1PF7E

Crystal structure of human pnp complexed with immucillin h
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
288
structure length
288
Chain Sequence
ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
publication title Structural basis for inhibition of human PNP by immucillin-H
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pf7E00
4TXNA 1ODIA 2AI2A 1V41E 1Z36A 1PR5A 3NM4A 5CYGA 4DAEA 3UAZA 3OF3A 1Y1QA 4DA6A 1A69A 3NBQA 3LA8A 4U2KA 3E9RA 1OUMA 3T94A 1ZOSA 1VHWA 1NC3A 1SD1A 1T8RA 4QFBA 2QSUA 5CCDA 5CXQA 4OGKA 1FXUA 4G8JA 2A0WA 1JDUA 4LNHA 1PR1A 4D9HA 5F7XA 3DF9A 4WKNA 1K3FA 5F7OA 3BGSA 3KU4A 5F73A 1JYSA 5EFOA 2A0XA 3FAZA 1U1FA 1YR3A 1RFGE 1VHJA 4M7WA 1WTAA 3PHBE 3FUCA 3UAWA 1Y1TA 4I2VA 5F7ZA 4LZWA 4OGLA 4OY3A 4EARA 4TTAA 4QASA 3EUEA 4DA0A 1V4NA 4LNAA 3E0QA 2AI3A 1T8WA 4F2PA 3OZBA 2HWUA 5CYFA 1SQ6A 4TYMA 3K8OE 3OOEA 2OXFA 4JOSA 5F7JA 1JDVA 4M3NA 1Z5NA 1A9PA 1CB0A 4KN5A 5B7PA 3EMVA 2OC9A 2AI1A 1TCVA 5B7GA 4FFSA 3NM5A 1RT9A 4R2XA 4LDNA 3C74A 3O6VA 3P0EA 4TXHA 1Z5PA 4D8XA 1Z38A 4L5CA 4WKBA 1Y6QA 5CCEA 3FOWA 2QDKA 5K1ZA 4TS3A 1CG6A 1ODLA 3OPVA 1K9SA 5I3CA 3ODGA 3O4VA 1M73E 3UT6A 3U40A 1VMKA 4DABA 3KVRA 5F78A 2Q7OE 4DANA 4JWTA 1K27A 2HSWA 4MCHA 2HRDA 4BMYA 5B7QA 1A9TA 1TCUA 4H1TA 1ODJA 1RSZA 4D98A 4G41A 1OU4A 4K6OA 4DARA 3KVYA 1PK7A 1RXSA 1JDSA 3TL6A 4BN0A 3F8WA 4TXJA 3GB9A 1ULAA 5IFKA 1OTYA 2P4SA 3FB1A 4PR3A 4F3KA 1U1DA 2OECA 4IP0A 1JPVA 4F2WA 3FNQA 3UAXA 1Y1RA 1ODKA 4BMXA 3BL6A 4EB8A 4YMLA 1Y6RA 4OF4A 5FAKA 1PBNA 4GKAA 1LVUA 3OOHA 4JP5A 4TTJA 1JDTA 1PKEA 3DJFA 3OCCA 5F76A 4G89A 1G2OA 2A8YA 4P54A 4PNPA 4D8YA 4MARA 3ONVA 1TD1A 3UAVA 3EEIA 1YQUA 1TGVA 4BMZA 2OC4A 4RJ2A 5F77A 2RJ3A 1TGYA 3MB8A 4QARA 1Z33A 1OVGA 1B8OA 1JE0A 2IQ5A 3DP9A 3MMSA 1N3IA 3PNSA 1PF7E 1SD2A 1Q1GA 1U1EA 4DA7A 4R2WA 5IU6A 4LKRA 1PW7A 4F1WA 4D8VA 1JE1A 5DK6A 1SJ9A 4E1VA 1T8SA 1A9SA 3OZEA 2HN9A 4QEZA 3INYA 3KUKA 1I80A 1QE5A 3LBAA 5C80A 1ZL2A 4TS9A 5EPUA 5JPCA 1OV6A 1PR4A 1RR6A 2A0YA 3FWPA 3UAYA 1LV8A 4L5YA 3DPSA 1RXUA 2QTTA 2B94A 1YRYE 1PK9A 1LX7A 3QPBA 4L6IA 2XRFA 1NW4A 3KVVA 4NS1A 1JP7A 4YO8A 2I4TA 2QTGA 3BJEA 1PR2A 3D1VA 2H8GA 4TTIA 4MCIA 1V45E 4WKOA 1Z35A 1RYZA 4NSNA 1YQQA 3IEXA 1T0UA 2AC7A 5B7NA 1VFNA 2BSXA 4YNBA 1NC1A 2PGAA 1RXCA 4UC0A 1Z37A 3LGSA 3PNPA 4GLJA 4QATA 3BSFA 1A9OA 1YBFA 1ULBA 4WKCA 5ETJA 5CXSA 4NY1A 1C3XA 3E9ZA 3GGSA 3EUFA 4GMHA 3PHCA 3SCZA 1XE3A 3P0FA 5KB3A 1RCTE 2ISCA 4OEHA 1Y1SA 4X24A 1ECPA 4TXMA 1V3QE 1OTXA 1V48A 4WKPA 2QPLA 1B8NA 4R31A 4YJKA 4ECEA 1PR6A 3OZCA 3ENZA 4L0MA 1RXYA 4QAQA 1T8YA 4M1EA 1V2HE 1Z5OA 1Z34A 2ON6A 2I8AA 1A9RA 4DA8A 4F3CA 1PWYE 5EUBA 2GUWA 4GLFA 1U1CA 4TXLA 1U1GA 1JDZA 4DAOA 3DDOA 3IOMA 4L5AA 1A9QA 3KHSA 4OJTA 1Z39A 3K8QA 3OZDA 3NM6B 1PR0A
chains in the Genus database with same CATH superfamily
1JMKC 4TWRA 1UFVA 3R8CA 1IY9A 1O2DA 5CLGA 4J0CA 3OPNA 2QZJA 3ZWMA 3D6TB 4DCGA 1IDN1 1LEHA 5JAHA 1QGDA 4EZIA 1TLTA 2WA1A 2W6MA 1D09A 2WTAA 3K94A 4I4NA 3ANMA 3D7RA 4N54A 3KQWA 4RSGA 1LSOA 4JLDA 3KOWA 1VL6A 2RKOA 4M2LA 4NCIA 4GW3A 3VYUB 5HWSA 1KH3A 1MAVA 1SAYA 1ZN9A 2GYUA 2Y1DA 4GOOD 5BURA 1Y7PA 3ECSA 4RELA 1XK7A 5AVUA 2QF7A 3I9KA 2GD6A 3LUGA 4O2AB 1WMDA 2JLZA 2V7QA 3PQEA 2G08A 1GM5A 1L4GA 1JB1A 2OXRA 1I6WA 2YMPA 1YRHA 3G0BA 4AYTA 1L7NA 4EGCB 3IE1A 3DHEA 1B2LA 2H29A 2KMLA 3CZAA 3MUFA 2JJ2A 4EJSB 5BSEA 2K2QB 3S8EA 4PZAA 1SBCA 4DZTA 5A4DA 2V3CC 3GLSA 2XTNA 5AW4A 2ADMA 3LNTA 4UARA 3I05A 3ET5A 5ALXA 4PLPA 4H6XA 3DZJA 4B79A 3RYIB 3AYXB 1XRPA 5CVDA 5BN1A 1KMHB 1DLJA 1VDZA 1NQ5A 2VCEA 2G77B 1IJBA 3HJHA 2YRFA 4WTOA 4XUDA 4YUVA 1RC8A 4KGDA 4IOLA 4JI6B 3ZC3A 3MJCA 1BIFA 2D1FA 2CYBA 1RZUA 1EDZA 1WCV1 4BLTA 3D4NA 4WAUA 1PIWA 1B8UA 1ISRA 4DUYB 2QTHA 4J6EA 5E0KB 4UCFA 5KAMA 5TQJA 3NHFA 2IS1A 1V7PC 3R74A 3ZKWA 2SKEA 1GAJA 1JALA 2PH7A 3QFCA 2XWQA 1KDVA 2I54A 4ER7A 1VMAA 1U1FA 4DLTA 3T15A 5BMVA 4YASA 4H31A 4E14A 5I48A 1G8PA 5F9MA 3NDPA 4UZFA 3F6YA 4Q18A 5FOVA 3SYNA 4QYXA 3D4BA 5LQMA 4KQ1A 2LVBA 5JR3A 4DLWA 1E94E 2AG1A 1YK0A 3VU1A 3HVJA 3OEHD 1DVRA 1UDXA 2XUOA 2PG3A 3DTYA 3KCQA 4LJ6A 5F7ZA 4DMMA 4PRZA 1VB5A 3CLHA 3CC8A 1G6OA 1EEXB 2V6IA 2BELA 3A9TA 5TPWA 5KYWB 1ZCFA 2JIOA 2PAFA 4MYHA 5D3KA 3KKLA 3NAQA 1D7OA 2FQ1A 4Q9DA 4BXOA 3TSZA 1R0SA 5TC4A 2GM4A 4MYUA 4PS0A 1KZ1A 1JWLA 1UBCA 3I9NA 3CKKA 4J2TA 4F4DA 1IC6A 3HA5A 4QT4A 5GTDA 3GROA 3R76A 1JQ3A 2O8VA 2YCLA 5JVDF 4B2YA 1Z9BA 3DE1X 2DMRA 4QNMA 5DE3A 2H07A 3ZCXA 1Q84A 3P9QA 1NUUA 1VGQA 2W2KB 3ASYA 3MWEA 3PDWA 1Z0FA 4DNPA 1JA9A 3RVJA 4A0FA 1SBTA 1Z5NA 4M3NA 4AJKA 4JP8A 1CB0A 4BNKA 4KPFC 3ILYA 1LF5A 2MCFA 4CMEA 4WWHA 4TSRA 3QY0A 2BM8A 3O82A 3ZQUA 1NW9B 4JP1A 1QHSA 3G7SA 3V8RA 4CKCA 2QN8A 2Q49A 2AOTA 1YQXA 2IYLD 1W0JD 2QEQA 2NU8B 1UEIA 5A3VA 3DCJA 3HKDB 1LPNA 2X6RA 4CEHB 1V5GA 2HT1A 1GZHB 3HDYA 1QAQA 2JI4A 1OAAA 1NVVQ 3BWDD 3I37X 5DDIP 3ELYA 4ISBA 4G24A 2YQ5A 3TR5A 5L3SB 1T35A 4M98A 1A97A 4ZXPA 1MGPA 4ZVSA 3EGOA 1DXYA 5E6SB 4A23A 1Y4DE 4CEJA 3DEJA 3DVRX 4HLNA 5BR7A 4G0WA 1DFGA 1X7ZA 4KE9A 4P83A 3W8FA 4PBTA 2DC1A 2NO9A 3AI2A 2IWHA 2Q2QA 3E3AA 3D3QA 3NOOA 5TVKA 2HXYA 2XUGA 1U5BB 1K88A 2XCQA 1AN0A 2RJOA 1SC4A 1MW8X 4DGQA 3KOYA 3C6ZA 4URVR 3FCAA 4N47A 4M9QA 2ZUBA 2C03A 1SB9A 3TW8B 4KQWA 4EMSA 4RK1A 3WYAA 4P1ZA 4KXNA 5HKKD 2ZJOA 5HRUA 2QVZX 5I4BA 3I2IA 5ADWA 5ED0A 1ZWKA 3R6TA 4H17A 1YV9A 1EVEA 3EQ9A 2QYOA 3BK1A 1TMYA 5AJTA 5IC6A 5JZOA 1L5QA 1YJQA 1C9MA 3K8YA 3KFXA 3KVRA 2L19A 3V4FA 4DTIA 2GERA 5G3YA 3QPDA 1JECA 1Q57A 5K3FB 1U3DA 4UDYX 4JXXA 3MJVA 3HLTA 5FA8A 3M4XA 5JDIC 1O57A 3LRXA 3IELA 4ND4A 4WVFA 1Y6JA 4EHKA 1LA2A 2Q3DA 2VYCA 1U99A 1KXJA 3W8NA 2FDRA 3GRRA 2CCGA 1IWBB 3AF5A 3LIIA 3NW9A 4XM0A 1G0OA 1UOPA 3I6BA 3UKJA 4AW9A 1XVUA 4MVJA 4W5JA 4YACA 1NATA 4CMBA 2ZK7A 4HH1A 3KVYA 1PK7A 1DHRA 1E1NA 2E82A 1RXSA 3A05A 1JDSA 1U2DA 4ATNA 2B2NA 1NG9A 2FVYA 3KHTA 1BYUA 3HU2A 5EN4A 2PMWB 3GJ5A 5JZ9A 4E12A 4RQUA 4B4OA 1DIBA 4GM0A 2V54A 3A1UA 3QTTA 5HBGA 1XZAA 1ZGGA 4CMCA 3FSGD 3FMPB 4MLCA 3D3JA 1R0BA 4RE6A 3OFSA 4G4IA 3UWDA 4Y18A 3CISA 1FA9A 3M5WA 1W8DA 4KXQA 4K9RA 1OF1A 3KIPA 1WPXA 3ZY3A 4F6CA 1PJLA 1KQ3A 2ID7A 1JPVA 3N70A 3ONWA 1UBNA 3ZVRA 4E3ZA 3R8XA 3Q0IA 1GGFA 3A4MA 1YHNA 1W44A 2ODNA 1JQKA 3R40A 4J1SA 1A2QA 1Y6RA 3CNEA 2FZWA 4NJMB 2V7PA 4DV6B 2CHGA 1GUFA 1H2AS 3SFTA 1UK6A 1P3JA 3PC7A 1U81A 2HAEA 1NRXA 2EXXA 5FL3A 2X0KA 5A4AA 2CE2X 3TM5A 1L4KA 1NX9A 3PPYA 1DTWB 1XCGB 3A1WA 1EA5A 4MS3B 4BOYA 3HEBA 1CUXA 1FDWA 3QWBA 4TUYB 2XB9A 1LCIA 1BVYF 3UATA 4AF6A 1LPOA 2B7CA 2XW6A 4NK4A 2H00A 1TA4A 3O1JC 4BNHA 1QH8B 1KEEB 1R6VA 2NZXA 4OKNA 1NQWA 3C3YA 5E4YA 4JI5B 3T0FA 3RARA 1HC7A 2ZIUB 4P33A 2FKAA 4RDCA 3ZH2A 2BBSA 1CUYA 3B5EA 4GI7A 4PLVA 3QXSA 4ZAYA 4JS0A 4JZYA 4DR4B 4F60A 1K66A 1HMYA 2D54A 4L8FA 1RS0A 3PR3A 1RQNA 3AINA 4OFBA 4WXEA 1QYXA 4S3MA 1PQPA 4BMZA 5AYVA 1HNNA 2DH6A 3CTMA 1WAMA 5E2IA 3H65A 1V11A 4ND1A 2OBBA 4B6FA 4EF6A 4MRVA 1HRDA 1GU1A 4TMFA 3UOAB 4AP5A 1ADGA 3T5AA 3NDBB 5BYAA 1ZN2A 4JP2A 3ZOZA 1ZCZA 2O07A 4JQSA 4DIEA 1WCXA 4TMZA 4WEQA 4RTKA 4IYRA 4OHBA 5JBQA 2ES4A 2BTQB 2I66A 3VDQA 4BAZA 2EGHA 3FRJA 1KZ9A 1OE0A 3L7OA 2J3MA 5CVUA 1CY0A 2GM5A 3OPXA 2YDXA 3PBKA 1QRRA 1GL6A 2OCIA 3CPSA 1UDWA 4YRCA 4HF7A 5JCOC 3NJ8A 5DTQA 3EJ6A 1W6UA 3ZGOA 1QGZA 4R1SA 3QVGB 3ER6A 2YRWA 4QDXA 1IWOA 1IAQA 1BW9A 4R84A 5DKFA 3UZUA 4U8HA 3WRXC 4G0XA 5JSHA 3A6DA 4D80A 5KTYA 4LF5B 5A06A 2LUOA 3GA0A 3ORSA 3QE3A 4ENRA 3JQQA 4MR7B 1ZCJA 2X8BA 3TDNA 3DZDA 1JT2A 4GAEA 4C22A 2X7JA 4N48A 4DVGA 2YVLA 1DRJA 3WICA 5K3OA 4G9GA 1YJ8A 4FFMA 3FCYA 3WFJA 1U9CA 2CHQA 2DSNA 4JJZA 3GXOA 5C80A 1I0ZA 2GNPA 4YDQA 1MDBA 1JEJA 1ZLXA 1CU1A 1VLHA 5EJ7A 3V4VB 2RGAA 4N0PA 3ZLUA 2HSZA 3FDFA 3HE3A 3TXXA 4ZVPA 1GZ6A 2NU6B 1N5OX 2GCOB 2VRCD 4D25A 2X7XA 5J5AA 3DMNA 1SD5A 3B7PA 4O2BB 2W6ZA 3HKEB 4O4IA 3ETGA 4H6VA 4TMXA 5G0SA 5DNYB 4A8JA 3P4UA 4CT0A 1ZUD1 4Q4JA 4B6RA 2D2IA 5BUCA 1L7XA 1SCBA 2GZDA 2NQ2C 1RQRA 2O2EA 4G63A 3NAMA 2J0VA 4PSAA 4QEDA 4V0NA 3VNAA 5A9SB 4N3AA 4U7WA 2IP2A 2V7EA 4OB6A 5HQJA 1AIPA 4GQAA 3ZDYB 1MP0A 4MUNA 3JQ8B 3B6KA 4I6GA 1CP2A 1ODSA 3N0WA 4O0MA 4R1MA 3ZJUA 5DH9A 5M29A 4I5IA 3U0BA 1T5IA 3ONFA 4QFCA 5JC1A 2IX3A 2FRDC 3JQEA 1LJUA 1Y5RA 3R23A 1RVDA 4PCUA 1U0BB 5AM5A 5EHNA 1XAJA 1XVIA 4NJEA 3O3OB 5CUQA 1ZGHA 3ELWA 3RKSA 4DCVA 4LAFA 4YYEA 2X77A 4KPUB 1BX3A 3ENVA 3QWHA 3PENA 2AF3C 2ZZMA 2HCFA 3WWPA 3RPEA 1MH9A 1YR2A 2Q7XA 3CF0A 3AERA 4TTIA 2AZXA 3TG2A 1SWVA 4UREA 2GPSA 1UPCA 2IRWA 1PD0A 2VJNA 3DUFB 3ITEA 3M5PA 3NETA 4AS2A 4F3TA 4E5VA 3W8RA 4ALLA 2IGBA 1NI4A 4YUZA 5ADUS 4IL5A 3RSZA 3C3WA 3RS5A 4D3FA 5FBLB 2ACKA 2EZUA 2PX0A 5E8JA 5A7GA 5KJCA 4Y9SA 2UUBB 5JOQA 2CE7A 2ZAMA 1XKXA 1QQAA 1F2UA 2C3YA 1V5WA 3L2OB 2PUBA 1E5LA 1BWPA 2BSXA 2XPCA 2IY7A 1KA9H 2VBCA 2QMUA 4FMDF 3NOVA 4MVXA 1YR7A 4DDMA 4EUSA 1ZVVA 4XUGB 2Y76A 3MJRA 3WZLA 4UC0A 2CB0A 4UBKA 4X1KB 5J2UF 2VTVA 3CPHA 1V5EA 1WHSA 1V9LA 3OU7A 3RUEA 3T5DA 2FPXA 2IUFA 3UWPA 4N03A 3ADDA 4R3WA 4INJA 3F1LA 4LKOA 2GGSA 3D7LA 4ARSA 3QYPA 3WFZA 1XRJA 2AJDA 1A9OA 2JBAB 3HUTA 2C9MA 3CIFA 2J67A 1Z6QA 1TQHA 2YXDA 1ABBA 3G5AA 3MAGA 4L2IA 4PN7A 2DBQA 3WYCA 3QUBA 3QXHA 1WQ4A 2GPJA 2Y99A 4JLJA 1PK8A 2MSEB 3LECA 2H2WA 1L8QA 3L4BA 1U8YA 3IUPA 2V65A 2XA2A 2Q4EA 4O3FA 2H8KA 2IIQA 3GCZA 1RWBA 1HLFA 4IEEA 3KT3A 3ZTYA 4XWGA 4X24A 1HYBA 2BMDA 2GARA 1N7IA 1OR8A 2EP8A 2FPIA 2P77A 2R6DA 2V4UA 3BXGA 1EXMA 4FMCF 4ZVKA 5LU8A 1JB9A 4WLUA 3K9CA 4KO8A 3VAZA 2PMFA 1XPOA 3AMVA 1ZIDA 1T9BA 3U9TA 4BEJA 1W75A 4MICA 5FO1A 1XYGA 2K7ZA 1NFFA 5HHTA 1U3UA 5HDBB 3F6EX 2Z95A 3ZXSA 1SKUA 3BWYA 3AEZA 2HTEA 3CLVA 3HVIA 1K5PA 1GN8A 1XZBA 2Q2NA 3QVTA 3HUDA 1YUNA 3N75A 3SEAA 2BUAA 4X9XA 4G6ZA 4OLBA 3K6SA 1KIAA 3BMNB 4JOQA 5AVJA 2IYXA 2VSNA 4L76A 1JHVA 4RTJA 4LOLA 5BWLA 3IIMA 3AHDA 3OZXA 4M1WA 4R8LA 4DNOA 1DV1A 2A4KA 4Q4DA 4WL0A 5CBPB 1V1JA 2IXBA 2I76A 3F1KA 4LMRA 4AZ0B 3COJA 3AEKA 4E6EA 3H5RA 4BS9A 4BU1A 2CJWB 4WNYA 3MOSA 1T6XA 1Y3DE 4E5YA 1KK2A 4E03A 5DEOA 2GHRA 4YQFA 1NUQA 1XAIA 2DFKB 2NSHA 2ON6A 3FKQA 3PJRA 5SY9A 1R0RE 3M0EA 1J00A 5FUMA 5EUBA 3G3EA 4ZO4A 3ADPA 4GLFA 2A0FA 5CIYA 2PO7A 4UHFA 2FI1A 7GPBA 2ZOSA 1GQSA 3C6MA 1AQ6A 2VNJA 5AW7A 4MWTA 5H0IA 2XUFA 2I2DA 3GEPA 1KAQA 1OH8A 1OWLA 3AVWA 3JQFC 3TR6A 2HA7A 2AOWA 4WZZA 5FORA 1IDOA 1UKYA 2J9YB 1LQ2A 5LBUA 3FPLA 2W7TA 5CD1A 3R4VA 4XB1A 3VC7A 5IYZA 4C6TB 2NZVG 1DAIA 2QRLA 4YP0A 4JENA 4BNWA 5CYGA 1KMQA 3DOEA 2ZETA 4PIMA 2ZRPA 1EM8A 5IDVA 1O6GA 1WTCA 3GLHA 1USIA 1K63A 4PR0A 2RGNA 3QPVA 5A6SA 3O91A 3PUYA 1IHOA 2IEZA 4DNQA 3H87A 4FJ1A 5JWOA 2ZIZA 4N82A 4J07A 2O2SA 4YMUA 2XCTB 4XYEA 1S2LA 1JQBA 1BAPA 2JHPA 2YNMD 3DF7A 5JRDS 2B5WA 2BONA 4J43A 3KZMA 4ZZ0A 3W9SA 2GM9A 4J0QA 2R79A 3KTFA 4Q3KA 2LP4Y 5H3HA 2ZSIA 1CIJA 4Z1MD 1SN7A 1Q2XA 2HMSA 2F3UA 1A4RA 1YWGO 4RMIA 4UBOA 2DRIA 4BMOB 2B8EA 2B92A 3EY4A 1WZIA 4EKYA 3HS3A 5K6AA 3THRA 2FW9A 1CYEA 1P2UA 4N8SA 4G4SO 3K9WA 3NTXA 3LCVB 2OHHA 3WL7A 1MGOA 3IBGA 1ISMA 1U28A 3OZWA 3D9QX 2OFOA 1B6RA 4JNCA 3K72B 4B4VA 3GAFA 1OW3B 2R62A 2PLNA 4UVIA 3O26A 3DF9A 3G7UA 1TUIA 4FOSA 5JNWA 2AK2A 2IUYA 2XVZA 1YONA 4J4BA 4LZJA 1JHDA 4R1OA 4F97A 2NXCA 3OSZA 5LKAA 2IYUA 3GRCA 1W49A 4Q21A 1JPNA 2ZRQA 3QW4B 4KH0A 4TT3A 3GGJA 1KFEB 2ZUDA 1U02A 1P31A 2RB5A 4FT4A 2GHQA 1XRMA 1K08A 5ESDA 3GQVA 3U62A 5DM70 4EBFA 5JHGB 1WQ1R 2ZQYA 1IUPA 3ICWA 4HZGA 5T57A 4CG3A 5HK8A 3QLTA 2P6OA 1VSBA 2O8DA 2VDWB 1YL6A 1TKBA 2P2ZA 3B1YA 3GJRA 1VJDA 3I64A 4O08A 1W87A 1XSEA 5ALPA 3ZCPA 2YOGA 1OLSB 2IXTA 4FJ2A 4NK5A 3SQLA 4WSOA 5E6RA 3H9BA 3TLAA 3DKRA 4BP1A 5DHRA 4MPDA 4BMDA 1MIOB 1E7QA 2X41A 3ORRA 3ZQJA 4LJ7A 1YS2X 3AB8A 3NHSA 4S35A 4CCYB 4YMHA 5KWJA 1Z4JA 4B44A 1THMA 2L0XA 2X9NA 2QXUA 1DIRA 4PX5A 4DJJA 2QU8A 3TSAA 4R5HA 2BBTA 3EC1A 4WEOA 4YP1A 1YJAA 2AE2A 2PJZA 3A1SA 1UBMS 2FOIA 4MK4A 4IZIA 4V0QA 5EEGA 4DA0A 1FUIA 4E70A 5AESA 1PR9A 2CNWD 3OG9A 4B3XA 1CUEA 3D5QA 3FDJA 1J5PA 3RSSA 3WSWA 1NYRA 3FOFC 4NH4A 1EH5A 1V35A 3A10A 3DOIA 3JASA 3ORFA 3HG7A 2ZJYA 3AWIA 4D4LA 3LLUA 1CUJA 4B71A 2IBSA 4BQEA 4YLEA 4ZJUA 4TS4A 2CLIB 3CLUC 3KJFA 3PGKA 2OHGA 4P2BA 4WY8A 3UOWA 4O4LA 3O2QB 5GONA 1E98A 1V71A 2ZBQA 1PEDA 3BS4A 3SFZA 3TNFA 5ICEA 2PA0A 1YZNA 4HI0E 4AMBA 3UGTA 1CF4A 2VZ8A 4JT2A 4JJ4A 3O2NA 1XF9A 3CCBA 3C14C 1E2NA 1L7MA 2D5LA 4ENUA 4N9WA 3L5KA 4TVKA 1A4UA 5HR5A 1OH5A 2JNWA 4YDRA 4RF2A 5J5CA 1PO7A 4MI9A 3W2EA 1GSHA 2P65A 3DDUA 3I0ZA 4RVUA 5EUMA 4EYQA 1SVSA 3EXIA 2VA8A 2AEFA 1Y9EA 2HXSA 2N75A 1Q1QA 4G0VA 1VG9B 4K6MA 1TRHA 2G7MC 1TYAE 3QUSA 3C6QA 3MVEA 4KWTA 3FR7A 1G5TA 4PICA 5B5SA 1F51E 2GHIA 1E6UA 2E21A 4OHZA 2A0UA 1YCHA 1SRRA 4RX1A 5JW6A 2VYFA 3EQZA 2XE7A 4C3ZA 1QYWA 3I28A 4HP8A 3EPHA 5CA1B 4QKQA 3GZNA 5ALQA 3QU4A 2B99A 4WFIA 2JI6A 3ISTA 5FA6A 4DUPA 4J94A 1ZA2A 3T7AA 2PIDA 4P6VF 2BKAA 4LQCA 3H83A 2P3LA 3D4IA 1A8IA 1PFUA 4LHVA 1WW8A 3H6KA 3PC2A 1J2JA 1DLIA 1TE2A 1UC9A 1Y7TA 3F3YA 4ZOAA 3P0IA 4Q4HA 3K1YA 5IKOA 2CLSA 1AKMA 3RW9A 3VHQA 1VPEA 4FT2A 4BNIA 4F92B 4PZDA 4EG7A 1DRKA 3P94A 4H18A 1IN7A 2YQ4A 2HX1A 2O6LA 4QFMA 5B53A 1KOFA 3LHDA 3MELA 4GRDA 4Q93A 4C7VA 4NF2A 3KV3O 1TT7A 2DCUA 5FLXA 2IHVA 3GEGA 3WE7A 1CVIA 2PFGA 2W22A 2C2BA 4H3SA 2R00C 3ZKWB 4PSVA 1JEQA 5I7WA 1I6MA 1POWA 2C8JA 2ZVPX 3Q72A 4DG8A 1EQ2A 5LDHA 3JD4A 4U6QA 1OLOA 3VYSB 1XWIA 5BMVB 4R5MA 3URMA 1ONBA 3SC4A 2PU5A 1UXIA 2BFFB 2XTJA 2C5HA 3H4MA 2GZRA 2VOEA 5GAJA 4EHIA 1RLOA 1S4MA 2AG6A 1K27A 1UPXA 1XVTA 4FOOA 5EMLA 5FWDA 4DQDA 2VXYA 2YV4A 3JYPA 3PD0A 1QP0A 4D6YA 4ND5A 1YVRA 5IHXA 2ASEA 2JIPA 3U61B 4B3MB 1JAHA 2Q99A 3FA2A 1FQJA 2W6JA 2PQ0A 3DONA 2YV3A 4JL5A 5BW8A 2GJKA 4HQFA 3K9LA 1EGVB 1HK7A 1W94A 3Q8WA 4E46A 3HBJA 4K6OA 1X1CA 4WLEA 4HGNA 2JIZA 5TPWB 2OCYC 2V7QD 5K5EA 4LHXA 2ZE7A 5C8XA 2IZ7A 4JA2A 5AK5A 6CHYA 2Z3WA 1E3WA 4FR5A 3MD9A 1BXKA 1G8MA 4Q9LA 5CDHA 2HR1A 2E6KA 2OP0A 2JJ2D 2BIFA 4ETIA 3WGGA 3PJEA 3L3BA 3UM9A 1YZ3A 1HQDA 1GU7A 1FYVA 1YAJA 1OGJA 1EUZA 3BGDA 3MMPA 3PUXA 3PQ7A 2GJSA 4MYSA 4GC9A 2Q6IA 2XKJE 4LWZA 2PGOA 4IHJF 4E2FA 1J24A 2AJBA 4FC7A 5K3EA 4KAAA 1G0NA 3OZAA 1E2EA 2ZU6A 1CB7A 3GJTA 1RW4A 3OURA 4O02B 1C1XA 1E4EB 1SC1A 1JKXA 1U1DA 4GE0A 1UBUS 4Z9AA 3V4SA 4XLTA 5TX7A 3MWEB 3N59A 4CT4B 1GZ7A 1QR6A 3PUJA 2PVCA 3NIWA 3DTVA 1WSBA 2ZT7A 3FNQA 1W5AA 2C2WA 4OOEA 5JT1A 3CWQA 1I2DA 1KHHA 2JGEA 3K0FB 3OU6A 2IHTA 1VI2A 5EIWA 2CDAA 4CKCB 2AOTB 5E1DA 1EX9A 1SQFA 4OBXA 4MA4A 3B7GA 2ODPA 2PUWA 1T8TA 2RH4A 4I1IA 3TKAA 1X7HA 3AL3A 3C3BA 3PDIA 3EB9A 4NARA 3ZCRA 3KQOA 1FJ2A 2A6PA 3KBOA 4RGBA 5HS4A 2Y8EA 3EZ6A 1GV1A 1R18A 3OQIA 1MLDA 3QA9A 3UW1A 2ZTHA 2V6FA 3T7RA 1QHGA 1IZYA 1RRFA 1X7ZB 2EAUA 4BVBA 2C5GA 3ANTA 4RZ3A 1UBTS 1VLZA 4IFTA 2Q41A 2VYVD 2WHRA 3EVBA 2WWYA 5HP4A 4AJHA 3RUAA 2VEDA 4KIUA 1C0IA 3TRIA 4WY5A 2FMUA 4HHEA 1EK1A 2C57A 4S12A 5KTOA 4PYRA 3ONVA 5IF9A 1OYYA 3PLAE 3H9JA 4CXMA 1E5QA 2W8ZA 5FLEX 1B14A 1UJ4A 1KAEA 2IYSA 4L5BA 3WJ1A 3R0QA 1KE1A 2QJOA 2FPOA 2VRWA 4RJ2A 2PUJA 1OBFO 1H6DA 2QDXA 5HQ3B 4GGOA 1YD7A 2VN8A 3U39A 2BEJA 3H17A 4DCJA 2GN9A 5JS7A 1L5HA 2J7PA 3DKIA 4MQUA 3W5CA 3AESB 1U2DC 1DX9A 1LSSA 3CBQA 3I01A 3GJ3A 1A8SA 4JV5B 1AZWA 1JE0A 4FN5A 4KDEA 5D86A 4QPPA 5EL0A 1U8TA 4RZUA 5DFAA 1KTVA 4MMYB 3UWKA 1BS2A 3AG6A 1Q7CA 4B6GA 2C82A 4DV2B 3K70D 1FZQA 1LBEA 4BVHA 4PHGA 3CF4A 1XDUA 1ZUIA 3C6KA 3I6MA 2W4MA 3UFXB 5E1OA 3VISA 4CV3A 1J39A 4QXQA 4IXNA 4B82A 1I2ZA 2JGIA 4REMA 4DLKA 1TU3A 3UIEA 4DR2B 1HWYA 2H3HA 3O4GA 2I9PA 2WP0A 3CGGA 4RPCA 5LBIA 1JSRA 2I1LA 2Y1KA 3UMFA 2F1OA 3TVYA 4ALMA 1EHYA 1FU8A 1FP2A 2P9HA 4DADA 4FSHA 1NDHA 1F8UA 1SHJA 3HWSA 3E5HA 1XNHA 1USWA 4YWHA 2K2WA 2Q9AA 3AJDA 3OTHA 4G8DA 2B1GA 3I9MA 4UQOA 3P0HA 4QEZA 3EXHB 1XMIA 4YRNA 1TM3E 3HNPA 1NW3A 4MP3A 4CF4A 3WLOA 1YH3A 2WABA 2YC4C 1I80A 1QE5A 3G85A 5LQUA 3C8HA 3OJXA 3ZHBA 4RNCA 1NV9A 4TS9A 3NHYA 4ZAXA 2PGXA 2C9ZA 3MTBA 2ZRCA 3PJGA 2RK4A 4OQFA 5A0FA 4F5YA 2Q29A 3IGFA 2W2TA 2NSYA 4RHXA 5AK6A 2C9BA 1W30A 3BIJA 3EWAA 1P8AA 4KWCA 1OGYA 4KU4A 3VR3D 3VPGA 3IXQA 2GD2A 5K20A 2IZOA 3GZ4A 2O5EA 4RFLA 1X8LA 1Q22A 4I2NA 1SG6A 3AIOA 2AS0A 3USES 2J3HA 2BP7A 1RAIA 2FN3A 2M6RA 4Q9AA 4CM6A 1R0KA 1XMQB 2VRBA 1NJ2A 4LC9A 2DT8A 3MXOA 4WBNF 2QKYA 1J97A 3FCXA 2XRFA 3QPBA 4L8GA 2R1TB 3ZGVA 3IBSA 2P2CA 2P9BA 3V8VA 2DUMA 5DN6A 5FUVA 2OUIA 2YXBA 2P5SA 5IASA 3SYKA 1LK5A 4ZGGA 3R3ZA 2I2CA 4I46A 3PQ6A 2GA9A 4MR8B 1B76A 1YULA 1JHAA 1D1TA 4JL6A 1NLFA 3H7IA 5C2JB 1I10A 2BC9A 3EHDA 3FLAA 1O3YA 1X9IA 5LQDA 3V1TC 3N7UA 1DQSA 5F4BA 4NHEA 3PVZA 1SUEA 2GLTA 2B9VA 4KLAA 3DZBA 1P44A 1M1ZA 2C1XA 4R1QA 3UUWA 5HCUA 6YASA 2D0PB 2VATA 1RHUA 2D1YA 1U0GA 1BMFA 1KOJA 2E4XA 2H2GA 1MEOA 1RRGA 2DG2A 2O9JA 4IHAA 4Q1BA 5D7NA 2AC7A 4Z9BA 4CF5A 1MQSA 4NCNA 4I1YA 3R5JA 4E08A 2XNKA 1N4DA 4RH1A 4YV7A 2HRBA 1KSFX 4JEMA 4RXTA 1V26A 2HSDA 1J9GA 3CB2A 3GPCA 3TLEA 3PHGA 4FCWA 3GO4A 4NPCA 3VR1A 4LJ9A 2FMFA 3FMOB 1ORHA 2TYSB 4N18A 4EI8A 5HIAA 4AKHA 1ZQ1A 3CVYA 1WXIA 3JQBA 3S28A 3TGLA 1JF8A 2HZBA 3DMYA 1MNQA 2VAMA 4OQPA 3M6MD 4FDLA 4NBSA 5EWLA 1YB1A 2CXTA 4WKCA 5ETJA 4TKVA 3IEVA 1QZZA 2WD7B 4WT7A 1W5SA 1BW9B 2RH9B 5E9JA 2GBCA 2GPBA 2FR8C 3KKNA 4LRTB 3T4EA 1WSWA 4F5WA 2NZ8A 2QMHA 4CR6A 2YJ6A 1K89A 3QTBA 3P0FA 4QUGA 4BBAA 2GXQA 5KB3A 2GETA 1KSGA 2W58A 4OIMA 3SSAA 3OVMA 1H66A 3VVCA 2IVFA 1R37A 2I7DA 3TNJA 5DB4A 3DTNA 1RHQA 2GZ3A 4CODB 3KETA 5AVKA 1WCYA 2I87A 1QX4A 5K99A 3MERA 3FGNA 2HA2A 2FW8A 4BDTA 4QNRA 4CL0A 3LT1A 4YBZA 4AJEA 1TEHA 2AXPA 2YXNA 2N1MA 2DP4E 1QOQB 2F9MA 2F3PA 5LBTA 1CNMA 3X1JA 1QIGA 1R6UA 4B6JA 4TM7A 4PYIA 2FSUA 1KYQA 1DS6A 1CS4C 3KOOA 1IVYA 1EFLA 3W2FA 4HBGA 4A8JB 2JFQA 3L9WA 4RABA 2A5LA 3CKLA 4NU5A 4NYIR 4WPGA 3OKFA 2R7NA 4HGRA 1P1FA 1AMUA 2VJQA 1NJ6A 4QD3A 5JG7A 5IJZA 2V03A 1FXWA 2XADA 3OO0A 2Z3VA 4GZMA 2C4TA 2B78A 2YWEA 2ZR0A 3V1KA 3R1IA 3BICA 4D6XA 1I4OA 3X1XA 4D56A 1Z0DA 2B61A 5GZ1A 5LMZA 3Q2IA 3SP1A 1P72A 2GOYA 4RUKA 4NJEB 1D2CA 4TS1A 3DQQA 1KI9A 3L6EA 4L72A 4X5OA 3V2GA 3ZOKA 5H4HA 1JSCA 1UMCA 4R8VA 4ZQGA 5CT9A 5AJYA 3F47A 4D0RA 1XZ8A 4DB2A 2XB4A 4L95C 1JG6A 1I51A 4JZKA 1F8YA 3RI3A 3AERB 4S2UA 2P2LA 3OD5A 1Y4SA 5CK5A 3ZIDA 2RC6A 1AM4D 5ITZA 3D3EA 3PFBA 4OL0A 3ZWYA 2ZJ3A 1NI4B 3K8QA 3NBUA 2YZ2A 3K16A 3RTBA 4B31A 1QKIA 1II8A 2O0LA 4TXNA 4CFZA 4DR7B 1BRMA 3EC2A 2I6FA 1IMOA 1KI8A 3C8UA 5A4MS 1XZCA 2OO5C 1C4WA 1VPDA 2BL4A 4WA7A 5T67A 4ACAA 1NM5C 1T9HA 4DAEA 2BDTA 1JLMA 3H16A 3CM0A 2A86A 1IH8A 1IEQA 4M83A 2IZZA 4BP3A 1NQUA 1XA4A 3FNIA 1WHSB 2YWDA 2VCYA 1OQAA 3UF0A 4HQKA 1C7JA 4Y1RA 2PDAA 3O8LA 4P38A 4HQOA 1M2OA 4RK4A 4HG2A 4X92A 1P0CA 1O1YA 4RU1A 1ZH4A 3E9YA 2L17A 2XUDA 3JYLA 4IUYA 5FJIA 4XJXA 4GR9A 3L0PA 3H5AA 3ZWDA 1ISHA 4C7KA 3TSCA 4RFVA 3ZS8A 4AUEA 4L2IB 5CD9A 2YMQA 2KI5A 3BQ9A 2JHFA 3R5SA 2WIBA 2YWHA 3IS3A 4DV5B 4YMVA 4YQZA 1BG6A 1N8TA 2QUBA 2FLKA 2FOXA 3UGKA 3KB6A 1H9AA 2P3QA 3P2KA 1O6BA 2A0WA 4C01A 3V4RA 1U9IC 2MTBA 3DWFA 1BE1A 4PY2A 3RK1A 2FXIA 3RJTA 4EAAA 4FBLA 3KOXA 5KNCH 1IVNA 3INRA 5FA5A 2ZWOA 4Q34A 4KMRA 3C7AA 2LCQA 2REQA 2ZRGA 1DWQA 3D6MA 5A2QA 2GPAA 3KJIA 1K6MA 1PGJA 4LE0A 4Q0MA 3PCRB 1GQOA 2OHOA 2EQ5A 2ST1A 3GEBA 5H83A 1LC3A 5K3DA 4TL8A 2TMGA 1XB2A 5REQA 3UMJA 4WLFA 4AMYA 5F7OA 5ITWA 4DLAA 1QWOA 3ZG6A 4IJQA 2C4KA 3JZIA 1TB4A 1VPVA 5CVTA 4EY6A 3P9NA 4UVEA 3ZY4A 4OXNA 2AC2A 3EGIA 4BIMA 4E21A 3I1IA 1UXJA 4Q9KA 2P5TB 3J81k 4XGQA 3UJNA 3A6JA 4LDAA 4L4YA 4FK8A 5TT1A 1NW6A 4YXFA 3HTXA 4C5CA 5FV4A 4W1PA 3DHVA 3TRHA 1ULHA 2QJTA 4JL8A 1ZJYA 4KQ6A 4LBZA 3TTXA 4CV0A 2JFNA 1TZKA 4ANFA 3KUUA 1DQNA 4LRUA 3FE2A 1QPZA 2FWMX 3CH5A 2AC4A 4D74A 1Q77A 7YASA 3OKCA 3SIRA 4XVUA 3GPDG 1V4NA 2FZCA 5LDGA 4ZXFA 1R66A 3NBYC 3E0QA 3PA6A 2C4WA 3S7ZA 1P7VA 4MROA 4CG0A 4ND2A 2F1RA 1Z6PA 4Q03A 3QUQA 1Z83A 4HWTA 5T7BA 4ZRDA 4JLBA 1U2ZA 2G17A 3DL7A 2P1RA 4W99A 1AQJA 3VO1A 2Q0QA 2F1HA 1JTFA 4X85A 2J59A 1RD4A 4EK9A 1B7GO 2CNDA 2NXNA 3M83A 4NG4A 1TK9A 3OCUA 2PO5A 3H5LA 1OBCA 4M0MA 5EESA 3WB1A 3SNKA 5K8IA 5DCWA 3JYHA 4UTPA 1PNVA 1KR2A 2EZ4A 4BO9A 2C95A 3HXLA 4KN5A 4DY6A 3KD2A 2AB0A 1L8XA 1E6KA 4C0QC 3L06A 3ZVKA 2M6SA 4JAVC 3BWVA 1U28C 2AI1A 1NUHA 4OXKA 1AK2A 4ZT4A 4AMVA 3EXG2 2H4XA 5I9LA 5KTSA 4RPIA 3Q3HA 3E7DA 3PWZA 4Q7JB 4G1BA 2RAVA 4JCCA 2JAUA 3GJSA 1NX6A 3P1JA 2H2DA 3CQ9A 4GSLA 3JQCA 2VO1A 4BKRA 3D6UA 2QWXA 2A1TS 3QG5A 3C8DA 2CC2A 1ETHA 1NF9A 2PR7A 4KDCA 5AM0A 4DC9A 5K03A 3O6VA 4RIHA 4AU1A 2UYHA 4D45A 1RLMA 5EKTA 1Z5VA 1I01A 5BNIA 1MVOA 2JB9A 3MWLA 2MSDB 1QGAA 1UPTA 1Y9AA 3E4DA 4J75A 4QXAA 5COQA 3S2ZA 1I7SB 2P6NA 2Y68A 1V4BA 1C1YA 1A72A 4R2MA 5KOIA 3LPDA 4BWGA 1G42A 1PWEA 1OYVA 3TR0A 4QRIA 2WOOA 4S1NA 1J9ZA 2XA1A 3QG1A 1B42A 1K86A 4I50F 4NFLA 4MCJA 4NMXB 1T5LA 5CFQA 1K9SA 5EJ6A 2QI9F 5A03A 1ADFA 5A3JA 2B20A 1B2RA 3D3WB 4JGIA 5FTMA 4YRSA 5FOQA 1BE8A 2VK8A 3LT0A 4BL5A 3FCCA 3KWJA 3THOA 4PSDA 5B36A 5KX5F 4GQBA 1BMTA 1GSAA 1KRHA 2PSFA 4L78A 1CUAA 2DTEA 1O9GA 4NJOA 2WQ7A 3M33A 3WL4A 3IP9A 3QVSA 4QAJA 1ML4A 3OUZA 3Q15C 1S2MA 2Q3EA 1X2EA 4DIBA 1JPJA 1UH5A 2EFCB 5MDHA 1OPXA 1UADA 1IHYA 1OU4A 3PG5A 2HSJA 2XKKA 3UMSA 3I39X 3ZLJA 4MKHA 5IX8A 4HH4A 2ZCJA 4B40A 2F7SA 1UJBA 2YIDA 1OX6A 4UASA 1K5HA 1UJ2A 2LWIA 1T4GA 3JASB 3TRKA 4E5KA 3UENA 4GXTA 2I4IA 3GN1A 4RY0A 5TF0A 2BISA 2RHDA 3HDJA 4GFDA 1EJ2A 1VJGA 4LFBB 2IU0A 5F1OA 5GONB 3C7CB 4F7WA 2BZ1A 4QUBA 5IC5A 1AMOA 2TMKA 2ZAOA 1JT9A 5AR1A 3S5JA 2IW3A 4ZV7A 4K88A 1ITZA 1T1EA 1KQFA 4X94A 4CKBA 1XRQA 1AB5A 4AB1A 4PZYA 3H8JA 4D92A 3B3FA 3P52A 4ESHA 3MWJA 1QG2A 3G7NA 4GOLD 3ZY2A 1P29A 2O3UA 4CDNA 1MD9A 1T10A 2GWHA 3GDFA 3SZRA 2KLBA 2WT9A 1K2WA 2JLAA 4K9LA 5FPHA 3ILHA 4EY4A 3EXIB 4TT3D 3CU5A 3DZFA 5EJIA 4ZCSA 5KSPA 4X65B 2VDNB 1KVTA 1IUKA 3LJKA 4MQ6A 3LCJA 3FKJA 4OQQA 2PWPA 5EJMA 3KQPA 1Q0ZA 4KL8S 4X20A 1UM9A 4W8OA 3LF1A 5BSMA 4TWJA 1W4RA 2QE7A 1LI5A 3FDZA 1E2DA 5EP1A 3P9IA 1PL0A 2OHIA 4O29A 4ZIRA 3B1KA 2H2AA 4PQYA 1WWKA 3GZNB 4RMGA 1QIJA 1NXXA 3QMWA 4URFA 3I09A 1MG0A 4B09A 4POOA 4LF8B 3K71B 1SBYA 5IXJA 3IJEB 1EK6A 2BGTA 4G89A 4GHWA 2QUKA 1G4UR 1XU4A 4FNOA 3K0KA 2ZXEA 221PA 3B3QA 1QQ5A 1KYYA 3C3MA 3GDWA 3LC0A 4Q4HB 5I7UA 2CLHB 4C7XA 1MB2A 3A31A 1K7XB 1YS6A 3JQ6A 3R3UA 2J1LA 2W00A 4EQZA 3CUEF 3PYXA 5JXWA 1Y8AA 3RFXA 3RS9A 4RCVA 5HW0A 2ECOA 3DEIA 2Y77A 1PQUA 3D7KA 3SU8A 3PI6A 1XELA 1TD1A 2HDNB 3EEIA 2ZRLA 4HAXA 4NBRA 3IIJA 4H08A 5FFMA 4YMIA 2EOAA 1JEQB 4N5NA 3ZZUA 2AFHE 3NAGA 3AVUA 3F46A 1DO2A 3BORA 4FNGA 1NBMD 1GDHA 2ZR8A 4C4AA 5MFPA 3TF5A 1HDGO 4S24A 3BWXA 1NSTA 4YUYA 1ZOPA 1E7WA 3DO6A 2Y1LA 4CYMA 3UA3A 2P3OA 3KVNA 4AY3A 4BFUA 1TKRA 1Y5NA 3G9UA 2B4QA 4NYJQ 4PYQA 3VPXA 3EIQA 3L8DA 4MA5A 5C0OE 5TQ2A 3KJGA 2Z04A 4YPOA 1S8AA 1K0UA 2FDXA 2R96A 1KK1A 3KALA 3M6FA 1RJEA 2WUFA 1C3OB 3BGWA 4G5OA 3TLBA 3IJPA 2VVTA 2JS7A 1MJGA 1H65A 4JROA 4MA0A 4UZSA 1H8EA 3KCNA 3NI2A 4F1WA 1Z6GA 3EAQA 3SOZA 1E3WB 2PS1A 3IVRA 2CWDA 5LXTB 3VPHA 4L8YA 5ELMA 1VL5A 3LPLA 2B5OA 1H6CA 1HO3A 5JBIA 2DBVO 2W2XA 3IV7A 1N5MA 1MHTA 1B6GA 2JIQA 1S1CA 1D07A 4J7XA 3TIGA 5B4UA 3TMAA 3MN1A 1VSVA 2F17A 2QGNA 1U65A 2HN9A 1ZQ9A 3IPCA 4RS4A 1W1WA 2E9SA 4A8TA 5JAZA 4FTWA 4LRSB 4K2AA 1NNSA 4EABA 2R7AA 5B6IA 2BGLA 3K0AA 3H3FA 5FFFA 5IAEA 1C1XB 1DAGA 3Q1LA 3EQ7A 3HJCA 2WFZA 2BM0A 3P2JA 1H0HA 2I2XB 3HO8A 4IJ6A 5EKXA 4X1OA 5IK2A 4XIJA 2FMTA 1W93A 1Q0SA 1ZISA 3NV9A 1LB1B 1JG3A 4DIMA 1K6IA 3BAFA 3KTOA 4BNZA 2HW8A 1WF6A 3KKZA 4JIGA 2GYVA 3Q5DA 4PAMA 1GZUA 2QN3A 4G5HA 4QUHA 4QZVA 3NBMA 1X14A 2ICAA 3LO8A 2ZTLA 3H5NA 1ODTC 1GTMA 4B76A 1G8KA 4R6WA 4DILA 4F4HA 3F73A 3NIDB 1HY3A 1V3VA 2A92A 1T2EA 1DKOA 1NPYA 2H2FA 2P2GA 3GFBA 1WSDA 4G0MA 4I4IA 3T9CA 4WLOA 4B2PA 3O4FA 9GPBA 1VBKA 1PFKA 5EJGA 3WNVA 1U8UA 2EARA 1KDTA 1VMEA 3N3BC 3DMTA 1PUJA 2J3EA 3OQIB 3CH4B 4NBKA 1PNOA 1M5UA 4Z5XA 1X94A 2QD5A 2V9CA 2WZDA 3AR9A 3BB4A 2FTKE 3DHYA 4R2HA 1EP2B 1YU6A 1QVWA 2JFOA 3E3LA 1XUOA 3OU2A 4QO7A 3SSMA 3ZGLA 5JFGA 4KPYA 2QRKA 3E2IA 3WQQA 3VHRA 2E4UA 2Z6QA 2GBLA 2JIZD 3HKBB 1DJPA 2FPUA 2B8WA 5D3MB 3CN9A 2QPTA 4ZVLA 1VGRA 2AFIB 4MS1A 1LDNA 3ANXA 5JAQA 3WNQA 1ZHOA 1UFQA 1ZH2A 2HMUA 3EGEA 4MCIA 3VZDA 1H85A 2C3MA 3R6WA 4RL6A 1L7QA 1O54A 5BWOA 1R74A 2BEKA 1RKQA 1S8FA 2ZDQA 1HTBA 2XWBF 3QUTA 1EAYA 1N6LA 5FBWB 1N7JA 3S2FA 4BQRA 1I6KA 3MS2A 5L51A 5B7NA 2N9UA 4LI3X 2GDJA 1ZKDA 1QYDA 1ZITA 1EFKA 2PYZA 4DSTA 4HX9A 3W7AA 1S3GA 1KY3A 5ECGC 1RXCA 3OPYB 4R2JA 1KJYA 1Y9JA 2JANA 5FWNA 2Q5CA 4DMKA 1QORA 1FYFA 1RM5A 1P33A 2X0FA 4GI1A 4PYKA 4DF3A 3RT1A 3RABA 5JNRA 4Y2HA 2X5XA 2OCGA 4IGKA 4UJ5A 4J0IA 2IK8A 2L2QA 2AOVA 3NZEA 5LP6C 4O1HA 1X70A 5A2GA 2OD9A 1F0YA 3UB2A 2IYZA 1YU9A 2XF8A 4ZYUA 5TIIA 4IKPA 3HCFA 1SXHA 2Q3CA 4MRSA 4ZRMA 4HVLA 5CDFE 3L4KA 2GB4A 2UYCA 3G0GA 4E15A 3J7TA 5IVHA 3T7JA 1M0SA 3NRJA 1HSOA 2G3YA 4E7PA 1USKA 4WMLA 3ND5A 1CDOA 5FOSA 1QMPA 3RG2A 1KI7A 3A6ZA 2IF2A 5I4KA 4Q9HA 3MTJA 3W78A 2GYYA 1DOAA 3NONA 2BPOA 4RLFA 4XM1A 2Q5HA 5EJ8A 2IWRA 2H1VA 4KRFA 1A4IA 2XYPA 4WK0B 1NW8A 3QIVA 2ZP1A 2BGMA 3SK0A 2HDWA 3L92A 1E1DA 4YJGA 2F1KA 3WAJA 4X8OA 1U2GA 1GTL1 2ANCA 3ZZMA 3O9MA 2UVQA 1EX7A 5JHHB 1VDMA 3BUSA 3ZWCA 1R8QA 4M8SA 3W2HA 3ZHZA 2GSWA 1MC5A 1FCJA 2JCXA 4JMLA 3LKVA 1P2BA 2P90A 1JIQA 1FNDA 1SUWA 1N7HA 1WPGA 2GXUA 2XVXA 4D8TA 4GMXA 4DEYA 1KO4A 4CTKA 3B5JA 3FR8A 2DH5A 5H3LA 3ADOA 4BBJA 3ID6C 3UAOA 1W2GA 1I2AA 2GZ2A 4AUNA 3FTFA 2H17A 3AXSA 2BP7B 4ERNA 2JI7A 2J7PD 2FFRA 4EUFA 3ZNPA 4DQVA 2HNKA 4PZUA 1PN3A 3VQTA 2QRGA 1N2CA 2Q3LA 4GYKA 4U02A 4F2DA 5DYYA 2XEDA 1NULA 4JUAA 4DLLA 4WCFC 1H22A 4A16A 2ALJA 2EP7A 3FLBA 1ZY2A 4Z0PA 2O5RA 4BNLA 3GJ8A 3KXIA 4J76A 3BXXA 2I8AA 2CYAA 3QEOA 4ZVTA 1N2JA 2WMYA 1V8ZA 4A6PA 4Z7NB 6REQA 2XMSA 1XDWA 1W76A 4IMPA 4MQ4A 4UOZA 1E3QA 1PFYA 4B4UA 5DBHX 1NPTO 3MPOA 1T9KA 3T1VA 1CQJA 1TA9A 1V6SA 5BT9A 4B7XA 5KC8A 1XNQB 4REOA 5CLFA 1K8QA 2H4WA 4FDMA 3PDUA 1KP3A 4UD2A 1BYIA 2P69A 3T1NA 5K0TA 1T15A 3CVJA 2HLHA 2YZKA 4Q1FA 4UBLA 4AIRA 4ZZIA 3BXFA 3FDIA 3P0JA 1VE6A 2DAPA 3DDWA 2C9OA 1JQLB 1IM5A 4W8HA 4J0GA 4TLCA 1PNTA 5HGXA 3BM5A 4BJ5A 1D5WA 2OEPA 1EVZA 4DMRA 4POAA 3NHKA 2V98A 3OX3A 2CYCA 4MAAA 2IH4A 1QFJA 3LP8A 4EECA 1DADA 4K9KA 2C7RA 4Y7CA 1VLJA 4UUNA 4XRGA 3EOAI 5M7EA 2J87A 4G2NA 4EOGA 4I0WB 2NZWA 4G9BA 3LQQA 5DW3A 2IHKA 1GEGA 1Z82A 1QHYA 2GCPA 5AVXA 4L3VA 5CG1A 1T1GA 4HNGA 4RMHA 1I6LA 3PJFA 4TOIA 2FUG1 5ALGA 5CJJA 3QW2A 5EWLB 1RNLA 5T4EA 4TKVB 1WR8A 4MWSA 4U7HA 5L8VA 4OB8A 3NP9A 1FL9A 3OESA 5GVSA 4Q37A 3D54D 2C4MA 2PH5A 3UEOA 4X6YA 5JVDA 1O5IA 3JX9A 4EPVA 5KQGA 3E1GA 1SXPA 5ISMA 5CXQA 2C7GA 4KQXA 4NCHA 4Q9IA 1M6NA 1JDUA 2PWYA 4NZOA 2OLEA 2P35A 2YY6A 3CWCA 1N0UA 5IVDA 1HRKA 2PX3A 3QE4A 5KYUA 3VOSA 3DCNA 1QYRA 3SQNA 4B87A 4Z4QA 3LVRE 1L4LA 4NONA 1CDDA 1BO6A 2HRRA 2IOFK 1A5SB 3IHKA 4S0ZA 2P6RA 3K2IA 3QBEA 4ND8A 4ZTUB 2FEKA 3DC2A 3QWAA 3RKUA 3CMMA 1VLQA 3KFLA 2WPDD 4A2CA 2TSYB 2XB6A 1NZJA 3NC1C 3UFBA 3UH1A 2WC1A 3CW8X 5F23A 3KU4A 3AKYA 1QIMA 1U4SA 2JLQA 3NIGB 1JLRA 1IXSB 1KJWA 4TUYF 3ZDQA 3GMDA 1MRZA 5CX4A 3ED1A 5E6RB 2C5EA 4YONB 1BMFD 4US2R 4FFLA 2O8CB 2XIQA 4OATA 1LWNA 4MPJA 5EIFA 2HF8A 5A6VA 2Q6VA 4WJKB 4FINA 1X7GA 4YQYA 4FFNA 1UKAA 2PZEA 4A15A 2B37A 3CX6A 1UPUA 3KR0A 3U13A 5A9TA 4XDHA 3VR2D 1YC2A 3F3SA 4JU8A 4EB6A 2WTUA 3M4NA 3ZCQA 1U2QA 2C2OA 4DBLE 4F45A 3TW6A 1X1EA 1FUYB 4S1VA 4LZWA 3PGVA 3DXFA 4JI4B 4YCDA 1MX9A 3WIEA 4DJFC 3W6OA 1C2TA 1T6BY 1TIPA 3HN6A 4Q9JA 1VXOA 1UMCB 3BMOA 1L5SA 1O94C 4PLTA 3ESZA 2PRKA 5AOCA 1ESNA 4IDFA 3S2SA 3SSOA 3CINA 3TM4A 1J5XA 1XQVA 4KUGA 3W4IA 2AI3A 3UJPA 5L9AA 3K20A 1PL8A 4DMGA 3RSQA 3K9QO 4RGVA 1QK5A 1Z8NA 5ITZB 4FI3F 2HF9A 3TQCA 4AY4A 5FTNA 5HTKA 2OQVA 3CXUA 3FJYA 4F71A 1II8B 1ZIOA 4FDTA 4D4MA 2R86A 4MKGA 3BJIC 4U00A 4QLOA 2HQSA 4ZYTA 4TYMA 1OYOA 4IMIB 1DBWA 1E92A 2QZ9A 3DGEC 3FOCA 5BSTA 3ZDEA 4Z4HA 1SHKA 2CNLA 3RRFA 3I5YA 4CM9A 2FB9A 1QAMA 1YR6A 1H5NA 1JEDA 2P0EA 2WLSA 3JPYA 4YAOA 5B58T 5KYVA 4BLWA 2RHTA 1RXVA 3BZBA 3CNBA 2CUNA 2ZWIA 3LKZA 4IFBA 4WDQA 3T38A 1F3OA 5BN4A 4ABYA 1MB0A 2LW7A 2RHBA 3H1PA 1L4UA 3QVXA 4HY3A 4LYJA 2GAOA 2QU7A 1SZPA 4EGFA 1XN1A 5B64A 3ZQ6A 2ZEJA 4YP5A 4HLUC 2HHJA 2REXB 2VZ9A 3IFSA 1ILEA 3LL4A 1F8XA 2PH1A 1GYRA 3CLSD 4BASA 3UPUA 7MHTA 2C2XA 3P26A 2P68A 1T9CA 5AKYA 1EFTA 3DLCA 2CFCA 1Y37A 2ENWA 3PTLA 1M6YA 4QWWA 1H2RS 2W37A 4XIGS 4E2ZA 2I3ZA 1WNTA 4UDOA 3VPFA 3H5IA 3LLCA 3LFHA 3GC6A 1GPLA 3ROTA 4IGEA 2PIAA 4FD2A 1OT5A 1Y3AA 2REQB 3LVQE 4QREA 4B84A 5KTKA 3COSA 2FEWB 1BCSA 2ATIA 1G60A 4PNZA 5DHUA 1IUOA 4H7JA 4RHUA 3SD7A 2QB5A 3IMEA 1D03A 1MVLA 3KYDB 4JUIA 4UOQA 3A32A 4H7PA 3S7TA 4MW5A 1D1PA 5KOHA 2HBQA 4DA4A 1QB7A 3A06A 3NBZC 5CCXA 3WYNA 3EF0A 3PXAA 4OJKA 3U3RA 3ODGA 1PZMA 4XLLA 3SQDA 3CSDA 3QGMA 3LFUA 3HCWA 2JH9A 3DUWA 5JJCA 1VSQA 3WXMA 3HZRA 3ORQA 2AEEA 4DANA 4DPKA 4DW8A 1E2MA 4J16A 4RA6A 2BR4A 3DOOA 2OBLA 3GFRA 3A11A 1SXJA 4MS4A 4K9SA 5FDFA 3R4CA 2MDTA 4M1KA 3RB8A 4DBZA 3AU8A 4QQFA 4LYDA 5BNWA 1A1VA 4LHWA 5FBRB 3W3AA 4MUYA 1I7DA 2Z43A 1T43A 2GCIA 4UEQA 4KMOA 3UYLA 1JLKA 4Q82A 4UCWA 1KBZA 1YS9A 1TO6A 1ZD3A 4MQFA 5FBKA 2Q1UA 2CUZA 2YV2A 5ARDA 2G25A 3KYBA 1D2GA 13PKA 2PQ6A 2HGZA 2V6JA 2VQ3A 2W2LA 2GLXA 2WG0A 2ID4A 4K9QA 1RYYA 2YVKA 2C5AA 4PFQA 3H1BA 4UHJA 1GNRA 1UEJA 3C8ZA 3OQVA 2Y3IA 3RYHA 1ZK2A 3C98A 4M9UA 2WUEA 1GSIA 5CURA 1DWOA 3L0YA 4PO9A 3IA2A 1TKCA 3HO6A 2HQBA 2I2FA 2P5UA 2QAGC 4FE4A 4IDGA 3TIIA 4YCCA 5I7RA 4KYTA 4IIBA 1Z6AA 3IEIA 1FFDA 1Z62A 2EBWA 3D4OA 3LX8A 5B3JC 5AW3A 5JJBA 1CSEE 5AVOA 1SXQA 3EG5A 3FOZA 1LBHA 4G01B 1Y3FE 4BKPA 3LVBA 4RTLA 3LP5A 4RHEA 1EDEA 1WIWA 4ZU6X 5L4LA 4UVGA 4I9NA 3OCVA 3GMIA 2J07A 5FQOA 1GCUA 4ZHQF 1NBIA 2HT6A 4QHSA 3BL6A 1D9XA 4QXRA 3OIWA 1FFEA 1CC1S 4Y1EA 1OREA 3ND6A 4KLNA 4PWZA 4B7CA 2Q6LA 1EU1A 4NFYA 4B34A 3MTIA 1F20A 5FEUA 5F9HA 2IF0A 4MYDA 1PBNA 2QW0X 1A5ZA 2VLIA 3FSEA 4GMFA 3ZV5A 1LK0A 2CV0A 4TYWA 3HDQA 3ACCA 4PQFA 2F9FA 2QW1A 2WG1A 1LJLA 3AR4A 1MFZA 1OZFA 4QDUA 1UPAA 1PJZA 1VCIA 4F8JA 4NOMA 4HZUA 1JV2B 2DFTA 5ALMA 2KWIA 1LV7A 4RIFA 1I5EA 2QUHA 2Q3BA 2A8YA 5NLLA 3V33A 4BYMA 2CV2A 5DI9A 1TVKA 1HYHA 1FEZA 1OWNA 1T9GR 4MMXB 3EGVA 1IRXA 3AJRA 3DR3A 1HA3A 4KHZA 1RWQA 1B6SA 1FP4B 2D74A 4A5OA 2X8WA 3OFNA 3QP9A 2MJLA 1P39A 4UDNA 5ALWA 3C1OA 2XEXA 3WLMA 4AULA 2HMYB 1E2PA 2AMYA 1HM5A 4PONA 3P97A 4RH3A 3ZWKA 4AAYA 2L18A 1XNRB 5IAAA 5DM60 1W5FA 3BQNB 1NFQA 5LVAA 1USGA 3HL4A 3MS4A 4ZDIA 2PKQO 2QZ4A 3I53A 3PDJA 3WK6A 5ULLA 2CDCA 1Q21A 4GPZA 1IPEA 1JNYA 1RP1A 2AQ8A 3BCUA 1PFQA 3PXBA 3FPEA 3IB3A 3PITA 4IH1A 4RPLA 2W93A 1GXSA 4QARA 2QK4A 3GLTA 4XVRA 3VDNB 5CFNA 4DZRA 1L5RA 1QWSA 1UBLS 1ZINA 3IT2A 3P9PA 1L5KA 1JG1A 2RI0A 1A8PA 2WY2D 4Z4CA 2FN8A 4UE3S 5LL6P 3P20A 2PAAA 2LCIA 1PYOA 4G5GA 1N1EA 2G4VA 3OLXA 3R9WA 1IYZA 2JFPA 1XD8A 3DNMA 3N6XA 4HGQA 1RDFA 4ZOLF 5ALNA 3GPIA 4D9FA 3U4QA 3K5WA 1ZH0A 1U0RA 2ISSD 2YXPX 2NV2B 4GG1A 2HHAA 4IUDS 4RAQA 1UWCA 5DK6A 5CEEA 5K09A 5KQSA 4P3OA 4L4UA 3AHCA 1PZEA 5LIRA 2JRCA 4MV3A 3HXTA 2I0FA 4KN9S 3UJ9A 3TX2A 5A7FA 5C8VA 3DBRB 3ACDA 3EDQA 2JJYA 1R9GA 3ULKA 2TECE 1T8SA 5C7LO 3V42A 1S1MA 4ZYZA 3A6PC 3R2JA 4IJUA 5JNSA 5J2UA 3INYA 1X7DA 4ROTA 4EMTA 4I8DA 4BQPA 1EWQA 1FMCA 1KFCB 2PZBA 3GJQA 3PEUA 1R8YA 4BNXA 3SQWA 4CKBB 1J90A 2D8MA 4IKEA 3W5VA 1P75A 4ZV9A 3AGPA 2ACWA 5JAIA 3W5BA 2O0MA 4JHLA 2VYQA 2OHJA 4JB2A 4PSUA 1J8FA 1GITA 2O2DA 2QTVA 5BMOA 1G8AA 4D4HA 2A0YA 2V7UA 4FPXA 3UAYA 4B3SB 3P2OA 3R3VA 1YDMA 2OBXA 1OIXA 2IIBA 2CLKB 5FOTA 2D1TA 4L4ZA 3LTEA 1ML3A 3DPSA 1X3SA 2BFMA 1UM9B 2DWUA 2IP1A 3GRFA 1XZFA 1WO8A 3IO3A 1VE9A 2YFYA 5HF9A 1JHUA 4AG3A 4AWXA 3FDZB 3K1AA 4M49A 4X60A 4ZIRB 3WGKA 3I58A 1R5BA 5DYIA 4F4JA 2RGWA 2PNJA 5JDCA 3QYAA 4N7JA 3LFTA 1M2NA 2XUZA 4Q3CA 4XKJA 5LB2A 1M8JA 4GPIB 1NN3A 2JGJA 4C0KA 2AGVA 4B85A 2FZEA 1F0KA 3BRCA 1PSZA 2B1QA 2JAPA 4OMFG 5F12A 1UKEA 3REFA 3AR2A 3VR4A 1RZVA 3U49A 1NI5A 2JLXA 3UHOA 3PFGA 2O2JA 3Q7QA 5ICFA 4ICIA 1T0BA 4M0FA 3M9WA 4MRPA 3QNWA 4BV2A 4PLCA 2Z1MA 3H8WA 4YAWA 3SZOA 2DKNA 4GD3Q 2RJNA 3P2MA 4MGYR 2MR6A 2OCLA 4Q9NA 2BHLA 3TLKA 1KETA 1ID1A 2VZEA 4UZEA 4C2BA 4EG6A 1E3MA 1N78A 2B21A 2ZIWB 3COWA 4P4UA 4W7SA 2QT9A 3DBLA 4WKOA 3A4VA 4DIOA 2D1SA 1M74A 2FF7A 2QX7A 4EPRA 1PG5A 2W2MA 1MOQA 4TTVA 1GV0A 3UMGA 4C4RA 4OUDB 2VNAA 3D64A 3IEXA 4Q00A 4RKFA 3S8MA 4PGAA 4HMQA 1JG7A 2FR1A 1KJZA 4B81A 2QJFA 1ISJA 1L1QA 3BTVA 1J6UA 2HO4A 2JGMA 3MA0A 4NEHB 4DCNA 4QYTA 1PV2A 2Q45A 1YZTA 1YVUA 1SNYA 3ASVA 4AJLA 1NBME 2CZQA 2ZUVA 4KITB 2G1AA 2OVFA 3T99A 5TQ2B 1PSDA 3S44A 1KEUA 2F64A 2F8LA 2ZI9A 3CKYA 3AQ4A 3FNEA 3FJOA 1SY7A 4PSCA 4Q48A 4JI1B 5K7SA 1CY1A 3I62A 2OGTA 1LS1A 1YZVA 3MILA 1PT7A 2YHUA 1RP7A 1TCBA 1U3TA 3HP1A 2VNIA 3T7TA 4PNEA 1MJFA 3JATA 1FJHA 4UUPA 4QOEA 1CTQA 2QE7D 3IQWA 4GVLA 1EB9A 1Q1BA 2Q21A 1C1DB 3LPMA 3T7SA 4MP8A 1UKBA 5I7FA 2J9ZB 3L6RA 3R5HA 1DI0A 4UM7A 4XA8A 3DBHB 2RCYA 3LXMA 4ARVA 1WXGA 2C2GA 4IH4A 2B35A 1W48A 2BGKA 3G02A 4PC6A 2OXTA 3UKDA 1ZZGA 1DKRA 2YFQA 2ZJBA 1ZMBA 3K0AB 4XTCS 1NNEA 1VKOA 4IDHA 3KT8A 3COVA 4WIAA 1V7QA 2KE5A 3KXLA 3LLVA 3SJ7A 2AYZA 5KQMA 2OYSA 3D02A 4WLNA 1OX4B 4R31A 2JAHA 1F5NA 2RGXA 2W6NA 3M4ZA 3GRVA 5DIZA 1B0ZA 4CKEA 5AM1A 1G19A 4PPFA 1OLXA 4IRUB 2J3IA 4HAUA 3F49S 3AY6A 2Q5LA 1IEXA 2D0DA 1X7XB 2NQTA 3DBVO 4PW0A 4QM7A 1D6SA 3QJGA 4BEVA 3B6JA 4DYDA 5FOUA 2YJGA 4F6RA 5CH5A 3B70A 4CEIB 1R50A 3AJEA 3TXAA 1YKGA 4BJ1A 4N5MA 4H59A 1ECLA 2D00A 2C8VA 1NVMB 3OZVA 1CZUA 1U7OA 4BB5A 4KWIA 1TJYA 2W0MA 1DKLA 4RKWA 5HJ5A 3WQRA 1DIGA 3OMLA 4UFPA 1Q0TA 4HDRA 3DOUA 2F1IA 2PZFA 3S99A 3I8OA 2BKUA 4BGEA 1FFBA 1BKDR 4ZT5A 1H8ED 4DHEA 1T4BA 4P93A 2GTIA 4L9WA 1MOSA 3LXXA 4DAOA 3IJRA 4MS1B 2WAMA 3R75A 1C5KA 4K6KA 3VR5A 1KEZA 2ZRAA 1JJ7A 2FW6A 5HPYB 1J42A 4ZEWA 2FPWA 1REQA 2ZRBA 1CUGA 3O95A 4XVQA 5P21A 4DJAA 1J99A 4DYHA 1KVQA 1F9EA 3PR2B 2EKZA 1FFGA 1QYCA 2VUHB 3HJAA 4ENTA 2XR1A 2HJWA 1G9XA 4JJGA 4NZNA 3C6XA 4BVJA 4KR6A 3ZWNA 3ZW7A 5JZMA 3NM4A 3NPMA 3LY8A 4F11A 1R4AA 1J56A 1NR5A 1D2RA 3KQSA 3RKRA 4EX7A 1B15A 1FY2A 3OC6A 5G1OA 3ZBUA 5DNCA 5IK2D 2J09A 3ECCA 1A69A 2E85A 1X8JA 1JIXA 1S5PA 3R5TA 3QLVC 3FYUA 1R5JA 3C7DB 3T94A 3T3OA 5JBNA 1K3UB 3L7AA 3GLIA 4YGXB 2YOHA 4BGVA 3HBAA 4EY5A 1O08A 4L5IA 6ABPA 4Q19A 2C9YA 3FNGA 5FTKA 2CJXA 1UOEA 2C98A 1OWPA 4P7JA 5TGDA 3FYCA 2H5JA 2P40A 2WNSA 3W1EA 1Z6XA 2XB2A 1E3EA 3P45A 4OYLA 3V4OA 1F14A 2R87A 3ESCA 4FWBA 3AR5A 2MSNA 1IQRA 2Q6OA 1JJBA 3FUXA 3R0XA 1BFKA 4YB8A 2GK4A 1XHLA 2KSQA 2WWIA 4UUQA 3JCZA 5F2EA 1IHPA 4Z6KA 3IB6A 4LNHA 3KBBA 1NVXQ 2E5WA 2P5YA 3P32A 4BATA 4QJIA 1UC8A 4KRXA 4F04A 5IBQA 1Z4MA 4D9HA 4IGFA 1Z4LA 1J8QA 2R9VA 3U3JA 3AHGA 1IJFA 4U0JA 2CXQA 2NYRA 2NX2A 4YJGB 1BN7A 2YY7A 4ZJZA 4HVCA 2NVUA 3I1YA 3OI7A 3I61A 3DDHA 1BX0A 4BU0A 2E48A 2A7XA 5EIOA 3O1IC 2BFPA 1B1AA 3H18A 4IM7A 1CXZA 1RAEA 1XCBA 5ARBA 2ZJ5A 2WQ6A 1PBTA 1T5DX 2N1BA 3NC0C 1XTJA 2NAPA 4RH0A 3NT4A 3OKPA 4I6JA 3V8NA 2HCJB 3QKUA 4BP8A 3G2MA 2FSIA 5F73A 2PPVA 2DWCA 2PLWA 3LPCA 1GCAA 4CTMA 4G4SP 1AK1A 3PK0A 1H2BA 2AFIE 4KRGA 4HWKA 3ZV6A 5A5EA 5FHRA 3X1MA 1J2EA 4M7WA 2WFLA 1CQZA 4I1SA 2O3SA 3HMKA 3AL2A 3ILXA 4OK5A 1U9ZA 4CWAA 1G59A 1WKBA 2CLLB 2JK0A 1EUQA 3CEMA 1WTAA 2GRUA 3PHBE 4G97A 2SKDA 1JKJA 2AA3A 3DLBA 1N2CB 3B9BA 1MG5A 2VS1A 3HXQA 3CSSA 4PC2A 1C1HA 1T5SA 2YJZA 3GVCA 4MW7A 1SUBA 3GIWA 1K7EB 3FWYA 1EBBA 3PNOA 2QY6A 1V1RB 3LS2A 4PCVA 4IIGA 2LV8A 5LDDC 1M10A 1R8XA 1T2DA 4GKJB 6REQB 3SJUA 1Z63A 2O59A 1X9GA 3MBIA 4D7AA 1HPLA 3EZLA 3GI1A 2DUNA 5EY5B 2O19A 1K5DA 3AFNA 2V4MA 4AL4A 3KJEA 4AS3A 1FRVA 1CQJB 1PEAA 3UTDA 5ILOA 2BYTA 4DIDA 1EX1A 1RZRA 4C7OA 1DP4A 2Q5IA 3I3SR 4OBEA 5UKDA 2YXLA 5KTRA 3PDCA 1RWPA 3R9XA 2EKDA 4BX2A 1KO8A 3IAAA 3W5JA 1UBFA 3E3MA 1H1LA 5F9FA 3O4HA 2OV2A 1QS0B 1IBSA 4MRMB 3WLRA 4OBWA 4MUBA 5FYDA 3WLEA 4HEJA 4KGVA 3OPQA 2RBEA 3PQ3A 4C29A 3CT6A 1KYVA 3HB4X 2D2VA 3AJ8A 4CN8A 2XY4A 1ETUA 4V0LA 4BP9A 4M99A 4ZFNA 1IQUA 3JWIA 2MYNA 1J09A 3ZJYA 1Z3CA 4PTZA 2NW6A 1IBMB 3W1VA 4MINA 4GYJA 1TW3A 3WDSA 5AKGA 3WDKA 2G1KA 4QGSA 3FCEA 5JPIA 2F43A 2V0NA 2NNLD 3SBEA 3FVWA 2QS9A 5SYNA 4BLVA 4JVNA 5E7JA 1C7RA 3IE2A 1J22A 4IOJA 1L5GB 1NONA 4PQRA 2RHRA 5C4GB 4PRYA 3HNRA 1IG0A 2LXNA 1WBBA 2HA5A 1G63A 3WRYA 3DAOA 1NVFA 2CHEA 2O7RA 2VUIB 2JEOA 4PINA 3EW9A 1A5BB 4K9OA 4BB9A 1E3LA 1KIFA 1N3LA 4QXOA 2J41A 2FHPA 5L3ZA 1E1RA 3N86A 2EYQA 2RCNA 5KYUB 2WJAA 4IEFB 2CMDA 4QTTB 5GPBA 1J8YF 1N7GA 3MM4A 3Q7IA 1EE9A 5HBRA 1I1OA 1Q3TA 3I0MA 4F96A 1NSYA 4RD3A 4REQB 3R3WA 5TR9A 3WNBA 3B6ZA 1H8HA 3U3MA 4C4ZA 3L7MA 1N0HA 1ODLA 1E9FA 2GNAA 3H2SA 4WXPA 1EFAA 5L53A 5ALEA 2DLCX 1N5DA 4K05A 1E32A 1QTRA 2J5KA 1A8HA 3N8KA 3QBJA 5AK0A 3RNOA 3RO7A 1I2MA 2H4ZA 4WESA 4N7BA 3TZCA 4D9GA 2MYPA 4F84A 3FBGA 3GLGA 3LIPA 1VHLA 1E1YA 2VDKB 4N5HX 1R16A 3T52A 5I9BA 3PUWA 1GFIA 2HF7A 3L0CA 1K5GA 1RRMA 2OGSA 3IT3A 4GOJA 4OP1A 3P8ZA 4QXPA 3VKHA 1RTKA 5J63A 1CP3A 1CQXA 5A3QA 3NCHA 4ZQFA 1ODJA 2FSPA 3AR3A 1TYDE 1ORVA 1TU4A 3ETDA 4YJFA 3M4YA 1G3QA 3V2HA 4NR0A 2PKXA 5A6SB 2X0DA 3BMOB 4OM8A 4RQAA 2XOKA 1OZAA 3P2YA 1H4TA 3PR1A 4HGOA 1G2IA 4IEIA 5FB3A 1AXRA 3UG6A 3BXEA 3H05A 4RF3A 1N77A 4IKOA 4JYCA 5JSZA 2JFYA 3JD3A 3FTEA 2MT9A 1ZR4A 4IIDA 3GB9A 1W88B 2ONJA 5KSZA 1JJAA 1AE1A 3U16A 3VO8A 5D87A 4Y2SA 1DJQA 2IH2A 1YRAA 1ZOIA 3EH2A 2UXCB 5F5NA 3VSEA 1PKXA 5H02A 5C7IO 4IP0A 5I7OA 4H60A 4QQ8A 3F67A 5DWVA 3NKFA 4F2WA 3ZLVA 2F00A 4G1CA 5KNBH 2X19A 5EKSA 1HKHA 1PZFA 2HD4A 5BN4B 3R3SA 1KYWA 8LDHA 3GEEA 4H6WA 4XX0A 3D5EA 4LMBA 4MVJG 2VZLA 3L0DA 2QLTA 5FAKA 2DJ5A 4OGFA 4ED9A 1E4OA 1R2QA 3OMWA 4J0JA 4FLFA 3RIGA 2XTZA 5LLDA 2NTYC 1PWHA 3EA0A 5JATA 1CE8B 5F64A 1T0PA 2DOKA 4TKUB 5M3BA 4AWBA 1M34B 1U11A 4TTJA 3C39A 4PYOA 4ENVA 4O1MA 2PD3A 4WK4B 1UDAA 3V3KA 1KDRA 1WDKA 3CCFA 2B98A 2ZPTX 5FRDA 2OCBA 3CUKA 1L5MA 2PX5A 4RNDB 1AKEA 1F9AA 3AP3A 4GZ5A 1SUFA 3WLHA 1X15A 3H5WA 5AKIA 1U2SA 5CFZA 5K45A 1N2GA 3UT5A 4RDHA 1OLUB 1H0SA 5ALRA 3TAHA 3TQRA 2A3RA 3G2LA 3A37A 5BOSA 5C81A 4HYYA 2ZLBA 4MUGA 1QGED 1UBSB 4FFPA 4QELA 1GRCA 1BCSB 1BDJA 1KGSA 2B8TA 2FF5A 3D43A 4MVJH 1BD4A 4TV8F 2A33A 2VPYA 721PA 4GPTA 3MTEA 2WM9B 2XYHA 2LKCA 1VJRA 2UV8A 5A4KA 1EUYA 1ZNYA 1E2QA 4X45A 4AQDA 4RDXA 1P5ZB 2PMKA 2E5FA 3QVVA 4OHKA 3E7WA 5F77A 3OHMA 4WBNA 3ZWOA 2HPVA 1XR3A 4B0OA 1IXKA 3C3PA 5KMGA 3ZHCA 2D2XA 1XHFA 2CKMA 1C8LA 4RA6B 4CM9D 3VKWA 3VR6A 3PEVA 4PHFA 2W11A 4H0FA 2SCUA 4MS4B 4AF7A 1SXJB 4M0EA 1P2DA 1YS4A 1CT9A 1QFXA 2GBGA 2G67A 3EQ6A 3MMSA 1PF7E 4PAWA 4YJ3F 1IXRC 5DLEA 5T41A 3T34A 4B35A 4CJXA 2XVAA 4FI3C 4MVWA 4MDEA 1PR3A 1LRLA 4XGKA 1BGVA 1SHLA 4OO3A 4MQFB 1XMOB 5AKXA 1OU0A 1PW7A 3KJQA 3NRBA 3UHJA 2CMFA 4DSAA 1LTHR 5BPHA 4EW6A 5FUYA 2XQVA 2MR5A 3I8XA 3KB8A 1PV4A 4KXUA 3STWA 1SZJG 5D00A 5KJFA 4DV1B 2X6TA 1BXGA 3ZQ4A 1QBKC 2FJPA 2GILA 1LW6E 3DFIA 3TAUA 1A50B 4TMYA 1X1RA 4CLDA 5J4VA 3QITA 3G2QA 1CS0B 2WSBA 2AW3A 4WZBB 4EG4A 3ND8A 5B6JA 4TRMA 2HLNA 4RK5A 2LNDA 4ZVVA 3G49A 3ISJA 4YUXA 3HVUA 3VOTA 1YUMA 5CDUA 3FKSA 3MSCA 1PJ2A 5JPCA 3LZDA 5KNDA 1Z26A 2Q8QA 3AEXA 1X42A 3EQ8A 3CVWA 4O4JF 4P08A 4HAVA 1QZUA 2IV2X 1QIIA 1TX4B 4ZO9A 3E2MA 5EMJA 3TYXA 3REOA 1FX0B 3ZH9B 4EELA 4ZEMA 2LZ0A 5I9NA 1HQKA 3LGXA 4LZAA 5FNVF 2NPOA 3TQOA 3SC2B 1LV8A 4Q3NA 4D9BA 5JAMA 3ADBA 1BXZA 3R8FA 1P7ZA 3WLIA 3FY4A 3MT0A 1DIOB 1GKLA 3WFIA 2Y66A 3L5OA 4I9HA 4OKSA 2PSEA 2JD1A 1SC9A 4RTOA 1O9BA 1PTJA 3UJ8A 1LBTA 3L7CA 4RENA 1FFAA 1SKBA 2CB9A 3IUQA 1NMYA 1SXJD 2ZTVA 3A9UA 4HZUB 1XFAA 1GG2A 2HCTA 3TZLA 4EHDA 3W3AD 4LOJA 3F74A 2YZGA 3SIWA 5H81A 2CFTA 1Y7HA 1W19A 4EI7A 2XE8A 1IOZA 1KMIY 2L82A 3WHLA 2XV1A 3GP3A 1YRLA 1ZM9A 2IXAA 5EJ4A 4WN3A 1XTSA 2LGJA 5ADVA 5J23A 2YX1A 2MSWA 2W2LD 3QELB 1GPNA 3LUKA 1JDBC 2HU2A 4FM9A 2J0SA 3K2BA 1XEXA 5F1PA 3URKA 3HB9A 4RPJA 4XDZA 3ZR4B 4Q16A 2FSHA 3CLTC 2WKWA 2F55A 4NWIA 4EJMA 2VUUA 3CTPA 3WLQA 4UBMA 3O0DA 3WB2A 3OE5A 3U3ZA 4BNDA 3C1UA 2PJRA 2HA4A 5FTJA 3I2KA 5EZ6B 2AMFA 1GGMA 1Y1KE 1DAEA 1YQQA 2HIHA 5KKAA 4ZI7F 5K9ZA 3DZIA 2FWIA 1VPTA 2QNBA 2Z4SA 4YEDA 4OU5A 1OKKA 3SE7A 3TG8A 4EDFA 4I6EA 2HOQA 1M2HA 3W5UA 2DBYA 1M6EX 3S5UA 3CE9A 3FRIA 3ZWXA 1ZKMA 1U5AA 2HUNA 2WAYA 3CLRD 3IURA 2C54A 1V37A 1AX9A 1TMKA 2NPIA 3BFPA 3PFIA 2V59A 4M1YA 3RIXA 1VJ0A 3RQIA 3R41A 5EXDA 1AQIA 4TZKA 5KYXA 1VHDA 3QKTA 3QYJA 3E27A 4GP6A 5K3BA 2Y4OA 3DV0A 3VSBA 3ZEAA 1FTYA 2OGWA 1VM6A 2VHZA 2RH5A 2BUCA 3T5GA 4NH0A 2FG6C 4OYYA 5K6TA 5EZYA 2JK1A 1FDUA 4B3BA 1K98A 3G2HA 3MG9A 2JAWA 2VP3A 1V5FA 5DX1A 3VU3A 1U04A 5LNK1 2DSTA 5HCIA 2GHTA 2BGWA 1JEAA 1O97C 3BGOS 3GT0A 4X7RA 3DCIA 4I81A 4KO1S 4V0ME 1MB4A 1XOIA 5CK4A 1Y5IA 3FG9A 4FMDB 1HT0A 2H5LA 3ZE8A 1HETA 3GJ6A 5F3WB 4QDTA 3RODA 3KQUA 1ECPA 2P0YA 2PT6A 2OE2A 4KOAA 5J2UB 3VZBA 5HSGA 4DCTA 5EC8A 1PQYA 4WKPA 1KFKB 4RBNA 4G0ZA 3RBZA 2QJRA 1MORA 1OTHA 3RTEA 2VKTA 3ABSB 3A14A 6PFKA 3OFND 2G5CA 3LUBA 3W9UA 3HCAA 5EZSA 5JDCC 3B9RA 1FX1A 5E9WA 3JQAA 5ES3A 4JX9A 1F2DA 1LH0A 2XVMA 1Z2CA 3D1LA 2OB2A 3D0OA 4MJLA 5AJWA 4AJ2A 5K8UA 2XXAA 3SF8A 1O03A 4BV8A 2IDMA 4ENSA 4ZKDA 3OZCA 5JU6A 4Z4IA 1JZTA 4PGGA 5M34A 5DP2A 1HUQA 4C0WA 1Z74A 3D5TA 4NTZA 5EYPA 1XO1A 4TMTA 1YB2A 1J1ZA 1XCOA 3K1AB 1T6YA 3OEEA 3CRRA 3Q3JB 1WSAA 3Q88A 4KVFA 1UJ5A 3AP2A 3GT3A 4MIKA 2GN6A 4E1AA 2NXEA 1OH6A 3K5IA 4P8RA 4D0GA 2ZVJA 4TTSA 2O7VA 3HC7A 6LDHA 8ADHA 3BILA 3N2GA 2NNWB 1VP3A 3F2VA 4N39A 5DT2A 3YASA 5JY6A 2QN1A 4LOHA 2PYIA 5JMWA 1ZJ5A 3B82A 2YFKA 5EERA 4CCSA 5B12A 5JAUA 1SCIA 3SZMA 1AMNA 1L5LA 2CXRA 1Z4PX 2E49A 2RGCA