3QKSB

Mre11 rad50 binding domain bound to rad50
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
b'AEKENRERVKKEIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA double-strand break repair rad50 ATPase
publication title ABC ATPase signature helices in Rad50 link nucleotide state to Mre11 interface for DNA repair.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication
total genus 60
structure length 179
sequence length 179
ec nomenclature ec 3.6.-.-:
pdb deposition date 2011-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qksB01
1E2JA 2GILA 4TLCA 4Q1CA 2CE7A 4LPKA 1SVMA 1J70A 3NEJA 2J0VA 1UDXA 3P4YA 1PUJA 4ZDWA 1Q0UA 1P2UA 3VNUA 1AM4D 2VHCA 2W00A 1V5WA 4I81A 1ZD8A 4TMTA 1G64A 1I4DD 2CNWA 4M9XA 1KIMA 5C18A 2IT1A 2J3EA 1G291 1MT0A 1R8QA 4V03A 1JBKA 3KTAA 2VLIA 4NHOA 4EPWA 3ZYCA 4DDUA 2FPMA 4TMWA 3MGCA 3IBYA 5GVRA 2VF7A 1CTQA 1P9WA 1Z0JA 2Y8EA 4AG5A 1T0JB 2ZI9A 4CVNA 5JS7A 3U7FB 2G3YA 2OG2A 4RD6A 1FNNA 2C98A 1Q12A 4NKRA 1HT1E 4TWZA 2QAGA 2VSXA 3GLGB 2H8KA 2ZRCA 4X8LA 2R8RA 4Q9JA 5HE8A 2ZUCA 4JL6A 4E03A 3AVXA 3BB1A 5CJPA 1YHNA 4CT5A 3ECCA 5G3ZA 2JIZD 3I4LA 1IQPA 3PEVA 2XSZD 3DHWC 2D2EA 1IJEA 1KI6B 3DOFA 4LJ9A 4US0R 3T1TA 3GLGE 1GM5A 4DLWA 2ZUBA 2QNRA 2XOKA 1NN1A 1W44A 3UPUA 1Z6TA 4PAQA 2BMFA 1WBBA 1CJVC 3Q5DA 5FUYA 2VP5A 1AGPA 2QPOA 4BZPA 2FGJA 1BYIA 2C5LA 2CL0X 1DG1G 3M0EA 2QROA 1NG9A 3QXHA 2WSSA 5AR1A 1FP6A 1YZKA 2OESA 1IN6A 4QM7A 1X8LA 2WKRA 3CBQA 4D6PA 2AL7A 3AKEA 3IQXA 4RY2A 4CYMA 4OHYA 1HY3A 4QGHA 1XCPA 4F4JA 3IIKA 4QNMA 2ZYWX 1CF4A 2OAQ1 2ZYTX 3KUCA 4YXWA 4PHGA 2GVZC 1E9BA 3EZ2A 4KITB 3ZZTA 4UXHA 4EDHA 3AVUA 4ZIRA 1OXTA 1QHHA 2VTKA 3EIEA 4MRVA 2ATXA 3GJ3A 2RGDA 4XWKA 1UBCA 2V3CC 5BN3A 5HKKD 4M9ZA 4DCSA 1XEXA 3TE6A 3KXKA 4P33A 1OHHD 1W4RA 3LX8A 4UNSA 3A1VA 1E69A 1XWIA 1E9DA 2VP6A 2VL7A 3VX4A 4EFLA 1G3IA 4JYCA 4KYIB 3GLFA 4FD2A 1R10A 1TADA 1AGRA 4RD3A 2EQBA 2EW1A 1WB9A 3QOFA 5FL7D 1ZD9A 5CM9C 4JSTA 1BH2A 1LB1B 2G1JA 5FOWA 1NIJA 2GAAA 3HR8A 4IDNA 4CZ2A 4EFMA 4MDFA 1DPFA 3EX7C 5KNBA 1JQLB 3OAAA 2JGNA 3EG5A 4MUBA 2ZVQX 3I3SR 1IXSB 1QG4A 4XD7A 5EZ6B 3X1DA 4KFSA 4G5RA 4EPVA 2HLDD 3RLFA 3REFA 3MFYA 4LHVA 1R8SA 3FVQA 4JVSB 2VA8A 1GWNA 2MSCB 4NE2A 3VR1A 3KQUA 2Z0MA 4TZ0A 1SXJB 1OFTA 1Q3HA 1SKYB 2PMKA 3Q3JB 4MGKR 3X1WA 4AC9A 1W36B 2IUTA 2KE5A 3DKPA 1FW6A 3EA0A 1KMQA 2AN9A 3K0SA 4NCHA 1IBRA 2ZR7A 3Q7PA 3WP1B 2WVJA 3THYA 1SXJE 5TY0A 4A8JC 1ZBDA 3HPQA 4BRUA 3VTKA 1X3SA 2ZUDA 5JRJA 4Z51A 2G1KA 5J4KA 1S2MA 4RZ2A 4FWTA 1N0WA 4US1R 2YYZA 3LXXA 5BYJA 3UATA 2XXAA 4OBEA 3AV0B 1N2CE 4M1YA 3PJRA 2XEXA 4IFEA 1VTKA 1GNRA 4LX0A 3RS2A 1NG1A 1YZGA 1KDOA 3E2IA 4MGZR 5FTJA 3IQWA 2CL7X 3LH5A 1KDRA 4ZI3A 4GOXA 3AVOA 1KJYA 3PXGA 4ARZB 4KLNA 1CR0A 3FOZA 1JQJC 2ZE6A 2ZRKA 2CHQA 4PAMA 4HLDA 4XTCS 5DYIA 4BFVA 3A1UA 1NI3A 3DL0A 4LDJA 4ERNA 2WMOB 4OK5A 3T1QA 4F93B 2A9KA 2FN4A 3NVAA 2W6JD 2R62A 4TZ6A 1SHZA 2JLQA 3LBHA 4GZLA 5JI2E 1E4YA 1LTQA 3GP8A 421PA 1N6RA 2CVHA 5KHOC 4QRHA 3QVVA 5IDVA 5BYKA 5FH9A 4TYWA 4LUCA 3AKYA 1UPTA 4GMXA 1NN5A 4D81A 2ZTSA 3MSXA 5FTLA 2PCJA 4CIDA 4Q4HA 5KSOA 3IIJA 5F9HA 3SN6A 2YVUA 1MH1A 2FOLA 1PJRA 3SJBA 1Z5ZA 2ECKA 3W5JA 3BB4A 5CDFA 1XMVA 1RYHA 1N3BA 2QENA 2WZQA 3TAHA 3FKSA 5EUMA 1OFIA 3A1TA 1TUEA 4IDHA 1A7JA 4YMWA 1YR8A 1XMSA 1VG1A 4TL7A 2GCNA 4EAQA 1NSFA 2VP2A 4PHFA 1CLUA 2G88A 3EZFA 1W4AA 2CNWD 1FTSA 5M04A 2KB0A 4D4LA 3I61A 2CLDX 1YZTA 4EPYA 4GL2A 4P32A 3ZVRA 3MUFA 2VEDA 2V1UA 5JJKA 1RJ9A 2XZLA 4ZCMA 2BKEA 4MYUA 4JBWA 1H65A 1YKSA 1KO1A 5EE0A 4MYHA 5FTMA 1FOEB 5AJXA 2FJUA 1XPUA 5HR5A 221PA 5LD2C 2XB2A 1Z63A 2PCLA 1QHXA 1U81A 1DG3A 1LS6A 2DFTA 5DIFA 4P31A 2REBA 3SNHA 4A15A 5F98A 1T91A 1KI6A 3E5HA 4TT3A 4URUR 1AZSC 2QQ0A 4R9UC 2ZRMA 3GEHA 4Q03A 2W58A 2NIPA 4PANA 4C0HA 2GEDA 2R65A 1HT2E 3RWMB 2XOKD 2WJHA 1KJWA 2PZGA 4MITA 4OJKA 2B7CA 1DO0A 4BPBA 4YLGA 2GJAA 2JLSA 3LLUA 3RRMA 1F6BA 1Z0KA 3CR8A 1ETUA 3BFKA 1BIFA 2UKDA 5KUTA 5CYOA 3CO5A 2YJTD 4KBFA 3TH5A 3KKOA 2WSSD 1VCIA 3TUJC 1W0JA 3U3RA 3QQ5A 5B30A 2QTHA 1OPXA 4V0ME 1K6MA 3F5FA 2FGKA 1NKTA 3ASZA 1L2TA 3K70D 3A1WA 3TAUA 4KO8A 2VP4A 4YXWD 1GKUB 1MO3A 4PR0A 3CH5A 4Q4AB 4U00A 1SVLA 4IVQA 1UF9A 3KXLA 1CIPA 1Z47A 3CRVA 4CT4B 4ZKDA 3KQNA 2JAQA 3CF2A 4R2HA 4M9QA 3ZVMA 1OXXK 2F43B 1NLFA 2XTZA 3PR1A 2QTVB 1ZNXA 3NDPA 4RZUA 4AG6A 1P6XA 4POAA 4Y0VA 3KJIA 3LVRE 5SZKB 4UNRA 4XVQA 2ASEA 5DE3A 1Q22A 5CK5A 1ESMA 1AS0A 3TIFA 1QF9A 1E0AA 1WRBA 3NEYA 4KSCA 1P72A 1OFHA 2WJGA 5CYPA 3D6TB 3W9YA 1ZVQA 1JJ7A 1WXQA 1D2MA 4TL6A 4CEIB 3OIUA 3OAAD 1SQ5A 4URZR 2VSFA 3EPHA 1G20E 2O8CB 3AVTA 2A5YB 3KDSE 1RFLA 4XD7D 1E2NA 1N0UA 1P3JA 1QZXA 1W5TA 1YJ5A 3KZ1E 4RJLA 4BECA 3I5YA 4UXIA 3U3OA 2EYQA 5CLLA 1EK0A 2FWRA 1T5LA 4QGFA 1TMKA 3LXRA 4G5OA 4OQXA 5HZHA 1A2BA 1KGDA 3EZ9A 3IPYA 4L5BA 1KHTA 2OZEA 4AWXA 3TVTA 3OEHD 1XTIA 5AK0A 3WYFA 4Q4LA 2JA1A 3QEJA 3SHWA 3C15C 4A0GA 1MR3F 1WCV1 1J8YF 3T06B 1E9SA 4DJTA 4DBLC 4AYXA 1N6HA 2ZS8A 3RWOA 1C4OA 3EAQA 5G40A 2WJJA 4F4IA 1KI1A 1ZCBA 1P5ZB 2ODWA 3GEEA 4RZXA 3Q72A 4CDGA 4NZYA 4C7OB 1OYWA 1OFUX 3VX3A 2IYZA 4CEHB 2I1QA 3FPAA 4US2R 2C04A 4JJZA 1Z0AA 2HXSA 3GMTA 5LPNA 1XF9A 2C9CA 1L4YA 5D3MA 4OHZA 1D6JA 3SEAA 3PUZA 3F3YA 1U9IA 2ZRDA 2WWXA 1G3QA 2DYKA 4LJ8A 4QJ3A 3MCAA 1KK2A 2OEPA 4B35A 5BN5A 3SQWA 3HU2A 5E95A 3U3MA 2CHGA 1FUKA 3AB3A 4KCGA 3PEYA 4BEBA 1LY1A 2DY1A 2TMKA 2Q21A 3SBEA 5IHPA 5FBRB 3T5DA 3LDAA 2P65A 1QVAA 2OV2A 4JKIA 2WV9A 1T9HA 2IYLD 5EE3A 3U7GA 1Z8FA 3QBTA 1K8RA 5C2JB 1M1YE 4L15A 4B3GA 1R2QA 2E1RA 3WNDA 3FDIA 3RS5A 2C8VA 2IYWA 4BFTA 4DLRA 4DC9A 3TW8B 2NQ2C 3LNCA 1YRAA 2IYVA 4PQFA 1US8A 1NKSA 5FR2A 2R6AA 1W46A 2D7DA 1KYIA 3QNUA 4MYCA 1E9FA 1N6OA 1TF5A 3GLHA 1XEWY 3W5IA 4YMTA 4KFUA 5DNYB 1E2PA 2C95A 4OI1A 2CCGA 4QL3A 2GBLA 5K8IA 3WXMA 4JL5A 3U44A 3DZDA 4Y0AA 1LW7A 4L4UA 1RRFA 4B3BA 1J7KA 1Q20A 3DKVA 4JBXA 1TL7C 3FKSD 4ACBA 4LJYA 3U4QB 4HB3A 2FZ4A 4DLZA 2IS6A 1U8YA 5JLJA 2DCUA 1R5BA 3L0IB 2UZ3A 2IYYA 2MMGA 1GL9B 4RKEA 1VHTA 4L8GA 4ZPXA 2ZRHA 4GOKA 3ZH9B 3CNOA 4E09A 3LFUA 5FBQB 3CPHA 1AS3A 2BBOA 4RD1A 2EU8A 3TMKA 4BFZA 4A2PA 4Z54A 1A1VA 3CX6A 3JVVA 1G16A 4LRWA 3TW4A 3IBGA 3IILA 1JXOA 3BE4A 4LV6A 5FI0B 3ZZ0A 1R0XA 4AYWA 1R6BX 4G01B 3C5CA 1UKVY 4DCTA 4WBSA 2C77A 4TT3D 2VIIA 3SDZA 4JT4A 1M7BA 1UEJA 4PO9A 4A9AA 1EFUA 4FINA 721PA 3BH7A 3I1FA 1ONBA 4M0LA 3T34A 3CPJB 2QP9X 5A0FA 1S1MA 1FX0B 2OT3B 1W48A 2BVNA 4JS0A 1BKDR 2V7QA 3GFTA 4YDSA 1AJEA 2JDID 2EYUA 4RFVA 2H5EA 3FTQA 1P9RA 3QPWA 4I1VA 2V6IA 2IYQA 4JVLA 1U8AA 4TMVA 5EXTA 1W0JD 2QGZA 3K0EA 1UKEA 2J0UB 2QE7A 3KKPA 4BFUA 4WZ6A 2J1LA 5E3HA 2HF8A 4IOLA 1Z2AA 1NVUQ 4QJ5A 4E22A 5IK2D 3RRNA 1E2FA 3VNVA 3PEWA 1YZUA 3IEVA 1K5GA 1D9ZA 1DAFA 3CRQA 4QC2A 4TLBA 5KNCA 3GEIA 2G9NA 4LBWA 3QY0A 4Q9IA 5AJZA 3UMRA 4BRWA 1ZNYA 1KO5A 4LBZA 4PPGA 3IDQA 3N5CA 4KAXA 4YONB 2XNDD 1Y63A 1FQKA 2BHRA 2GF0A 3GLFE 2F43A 1P9NA 2Q9AA 3FFBA 5LD2B 1ZU4A 1NVVR 3KB2A 4LJAA 2WIBA 4NYJQ 1E2KA 1ZUIA 5L3RA 4B48A 2ZSBA 4OI2A 5TB5A 3SFVA 3WHKA 3B1VA 4FN5A 5FPYA 4NH0A 1NF3A 1KKMA 4PZLA 4FXPA 4TYNA 2HV8A 1CBUA 1SVIA 4LWZA 3KJEA 3AVPA 5TV2A 1OB5A 4JMPA 2G83A 2IA5A 4MRPA 4CEIA 3HJNA 2OXCA 1TQ6A 121PA 1HA3A 4A1FA 4V0KA 3GJ4A 4Q7JB 5J5CA 2J45A 4M22A 4AK9A 1WA5A 1N6IA 1TU4A 2B92A 4ABYA 1CULC 1ZYUA 3O8DA 3RABA 3OF5A 4Q1AA 2D2FA 2XB4A 3P20A 2ZJOA 2ZJZA 1E0SA 3BS4A 2GAOA 3RAPR 1OXSC 2B8TA 1TQ4A 1SXJD 4ASUD 3TUIC 1JR6A 2XAUA 3FMIA 3QG1A 4JZKA 1W36D 1FQJA 2Q3FA 4M1SA 2QRNA 4WA7A 5C1BA 1GITA 1S8FA 2JEOA 3M4YA 4B73A 3W3ZB 4EKDA 1R4AA 1ZM9A 3RC3A 1G7CA 1JXMA 4YMVA 1UBGA 3EZ6A 1KZGB 2GCPA 4UXJA 2O0HA 4QBIA 4WXRA 3RNLA 2A3RA 2ZRAA 1Z22A 5D3QA 2WPDA 3LW7A 1GUAA 2VO1A 2FSHA 4C7OA 3QXCA 4CEHA 3OIVA 1AKYA 1DAMA 3DZ8A 3IUYA 4D4MA 4O0MA 1IY0A 3X2SA 1HEIA 1Z28A 2FSIA 4KVGA 3SQXA 1VKJA 1G8GA 5DISB 4D4KA 2W2XA 2NO6A 2FSFA 2GKSA 5JFGA 3OFNA 4DUGA 2IWRA 1ZINA 2V6JA 4S35A 5E4FA 2GJ8A 1QG2A 5KDOA 2JLXA 4DWJA 1G4UR 2DFLA 2FFHA 1XDBA 3HR7A 2DWOA 1ZP6A 3NKVA 4FCVA 2R2AA 2ZRLA 3WYGA 3LY5A 1PV4A 1Z06A 3QKUA 1KI7A 2ZPTX 4GOJA 4S2EA 2QAJA 4TLEA 1E96A 3A58B 3QENA 2KI5A 4YMUA 1S1CA 4DLYA 1E2LA 2XITA 5AJWA 5CDFE 3PUWA 1VG8A 3P1JA 3W34A 1OV4A 3N2EA 3E1SA 4QHTA 4GBMA 3I32A 4PAOA 2LKDA 4M1TA 1DE0A 3RRZA 4D0NA 2QMOA 2JJ8A 2GXQA 4BLRA 4XJXA 4JLPA 4DZZA 2ODNA 3PFIA 2C9YA 1RJ9B 1UJ2A 1TF7A 2VRWA 3X1YA 4OL0A 1XEWX 1QHGA 3DDCA 2JJ2A 3CZQA 5GJCA 1T0HB 2WWIA 3U4QA 1KO7A 1QRAA 3PITA 3EASA 3NBYC 1OT3A 4QG7A 5DN6A 3VHXA 4YDHB 2BJWA 1P4SA 3UMSA 4EJSC 5FR1A 3D31A 2NPFA 1G8PA 2OBMA 1XEFA 5F9FA 3I73A 1Y3AA 4B47A 3FB4A 1RE0A 4L16A 4PC1A 3B82A 3PENA 4JVMA 1ZUNB 3THOA 2PBRA 2CJWA 3MG9A 2WOJA 1W5SA 3PEUA 1KDTA 2ZYUX 4D82A 5EQTA 1XU4A 1NMXA 2GA8A 2RHDA 2GZHA 1W4CA 3P27A 4M2LA 1C9KA 3CRMA 4O2LA 1FUUA 1OIWA 4TTPA 2RGGA 3QKSB 1II0A 1T4GA 1KSHA 4URVR 1XPOA 2UZIR 1ZIOA 4NL4H 2NO7A 4FI3C 4DCNA 3QPUA 2GJ9A 3CPEA 2FSGA 1FX0A 3X1ZA 4CW7A 4A0HA 3KB1A 1LF0A 3AP2A 4U02A 1M2OB 1HV8A 2GXSA 4EQ6B 4BGDA 1XTQA 3NC1C 4N0DA 2YHSA 4LHXA 4YC7A 4PHHA 4C2TA 3BXZA 4URWR 3CR7A 2P5TB 4C30A 3D7MA 2P6RA 2J0UA 1P7CA 2IEZA 2C99A 4DXAA 1WP9A 2NO9A 1G8HA 1VMAA 4JKYA 4FMBB 4JSYA 4LSGA 5KNDA 2FNAA 2NZJA 2GEVA 2QE7D 2ZRFA 2PX0A 4FMDB 2ZU6A 4H1UA 1ZCAA 2O52A 3UWOA 3QVUA 2QP3A 3H84A 1XD9A 3L0SA 2V54A 3W6NA 5KDLA 3TSOA 2FH5B 2FFQA 2A5DA 2ZANA 3VAAA 3ONWA 4RSGA 4A6XA 2NZ8A 3F0TA 1TQ2A 4B2IA 1AK2A 5DLQC 1JR3A 1T8UA 1OH6A 4AKEA 3FFAA 2ZJ2A 2F1IA 3U3JA 2B6HA 2XTMA 3HWSA 4GMDA 5EP3A 1MOZA 4PX9A 2ZEJA 3CONA 4CGZA 1JPJA 2CMKA 2HCJB 3NH9A 2O8FA 4HB0A 2HUPA 3B1ZA 1JI0A 1SKQA 1G17A 3AEZA 3K0AA 4Q5IA 2FG5A 4Q02A 4GFDA 4B34A 3WHLA 1IY1A 2UVQA 3UWKA 3GJ6A 1EX7A 4B76A 5AUPB 3SYNA 4M4SA 2FDCA 1G21E 5GJBA 2LKCA 1SKYE 1TPZA 1AQYA 5EE9A 4Q4JA 4M1WA 1PLJA 2H18A 3H0KA 3M1IA 4AKIA 1P2VA 4PC3A 2WSMA 5DI9A 821PA 1SULA 3R9XA 2IF0A 3DMNA 3FE2A 1KI2A 5KPJA 1JAHA 2E9SA 1II8B 2EFGA 3FMFA 1PLLA 2HYDA 4BLQA 2QQEA 2WWWA 4ON9A 5CIWA 4A82A 3R20A 1VCOA 1MRSA 4QM6A 1G8YA 2QMHA 3LWNA 4PSAA 3L0PA 4IDOA 1LFDB 5D3MB 1J90A 1KNQA 4URXR 1OE0A 4NYMR 1I2DA 4KHZA 3RS3A 3KQKA 4O25A 4QFMA 1R0ZA 2F3RA 2WAYA 4P4TA 3TJZA 3ICEA 2V1XA 3ZIAA 3JVUA 4M21A 2WKPA 1XFAA 3HYTA 3Q7QA 1KTVA 1GRQA 3H4MA 2WKQA 2R6FA 4BEJA 1G19A 4ZI2A 1N5IA 1JJVA 4Q1FA 3SJZA 3ZVLA 2D3WA 4Q1EA 1RRCA 1EXMA 3BAFA 1YRBA 1BS1A 2HYIC 5F3WB 2R9VA 5FOXA 4F92B 2ZAMA 4HAYA 3VHLB 2ZJ5A 1N5KA 3LD9A 3LQRA 3Q9LA 4C0AC 2GJKA 2QZ4A 2XX3A 3KKNA 2WBLC 1BYUA 1DS6A 4W5JA 1XBTA 3WMEA 3N70A 8OHMA 1US8B 3HU1A 3OFND 1XNJA 4MKFA 4DUGD 1AQUA 5DHAA 5B2ZA 2F9LA 1MRNA 1KSFX 3GLHB 4LZZA 2F3TA 4NCKA 3AUYA 4AI6A 2AKAB 3EPJA 1TEXA 2VBCA 4Q1BA 3DPUA 2EFEB 1H8EA 3AF0A 3B7GA 3U44B 3L8ZA 1KMHB 3QPVA 4PHTA 3NH6A 4JYBA 2J87A 2ZYVX 3GLHE 3NBXX 4B33A 4HLCA 1Z6AA 4B75A 2Q0HA 4OJQA 5G53C 1UEIA 1XJ0A 1W47A 1Q44A 1JEDA 4IDPA 1E2EA 1Z6GA 3OZXA 3MJHA 4HLQB 5JSZA 5KDDA 2IX3A 4PC6A 1GNQA 1GIAA 2WWGA 3B1XA 4LC1A 2IC5A 1GNPA 2RGCA 3WNCA 2ZSEA 1TQDA 3ZGXA 4DT1B 5C46F 3RS7A 1RPZA 3CX7A 4NU0A 1E98A 3DOEA 4LJ7A 3K09A 4HATA 1J99A 4I1SA 1Q1QA 4NYIR 4JLBA 3SC3A 1B23P 3KUDA 5DN6D 4I1OA 3DO6A 5AWFC 3LW8A 2NTYC 2EVWX 3EA5A 2RGBA 3EARA 4II7A 1F60A 5FTKA 4EPXA 3BBPA 3KFVA 2F1RA 2GF9A 4DLTA 2OCYC 3BC1A 1UBFA 3SOPA 1XD8A 2OLKA 4IKEA 4HDQB 2QY9A 4IEIA 2D4HA 3C5HA 1OW3B 3WYAA 3A4LA 4X8HA 4DCVA 4BFYA 1NP6A 4ZDIA 4NTZA 1GZSA 3DVLA 1R0WA 1PUIA 1YR7A 2I3BA 2QN6A 1ZW6A 3LQQA 1ZNZA 3NTUA 4X8MA 3BOSA 1OH7A 2XZPA 1I4TD 3QKSA 4AKGA 3CF6R 1FMJA 2ZE8A 2P2LA 1F2UA 4C0SA 4OI4A 2W6IA 4DDWA 2F6RA 2Z4SA 4JLAA 5CJ2A 5G41A 5TMPA 3TK1A 4KJZA 4LOAA 2OSBA 1Z29A 5DGXA 3EIHA 4EQ6A 3E70C 4LC0A 3KKMA 5GVSA 1R5NA 3VKHA 2ZS7A 2ZI3A 3V4RA 4EPRA 2BCJQ 4RZ3A 3CRRA 2BEJA 4U5XA 2ZETA 1A4RA 1Z07A 1OH5A 4DVGA 3NIBA 2G0TA 1U90A 2EFDB 4IOJA 1TU3A 4EJSB 2A7QA 2Q3HA 3LA6A 4XOIA 2H92A 5BW8A 2VF8A 1UKZA 1E2GA 3TSWA 2ZJAA 1E99A 1IAQA 3WBJA 5JECA 1SVKA 2RGXA 4W7SA 4XH9B 1GSIA 2QSZA 5FUVA 1TUIA 4IXNA 2J5XA 1I2MA 1GAJA 2YWEA 1GKIA 1XRJA 2AR7A 2ZJBA 2QSYA 1DELA 2KWIA 1E94E 2OUKA 3QF7A 4LK2A 2OFWA 2O8BA 3MWLA 2HDNB 2F1HA 2BV3A 2QORA 1G6HA 2ZI4A 3AVQA 4PO8A 4B3FX 2J9RA 5L3QA 2WM9B 4NDZA 2WIAA 3I8SA 2ZI5A 2MSDB 4RD0A 4B2LA 2ZQ5A 3FMPB 2ONKA 4W5WA 1FMLA 3RYTC 2A5FA 3FHTA 2AD1A 1S9HA 1ZM4A 2KBFA 4MH0R 2NMVA 1E79A 2QL6A 2ZSAA 1U0LA 1Z83A 2IXGA 5E7IA 2V55B 4JVNA 4C4PA 3NHBA 3TBKA 2ZJ8A 1IONA 1XCGB 5JI3E 1OH8A 3C7KA 3VMFA 1D9XA 2QU8A 2V9PA 5EP1A 4E5UA 1CR1A 2O8EA 3K0CC 1XMIA 3A1SA 1E6CA 4D80A 3LBIA 2BMJA 1E0JA 1TEVA 5E7MA 1KSGA 5B57C 2VH5R 4BQSA 3PQCA 3U5ZB 4LGMA 1II8A 3CWQA 1E1QA 1E3MA 1HQYE 1LNZA 2X19A 5J4VA 4LYJA 4R7ZA 5J4LA 2FV8A 3PUYA 1R0YA 1DADA 2YINC 1J8MF 4MRRA 3O8CA 1YR9A 3AP1A 4B6FA 4EPTA 1XJQA 2EWVA 3T35A 5EP4A 3AH8A 3B2EA 1X8JA 4RCYA 4DLXA 3QKRA 4DHEA 4TSFA 4ZCIA 1DAEA 1ZU5A 2ANBA 1SZPA 2FFBA 4M9SA 4FCTA 1JAIA 3ZIAD 5BN4A 3MMPA 1IN5A 4CF7A 1DARA 3QBVA 3UMFA 1DTSA 4B3XA 1NBMA 1KI3A 1T3LA 4OYHA 5EXXA 3RHFA 2GRJA 1P60A 4F7WA 4AKHA 2HJVA 1P73A 1YZQA 3R8CA 3IKJA 3UK6A 3B6EA 2HXYA 3AGQA 3MAAC 1X6VA 5LDDC 4K46A 1ZIPA 4IEEA 1K5DA 2BM0A 1E9AA 1NIPA 1OSNA 4PPNA 4RKFA 4HLUC 4LBYA 3GFPA 3B13B 4MKGA 4Q19A 4A8JB 1G5TA 2N1BA 4OHVA 3MWJA 1NN3A 2QBYB 4Q9LA 1H8HA 4TN1A 1HQCA 1X8KA 5CK4A 4WW0A 5J47A 2FU5C 4Q48A 1N5JA 3QSYA 4CEJA 1KMHA 4IVRA 2OAP1 2VHTA 3MJRA 4HYYA 5HCIA 5K8TA 1SVOA 1U0HC 2NGRA 4QKQA 1H8ED 1P2SA 2Z43A 3ZQ6A 3IO3A 2QP4A 4B3DA 3N2IA 1IY2A 4ITRC 4K8OA 5KPDA 3BK7A 2QM7A 4DSUA 1NY5A 3I72A 5BQ5A 1RRPA 2PZEA 4Q00A 1O87A 1M8PA 4QGAA 3VU9B 1IXRC 2D7CA 2WWFA 3GJ8A 1XPRA 3GLIB 5IF9A 1NVXQ 2YV5A 1TNDA 1ZM3A 4V02A 1PLKA 4JLJA 3AVWA 1LVGA 3PCRB 2BBWA 4B44A 521PA 3CUEF 2DWQA 1N5LA 3BORA 1CJMA 3C16C 1Q57A 4KV9A 4DT1A 3R8FA 3A37A 2GETA 5A5GA 2CJWB 2BEKA 3TSZA 3THXB 1ELOA 1GRNA 2BMDA 4G1UC 4QJ4A 3TRFA 4AIIA 4D4JA 1LF5A 4ZDJA 4O3MA 4IFBA 4QHYA 5SZJA 4WZBE 4DEXA 1KO4A 2CLCX 1NN0A 5FI1B 4NONA 2BKUA 1W2GA 2DFKB 2OCAA 1KO8A 3IEUA 4IRUB 5GJWC 5CM8B 2XZOA 2QM8A 3QG5A 5AUOB 3SJCA 2IW3A 1RVDA 2GXUA 2D74A 4HZIA 5FOTA 5FPTA 5FPSA 3R7WA 5L3SB 2WAXA 4IVPA 4PZYA 4XSHA 3O47A 3AF4A 2HCBA 5DHFA 2JLVA 2PLRA 2RKOA 3SHFA 3AF3A 4WIAA 4WZAE 4IHQA 2IS2A 3EXAA 5TDHA 4UKDA 2LWIA 4OHWA 1WF3A 1RZ3A 1P2TA 1NSTA 1XXHA 3EW9A 2IL1A 3CZPA 5K8UA 1VG9B 1RC8A 2QT1A 3T12A 4JJKA 5FBVB 1AKEA 1YVDA 3TKLA 3NG1A 4IOMA 4PPFA 3V00A 1G9XA 3D3QA 4JBYA 3A8TA 1G3UA 1FTNA 1CRQA 2BC9A 1SXJC 2P0EA 4R71A 5TARA 1G7TA 1FFHA 4PSKA 3ZQJA 3H1TA 4B74A 2W6ID 2RAPA 1KDPA 1OKKA 1G3RA 2BM1A 1NRJB 1ZNWA 4LI0A 3T1OA 3RSOA 3V9PA 5HKKA 4JLOA 4WXPA 2GVDC 2OILA 5LB2A 3ZVNA 2A2ZA 4GZMA 4LYFA 1OXUA 3WP0A 4A0FA 3PG5A 5BXQC 5FUWA 4BFWA 4KVAA 2ZREA 4MDEA 2F1JA 5JCPA 2C2HA 4I1UA 4EJSA 2ZJYA 1GOTA 2AKYA 4NP6A 2GCOA 3WY9A 3CWZA 5EXSA 3B5JA 3RS4A 2ZRIA 1ESNA 4WAUA 1GILA 1G18A 1M74A 2CLSA 4HZUB 1XP8A 1Q21A 1ZJ6A 1JR3E 1XZPA 2O8FB 2F7SA 4IW3B 1UKYA 1ZC3A 3K0AB 2ZM5A 3TUZC 1DAHA 3K0FA 1IM2A 3SZRA 3H2YA 4DLSA 2WOOA 2JATA 4LHZA 3EC2A 4Q7MB 4RVCA 5EP2A 4NCJA 4H9GA 1N0VC 2BDTA 3ASYA 1G8FA 4FWIB 4Q4JB 4Q9KA 4WVFA 2OFOA 3FYHA 4N0EA 4G3XA 4HAWA 1W0KA 4PQRA 4G5GA 1IOZA 4QBFA 3UIEA 3A4NA 2RGAA 4QGGA 1JPNA 1XX6A 4TL8A 1E79D 3THWB 3OHMA 4HUQB 2DHRA 1COWA 2ERXA 5JWRA 1S3GA 3TQCA 1VCMA 3KL4A 4LY6A 5FUXA 1G1MA 3W6PA 2IF2A 4ZO4A 4KXFB 1VG0B 3EIQA 5P21A 2BBSA 3DM5A 3K9NA 1U94A 3QUSA 1FL9A 4ESHA 1E9EA 5FL3A 3TR0A 1HURA 3LX5A 1FZQA 4LCBA 1WMSA 2ZRBA 3AKDA 4Q18A 1Z2CA 4M53A 4DSNA 5CLQA 2F55A 3NBZC 3W6OA 3I8XA 1M7GA 3B1WA 3DM9B 2FE4A 3SJAA 4Q47A 4F4CA 2JLZA 4B2PA 1EG7A 5AUNB 3GFOA 3TVDA 2IS1A 1DAGA 5K8LA 4OI0A 5TXGA 4TSFD 5JWOA 1CEEA 1S4QA 3LBNA 1ZMXA 2PJRA 2WTUA 2A5GA 2ODEA 4PC7A 5KSYA 1F48A 1NBMD 2DWPA 4NPHA 3OE7A 2CK3A 3NC0C 4DCUA 1G5PA 4M1OA 3ZD6A 2QEQA 3OEEA 2V8OA 4HUTA 1ODFA 1GTVA 4RD2A 1S96A 2J7KA 1AA9A 1G6OA 4C0LA 1EFTA 1QHYA 1Z0DA 5ELXA 1E1RA 3AVYA 4HB2A 5L8VA 3VR5A 4A8JA 3K1JA 3RS0A 2QBYA 4GNKA 4A36A 5TVKA 4L9WA 2VYFA 2FPLA 4KYUA 5JSZB 5UKDA 4PSVA 1H8HD 4LHYA 5IRCD 2GEUA 3MWYW 2RGNC 1HE8B 4C9BA 1KK0A 2QMUA 1NL3A 1W1WA 2P6NA 2QA5A 4V0NA 3NWJA 4TLDA 5J40A 1IHUA 3VU9A 2QTFA 2IHYA 3IHWA 3GLIA 2XJ9A 2GK7A 4KFTA 4Q01A 4Q7LA 1TF2A 2YOGA 3WNBA 2ZITA 2ZRJA 1TX4B 3REGA 3PUXA 2X1VA 1ZM7A 2AK3A 3L82B 4AYTA 1VPLA 3THXA 3NBFA 4JL8A 3G0HA 1U98A 2IXFA 4R98A 3ND8A 1E9CA 1GVNB 3ADDA 1NJGA 3QXSA 1T8TA 1II9A 2QI9C 3UANA 2R44A 3S1AB 1HUQA 1RRGA 4KFRA 3SYKA 5KSZA 1NVVQ 4TQ9A 2R6DA 1NMZA 1A2KC 4Q9HA 3KFXA 5L3SA 5KOYA 4TMZA 5DSZA 2PEZA 2NO0A 1SHKA 4Q21A 3SS8A 2NOAA 1LS1A 1F2UB 5GJVC 1S0UA 1CJKC 1S9DA 1OIXA 5FPKA 2JLYA 2H57A 4TMXA 5H70A 1JB1A 3PV0A 1IN8A 2DR3A 2PLFA 3CIOA 1GG2A 4GDFA 1N6PA 1YU9A 4AD8A 1IXZA 2V7QD 3G5UA 4RCZA 2VPPA 2YOFA 3QF4B 1ZAKA 3IHLA 3VR6A 2O5VA 1XB2A 2IS4A 1NLYA 1R5OA 3TLXA 1AS2A 3UG7A 3BGWA 3BFVA 4LBVA 1PZNA 2PZFA 2ZROA 5SZHB 1VIYA 2Q6TA 2PEYA 1IN7A 2G6BA 3VKWA 3GJXC 2DB3A 4L9SA 3X1XA 3LAWA 5JS8A 2AK2A 1XZQA 3VR3A 4A2WA 2H16A 4MQBA 3BB3A 2PMDA 3P32A 5IT5A 1OB2A 2AWOA 4A0RA 1OKKD 3QKTA 3QXXA 4H1VA 1D2EA 1XTJA 2GXAA 3QI2A 2DFNA 1TAGA 2JJ1A 2CXXA 4HDCA 2KJQA 4KU4A 4NMMA 2O8BB 1YQTA 1G41A 3K9HA 4NCIA 5FPHA 2BIFA 3CB4A 2Z5FA 3U60B 4QNRA 1CU1A 1CRPA 5L3QB 1T3SA 4HZUA 2VHUA 2X77A 3QE0A 4D2IA 3GPLA 1N6LA 3OIYA 2IEYA 1TTTA 5KYKA 2Z4RA 5KTYA 2HEIA 1D2NA 1UFQA 4D0GA 5JEEA 4B3CA 2H17A 4PQYA 3W90A 5BWMA 4UNNA 1DAKA 2AXPA 4OK6A 4OHXA 4UNPA 2PX3A 4P4SA 4KI0A 4LPSA 5J4YA 2O8EB 1F5NA 2BBTA 4W5HA 2ONJA 5EZ5A 3W8RA 1CR2A 4C0KA 3IGFA 1KI9A 1W0KD 3OEHA 2GHIA 1R7RA 2C03A 4MUAA 5C4MA 2QPTA 3T15A 1LV7A 2JLUA 2ZRPA 3THWA 4HUQA 3VQTA 4GSYA 1T6NA 1X1RA 1Z3IX 2ZRNA 3I62A 2EFCB 3ETLA 3WMFA 2WWYA 3LV8A 4JLVA 1JECA 2ORIA 4JLKA 1COWD 2A5JA 4EIWA 3EPLA 2W2TA 2OO7A 6Q21A 3GJ5A 3HP1A 4A92A 2HF9A 1OXVA 4DKXA 3QKRB 1NMYA 4LJ6A 2D62A 4ZKEA 2QAGC 4FW9A 1JALA 2ZE5A 1WBDA 2WPDD 2J46A 2GNOA 5B58C 3Q8XB 2QRZA 3U6BA 3AF1A 4PPQA 1XCMA 2EFHB 4DB4A 4FCWA 2IK8A 5JJIA 2OXRA 5FFMA 2RH5A 4RFSA 2QMEA 3EZ7A 2WWHA 1NBME 2FA9A 5EUQB 3MRSA 4YMSA 3WRXC 3T5GA 4IOKA 5LB4A 4G5QA 4NBSA 5ANRB 4TL9A 1ZC4A 3SBDA 1RYFA 1V43A 2BMEA 3PVSA 2ZVPX 1E2QA 2YWGA 4GP7A 4HI0E 4QBHA 4V0LA 1Z6XA 3KQHA 1ZM2A 2OBNA 1QHNA 1VECA 4CEJB 2CHVA 4TQAA 4ZCLA 3KJHA 3Q5EA 3UXMA 3U61B 1NLZA 5H8WA 4Z8XA 3SI7A 2BWJA 4PC2A 5SZIA 3K70C 3OE7D 2CK3D 2OBLA 1RIFA 4FMCB 3OEED 1OJLA 4TTQA 1G7SA 4I4LA 1ZRHA 1GL7A 1E1RD 1KY3A 1ZUHA 4D25A 2AFIE 4MGYR 4OKSA 1VDZA 3K0CA 3P26A 4DB2A 4URYR 5HZKA 4G5SA 4MRNA 4B43A 1G5RA 3CKLA 4TYPA 2SHKA 4QXAA 1QBKC 4LHWA 1UBEA 2H1LA 3AUXA 2BOVA 2AD5A 1XD2B 4DLVA 4MKIA 1CKEA 2OHFA 4QHSA 3C14C 4XVUA 2JJ2D 2XTNA 3RANA 3TQFA 1Q3TA 4XTRA 2GDJA 4GT1A 3PIRA 2IHBA 3DMDA 3NHAA 2A78A 3CM0A 2QPAA 4C2UA 1QDEA 2GESA 4DDTA 2REXB 3I92A 3ZD7A 4HSEA 1FNMA 4X8OA 5CIQA 1XJCA 3R7WB 2ZAOA 4AURA 3IIMA 4BFXA 4YQFA 1SGWA 3GLGA 2RCNA 1E2MA 2EWWA 4ZDKA 1MO4A 2GJSA 2FEOA 3OESA 4KLZA 1BOFA 2ZS9A 3BD9A 4HB4A 3L2OB 3S1AA 3WBKA 1PVOA 3VFDA 1XXHB 5JEDA 4F38A 4ACAA 2GWHA 3P4XA 1BMFA 5H68A 1KI4A 4UJ5A 4A6PA 1E9RA 4M1KA 4UJ3A 5FBWB 4V0OA 1XXHE 2Q9BA 2O8DB 2WJYA 4HLUA 1KK3A 5JCZA 1KOFA 3FHCB 2WICA 4OQNA 5FOUA 4BE7B 3G82C 1BO6A 2JDIA 2K5UA 2AHOA 2PH1A 2DBYA 4KBGA 4DDVA 4DIDA 1VIAA 3C4JA 3BIFA 5CITA 3QF4A 1IJFA 3AF2A 4IJMA 4BLTA 3TR5A 4IDQA 3U3KA 2KSQA 4DSTA 2C9OA 1OLOA 5FTNA 3H86A 5IK2A 1CR4A 3B85A 2X8AA 3CLVA 3BWDD 2GCOB 4B32A 1MABB 4I99A 3B9PA 5HE9A 4N1AA 4OQMA 1FPMA 2YZ2A 1GFIA 3QEOA 4BLSA 3L8YA 4KSBA 2F9MA 1Z6YA 4UNQA 2XNDA 3EWAA 4Z8YA 5C4GB 2G0NA 1QHIA 2ANCA 5G3YA 5AUQA 1U0JA 4DRZA 1MV5A 2L0XA 3SFZA 3T1VA 1E0KA 1W4BA 1Z0IA 1EFCA 1Z0FA 3K0FB 4NYMQ 3SYLA 1XTKA 1KZ7B 4F91B 1UAAA 1XTRA 5DH9A 2O0KA 3AKCA 1UADA 1JR3D 2C96A 3AQ4A 4JLNA 2WJVA 2JJ1D 3MD0A 4PTLA 1G7RA 2JCSA 4LV8B 3TGPA 3I5XA 4ESVA 2YKGA 3HDTA 2LCFA 3KQLA 1HH4A 5JJLA 2IYUA 2QGNA 4WOPA 1A5TA 1KSJA 2Z83A 4TYYA 2ZR9A 3QXJA 3O8RA 1P62B 4MRSA 4XIGS 3A36A 1N25A 4TYQA 3FMOB 2IUUA 1YZNA 4HAVA 3HYRA 2IYTA 4BLPA 2PT7A 2OCPA 3SE0A 2MSEB 2CCKA 5KU1A 1RKBA 3ICQB 2ZI6A 2IYXA 3CW2A 3QIAA 1L4UA 3AP3A 5EE5B 4DSOA 3ADBA 1NVWQ 3MWKA 2RHMA 1T5IA 1SXJA 3K53A 4NCNA 4ASUA 3ZJYA 2YC4C 3BRWD 1ZD1A 5DI3B 2C78A 1DAIA 1EFRA 2FZLA 4GRAA 3U7HB 1E2HA 3J81k 2I4IA 2IXEA 5EXPA 5KSPA 4D26A 1VCNA 3GJ0A 4HDOB 2P6UA 3ZS9A 5A4JA 4P4UA 4DIEA 4BUJA 3GD7A 1DOAA 4NYJR 3B8HA 2FFAA 4DEYA 2J59A 2W2VA 3W8NA 1E2IA 2J7PA 1EESA 2CVFA 2P67A 4O2RA 2J41A 1P61B 5HCNA 3VR2A 4LV5B 2AX4A 1AN0A 2KBEA 3V4FA 2J0SA 2CE2X 1J2JA 1DVRA 1VYTA 1W7AA 3K09C 3ADKA 2BJVA 2REOA 1U8ZA 4TMKA 1VHLA 4XSGA 2R6CA 4QOSA 4M8NE 2ZI7A 3RC8A 1YE8A 4NYIQ 3NDBB 1F2TB 2YOHA 5KO2A 1U99A 4HAXA 4MYTA 4ARZA 2CL6X 3ZDQA 3U7EB 3CF0A 5E7JA 4Z1MA 2CCJA 1CJTC 4OQFA 2V4ZA 3GJ7A 2VP0A 3SU8A 2JLWA 2XGJA 1OYYA 5CB6A 3GCGA 1U2RA 2I1VB 4C0BA 4U7DA 1W2HA 3L0OA 4TLAA 4EUNA 1VYVA 1DEKA 2R6GA 1EWRA 2GZDA 2XNSA 3F8TA 5LBIA 2OCBA 1GL6A 1GRRA 3JZAA 1D8TA 4TQUS 4OQLA 4DLUA 2DPXA 4C0JA 2VHQA 1NNEA 1M6NA 2W0MA 1AIPA 2ZR0A 3C8UA 4M1MA 3KKQA 2NPIA 3GQBA 3KXIA 2OFXA 2ERYA 4IXMA 4FIDA 4HAUA 4CRWB 4D0LB 1Q1ZA 3KTAB 3QJYA 3L43A 4B6EA 4LJ5A 5HPYB 2GTPA 5FOVA 1JNYA 3HU3A 4BFSA 4C3ZA 2G77B 5JBQA 4RD4A 2JLRA 1XD2A 3GLIE 2FEMA 2PJZA 2B21A 4PZZA 2CBZA 2QAGB 3TNFA 2JIZA 2ORVA 2IYRA 2XSZA 5DO9A 1DBSA 1NY6A 1O3YA 4PXAA 1RW4A 3U2QA 3K8YA 4UQOA 1HYQA 2IWHA 3RVBA 1SVSA 2A30A 1GDDA 1YR6A 3VR4A 5B64A 3LVQE 3WRYC 4MA4A 2VHJA 4BLOA 4ZV4A 1I4LD 1EFHA 1KAGA 2FF7A 4GP6A 5DYGA 1OF1A 5EE1A 4AY2A 1UDWA 2WMNB 3JZMA 1M34E 4HAZA 4BASA 1X86B 3ZLJA 3D8BA 1XMJA 3RSLA 3CRW1 5JHHB 3C41J 3IO5A 4R2IA 1CP2A 2X2FA 5AJVB 1A82A 3UG6A 3K9GA 5HTKA 2HT6A 2ZIAA 1IN4A 3ZS8A 621PA 3T61A 2PT5A 2Q3MA 3VKGA 1BMFD 4A4DA 5JRZA 1WDTA 2WHXA 3K70B 2O8DA 3FWYA 3EWSA 2OLJA 2P3SA 4C0QC 1HE1C 1AZTA 2ZE7A 3B9QA 3OIWA 5AJYA 3RDPA 2XJ4A 1W36C 3A4MA 2ODBA 1MO6A 1QHSA 4GI7A 2YNMA 2ZSFA 3R9IA 3AGPA 2N42A 4V0MA 1FP7A 4OK3A 2X2EA 1YZLA 4ZIRB 2IUSA 2WJIA 1QHHB 1KAOA 1M7HA 4FMDF 3B60A 2RGNA 3FHOA 4P3YA 1GP2A 4Q7KA 4W9MC 2YC2C 2IYSA 2P5SA 1X1SA 3KJGA 5JWHA 2YWHA 1OHHA 2VQSA 2YWFA 4QBGB 5JMTA 4LJ4A 3R9WA 1XEXB 2H7VA 1Z08A 5CB8A 1Q1BA 4B71A 2O0JA 1MABA 4XWOA 4XVRA 3SR0A 2W83A 3FKQA 2VSOA 5FL7A 4BZXA 1KNXA 3IPXA 1QVRA 2BCGY 1N6NA 3CH4B 3GLFB 2JASA 4Q4AA 3U6KA 2CEAA 1CXZA 4HEJA 1CS4C 4LYAA 3BFXA 2HT1A 1U9IC 3WMGA 2QG6A 4J0QA 1F3OA 2N46A 5JHGB 3AVVA 1SVWA 2HLDA 1C1YA 3ND9A 3LLMA 2OM2A 1G3MA 3RRYA 1JEEA 1L7VC 2ZXUA 4BWYA 3BH0A 2OE2A 4P4SB 1MKYA 4ILEA 1KK1A 1P75A 2RGEA 4JIMA 5JZVA 3EPKA 3CNNA 3CNLA 4GPTA 2ZSDA 2FMXA 4XWAA 1EWQA 2QUZA 2QT0A 3B78A 1T3HA 4EFNA 2FPKA 1EX6A 1DO2A 1KI8A 1MO5A 3BH6A 4PO1A 4JLDA 1E4VA 1GKYA 1WQ1R 1E2DA 1E32A 1OIVA 2O8CA 1KJZA 3THYB 2ATVA 4BZQA 2NO1A 2GZAA 2HJGA 1Q1EA 2GBLC 2Q9CA 3B1YA 3PUVA 2PL3A 2AWNA 4TTRA 2J0QA 4Q66C 3FGNA 4G0NA 2W0SA 4JT2A 5DI3A 3Q85A 2D06A 4K81B 1S3SA 5EJEA 2XXAB 1E1QD 4E07A 2RMKA 3BJIC 1UM8A 2B8WA 1EFRD 1D5CA 3KX2A 1G4AE 1VYUA 3M6AA 1XTSA 2AXNA 5GADl 3ADCA 4RFSB 1KY2A 4JLMA 5J4HA 3AM1A 1L8QA 2W6JA 3LO5A 2B7BA 2GK6A 4A2QA 2J7PD 3UKDA 4KODA 2VP9A 1N6KA 2Z6VA 5L3VA 2FX3A 3K9LA 3BERA 1W49A 4P0TA 2CDNA 2RB4A 4MKHA 1F2TA 1ANKA 1WE2A 2ZU0C 2MMCA 2AFHE 2ZRGA 4N3NA 4MGIR 3O8BA 5FBLB 3CX8A 3LRPA 5F2EA 3ZZUA 4PFSA 2NG1A 1CJUC 1NJFA 2ORWA 1EGAA 2E87A 5H1YA 1HTWA 4LYHA 3HPRA 3W3AA 4Q4HB 4Z1MD 1B0UA 4Q1DA 3A6PC 1KKLA 2IBMA 4FMCF 3DEFA 3NXSA 3MLEA 3EC1A 5FOSA
chains in the Genus database with same CATH superfamily
1E2JA 3PSAA 3I01M 2BJHA 3VNUA 2J0VA 1U2DA 1AE1A 2OA0A 2POQX 3MMNA 1C7EA 4WFIA 3MWEA 3EHEA 4TMTA 4M9XA 2CNWA 4LMPA 5C18A 4LOLA 4OAQA 2IU0A 1WPRA 3F1KA 5AKZA 2PKWA 5KTOA 2EL7A 1F8FA 1R8QA 4V03A 4EPWA 3AL0C 4CFSA 3NONA 3GDFA 3HI4A 4UFNA 1TC2A 1P6QA 1XA3A 1A8QA 2JVKA 4WERA 4R9SA 2HRZA 3IBYA 2VG8A 1CTQA 2OGUA 4MRAA 5FRDA 1BEZA 1GZ5A 1PFVA 1QIHA 1Z0JA 2P6MA 1CUSA 3JZDA 2O2IA 3UO8B 2F3UA 4CVNA 3U7FB 3HB0A 3L06A 5JS7A 4E6EA 1TA9A 3LLCA 1VBNA 4J2TA 1CQPA 2G3YA 4IQ4A 1LLQA 4LTMA 4Y7DA 1AKWA 1P1HA 2BFCB 2C98A 2OG2A 1HI9A 1YDWA 1EE2A 1Q12A 2YYAA 4TWZA 1QFJA 1J25A 2Q99A 2H8KA 2ZRCA 4OVKA 2ZUCA 4B45A 1NF8A 2I4RA 3ECCA 4CT5A 4QDOA 5G3ZA 2JIZD 4DPLA 1IQPA 5JMPA 4NCBA 2QUAA 1QKIA 1SUCA 3PPXA 5JRDS 2E4XA 3DOFA 2FPIA 1T4BA 2YWXA 1TI7A 1CEXA 2BTOA 3K9CA 4D9CA 2ZUBA 3ESCA 2RI6A 2ODTX 1PZMA 5CW1A 7ADHA 1XKLA 2PMEA 3SZGA 4AJEA 1X38A 5EXEA 4F2PA 5EZSA 2OK7A 3FCUB 3VR4D 1H69A 3G02A 1JDZA 2PRIA 2VP5A 3ZXYA 1AGPA 4YMIA 3PPIA 2FGJA 2CL0X 2YXLA 3I6IA 3IH5A 1DG1G 5FKJA 5I7OA 1O0BA 5KQPA 3LT1A 4BMDA 4YRKA 2QT9A 1PDVA 1FP6A 2OESA 2NVUB 1X8LA 4D6PA 2W6ZA 3QLUA 4RY2A 4KREA 4QGHA 2XCTB 4C06A 3DT9A 3IIKA 4QNMA 5AVVA 1CF4A 3WQSB 2HNBA 4IJQA 3M9WA 5KNDH 3CH7A 2GD0A 3KUCA 4TXJA 4PHGA 4PNHA 4IH4A 2PUJA 4V0SA 1NW7A 3PUIA 3EC7A 4ZARA 5EHZA 2I4NA 3RIMA 3J80A 4DV2B 2HA4A 3VNSA 5JSHA 2C5HA 1L3CA 1Y82A 3KUKA 4AJHA 1U5CA 1JE1A 4EDHA 3HTXA 2X2PA 3OZFA 3T4PA 3FXAA 2C7QA 3CLSC 3IA2A 1YZYA 2KS6A 2VTKA 3EIEA 1D4ZA 5BSGA 3GJ3A 2RGDA 4XWKA 5KNBH 5P8WA 4X63A 1UBCA 2EP7A 2OCKA 4QU0A 4D1YA 3REQA 1CUHA 2DQZA 4MWOA 5AKGA 1DIHA 1D4FA 1Q14A 4M9ZA 1XEXA 2O4UX 5HF5A 3SFTA 4W1PA 5C8VA 3VNRA 3H2JA 5HKLA 5C31A 1OHHD 3LCMA 2PGIA 3I1JA 3F9CA 3HFGA 3I04M 1X7ZB 3SICE 4ZJZA 4LF5B 3WLPA 2QV0A 1XWIA 2VP6A 3VX4A 3QPAA 4EFLA 2DPYA 4HGRA 4FD2A 3ZHXA 2A33A 1JGTA 2ZSHA 3KP1A 2D2XA 3UBTA 3IURA 3QOFA 2SCUB 5HJEA 1JHUA 2WG0A 1FDUA 1N8TA 3RAEC 3EGVA 4PGFA 3CG0A 4XARA 1D0IA 2GAAA 3HR8A 3VDMA 1BGVA 4BX0A 3D6MA 4CZ2A 5CFLA 4Q05A 4EA8A 2EKZA 3NYRA 5F2KA 2GHQA 1F1BA 4MUBA 2ZVQX 5B12A 1IXSB 4CPDA 5JAHA 4R2LA 4AZSA 4C87A 2G4LA 4G5RA 4HS4A 3RLFA 4XRGA 4W5QA 3REFA 3DNMA 4BNUA 3GR6A 3QLEA 4I1YA 2HA3A 3JQ8B 4NQRA 4YCNA 3F9RA 4IVNA 1E20A 5CPFA 4FFOA 1GWNA 2MSCB 2GHTA 2WU0A 2MSWA 5IP5A 1NQOA 3ZWNA 2X42A 1L5VA 1BEEA 2HMSA 2PMKA 1M75A 1NUUA 3QELB 3TVYA 3T5PA 4INAA 4S2UA 1W36B 4DDHA 3DKPA 4M0DA 2IBTA 2VJNA 1QZ3A 1KMQA 3GRKA 5KVVA 5J2UA 1IBRA 4RPCA 2HCTA 3W4KA 4DJAA 4F7DA 3M7IA 4R31A 1RBMA 1SXJE 5HEKA 2C0QA 2CV1A 1X3SA 1QG6A 3BCSA 4QZVA 4KAJA 4PS1A 3GNTA 1S2MA 1WOMA 1SQSA 2VT3A 4FKZA 5F2EA 3RVRA 1N0WA 1QIMA 3D6FA 5B1EA 1BFDA 3WXBA 1NUSA 3UXYA 5KYGA 3DHEA 1GZVA 1F12A 1N2CE 3L9WA 1JIIA 4ZALA 3TL6A 3D0RA 4LX0A 2XYVA 3QGMA 4JJ8A 5C37A 1TJPB 1KDOA 1GA6A 4WXYB 2XNHA 1P5HA 1V25A 3IQWA 2CL7X 1JILA 3RBVA 4A10A 3QW2A 5TSDA 1CY4A 4GOXA 5IKMA 3C8MA 1PTKA 1KJYA 4HQKA 5F3DA 1E6EA 5DIZA 2HIAA 3PWZA 2ZRKA 4CIWA 1DTWB 2CHQA 4DS3A 3FWPA 4OAOA 3QMWA 4Z1OA 3A1UA 1KTIA 1N2BA 3LMKA 1OZGA 4EY3A 4MCIA 2FN4A 4GGMX 4IMRA 1R0BA 1SQFA 2DQYA 3H9UA 3VYVA 3EVGA 2O05A 1SHZA 3LBHA 1F9AA 1DJOA 1E4YA 2HNKA 2OV4A 3RTAA 4XCQA 1N6RA 4FSDA 3G13A 3T94A 1PGQA 1VP3A 5ARCA 3V1UA 4JLWA 4Y2RA 3T5BA 3WL8A 3F46A 3PC4A 2V7BA 1R0CA 4GMXA 4JOBA 3W2EA 1F4PA 1FDVA 4CMAA 3PA8A 5FTLA 3BWBA 1I51A 4H7PA 4CIDA 5IWAB 5F9HA 3PIDA 3V32A 2YVUA 4Z2AA 5H80A 2G67A 1NVDA 2DPLA 4AZ0A 1X9GA 3WIBA 3W5JA 1XDUA 4C2AA 1Y7LA 2B4RO 3BB4A 4IWYA 2O3TA 5CDFA 2I5PO 5JD6A 1RYHA 3C87A 1N3BA 1ARZA 2OO3A 2QENA 4W9NC 4F6RB 3FWHA 1PJSA 1Z12A 3BA6A 3URKA 1PEDA 4BKOA 2PKCA 4U9IS 1D2CA 4RACA 3R3JA 1JG6A 1YR8A 1XMSA 4TL7A 1UBNA 3V2UA 4EAQA 2EWMA 4DWVA 4E88A 1LCIA 3G5AA 5LMNB 1G9TA 3EZFA 3LP6A 1TD9A 4D4LA 1EWVA 3RVDA 3H42B 2EHJA 3CLUD 4EPYA 4DGSA 3ZVRA 1PEAA 5LL6P 1N8SA 1NBHA 3GGCA 4I55F 3SHVA 3WOVA 4L2IA 3QVMA 1MQSA 4F1WA 2UYQA 2H1VA 2IOYA 5H81A 3KVRA 3FHLA 2BKEA 4NBUA 4JBWA 4IIXA 1F6DA 2WDZA 3MWGA 2B37A 4DR7B 2P6OA 3MINA 2PSJA 4RX1A 1XPUA 3TTTA 3CNQS 3PHHA 1Z63A 1FVXA 2PCLA 3EIXA 3G2LA 3L79A 2VF2A 3ED1A 2P91A 4Z3DA 3UK7A 1ZAYA 1LX7A 1QHXA 3OZGA 1SPBS 3PL1A 1VJTA 1U0BB 4MV5A 3ZBPA 5ICSA 1EHIA 2Y2VA 3BWMA 3CWCA 3E5HA 4IQ0A 4IIYA 4TT3A 1DC4A 4URUR 1AZSC 4LJRA 1RWVA 4CJXA 5CA1A 4R9UC 4WESB 2O14A 3CLRD 4Q03A 2JLAA 4EHIA 2HSDA 2NIPA 4CIBA 3PXCX 2R65A 3NTVA 4WOCA 2W93A 4RV9A 2XOKD 5AMXA 1C3OA 5AOBA 2PZGA 3E82A 4MITA 3OPNA 1RR6A 2ZJFA 2A9QA 4BAZA 2GUWA 4XDHA 2B7CA 1DO0A 1FNBA 1M54A 4YLGA 4ZTBA 4BGIA 1NZFA 2O2CA 3I12A 4D8XA 1AQJA 3LLUA 3RRMA 3HMQA 4X1IA 2UKDA 3ANSA 4IKOA 3HCCA 4KBFA 2GM5A 5LU8A 3K7EA 1YUNA 4FUQA 2OYSA 2VJYA 4MDYA 1RZRD 3K16A 4GEKA 2WSSD 2CDAA 2X9GA 1ZS9A 3TZKA 4DUPA 4K1XA 2HK9A 3EIUA 5JSQA 1H2BA 3QQ5A 2WJ6A 1NNI1 5CAEA 3N6RA 4V0ME 4O4HF 3PP8A 3G59A 1E66A 3ASZA 1L2TA 3DV0B 4QYTA 4RJTA 2Z6UA 2JKYA 3BGSA 2YZKA 1EA5A 1R37A 4GLOA 4MV0A 1I4EB 5EJ8A 3K0HA 1OWNA 1UPBA 4QG3A 5EZYF 4MWZA 4KK4A 2P4UA 1U7PA 1C0IA 3V4SA 4IVQA 2FWAA 5EWJA 3H8JA 5GP1A 3KXLA 3MS2A 1Q7GA 3HA5A 2J5RA 5IDXA 1CUDA 2B94A 2IPNA 1E58A 4R2HA 4DEVA 3DOHA 5AM5A 1QANA 3OLYA 4DQDA 1BCSA 5IM4F 1JZSA 1NLFA 2F43B 4YAUA 2XUKA 1QRDA 3AOEA 3TINA 4KPEC 2RFLA 1YFLA 4FB4A 3G2KA 1J1IA 2DWCA 4UHDA 1M6YA 2R79A 4AJ1A 3ME5A 5EN4A 2PDAA 4L27A 2ASEA 3ABOB 5DE3A 1DKQA 2HGSA 1KXZA 1ESMA 1AS0A 1MDBA 3D6JA 4NPAA 3NEYA 3CZRA 1NOKA 2PN1A 1P72A 2Q0XA 1OFHA 4RVHA 2HOQA 1CK4A 1JWLA 4ERXA 2A84A 3FMGA 1LK7A 1H3EA 4IKPA 3D6TB 3T4UA 2NQ8A 5A9TA 1ZVQA 5E6SB 5FLKA 3TG8A 4WBNF 3C98A 3RQIA 3OAAD 4CTNA 3EJ6A 1OYOA 1UDAA 1U0SY 2JCBA 3KDSE 4IRXA 4KWEA 4CKCB 4XD7D 1PK8A 1QZXA 3WNCA 2G8LA 5A0TA 4DNQA 3KDAA 5BR8B 3DQZA 4HVAA 1T5LA 4P7GA 1G21A 2CV0A 4OQXA 1DXQA 4HP8A 1Z74A 2C4HA 1KGDA 2HBZA 3IPYA 3O83A 1I2CA 5K3EA 4IX1A 3ONEA 3OEHD 1BGWA 4M55A 4C6RA 1LDBA 1DSSG 3CPSA 3COPA 1PV1A 4A0GA 1J8FA 2IEDA 4IIJA 4RJIA 3T06B 2FUG1 4DMCA 3WS7A 4DBLC 1DRUA 4ZICA 4O1MA 3KPUA 2OV6A 5FAKA 4LVOA 2ZS8A 3RWOA 1A4UA 3B1FA 3EAQA 6CHYA 5IC6A 2R25B 1NXSA 2IXBA 4RZXA 4ZQCB 4NZYA 1TIBA 1E6MA 1R9MA 4CEHB 1EP3B 3FPAA 4OHMA 4US2R 3AHFA 3R9KA 2PKEA 1E1KA 2BAGA 3C6ZA 1XF9A 1L4YA 4YJDA 1I9CA 2VJQA 3O3MB 4OHZA 3RU7A 1D6JA 3HEAA 4HBGA 4X1YB 3UMCA 1G9SA 4XGRA 2DYKA 4IX9A 4LJ8A 1OI2A 1KK2A 1F4VA 4B35A 3BJEA 4KBYA 1RZUA 4XRRA 4UD6A 3O4IA 1EQUA 4YV7A 1BW9B 1C1XB 2CB0A 2ISCA 2XCSB 4OLHA 1FUKA 2R0QC 2YMMA 1KYWA 1QQ7A 4G4SO 1M5RA 3LUJA 5GPBA 1U4OA 3I2FA 4L8FA 3DE0X 3HYLA 3LDAA 3HO8A 3DS8A 4X93A 4RQBA 3ICVA 5EE3A 1K66A 2Q5QA 4ZAXA 3MMZA 4L15A 1T13A 3KQTA 2OMKA 5KQLA 4UOZA 2GTHA 3KVOA 3C6KA 3FYDA 3FDIA 3SSAA 5CCBA 1HZZC 4DLRA 1J2UA 4WOKA 3LCCA 4OLFA 1F0PA 2VA9A 3S7ZA 1YRAA 3COSA 4MAAA 2FR1A 1OXBB 2Q5OA 1IVNA 2EGHA 1XKTA 2VPYA 1NKSA 4ZQEA 3KOXA 3BQNB 3OF3A 3UV6A 2UUCB 3QNUA 1DXYA 3HB5X 3GLHA 4PQGA 4HXGA 1KVUA 4MW9A 4EKGA 1RAEA 1TVCA 5DM70 4IQ8A 1LW7A 4Y0AA 4DVJA 1RRFA 3I9JA 1DXOA 1XZJA 2FEWB 2YR0A 3DKVA 3ESQA 4ACBA 3D8SA 2MOKA 3O1HB 5FULA 1YI1A 4CKEB 2PV0A 1FJXA 3L7CA 5EIHA 4IIHA 5JAUA 3Q6NA 5JZMA 4EGFA 5JLJA 4CLOB 2R11A 4I4TF 3FSRA 3UPTA 3AY3A 4ADSG 2ADOA 2WFMA 4ZAWA 2MMGA 3PCXA 1NGSA 1Q1AA 2VDRB 2ZUEA 4Y0NA 4L8GA 1OV6A 3DE2X 2Y2UA 3IVXA 4LA4A 3WDKA 3CPHA 1AS3A 4N5HX 5EJGA 3BVPA 2F2TA 2ZBQA 2BYTA 2EU8A 3TMKA 5DCUA 1TA0A 4FHFA 5A62A 5JNSA 1A1VA 3DZIA 4I5EA 2PR2A 1G16A 5JG7A 8MHTA 2C31A 3TW4A 3IBGA 4GUDA 4CODB 2WD9A 1P5FA 2QV7A 3GEBA 3BE4A 3ONDA 4LV6A 3M3HA 3D8RA 5FI0B 3LOUA 3ZZ0A 2AOUB 4FFLA 4KNWA 2AOTB 4DUZB 1GGMA 2AUMA 5F7ZA 3DMFA 2ZJ1A 3H2IA 4YI5A 2C77A 3PR3A 3DFFA 2VIIA 3HKBB 5KS2A 2AS0A 5CW2A 1M7BA 1UEJA 4N41A 3HRIA 4WQMA 4OBWA 4XEHA 1HGXA 5CXXA 1ONBA 3WAJA 4N0QA 4M0LA 4RKYA 3M9LA 2QP9X 2QJWA 4XB2A 1HRKA 1ML3A 1S2GA 1FX0B 1V8ZA 2OT3B 2YW2A 1W48A 2BVNA 4Q4DA 5EIEA 2J3QA 3UB4A 3NT5A 1AJEA 2D13A 1SG6A 4MVJA 1RI3A 3KCQA 2DT8A 2NYAA 1NPYA 5AI0A 4G67A 5GV8A 5JSKA 4DA4A 1FVFA 5DRYA 1A96A 1U8AA 1J97A 1QHFA 4M0KA 1YQ9A 3PNSA 4K9QA 5EXTA 4JC5A 5F78A 4YP0A 1UKEA 2J0UB 1CETA 2QE7A 1YRYE 2JZNA 1SELA 2HZ7A 2J1LA 2ZSUA 4RH0A 5JDIA 5T64A 4QJ5A 3C70A 5IK2D 3EQZA 3H1FA 1FRNA 1M83A 1EXVA 1RAFA 1PFUA 2JJQA 1QQTA 3L02A 3QOXA 1DAFA 4GPZA 4N3GA 4O2AB 4TTSA 3G6WA 4EECA 3UMRA 4YXFA 1ZNYA 4PPGA 1QORA 4KAXA 4YONB 5I4CA 1VA5A 1Y63A 3FIUA 5AQEA 3WO1A 2NP6A 2AF4C 4GHWA 2Q9AA 3MBIA 3SD7A 3I6BA 3AHJA 5EIBC 1Y8QB 5A3SA 4EF4A 4EG3A 2WIBA 2QLMA 3F8WA 4ESEA 4Q3LA 3SF8A 4BIMA 1DNPA 3Q15C 3S6JA 5L3RA 3WHKA 4OM8A 3E22B 2C7BA 1GQFA 2G07A 4MNTA 5JH7B 3F2VA 4Z5XA 4B4DA 2O3JA 2Q3BA 4MINA 5KOHA 1LW6E 1XRQA 1UIRA 2A9PA 3O1LA 4IRMA 4NH0A 4O4IB 3VSAA 4XCXA 2Z2YA 1C4XA 3DHNA 3WGGA 1SVIA 2F00A 2V9ZA 3A9WA 4Y2YA 1XTTA 3UKOA 4FVTA 5BURA 3U4MA 5DYWA 4A5SA 3SP1A 4CEIA 3I28A 4QYMA 2Q4OA 2C83A 4FDLA 1V71A 3A14A 4HDNB 3KLBA 4RH1A 5E9AA 4WECA 3E48A 1D6SA 3M89A 4XYEA 4JI4B 5H83A 2FQQA 3QX8A 8ATCA 4ABYA 3O8DA 1ZL2A 3GNSA 3JQFC 1FP1D 3P20A 4G6ZA 2ZJOA 1WUIS 4XKJA 5EIOA 3GO4A 2EDAA 1YWGO 2QRLA 4QYXA 1NMEA 3N0RA 2VJLA 4E2ZA 3DXZA 4GPIB 1JR6A 4IWNA 1QH0A 5GVRA 3HN2A 2AJLI 4EDFA 4D9BA 1SKMA 2IP1A 3NHKA 3EFHA 3WKCA 4EHLA 2QRNA 1L5YA 3RVLA 1GITA 1S8FA 3M4YA 4B73A 4EJ6A 3W3ZB 3A7EA 4EYEA 1R4AA 3HCWA 1KAQA 3L84A 5LXTA 1E6LA 3RC3A 3CVXA 1JXMA 2VXCA 2HMVA 1A9PA 2GCPA 5JVDB 3WIVA 1LFAA 2D54A 5FPQA 1QHEA 1HYEA 2Z8XA 3OIFA 4EF5A 4M88A 4JR0A 1UT5A 1P0CA 4ZXFA 2ZRAA 3BREA 5AI5A 2WPDA 2I87A 3LW7A 3OZCA 1GUAA 1TRKA 3A25A 1GNSA 3FKJA 3C3WA 2IE0A 3AI7A 4PPYA 1K8YB 1LLCA 2Y93A 4X00A 5PGMA 3PTZA 3R3WA 4A73A 3D64A 3ZBQA 3HBJA 1K9VF 3C2QA 3IUYA 1GT91 4N5NA 3SMVA 4ODIA 3ZE2B 3ZXUB 5LQNA 3ETEA 1UPCA 3DWGA 3EVZA 4NZMA 4MK4A 5JALA 4GE0A 1Z28A 2NACA 1ONNA 3G89A 5DISB 5A5EA 1LBEA 2W2XA 1GYQA 4RK7A 4C01A 3JAWB 5K0BA 2AVNA 5D87A 3G7UA 3VR5H 4IGFA 1Q17A 4LZNA 1QG2A 5KDOA 2JLXA 3IMKA 1JSRA 3Q0IA 3B5EA 4RETA 4CM7A 1L5OA 2DFLA 2FFHA 3QU4A 4BNLA 3S1SA 5KMGB 4R68A 4JI6B 3M82A 4RPIA 1MJ5A 1PSDA 5DZSA 4A1OA 2R2AA 1R74A 1CHNA 2ZR8A 3V8EA 3RGGA 2O2ZA 3WYGA 4FDUA 4A3SA 1Z06A 1AGNA 1KI7A 2P5YA 4GOJA 4TLEA 4TWRA 3FVTA 2PRSA 3SHQA 3R5SA 1S6YA 2J9ZB 2KI5A 3HZRA 1YB2A 5KX5A 3M6XA 4DLYA 1VG8A 3L4EA 3PNLA 3SC4A 3W34A 5DBEX 2FB9A 1AZWA 4WNAB 2QD3A 2WA2A 3I32A 3KK0A 3DLPX 4G5FA 4KVZA 2NUTA 4MA0A 1JG7A 4ZJUA 4H7DA 4X84A 4U63A 3V3KA 4PX3A 2M2IA 3FOBA 4JHXA 4RXMA 4ZQHA 4ZTZB 5C81A 3N74A 4AZTA 3IMFA 1CZOA 2VRWA 1XEWX 1CLEA 4M49A 1DKPA 2F1OA 3GPCA 3WJ7A 3L7NA 1Z7YA 3EMKA 4KN5A 1Y1TA 5D5HA 4Q39A 5GJCA 3NANA 5FTWA 2WWIA 2TECE 5AVZA 1ZJZA 1IUNA 3HB9A 5DN6A 5IKEA 4YP7A 1J42A 1P4SA 2I9PA 4ER3A 1U2SA 4HD8A 1WX1A 2VNSA 3D31A 4TM8A 5FR1A 2NPFA 4BVEA 4DA9A 3RM3A 1KP3A 2JIQA 4B47A 3VH1A 1R4MA 4YCSA 1DU4A 1A5ZA 3SIRA 1NF9A 1PJZA 3P4UA 4YACA 4HK4A 4CQMD 1UUFA 2PQ2A 3IEXA 4O08A 3NEPX 1FXUA 1Z4NA 2DECA 2VYVA 4FNOA 5CTAA 3NCTA 3MS7A 4BS9A 2SKEA 2WOJA 3FNQA 3G0BA 6PFKA 5BXYA 1Q11A 4RTKA 3RBXA 1PU2A 4Z0TA 1TCVA 1SXGA 2PU7A 3S27A 2BGGA 1O6GA 1FU7A 4IDEA 5LP1A 5FWXB 1M2KA 3UJCA 4MCAA 3LX6A 3TFQA 4U2BA 2C84A 3I1YA 4EENA 3VYUB 1C9KA 1COZA 3PXEA 4ESOA 1FUUA 4DCPA 2A0XA 3VKUA 3NGXA 4URVR 4HDSA 1KSHA 3PCTA 4X24A 1JR4A 1ZQ9A 2VPZA 1VBMA 3K1YA 3T4EA 4NL4H 5BY2A 2NO7A 1XPOA 2EAUA 2BL4A 3ZUPA 2YHUA 3CPEA 3N05A 2ATCA 1GPWB 2FPRA 3TOXA 1PWEA 2IKSA 2WIKA 4HG2A 4RSHA 4U02A 2UVPA 4HQ6A 3R7SA 3MERA 4W9NA 1UBHS 2YCLA 5H82A 1JVSA 5K7SA 4C14A 3KWMA 5CX4A 1BKYA 2ABWA 4JJ7A 4LHXA 3FWZA 3HVJA 5ED0A 2OKGA 5D01A 4LIPD 4Z3KA 4D3YA 2HRCA 3EA4A 2ENUA 3KQQA 4HNHA 2HHAA 3ZV7A 4KR6A 1PHPA 3D3EA 4B7CA 4DIBA 3ER9A 1WP9A 2NO9A 1G8HA 5KNDA 2PX6A 3A06A 3JY6A 3A9VA 1SOVA 2FNAA 3QFSA 4R9RA 3HS3A 2ZRFA 3ELDA 2PX0A 4QEKA 1ZESA 3JVDA 4W6ZA 2Q8NA 3G7SA 3ID6C 3UT5B 1LTHR 1EK1A 3AOGA 2YXDA 1GQQA 1TM5E 1XD9A 3RYHA 2FKNA 1MMFB 4BVLA 5HM6A 3WYCA 2HQ1A 1SQ6A 5LZ2A 2REQB 1V26A 3ONWA 4NJEB 3Q8WA 3CW9A 4A6XA 4EATA 1TQ2A 3KIPA 2C4VA 2PA0A 1JR3A 1JFFA 1T3TA 4ER0A 1OH6A 4BZWA 1WZNA 1CHDA 2VK4A 3AQIA 3IALA 3JQ7B 5SY9A 3TQIA 3IR7A 3VPBA 4RULA 1A8PA 2WF9A 3HWSA 4F5DA 2D8MA 1MNQA 5HQJA 5EP3A 4RESA 3UFBA 2EDCA 2HPHA 4CI0B 1O6BA 5DGDA 1V47A 3PQ7A 3BQ9A 4ME6A 3NH9A 3PT5A 1V0JA 4IZIA 2O8FA 1C1HA 4ARCA 1JI0A 5A3JA 1EDEA 1QWOA 3JQAD 4HQOA 1UZNA 2DUNA 5I9TA 2QM0A 4EA7A 2JK0A 2I33A 4J0IA 5AVKA 5ERGB 1NJSA 4B76A 1QCYA 5AI8A 1QOPB 1Z4PX 4Q3BA 5A03A 3FFTA 4NIMA 2LKCA 1ZK1A 3NAQA 3O1JC 5GJBA 1AQYA 2QR3A 4FW8A 3LT2A 5EE9A 3RE1A 1O7JA 1XI2A 4FU0A 4DQ0A 2XNKA 1KS2A 4M1WA 4WKNA 4BNDA 5J5AA 4FZVA 3RUPA 3R3YA 3EFBA 1K98A 2WB2A 3VSEA 1KI2A 3IB3A 4KRXA 1RXSA 1JAHA 4J7CA 2EFGA 5L7YA 3FMFA 1VXOA 1PLLA 1L5WA 2QQEA 3FI0A 3R20A 1EK6A 3Q5GA 4HPWA 1ZEMA 3TQRA 4M98A 2QMHA 1M1ZA 3I2IA 3M8KA 3L0PA 4YJFB 1VQ1A 5D3MB 2HA0A 4H7HA 1K06A 2VJMB 4URXR 1GPH1 5CA0F 4NYMR 4KHZA 5E9JA 2C7RA 3SZOA 3KQKA 4O25A 1IWOA 5AOCA 5EMNA 3C3JA 4Z0PA 1Y4DE 3KPYA 3UMBA 3PKIA 2JLBA 1YI0A 4MVJP 2NVUA 2OCXA 3F90A 3KT6A 4QJBA 2V1XA 3ZIAA 3IL2A 2E4YA 2WKPA 3HYTA 4OGWA 3AFOA 4U8HA 2Q6KA 1GRQA 2QJRA 3KTOA 4ZI2A 1EFPA 1TVKB 1CE8A 3TQTA 1PK9A 1R0SA 3SJZA 4HY3A 3UV7A 3ZVLA 4EZBA 2P5UA 4D57A 1UP7A 3BAFA 1WABA 3CXUA 4GLFA 5A06A 5A3VA 3VGJA 3ACDA 3K1ZA 1Y6JA 4N39A 2ZJ5A 3WWYA 4C0AC 3CEHA 4ZC1A 2GJKA 2QZ4A 3B6KA 1LX6A 3KKNA 1NM5C 2WBLC 1DS6A 2YUTA 3V1TC 8OHMA 5ADWA 2IUFA 2XT6A 1WSBA 4C78A 1XNJA 3TJMA 1NW8A 4MKFA 2AFVA 3RG2A 4DUGD 5DHAA 2IZ6A 4WY5A 1KIAA 2H65A 5ALJA 1PTJA 1P9LA 3ZKWB 5BQPA 5U4QA 4CMCA 2YDYA 2XUIA 3MFQA 3EPJA 4B6SA 1WOYA 1WM1A 2FW9A 1T8WA 4H3SA 4DJEC 3DPUA 2H1CA 4YCDA 3AF0A 5THKA 1KMMA 4TKZA 3SR3A 1WZ2A 4YLYA 5IARA 4PHTA 4RABA 3NH6A 1YCFA 1C30A 1RKVA 3VZQA 1Z7WA 4HUJA 3RIXA 1WZIA 4OPMA 2AFIB 3CSUA 1I3NA 3GV0A 3G79A 5LA6A 4B75A 2Q5CA 4OJQA 1RJWA 4YJ3B 3HXPA 4U2FA 3ODGA 4P5EA 3H6HA 9MHTA 3KSMA 4CKYA 1Q44A 2JEZA 1YHYA 4R7TA 1PG2A 1E5XA 4IDPA 1UC8A 5H4GA 5HQ3A 1BX0A 1E2EA 1I5RA 5FNZA 3SZ3A 1JIXA 4NAHA 3DE7X 4HLQB 5JSZA 1FXSA 2JIPA 3KSRA 4NOMA 2ZK7A 4G56A 1WKCA 1GADO 1Z56C 4W8OA 2NU9B 1EZ1A 3ZQ4A 2OXIA 4HEQA 2B3DA 2RGCA 4RA6A 2ISSD 2OVBA 3RRXA 2F67A 1KYXA 3LVBA 3CXRA 4G1CA 3CX7A 3RS7A 3UFXB 3DOEA 4LJ7A 4X44A 4YRGA 3K09A 4E21A 2WUFA 3KSBC 1Q1QA 4X1KA 4NYIR 1GCGA 3EE6A 2W8ZA 3VH2A 3KUDA 2QPLA 1E3LA 2VATA 1RXWA 2BRUA 4I5DA 4O6VA 3THRA 1WDWB 4JEHA 1JHOA 3LW8A 2XTAA 1NU6A 3EARA 2BFBB 4CTMA 4N0PA 1VJCA 4LXTA 2X9VA 3LYUA 4EPXA 4WCDA 3KFVA 2P35A 2ORYA 2FPXA 1RPJA 1JG3A 4F85A 4B6JA 3DMTC 5KTMA 4JA2A 4NMHA 3TWOA 2OCYC 3ZJVA 1XJWA 1M6VA 4IIFA 4AN0A 4D43A 3HE3A 3OZSA 4IKEA 5EVJA 5DEOA 4GUAA 2IU4A 4IEIA 2D4HA 1QO7A 3C5HA 3HV0A 3OQJA 5AHWA 1T9KA 3CZCA 1B0PA 1OW3B 1ZH8A 3R76A 3U81A 4GPAA 4X8HA 3PT9A 1Q83A 1GZSA 3K15A 4MW4A 3SJUA 2QN6A 3G0IA 2I3BA 2INGX 4RK0A 4X8MA 4FE4A 5G4KB 1X1TA 1EG2A 5LP6B 1GPNA 1JDUA 1Y3BE 3PHJA 3QKSA 5T4BA 1KQFA 3UN1A 1FMJA 4KMOA 4TRMA 1SHUX 5GGXA 9ABPA 2W6IA 4UDXX 2Z4SA 3CF4A 5CJ2A 3FIJA 4KJZA 4FDMA 1ADBA 2EC5A 4J9UE 3G8AA 3UXEA 3WDMA 4C6SA 1JKXA 3LP8A 1Z7GA 5DGXA 5T41A 3IV7A 3E70C 4XUDA 3RSQA 1HF3A 2PS1A 3KKMA 2I71A 4N40A 1U1IA 4XEUA 4PG8A 3BL8A 2ZS7A 2ZI3A 3DNPA 3OKCA 4HNTA 1NVMB 1T1SA 5L9AA 2JKVA 3P52A 4G89A 4BU1A 3T3GA 4TUYF 5IX8A 2G82A 2BEJA 3OQMA 1YAJA 2W2KB 1Z07A 3B9RA 4DVGA 2G0TA 1G5QA 1Y3HA 3AX6A 2H48A 1VKRA 1U0FA 3G0GA 1USVA 5GONA 2CJXA 4H1WA 4G0VA 2W6NA 4ID3A 4XOIA 3O2SB 3NBAA 3WBJA 2PG3A 2KX7A 2Q8PA 5KC9A 4MIYA 1SVKA 2RGXA 4QXQA 4XH9B 3ZHZA 5CDGA 1UAYA 2DUJA 2QSZA 1CVLA 1EUCA 4OKNA 2WVGA 5CR9A 1GUZA 1TUIA 4CR6A 2H1OA 3INRA 5DOZA 3CO0S 1AK9A 3KXDA 4D02A 1MUUA 5E2AA 1GAJA 2YWEA 4ROTA 4ZXPA 4QQ8A 1E77A 3VDXA 4BKPA 1UBRS 2CXRA 4AFNA 3OLZA 1E94E 1GUFA 1SCNE 4LK2A 4ALKA 4CF6A 2OFWA 2PGAA 5E38A 4UEQA 2XRFA 3CRNA 2HDNB 3G3EA 4IIBA 4MX8A 3AVQA 4PO8A 4DPKA 1NW9B 2GKGA 4NDZA 2RC5A 2PZJA 2ZI5A 2YVKA 1P1FA 2HAEA 4XM2A 3OQBA 5CLIA 2BEWB 3BQMB 1FMLA 2O3SA 3IP6A 2BFOA 3C1AA 2KBFA 1H66A 1QFZA 1B6TA 2ECFA 1GZ4A 1E79A 4X45A 2QL6A 1XPJA 2ZSAA 3VYSB 4B80A 2NMVA 1E6WA 1Z83A 3HUUA 5E7IA 5E3IA 1UMCB 3X1JA 4JVNA 4JEIA 3TBKA 5IDQA 1XCGB 1IQUA 1WBJB 2ZCVA 4IO0A 5ITZA 5ECWA 1D9XA 5I48A 1CR1A 2J9XB 4RPLA 3U3XA 1XMIA 3A1SA 2R1TA 1U2EA 4D80A 1ADYA 2FMKA 3KV1A 1SXHA 2CJPA 4LDRA 1CIJA 4N01A 5FLYA 4EHDA 1E0JA 5E7MA 1YOBA 3PQCA 3MQ2A 1MEOA 4N3BA 4W1QA 4ZVSA 1CQJB 1E3MA 1CCWA 3AUUA 3N8GA 4DILA 2C7PA 2TSYB 3PUYA 3BXFA 4L75A 1WF6A 4C07A 1DADA 3AJDA 3ZJ4A 1J8MF 1YT5A 1UBLS 1Y5NA 4FZRA 4MRRA 5ALGA 5J63A 2HM7A 1XVIA 1MHPA 3AI3A 3IE1A 1NW3A 2D2VA 2EWVA 5DHTA 4AO7A 2VPQA 2BGRA 2CF5A 4RS4A 5EP4A 1R6AA 2YTZA 1QOQB 2JCXA 3E4CA 1B2RA 1XU7A 2NNWB 4Y9DA 5BR1A 4ZVRA 3EISA 5TPWA 1G60A 1L4NA 4TSFA 2Y1LA 4FGUA 4G1VA 2WHRA 5K3FA 4YUVA 1YOVA 1NT4A 4K9SA 4PS0A 5BN4A 2VFAA 3O1IC 2O4CA 1A8SA 3PYXA 3QPBA 2XOXA 1OWMA 1R0LA 3OZAA 4I6JA 4B3XA 3L8DA 5EXXA 1V1JA 5J2TA 3A3NA 4XE5A 5D1HA 1P73A 4IS3A 2I2XB 2DF8A 1KU0A 5F7JA 3MAAC 4KI7A 3TS1A 3INGA 3DVRX 1ZIPA 2Q28A 3UZUA 1K5DA 1BWSA 1TFUA 5FJIA 5I9IA 5ER6A 3T54A 4BGEA 2B34A 2P2GA 4JDPA 1E1LA 2HJSA 3NYWA 3QYJA 3PQ3A 4Q19A 5LSAA 4UUBA 1G6KA 4OHVA 2Z1DA 1DC6A 1RRMA 3HB4X 2AZXA 3G2HA 3P0RA 1U7TA 4WW0A 2FU5C 5CK4A 4Z4HA 2Z5LA 3FVVA 4IJWA 4K5QA 1AV6A 4CEJA 3F3SA 1LKZA 4JODA 4NFYA 2B25A 2FXVA 4RVNA 4U2GA 1U0HC 2NP7A 2OUIA 4KQ2A 4MV7A 2AYXA 2ZBUA 1DIOB 1Q7BA 4TM7A 3UV3A 3WK7A 4ITRC 5HZMA 5AM1A 3GCXA 4DSUA 3ESBA 2ECQA 4C7MA 3AFMA 2Z4TA 2PZEA 4RMGA 1O87A 1M8PA 2IPAB 3UAVA 4HWTA 4DA0A 4RIGA 1XHEA 3ZZ1A 2DERA 1USGA 2YV5A 2X4DA 2K7ZA 3K8OE 4M37A 3AVWA 5JXHA 1C0KA 3MB5A 1GRVA 1DBIA 2H2GA 2O2HA 5AOAA 3BORA 5ED4A 1CJMA 2IUYA 1Q57A 2GQ0A 4DT1A 1EDDA 1VSUA 3AFIA 4PYJA 3R8FA 2CJWB 4UNIA 3TSZA 1ELOA 1GRNA 1QV6A 4G1UC 4J1SA 3IUMA 1VKOA 3MJFA 4H31A 4UDNA 4UMEA 3JQ9C 1GEEA 3TJRA 4DL9A 1JDBC 2IYNA 3C3EA 1NN0A 1GTL1 3FNGA 5KYWB 2G76A 2YMQA 3IEUA 4IRUB 4F04A 1KO8A 4Y8VA 3H0EA 4LE1A 3OT1B 4XSVA 5CM8B 3W1WA 3QG5A 3S3TA 4S12A 3LUBA 4HZIA 5FOTA 3MJEA 5JAZA 5TX7A 5L3SB 3RAFC 1BD3A 2XAAA 4BAGA 5EJMA 4P83A 3GEGA 4EB6B 4KQEA 2HCBA 2R00C 2BEVA 2YWCA 3NI2A 3P9PA 4TVOA 5CX1B 1MC1A 4PRZA 1N0HA 2ZCJA 3JWEA 3SHFA 2X4GA 2O2YA 3AL3A 3EXAA 5TDHA 1DC3A 5KMGA 1DC7A 4QD3A 1WF3A 2WLTA 2IH4A 1P2TA 3A11A 4KNYA 3EW9A 1J5XA 2IL1A 1VG9B 1JFSA 4MTLA 4P7KA 3TSYA 4BN4A 4JJKA 2Z6QA 3MCZA 4PZAA 4YYEA 2ZZKA 4LF7B 1QIIA 4JBGA 1G9XA 3D3QA 1ONOA 5JUWA 4I8DA 1SXJC 2P0EA 4EYGA 4WN9A 3LBYA 4F8EA 3IR5A 3EGXA 5IMSA 1FFHA 6LDHA 1REQ