3QKSB

Mre11 rad50 binding domain bound to rad50
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
AEKENRERVKKEIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA double-strand break repair rad50 ATPase
publication title ABC ATPase signature helices in Rad50 link nucleotide state to Mre11 interface for DNA repair.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication
total genus 60
structure length 179
sequence length 179
ec nomenclature ec 3.6.-.-:
pdb deposition date 2011-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qksB01
4ACAA 1AS3A 3EZ9A 4BUJA 1U90A 5DHFA 2NZ8A 4C9BA 4WBSA 3FFBA 1E1QA 4Q9IA 1CR4A 3W34A 1FUUA 1W2GA 5FTKA 2J7PA 1IAQA 4WXPA 3BFVA 4OHZA 3SU8A 2JLUA 5FTNA 3QVUA 2H16A 2ZYVX 3MD0A 3QNUA 3WNDA 1GM5A 3MGCA 5IT5A 5C18A 4DCUA 1SVMA 1KIMA 1VYTA 5FOUA 3NIBA 5JZVA 2WOJA 2DFKB 4HZUA 3UMFA 2JCSA 4XTRA 2FSHA 1U99A 3NKVA 4TQAA 3WHLA 5F3WB 5KYKA 5JSZB 2CL7X 2A7QA 3FKSA 4AG5A 2IW3A 2JJ2A 2VH5R 3CRQA 5DH9A 4YQFA 1CBUA 1SULA 4HATA 3BB3A 1TUIA 1P6XA 2FX3A 3TVDA 1BKDR 4RZ2A 1VCOA 4QBGB 2ODNA 3X2SA 2O8CB 2DFTA 3AF0A 1RVDA 2FMXA 1W2HA 3VU9A 4C0LA 1DE0A 1BYUA 3OEHD 4UNQA 4JS0A 1J8YF 1NSFA 4Y0AA 5LBIA 2CLCX 2LKDA 1KSFX 4OL0A 4OI0A 1DPFA 1SVSA 3F5FA 3WMFA 1G3IA 4UJ5A 3IQWA 1DG1G 5J4KA 1ZM4A 2MSDB 2N1BA 5CK4A 5FTJA 3TBKA 2ZYWX 4TL8A 1Q3HA 3CRVA 2ONJA 2D4HA 4PFSA 2I4IA 3U61B 2JIZD 2IK8A 4U5XA 3TUIC 4HSEA 3TGPA 2VP6A 3BXZA 4NYMR 1Q21A 4FMCB 2WOOA 1VMAA 2EVWX 4LHVA 5DI3A 3DZDA 1HE8B 4Q03A 2ZXUA 1KDRA 2JASA 2OV2A 3L0IB 4HZUB 3TW8B 1NBMA 4AC9A 1TF5A 4O3MA 4IEEA 5IF9A 3LBHA 5JCZA 2WPDA 1M6NA 1XCGB 2ZRHA 4CYMA 3QG1A 4B35A 3IHLA 5TV2A 1E2PA 1IONA 4QGFA 2IS2A 1NVVQ 1N3BA 2AHOA 1ZJ6A 3AUYA 3OAAA 2GESA 5CITA 4PO9A 3CLVA 4U00A 4DKXA 1W0KA 3CONA 3LA6A 4QG7A 1ZNXA 3VU9B 4W5WA 1Z3IX 3ADDA 1G17A 2ZAOA 4I81A 4EJSA 3QY0A 4MKFA 3SZRA 1E94E 4NMMA 1HY3A 5SZJA 1NLZA 2FGKA 2REBA 2JATA 3TRFA 5GJVC 4YMTA 3RC8A 1E2IA 1U8ZA 1DAIA 3W6NA 5SZHB 4E09A 3P1JA 4LWZA 1E79A 3AKDA 3NBFA 3CZQA 2QPOA 1N5IA 3TUZC 2CHQA 3TIFA 5TY0A 2EFGA 5LB2A 4KLZA 2ZRLA 4MQBA 2RGNC 4ZDIA 1H8HD 4IFBA 2ZM5A 4KAXA 2XJ9A 2XAUA 1KO5A 3I5XA 5HCNA 2H57A 5DI3B 2ODEA 3K9NA 1E0SA 2NO1A 4DHEA 5KNCA 4D4JA 2RAPA 4A36A 2R2AA 1KK1A 2QENA 3OIWA 5HZHA 3NXSA 4ZCLA 2VP4A 2KE5A 3FGNA 3T5DA 1G8PA 5J5CA 4DB4A 5EP3A 5CJPA 3FDIA 4M1YA 5JS7A 4AIIA 2WTUA 621PA 1N5KA 4Q7LA 1F3OA 1ESNA 2J0UB 4NL4H 2YV5A 1QF9A 2H7VA 3EIHA 1W36B 1YHNA 2XOKD 3OF5A 4P32A 4PAMA 4XTCS 1JQLB 1G41A 1XZQA 3WP1B 2IYXA 2MMGA 4MUBA 4XOIA 1N5LA 4F92B 4EJSB 4LJ8A 4PPNA 3EPKA 2W2TA 4DLUA 2HYDA 1OF1A 2H5EA 1G5PA 3CPEA 2ZJZA 2OSBA 1FTNA 2WHXA 1EWRA 1ZIPA 2ZE5A 4A0GA 2GF9A 2ECKA 2H8KA 5EZ6B 4MRPA 1XEFA 2EW1A 4Z54A 2AXPA 3U60B 2OCAA 4PHTA 5E7IA 4IXNA 2B7CA 1XEXA 4LI0A 1E2FA 2VRWA 4QFMA 4RD4A 5C46F 1XD2A 3A1UA 3UXMA 4BEBA 4Q7KA 4EKDA 5JEEA 3EA5A 2FSGA 4MGZR 2I3BA 1AGRA 3I32A 2VQSA 4DWJA 3DPUA 1KJWA 3VX4A 4DIDA 4KBFA 1XJCA 1AS2A 2HCBA 1T5LA 1B0UA 1VIAA 4HI0E 3QOFA 4Q9HA 2FWRA 3MRSA 1KAOA 2ZI6A 4PZYA 5LB4A 2IYWA 5KPDA 5FR1A 1N2CE 2IS1A 2P6RA 2F3TA 5H70A 1ANKA 4P3YA 3I1FA 4R7ZA 4RKFA 3M6AA 3WY9A 4UJ3A 1UBGA 2TMKA 4A1FA 2QRZA 4MYTA 3SJAA 1ETUA 3X1WA 2IL1A 3OFNA 2RGXA 2NTYC 1DTSA 3GLFE 1GTVA 4FWTA 1BYIA 5LDDC 1YQTA 1T8TA 2A5DA 2AKAB 1US8A 3M1IA 4Q4LA 2VSOA 4WW0A 3QBVA 1KY3A 3QI2A 4M22A 1A5TA 3AKCA 2R62A 2OCBA 2YOFA 3I72A 4HB2A 1CJUC 4XWKA 3D7MA 4DLSA 3A37A 3U7EB 4TMWA 2E87A 5CJ2A 2OXCA 2FDCA 1GITA 3NEJA 2F1IA 4GL2A 2B8TA 3EWSA 2J3EA 2A9KA 221PA 2GCNA 4TLCA 5AR1A 1XEXB 4JVNA 4TT3D 1EFUA 1XD2B 2QP4A 2IWHA 3U44A 4D4LA 3MLEA 4FCWA 1YZKA 4I1UA 3HPQA 3HWSA 3FTQA 2XZLA 5JWHA 5AJXA 1E9CA 4LC0A 1NVUQ 1X8KA 1Z07A 3IEUA 5FR2A 3PG5A 3U5ZB 2CL0X 3RVBA 4XSHA 1DS6A 2ANCA 2CBZA 2QI9C 2GKSA 4EQ6A 3WRYC 1SHZA 5FBRB 1QHXA 3LBIA 3P27A 5A5GA 1FMLA 4WIAA 1HQCA 4MITA 4C0BA 1EX6A 1F48A 1US8B 3NBZC 3KJEA 5F9FA 3AVVA 5EP1A 2VTKA 2IBMA 3CO5A 1ZC3A 1N6OA 3ND9A 1M2OB 721PA 2HCJB 4ESHA 1JJ7A 1FTSA 4X8HA 1HT1E 4IKEA 1FQJA 2O0KA 2WAXA 3DOEA 2W00A 1Z83A 1KO1A 1D2EA 2BOVA 1GKUB 4Q9JA 1QDEA 1JECA 3BD9A 1NVWQ 1XTSA 3T1TA 3RABA 1NF3A 3BERA 4PPFA 3T12A 3VR3A 3U44B 1W7AA 5ELXA 4ON9A 5B64A 4Q1DA 3TSZA 1KO8A 3C5HA 1FPMA 4HUQB 1SXJE 1TPZA 3MG9A 3IPYA 4BZPA 3H2YA 1IM2A 2EWVA 2F1HA 3C8UA 1S9HA 5EE0A 4NZYA 5AJZA 2C95A 1VG9B 4C0QC 2VBCA 5AUNB 3GLHE 3T35A 1KI1A 1O3YA 4EQ6B 5G3YA 1T3HA 1P2UA 1G64A 3R20A 3PUWA 4BZQA 1PJRA 2GZAA 3MWLA 4LPKA 4Q00A 1H8EA 4V0MA 4BFUA 5BN4A 1N6PA 1R10A 1ZBDA 4M21A 4FXPA 2ZSBA 3ZQJA 1TF7A 1KZGB 1MT0A 4M1KA 5D3MA 2ZRDA 1M74A 1COWD 3IHWA 4WXRA 5C1BA 4RFSA 2J0QA 5JHGB 3A4LA 4ASUA 1Q12A 2WMNB 2WV9A 3RS7A 3VR5A 3FMPB 5JFGA 2IUUA 2WSSD 4M1OA 4IOMA 5H1YA 1W4CA 4Q4JA 1ZUNB 5KPJA 2XB4A 4CEHA 3DM9B 2BMJA 3FE2A 3BAFA 2A3RA 4DJTA 3IUYA 1OIXA 4MRVA 2IHBA 4MKIA 4MYHA 5EE9A 4CT4B 3ZDQA 4E07A 4JYCA 1DOAA 2XTNA 3E1SA 1G7CA 3QKUA 5B58C 5F98A 3JZMA 1YU9A 5BYKA 2DCUA 3PEVA 4OI1A 3ADKA 4L15A 4RZXA 5DN6A 4BLOA 2RCNA 4B76A 1LS6A 1S3SA 2PX0A 3FYHA 1Z0IA 3LLUA 4QM7A 1HEIA 2NQ2C 1OIVA 2XB2A 2A5FA 4MKGA 2V9PA 5DGXA 4FW9A 4BZXA 2PZEA 1ZNYA 3THXA 4KFSA 4AWXA 1U9IA 1S0UA 4HAUA 1P4SA 5K8LA 4LHYA 3CR7A 3PCRB 3CF0A 3MCAA 3FMIA 4POAA 5H8WA 3BBPA 4PQRA 2WJYA 3CBQA 2QZ4A 4JZKA 1MH1A 4LSGA 5JJIA 5D3MB 3IKJA 4B44A 2CE7A 4RFSB 3LW7A 5E4FA 2OFOA 3THYA 2V4ZA 3K0FB 4JSYA 1QVRA 4Z8XA 2CL6X 4E5UA 2O8FA 2YNMA 2KBEA 1YZTA 2HT1A 4V0KA 2QORA 1P9WA 4Q4JB 4B6FA 2A5GA 5FL7A 4GNKA 4CEHB 1PLJA 2VO1A 4ILEA 4G01B 3A8TA 1AZTA 4M1WA 2CCGA 3NHBA 2ZE7A 1GKIA 4F4JA 3OEED 1K5DA 3I62A 3ZQ6A 4MH0R 4CDGA 4XD7D 2WBLC 2IYTA 4MGIR 4Y0VA 1Z06A 4HB0A 4A82A 1M8PA 4LUCA 1RKBA 5DNYB 2OBNA 3ONWA 4DLTA 5ANRB 2V7QA 1AGPA 2G1KA 2CVFA 2C98A 2WWHA 4HAZA 4KO8A 1RW4A 1UKVY 2BC9A 1EGAA 3BGWA 1KI7A 3Q7QA 5BXQC 2OILA 1W0JA 5FOTA 1XTIA 3TR5A 3THXB 4LHXA 3CH5A 1GG2A 1X3SA 3QUSA 1OKKD 2J7KA 4PPQA 2LKCA 2EU8A 2ZI5A 1KSGA 2FSFA 3H0KA 3MMPA 3TLXA 3PUVA 4OK3A 3EPLA 3CB4A 1OW3B 2WWIA 3K09C 3UK6A 2V1XA 2YOHA 2X19A 2J0VA 3N5CA 3THYB 3DHWC 5DSZA 3SJBA 4MUAA 2ZU6A 3AF4A 3IIJA 4JMPA 4ZI2A 2CK3A 4IVRA 4V02A 4C0KA 2O8FB 3T1VA 1II0A 4B33A 3TUJC 4ZDJA 4ZCIA 4X8OA 3CIOA 2QRNA 4AKEA 4P33A 4B75A 1TQ6A 5F9HA 5TXGA 1S8FA 1COWA 1NVVR 1LF0A 3QKTA 3KXKA 3TMKA 3K09A 5TARA 3PITA 1GP2A 3RC3A 2R8RA 4B71A 3K70B 2X77A 4KFUA 1Z0AA 2GVDC 1NG9A 3ZS8A 4G5SA 1GKYA 3A36A 2JLZA 4Q48A 4P4SA 2ZS9A 3PVSA 3LW8A 1NY6A 1Z0JA 4QBIA 2YWFA 2ZS8A 5KDLA 3AP2A 4OHVA 5J40A 4JT4A 1YR9A 1I2DA 3QPWA 4ZKEA 4LZZA 1E2LA 2H92A 4C30A 1P9RA 1ZM3A 1W48A 1YZNA 4D4MA 1OXTA 2QQ0A 4LY6A 1E6CA 2RGEA 3SQXA 4GMXA 3U7FB 1EESA 2NO0A 2IXEA 2JLSA 2ZSDA 1GNRA 3AV0B 3X1ZA 2RMKA 2GEDA 1SXJD 3FMFA 1OHHA 4IDPA 4QHYA 1MRSA 1Q57A 4EPRA 3PEUA 4RZ3A 2FF7A 1K8RA 2PLFA 3LD9A 2BIFA 3P26A 1TMKA 1XJ0A 2W83A 4E22A 1JEDA 2JDIA 1XD9A 1KK3A 3GLGA 5TDHA 4EIWA 1JI0A 3OESA 3T34A 4IFEA 3VHLB 2ZS7A 4GP6A 1EWQA 2CCJA 1N6LA 2V1UA 1OXSC 3B2EA 4IXMA 1G5TA 1TNDA 3SFVA 1XXHA 2DWPA 3LV8A 1LV7A 4LOAA 3HP1A 2V55B 3KXLA 1D8TA 1DEKA 1KI6A 4TLBA 5GVRA 1IHUA 2X8AA 4W7SA 4Z1MA 4AYWA 2CJWA 4MRSA 2G0NA 5DISB 2RKOA 1Q3TA 3QKRA 1NI3A 2XZOA 4L5BA 4R9UC 3GLIB 4A6XA 2WSMA 4P4SB 3PUZA 2GK7A 1P61B 1UEIA 1Z8FA 3NG1A 5HCIA 1OFUX 2Z83A 1KI9A 1CLUA 2IC5A 2HXSA 2WAYA 4BRUA 5B57C 3O8DA 1Q1QA 4K8OA 4Q1FA 4QJ3A 1Z08A 5CYPA 3U3RA 3V4RA 3CRW1 3HR7A 4TTPA 2EQBA 1RRFA 2EYUA 3AP1A 3F3YA 1I2MA 2PCLA 1F2UA 4EPXA 5JCPA 5IK2D 2QMUA 2HYIC 1DELA 3SN6A 1QHYA 4G3XA 1F2TA 3CNLA 4KYUA 4M9SA 1SGWA 1E99A 1D5CA 3U7GA 4HB3A 1OH8A 1Y63A 4M1MA 1E9DA 1M7GA 1GDDA 3RRMA 2QPTA 3WNBA 3ZIAA 1P2VA 1WB9A 1AKEA 3GLGB 2PX3A 2W58A 1GSIA 2OEPA 4ZO4A 4PSKA 1SVLA 2ZJAA 3KDSE 2GETA 1VECA 1G7TA 1ZP6A 4LV6A 1AQUA 3RRNA 2QA5A 2IXGA 5IHPA 1XXHB 3M4YA 5HE8A 4DEXA 1LVGA 1Z6YA 4B48A 1BOFA 3E5HA 3CRRA 4F93B 4PC7A 5KOYA 1VYVA 1MO6A 3O8RA 1KI6B 1XTJA 4XSGA 4GDFA 4JL5A 2CNWA 2C5LA 4GZMA 4XWOA 2JLQA 2P0EA 3N2IA 2BBWA 4PO1A 1GRQA 2ZROA 2QTFA 1G8HA 3QKRB 4ITRC 4RCZA 2QP9X 2O8BA 2ZI9A 2QAGA 2IS4A 4OJKA 1R0ZA 4BWYA 2D62A 1T9HA 2FU5C 2QT1A 4OHXA 5BYJA 3P4YA 2ZRFA 2QT0A 3QPVA 2YZ2A 1XDBA 3GFTA 4DBLC 4JLJA 1Y3AA 2C04A 4H9GA 4HDOB 4LHZA 1F2UB 1SXJC 2D7CA 4KI0A 5G40A 5L3VA 2XXAA 4GP7A 5G53C 2QM7A 3OZXA 2BMEA 5FI0B 1LFDB 3H1TA 2OM2A 1OFTA 2ANBA 1F2TB 2LWIA 2ZITA 1VG1A 2WMOB 1HT2E 1ZMXA 3U2QA 4Z8YA 1DAEA 1T4GA 5FPYA 1E2QA 3MWJA 2EFDB 1BMFD 2VSXA 3D31A 3ADBA 1NL3A 1P73A 3KQLA 3I61A 4OYHA 3Q7PA 4DCSA 1AK2A 2P5SA 2PBRA 3IGFA 4A9AA 5KTYA 1XTKA 1E9SA 1X1SA 3R9XA 3GPLA 1KMQA 2ZUDA 2BMFA 3BJIC 3CUEF 4B47A 2F6RA 3B85A 1O87A 2ZI3A 3TAHA 4JBYA 2JJ1A 2IYRA 3SE0A 1CRPA 3PQCA 4QL3A 2W6IA 4JVLA 3TW4A 1E2HA 3LO5A 4FMDF 1LW7A 5CIWA 2N46A 1ZD1A 4P4TA 4GMDA 4TSFA 2XGJA 4Q19A 2ERYA 3VR4A 2VHJA 2YYZA 1G20E 3QVVA 2F1JA 5AJYA 3W5IA 2O8BB 2HT6A 4G5QA 2WWFA 2QAGB 3SJCA 4L16A 3DKVA 4DB2A 1JNYA 3FHCB 3QEOA 4URYR 2OHFA 2BMDA 4KJZA 4D0NA 3AVWA 3AQ4A 1V5WA 2GRJA 2GEVA 1KK2A 4OQMA 3U4QA 1U8AA 2Q0HA 4RZUA 2XXAB 1JR3D 1GRRA 2A5YB 1W4AA 1ZD8A 4CEIA 4P31A 3VFDA 4MRRA 3RANA 3SI7A 5CB8A 4PSVA 2OESA 4Q1BA 5FH9A 1NJFA 3BB1A 4QBHA 5AUPB 3KJIA 4QBFA 3W6PA 2J0UA 1XX6A 1C9KA 3ICQB 4BFTA 2QNRA 2BCJQ 4ZIRA 4AKGA 4PXAA 3CH4B 4Q18A 4GBMA 1DADA 2DWOA 5IK2A 2H18A 3FPAA 3FHOA 4HAVA 5FUVA 4NTZA 3U3KA 1XZPA 4TLAA 4D0LB 3RSOA 3QE0A 4WZBE 4DSNA 4KFTA 4HAYA 4YDHB 1IN4A 5JRZA 3SQWA 1RZ3A 1XCMA 1QVAA 5HR5A 1SKYB 1YRAA 2ATXA 2ZSEA 1BS1A 3IO3A 1KDTA 2QE7D 1G8GA 3LFUA 3H4MA 3SBDA 5EP2A 4URXR 4YC7A 1GILA 2J9RA 3BFXA 3QJYA 1P62B 3UMRA 1D9XA 1RE0A 3VMFA 3B9QA 1E1RA 4PAQA 2WJHA 4Q1CA 1Q44A 1MRNA 2G9NA 1KNXA 1HURA 1TEXA 2GJ9A 5TMPA 4XH9B 5E7JA 4RD0A 4M9QA 1FP6A 5KO2A 1WRBA 4KVAA 2CHVA 1QG2A 4KODA 4AKHA 2YWEA 1CJKC 1ZIOA 3LRPA 4A0FA 3U4QB 4PZLA 4HDCA 4QGAA 4BFYA 4BFWA 5JMTA 2WJVA 2RGNA 2JLXA 2DB3A 1G7RA 1W4RA 1MOZA 1XU4A 2QQEA 4CEIB 2DWQA 1G291 1R0YA 4V0NA 1DBSA 1VCNA 1UBFA 3LLMA 1II8A 1XB2A 1AKYA 1TQ4A 5C4GB 5JLJA 2ZRKA 1RRPA 3FFAA 4IJMA 1J70A 1A82A 4ZIRB 4C2UA 2VLIA 4B2PA 3BRWD 1QHHA 4PC1A 3GJ6A 1RPZA 4DVGA 2ZR7A 2HLDD 5CDFA 2WIBA 4QNMA 2QPAA 2QL6A 4PC3A 3MFYA 4RCYA 3MWKA 3BH6A 2XTMA 3LDAA 3PV0A 4RFVA 4TL9A 1NG1A 3ZH9B 3D6TB 1EFRD 1VHTA 2BEJA 1SVIA 3IIKA 1S3GA 4Z51A 4MKHA 1DO2A 2JA1A 4HYYA 3OEHA 4KV9A 3R9IA 4DSTA 4UNPA 3GJXC 5FBLB 1UKZA 3PEYA 1RJ9A 4DT1A 4QKQA 3M0EA 4NYIQ 3WNCA 2FEOA 5KSYA 5LD2C 3CX7A 1JAHA 3HPRA 2I1VB 4LC1A 2ATVA 3ASZA 4B3GA 3EPJA 1Q0UA 2N42A 4JT2A 4G0NA 3REGA 2KJQA 4V03A 4ZDWA 2RGDA 2R9VA 2QSYA 2ZJ5A 1S1MA 4LJ6A 2JIZA 1M1YE 4A2WA 3B13B 4YDSA 1KZ7B 1HYQA 3DKPA 3EIEA 2B8WA 1ONBA 3PEWA 1FMJA 3B5JA 1II8B 3R8FA 2H1LA 5K8IA 4S2EA 1P9NA 3RRYA 5EZ5A 3I4LA 2O8DB 2NMVA 1QHHB 4LYFA 1KDOA 1E98A 1NKSA 4C7OB 1JR3A 4CEJA 3GQBA 2J45A 2NZJA 3L0PA 2YINC 3KXIA 4KSCA 1DAHA 1QHGA 1CU1A 1JPNA 3TQCA 1ZM7A 2CEAA 3C41J 2CVHA 5IDVA 4MDEA 2RH5A 3GP8A 1WQ1R 4BLRA 4LYJA 2IA5A 1P72A 1W4BA 3KL4A 2Q3HA 3L8YA 4B3DA 4EPWA 4DRZA 3C14C 2ORWA 3UIEA 1ZAKA 5AUQA 3I5YA 3OE7D 1E0JA 2YC2C 2ZRIA 3BH0A 2AWOA 4UNRA 3U6BA 2PEZA 4KXFB 4R71A 1RJ9B 1G4UR 4IVPA 4DT1B 1CJMA 2IYYA 4PQFA 2X1VA 4NDZA 3THOA 5KNBA 3KKPA 4Q7MB 4Q5IA 4TLDA 1WA5A 1NN5A 2EWWA 3K8YA 4JVMA 3ASYA 2IUSA 4JIMA 3NWJA 3W9YA 3NDPA 1Z63A 3C15C 5CK5A 2ZANA 3BC1A 4C0SA 2J59A 1H8HA 5BWMA 3GFOA 5H68A 1LB1B 4JLMA 4D0GA 2VP9A 3AVOA 4HUQA 2PZGA 3IPXA 3Q5DA 1E2DA 1NSTA 2BHRA 5JJLA 4WA7A 2Q9BA 3NEYA 4GFDA 4A0HA 2A5JA 1PV4A 4KCGA 2F9LA 2ERXA 5JECA 2OBMA 3H86A 3NC1C 1U8YA 3WYFA 5JHHB 2PJRA 1F5NA 4CEJB 5CLLA 3ZGXA 4Q1EA 3LQQA 1UKYA 3I3SR 4LJ9A 4RD3A 4AKIA 4GOJA 3T1QA 3DOFA 1ZUIA 4AYXA 4NPHA 4FMCF 1Z0FA 4M0LA 2C99A 4Q7JB 3W90A 2HUPA 1J8MF 3CF2A 1TL7C 2VSFA 1UFQA 1NIJA 2XOKA 1W5TA 5EXTA 3K0SA 3L2OB 2IYZA 3CZPA 1N6NA 3QENA 4GT1A 3BB4A 4L9WA 3VR6A 4DLYA 5FBWB 2J41A 1YZLA 3HU2A 4DUGD 5J4LA 1VKJA 1T3LA 3REFA 3VTKA 1OB5A 3LQRA 1EFRA 1FNNA 5D3QA 3KUCA 4TL7A 2CHGA 4U7DA 2IYSA 1G3QA 1I4TD 4DLRA 4F7WA 1W46A 2RHMA 2MSCB 5IRCD 1Q1BA 3ICEA 1PVOA 4DDWA 1FNMA 2ZSAA 3FB4A 1TQDA 4URWR 2ZJ2A 2C96A 2REOA 3VKWA 5J4YA 1SVWA 4IOLA 1A7JA 4PAOA 3CKLA 3KQKA 5EE5B 4FCTA 1OB2A 2ZJYA 2PCJA 2OLJA 1OYYA 2XITA 4FINA 3ZYCA 1M7BA 1NMYA 5KUTA 1G6HA 2WKRA 4I1SA 4QC2A 4PZZA 1D2NA 3UANA 5GADl 2VP5A 2FN4A 1JR6A 4TTQA 3AF1A 4LBZA 1QZXA 3QKSA 3KJGA 4R2IA 2P3SA 1OT3A 1P60A 1CEEA 3JVVA 2W0SA 5JS8A 1XMJA 4B74A 3IO5A 1BO6A 4DCNA 2MMCA 3EC1A 3HDTA 1CULC 4ZDKA 1M7HA 3U3OA 5KDOA 5FPHA 1DAFA 2GBLC 4BQSA 3ZVNA 2GJKA 5FBVB 1N6KA 2XZPA 5EUMA 3ADCA 2QROA 1T6NA 4WZAE 1Z22A 1KHTA 3K0FA 1E69A 4KBGA 3WYAA 1UKEA 5HKKD 2G77B 2QUZA 2UZIR 5BN5A 1OH6A 4AY2A 2CLDX 3ZLJA 5JBQA 2VHUA 2GJSA 1MO4A 1WBDA 2YHSA 3O8CA 4TLEA 2OXRA 4B3XA 3RWOA 5FPKA 2O8EA 3OE7A 3EX7C 1SQ5A 4QNRA 1AJEA 2A30A 2Z5FA 1YR6A 4JBWA 3HR8A 4Q66C 3AVUA 2ZE6A 3VX3A 3NC0C 3WMEA 2VHQA 1E9FA 1G6OA 4HEJA 4N1AA 2D7DA 4TT3A 1QRAA 1X8JA 2PJZA 3RS4A 1E4YA 2GCOA 1NBME 3TAUA 3QKSB 4O2LA 1D2MA 4TTRA 4A4DA 2F1RA 3A1SA 4ARZA 3ZD7A 2VF7A 3SDZA 1J7KA 2XJ4A 2UVQA 3I8XA 4HLDA 5AWFC 2FH5B 2QY9A 3SHWA 3AVYA 1L2TA 2GZHA 4N0EA 3TH5A 2ORIA 2ZUBA 3EZ6A 3IQXA 3KTAA 2NO9A 1AIPA 1ZU5A 2ZJOA 3DM5A 4J0QA 1R4AA 1FZQA 3AUXA 2BCGY 4NH0A 4BGDA 5P21A 5KU1A 2IHYA 4Q9LA 2DFLA 2ZSFA 4DLXA 2IXFA 2IF0A 3E2IA 1R0XA 4JLOA 2B7BA 4HB4A 4U02A 3OIUA 4A2PA 1XPUA 2YC4C 1ZM9A 3PUYA 4IDHA 5CM8B 3CW2A 4JLKA 3FKQA 3PIRA 3FVQA 2B92A 3FWYA 2VPPA 2V54A 3GJ5A 4M1TA 5AJWA 2O8EB 2Z4SA 2PZFA 1S1CA 1GL6A 2GHIA 4DDVA 6Q21A 3HU3A 2Q3FA 4UXJA 1CR0A 2P67A 4WVFA 3ZZUA 1G4AE 3QXHA 1E96A 4A2QA 2A2ZA 5FUWA 4ACBA 2ODWA 1L4UA 1N0UA 3KQUA 1E2GA 5JJKA 1MKYA 2NG1A 4R2HA 1OFHA 3EPHA 2GCOB 2WM9B 3VKHA 3VNVA 1NMZA 3IDQA 3AP3A 2JAQA 1DO0A 3MJRA 4NYJQ 3CX8A 1C1YA 5FUXA 2GAAA 4JKIA 4LPSA 1HA3A 3TSOA 2R65A 2NGRA 4F91B 2G83A 2YKGA 1II9A 2RB4A 3KTAB 1IXSB 5CM9C 1A4RA 5GJBA 1SVOA 5GJWC 2NOAA 2PT7A 4FCVA 2OAP1 4TMKA 3B60A 5AK0A 1VDZA 3TE6A 1NY5A 2CCKA 4HLUC 4P4UA 1Z0KA 2ZUCA 3V00A 4LV5B 4DC9A 1KNQA 1UF9A 2VA8A 3X1DA 1KK0A 2NPIA 2IUTA 5HE9A 2WWWA 2ODBA 3EZFA 1P2SA 4B73A 5HKKA 3GD7A 4GOXA 4UNNA 3LXRA 2FFBA 3NTUA 3IBGA 4LBWA 4HLUA 1WBBA 1LNZA 2WSSA 3GLIA 4B43A 1UEJA 1NVXQ 2EFHB 4OKSA 4KFRA 1RIFA 4IOJA 4XVRA 2Z6VA 1QG4A 3LY5A 2EFCB 3KQHA 4IOKA 3FOZA 1WMSA 2G1JA 2RGCA 4RJLA 3ZD6A 1E1QD 4TMXA 2OLKA 2FE4A 3EZ7A 4MYUA 1FX0A 3B1WA 2J7PD 4LHWA 4OBEA 4D6PA 3W8NA 4A8JC 4A92A 1OLOA 3PUXA 4BLSA 2EFEB 2W2VA 4QRHA 1RRCA 1XD8A 5KDDA 4M9XA 1R6BX 2AD1A 2ZRJA 2Y8EA 1AA9A 2VIIA 4TWZA 4UXHA 2JLYA 2KWIA 4MRNA 2ZVPX 2PT5A 4BLPA 1LS1A 3FKSD 2JJ2D 4BE7B 1N25A 3D8BA 3E70C 1J90A 1GOTA 1IXZA 1VPLA 1R5NA 4Q9KA 1YJ5A 3BS4A 4PX9A 2FGJA 4D81A 3EZ2A 3K9HA 2OCYC 1FP7A 4M8NE 4RD1A 3CX6A 1P7CA 2GA8A 1L8QA 4N0DA 1NN0A 1Z5ZA 4Q47A 1A1VA 5M04A 1Z6XA 1A2BA 1CS4C 4OK6A 1G3MA 4K81B 1T0JB 3QF4A 4D82A 3GLFA 4PC2A 1XMVA 5EJEA 3QIAA 1RRGA 1N6RA 4Q4AA 4GRAA 4LCBA 5KHOC 2QMHA 5F2EA 3T06B 3AVXA 4HZIA 2VHCA 1KO4A 1ZC4A 4ZV4A 3CR8A 2D2EA 3B8HA 4PQYA 1HV8A 1XFAA 2BJVA 3OEEA 1UDWA 2GXSA 3TKLA 4AYTA 1FX0B 1YE8A 1UPTA 1TTTA 1Q1EA 4XD7A 1Q1ZA 3O8BA 3SYLA 2V3CC 1CF4A 1UDXA 4RY2A 3TJZA 4Q1AA 4L4UA 1XP8A 2WIAA 4B34A 1HE1C 4NYIR 4BLTA 4Q01A 1OXXK 2ASEA 3EXAA 3FMOB 2QEQA 4KVGA 3H84A 1RFLA 3N2EA 2LCFA 1WDTA 2FZLA 4O2RA 2O5VA 4NCIA 3UATA 3G0HA 3OAAD 2XNDD 1OKKA 3R7WB 2D06A 1EG7A 3THWA 4TMZA 4LYAA 1W36D 3RYTC 2J0SA 1W0KD 2Q9AA 2YJTD 3T15A 1TU3A 2GDJA 4KYIB 4E03A 1E9RA 1G8YA 3DDCA 4LRWA 4NCKA 2NPFA 3Q85A 3RS2A 3SHFA 1NLYA 1MABA 2R6CA 2NIPA 1CXZA 4EPTA 4JSTA 1U0HC 1IJFA 5DIFA 2O0JA 3QF4B 3CNNA 3AM1A 1U98A 3GLFB 3GFPA 4Q4AB 4BPBA 1KDPA 3LH5A 1E79D 5KSZA 2PH1A 2ZYUX 3TQFA 1S96A 3NVAA 1WF3A 1KJYA 2ZREA 4LX0A 3SJZA 4ERNA 1JXOA 4QHTA 1IOZA 1JB1A 1KSJA 2OFXA 3OIYA 4TN1A 3WMGA 4BFXA 3KUDA 1RC8A 3W5JA 3EASA 1R7RA 2C03A 1TUEA 3RS3A 2WZQA 3L43A 3SBEA 1CR2A 1AZSC 1PLLA 1WP9A 3DL0A 4BFSA 2ZRPA 5JWRA 5L3SA 2BDTA 2QGZA 3QXXA 1I4LD 2OUKA 3L82B 4RD2A 3GEIA 2FA9A 1D6JA 2ZEJA 2R6FA 4ZPXA 1G1MA 4DXAA 1G18A 4LJ7A 2FV8A 3UG6A 1LTQA 1SXJA 3PFIA 4V0ME 2KI5A 1J2JA 3THWB 2ONKA 4NE2A 1HH4A 1XBTA 3B7GA 1CTQA 3K53A 4US0R 4V0LA 4XIGS 5CLQA 5FUYA 3AEZA 3HJNA 4BASA 3U3MA 1PUJA 5LPNA 1X8LA 2ZE8A 1NKTA 1XTQA 1KKMA 1G19A 2HDNB 1L4YA 3AH8A 2GVZC 1N5JA 4URZR 1FQKA 2FSIA 2ZRAA 3GLHA 4FD2A 5FOVA 1MABB 3UMSA 2QGNA 1KI3A 5DO9A 4CZ2A 2ZU0C 1S9DA 3TK1A 1LY1A 3D3QA 2D2FA 2R44A 5FI1B 2XEXA 4C4PA 3NDBB 2GNOA 1JQJC 1ZUHA 1WCV1 2GF0A 2Q21A 2ZJ8A 1IN6A 1VCIA 4QGHA 3X1YA 2GEUA 1GNPA 2OCPA 1CRQA 1KSHA 2BBTA 2BKEA 2EYQA 1N0WA 3AKYA 5L3QA 3Q72A 4S35A 4YMUA 1U81A 2BEKA 2ZR0A 3ZZTA 3VHXA 4MYCA 3C5CA 5FL3A 3F0TA 1C4OA 2OO7A 2P2LA 4DIEA 1X86B 4R98A 1GZSA 2HEIA 5L3SB 2FFQA 2X2FA 4OJQA 2X2EA 4I1VA 2GXUA 1UAAA 4TQUS 3BFKA 3ECCA 1I4DD 1N6IA 4EFMA 5BQ5A 3W8RA 4LJ5A 1B23P 1E3MA 1RYFA 4RKEA 3A1VA 4LJYA 4KU4A 4TMTA 3RS5A 1SXJB 1W36C 1BH2A 2Q9CA 4HLCA 2P5TB 3QPUA 5UKDA 2SHKA 1YKSA 1IY1A 2BM1A 4N3NA 3SNHA 1XEWX 4ARZB 1X1RA 3GLHB 4EJSC 1OIWA 2D74A 2DHRA 3OFND 1VYUA 1EX7A 3GEHA 4QJ4A 2XNDA 1E9BA 3DO6A 2W0MA 1IBRA 2BM0A 2PL3A 1L7VC 1NMXA 2FPLA 3N70A 4OK5A 3A6PC 1KI2A 2ZRGA 2IYVA 2VHTA 4LGMA 4MGKR 3ZVLA 3A4NA 1HTWA 5L3QB 2ZETA 2IS6A 3SYKA 2ZI7A 1Z6AA 4I99A 2AN9A 3C16C 5CIQA 1P5ZB 5FPTA 1AN0A 5EXPA 3T1OA 1ELOA 3R9WA 3NBXX 1GRNA 2H17A 1HUQA 2IEYA 2YOGA 1PLKA 1XMSA 2CE2X 3QQ5A 2WJJA 4JJKA 2FJUA 3SFZA 2OAQ1 4YLGA 1ZNZA 1E0AA 4LV8B 2JLRA 2VP0A 3RAPR 2KSQA 4JLBA 5EQTA 2O8DA 2HF9A 4K46A 3DVLA 4QOSA 1KOFA 3P20A 5JI3E 2B21A 4C7OA 3WHKA 4D4KA 5EE1A 1FOEB 2E1RA 1QHIA 3WXMA 3ZVRA 2ZRCA 2Q6TA 3IBYA 5FOXA 1S2MA 1VG8A 4X8LA 1QHNA 4QXAA 4KSBA 4KLNA 1IN8A 4JJZA 1SZPA 3QSYA 3KQNA 4TYWA 2WVJA 4FWIB 3KB2A 2BBOA 1Q20A 2HXYA 1MV5A 1BMFA 3WYGA 5A4JA 5HZKA 3VKGA 2VYFA 5B2ZA 3B1YA 4TL6A 1GL7A 1W49A 5L8VA 4OQFA 1E2JA 3GCGA 2ZQ5A 1OXUA 2C78A 5C4MA 4PC6A 3K9LA 3LVQE 2W6JD 4CW7A 4DEYA 1DG3A 2FOLA 2CDNA 3B1VA 3BK7A 3G5UA 2C8VA 3KJHA 2PEYA 3GMTA 3LBNA 4US1R 3QEJA 2W2XA 4C3ZA 3L0SA 1CR1A 3B82A 521PA 3SOPA 4DDUA 2O0HA 3BIFA 3GJ0A 4GPTA 3GLIE 2BWJA 4TYYA 4HDQB 2FG5A 4RSGA 3BORA 2XSZD 1YZGA 2Q3MA 2AD5A 3PENA 4AG6A 1KJZA 4FMBB 2YWGA 4PTLA 3RWMB 3W6OA 1ESMA 3P4XA 4AI6A 3Q8XB 2FEMA 5FFMA 1AS0A 3KKOA 3QG5A 4QJ5A 2IEZA 1JALA 3EAQA 4RVCA 4ZKDA 4TZ6A 2B6HA 5EP4A 1E0KA 3LWNA 4DLVA 4BEJA 1Q22A 1GUAA 4LJ4A 2C9OA 121PA 2RHDA 1E2KA 1UADA 3GLGE 3KKQA 2C77A 5FOSA 4YXWD 4C0AC 1G3UA 3L0OA 4PHFA 4XJXA 1SHKA 2K5UA 2ZPTX 1XXHE 3HU1A 1H8ED 2MSEB 4I1OA 1G3RA 3S1AA 4LBYA 3SC3A 1DAMA 2R6DA 2L0XA 1G21E 5KSPA 2QTVB 1K5GA 2ZIAA 4NYJR 2ZJBA 1XMIA 4JLNA 2AK2A 4XVUA 4IDOA 2GILA 1ZM2A 4ASUD 4TYQA 1KY2A 1GIAA 3TVTA 2FPMA 3KFVA 4Q4HA 4URVR 2QSZA 2QE7A 1IN5A 1XWIA 1YZUA 3CF6R 3RSLA 4GI7A 5EUQB 1KI8A 1OE0A 2F7SA 2G0TA 1P75A 3F8TA 1TAGA 1W44A 5CB6A 1DAGA 2GTPA 3AKEA 1DVRA 2PLRA 4M1SA 4OQLA 4UXIA 1Z0DA 3K9GA 5LD2B 1LF5A 1IY0A 1XRJA 1KO7A 1AQYA 1VIYA 5GVSA 3CWQA 5AUOB 5E95A 2REXB 2J5XA 3MAAC 5SZIA 1E4VA 2IYLD 3IIMA 5DN6D 3BOSA 1UBCA 4GZLA 2F55A 4C0JA 3GJ3A 1NNEA 5DI9A 1Z6TA 2YWHA 5HTKA 2J1LA 5DHAA 1GWNA 4LK2A 2DR3A 1F6BA 4G5RA 4DSOA 1DARA 2XNSA 2ZI4A 1TU4A 2YVUA 2IF2A 4UNSA 4QGGA 4UQOA 4A6PA 4C0HA 821PA 4JVSB 3SR0A 1S4QA 1ZU4A 1TEVA 2HLDA 3K0EA 4BFVA 2C9YA 3A1WA 1Z47A 3P32A 3OHMA 3S1AB 3B78A 1OV4A 4B3CA 4I4LA 3WBJA 1GNQA 4TQ9A 4IDNA 1KYIA 3GJ7A 5G3ZA 4G5GA 1T0HB 3K0CC 1W47A 1T8UA 2QM8A 2C2HA 3EA0A 5KNDA 1GAJA 4F4IA 3MUFA 3NBYC 3AGPA 2BV3A 3CWZA 4TMVA 2ZR9A 1ZINA 5L3RA 3UWOA 4Q4HB 1E2EA 3GEEA 4NYMQ 1IJEA 2WICA 3CPJB 2W6JA 5EXSA 5FL7D 3EG5A 3Q5EA 2QP3A 2AL7A 3DMNA 2F3RA 1MR3F 4HUTA 3A4MA 4IHQA 3K0CA 4HLQB 2A78A 5G41A 3K70D 1T91A 5C2JB 3VR1A 1PZNA 3DMDA 4PPGA 4MDFA 3QF7A 5FTMA 3HYRA 5JWOA 1GVNB 3TNFA 2VEDA 4OI4A 5DYIA 3PXGA 1VTKA 2XSZA 2ZYTX 2V7QD 2IYUA 3MJHA 4URUR 1OXVA 4M9ZA 4NCJA 4M4SA 5K8UA 3V9PA 1CKEA 2J87A 4AD8A 2Z4RA 1ZD9A 2F9MA 1WE2A 1W0JD 421PA 1D9ZA 1FL9A 1TADA 4CVNA 4EPYA 2ZVQX 3AVQA 1CJVC 4V0OA 3AVPA 3EIQA 3UKDA 3VAAA 1IY2A 2GJAA 1CJTC 5J47A 2BVNA 3KB1A 3LAWA 2ZRNA 2Z0MA 1ZCAA 2CLSA 3NHAA 1CIPA 1NN1A 4MA4A 3T5GA 3T61A 3AB3A 2AXNA 2O52A 1TF2A 1SKYE 3A1TA 4DLZA 1NIPA 3W3AA 4YXWA 1OJLA 4LBVA 4BFZA 3RS0A 2GBLA 4NCNA 2CK3D 2QMEA 3EW9A 3PJRA 1E9AA 3KZ1E 1H65A 4NKRA 3EC2A 5JI2E 4FIDA 4ABYA 3CRMA 5FPSA 1OSNA 1U0LA 1UJ2A 1WXQA 2CXXA 1T3SA 3KFXA 3QXJA 2KB0A 4KITB 3C7KA 4OQXA 4OHYA 5TVKA 3K1JA 3TR0A 2IYQA 4US2R 1R5OA 3CNOA 3WBKA 3I8SA 2AFIE 3RHFA 1T5IA 4OI2A 2Z43A 4CIDA 4FI3C 2FPKA 4GOKA 4IW3B 2QU8A 1IN7A 2OBLA 3L8ZA 1R0WA 2OE2A 2WJIA 3UWKA 3DZ8A 2WWYA 2R6GA 2JLWA 1FW6A 1MO5A 3LX5A 3RRZA 3LVRE 3MWYW 4F4CA 3V4FA 4DDTA 1KI4A 2DY1A 5DE3A 3NH6A 4CGZA 5J4HA 1U9IC 3JZAA 4GSYA 3LX8A 4W5JA 4LJAA 1R8QA 4H1UA 4M53A 3B9PA 2FZ4A 1OHHD 1E2MA 4YMSA 4NU0A 4C2TA 2WKQA 3Q9LA 2JLVA 1N6HA 2G3YA 5EXXA 1U2RA 2JDID 1A2KC 1NRJB 4UKDA 3U7HB 1RYHA 4B3BA 1KTVA 5JRJA 1Z2AA 3SEAA 4M2LA 1P2TA 2P6NA 4A0RA 1JBKA 1ZCBA 1CP2A 2V6JA 3HYTA 4NCHA 1YRBA 3W3ZB 3KX2A 4W9MC 1YR8A 3K0AA 2AX4A 4TYPA 2BJWA 1NP6A 5GJCA 4Q02A 2RGAA 4DLWA 1XPRA 2ZRMA 4H1VA 2PMDA 4NHOA 4DUGA 4G1UC 3QBTA 1G9XA 4L8GA 2AR7A 5FBQB 3K70C 4F38A 2RGBA 2V8OA 4NP6A 3RLFA 4Z1MD 4BLQA 4LYHA 2ZAMA 4IEIA 4TYNA 1IXRC 5JEDA 3B6EA 3UG7A 4WOPA 1N0VC 2IX3A 2XTZA 2NO7A 3I92A 4Q21A 2JGNA 5BW8A 1ODFA 5KSOA 5CYOA 1XF9A 4XVQA 4YMWA 4PSAA 4YMVA 2OFWA 3FHTA 2JJ8A 1VG0B 1OPXA 3DEFA 2F43A 2FFAA 2V6IA 2DFNA 2VP2A 3O47A 3WRXC 3EARA 3BE4A 3R8CA 1VHLA 2QMOA 1ZW6A 1JAIA 4JBXA 4KHZA 4B2LA 3AF2A 4DZZA 1FUKA 1P3JA 2GJ8A 3G82C 1E2NA 2GZDA 5TB5A 2QBYA 4NONA 5CDFE 1IQPA 2VF8A 3KKMA 5AJVB 1TQ2A 1ZRHA 2WJGA 4IRUB 2FFHA 4ESVA 4IDQA 1XJQA 3VR2A 3ETLA 3ZVMA 1G7SA 3LXXA 3CM0A 1KGDA 2OZEA 4W5HA 4A15A 3ZIAD 1EFTA 5J4VA 4G5OA 4PO8A 2GWHA 4RD6A 4FMDB 1JJVA 4D25A 1HQYE 3K0AB 5A0FA 3SS8A 1XEWY 4JYBA 5BN3A 1EFCA 1ZVQA 5FTLA 4JLDA 4D26A 1XNJA 1JPJA 4B3FX 2BKUA 1MO3A 1OH7A 3IILA 1OH5A 1W5SA 2CNWD 2ZRBA 3BH7A 3GJ8A 4CF7A 8OHMA 1M34E 1AM4D 2GAOA 4ZI3A 2R6AA 2WWXA 1DAKA 1YVDA 3LNCA 2J46A 3Q3JB 2QN6A 4BRWA 2WWGA 1Z6GA 4B6EA 1U0JA 1OFIA 2NO6A 2F43B 2HF8A 1JXMA 1R8SA 1XCPA 2E9SA 3IEVA 2HJVA 3WP0A 4LDJA 3VNUA 2KBFA 1W1WA 1V43A 2DYKA 3A58B 2GXAA 3JVUA 2C9CA 4JL6A 1YR7A 3QXSA 1J99A 1JR3E 2IWRA 1U94A 2QBYB 3OIVA 4OHWA 2DBYA 2AKYA 4YONB 4D80A 4A8JA 2UZ3A 4FN5A 3UPUA 4NBSA 3R7WA 4AK9A 3RDPA 1K6MA 1YZQA 4OQNA 4WAUA 4MGYR 5E7MA 3VQTA 4JLVA 2QG6A 4WZ6A 1NLFA 1KMHA 1GL9B 2D3WA 2IT1A 1BIFA 2AK3A 1Z29A 1VCMA 1XPOA 5FOWA 4DCVA 3KKNA 3AGQA 4DCTA 5SZKB 2P6UA 2GK6A 3AF3A 4CRWB 2PMKA 1G5RA 1E32A 2JJ1D 4EFNA 4HAWA 4TZ0A 1JEEA 1FFHA 4EUNA 2W6ID 3TSWA 3J81k 2ZTSA 4ZCMA 1UM8A 2DPXA 3ZZ0A 4JLPA 4TSFD 1EK0A 1SKQA 5DYGA 2I1QA 2GCPA 4CT5A 2JEOA 4PHGA 2WKPA 3ND8A 1EFHA 5EE3A 2P65A 4X8MA 2HV8A 3U6KA 1PUIA 4P0TA 1F60A 1G16A 2UKDA 4XWAA 2QTHA 4EAQA 1KAGA 2AFHE 4B32A 3MSXA 1GFIA 1QBKC 1QHSA 2OG2A 1ZNWA 3X1XA 4EDHA 4EFLA 2OT3B 2GXQA 5HPYB 3NH9A 3U3JA 4IVQA 1NBMD 2ORVA 4PR0A 3AVTA 1X6VA 3ZS9A 1Z28A 2WPDD 1R5BA 3CPHA 1ZYUA 4A8JB 2VL7A 4QM6A 3B1ZA 1TX4B 1NJGA 3QXCA 1KKLA 3B1XA 1KMHB 3ZJYA 2BBSA 4B2IA 5JSZA 4HAXA 5B30A 4AURA 4II7A 4PHHA 4O0MA 1EXMA 2G88A 1E9EA 3I73A 4D2IA 1R2QA 3EWAA 5K8TA 4EPVA 2O8CA 5DLQC 1XTRA 2AWNA 4DSUA 2RGGA 2HJGA 4JKYA 4BECA 3C4JA 4JLAA 1OYWA 4QHSA 5E3HA 1UBEA 4PANA 2QAGC 1SVKA 4L9SA 4JL8A 3RNLA 1E1RD 2CMKA 4O25A 1G8FA 3BWDD 3GJ4A 3SYNA 2QAJA 3PR1A 2XX3A 2CJWB 2G6BA 1NN3A 2FNAA 1Z2CA
chains in the Genus database with same CATH superfamily
4PLYA 4DV6B 1YJXA 1RXYA 2C9DA 2XI4A 3EZ9A 4RH0A 2B37A 2RGUA 3KK0A 3O8LA 4WESA 4C9BA 3F47A 1LDBA 3FFBA 4Q9IA 1CFJA 5JG7A 1A04A 3WK5A 4QQNA 5DMXA 1RT9A 3KHKA 2HPAA 1U2TA 2YJ6A 3QVUA 3QNUA 3WNDA 1Z0ZA 4I55F 1LV8A 1YULA 3DW3X 3I9KA 1GL3A 1MOQA 5C18A 2ID8A 3ZBQA 1VYTA 1ZA1A 2AOXA 2WOJA 3TQTA 4QUKA 4E1VA 2X2PA 3LYUA 3UK2A 4RACA 2XWJI 1FYVA 2XCUA 1M1UA 1UMCA 3BGIA 4U6NA 4X63A 3FKSA 5D7BA 4E88A 4K6FA 5JSZB 1EYZA 4IV0A 4PVCA 3W5CA 4DM4A 1JU3A 3ESQA 3KR0A 3QWHA 3UWMA 1EM6A 3DHNA 4HATA 4D97A 2PTHA 2WI8A 3VR5H 1G59A 1RQPA 4MIKA 2Y66A 3DOHA 3WGLA 4ALJA 4E4RA 1EPUA 1A5ZA 2FX3A 4XD2A 1BKDR 1Q1AA 3OOJA 4QBGB 1WL8A 1JDZA 2FTKE 4JNKA 5CD1A 2DFTA 2O8CB 3D3WB 3TF5A 5C80A 1J8YF 2YIDA 4B5LA 1ONOA 3ZDZB 4PWZA 2OOKA 2CLCX 2LKDA 2WEKA 1KSFX 5REQB 4LTDA 1U8XX 4R7GA 1ZHOA 1QIKA 3ANYB 1LBEA 1SVSA 4KIWA 1WUKS 2VYNA 1JA1A 3FFXA 3HNRA 5CLHA 3ZWQA 1RJEA 3IQWA 5J4KA 1VRCA 3HY3A 1M1ZA 1ARZA 4L27A 3ZHZA 3GLSA 4DRYA 3UK7A 1X94A 1KU0A 3LE8A 1MHTA 2BFFA 2BR3A 3EBLA 3H5AA 4C2BA 1FS6A 5JANA 2ONJA 2BE7A 2H2AA 5ALLA 1N36B 4K9DA 5LQMA 5DVZA 3QPCA 4OBBA 2JIZD 3JZIA 5AVTA 5C5CA 1MFZA 2IK8A 3HSYA 1T8RA 2W4QA 1WY5A 2OD9A 2VP6A 1ZL2A 5AVKA 1SZJG 2WOOA 2EVWX 3EVAA 4EABA 5JD5A 3DZDA 1JJAA 2J33A 2VHXA 4E5DA 4ZYXA 1KDRA 2XIQA 5TMEA 3BM5A 4AMGA 2JASA 4B45A 2GKOA 5AM5A 3BXEA 5F5NA 2WD7B 4C0XA 9ATCA 3NHLA 3TW8B 1XDSA 2VK8A 1NBMA 3GPBA 4M6WB 1TF5A 1FJXA 2O5CA 5IF9A 2G71A 2X0IA 2XMSA 2ZLBA 3LBHA 5KTPA 1FNBA 2UUCB 4IIHA 1M6NA 5FI5A 2IPOA 3WLFA 3IHLA 4QGFA 1IONA 3RSQA 1JG2A 3N75A 2AHOA 1R0BA 2GN4A 4Q05A 4HDNB 2I9KA 3UT5B 4EB3A 1A96A 3LLVA 4HRAA 1E5QA 1XQYA 2WKWA 1PNQA 1W0KA 1C4WA 1X14A 1H5QA 3IUEA 2ID4A 3QEMA 4J0HA 4XEHA 3UENA 4YLEA 4BEVA 2B9VA 2XUDA 3OM0A 3TL2A 4ZYLA 3LA6A 4QG7A 3VU9B 3MCTA 4WY2A 1OI3A 1PZXA 1EFPB 4QD3A 4LEIA 1YUMA 4MKFA 5K3BA 1R4NA 1OUMA 3KQPA 4NMMA 1ZOPA 1KYXA 2REBA 3VOBA 2UYGA 5AI6A 5GJVC 4UARA 4YMTA 1E2IA 3MJVA 2XKBA 4ZEWA 1P9OA 4CG0A 3NHWA 2FB9A 3P1JA 1I3OA 4GX2A 4LWZA 4RKWA 1RAIA 1XJ5A 1LTHR 5HIAA 2DZDA 2QPOA 2G5CA 4GLOA 3TUZC 2JHGA 3F7NA 5IYZF 5KYVA 2EFGA 4ZN6A 4MQBA 3VVMA 2Z04A 2H4WA 3QKIA 4IFBA 3GP5A 4M8SA 2H2HA 1QZTA 4NH4A 1KGSA 3VMMA 3VAYA 3EFEA 2WPNA 4IO1A 5ALOA 3DA8A 1KO5A 3HXMA 4XX1A 1XNGA 5HCNA 1YIAA 2OB2A 2H57A 2ZAGA 1CK4A 4D4JA 3R77A 5CFMA 3AI1A 1R50A 3OZIA 2OHOA 3OIWA 4AUNA 1QB7A 1O6BA 5DM1A 2KE5A 4FMPA 1MQ9A 1NZJA 2Z6QA 4IZHA 2XEDA 4JI1B 1RM5A 1J0XO 2OKGA 5IN4A 3C6MA 3O95A 3LOQA 4INZA 3H9UA 2DH6A 3GWZA 4AIIA 1ADGA 3EYAA 1F3OA 1ESNA 4X3OA 1XNHA 2YV5A 2VHEA 2YV4A 4QRIA 2XMQA 3JASB 3L4SO 1RCUA 4BV3A 3GK3A 2XOKD 2O2DA 4CV0A 4P32A 1BFKA 2QTGA 3AWIA 3H05A 3OKAA 1JQLB 2DWCA 3WWZA 2I54A 3M34A 1WNFA 4R51A 2IYXA 4K2HA 3N0RA 3D6MA 4TWRA 4XOIA 2QT9A 3PQ4A 4ZVTA 4KK3A 5GONA 2WVAA 3CCFA 4C21A 4FE7A 4NDNE 4CMGA 2ZWAA 2JFNA 4EJSB 3IJPA 3CVWA 1DC6A 5HKOA 3WWCA 1YFZA 4PONA 2WU4A 1A88A 1OF1A 4DLUA 3CPEA 5B58T 4K9LA 4L51A 4TKUB 5ALMA 4NSNA 3ACBA 3R3WA 3WLRA 1W19A 2OSBA 1UUFA 4EDFA 1KDVA 1YRQA 1U3GA 5COQA 1BKSB 1EWRA 1ZJ4A 2I6GA 5LOVB 2Q1XA 4YT4A 4TWAA 4GEKA 3VUEA 4L78A 2H8KA 1Y8CA 2NZWA 1E61A 3OX4A 5E1BA 2EG5A 1U7PA 4FLFA 4CGYA 2EW1A 2JFOA 3MLBA 1SQSA 4MW1A 4R2KA 4PZEA 1T9GS 2AN5A 5AT1A 4UTVA 1A95A 2OP0A 3CSDA 3PDIA 4E5VA 4WX2B 2A0XA 5E7IA 1Y5IA 3QH4A 4HFNA 4M1ZA 4J0GA 3JQDA 1DC3A 3ILHA 1C1DB 5C46F 4U2KA 4HOYA 1KL7A 2JEZA 3EA5A 3EVBA 3WO1A 2I3BA 1JDBC 1L8LA 2CEKA 3I32A 3HVHA 4JGBA 5BSVA 1ORTA 3VH4A 1KQFA 2EP7A 2FHPA 4H7DA 3BCHA 1RZRD 2VQSA 4I6EA 1LNQA 1U11A 5DTJA 4WV3A 3I6YA 3VX4A 4DWJA 2O2GA 2E6UX 4PCVA 1WW2A 1T5LA 4B7UA 1B0UA 1W4LA 1EXDA 2G82A 3IQZA 3QOFA 1NXWA 3DCJA 5DLDA 4PCAA 3WQSB 2ZI6A 5LB4A 3TINA 3WC4A 3JYHA 3PFCA 4QUBA 1M0EA 3Q3IA 4UHCA 2PKEA 3KYIB 5T6BA 3IDZA 1XZLA 6REQA 3L9WA 1ANKA 4A1FA 4MMXB 1VL8A 4TKVB 2PY6A 2A9JA 2FEXA 3JRXA 1MU0A 5DASA 4CV3A 3UJCA 3OFNA 3IELA 1NOIA 2JAOA 1CUHA 2RGXA 3WL4A 2NTYC 4LHSA 1ENPA 4FWTA 4DQXA 5J43A 1DKUA 4DSZA 1KFCB 2A5DA 4G1VA 2IE0A 4REQB 4Q4LA 4WW0A 3EOAI 1TTQB 2VDRB 1Z4NA 3I9LA 3QI2A 3A6KA 4AIRA 2R62A 2OCBA 2B99A 3JATA 2VYQA 3VV3A 1QSGA 5DK4A 5K0BA 1GO2A 1AHNA 2VJDA 4HB2A 5U4QA 4MVJH 1I3KA 3JD1A 4MQLA 4UEQA 4DLSA 1EHCA 1X0XA 1DSSG 2QD1A 2OXCA 3RYCA 3BT7A 2BFBB 1QO0D 3NEJA 3H87A 5TQ2B 4CQMD 5E2IA 3KJXA 2B8TA 3COVA 3EWSA 4D02A 1HL3A 2QM0A 3R7NA 1E1CB 5IANA 3H2JA 5KKNB 1R0RE 2FQXA 1QIFA 3KUUA 3PC4A 3NEAA 4YYZA 1XD2B 2I2BA 2QP4A 3H2HA 2IWHA 4KQJA 1H4QA 1PI3A 1R6TA 1SVNA 2PWYA 2VYCA 1B4DA 1EM8A 4KWIA 1JTFA 4B6JA 2DHEA 2PE5A 4Y0NA 2NQ8A 5I7RA 3WIOA 2O3JA 3CB2A 4MPPA 4B83A 1RZUA 2J6HA 4YMHA 3HNOA 3HWSA 3T7IA 3ABIA 1VGQA 4GS5A 3LLCA 3I5AA 1IHOA 5BPFA 3W04A 4K9NA 2CXTA 1EUDB 3K3PA 1OV6A 4PG5A 1I7NA 5FUBA 3UJDA 3NVKI 2GLXA 3IEUA 5FR2A 4YRPA 1ZK0A 2CL0X 3RVBA 3WLKX 1O6FA 1B15A 4EQ6A 4NNPA 3T1HB 2SECE 1QZZA 3OQPA 5BOSA 4ZCQA 1GNVA 1OOEA 1Y6ZA 3ZWPA 2VR1A 2PMCA 1MG0A 3ESCA 3PHIA 2QLFA 3P27A 1FMLA 1B0AA 3PGVA 4X97A 1HQCA 1WV0A 3PFGA 5JLAA 1EX6A 1F48A 1US8B 2IHTA 4XWGA 3S2GA 3AVVA 1UP4A 1SBQA 5EP1A 2VTKA 4DJJA 3LZ6A 4OFXA 3T7KA 3BMQA 4IHJA 1L5OA 3ND9A 1M2OB 2H1HA 3E9QA 4MYRA 4TKLA 2ZTMA 2HCJB 3X2FA 4AP9A 2VJOA 4C3VA 4ESHA 1J8DA 3HKEB 3IQFA 2IQ5A 2O5RA 4WFJA 1BFDA 3GFRA 3H75A 5H80A 2FKAA 4JENA 2I7TA 4U39A 1NW9B 2W00A 4R01A 1FW8A 1Z83A 1DJQA 2Q9UA 3VSDA 2QW1A 4XRGA 4G09A 1A0OA 2BOVA 1GKUB 4Q9JA 1KYTA 5GZ3A 3K6SA 1JECA 4J43A 1XTSA 4GWKA 1ENOA 4Y2RA 1RAAA 3RABA 1NF3A 4PR3A 1UBMS 1CDDA 1Y3FE 1WDWB 4NJMA 3REOA 3ZOKA 4ILKA 4Q1DA 3INNA 2YY6A 1ICIA 1JT2A 1UINA 3F4BA 3TSZA 5IJ9A 1VSQA 3C5HA 2J3QA 1LNSA 4NBNA 1T2NA 1V4NA 5D6NA 3F6RA 2CW5A 1YS4A 3Q10A 3VKVA 3IPYA 2HHLA 5ES4B 2GEKA 1VMIA 4RCVA 1E3EA 3QUBA 5ARDA 5G2OA 5EE0A 5CX1A 3RUPA 3G1TA 3CUWA 4D8XA 1CQWA 1DINA 2J8ZA 2C95A 4C0QC 1ZMTA 2QUKA 3DDUA 4MVXA 3PR3A 4JLWA 4ZU3A 1E3LA 2VJPA 3IDFA 3PF9A 4RYLA 1GXSA 3CEPB 5KMGB 3R20A 3PUWA 4CDNA 2GD6A 4XDHA 3EGXB 4F04A 1PJRA 2G76A 2YH2A 4XX0A 4LOJA 3MWLA 2XQGA 1TYAE 4V0MA 3MJDA 3BXOA 3LL7A 4BFUA 4CKXA 4EA8A 1BMQA 5K8CA 1DRKA 3S2EA 3GFFA 3KLMX 4EUSA 4Q7QA 1TF7A 1KIAA 4D8YA 3M4NA 1DJMA 1R00A 1KZGB 2BF7A 1EGHA 2HJRA 5B3LA 3JW8A 1UIRA 1WKCA 2J0QA 5C1BA 1T8SA 5JHGB 2AXEA 3MQFA 1Z25A 2DBRA 3BA1A 4Q3DA 3RR2A 3IPRA 2PSHA 3WTBA 3ZNPA 2TSYB 1B74A 4MUHA 1ATIA 5E2BA 1E5VA 2IUUA 5H1YA 5KPJA 1IZ7A 1OD6A 4PVDA 3ZY6A 3GFSA 5AQEA 2YW2A 3I39X 4DJTA 3TZCA 5A62A 1Y6FA 4MYHA 5ELLA 5E0KB 4CT4B 4QIHA 3ZDQA 4XEUA 3ELDA 5IWAB 4Q3BA 4N12A 1DOAA 4U7HA 1W5EA 3MJSA 4AZ3A 3BMNB 2XNJA 4R69A 2PS0A 1H3FA 1R6VA 2IITA 3HYNA 3SC2B 3WNVA 2DCUA 2FFJA 2O2XA 2VBFA 3CLSC 1WOMA 3HBLA 5IDQA 3ADKA 5DN6A 3KT0A 2Q5LA 2RCNA 5LUAA 1PVVA 3GT4A 3MYYA 4B76A 1LS6A 3DC7A 3LLUA 3TZ6A 1XO1A 4BQPA 1L7EA 4MS3B 3PTAA 4HTFA 5JQGB 1MAAA 2WABA 3V8NA 3VZBA 4GUAA 4QTXA 1GPH1 2V9PA 1JT9A 3EQ8A 4QYIA 4UM5A 3B6IA 4RGQA 1VLVA 4IEFB 3F6YA 1S02A 4KFSA 3Q2IA 1PR6A 2IODA 2JA2A 1X15A 1WHSA 4AWXA 1WPXA 4HAUA 5GOZA 3WBBA 4HT3B 5K8LA 3JD4A 3FPGA 5ERXA 1CVIA 2DQKA 3GAFA 4HNVA 3CF0A 5HRAA 4P5EA 3OWHA 1F0PA 5K20A 2ZYDA 2MSLA 2WJYA 1QM5A 3A9SA 1E6LA 4YRGA 3F9CA 3L7JA 5D3MB 1R12A 1Y8ZA 1N33B 5NLLA 3IP3A 3IKJA 4UAUA 4EYKA 3ZIUA 3N1UA 5E4FA 5GZ1A 2OGUA 2OFOA 2I1LA 3HY6A 3E5MA 3UUFA 9ABPA 3EQ7A 1WW8A 4Z8XA 5B36A 1A9SA 3TOXA 4DMRA 4YI5A 4B7CA 2YNMA 4W1RA 3GDWA 1H94A 2HRCA 3BG5A 3AR2A 1GTG1 4XYLA 4Q4JB 2QE6A 3PWKA 1G42A 3U7RA 4CEHB 3BDIA 1L8OA 3WQQA 2VO1A 1T2EA 2VDWA 3A8TA 2YW9A 4G0UA 3OI7A 1Y9EA 1WP4A 2CCGA 3LHFA 1ILWA 4YJHB 4KH1A 3OEED 3G8CA 3SQLA 1RACA 3UZUA 1CUAA 2YFYA 2DERA 3P94A 4CDGA 1XYVA 4Y0VA 2YWDA 4MGIR 1Z06A 3DAGA 3Q6NA 4X66B 1CF9A 2C4WA 5TGDA 4A82A 2MCFA 1SKMA 3WJ7A 1RKBA 4JASB 2ZB3A 4DLTA 5DNYB 2OYRA 3GBSA 4XA8A 4Z3DA 3PL5A 3SXPA 4EG1A 2Q6KA 2QAIA 3FPEA 4HAZA 1RW4A 2BC9A 2QQGA 3BGWA 4BAUA 4BMDA 2Q4TA 3K8ZA 1IVNA 1D09A 5IABA 2G80A 1FDVA 1V1JA 2O3TA 4O2BA 4ZOLB 4IZIA 5DBHX 2CGEA 2BUBA 3CEMA 4YPOA 1QRTA 5KVSA 3DLHA 1MZPA 1NZFA 4G0PA 4ZOBA 2ZI5A 5KC9A 1IPHA 4ROTA 1T9ZA 2C2WA 4EKNB 2X1LA 2D6FA 5F3RA 3TLXA 3PUVA 5B1HA 1WOYA 4R40A 3CB4A 1QG6A 3MTDA 4PSCA 5E4TA 3UQZA 2V1XA 4EMSA 3ZHOA 3MOSA 3ZD8A 1SRQA 5CA0F 2CVPA 3EIFA 4UE3S 3SJBA 1TZCA 2ZU6A 3AF4A 4CF5A 1RPTA 5ALWA 1YHYA 4HFJA 3TUJC 4X8OA 1NI4B 4TYMA 1SAYA 3SG0A 1DIRA 4AKEA 1U7XA 4FOOA 1GZHB 1NVVR 3ND5A 1JEOA 3KXKA 1FJ2A 3JARA 5TARA 4P93A 1Q0LA 3N2KA 4JH0A 5KKAA 1U9JA 3OFJA 1J22A 1T9BA 5CW1A 2QZPA 1RPNA 3NM6B 2GQ0A 3NBAA 1XIVA 1PTJA 4G5SA 1AKTA 3A36A 3KZVA 4JWKA 4BMCA 4KXXA 4GOLD 3PVSA 4CN9A 1LDGA 4QU9A 2A1UB 3GGOA 1SIUA 4QBIA 2C9ZA 3REQA 1HDYA 4YCSA 3EXFB 1H1LB 5J40A 1T2VA 5KCZA 4R8VA 1NPTO 1MC1A 1I2DA 1YR9A 3QPWA 4ZKEA 1T26A 2H92A 2FLKA 5FD8A 1GQOA 1ZM3A 4J94A 1YQQA 4UDNA 1JG6A 4D4MA 1OXTA 2KHZA 3U4AA 1E6CA 4FHZA 1EESA 3U7FB 3C6XA 2ZSDA 2IXEA 1SRRA 2JLSA 1GNRA 4OQZA 4N0PA 4EJFA 1QIJA 4N6NA 1DL5A 1SD1A 2EZ9A 4KBYA 4EARA 1K8YB 1SXJD 2GEDA 2W6OA 2Y9PB 1I4OA 3DGEC 4JJ8A 2GFQA 1RWVA 3AESA 4RK0A 2OCKA 4N8SA 1PV1A 2HIAA 5HJ7A 2PLFA 3C97A 5BNWA 1IFXA 1XJ0A 1LPMA 3V6MA 3V7NA 4LYEA 5LJIA 3ESRA 4ZHSA 7MHTA 3CTMA 5GIPE 5KKCA 2D0PB 1JI0A 1RM0A 2UDPA 4JYPA 4IFEA 4EIWA 3L9XA 5FUQA 4EZEA 1M0SA 2W5UA 1IBMB 2CCJA 1OXSC 4ZJPA 3DAPA 2H1OA 1IWBB 3DQQA 2QSUA 1ULUA 3SFVA 4CTKA 2Q3BA 2AUMA 2Z2KA 1A72A 2DWPA 2E4VA 1UQRA 3BAZA 1R4MA 3H2SA 2NADA 2AYYA 2YVKA 4QPDA 1VBMA 5TF0A 1RWPA 2V55B 3OQVA 3WSWA 4EI7A 3K5WA 3KKEA 2CNLA 4TLBA 4EW2A 1B8PA 4GEGA 2X8AA 4W7SA 5ALGA 3IJ5A 1NUTA 1N2JA 1DJNA 1GY8A 1SBZA 3ICPA 5HEKA 5KJCA 1K0UA 1YE3A 3ZY5A 3DHEA 3UV6A 5BR7A 3RG2A 1NI3A 4N7BA 4L5BA 1JQAA 4GX5A 4BU1A 4BATA 2GK7A 1P61B 2RKBA 3FDZA 3VDMA 5HCIA 3K9WA 1OFUX 2Z83A 1Z26A 2F8LA 3HMQA 4FDTA 1TAQA 3I04A 3K9QO 4BQFA 5B57C 4Q1FA 1NNI1 1Q1QA 3KDPA 4K8OA 4QJ3A 3V1UA 3KEMA 5BSWA 4LY3A 1C4KA 2D54A 1UOQA 1EUCA 2VDPB 3HR7A 4OQYA 1ZEMA 4PIVA 2HNBA 4XM0A 4MIOA 4EF4A 4BNDB 2AJLI 2NSJA 2PCLA 2GB4A 2LCIA 1YKFA 1RWBA 2HYIC 1E3IA 1OX6A 4W63A 4GVXA 1SELA 4G3XA 1NONA 4WUVA 1H9BA 4H0CA 4MTLA 4Y2SA 4M9SA 1SGWA 3SICE 4AO7A 3LGXA 2VPXA 3EXG1 1Y63A 2HIGA 2XTJA 1XDDA 1M7GA 1H2XA 2IOFK 2M6LA 3NRJA 5EMJA 1P2VA 1U8CB 1AKEA 1AKWA 1FLNA 2JEYA 5AKLA 2NZVG 3GLGB 1EB9A 1A4XA 1K2VN 3G6WA 3TFQA 4QREA 1KYYA 1PYDA 1U3FA 1ZP6A 4LV6A 4TTIA 1QLHA 1O77A 2YDYA 2IXGA 3VC1A 5BV8A 4IF6A 1E64A 3M4YA 5HE8A 4HPXB 1LVGA 1Z6YA 1VP9A 4B48A 3CRRA 4C04A 3I9V6 1U0FA 2VXYA 3RI3A 5H82A 4EAAA 4DNPA 1XTPA 1KI6B 5I8PA 2FPGB 1U65A 5ITWA 4J0FA 5U4XA 4JL5A 3OZSA 1BA2A 3DKIA 3KQMA 3A06A 4PSDA 1UMBA 4R2XA 5TF4A 3ZCTA 4BGEA 3MTEA 4WBNF 4I4TB 2V7TA 1UBHS 1UJ6A 2R4TA 3D7NA 4EKIA 5HOQA 4PO1A 4DJ5X 4RCZA 5K3EA 2K6GA 2FY8A 2W71A 4R31A 3WRWA 3WA7A 1Z5NA 2O8BA 4DYVA 4MV1A 4K0KB 2IS4A 5D3KA 2CMDA 3AKZA 4BWYA 5IG2A 2FU5C 4OHXA 5BYJA 1P3Y1 5F4BA 5FFNA 1N2HA 4XZ3A 3PE6A 2XH8A 5C8DA 1YQWA 2HMTA 5AW2A 3PEEA 3ZDAA 3NEPX 1EP1B 3FETA 1X92A 4JLJA 4DBZA 5B3JC 3OLWA 1TJ4A 3UUEA 1MD9A 4LHZA 1F2UB 2D7CA 1SU8A 4WK0B 4AJKA 2XXAA 3OEWA 4IQFA 4CFZA 5KQRA 4GW3A 3H11A 3C87A 1Z13A 4KJXA 2WMOB 3CNQS 4KI7A 4DR2B 1HT2E 2OOSA 4BO1A 5CCBA 1RLMA 5FPYA 3NQ41 3KC2A 4RVUA 3UT5A 3UAXA 4D44A 2VKTA 3C24A 3W3AH 1E1LA 1QYVA 5AYVA 2YWBA 5B3JA 3I61A 3C3XA 3FMGA 5IJ0A 2PBRA 4HQKA 1X1SA 3GJTA 4BO3A 4F5ZA 4FDMA 1V16B 2AQ8A 2Y67A 4RVOA 2B25A 4B47A 4RVSA 5AM3A 3RSHA 4CL2A 1MRZA 4E2FA 3TAHA 4JBYA 2IYRA 4BNWA 4I1YA 5BSHA 5E0OA 4B79A 3WIVA 2AG0A 3LO5A 5JXHA 2Q2WA 5LXTF 3UUGA 4EHAA 4BGUA 1ZD1A 1Y48E 1K1EA 2PD6A 3OZVA 4GMDA 1UC5B 2LGJA 1UZNA 4HN2A 2XGJA 4YRMA 4X1KB 4HH1A 2CDAA 3DH0A 3VR4A 1G20E 3QVVA 5AJYA 3BIXA 3BHIA 5FLXA 1RWXA 2HT6A 3ABQB 3V8RA 3DKVA 2ODAA 4D8VA 3FHCB 3QEOA 5JNUA 3PSAA 4URYR 3UAWA 2WNSA 4ETMA 3PFKA 1PNVA 5KVVA 2R00A 3S0JA 3OWOA 4H27A 1UPAA 3AQ4A 2VUUA 4GX1A 4WUTA 4GLJA 2G17A 1KK2A 3U4QA 2P1RA 2QGFA 4EVSA 2EBWA 1GZDA 1SOWA 3C6BA 4IH9A 1ZD8A 1YUNA 2H52A 2IFTA 3LOPA 2PG3A 4YMGA 3L7MA 4OKIA 4IIXA 5FH9A 1AUOA 3EVCA 4RVGA 3LJKA 3PXAA 4NE9A 3BB1A 5B12A 3GEGA 3TB6A 4QBFA 3N74A 3VJMA 4DR7B 3ICQB 1GGMA 4M9UA 3WNQA 4ZIRA 3L4JA 4KXYA 4IDDA 4FGJA 3LQ4A 2OHIA 4MLZA 2OBBA 3GBPA 3SLKA 1RBZA 1X7WB 4GBMA 4RNCA 2KPOA 4CF3A 1T4BA 3BVPA 4AFNA 4OGGA 5BQ3A 4NTZA 1ULAA 3R9XB 1XZPA 4TLAA 3FIUA 3Q0TA 4KWEA 4L85A 3QE0A 3RSOA 3TJMA 3IKLA 3ZK8A 1J07A 3JQAB 3PPYA 3KEFA 4R7TA 1RZ3A 1U1IA 2I2WA 4DR3B 1SKYB 4HPWA 1C7JA 2J9GA 2Y71A 3DZFA 3QLVA 2ZSEA 1UFKA 1ONNA 4F84A 4XB6B 3NOOA 3U49A 1G8GA 4U2CA 4ZCSA 2NVUA 3B3QA 3H4MA 3LFUA 4N7MA 4BNZA 4URXR 2DR2A 3CVJA 3BFXA 3GA5A 3QJYA 3RYIA 1EVJA 1KYWA 5DYTA 5HS6A 2HF2A 1RI1A 2JCYA 1ZDMA 1E1RA 3ZWYA 1WD7A 3F8WA 1FYWA 3HU5A 3OLVA 1OLXB 5TMPA 4NBVA 5EIEA 4M9QA 5DEIA 1ZD4A 4PV7A 1WRBA 1Z8NA 4MKZA 4ZA2A 3RBAA 5C1PA 1UBOS 5FWDA 4ZOCA 4G2NA 3A2LA 2AFIB 5F2NA 3RHSA 3SSMA 2W42A 1I30A 1EAMA 4O0LA 4BXOB 1GYPA 2RGNA 2DB3A 2JFXA 2NX2A 2QVBA 4ALMA 1IJBA 1W4RA 1XU4A 4CEIB 1GPLA 2WV7A 1VHWA 2PU7A 1KWGA 3B5IA 3LLMA 4YLYA 4BO4A 1TQ4A 2IDZA 5C4GB 3C98A 1RRPA 1VLMA 4GSLA 1PNRA 1CJCA 3QYPA 2JGIA 2ZKIA 5DM2A 2PYDA 2ZR7A 2HLDD 3EUWA 4TPKA 2WYIA 2PGAA 3R0QA 1YGPA 2PAAA 3JQFC 4HWKA 4QNMA 3AHDA 5IAGA 3G23A 2CUKA 2BDEA 2WG1A 4EHKA 1GTJ1 3EOBI 3M89A 4RY9A 1Y1TA 3AXSA 3QFHA 1WXGA 1J2EA 1E7YA 2OGTA 4EHDA 4BV9A 1PFUA 2NSYA 3BQ9A 1C0EA 3DOOA 1EFRD 1U3WA 2ZFUA 2I76A 2ZPAA 4PZPA 1K3FA 3MMXA 3U4HA 1Z82A 1ZK4A 1QTRA 4A6DA 5INTA 5ECWA 5J2TB 2CYCA 3UCEA 4LGCA 1QYDA 2Y1DA 3SIRA 2Q1YA 1YZFA 3OEHA 3A1EA 3D8TA 3P9PA 4UNPA 3GJXC 4H16A 1KE2A 2Z08A 2OZVA 5J58A 1UKZA 3HH8A 3PEYA 1XZFA 4UE6A 1B3BA 2HBYA 1U0EA 1JFSA 3LDHA 2E7ZA 3A9RA 3D6VA 5FJJA 5TQ2A 5LD2C 1U0BB 4ZXPA 5K3OA 3HPRA 1FFBA 4XVHA 2I1VB 1JQDA 2H4XA 1P7VA 4LNHA 5C4IA 4BNYA 3KCNA 4LDPA 1Q0UA 1Z73A 3ZCUA 3RTBA 3Q8LA 16PKA 4JT2A 4L95C 1LLCA 1ZI8A 2EGGA 4N5LA 2KJQA 4B7XA 3FPBA 3I30X 2QSYA 2CB0A 1S1MA 2ZJ5A 3OQOA 3HI4A 3RTCA 1AHPA 2PZJA 4M86A 5C8YA 4JQOA 5CNJA 3SXUA 1CZKA 1KZ7B 1HYQA 1JUDA 2CZGA 3DKPA 5D5PA 2YJNA 3M9XA 2QJOA 3QE3A 4BRSA 2GFHA 3PEWA 3PGLA 3UW3A 3N58A 2HBZA 2OZPA 3EXEA 1K06A 4NBUA 5FP0A 1N5MA 5EZ5A 2O8DB 1QHHB 1XTTA 4LYFA 4K6GA 4QGBA 5CFZA 1Z36A 3QM1A 3GH1A 3NX4A 2NZJA 1OXMA 3L0PA 3LDGA 4WY5A 1HGXA 4OMCA 5LMZA 2Z98A 4YECA 5TLSA 4HYEA 4U2BA 4X65B 1GFZA 1JE1A 1JPNA 4RX1A 3HSSA 2CEAA 3C41J 2CVHA 3B51X 1H4TA 2GCIA 4V1CA 5CIYA 3RBVA 3ZV4A 5HZGA 4NFHA 1WCWA 4MDEA 4ZT6A 5MGNA 4ZQCB 1WQ1R 2IA5A 2EX4A 3DMRA 3SYMA 3BX1A 3ESBA 3T4UA 1JLLA 2VPTA 2PZAA 1Y42X 2Q5JA 1CW2B 3AFMA 2GN6A 1Y89A 2OSVA 3Q3VA 4YP6A 3UIEA 1W52X 5IAAA 3OPYB 1Q74A 1DIAA 2ZYIA 4Q7EA 4YGXB 1XA4A 1U5BB 1Z7BA 3GUUA 1E0JA 3OIFA 2YC2C 3OE7D 2C4KA 4P7FA 4QFCA 3HKCA 4RADA 3U6BA 1WLSA 3E2MA 1YBVA 4IVPA 4S1OA 4PQFA 3ZVKA 4PEVA 4EEZA 5KNBA 1IJKA 2DQYA 4Y6LA 2QRMA 4NMXB 5K3AA 2Q45A 4Q5IA 3X3HA 3DD5A 1NMSA 5EMNA 1ISFA 1FLDA 2AZDA 2IUSA 3BJRA 1M34B 4MROA 3H19A 3WAKA 1N8SA 3HKBB 5L53A 3NDPA 5E6RB 1HM5A 1W85A 2X8WA 2ZANA 1QZ3A 1H8HA 2Z1MA 1HDXA 2QIOA 5JR3A 4D0GA 1YJCA 4NZZA 5LNK6 2WA2A 2X4IA 3AVOA 2Z8ZA 4BX3A 1F06A 3RARA 1DEAA 2IOHA 2I91A 2IY8A 1GEEA 3PNBA 1TM7E 4LG1A 4WA7A 5K0NA 4F86A 3EVGA 4FFMA 2A5JA 1O9HA 2F9LA 5JAPA 4RA9B 2OBMA 1QVWA 3NC1C 5JHHB 1NLUA 2IH5A 2ZBFA 3PD7A 4CE6A 2RIPA 4ZRNA 1ICEA 4OXYA 4YRCA 4LJ9A 2Q6VA 2O2JA 2WZCA 2P4EA 3X1JA 3UGJA 4IHAA 2H5IA 1ZUIA 1F0NA 3T1QA 4CR6A 2C4NA 1D7AA 3EC7A 4NPHA 1BZYA 3W06A 2VI5A 3NV9A 2C99A 5LSAA 4DQLA 2XY4A 2NAFA 3CF2A 1NT4A 1UMDB 3BHNA 5KTOA 4NZPA 4OJMX 3A7DA 1DKOA 2Z2YA 5EIFA 3CZPA 2B0CA 3EXG2 4M37A 2HADA 3H1AA 3TLJA 2BZ0A 4DLYA 1JHAA 1GCAA 4UUMA 4ENVA 2UYCA 2ZQZA 3M6UA 5J4LA 4LDRA 3TX2A 2HMSA 3P5SA 1BS9A 1OB5A 3LQRA 1GYQA 1L7DA 1H23A 3KUCA 5ES3A 4TL7A 2CHGA 3IQDB 1U6IA 1JR2A 1PKXA 1Y1SA 4FKBA 4C08A 2QR3A 4DLRA 4MW2A 3I0ZA 1MC8A 2VF5X 4FFWA 4AJ1A 1HOTA 3Q9NA 3DBLA 4RETA 3K9CA 4B1FA 4Y9DA 4G65A 4J1TC 2NO5A 3KSZO 3CKLA 1EXVA 5EE5B 1TYZA 4ZREA 2OLJA 3ZYCA 2XITA 1NYLA 2GERA 2AFHB 2XDYA 1RI4A 2OV3A 4DOMA 3AUSA 5GADl 2VP5A 1SNYA 1LQUA 4O1HA 5EZSA 2NZUG 4GF5A 1IPFA 1QZXA 5DBGA 3LUPA 2P3SA 5AXDA 1HDGO 3AUUA 3I9OA 4JQZA 1CEEA 1VZ2A 2M98A 2W0SA 4TSKA 5JS8A 1ZR2A 2GPJA 3Q6MA 1RVV1 1AXRA 4DCNA 2MMCA 4OHFA 4BQQA 3EC1A 4V39A 5K7SA 5L40A 2AMLA 2CFRA 2OQRA 3EQ6A 3IYLW 2E4UA 4KOEC 3S5JA 1KR5A 1LW6E 1GHTA 2PO7A 3CTPA 3DF7A 1PG2A 4KQIA 5G0SA 4DA0A 5FBVB 1AGNA 4LE1A 5EUMA 1GFSA 2N47A 3ZCQA 1EINA 1SVUA 2JVKA 3UKOA 1NU6A 3P2IA 3P52A 4ZAYA 2X6QA 4I9FA 4KXQA 4MPRA 5IDYA 5F52A 4BVGA 4I9GA 4C20A 5HKKD 4CR8A 4DC1A 2QVZX 5BN5A 1OH6A 1TK9A 4C1NA 1RRKA 1L4NA 3IODA 3ZLJA 4CMEC 4YFYA 1MGPA 5K45A 3ZDCA 3HCWA 3AFIA 3N7TA 1WBDA 2YHSA 3RBXA 3SSAA 2OXRA 4IXTA 1M0TA 1YVPA 3PQ5A 1CY8A 5FPKA 2O8EA 3P9SA 3F67A 1SQ5A 1AJEA 3MK31 2AG5A 2YMQA 3RCBA 3HR8A 4Q66C 3AVUA 2OENG 3HWRA 2X6RA 3NC0C 1JILA 2ATEA 3MCUA 2VHQA 3D0QA 4IMJB 4NK5A 4X85A 3VZSA 1P91A 3WMEA 2OC4A 3SF0A 2R5FA 2D7DA 1FXWA 1QRAA 4PGHA 3H9JA 3JD2A 4PZ0A 5LOVF 4PN3A 5L6MB 2FG6C 2DUMA 5IUJC 1UXOA 3I9V1 1UPBA 1YNOA 3G68A 3IP8A 4OYLA 2WUFA 3OQIA 4TTRA 4G9EA 1MPXA 4GM1A 3ZD7A 3EMDA 5F33A 1J7KA 2UVQA 5AO9A 5AWFC 4NBKA 5BWNA 5JARA 2P3QA 3AVYA 4OCZA 4QVKA 1IEQA 2KW5A 2R79A 3M1LA 4IUYA 1V71A 3V46A 1AIPA 2DUWA 3T6KA 1ZU5A 5BY2A 1Z2NX 1R4AA 2YCLA 1P44A 4UM7A 3AUXA 2GN9A 2IELA 4CM3A 3V2GA 1WETA 5JE8A 1PV2A 4QVIA 1QS0A 1T4CB 5P21A 3BZBA 5KU1A 3DKKA 4Q9LA 4HEA6 2DFLA 3NTXA 4FFBB 4DLXA 2ZSHA 3QIVA 4QLBA 3EH2A 4G0VA 2IZ6A 4EY8A 1R0XA 5BSMA 3DLAA 4CIYA 4KPYA 4A2PA 4MV3A 1LI7A 4U02A 2HL6A 4U1RA 4C2AA 1K7YA 1KXJA 1N3LA 3NAZA 4IDHA 5D87A 4BNFA 1XRRA 2DGDA 1I80A 1IBSA 3EIUA 2HH9A 2W2LA 2VOEA 3FKQA 3FVQA 1DV2A 2VPPA 3IE0A 3PIRA 3R6GA 5IZ4A 2Z4SA 1THZA 1IM8A 1H1DA 2WFZA 2Y6VA 1GL6A 1LBQA 3A2NA 4BMPB 4KDFA 3HZZA 2G4VA 2V7BA 4MWOA 2ZBVA 5FUWA 4EENA 4ACBA 1C7FA 4UOEA 5DXJA 4G85A 4B31A 1A2OA 3JQBA 2Q6IA 1OFHA 5KYWB 3H18A 2GCOB 2C2KA 2ZYHA 4JT8A 2BTQA 4N01A 1DC7A 3VNVA 2VZEA 3DYBA 1ZK3A 5JXJA 1K9SA 1W34A 2IY7A 5BSRA 3MJRA 4GKBA 2CL5A 4BNLA 4PZUA 1VHQA 1ZN7A 4CIXA 2Q0QA 1A8SA 3C43A 3L6DA 1VJ5A 2EP5A 1P7YA 2BI4A 2GAAA 4JKIA 4LPSA 4WLVA 3UV7A 3I53A 2DTEA 4K6KA 4F91B 3LS2A 3BRSA 4QXMA 2GLTA 3K9BA 3ROXA 3SF8B 1BU5A 3COWA 4DMGA 4CXMA 5A2GA 1IXSB 4L6IA 5CM9C 1E3TA 2G8NA 3FI9A 2CLFB 4M8LA 1M6EX 3D8HA 4JXJA 2FN8A 2QDXA 1U2PA 1P1RA 5GJBA 1SVOA 2NU6B 3DXZA 4GI1A 3D4IA 4NHEA 2NOAA 5GJWC 4BB6A 3B60A 4MLCA 3TE6A 3FNHA 3IP6A 4P4UA