4C3OB

Structure and function of an oxygen tolerant nife hydrogenase from salmonella
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
263
structure length
263
Chain Sequence
KPRTPVIWLHGLECTCCTESFIRSAHPLAKDAILSLISLDYDDTIMAAAGQQAEQALADVMREYKGNYIVAVEGNAPLNEDGMFCILAGEPFLEKLKRVSADAKAIIAWGSCASWGCVQAARPNPTKATPVHKLITDKPIIKVPGCPPIPEVMSAVITYMLAFDRIPPLDRLGRPKMFYGQRIHDKCYRRAHFDAGQFVEAWDDEGARKGYCLYKMGCKGPTTYNACSTVRWNDGVSFPIQSGHGCLGCSEDGFWDYGSFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROGENASE-1 LARGE SUBUNIT
publication title How the Structure of the Large Subunit Controls Function in an Oxygen-Tolerant [Nife]-Hydrogenase.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. lt2
molecule tags Oxidoreductase
total genus 77
structure length 263
sequence length 263
chains with identical sequence D, F
ec nomenclature ec 1.12.7.2: Ferredoxin hydrogenase.
pdb deposition date 2013-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
B PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4c3oB01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4c3oB02
3USCS 1FRFS 5JSYA 3UQYS 3MYRA 1UBMS 4KO1S 3USES 1YQ9A 4UD2A 4TTTS 2WPNA 4UQPA 5A4MS 4UE3S 1UBLS 1WUKS 3ZE8A 4URHA 1H2AS 1WUHS 1FRVA 4IUDS 1UBJS 1YRQA 4KO4S 4UE2A 5ADUS 4UCWA 1YQWA 4UD6A 4KO3S 2FRVA 5JT1A 5A4FS 1UBTS 4UCQA 3AYZB 1UBKS 5JSKA 4U9IS 3RGWS 5D51S 3H3XA 4KL8S 4UPEA 3CUSA 4UEWA 1UBRS 4C3OB 4GD3Q 1E3DA 4UEQA 5JSUA 4CI0B 1UBHS 4IUCS 5A4IS 3ZE9A 4UCXA 1WUJS 4UPVA 3CURA 3ZEAA 4OMFG 3ZE7A 4IUBS 1UBUS 4U9HS 1CC1S 4UQLA 4KN9S 3ZE6A 5JSHA 1WULS 1UBOS 3AYXB 5JRDS 1WUIS 1H2RS 4KO2S 4UE6A
chains in the Genus database with same CATH superfamily
1W36B 5JBNA 4PS1A 2GEKA 5ALZA 1G17A 1RAFA 3UHAA 2C5LA 2FWJA 1QV7A 5TRTA 1P19A 2PXHA 3ZHCA 4C04A 3QXJA 3SOPA 5I9IA 3H0KA 1QB8A 1NNI1 3QVLA 4F72A 4EF4A 1UMCB 4MAMA 1GNSA 1O9BA 4OSEA 3ZWWA 5AVXA 1XZGA 3D3EA 4R2LA 1EWTA 1M8GA 3IPXA 4JITA 2QM0A 3X3HA 3NIWA 4TMXA 4ZIRA 4IJVA 2XUOA 3Q0TA 1QIGA 3K5HA 1K98A 1SBNE 3LZ6A 2QZSA 1IY2A 2HHJA 4MWTA 5BSEA 4RJIA 1HO3A 2B8EA 4ICIA 3BWYA 3IR6A 5CFNA 4BVAA 3K0BA 1DEOA 3GPLA 3UUGA 3D5EA 4AU1A 3ANXA 2P6RA 3MZ0A 1KZ9A 3M5DA 5HKAA 5CIWA 5DB4A 2FEPA 1TRKA 3A10A 3AR5A 4XEUA 5DSZA 3WRXC 3O92A 3QEBZ 4E03A 1F2UA 3LL7A 4FYWA 3JQAD 1GTMA 4UTNA 1G4HA 2Y1XA 3ZHYA 4E07A 2B9VA 1QJCA 2AMVA 2HZBA 1T9HA 2Z8YA 2ZWOA 1GUAA 1RKXA 4ZEXA 1N5KA 3EXFB 5D01A 5FQNA 4CFZA 3DM9B 1Q0RA 1W0JD 3NTXA 1BRMA 1EVJA 3PNBA 2RSLA 2OCIA 4D7AA 1Y5RA 1CUZA 5JAOA 1CT9A 4WQMA 5D87A 4ZYWA 3UMMA 4FGLA 3RW9A 4DIBA 3H5TA 5JU6A 3JPWA 2NU8A 1KIAA 1AKVA 3E7WA 3R9XA 2I66A 4JVNA 2EKZA 3HBFA 2X1VA 4LG1A 4RM3A 1IG0A 1XRSB 4ENWA 1OJLA 1MPTA 4ZU1X 1LSJA 4FFWA 5E6UA 2YDXA 4X9XA 5TVKA 4CM4B 4M9CA 4NEGA 1CR4A 5KSPA 1V8FA 4QU0A 3JQBC 4CQMD 1N2OA 4ZOLF 1J4AA 1IVYA 1O94A 4LWZA 2QTTA 2FW8A 1C9KA 4LXYA 3D3KA 2AXQA 3HCAA 3L8GA 4URFA 5ER9A 1KIFA 2E1PA 1USUA 2ORWA 4OMUA 3EHEA 1PCXA 4E09A 3OY2A 3PDIA 4RD6A 5B64A 3K9QO 3MRTA 2JGNA 4BX2A 3K1YA 2BEUB 1M0TA 4IILA 1WJGA 3K6KA 5K3FA 3UV3A 1H5QA 1KPIA 1UJ5A 2HJ9A 3G89A 5D6NA 2W90A 5H5JA 1LRJA 4E1AA 3BHJA 5CVJA 1TU4A 1PJLA 3MSCA 1JQEA 2IYOA 3TNDA 1LFAA 3ORQA 3ICEA 2WVJA 1JJAA 3UK2A 2GJ8A 3IQXA 4OJMX 5FWXA 1B8VA 1VE7A 2MINA 2PGOA 3BN3A 3QKRA 3JARA 2WV9A 3R5XA 4TV9A 2Q27A 3JAMA 3UCFA 3D8UA 1G5HA 5DHSA 3UWSA 3EQ6A 4AG3A 3ED1A 3RUAA 2PBFA 1MO6A 5LA6A 5KWIA 4Z0PA 5TMPA 1HNWB 2J3KA 3GFTA 4N5DA 1M1ZA 1TMYA 5BYBA 3VR6D 5C5IA 3BH0A 5HG0A 1W76A 5FBKA 3IAXA 1VPVA 5CDYA 4KKXB 4LOKA 4DEYA 1W4BA 4K2HA 4MDHA 4PX5A 1B41A 4XA8A 1Q3HA 1XHLA 2PO7A 3VKWA 1REQA 5CFLA 3IQDB 2PUDA 3STYA 2WP8J 2PKEA 2XD9A 3HSSA 3U4AA 2CE7A 4MYTA 4X8LA 2GQ0A 3USCS 3RKSA 3TIIA 3UQYS 4A8JB 1ONOA 1X2EA 3NM6B 4H7IA 4WT7A 4EX6A 4NDAA 2YY5A 3RTDA 1VBKA 3DZDA 2CEAA 4MRRA 2VF2A 2NT4A 5LZ5A 3G23A 4HPJB 2HF2A 2V7UA 3HB4X 1E20A 3PFCA 1KAHA 1AMOA 1J0BA 2VF8A 3QV2A 1XKLA 1JXAA 4KQCA 2DQYA 3FOCA 3H2HA 1S3GA 3S2ZA 2ISSD 2LVBA 3V6LA 2A5JA 5AM4A 3F73A 2V7VA 1ABFA 2JLWA 3TR0A 2BFDB 1Y8QB 5FHRA 3SXJA 5C1OA 1IUNA 2C2OA 1JJ7A 1PL6A 2LCIA 2V74B 3CZQA 3M4XA 4J0CA 4K1LA 4R9UC 4ZMRA 2PZGA 4GZ5A 1PZEA 1ZOIA 1H8EA 3I04M 3OD5A 4D0SA 1EFKA 1NJ5A 3C43A 2AJDA 2UZ1B 2CHFA 4H2DA 4I9NA 4LZPA 5AI9A 5I7AA 5DNVA 2A4KA 3RVMA 1R74A 1RABA 1SIUA 1T26A 1K3UB 4PO8A 2H1CA 3N7TA 3ZK8A 2GXSA 3DOCA 3ABZA 2R6JA 1DDIA 5CCDA 4CIBA 3O03A 4JYPA 3KPYA 1TQ8A 3LI2A 3PQCA 4YUYA 3R5TA 2AL7A 4GRDA 3U37A 2R4UA 2C07A 5DT9A 4DLSA 4PYIA 2HWXA 1DU4A 1W5EA 4ZVNA 4BFUA 2H18A 4CZ2A 3OJXA 5K0TA 2W2LD 2ZOSA 3OC0A 1J0CA 3ANTA 1MFPA 5F73A 4XPZA 1MEEA 4Z7NB 3TGWA 3WLTA 1E2FA 2F2TA 1XHEA 1AGRA 3OX4A 4C01A 4YRGA 3OT1B 1ETHA 1X74A 3ZVNA 1BS9A 1C3LA 2IYEA 2QRPA 4OYHA 3PRKE 5LVAA 1QH8A 3FHTA 3KS9A 2GFIA 1EVIA 3LFTA 3N9IA 1KEPA 3PPXA 1APBA 2G28A 4JUAA 3LXUX 4IHQA 4F5YA 4TSFD 2XGMA 3GEMA 2QL6A 2HA3A 1E77A 1HETA 4KV7A 1XELA 5EI5A 3FVTA 4HYTA 2X8LA 1VGRA 1KFEB 1VFPA 5BQOA 3ZWPA 1KDOA 1TA0A 5EE5B 2QAGC 3DHEA 1XJWA 4UHEA 4D6YA 3WTBA 1T9BA 3KJZA 4U1RA 4XTRA 1F3LA 1U2TA 5EMMA 2Q7OE 3A1TA 1PK9A 5LJLA 2PX4A 3PQ7A 1CJTC 1NN0A 2OV2A 1DPGA 2ZR7A 1V71A 2HDNB 2B37A 3FTFA 4WADA 2P2DA 5FT9A 1WZ2A 5KVVA 3AUYA 2FG6C 4AY5A 1N92A 4XDZA 2JFHA 1QHHA 1K8XB 1A4UA 3IC5A 4UBNA 5JH7A 2EZ8A 4QPPA 2X15A 4I50B 3RFTA 5JADA 3JSAA 4OHMA 3ND8A 3Q0EA 3E2IA 3OTIA 2Y1FA 4QTXA 4DXDA 3AERB 4D4MA 1TUBA 3H6GA 2PZJA 1B8PA 3WG9A 1YB1A 2GARA 2HFKA 2VJDA 1I6MA 2C2HA 3PF8A 3URKA 1LA2A 1TK2A 4UE6A 3W5CA 4D98A 5ICFA 3NBUA 5H3LA 1FEZA 5F2NA 3ZD7A 1O95D 1SHJA 2QUHA 4WKCA 1K6EA 2C2XA 1NT4A 1KH2A 1VMKA 4O4JB 1DHTA 3AMVA 5JFGA 5CVEA 4J9UE 4MEAA 2OHIA 1VG0B 3CW2A 3FXAA 3GUVA 4QLAA 4UM7A 2XZDA 3AX6A 3L06A 3QPAA 2O05A 2G9QA 1QQTA 1XA3A 1M5RA 4D45A 4MS3B 1ZX1A 5LZ8A 1XEXA 1XTSA 3DMGA 3EVTA 3P0JA 1ZM9A 2VTKA 1XTZA 1F9AA 5FYQA 1XZ8A 2OZVA 3TOSA 1P1CA 1A2OA 1XD2B 3P4YA 1SIBE 5CVDA 1TW3A 2FHPA 2XQGA 4O2LA 4JEIA 3FM9A 1FYFA 2CVPA 1ZD8A 1TKAA 3JAWA 4FLFA 5HTOA 1M2HA 4KO4S 5CTAA 2VDWB 1PUJA 2YV2A 5IDVA 1Q7EA 1MAUA 3G0CA 3WMRA 2D3TA 2OV8A 3EGXB 3LECA 1MC1A 2AN4A 3JAKA 3WQHA 4A9AA 1LW7A 3VYUB 3N3AC 5E1BA 1X7YA 5LQMA 1YB6A 1Z2NX 3BXXA 5HIJA 4QASA 2ZI9A 1RJWA 2VXBA 3M1IA 1NBME 3FR7A 4FZVA 1U2DA 3OPNA 4FOLA 2IYFA 4EJMA 4F1JA 5H4HA 1J33A 1VRCA 1LXCA 3EZLA 621PA 3F74A 2NACA 1HGXA 3LUAA 4MMYB 3FYDA 3BVPA 2M6SA 3GUUA 2GLUA 1C0PA 3VYVA 4DYVA 1E5TA 4G6ZA 4YDSA 1AU9A 4G5XA 3X1YA 4DV3B 2G8LA 1M9NA 2PV0A 3DV0A 2YC4C 3GRPA 4MW5A 1CUGA 4NL4H 1JFVA 4MICA 4LXGA 1EJ6A 1KC1A 4CIYA 2CNKA 3KR1A 4M6WB 4Q01A 1I0ZA 4LQLA 1Z22A 4PV7A 2XW6A 4WKGA 4C3OB 5A4DA 1FP2A 5BRAA 4IOKA 2ACVA 1Y89A 4D8UA 3E6AA 3HXTA 1W5FA 3AUAA 3G6KA 3LDFA 4OOEA 2B21A 3PKIA 4EY7A 5KEIA 2IEAA 2X8WA 1LLFA 2B1GA 2OAGA 2GHTA 2PFSA 3EVEA 3HG7A 3QKSA 4FYIA 4PICA 4RQTA 4YCDA 3V4ZA 2RI0A 1CR6A 3B1WA 4AUEA 3O3CA 4RSMA 2R86A 3PE3A 4XDHA 4FBLA 2PGNA 1W5TA 5E1DA 3FDFA 1N7JA 2BGJA 3OEED 2CLEB 4LSMA 1CBUA 2CNWA 5EWLB 4DW8A 3IELA 3UWDA 1TLFA 3I5UA 2VHUA 1CP2A 2ZT8A 2GJSA 2HA0A 3HJCA 5DPMA 3G2MA 4ZV9A 2O2YA 1JP7A 4B31A 1UCFA 1W1IA 2G9NA 5K8IA 1FXUA 3AZQA 4IJ5A 3ZV3A 1KBQA 2N0SA 1SC3A 2UVPA 2WLTA 5IAEA 3VR4D 3T7EA 1EXMA 3RVDA 5EQJB 1W75A 3RVOA 1XZNA 2JA2A 4CG0A 2RB4A 5JECA 4L72A 4MZDA 4O4IF 3BM5A 2PMWB 1FB5A 4TYWA 2NPIA 3EOBI 2EW8A 4C76A 1P7WA 1VKRA 4X0EA 1NPTO 4KXYA 7ADHA 4BVHA 3NVAA 3FGNA 1JQ5A 1HZZA 1V39A 4NG5A 2G1UA 2N1BA 3GLGA 1NY5A 1H9BA 4R1TA 1I7DA 1IN7A 2DLDA 1M2KA 3BMCB 3E23A 1C7QA 2H0RA 3LRTA 1BX1A 4C6RA 4PCVA 1ZH0A 2VTVA 4HQ6A 1GCGA 2W83A 4BYGA 1OFTA 2F3TA 1DFHA 3TS1A 1E79D 4GE3A 1E60A 4PLHA 3J80A 3VVLA 5ADVA 3A6PC 3CUEF 1FNNA 2DPGA 3I04A 3OX2A 3JWIA 3B8EA 1CRWG 3OG9A 3KTFA 3FF4A 4WZAB 3T4UA 1CUHA 2M98A 2P4HX 3UJBA 3WK9A 2RBGA 3E61A 5KKNB 5AW6A 3CZAA 3EJ6A 3QUBA 4TTTS 1AS3A 1RTKA 2DRIA 5GV7A 4K03A 3OM9A 3JWHA 3G49A 5D2CA 5IBRA 2DQZA 2AFHB 2FW9A 2QMYA 1OGIA 3SJCA 1LSOA 1BH2A 4MQLA 1ZR4A 5IDXA 4QFDA 3ZGVA 1ZI8A 3LT1A 4Q66C 1XMXA 3FW1A 3VPHA 4JCCA 4JC0A 4FWBA 4G9EA 4QPZA 3IQWA 4AW9A 4QG7A 4KQIA 4Q4AA 4C87A 3IOMA 3GA0A 4C21A 1XUOA 2E85A 2YWGA 2EG5A 3QUCA 4OFBA 5ECGC 5J4VA 3MGKA 4XRRA 2VC2B 4IQ8A 3JV7A 1QGUA 3HY6A 5FL3A 1QWSA 3BDVA 2D62A 4KLAA 2CK3D 1NI4B 1R5BA 2Q4TA 4RPKA 2FMHA 1YZUA 1VM6A 4F1WA 1SK9A 2P41A 1LLQA 3QK7A 2AUTA 1U1GA 2CT8A 1A77A 1OXTA 4NOKA 1ESMA 3WWOA 3HJUA 4DY4A 3EF3A 3TL3A 2C4VA 1LQUA 1CQWA 1D2CA 1CUCA 2IXBA 1IYZA 3QFTA 2Q3JA 3O3MB 3T5MA 4QBIA 1YU9A 1PG0A 4CDMA 4ZI7A 1X2BA 1QF7A 4J0QA 3ENNA 4IEIA 1JB9A 3QXHA 4HSGA 3VYTB 3O2QB 2PUCA 2RGAA 1LVHA 3EXG1 4OI0A 1E4VA 3OCWA 1T1IA 1Y5IA 1OYWA 3CPEA 2RGDA 1X3SA 5BUSA 3QF7A 1PZFA 4J90A 3Q3JB 4X00A 4D3SA 3EXEB 1I2ZA 1XCBA 4LK2A 1H2YA 4X6UA 2GM4A 3WICA 1A27A 1GXSB 2TS1A 4U7GA 4K86A 1Y3CE 1LPBB 3WLKX 3AUFA 3TQIA 4F5WA 2HA2A 3LCRA 2BJHA 3A7DA 4UNPA 2PLRA 1T2CA 1ORWA 1RYZA 1WUJS 3TB4A 3WOHA 2PM8A 4UPVA 2OORA 2XRMA 2WG2A 4L4YA 1X8JA 1NXWA 1WDTA 3X1WA 2HLDA 4JOBA 3U13A 2VZ9A 2F62A 3RF6A 2BEVB 4HWKA 3PC2A 4WKNA 4BTVA 4DKXA 4PC6A 1QQAA 1ECBA 2Y1KA 1JKMA 2XHZA 4G5QA 1RACA 5B2ZA 1U7PA 4CDNA 5DK4A 4OO3A 3WV5A 4CFYA 4Q16A 4EG8A 1FUIA 4AQDA 3E84A 3REFA 3WRYA 3V7WA 1LGYA 1UJCA 2FTKE 2Q5CA 2XQVA 5CRIA 1SKUA 2XZPA 3E48A 3QMPA 4FYPA 4BNMA 5CLJA 4FSXA 3HN2A 4WV3A 5C3MA 3P9CA 1UWVA 4D6PA 2AVDA 2JFXA 2WF9A 1ZD2P 3FOAA 4Y6QA 3HLTA 4LPSA 5FADA 5HYVA 3R7DA 3KHTA 2ZZMA 2IU3A 4QBTA 2QVGA 2D06A 1ORRA 4G1EB 2AWOA 2Q6TA 4DXHA 3UAGA 4I3GA 3OQ6A 3PI6A 1GD1O 2NZYA 3EF1A 5L7WA 1IPHA 5F9FA 2FWAA 1KEUA 4H60A 3TDMA 5JE8A 4XEHA 2PT6A 1IB0A 1BU8A 3W3AH 5AVQA 1ZESA 3AUKA 5LQRA 3FNHA 3D2LA 4B3TB 1P91A 2G0TA 4HQRA 4BNTA 1VIAA 3S70A 3AB3A 5KU7A 5JUWA 4Q9DA 3UMCA 4QOEA 5KTNA 2ZRPA 1GQQA 3EWIA 1CDZA 3EXHC 1YWGO 2CBGA 4RDIA 4NDNE 8ABPA 1YFLA 1CUEA 1K5DA 4HUQB 3UZUA 5BURA 5AVRA 1TLTA 2HPVA 4NQZA 5BQPA 1AQNA 2JVIA 1BW9A 3ZTTA 4BO6A 1FSZA 1QAQA 3PJGA 3EGOA 4RK0A 3HP1A 3G9TA 4DR4B 3L6EA 1WUKS 5E2IA 3ROPA 1KFCB 3WHPA 2O0KA 1UFOA 2CCJA 2XWPA 3NC0C 4P36A 1S1MA 1W1UA 3TOVA 2NM0A 4KIJA 3E7PA 4KXNA 1G2IA 4L50A 2SHKA 3TFQA 1AF7A 3KOUA 4X84A 2BR5A 3HVKA 4CU5A 4PG4A 4DLKA 3LLMA 3JWJA 3DV2A 1H6AA 4OXNA 3MMNA 3HFRA 2PMCA 2E6KA 1WXFA 5B1HA 4HP8A 1VYHA 1R88A 1R6BX 2EHJA 2OV1A 2Q3DA 3ER6A 3K4HA 4PLGA 2HIHA 1QRRA 4QT0A 2EG9A 3E3NA 3AVPA 2YQ5A 3ASVA 3IAAA 2X5OA 5DTEA 4BO5A 2NUTA 3CONA 5SY4A 5U9CA 1CXZA 2J3IA 2JZOA 1G8AA 1S4QA 4MKFA 3FPJA 3W6NA 4JP8A 3JQ9C 3RTCA 1YMVA 1OU4A 4QSMA 1D3AA 1U1DA 2WHEA 3I0NA 1Q19A 3RNOA 5I9TA 1J0DA 1P1HA 2O0MA 2X2EA 2R7AA 1S3FA 1IMOA 2OKCA 4POAA 4X1KB 4IRXA 1AHPA 5AD1A 2XBLA 1JMYA 4YRNA 2GYVA 4J0EA 4LYDA 3IE0A 1JAYA 1KEZA 2GXQA 3PDJA 4K9OA 4C0KA 4DMHA 4GGOA 5DTMA 1JQKA 1NT2A 4HLNA 1L5OA 2F1OA 3VZBA 1G3UA 1YRHA 2A6PA 3G59A 3NHWA 3HE3A 1QGOA 1ZKMA 2VPYA 1JSRA 3IJPA 3FGPA 1E9EA 3LDHA 1JDBB 4LYYA 3OQHA 1M2NA 2JI9A 4L3WA 4WUTA 1R3UA 3BQMB 4H1HA 3SYLA 2X9GA 2LDXA 3WISA 3F7TA 1H2WA 1YJQA 4I8DA 3BS4A 5EIXA 1PV4A 1SQ0A 3VBCA 3CFYA 1GFZA 2G71A 2QTVB 4OMFG 1VG1A 1DEHA 3QFHA 2HMUA 2Z83A 5I8PA 3Q8LA 1ZNZA 4MVJD 3HXLA 4UMFA 1B2RA 1XVIA 4DM7A 4MWOA 2ZUVA 1B15A 2XGOA 4JROA 3NETA 4WHMA 2QWXA 1E9VA 4I50F 5KS2A 4YB8A 5LU8A 3HO1A 4WVFA 4XAQA 3ZUGA 1AY0A 5IEJA 3HSKA 3K4QA 1GCOA 3DE0X 4I55A 5AW8A 5JNWA 3PT9A 4Z7JA 4H15A 1GAXA 1X86B 3KYIB 4ZV7A 3B60A 2JLYA 1FDIA 2P3OA 2G1PA 2QAIA 3FKQA 1YQDA 2I99A 3TNJA 1CR2A 1R4MA 3C5EA 3HJAA 3PWZA 4XLLA 5CP8A 1Z33A 1P39A 1RDFA 5I7OA 4O4JF 3VSCA 1H2FA 1Z8FA 5GINE 2C9CA 2WNSA 4WY5A 1OMOA 2GHRA 2Z04A 4PZ9A 2CMKA 1C0KA 1QQ5A 1A5SB 2DETA 3QUTA 2FY8A 3VVCA 2I4OA 2G77B 2IHZA 3IP5A 4P35A 2GN2A 3B20A 2R00A 3RARA 1E3WB 3UICA 4CLOA 4LX8A 3NTLA 5KNDA 1D1PA 1QFJA 3V8MA 2AE1A 3TZBA 4EK9A 3RRXA 4X63A 4KRXA 1PUIA 4OSOA 3G82C 4BMNA 1WHTA 2VNAA 2WINI 4AP6A 5IM4F 4U7PB 5KOYA 1C0LA 4J0DA 1HKHA 3O0TA 3J81k 2HIMA 3A6KA 1QHIA 2QVCA 4TPKA 2VXCA 3QUQA 3ONVA 4MLZA 4ITVA 5TR9A 4KWEA 3HNPA 2OCAA 4Y7DA 4YRCA 3VKUA 3OF3A 2PFKA 2X5JO 5DXFA 1V2GA 4YRKA 1RZRA 4KX5A 1DBRA 3ZNPA 5EXSA 4CMIB 2C03A 2OM2A 3EVAA 1JHMA 1ZY2A 1J90A 1MFZA 4OM7A 4RK4A 3TB6A 4UD6A 4DTIA 1ZJ4A 2R8BA 2XV1A 3TW8B 3UGQA 3TMAA 2XKKA 4F6CA 2EWWA 2IUTA 1G21B 1SZCA 3AUTA 3CMMA 3NTOA 1KHTA 1VGQA 5KTPA 3MAJA 4BNDB 2P1DA 3H04A 2CV1A 3IVCA 1ZVKA 3FYUC 4HXYA 4IDQA 2W8BA 5LM3A 3CM0A 2XOKA 5C7LO 3IVRA 1ZXLA 2G5CA 1P29A 2MDTA 4KFRA 1H05A 4UASA 2YJ3A 1I2CA 4G2NA 4G0QA 3R9XB 5K0CA 1WY5A 4MHOA 3SBXA 3V8VA 3QVMA 4D0LB 4JB8A 4Y2HA 1Y1SA 4WMLA 5EKXA 2O2CA 1E1QA 1GAJA 2JL1A 1RPNA 2RE8A 1P7PA 4LN1A 3OEWA 1SXGA 2DPLA 1YA4A 2QRJA 2DYKA 1QGAA 1RRMA 1X80A 2OFOA 3RUCA 4N82A 1DC7A 2QN9A 4O0LA 4RULA 2A88A 2FPXA 4XQ0A 4LVOA 1FXSA 1NUAA 3FUUA 3NTUA 5L7TA 5LP6C 5DF1A 2V1XA 1ZAKA 4IRMA 2XECA 1JHYA 2FX2A 2XA1A 1DLIA 1NIPA 2A2ZA 1DIOB 2JDIA 2Y0PA 4Y6OA 4P4LA 3C5CA 4QOJA 4PWZA 3SP1A 3WGKA 4ZCMA 2BFAA 1COWD 1QIDA 3VR0A 1KK2A 2GYYA 2V4ZA 2PZLA 1Z5ZA 3FPEA 1JIIA 3I3OA 4MUXA 4ZMSA 3PV0A 5D85A 2V0CA 2HWKA 3OQMA 3KXPA 4A6PA 4MGHA 3WRXA 3SK0A 1I32A 2PV7A 2QIOA 1Y98A 2ZULA 3B6MA 4FUTA 4IX9A 4WOBA 3MLBA 5DOVA 1OFIA 3VR2A 4DR6B 1OX4B 2YHSA 4N18A 1EHYA 3CR8A 5EEGA 3PGMA 1QYXA 2WT9A 1Z0AA 1FYXA 2R1UA 3DFKA 4L8YA 4JJKA 1BH6A 3CKYA 4FEYA 4AKSA 4CKWA 5MF6A 3L4JA 2IS4A 2QPAA 3R8XA 1V2HE 4KQGA 2YNMD 1Y9EA 3H3FA 4RLQA 3E0XA 1MW8X 4ND7A 5C8DA 5EP1A 3DKPA 1RHUA 1GVNB 4MOWA 5AW5A 4GYWA 3KQUA 1G4UR 1TM5E 1NQAO 5MGBA 1AUQA 4YAKA 2BI7A 1SOUA 4HEA1 1NPDA 2FRDA 2ZREA 3SEFA 2BTQA 1Z0FA 4E5UA 4BMSA 1X8LA 4Z4CA 1G3MA 4Y2TA 5B4VA 1FZTA 1TD1A 3H2BA 4MW4A 5FEUA 3JQBA 3DSRA 1DZIA 5G1OA 4QTUB 4HVLA 2WKWA 4JLJA 4X20B 1NOIA 4UUQA 1TADA 1CWUA 1IRXA 2EU8A 1JPJA 4CQJA 4GOND 3ZGOA 5LD2B 1PZGA 1K7FB 5A9SA 4C9BA 1GTL1 1KJZA 1X1DA 2REQB 1IZ8A 4ZV4A 1YL5A 2RHWA 4QDZA 4EW2A 4IMIB 3GLHE 2W8ZA 1R12A 4Q3LA 1VCNA 4EYEA 3UCXA 1H4TA 1VLZA 2IOFA 3J81A 1NMZA 2D5IA 3OLVA 2ZIXB 4KFTA 4RPHA 3EZ7A 2QRLA 1OT3A 4ZCPA 1XX6A 4ZPXA 5CAEA 1QU2A 1LW6E 1PR5A 3I92A 3O1HB 2YFQA 2BLNA 1GDDA 4IJWA 2NSLA 2ZVDA 3GLKA 5EP4A 4OGWA 3UBTA 5JJBA 2GH1A 4WKOA 1KI8A 2BMDA 4CW7A 1XT6A 1ZUHA 1J8VA 2WSSD 4KV9A 3U4CA 1TJ5A 3AOGA 3PEYA 3VNUA 1AIPA 4H0CA 2HO5A 3IERA 4U9IS 3O47A 3OQ1A 4P86A 3LXMA 1YDMA 3SC2B 3VRHA 2HEIA 4KBYA 1ABEA 4BVLA 2BBSA 3TZQA 3RADC 4LJKA 2C2WA 1WV1A 3H9QA 4KE8A 2PMEA 3QG1A 1GGNA 4BKOA 3OP1A 1WCYA 4E6EA 1VPWA 4DVJA 1Z9BA 1URPA 4MWZA 2VNJA 1PJBA 2O6LA 3R0XA 5TJ9A 3G8BA 3WGVA 3OA2A 1BG6A 5E4YA 3ORYA 3C74A 1W4AA 2X0NA 2L69A 1MAHA 1JB1A 3ITDA 3A6HA 1LK7A 2GERA 1O96A 1G66A 3GVHA 1JVNA 4BLSA 2IIPA 1U3UA 2WB4A 2XYGA 1CZOA 3IUYA 3AM4A 3TJRA 1DUIA 1XCGB 4MQ4A 2XOEA 4ZZ1A 3RUFA 2RGWA 3A8TA 4LEIA 1SQGA 4F2PA 5J1TB 5K01A 3Q3VA 2Z08A 5CIYA 3T12A 7MDHA 4D4JA 5JDIA 1BDHA 1NZDA 1Q14A 1RP1A 1Y4AE 5LQDA 1Y4DE 2C4TA 4C7MA 1VRVA 3FUXA 4N9QA 4KSBA 5H7XA 5HM8A 5LQUA 4BNYA 2ENWA 2CE2X 2XEXA 4GXNA 4FONA 4AVYA 1KPGA 1YS6A 1RZ3A 1DRWA 3I62A 8MHTA 3KZCA 2XPCA 3GRZA 2F67A 2LDBA 1BCRA 3I42A 5FA8A 3VZCA 4O2BF 2J0SA 4CJXA 1OX5A 3V42A 1WMBA 3A1DA 2ZSDA 4ZDJA 1TTTA 2JBHA 3WDSA 3NC4A 1M2OB 2AFRA 4DADA 1DWOA 1E6EA 1PWHA 1KDVA 2GSDA 1EXVA 3IEMA 3GRAA 5FLYA 2QZJA 4GXQA 3RUDA 5I9LA 2ZE6A 1KAEA 4BMYA 2PH7A 3G8CA 3MF4A 2UVDA 1E59A 2FHSA 2HNBA 3C8HA 2D54A 2JBAA 2GF9A 5JXIA 3E9NA 4PQYA 1PQPA 1TF5A 2HRCA 2QVYX 2O8BA 3LDUA 3LH5A 1D09A 1DJPA 4FFRA 3INTA 1NDHA 4F12A 3MTQA 5JI2E 1A7JA 1D9XA 5DM2A 1KOLA 3TLAA 3WKDA 2DKNA 2R5NA 2ZJ2A 1WPGA 4TWJA 1F6BA 3WE7A 2H29A 1ZRNA 3FRHA 2NV0A 3TVYA 4FE3A 5JD5A 1EI9A 3NBYC 3T41A 4E5DA 1JX6A 1O57A 3N5KA 2HCJB 2ORIA 3G6WA 3UC9A 3FMPB 2FF5A 2Y1WA 3NHUA 4DWVA 4E2XA 1Q2XA 1N32B 3ASZA 1RFLA 3PFKA 1CY7A 2ZPTX 2DR0A 4BWYA 1W5SA 5HFNA 3CNNA 2QAGA 1EVLA 2I3GA 3R3JA 1Q0UA 2CGEA 4ABTA 4XCVA 1XRMA 3EMBA 3SBOA 2HL6A 4OLJA 3R2JA 5DW3A 1EYZA 3M5WA 3GH1A 4BO8A 4K8OA 1AD2A 3L40A 1GKUB 3VO9A 1IFXA 4JJEA 1OLSB 2E4ZA 4JJFA 3QVTA 3PEVA 1E3QA 2Y1DA 1NN3A 4UFPA 1N5OX 2DFNA 4XX0B 2IUYA 3I9LA 4IDEA 5F3WB 5LBIA 4O4HF 2BF4A 2AMFA 3PGVA 5T5QA 1MAVA 2EV9A 2XB8A 3QQ5A 1Q1EA 1RXCA 1SULA 4FOTA 4DNXA 4D99A 4B7UA 3M33A 4RHTA 4JDPA 1WU8A 5AJXA 2VJOA 5AVJA 5IVDA 3D3JA 3P0EA 4UOQA 1D9ZA 4U63A 5CA1A 3H11A 3TDKA 4D9MA 3ZNNA 4D43A 2RHRA 2WYIA 3E8MA 3WFIA 1N6RA 4PCAA 4PYKA 1F20A 1JQLB 3TSZA 1ICEA 2HDHA 3P71T 3IB6A 4C0SA 4L7VA 2UYCA 1W87A 3TLXA 2AK2A 4OJNA 3WXBA 1DS6A 1ORTA 2P9QA 1TNDA 4DCNA 3LU1A 3P20A 4KLZA 2BEWA 4PZPA 5KNDH 4W5NA 2BJVA 2AV6A 3MGBA 3PLNA 1NQWA 2TYSB 3UKDA 4A36A 2HTFA 1QGZA 1R8QA 1SU4A 4UEWA 5FLXA 4E5PA 1ESEA 1UXKA 1Z35A 2IBMA 4QFBA 1ML3A 1YBAA 1F3OA 4ZODA 4E08A 4KOAA 1OH6A 2KLHA 1XU7A 2X9LA 3M83A 1C7EA 1YC5A 4HZUA 5DBHX 3AW9A 4L85A 3U3OA 5IKEA 4R05A 1E69A 3F6EX 3TI7A 3DT8A 5KYWA 1L7MA 3HK2A 1EE9A 2ZCJA 5G1NA 4D9CA 1G5QA 1RBZA 1XJ0A 1P9OA 3MVEA 4KR6A 1BNCA 1D6JA 1TCAA 2ZDGA 1UDWA 3HVUA 3ZIAA 1U2EA 1MIOB 2OILA 5BW4A 1BE1A 1N1MA 1VZ3A 4DLUA 5EPEA 1W29A 3OI7A 4F21A 3OMXA 1WEKA 2IP1A 2HIAA 2OCDA 4QELA 4BOYA 1HNXB 3WL5A 4UBKA 1DHRA 1QE5A 1MKYA 2BI8A 2G5TA 3HBMA 3AETA 2F3UA 3LBNA 3FOBA 2C9BA 5CBPA 2H5EA 5IAJA 3UWOA 3IKLA 2IS6A 1Q74A 3HKDB 3W2EA 4D57A 1XTPA 4KPUA 2CXQA 1RPAA 1YR7A 4IIFA 3IMEA 3IH5A 4QQNA 2OLJA 3SBEA 3MTDA 1US8B 3K9WA 4XGRA 4MQUA 1MP0A 3CHYA 2YZ2A 5HRAA 2XXBA 1T2AA 5HDQA 5E2BA 4YO8A 4YCCA 5DM4A 1JA1A 4WNCA 5SV2A 2D1TA 4LF8B 5C5DA 4HGNA 2HRRA 2TMYA 1EWYA 1LI7A 1BWSA 4D82A 2BSXA 1I4DD 3DTVA 3GZNB 3VAYA 5M34A 3EIEA 3DKVA 2W6CX 1ZGZA 5MFZA 1CPYA 3JASA 3L0ZA 4IV0A 1ECCA 2ZWIA 3OZDA 1XU4A 3BDAA 1W30A 3DUFA 1BGXT 5FFNA 4DS3A 2X7JA 4M9SA 1M0SA 4TTIA 3FCAA 2VDOB 3IDAA 5JI3E 4LDPA 2IXAA 3CX6A 5IASA 2QXTA 4QPJC 3ZGYA 1I3MA 2VP3A 5I9SA 3HCFA 1VG9B 2HT6A 1ZIPA 4LGMA 3HDQA 3JTMA 4I5GA 1YQEA 5TQ2B 2H4XA 2B69A 3C15C 1I7PA 3NBZC 5CEFA 3ZGZA 4M0PA 1T36B 1M5UA 3KOYA 1ZONA 3ZI0A 1LB1B 5MDHA 6CHYA 4DR2B 1D1SA 4XB1A 2C9YA 4ESOA 4A7PA 3ZU4A 3C3DA 1WRBA 3E5HA 2RK3A 5CVVA 4F04A 3MINA 1JU9A 1SM4A 3DMFA 4K6MA 4QL3A 4WBXC 5I7FA 1JFTA 2FPKA 3CZ5A 1J8QA 1ULZA 3RAFC 5A9TA 3HJTA 1TI7A 1TJ3A 3F5QA 4HUJA 1R6UA 1P44A 1YS4A 3E1GA 2V45A 4JDUA 1LBEA 1P80A 5AK0A 5JAHA 4K3VA 1SC4A 3IBTA 4OQXA 3RNLA 2J9FA 3SY8A 3KIPA 1SEVA 2W93A 1GFWA 3EZGA 4RLSA 1FLDA 5FRDA 5DYWA 3ZDBA 3B1XA 1D03A 3L8ZA 4WL0A 4YMTA 2EERA 3LUCA 4HDCA 1G5RA 2O7SA 4BU0A 4A0GA 2ZXUA 1SPBS 3VX4A 4KOEC 5AOCA 2ZS9A 4ZOBA 4BLUA 1PN3A 4ZJZA 5IT9A 4KR0A 1U7OA 1QG2A 3MGGA 3MD9A 4QHYA 3RCBA 4HNVA 2GMWA 5JZVA 5M5BA 4DV2B 3N2IA 1GEEA 2WWFA 1M7GA 1YS7A 3R40A 3AWDA 2V65A 3CZMA 4I4CA 4Y2GA 2WTMA 4NBWA 4R2HA 1BFDA 4A1OA 4N3BA 1E5XA 4PN7A 1N3LA 2C5BA 3A6JA 1EWVA 1FX0B 1Y7TA 4MVJE 1Y9JA 2G0NA 5EMKA 3ETEA 3CVYA 3T3EA 5G4KB 3C7TA 2D1RA 1LDGA 4KDEA 2ZTUA 4UU7A 3WL6A 5G1PA 1V16A 2B8JA 2H17A 2CLSA 3ZJVA 4RU1A 5TQ0A 1H66A 4KN5A 3D3WB 4EELA 1PE0A 2O2EA 2OXFA 5IAGA 1C9JA 3AJ8A 1L4EA 2Z2XA 3INGA 5FI1B 4IUCS 3IFSA 4JBXA 1AGXA 2G63A 2ZRNA 2Q5FA 3VNQA 2H7XA 1I7SB 1LV7A 5DWDA 3DB1A 5AUOB 4JASB 1IOVA 3DHVA 2IHVA 3W7BA 3AJRA 3A1EA 1QLJA 2WU8A 5LQAA 2AVNA 1AO3A 3T5GA 3D5TA 3CLTC 5D3QA 1BRTA 3IAFA 4REOA 4UVEA 3TN7A 3W5UA 4BFWA 2IOYA 3ANLA 2ATCA 3LC1O 4HLQB 1QORA 2R2GA 5IUNC 3RYHA 2XUJA 2C97A 4JK3A 1V5EA 1I3LA 1YCFA 4BBJA 1T6NA 4PPYA 2WUVA 4ZDWA 1FXWA 1G3RA 3SE0A 1GFSA 4CTMA 3DLAA 4Y2YA 1QLWA 1GZ3A 4KP7A 3FHCB 1XG5A 1NVKA 2ODAA 1C1DA 3WLJA 1R6AA 4FZ3A 3WV4A 2PU7A 5CT5A 1ZSNA 2VPPA 1BIFA 3ESBA 5HEKA 1OTYA 2D0DA 2I80A 3V4OA 4AZVA 4L4ZA 1AQYA 1ZG3A 4BQEA 1XIVA 2B30A 2COUA 3ETDA 2AC7A 3CCCA 3MUEA 5FJJA 4ACBA 4O33A 4P5DA 5AXDA 3FD8A 4P0TA 4GVXA 3U48A 1TQ6A 4NOLA 2ZJBA 2AFIB 1C3OA 1TJ4A 3I39X 3L4KA 1JEOA 1JFFB 3ED5A 5FWYB 1CB7A 1BDJA 1ODIA 4AWBA 1MV5A 1F4VA 3U62A 1NFRA 1QBKC 3F6YA 4J1TA 4G1MB 2WPNA 3E3MA 4ZYVA 1QTRA 4BO9A 1TEXA 3HDVA 2OZLA 1C0EA 2ZWAA 4IJMA 4DC9A 3VC1A 2C77A 1YBMA 3I83A 4YWJA 3PWTA 4WXEA 2HGSA 3GZTB 2FNAA 1M75A 3GLFA 1DKPA 4JUFA 4RSHA 4UUAA 3SJ7A 3R3UA 3U4HA 4O59O 1OJ7A 3AFOA 2PHZA 1YXMA 4QDUA 4RVFA 3ZWNA 5BR8B 2C00A 1FBNA 2W2MA 3K0AA 5DFAA 3QLEA 3L7KA 1GPKA 3CNLA 1PL8A 1Y5LA 3CRMA 3REOA 3B1JA 4FQ8A 2O06A 4QPCA 4CMAA 5C3UA 1T0PA 4GX0A 5K99A 2ACEA 4LZNA 4XYGA 1C30A 3EIOA 2ZR0A 3EUAA 5JPCA 4H0FA 2VHWA 2IYTA 4KC0A 3A05A 2FN4A 3AR8A 5IP5A 4REQB 3W6PA 3KYDA 4CT5A 3P9XA 2WHPB 4YTEA 4AECA 1LLUA 1Q22A 1Y1PA 2CHUA 4PF1A 2OGWA 4NK5A 4HBZA 1L1FA 2H07A 1RXVA 1JDPA 4OATA 4HEQA 4ZHQB 4PY2A 1OXBB 2V9CA 4J07A 3JD4A 4UUBA 3NV9A 4K7JA 3CLRD 1U9IC 1UDCA 5EQTA 2BY4A 4FOSA 2YHUA 1UC9A 3E7FA 2EFEB 2B4YA 1GLNA 1VL6A 2FSHA 2JK0A 2JLBA 1V5FA 2WFLB 4P4GA 1OBCA 1NRIA 3MJ4A 3UKOA 2F4VB 1Y6RA 2OFXA 3O74A 3I01M 2NTNA 3H9JA 4WPGA 4W7HA 3RWMB 3RT9A 4XVUA 2VQ6A 4OYRA 4AURA 3LQQA 3T5TA 3R09A 5KQPA 2JIQA 4KJXA 2H1FA 1RWOA 4M0CA 2YJ5A 3V8RA 2HCRA 1VJ0A 1K6IA 3MUNA 2QPLA 1JAHA 5D86A 3PC4A 1TGVA 2B34A 3ZVRA 3L0CA 2NAFA 3GY0A 1RZVA 4IWYA 5B2FA 3WLHA 4LHSA 2GCOA 3RRNA 4POOA 4IIVA 1WUTA 2WIFA 3DQQA 3KJEA 2NU6A 4KXQA 3W7AA 1O5TA 1E92A 3WZLA 5LP6B 3PD1A 2ZB4A 3VVMA 1ISJA 2WQ7A 1RCTE 3GJ8A 1PFVA 2BFMA 2DKOA 1KI1A 1N6OA 1OHHA 1SBYA 3AHJA 1P2GA 1IONA 3P9IA 4MYSA 1RFGE 5E4TA 1X3LA 2XRFA 2ZBPA 1TW2A 1JBEA 1K97A 3DR3A 4DM3A 3NUZA 2Q3CA 5ITVA 2ODQA 3D7KA 3P4UA 1YR2A 4D9BA 1GTSA 2ZYSA 1YACA 1GGHA 1N7HA 3CH4B 4QFCA 2V7QA 2PLNA 2N75A 3OH8A 2ZBUA 3QWBA 3AR2A 5IJ9B 1P4AA 3F4KA 3JZAA 3I28A 2J5KA 1ZITA 1ZOSA 3C3XA 1YZGA 1NUTA 2H0QA 4QPNA 1YFZA 3C1TA 5D1NA 2A1IA 4LVCA 2DWCA 3KE9A 4EAQA 2XHEA 3C97A 3OOWA 3PFGA 4CM6A 2OV3A 3M6AA 1A4IA 5J5AA 2PCLA 1DGQA 3KSMA 2AG5A 1DKLA 4EF5A 4MUYA 3SIPA 1WDMA 3HXQA 3HB9A 4YP0A 1I4WA 1T9GS 2FJ0A 2PL1A 5L6MB 1XZCA 1EA5A 2FLVA 3ZGNA 2WU1A 1LS1A 3TLMA 3KQLA 1UMDB 2DMRA 2PRSA 4KO1S 4QFMA 4AG5A 1ORIA 1KI6B 3OU2A 4HHEA 1CRZA 4YONB 5REQB 1W4RA 5TNXA 4RAOA 2I71A 1GZSA 5B37A 1SCNE 1UDAA 3WYFA 4TQ9A 2PGLA 2W7TA 3RIYA 2NZVG 3ROGA 4J75A 3DP9A 4KIWA 2EJWA 1OD6A 4BCDA 2FSVA 3LHSA 4FFPA 1XAJA 2NXEA 2XVXA 4C4XA 1XTRA 4UATA 3VGJA 2QTRA 1XD9A 1PI3A 3RJ5A 1MABB 2DY0A 3DULA 3ZBUA 5PNTA 3QEJA 1BDBA 3OQPA 3QG5A 4ZT7A 1ORHA 2BDEA 2ZIWB 2DT8A 4E1VA 2HJGA 2Y8EA 4ZVQA 1DJNA 1R50A 4DJFC 3UB2A 4KIUA 3HU2A 2QUAA 3C5VA 5B4UA 2OGUA 2OHFA 3C4JA 4Y2JA 4HWOA 5CFZA 2YYAA 1E1DA 1SXJE 4PXAA 1PEDA 4YQFA 3DBLB 5CDHA 2OCKA 1C9YA 1XALA 1AO0A 1YNOA 1ECPA 3GZ4A 3LKDA 3DE2X 2UAGA 4PIMA 1KR2A 5JNRA 3KQHA 5LMUB 2BYTA 1RHMA 4J9VA 1DQSA 1M34A 3PB3A 1NXVA 2CJPA 5DBGA 4F6LA 3THYB 1W36D 1U0FA 2AD5A 2RC5A 3H1PA 5JW6A 3UMJA 3QVJA 5CNIA 4HGOA 2EQAA 3NHMA 1T91A 4P32A 4JI3B 2HAEA 3R6WA 3R76A 3GEDA 3FMGA 3IVAA 2FUCA 4H6WA 3ZHSA 4NJMB 2VPQA 1IZYA 3DGEC 3NP7A 4XJSA 4P8RA 1ADGA 1DX4A 2AN3A 1MN6A 1EEXB 3GJ0A 3K20A 5JNVA 5KOIA 1Z4JA 4FC6A 4ZK6A 1FSFA 2YR0A 4GZ6A 1MRSA 3P9RA 3TLJA 1Y3DE 4D8XA 4FDMA 1QO0D 3FF1A 2PL5A 1IU9A 1OBOA 3ZWYA 1Z2CA 4K0KB 4D3XA 1OWLA 2RARA 5KDLA 4OEHA 4YRRA 5H68A 1EFDN 1NHGA 5CX1A 3E9CA 5HP4A 2Q1SA 3IAEA 1A9YA 5H8WA 4RESA 4Z1MD 4Q9IA 5L3RA 4JKIA 1EWKA 4XM1A 2AQHA 1H8HA 4QYTA 3P2EA 3H05A 1QKKA 3B9PA 3AWIA 3L8MA 4CV0A 1N0UA 4FQ7A 2XA9A 4ZXFA 4M3NA 5CVTA 1LH0A 3R41A 5LLSA 4I1SA 1TZKA 4L3OA 3NJ8A 1TA4A 3EG9B 2O3RA 2IZOA 2FWPA 1PU2A 3K32A 2L19A 4RKEA 1HLPA 2AMYA 3I8SA 3OAAD 5KHAA 3T0GA 3W3AD 3LCMA 1E2GA 2GDZA 3I5AA 5HF5A 3A9CA 3UMFA 4RJJA 4J6EA 1ADBA 5KNBA 5JZ9A 4KN9S 4JI8B 1ZMTA 2O8DA 2XUGA 1N6HA 1XQ1A 2H4ZA 5ITWA 3K0FB 2Q45A 2BGWA 3SFZA 2AZDA 1Z0IA 5C2JB 4RMGA 4UZSA 3I58A 4XGIA 3BHIA 4PNHA 1N5IA 4L5JA 2X1MA 4LS3A 4Q4HA 3PTAA 4LQCA 3NIFB 3H2ZA 1YDGA 4GLFA 2Y77A 3O8RA 1N33B 2GZDA 4C07A 2P62A 5EJGA 5IFKA 3KTAA 1ATZA 4OQPA 2B20A 1W4ZA 1W6UA 2EJUA 2PEYA 4C7KA 4TKVB 4XDGA 1L4NA 5KYXA 4RZHA 1YZFA 2GCPA 4EEKA 3H4VA 2CHQA 4R69A 5ARBA 3OEYA 4B9AA 1QVVA 1HH4A 3NU1A 4AKHA 4X8HA 5FWDA 1DWUA 4EPTA 1LSUA 4BJ1A 2FQYA 2EAUA 3VFDA 3ZWCA 1XZMA 1YR8A 2C88A 1ZWKA 4ID3A 2ZBGA 5COBA 5FQOA 1XZKA 3WO1A 1J5EB 2R8EA 3ILHA 2B99A 4OQ4A 1L4YA 3V7YA 1ZCFA 3P9PA 3BE8A 5KOHA 4GP6A 1Y3AA 2JEOA 3WXMA 1IL0A 2FPMA 2AJBA 2NTVA 3AG6A 1M6WA 3G5LA 4FINA 4XWKA 1EHCA 3OCUA 2VSXA 1GGFA 3MHTA 1YA8A 3ETCA 2QGNA 1NYTA 3X44A 3ZI4A 3CF4G 1K7EB 2D1SA 2JAOA 2I78A 3DXZA 3A27A 3WWZA 3I5XA 2AMLA 2J08A 4ME6A 5JBIA 4YCNA 2VJPA 3MQFA 1N6KA 3C4VA 3I01A 1GDTA 1YGPA 4GT1A 1C8LA 1IHXA 2FPOA 3D4LA 4JA0A 5K0LA 2DQSA 1OPRA 3SX4A 1XXHA 1L5VA 3PR3A 4N7BA 1JHRA 3OO1A 2WJ4A 1IUKA 3BTSA 3JZMA 3IIEA 4GC9A 4KSYA 4C2AA 1E3SA 1USVA 2CJWA 1DE0A 1PT9A 3DZHA 1S3IA 3GGCA 2XEDA 4H6PA 1K08A 4W4TA 4BLVA 3TRKA 3TLCA 1INLA 2Q1WA 2XB2A 3WDLA 3CX8A 5K3BA 1B23P 2PRYA 2HK8A 1CEQA 3EF0A 1C4OA 3KQMA 2CL5A 1RHJA 2OPHA 2DWQA 4IDPA 3WGYA 4FTWA 4Z54A 5FPSA 1LS6A 2CD7A 2ZETA 3NG1A 2VS1A 3CX7A 4YAFA 3ETHA 3MELA 3QBJA 3IVXA 5BNTA 2ET6A 2JGMA 2GASA 1R4NB 1AK9A 1II8B 4J7UA 4EFKA 3PIRA 3BK2A 3Q3HA 1T8PA 4LQ4A 3WB1A 1PYOA 1UJBA 4L8LA 3I9JA 2CUZA 3NBMA 3PGLA 4IPTA 4I4NA 4G1FA 4ZVMA 3WDKA 3RIEA 4R7GA 4CDGA 3KQNA 2Q3FA 4KW7A 3TOXA 4BE9A 2PUWA 4BPBA 2X7HA 2XITA 5B4TA 2QUKA 2YL2A 2BFFB 4QT4A 2EW1A 3FPGA 1JJVA 2YWBA 3O8OB 1YOBA 4K88A 3PWSA 1JAXA 3ROEA 2Q5IA 1WS6A 3RTEA 3EMKA 4KWHA 4Z5XA 2JLXA 2OHJA 1M2WA 5EUMA 2E82A 2CL0X 4ZO4A 5IX8A 1OYVA 4FGWA 4YP9A 5K8CA 3LHFA 3HWSA 1Q6ZA 5IYZA 2BN4A 5JCZA 1TZ2A 1YBHA 3GGJA 1O5IA 4B17A 1VRWA 4XIIA 3BUSA 3TAHA 1BEZA 1VJDA 1KRWA 4LCEA 4Q1EA 4D8TA 4NYMQ 3IP1A 5HZKA 4F56A 3IMCA 1M7HA 2G70A 2JIOA 2GRAA 1NNUA 4AAYA 3H9EO 4BC1A 1GCIA 1U3WA 4B3BA 5HE9A 4GM0A 1FFDA 4HDSB 3IOYA 4LZOA 4NR0A 4NBLA 4Q4JA 4XFJA 4NXMB 2Q3BA 4D9JA 1G3IA 2Z5LA 4RFLA 4O6VA 2OVFA 5A05A 3I37X 4IIXA 3W5SA 1QHSA 3M1AA 2ZDQA 1TL7C 4M1KA 1CQIB 3LRPA 4QJ4A 3UIEA 1RHKA 2IGBA 3FI9A 5TJHA 1UPUA 5AR1A 3TECE 2RG7A 1SCQA 3ZDCA 4UQPA 1T4DA 1G9XA 3HV0A 4GOOD 4GPTA 4M60A 4XTCS 5BSWA 4LX0A 2Q2OA 1KXJA 3NTQA 5DHFA 1VJ5A 1JF8A 1HA3A 1KSHA 2A1UA 4ZAZA 4FNGA 2ZZNA 1IG3A 2BMFA 2DQ4A 5CPFA 5G4LA 4AL4A 4G5GA 4DCTA 4TVSA 2H06A 2I03A 3DE5X 4DREA 2CLOB 4J2HA 1JDNA 1Q21A 1P1RA 2F43A 3UJCA 3L79A 5LMZA 1UOPA 2X9QA 3QPDA 5LSAA 2VYFA 3RS4A 1F0NA 1PWXA 1K88A 1QDEA 3QIAA 1N2SA 4L6AA 3R75A 2AOUB 4ODIA 4NECA 2FN8A 3A04A 4LYJA 1TM4E 4MZXA 1OV6A 1Q50A 2ZAMA 3C3YA 1OKKA 1SAYA 4EVIA 1JEQA 1UOOA 3MS7A 4ZHQF 3SZOA 2X7XA 3EFOA 1QWOA 3PXUA 4BNKA 2IHKA 4DBLE 5H70A 4CM4A 2XMZA 1GA6A 2F8TA 2P67A 3TBFA 4NV0A 1NYRA 4JMLA 5JCOC 2H92A 2PJDA 1NAHA 3TOCA 1OY1A 4QXRA 3HP7A 3RVLA 2ERXA 1TM2A 1U0JA 4GPIB 1ICIA 4M7WA 3WLSA 2V96A 4TZKA 3ZK7A 3AVQA 5IBQA 4FKMA 2BEUA 3CLKA 4WKPA 3U1VA 3V2UA 2V7PA 4HTAA 2VLIA 3IHKA 4EGFA 2DPXA 1KDRA 3MAAC 4M55A 3ABIA 3IS3A 4FBGA 3TPCA 1ABBA 4QYIA 4D9HA 5F78A 2P0AA 3BGWA 1GSIA 2XTNA 3AF0A 3PICA 1AKRA 1KSGA 1JXOA 3DFFA 3OPYI 4YCLA 5I3CA 4B5LA 4GEGA 1N6LA 3DWIA 4EYOA 2XSZA 1JAZA 3JX9A 4Q1FA 1TD9A 2NT3A 4HNQA 5LP6F 3USZA 2ZWPA 2G4VA 3LCJA 4WBNB 3AIIA 2DLNA 4KHZA 4KQEA 3T7AA 3V46A 2NUAA 4L5BA 4PINA 4WA7A 5KREA 3T6KA 4GX1A 2VQ3A 3R3SA 4N9WA 1RMQA 4PIVA 2J9ZB 5GMOA 4OQDA 3VR5H 3ZQUA 1QPGA 1YB7A 4L51A 1U9ZA 2OZEA 3B89A 2VPWA 5ALIA 1QK4A 2ZSFA 1NX9A 1QIMA 1SA0A 2H7YA 5EHGA 1ZSVA 5EWJA 4A8JA 2ZUSA 3OFND 2CF5A 3ZDQA 3OQIB 2JCXA 5DTRA 4JYAB 4YC7A 4QUGA 3GGSA 5AH0A 5LXTF 1WXIA 3E22A 3VPXA 4DCPA 1U0RA 3U7HB 1TT5A 4U7FA 4U5QA 2VYNA 3V32A 1WDLA 1GADO 1EQ2A 1JEYB 1ZHFA 1J00A 1L4FA 2EFHB 2GLXA 1Y5MA 5JJIA 1J1UA 5D5PA 3FTEA 1SCKA 3NVKI 1R9MA 4EB6B 3D6AA 1E2DA 1JQDA 5CFRA 4AIIA 3QELA 1JWAB 2SKCA 3ESYA 3ZUPA 4TX1A 4Z9AA 3QA3E 2CW5A 4ZYLA 1G18A 4H08A 2D8MA 3G02A 5KQRA 4MV3A 4MW7A 4TKUA 4J29A 3MJCA 1IWPB 4UU1A 3TIVA 5EZSA 4ZOAA 1CK4A 1T43A 2BW0A 2DHRA 3RM3A 4DC1A 1LRKA 4RFSB 4DUGA 1KYWA 3GLVA 1WZUA 4R2MA 2IELA 2ZIFA 5DE3A 1MMFB 3TTUA 3LO8A 2FMTA 3NLLA 4KLRA 1MVNA 1NN5A 2X6TA 3C3PA 4YFYA 3V4VB 5K0BA 2RMKA 4PXSA 4JD5A 2PYZA 1VE1A 5EIOA 5P8WA 5E8RA 3TCXB 5GM2A 2C1XA 2B2NA 2WOOA 3HWX1 3ILYA 2FGKA 3K96A 3LA8A 1E61A 4J43A 1QCYA 3K4PA 1IEXA 1MORA 4IFIA 3DZGA 1YDHA 2EXXA 3CG4A 1K66A 1WA5A 2G04A 1SUDA 3I3SR 3WK6A 2QT9A 3RIHA 2DSTA 2OYSA 4MX8A 2WD7A 2Z2JA 4IJUA 3KKZA 4JLNA 4Q7KA 5D5QA 3D6HA 2JJ2D 1EFVB 2E1RA 1Q1BA 2H2FA 1L3CA 3CUUA 1AMNA 4X7BA 1VA5A 2FEAA 2H3EA 1X7WB 3OT1A 4BO2A 4CCYA 4IDAA 2H6EA 4X95A 4TTQA 5JANA 4HY3A 4TSRA 1DKOA 1OROA 3GOQA 2Z8ZA 3O93A 4YRPA 4ND5A 3OE7A 5C37A 5M2QA 4D42A 2QNRA 3IPRA 3LLVA 3OOSA 4MIEA 1DC5A 3OKPA 2X5XA 3RVRA 2DBRA 2VNHA 5C53B 4NESA 1SXQA 5AK3A 2OO3A 1FTWA 3C6XA 1QUFA 2FFQA 4Z8XA 5EJ9A 4U0JA 4JNCA 4NCHA 1G6Q1 4IDGA 4US2R 2IF0A 4RH0A 2ODTX 5K3OA 2MIIA 1WZNA 2KYRA 1HFKA 3G2IA 2XNDD 4NFYA 4L74A 4ER3A 3MD0A 2Q5QA 3O2JA 4KI0A 2BMJA 2GPTA 2HO4A 4XI9A 2GPYA 3IE1A 2ZTLA 4LJRA 5KO2A 2ZKIA 3BIJA 4O25A 1DC6A 3DAYA 3D0RA 1B8UA 1DAEA 4HWPA 4IX1A 1X7ZA 3S55A 4RA9B 1UP7A 4LA4A 3TD6A 1WCIA 4U7WA 3ZXYA 2BFBB 5JCJD 1TO1E 2F3QA 4EG0A 3OC6A 3OEHA 4UM8B 2VYVD 3NHRA 1ZQ1A 3SEQA 1O6FA 5TXGA 3A14A 5AVKA 2OC9A 4BZWA 4UTRA 4MR7A 1G19A 3DVRX 1YL6A 1FY2A 1QFMA 1S2NA 3SF8A 5HQTA 1VTKA 4HGZA 2BHRA 1AQLA 4PZZA 3NAQA 1YAJA 1NPYA 1CJVC 1FU8A 5JISA 2QV0A 2Y93A 1JYSA 1YVEI 3RVKA 4NMHA 2KW5A 3E3AA 1TGYA 1ILWA 1PDWA 4FYVA 1E2NA 4L3VA 4XWTA 3SZGA 1GV1A 4LHXA 1CZUA 3KZKA 1LK5A 1WE2A 2RHLA 2XKAA 5IC6A 4FDVA 4FFNA 1G20A 1HXHA 5AVVA 3FZQA 2QD1A 2GD6A 1I7QB 3RV4A 1P8AA 1XD2A 3G2HA 4JLBA 2D4HA 2MYUA 4P53A 2AXNA 4B32A 2W6JA 4G0YA 5AFSA 1XJQA 4BMZA 1LKZA 5LOVB 5EHXA 1RRGA 3A3KA 2TMGA 1GPDG 5CT8A 4P3XA 3D31A 5GP1A 3EGXA 2WVAA 4HN2A 5ABPA 4ROSA 3IUMA 1DBWA 4N5HX 4RY8A 2GA8A 4QTTB 3WL3A 4CUZA 1N9ZA 4D25A 2B1IA 2QLTA 3TFOA 2F8LA 4BMDA 7REQB 1J20A 1O97D 4PPQA 4IDOA 3UA3A 1EUCB 2J30A 2V3VA 3H5WA 2Y76A 1Z4LA 2WWTA 1NR7A 1L5QA 1ZGAA 2O50A 2GZRA 3R4CA 3U2QA 4R9SA 1XZEA 1TAQA 2PMFA 4QVGA 5CVCA 4EKYA 2PUEA 2G7ZA 3DL7A 1LZKA 1VG8A 3N3BC 5J5CA 3SIRA 1CKEA 5IJAA 1Y7IA 5FDFA 3AL2A 3KAQA 4FC7A 3U4QA 4ZD6A 4EENA 4M9ZA 3MK31 1P0MA 5KNDD 4K9QA 3Q7PA 2IH2A 3Q7IA 4DT1B 3MRXA 3RT7A 2LTAA 3DPSA 2JI8A 4LUCA 4QICA 1WIWA 3ZV7A 3BMQB 2E87A 2VTEA 3QU4A 3DYVA 3GYGA 4EDFA 1KKUA 4IXTA 3NDIA 1T5HX 3A26A 3EA5A 3W06A 1DTWA 4OF4A 5LQCA 1DKUA 1JN0A 5BWNA 2IC5A 3U61B 1RQXA 1RJGA 1U8TA 3EGDA 2H2IA 3MLEA 4JA2A 2VH2A 4RF5A 1QVWA 4V38A 3U7EB 1Q0LA 4OYYA 2XMBA 4B74A 2G1AA 2YINC 4PZ0A 5TPWB 1OFVA 3AM5A 4TN1A 3CUSA 3RC7A 4TYNA 1OZGA 1BMFD 1O8BA 4Q39A 2NO6A 1U1FA 2JGIA 4TQGA 2V97A 4XZ3A 3IB3A 2BAGA 4MS1A 2NUPA 3DNFA 4TKMA 1A71A 4UBLA 3OFSA 1AN0A 2IXEA 1ZN8A 2SECE 5IAOA 5GZ3A 1J2UA 1BXZA 1Y7HA 3AHEA 2GD2A 3BKXA 3W3ZB 4X7MA 5BY2A 5F23A 3NVMB 4FDTA 2N46A 3Q5EA 2HQRA 3T61A 1QPZA 4LRYA 3WGQA 1GRCA 3U6BA 3PNMA 3HYLA 1HT1E 1TOAA 2A33A 2B3DA 4AKTA 3OFJA 1QRTA 1N8TA 4MV1A 2QM7A 3H2YA 3S0JA 3TRHA 4RJTA 2LUOA 4Y6SA 1GL7A 4IF6A 1JA9A 1NIJA 2NQTA 3L7LA 4HH0A 2Q6OA 3QVUA 4TS9A 5LBTA 4QYSA 3RU7A 1PD1A 5TT1A 4PN3A 4GDFA 5LCXA 1NJ2A 4YJGB 1XTUA 2Q0QA 5EIEA 1FTQA 1I33A 4HVTA 1Z5NA 5J1SB 4HQKA 2V59A 1GCUA 1Q7TA 3KTDA 4BGVA 4CHGA 3RVPA 1I5OA 3CV3A 3LPAA 4MLPA 2IHJA 3OKFA 1BFUA 3GCGA 1L4UA 4HX9A 4KREA 2JLQA 3E53A 3IHTA 4QU8A 3T7TA 1TM3E 1F8YA 3PPWA 4WZAA 4NEHB 221PA 3FCSB 4WXPA 4L0CA 1IBKB 3DA8A 1L0BA 3O38A 4Q0MA 3UOGA 2Q21A 1F8XA 3B53X 1LBQA 1NNSA 2CB9A 1L5KA 2VZ0A 4JJ7A 4ZCSA 1W2GA 2VJLA 1IJKA 2R1VA 2AFHA 3KKPA 3HN6A 1TLLA 2NSJA 3Q1LA 1K6JA 1OLXA 2QJFA 1RLUA 3GI1A 4RS4A 4AN1A 5BSHA 3IYLW 1NQ5A 2FZVA 3W5BA 5E6SB 4MJLA 4ISBA 2IHBA 3CW8X 4HDMA 4LRSB 4MINA 2DTEA 1KGSA 2IY9A 4NG4A 4RVNA 4UFOA 4ZREA 4ZJYA 2CFRA 3F8WA 4JWKA 2UYYA 3Q11A 1WHSA 3Q40A 1MO5A 1P9LA 2ZJZA 4J3FA 3P0HA 4EW6A 2ZRJA 2O3TA 1AV6A 3T9BA 1CS4C 1RWQA 4I6JA 2P4SA 5F12A 3CC8A 1W73A 2UUAB 4C7OA 1M1YA 1P60A 2QI9C 1U8CB 4NONA 4GPAA 3WLIA 4OU4A 3SDBA 4PYJA 3HVIA 2OHGA 4REMA 2SCUB 2FPGA 3HCCA 4WOKA 1FRVA 4ZAVA 5K7SA 3PXGA 3FWKA 1Z5WA 1VL8A 3JQDA 4LZWA 5HZGA 4IOJA 4WCFC 2DT5A 3Q9UA 3RHTA 2CVQA 5HBGA 4B4VA 1CB0A 3A3PA 4X6LA 2WPDD 4A0HA 4AYTA 1YE3A 3LWDA 1P2SA 3C8ZA 3GJTA 4N01A 4TLDA 2QA5A 1Q0SA 4FLEA 5AUQA 2FSUA 4DBVO 2Y2UA 4JQYA 5BUZA 5BP7A 5JCPA 3L18A 1XEFA 4PX3A 3H18A 4NAVA 3EEOA 4KPYA 4MA0A 2FEOA 4V1CB 1GXSA 1Z2OX 1CY8A 4OK3A 4KITB 3K72B 4YHHB 4LF9B 2PSEA 1FNDA 2ZAIA 3HB5X 1ACJA 3LQFA 3S28A 2BFEB 4DHWA 2I22A 1EUZA 1G16A 4FPXA 4L8GA 1SO8A 2G08A 3TBKA 5L9AA 1K68A 4YACA 4Z2YA 5B53A 3AHFA 1D6SA 1F8UA 3AFNA 4MIYA 3SVZA 4Y30A 3LLUA 4HMQA 4AJHA 4B7CA 3KLOA 1QIIA 4CN9A 5JYCA 3Q98A 3D6UA 3IT0A 5M04A 2H54A 3ZJTA 4C4ZA 3U9TA 5FAXA 3C7KA 3CN7A 5E6RA 3VVBA 2FSPA 4WBNF 4NF2A 1IB6A 4CM8B 2PFGA 4BV8A 4IS3A 3T1OA 3EZ9A 3B7PA 6Q21A 4RW0A 1DG9A 2EFJA 1OTHA 1WCXA 2PD3A 4QDKA 4GX2A 1SELA 5J58A 5C46F 3T4EA 1PGQA 2ZUUA 5A5DA 4ZC8A 2JFYA 4UCFA 3EVGA 1TB4A 1NVGA 2JKYA 3EVZA 3VPSA 3T1NA 3BRWD 2NV6A 4B8ZA 1CERA 4FCCA 1QG4A 4V02A 3WB0A 4D0GA 5KTOA 4A0FA 3ZEAA 2EDCA 5CT4A 1U0GA 3PJDA 5E7QA 3HB7A 3IESA 4NU6A 4OGFA 4YQEA 4GKBA 3U0VA 3OTWA 5CDUA 3HLYA 3G2QA 1T1RA 3GRUA 3IKJA 1NVXQ 1UODA 4LJ7A 1YRYE 4LDQA 4G5FA 1T5SA 2HMAA 4Z99A 4EB8A 1P3Y1 3U4GA 3A0UA 1L7RA 2GO1A 3OECA 5BN5B 5KVCA 1ISGA 1AQ6A 4ZO7A 1MQ8B 1ZN9A 1AB5A 4HN4B 5CJJA 2JFZA 4RUKA 1XKTA 2NZ8A 2QJTA 3TVDA 4HUQA 1KEKA 3GLGE 4YT8A 4H1VA 2GVDC 3OJEA 4EHIA 1PFGA 1VP9A 2IYLD 2ACWA 3EZFA 3I1IA 2LD4A 1JDUA 1EG7A 2CSUA 3G3EA 1JT9A 3KOOA 4B44A 3QF4B 2QQGA 5K3DA 5KKCA 1HDXA 3H5NA 4FNMA 3X1MA 4IHJB 1TKBA 2GBCA 1A9SA 2CNBA 1KS9A 4K87A 1I1QB 1R9GA 4ZVLA 5LNK1 4Y0NA 4RGYA 2WJGA 2V8BA 3PUXA 1QX3A 4KTVE 1FDTA 2OK8A 3N76A 4LOAA 5K2MA 2A57A 2Y3IA 4CCWA 1L7NA 1HNNA 4I0WB 4OTZA 2BHTA 4MUHA 3E15A 3HDHA 1PJTA 2WUDA 2F8MA 2XVZA 3UQZA 3ZLVA 2WYUA 4IRUB 2NWQA 4WESB 9LDBA 4TYPA 4N5IX 3PJRA 4K0RA 4GMDA 1PG5A 5F7OA 4HQ0A 5FTLA 3E2PA 1IK4A 3ENKA 4YUVA 5BVHA 3NKVA 3B12A 1SZJG 4DDHA 3FI0A 4KEAA 4RQUA 5IJXA 4ZYUA 4S1VA 5A71A 3WGLA 2HZ7A 2HSDA 4C2TA 3TEFA 3HZOA 1WXDA 1EB9A 2FZCA 3IAS6 4DV1B 4L4XA 3KEQA 3HBJA 2CF6A 5I7WA 1H22A 2E55A 3HHEA 3PEFA 2FFJA 1J06A 1YTLA 1U6JA 1LNSA 3PC7A 3R5JA 3R9KA 5JS8A 1H3EA 3IHLA 3NEYA 2GAOA 1L8QA 1VSUA 4TKLA 4CE6A 2CFIA 2QTLA 2W4QA 4GECA 3GEHA 1ES9A 1D2EA 2I2WA 2Q4OA 4YRTA 3T7IA 3N53A 1II0A 4Z0NA 1IZ0A 4BVKA 5DYTA 3LKVA 4FHGA 2PKXA 2NZJA 3FVWA 4MWBA 5JATA 1N2GA 1O2DA 1JLRA 1L5YA 2CLKB 3LYHA 4P4SA 3U7QB 1XF1A 4BUZA 2YVLA 1WUYA 4BNJA 4LJ4A 5SZIA 2DXIA 4DYDA 1OQAA 3WIVA 3KAPA 2Y92A 1JHXA 3NO4A 1LVGA 4MW6A 3ILSA 4AMYA 2QTVA 4LV8B 4G1BA 4PVCA 4R9RA 3A2KA 1DBVO 1BQEA 1Z83A 4LBVA 3KQKA 1PNVA 1U6IA 1XDWA 2B1QA 2ATVA 4IGAA 1NLUA 1DIGA 4RL6A 4XM2A 5JASA 4R2WA 4LNHA 3RFUA 4CMCA 2UVQA 3AEKA 1NVVR 3QTLA 4Q15A 3FN4A 4PX2A 3D81A 2ZBVA 3E3OA 3G79A 1N9GA 4K40A 4OHXA 2F59A 3VOTA 3VU8A 3ZKAA 5CXXA 1QZUA 1AGYA 3U26A 4ZC1A 4K8RB 3QFCA 3D43A 3CRQA 3O73A 5J2UB 4I14A 1WXQA 1XOIA 3TLKA 4WTOA 4N5NA 4IVNA 1E2LA 3SVLA 2IK8A 1C7FA 3KPJA 5DSTA 3OIWA 2QJWA 3SF0A 1PTKA 1Z26A 1MX1A 2C3UA 2IYSA 3CY6A 3TKAA 1SJ9A 4C4OA 3BE5A 4DB4A 1VE9A 2EVWX 4OLHA 1X1RA 1P3JA 1YZHA 2R6DA 3C8UA 4G23A 4RPJA 4NYJR 4S1PA 3MRSA 3L9XA 2ON6A 4Y7CA 1IE3A 3A4YA 1V48A 5CLLA 2O0HA 2ADMA 1E3WA 2QTMA 3DMTC 5K3SA 1ZWLA 1H6BA 1EK6A 5CJ2A 2QE7A 1JHPA 2GTIA 3EDOA 5JCXA 3C24A 2W22A 3EHDA 3CEAA 2HHLA 3EEQA 3K53A 4DAOA 1SD2A 4X62B 1J24A 2WICA 2JJ1A 4FI3C 4D79A 3OP4A 4NTZA 3PZRA 1JR3D 4TYYA 1V3QE 1XAGA 2K5UA 2ZDHA 3F6RA 4L0DA 4DJAA 5LOVF 1HQCA 2JGJA 5LWQA 5LYJB 3AVUA 4M38A 5AQEA 4AD8A 2QVLA 3K8QA 4B3CA 1GZUA 3RVQA 4N6OA 4YV0A 4H1UA 1FTGA 3RYFB 4L28A 3DOEA 3HBNA 1CVIA 4FCTA 3EPHA 2QGFA 5E1OA 2Q3HA 1WB4A 4MCJA 5MGNA 3RV3A 3V8PA 4UAGA 5JQGB 3OX3A 1UMKA 4PE5B 1VHLA 2O8CB 4HRXA 3CISA 1SCBA 3TW8A 5DHAA 2UU9B 4RCVA 4BNDA 1DJMA 3EEIA 4IIEA 1X1CA 5J63A 3H83A 3HV2A 1J25A 4QOIA 2WA1A 4LXIA 4PFJA 4RA6B 3BXOA 1TAGA 2DR3A 4YREA 1QHEA 4EPRA 3P0FA 5I5GA 1Z6PA 1YOVA 3GCWA 5I9MA 2PXCA 3IL2A 2UZ3A 5FTKA 1OYOA 1FS4A 3FR8A 1N6IA 3DDOA 4FFOA 4IIDA 1EH5A 1TKCA 4AJ1A 2C8JA 1SUIA 1TO6A 1CIVA 3A0RB 3A2LA 1RAEA 3CZ9A 4GBED 3Q9LA 3MBOA 3L77A 2ZLBA 5EZ5A 2F9MA 1D2GA 4B6EA 1I10A 3C5HA 1KVUA 4HJXA 5E9WA 2VYQA 1DRUA 2BISA 3WS7A 3LUFA 1VI6A 5DT2A 4AY2A 1CJCA 1U4OA 3L8CA 1DBPA 2BUAA 1WL8A 3NWOA 3GLIE 2VP9A 2ZUCA 2IWRA 5FPTA 1PTJA 1PKEA 2W70A 1TEZA 1Y9AA 2GPBA 4XKJA 1FDRA 1E1RA 4MR9A 4IQ4A 3DF7A 1X7GA 3ILVA 3LF1A 1TFRA 4S12A 1ULTA 2X0RA 4UTVA 4KPEC 4M49A 1MB2A 1Y6GA 2H2AA 3WGOA 3NMUF 1I2DA 2WTBA 3PXBA 1JSXA 1JPNA 4M0KA 1ZD1A 1T4BA 4R1PA 4RY0A 1JHZA 3I30X 4AXXA 3GNTA 4BE7B 2ZI7A 4ZVSA 4P4NA 1QAOA 1OX4A 1XRNA 3DLPX 3HEMA 3HJBA 3I4LA 3L49A 3RLFA 3L8HA 4AUKA 1QC5A 4ZCRA 1OIVA 2MWMA 5K03A 5IKPA 5GONB 1HDEA 2F48A 1WB6A 4MUIA 4M99A 1J5XA 1CU1A 1MW9X 4UARA 3O8CA 5IUJC 3BMNA 3TWOA 2GJAA 3K09C 3IT1A 1KA9H 1RPTA 4HI0E 4RACA 4KGXA 2MYTA 4TTRA 3N58A 4ETIA 1RM4A 2OD2A 2JEYA 1W8DA 2G76A 2OV4A 3PNPA 1R5NA 4OM8A 2ENUA 2GYWA 4HDRB 4R4JA 5FI3A 1QQ6A 4CKCB 5J2TB 5E2AA 4KQ9A 3LIPA 3HBLA 4W5HA 1S8OA 4IZIA 3U3RA 4YT4A 1UP6A 2AOVA 2M2IA 3I64A 3GELA 1KEEB 3P8ZA 5IKOA 3TQOA 3WIEA 4QU5A 2AJCA 4YRFA 1WBDA 1M10A 4NRDA 3LX5A 1K6XA 1ENZA 5JCOA 2CDAA 3WQSB 2F1RA 2JIBA 3CIFA 1IM2A 3L04A 2GUGA 4X20A 4Z0TA 5FAKA 1GPYA 3D4NA 5AI6A 4EA7A 1ZK3A 2JJYA 3OVMA 2QBYA 4BEWA 3T7DA 2J3JA 3U5TA 4EPYA 4EB0A 1GZ4A 2JZNA 2EJBA 2QRGA 4DMUB 1PJ8A 1WUIS 2AEMA 4KX3A 4ND2A 4MPDA 1NQXA 1WV0A 1GUDA 4WNAA 5CH3A 4ZT3A 4ASUA 4D4HA 1W9HA 1WSBA 2PT5A 3I09A 4JBIA 1R66A 1D8TA 1RWBA 1Y42X 2WIDA 5BWMA 1T9ZA 4BLRA 4B79A 3MWFA 4GR9A 5JYBA 2H48A 2PBLA 4DNOA 1XA4A 5JC8A 1FSPA 5CLGA 2VJMB 4BNFA 1OREA 3NXKA 4HS4A 3SXUA 2P69A 3EZNA 4PG7A 4DIMA 2VQFB 1W0KD 3R4VA 2IS2A 3ZXUB 4AC9A 1MAWA 3LUHA 2H1HA 1ZH8A 3M34A 3CVJA 3HUEA 4HNSA 4P7KA 4R1OA 5C32A 4IZOA 2PSDA 3AH8A 2OL4A 5IVHA 4RD3A 2IYNA 4UPDA 4R8SA 1SUAA 3H5OA 2QT0A 4P81A 1HM5A 1CHNA 3ZS8A 1KY5A 2AKEA 4WZBE 3NYQA 1RYEA 2GEBA 2ZJ7A 1Z45A 2X14A 3PC8C 5ALSA 4EHFA 4BJ5A 3OO0A 5MFPA 2J6CA 4ZQGA 1DG3A 4DQVA 1UDRA 1TMKA 4ZO6A 2V5AA 2VDNB 1PGOA 4YCBA 3PRJA 5A4AA 4PHFA 2HUNA 4FYYA 2P91A 4KR3A 3FLBA 1HLFA 5CGZA 3K71B 4X3CA 2ZUEA 2GK4A 3HPRA 1R9NA 1ILEA 3OZGA 2JAWA 1RHRA 4NENB 4EOGA 3LGSA 1FFXA 1U81A 1USWA 3G8AA 1NN1A 4B82A 2WJZB 3JATA 4I1OA 4LSZA 4TS4A 3ZDRA 3CNOA 3M2TA 1MOSA 3RYCB 4JJ8A 3PD7A 4XB6B 3PX2A 2J4DA 4JP1A 3FVVA 5CLHA 1ZUD1 2P4UA 3T7SA 1Z4QA 1U0HC 4OLAA 3ONWA 2C9ZA 2NVUA 3QVGB 4RVSA 3ZBQA 4IXDA 1JIJA 1RAHA 3O4JA 1T2VA 3T3HA 5BNZA 4HL6A 1YA6A 2ZRKA 3KJHA 5CLIA 3AC0A 3VSEA 2HTEA 4RS3A 1OR8A 3DO6A 5E7JA 5J59A 2AX3A 2GJ9A 3O8QB 3WQQA 5JEDA 2CFOA 4LF6B 3VTAA 4NYIR 3VH2A 1UFQA 2ZU0C 3HA3A 3KSUA 1G55A 2BFOA 3MWKA 4NZZA 4DZZA 3ST7A 1P4JA 3ENWA 3HXKA 4PM4A 2DCUA 1DSSG 3GLHB 1FUYB 1GNRA 1GUFA 2M9MA 4RMHA 2HA5A 3RWOA 4X97A 1ZR2A 2JH3A 1VKOA 2G6BA 1B74A 5IULC 2C57A 3WMFA 3PI7A 3EY9A 5HR5A 1EGHA 2CC2A 1GYRA 2X19A 3RRYA 3U9LA 4LFBB 3WSVA 3NDBB 3H1GA 3UV7A 1WNTA 3BBPA 4HNRA 2JI7A 3LBYA 3GCZA 1CC1S 2YYYA 2CXXA 3WB2A 2J0VA 1IRIA 2XNSA 2EYUA 3ODGA 2AUMA 3PPYA 3THWB 1VSQA 1BMQA 3O4VA 5JXGA 2Y4OA 4NMXB 1HYQA 4WCDA 2D2VA 1ECGA 1UMBB 4JJGA 1C4KA 3FPKA 5ALJA 5CDTA 1N1EA 1Q17A 1SCIA 1Q1NA 1SVLA 1TDJA 3HR4A 3LC2O 2KJQA 4L5CA 4WOJA 1QP0A 5EMNA 3WGUA 3OUUA 2PTGA 4JB2A 4UVIA 1XKXA 5DRTA 1WMDA 2NG1A 3IAM6 3THOA 4DHEA 1BC5A 1BVYF 2XMSA 1J2TA 2GCEA 4LBZA 4FD2A 4MKGA 1TZJA 2C4NA 1BHJA 4NI5A 2ES4A 2QN3A 1J8DA 4IHAA 2IOQA 4H3HB 4DEVA 4CEIA 3C6ZA 2JCGA 3EVDA 1X77A 3FCYA 3PUIA 3RR2A 1UK8A 3T4PA 4A91A 4DXAA 3L41A 5I6DA 1IN1A 4HX2A 2N3ZA 2ECFA 3K9BA 3J7AC 4M22A 2OBLA 1Z0KA 5A7GA 3WQRA 4MYHA 3GH3A 4OAQA 4R31A 1WDWB 4MV9A 2QYSA 5IJWA 5ARDA 3RJMA 4X8MA 2RGNA 2IPXA 2PVPA 4QNNA 2R97A 4CLHA 2GAIA 1CY2A 1KJ9A 4I5EA 3ZHRA 5F1YA 4RTKA 4WJLA 2VP2A 2PX0A 1R9JA 3HI6A 3CT6A 1XZBA 4P3OA 4KQMA 4QYWA 4MK4A 4O8CA 2OG1A 3N2KA 3X43A 4DG8A 2FWBA 2B8TA 2CJFA 4FSDA 3FYTA 2HR1A 3P9ZA 3C1UA 3G2LA 4WZBA 3JYOA 2AWNA 4QNMA 5IPFA 1LDMA 5KMGA 1OI3A 3A4LA 3I9KA 5DGXA 5EIBD 1KMIY 3VC2A 4XUGB 1KARA 4MIOA 4W5WA 4RTRA 4QUAA 1PL7A 2X76A 1I9CA 3AFMA 3DBRB 1MIOA 4YAIA 1YUNA 5LN1A 2WUGA 2J8ZA 1P6QA 3G9QA 3UH1A 3BREA 3ETLA 4BATA 3K8OE 4B2LA 5A4KA 1T1EA 2P5YA 2HMVA 3M0EA 5EG5A 3TL6A 1EFRA 2CDRA 2H2GA 4YBRA 1JKXA 1XMJA 3AUSA 5T8KA 4U6NA 1HE1C 3WKEA 2BP7B 4UOZA 3G9ZA 1JR2A 2QJRA 2RK6A 3LF2A 4MP3A 1HEUA 1Y0BA 2IUSA 3G9XA 3RSQA 5JMTA 3NWBA 4E2ZA 1NU8A 2A7QA 4XD2A 1IXRC 1ZK4A 4XGKA 5C31A 2G5PA 4I1UA 4MPJA 3C98A 3NWPA 4N0DA 4O4LA 4X85A 1US8A 2O6HA 1Y1RA 3NBKA 3VR5D 1Q1AA 5J2UF 1PDVA 2YJ4A 4JXZA 4YMVA 1PK7A 2IDJA 1SZDA 4HH3C 3U4DA 2IFTA 3ZX4A 3VNBA 3ZOZA 4EBBA 1N5RA 3ESDA 2F6RA 2EP5A 4KE9A 3C3KA 2Q4DA 3FCUB 4JUDX 1SXPA 3FBWA 3BMXA 1QZTA 4PC1A 1UK7A 2H31A 1IOLA 1K7XB 1YIAA 1D4FA 4UEKA 2W58A 4PHHA 5G40A 3VU9B 1FQWA 4AQYB 1H1LB 1CFJA 5KJCA 1WD5A 4CMHA 4QTYA 3K1JA 4TROA 4YXWD 1ZZEA 3SKYA 4DF3A 4R0NA 3JQGB 4WLVA 2J0EA 5G3ZA 5A3VA 4ECAA 1ZUNA 4QGGA 1NXSA 1UPAA 2I0FA 1NW7A 2QTGA 1T9GR 5TQ2A 1SUEA 1NQTA 3VC3A 2XYHA 4DY6A 3VTFA 3T1HB 4Q18A 1T36A 4IV5A 5ENZA 2XYQA 4GOKA 4ZRMA 4TWAA 5EIFA 4EYGA 4PZDA 2A9JA 3NM5A 1TF2A 2AOTA 4CTJA 5JQGF 5CX4A 4AJKA 3D6TB 4CU2A 3ZJ5A 1U9YA 3L07A 1BEEA 4A6XA 4URVR 1N9KA 2BTOA 2IYWA 4R71A 2VI5A 1U0TA 3PXDA 3AVTA 2J3QA 4J0JA 1IPEA 1PR3A 2PRZA 3RKRA 1P4HA 1TYEB 1CZHA 1M8JA 2A30A 2CUNA 3AV3A 3KEOA 5THQA 1O0BA 1M2VA 2HSJA 1RQGA 1HZJA 1SBIA 1ZH6A 3NTVA 2H65A 1YI8A 1SUFA 5JO9A 5TSDA 3O9MA 2PS3A 2OMEA 4AICA 5JR3A 3GT3A 3C1AA 4G0NA 4A16A 2B9EA 1CS0B 2A5GA 2LCFA 4PZAA 4QBFA 2Z1NA 2ZQZA 1S8AA 1ZNXA 3ACDA 1U0SY 1NL3A 4OD0A 5HUHA 1A82A 2AGVA 4LC0A 1PGJA 3ZE8A 4IS2A 4DB2A 3LQ1A 4WRRA 2FXIA 2A9VA 3GRRA 4W99A 5EE9A 1YL7A 5C8YA 1U4SA 3LBHA 5CB0A 5ICSA 5JLJA 3PX3A 2G40A 3T5AA 4TQUS 1LC0A 2BCGY 2ZRMA 3BXGA 1YULA 3A3OA 3KKLA 1K0UA 2OP0A 1VKZA 2NIPA 2QEQA 2VWHA 1Z15A 4LDRA 1JFSA 3GCXA 3UK1A 4BRSA 1RRPA 2IPNA 2GS9A 5G4KA 1KQ3A 3LCCA 4B33A 1U8YA 3IR7A 4EHDA 3MMSA 3PGXA 5H3HA 2ZUBA 4RADA 5LC1A 2Z95A 1EZZA 1WXXA 2AH5A 3IJRA 4O29A 5JSKA 5SY9A 2EBFX 5KX5A 2UUBB 1HDRA 3D3WA 3R1IA 2A8YA 1YHNA 2QMOA 3GPIA 1KJ8A 2CWWA 1T6XA 4J3NA 1NJ6A 1NW5A 1USKA 3FRJA 5DLEA 2QNBA 3T7RA 3KQOA 4A0SA 4XCXA 5DASA 4BVJA 4OJKA 3VPAA 4UOEA 1XMIA 2R48A 1M6YA 1TX4B 3EISA 3ANNA 4EDHA 4LWOA 2PQ2A 2E6UX 3HR8A 4IL5A 2JIZA 3B7WA 5AMXA 3AI2A 1SZPA 4IDFA 2ECKA 4JLSA 3UGKA 3KV3O 1YZ3A 1LF5A 5GONF 4V0NA 4YMLA 3EGCA 1G291 3MT7A 4J0HA 4HDKB 3A70A 4OGGA 3C87A 4UUOA 1R27A 1XHFA 1MPXA 3OM0A 4UHKA 3M4NA 1T8UA 1YZNA 4EL5A 3NASA 3QI7A 2P9CA