3QKSB

Mre11 rad50 binding domain bound to rad50
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
AEKENRERVKKEIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication
molecule keywords DNA double-strand break repair rad50 ATPase
publication title ABC ATPase signature helices in Rad50 link nucleotide state to Mre11 interface for DNA repair.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 60
structure length 179
sequence length 179
ec nomenclature ec 3.6.-.-:
pdb deposition date 2011-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qksB01
1X86B 4ZCIA 5BN4A 4B3DA 4XWOA 2A5YB 1XFAA 3A4NA 4B32A 3QUSA 4URYR 1OFUX 2OFOA 1TU3A 1NBMD 4M1MA 4BZPA 4QKQA 621PA 4Q4JA 2J3EA 4HZIA 1ZUIA 4XVQA 1F48A 4MGIR 1AKYA 1TF5A 3CR8A 2PZFA 3NG1A 4JVNA 3X1ZA 5AWFC 5EJEA 3ZZ0A 1YR7A 5A0FA 3K0FA 3HU2A 3UMRA 1E2PA 2ZS8A 1J70A 1KZGB 4LJ4A 4LSGA 1NMXA 2J0VA 4LV8B 3KQHA 2BCGY 4JKIA 1DAKA 2J59A 5K8UA 4MRRA 4URWR 2MSEB 1XXHE 2O8FA 4AI6A 2ZSAA 1K5DA 1I2DA 3LLMA 4QFMA 4BASA 3GPLA 4C0HA 1K8RA 1MO4A 2G1KA 3LQQA 3N5CA 4JJZA 3K70C 4R98A 4H1VA 1WBBA 1T4GA 1LF5A 3BIFA 4YXWD 1D2MA 2G3YA 3M4YA 3CH4B 3I73A 1HE8B 1N0UA 1DS6A 3AM1A 4DB2A 3DZ8A 1BMFA 1CXZA 2V55B 3CNOA 1GZSA 4QHSA 4UNPA 3B60A 1IXRC 1XZQA 2AWOA 2NQ2C 4RD2A 2FFAA 1CIPA 4JLPA 3HYTA 1ZD9A 3LLUA 4DCVA 1W4CA 1XCPA 4GOJA 1I4TD 3FMIA 3RC3A 4CEJB 2FPKA 1UKZA 2EU8A 1E9EA 2GCOA 3CUEF 4NCJA 4WW0A 3U60B 4CF7A 3HR8A 1FTNA 4L15A 1JAHA 4EPTA 5J4KA 1NNEA 3QXSA 1KO8A 4NMMA 4LI0A 2P6UA 4JSYA 4RFVA 4IOJA 2CL6X 2DYKA 3THWA 2RMKA 1KI6B 4S2EA 2ZRHA 4TT3A 2I1QA 4BPBA 2PX0A 1PZNA 2ZITA 1VG9B 4B43A 4D82A 1ZIOA 2BIFA 3EPKA 3T15A 1OFHA 1IN5A 1XEWX 5KTYA 2B6HA 2F9MA 4ZDWA 4DCTA 3DZDA 4HB2A 4P4TA 3KXKA 2OILA 3IHWA 3U3KA 3MGCA 4LYAA 4YDSA 4IEEA 2CJWA 2GJ9A 4OHZA 3EG5A 4HDOB 5DHFA 1CU1A 1TU4A 4WIAA 4GOKA 2UZIR 4Z8XA 4DEXA 4D0NA 1II8A 3BE4A 3QXHA 4YQFA 4G0NA 4EPRA 4E07A 5EE5B 1R6BX 4ZPXA 5DISB 2R8RA 4M1WA 2FEOA 4BRUA 2OSBA 2D7CA 4G01B 5CYOA 2VLIA 3R8CA 4QJ3A 3I92A 4HB0A 4MYCA 3SFVA 1DAFA 4D2IA 2R2AA 1NN3A 4DBLC 3JVUA 4JBWA 3K9GA 2GZHA 4B48A 5TARA 1QHIA 121PA 4LWZA 1ONBA 2WSSA 1QDEA 1IJEA 1Z0KA 4JBYA 1NIJA 2P3SA 1A2KC 1YRBA 1ZINA 1BIFA 4E03A 1N0VC 1XTKA 5JCPA 4CEHA 2J1LA 1T3HA 5E3HA 1OYWA 3ZD6A 5H70A 1Z6XA 1G21E 3QF7A 3VQTA 1VIYA 3K70B 4KFUA 3HU3A 4DSNA 3GEEA 3S1AA 4W5WA 2ZXUA 3WXMA 4FMDF 1G8FA 1XF9A 4M4SA 1OFTA 1G4UR 1KDOA 2RKOA 1RKBA 3NIBA 2VP9A 3UPUA 3EIQA 4A0HA 4LYFA 3KTAB 1XX6A 4CW7A 3BORA 4GZLA 1GNPA 2JGNA 5JRZA 1S8FA 4B76A 3NHBA 4PHHA 4L4UA 4B2PA 4PSAA 1QVRA 5EZ5A 4HDCA 2WIBA 4QGHA 5IF9A 4PX9A 2FX3A 4P31A 2QAGB 4A6XA 1Z47A 2FN4A 1G5PA 1LVGA 2SHKA 1E2NA 2WICA 3WP0A 1Z5ZA 2JATA 1CEEA 1RJ9B 2I3BA 1QRAA 3QPVA 3NTUA 1GILA 4Q19A 5LBIA 5JFGA 4AYXA 2QZ4A 1TEXA 3MWYW 1FOEB 4MYTA 1W48A 1IY1A 3EZ6A 1VTKA 2DB3A 5JJLA 4BE7B 1OXUA 2W6IA 2H18A 4RJLA 5E4FA 2CEAA 2ZAOA 2ZI5A 4TQ9A 1UM8A 4HUTA 3PEWA 2GESA 1QHSA 4JLAA 5K8LA 3B85A 2CHGA 1ODFA 4DVGA 3LAWA 1R10A 2J5XA 3CZPA 3IO5A 2QPOA 1Z29A 3MD0A 2WJJA 3LWNA 2QG6A 1T9HA 2ZTSA 3SHWA 2AX4A 2QTHA 3OAAA 2C9OA 3EARA 3T5GA 2F1HA 1E96A 4ZIRB 3A1UA 3RS3A 3G5UA 3W6NA 4EFLA 1CULC 4QBGB 2HYDA 4BFXA 1G5TA 4NYIR 1AK2A 1G16A 5BW8A 3W5JA 2YZ2A 2WIAA 2BBSA 1WF3A 3T1VA 4OHXA 2MSDB 2ZQ5A 4V0KA 2ZS9A 1R5OA 3LW8A 2OBMA 3AVOA 4PQRA 1US8A 1OIXA 3DO6A 4RD1A 2F43A 2PEYA 3HWSA 4GPTA 3CLVA 3QBTA 5J40A 4GL2A 4IFEA 1KI3A 1H8EA 2R6AA 4U5XA 4Q9KA 4B2LA 4D4JA 3SS8A 1E1RD 4QGAA 3B6EA 3A58B 4Z54A 1WB9A 2FA9A 4Q1AA 1JXOA 2X8AA 3H4MA 1TUEA 1XD9A 2OCBA 4HLUC 3TKLA 3RWMB 3TIFA 1Z6TA 2C5LA 1UEIA 3AP2A 1CJTC 4GP7A 3AGPA 2Z43A 3IHLA 1KO4A 1KK2A 3T1QA 2VSXA 4HYYA 1ZM3A 2QTVB 4TYYA 5B64A 5DSZA 1CTQA 5LB4A 1R2QA 1E2IA 2RGDA 1A1VA 4I1VA 1G6OA 4TQAA 1XPOA 4LBZA 1S1MA 5P21A 2EYUA 2GAOA 1D9XA 2CK3A 3EX7C 4WBSA 1YU9A 2A2ZA 3K0FB 3W3AA 4LJ6A 3Q5DA 4JLJA 5EXXA 1G20E 1KMQA 2CNWA 2GA8A 2JDIA 5HR5A 1IN8A 3GJ5A 521PA 4PPNA 2GEVA 4OI4A 4JVMA 2FDCA 1GNRA 4AG5A 2PH1A 4DSTA 3LVRE 4LHXA 2FU5C 5SZHB 4GDFA 2Z5FA 1M2OB 3QEJA 4RFSA 2O8FB 1N5LA 3ZQJA 4K8OA 4XD7A 5FFMA 5LDDC 1HYQA 2EFCB 5DLQC 2IYQA 3AH8A 3BBPA 3NWJA 4N0DA 4OKSA 5L3QB 4O3MA 2VHUA 3I3SR 4TN1A 2XSZA 4PHGA 1Z0AA 4LC1A 3DOFA 1Y3AA 4DLWA 4OQFA 2KWIA 2B7BA 1UADA 3KJHA 3FMFA 4OYHA 4EFMA 4YMVA 4KXFB 2WPDA 3BFKA 4R2HA 4UQOA 3D6TB 4YC7A 3TUZC 4NYMR 4FCWA 4GI7A 2H5EA 2A9KA 3VMFA 1PLKA 2GCOB 1R8SA 2NMVA 3R9XA 3W6PA 5FTKA 2QA5A 4ZDIA 3PJRA 2C03A 2ZRIA 5JHHB 1OH5A 3QQ5A 2OE2A 5KSYA 2IYYA 2J41A 2Q9CA 3BK7A 1YZLA 1JBKA 4PTLA 4M2LA 2G6BA 3TSWA 4ACBA 4ARZA 4DWJA 1DBSA 5DYIA 4HAUA 2GEUA 2IF2A 2FPLA 2QEQA 4DLYA 1AN0A 1NBME 1BS1A 2DFNA 3NBFA 4O25A 3U7HB 2QBYA 2IS2A 1G19A 2C95A 3LD9A 4OQXA 3RYTC 3QKUA 2WWWA 5DYGA 2J0SA 1HQCA 1T8TA 1X3SA 1XBTA 4CZ2A 2OBLA 3PVSA 2NO1A 2VIIA 3EXAA 1F2UA 2N1BA 2ZJ8A 4URUR 5B2ZA 4ESVA 3NEYA 2CLSA 2ZJZA 1YZTA 3B7GA 4XVRA 3SR0A 1KO5A 2QUZA 4TL8A 4LV5B 5EP1A 4C4PA 2FZLA 3VKWA 1WMSA 4AKIA 4KCGA 3SC3A 1LF0A 3TSZA 2QY9A 1D8TA 4P32A 3P4YA 2GBLC 4FW9A 5CLQA 3KQLA 1UBFA 3SI7A 3REFA 2GCNA 5EXPA 2V1UA 1NLZA 4QBIA 3B9PA 4N3NA 2RH5A 2ZI3A 1FW6A 3C4JA 3IDQA 1TMKA 2ECKA 1E94E 4B35A 5C46F 1IY0A 3EC1A 4JYCA 4C7OA 4PQYA 1DEKA 4KFSA 3WY9A 4W9MC 2OFWA 4QNRA 1JR3E 2ZRJA 3OEHA 1GM5A 1N25A 3AKCA 1GG2A 4JT4A 4TLAA 3ZZUA 5FUXA 3UMSA 5KNCA 2BOVA 1U8YA 1XWIA 3QE0A 1G3RA 3A1WA 2J0UB 3DVLA 4P4SA 4FCTA 4UXHA 4E09A 2P2LA 2ZJYA 5AUPB 2HT6A 1OXTA 2C96A 3FKQA 4D25A 1X8LA 3A1VA 3OEEA 3E5HA 3WRXC 1DOAA 4RD4A 3W8RA 4B34A 1E2KA 2O5VA 4DJTA 2J7PA 3UWOA 3WHLA 1FP7A 4LRWA 4CIDA 2ZU6A 3VTKA 3RNLA 1YR9A 2XTMA 1T0HB 4LCBA 2FZ4A 2JCSA 4MKHA 1CR4A 5DIFA 1AQUA 5BN3A 2QI9C 2DCUA 3L82B 2BC9A 2ZYTX 3THOA 2BEJA 4UXJA 4E5UA 4M22A 1DVRA 4TMWA 4WXPA 3RS4A 5JJIA 1VIAA 3AP1A 3EWSA 4MUBA 4YMSA 3GJ6A 3VKHA 3J81k 2Z4SA 4LHWA 1GVNB 3C16C 1ZC3A 1Z28A 3K53A 1ZAKA 2JJ1D 3OFND 2R9VA 4HAVA 1II9A 4AKGA 1E2GA 2GK7A 1EFUA 3RRZA 2IXGA 5B57C 1KAGA 5H1YA 1MH1A 1Q0UA 1YZQA 4GOXA 3SHFA 1IQPA 2YOHA 3T1TA 1KK3A 4MQBA 2V3CC 4Q1FA 1ZU4A 4ZDKA 2Q3MA 1W0KD 2ERXA 5EE0A 2HCJB 2OZEA 2W0MA 4C0LA 2GKSA 3PCRB 4NZYA 4PR0A 3TUIC 1TQDA 1W49A 1RRPA 2G83A 2OEPA 2CHVA 1Z07A 5TDHA 3SDZA 4B3FX 4UNRA 3UKDA 4DZZA 3CF6R 3AVQA 3VX4A 3DOEA 3HU1A 2KBEA 3PEVA 1KK0A 3X1DA 4XIGS 1US8B 3KL4A 2F9LA 1VKJA 2F43B 3GJ7A 2QP3A 5CYPA 3CRRA 4NCKA 4JZKA 4OHVA 2YWHA 4LHYA 2JJ2A 2JEOA 1HE1C 2NG1A 1BOFA 1XCMA 2PJRA 5JI2E 2IWHA 1OT3A 4HEJA 1IAQA 2D62A 5JWRA 1SULA 1SKQA 3SYLA 2BJWA 1N2CE 1U90A 4LGMA 4A82A 2ZVPX 4Z51A 2V8OA 1OB2A 1FNMA 2GXSA 1KI1A 1TF2A 1E69A 2FG5A 1NIPA 1ZIPA 1ZU5A 5KOYA 3ZH9B 4WAUA 1UPTA 3U61B 1UKYA 3O8CA 1BYUA 2BDTA 5FPYA 4A8JC 5SZJA 1PJRA 2ONJA 4BZXA 4YONB 2ZUDA 4B6FA 2BMFA 3K0CC 2FGJA 4PSKA 1YR6A 4Q7LA 1JQLB 3QY0A 4LHVA 1N6IA 4U02A 1UJ2A 2IBMA 1BO6A 2A5JA 5FBRB 4FMCF 1V5WA 2W58A 3Q3JB 5C18A 1RE0A 5J4VA 2OUKA 4L8GA 2NO6A 3BB3A 3GJXC 5KO2A 2FF7A 2J0QA 4BLSA 4HSEA 4LOAA 1R0ZA 1T91A 2VP2A 2X77A 4F91B 1LNZA 2BBWA 4RCYA 3L43A 3BH0A 4C0JA 3WRYC 1M6NA 4NONA 4TYNA 1NBMA 4JLDA 4R71A 1D5CA 1E2EA 2F7SA 2CL7X 3C14C 4JLKA 2IUSA 1RJ9A 1KI8A 3A6PC 3SYKA 4M1OA 1E1QA 4MRPA 1WBDA 4TL7A 2OAQ1 2RHDA 1UDWA 3MJHA 2WJGA 4BFUA 3F5FA 4I1UA 2NZJA 2PZEA 3SZRA 4DC9A 4DRZA 5FPSA 4MGYR 3GLIA 2C04A 2KSQA 4A2PA 3ZD7A 1TL7C 1UEJA 3AVXA 4H9GA 1GKYA 3MSXA 4RD0A 4GMXA 3U4QB 3T06B 1XTSA 5BN5A 2FPMA 1JR3A 1LY1A 3D31A 1OXXK 4DUGD 2CLCX 4DT1B 5K8TA 5LD2C 1IXZA 2IK8A 3SOPA 4ZIRA 3LRPA 1COWD 4IOLA 1SXJD 4A8JB 3JZAA 2V4ZA 1N6RA 4KFRA 1DADA 1NVVR 1TEVA 1A7JA 3CKLA 3DPUA 4M9QA 4PO9A 4TLDA 3B1XA 1E79A 3LBNA 2IXEA 3DHWC 3SJBA 5F3WB 4HAZA 1ZUHA 2XEXA 4OQLA 1F60A 4DSOA 2GCPA 2ZI6A 4NPHA 2PEZA 3AF2A 1T3SA 3TNFA 4QNMA 2BM0A 1GITA 1U0LA 1WDTA 2AKYA 2RGAA 4F7WA 2WJVA 4LZZA 2O8EB 1TAGA 3QIAA 1AGRA 4KBFA 1R7RA 3MCAA 3VR2A 3RANA 2WKPA 2IYTA 2YNMA 4N0EA 3GLFB 2W6JD 2F3RA 4FWTA 2X1VA 3ZLJA 5HZHA 3AF3A 1KGDA 1AIPA 3CX7A 2C2HA 2FWRA 4TSFA 4UNSA 4LV6A 3CONA 3ZVLA 2P5TB 4X8HA 1KTVA 2JIZA 2IYLD 1QZXA 2B8TA 2REOA 3NBYC 4DSUA 3K09C 3B82A 4K81B 3W90A 3BRWD 3LY5A 4OK3A 4C0SA 1W2HA 4Q02A 1EESA 1TQ6A 4AKEA 5FL7A 4Z8YA 1SVWA 1SXJC 2HT1A 1U0HC 3EASA 2QP9X 3GMTA 1R8QA 3E1SA 2ZRGA 1MOZA 3T35A 1AQYA 3R20A 5TVKA 4CEIA 2QM7A 5D3QA 4EPWA 5IK2D 4BZQA 4YMUA 1SVOA 1T8UA 2PBRA 1ETUA 2AD1A 5L3QA 2VP0A 3VKGA 1DG3A 2K5UA 1G1MA 3ADKA 3EZ2A 5BYJA 3V4FA 4TZ0A 3ICEA 2IYSA 1N5IA 2P6RA 2NO7A 2QL6A 2A5GA 3FDIA 2GWHA 1M7GA 1ZW6A 3KB1A 4BFTA 1M74A 2QMOA 4RKFA 3AVTA 3BB4A 4PC7A 2P65A 1AZTA 4AYTA 3IIMA 1EFRD 3CX8A 4MA4A 1Z06A 1KIMA 3V4RA 1YZUA 2DY1A 3Q85A 1TUIA 1AS0A 1JAIA 2FFHA 1GOTA 3KKOA 2GNOA 4Q9LA 1RW4A 4M21A 2W2TA 4TLCA 2B7CA 1GP2A 1J8YF 4HLUA 4LPKA 4MGZR 1EX6A 3AEZA 1G7CA 1XMJA 5C4GB 3DL0A 4W7SA 1NY6A 5JECA 3AF1A 1A82A 4QHTA 1YZKA 4DLVA 5EE3A 4UKDA 1MO5A 1K6MA 2Q6TA 4POAA 1OH7A 3AVPA 5FBQB 3Q7PA 3FOZA 5J47A 5FH9A 3CBQA 3VFDA 3CRW1 4Q1DA 3CWQA 5G41A 2FSFA 2WZQA 3GLGB 2ZJ2A 1MT0A 3PEUA 4HAXA 3F8TA 3ZVNA 1XDBA 3W34A 4LY6A 1E9AA 4ZCMA 1OSNA 3REGA 4PPQA 5AJXA 2IS6A 4O0MA 2IYVA 3AGQA 1GRRA 2F1IA 5DN6A 4KITB 1W36D 1OV4A 2P67A 2Q21A 4C2TA 4QM7A 3B1ZA 1L2TA 1VDZA 5TMPA 2IUUA 3U3RA 1SVIA 1W44A 4A1FA 2KB0A 4PAQA 4GP6A 5IRCD 1LB1B 2RGBA 3IQXA 2GTPA 3AP3A 1XPUA 2GILA 3MUFA 2A78A 3ND8A 1A5TA 5CB6A 4Y0AA 3BJIC 1QVAA 2P0EA 2QQEA 3FKSA 2CCGA 5HKKA 2QROA 1FFHA 4ZKEA 1OXVA 2OFXA 2J0UA 4RY2A 3DM9B 4LK2A 4RSGA 1XJCA 4Q9JA 4DKXA 3RC8A 5JWOA 4QOSA 1PLJA 1W5SA 1SGWA 5FTMA 4Z1MA 1RZ3A 2R65A 4IKEA 1SVSA 3EZ7A 1R5BA 5CITA 4M9SA 4MYHA 3U44A 3RHFA 2NZ8A 3RSOA 3ADDA 4TMKA 3PV0A 1SQ5A 3TE6A 1L4UA 3I5XA 1DPFA 2HLDD 1PVOA 2DPXA 3UATA 3GLFE 4TLBA 2H17A 3KUCA 4X8MA 4JT2A 4BLOA 4ZV4A 4UXIA 1IM2A 5LB2A 1E2QA 1DO2A 3SU8A 3PENA 2A3RA 1ZP6A 4P3YA 2WWHA 2W83A 3TR5A 1ZMXA 5FI0B 4PZYA 4AWXA 2QGNA 1BMFD 2B92A 4A2QA 4C0QC 4A36A 4Q03A 5EXSA 2GETA 1E2JA 2MSCB 4Q48A 3SBDA 3QKRB 1CBUA 4LYJA 2QAJA 2JLYA 5BQ5A 1Q1ZA 3BH7A 4PZLA 1NP6A 1OKKA 4FD2A 1FMLA 4GSYA 4NP6A 2NIPA 4LDJA 4TMXA 5J4YA 3GLIB 1Z8FA 2ZSFA 1XTQA 1N0WA 4P0TA 5HE8A 4BGDA 3AVUA 3GP8A 1A2BA 3MWLA 4US1R 3CRVA 3TJZA 3WYGA 3ZIAD 2AR7A 4TYQA 2PCJA 2GBLA 1W4RA 2EWVA 4TT3D 3TVDA 3R8FA 3RAPR 5HCNA 4P4UA 1CRPA 1EX7A 2YHSA 4KYIB 4M1YA 4XJXA 2R6DA 4IEIA 1OH6A 4V02A 3MG9A 4FMDB 1ELOA 2ZYWX 3KUDA 4U00A 1HEIA 4B33A 4JLOA 2BWJA 2DWPA 1X8JA 1G18A 2TMKA 4NYIQ 4PO8A 3D3QA 2BM1A 3RRMA 4KI0A 4TZ6A 1L4YA 1Z6YA 4BFYA 4ZI2A 2JLUA 1Q12A 2ZJBA 2ONKA 4G1UC 4C9BA 2XNDD 1NN1A 4PSVA 1T6NA 4KLNA 2HF9A 4MKFA 5EP3A 4F92B 1KSFX 1CJUC 1ZD8A 1G17A 2WSSD 2HXYA 2QE7A 2JLQA 1J2JA 1MO6A 2DWOA 4ASUA 4PFSA 3QPUA 3SJCA 4EJSC 2P5SA 2O52A 2PMKA 1KZ7B 3H1TA 3KXLA 4DB4A 2WJYA 8OHMA 2OESA 3L8ZA 5KNDA 1KNQA 4JVLA 4YDHB 4YLGA 3KQUA 1ZNZA 4TTRA 1KDRA 1KHTA 1LS6A 3ETLA 5FPKA 4I1OA 2EW1A 1G5RA 4IDHA 1G291 1MRNA 4UJ3A 2GVZC 3NC1C 4HI0E 1GSIA 4Q9IA 4KV9A 1TQ2A 2ASEA 4W5HA 3GLGE 4B3BA 2OV2A 4CEIB 3QOFA 5AJYA 1W0JA 1XD2B 1GNQA 5G3YA 2YWFA 3EZFA 4CDGA 5L3VA 4HAWA 1E9DA 1W46A 3UXMA 1QHHA 4B3GA 2ORWA 1H8HA 2D2EA 4DLRA 5BYKA 3P26A 1KOFA 3FHOA 3UG6A 1OB5A 2NGRA 2BBTA 4LBWA 5JZVA 2NTYC 3CH5A 2FOLA 2CCJA 2W2VA 4Q21A 4V0LA 2WWYA 5SZIA 3WBKA 3RDPA 1S4QA 3OZXA 1AJEA 1JR6A 2VRWA 1P73A 2GEDA 2JA1A 1Z83A 1CJMA 2G77B 4URVR 3RLFA 1DE0A 3SE0A 4O2RA 4BUJA 3QI2A 1OE0A 3FYHA 3L2OB 4W5JA 3AVWA 2O0HA 4DHEA 2JAQA 3NBXX 1VCOA 2WKRA 3A4MA 4RKEA 3B9QA 1GRQA 4NYMQ 3BOSA 1E9FA 3B13B 1M7HA 1XMSA 3DDCA 2IX3A 5JMTA 3IBGA 4OBEA 1D2EA 1JB1A 2IHBA 2VBCA 5L3SA 3VR5A 3MRSA 3G0HA 1HA3A 2OLKA 2PZGA 3LX5A 3I1FA 1NKTA 2ZE5A 2VP4A 2D06A 4UJ5A 4QM6A 1Z22A 1M8PA 1KJWA 1DARA 1N6LA 3NXSA 1Z63A 3OF5A 4OJQA 2XOKA 2ZI4A 1RPZA 3IKJA 2W2XA 2IW3A 2YVUA 4RZUA 5AK0A 1TTTA 4IDPA 3GEHA 2VL7A 3IIKA 3RRYA 4EJSB 2OCPA 2I4IA 2YOGA 3U4QA 1P62B 3B1YA 3T5DA 4YMTA 5EQTA 4DT1A 2Z83A 2IA5A 3EAQA 3ZGXA 4B75A 4IDNA 1W0KA 4EPXA 1NMZA 3P27A 4A8JA 4R2IA 2HF8A 4L9WA 2GDJA 1FUUA 2GK6A 3QXJA 1H8ED 2ZYVX 1KNXA 1G8PA 5JJKA 3GLIE 2X2EA 3VR3A 3K0CA 3LW7A 4G5OA 3WYFA 1MABA 3W3ZB 3QVUA 4ABYA 2XX3A 3FFBA 5F98A 2A5DA 5GADl 4IW3B 1KKMA 2IYXA 4DCUA 5HTKA 3ZZTA 4X8OA 1R0WA 4QGGA 3THXB 3WMGA 221PA 2FMXA 3BFVA 1HT2E 4M9ZA 4QBFA 2H16A 2O8EA 1Y63A 1DAGA 4EQ6B 3GLFA 2VPPA 1QG4A 3QKSA 2XZPA 5FTNA 1U81A 1Z0DA 2ZJ5A 1TPZA 2QPTA 4QHYA 4DDWA 2EWWA 2QM8A 1Q1EA 1NRJB 1P2VA 2CNWD 2FH5B 2JDID 2ZE8A 2PT5A 3GQBA 4L9SA 3LX8A 5E95A 3TRFA 5FPTA 1E0SA 5CJ2A 3U44B 1FNNA 3QKTA 5KDOA 3U7FB 1KI9A 1U9IC 1E0AA 1R4AA 5G3ZA 1KSHA 4D4KA 1X6VA 1G7SA 4NTZA 3FHCB 1VHTA 3LA6A 4XD7D 5IDVA 1I2MA 2FJUA 4NE2A 5C4MA 1OHHD 3GFTA 2XZOA 1QBKC 5FOXA 1YZGA 1W2GA 3R7WB 4JIMA 3KFXA 1WP9A 3A4LA 2ZRPA 4L5BA 1G8GA 3L0OA 4Q00A 2Y8EA 3DEFA 1OLOA 1IN4A 2YINC 2ZE6A 1YKSA 5FOTA 3BH6A 5CB8A 4TLEA 2W00A 1NY5A 4S35A 3I61A 2WPDD 2AN9A 4B74A 3ZVMA 2HEIA 4IOMA 4QG7A 5A5GA 5J4LA 3OE7D 4OI1A 3VHXA 4MKIA 3DKVA 2QPAA 1UFQA 1YRAA 4EDHA 3P1JA 4DLTA 1K5GA 4H1UA 4KVGA 3SN6A 3B1WA 2ZEJA 3ADBA 2GVDC 1P75A 4FMBB 2FSGA 4PHFA 4C0AC 3GCGA 3LDAA 3ASZA 4MITA 2J7KA 4R9UC 1VYVA 2V7QA 3HP1A 2FE4A 2KE5A 2A30A 3ADCA 2IS1A 4RZ3A 4NDZA 3HJNA 1E9BA 1V43A 1P60A 1Z2AA 3EIEA 3TQFA 4BEJA 2RGGA 5FI1B 4AIIA 4FINA 2BMEA 1UBCA 5DH9A 1FUKA 2G9NA 1KDPA 1OH8A 1R5NA 3TBKA 3IEUA 4XSGA 4AYWA 3Q7QA 2JASA 2D3WA 2QSZA 2ODWA 2Q9BA 2RHMA 1KI4A 4EPYA 5HE9A 1CKEA 1NL3A 4OL0A 2BMDA 4BEBA 5AR1A 1SVKA 3Q9LA 5FBVB 1MKYA 3PUVA 3FB4A 1Z6AA 2WVJA 4HLQB 4PC6A 4Q4AB 3KJEA 3KFVA 1NN5A 4NYJQ 1KO1A 3IILA 4HB3A 3G82C 4LBVA 4HLCA 3TW8B 4AG6A 1YVDA 2DHRA 1YZNA 1EFCA 4LHZA 3K0AB 2GZDA 2GJSA 3C15C 3CPHA 4URXR 2ZR7A 3K09A 3GLGA 2NO9A 3QXCA 4DLSA 2HJVA 4PPGA 3C7KA 1C1YA 3I8XA 1COWA 1SXJA 2H8KA 3OEHD 2AXPA 3LH5A 5GJVC 4GZMA 1XZPA 2ZRNA 3GFOA 4PC1A 2A7QA 2EFEB 1P2UA 2YYZA 3F3YA 3P20A 1F2TA 2BV3A 2H7VA 3B78A 2JLWA 1CLUA 2OG2A 4GBMA 3MFYA 3VHLB 3SYNA 3DM5A 4KBGA 3PR1A 1NN0A 2HUPA 1XJ0A 3V9PA 2ATVA 3I8SA 1VG0B 2W6JA 2ZREA 4KO8A 4G5RA 4P33A 1QHHB 1ZCBA 3GLHE 1P5ZB 5EP4A 4OK5A 1E2DA 1S96A 3CZQA 4A92A 3U3OA 2GZAA 3R9WA 4KLZA 3VU9B 3ZJYA 2V9PA 2WAXA 4PXAA 5FR2A 2XJ4A 4BLQA 1EK0A 3P4XA 4DLUA 4LX0A 5FBLB 3O47A 3JZMA 5LPNA 4F4CA 1E2HA 1Q3TA 2YV5A 2FFQA 2ZRCA 2XJ9A 2CXXA 4ON9A 4Q7JB 1W5TA 2QRZA 4QGFA 1Q22A 3C5HA 4Q9HA 1P61B 3K9LA 4DCNA 2VO1A 1EGAA 4D80A 4WZ6A 1Z2CA 2RGEA 4ITRC 2JLXA 2DFKB 1JQJC 3NHAA 2D2FA 2R6GA 4AC9A 2P6NA 3K9HA 3KKNA 5L3SB 4HZUA 1HT1E 3QG1A 3LV8A 1JEEA 2GJAA 3U3JA 2J45A 2UVQA 4RVCA 1XD8A 4IHQA 4KU4A 4IDOA 3TW4A 5DI9A 1XEXB 4K46A 5AUQA 5K8IA 1NG9A 3QKRA 1XTRA 3ZS9A 3K0SA 3WMFA 1HQYE 4TYWA 1C9KA 1SKYB 4DDVA 4C3ZA 1XPRA 1ZYUA 4OK6A 5DI3A 3WMEA 4D81A 4YXWA 3L8YA 3HPQA 1W4BA 1XEFA 1EG7A 1TF7A 2XB2A 5FUVA 3GFPA 1G64A 3CW2A 3LXRA 2ZRAA 2X19A 3U5ZB 1OW3B 5E7IA 5EE1A 1GFIA 5BWMA 2G0NA 3IIJA 2VEDA 5AUOB 1G3UA 3LBHA 3O8BA 4IDQA 5JSZA 1C4OA 3L0SA 1S1CA 3PIRA 1XP8A 1EFRA 4DCSA 1Z6GA 3U6KA 3SBEA 4FMCB 3I62A 1RIFA 2VF7A 1KKLA 2C99A 1UBGA 2HV8A 1Z0IA 1MABB 2JJ2D 4PAMA 3KQKA 1GL6A 2XITA 2OLJA 4QJ4A 1NVVQ 1XU4A 1U98A 2FV8A 2QGZA 4NCHA 4OI2A 4NCNA 5GJCA 2ORIA 3UWKA 5J5CA 3C41J 1F3OA 2WJHA 3EW9A 5UKDA 3DMDA 2ZETA 1XTJA 4XTRA 2EFHB 1WRBA 3AUYA 4V0MA 4TL9A 5KYKA 3IEVA 5EUMA 1U94A 1ANKA 2PLRA 1NSTA 3QNUA 4DIEA 3GEIA 5EXTA 2OAP1 1FMJA 2ZRDA 3FE2A 2C9CA 3QKSB 1NVWQ 4KHZA 1HURA 2ZPTX 2WOOA 4KVAA 3UANA 2QMEA 3LO5A 2ZUCA 4BFSA 1CS4C 1X1RA 5KSOA 4PC3A 1II0A 1KAOA 1OIWA 3LVQE 3AV0B 4JKYA 4G5SA 1JJ7A 2E1RA 1DAMA 2BBOA 2WSMA 4OJKA 2KBFA 1DAHA 3K70D 2BJVA 3D8BA 3NH9A 4IXMA 3VNVA 2Q0HA 3PQCA 4DLXA 1L8QA 1S9DA 1UDXA 2CMKA 4B3XA 1FQJA 2OT3B 1BYIA 2ODBA 2AL7A 2IT1A 1IY2A 3RS2A 3W8NA 1NKSA 4QXAA 3SQXA 4MRNA 2UZ3A 1XRJA 2ZROA 3PFIA 4ERNA 1IOZA 4G3XA 2WHXA 4LJ9A 2IYWA 4C30A 4D4LA 1YJ5A 2ZANA 1XD2A 5GVRA 4JLBA 1HTWA 5HPYB 3VR4A 2WM9B 4BFWA 1KMHB 2D7DA 1LTQA 1YE8A 4I81A 1I4LD 4WOPA 1SHZA 5AJZA 3CNLA 4Y0VA 1XMVA 3KJGA 4LC0A 1G8YA 1G3MA 2QU8A 2XZLA 4F4JA 2KJQA 5JBQA 5LD2B 4NCIA 5KSZA 1YR8A 1P9NA 1E1QD 1OJLA 4LJYA 4XTCS 3EPJA 2LWIA 1E2FA 2VSFA 3BWDD 4WXRA 4OHYA 1JXMA 2JLSA 4ZCLA 2HLDA 2WWGA 3IUYA 4NBSA 1IJFA 3U3MA 2Q3FA 2E9SA 2QORA 3C8UA 1FX0B 3W9YA 3W5IA 3K1JA 1KY3A 1RYFA 4EIWA 1Q44A 1AS3A 2VH5R 3SFZA 4KSCA 5D3MB 2WWIA 3FPAA 5AUNB 3VR6A 6Q21A 2IF0A 2JLVA 2QMHA 4L16A 2XTNA 3AKDA 4MDEA 1JR3D 1IBRA 2RGCA 1Q1QA 4MRVA 2ZI7A 1G41A 1UKVY 5TY0A 3CRQA 1Q20A 1MR3F 2ZSBA 5J4HA 4U7DA 2REBA 1CR1A 1KO7A 2ZVQX 4O2LA 2GJKA 2WKQA 2HJGA 1E79D 5FOSA 1E4VA 2QAGC 5KUTA 2FGKA 2CL0X 2C78A 1LV7A 2F6RA 3ASYA 2FSIA 1B0UA 4FN5A 3M1IA 3ZIAA 4EJSA 1U8AA 3JVVA 1FQKA 1SVLA 1E98A 4WZBE 1JEDA 3EA5A 3VNUA 1VYUA 2HCBA 4BFZA 4CGZA 3O8DA 3WYAA 1SXJB 3QXXA 4JLVA 3B8HA 3QF4B 2DFLA 2RGNC 4Q1EA 4TMVA 1CJKC 1KDTA 4J0QA 1SKYE 1S3SA 3GLHA 2ZR9A 3L0PA 3AKEA 3U7EB 2IEYA 4HLDA 3CM0A 3NVAA 2JLZA 1Z08A 3CR7A 3H0KA 1F2TB 2QMUA 2FNAA 4TSFD 1J90A 1GAJA 2KI5A 4JLMA 3THXA 4A0GA 2WWXA 3IBYA 4KSBA 4RZXA 1NF3A 4M9XA 3ZQ6A 2JIZD 2XNDA 1AM4D 2A5FA 4MYUA 2WTUA 3ZYCA 3F0TA 4EQ6A 4BLTA 4WZAE 1E1RA 5CM9C 4E22A 1KI7A 5JRJA 1GUAA 3RSLA 2HXSA 4A0FA 5FL7D 1NJFA 3I5YA 1KJZA 5FTJA 3IGFA 2QP4A 4D26A 5EUQB 3FVQA 4DDTA 4Q4HB 1W1WA 2Z6VA 2VF8A 3IO3A 4KJZA 5KDLA 4FI3C 4HATA 1ZC4A 3L0IB 4AY2A 4NH0A 1XEWY 2ZYUX 1JECA 4DEYA 4FWIB 3C5CA 2O0KA 2B21A 2XB4A 2LKDA 1E6CA 1JI0A 3R7WA 4Q66C 4QJ5A 2ZE7A 4B47A 1JALA 1UAAA 2J87A 4HUQB 1F5NA 1JPJA 1YQTA 2F1RA 1DTSA 2X2FA 1W36C 3E2IA 5ELXA 4HZUB 4LJ7A 5E7JA 1VMAA 3THYB 1NI3A 1OPXA 1PUIA 3ICQB 4JS0A 2ZUBA 2WMNB 4NL4H 1W47A 5EP2A 2EYQA 1DAEA 2UKDA 2GXAA 1E9RA 4CRWB 2VHJA 1OF1A 1A4RA 3OIVA 3RS7A 5CDFE 1N6PA 2WBLC 3AQ4A 2AD5A 4PPFA 5DI3B 5CLLA 1IONA 2WMOB 3TMKA 1IXSB 5BXQC 2O8BA 4ZI3A 5EE9A 5KPDA 1WE2A 3IPXA 1WA5A 4DIDA 2JJ8A 3BD9A 5G40A 5H68A 1BH2A 1N5KA 3ZS8A 2ZRKA 3LQRA 4RD3A 4F93B 1KI2A 1HY3A 2V6IA 4ILEA 1S0UA 3PUYA 5JSZB 1VG8A 3BB1A 1XB2A 2VYFA 1E0JA 5KPJA 1CR2A 5JLJA 3VX3A 1RYHA 1E9SA 1YHNA 2WAYA 2BMJA 1E0KA 3NEJA 1N6OA 4EFNA 1ZUNB 2DR3A 2R6FA 2WV9A 1Q1BA 5CIWA 1JPNA 2VHCA 1E9CA 5SZKB 1GIAA 1X1SA 2O8CB 3EC2A 4QRHA 1ZD1A 4Q4AA 3LNCA 5G53C 4IVPA 4HB4A 1M34E 1FZQA 2DBYA 5FR1A 3IPYA 3K0EA 1E2MA 1U99A 2OXCA 3BGWA 4IVQA 2FFBA 3PUZA 5FOUA 4A15A 2XXAB 3O8RA 4JL6A 5DN6D 1UBEA 3K0AA 1DAIA 1U9IA 1L7VC 4PZZA 2ODNA 4C0KA 2EFGA 3MAAC 5B30A 4JJKA 2ZRLA 3BERA 2G88A 1EFHA 1G6HA 1G7TA 1XMIA 2HDNB 2VP5A 3TUJC 2Z0MA 4D0GA 1RFLA 2RAPA 3WHKA 4A6PA 1T5IA 3CO5A 5JEDA 4JMPA 2FSHA 3FKSD 3EPHA 1OFIA 5HKKD 1ZRHA 1VCMA 2C77A 1ESMA 3KDSE 1P9WA 3I72A 4FXPA 3BC1A 5GVSA 1W36B 1N6HA 421PA 4Z1MD 2PJZA 4CYMA 5TB5A 1UKEA 1ZNYA 1CR0A 1LW7A 4XWAA 3Q5EA 4BECA 2PX3A 1R0XA 4MUAA 1XXHA 2AXNA 1SXJE 2ZIAA 1RRCA 3LBIA 2PLFA 4Q4JB 2WOJA 3BAFA 2IUTA 3AB3A 3CF2A 4TQUS 3B2EA 2ZJAA 4BLRA 4YMWA 4LJAA 4XH9B 4A0RA 4LBYA 5FOWA 3VU9A 1GL7A 4RZ2A 2IWRA 2IYZA 1VECA 1J7KA 4PO1A 4RD6A 1CF4A 1EFTA 1S2MA 2QSYA 4DXAA 3PUXA 1P72A 4F38A 3T1OA 1NG1A 3UMFA 4KAXA 2W6ID 4XWKA 2F55A 1H65A 4Q18A 2AFHE 2NPFA 3U7GA 1G8HA 3HYRA 2MMCA 3RS5A 4ZKDA 1OHHA 1P6XA 1TQ4A 1OKKD 1CJVC 1TNDA 2XNSA 4TWZA 5HZKA 1KK1A 1BKDR 4JBXA 1FPMA 1MRSA 5FTLA 1LS1A 1KSGA 1ZM4A 1GWNA 3D7MA 4FCVA 3EWAA 4ZO4A 1R0YA 3NC0C 2DWQA 1I4DD 2LKCA 2DFTA 5C2JB 2R6CA 3TAHA 3TVTA 2ZI9A 1G3QA 4LJ8A 1AGPA 3OAAD 3WNBA 3WNCA 4IJMA 4B3CA 1XEXA 4AK9A 2JJ1A 3OE7A 3FFAA 3TLXA 1EWRA 4M1TA 3FMOB 2N46A 3OFNA 4Q7MB 3BS4A 4GRAA 4NKRA 3E70C 1O87A 2ZRMA 1ZJ6A 3NDPA 2CVHA 2QNRA 4M8NE 2R44A 4C2UA 1P4SA 3T12A 4URZR 2GXUA 3TAUA 5IHPA 3CB4A 1G3IA 1IN6A 3MWKA 1KY2A 1XNJA 721PA 3THWB 3Q72A 1JJVA 1QF9A 5DO9A 3X1WA 2NPIA 3X1XA 3PUWA 3PITA 1S3GA 4OQNA 5DGXA 2ZU0C 4GNKA 1G4AE 4D0LB 2H92A 3B1VA 3WNDA 3QVVA 2WWFA 3GLHB 2BCJQ 2R62A 3RRNA 3RVBA 3MJRA 4AKHA 3R9IA 2D74A 5KU1A 1P9RA 1RRGA 1U0JA 2ANBA 2CJWB 1S9HA 3MWJA 4UNNA 2WJIA 2OCAA 1EXMA 5ANRB 4US0R 3ND9A 1II8B 3SJZA 2C9YA 5FUYA 3KB2A 2QE7D 4M53A 1QHNA 4ASUD 3GJ4A 4LJ5A 4V0NA 3GJ8A 3QBVA 3B5JA 1Q21A 2ATXA 3X1YA 3I4LA 2O8DA 3AVYA 4G5QA 2AHOA 4KFTA 1PLLA 3H86A 2V1XA 5F9FA 2C98A 3EA0A 5FL3A 3TQCA 2CK3D 4ACAA 1KYIA 3GJ3A 1AKEA 4HAYA 1OIVA 4MH0R 4MGKR 3W6OA 1NLYA 3QG5A 4IVRA 2ZS7A 4CEHB 3FWYA 4PANA 2C8VA 1FP6A 4NHOA 1HUQA 5IT5A 1ESNA 3BXZA 4V0ME 3RS0A 2QENA 1GTVA 1WXQA 1NMYA 1W4AA 4PQFA 1W0JD 2N42A 3S1AB 3NH6A 2G0TA 2OM2A 3IQWA 3ONWA 3UIEA 5CDFA 2OBNA 2EQBA 2QT1A 1H8HD 5KSPA 821PA 2CE7A 4XOIA 3AF0A 4BQSA 2XSZD 4BLPA 4B44A 1E32A 3MLEA 1VG1A 2OO7A 3GD7A 3NDBB 2GRJA 3A37A 2RGXA 1TADA 1IN7A 1NVUQ 2GHIA 2YOFA 2VHTA 1XCGB 2QTFA 3PEYA 1KMHA 4EPVA 1XJQA 3U6BA 4JSTA 2L0XA 1SZPA 3M0EA 1GKUB 2V6JA 2O8BB 5CK5A 1Q57A 2ZSDA 1QHXA 3AF4A 2OXRA 4M1KA 1E99A 1NSFA 1UF9A 1N6KA 2GXQA 4WVFA 4ESHA 4GMDA 4FIDA 2PCLA 1OXSC 4CT4B 5JCZA 5C1BA 1Z3IX 1WCV1 2ZRBA 3OHMA 3TGPA 1NJGA 2V54A 1FX0A 4CT5A 1U8ZA 2JLRA 1IHUA 2YC4C 2YJTD 3CRMA 1P3JA 3DKPA 3MMPA 4II7A 2XOKD 1MO3A 4Q1CA 5KDDA 1MV5A 2F3TA 1J99A 1QHYA 2ORVA 3SEAA 4MDFA 3KKMA 5D3MA 2QN6A 3VR1A 1JNYA 3AKYA 1VYTA 4AD8A 4I99A 5L8VA 4Q1BA 1ZNWA 2G1JA 4TL6A 1M1YE 1ZM2A 2PT7A 5EZ6B 5L3RA 4CEJA 4M0LA 2YKGA 4G5GA 4OHWA 5E7MA 4TYPA 4TMTA 2YWGA 4KYUA 3U2QA 2BVNA 2GF0A 2CDNA 3TK1A 3T61A 4JLNA 4QBHA 3H2YA 3A36A 5FUWA 4TTQA 4M1SA 1ZM7A 2D4HA 3N2EA 4Q47A 3P32A 4QL3A 2CVFA 2I1VB 3A8TA 4D6PA 1RC8A 1KI6A 4DUGA 4KODA 1PUJA 2VA8A 1SHKA 4GT1A 3CX6A 4WA7A 4AURA 5F2EA 4NYJR 3QF4A 3NBZC 2EFDB 2AWNA 4LYHA 2ZM5A 1VCIA 1HV8A 1F6BA 1Z0JA 5FBWB 1ZVQA 1NLFA 1P2SA 1M7BA 4I4LA 4XVUA 4Q5IA 2IS4A 2H57A 5TXGA 1X8KA 3EIHA 3QPWA 4IXNA 2CLDX 3VAAA 2VSOA 4PAOA 3GJ0A 3KXIA 1ZBDA 3CPEA 3NKVA 3A1TA 2J46A 5DHAA 3BFXA 3LXXA 2QT0A 2REXB 5HCIA 4IOKA 1GKIA 2CCKA 5A4JA 1ZNXA 5F9HA 4TMZA 2AKAB 2ZAMA 3OEED 2VHQA 1XXHB 3UK6A 4B73A 1DO0A 2IEZA 5JI3E 4EAQA 5KHOC 3M6AA 4HDQB 2J7PD 3OIWA 2ZRFA 5DNYB 3TR0A 2ODEA 2BKEA 2B8WA 2ZR0A 3SJAA 4CVNA 2GJ8A 5CJPA 2J9RA 3AVVA 4Q4HA 2IYRA 1OYYA 4A4DA 1D6JA 2LCFA 3KZ1E 1FTSA 1TX4B 4Q4LA 1N5JA 2PL3A 4JVSB 2OCYC 4MKGA 1O3YA 4IRUB 2YWEA 2IXFA 2AFIE 2AK2A 4EUNA 4OQMA 4RFSB 2E87A 3I32A 1ZM9A 3RWOA 2RB4A 1T3LA 2AK3A 5TV2A 4B71A 3FGNA 1G9XA 4IFBA 2Z4RA 1Q3HA 3OIUA 1QHGA 1E4YA 4DDUA 3CPJB 3KTAA 1RRFA 1GDDA 4HUQA 3HR7A 4I1SA 3KKQA 3QENA 3T34A 2RCNA 1AS2A 1N6NA 1EWQA 2W0SA 2CBZA 1G7RA 1NVXQ 5CIQA 1E2LA 3THYA 4MRSA 1P7CA 2NOAA 3CNNA 4N1AA 4C0BA 4LUCA 4A9AA 1CRQA 5JS7A 5IK2A 3CWZA 3N2IA 2V7QD 3CF0A 5GJWC 2QAGA 2CE2X 2OHFA 3LFUA 4EKDA 3DMNA 1GRNA 4JYBA 2HYIC 3K8YA 5GJBA 2XAUA 1VCNA 5JHGB 3TH5A 2QQ0A 4B2IA 3FMPB 1E3MA 4BFVA 1KSJA 2FEMA 4PC2A 2XGJA 4V0OA 3QEOA 1AA9A 1ZCAA 2EVWX 3WP1B 3HDTA 2Q9AA 2VTKA 2IL1A 1LFDB 3RABA 2VP6A 4D4MA 3H84A 3PXGA 2GAAA 1HH4A 2RGNA 2ERYA 5JWHA 4ARZB 5JS8A 1PV4A 5AJVB 3UG7A 2F1JA 1N3BA 3A1SA 1GL9B 2IYUA 3KJIA 4PHTA 3SNHA 5H8WA 2QBYB 2Q3HA 4RCZA 5B58C 3FTQA 4US2R 5CK4A 3KQNA 3KKPA 2PMDA 1CP2A 4GFDA 1AZSC 1F2UB 4LPSA 2IHYA 4R7ZA 4A2WA 4OI0A 4TTPA 1FL9A 2GF9A 3N70A 4JL5A 3ECCA 1VPLA 1T0JB 1DG1G 1Z0FA 2O8CA 2CHQA 3OIYA 3Q8XB 5AJWA 3TSOA 5KNBA 3CIOA 3EZ9A 4BRWA 4DLZA 3QSYA 2XTZA 5DE3A 4B6EA 1SVMA 1WQ1R 2ZSEA 5FPHA 1U2RA 3WBJA 5M04A 1T5LA 3SQWA 1W7AA 1P2TA 2O8DB 2ANCA 5CM8B 1J8MF 2XXAA 2VQSA 4X8LA 4NU0A 2H1LA 5FOVA 1D2NA 1B23P 2O0JA 3AUXA 2ZJOA 3OESA 4QC2A 2BKUA 4C7OB 1DELA 1RVDA 3ZDQA 3ZVRA 2BHRA 3KX2A 3PG5A 3EPLA 5JEEA 3HPRA 1KJYA 1D9ZA 4UNQA 4JL8A 4ZDJA 3K9NA 3X2SA 2YC2C 3V00A 2IC5A 4Q7KA 1QG2A 1XTIA 4BWYA 4P4SB 2BEKA 4Q01A 4F4IA 2NO0A 3QJYA 2QRNA 3FHTA 4V03A 1VHLA 4XSHA 2MMGA
chains in the Genus database with same CATH superfamily
5KYXB 1IZ7A 1C1HA 1L1EA 3LRTA 2FMIA 5DLDA 3REQB 3SFTA 1EFPB 2ZTVA 4MTLA 1C3LA 1GPJA 3E2PA 4FDUA 4B32A 5KYNA 4BVHA 3I6ZA 4IO1A 4B7ZA 5B1EA 2XNCA 3SC6A 4CG3A 3FZQA 4HZIA 1X80A 1QXSA 1E5LA 1UKBA 5CX1A 2UDPA 2PZFA 3BKWA 2V5AA 3L1KA 5AWFC 3V4SA 5EJEA 3UOAB 1MDFA 4IWNA 5A6SA 1YR7A 1LDMA 2ID4A 3PI6A 3BN3A 2P9HA 4BMXA 4UM9B 4YEDA 2WU0A 2G36A 2OD7A 1KZGB 1KJJA 1Y1QA 3UWPA 3ZHTA 3ON5A 4LV8B 1YS6A 3AI2A 2J59A 1H2ZA 5SV2A 4AP9A 4MRRA 2UYCA 1D07A 3MTGA 2ZCJA 3Q6NA 5FV7A 4FB4A 2FTKE 2ZSAA 4JA2A 3BE5A 1K5DA 2TMGA 3LLMA 2XWPA 4KIUA 3JAWA 4HDRB 5DGCA 2C5FA 1MO4A 1EM8A 2GEBA 4JENA 3RFUA 4DAOA 1SM4A 2G1KA 3IPAA 3K70C 4R98A 5JXIA 1KYYA 4HDNA 4K9LA 1I30A 3A6DA 4BXOB 2EARA 3BIFA 1Q5PA 1FB5A 1MAAA 2G3YA 4C21A 7REQA 4E08A 4DB2A 3DZ8A 4TN5A 3PS9A 4LWPA 4F56A 1BSVA 2V55B 3QPBA 2NYAA 3RTDA 3EEYA 3M1AA 4YFVA 2AYYA 3B60A 4A1OA 1XZQA 1M2KA 1CIPA 1ULSA 5BURA 1ZD9A 1SUDA 4MVJI 4RQAA 2Q62A 4DV7B 3TGLA 1P0IA 3RC3A 4DV0B 4IPTA 1UKZA 1E9EA 2C57A 2B25A 2FWIA 1DDIA 3HR8A 3ODGA 3RQSA 2XAAA 2NSHA 4RW0A 4JSYA 4BBZA 3QX8A 3V1UA 2B0JA 2I76A 3BZBA 5BWCA 1G5HA 1R6VA 1NJ8A 1IU9A 5AVTA 3GDGA 1DBVO 3JQBC 2CFTA 1WUHS 3UH0A 1Q15A 3EQ2A 2BIFA 4HADA 1EVQA 2NZUG 3EPKA 1OFHA 1AHPA 3VVBA 3VTFA 4BX8A 4L5IA 4DCTA 3DZDA 1VGVA 4P4TA 3PXCX 4RMJA 3IUJA 3EHEA 3IHWA 1X1BA 4LYAA 4O2BB 3T3GA 3U3KA 5IM4A 3ZU5A 2ZBDA 4OLHA 4JP5A 5T7BA 3EG5A 1K7CA 2H9AA 3JQFA 4HDOB 4GOKA 2P9GA 2FRXA 3ZW9A 1YJXA 2NU7A 2O2YA 4OXNA 5JNUA 4G0NA 2OVFA 4EPRA 3AKZA 4ISBA 3OBIA 5TQ2A 3W2IA 3WSVA 2C1XA 4AX8A 2R8EA 1GTJ1 1X3LA 3IERA 5B5SA 2FEOA 1Q74A 2D6FA 3KWJA 3GMDA 3TBFA 1FFWA 4JV5B 3R8CA 4QJ3A 3SVLA 2CN1A 3I92A 4CTOA 2D1YA 4HFJA 2IGTA 4EGCB 3JWIA 3BXFA 2PH5A 3JVUA 3K9GA 3ENVA 3NC4A 4LSMA 1T3ZA 1YDFA 2WA1A 2CMGA 3S6JA 4LN1A 1PZHA 3QGMA 121PA 1DWUA 1L7PA 1ONBA 1P77A 1TZMA 2QM0A 2WSSA 4WFQA 2GRAA 1Z0KA 2CLMB 2QMZA 4IZOA 4JBYA 4YUAA 1HEUA 1A2KC 2D1RA 2P3SA 2VSNA 3O4HA 4CM9A 1N0VC 1XTKA 5CNKA 1XRQA 4BYMA 2E82A 2CXTA 3T4EA 2QRMA 5AESA 1ECLA 5E3HA 4Z7JA 5H70A 3HVHA 3AG6A 1GAXA 1VLQA 3GEEA 5CEEA 1G8FA 4MUMA 3FSEA 1G4UR 1O95C 2RKOA 1RKBA 3GARA 3PC8C 1XG5A 3NIBA 3UPUA 5EHZA 4FNAA 2NSLA 4C6HA 5B6IA 3KTAB 2YNMC 3BORA 2OB1A 4HS4A 1GNPA 4JOCA 2DQYA 3KEMA 2H54A 4N12A 3WNQA 2ODTX 1G5FA 2NXJA 2JFFA 1Y6FA 4FYYA 3ZDDA 1EVEA 4B2PA 5ALYA 2CUZA 3T0GA 2AN3A 2AI2A 3ZNPA 3DPIA 1CUGA 2FEKA 2C1EA 3WGQA 2VT6A 2WIDA 3IR7A 5EI5A 5CFRA 2ZTLA 4HBZA 5HM8A 5HOQA 1Z47A 2FN4A 2MHCA 4KXWA 1G5PA 1YUNA 1NBOA 2W2KB 1JB9A 4MVWA 1TO2E 5KMGB 4GKKB 2JATA 1K3TA 4WT7A 1CEEA 1RJ9B 3VDXA 5DM70 1ZGGA 3FPLA 1K1EA 4FDAA 3NTUA 1HDRA 1JH9A 1L4FA 2JH3A 4AYXA 1TEXA 1SIUA 4XPZA 2XBMA 1C9EA 1Y8AA 3KKKA 2L2QA 3EZ6A 1F06A 1SY7A 2DB3A 1BD3A 2W6IA 4JUFA 2HBQA 3NASA 4CMKA 4RHTA 5C8YB 3SXPA 3R3UA 5E4FA 3UGQA 4CL8A 4E1AA 2ZAOA 3ENNA 5BVGB 4TQ9A 1JBQA 1UM8A 1T4BA 3T7CA 2GESA 4IHJB 5B6JA 3T4UA 1I4WA 4HQ6A 4J49A 3B85A 4U5QA 4DR5B 1ODFA 3LAWA 1BFUA 2J5XA 1PR2A 3IO5A 3QI7A 4U63A 3TEMA 5HGXA 4D8YA 2WHEA 2POCA 4K26A 1PG5A 4YCCA 4U0JA 5T6BA 4UTZA 3X1KA 4D56A 4YMIA 2QTHA 3VH2A 1B73A 1TD9A 2XVYA 1IVNA 2C9OA 2PQ6A 2QD4A 3PBKA 5I9TA 2F1HA 4MCJA 1NJ1A 3T5GA 1VP3A 2V7BA 2CV0A 5FA8A 3A1UA 3U0VA 3G5UA 3QTBA 1NBHA 1ZAYA 1CULC 4QBGB 3P9NA 1R8JA 4X41A 1VPVA 3IS3A 4N7MA 3I1YA 4NYIR 4ARIA 2VTVA 3UFXA 2C7BA 3W5JA 4RTSA 3N28A 3COPA 2HWKA 5EYPB 3FWHA 3T1VA 3LPAA 4L9AA 4OHXA 3B3JA 4IIXA 1UK8A 2MSDB 2ZQ5A 4BGIA 4XPIA 5E6RB 2UXDB 1R5OA 2WTEA 3R5HA 2OBMA 1OTYA 1QV7A 3HMQA 4LDAA 4YCDA 3QWBA 5K7SA 4IL5A 4OFXA 3ICVA 3EBPA 2F43A 3HWSA 3ZWCA 3CLVA 3FLAA 5J40A 3DMHA 3FLEA 3OMXA 4GL2A 1KI3A 3UT5B 1SC1A 4D4JA 1YCFA 2XCRB 4QGAA 3B6EA 4Z54A 4Q1AA 3R74A 2VOJA 4N39A 2Q7DA 2IXBA 3FWNA 1KZ4A 4LOKA 4A3SA 3PEFA 1Z6TA 1VLJA 2BZSA 2C5LA 2WP0A 2F64A 3ONVA 1CJTC 5BUZA 3AGPA 2FMFA 3OZ7A 5DHPA 4BVGA 4G0WA 1EFKA 5BPFA 2WDPA 4O63O 1C1DB 1EKXA 2ATEA 1GUDA 1XTTA 2G40A 2GEFA 5BN4B 2GHRA 3ABRB 4PR3A 2PIDA 4TYYA 4DBVO 2YZKA 1R8YA 5B64A 4LY9A 5DF1A 2VCHA 2JZOA 2RGDA 1OX4B 2W48A 4QUIA 1G6OA 1YB5A 1XPOA 3VYVA 5ELLA 2EYUA 3QFFA 2ZB2A 3SEQA 5CA0F 3EX7C 3CH7A 1YU9A 3QKIA 4LJ6A 2I66A 2K6GA 3MA0A 3PC2A 4IFTA 2CNWA 1OWPA 3GJ5A 521PA 2H3HA 1P1HA 1E8NA 2I22A 4HHEA 4PPNA 3G7NA 4DLBA 3T95A 1TCBA 1DJMA 3DBRB 3UXEA 4DSTA 4F6LA 4EF4A 1Y3DE 3LVRE 3NIDB 5SZHB 4LFBB 1U7OA 1PNQA 2B35A 3QEJA 4RFSA 5DBHX 5JXGA 1K06A 1M2WA 1C1XA 1MP0A 2VXCA 4ER6A 3V34A 1X19A 4U7JA 4XD7A 2PJUA 3I01M 1HYQA 1N4DA 3LQKA 4GSKA 2C7QA 4OKSA 4UAVA 1YK0A 3I3SR 1WB5A 3VNSA 3NETA 2XSZA 4Q6BA 5IC4A 2F3PA 2HWUA 2BY4A 2YMMA 4GPEA 2Q4BA 1Y3AA 3I9OA 2KWIA 4P2BA 5A02A 3HA3A 3M4ZA 3I6QA 2BR5A 4RK4A 1YKFA 2E4AA 2FPPB 1UADA 3KZXA 3FMFA 1FFYA 1QO9A 3D6TB 4NYMR 4H1TA 1L5YA 4GI7A 4UMFA 1RCFA 4JEHA 1UC5B 4JR1A 1TKBA 3JATB 3MGKA 3AU8A 3GL9A 5GONA 3ZTYA 1PRYA 1PBNA 3SZUA 3MOSA 4L4XA 3ST7A 3Q2IA 4XDGA 2QA5A 4J03A 3UK2A 1VRWA 3SD7A 3H3XA 2ZYIA 2G7MC 5F7OA 4KWCA 3QQ5A 3U4MA 4DGQA 1YZLA 5JS1A 4ACBA 3CINA 4ARZA 1CFZA 1DBSA 1MOPA 5DYIA 4KKXB 1F1BA 1FRVA 1ND6A 2JC3A 3DVAA 3VNQA 1TJPB 2H31A 4XFDA 3VPCA 3ZWMA 3NBFA 3RU9A 4O25A 4OD0A 3N8KA 3JWGA 4QXOA 3TX6A 4AY5A 5DYGA 2WWWA 3WJAA 4R9VA 1JHDA 5FO0A 4BNJA 3U4AA 3PNOA 5DKFA 1B3BA 2OBLA 2P4EA 3CNBA 3UB4A 1MC1A 4GXTA 2VIIA 3DZKA 1A27A 1NNUA 4R01A 4FYKA 4INJA 4URUR 3TF5A 2VG8A 4YHBA 2FJ0A 1YTLA 5KNBH 1A96A 4CKBA 2RHWA 3LI2A 1ZL2A 4WDQA 4C04A 4HG2A 1URPA 4DLAA 2FW7A 2CLSA 2ZJZA 5E1MA 2JAHA 4TTAA 4RIIA 4BO7A 4Q9AA 3SR0A 1V5EA 5KHAA 2YMQA 2XE7A 4LYEA 1IIBA 1Q7GA 2JG3A 4TL8A 3MQ2A 2AFIB 5EFZA 3GEGA 3EGDB 1OWNA 4KCGA 1UPXA 3IOEA 1LF0A 3JQQA 3PDIB 3P4YA 5CLQA 3LQ4A 3SI7A 3T38A 1J49A 4J2HA 4Y3UA 5EXPA 4H08A 1NYQA 3B9PA 1SEVA 4N3NA 4RHCA 2ZI3A 4TSRA 1L1QA 4W8OA 3RE1A 3B52X 1JAZA 4EDFA 1DX6A 5LM3A 2Q45A 2GN1A 1CJCA 4WASA 4ZZ1A 1IY0A 1PGQA 5C46F 2Q8NA 3S55A 4JYCA 2J8ZA 4C7OA 2AG5A 4PQYA 4DA9A 1W75A 5H82A 4W9MC 1ENZA 4QNRA 1ITZA 1JR3E 5EJ5A 2V65A 1CY8A 3FVVA 3OEHA 3AKCA 1P1IA 1QIHA 5DBIA 1FSFA 3ROKA 3LHKA 3MMSA 3UHOA 3LU1A 5JO0A 4CQNA 1F8UA 2I03A 4MUYA 1X8XA 3OP1A 4E09A 2J0UB 1SZJG 4P4SA 4UXHA 1YA6A 2OC4A 2YWJA 3FIJA 1T8SA 3NIFB 2Q1SA 3EH1A 2EQAA 4HEA1 2C96A 1ZVMA 3FKQA 4D25A 2VWGA 1Y33E 1X8LA 4BO4A 4YRBA 4PNPA 2ID8A 4D9MA 1DOAA 1JG1A 2WFZA 3ISTA 3OQHA 2MJLA 5AW1A 5KWSA 1M6VA 4EEXA 3C74A 3QVTA 1C8KA 3MK31 3TAXA 1KFKB 4HFMA 4XX0B 3SYMA 2LE0A 5KKCA 1I1OA 3GRUA 2G5PA 3IULA 5H3CA 2FZ4A 1OR8A 2JCSA 3FIUA 4H4DA 4KIGA 10MHA 3ABOB 1AQUA 3NUGA 2DCUA 3FYCA 4AJKA 1OC4A 2BC9A 1GPYA 4M22A 1SCJA 4OLAA 3OVMA 5EGSA 3EDRA 2PV7A 1LTHR 3CURA 5JJIA 5KYWB 3CKYA 1OBVA 4MUBA 4CKZA 5T41A 4LMPA 5KYYA 1RAGA 4IWYA 4FDVA 1GAWA 3WGHA 3W78A 1XNRB 1X7YB 5AKLA 1Y3BE 3ZX4A 4C03A 4KGZA 2Q3CA 2QLTA 1N5OX 3V42A 1XYVA 3VR6H 1I3MA 3PNQA 2ZJ6A 1JA0A 1YUBA 1MTOA 5DIZA 1UP6A 2GK7A 3NYQA 4HRYA 4LOIA 2QOEA 2VF2A 3PLNA 2Q7OE 2RH9B 4G4IA 4JN6B 1PD1A 3KSMA 2PVSA 1PNRA 4AS3A 2J5RA 1KAEA 3VDRA 3SHFA 4MI9A 3WLJA 2YOHA 2V3CC 1KK3A 4MQBA 4X54A 5AM1A 3BIJA 1P8JA 5EE0A 1NI4B 3PQ5A 2OZEA 3CXRA 4PYNA 5IJ9A 1T2UA 1W25A 1UZMA 2GKSA 3K0BA 4IINA 4M76B 2V45A 2Z2ZA 3TUIC 3GRVA 621PA 1TQDA 1WXHA 2I6GA 4D5EA 2C97A 2G83A 5MDHA 4X63A 5T4FA 1QZZA 5BT9A 2WTNA 1EFDN 2I34A 1L5FA 3AVQA 1S2DA 2XMCA 4UPDA 2DUUA 1NX6A 3ZDYB 3HU1A 1WNFA 4ER7A 3WQSB 2KBEA 3PEVA 2OY0A 5AXBA 1DRUA 2PK3A 3L49A 2GOYA 2P9BA 2F9LA 5IDXA 1I7LA 3DL2A 3EFBA 4M8IA 1N8KA 3WGGA 1NJ2A 1HR0B 4WBNF 4LRYA 2V3VA 2YXDA 4P3KA 1UWVA 1QH8B 1XKQA 2QP3A 5B1HA 2H07A 4UDOA 4WESB 3LPCA 3MRVA 4OHVA 2G76A 3OU2A 2ZIZA 4KB5A 3WLIA 1PT8A 4WOBA 3S7TA 2NG1A 1BOFA 3NHRA 5T4BA 2IWHA 1QPZA 1GQ2A 2GYVA 3FYUA 3P4UA 1IAQA 3DL7A 1U5AA 4K86A 1ZJWA 5JWRA 4CV2A 4XQEA 5IFLA 2CDAA 2FYTA 4NU8X 4WA8A 2AJDA 4M9UA 4PYIA 4A82A 4ARBA 1AXGA 4Z51A 2GXSA 1FMCA 2O3SA 2I29A 1ZIPA 4R2XA 4XCXA 4KUGA 2NUAA 2YQ4A 1P1KA 3D5EA 4CKEA 4FFVA 2ONCA 5IDQA 3U61B 3PXBA 1F0KA 4A8JC 2ONJA 4AF6A 4A8HA 3PIIA 3M6MD 1YASA 1UEXC 1VJGA 5KOJB 3IJPA 2ZUDA 2XCLA 4B6FA 4KLAA 5KC8A 4J16C 2BMFA 4AUEA 3C6YA 4MV0A 3NRJA 4MUJA 1Z6ZA 1JQLB 1YCHA 1YCDA 1Z38A 2I3GA 4LNUB 3G0DA 1KAQA 4MW2A 4QOGA 5AD1A 4Z2YA 4S1NA 2ZDGA 2HI0A 4AULA 2IBMA 3E5RA 5C34B 5T3YA 2JEZA 2W58A 3Q3JB 4KWHA 3ZW7A 4ZJPA 1RE0A 4GH5A 1BDIA 3ZHCA 4F6CA 3CVXA 1XTPA 3SQXA 4CCYB 2P2SA 4AKSA 1CIJA 1A9XA 4HDKA 4KWIA 4BLSA 4HSEA 4D9EA 1TCAA 3OZCA 1E60A 1LNZA 2BBWA 4HLNA 3OJLA 1XRRA 4ZAXA 3UH1A 4H0CA 1W1IA 3BH0A 1M6NA 1WB4A 3AEQB 4NONA 4TYNA 4KK3A 5FNZA 1JHZA 4L57A 5CUQA 2IOHA 3TZHA 2XMRA 1EWTA 1C2YA 2J48A 5MFZA 5DMHA 1E2UA 4H18A 3IKTA 2VEOA 2WUFA 3HE3A 4P3OA 5CHYA 3TZ6A 2G4LA 4MPRA 3IDZA 1D0SA 1VHQA 2C59A 4MWBA 4RX1A 3IQGX 1XZHA 2HA7A 2PFGA 4NU5A 4BJ5A 4DA0A 1VA4A 4PRZA 4UTRA 2J4DA 4WV3A 3MWEB 4E5PA 1FZTA 4IH4A 3UJ8A 1YVEI 3ZJUA 2LR0A 2YWRA 2XH8A 2RHDA 3OQIA 1R18A 1I14A 1TW3A 2GQ0A 3H9JA 4UBNA 5FV4A 3TL6A 1R74A 1FDSA 2GZ2A 2VWPA 1AA6A 2NZJA 1X7XA 5I7HA 3FWZA 4E4YA 3WYBA 1TVCA 1ZD4A 3SAJA 3GLIA 2EJWA 2C04A 5HRCA 2KSQA 1WZ2A 1Q17A 3IUNA 3ZD7A 1TL7C 1YDMA 4I2NA 3AVXA 4XOUA 1R0RE 2RC5A 3AESA 2B8EA 3VZPA 4R1MA 1TYCA 2LV8A 5ALLA 2PGIA 2OD2A 4KAJA 1XTSA 1L4BA 3MB8A 3RU3A 3T06B 3AERA 3F96A 4FEYA 4MUHA 5LD2C 3Q2KA 5JAZA 2YHAA 1G21B 3NEAA 3BPSA 2QRVA 4IOLA 4NYJQ 2Q5EA 4ZQGA 5H59A 2PSDA 3H1PA 2ZAGA 3NVMB 2ZBGA 1Y98A 4EA8A 5LQAA 3N59A 1EP3B 1F12A 2AFRA 4OJMX 1NVVR 4TLDA 1A7JA 4BOYA 1IN1A 3B1XA 3LBNA 2CXHA 1TFRA 2EIXA 2IXEA 2MR6A 3IIEA 3DHWC 1BWPA 1YJ8A 1L5MA 5F3WB 4HAZA 2YQ5A 1A5AB 1LLFA 1ZUHA 13PKA 2XEXA 3DMYA 4GE0A 1F60A 4O0LA 4MVJE 3TINA 4DSOA 5LXTB 2GCPA 5AXCA 3MRTA 3AF2A 3TNFA 1JNXX 4PRYA 4QNMA 2NZYA 4WNAB 5L95A 5K3EA 3IC5A 1U0LA 2MOKA 1B0ZA 3DW1X 3CUTA 2I80A 1MQ9A 2WJVA 4MLPA 4LZZA 4PYLA 1NV8A 2XOEA 4ZCSA 2R60A 4UVDA 3A31A 3IP6A 5EWMA 2GM3A 2O8EB 3VR2A 3RANA 5CFQA 5CDHA 2C2KA 2JGEA 3KLPX 1CRZA 4GKVA 4QBKA 3HK2A 4YUVA 3ZLJA 2NVOA 1VGQA 2B4TO 3C6XA 4JP2A 5H16A 1AIPA 2HSZA 4PYQA 3ILVA 5DEIA 4EHBA 1FTYA 3SX2A 4LV6A 3UENA 2BZ0A 1IK4A 3EVZA 4H16A 2P5TB 1EBUA 2UUCB 1XQ6A 2V7VA 5LJLA 2PR2A 4X8HA 3FM9A 1KTVA 4MARA 2IYLD 3HFSA 1BMDA 2A67A 2HSDA 1UC9A 1GG5A 4GRIA 4MUXA 3TIXB 4DL9A 1DCFA 2XQVA 2DETA 2REOA 3EMDA 3B82A 3IMKA 3KSDO 2UVPB 3BRWD 4C5AA 4QBTA 2VJLA 4CMGA 1TQ6A 1ZH2A 1PIWA 1EDZA 4Z8YA 4CU2A 3M6XA 3IRUA 1U0HC 2IV7A 5LWQA 3INTA 3PWTA 4BO6A 1PG0A 5IBRA 2OZLB 2Q0XA 3IP3A 4M0UA 1BX1A 4ISCA 4EABA 3E1SA 1U1GA 4ZAYA 1TK9A 3VH3A 1MOZA 1MB3A 3EXHB 1Y9EA 3L1JA 4HEHA 5DASA 4YRLA 1Z8DA 5GQSA 2VDWB 2H6EA 3O1HB 4YMUA 1GSOA 4JYAB 3B5EA 1GT6A 3O8NA 4BKRA 1BVRA 1T8UA 3DZJA 3VHXB 1TA0A 3PHHA 1ODJA 5L3QA 3QE9Y 4YR9A 2RJNA 3O21A 3SVTA 3FTCA 1G1MA 1BDBA 3EZ2A 4TS4A 1SK8A 3B1FA 4M1ZA 5EQFA 5BYJA 2OXTA 4IIJA 4DQKA 4MP8A 3JQGA 3FDJA 4MEJA 3SC4A 4OB8A 3WL4A 2EEZA 4O02B 1N5IA 3HV0A 2P6RA 1Z2PX 1MAHA 2NO7A 3HJAA 3A6ZA 3TQHA 3K2EA 4DILA 2GWHA 5DM4A 1ZW6A 2QJTA 2NP7A 1PW7A 4BFTA 1M74A 1EB8A 1QS0B 5B37A 3N39C 3H7IA 2UUBB 4BMDA 2P3LA 5A5DA 5K6RA 1AZTA 3KUXA 1ECPA 2IYNA 4GIBA 3IIMA 2XA9A 4WN3A 1D3AA 2XODA 3IV9A 4YDRA 3FOEC 1A71A 2HJHA 5LBUA 2WUVA 4N0QA 4K28A 5D86A 4MWSA 4WEOA 4BN0A 2F4NA 4CV1A 1AS0A 5BMVA 4UCWA 5B1DA 4TVKA 1JAIA 2FFHA 4LYDA 1UJBA 2GNOA 3M5PA 1F9EA 4Q9LA 4M21A 2W2TA 5C5DA 1TM5E 1L8LA 3EF1A 2JFZA 3MYYA 3KRTA 3TQOA 3U09A 1GP2A 3ENZA 4HLUA 1E4EA 3PQ2A 5SY9A 1XCBA 3DL0A 4RK0A 2GAJA 4YJGA 2FWMX 4ZJZA 1UXIA 3U1VA 2A58A 4BLWA 1K3FA 5JECA 2PE5A 5BSRA 4DLVA 1V3VA 1MO5A 4AWAA 1K6MA 1M2VA 1JE0A 3LPLA 4C6TA 4POAA 5AM2A 5IJ0B 4IKOA 4WJLA 1TFUA 2VYVD 1ACLA 3Q7PA 4I46A 3DXXA 5J47A 4M54A 2XRFA 5G41A 4QELA 3NWPA 3USES 4NABA 4A27A 3I53A 1P9LA 2ZJ2A 3O8QB 1ZISA 4WGGA 3EW7A 2I7TA 4DZRA 1NQWA 1LRLA 3KZKA 2PSJA 3F8TA 4PY2A 4TOIA 4E1BA 3W34A 3BGSA 1KH2A 4JI1B 2AW5A 1OI4A 3QMPA 1E61A 5AJXA 5ICSA 1P4JA 1Y81A 1WHSB 2IYVA 3AGQA 2JEYA 2F1IA 4O0MA 3RBXA 3E27A 1OV4A 1KPHA 2P67A 2Q21A 3KQWA 3DVSX 3GWGA 4MWDA 4B83A 1LLQA 2IUUA 3U3RA 1PBTA 3LYUA 4QAQA 2I6TA 2MCFA 1G8MA 3L6BA 1U1FA 3DVQX 4PAQA 3FVWA 2RGBA 3IQXA 4KVZA 1Y9ZA 1RYMA 2GTPA 2CLKB 4AWBA 2PJDA 4F85A 2A78A 2IDZA 2ZUVA 3NZEA 3ND8A 5CB6A 2I2BA 3FKSA 3RYIA 3SIWA 1JFVA 3U1BA 4TUYA 3KYJB 2QROA 2ZPUA 2ZWOA 3L8CA 1OXVA 4J1NA 1U8XX 4QULA 4RY2A 4ZKEA 5HKOA 2DVMA 3DM9B 3GEBA 4RSGA 1XJCA 2GI4A 5K03A 1VRCA 1EE2A 4QGBA 4P93A 2G1UA 4H3KB 4QOSA 2FP4B 1V6AA 4Z1MA 4JI6B 5ICFA 3HTXA 3IVXA 4HR7A 4IKEA 1Q14A 1R5BA 9LDTA 3AJDA 4CLEA 5EY5B 3CCBA 1DC3A 4QTYA 3AUJB 3HCFA 5GMOA 3U44A 1WABA 1X9GA 4I4TF 1TJ5A 2B9EA 5DWQA 5F78A 5F76A 5B36A 5K3OA 5LOVA 1SQ5A 1L4UA 1JJIA 5D5PA 5B3JC 1DPFA 2XMZA 1PVOA 3WAKA 4UREA 3UATA 3GLFE 3KUCA 1YIDA 4X8MA 2HCTA 3S5UA 2BLLA 2JRLA 4Y0NA 4OH1A 4BLOA 3VV3A 4EG5A 5ICMA 1XMOB 3MWDA 1NRXA 5EZYA 1KY5A 3OT1A 5HBRA 2C2YA 5BY2A 3NUQA 1RLTA 1TVKB 4HRAA 2W83A 1KMNA 5KQPA 3M83A 1T29A 2TS1A 2FR0A 5DLYA 5FI0B 1OCEA 4BVBA 4AWXA 3INNA 2QJOA 3P0IA 1NBAA 2EJCA 2EWMA 3PPXA 3L4KA 2CSXA 2IYPA 2EW2A 4ITVA 5KB3A 3DWEX 1GQOA 3B12A 3BJZA 3PGLA 5JXHA 4BNIA 1RRVA 1CBUA 1XKLA 1CT9A 2C2ZA 4XGNA 3HBLA 1WD5A 5CB0A 4JC4A 4PZLA 2ZBPA 2Z30A 1FMLA 3KZVA 4GGPA 2OHHA 4LDJA 1DSSG 5EJIA 2ZSFA 3OZDA 3C4VA 4A5SA 4HTAA 5C8DA 1JKXA 3I9JA 3FBGA 2HN9A 4QU5A 3MWLA 4US1R 3PFHA 3CRVA 5CBPA 3TJZA 5E7QA 2P41A 5AK3A 2AR7A 4TYQA 4BU1A 4KG7A 5ALHA 3V1LA 2AYZA 2ZIXA 3EJ6A 4IUYA 4K6FA 1JMKC 1YL6A 3MZ0A 1YQDA 3GPIA 2EWVA 3K32A 2CKDA 4TT3D 3R8FA 3LBAA 4FYHA 1RBZA 3EGVA 3PRYA 2Q6OA 1KVQA 1F6DA 1L8OA 4M1YA 3WYEA 1FS5A 3IE2A 4LMRA 2NZXA 2P7HA 2EQ5A 1ZOPA 1EEXB 5FUBA 5MGNA 4IQ0A 3GGDA 4B33A 3KU1A 4JLOA 1L5HA 5B3LA 1G18A 3D3QA 1IZ8A 3BVPA 4U7HA 3W77A 4TZ6A 5LOVB 4BFYA 2JLUA 1Q12A 4EHHA 1VBNA 1S2GA 2PLWA 2FUCA 3I05A 4Z9FA 4C9BA 1ZK1A 1QJCA 3PKJA 3KPWA 2P7IA 4GHWA 1O96B 1A9QA 1C0PA 1T6NA 2PD3A 4EA6A 4F92B 1HGXA 2HCRA 2YW2A 3CNHA 4AMVA 2MSNA 3PUHA 1CJUC 1PS0A 3BGVA 3BULA 3H6GA 1G17A 4JBNA 4NENB 3FB1A 3D2CA 2FN7A 4HAIA 1KIFA 2O6LA 4DDHA 3K9QO 2VBGA 3SZOA 5BUQA 2YY6A 1OI7A 4YIHA 2O2CA 2R97A 1J2JA 2DWOA 3PCTA 1V2HE 4J90A 4ASUA 2QUBA 5K05A 4PFSA 5BW5A 3AONB 1N7JA 3QPUA 2P5SA 1I0IA 2PMKA 5ENVA 2ZXEA 4P84A 1RI3A 4QLBA 1BXRB 4RACA 4RPIA 5KNDA 3FFTA 4YO8A 3B2NA 1M8KA 2O05A 5DHTA 1ZMTA 2O7QA 3GAFA 2R6R1 5CMLA 2QQGA 4YDHB 4UMDA 4YLGA 4QX6A 2PKCA 1LBTA 2C7VA 2J3HA 2IIPA 1F5SA 2HU7A 3VPHA 4EA7A 1USVA 4QRDA 3PTLA 1MRNA 1RT9A 3Q87B 1CETA 3NC1C 1F17A 1ZJYA 1J24A 3V97A 4TPKA 4KXQA 4EGJA 2ASEA 4W5HA 2HSWA 3VPGA 4ENQA 4OSOA 2Y71A 4A5OA 1WJGA 4J0IA 2OV2A 1IXYA 3TLMA 3V8EA 3K73O 1L5LA 1VJRA 3Q88A 4B3GA 1QHHA 3LP6A 5DX1A 2YMLA 4KZKA 4KQKA 5AI4A 1ZUD1 4GBGA 1UMBA 4YJ3A 3UG6A 1OB5A 3VXKA 4JGBA 2D3TA 2I62A 2NTYC 4HH3C 1UMCB 2ZIEA 1TA9A 1P7YA 2RB5A 5SZIA 2NUPA 3WBKA 2ZDHA 4S12A 1S4QA 5DNEA 2X0FA 3K6SA 2VRWA 1P73A 3G2LA 2GEDA 4MUFA 4ES6A 5U4QA 3NCTA 3BMCA 3HY4A 3AINA 3BHIA 2W43A 1DE0A 2VS1A 3HZHA 4LW8A 4YRZA 3QLUC 4XZ3A 3ND7A 4JOSA 3QI2A 4S1WA 3RYCA 3AVWA 5ALTA 4O4LA 3B38A 3P9CA 4QU8A 1NDHA 3FYSA 4BZPA 5JC8A 1O9BA 1XRPA 1GRQA 1UBKS 1BQEA 4PLPA 5JMTA 1W5EA 1CF2O 1RE1A 1CW2B 3EYAA 2COEA 3JQAB 3C7AA 4B4UA 4EH1A 4YLYA 3GDOA 5LP6C 3OSUA 1ISMA 3A27A 1MIOA 3H2HA 3ETDA 4CMEA 4E94A 2HQSA 4XVCA 3I1FA 2HL6A 5EIXA 2ZE5A 2A94A 4K1LA 1KJWA 1Z63A 2VP3A 1DXHA 4RAQA 3TD2A 2XOKA 5J2UA 3UAXA 3EUAA 2ZT6A 1FYEA 2VWHA 2Q28A 3JWEA 3M81A 3HB0A 3RVQA 1V8ZA 2A88A 2QR3A 1UIRA 4IDPA 5AM5A 3A3OA 4MUEA 2OKGA 4O4IA 2FHPA 4EJSB 2I4IA 4V0QA 2ORED 3PGVA 2HLPA 2NVUA 2VDOB 2ZYSA 1WVMA 2PIAA 3FRHA 5EQTA 4DT1A 1SNYA 2Z83A 3G23A 1O94C 2DPYA 2IOQA 3I2HA 2FW0A 3ILHA 1W0KA 4G1BA 4J4BA 4YJFB 4YECA 5EWLA 5CURA 4DJEC 2HW8A 3AR7A 3KELA 1SHLA 3L1VA 1TJYA 3HDYA 2JL1A 3NNSA 4GGOA 4DCMA 2GDJA 1PFKA 3ZWYA 2ZYVX 3LC1O 3CLSD 4IUCS 5HVNA 3V80A 5LLSA 3GLIE 1IFXA 3K0CA 3CHYA 3LW7A 4ZZIA 1VBMA 3N58A 4BQFA 3RODA 4ZICA 3WHPA 1CG6A 4YY3B 1D04A 4LGVA 4IX9A 2R8PA 3DFZA 1D5WA 1R0WA 5JH7B 3WMGA 2JGKA 221PA 2FW6A 2FMXA 3LG2A 1N9GB 4LGCA 4NK4A 4WCFC 2H16A 1FNCA 2P8SA 4O33A 4RVGA 5EEGA 4ZALA 2Y9PB 1J6UA 1J8DA 1HG1A 3V1TC 2XLCA 5JNWA 3O0TA 3OJWA 1YR1A 1QG4A 3O1LA 5AW9A 2O5CA 2GBCA 2XZPA 2DE0X 4LF5B 1I5OA 2Z4TA 2ZJ0A 3W5SA 4NMXB 4ZA2A 1B2LA 5HJ2A 4I3GA 4C2AA 2ZP1A 4X1KA 1TPZA 1CP3A 1GQFA 1B0PA 2IU0A 2RHTA 2QM8A 1NOJA 1TM1E 1UAYA 4L9SA 3PR3A 5E95A 4FFSA 2W6QA 3TRFA 5EA2A 3ZGLA 2VHVA 5CTAA 1KI9A 2A9FA 1RXVA 3VSAA 2BFAA 4J75A 4HT3B 2KM1A 3KTFA 2BRUC 2EZUA 4OXQA 1N2JA 2O1XA 1Z0ZA 4KX3A 1ZK2A 1RJGA 3UA3A 2XZOA 3WQRA 4EMSA 2QTRA 3A9VA 3VI3B 4PE5B 1WP9A 4Y9DA 3CZMA 2IPMA 2XKJE 3CEMA 2BEVB 4G97A 3DZFA 1QP4A 2Y8EA 1ZBQA 4N5NA 4CR8A 2HADA 1IOWA 4LXUA 3DCJA 4BL5A 4TLEA 1B1CA 1JHPA 5HF5A 2QD1A 2V4UA 4S35A 3TRHA 1UJ6A 4XSVA 1LPMA 2WPDD 4B74A 1J7JA 2PLNA 4H15A 5I7UA 1Q0SA 2HEIA 4IOMA 5F35A 1U2TA 5EXEA 3A3YA 3CN9A 3RS9A 3T9BA 2PA3A 2XQFA 4CPDA 2C7PA 4KL8S 4MQFB 1YRAA 2WHRA 3DE1X 4MV5A 4DMKA 4EDHA 5GTDA 3UB2A 2VUIB 3R5JA 2X22A 4GM4A 4LA4A 4YUWA 2UAGA 2R8BA 2W2LA 3B1WA 2JFOA 2ZEJA 4REQB 3S2UA 4E6EA 4UAGA 5J2TA 3ADBA 3IE1A 4GQIA 3M3HA 3UHPA 4BNXA 1FDVA 2FSGA 4PHFA 5EIOA 2CXSA 4UBIA 2WM8A 3ITEA 1G0NA 2PFSA 3ASZA 4U3JB 3RIGA 4EW2A 2QNIA 2J7KA 3E22A 3V2HA 3HP1A 4DIMA 2KE5A 1PE0A 2A30A 1QTQA 3S2SA 2VNSA 4ZOLB 2RBKA 4BEJA 5CEJA 3V32A 4N5MA 4FINA 3JRNA 4IDDA 3TMAA 1CQPA 5TF4A 4OLBA 2QKYA 1FUKA 1ZKMA 2O14A 1JQDA 2AB0A 3LT4A 2MSLA 3E9RA 5BNWA 5MN5A 2D3WA 2QSZA 3LE8A 1AQJA 2VPZA 3IOMA 1FLAA 4IIYA 1V3TA 5DWVA 2IY8A 5DNUA 5EIEA 5KBYA 3K4HA 2I6FA 3QM1A 3WGJA 3IP8A 5FEMA 1RMQA 2J9GA 4OL0A 3WA7A 2LXNA 4BEBA 5IKXA 5REQA 3L04A 3TXAA 3KR1A 3W5AA 6ADHA 1RZUA 2PWYA 4J6EA 3DZHA 2WVJA 1IY8A 2ECQA 3AOEC 1MA0A 4WKGA 4WFJA 2I9PA 5LU9A 3G82C 4LBVA 3GDFA 4GI5A 1L7BA 1DHRA 4MO9A 1WPXA 4PZPA 1XVVA 3N2ZB 5B53A 2Y0CA 1UANA 2NUTB 3O4VA 2WIGA 5B2FA 1A69A 1AU9A 4BLVA 2DKOA 1RXSA 1OMOA 3K09A 3B3AA 3KQSA 4XKJA 4CNQA 2NO9A 4EYKA 2HJVA 5A1TA 3W5CA 1Q2UA 1RC0A 3GPDG 3LUGA 3V4PB 1JDBC 1T4CB 4B09A 2HZBA 3S3TA 2Q27A 3GT3A 1VP9A 5AHOA 3DTVD 3LH5A 1VPEA 1XZPA 4BZWA 3ROQA 2PG3A 5DRYA 4IILA 3UT0A 5AXDA 5MFPA 5C8VA 2R4QA 3P9IA 2A7QA 2YYZA 1JJFA 3E7FA 2ZULA 3F3YA 2FW1A 1F2TA 3ZHOA 1V6CA 1ONSA 1Z2OX 2OPHA 4KO2S 2OG2A 1QVZA 4ZANA 1DC5A 1MB2A 4ZYZA 4FGSA 1LNQA 3I2GA 3MFYA 3D7NA 3VO9A 1NI5A 4MEBA 1WMBA 4UMVA 2FMKA 4B7XA 4N3BA 4FT2A 3V9PA 3VRHA 2O2IA 4XARA 2ATVA 3RVJA 4HPXB 5HDBB 2W6JA 4U2GA 4BP8A 1M1NB 3EVTA 1M2GA