3QKSB

Mre11 rad50 binding domain bound to rad50
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
AEKENRERVKKEIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title ABC ATPase signature helices in Rad50 link nucleotide state to Mre11 interface for DNA repair.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication
molecule keywords DNA double-strand break repair rad50 ATPase
total genus 60
structure length 179
sequence length 179
ec nomenclature ec 3.6.-.-:
pdb deposition date 2011-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3qksB01
1P9WA 4A0HA 2WKQA 4TSFD 4DRZA 2QQEA 2VHUA 4PHGA 4TQUS 2D2EA 5B57C 1J2JA 1MO3A 3TBKA 1ZNZA 3KUDA 1BIFA 1LF0A 4PQFA 3AVTA 1AKYA 2AKAB 4FCWA 5DHAA 4DCNA 1DPFA 3U61B 1G3UA 4Q9KA 1OH6A 2WM9B 3BWDD 3UMFA 2IUSA 4B75A 1UEJA 2BJVA 2PCJA 1Z6YA 3AF3A 5JSZB 3AUYA 4ZDKA 2ZRAA 3G0HA 1QHXA 4OK5A 1LFDB 4RFVA 2IYLD 2FPMA 1U99A 3KB1A 1F60A 3RWOA 2CXXA 2YWHA 1XU4A 3C4JA 1XEFA 1E9SA 2ZJ8A 1KOFA 1S96A 4OK3A 4B3BA 1ZP6A 4EPVA 5JWRA 4F91B 4RFSB 1XTKA 1Z8FA 3AKCA 3EZFA 5FOXA 2CE2X 3OEHA 4DT1B 2QORA 4C0QC 1A7JA 4GRAA 4QBFA 4W5HA 1A82A 2H1LA 1VG1A 3KQLA 3RS5A 5BXQC 1RC8A 2GXAA 2IF2A 2ECKA 1EWRA 1G17A 2GJ8A 2SHKA 2AFHE 1ZM4A 3WP0A 1E9FA 1ZU5A 4JS0A 3KFVA 1E3MA 5KSYA 2A30A 2R8RA 4JZKA 1OKKD 2ZSEA 3DZDA 4AC9A 3PV0A 3GJXC 5H1YA 4DLWA 1K5GA 2BBOA 2CL6X 3CR7A 1ZRHA 2BJWA 3RNLA 3TKLA 5DYIA 2BM1A 2LKDA 4DWJA 2X2EA 4TLEA 4F4IA 3GJ0A 3RS7A 3ZIAA 3F5FA 3NVAA 5FPYA 2QSZA 3FHOA 4U02A 1Z0FA 4TLDA 3ADDA 1S9DA 5UKDA 3TGPA 4CF7A 4DLXA 1YU9A 2K5UA 1V5WA 4DLYA 2VP2A 3FFBA 3WNBA 5FBWB 1MRNA 2YV5A 3GLIE 4YONB 1HQCA 1CBUA 4PZYA 3DDCA 5J47A 4TZ0A 1CJMA 1YR9A 1P4SA 5KOYA 1A5TA 3LH5A 4UXIA 5CLQA 1GRRA 5FR1A 2P0EA 5EP4A 4Y0AA 4IDNA 3OIWA 4X8HA 3RRMA 2KE5A 3MCAA 2W2XA 2KWIA 3CLVA 3K53A 4NL4H 4D4MA 5GJWC 1MKYA 2BBTA 2EW1A 2R9VA 4GOXA 1HT2E 1TX4B 1XBTA 2AWNA 3EW9A 2JJ2A 3RANA 1RIFA 5CIWA 4B74A 4UXHA 1N0WA 1KAGA 1SGWA 4ZI2A 1JR3D 3JVUA 2WIAA 3THWA 3ZLJA 2GXQA 1IN8A 1D2NA 2JLVA 5J4LA 5JHHB 2GCOA 2JLYA 2EYUA 4IXNA 3OIYA 4Q18A 2JAQA 1NVVR 3UXMA 5KDOA 3HPQA 2XXAA 5DI9A 1FL9A 4M9XA 2ZRPA 2IYQA 3VTKA 1M8PA 1ZU4A 3VX4A 4LHXA 1EX6A 1ODFA 5DLQC 4D80A 5J4HA 1RE0A 5JI3E 4GMXA 1IJFA 3C7KA 5C4GB 4JLBA 4KSCA 3CF2A 5HE8A 4QM6A 1I2MA 2XB4A 3RRZA 1ZAKA 1AKEA 1AM4D 2ZRKA 1T4GA 3B9QA 4M9QA 4V0KA 1DAHA 4BFZA 5FUWA 1Z07A 2QY9A 2VP6A 1OE0A 1FTSA 1Z0AA 3QQ5A 1E1QD 2QBYB 4LRWA 3FMPB 2WICA 1R0YA 4QBIA 1W47A 2YWEA 4MYTA 1CLUA 5JHGB 2H7VA 2QENA 4Q5IA 4DHEA 2BWJA 2C03A 2X8AA 3MG9A 3OAAD 1XD2A 1DARA 5FBVB 4MITA 2DB3A 4P4SB 3R8FA 1A2BA 2AFIE 2O8FB 5DN6A 1UM8A 3EC2A 3P20A 4Q4AA 1GKUB 2CJWA 2IK8A 3GJ6A 2OXRA 2V8OA 3KXLA 4MKHA 4LJAA 1JPJA 2OBMA 4PC3A 3GQBA 5LD2B 2REOA 4J0QA 1OH7A 4R7ZA 4FCVA 1E32A 4KVGA 1NN0A 2A5YB 4QHTA 4C0HA 1DE0A 1TADA 1E2FA 4KFUA 1E2HA 1W0KD 4IVPA 3TSOA 1VPLA 3QBVA 5FL3A 4Z1MA 2PT7A 4ZDIA 1U98A 4LJ8A 4Q48A 3TUZC 2H92A 2QPOA 1Q21A 4KYIB 2OFXA 2P6NA 3UG7A 1KK3A 4RD4A 4A1FA 2EQBA 4WXRA 5SZJA 3K70C 1JR6A 1U90A 1OT3A 4A8JC 3R20A 5J4KA 3SQXA 5H70A 1ZVQA 1IN5A 2BKEA 2ZRGA 4HZIA 4E5UA 1N6KA 1E2EA 3Q5EA 2V7QA 3VR3A 1P75A 2W0SA 4CEJB 2PJZA 3BE4A 3TQFA 3RHFA 4ZCMA 2D7DA 4XIGS 1XTJA 4XD7D 2FFQA 4A92A 4CT5A 3F3YA 1M7BA 4LBWA 3EIEA 3QG1A 4PZZA 2ZRHA 3PG5A 3U3OA 3DKPA 2YYZA 4LOAA 3OEEA 4V02A 4HDOB 1Z63A 1OIXA 1EK0A 3QKRA 3ZZ0A 4BLSA 4DCVA 2BV3A 2I3BA 2WWGA 4OHZA 2GAOA 4TTRA 1CTQA 4A8JB 1Z22A 4GSYA 3QOFA 3EX7C 4IRUB 1HH4A 2AK3A 4PC1A 2QE7A 5TDHA 2PH1A 3RSOA 1D2MA 3ZJYA 1YQTA 1X86B 3ECCA 4LZZA 1R0ZA 5AR1A 3WY9A 1P2SA 3T1VA 4F38A 1E0JA 1F48A 1XXHA 2FA9A 3SFVA 1N3BA 4IDHA 3K0AA 4KCGA 2ZYTX 5F9HA 2ZM5A 2RGEA 4BRUA 1GVNB 1QF9A 2Z5FA 3EIHA 2ZI4A 4C3ZA 1XEXA 1D8TA 3LW8A 3U3RA 5DN6D 4JL6A 1N5IA 2R6AA 4DDTA 2ZAOA 4EJSA 1KMQA 4DSNA 4ZV4A 3KXIA 4B33A 1KNXA 3KJHA 2QPAA 1P73A 1AZTA 5DISB 3A1WA 4Q9LA 2VIIA 2ERYA 3MJRA 1YZTA 1VMAA 4PAMA 3D8BA 4FMBB 2JLZA 1E9BA 2H8KA 2BBWA 2XGJA 3NC1C 1L4YA 2WV9A 5J40A 2HLDD 2MSDB 3SBDA 2QAGC 4A8JA 4LC0A 1PUIA 4AURA 3FMFA 2FSIA 3CKLA 1EXMA 1ZD9A 3CW2A 2JLXA 5EUQB 4KV9A 2BMDA 2RHMA 3AGQA 1QHSA 2IYSA 3W5IA 1FPMA 3A4NA 3DMDA 3KKMA 1G5RA 2WJHA 1L7VC 1XTSA 3BS4A 3FHCB 4BFXA 2BDTA 5KNCA 3QPUA 4RZUA 1VCIA 2P67A 1IY0A 3J81k 3X1YA 3A4LA 3WBJA 3UATA 5JJIA 4Q7MB 3SJCA 3AVYA 4LC1A 1TF7A 4P0TA 2O8CB 3SC3A 5CITA 4B47A 1CXZA 5H8WA 2CVFA 1PUJA 1NBMA 2OUKA 1J8YF 3MWKA 4O2LA 1LTQA 4HUTA 5FOSA 4AY2A 2CE7A 5JJLA 2CBZA 2G9NA 1G6HA 2CLCX 3ZQJA 3DHWC 4MUAA 3GLIA 2ORWA 3PENA 3QUSA 3SHWA 4OQXA 2F1IA 2HUPA 2QROA 4OI2A 1IQPA 2FE4A 2YOGA 2GZAA 3FWYA 2NZJA 2YJTD 3RLFA 1E2QA 3CUEF 3W3ZB 2IXEA 1DO0A 4A6PA 3ADBA 5E3HA 3VR6A 1XJ0A 1F6BA 2ZE6A 2WTUA 2WOJA 1G5PA 2HCJB 2V6IA 5KHOC 1W44A 3V9PA 4B3FX 3CNNA 2PLFA 3O8CA 2QTHA 5K8IA 2GK6A 2VHCA 4EJSC 1CEEA 4A2WA 1CF4A 2G1KA 4MQBA 4EPWA 2GWHA 1B0UA 4LJ6A 3WNCA 4EPXA 5KO2A 1VIYA 1R10A 2F9LA 2XJ9A 3OF5A 3PEVA 1XPUA 3NC0C 4WW0A 4DUGA 1KSJA 2JDIA 4LBYA 2IA5A 3LLMA 4PSKA 4ZCLA 2ZSAA 2GXSA 1GFIA 4R2HA 1QHHA 3QPVA 3BAFA 4XD7A 2IUUA 1GILA 4D82A 4OHVA 3KXKA 3QY0A 3KL4A 4BASA 2OFOA 3C5CA 3A37A 3AUXA 4C7OA 4NCHA 4HUQA 4G5OA 2OESA 2X77A 3ADCA 1WF3A 1NY5A 1ZC3A 2ODEA 1NJFA 5FBRB 1NIPA 3TAHA 2MSCB 2IS2A 4GZMA 5GADl 2DWPA 5G41A 2VBCA 1Z6GA 1UKVY 2RH5A 5CLLA 4Q66C 1OH5A 4JVMA 4IW3B 2X1VA 1NF3A 5HZHA 1BOFA 1R5OA 1G7TA 1CJKC 1R5NA 3CF6R 3QVUA 4PO9A 4NKRA 4LHZA 4PPFA 1YR7A 1ZNYA 4QBGB 5G3YA 1A1VA 4E09A 4G3XA 1IY2A 2DPXA 3CBQA 4B2LA 3EA5A 4MRVA 2Q6TA 4TMKA 5AUOB 4HUQB 1F2TB 3KJIA 2JGNA 1G3IA 2FZ4A 3PCRB 2GEUA 3NEYA 4M1SA 2XB2A 1XTRA 4O3MA 4B2PA 2XX3A 4WVFA 1OKKA 2CNWD 2PX3A 1VHTA 1YR8A 3B85A 1D6JA 1UBGA 3RS3A 1Z2AA 2I1VB 1JNYA 2H57A 1FFHA 2NO1A 1KK0A 1NKSA 1U0LA 2ZI3A 3EWSA 3HU1A 4A15A 1E0SA 2ZSFA 1JXOA 2V9PA 4QFMA 2JLSA 3U4QA 3TE6A 1QHYA 3IPXA 2GCPA 4KODA 3TUJC 1ZJ6A 1XD9A 3LX8A 4IXMA 4PQRA 3G5UA 1ZBDA 2IHYA 5DHFA 4B73A 4FMDB 3QF4B 1GSIA 3G82C 1D2EA 3KKPA 4PAOA 3VR2A 5JMTA 3HYRA 2OCBA 5CM8B 4JSTA 4M2LA 3AV0B 2J3EA 4EQ6B 2ZJ5A 4KHZA 5CB6A 3AB3A 4Q4AB 3CIOA 4DIEA 3H86A 3O8BA 4KFTA 4L9SA 3QF4A 1QG2A 3IQXA 1TTTA 3MWLA 1XXHE 3PQCA 4EFNA 1XDBA 4TZ6A 2PMKA 1US8A 3I73A 1KI6B 2QAGB 3PJRA 2WSSD 3RAPR 3SE0A 2ZQ5A 3VU9B 4B35A 5P21A 3NH9A 2PMDA 4Z8YA 4MGIR 4QNRA 4C0BA 1YJ5A 4TYNA 2DCUA 5HKKD 1HE8B 3VQTA 4EPYA 1OXVA 2E87A 1U81A 1N25A 4ZI3A 1M7GA 1N6HA 2ZVPX 4FN5A 5FI0B 4HZUA 5EE5B 3HDTA 3HR7A 621PA 2CLDX 1UJ2A 3N5CA 1II8A 1TUEA 4DBLC 4HSEA 5KU1A 1OJLA 1BMFA 3BJIC 2G83A 3BRWD 4M22A 1KK1A 5BWMA 1MABB 4OQMA 2IWRA 3SZRA 4F4CA 1E4YA 2V3CC 2YINC 3ZS8A 1SHKA 1M6NA 2G0TA 2EYQA 2R6DA 2Z43A 3LQRA 4RSGA 1OXUA 2BBSA 1KIMA 1YZKA 4QRHA 3RSLA 5L3QB 1G3QA 2QMEA 4IVRA 2BIFA 1VIAA 2ZRNA 5LDDC 1IN4A 3IIJA 1SKQA 1Z2CA 2XOKD 2CCJA 1E2KA 3CB4A 3L82B 4JL5A 1UF9A 3OEHD 2QG6A 2RB4A 8OHMA 1CP2A 1YZGA 2KB0A 3T35A 1BS1A 1DAIA 1KO4A 1EG7A 1T0HB 3EASA 2GTPA 4NYIR 5GVRA 3VX3A 4UNRA 2HT1A 3SNHA 4CIDA 421PA 3U6KA 4LYFA 3RDPA 1KY2A 4OI0A 2IUTA 4YMSA 1JR3E 3NDPA 2ZJOA 3VMFA 4G1UC 2GXUA 3BXZA 4LV8B 3FHTA 2A3RA 2P5SA 1N6NA 2GBLC 5KDLA 5C1BA 1T5IA 1TF5A 1WMSA 4I99A 3QG5A 3CPHA 4B3XA 1C1YA 1VCNA 5LD2C 1DG1G 4GOKA 3C16C 2C9YA 4BFSA 1WCV1 2FV8A 2OBLA 4JBWA 5K8TA 3H1TA 3U44A 1W4RA 2D7CA 1G8YA 3FMOB 3MGCA 2UVQA 1CRPA 1G7RA 2B8WA 5SZHB 1ZIOA 3WP1B 3UK6A 1T91A 1XMJA 4W5JA 2QUZA 3IEVA 4B3CA 2RCNA 3EC1A 1NN5A 2ONJA 3BH7A 2Q3FA 3IIMA 1GTVA 4AWXA 1GL9B 1OHHA 1XEWY 1FW6A 2OO7A 3D7MA 2XZPA 3FGNA 1XWIA 4DLZA 1W2HA 3U60B 2O8FA 4DLUA 5JLJA 3IBYA 2W0MA 2QTFA 4OHXA 3VKWA 3PEYA 4URYR 4KYUA 1YVDA 2XTNA 5M04A 5F98A 4PC7A 4BWYA 1CR2A 1X1RA 4JBYA 1HYQA 3BD9A 3LFUA 3HU3A 4PZLA 5D3MA 3K9LA 2QRZA 4IOLA 4MYCA 1WDTA 1OYYA 2VSXA 4XVRA 2IL1A 2OE2A 1Q0UA 1W5SA 2RGGA 1FUUA 4JVLA 3BH0A 2O8BB 1OF1A 3HP1A 1NMZA 4GI7A 1E69A 1X8KA 5DI3B 3WHKA 1MOZA 1JR3A 4LX0A 3K0CA 1S2MA 1UKYA 1IY1A 1MO6A 2REXB 3EG5A 4PX9A 2JDID 2HDNB 1Z5ZA 3B78A 2AL7A 2YOFA 4PSAA 2O0KA 5CYPA 1Z3IX 2JLRA 4OYHA 2CVHA 3HWSA 2WWXA 5FPKA 3THXA 2L0XA 2I1QA 2XZOA 3SEAA 1P2VA 1JAIA 1JEEA 1M34E 1TQ4A 4GFDA 4RD3A 4Q7KA 3RS4A 3KTAA 4HLCA 2W6ID 4IEIA 2WKPA 2ZYVX 2ZI5A 3LX5A 4IFBA 4YXWD 4CEIA 3FOZA 3KZ1E 3DKVA 4D0LB 4EQ6A 3L0PA 2VF7A 4R98A 2FH5B 4MGZR 3GLFA 1W5TA 2P6UA 4Q1EA 1BH2A 1SVOA 1T0JB 2CHQA 2DFKB 2N1BA 4JLVA 3CX7A 1MH1A 3DL0A 2J5XA 4BLRA 1G9XA 2BCJQ 2C78A 3GLIB 3LQQA 1KDOA 1S3GA 4FMCB 3NBFA 4I81A 2EU8A 1OB2A 4TLAA 3L0SA 1K5DA 5EE1A 4M1WA 2ZPTX 1LS1A 3LVQE 4EPRA 2IYRA 4TYPA 1KKLA 3B1WA 4BEJA 1U2RA 3DOEA 3HYTA 3TVDA 3K1JA 1R6BX 3B82A 2YZ2A 3R7WA 4B76A 2DHRA 4C2UA 3JZAA 2F1JA 4O25A 3PUVA 3AM1A 5L3QA 1RPZA 1S1MA 3E70C 3EARA 4JBXA 1DAKA 1Z6TA 4LY6A 1S1CA 2IHBA 4LJ4A 1U9IA 3JVVA 3PVSA 1OB5A 3IKJA 1QHGA 4YLGA 3QENA 3TQCA 4ASUA 3H84A 4II7A 1E9RA 5E7JA 4RKFA 1V43A 1GDDA 2DYKA 2CCKA 4DJTA 4H1UA 2G77B 1P60A 4IFEA 3T12A 4HAXA 2WWYA 3MSXA 2VA8A 2HLDA 5JS7A 1KI8A 1NLZA 3P32A 3BOSA 1WQ1R 4I1OA 1K8RA 1P2UA 2J0VA 3VAAA 3CWQA 1E99A 2QNRA 5CB8A 2N42A 2JLQA 3TRFA 5CM9C 2GZDA 4BQSA 1MR3F 2GETA 4C7OB 3OESA 4LJ7A 1QHIA 3BFXA 2PLRA 1KO5A 2WSSA 4B32A 1GM5A 3QXCA 1E6CA 2ZE8A 4A0GA 3OAAA 2IXFA 3AP2A 2LCFA 1DBSA 3CRW1 3CH4B 3T06B 4B6FA 1D9XA 1KSFX 4XJXA 1IXRC 1WXQA 1N0UA 1IHUA 5DE3A 1EGAA 5TMPA 1BO6A 4FIDA 3FB4A 1N5JA 3QXSA 4K8OA 1VKJA 1E2PA 1VG9B 1ZW6A 3W3AA 4JVSB 1LF5A 3U4QB 4QC2A 4TMVA 4MRPA 3S1AB 4ZDJA 2H17A 1ZNWA 2BC9A 3LVRE 2O0JA 2HJVA 1KI7A 5C18A 3FKSA 5G3ZA 5EXSA 3U3JA 4M1OA 1AQYA 3BB1A 3K0FA 4Q7JB 1LV7A 2ZAMA 2JLWA 1KMHA 1OW3B 4U5XA 1VYTA 3MLEA 4KU4A 1MO4A 1U0JA 4C0SA 3WRYC 3IEUA 2GZHA 4YMTA 1EX7A 4YMVA 1TU3A 4QHSA 2QPTA 1FTNA 1P6XA 3LW7A 1RW4A 4URZR 1DTSA 1Z29A 2QGNA 4PC6A 5C4MA 5DGXA 3AVXA 4ZO4A 4Q47A 5K8UA 1RRPA 4MYHA 3BFKA 1NNEA 1COWA 1II0A 4LPSA 2A5FA 2QQ0A 3OZXA 1T3SA 3QPWA 3HR8A 1HT1E 2PZGA 1JQJC 4HAUA 4LI0A 2VEDA 1NVUQ 3ZZUA 1GUAA 2O8CA 1HA3A 3REFA 1LW7A 4Z54A 1KI9A 4DB2A 3GLGB 1SXJE 2BHRA 2X19A 5DI3A 1KJZA 5EE9A 4BFUA 1ELOA 4DUGD 4C9BA 2XTZA 2P5TB 1SHZA 3C41J 4V0NA 3CF0A 1UAAA 3QF7A 1E2LA 4PQYA 4NH0A 4UKDA 2ERXA 1GL7A 4LK2A 4NTZA 3SYLA 1Y63A 1SXJC 1OPXA 1CJUC 1SVSA 3M0EA 4Q9IA 3H4MA 4CYMA 2ZU0C 4Y0VA 3ZIAD 1KK2A 1TPZA 4BEBA 4CGZA 5SZKB 5FOUA 4EFLA 2J45A 2HXSA 2C95A 1ZMXA 2OG2A 3B5JA 3AP3A 5GJBA 2ZJ2A 3IUYA 1KSGA 1KMHB 3QVVA 4M53A 2TMKA 2ORIA 1UKEA 3FVQA 3DM9B 1OFTA 3WXMA 3QKSA 2VH5R 4KBGA 5CDFA 1QVRA 1R7RA 2CLSA 1UEIA 5A4JA 2J7KA 3P4XA 2VYFA 4CEJA 4K81B 5F9FA 2EFCB 4C2TA 2NPIA 2ATXA 2KI5A 4QOSA 4LJ9A 3RS2A 2OLJA 1H8ED 1RRFA 1E4VA 3UPUA 3QIAA 4PSVA 1EFTA 1P9NA 1O87A 4Q21A 1P61B 2FFHA 2Q9AA 1PLLA 4HLDA 2ZS9A 4PC2A 1VTKA 1TL7C 2F1RA 2RGDA 1C4OA 3E2IA 4A0RA 4G5QA 4RJLA 2FEOA 4KFRA 1G20E 4WZAE 1ZCBA 3H2YA 4ZCIA 1E2JA 3RS0A 2C98A 5TV2A 4ITRC 5JEDA 1XF9A 4AKIA 4TYWA 1NIJA 4TLBA 521PA 1X8JA 4CDGA 2VF8A 1SVWA 4IVQA 2AWOA 3T5GA 1LB1B 1Q1EA 1KZGB 3BORA 3NHBA 2G1JA 1BYIA 4HAZA 5JCPA 2ZJAA 1HV8A 5FBLB 2QL6A 2N46A 1X6VA 4HZUB 3LXRA 2QM7A 1AGPA 2Z4SA 2RKOA 4FD2A 4TL6A 5EXXA 1TQ6A 4S2EA 4KITB 3KQHA 5ANRB 1NKTA 3EPHA 2AHOA 4LSGA 4D26A 5AWFC 4MKFA 1SVMA 3T1OA 2J7PA 1QG4A 1HE1C 3N2IA 1X1SA 1T9HA 1QHNA 4L5BA 2KSQA 1AZSC 2IS6A 3NKVA 4QGHA 1PZNA 4BE7B 2NMVA 3QKSB 5BYJA 1JXMA 2W00A 1JALA 1GL6A 2O8BA 2FPKA 3QKUA 5CYOA 3TSWA 2FZLA 4Q4JA 3SS8A 3H0KA 2C77A 3TIFA 3Q7QA 5KNBA 1VCOA 2R62A 4A0FA 2HYIC 1GKYA 5AJYA 3SDZA 1M7HA 2J0SA 1NJGA 3B1ZA 4LHWA 1FP7A 1XTIA 4P4UA 4Q7LA 1JJVA 4H1VA 4UXJA 1UFQA 1U8ZA 2VRWA 1XP8A 4R2IA 1CU1A 1GP2A 1Q3TA 2NTYC 3SYKA 4EPTA 4KVAA 4AYWA 4QXAA 4DLVA 3BBPA 1QZXA 3M6AA 1ZYUA 5IDVA 4BPBA 2WIBA 4NP6A 3A1UA 2W58A 4M1MA 5E7MA 2NOAA 4TL8A 4CEIB 2AK2A 4EAQA 4Z8XA 3TMKA 4C4PA 3HJNA 2ZR7A 3K09C 5GVSA 5KUTA 2WKRA 4POAA 3ASZA 3B9PA 3LV8A 2XOKA 4US0R 3B7GA 2HCBA 3AKEA 4EJSB 2RGNA 1Q22A 2FSHA 3HU2A 5B30A 1AN0A 4Q19A 4BZXA 2QT0A 2XEXA 1J7KA 5KSOA 1QBKC 5BN3A 2ZRJA 2IYVA 1UADA 3NBZC 5EQTA 4AG6A 4Q01A 4I1VA 2O5VA 1R0XA 4HDCA 2O8DB 2C8VA 2FU5C 4LDJA 5TY0A 2PBRA 3AKDA 3UMRA 2DWOA 1CR1A 4JL8A 3ZVLA 3PFIA 1G7SA 2WOOA 3C14C 3CH5A 1AK2A 1J8MF 1WP9A 4N0DA 4W9MC 1KO7A 3AQ4A 4DC9A 5L3SB 2ZETA 1GAJA 3LWNA 2O0HA 1EESA 1VYUA 5AK0A 5JWHA 4LWZA 1G8HA 1COWD 4C0AC 4LGMA 1JB1A 2HF8A 3B1YA 4FI3C 2R2AA 1FOEB 2ZUCA 4NCKA 1DO2A 3SU8A 3A58B 1II8B 4G0NA 5TXGA 1UPTA 3EAQA 4L15A 2QEQA 4AG5A 2VP9A 1W46A 4LV5B 1ZIPA 2Q3HA 4JLPA 5SZIA 4K46A 2OAQ1 3THOA 3W6NA 4CEHB 1XMSA 4OHWA 3QKRB 2ZRCA 3FKSD 3LRPA 2OBNA 4KLNA 2W2TA 3DOFA 4AYTA 2ZU6A 1GRNA 4G5RA 3K0CC 3ICEA 1R2QA 2NQ2C 2ZI6A 3K0AB 2ZRMA 2A7QA 3ND9A 4RD0A 4WZ6A 5KPJA 3EPKA 4WAUA 3L8YA 4NCIA 1OLOA 2QP3A 2OHFA 1KI6A 4B44A 2NO7A 1P3JA 1US8B 2EWWA 3VKHA 4G01B 1U94A 3RRYA 2IYXA 4ASUD 4JKIA 1NRJB 2GVDC 5AJVB 1Z83A 3GLFB 2JASA 4IDPA 2FG5A 2A5DA 3Q5DA 2PEYA 3LLUA 1UKZA 3MMPA 4QJ4A 2OAP1 1W49A 821PA 3E1SA 4Q1BA 3TNFA 2EVWX 1Z0DA 2JIZA 5CIQA 2ZTSA 4NYJQ 1AJEA 3OE7A 2FSGA 4EUNA 2E1RA 1AQUA 3ND8A 4L16A 5B58C 3UWOA 3RWMB 3R9WA 1Q12A 3ICQB 1JEDA 3UANA 5FOWA 3Q85A 1PLJA 4Q4JB 1H8EA 2ZROA 1WBDA 3AGPA 3GFOA 2HYDA 4QNMA 2NO0A 4XSGA 5IK2A 1MV5A 5BYKA 1ESNA 1ANKA 1NMYA 2IBMA 1RKBA 4JYCA 4Q4HB 3UG6A 3U7GA 2FWRA 4TMXA 1G6OA 4YC7A 1CULC 2IF0A 2QMOA 5FOVA 1XD2B 4BFYA 4XWOA 3R7WB 2R65A 1KJYA 3KQUA 4TMWA 2GF0A 4NE2A 4KAXA 3WYAA 3R9XA 4NHOA 3K70D 4IEEA 5DIFA 1FQKA 2QT1A 1E2GA 1HQYE 2YC4C 3EWAA 1MABA 1NVVQ 1IOZA 1G8FA 1SZPA 4HB4A 3ZVMA 2QSYA 2F3TA 4US2R 2KBEA 2AXNA 3KUCA 4F7WA 4RKEA 5KTYA 2P2LA 4KFSA 4NZYA 3L8ZA 1B23P 4Q4LA 3THYB 2WMOB 2ZE7A 4PXAA 2NIPA 1EFUA 2ZITA 4GPTA 4OQNA 2CMKA 1F3OA 2Y8EA 4LYAA 2O8EB 1NN1A 1UBCA 2GK7A 4MKIA 2C2HA 3D6TB 2CJWB 4JLDA 4PR0A 3I32A 5H68A 3U7EB 3U7FB 2IX3A 4QGFA 1T8TA 4XOIA 3KTAB 3LDAA 2DWQA 2WAXA 2IEYA 4NMMA 2D4HA 5A0FA 5KPDA 4QGAA 3K0SA 3U44B 5AUQA 2ZI7A 4ZPXA 4FMDF 2FOLA 3EIQA 3X1XA 2E9SA 2RMKA 2WJVA 3KJEA 3ZVRA 3QXJA 1GG2A 4HB3A 4JLKA 4PANA 4XSHA 1JQLB 1I4LD 2J41A 2JJ1D 2HXYA 2RGBA 2RGNC 3B6EA 4C0JA 1N2CE 4QKQA 4D4JA 2BEJA 3KKOA 1LNZA 2ATVA 4JKYA 2QAJA 2WPDD 2XSZD 3F0TA 4AKHA 1KKMA 2WAYA 3EXAA 4V0ME 3LNCA 3NIBA 2OLKA 1U8YA 4TT3A 1AGRA 1GOTA 2OILA 5JECA 2OEPA 1E1RD 4TLCA 3WMFA 2B92A 1YE8A 1EFHA 3AF4A 3CO5A 1XPOA 1FUKA 1ZUHA 5D3MB 4B43A 5FI1B 2GCOB 1BMFD 2QBYA 5L8VA 1G5TA 121PA 2D06A 2FFBA 2J7PD 4OBEA 4TQ9A 4U7DA 2JEOA 3LBHA 2UZIR 3Q72A 4P3YA 2WJIA 3ETLA 2XNSA 3X2SA 2F1HA 4OJQA 2QMUA 3CNOA 3LXXA 2QGZA 4Q9JA 5FOTA 1CKEA 3NWJA 1GWNA 1N6RA 2YC2C 1KYIA 4LBVA 2Q9BA 2VO1A 1YHNA 1Z28A 5BQ5A 2HV8A 3FFAA 1KI1A 1W36D 4A4DA 3CPJB 1E98A 5JCZA 1I2DA 3KKNA 4NYMQ 2DBYA 5L3RA 2WJYA 2CHGA 3UIEA 4HYYA 4JLMA 4LJ5A 2O8EA 4JYBA 5DYGA 2ZS7A 5B2ZA 4H9GA 2PJRA 2YOHA 1G18A 5EUMA 5LBIA 1XB2A 1GNQA 3KQNA 1YRAA 1ONBA 2WHXA 1P9RA 3B13B 3UKDA 3I8SA 2ZRLA 5GJCA 2AXPA 4KI0A 4LPKA 4BLOA 4HAWA 4DVGA 3K0EA 3TVTA 5CJPA 5A5GA 2B6HA 2R44A 1Y3AA 2B7CA 1AS3A 4QG7A 1Z0KA 1XTQA 3ADKA 3QEJA 4XTRA 4LCBA 2ZSDA 1GKIA 1E9CA 3GJ5A 2MMCA 4WIAA 2FJUA 3I92A 1Q44A 3NEJA 3VKGA 1P2TA 3AVVA 2C04A 2WVJA 3GJ3A 4UNQA 2F3RA 4OHYA 1KDRA 4HAYA 1K6MA 3I4LA 3KKQA 3Q7PA 5JFGA 4MH0R 1W36C 2W6JD 5FPSA 4EFMA 2GF9A 3AP1A 3OE7D 4IDOA 1KDPA 4PO8A 4XH9B 2JLUA 4Q02A 2GJSA 3I8XA 2P65A 5IT5A 4M9SA 4AIIA 2H16A 5JRZA 2RGCA 2YVUA 2BVNA 3I3SR 1Z6AA 4TYYA 3P1JA 3GLHE 2VHJA 4URXR 4TL7A 4WXPA 1M74A 4QJ3A 2QU8A 4Q1AA 1PJRA 3TR0A 4UQOA 3CRVA 4LHYA 1XCPA 2WJJA 2C9OA 5JS8A 2RHDA 1PLKA 3EZ9A 1W4CA 1VG8A 2GBLA 4MDFA 2WPDA 2XSZA 2QA5A 2WMNB 3BGWA 3QXXA 4P4TA 4RD2A 1J70A 1DG3A 1L4UA 2VP4A 1H65A 1FP6A 1HUQA 1T6NA 1TAGA 3BK7A 4KXFB 3F8TA 3I61A 4PAQA 4RZ3A 4PTLA 3I5XA 4D0GA 5GJVC 4G5GA 4Q00A 2PT5A 1HTWA 5TVKA 5JSZA 2OCYC 3B60A 4DSOA 4ESHA 3QBTA 1YZUA 1SXJA 2VP0A 1ZUIA 4JT4A 4RY2A 2PEZA 5ELXA 4IJMA 5CJ2A 4DDVA 3HPRA 5FFMA 1G19A 1XZPA 3K9HA 1G3RA 5DNYB 2CCGA 3AEZA 3K0FB 3PITA 4WA7A 2ZIAA 3ZDQA 4DDWA 2W6IA 2V1XA 1EWQA 1Q20A 1GITA 5C46F 2CNWA 2BM0A 3EZ6A 4S35A 2ZI9A 1G21E 2W2VA 4RZ2A 1P72A 1E1QA 5EP3A 3AF0A 2D74A 4C30A 4ABYA 2YNMA 4JLOA 1TUIA 4P33A 2X2FA 3AH8A 3B1XA 4B3GA 4AI6A 2PX0A 5FTJA 4B71A 2GHIA 3KDSE 5TARA 1RRCA 4ERNA 4BZPA 5JEEA 2AR7A 1OXTA 1EFCA 4MGYR 1OV4A 3IILA 4XWAA 4DEYA 4DZZA 3LAWA 5KSZA 4OQFA 1P5ZB 3DZ8A 1QRAA 3U3MA 2O8DA 1AS2A 4B2IA 4LHVA 4W5WA 3VNUA 5JZVA 2VQSA 2GILA 2FPLA 3A6PC 3KX2A 1M1YE 2RGXA 3VU9A 5HPYB 2B8TA 1J90A 4BGDA 1JJ7A 5JBQA 2A5GA 4RVCA 3CX6A 5EZ5A 1W0KA 4FMCF 4GP6A 1Z6XA 1ZM9A 3UMSA 1HURA 5HZKA 5FL7A 4FW9A 2FX3A 1OSNA 2NO9A 2FGJA 4X8MA 3V4FA 2VHQA 2GEVA 1JI0A 4YMWA 1KI3A 2HT6A 1E9DA 4TWZA 3SN6A 3QE0A 3K9GA 3LBIA 4NPHA 4JLJA 1RYHA 1Z08A 3PR1A 1RJ9B 4C0LA 3DMNA 4Q1FA 1OYWA 2J46A 3QI2A 4RCYA 2WWFA 2WWWA 4TSFA 2XTMA 4JMPA 5JI2E 2P3SA 4M8NE 1DADA 2Q0HA 5FTNA 4CRWB 4AKGA 2UKDA 2NPFA 4D4KA 1IXSB 3MWYW 4M9ZA 4JLNA 3WRXC 4W7SA 3B2EA 1G41A 1YR6A 2G0NA 1T8UA 2FDCA 4M21A 2OT3B 3IGFA 2VL7A 1KAOA 1N6IA 4Q1DA 4BRWA 2Z0MA 2F6RA 1XNJA 3KJGA 2MMGA 2JJ8A 4PFSA 3ZS9A 3DEFA 4QHYA 3Q9LA 4TTPA 5CK5A 3RVBA 1IBRA 1VDZA 3PEUA 5AJXA 3CZPA 4IKEA 1SKYB 3VHLB 1XZQA 4TN1A 4AYXA 4F92B 2NG1A 3V00A 2QM8A 3SYNA 2ZJYA 5K8LA 1FMJA 2JJ1A 3ZD6A 2LKCA 2CDNA 3SR0A 3BIFA 2OZEA 3SI7A 2VSFA 3GCGA 1IAQA 4URUR 3TLXA 1ZM3A 1X3SA 2GDJA 4NBSA 1DAEA 4MRRA 5DSZA 4R71A 3MWJA 4EIWA 2DR3A 5CDFE 2EFHB 5D3QA 1E9EA 1R0WA 1XCGB 5HE9A 4JIMA 1VCMA 1FQJA 1KSHA 1N5KA 2V6JA 2VSOA 1E79D 3OEED 5FTMA 5IHPA 1J99A 3UWKA 3FDIA 4A6XA 1VECA 3TH5A 1RZ3A 3CONA 2EFEB 3PUWA 4P32A 3MUFA 2NO6A 4P4SA 3S1AA 1WRBA 3KFXA 2ANBA 3SJZA 2OM2A 3RRNA 4AK9A 4XVQA 2IEZA 2OXCA 3FKQA 2HJGA 1IN7A 2QP4A 4GDFA 2RGAA 1IONA 4UJ5A 2JATA 2J9RA 1KI2A 5AJWA 1W4AA 2BMEA 2XNDA 1G291 1Q1QA 1E1RA 2B7BA 3A36A 3M1IA 3GJ8A 1XX6A 4NCJA 2IWHA 721PA 3FE2A 3W6PA 3SFZA 1SVLA 1SULA 3PUXA 2BEKA 4M0LA 1LVGA 1XEWX 1YKSA 3IQWA 4TYQA 5G53C 2P6RA 3I1FA 3ASYA 4ACAA 1OH8A 4M1KA 1D5CA 1H8HD 1NLFA 4OI1A 4TMTA 4YMUA 2OV2A 3C8UA 4PHHA 1ZD8A 2G88A 5FPTA 1CJTC 4BFWA 2QP9X 3NH6A 2ZJBA 1YZQA 3IO3A 4M1TA 3QJYA 4LUCA 2JA1A 2XJ4A 2GNOA 1ZNXA 1S8FA 3OFND 4CT4B 4DLTA 3ZD7A 3AVWA 3SJBA 4JSYA 2V7QD 1NG9A 4JJZA 1W0JD 3GEHA 4MYUA 1TNDA 1XRJA 3GLHB 4TL9A 1UDWA 1CR0A 1ESMA 4N3NA 3GMTA 5E95A 3ZYCA 1NBME 2Z4RA 2ZSBA 4DXAA 1S0UA 3WNDA 1JAHA 3GPLA 4L9WA 1DOAA 4TTQA 3IBGA 1L8QA 2IW3A 5JJKA 3EZ2A 3DM5A 4XWKA 1E0AA 2GKSA 3IDQA 4PPGA 3FTQA 2Q21A 1LS6A 3KQKA 2PZEA 4DSUA 1CJVC 3THWB 1NSTA 1GIAA 3V4RA 1NVXQ 2DFLA 2ZYUX 2ZUBA 4GP7A 4BLQA 1IN6A 3MFYA 1WB9A 1HEIA 1N6PA 1GRQA 4QJ5A 1ZINA 5J4YA 4A9AA 1SVIA 3OIUA 5AJZA 3K09A 1OHHD 4OK6A 2DFNA 2EWVA 1KJWA 2XITA 1OFUX 2GEDA 3ZVNA 2G3YA 5KSPA 3X1WA 1XXHB 2IYYA 4I1UA 4G5SA 5KYKA 3FMIA 2ZVQX 1JPNA 1T3LA 2FF7A 1U9IC 1ZCAA 3QNUA 2JJ2D 4KLZA 4RD1A 4OJKA 1CRQA 1R8QA 1U8AA 1AIPA 2XAUA 3WHLA 4JT2A 3O8DA 2V55B 2W83A 2CL0X 3T15A 2C9CA 4GNKA 1KTVA 2J0UB 4UNNA 1NN3A 4LYHA 5EP2A 6Q21A 1W4BA 5E7IA 2ZUDA 2LWIA 4URVR 4ESVA 3T1QA 2Q3MA 2ANCA 5KNDA 2ZANA 2WSMA 1XMIA 1W7AA 5AUNB 4RZXA 2A9KA 5F3WB 1G8GA 2IYWA 1X8LA 3B8HA 3AVUA 1NVWQ 4ZIRA 3TUIC 1TQ2A 3WMGA 2WBLC 3AVQA 4TT3D 4D81A 1G4AE 2GJ9A 4I1SA 4N1AA 2H18A 3VR5A 4BLTA 5HCNA 5EJEA 4IDQA 4DT1A 5HR5A 4UNPA 4WZBE 3REGA 3SBEA 1N0VC 2REBA 4TMZA 3L2OB 3P4YA 3GEIA 4QBHA 2IS4A 1SQ5A 1NG1A 1DAFA 3OFNA 2ZR0A 2HEIA 1FNNA 2I4IA 4FXPA 3VR4A 3QSYA 2NZ8A 1N6OA 3NHAA 1XJQA 4HLUC 3BB3A 3CWZA 2Q9CA 4BFTA 1KNQA 1VG0B 2ORVA 3W34A 5DO9A 5TB5A 5LB2A 5FPHA 5F2EA 4FINA 1OIWA 1Z0IA 2PCLA 3AF2A 1FX0A 1RVDA 3M4YA 1RFLA 2FEMA 4EKDA 3FPAA 3I62A 2J87A 4ON9A 4E07A 1ZUNB 2EFGA 4AKEA 3TSZA 1E9AA 2F7SA 4GOJA 4IOKA 1S3SA 4FWIB 4PHTA 1E2DA 4FWTA 2YWFA 2ZEJA 3TAUA 1II9A 1NBMD 3R8CA 4GL2A 1EFRD 2EFDB 3NDBB 1F2UA 3Q3JB 2PZFA 1TQDA 1SKYE 3TK1A 5FTKA 2AKYA 3PXGA 3PEWA 3NTUA 1FNMA 2J0QA 3ONWA 5EE0A 1SVKA 3A1SA 3THYA 3BB4A 3T61A 3BFVA 2BMJA 2VHTA 3PIRA 1GNPA 1NSFA 1R8SA 5IK2D 2GESA 4JLAA 1L2TA 1CS4C 2D62A 2ZS8A 4WOPA 1F5NA 2C99A 2ODBA 1W48A 2W6JA 1ZM2A 4QGGA 4JVNA 2D2FA 2ZYWX 2QTVB 2ODWA 1RYFA 1R4AA 2WWIA 3DPUA 2JIZD 1DVRA 2ASEA 2AN9A 2D3WA 2ODNA 2WWHA 2Z83A 3W8NA 2F43B 3WYFA 2A2ZA 2GRJA 1KGDA 3C5HA 4QL3A 1MRSA 3A8TA 1OXSC 3I5YA 2XZLA 4CZ2A 1T3HA 2CK3A 2QZ4A 2R6FA 4L8GA 4MKGA 3FYHA 5JRJA 3GLGE 3VFDA 3WBKA 4C0KA 4QM7A 1XD8A 4NCNA 5C2JB 4TQAA 1DS6A 4NYIQ 1BYUA 1XMVA 1DAGA 3P26A 1XCMA 1U0HC 4E22A 1G3MA 1Q1ZA 1XJCA 4NYMR 3B1VA 3TJZA 2Z6VA 2H5EA 3U3KA 1W36B 4KBFA 1TF2A 4UJ3A 1E2IA 4ARZA 4XVUA 4KSBA 4CW7A 1HY3A 1YZNA 3TW4A 4KO8A 4DDUA 5L3SA 1TU4A 4WBSA 3GD7A 2ZJZA 4M1YA 4EDHA 4YDHB 2FSFA 1PVOA 1ETUA 1E0KA 4XTCS 4M4SA 3GP8A 1W0JA 2B21A 2OCPA 1WA5A 1SXJD 4OQLA 3LBNA 5HTKA 1ZD1A 1JECA 2A78A 3CRMA 4IOJA 1F2TA 2QN6A 3EA0A 3LY5A 1FX0B 3U2QA 3W5JA 1YZLA 2BMFA 4B6EA 1FZQA 3VNVA 3SJAA 5LB4A 3U6BA 2GJAA 1NY6A 3BERA 1IXZA 4DLSA 1S9HA 3CR8A 1EFRA 1ZM7A 3A4MA 1QVAA 1CIPA 4ZIRB 2V4ZA 2ZRDA 3AF1A 5E4FA 2ZRIA 2FMXA 4V0MA 5CK4A 2WJGA 3DO6A 4ACBA 1W1WA 4D2IA 1NP6A 2NGRA 5FUVA 1NI3A 3IHLA 4PO1A 3T5DA 5EP1A 2F9MA 4RD6A 3RC8A 4MUBA 5DH9A 3NBXX 1UBFA 2ZREA 4AD8A 2ZE5A 2OSBA 1FMLA 2WZQA 5KDDA 3PUYA 2BCGY 3CPEA 4OI4A 5IRCD 3O8RA 3EZ7A 2AD5A 3OHMA 4LBZA 3THXB 5IF9A 4A2QA 4NONA 1G7CA 3CRRA 3RC3A 1N6LA 2FFAA 5G40A 3GLHA 2QRNA 4DEXA 2AD1A 2MSEB 3Q8XB 3T1TA 1OIVA 2IXGA 1VHLA 3I72A 1W2GA 1Q3HA 2C96A 1NL3A 2IYUA 1R5BA 4PPNA 4Q03A 4HLQB 3D31A 2IT1A 1PV4A 221PA 4HI0E 4ZKDA 2DY1A 4ILEA 1NMXA 2HF9A 3U5ZB 4GBMA 4DIDA 1UDXA 4GMDA 5AUPB 3ZQ6A 1G16A 3A1VA 1XPRA 1KI4A 4YXWA 4BLPA 3U7HB 3RYTC 4HATA 1A2KC 3QEOA 4BZQA 3SOPA 1OFHA 2VLIA 4LV6A 4GT1A 1Z47A 4HEJA 1AS0A 4CVNA 4O2RA 1RRGA 3MJHA 4CEHA 2YWGA 3AVOA 4OL0A 2IC5A 3CM0A 1IM2A 3D3QA 4X8OA 5FTLA 3TW8B 3CX8A 2FN4A 4HB0A 4JJKA 1T5LA 3IO5A 4NU0A 4KJZA 5BN4A 3MAAC 4Z1MD 2KBFA 1C9KA 3L0OA 1NLYA 1Q57A 4PHFA 4DCSA 3X1DA 4MRNA 2ZRBA 4YDSA 2GCNA 3OIVA 1E2NA 4LYJA 2CEAA 1QDEA 4MGKR 4YQFA 5B64A 5FBQB 4BFVA 4BECA 4MRSA 4NYJR 3SQWA 1IJEA 4N0EA 1CR4A 4RFSA 4E03A 1OFIA 1QHHB 4X8LA 2GVZC 3ZH9B 3GLGA 4ZDWA 1BKDR 4I4LA 3KB2A 5HKKA 2KJQA 4ZKEA 1E94E 3GJ7A 1O3YA 3NXSA 2V1UA 1UBEA 4DSTA 5FUXA 4D25A 4O0MA 2O52A 4BUJA 1H8HA 2ZR9A 2VTKA 2J1LA 4L4UA 3NG1A 4F4JA 2QAGA 5EZ6B 1KY3A 2ZXUA 2YKGA 3IHWA 1Z0JA 2G6BA 3EPLA 3A1TA 4U00A 1KZ7B 3LA6A 5EXTA 1AA9A 4Q4HA 1I4TD 1MT0A 2VP5A 3QXHA 4UNSA 4URWR 1KO1A 2R6CA 1Z06A 2GA8A 4A2PA 2PL3A 2QE7D 1WBBA 2BKUA 2IYZA 2FNAA 2J59A 3VHXA 4Q9HA 3X1ZA 4HB2A 1MO5A 4A82A 1XFAA 1JBKA 2IYTA 3MD0A 4V0OA 4P31A 4NDZA 5L3VA 2V54A 1GZSA 1S4QA 2RAPA 4HLUA 4D0NA 4DKXA 3PUZA 1OXXK 3W8RA 4B34A 2OCAA 1P7CA 5FH9A 1G64A 4MDEA 1D9ZA 3E5HA 2J0UA 3BH6A 1DEKA 5BN5A 5FUYA 3IIKA 1YRBA 2QMHA 1GNRA 3AKYA 3GFPA 5BW8A 2JCSA 3K8YA 1TMKA 2XNDD 3T34A 1KDTA 4DB4A 2DFTA 4FCTA 4MA4A 3EPJA 3WYGA 3K9NA 4R9UC 3SHFA 3W6OA 4OKSA 4A36A 4IHQA 1DELA 2XXAB 4DCUA 3ZGXA 1F2UB 1G4UR 1A4RA 2GJKA 4ARZB 4Q1CA 3NBYC 3CRQA 3L0IB 1E79A 5LPNA 2AX4A 2GAAA 2CHVA 4DLRA 4LJYA 5EXPA 3IPYA 1WE2A 4Z51A 3DVLA 3WMEA 3O47A 4GZLA 3W9YA 1E96A 3GLFE 4US1R 1TEXA 3C15C 1N5LA 2ZRFA 3QKTA 2VPPA 1DAMA 3LD9A 3R9IA 2IS1A 2A5JA 1E2MA 2CL7X 4V0LA 5FR2A 3RABA 3LO5A 2CK3D 1P62B 2F43A 1M2OB 2OFWA 4PPQA 3N2EA 4RCZA 4HAVA 3CNLA 1G1MA 3P27A 4D6PA 3K70B 1VYVA 5EE3A 1LY1A 4B3DA 5JWOA 3GFTA 2BOVA 5J5CA 1SXJB 3MRSA 3BC1A 1RJ9A 4IOMA 5HCIA 1XEXB 1ZC4A 2F55A 1KO8A 3W90A 4DCTA 1G8PA 3AVPA 5FL7D 2ONKA 3CZQA 2C5LA 4HDQB 2FGKA 4D4LA 3TR5A 4B48A 3JZMA 1Q1BA 3GJ4A 1KHTA 2YHSA 1I4DD 4V03A 3GEEA 3L43A 2R6GA 3ZZTA 4F93B 1TEVA 2UZ3A 5J4VA 3N70A 2QI9C 3VR1A
chains in the Genus database with same CATH superfamily
2CF6A 1QTIA 3TDMA 5CX1A 4DRZA 4W9RA 3DHVA 2ZP1A 3BULA 4XDHA 5B57C 2XYHA 4LMRA 5LYJA 2C7QA 3R0JA 3G89A 1J2JA 3IP9A 1MO3A 4MEJA 4QULA 3QP9A 3LKVA 5ERGB 2EF1A 3DMTA 4HZGA 1IPFA 3BX1A 3E15A 3W3AH 1AKYA 4FCWA 2IH2A 1C0PA 4M99A 4AQDA 3RFTA 3CH6A 1NBHA 3FUTA 4Q9DA 5FWXB 5HKAA 1A04A 1UM9B 1QLWA 1ZJJA 4EB3A 4RPLA 2DHQA 4UDNA 2ZQZA 5SV2A 1UEJA 2BJVA 4B87A 3PLNA 3HSSA 1ES9A 1XTZA 3V1YA 1W88B 3OQBA 3HXQA 4KIWA 1DI0A 3TEJA 2ZRAA 3AFGA 5AVYA 1W5EA 3PL5A 1HT3A 4J07A 1NR7A 2IYLD 4UU8A 3DMTC 3I6IA 2HPHA 2WG0A 1UAYA 5B3AA 3ZEIA 4M0EA 1C2TA 3E3AA 4F60A 1JEYB 3RWOA 3C5WP 3C3CA 2YWHA 3DTTA 1XU4A 3HB1A 4IJ5A 4PYNA 3F7NA 4WN9A 4CLRB 1S96A 1V16B 2ICAA 2NZYA 5AD1A 4NY1A 1MPTA 1QJCA 2PJDA 1L3CA 2RB5A 3EXFB 3NONA 4EG3A 4F91B 1OZ0A 3DDHA 1ZH6A 4FHCA 5JWRA 1XTKA 3U40A 3RUPA 3EZFA 1P1IA 1XL1A 2QNBA 3OJLA 2PM8A 5FOXA 4Z2AA 4ZYZA 5J58A 2HA4A 5KYWA 1IXYA 4BWFB 4ARIA 4I46A 4B8ZA 3F71A 4AJIA 4G5YA 3S2GA 4XKJA 2IF2A 4UNIA 5CDGA 1L4LA 2BDUA 3JTEA 2AFHE 1KP3A 3ET5A 4S12A 3ZE6A 1E9FA 1XCLA 1NYLA 1MJHA 1ZU5A 3D8HA 4JS0A 1SB8A 1ZJ4A 2ECOA 3I37X 3Q7SA 3FZYA 3DOCA 1Z37A 1QPGA 1I7SB 1E3MA 3BQMB 2CYAA 4MEBA 4U7FA 3SKYA 4O63O 1MOPA 2VYCA 3I9V6 1UP7A 4UBIA 1OKKD 2ZSEA 3OCCA 3DDOA 2CL6X 2A59A 1GPAA 3I9NA 3R6LA 2AI3A 2RH4A 3U1TA 4BVKA 2B3DA 2CLKB 4ZEOA 2BM1A 2LKDA 1DRUA 1M75A 3L6UA 3R0ZA 2HCRA 1CHDA 4IKOA 1J09A 4DWJA 3F5FA 4D8YA 1GTRA 5EMJA 3ODPA 2O20A 3DL7A 3FHOA 1HX7A 2YR0A 4YRNA 5EA2A 1VZ2A 2BMVA 2G80A 2WP8J 5DEOA 3TGPA 3NOXA 4E46A 1P1BA 2G9ZA 1YU9A 2BFDA 1V5WA 4DLYA 4EG6A 2Y1LA 3FFBA 1TJYA 3G2IA 4TQGA 1DDIA 2DJ5A 3E5RA 4FS3A 4YONB 1EX9A 1CT9A 2LCQA 1YR9A 1TE2A 1P4SA 2EWMA 1JEOA 1T2CA 4GKVA 4UXIA 5CLQA 4BO1A 4DMGA 5C8DA 1V11B 1Q14A 2J9ZB 3A6EA 1OTYA 2ZIEA 5DSTA 3E48A 2AG6A 3S2YA 3PGA1 3OZTA 2D1YA 4ZI7B 4I8IA 4NESA 3CLVA 4IG9A 4D4MA 3IMGA 5JS1A 1EFVB 3CX4A 2TMYA 1WDMA 1SK9A 2IHZA 2BBTA 4Y0NA 1CZNA 1O03A 4KOEC 5IM4F 1V0JA 3NUZA 4IPTA 1HT2E 1P0CA 3KWMA 4LNAA 4AKSA 1QTRA 5LOVB 4D6YA 2AWNA 3EW9A 1L5HA 1PKXA 1N3IA 1QH8A 1RIFA 1UPFA 4B74A 4UXHA 4BCBA 2VNIA 1KAGA 1SGWA 4JGIA 5CLIA 2QVBA 3RNOA 1LUAA 3VSEA 3ZJTA 2ZSUA 3OPVA 1MZVA 1PU2A 3HUUA 2QLTA 3DXFA 1VC2A 3CHYA 3QZUA 4H59A 2BTQB 2GCOA 3VU8A 3ZHXA 2QNIA 1CRZA 4GM4A 3UH0A 2IGTA 4BKQA 4EYSA 2AFIB 5KDOA 4NENB 4DMLA 5DI9A 1FL9A 2ZAIA 3QLUA 3WKEA 5IEBA 1WR8A 5ADVA 2ID4A 1ODFA 1T8RA 3JATB 4KXQA 1K88A 1D1QA 3OZCA 2ZFUA 3TZHA 4F4DA 1IJFA 5AVVA 3C7KA 3OE5A 3ABSB 1QQBA 3NU1A 3DB1A 3I64A 5HE8A 1U80A 3LSTA 3RRZA 5IXJA 3MPOA 2CD7A 4M9QA 1G5FA 1V1MB 4F3KA 1IHOA 1GT91 1Z07A 2VP6A 4QYIA 5FUWA 1OE0A 1FTSA 3OJCA 4OU5A 3B6JA 1E1QD 4B7UA 3DXXA 1KRXA 2C2BA 4LRWA 2WICA 3G7SA 1R0YA 3L46A 2VQFB 3OQNA 2H8GA 2A9FA 2XB6A 5DM1A 2BWJA 4OO3A 2R48A 2C03A 2X8AA 4RS4A 4WLUA 1ZITA 2J9YB 3OAAD 1XD2A 2RI0A 1LLCA 3PFBA 4QA9A 2M1XA 4MITA 3OQOA 3R8FA 3SC2A 4R0NA 5DWDA 2WF5A 3LL4A 4KXMA 2XDAA 1B16A 4XVUA 4G23A 2IK8A 4Q3CA 4Z6KA 3MWEB 1XVLA 1BRMA 3TAXA 2JLAA 4PC3A 3RU3A 1GTG1 4R7ZA 3BXEA 2FG6C 2YVAA 1ADCA 2Q29A 4FCVA 1QO0A 1NN0A 2Y9MB 4O4JF 2H4WA 4N3AA 5LP1A 4PLYA 1K3FA 2X8LA 1QP7A 3SC2B 1SCAA 1SK8A 3A2KA 2C5EA 3WYNA 2QTAA 3QBVA 3BIJA 4ZDIA 5FULA 2PE5A 4RA6B 4Q48A 4WXHA 2H92A 4NBVA 3NX4A 1A8UA 1O5TA 1WD5A 2OFXA 2QPOA 3UG7A 2I71A 2OXFA 1BMQA 1KK3A 2AI1A 5EL0A 1WQ4A 2AOUA 3CUWA 1WZEA 2EQBA 4WXRA 3TB6A 4J3JA 5ICGA 2Z6QA 2VAXA 2VBIA 5LM3A 1OT3A 3AHIA 4RTLA 1UPAA 4P5DA 5H70A 1K68A 1ZQ9A 2PZBA 3C98A 4IIJB 5FT9A 4F4FA 1TW3A 4GGOA 1IN5A 3UBTA 5C9ZA 1Q0HA 2ZRGA 3H5IA 2B7LA 3V34A 1CWUA 4HVTA 3Q5EA 2GO7A 3E9CA 4NAVA 3JQ8B 4G07A 4TMFA 3DLIA 3O7WA 4G9GA 1BWQA 1NVKA 5B1EA 1T2NA 3RAFC 2PJZA 3BE4A 4I08A 1QBGA 3D81A 3K8ZA 2GCGA 2JHCA 4WK4B 2B1RA 4XFDA 2CXUA 2HMWA 1M7BA 1SUBA 1ZSNA 1F0PA 4LBWA 4AJ2A 5HOEA 3J81A 2XVZA 5CTJA 5JQGB 4YVFA 5IM4A 4PZZA 1ZMTA 5DK6A 5EHGA 1Y4DE 1M73E 2LPMA 1JSZA 4K40A 1UFVA 4QQKA 1C1DB 3HRIA 3QKRA 4HJRA 1E66A 2B4KA 4MKXA 4G0VA 4AUKA 2QR2A 1NJ5A 5HJ2A 1CUYA 2GAOA 5CUQA 4U7GA 1CTQA 2PVPA 2JGDA 3SR4A 4A8JB 4B7AA 1VE7A 5JARA 1I1NA 2YY6A 3I45A 4ALJA 4ZGGA 3EX7C 1CUUA 3TNDA 1W8IA 2IIVA 3C4VA 3H42B 3IMKA 4IRUB 3DXYA 3IAHA 2MR6A 4JJEA 3D3WA 3AR9A 4R2WA 4EG4A 1FMFA 1ECGA 1H5NA 3G0GA 4F11A 1UQUA 1ZOSA 1JX6A 2RGYA 4DLPA 4U2BA 2QD1A 1JU4A 1GXSA 4BNUA 1NXQA 5T6MA 4ZJZA 3ECCA 1V8OA 2E82A 4LZZA 5FHRA 3H5NA 4I0WB 2HDOA 1P2SA 2DKNA 5F2KA 4ZT6A 1OU0A 3RPEA 1UC4B 3KAKA 1E0JA 1F48A 2ILTA 3B2NA 3ENZA 4ME6A 3WYEA 3K0AA 4KCGA 2WB4A 3RTDA 4DCCA 4I19A 2XYVA 4BP9A 3NIFB 2Y2UA 5HMLA 1OTHA 3IQDB 4AMUA 4C3ZA 2J6HA 2W6MA 5BWNA 3V46A 3SC4A 3GWZA 4MW6A 1YUMA 1B6SA 1VSTA 1GUYA 4CTMA 2ZB2A 5CEEA 1HG0A 3P5SA 4EWLA 2VDQB 3NTRA 4GOLD 3EQ7A 1JHQA 3KJHA 1WABA 3VV2A 1X92A 2QPAA 3E5MA 5EJ5A 1P73A 1Y7PA 1EK5A 3WGJA 4IQ8A 2BHTA 2ERYA 1KRHA 3LA8A 4C3OB 4EX6A 1RZUA 3DO5A 3AI2A 3MWGA 4YB8A 2VN8A 1E9BA 3KYCB 1TIKA 1P5JA 2QZSA 1K9SA 3ICWA 1J49A 2BBWA 1A8SA 3AMVA 3BTSA 3EVAA 2VDWA 3IJ5A 3NC1C 3Q4GA 1JF8A 2WV9A 4JC0A 4N3GA 5U4XA 2OCXA 2OFFA 1G38A 2MSDB 4LISA 4LC0A 4NX2A 4UFOA 5TX7A 4FXOA 1CC1S 3SE7A 5JNUA 4F06A 1QYCA 2HWXA 1JDZA 2LNDA 3RIXA 1D2GA 1Y4UA 3BGIA 1E3IA 5I3ZA 2AQKA 4LYGA 2BTEA 3DBVO 2RHMA 1ZOIA 1Z4PX 3K9QO 4J6FA 1QHSA 3KD2A 3BA6A 4BVEA 4CBVA 4K88A 2JJQA 3GVCA 4QEDA 4RE6A 4EG8A 1OWLA 2QN3A 5FXMA 4F2PA 3IOBA 2UUPA 5KNCA 3E9QA 5ALEA 3VPCA 5JZOA 4N7RA 2QQ5A 1MAVA 1S6YA 1D2AA 3A4LA 3UWPA 1SQ6A 4IJKA 2GYUA 1HDCA 1H4SA 2BKXA 3L7DA 2PX8A 1M2GA 4LC1A 1MQ8B 3RKSA 3WLIA 5FWYA 2Q5EA 3A6KA 1R3UA 2AH5A 2M9MA 5JAZA 4XJVA 1QK5A 3G2PA 5CITA 5H8WA 2W2QA 1PUJA 5FFFA 4BX2A 1JLRA 1J8YF 2HY7A 3MWKA 3N75A 5T57A 1LTQA 4HUTA 4YK7A 3F74A 4L02A 4JYMA 5IBCA 1YGYA 2ILVA 5DLDA 4PX5A 4AY2A 4B7ZA 4BMNA 2G9NA 2HU5A 4H77A 2P79A 2GZSA 1X7ZB 1N8NA 2BP7A 3DHWC 3GLIA 3QUSA 2FEPA 1KERA 2VCHA 4L28A 3LQ1A 3UEOA 1UOQA 1WJGA 5F73A 2QOEA 3ESRA 1E64A 1GTMA 1MX9A 2IU6A 4NBUA 4NQZA 2TS1A 4K2HA 5H3LA 4Y1GA 1KOGA 2GZAA 1N5OX 5FLKA 3RLFA 3CUEF 4F3NA 3I4CA 4XZ3A 1DO0A 3DE6X 3ADBA 1DEXA 1XSEA 2DQ4A 3KDPA 4RH3A 4W7HA 4JI1B 3U0VA 3HA3A 3FYUB 3I34X 1F8UA 5EEGA 2WTUA 2WOJA 1UZAA 2GBGA 4CF5A 3DW3X 1W44A 3A2LA 5AXDA 3V9PA 4Y6SA 2PLFA 4DC0A 1A9ZA 1WZUA 2PFKA 5K8IA 2PGLA 4HP8A 1CEEA 2HREA 1A72A 3L6RA 4MQBA 4DIUA 3MRTA 1TA9A 4K8RB 4QE3A 1UBJS 1UK6A 5C8VA 4BY9E 2F9LA 2MDTA 2XJ9A 4I9GA 4LFCB 3VPAA 4FFDA 4WW0A 4OGGA 4Z7JA 1D4ZA 3P9QA 4LBYA 3QLVC 4XIYA 5FFNA 2PZMA 4ZCLA 1GU7A 4MW2A 4BU1A 4LC9A 1X1DA 4Z3KA 3Q7RA 3Q7TA 3C6BA 4KWTA 5J2TA 1QHHA 4OHBA 1YB7A 3VBCA 1W93A 1BDJA 3E4CA 3D1JA 1H6CA 1JLLA 4TKZA 4O4JB 1M10A 2QZ9A 2G72A 4HUQA 5ILOA 4OLBA 3FOCA 1PEKE 3UJ8A 5CVDA 1RHRA 5DP1A 4RLHA 1V47A 5EGSA 1NJFA 1SHUX 3TLGB 3A9CA 1BCRA 4P54A 3B8EA 5A3JA 2IIPA 2VJBA 1D4OA 2GNPA 3KB6A 3PJGA 5GADl 2O2DA 2QMQA 3ZOZA 3A9TA 1Z6GA 2QLMA 2OVFA 3MIZA 3F97A 3O4RA 4JVMA 4RGQA 1HDGO 5EJGA 5IJ0A 1WTAA 4GRAA 4ZVKA 1Y3IA 4BVHA 4UD6A 3G0OA 4DIBA 2P9TA 3A28A 4NKRA 3QITA 1IZ7A 4LHZA 4PWYA 5AKXA 1U2GA 3ZDFA 3UJ9A 4C01A 1NFFA 2XE4A 1KORA 1R4MA 1Y5RA 2WJWA 3OKPA 1E1YA 2HDHA 1Q83A 2IYAA 1YBHA 1Q0LA 4OVKA 2FZ4A 4P58A 1U5CA 5DNDA 4C43A 1PUXA 3AYXB 1T2AA 4E5KA 1VLMA 3IDFA 4IHJB 5JE8A 2J33A 4B2PA 4DANA 2R47A 4OOEA 2IV2X 5GPBA 1NWHA 1EDDA 1R0SA 1VHTA 1OWMA 4HRXA 3B85A 1MX1A 2WFLB 3EVZA 3ZZNA 4OF4A 1B26A 3QFFA 1FFHA 1I7LA 2NO1A 4K6GA 5DTEA 3VNRA 4PNEA 5JYDA 4A15A 1IM5A 1E0SA 2HV9A 6REQB 1YS1X 3WK9A 3S29A 3TUJC 2POQX 3LX8A 4PRYA 4CIBA 3QGMA 2H1VA 1PYGA 1I2CA 2Q7DA 1I3NA 2PA3A 2WLSA 4LWQA 4PAOA 4WE3A 2OCBA 1RWMA 3CG4A 2PN1A 2NTNA 2YWJA 4KZKA 5KYVA 3A3OA 3JS5A 2VRCD 4OMFG 4L2IA 4KQIA 3NWOA 3CIOA 2QRQA 4LXHA 3I12A 3I1IA 3QUAA 4RX1A 1UWLA 2WM8A 3IQXA 4RE5A 4C6TA 5JBIA 1TTTA 4D3XA 2CFRA 4IM7A 2G5TA 1T36B 3C8MA 5E6SA 4KG7A 2QT9A 2Q8NA 3B53X 3I73A 3AIIA 2QAGB 4FCCA 1GNVA 4M1QA 4BAGA 1J00A 3Q3CA 2E2WA 2X0EA 5BR4A 3S8YA 1V4VA 2G9UA 3VJMA 3RYIA 2WF7A 1IVSA 3DDZX 1THGA 2QG4A 2VJPA 2PMDA 3NORA 3OLZA 3DAPA 3ND5A 4MGIR 4N8EA 4RKRA 4Z8YA 4XLLA 3LRTA 4JI5B 3WK8A 2DCUA 3QE9Y 1Z8NA 3VQTA 4ZI3A 4QVGA 1U81A 1N25A 4RKYA 1M7GA 1N6HA 1DWOA 3OUZA 4FN5A 5IC5A 4EGAA 3FSJX 4ZAWA 1PJQA 3LWDA 3MWDB 1P74A 5EE5B 4P7GA 4EUSA 5CCEA 2X0DA 5A5EA 3W9SA 1UJ2A 4DA6A 3N5CA 3OU2A 5CLFA 2WSYB 3HI4A 1WPGA 1A8PA 1TUEA 2EJWA 2MT9A 4FDMA 4GKBA 4DBLC 3LUHA 2AZMA 1AZLA 1FFBA 1I01A 4QUEA 5KU1A 3K1AA 2IH4A 3QHQA 1T2FA 2G83A 4M22A 3P4UA 5BWMA 3AU8A 3SZRA 3OKFA 4CKWB 4F4CA 3U19A 5CNJA 1Y34E 2VJKA 2V3CC 1HTTA 2QVXX 2YINC 1YHYA 4O2BF 4MJXA 2EYQA 1C5KA 1J0DA 1TM2A 2PMWB 4LZLA 2AOWA 4N0MA 3KXDA 5DM70 4RBNA 3RSLA 1LNQA 1BDMA 4GI2A 4NFSA 4YMHA 3PC3A 4N0PA 5H3CA 5J5VA 1BXKA 3QELB 3ZZ1A 1FSZA 1HSZA 1SKQA 1Z2CA 2CCJA 3CZAA 3JVEA 3QUBA 4QGBA 4UHFA 4UVHA 3RTGA 2PRYA 4F56A 4ZVSA 2TRSB 4ZO7A 4JC4A 2DQSA 3CUSA 1YZGA 2KB0A 3ETNA 4RPGA 1EG7A 1N9KA 4RJTA 4NYIR 4U7WA 3T3EA 3VX3A 3FNRA 1HEUA 1EVIA 2V5VA 2WIKA 5K3EA 4PZUA 2OCDA 4TKMA 5I9LA 2L69A 1U7UA 1XNQB 3P96A 4L8YA 4XW2A 3TSAA 5D51S 4OI0A 1E6LA 3PHGA 5T4BA 4EH1A 2X5NA 1UT5A 3QA9A 3RYCB 2FP4B 2HK8A 1M1NB 4LV8B 3T7AA 2P5SA 4YRMA 2FZ5A 2Y1CA 1SB9A 5E7QA 1NOKA 4OCZA 3R75A 4H18A 1OLXB 5ER9A 1I3KA 4CF6A 1NV9A 3HKBB 1AQLA 3JD4A 3QG5A 3SF8B 5FOQA 5LD2C 1DG1G 1KMIY 1CIVA 1KFEB 3C16C 4ND1A 1VA4A 1DL5A 1WCV1 4JYAB 1DQYA 2BKVA 3ELWA 3VHQA 16PKA 4BRSA 2HJSA 1U8CB 3OPMA 4Q6WA 4G36A 1G8YA 3FMOB 5FV4A 2QD4A 5KAMA 1CRPA 4ZXPA 3ZD8A 1EBUA 1V26A 4ALKA 4I1PA 1A5SB 4GM0A 1T91A 1XMJA 1YUNA 4W5JA 4NNJA 4WERA 5K2MA 4M6WA 4B3CA 1M83A 3IEVA 3ZCVA 4HF7A 3P0RA 3PTAA 2ONJA 2BFWA 3GUHA 4R8VA 3VZRA 3BPSA 3N53A 5TSDA 4H6PA 1GL9B 1OHHA 3V5NA 4NK4A 3KHUA 5EIBC 2VAVA 5AVUA 2XZPA 4WX2B 1N8SA 2C54A 3DDUA 3NHMA 1B6GA 4I3HA 1W2HA 1WZ2A 2Q1TA 3ZNQA 2O8FA 2WZCA 5HGJA 1DSSG 3IBYA 3PRYA 1Y0BA 2QTFA 3IPCA 4PC7A 4CM6A 3EGDB 1CR2A 1WMAA 5AXBA 1VI2A 4AM8A 4JD5A 3LFUA 3BDVA 2R1TB 2E4YA 4J49A 4JB8A 2QRZA 4MP8A 3AR4A 4PRKA 1WDTA 5L7YA 1OYYA 3TD6A 2CYBA 2VSXA 3BMOA 4F0JA 2IL1A 3DVQX 1Q0UA 1W5SA 1QFJA 3DAHA 3OA0A 3TTVA 1NMZA 2Z6AA 2HL6A 3CINA 3UZUA 1Z88A 3HJBA 3JRNA 1MOZA 1JR3A 3G6KA 5DJ5A 3MT8A 4ZN6A 3Q5GA 3VNAA 1MJGA 3EG5A 3ICVA 1L8OA 2HDNB 4F1KA 2F1OA 5TQ0B 3JQRA 2JLRA 5LUAA 1CPYA 2RHWA 2CVHA 2Q1XA 1WHSB 2NU8B 1C80A 1VJDA 3RKRA 3SHOA 1H9CA 1BD4A 3WLAA 1QORA 1XDSA 4WXYB 1A95A 1OREA 4GFDA 3BWMA 5KYYB 1N0IA 3X44A 2J5KA 2VDVE 1NA5A 1I0IA 2GN2A 2WKPA 3CX3A 3CV3A 4M0FA 4RQAA 4WSOA 4CEIA 2I87A 4HBGA 4R98A 4GL4A 3R0IA 4D4IA 3R5FA 2FH5B 1HRKA 4MGZR 1W30A 2P6UA 4Q1EA 1T0JB 1SVOA 1VB5A 1G8MA 4JLVA 4YLYA 1JLHA 1MH1A 5CM2Z 3DL0A 2UYHA 3NHFA 4URFA 3IRUA 1RZVA 5CT8A 2GD1O 2PYIA 4IJWA 5L51A 1E62A 2PYZA 4I81A 4PHCA 2HIAA 5D85A 4FOSA 3L0SA 4TLAA 4YJ2B 3SC6A 1M5RA 3RRBA 3H65A 5K6AA 3OECA 4M1WA 3LKBA 4X71A 1V6SA 2IXBA 4FIZA 4EJMA 2BONA 4Q0MA 3DE2X 4IY1A 3SBXA 3OQJA 2PS9A 5IXSA 4BEJA 4ZHQA 2GCIA 2RHRA 4RIHA 5B7PA 2HWUA 4EKEA 3IV7A 3L1IA 3QMMA 1R6BX 2GPNA 3B82A 3AR5A 2XHEA 4PAWA 5T67A 1RHUA 2DHRA 4XWYA 2C5SA 2X0JA 3R7BA 2PUBA 1SNYA 4O25A 2WP0A 2WHRA 2X1LA 3D7NA 3PJEA 5ERYA 3FYCA 2H63A 2PDAA 3HKEA 1QONA 2B1JA 3EJ6A 1BGVA 4FNOA 3EARA 2I78A 2I7CA 3N2YA 4N03A 2UUCB 3RF7A 3NP7A 3T0FA 4DQ0A 2X9QA 4YJ3F 2FMIA 3LUPA 4H31A 4LJ4A 3PUHA 3JV7A 5L4NA 1IM8A 3C45A 3PVSA 4CQMA 1OB5A 1G60A 3K9FC 3I9V1 3ZDCA 1RYYA 2P9QA 3RFXA 4ASUA 4CL2A 2HCTA 4RKFA 1K0FA 1V43A 1VGQA 1E3DA 2R97A 3BMCB 3AL0C 4YAKA 4DJTA 2H9IA 5C81A 3DC7A 3H3JA 2G77B 3JQ7A 3T12A 2WWYA 5BQ3A 4GSLA 3HBAA 4OQ4A 3UGTA 3KCNA 5JS7A 2HLDA 5HMMA 4LIPD 1KI8A 1NLZA 3P32A 5CFPA 1WQ1R 4G67A 1O94D 2BI7A 4GOOD 4I1OA 3QRWA 4WJLA 1GPUA 5IM5A 4EM6A 1YTUA 3ACCA 1QKIA 2QNRA 3ZLTA 1J25A 1FYFA 2OGSA 4DSAA 4AJJA 2GZDA 4BQSA 4C7OB 1EYZA 1DDGA 5B4TA 3IVCA 3CUTA 4LJ7A 4P34A 3BFXA 1XELA 1RR6A 2A88A 2PLRA 4TUYF 4B32A 4W7IA 4GGPA 3ZCRA 4BX3A 2QJFA 3LPDA 1E6CA 1QGED 3TKYA 3OAAA 4AZVA 1CE8B 4C4SA 1JIQA 1NXOA 1ETHA 1KJ9A 1DTWA 4D99A 1L4NA 1R8YA 3PC8A 3CH4B 4IJQA 5G1NA 1GLGA 3D43A 4INJA 3RQIA 2YS6A 9LDBA 1WD7A 3G2HA 4RPKA 3AK4A 1I3LA 4G5HA 4GKKB 3ZKWA 3S5JA 1NX6A 5AICA 2O7VA 3QXSA 4TS4A 3FYUC 4YASA 4NXNB 1E77A 2WJZB 2RKBA 1QB7A 4JVSB 3U4QB 1EU1A 4TTTS 1YS7A 4TMVA 2FJ0A 1DV2A 4MRPA 1QQ6A 5I4CA 2GPAA 2HJVA 2O0JA 1EK1A 1HORA 2JIRA 2XWJI 1PYDA 3NAZA 4GXRA 4R31A 3AEQA 1AQYA 1IVNA 1T2DA 4Q7JB 3PDUA 1LV7A 1SIWA 2QQFA 4KO3S 1G21A 4OH7A 4BO7A 5A1TA 5IAAA 5LVAA 4G0WA 2JLWA 3BMXA 4F97A 2XD9A 5I01A 4B83A 3EVDA 1T13A 1A7UA 3F6PA 3PFHA 1RXVA 2I4RA 3EFBA 1FTNA 1P6XA 1RW4A 2E4ZA 2Z08A 2IDKA 3F5SA 4Q47A 3OCYA 4MYHA 1QH9A 1J56A 4XWGA 3VVBA 5KJ1A 5CFQA 3EZLA 4W9NC 1D6MA 4LXQA 3EVTA 1DUIA 1WXHA 3VISA 4AMGA 1OI7A 2DT5A 4MWEA 4PLFA 5LWQA 1H2BA 3U4HA 5I6DA 2ZSKA 5ALVA 2Q49A 2VEDA 3L05A 4RF4A 2O8CA 1HA3A 2A9QA 4EP1A 2ZYAA 1O94C 2WTMA 1DIGA 1SXJE 2P2YA 4R7TA 2X19A 3GA7A 2G0AA 3JZDA 3SEQA 3RTEA 4IH9A 4UBNA 5LLDA 1ELOA 3F3KA 3MELA 3PQFA 4BNDB 2BGUA 4DUGD 4TTIA 3K8QA 4DV4B 2H65A 1KQ3A 2PLWA 4PZAA 2FWNA 3VBEA 1JAXA 3PHJA 1TEZA 1E2LA 5TT0A 1AKQA 2BN4A 4LK2A 4OFBA 4NH0A 4L3WA 5TMBA 1U7TA 2O5RA 2YY7A 3NJRA 1SA0B 1OPXA 3SYMA 3HKDB 3M7IA 2MSWA 4HQKA 1JPVA 5K3FA 3GEPA 3M0EA 4K9SA 4RTJA 4CYMA 4D46A 5A5DA 1GCOA 1A7KA 3QYFA 4H7DA 4M9RA 2VDPB 5K0TA 2ZSHA 4CGZA 3FTFA 3A6ZA 1ZMXA 5DBFA 3CKMA 3AP3A 5GJBA 2JFWA 2ZJ2A 2FZEA 1KSGA 4B9AA 4PN3A 3KR2A 3HA7A 3FOBA 2F4NA 4FW8A 3DTVB 3W8DA 4MWDA 2ORIA 4HO1X 4XJSA 4YBZA 3DM9B 2EKZA 3UNXA 4POOA 1OFTA 2J5QA 1F20A 3QKSA 2OENG 3PC8C 3T7TA 1QVRA 4NMWA 4RKQA 5AYVA 1MQAA 4N0QA 4LEIA 4EITA 2HNAA 3OSZA 4CEJA 4NIMA 2C83A 4K81B 1MX3A 5HF6A 1SOAA 1VB3A 2AS0A 2EFCB 2NPIA 2ATXA 2KI5A 2PSEA 2Q3CA 3MJDA 1PR0A 4MP6A 2Y0CA 1JZSA 3BAZA 3RS2A 2OLJA 4XWTA 4D45A 3UTCA 1RRFA 3JAMA 3PRJA 1B74A 3S4YA 4LXTA 5EINA 2ZKIA 2HMAA 3GUCA 4AIRA 5AHKA 1P9NA 1SCUA 4MJLA 3LT5A 1XCJA 2I7DA 1Y4ZA 4X63A 3NJ4A 2QR5A 3U1VA 4XPZA 4HLDA 2IKSA 2OTCA 2JA2A 3H6GA 3PT9A 4GZ5A 3TQTA 3UMGA 1VTKA 2VPYA 4REQA 4URHA 3GELA 3TDKA 1C4OA 3WIOA 4BJ3A 2Z58A 2XADA 4RJLA 2FCRA 2I33A 1A27A 5FBKA 3G8AA 5ALNA 4FDVA 4ZALA 1Z2PX 4WZAE 4QUJA 1ZCBA 3H2YA 2WV7A 2B4AA 4PWZA 1E2JA 4ZCIA 3NHSA 1BWRA 4ITRC 4CWAA 1DIBA 3JQCA 1XF9A 2AXQA 4AKIA 2V3WA 1KQGA 1AUQA 5IAEA 1XQVA 3NHWA 4QUIA 4UEOA 3KTOA 3UJ6A 1E0AA 1SVWA 2AWOA 3T5GA 1U2PA 1Q1EA 5HJEA 1KZGB 3BORA 3NHBA 2BFFB 3DOOA 4E2ZA 1M1UA 2ST1A 3U5TA 4UCQA 1X6VA 4HZUB 2WTEA 1IBLB 3VJKA 3ZLUA 3DWGA 3K92A 4XM0A 1TQ6A 1B14A 2ENWA 1CQXA 1NKTA 5I9TA 1U31A 3GLFE 2EV9A 2OHXA 3ZNOA 4AP6A 4N76A 4OBWA 1QGDA 3HBLA 3ND7A 1Q0PA 2JCGA 2RHHA 5C7YA 3T1OA 4WFKA 2WZBA 1TK2A 1J7JA 2WD8A 4KR2A 2FAXA 2XVAA 3N2IA 4M0MA 3ZHTA 4BUCA 1T9HA 1QHNA 1E0DA 3NKVA 4HNUA 1S2OA 1ZESA 2XYPA 2ASVA 1JXMA 1LJLA 2E1PA 1JALA 1GL6A 2FPKA 1PRYA 3I58A 3JARB 2R6JA 3NRJA 2GPSA 3FFWA 5CYOA 3TSWA 1JEYA 3H0KA 2C77A 5AKJA 3EN0A 1NMEA 3BJZA 3GF4A 4GSKA 3VA7A 1U2DA 1QQ7A 1TJ4A 4DL9A 2VOJA 3CXUA 4JFRA 1RM4A 4PU0A 2NSHA 3NLLA 4ZTZB 4P4UA 5EJ2A 4C22A 2CV0A 2I65A 2PXXA 1XMXA 1U8ZA 5DXJA 5BNWA 1EVEA 4XSVA 3CURA 3HKBA 1OU4A 3QW4B 1P7VA 1RSZA 4WLEA 2NV6A 1LTHR 4UTOA 3QPBA 1XT6A 1OBFO 4BPBA 2J08A 5C34B 4YHHB 4NP6A 3A1UA 2W58A 4IUYA 1EJBA 2AK2A 4EAQA 4R40A 4YREA 2H29A 3HJNA 2O5EA 5E1BA 1GQRA 3GFBA 2R8XA 2OKGA 1Y3HA 3L07A 4PG4A 1H0KA 1RYZA 2A33A 2JAUA 3LV8A 1A8HA 2XOKA 5HDQA 5BMVA 3VR6H 1Y8CA 2FB9A 5F21A 2FMUA 4EJSB 2G7ZA 5CFOA 1Q22A 5GY7A 5B30A 3SM3A 3W2GA 4BZXA 3TRHA 4HNTA 1J7KA 3GEBA 1QBKC 4Z9XA 2ZRJA 3R7FA 2IYVA 5EQTA 3T4XA 2GPYA 3HFRA 3JWPA 1XEAA 4KUEA 4GYKA 3PX2A 2VYVD 1RWBA 1ID1A 4Z86A 4LDJA 2CXTA 4O0LA 5G0TA 1UP6A 3AHFA 3BCSA 1Z35A 3N2LA 4JX9A 4NDAA 3ZVLA 5EEHA 4DGQA 4GWGA 1B8PA 1V8BA 3KQPA 5GGYA 1ZEMA 3C14C 3CH5A 1J8MF 1WP9A 3DGEC 4GPAA 4YPFA 4YQZA 1KO7A 1XNGA 3I23A 4R5HA 1VRWA 1ZY2A 4DC9A 5EKXA 3LWNA 4XOUA 3ROKA 5JJCA 1Z25A 4KKXB 3ZW9A 1QCDA 2Y77A 5DBHX 3RSQA 1COWD 1D09A 2FW0A 2HF8A 4Q37A 1UKCA 4UHJA 4YALA 5IMSA 2JGIA 1DO2A 3G88A 3RSCA 3SU8A 2DPYA 1QO9A 4Z53A 1II8B 3TTWA 3S44A 4AO6A 2O07A 4L15A 3P9RA 4UVDA 4AG5A 1ZMRA 3A2NA 2Q3HA 3G2MA 4RM3A 3W6NA 4K46A 1L4BA 2OAQ1 4XE5A 4G86A 1XMSA 3VR4D 1BX0A 2GASA 4ZVUA 2W2TA 4ALLA 3AL3A 1U7WA 4G5RA 3HSKA 3K0CC 5THXA 1R2QA 2NU7A 4IF4A 3NTOA 4E5VA 1KC3A 1EM8B 2DH6A 3ND9A 2EW2A 2YIMA 1T5DX 3L8YA 4XUDA 1C30B 3WO0A 2OHFA 1PG2A 3GEMA 4AMVA 5ICSA 5BWOA 2JG3A 1IU9A 1P3JA 2AT1A 4QFBA 3VKHA 1XDDA 2R4TA 4G01B 1H22A 2NYUA 3E9NA 4MW0A 4XR9A 2OKCA 2VPTA 1BA2A 4CFZA 1AKRA 1G63A 2NTJA 5JXHA 5MN4A 4KUHA 3WL7A 1KEZA 3KOYA 3DPSA 3LLUA 4MR7A 4XQ0A 4IO0A 4O1IA 2C9DA 4F86A 1W49A 1L0BA 2O3RA 1IQRA 3LPAA 3TNFA 2EVWX 4O2AB 1UBOS 3ZHBA 2AFVA 1J2TA 1V3QE 2G40A 2XYQA 4BJ1A 1YO6A 3DTNA 3EDMA 5F7OA 3OE7A 1MNQA 4EUNA 2XTAA 1Q0TA 2E1RA 5B58C 4RTSA 3UWOA 3TR6A 1UT8A 3WLEA 1HE4A 4O2AA 4U2EA 1JEDA 1APBA 1WMFA 2A8YA 2OM6A 1GPLA 3LUCA 3HA5A 5FOWA 3UANA 4Q4JB 1H8EA 3WMWA 5AXCA 3BA1A 2CDRA 3D6NB 4R1NA 3AGPA 3QU7A 1FSFA 1CFZA 1EFDN 1TAQA 4QNMA 2PXAA 4UFNA 4XSGA 5IK2A 4EA7A 1SBYA 3AKZA 4B3RB 4JYCA 2GDZA 4DABA 3T38A 3L4EA 2EZTA 2R7KA 4S1TA 1G6OA 4C87A 5IP5A 1QLJA 1TI7A 2G07A 4E5YA 1CULC 2HGZA 2P91A 3JYQA 1XD2B 3QMWA 1VXOA 3QWAA 3R7WB 4KSYA 4XWOA 2ALJA 1WCIB 1KJYA 3KQUA 2PY6A 4FJ2A 4E32A 3HZRA 1NVAA 4S04A 5D86A 5LDHA 1NQWA 4ZV9A 4AQ7A 1YDFA 2OQIA 3R3JA 4TTVA 4I4TA 4MI6A 4GMFA 1JS1X 4NOJA 1MABA 1NVVQ 1IOZA 2F8LA 2P3OA 1XZGA 2Y1XA 3FCAA 4HB4A 1NW6A 3N59A 2X0NA 3FBGA 1EP9A 4FZ3A 4O4HF 2F3TA 3QMPA 4US2R 3KUCA 4ISBA 3H1FA 2J5BA 2P2LA 3FAZA 2M6LA 1NI4A 4MCIA 4U63A 5EJ8A 3DT6A 1KFJB 4PXAA 1EFUA 2COEA 1X94A 2JJMA 3MINA 4I6GA 4ZZ2A 1MD9A 5ERXA 1F3OA 2O8EB 1E2BA 2CN1A 2QW8A 2ES4A 3GZNA 2GK7A 2JGFA 4M87A 4MINA 4MKIA 5A3SA 1M1ZA 3A25A 3AXTA 3I32A 4JLDA 3U7EB 2ZZNA 5IT9A 1YDGA 4EK9A 4YUVA 3F6SA 1LPAB 3KTAB 4NMXB 3ZPXA 2OK8A 5ADHA 1R50A 1I2AA 2WAXA 4YRCA 5AKIA 3IHTA 3K9WA 3NHYA 4HWPA 5KPDA 3UQZA 1O08A 5AUQA 3GA0A 4Y3UA 1YSCA 1D8AA 2PS3A 4OM8A 3ZHQA 2E9SA 2WJVA 3ZWCA 3ZVRA 1FZTA 4X6YA 4MRMB 1TRKA 4OSPA 3RU9A 2HZ7A 2BGMA 4TXJA 3TLYA 4JLKA 4XSHA 1XWFA 5B3JA 1JQLB 1PFKA 1WU7A 4IXTA 1CLEA 3ZDXB 2HXYA 1JHXA 1YOVB 3B6EA 3ZGYA 4C0JA 3QVOA 2C3UA 3DGFC 3VPXA 1Y4AE 1BS2A 4QKQA 3KOUA 2EP5A 4AKHA 1W25A 2WPDD 1KKMA 3JYLA 2OCIA 3EXAA 1X38A 3G7UA 3NIBA 2NU6A 2OLKA 3OPXA 4GGMX 4ICIA 4UMDA 4CTJA 4HQ6A 1EE2A 2OILA 1GYPA 4ES6A 4YCBA 4MVXA 2R8EA 3AF4A 3CO5A 3IESA 2H51A 4ZT5A 4AZ0A 1ZUHA 4QDJA 4C6RA