA 3MT7A 1SBZA 3EK2A 3HVIA 5ALEA 4QULA 1XAIA 2IZ7A 3LTEA 4C4TA 1Y4DE 4W5HA 2Y71A 2RHBA 3ANLA 2WU4A 3FPEA 3NHWA 4BEWA 3FTDA 1LK0A 4NJOA 1FXUA 2XGMA 5CIWA 1OFHA 4ZVUA 4NYIR 4C2AA 5BV7A 3F8SA 2PE5A 4JEMA 1EIZA 5G4KB 1LDNA 4WCFA 3IE2A 1L7NA 4FDUA 2FZ4A 4NU6A 5L3SB 5DBEX 1DJQA 3THWB 4ILEA 4I55A 2AD5A 4BVFA 2QSZA 3OX2A 4I6EA 1P61B 5ADWA 1GD1O 4H7HA 5JOQA 4JJ6A 2GS9A 1NWCA 1GGJA 2EYUA 3QX8A 4IDFA 5JZBA 1DIOB 1HURA 2G83A 2GAIA 3IT3A 5LMZA 4HLQB 1LPAB 3HBJA 3AI7A 3N3BC 4TL6A 4LDRA 4LF9B 1PFGA 4G5SA 2J9XB 5KVQA 4ZCRA 2XX3A 4JJ7A 1APBA 4E12A 2OP1A 1U1CA 2JLZA 4UHHA 1P1JA 4GVLA 4F56A 1JIKA 1WXXA 2O8DB 1A50B 2Q6KA 4QPPA 3VHXB 1QE5A 2IU6A 4F3CA 5SZHB 3HZHA 4R51A 1Z0ZA 1V7QA 3QU5A 1JI3A 1KFJB 4BTLA 3QWIA 4WKGA 3DEIA 1YI0A 3EF0A 5ADUS 4K28A 1KOFA 1A2OA 2ZWOA 1J99A 1J0DA 2B4RO 5JCPA 1ESCA 1JT2A 1JKMA 2W2NA 4H4EA 4WY5A 3I12A 2IE8A 3E8SA 3F67A 3L0BA 1YHZA 4REMA 4MKZA 3ILHA 2PQ6A 3L7YA 2WDZA 2BAGA 4JQSA 3NP9A 1PVDA 1EXNA 2CUZA 1VC2A 2J85A 1OI3A 4O2LA 5DSZA 5AW5A 1I1QB 4UFOA 4Z2AA 1CE8A 1H8HA 4JUDX 3QENA 1ZJJA 2QN2A 4JWTA 2NP6A 4K8OA 1J5PA 4J49A 2H7CA 5ALRA 3GIWA 3KSMA 4N0EA 4P81A 3Q9SA 4MLPA 3E22B 3GT0A 3AXSA 4B0PA 4FN4A 4EO4A 3W5AA 3JSAA 1OV4A 1Q1AA 3DLCA 3FTCA 3WBBA 3RAFC 3GDFA 4K9KA 3IVRA 4MW9A 1USUA 3T4XA 1QTRA 5FUXA 2BHTA 2ZYIA 3AHJA 1MQSA 4ZVMA 1RWNA 2WHYA 1GL3A 1YZUA 4CIAA 1N78A 5A3RA 3GLVA 1V1MA 5KPJA 1ISIA 4MTLA 3TZCA 5IFLA 4XD7A 3FCUB 1GPJA 3DV0A 4D02A 3TSWA 1IVYA 2XXAA 3ZE6A 4Z54A 4N5IX 5ENVA 3AYXB 3KEOA 4RW0A 1G9XA 2NU8A 1FFBA 3FKSA 4DLXA 4X61A 3DXXA 4L22A 2LWIA 4PG4A 4B3JA 3O4RA 4QVGA 1GZ3A 2B99A 1ZI6A 4MWDA 2OWEA 3H2IA 2BMJA 4A27A 3MM4A 2X8JA 3AJEA 2QVZX 4ALKA 3ENQA 3ETHA 1NURA 1DUSA 2V4UA 3K1AA 1RPTA 5A3JA 3LY9A 3REFA 3AHGA 4J9UE 4MKFA 1N2XA 4PBTA 1MVOA 4YP7A 3EFBA 5CB0A 2C88A 1JDVA 3VR6H 3WBFA 1HYGA 1PL0A 1Y1PA 5T6BA 2EZUA 3Q7QA 4NZPA 5CVCA 5EMMA 5I8WA 1G18A 1T5LA 2WA1A 3CMMA 1MAUA 3L7BA 4NSNA 5EMKA 3TLEA 4E13A 3ZGOA 2DRIA 2ZU6A 4O4HB 3ZHBA 3SDSA 3OZFA 2IYEA 1BCSB 2YIJA 4M38A 1FZQA 1X9IA 2Z1NA 4RETA 5HBRA 1OLUA 5B37A 3V9AA 2GO7A 1U94A 4R68A 1K5PA 2C5GA 2JLSA 4D92A 1XYGA 2OBLA 2GBPA 1TF2A 3EZYA 1IIBA 4Y6QA 2COEA 1TJNA 3C4VA 3CJRA 5EFOA 4BEJA 4TYYA 1WUHS 2J7PD 1RLMA 3D2BA 3JU3A 5B2FA 2PGXA 2H1CA 4B7XA 4A26A 4HDNB 3H5WA 3PXAA 4QAJA 4NU5A 1QIHA 1G2QA 3F47A 1Q21A 3ED5A 2AFHB 3QSGA 4IDPA 4UM7A 2GASA 3MLAA 1J33A 4NEGA 2C8VA 1E9FA 4FEEA 4GKBA 4JQOA 2V3CC 3IAXA 5PGMA 1SUCA 2IUUA 2Z2KA 1MVNA 4F21A 1B7GO 2KSQA 3B9QA 1I5RA 3FPJA 3QF4B 4DCVA 5KTRA 4L0CA 1KMNA 3I9LA 1QHSA 3QPVA 4JGGA 5F1OA 2I6FA 2QNIA 5J4HA 1XL1A 1RAHA 1HM5A 3ZS8A 4H7IA 1XQ6A 1X7GA 1E58A 2IXDA 1F48A 2ZSEA 1FYWA 2JGEA 4O4IB 6REQB 4WA8A 2YIVX 5AIAA 3AUXA 3OOEA 3ZHYA 4L9SA 1G20B 3W1EA 1MH1A 2Q7XA 3SEQA 2H1FA 2X4GA 4J4TA 3BEOA 3GAFA 5KS2A 1F60A 4EK9A 1V8FA 4FBMA 1MO5A 2MDTA 3IQHX 2F00A 4JROA 4I55F 2GA9A 3SBEA 4C3ZA 2ASEA 4QHYA 3E81A 2HSGA 3OU6A 1FJ2A 4L85A 4Q9JA 4KAAA 3FHLA 2J3DA 3OFJA 5DX1A 5IFKA 4PLYA 3BD8A 2P79A 4CI0B 4EAAA 1KSHA 3QHPA 1V47A 1GFIA 1F0NA 1PZFA 5D7NA 4ALMA 2EP8A 4KAJA 1Y5LA 2IXFA 2OCIA 4MUBA 4YAOA 1QIJA 3CLKA 1VMEA 1Q91A 3MRSA 4GD3Q 5AQEA 3SQOA 5IJWA 1WDTA 3PDIA 1FX1A 4P33A 2A9PA 4BN5A 2R68A 3URKA 1YBAA 3C6MA 4FGWA 3WMRA 5DRTA 4C9BA 2UYCA 2Q49A 3SWWA 3R9WA 4FGUA 3R7WB 2IIQA 3H8VA 5ICGA 2AC4A 2YZ7A 1G5FA 3Q6NA 3RBVA 4REQB 4WACA 1LD3A 4DBZA 2R6DA 4FOPA 3Q8WA 4PFQA 3RRNA 1S89A 2EWWA 1H4TA 4JJIA 4XB6B 4AO6A 3ZHVA 4B84A 3NIGB 4DB2A 2EP5A 2PT9A 3GK3A 3KWFA 3UFBA 3GJXC 1NBHA 3UTDA 4KO2S 1ODJA 4LK3A 5CG1A 5GM2A 3MCUA 1S3FA 4QOFA 4DC0A 2C3MA 4KQGA 3GMTA 1R1DA 5MF6A 4P0QB 1EB8A 1USGA 3L01A 3IUMA 4V1CI 4DCCA 5IH3A 5E1BA 3RHZA 1YCHA 2PU5A 3CN7A 1SXPA 4R1NA 3M9XA 5DBGA 3JQCA 4JLSA 1C2YA 1DB3A 4KR2A 3EVDA 3ZJ5A 4X45A 3KZNA 3U48A 4EHLA 1B23P 2FEAA 1I1OA 3FYSA 3PB3A 3U4DA 1XD9A 4L7VA 3NM6B 1MR3F 3DFFA 1IHPA 4QG7A 1JKFA 1XWFA 2PIDA 3HVRA 3ZXYA 1I32A 1ZGCA 1PQYA 3NV9A 5DCUA 2X5NA 1Z2AA 3OQIB 1RCUA 4L5BA 4LGVA 5L6LB 3ADBA 4ZU1X 1XZMA 2J3LA 2SCUA 4NFSA 2OOSA 3V7NA 3U0VA 1X77A 5FEMA 5GJVC 3T5BA 1NBMD 2QD3A 2ZE8A 2ZS7A 3HXTA 2F64A 5F78A 2X7JA 1P9LA 1RHRA 4ID3A 3VKVA 3F78A 1FCJA 1ISGA 4UUPA 4TTTS 4B45A 3QEJA 1H2HA 4D4GA 4X0EA 1KIAA 3FYUB 5DM4A 1QDLB 4INPA 2IZZA 1TKBA 4DM3A 4UBNA 1DTWA 4I4TA 3R6DA 4FBLA 1KJJA 1QRDA 2ODPA 3AJDA 3Q0EA 4IIDA 4FD2A 3TLGA 4A0QA 4B7AA 3SLKA 5GGYA 3CNQS 3OCVA 2WBLC 2QN9A 4GSKA 4XYMA 1T5HX 3BMQB 1YL7A 2IT1A 2JGDA 1DS6A 3ILXA 3TBKA 4D6YA 4MZXA 2GGSA 4IGIA 1NM5A 1FC0A 2LCIA 4GIBA 3T34A 5J47A 3ODGA 1J7KA 2Q8NA 3AI3A 3C3XA 4N3GA 4V0MA 1XVAA 4W7SA 1GZSA 1PK9A 3T5DA 1IJKA 1R2QA 2GN0A 4A6EA 1GUYA 2YW2A 2NV6A 4BQIA 1J49A 1WM1A 3L4KA 4BHTA 1T8RA 4ZTBA 4FZ3A 1MZPA 3DTTA 3O2QB 4FCCA 3TIFA 1N36B 4FYPA 4UE3S 5BN3B 2WUDA 2W5UA 4YYEA 2D5AA 4YRFA 4NG4A 4X97A 4IL5A 3BXOA 1LUAA 1G5IA 2PVCA 2QP9X 2A35A 5AVRA 3PVSA 4Y18A 5DISB 4LYYA 4CEJA 3S1LA 4Q02A 5I5GA 2I91A 1WR8A 4MULA 1Y6RA 2QYSA 5IWAB 2PRIA 1L8LA 3T9AA 1O57A 4E7PA 2YOFA 3GDGA 2FXVA 3ZX4A 1KS9A 1VYVA 3ZZTA 4F7DA 3DEZA 1OFIA 1TEVA 3ANYB 2FVYA 2VHQA 4GBED 4M54A 3KKZA 1T4CB 4U6NA 4PR3A 4HAZA 1YCFA 1G64A 1XQYA 3PE4A 4OBXA 3W7AA 1XTZA 3GLFE 1WF6A 4WBNA 1OFUX 3M6WA 4QECA 2VUSA 5A3SA 4ZCSA 1ZRMA 1CUIA 2WF8A 1ZG3A 1EINA 4YCAA 5AKJA 5IZCC 3DMTC 1VL8A 5BYAA 1M73E 2O2HA 3K9CA 4FWBA 5F2EA 5JYBA 4GUAA 2WHEA 3WFIA 1H05A 1FUIA 5I47A 2PQ2A 3LBHA 5KYTA 4BPBA 3MQ2A 1U8ZA 2FSHA 2EIHA 3V4PB 1YASA 1G8AA 2ZI9A 3R5XA 4MKRA 4OFWA 3PT9A 3HCAA 1SKAA 3GLIA 3W8NA 2QQGA 5ELXA 1U0TA 3ESRA 3P2JA 2ZE7A 3VOTA 3NM5A 1CQIB 2O4CA 3I83A 4S0ZA 4QTYA 4GE3A 1NNLA 2IUTA 2X6QA 1L7RA 1Y63A 2RBKA 1X7XA 3K0AA 2ZAGA 2W2LA 2WJJA 2OV6A 1RABA 2H5LA 2UYOA 4M86A 4TRRA 1DBVO 1GNSA 1A5ZA 1T1EA 3SY8A 3W3AA 1U6IA 4I1PA 5EZ5A 1AXRA 3IL2A 2WM8A 1ZVJA 3RAPR 4EG7A 1NBME 4HGOA 3GEGA 4JI7B 1QOPB 2BSAA 4ZIRA 3U5ZB 5BVHA 1FVOA 1AA9A 2J6HA 3QQ5A 4GRAA 2QMZA 3LD9A 5ULLA 4V2UA 4ZDWA 4D9FA 4AB1A 3H7IA 5CDYA 1SD5A 1LB1B 2C5FA 5FOTA 4R0NA 3JVVA 4EB6B 2QW8A 1GNTA 4PHCA 4YCJA 2G3YA 3Q0IA 3GVCA 4ZPJA 2HGZA 3A25A 1TFRA 5LP6C 3KQNA 3MMZA 3PTZA 2HU2A 1SVNA 2W6QA 4QRDA 1Z63A 3C45A 3HPQA 3R3ZA 4DXAA 1U1DA 3E53A 3DE4X 1VKJA 4FB5A 1KSGA 5HUHA 3AW9A 5JTUA 1AXGA 3R8CA 2V7QD 2VL7A 1VMKA 3QYJA 4PSVA 1CUBA 1EVKA 1V3UA 4Q3OA 4UDOA 5ESXA 1RTTA 3PV0A 3AGPA 4KITB 1JEDA 2H3EA 3HKEB 5JH7B 2DERA 1M0SA 2II6A 4TV9A 3RT7A 3G68A 1ESZA 3JAKA 3G2LA 1PNQA 1QHXA 2I3ZA 3H5RA 3COJA 4XYGA 1T5SA 3AVTA 1Y3DE 1N2CE 3STWA 4WKPA 1EDDA 4IIUA 1F5SA 1H94A 2OESA 1NSYA 5IBQA 3U62A 2BFFA 2FK8A 2PX6A 1VBMA 3PJDA 4TXLA 4J3NA 4DIEA 4RVCA 3OT1B 4JI6B 8LDHA 3OPYI 4CM6A 1JJVA 1SBQA 4PZPA 3T9CA 3H9CA 5K0LA 3FF1A 4BCDA 3N53A 4MRMA 3L6BA 4LBYA 4IO1A 5KTMA 4BGIA 2F4VB 2QBYA 3H6GA 4FLMA 2IW1A 4I4TF 3ZLVA 2RGCA 1E8NA 5LLSA 2CJPA 4LJRA 1WW8A 1WVMA 4F4JA 2O59A 2PEZA 1H2EA 3WMXA 1PT7A 1ZNYA 4DEXA 1FU4A 1SCAA 3RSLA 4DMGA 2P40A 1HE2A 2GTIA 5HQ3B 2X86A 1JI0A 5TGZA 3D3WA 3NBUA 5C4MA 1XD8A 2RAVA 4PCLA 4LPKA 3GRUA 2V58A 1JHYA 2RHRA 2Z57A 4HXGA 3RC3A 1X9HA 1R6DA 2WIJA 4CM7A 3IP8A 2ZAIA 5L3VA 2OHXA 2VLBA 4FN5A 4L9RA 1BMTA 1DO2A 3BB3A 3LX6A 1VL6A 2PMEA 3KVOA 1MEOA 2QHXA 2VKQA 4IH1A 2A5FA 2CUKA 3VU3A 4RKWA 3L0DA 4FMDB 4RANA 3M6VA 4YUXA 3H5OA 1ZKDA 3CF2A 3PQEA 5F9FA 3GFGA 4W8GA 2DR3A 5IDYA 5K2MA 3EWSA 1P4AA 4K81B 1USVA 1M5UA 1XAGA 3SHOA 3B8HA 3IESA 1XLTA 2GTHA 4BFTA 1NI4A 2VNJA 1HEYA 5CG2A 3G82C 1Z34A 2F8LA 3WGMA 4ITRC 4QJ3A 1DBRA 1NRIA 2AG8A 3C4JA 1TC1A 4LDZA 4EY8A 1HNXB 1EEXB 3OQPA 1M1ZA 4YYZA 2GPYA 1Q6ZA 4E2ZA 2GZMA 2QIPA 2HI0A 5BNTA 4CKEB 2JJQA 1EFVB 1IXSB 4MAAA 2OKCA 1NLUA 5JISA 1FEZA 4MZDA 3SS7X 1V5WA 3JS5A 1TCVA 1JYEA 2XGGA 3RKUA 3RUFA 1WZEA 3SVZA 2FYTA 4NJMB 1G9TA 2WMYA 3F8WA 4WBNF 5JCXA 2R66A 4FINA 4MEBA 2N42A 2V1XA 2C9ZA 1B26A 2X7XA 4OQFA 3SHFA 2PRJA 4N03A 5A71A 1VA4A 1V1JA 1YDFA 4U8GA 3RWMB 5IH7A 2VCEA 3EG9B 4Q4DA 3ZKWA 1SZDA 3GX1A 1YD7A 4GBGA 2OAP1 2V8BA 1U8XX 4JFAA 2RFLA 4NMLA 1F2DA 4NY1A 3NIWA 3A1WA 2FLVA 1Z7BA 4HK4A 1Z5NA 1TL7C 2O5CA 2E4XA 4R05A 4XA8A 1EWRA 1JGTA 3S2EA 2VQ6A 1W4CA 5H02A 4MUYA 2ETXA 3E9RA 5IZ4A 1F2UA 1HDYA 2HH9A 2CVZA 4LOJA 4RHCA 1WSWA 1N2IA 1OAAA 4DQ0A 3IDSA 4B6FA 1UPUA 4UUNA 1TQ4A 2DBRA 2QVGA 3I73A 2PNJA 2OPHA 4RTRA 5EYPB 3DULA 1BJKA 1V5GA 2OE2A 1N6KA 5I9NA 5L3QA 2ONCA 2C07A 2Q1TA 1E1RD 2QQFA 3EIHA 3BMNA 4G1MB 2BF7A 5B1IA 3THYA 2XDQA 3NHSA 2WTNA 1H4VB 3O6VA 4I8DA 1FTYA 3O2NA 4JUFA 1TT7A 3CUEF 4JC4A 1Q15A 1IOZA 1UXIA 4MR7B 2I6TA 4F2DA 5HX7A 4RY0A 5TRTA 4JKIA 1BO6A 1FPMA 3EVGA 1AV6A 1C0IA 4DQXA 2RGGA 3RRYA 3PUJA 3LXUX 1NVUQ 3TO5A 4AW9A 2R47A 4ND7A 4CF6A 1FQOA 1YJ5A 2REQA 3G8CA 3QE4A 1LCIA 1T9DA 1F0YA 1NVWQ 2GCOB 3DWGA 4HAUA 4ZOQI 4NPHA 2AFIA 2QQ0A 3EEIA 4CLEA 3I9NA 2DFLA 3DWFA 4W9NA 3AEQB 3BXPA 3ZG6A 2WMOB 1UZNA 2IJGX 2OB2A 2ZKIA 1IH8A 3SC4A 1XZJA 4R5HA 3M4YA 2AQHA 4YQYA 2JFBA 3H4TA 3UJAA 4KLAA 2I3GA 2BI4A 3AY3A 4TL7A 4YMTA 2EWMA 3C3AA 4MO9A 1J4AA 3ZDYB 1T3TA 4QDJA 2OCYC 3KIPA 3H04A 5D84A 4TN5A 1FA9A 2HO5A 2Y76A 3KL4A 5DM2A 4DR3B 3PNOA 3PE3A 4A2QA 2XXJA 5HFJA 3NM4A 2NACA 4R40A 3TB4A 5AESA 4AWBA 4AROA 4B3DA 4WWHA 2MMGA 2V0CA 3FZGA 3RHSA 4D4IA 2JK0A 1BDMA 3LV8A 1G8HA 2YVQA 3DP9A 4K6FA 3ZWDA 1WULS 5I4BA 4RFSA 1SXJC 2ZITA 1TLTA 4L2IA 4RZ3A 3FBWA 4IGAA 4GLOA 7REQA 3HKDB 1XI2A 4UJ3A 1V3TA 4PQGA 2ECFA 1T6YA 2GR9A 2X42A 2OD9A 5T4BA 3I52A 4KO3S 4XXHA 5DHRA 4CQJA 1FLNA 3LUGA 3V1YA 3DVAB 5C8YB 3E5RA 1H0KA 1ZH6A 2N1BA 1WDWB 4GMXA 4M89A 3JTMA 4OOEA 3SD7A 4ZT5A 1F1BA 2KBEA 3UFXB 2VQFB 3WGQA 5KWEA 3L7IA 1L8QA 3OLWA 4B4VA 4QBIA 4YMUA 4MS4B 4B5KA 1A96A 2B7LA 4C4XA 2PRKA 1JVNA 2H57A 1FVFA 1W7AA 3Q3GE 2AJDA 2W6OA 1H8EA 3MUNA 2H2FA 4C0BA 5GJBA 3CONA 3OD5A 1Z83A 3K5IA 1CYEA 3Q6MA 3S8EA 1YK0A 2V65A 1E5XA 3W4JA 3BCUA 3RTCA 5TPZD 4EITA 1Q0TA 4DV7B 2V6GA 3DWEX 5HE8A 3L0SA 2AK2A 1ZN2A 3GU3A 3HY4A 1V1RB 4HPWA 5A5EA 2JJ2D 3TLBA 2A9OA 4E07A 3EGOA 5BPFA 1SCUB 2EGHA 1E0JA 1CS0A 1V5IA 2GD1O 1L4MA 1OPRA 3DLPX 3BTUA 3QYFA 1YVEI 4L3OA 4NAVA 1RC1A 3QOFA 5EZSA 4LNUA 4QBFA 3RGGA 1PR0A 3U80A 5K6TA 1SCJA 3L06A 5DI9A 5KSOA 1ADCA 1NQTA 2J9YB 1IK4A 3EAFA 4RACA 3RVSA 3AOEC 3P19A 4IFTA 1ES9A 3EZNA 3TL3A 2HHAA 2V9ZA 3K35A 1S5PA 5HF8A 1L5GB 5UKDA 1N1MA 2Q2VA 3PPYA 4OLAA 1VP9A 4RPKA 2GBGA 2HJWA 3U4QA 1EG7A 2HAEA 1CFJA 3B7PA 2DBQA 2GN1A 1BE1A 3SQLA 3UJ3X 3ET5A 1EK6A 5H7XA 2QY6A 1H42A 1YR7A 2NXWA 3EIEA 3PR2B 1HUQA 3DE0X 2WTMA 4AULA 2WQ6A 3G0HA 5C8ZA 3I2FA 4DR2B 1F06A 1ZXXA 3L1UA 3W6OA 4X6UA 3AR9A 4YJGA 2B6HA 2DM6A 2Y0CA 2B69A 4OXRA 1Y7HA 2H17A 3DZHA 4P7JA 5ALFA 2V6BA 4WCDA 4DANA 2EZTA 1YJXA 3HLYA 4R83A 4IFEA 1KA9H 4ZCLA 5IHXA 4MR9B 2FDCA 2P69A 1UBFA 3LT5A 5E3IA 4BKMA 3D4PA 4RVGA 2NU9B 1I7NA 5BW5A 2GO1A 4INAA 5C34B 4MA5A 4R4JA 2F59A 3FA2A 3SMQA 1RP7A 4WZBB 4XKJA 3STUA 3VPHA 3FM9A 5K20A 3OJEA 1YIAA 1YQUA 2GBLC 2CFIA 3Q15C 1BS2A 3B1XA 1B8OA 4IDBA 1ISPA 4RDHA 1NUAA 2C1XA 2NOAA 1M2OA 5KYNA 3BDIA 4ZO9A 3ENWA 4UQOA 2BEUA 4G8CA 4U39A 3OKFA 3H2JA 1G0NA 3N05A 3OMWA 3MJRA 3OF3A 3Q5EA 4W5WA 5ALMA 1K6EA 5WRFA 4AN4A 4IIGA 1NVFA 3PUKA 4PRYA 1PT6A 3I8OA 4JJAA 3QELA 1HOXA 3UW3A 2M9MA 4LDQA 4EX7A 3TSOA 5M34A 1PAUA 4IS3A 2GA8A 3F90A 5K4AA 4AZWA 2VTVA 4TLAA 4OCZA 1DTEA 4EYKA 1OXSC 1YRBA 3O8BA 1ESMA 3SF8B 3LOUA 2OMKA 4ZVSA 3VSCA 1IE3A 1TXGA 1YB1A 3X1YA 4C07A 1RP1A 2HV9A 1BS9A 4IJWA 3P9NA 1IUOA 2HJSA 2Z3VA 2JFUA 3GH3A 3PC3A 4G23A 5AUPB 1QGZA 4IINA 5CAEA 1C41A 2A86A 2NV0A 4MINA 1YZGA 5AVTA 1U0RA 1XE3A 2OC9A 1KI1A 2UUPA 2XHZA 2G28A 4YRTA 5JBQA 4URFA 4ZANA 1HV8A 4X8OA 1B6RA 3DBRA 3WVNA 1HMPA 2CDRA 3R77A 2HK9A 2VKTA 2JF0A 4CQMD 3COVA 4NWIA 2QLFA 4UHCA 4H1UA 4HB3A 4RX1A 1AKMA 4X94A 3W04A 3NGMA 1Z16A 3DCNA 4KQ2A 2COUA 5L9AA 1V2HE 4YP0A 4KEAA 2ZUSA 2ZB8A 2IUYA 1JU3A 3F9CA 3QWFA 5AJYA 1ZH4A 4B3RB 1Y42X 1YQEA 2POCA 3PWTA 1ZX1A 2Z30A 3RTBA 3RRJA 2CJWB 5CVVA 4UOZA 2PX2A 4KNWA 5MGBA 4QARA 1N0IA 1KEKA 2C2MA 1S8FA 3FDFA 2XECA 3I6QA 5KI6A 1P73A 4FX2A 4BRUA 3FMPB 1MOQA 4DT1B 2ZE6A 3N28A 1EQAA 1CDZA 4LXQA 4KSYA 4Q03A 1GUDA 4NKRA 3A4VA 4LFAB 3MS2A 1DTSA 1HRDA 3DVSX 4EKDA 2LPMA 1O2DA 2RKWA 1TO6A 2X4LA 4NV1A 1FMLA 4EVQA 3CYFA 1JPJA 1CEQA 3UCFA 3KVVA 1BA3A 3PXBA 4O8CA 5I7HA 1JHPA 4D0SA 4BNDA 3ESAA 1VGVA 2JCVA 4CEHB 5IRCD 2H1VA 2Q2OA 3K1ZA 4G3XA 4OIMA 4YT2A 4BNJA 3B1VA 3MRTA 4WK4B 1T2NA 1U90A 3QNMA 2GHRA 4WW0A 3RBXA 3EASA 2G7ZA 4B17A 3AR3A 3IB6A 5HK9A 2VJOA 2F9LA 1A8UA 2WVGA 3IV6A 3E5NA 3GZTB 2OHGA 5KX5A 2P9GA 2ZGVA 1JAZA 1C3LA 1DWQA 3OLVA 2WKPA 3RJ9A 2R5WA 3HR4A 2ZG6A 2GCPA 3KLBA 3KB1A 3RSQA 4P58A 1L5QA 4LJLA 1TJ5A 1AHPA 3H05A 5CVEA 1AUXA 1C9NA 1Q44A 2LXNA 2PO5A 2FGJA 1G4UR 3BK1A 3MFYA 5LYYA 1TZ2A 2XUKA 3H1FA 3RLFA 2EKLA 1NQAO 5DXFA 1TO1E 4EHAA 2BJHA 3HBLA 2JGKA 1VIMA 2KPOA 2HA3A 3LFHA 3I1FA 4GAEA 3NZEA 4AJPA 4X20A 1P5HA 2AFRA 3EQ7A 2IYYA 1Y5NA 4JUCA 4LBZA 4MP3A 1FFDA 1M8KA 1UBUS 1CY0A 1K75A 2XITA 4K9OA 3VR6A 4PAWA 5GONB 2CEAA 3M6UA 3BXGA 4S3MA 3BRWD 3TH5A 1RXVA 5C0OE 2GPBA 5IM5A 3IAM6 3RUIA 2XHEA 4HZUB 3V4SA 2NVOA 4QRHA 5EUCA 3M6XA 1AO0A 2B3TA 2WSIA 4K7JA 5FTWA 4ARAA 5H8WA 1UFKA 3W5JA 2DLCX 2QTHA 4C7MA 4GR4A 5K0SA 1WMSA 1W0JD 1BRTA 1TO2E 3BRSA 1XRSB 4D79A 2VTKA 3LHKA 3LCVB 1UPFA 4BV8A 2FPGB 5AKZA 3I32A 3OMXA 4IF4A 3UCEA 4TYQA 1VE5A 5DZSA 1HNNA 4Z0NA 1ZFNA 2Y99A 1NG1A 2OZLA 3B13B 3MINB 4GVPA 4JJGA 4O6VA 1SJ9A 1ZIPA 4O4JB 4C08A 3DZCA 1QO0A 2DETA 2PZLA 5ECWA 4KR9A 5FKJA 2JFQA 4MAMA 1TVKA 4A23A 2ORIA 3TDNA 2QF7A 1TYBE 4WLEA 4PAMA 4E51A 1I2DA 2V45A 2IH5A 3BDAA 5BRAA 3D0OA 1W1IA 4DIFA 2AWOA 3WGOA 5KTTA 1L1EA 4ARIA 1BYIA 4R9RA 4JBGA 5LL6P 5FPTA 3R0XA 3RS9A 1KDTA 5K8IA 3R6GA 1HT2E 2H0RA 3GVXA 2I8CA 3RCBA 1WBJB 2A5YB 1HLGA 2O4UX 2R1VB 4X9XA 3T4UA 1P1HA 2ZYVX 3NP7A 4E70A 4L9WA 4ZT3A 3NDRA 5ITVA 2NUPA 2FN4A 3NEYA 1XZGA 4BJHB 3P0EA 3VDQA 3PXEA 4HVAA 3TEFA 2FP4B 3E0XA 1PFQA