4C3OB

Structure and function of an oxygen tolerant nife hydrogenase from salmonella
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
263
structure length
263
Chain Sequence
b'KPRTPVIWLHGLECTCCTESFIRSAHPLAKDAILSLISLDYDDTIMAAAGQQAEQALADVMREYKGNYIVAVEGNAPLNEDGMFCILAGEPFLEKLKRVSADAKAIIAWGSCASWGCVQAARPNPTKATPVHKLITDKPIIKVPGCPPIPEVMSAVITYMLAFDRIPPLDRLGRPKMFYGQRIHDKCYRRAHFDAGQFVEAWDDEGARKGYCLYKMGCKGPTTYNACSTVRWNDGVSFPIQSGHGCLGCSEDGFWDYGSFYSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROGENASE-1 LARGE SUBUNIT
publication title How the Structure of the Large Subunit Controls Function in an Oxygen-Tolerant [Nife]-Hydrogenase.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. lt2
molecule tags Oxidoreductase
total genus 77
structure length 263
sequence length 263
chains with identical sequence D, F
ec nomenclature ec 1.12.7.2: Ferredoxin hydrogenase.
pdb deposition date 2013-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
B PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4c3oB01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4c3oB02
1H2RS 4UEWA 1H2AS 3RGWS 4UCXA 4KN9S 1WUIS 4OMFG 4UQPA 3ZE7A 5ADUS 1UBOS 3CURA 3ZE9A 4GD3Q 5A4FS 4UE3S 4CI0B 1FRVA 3UQYS 5JRDS 5D51S 1UBKS 4UEQA 4KO4S 1YQ9A 4KO1S 3ZE8A 3AYZB 4UCQA 1E3DA 4U9HS 4IUDS 1UBMS 1WUKS 5JSUA 1WULS 4UD2A 3USCS 4IUCS 4C3OB 4UE6A 1CC1S 1UBUS 1UBLS 3AYXB 1UBJS 1UBRS 3MYRA 4U9IS 5A4IS 4TTTS 1YRQA 5JT1A 2FRVA 3H3XA 4URHA 2WPNA 4KL8S 4UE2A 3ZEAA 5JSYA 3CUSA 1UBTS 4KO3S 4UCWA 1FRFS 4IUBS 1YQWA 4UQLA 3USES 4UD6A 4KO2S 3ZE6A 1WUHS 1WUJS 5JSHA 4UPVA 5JSKA 4UPEA 5A4MS 1UBHS
chains in the Genus database with same CATH superfamily
1RCFA 1USIA 1YD7A 2JGJA 3GLQA 1WMAA 2A0XA 2IY7A 2R4TA 1SR8A 3G68A 1E8NA 4OFWA 1Z88A 4EGAA 2UUCB 3IR7A 4YV7A 3QPVA 5EWMB 3CZ9A 3I8XA 1TUBA 1YR2A 1W25A 2VJAA 1R4AA 2W2XA 3I2YX 3QVTA 3R3HA 2XB6A 3TZ6A 4DLPA 5AVKA 2P77A 2RKOA 3DDWA 5KU1A 5TPWA 3O4JA 1QX3A 2JI9A 1AA9A 2G9RA 3H4TA 4NCJA 1A50B 1JIJA 4C22A 3DPUA 3OQIA 4UUAA 3MG9A 2Q62A 4X1OA 5JECA 2GPYA 2HHAA 2ODPA 1K7YA 3AJRA 4RELA 3R3ZA 3UY4A 4YRBA 5EJ9A 1ZN7A 3K7EA 3JASB 2I2AA 4KWCA 2E7ZA 3W2IA 5KO2A 4BGVA 1HA3A 4Q21A 3DE2X 3KV3O 3O4RA 5CFQA 5JIBA 4MI6A 2G8NA 1VMKA 2PV7A 2F8SA 1DQPA 1LVUA 1ZGGA 3VHXA 1C0IA 3MJTA 3CEMA 3BEOA 1Z36A 4MGYR 2FE4A 1LS6A 4RPCA 1TRKA 1LX7A 1Y5NA 5COQA 3RVPA 5JRDS 3JQFC 3ZZMA 1B8PA 5HF9A 3VPGA 4DABA 1CUBA 2OGTA 3EZYA 1IQPA 4QPDA 3OOEA 3B52X 3CUYA 3QU4A 2NPFA 3S7ZA 2J59A 2PZ8A 4AZ0A 5HDBB 1BWQA 2PLRA 3SU8A 1L8XA 3P97A 3OPNA 5G4LA 3V8BA 2QG6A 3IMFA 3KHSA 3W2EA 3KR2A 4AL4A 4RHXA 4C88A 3DBVO 1P73A 1T9CA 1LGYA 2C2GA 2HSGA 2OM6A 5C1IA 1A9XB 1JR3D 1W0CA 4LVUA 4Q1FA 3ROQA 3BWBA 4XM2A 4FWTA 3G17A 4E11A 1J1IA 3ESQA 1UAGA 2DYKA 2G77B 1MT0A 2O50A 3DKVA 5F7XA 5IASA 5H5JA 4O1IA 2Y0DA 5HMLA 2P2GA 3Q0IA 3GAMA 4AIRA 1MH1A 4HDSA 1YONA 4NMHA 5KMGA 3OM0A 3TMYA 5C37A 3PCTA 2IF0A 2YHSA 1ONSA 2JKVA 3T4XA 3ZG6A 4BMCA 3SFZA 2GPWA 1LSUA 3QBJA 4MPJA 2X8WA 4YWHA 1DCFA 1JTVA 1CERA 4DCOA 1GXSB 2FWRA 1KEPA 1RI5A 4ZTZB 2VEDA 4BMPB 2WJHA 2HQ1A 5AVZA 4N8DA 4U7WA 5FJJA 4UBIA 3JQEA 4QTZA 4JJFA 3LUAA 3WGLA 2WOJA 5AJXA 2BFCB 4NP6A 5ARCA 3UMRA 5GADl 5C31A 3AZPA 4PW0A 1C41A 2B69A 1WPRA 2A88A 3SXPA 4QE3A 3S2GA 2Q0QA 4LRXA 5ES3A 2RGDA 5AJZA 3DE3X 1JG6A 3JQFA 4RMGA 5D2CA 2VNAA 4QICA 1Z6PA 4ZEXA 1QF9A 4C9BA 1JHVA 3CNOA 3AW8A 3LQRA 3OOJA 4K87A 1W46A 1KBZA 1Z7GA 2B37A 3MS7A 4FDUA 4IQ0A 4MRNA 4CG0A 4TRNA 1LLQA 3WB9A 1ZMRA 3LQ2A 3QVJA 1M7GA 1VIAA 1VYTA 4BRUA 2FJ0A 4HB4A 1ZM2A 3E8XA 4RIIA 4H1UA 5TE9A 2FWAA 1W49A 1PNOA 1Z2NX 2R65A 4NESA 1L9KA 4X6UA 1SIWA 2AJDA 3RYCB 3DE0X 3QW2A 1PJAA 3IAHA 2HR1A 1BIFA 4CUZA 4AX4A 4X3CA 4XWOA 2XKAA 1GUZA 4OX9B 3CO5A 1XELA 2EARA 2XUGA 3CLTC 2R62A 2Z1MA 3ISTA 3EODA 4RO0A 2BHSA 2UZ4A 4P08A 4QOIA 3JYQA 3DT6A 3FNHA 4BRZA 1E79D 3ZDFA 2H57A 4E6EA 5JSZB 3L6BA 2B30A 3FMGA 3VPCA 4KQFA 1QH8B 2BFMA 2I80A 4KWTA 2C94A 2RK3A 2P6NA 4OJTA 2J30A 3OKPA 4DEXA 3TWOA 4JS0A 2TYSB 4FUTA 4R7GA 5G1OA 5IYZA 3FPKA 1CU1A 4N6GA 2GN2A 2GD0A 2JA1A 2OXIA 1Z63A 1NNUA 1R8XA 1P5HA 1SBTA 2G70A 1ZW6A 1FYXA 3OZVA 4IOLA 3RLFA 10MHA 4WXHA 4B32A 4MKIA 4O4JA 3IB3A 1BVUA 4B45A 2P1DA 5IBQA 3WLSA 1UBOS 1B14A 1CYDA 2B5VA 1TJ4A 2FX5A 3D4LA 3PT9A 2C5EA 3QEMA 4NJMB 1IWBB 5EZ6B 1GL3A 3WOHA 4CMIB 5IJ9B 2D2VA 3JALA 3WK5A 3VPFA 3N6XA 3SR3A 3VKVA 4X3PA 2JKYA 5J4YA 3TS1A 2A1TS 4I2VA 5ELLA 2EV9A 1O77A 3RYIA 5CLQA 1HFKA 1Z5ZA 2ZUDA 3NS7A 3W0LB 4D3ZA 4Y2GA 1I0ZA 3E3NA 5CFZA 1PNRA 3R20A 2GD2A 1Q19A 3EEFA 1MH9A 4S1PA 3EDCA 3E9DA 3QJYA 1Q1ZA 5DCLA 1DMRA 1NPYA 3AHFA 2JARA 2HDOA 4PGAA 3GLIE 2HU8A 3H6HA 4RJLA 1Q91A 3A2LA 1AIPA 3JAWB 3QE9Y 2C04A 2ORVA 2Q28A 2AVDA 1B3BA 2AMJA 4IOJA 2X7JA 4MCAA 3TW6A 1LK7A 1DEXA 2H63A 1QHSA 1KS9A 2MSNA 2P90A 1PFQA 2RGGA 3KT3A 4J91A 4JYPA 4M8IA 4B73A 2WT8A 3OUUA 4L72A 4W63A 3GT7A 5GV8A 2B2NA 3NI2A 4NHEA 5KYYA 3UBTA 3Q8KA 3R7WA 4WFJA 1PEAA 3HY3A 3LBHA 5CPBA 3AG5A 4ILEA 4O8ZA 1PDOA 1X0XA 3HYCA 5AHRA 3QVGB 5T7BA 4AWXA 5FHRA 4CL3A 4F2DA 1IZYA 3LOQA 4BCBA 1P77A 4AURA 4YPVA 3EVTA 3CRNA 2O1XA 3DW3X 3PYXA 1E6EA 2G4LA 3LHSA 3P9QA 4H9GA 1NW9B 4R4JA 4W1PA 4ZT2A 3OX4A 3V8MA 1ISIA 3NWOA 4AKEA 2HF9A 1PNQA 2RKBA 4NE7A 5K3SA 1XKQA 2VH2A 4N3CA 1JIVA 5HKAA 4C4TA 5K0FA 1DXQA 3W8DA 4RD6A 3S4YA 1A5BB 4X54A 5KSPA 1NVBA 3HC7A 1P2UA 3EGCA 5E6UA 5G0WA 3DOFA 1YRHA 4HZIA 2W6NA 3CVXA 4D9CA 1SVOA 2GTHA 2R8YA 3L7AA 2ZQYA 2A9OA 1JDZA 3LLVA 4NLLA 4R1LA 5FKJA 4B47A 2ZSFA 1G3UA 4RLSA 1Y7LA 5DM2A 3K9GA 7REQB 3V4SA 5F9FA 3D8RA 1VECA 4EG3A 1TMOA 3BN3A 1WDTA 1I5EA 4EK9A 1M2JA 5HUHA 3LT0A 1ZK0A 3KZOA 2JAHA 2ZB4A 4RA6B 1WCXA 4G4GA 1L1RA 1ZONA 1ONNA 2J6IA 3L7YA 5SYMA 2NU6A 3A6DA 3IUMA 4H6VA 4XTCS 5BN5B 3WGYA 4A1FA 4I3GA 1FQJA 3WB2A 1D6NA 3Q41A 4OXRA 4X6XA 3L0IB 4S3MA 4B3TB 4U4AA 1G16A 1LDNA 3U4GA 1A76A 3GRYA 4PLVA 4DG9A 4DSNA 3MCZA 1RYHA 4UM9B 5AUPB 4MROA 3PB3A 1O08A 2WU1A 4URFA 5IXJA 2IC5A 4XPIA 5KQLA 2C4WA 3RYCA 3C2QA 1ATZA 4C4SA 4GH5A 4J0IA 3QXHA 3QX7A 1OY1A 1P91A 1QFZA 3D0QA 3RVJA 3G2KA 1QGUB 2Q5HA 1OXVA 5DP1A 1CV2A 2H11A 2QTRA 1E60A 5EWJB 2X3FA 1KP3A 1LJ8A 4DBZA 3VAYA 4BMZA 3FCAA 4I6GA 4W82A 2YJ4A 3BTVA 1NVWQ 3PWSA 1Z29A 2C3OA 2JGKA 2TMGA 1DKLA 4W7IA 4DLZA 4MYUA 2XDYA 3L46A 5I4BA 2IEDA 4OM7A 2CK3A 3T7RA 1VLQA 2ZUFA 3CTMA 4OGFA 1XZFA 1VJDA 1UPAA 4Q7LA 2FN8A 3LX6A 3W9SA 3ZHCA 4Y1EA 4LPSA 4DNQA 3OM1A 4CLOA 2BWJA 2ILTA 4XCQA 5DTIA 4MW4A 2G67A 4Y2RA 4NCIA 2E4WA 3ME5A 3DNFA 3NTQA 1SHTX 1ZVQA 1KFKB 1NT4A 2MYUA 3A14A 2XCQA 3C7CB 4NENB 4BB5A 2D1SA 4PAGA 4AMZA 2RHHA 1PJTA 2WYVA 5CT5A 3F97A 3GG9A 1N7IA 3UMSA 1N6KA 1VLHA 3WYBA 2RGBA 1F0PA 2W37A 3RUPA 1JP7A 4G9GA 4URVR 4KK3A 3TH5A 3LYHA 4A16A 3OZIA 3ZV4A 4L07A 3Q7QA 3BIFA 2GZMA 1SCJA 2Q5FA 1SU4A 3MMPA 1E0AA 1PR9A 2Z98A 1HDXA 3NTOA 4H4CA 4DSAA 1SJ9A 5B2FA 1U7DA 3LHIA 3AUXA 3SJCA 3EOAI 1Y3HA 3QPUA 1YS2X 4JLMA 1QYRA 2EBHX 3PFBA 2H2HA 4K9NA 2D59A 4OK5A 5FUMA 5E4FA 4CWAA 4FMDF 2FUCA 3KD3A 1POXA 4F8JA 2ILVA 5TLSA 1J7JA 3ICOA 1G3QA 3G2MA 1DJMA 3RTBA 2PX0A 3R0VA 4QQRA 4W9RA 4CL0A 1IN6A 1U2TA 5HIJA 3TLYA 4MWTA 1NJ2A 1T8TA 4UVDA 2JVIA 3OFSA 4FSXA 1DKUA 4QJ3A 1OZGA 4M8NE 4MS3A 4NL4H 3SKYA 4IIJA 4Q9LA 4X60A 4RTMA 3FYDA 5IDXA 1K27A 1NLMA 3HCPA 3JQAD 3TTVA 1QNLA 3B6IA 1QZUA 3DMTC 2EG9A 4IHQA 1WXXA 1MC1A 4GWGA 2AXPA 3R5HA 4PC2A 2DC1A 5GONA 5CDYA 3IO3A 3ADDA 4URXR 1BMQA 1Z7BA 2CBZA 3KDSE 1VIVA 3QEOA 2FPWA 4OP2A 2RH5A 4IS2A 4OFBA 2QK4A 2FPKA 3TGPA 2JGIA 3I23A 5IC5A 5BO5A 4KV9A 2XYRA 2ECKA 3FPEA 3BKXA 4ADSG 1UPUA 2A3NA 1VBMA 1A98A 3B3JA 3O8QB 2XOEA 3PQ4A 1YU9A 1TVMA 3OVMA 4ZVRA 4YMTA 5C35A 2R66A 3LWDA 4IH1A 4MQFB 1UBHS 1NVDA 1N8SA 3GVPA 4XB2A 2E4XA 3C8UA 3WWYA 1QGYA 3RFTA 2ZDGA 3RREA 1I4OA 3ETHA 3HLTA 4AUMA 3T3DA 2A59A 2SHKA 3M8KA 5DISB 2HX1A 5FWYB 1X7XB 1UJNA 2B94A 5AW1A 1N2OA 4QYSA 1HNWB 3T3OA 2QZZA 2VYND 3IP9A 2XDAA 3UC5A 1WHSB 3RGGA 1ONPA 5B7NA 4FMDB 4QJIA 4YUZA 2IYEA 3LQ4A 1N36B 4RSGA 4M22A 5IG2A 4BXOB 3U7JA 1BWRA 4YJ3A 3NBAA 1VE5A 4MYHA 4MRVA 4EOGA 3IP5A 1V3TA 2Z4TA 1PGOA 3OU7A 4ZVPA 1E20A 2AA3A 2H65A 3F3SA 1H4VB 4DCNA 2IPLA 3DMTA 2IX9A 4K28A 1QU2A 4BLQA 4RVHA 2FSVC 3GH1A 1I4LD 3S81A 3T9DA 5L45A 2OCPA 4AB1A 5IKOA 1P6QA 1FSFA 1QYDA 2BFWA 1L4YA 4JYZA 1UMKA 3QYAA 3OWHA 4ERXA 3GD7A 4QUJA 1K3UB 3ODGA 5ALLA 4JBLA 1SKBA 4MLCA 3IMEA 4ZT4A 1V4NA 4ZVNA 2YIVX 2IZ5A 3AO0B 1XNRB 3USZA 2C29D 3Q9SA 4HNRA 1RPAA 5A3JA 1BE6A 3A6LA 3UXEA 1C8LA 1P2BA 2XMQA 3NUZA 1V7QA 5IVIA 3CVYA 1JILA 2XAAA 3I6YA 1D4FA 1SELA 4OHWA 4EA6A 5BOVA 1C9MA 4I99A 2AW3A 5BWOA 5HRCA 1U1GA 3BF8A 3GFVA 4BEWA 3TRHA 1BW9B 3LBAA 1C9DB 3BHJA 3IUYA 5F7JA 4DIDA 3HU3A 4FHGA 2RKWA 1XEAA 4DTIA 2IKSA 2P9CA 5FI3A 3GLGB 3USCS 4MX8A 1KYTA 3GRRA 3G0IA 1PJ4A 1E5DA 4TTIA 3BTSA 1QFJA 3UENA 1TFRA 4IFTA 3QVMA 4D46A 3L0YA 1HX7A 2QPLA 2EC5A 4Q3DA 4RKQA 1WDMA 2MYTA 1P7YA 1WW3A 2I2FA 2V55B 3RVLA 1E3QA 3R7AA 3L7OA 1BCRA 3SLKA 3UN1A 1W36C 1FTQA 4IRXA 1EHIA 2WM8A 4N5LA 3V7FA 4F2PA 4N18A 3QMVA 1FFCA 1I7LA 5ANRB 5J4VA 4YJHA 4ZO6A 4U7DA 3GLRA 4PS0A 3E03A 2W2OA 5KNLA 1EG7A 3TKAA 2P3QA 1OV6A 4LHYA 2WPNA 1PVDA 5FBKA 3ZZ1A 3HE3A 4DCMA 2WWTA 4B0OA 4KACA 3GDGA 4C6TB 3X1XA 1T1GA 1SUCA 4EO4A 4FJ0A 4JGBA 1OKKA 3IT3A 2MYNA 2X2EA 2YWDA 1AZWA 1E2DA 2C9YA 2Y76A 4JBIA 4ZV7A 2RGNA 3AR6A 4UAGA 1GR1A 1Z0ZA 2A14A 2I78A 1F38A 4TXNA 3RVNA 1MOQA 1OA1A 2WTMA 4MVJE 4Z1MD 4F5EA 2ZM5A 1V48A 3D7SA 2B6HA 1Y9EA 1ZK4A 4LYHA 4OHZA 3N05A 5I9TA 1TLFA 4QTTB 5CH5A 1CZOA 4BBPA 2G1JA 2H2DA 3JQ8B 1YSCA 1U3TA 1NW6A 2VFAA 3QBVA 5GOZA 3UF0A 2VJMA 2DSNA 4ALKA 1LBHA 3K0EA 1SHLA 3SR0A 4BFLA 1IMOA 1FNDA 2X9VA 5FUBA 1F5SA 5HK8A 4FJ1A 3SDBA 3DP9A 3BJEA 4QHTA 5K6AA 2ZT6A 4YMUA 1QYVA 3VC1A 3NQ41 2WNSA 4A6XA 3HXLA 2PCJA 4YV1A 1FMCA 3NTRA 5DVZA 3AONB 4KN9S 3W5VA 4LE1A 2AE1A 3WYCA 4BOYA 4JT4A 3S8EA 4A92A 3WBJA 1OI4A 3ABRB 1U11A 1T10A 3FRIA 1TAQA 1Z5UA 3BERA 4GM0A 4TT3A 1GG2A 4JOCA 3L4KA 4RJ2A 3SYRA 4FM9A 3DE6X 3S28A 1HG0A 4YJGB 4P0PB 1QGZA 2HNKA 4OREX 1PGQA 5BN4A 1F8XA 1E3EA 1AQ6A 1KFEB 2NG1A 2WM2A 4OH7A 1AUPA 2R8BA 3FSJX 2P4HX 2YJ5A 4FFDA 5CFPA 4DXDA 1QE3A 3GPCA 5K4AA 3ZR4B 1F2UA 1BD4A 5EQDA 5I7RA 3R3UA 3JQQA 5IJAA 4JX9A 2ERCA 1FEZA 4BZZA 4KNYA 1BG6A 1MO6A 1YHZA 2DMRA 4IJKA 2GAFA 4GMXA 3ZU2A 2EP7A 1YBFA 1F1JA 2FKAA 2EDCA 3DPSA 4LVNA 4HB3A 3U40A 1TF5A 2N1MA 2BMVA 3I45A 3K94A 4YGXB 5THXA 1GQOA 1TLTA 1XPJA 3CLKA 3UJPA 4QFMA 2JJQA 5KQPA 3N6VA 3OQVA 3HA3A 4X90A 2F3RA 3DMGA 3AV3A 2O7NA 2YVUA 2ZI6A 5ALFA 1FDRA 4NOLA 1EFKA 1JHZA 3HNRA 1G42A 1QRRA 5BP7A 3NEAA 4MQ6A 2Q0HA 1GRVA 4BFWA 1EJ6A 1N2IA 5LMNB 1NX9A 1OT5A 3KVNA 2BEUB 3A1UA 2VBIA 4ARZB 1U0HC 3P0JA 4EB3A 4TMKA 4CVNA 3KE9A 1FS6A 4OV6B 3WK7A 5AVTA 5KSOA 2Z5FA 4HGNA 5YASA 4N8EA 3GEPA 5BNFA 1HYEA 2ZSBA 1XO1A 2GVDC 4X63A 1TDJA 4NV3A 1ZVMA 3CU5A 1ELOA 3LKVA 1AKRA 2BH9A 3PG5A 4FGKA 1WXQA 2APJA 4C3UA 5CG1A 2JIMA 1Q14A 2GH1A 4ARBA 5LMCA 3H1GA 3RK0A 1V11A 2VWGA 3NHFA 3NBQA 4BTLA 1ZP6A 3LDHA 3HUEA 3IDSA 4CIBA 4BN0A 4B6EA 4MR9A 2AW5A 2BGGA 1GKIA 4Q24A 4TXLA 1ZCFA 1CEYA 3R0QA 1SBNE 2CLFB 3BFPA 3FVVA 1RJ9A 4MV5A 2VQ6A 3R6TA 4S0XA 3SBEA 4B4WA 3R7FA 3ADCA 2CLHB 3UTDA 1J97A 3T1TA 2P0EA 1G5TA 2ZT7A 1ID8A 2IUYA 3RTCA 3GMIA 2CKDA 1FOEB 3AEQB 4BJ6A 3I61A 3RG2A 4U9UA 1OBVA 4WKNA 2PLAA 4JELA 2CVPA 2MMGA 4GPAA 1X1DA 4YAFA 3DLPX 2W6JD 2OHHA 4PCVA 1EGAA 5CYFA 4CHGA 1X39A 3WWPA 4N49A 3GRAA 3AUKA 3ACCA 1QO0D 3JS5A 2F3QA 2Z58A 3HKEB 1FW8A 3ROZA 2ONYA 4ZT5A 4RF4A 1ECGA 3LL7A 2DECA 5B4TA 4D42A 3PEEA 4P31A 2PZKA 3WNZA 2G4CA 3JW8A 3OFKA 2ZI9A 4H6PA 1JXQA 2FY8A 3VRHA 4HVCA 2W2KB 4W7HA 4YHBA 4TZ6A 1RWXA 4NDZA 4YVFA 3KB2A 1BHSA 3W7VA 4LDNA 1ENOA 2E2WA 3LOPA 1ZVKA 2FEOA 4MB6A 4PVCA 5FO0A 2X5JO 3AM5A 4LDAA 1E96A 2PGLA 1T8SA 2PX2A 3V9PA 2XNHA 1PX0A 3K1YA 3LQYA 4PZUA 1Q77A 4DL9A 4ZDKA 1OUMA 4D02A 1V37A 2DPGA 4YAOA 4LQCA 4DV4B 2MSDB 4L27A 1SURA 1GPLA 1PFYA 3IHKA 3WKBA 3K6RA 4P3KA 5DZSA 2WJYA 3M1LA 2VCEA 3RIGA 4OI0A 4UE3S 1T6NA 3UAZA 3KYDB 4NQRA 3OF2A 2X1VA 1LD3A 1C5KA 2VHXA 1AGRA 3WTBA 1G18A 2GWHA 4EPXA 3PNVA 4XD2A 2J6CA 3ZH2A 2YRWA 6YASA 1JWLA 1UP4A 1U9IC 3L6OO 3G2LA 3OCVA 2IOYA 3D8HA 1PZEA 2XA1A 2LBPA 3PJRA 3EZ9A 1TO2E 1FC0A 2XNDD 2E4ZA 4FC7A 4GL4A 2H2FA 3UKDA 5KTMA 1X7DA 4CTJA 1C30B 1R0SA 1QSGA 3HEBA 3EIQA 5J40A 5I5GA 1F60A 2E18A 2V58A 3ZVLA 3B12A 1RHQA 3NM6B 4BJ5A 5IXYA 1XRNA 1BHO1 3KQPA 3R09A 5FPPA 1CZNA 5A3VA 1I5OA 1ZUWA 3S1AB 2BSXA 3DBOB 1U3WA 1ZXBA 4MIOA 4TQGA 1VKJA 1DWUA 4XLLA 5BMVA 3QLUC 1YFJA 1DMSA 1Q92A 3D81A 3QNWA 5FHQA 4ZVVA 1XYGA 2EFGA 1NVGA 1ZI9A 3BQ9A 3DULA 3AIKA 1P3JA 1JU4A 3JY6A 3NBKA 3BRSA 3DDCA 4G4SP 3ZI4A 4ACAA 1TMKA 4BMSA 1Y3BE 4LJ9A 5IZCC 1LTKA 1XB2A 1L4LA 3PRKE 1T3ZA 2OAP1 1U7HA 3AY6A 2FVYA 2HA3A 3KX2A 5FP0A 4CDGA 1ZKMA 3EGVA 3OEWA 1VYHA 4LIPD 1F8GA 3T5CA 1XTZA 2JRCA 3O6VA 3ZHBA 5C8XA 3Q5DA 1UMDA 1SVWA 4YRDA 2DX7A 5E2AA 3E3AA 2YNMA 1A95A 2ZCVA 5KVSA 4YI5A 1EFTA 1MRZA 1T0IA 3QMPA 5P21A 4F3NA 4D81A 1ZG3A 1E2NA 5KJ6A 2IV2X 1TD1A 3K9LA 1J4AA 2HRQA 2DWCA 2CNLA 4GNRA 4EB6A 5HXAA 1CUVA 2YWJA 2C2OA 1PRYA 2C7RA 3STUA 1DS6A 1HDEA 4M86A 3UGKA 3E82A 1KI1A 4TTRA 5B2EA 4MW2A 5AKYA 4Q9DA 1VCHA 3I4CA 4DR6B 2I67A 4YH1A 3BICA 5JAMA 1NUUA 3KJGA 4EZBA 3CF4G 3GNSA 5ALXA 3CLUD 3KELA 3QNMA 3GPBA 3ADOA 4O3FA 1UK8A 3PUIA 2CXSA 4Q66C 1QQAA 4M53A 2O05A 2FP4A 4UNRA 2IV7A 1LSSA 2HMTA 4Q3LA 2C9CA 2CXTA 4LFAB 3NJ4A 1V4BA 1MAAA 1OPXA 2PUBA 1IU9A 5L7YA 4TYNA 2VK2A 4Q34A 3CKMA 1IZ9A 3DE5X 1HV8A 3JPWA 2MDTA 3MSCA 4KFCA 3B70A 4JXKA 2V9CA 4QLOA 5TT1A 5MDHA 4IMRA 1A8HA 2DUUA 3L40A 1CEEA 3ZNOA 3TBHA 5IZCA 4MUIA 1H2RS 3V4ZA 3JD0A 2XCTB 1ODJA 2COUA 3WICA 3U9TA 2Q9BA 2EJCA 3FUXA 5CB4F 3FETA 4DYHA 1TE2A 5BVGA 1KTIA 1R6BX 4IKEA 4RJIA 5K4GA 1JQEA 2JFUA 2OLEA 3PXXA 4HB0A 4TMTA 3OPQA 5F4BA 1DAIA 3RM3A 3BMOA 3QFCA 3L8CA 3BQNB 3JQBC 4GPBA 1JV2B 2ZPAA 1PZNA 2AI1A 3O8OA 2VDPB 1SY7A 1OFUA 2ZSDA 2HWXA 4MOWA 3JRXA 4XYGA 3S27A 4TZ0A 2O8CB 3EXAA 5A4DA 2FQWA 1GRRA 1TU4A 1E79A 1Z7YA 3FOBA 4JP3A 4CM6A 4CM9A 1GGFA 1WMFA 4OQLA 5AP9A 5JEEA 5JWHA 3KJIA 1HDOA 4QDJA 2F59A 2GR9A 4FN4A 4R69A 2A84A 4G3XA 4G5HA 4XW2A 5EMHA 4X85A 5TGTA 4DDMA 2WQ7A 3QUBA 4Z4IA 2G71A 3C0KA 3OTWA 7MHTA 4HAYA 4WA7A 3OU6A 1LBSA 1RXYA 3ZC3A 1B8UA 4G26A 1NJ6A 5GVRA 1XCOA 2C8LA 5F78A 3VFDA 5ICSA 1WEKA 1WO8A 1OLUB 4D74A 2ZVDA 1GLGA 2O4CA 3IB6A 5ADWA 1P7PA 1AGNA 2ZXFA 4ZVKA 3PLNA 1GD1O 3WHLA 3ES9A 4UUPA 2X58A 2NXJA 3VR5D 2C7PA 5E9WA 2PJRA 3RD5A 3FR8A 2QL6A 2QMQA 3D3QA 1JDVA 1T35A 4U0KA 1M0WA 1Q3HA 3VR4H 5AK3A 3W3AH 3LXUX 4J9VA 3LPLA 4HNAB 3RE1A 3ASUA 3LL4A 1SXJB 3PQ7A 4H1TA 4ZEMA 1O8BA 3BJMA 1GPDG 4BRSA 5B7GA 3OESA 3G2HA 4P84A 3SJBA 2I6FA 2GZAA 2PPVA 4B7ZA 4F91B 2WD8A 3CBGA 4YP7A 4WK0B 1K4YA 1ZH0A 3C1TA 4MO2A 1SCAA 1AN9A 2V0CA 3MUOA 4URZR 1KKMA 4NBLA 4PZAA 4Q3BA 4HXGA 2AOUB 3MK31 4DPKA 4LYJA 2JD0A 4TVOA 3O8BA 3VU3A 1GZHB 1IBRA 3C5WP 3NDBB 5AW9A 1XYYA 1Z0FA 3I37X 1RTTA 4XEUA 4B0PA 1XVVA 1RCTE 3RTEA 3GFRA 4IINA 4DNPA 1Z33A 3EFOB 3ADKA 3LY5A 2AUNA 1ZD4A 4RACA 3OLVA 3RUFA 2XV1A 1LEHA 3VI4B 3AVXA 4KR7A 4MP3A 1U4NA 1FTSA 4EVIA 1YU6A 2QRGA 2RD2A 4FR5A 5EJAA 5JMOA 3W5BA 4E2FA 2CNBA 3VUEA 3B20A 2DAPA 4NFLA 1RCUA 5JO9A 3Q98A 5KWSA 1BDJA 1M2FA 1QIJA 3F6BX 2R8ZA 4NZMA 3Q3CA 3KJEA 1DOAA 1PFKA 3BMQB 4R9NA 4RORA 4GWLA 4PC3A 3LC0A 4QBHA 4OMUA 1R50A 3SEFA 5DBHX 3BRWD 1CQJB 2DH6A 3D6UA 1JKXA 1Q2XA 4UAVA 3GI1A 3CH4B 3L79A 5F5NA 3FLEA 2ZCJA 3N2KA 2O5RA 2FZKA 2SCUB 4LX0A 2V7EA 3RJ9A 2Q3JA 1M33A 2VZLA 3FB1A 3IUJA 2XIQA 3LHKA 3NHAA 3PHGA 1M6NA 9ABPA 4B5KA 5DM70 1V5WA 4L8GA 4BNYA 1PO7A 2OECA 3FUWA 2HY7A 3KWMA 3S0JA 1HMYA 3E22A 5CU7A 4AMUA 5JD5A 4RVUA 4BMDA 2MSCB 1DWQA 3HSKA 4MA0A 1OX4B 3IXLA 3B5IA 4L0DA 3WLNA 4BFUA 1R18A 2A30A 2WWWA 3MBIA 5JZ9A 1VSUA 1NUAA 3M70A 3M49A 2CD9A 3EB9A 1FTYA 3EA5A 3GR6A 3C8HA 3MLEA 4LXHA 1T15A 4CKCA 3G0HA 4X00A 5DNUA 3I12A 1VHLA 1QAMA 3L7IA 2EHDA 3LECA 4PG7A 1MOSA 3CLSC 2ZJ4A 5AM4A 3WDLA 1B8NA 2FPPB 4PSKA 1DOZA 3A9UA 3AW9A 4B81A 1ZDMA 3MUFA 5BYAA 1G8PA 4B31A 1YQ9A 3OI7A 3EXIB 3ANMA 1VIDA 2DLNA 4BB9A 3TNDA 3P5SA 3KSUA 2R6AA 4KO1S 5DLDA 4EI2A 3SJZA 3EMVA 3S29A 3CNNA 1IHUA 2EKLA 5DLYA 3HCFA 2JA2A 1J25A 1KXJA 2XDWA 3OMLA 4DJEC 3V8PA 2O7SA 4D25A 4DBVO 2QVLA 3BM5A 4OYYA 5TXGA 5F9HA 1QIMA 3GLSA 4LI0A 2HW8A 4EBBA 2ECQA 4ER3A 1W4RA 2IV3A 3TCNA 1QTNA 2WFAA 4FDMA 4LHVA 2R60A 3TI9A 1ZHHA 1AKNA 4JLSA 4UNIA 3UMCA 3EGDB 2QTVB 3GLIA 2Y9PB 3DV9A 4MRMB 5AW5A 3H5VA 3AU8A 3RPEA 4NMXB 3RS2A 2FHSA 3JYLA 3L7DA 1GKYA 4UHDA 3QF4B 1HI9A 1XNQB 5ADHA 2VRBA 4P4LA 1E1RD 4X6LA 2BJVA 3N8IA 2Q3DA 4L4SA 4LX8A 3HXQA 2QMZA 2F1HA 4MGHA 3TTUA 1PR4A 1ISHA 2QZJA 2W2QA 3OE5A 4IR7A 3CJRA 2F3UA 4GI7A 1ORDA 4IEIA 4PX2A 3G2QA 4C2AA 3C3AA 3WL5A 4AX8A 3SMVA 1AMNA 2G9NA 1GU1A 2P41A 3LK7A 1L4GA 1JJFA 2J09A 1KNXA 2HSWA 2Z56A 3EC7A 3OEYA 2A94A 5KTNA 2Z1DA 5B5SA 3H9UA 4HBZA 4C7XA 1AV7A 1HKUA 4PWYA 1JJ7A 3VAZA 1KO5A 4BMVA 2YKGA 4J9UE 1C3VA 4R0NA 4D80A 3I2GA 3SIWA 4BN4A 1YCHA 1MNQA 2JJ8A 3W4JA 2ECFA 4ZAWA 1L6IA 3FNEA 2GJ4A 1T91A 4LAFA 1NY6A 221PA 4U6NA 4OGKA 2QAGA 1RI4A 2P8SA 4IUBS 3SHWA 4CF5A 1LRJA 2QD3A 3GOHA 1OYVA 5E6RB 5AVVA 1HDGO 5SY4A 2RH8A 4BZQA 2CXRA 4BCCA 1FMFA 4HATA 4EI8A 1HF3A 4MAFA 3ORSA 1LRLA 2NYRA 3WDMA 1EVLA 4MUBA 2H0QA 3LK6A 1ZK1A 2QTCA 2OBNA 2VI5A 3L7LA 2EIHA 3O74A 1GG8A 3CF2A 4JLUA 1ZLXA 1ZRNA 1ZN9A 4YRIA 2GOYA 2YS6A 1VPTA 3OIUA 4L02A 4Q00A 4WPGA 1LBTA 5DI3B 2BFEA 4NARA 2Z6VA 1SK8A 1XEWX 3LW8A 5ALVA 2XKKA 2FPGB 3KHUA 3PL1A 1TX4B 3GEBA 3HJFA 4OSOA 2BFFB 2OGZA 2XVXA 3NV7A 3OLYA 4JGIA 2JFZA 3IE0A 2UYOA 4N1AA 2WILA 4DMCA 1EQ2A 1XN4A 1OF1A 2IP1A 1UXHA 3H86A 1UXJA 3LT5A 3ONNA 4OKIA 4ZU1X 5IANA 1KQOA 2XGJA 3IA2A 4L5YA 5AKGA 3QXSA 2CDBA 3R7LA 1EWRA 4MR8A 1JSCA 4QRHA 1YWGO 5T8KA 1U8TA 3TNFA 5JAUA 5CDFE 3CUVA 3O2QB 2OGWA 3KQMA 4R51A 3KR9A 4ZCQA 3ELWA 2J3HA 2RI6A 4N40A 3VMMA 4EQ6A 1TW3A 5AJVB 3D3EA 1PT6A 2GESA 3O3OB 5AUOB 4CEJB 1NRWA 2CUZA 4Z3OA 1CJVC 2IYSA 4RD4A 1BN7A 1ST3A 3OG9A 2X0IA 5HUQA 3IBYA 4BNGA 4V0LA 5IFLA 1FP4A 4D8VA 1EUCB 3I83A 3NGMA 1MABB 2VYNA 3FMIA 4ETWA 1XWIA 3ZE8A 4ND7A 4ZREA 1ZC4A 2G9QA 4CF3A 1LJLA 2WIAA 3I4LA 5ALZA 3T7SA 2WMDA 4BQEA 1ADFA 1BQEA 3HKBA 3COSA 3G2PA 3JQ7B 3OKFA 3QLVC 4GOMD 2FDCA 3BHNA 4LRWA 3RC7A 3G6WA 3V80A 3NVDA 1KZYC 3RS8A 1NBOA 2X4DA 2D5AA 1P0MA 3C4VA 5F52A 2WQ6A 2HK7A 4WCVA 3L49A 1JNYA 1E1LA 1GGNA 2VJQA 3AJAA 4MDFA 3OMXA 2GM4A 2PRIA 4ZZ0A 1DKQA 1SMKA 1UBUS 2PZGA 5KNCD 4ZOQI 3RJTA 4JYAB 1WHTA 1I1NA 1CIVA 2B1IA 5IBRA 3I52A 4HN2A 2OFOA 2CNNA 3Q3EA 1ZNZA 2RHCA 5K0BA 1LVGA 2CXPA 3FZGA 1U8FO 1ZJZA 1NZFA 1Q6ZA 2OAQ1 5KDDA 1P5FA 2NSHA 4EYEA 1TUEA 3S2EA 2NUTA 3JTMA 2YY5A 3K8ZA 3KNZA 2FZ4A 4GSLA 1A72A 1GPBA 4OTZA 4XA8A 3VOSA 3C7DB 3BE5A 3RS7A 3UJ6A 5CXQA 1SVMA 3K1AA 1EFAA 1DBSA 1DQSA 1M34B 1EVEA 1Q7TA 2C2MA 1M66A 2RC5A 1GN8A 3MWEA 5AH0A 3TL2A 4F60A 8MHTA 4X94A 1ZS9A 3RHSA 3NX4A 4KHZA 5KS2A 3EXG2 4UAUA 3FSRA 4EYSA 4LXQA 5L3QA 2X41A 4LY9A 4XB1A 1B16A 4MJ3A 3SF0A 4DIFA 4MWEA 2IWRA 3FNIA 2W8BB 2P2SA 3ZLVA 4AJ4A 3Q2OA 2G72A 3GX1A 4OQ4A 4E3ZA 1GV1A 3F7OA 4A0RA 2FYTA 1NMZA 1PW5A 2GLUA 2FPLA 3BCRA 4HTFA 3E1GA 4J7CA 3ZHVA 4H08A 4FFBB 3QLVA 5A3RA 1XLUA 1QV6A 4ASUA 1T1JA 3PZBA 2PWAA 3K09C 4O4IA 4GFDA 4HWKA 4QQFA 4D4HA 4JL8A 4IWYA 1TAGA 4A36A 3QOXA 1UOQA 2JHFA 2HJSA 2ADFA 4FHEA 4PO9A 5BQOA 1N2EA 3U49A 3VKHA 3PC7A 1FCJA 3BD9A 3WNDA 4EG8A 1LBEA 3FOAA 4A6DA 1IM2A 1V2GA 3H8JA 2DPYA 3W6ZA 1G5HA 3PC6A 2H8KA 5KCMA 4EEXA 1RWMA 1L5OA 1V35A 3F96A 5G3ZA 3OIWA 1NR1A 4IP0A 4CM1A 3JQRA 2P2DA 1T2AA 2ID4A 1N3LA 1G64A 4NU0A 3FFAA 1QB8A 5JNUA 4HX9A 4MUAA 1E32A 2NN3C 1Z28A 1O97C 4Z1MA 3NPAA 1H1DA 4KMOA 5F76A 5D3MA 2D7JA 4NX2A 5IN4A 1QPZA 1AK1A 2NZ8A 5CH8A 1N78A 4EATA 5EE9A 2JAWA 3NRBA 3H1BA 3A3OA 1X7ZA 2WK1A 3L8FA 4AYTA 1P1KA 3R9WA 1AF7A 2FP3A 4Q9IA 4CIYA 2AZDA 2AI2A 4RX1A 4CI0B 2LPMA 1HLPA 3PGKA 2VXYA 1HDCA 3V1TC 2XUHA 2FPUA 5BSKA 1RMTA 1Z75A 2YXPX 1ETUA 1P81A 2PLNA 2Z2KA 4I7EA 4D4KA 1RQLA 1FPQA 1MXFA 1R4MB 4J75A 5CK5A 4YP0A 3S40A 4U2DA 3UWPA 3Q2IA 4RTRA 3HB1A 1TZMA 3K0FB 5LYYA 2C9BA 3LFTA 3PNPA 5EMNA 1FVOA 2YR0A 1N7JA 5KYKA 3RBXA 5I7HA 1J24A 1SPBS 4GMHA 3KTAA 3OCZA 4WXRA 4LN1A 1RZ3A 1FLVA 4JROA 2PHZA 3AHCA 1U0GA 3R6DA 4MVWA 3LF1A 3EQ7A 5LSAA 4CV1A 3ESZA 1SFRA 5DM4A 4RIEA 3O95A 4BASA 3QF7A 4RVSA 1POWA 1N3IA 3BL6A 4Q5IA 3AGPA 5A4JA 4MLDA 1T9GR 1M54A 1RQGA 1NVAA 2AF3C 2I4OA 2OGUA 3FLMA 4JOSA 3ASVA 4P4NA 4MHTA 3EEIA 1SCQA 2ZI4A 1ZNXA 4Q9NA 1XJ0A 5A6SB 5DGTA 4TS1A 5IBPA 1Q3TA 4GPEA 4REOA 2WIGA 1MDFA 1Q84A 3AY3A 3NC4A 4AP5A 1JG2A 2H18A 1MX5A 1DWOA 2HMAA 3WMEA 4DRYA 4MITA 2DHEA 3R6WA 4HH3C 2XCOA 1G2OA 1RIIA 2LKCA 3GJ7A 3I01A 5KYUB 4TTVA 2DPMA 4WZAB 4GR5A 5IDYA 1J0BA 2CXNA 2MWMA 2BEVB 3EBOA 4RFSA 4JBHA 2SICE 1TQ6A 4HO1X 4KZKA 4P1ZA 3VTZA 4B6QA 1Z47A 2Q5JA 3D6HA 4PIMA 1A88A 2DBYA 3FY4A 1V1JA 1EBUA 2XMBA 1QIGA 3MJSA 3PT5A 2NU8B 3V8QA 2UU9B 2I2DA 2YJTD 1WD5A 2JFXA 5DJ5A 1ID1A 2HPVA 1HE4A 3ZD8A 3BWDD 1T5BA 3HB7A 2BL4A 2IGTA 1ZW1A 5TRTA 4YP9A 4AKIA 3CTPA 1RLMA 4WOPA 1BH6A 3REGA 2OG1A 4B7UA 3T1HB 3OE4A 3DNPA 3N9IA 4U7FA 1B42A 4ZK6A 1AQUA 2ZUBA 2P2LA 2ZIWB 3BYZA 3NHLA 4XB6B 1PNVA 2X40A 2VYCA 2ZGVA 2Z2IA 2IZZA 4IDHA 5H0IA 4DCCA 4E2WA 2EWVA 1FFXA 3UMYA 2G1PA 2ZYRA 4U7HA 3ZGOA 2JLXA 4NS4A 2VQEB 4R1NA 1RKUA 4WBNF 1LH0A 2VH5R 4C7VA 2O2SA 2PA0A 2WJAA 3SS8A 2BKUA 3DXYA 4R5HA 3IP7A 4MVJA 2BLNA 1EVKA 4YYEA 1H2ZA 3QG1A 2R2GA 4HAOA 4NU6A 2W6JA 4QL3A 4F9FA 5G1NA 1OVMA 1UADA 4W5QA 1SIOA 4GR9A 2GD6A 2RGYA 1LBIA 1I32A 2EW2A 3EN0A 1ULBA 4TL9A 4C4ZA 1QO0A 4E70A 3QPDA 3DJYA 1MFPA 4DLVA 1WCYA 5JBIA 5DHSA 2VBFA 4QYIA 2UZ0A 3OIYA 1VHWA 2HZ7A 1G8SA 5CK4A 1KYIA 4J4BA 3WRXC 1EGVB 1XEWY 3O93A 3GUVA 3N2YA 3P4UA 4OK3A 4D0NA 4AS1A 3IEKA 5BSUA 5FTWA 4Q4AB 1C2TA 1S4MA 1P61B 3U60B 2NZVG 3JYHA 4DREA 4MRPA 4WT7A 1U1IA 4L50A 5JAQA 4DM3A 5KBYA 3B6EA 1PJQA 1VMAA 4WOKA 3E9QA 2DFLA 3KYBA 4WH0A 2HDHA 1HZJA 5IJXA 4EQZA 3UA4A 3PE6A 3OHPA 4D79A 3NM4A 5FLYA 1R00A 1CVLA 2I0FA 3A4TA 3C6QA 1PT5A 3CN9A 4M9CA 4M1OA 3OH8A 3VPXA 5LC1A 5IBCA 3WAJA 3PEYA 1TM4E 1G291 2R86A 2ZUSA 3PDJA 2IPXA 3B38A 2ZULA 5JYDA 5EP2A 1NWHA 3SNHA 1PLJA 3D7NA 4L0CA 2CSXA 1ML3A 4DIOA 4HYQA 3NHWA 1SGWA 2DXIA 3TLAA 1B26A 3OQIB 1DRJA 1YRWA 2VXCA 5FR1A 3U81A 4CGYA 5KX5F 1K3FA 5F9MA 3VDQA 2BKXA 2CSUA 2Y92A 4OB8A 3ISVA 3WRYA 2X19A 1RP7A 2YMPA 4BAZA 4BIIA 2AR0A 2IYYA 2HMVA 5CAEB 3KZNA 5B7QA 4YS6A 2IY8A 2ZS9A 3JQCA 4N3NA 2YMLA 1ONBA 2CB9A 3ETEA 4L6CA 4A8JC 5L3VA 3K5WA 3L77A 4EJFA 5JR3A 2XNDA 4YX9A 2ZIEA 1UBJS 1JXAA 3MYYA 4G1VA 4KV7A 4L5IA 5TVKA 5BWCA 3OE1A 4EJ2A 4WERA 2H5IA 3GQBA 5HCNA 4JL5A 4CLDA 1CUGA 2CHQA 2PUAA 5EI5A 4J1TC 3SC4A 2GFIA 2PSFA 2HXYA 2J9FA 3L0PA 4G0XA 2H3HA 4HN4B 2UYQA 1OB5A 3GLUA 4ITVA 3FKSD 3K1ZA 3R7SA 4KNVA 2FK7A 3L1KA 3DMDA 4Q1EA 3S2UA 3WB0A 3T5DA 5C4IA 2O8EA 4R9RA 1JH9A 2XBLA 3EC2A 1NVXQ 3FWPA 4MIEA 4R81A 4FOPA 4KB5A 3PJEA 4GP6A 3SSAA 3EF0A 3X1KA 1MB9A 4D4LA 1MZPA 3TF5A 2C2BA 3IQZA 5F2EA 4LZLA 5KTTA 2O0KA 4MKGA 4AJIA 4IHJA 2C5AA 1T4GA 2C2ZA 4D9JA 1YF3A 1O03A 1XF9A 2DR0A 1CR2A 2D2FA 3NHSA 3QPBA 2FEKA 1QS0B 1UP7A 4M21A 3T5MA 4E1BA 3NANA 4EA7A 1UF9A 2C61A 1S8OA 5CNIA 1W88A 4LE2A 1DXOA 5EVCA 4NQZA 4WK4B 1JE1A 2QE7D 3Q12A 3R2JA 3MTAA 4LV8B 5FPTA 2O3QA 3L1HA 4HDMA 3IE2A 3CC8A 5KAMA 3EA0A 2HBRA 4TTPA 3W3ZB 4YRCA 1Z2CA 1QYIA 2IXBA 3PCXA 3TAHA 4Y1FA 3HO8A 1PKXA 2W71A 3K9CA 3GROA 4EW1A 1OXTA 3ET4A 2YYAA 2Q21A 4JQCA 4FS3A 2EBFX 2KI5A 1NZJA 2KE5A 2FH5B 4A8JA 4M76B 5JS1A 1DQYA 1PJBA 1AB6A 2VHCA 3M6XA 1YNOA 1UJMA 4GGPA 2Q2WA 2OTCA 3BULA 5ARDA 5F2KA 5AK6A 4AKTA 3PHHA 1O54A 4LVOA 3A58B 4ZARA 4BYMA 1OT3A 2QN3A 4MRSA 1V47A 2P1ZA 3E5NA 3KEFA 1E1YA 3ZU5A 1H23A 3GUCA 2UZIR 4J1TA 4CMEC 5I3ZA 3OUZA 1X13A 3G5TA 2J1LA 2HJGA 1XHLA 2XKBA 1WMDA 2WSMA 1ZICA 4JI8B 4QU8A 3LQKA 2ZIVB 4AJHA 1CUUA 3ITEA 5BNIA 3AVQA 3KTOA 3R9KA 2V59A 3WJAA 4DNXA 3BG5A 3RG8A 1YRLA 4EELA 4DQ0A 1D1QA 1GAXA 4J0CA 4KIJA 4XGNA 4LJ7A 4HVLA 2G08A 3D2CA 4HEHA 2QMOA 4TWBA 3K30A 4Z7NB 4YMGA 4Y2PA 5TNXA 2FUKA 1R7RA 5FLXA 4UASA 3NYIA 3U37A 1SO8A 1G7RA 2ERXA 2QRMA 5IYZB 2QORA 3DH0A 2YVLA 1MG5A 4C4PA 5SY6A 3ORYA 1FRQA 2WJPA 1L3BA 2UYCA 1UZAA 4L85A 3N2NA 4XDZA 5T4EA 3WLPA 5JASA 1K2VN 1YS9A 4M7RA 4O4JB 3ZK7A 4HAUA 1S3GA 4PICA 3O3CA 3QEMB 1LV8A 2Y6VA 1X9GA 1QC5B 3FLAA 5FTLA 2V97A 3C3CA 1KXZA 2CLIB 2VUIB 3I53A 5CFRA 3QYFA 4GU5A 2CL6X 3OPYA 1ESDA 1PK8A 4QTYA 4LXUA 3ND8A 4IO0A 1LZLA 2H00A 4QECA 3TW0A 2PUCA 4RQBA 3GNLA 2HHLA 3PNSA 2PVPA 1M9NA 2VH1A 1P8JA 3M4ZA 1QIDA 2HN9A 1Y3AA 2EFYA 2Q1TA 3S2YA 1AHIA 3T3PB 2E1RA 2DQYA 3VKUA 4LNHA 1G9XA 2WLTA 2OUIA 3MCUA 4RZ2A 8ADHA 3CRW1 4EHFA 1V71A 3H4VA 3IIMA 4TQAA 2P69A 1S96A 1E3LA 2I3BA 1BJRE 1M2VA 2JFGA 2GSDA 1P9OA 4IGFA 4N3AA 1DV1A 3VR5A 3U4MA 2R7LA 4BVGA 3Q3IA 1ZLYA 4OLFA 4J1NA 5K3DA 3GWGA 5TS2A 3CUSA 2WJZB 4JQYA 2BEWB 2HLDD 1Q1AA 1TO1E 2OXEA 4RZIA 4NTZA 1F6WA 3FCOA 3QJGA 2TMDA 4OYHA 4GI2A 1SUEA 1DRUA 1FDSA 2J4FA 3DOCA 1DG3A 3KUUA 3Q9LA 1RWKA 2BGIA 3NEYA 4IIYA 1TYDE 4YIKA 1KMQA 2O8FA 4DC9A 2X2OA 4BQSA 2B7CA 3WLKX 2FMXA 3DQQA 3H04A 3K0CC 5D8DA 5GAJA 3RUAA 6ADHA 4Z2YA 3W2HA 5EIXA 4Y6LA 3KEOA 4X45A 5IFKA 4RTNA 1M72A 4NXMB 4I1PA 4M0MA 3Q5EA 1AKVA 2RHJA 3D8NA 3K92A 3N07A 2ZBQA 2Q9AA 1MC8A 3EUWA 2IWHA 3WZ2A 3GMTA 4NPCA 4UXJA 1WQ3A 5AXBA 3GZTB 5FOTA 4IDCA 3CXRA 1T2DA 2VQFB 1EK1A 2A5GA 4IJ5A 1BMTA 3MQFA 1UQTA 1NVUQ 3RI3A 2NP7A 4MKHA 3TTYA 5E6UB 1FFGA 1I0LA 4NK5A 2AFHA 2D2EA 1X9IA 4BV3A 5HF6A 5EQFA 4I5IA 1NKVA 1XHFA 3RRYA 4OMDA 1Y7HA 3BGOS 3TYXA 4E5VA 1UZNA 1WBBA 3IUQA 3WWOA 1KIFA 2ERYA 2XUZA 4PHGA 3RVQA 1ECCA 1JDBB 2G07A 3IEXA 3L0DA 1H9AA 1WPGA 2NYAA 4R1SA 2EHJA 2ZAOA 3L8DA 1UEJA 2PZAA 3OM9A 3DGEC 2NU6B 3VU0A 2J3LA 3A32A 3LXXA 4NOMA 4AJ2A 4EYQA 2P9HA 1JYFA 4OBEA 4QHYA 1KI7A 3IYLW 5CVEA 1C4WA 5HKLA 2LWIA 3OT5A 1NI4A 4H7IA 1KMHA 2PGAA 2QGNA 2XQGA 4GICA 1QH1A 3I8OA 4E4TA 1JQJC 1E0DA 2IHVA 4LGYA 3WGNA 3RV4A 1YUNA 3A6EA 4XPIB 1B6SA 3PJGA 1F7UA 4ZRNA 4UVHA 1K08A 1A71A 2H9YA 5K0CA 2AFRA 5JJCA 5DK6A 3FBGA 5LDGA 3LWNA 1CQWA 1B0UA 4OO3A 3SP1A 1Z56C 2A7QA 3SZGA 2EKZA 4CIWA 1F0KA 2AG1A 5EC8A 1S2NA 1EFPA 3QYJA 1HFJA 4K9OA 4W8HA 4FCTA 1EVIA 4HK4A 4RTOA 4R3NA 5TF4A 4KCGA 2OQ2A 2VNSA 3H99A 2BM8A 3CH5A 3MWGA 1GEGA 4MVCA 4V0MA 2CXUA 4A15A 3H5AA 5AW3A 2FW0A 3DL7A 3J81k 1RHMA 3CMCO 4PLZA 5JHHB 1J7KA 2W2VA 3L3BA 1DAMA 4G5QA 5TJHA 1QLHA 1G63A 1SB8A 3CR3C 4DE5A 5I8PA 2HCRA 4G9EA 2VDOB 4CLOB 3HBLA 3PCRB 5CLLA 4DMLA 1ZR2A 4MGIR 4XLTA 1IMJA 1NOKA 4MHOA 3PXCX 4JJEA 5DYTA 4BO3A 4DV1B 2HH9A 1MLDA 4R7ZA 1ENZA 3SQDA 1Z0IA 1D2GA 2C57A 4ZAXA 1KU0A 1OGYA 4Q4HA 4BNKA 4LRUA 2PAFA 4CM4A 1PP4A 4NBNA 1CNFA 3D8SA 2LIVA 2RH9B 1M2HA 1WY7A 3H9QA 3P96A 4WJLA 5LDHA 1BX0A 4RBNA 3GJSA 1KVRA 2BEKA 1QG2A 3D6NB 3MTBA 4JKIA 4L73A 1A7AA 2OEPA 4MS1A 5JCOC 1E1RA 3WWDA 1Y4DE 4HGPA 1DEKA 3F78A 1QAOA 1QYXA 2J08A 4IIVA 3VO1A 3L1VA 1SG9A 4BQFA 1DEHA 1PR3A 4RXTA 5H4HA 1I3KA 3IUPA 3AM3A 1T3SA 1N0HA 2ZRDA 3TB4A 4C43A 1UR5A 3I9LA 4OX9Y 4S05A 1EWYA 3NFYA 3NGXA 4UVEA 1XPOA 5JZMA 3EVEA 1A5ZA 2B92A 3T9AA 1H2AS 4HUTA 5INTA 2BFAA 3EGWA 3MJEA 2Z2ZA 1GZDA 1XN1A 1Z4MA 4B43A 5AXCA 1EXMA 3RUDA 4IIJB 4M1MA 4ZVMA 4TPKA 3OZFA 3T3IA 5HGXA 1G20E 1UKYA 3GEDA 3V7NA 1DFGA 3KT8A 4N5MA 4QQNA 3G5UA 1L5VA 2UDPA 3VVMA 4AG3A 1W9MA 1CFJA 4JUAA 1IK4A 5K7SA 1X70A 2OVBA 1X8LA 3TLMA 3N6RA 2TMYA 5KU7A 4G36A 4TKVB 2VSYA 4CKWA 1FU8A 1A9QA 3TJZA 4R71A 1R88A 2BM9A 2RE8A 4Z9BA 4UXHA 3C3BA 2DKNA 4FB4A 2WDPA 3CUTA 3K9WA 3IT0A 4LBVA 3QEAZ 1TYAE 4MWOA 1LNSA 4EG0A 3OKCA 2GF9A 1D2MA 4NCAA 3OPXA 3AZQA 2NUBA 4G5XA 4GXQA 3OBIA 1CJBA 4COKA 5ISMA 1W6RA 3D6MA 3P9RA 3D3NA 3HRKA 4LMAA 4I36A 3GRPA 5JCOA 2AB0A 4FE3A 3M82A 5DNVA 2WJJA 3I9MA 3AINA 2C9ZA 1RBQA 4YPOA 1DO2A 3I0NA 5T3YA 3RS5A 1U4OA 1DCKA 1NUPA 4YNBA 4R1UA 3A1FA 2G9VA 3PUJA 1GZUA 5HJ7A 4R54A 4B7AA 2M32A 3EFBA 4ARVA 4YXWD 3DPIA 3IILA 4HCJA 2BGLA 4MMYB 3RSOA 2OHOA 2UZAA 621PA 4FYWA 3HABA 2O0MA 3NBZC 3TSAA 4D3XA 3NB0A 4YJ3B 1S1MA 4MV7A 4BFVA 3HLKA 3LWZA 5DGXA 4RHEA 5FBWB 3WGZA 1IWPB 1KZ7B 4PV7A 2IDZA 1Q0ZA 1UT8A 2MMCA 5BNZA 4ALMA 121PA 5DNYB 4AAYA 2UVPB 1GCOA 1NYRA 1QHNA 1V0JA 1JPVA 1YVDA 3DEKA 3ICVA 3H8WA 3L7NA 3VR3D 1ILEA 4KR0A 1FDWA 1ABBA 1ZOIA 4F97A 1VG9B 2J85A 1NJ1A 5D84A 5FFFA 4TLAA 4AW9A 2CWWA 2BCEA 3MWKA 4DF3A 5BV8A 5KQMA 3E9ZA 1WV1A 4HDQB 3UCEA 2PPLA 1QCZA 2QV7A 1B43A 1KZ6A 2FZVA 5IJWA 5HX7A 2QWXA 3G0GA 5JT1A 2V45A 4X97A 5LA6F 5EINA 1NYQA 2CVFA 4YCLA 1F8FA 3THRA 2ACVA 3GDFA 4UNSA 4X62B 3OSUA 1P7CA 2PZLA 3AL3A 3BS4A 1RQRA 4A26A 5FNZA 5I4CA 2A9PA 5ERXA 1GZ4A 1JQKA 1OYYA 3U1TA 5M3BA 3LX5A 3VU8A 4F3KA 2H85A 2YY7A 5KNCA 5CB6A 1OZFA 1WVGA 1C29B 2HV9A 3O47A 4D99A 5A62A 4QPNA 4O2AA 3QTLA 2Y0CA 3BUSA 3R7BA 1NATA 1VG1A 4TL6A 4AJOA 4AYXA 4M98A 4DARA 4NULA 1ZOLA 3A9SA 3DO8A 2IS6A 4WXEA 2A9FA 1GZ5A 2AJTA 2CYBA 3VO9A 3FVWA 3UXYA 1Z6TA 3EAFA 5A04A 5JSQA 4TWRA 4A5OA 3HUDA 3HKCA 3B5JA 5ALWA 2W22A 2Q7XA 3PDCA 3CYFA 1V9LA 2PBZA 1BCRB 1ABFA 4G0NA 5B1SA 4CDRA 4BATA 1AH2A 1H6AA 1PWXA 2MTBA 1Y3FE 4YJHB 5F2NA 3H75A 3JV7A 3LUDA 4JH0A 1WSAA 4U2CA 5KHLB 3WLIA 1TO6A 2D3TA 3BZUA 5HR5A 3DWFA 4PZ0A 5K8CA 3QBDA 1FU4A 3GVIA 4LOAA 1QIFA 1XDZA 1WNTA 1AUXA 821PA 3IE1A 1C9KA 3ABOB 3B6KA 2PKQP 4ISBA 3L0OA 4XVRA 5EUBA 2IYRA 2QRUA 4ZV9A 5KSZA 2V0GA 4GM4A 3TR6A 1DKRA 4RW0A 3TG8A 1ZVVA 3OCUA 4DV7B 2GSWA 4W9NA 3LMKA 3EZGA 2O8DA 1L5RA 3DM9B 4B2YA 2R00A 1VPWA 3UUEA 4UUQA 3DQZA 4MRAA 1IZ8A 1Q1NA 2IZ1A 5IAKA 4LWQA 2FZCA 3SKVA 1UQUA 2RK6A 4GEGA 1UBKS 1B74A 4HRYA 3M6WA 3H3FA 3H7AA 1FJXA 2H59A 4J29A 4M9UA 1SCUB 3RARA 3SGLA 5BSGA 1O58A 5CDFA 2NV0A 2CHVA 2X9LA 4GXRA 4V24A 2FOLA 1TT5A 1AGXA 4DEVA 1MNAA 3EA4A 4EY5A 4BLSA 3D5TA 1RNLA 3H84A 1LSJA 3NIWA 4KXFB 5DNCA 1Q0RA 2HA5A 2CFSA 3OLZA 4RKRA 1HE5A 2O5CA 4QC2A 2CJPA 1PS0A 1SULA 2C1XA 3BEDA 3GJ5A 3T5GA 4R9SA 2YHIB 3NBFA 3L0CA 3AB8A 4WESA 4BP8A 3KQTA 1U8AA 4AYWA 4UQOA 3IAS6 3QWFA 4S24A 5MN4A 2FZLA 4BO1A 5IKXA 4H1VA 3Q7TA 4MA5A 3K72B 4M38A 5BN4B 1NDHA 2QP3A 1A7KA 3K9HA 3PYMA 3UANA 1PTJA 2CLEB 2PK3A 3T4EA 2OK8A 3LCRA 5LN1A 1ZU4A 2PRSA 1IONA 5LZ4A 2CFIA 4QDUA 1F2UB 5LP6A 1K88A 1TGYA 4DAEA 4KDCA 1NUHA 2D8MA 3A4YA 4L1KA 3SNKA 4B3JA 1II8A 3ZDBA 1XTTA 2IU0A 2VJLA 4HN9A 4KQMA 3LVBA 3T4PA 3JZIA 4LF8B 1J21A 3N59A 2E49A 4BFCA 5K8JB 1L7MA 5DV9A 4KE7A 3BD8A 2OV3A 4NU5A 2G25A 4Y30A 3DCJA 5FEMA 5FADA 1I7QB 5FQNA 4YRZA 2ZREA 5A3SA 2RFLA 1SD1A 1Z0UA 1YGYA 1AS3A 3TCXB 3MUEA 3WLFA 5D5QA 4JL6A 3HSYA 3FB4A 1Z8HA 1RZRD 2OHFA 3C1UA 5FB3A 5KQGA 2GTIA 1MORA 1N7HA 2V7BA 2HFJA 4H4EA 5CVDA 3UB4A 4BJ3A 3Q9UA 4D44A 5I4IA 3RC9A 4DNFA 2FF7A 1SBCA 4OMCA 4BPRA 5C2JB 2IS1A 2I6GA 5EZYA 1J39A 4XJXA 3OJWA 4S2UA 1KNQA 1HLGA 2JAPA 1LI7A 2I1LA 4MWBA 4YAEA 4BEVA 1MTOA 2VKTA 4KQ1A 1XTBA 4S1WA 1RPTA 3L84A 3S6JA 5BRJA 3X2EA 3WKEA 3NKFA 1KFBB 1E9AA 2DQSA 3NIBA 4I4NA 4IVPA 2ZCUA 4YDQA 4XWWA 2C7VA 3LUBA 4HGRA 2Q07A 1BWPA 3G59A 3T0FA 4JUBA 1F0NA 2OM2A 2PZEA 4RK7A 3VDNB 1ZI8A 1Z45A 1CP3A 1LXCA 1Z3IX 3P52A 3DVSX 3GDHA 4N6OA 1XTKA 4R3WA 4WXPA 4E5UA 4MR9B 5L3SA 3AI2A 1VB3A 4N3BA 2CL0X 1ADBA 1EXNA 5J2TA 5LLSA 1OX5A 2UYYA 3IBFA 1WKVA 1L5ZA 2DBZA 4IJVA 1W5AA 1A9OA 4FINA 1TXGA 2Z2YA 1T3LA 4ND4A 3HJBA 5FV4A 3DR5A 2VOJA 3DL0A 3LQ1A 4HEA1 4M37A 1MO4A 3EDOA 2P4QA 2OB2A 1GTJ1 2R96A 4YJKA 4EJ0A 3TZQA 3C16C 4REQA 3EVDA 1E2JA 1XCGB 1RWNA 1JPNA 6PFKA 1WPQA 1SUPA 1BTOA 3JWIA 4AJNA 1NXQA 4OU5A 1NMYA 1DKPA 1XTIA 2IYUA 2R4UA 3FWZA 4J0FA 4BZPA 1VJRA 1JHYA 2HA2A 1I01A 4I4TF 1XALA 1H94A 5KTKA 4D3YA 3NWBA 1VKHA 5H1YA 2IYQA 1BRTA 4HNQA 2V1UA 4G9BA 3R75A 1FX1A 4DW8A 2Q1SA 2BYTA 1YJBA 3T35A 4P3NA 4RC9A 3B9RA 4N4AA 1ZM4A 4YT2A 1LW7A 2PM8A 1M8GA 2JH3A 1UBFA 3I05A 4B4UA 4FP9A 3ECCA 1Z68A 3AVWA 4TYMA 2WG2A 3I4FA 2P6UA 1E4EA 4OG2A 4QHSA 2XF8A 3MGCA 1XTQA 3D1VA 1W6UA 4CU2A 2EJTA 3TRFA 2JFNA 2XE4A 4H27A 2R25B 4BE9A 1XQ9A 4KNWA 3MHTA 2B8EA 4IF6A 4EI9A 1KDOA 1A04A 1OGJA 2Z83A 3JQPA 2X0RA 3CG4A 5DEIA 1G41A 4F04A 3DUFA 2C5SA 3RWMB 1X1SA 1MA0A 2NMVA 1YKFA 5T3UA 4DA6A 2QTFA 1OHHD 4RA9A 2O6LA 1SQFA 2ETVA 5EWLA 5LBTA 3CRVA 4A03A 4RVNA 4EFMA 3MWDA 3SEAA 5HEKA 1JR6A 2ZW9A 3DVQX 1BMFA 5E3IA 2IS2A 1VPEA 1NMEA 3U19A 1M0EA 4E94A 3KT0A 5AVWA 2XUIA 1MEJA 5DHUA 4BL5A 1BKSB 3RYFA 2BDTA 1Q7GA 1TCAA 2YVQA 3EMBA 3TIGA 3H5LA 3WMRA 1TVKB 5JISA 4I1RA 3GJRA 3TQCA 3QI7A 1ESEA 3ND5A 1DELA 2YFKA 3LGXA 1GITA 2IU3A 1E4OA 3GN2A 2WU8A 1PFGA 2WW8A 3I9OA 3PNKA 4HQ6A 1TQDA 5D6NA 1XMVA 2DBQA 2Q6VA 2PMWB 1L7EA 1E1NA 3LCMA 1FK8A 3P9ZA 4ZYYA 4YUVA 3OZAA 5FAKA 3M4JA 3G9TA 1AK2A 1JG4A 4ZI2A 2D1YA 1I33A 3A31A 3KR0A 3LRTA 3VOAA 5CFLA 1N5OX 2ZBVA 2GJ8A 2PUWA 3FKSA 3WQRA 2Q2VA 4ND8A 1RZUA 4XSVA 4DADA 3MAGA 3NAQA 2QRVA 3AESA 3CRZA 2QY6A 1G6Q1 5K20A 4EY7A 4Z53A 1XROA 5DHFA 4L8FA 3H7IA 1GAJA 4DV3B 4PAOA 3EIFA 3JTEA 4J49A 1T5IA 3O1JC 3SN6A 2V98A 4UQPA 4ZVOA 1ENPA 1VG0B 4HAVA 3ILVA 4A9AA 3UHOA 3ZVMA 5AVYA 1PV2A 1YAHA 1O8CA 3GFOA 3TLXA 3VQTA 1N75A 1YQXA 2YFQA 3ZY5A 3V6MA 8ABPA 1E5VA 1F4VA 2C2KA 2ZJOA 3DUWA 3A25A 2V3VA 4GM1A 4JMPA 2PUJA 2DT8A 3MINB 1PIWA 1GGVA 2H1FA 4FW9A 4HRAA 5EKXA 4BP3A 4AY5A 4FLFA 3ZHRA 3W4KA 1DC3A 1ZNWA 2XOKD 3BWXA 1WZEA 2W11A 3DYVA 3ENKA 1G9TA 3Q3VA 4GKAA 4HFJA 2ZSJA 3BFVA 1TQHA 5FI5A 2I8LA 3QU5A 1CB0A 2EL7A 4TL7A 5TMEA 2YZGA 4B48A 5L6MB 4OHBA 3PZRA 5L3QB 5KTPA 3BSWA 1VM6A 1GZ6A 4HH4A 4NV0A 5B6JA 1DADA 2PMDA 3FNGA 2IH4A 1A7JA 5G0TA 2PFGA 3T15A 2QNIA 1KC1A 3UBMA 1M1ZA 3W6NA 1P9RA 1V45E 2ZYHA 1SD2A 1JDJA 1X74A 1IDOA 2YXEA 2PBFA 4OGWA 1P9NA 4GMGA 4PNZA 3CN7A 4ZODA 4YO7A 3VJKA 5PGMA 3AMVA 2ODQA 1F1BA 3EAQA 3B1JA 4HP8A 4L0MA 4M7PA 4AICA 3DYIA 2FN4A 1AKMA 4RKWA 5H9WA 2GEKA 3P9YA 3NEJA 4J3FA 5ABPA 2D1FA 4KVGA 2MSLA 1Y34E 3MTJA 1SIBE 3O8OB 2QR2A 3HRHA 2QSUA 3GU3A 3L5OA 1GM5A 3ZNPA 4HHEA 5AJUA 3F6YA 3UMJA 2ZJ3A 2JNWA 3P0RA 4CODB 4E07A 4ECAA 1TKAA 4CGZA 1QFMA 1Y4ZA 3OTHA 1IHDA 1T4CB 4K6KA 1UUFA 2H1HA 4CT5A 1T4DA 3HJRA 1WTAA 1BQ4A 1J5PA 4EFNA 1DG9A 4EHLA 1FDUA 2C2HA 2QJWA 1M8JA 4QU0A 4ZO7A 5E95A 3E27A 4MTCA 3M9LA 4QX6A 2QI9F 1YHNA 4UBOA 3U61B 3EC1A 2V5AA 1E2UA 4B6JA 1J1ZA 3N28A 3LCCA 3WNCA 2JIOA 4AJKA 5HKOA 4LMPA 1S02A 1I24A 3ZCSA 3IEUA 2F1IA 3HB5X 1HO3A 5E4YA 3SBDA 4YP6A 3VISA 1C0PA 3VPAA 5ICFA 1HNNA 1T0PA 3MT9A 4QNNA 3P4XA 4PX5A 4CNQA 1OVGA 2JEYA 2GK6A 2C97A 3D6VA 1HM5A 3JZMA 3OETA 4IH9A 5LQSA 3S70A 5KYGA 4B76A 2CV1A 5A02A 4HTAA 3AR8A 4KPUA 3H1AA 1G5PA 1T5HX 4G8DA 2EFEB 2OOSA 1OIWA 2WFMA 2Y1FA 1JLSA 4OL9A 5ALHA 1TZCA 1FXWA 2J9GA 2QI9C 4BVHA 4GZ3A 3WK8A 4AD8A 4DLYA 1RYDA 5B4UA 1ISRA 5M7EA 1G1AA 3MGKA 1BYUA 3EASA 3E4CA 5AI0A 3M4YA 3GEEA 5EZ5A 7ABPA 3FPFA 2GVNA 3WR5A 1JDSA 1KS2A 1TM3E 1WF6A 1W85A 2CF6A 2GPBA 3K6KA 3NNDA 2HDWA 1NLFA 2X6QA 5BOSA 3H2ZA 3VM6A 4GZLA 2NT3A 4Z0HO 1UPXA 2HMWA 3KT6A 1B6TA 1ORTA 3BTUA 2R8XA 5AWFC 4A0HA 4GP9A 4I3FA 4L9RA 2NV2B 3T1NA 3UG6A 2F3PA 4MSUA 1RQNA 3H11A 3FN4A 4K26A 4Z7JA 3N3AC 4C7JA 1Z5VA 3NOXA 4K9MA 5CM9C 3PXGA 5KC9A 3TCKA 1APBA 1UKBA 2NUPB 5A71A 2DF8A 4P9NA 3BC1A 4D1YA 4JBGA 4LI3X 4AUKA 3P8ZA 1SOMA 3P2IA 3ESAA 5EL0A 3DCIA 4I5FA 4KE9A 2PANA 4A1OA 4LHZA 1IJEA 1YE8A 3GL9A 3IESA 4O4HF 5E9AA 2H51A 3AI3A 3BSYA 4I8XA 2JI6A 2JGDA 1WW8A 3MTQA 2Y4NA 3NAMA 2L82A 3I6MA 3WZLA 1TU3A 2BRUC 3N0RA 5FNVF 3H2IA 1A7UA 3I9KA 2ASEA 4B7CA 2FCAA 1AKEA 4CCWA 4XGQA 2W00A 2AN9A 2VBGA 3N2KB 1XDGA 2O3UA 3GJ4A 3X2FA 4B6RA 3F8WA 2QUAA 4XX1A 3EDQA 1USVA 3G85A 1A2BA 2A2ZA 3MRSA 5G1PA 1XU4A 2B3TA 2FCRA 3DTVD 4GBMA 1VL6A 3ETNA 1N4DA 3HZZA 2F6RA 1CQIA 1N2BA 2JK0A 1WM1A 4II7A 4RS3A 3ROEA 4EJMA 2DUMA 3I28A 5TF0A 3ELUA 4H60A 3IRVA 1LLDA 1NW4A 1PAUA 4LV6A 3UFXB 2BGRA 1Z6QA 4L4ZA 2ZJFA 5DHPA 3S8MA 2NP6A 1TYEB 4EB8A 3UPUA 1WDKA 1QZZA 2MU1A 5AUNB 2ZI3A 5DYNA 4GNKA 1EFRD 4QATA 3RVDA 2VDLB 5IEBA 4FFVA 5KSYA 3NIGB 3O8RA 4GXTA 1T6BY 2DB3A 3EIOA 3G8DA 4YMSA 4P35A 1YJ5A 5HHTA 3CPEA 4FMBB 4KH0A 4YRJA 5I4KA 4ZO4A 4DQDA 4FXPA 1EPUA 1A5TA 2Z3VA 2R3SA 5KDOA 2JASA 2YQZA 4F7DA 2B83A 5C8DA 2LV8A 4ZJYA 1RFGE 2GEBA 1R27A 3L4JA 3NMUF 3AVUA 4N65A 2DLCX 3RU7A 1M83A 2YY6A 1NZDA 3CPHA 4UPDA 5CVVA 3OC0A 3GBVA 3Q1LA 3EVFA 3I64A 5LXTA 1R4NA 2NYVA 1J2JA 1VKZA 4CLXA 2GK3A 4QULA 1Z6AA 4C6SA 4CTMA 4Y2XA 1DIBA 1Y37A 3BKWA 4N7JA 3ROKA 3N2GA 4OCZA 1P5ZB 3VH1A 2CJWA 4LYFA 4N7BA 3WLMA 4AECA 3IDZA 1ICIA 2HBQA 1NONA 3LTEA 2B61A 5FNVB 4EYOA 1GDHA 2QQ0A 3C1AA 3FKQA 2BZGA 2PRJA 4MH0R 1M5UA 2C3MA 5H3HA 3P19A 1YQWA 2DFTA 3WO1A 3ZE0B 2JCGA 2A9KA 1DPFA 3FM9A 3B6JA 2NU7A 2HF7A 2YWCA 1JSLA 1K68A 2ZYDA 3EK2A 3QVLA 5JSKA 3OFJA 4Q37A 4YLYA 1NXSA 2PWYA 3JWJA 1TQ8A 3SPXA 3VUFA 3EISA 5JDIA 1JT2A 1XFAA 3M2TA 4DCGA 1GTZA 2J3QA 1WDWB 2DRIA 1JBQA 3FRJA 3HFJA 1LBQA 4LWOA 5F98A 4J0QA 1NJ8A 2G8LA 4MV8A 3SBOA 3MC1A 5JADA 1JF8A 1JXOA 3EJWA 4ZTBA 4TSKA 3FWNA 1GAWA 4DEYA 2G04A 4DLTA 2B34A 4M9QA 2B7BA 3GVCA 1D7OA 4IJUA 4L4XA 3HCWA 1V6CA 4BLPA 5HZHA 1XPRA 2VC2B 4CFZA 1I6KA 3WFZA 5JJ5A 4Y67A 1J22A 1E2MA 4FQ8A 1HT0A 3TIFA 3WL8A 1QIIA 4UBKA 4B33A 3I9V6 3M6FA 1UBEA 1PFWA 3H9GA 1CRLA 1VSVA 2XUKA 1XLWA 2CHFA 2PMFA 1LFAA 1A97A 4BJ1A 4CKYA 2N42A 4FD2A 1RJFA 3IQXA 3V55A 2QTMA 4F6LA 2HZBA 3RF6A 2V7XA 2QAGB 2WTAA 3LYLA 1NI3A 2FW6A 3CEHA 1TW2A 2B8JA 3EEBA 4GRIA 2FR8C 3TIIA 4ENRA 1GCIA 2B78A 2WPDA 1QG0A 2YWXA 3P71T 4GLBA 2GYYA 4N41A 1PS9A 1VCNA 3KUXA 4QUDA 2ZUTA 3JVIA 5E6SA 3KDAA 1BROA 4MINA 3I5UA 2F00A 4C0SA 4F9TA 3QITA 2WYIA 3UJBA 1WQ1R 2WHEA 2R5FA 1KJQA 5ALUA 3E7DA 4A8TA 4ZPJA 5C1DA 2WA1A 5IHPA 5MGNA 2OCYC 3WHIA 3FTCA 2BFEB 4CEIB 1O57A 1T25A 2NTNA 3EIUA 4JT8A 5B55A 4OBBA 3VR4D 3W3AD 4DV2B 4KQXA 4BNDA 1UL1X 5FL3A 1MQ9A 2WHRA 3HO6A 4I08A 1C7QA 4J2HA 4GSKA 4ZQEA 3ETDA 3CGWA 3ICEA 2C7BA 2DUNA 4TRMA 4CM8A 1DCMA 2VPWA 1GLNA 2OHXA 1Q1EA 3CLHA 4IDAA 5BV0A 2YYSA 2HWYA 3EWIA 3HSSA 4MR8B 5ELMA 1E63A 1E77A 1VJ1A 4MVJG 4JDUA 1VMDA 2FA9A 4E13A 1QVWA 3P45A 4ESOA 1WKCA 4U6SA 1R9JA 4PHHA 2P9ZA 1OASA 1UK9A 2JAQA 4YREA 2RHWA 2R85A 4EQ6B 1FUKA 4INZA 3K8OE 2AEFA 5KJCA 2WM3A 2ZVJA 3OCCA 4IYRA 4WOJA 4LSMA 1QUFA 3FBTA 5DASA 4TS3A 1VG8A 2FZWA 4LZOA 4TTTS 1X77A 5CEEA 2PX6A 4JB0A 3QU9A 1L3CA 1HPLA 2C88A 4MPPA 3ZLUA 5CA1A 1DTWA 3D3WA 3LUJA 4PRLA 3V33A 4RS4A 5GGYA 4C0BA 4YXWA 3C43A 4KO8A 5AESA 1EI9A 1PZHA 1J06A 4J0JA 4F4IA 2DPXA 4EGSA 5KOYA 1KARA 1XZMA 3ZXSA 2PSSA 3HKBB 2IEBA 4TUYA 2OFPA 3K9NA 2SKEA 4GQIA 4JOQA 3G7NA 3KPUA 1EAYA 5AUQA 5C3UA 2OXTA 3RRMA 1RTKA 2PGOA 1PDVA 3CRQA 2F4VB 3U13A 1UAYA 4X1YA 3BQMB 3OZUA 5C34B 3NEPX 5CX4A 5D5PA 3VR3A 4DMFA 4NRDA 6NULA 1D04A 3U4CA 3I5MA 3UYLA 3PJDA 4Z0TA 3IODA 3PRYA 1DC7A 1C7ZA 3P9SA 4G0YA 4M0LA 4M9ZA 3RO7A 3WQSB 4AIIA 1E3TA 3UOWA 4ZEVA 3DB2A 4H0CA 1WHTB 3AUFA 5KOHB 1W0JA 1FZTA 1Z38A 3RU2A 3WVNA 4INJA 3ZWPA 2IHUA 3SF8A 4KRYA 2CD7A 2ODNA 4OF4A 1DC4A 3PEVA 5EPUA 1L7XA 4W8OA 5FWAA 4DV0B 1QRTA 4HY3A 4FDVA 4IWNA 2P40A 2IU6A 4UEKA 3VTFA 3A11A 4CDMA 2P30A 2BHLA 3ADBA 4Q93A 1THMA 3AZOA 3DAFA 4FHZA 4ZKDA 4ZZ1A 1AMOA 3MWEB 3Q87B 3RJ5A 3IERA 5AKZA 1ZOPA 1DOHA 3OOWA 5F2OA 4P92A 2G1AA 5AW0A 5JVDA 1AZTA 1MJNA 4URUR 4HWOA 1USKA 3K05A 3REFA 2DZDA 5HCUA 1BS9A 5IUKC 1F2VA 3ACBA 4NEQA 3WRVA 1N2JA 2C3UA 4R2IA 4AJLA 1INLA 3FZYA 2QPOA 4E32A 5BWNA 2P7HA 3IFSA 4B4VA 2I7VA 1Y6GA 3BH7A 4V02A 1E9DA 2J46A 4MS4B 3L7BA 1LPBB 4BLRA 1LRKA 5AI9A 2EP5A 4QLAA 3LPCA 4H3KB 4G0MA 5IN5A 5JH7A 1G20A 1JFTA 5EHZA 4GPZA 4HJXA 4Q1BA 1Q0LA 2A5DA 1LI5A 5ETJA 1U0NA 1R1DA 3GFPA 4PNPA 3SOPA 2CUKA 2N1BA 4O4IB 4PC1A 2WJIA 4EENA 4C7OA 2JLZA 4CKXA 4F3CA 4RHFA 4FK8A 1R5BA 4MGKR 4PPYA 2C4HA 4RNCA 5B2ZA 4E2YA 4YCNA 1QO9A 4RH1A 4GPTA 3COWA 3ORRA 4FKMA 4CM7A 1IK6A 4MEJA 1PL0A 4HMPA 3H83A 2CXXA 2E4VA 1N2ZA 3QMWA 3PRJA 3ETJA 4MJLA 5JYEA 3OTOB 4QEKA 4D3FA 3AVYA 1R6UA 4IFBA 4Y2VA 1PHPA 5D3MB 2CYCA 4QREA 1C1HA 4ZMBA 3L0BA 4WE3A 2VJKA 3MT0A 3D3KA 3OCWA 3PF9A 5AI8A 2XZOA 3D8BA 4HZGA 1GL6A 1JL3A 4GOND 1X7ZB 2ZJZA 1IH8A 2QHXA 2BZSA 3FDJA 2C31A 1ZGJA 4TLMB 1AO3A 4F2GA 5KVVA 4AKHA 1Z17A 3UV7A 4HV4A 1H0KA 1RKXA 2G06A 4PYMA 1KWGA 2Z8ZA 4UHEA 2GXUA 2LDXA 3IIIA 4UNPA 2Z08A 1G38A 2R6GA 5DYWA 1QRDA 2Q3LA 1SC6A 2BJWA 3PQ5A 4Y9UA 5CDUA 2Z5VA 4AY3A 2PGIA 3BMNB 3AQIA 1J9GA 2RB4A 1I30A 4AUEA 3L2OB 2C0PA 1KQNA 1QMPA 1TYCA 3HJTA 4BQOA 2OY0A 3OPYI 4J43A 3KTAB 5DWDA 5FBLB 1MJFA 2JAUA 3IVCA 4DQLA 4YDHB 5H8WA 4OHPA 4M0EA 1IZ7A 4FOLA 4KXNA 2NX2A 1TJPB 4PC7A 4DMHA 1CB7A 1F12A 3A0UA 3IR6A 5AHWA 5IHXA 1QXSA 3QKTA 4BC1A 1KOGA 3KCQA 1U5BA 4MP8A 2HCJB 2DKFA 4PYOA 1DX6A 3H2GA 1L5FA 3MWFA 4QOSA 3UWDA 3V1UA 5DNAA 4DBLE 4MVJF 4MWGA 4B40A 1SBYA 3HJNA 2QJFA 3QWAA 4NVRA 4Q19A 3RB8A 4L4RA 2GCOA 3CZ4A 3F7MA 2AFIE 1G6OA 4U2BA 3USES 3FCEA 3MJVA 4MARA 5K2OA 3PNBA 3KSAC 4OFXA 5MHTA 1CKEA 2A4KA 1Y9JA 1I2DA 3QVXA 3K0AA 5L40A 4TKUA 1TGVA 1CULC 1FFHA 1L4FA 1S2GA 3M81A 1HORA 3ZBQA 4JBNA 1A8UA 1A2QA 3GC6A 4UHCA 1TJNA 3IMGA 4IDFA 1X7YA 4KIFA 2NO9A 4RFSB 1UFVA 1V8PA 2G83A 2HU5A 3AKEA 4KN5A 3PFIA 2QX8A 4WLOA 5DI9A 2M6LA 2XGOA 1DJQA 2Y1LA 2A5FA 2GBIA 5ECGC 3AUUA 3GN1A 1SQ5A 1KYQA 3TQSA 2FI1A 4YBZA 2VJOA 1Q0UA 2DOKA 1X1BA 2OWDA 2RHLA 1P19A 1EA7A 1N5RA 4AM8A 4UHHA 4P2GA 1SUDA 4E7PA 2XUOA 4QOEA 8GPBA 4IDDA 4W4TA 1PZFA 4D4IA 5JCZA 2VPTA 3LT2A 3N1UA 3Q3JB 3CPSA 4ND1A 5EP3A 5C8YA 2IRWA 4HGZA 1WB9A 3DKIA 3L8EA 2B4TO 1EP2B 4G84A 3AFNA 5KYVA 2QTNA 4A5SA 1MQ8B 3PUVA 2R6DA 3D0KA 5EMKA 1IQRA 2YL2A 3WWZA 3WYDA 2GN9A 1GIAA 2EFHB 4L5CA 4BKQA 4EVQA 2WD9A 1NLZA 1SKQA 1XZEA 2E85A 3ZHYA 4RF3A 1FFXB 3X0DA 1BO6A 4D6PA 5BSHA 3UMMA 4NCBA 1E9SA 3TSOA 1KMIY 4JJ4A 5I7AA 1J0XO 4ODIA 3W90A 3WMWA 3B1FA 3FHJA 1Y7IA 2W7TA 2GETA 4JYMA 1N2CE 4S1TA 4X1IA 4ZQCB 1QCCA 1Q22A 3ROMA 1ECLA 4YI3A 1UBMS 2B1JA 3FUUA 3HCCA 5K9ZA 1P7WA 2NLOA 3UWOA 1SVNA 1Y33E 2QPAA 2D8AA 2E48A 1LPAB 2B0JA 1TCVA 1U9CA 2WKWA 2C8VA 1DB3A 2X5XA 4C07A 4J07A 5HFAA 5IAOA 1DXHA 4QYIB 5AK5A 4CF4A 4IS3A 2XUAA 3M6UA 1DUSA 4R1OA 3LZ6A 3VR6H 1GRNA 3BK7A 3KOYA 1FX0A 3MLBA 1WF3A 4WWHA 1R2QA 4MRRA 5FJIA 1UPCA 1HXHA 2CDRA 1BS1A 1PR0A 3QFTA 5J47A 2VDUE 2FG6C 1KPGA 1T2CA 1PTKA 2O23A 3PR2B 4C5AA 2P62A 3UW1A 2H31A 3ZU3A 4E4RA 2I8CA 4LJLA 2EX0A 5GZ1A 4YK7A 4RCVA 1U99A 3GIWA 4Q3AA 1OV4A 3L05A 4JI0B 3U7FB 3AGQA 2H1RA 1T9BA 4OQDA 3OQPA 2IQ5A 2RHMA 2VWPA