1PF7E

Crystal structure of human pnp complexed with immucillin h
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
288
structure length
288
Chain Sequence
b'ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
molecule tags Transferase
source organism Homo sapiens
publication title Structural basis for inhibition of human PNP by immucillin-H
pubmed doi rcsb
total genus 87
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pf7E00
4JWTA 4EB8A 1ODJA 4TS3A 4D8VA 4DAOA 3PHCA 5CXQA 4R2WA 4OEHA 2QTTA 1Z37A 1V41E 4TTAA 4M1EA 3EUEA 4WKPA 4GKAA 3E9ZA 3FWPA 3DF9A 1A9RA 4D9HA 1SD2A 3KU4A 2H8GA 1TGYA 3FAZA 3OPVA 2HRDA 1YRYE 3ENZA 3KUKA 3PHBE 3T94A 4TXLA 3EUFA 5EUBA 2AC7A 4MCIA 5B7QA 1OVGA 4TTIA 3NBQA 1A9QA 1Z39A 3P0FA 1N3IA 1NC1A 3TL6A 4BMXA 3IOMA 1RSZA 4OGLA 4WKCA 2I4TA 5K1ZA 1YR3A 4BMYA 2OC4A 2ISCA 1V45E 3O6VA 4GMHA 2A0YA 4G89A 1RYZA 1SJ9A 2I8AA 4OY3A 1G2OA 1TCUA 1Z38A 3PNPA 5EFOA 5F77A 1ULAA 3D1VA 1PWYE 4F3CA 1FXUA 5CCEA 1Y1RA 4R2XA 1T0UA 4TXHA 2Q7OE 1OV6A 3UAVA 3OCCA 1Y1TA 1JDSA 1Z33A 3KVVA 4R31A 5IU6A 4LNHA 4X24A 1U1GA 2P4SA 2OC9A 2QSUA 3ODGA 5C80A 5B7NA 4PR3A 4YMLA 1OU4A 4RJ2A 4NY1A 1PK7A 2PGAA 4OJTA 1RT9A 4F3KA 3K8OE 5F7ZA 4F1WA 3FUCA 4MARA 3GGSA 1T8RA 1YQUA 3BL6A 3LGSA 4G41A 1PW7A 1CG6A 1V2HE 4MCHA 4JOSA 1NC3A 1JE1A 5CYGA 5JPCA 4TXMA 4LZWA 1V4NA 3U40A 4QAQA 1Q1GA 1JYSA 2A0WA 1Z36A 5DK6A 3OZDA 4L5CA 4GLFA 2QPLA 4L6IA 4KN5A 4OGKA 4TXJA 3DDOA 4D8XA 1A9PA 1T8WA 4DANA 2HSWA 3OZCA 1U1DA 4NSNA 2A0XA 1VFNA 2A8YA 3FB1A 1PK9A 1ULBA 1U1CA 3E0QA 1ECPA 3KVRA 3DP9A 4DA7A 5F7JA 3BGSA 1RCTE 4L0MA 1JDVA 2IQ5A 4DAEA 3P0EA 1V3QE 1RXSA 4D8YA 3QPBA 5ETJA 5F7OA 3E9RA 4OF4A 5F7XA 4ECEA 5EPUA 1PR6A 3BSFA 4QARA 4NS1A 3ONVA 1ODIA 3OOHA 1NW4A 1Y6QA 2AI3A 1LVUA 3K8QA 3NM5A 1RXCA 4YJKA 1TD1A 5B7GA 4UC0A 1YBFA 5B7PA 4M3NA 3KVYA 3UT6A 3UAYA 1B8NA 1Z5OA 1VMKA 4M7WA 2OECA 5CXSA 1ODKA 1V48A 1VHJA 2RJ3A 1A69A 1PKEA 1C3XA 2BSXA 3IEXA 3LA8A 1PR0A 4E1VA 3SCZA 1PBNA 4EARA 1A9OA 1PF7E 1K27A 4BN0A 3KHSA 4DA8A 4QATA 2ON6A 4QASA 1SQ6A 3NM6B 4F2WA 3FOWA 4DARA 1XE3A 4DA6A 1JE0A 3PNSA 3EEIA 3DJFA 1Z5NA 1VHWA 5CYFA 4WKNA 1Z35A 1SD1A 1PR2A 1K9SA 4WKOA 2HN9A 1T8SA 5F73A 4P54A 4LKRA 1K3FA 3OF3A 2QDKA 3MB8A 5CCDA 1T8YA 4QEZA 3NM4A 4D98A 2OXFA 3FNQA 3O4VA 3C74A 5IFKA 1RFGE 3OOEA 5F78A 4LDNA 4TYMA 3F8WA 1A9SA 1PR4A 4TXNA 1JPVA 1QE5A 4PNPA 3UAZA 3MMSA 1JDUA 4LNAA 1JDTA 4JP5A 3BJEA 4YNBA 4GLJA 4BMZA 4WKBA 1CB0A 4G8JA 1Y1QA 3GB9A 4DABA 1I80A 1RXYA 2GUWA 1WTAA 3EMVA 4L5YA 1Y1SA 1M73E 1ODLA 1RXUA 1YQQA 3UAWA 2AI2A 3OZBA 1JDZA 1PR1A 1OUMA 1U1EA 2AI1A 2XRFA 1LX7A 4TS9A 3OZEA 1OTXA 3UAXA 2HWUA 1Y6RA 4QFBA 1JP7A 2B94A 1PR5A 1Z5PA 1LV8A 1B8OA 4TTJA 1ZL2A 5KB3A 4K6OA 1TGVA 1OTYA 1U1FA 4YO8A 5I3CA 1RR6A 4DA0A 4H1TA 5F76A 4L5AA 4U2KA 4IP0A 2QTGA 1TCVA 1A9TA 4I2VA 1Z34A 3LBAA 3DPSA 4FFSA 4F2PA 3INYA 5FAKA 1ZOSA
chains in the Genus database with same CATH superfamily
4IW3B 1N9KA 1EVLA 3CA8A 3KT0A 1D0SA 4HNRA 4OV6B 5HP4A 1PWHA 1D1PA 2OP1A 3SHOA 3QG1A 4CEHA 4HGYA 2IWHA 2YZ7A 3GD5A 1N8KA 1XTPA 2YZKA 3OY2A 4UW9A 4K1LA 4A8JA 2CBXA 4AF7A 3FIJA 4DXDA 2R6CA 5DX0A 1C7JA 4QUDA 4UMDA 5CXQA 1M8FA 4BZXA 5IKPA 2OAGA 3F6BX 4AUKA 1KTIA 5FLXA 3EFOA 4G36A 3H3JA 1TYZA 4H3VA 1Q1EA 3FTNA 3AR8A 3V1KA 2YWJA 4KWEA 5ESDA 4DNXA 1ZC3A 3HDTA 3QPDA 4MS3B 1RZVA 2DUWA 4YXWD 4H6XA 4URHA 3U7GA 3EEQA 1RBZA 1VKJA 2C96A 3F5MA 4GPBA 2CXHA 2GLTA 1C1XB 4ND7A 4QYTA 5HF5A 1XNQB 2IZ6A 4NU8X 4AJ2A 2V3CC 4IYRA 2Y9MB 1KDPA 2VP4A 2YIDA 3P2EA 2GM4A 1PN3A 3C43A 2I7DA 3NIDB 4WXRA 1BEZA 1ZRSA 2WJ4A 3GGOA 3L6CA 1ESNA 3E7XA 1SGWA 1P3JA 3RTAA 1CC1S 2IV7A 4DBLC 4DT1A 5BN3A 5C2JB 1WP4A 2OHVA 4LCJA 3L40A 3EZYA 4F3YA 2CVPA 4IH4A 4CG3A 4GNRA 5CLFA 2MR5A 1KEPA 1PKXA 3KQTA 2VTKA 2XDQA 4GIBA 1TD9A 3TNDA 1TU3A 3EUFA 1M7GA 4J3FA 3NWEA 4QGAA 2ODQA 4FDTA 4YECA 3ZWCA 1KFCB 2HPZA 1OT5A 3AOEC 4QJ4A 3ME5A 5B7QA 5ADUS 3FB4A 2NTJA 3IV9A 2BDUA 4M8KA 4DTIA 5K4GA 1TTPB 3ZGZA 2FTKE 4F5DA 3DONA 1LJ8A 1UJCA 1G3UA 1DI0A 1XELA 3H97A 5KWVA 2Z6QA 1J4AA 2D1TA 2G82A 4F6RA 1T13A 3GVHA 1C4WA 4YP6A 3DE3X 3HJRA 5IT9A 1GA6A 2MSLA 1XZCA 3EK2A 2K2QB 1ZIOA 5LBUA 1WHTB 2CL5A 5K1ZA 3SYMA 4B2IA 4OGFA 3I58A 2I80A 2A9OA 2W6QA 2VJKA 3C41J 3D02A 2EV9A 1F8UA 1FTSA 4J0QA 1SXJE 1ZA1A 3UJPA 2BN4A 1HZZA 1JUDA 2FEKA 5C1DA 4RF3A 2O6LA 3F9RA 4EGFA 1J7KA 4XUEA 3TVYA 1P7ZA 4L4RA 1B8UA 1OAAA 4UHBA 4HQ0A 3I2YX 2R86A 2IY9A 4K3UA 4IV5A 3MGAA 3AR2A 1VP3A 4FYYA 1ENYA 1M1YA 1NVXQ 2RHJA 1ORVA 4W8GA 3VPDA 5JMOA 2PJUA 5DWDA 3MRTA 5ED0A 5ALHA 3IBCA 2XZDA 1R3DA 3JVDA 2QRJA 1LLQA 3FJYA 2QLJA 1RMYA 4PNZA 2KPOA 4DBZA 5F3DA 5IZCC 1IZ8A 1Y1RA 4ZD6A 2GAOA 3U4AA 1OYOA 4Q1AA 1JECA 5LLSA 3WRXA 2HCTA 5LOVA 1LV7A 2F1RA 2QRUA 2W2KB 1N0HA 3DHEA 4HMPA 5GV8A 2Y2VA 3PGMA 4DXAA 2DP4E 4IXNA 1YAHA 1TK3A 3ESCA 2OFOA 1GY8A 2V45A 4U6QA 4JYAB 3N8IA 3EY9A 3K0KA 1KY2A 2G4VA 2J4CA 2D0DA 2HV8A 2XQJA 4C7BA 1Q44A 4WY5A 1ZEJA 5SZHB 1OF1A 1YOVB 3VHXB 2C61A 2WU1A 5IU6A 4JFAA 4ZK6A 1R6TA 3RAGA 1NULA 1RYMA 1V5IA 1D7AA 1NRWA 1UOQA 1QGOA 1TJYA 4IDGA 2LGJA 3FGOA 1GEGA 1EZZA 4EHLA 1UPTA 3VI4B 2QSUA 3MTEA 3CPJB 3QF7A 3F1KA 1PUJA 2QU8A 4X61A 3MGKA 2CXSA 3KJXA 1U8UA 3X1XA 5F2OA 5JHGB 1TVCA 2Q5JA 4DR4B 5C3MA 1OIVA 1TF7A 1G5TA 3R7FA 1M2KA 1GUDA 4MKIA 3ZV5A 5JJCA 4KGVA 1FRFS 4M99A 3EBLA 2CE7A 3T7SA 2VHEA 5AK6A 4KV7A 1OLXA 1FTGA 3ETGA 2X9VA 3I04M 2DC1A 3RIHA 2PGAA 1FNBA 3ASZA 3EXFB 3JWJA 5BN4A 4QODA 3C7CB 4YN3A 4JB3A 3O1LA 4F1WA 3GDOA 2F8TA 4QVGA 4UE2A 4TWZA 2DF8A 4HNQA 1DWUA 1USUA 5J2TB 1U99A 2C83A 1EHCA 3BM5A 3F2IA 3UMRA 4R9SA 4NH4A 7ABPA 1HQYE 2ZETA 3F4KA 1JSXA 3BMOA 4MZDA 2O07A 3RANA 3CZ4A 1USIA 4NBTA 5MN5A 4JOSA 3FZEA 1VLLA 3LPCA 3W2FA 1XIVA 3BDIA 2X14A 4WCFA 2PT9A 1AY0A 5CYGA 4YAEA 4A15A 3CN7A 4I5IA 1J8YF 1QDEA 1RAIA 2F9MA 4GPAA 4IJKA 1DDGA 3J7TA 3PFIA 1XZHA 1Z56C 2IA5A 3RUEA 4XRGA 5DHAA 2QBYA 4ZV4A 2XI4A 2H63A 2QIOA 4UE6A 4UFNA 2V7UA 2QYOA 1W76A 4HNGA 4LGMA 4QGSA 3AP2A 4KYVA 2JGIA 3RSQA 1U9CA 2R5WA 4NHOA 5MDHA 4TSKA 4BWGA 5FD8A 1KO5A 1UFOA 1VPTA 1Z13A 2P6UA 4R4JA 3V1LA 3CEJA 1P5JA 4AW9A 2HYIC 4K1XA 4Q9AA 1HYGA 3MQFA 3GLSA 5JJ5A 2HUPA 4FGSA 4QRDA 1G3MA 3VAAA 3K0EA 4UJ5A 3I0NA 4L6IA 5KOIA 5M5BA 4MWGA 1I3MA 4TVSA 4ND5A 4QREA 1KRHA 2O2ZA 3N0XA 4IGFA 5A3RA 2C82A 1RCUA 2A5JA 3ESYA 4I4LA 4Y0VA 5EJFA 3SLKA 4DCSA 4LGCA 4F6CA 2QBYB 4Z0PA 3PF8A 4YUYA 2VNKA 3NEYA 3TX2A 1TA0A 2VXOA 4JXJA 1TVEA 3Q7TA 1G21A 5I9MA 2IZ1A 2J5KA 3ISTA 1L5FA 3FI0A 5IFLA 1RWXA 3G23A 2PMDA 2JK1A 3F98A 2DPGA 2ZOSA 2G9NA 1ZJ5A 1KI4A 2OOKA 2UXBB 1D2RA 1QGUB 4IF6A 1LVHA 4FDAA 2X0JA 3TTSA 3TLBA 3KM0A 3KVRA 1V16A 2ZJ7A 3KYBA 3FNFA 1TT7A 1C2TA 3L84A 1WUHS 5BYKA 3EXIA 3WWCA 1HSOA 2QLBA 3IMGA 2R44A 3II6X 3SE0A 2JIDA 1R0SA 1UMCB 2O5VA 2HHCA 3OPYA 2ILVA 2Q4RA 3UTCA 3A05A 4BGUA 5D5PA 1ZX1A 3FGPA 3JAKA 1ULTA 4JITA 3A7EA 4PYNA 1IUPA 1GIAA 2D4HA 3DJYA 4MV3A 3SQXA 3OIUA 1YC2A 1USVA 2XOEA 3KOYA 3ORRA 1U2GC 2AXNA 4JDPA 1EQ2A 1QYIA 1VE1A 2W4MA 4TRJA 4YUVA 4LJSA 5LIPA 2DVMA 4M21A 1TA9A 4IDHA 1KY4A 3IUPA 2X5XA 5JASA 3F2VA 1HOTA 1I7SB 1RFLA 5FB3A 3CR8A 3R40A 5CEJA 3TTYA 2EFCB 4N6OA 4OXQA 4RM2A 1XZGA 5KNCD 1DC8A 3BQNB 5HEKA 2HHHB 1GT6A 2G0TA 2JVIA 1N77A 2DUMA 2F8MA 4BB0A 3IO5A 2VZLA 4AG5A 4OQDA 4E2YA 4DG9A 2F1IA 3UMJA 1XSEA 4ALLA 2Z57A 3W3AD 1WXGA 2BKLA 3OTIA 1GPBA 4GOMD 1ZXLA 3GP3A 3QNMA 4UTZA 2G5GX 3D1JA 2LR0A 4I46A 3WWPA 1THGA 3FVQA 4AMVA 1QX3A 4IHKA 1XMQB 3KVYA 2VYCA 4N65A 5KKNB 4QU0A 2P6MA 1ISGA 3A3OA 3H19A 3IDOA 1BYIA 1UBKS 4K9RA 1YR6A 4V3BA 2QYTA 2XYQA 4MGKR 5TQ0B 3C7DB 1YI1A 2XD9A 3HV0A 3K0HA 4TQ9A 3G9UA 4G5QA 3G0BA 3ZHYA 1T9CA 4HLCA 4HX2A 2WE8A 5E7JA 2XOKD 2EAUA 4HH4A 5JYBA 2FW0A 2J9YB 3D54D 4K9SA 3U3MA 4HX5A 2BW0A 1W87A 3FFBA 4QYXA 4UARA 4BLWA 3T5AA 4UEJA 1C3XA 1RHMA 1OWMA 1E89A 3ORSA 5KNDA 1OASA 3EAGA 3B3QA 2GPWA 2Q4EA 2RHRA 3H18A 3RYIB 5SICE 1AB5A 1LBTA 2REXB 1G7TA 2I6XA 1TO2E 4XOUA 3AR6A 1XVVA 4I7EA 1YCDA 2VHZA 4G85A 4L28A 4MS3A 4BZWA 1E0AA 2VDVE 3NP7A 2BFBA 4N7MA 4Q66C 4UM7A 2WUEA 2ZS9A 2X4DA 2Y9PB 3BREA 3WL4A 5LWQA 2RK3A 3AR4A 4LIPD 2GNAA 2PIDA 3TDKA 4INOA 2CJPA 3VH2A 4CQMB 2IODA 3NM6B 1YR1A 4GWGA 4NPHA 4MSUA 1KEEB 3B3AA 5K3FB 1DT3A 1Q1ZA 4KDCA 4LRSB 4DPMA 3LW7A 4L16A 5KOJA 4XVQA 2GBCA 5LP1A 2O8DA 3KLOA 1CP3A 3TE7A 3VX4A 4U7WA 3HYRA 2XZPA 1FYWA 4RH0A 1O6CA 5F98A 1SC4A 2OAP1 1TEXA 4P84A 2MWMA 1QIEA 3A2MA 3DZFA 3W77A 4CM3A 3UG7A 3R5TA 4P34A 3OOWA 3AVXA 5ES3A 1ONSA 1WD5A 4KO4S 3KQPA 5HS6A 1K3TA 1L7PA 4YMGA 3TUJC 4LKRA 1HMYA 4OHPA 3NFRA 4FUQA 4D97A 5FBHA 3DOIA 1RZRD 3DXYA 2NO5A 5DTIA 1A7JA 3VR4A 2X3YA 2DM6A 2IIBA 5AOAA 4REOA 2X40A 5T67A 2QDKA 4DGSA 3FETA 3V4LA 2HM7A 5EKDA 3V8PA 5J2UF 4CLRB 1CR0A 3OEHA 1B26A 3RC2A 1YS4A 1VTKA 4PZEA 4FE3A 2X5KO 3A4YA 2YDYA 2VFAA 4MDFA 4TTVA 3H9EO 3JQFC 2KBFA 5K6AC 1E0JA 4DWJA 2NU6A 3Q85A 4TYMA 3RIYA 3MK31 4IDAA 3WKAA 2FW1A 1JEEA 3L4BA 1N0WA 2XTZA 1YIOA 2ZSEA 3FZQA 5AESA 3DT9A 5BO5A 4CEHB 4JYZA 3UICA 3R3YA 4K9LA 5KC8A 3N2KA 2JI8A 4JC5A 3ZLBA 3OLWA 2C42A 2UZ3A 3SYNA 4R2IA 3ITDA 4ZJPA 2PZFA 5GM1A 4F7WA 3SM9A 3GLHE 4TVOA 2WWXA 2XWBF 3C7KA 1RRKA 2JLYA 3CJRA 1Q7GA 3AKZA 1JTFA 3EGCA 3PNBA 3JQAB 2Q3EA 2YTZA 4RQUA 4G8DA 3W6ZA 4C3VA 3KQKA 2VDWA 1H1LA 2FVYA 2Q0XA 3E61A 5I9LA 1QG2A 3PBKA 5LA6B 2AGVA 2I99A 4EABA 3TAXA 4L8VA 2ZJBA 2WU4A 3M5DA 4PZYA 1VYHA 2A58A 2D5CA 1P3Y1 5IN5A 4W5NA 5BYAA 1VJ0A 1H3NA 1R5OA 2SKCA 4AN1A 1U0LA 1A5ZA 3OC6A 2RBKA 4KR0A 4QLOA 4ROTA 2VJAA 1A9YA 2ODEA 3OUTA 4A0QA 5BOSA 1DARA 1BHQ1 2JIZA 4ZC1A 5LU8A 1EX7A 2Q62A 3S1SA 2Z2YA 1XRSB 3C3KA 1ZIPA 4G67A 1VCOA 2WG2A 4R5HA 4DSTA 1XF1A 1G18A 3H9GA 4YQYA 4D57A 2CF5A 3A6EA 3ZY5A 2YXBA 1Q21A 2H18A 3PQ4A 1SZPA 2XUQA 3TEJA 1YQQA 1SURA 2VHTA 4RD4A 3KWJA 1SWWA 3ZV7A 2FEMA 5A4MS 4YIHA 2EZTA 1J7JA 3QKSA 5F3WB 5CB0A 2PUJA 1QHXA 1G42A 3M34A 3FYDA 1XZEA 2YWRA 3LXXA 3E2MA 5EPEA 2WTEA 5FF9A 3OFND 4CLOA 3HCPA 3QMMA 3H9BA 2BEUB 3NXKA 3A3NA 3AB8A 3DOFA 3G5TA 3H8SA 3O9MA 2FP4A 4CXMA 1ZI9A 2IDMA 3VMMA 2WWHA 2B92A 2P27A 5IC6A 4GQAA 3REOA 1Y6RA 5BSKA 1X15A 1XK7A 5FWXB 3EARA 2IHTA 4G84A 1PR5A 2YW9A 4Y1FA 1MT3A 3KTFA 3HXTA 3JX9A 3M3DA 1VMEA 3IJ5A 1PL6A 3PPXA 3FWKA 1R4MA 3K9HA 3PC3A 3EVAA 1W6RA 1HDXA 4EDFA 3N58A 4QJ3A 1XAHA 3KZOA 2Y05A 4JL6A 4MWCA 2OE2A 4NIMA 4OQPA 3Q3GE 3U4GA 3FMPB 3WFIA 4C0LA 3X1DA 2MJLA 2VJMA 4O29A 3T54A 3PITA 1YHZA 1W1IA 3QK7A 5JD6A 5JD5A 3OTWA 3NCTA 5JEEA 2BH2A 3N75A 2FPSA 4HP8A 3EIUA 1SHLA 3GL9A 2VF5X 3HSYA 2B2XA 4WXHA 5CA0A 4D41A 1O95C 3V46A 4QWMA 4DA0A 4ZZIA 1XLUA 1Z0SA 3S70A 4IP0A 1K8XB 2IDKA 3IKTA 2WNHA 1V1JA 3O8OB 1PV2A 1VLMA 1GZSA 1YDMA 3ESZA 4EJ2A 4WCFB 3VC1A 1SN7A 1O5OA 2AQIA 1XZPA 2VDOB 1DWQA 3S2SA 4OCZA 1MD9A 1XNJA 2GM3A 4ARSA 4EQZA 3E8SA 1SUEA 4EB8A 3LCUA 3VU1A 5CAEA 4Y6SA 4B3MB 5IANA 3TTWA 2YYSA 1R27A 1ND6A 3ZDEA 4IXTA 3P2YA 4LDJA 4AJ1A 1T2FA 5BN5A 4PONA 1NE7A 4FR0A 3G1TA 1H85A 2ZAMA 3JWHA 4X63A 2R8ZA 4LMBA 2EX1A 1T8UA 1ZUIA 4QUKA 1XXHB 4QDZA 3EVDA 3W5IA 7MHTA 1E9DA 1HZZC 4D4KA 4UEKA 3D43A 1SC9A 2Y6VA 4BVAA 1R4NB 4DPLA 1RD4A 2HPAA 4NZOA 4KV9A 4RZIA 2ZCUA 2C7VA 1GRQA 1L3CA 1NOJA 2BI7A 4GLLA 4R54A 3WGVA 2Y67A 3U7HB 3QKRB 1BNCA 4MLPA 1E69A 1MLDA 4H7PA 3UJDA 3P9XA 1WY7A 2C7PA 5FO1A 3RFXA 1KAQA 1H2WA 4CKEB 2E4VA 2KLBA 3NV7A 2JGAA 1IWOA 1YRQA 1C3EA 1TJ3A 3C6BA 5EJ7A 1L4NA 3LXUX 2EWVA 3DMGA 3OPVA 4ZEMA 1W88B 2HA5A 5JYEA 1NYLA 3BEOA 4FFRA 4K6MA 4XQ9A 1YR7A 1UKEA 1XDGA 2H7CA 2ONZA 4J07A 3C3WA 4ARUA 4I8IA 2KWIA 2Q3JA 1D9XA 3VKWA 1QIGA 1V5FA 4ENUA 2MCFA 2DHQA 3DLPX 2WZCA 3QFRA 3QBTA 3PWKA 2JANA 1R64A 1LBIA 1A95A 2H1FA 3OFVA 1DAIA 4Z3OA 4B32A 3REGA 4HGRA 2ZJ6A 2ENWA 2X1LA 4FPXA 3X1KA 4GP7A 2I4TA 2H48A 4UD6A 3U3OA 5A4JA 4RD6A 1GUAA 2HNAA 3PFFA 4HEHA 4ZDIA 2IKSA 3LHSA 2PGJA 4MVJA 1DEAA 3HL0A 1Z8DA 2CD9A 4A6XA 2P75A 3G2JA 2COUA 3HXPA 5EPOA 5IC4A 4AKGA 2OYCA 3ONDA 4M0FA 4NL4H 1QYWA 4UHEA 3U49A 2AW3A 1ZJWA 2VHVA 3I64A 4QXOA 1FDWA 3TMAA 1ZK2A 1SCAA 3ZHUA 1GCOA 3U7QA 5ICGA 5HRUA 2RGNC 4KRXA 5EMLA 5GIOE 1BZYA 1AUXA 1JJ7A 2WPDD 3DVLA 1M5UA 5BYJA 2JEOA 4LXXA 4RQAA 1L5YA 3JQGA 3QTBA 3VO1A 5EIBC 5MFZA 2BGGA 4MYDA 1QIIA 1KWGA 4OI2A 4RHEA 2EARA 4WNIA 3KQNA 3U3ZA 5E1MA 1SULA 1RYNA 2IXGA 2IXTA 3GNLA 4P82A 3DT8A 3TUZC 2P0EA 1GZ6A 1XMVA 4G86A 1V26A 4EEKA 4IQ4A 4UEOA 1NM5C 1YIAA 1NQTA 1OWPA 2Q7OE 2O8FA 3GFQA 2R8BA 1TQDA 4QVKA 3NBMA 3QE3A 5EEGA 3RS3A 2ZS8A 5JJIA 1VHLA 2IK8A 2FN3A 4N40A 5LN1A 2DJ5A 1GEEA 3BL8A 3NUGA 4LYJA 1UAYA 2JIRA 2GZDA 3A1CA 1MAVA 4G9GA 5EE5B 3FFWA 4CDMA 2G76A 2NT3A 2L42A 5KSOA 1NONA 3L0CA 2P9ZA 1EX6A 1SXQA 2G77B 1P2FA 5EWLA 1P7PA 3OG9A 4YRGA 4YT8A 3QY0A 1Q15A 3GQBA 2FAXA 2J32A 4YHHB 4XR4A 2L82A 2ZBEA 3P20A 1E6UA 5E2AA 2ZWMA 3PSAA 1J0XO 4DWOA 1JLSA 2FP3A 3M82A 1VIVA 4YRMA 4H6PA 1ISSA 2FW8A 4NCIA 2J9XB 2AJLI 2B4YA 2K2WA 1PFQA 1T15A 2QP4A 5CFLA 1FMLA 1TJ4A 3UY4A 1J97A 3NVAA 1E3LA 2IYYA 3I1FA 2CCJA 4DLZA 1E60A 5KNBA 1RM5A 1C9EA 1K8YB 2E0IA 3TKYA 4CL3A 5ES4B 4CJXA 3A6DA 4B33A 3X2EA 2QXYA 1UODA 1E3IA 3Q3EA 4KQXA 2B1JA 5KSPA 2H2IA 3QXSA 1EP1B 1FQJA 3WLQA 2WAYA 3MWKA 3UHAA 3VYTB 4Q9JA 4GFDA 4HAVA 1TW3A 2ZW9A 1LDEA 1KI8A 4M6WB 3RG2A 3DSRA 4YFYA 5ECYA 3PLNA 6CHYA 4WMLA 3WJAA 3TI7A 3R5JA 4KXWA 4MUXA 4B31A 3M6LA 1EUCA 3OD5A 2HEIA 1W49A 3AJAA 4K6GA 4B46A 4HPJB 3VDQA 4ZQGA 1NQWA 1X77A 2Y3IA 4CCYA 4H31A 1JLMA 1WHSB 1UDXA 2GZ2A 8AT1A 2P5TB 2R1VB 1Q12A 1TM5E 3TZQA 1YACA 2C9OA 2BISA 3ADBA 2HMVA 1PLJA 3CFYA 2IZOA 4TXMA 1GL9B 3EQ9A 3TSYA 4W5TA 3MEQA 2PX4A 2G80A 3RV3A 1FPMA 1FYEA 4EPYA 3RIXA 3RNOA 1KBZA 1O95A 1E5QA 3GFFA 2I03A 3CWZA 1WR8A 2O0MA 3FFXA 2ZUTA 1R8YA 3HDJA 3NS7A 2MINA 1JNYA 4MAMA 5A04A 4AKHA 3T7AA 2A33A 1R10A 1G8HA 1L7OA 1Y8CA 2I2BA 3KHKA 3PD7A 5DK6A 4EPTA 1GPJA 1XX6A 1CCWA 1J5XA 3MGGA 2JFUA 2Z9CA 4MDYA 2GTPA 5G3YA 2PCJA 2AKYA 2ZP1A 3LDFA 3L8GA 4HOYA 2V0GA 2WIDA 1W85A 5EMHA 2BMVA 4GT1A 2GCIA 3GIDA 3PV0A 1AZSC 1MRZA 1LBEA 1CUAA 3AWIA 4NG5A 2V7BA 4NBWA 4BBZA 4F8YA 2CB9A 1WBDA 2Y27A 2VUTA 5FBLB 5LBTA 4AZTA 4JNKA 1MDBA 2O4UX 1GL3A 3GBSA 3ZNNA 1MAHA 1XPUA 3UT5B 1L7VC 4B3CA 1CZHA 1QK3A 2V0NA 3ZCUA 4W1QA 4I6GA 4QDKA 4AXXA 4JJAA 1PQ4A 3MUOA 4C5BA 1NVMB 5JPDA 3NVMB 3RLFA 1K2VN 1HDCA 5DRTA 4MCAA 5BW6B 3U4DA 3AL3A 2QAJA 4RPLA 1Y1LA 4O2AB 2GCOB 1KKUA 1AZLA 2F43B 3IAM1 3IODA 3DMNA 2C57A 3ISJA 4CG1A 5KHOC 1WCIB 4L8LA 2O8BA 3LZ6A 5DBEX 4BIMA 4HTFB 4J43A 1QVAA 4H15A 4DLNA 1FXWF 1ZIXA 4UDYX 1RTKA 1BEUB 3K8ZA 4RGYA 3OQ6A 3JQBA 4DCGA 3NIBA 3GJ0A 2GEDA 1CEEA 1EVEA 2ZKIA 3QPAA 5EPUA 2Z56A 1MIOA 2JARA 4QUAA 4EUHA 1HFKA 4NXMB 1QHHA 1Z7GA 1Y63A 4C4AA 2E55A 1LTQA 2QN1A 2OQRA 2B21A 221PA 3GZ4A 3Q3JB 5IKXA 4X95A 4OJMX 5GY7A 4XRRA 3HS3A 2VP6A 4FS3A 3RVSA 4GC9A 5IUKC 5ADWA 1R7RA 1S2OA 5BUZA 5LP6A 2A86A 4YJDA 1H22A 2QRKA 3ZE8A 2GBLA 2IYUA 4QQNA 4EI8A 2GO7A 5CJ2A 3VISA 3W1WA 2V9CA 1QHHB 4ENPA 4UXIA 2FZCA 3LUBA 5LIRA 4RSRA 1J56A 3KPYA 1B8NA 3SG0A 1IBSA 3L1KA 1VMKA 1TUGA 1M2VA 2O3SA 3X2SA 3ROZA 4GR9A 3ZC3A 1DDIA 3TQCA 1DBPA 3EAFA 1ZVMA 2IX3A 4OHOA 3HE3A 3U7RA 5IJ9A 5KPJA 1NLUA 1VBNA 3DQPA 1F6WA 4Y0NA 4W4TA 2QTBA 4IOMA 2GEBA 3NTXA 4FDLA 4O2BB 1M2WA 4BAGA 1HE2A 3MHPA 3MN1A 4I6JA 1M6VA 3HP4A 3ETCA 4BQSA 5KTNA 4ARZA 1WPRA 2VKTA 1OGYA 1EA5A 4QAJA 5FUBA 3TRIA 3K6JA 1Z5VA 4RHYA 1QAMA 1JSRA 3L4SO 4R71A 1SUIA 5A5VA 4CEIB 3ORQA 1P2GA 2FMXA 1J2TA 1G9SA 4JYBA 1S96A 3UB2A 3UWPA 4DRZA 1XMSA 2Q9UA 5AJHA 3LC2O 3LGXA 2XNJA 3OOYA 2R65A 1WZ2A 1N8NA 1TIPA 1KO4A 5DI9A 2HMAA 2VSYA 2XBMA 2H4YA 5DMXA 3ESAA 5KMGB 1J09A 1F8XA 1F1BA 3JAKB 2F9LA 2QR2A 3FOWA 2HNKA 1IHOA 1Y34E 2WPNA 4NCKA 3KLPX 2N42A 2P2YA 3FDXA 2IYFA 3G0IA 2JGNA 4P58A 3KT6A 4R2KA 2WHXA 4KQ2A 4H7FA 3RYFB 1PJBA 1KVUA 4LX8A 4QDUA 4FYJA 4OMUA 1CUXA 4KCGA 3GT7A 1NT4A 2E37A 1YR8A 5F73A 4G5FA 1QVZA 2C2YA 3I83A 4JV5B 1EIWA 3LOQA 3I0ZA 3V4VB 2VPZA 1BE1A 5I7SA 1R8JA 3CN9A 4C2AA 3ITEA 3Q7RA 2ZIUB 3QIVA 3UAOA 1IEVA 3OETA 4I9FA 1YAJA 3DV2A 3EA4A 2O06A 4LHWA 5AVQA 5DBIA 2A1IA 2WMNB 1OMOA 5LZ7A 5FOQA 1Z63A 3ET5A 4DB2A 3HKEB 1S4QA 5ALQA 1CZKA 4A92A 1MA0A 3AM4A 3IIEA 3WIBA 4B35A 2WM9B 1KSHA 2JHGA 1N25A 4IDDA 4BU0A 4EQ6B 1ZN9A 3KWLA 4WKGA 1F5NA 2GJ4A 5B57C 4CKWB 2A1TR 3IBSA 4AS3A 1JQKA 3H75A 1NPDA 3R6WA 3ZGXA 5FUMA 1K6JA 2QZJA 2ZAGA 3FF4A 2Z58A 1E94E 4NENB 2ERXA 3WLRA 4CQNA 3F8WA 3OUUA 4NECA 1EXDA 1U2DC 3Q1KA 4B9AA 4FHCA 5DOVA 4KOAA 2NUAA 3HYNA 3EOBI 3DTNA 1TFRA 4BO1A 2QWXA 3DG9A 1JQBA 5AVUA 2L19A 4Z4FA 1UBLS 1FBNA 3NJRA 1PU2A 2XITA 4LHYA 1DKQA 2XE6A 1FLAA 1PYGA 1TIKA 1V2GA 3W79A 1EWQA 1JR3A 1VYUA 4XUDA 2BEJA 4KXLA 4A0RA 4PFJA 1XXHA 4XD7A 2RAVA 2W6NA 4LXIA 3H3XA 3HVRA 1QRAA 2PD4A 1NP7A 5H1YA 1KE2A 4NFSA 4KREA 4BB9A 1QF7A 1I30A 4DDVA 1VGQA 5J4VA 2OORA 2WF5A 3IOBA 5G4KB 1LBHA 3RRXA 3QTTA 1L4MA 1UJ6A 4JJ6A 2E2WA 3RC9A 2ZRQA 3PPWA 2KI5A 2OGSA 1IEXA 3OZFA 3TR0A 2OCGA 2J3JA 3L0DA 4NK4A 1GAXA 4L5YA 2FZLA 2VBCA 4AZ0A 3WO1A 1Y1SA 2OMKA 3ZDCA 5AM5A 4UM9D 3DEJA 4Z0HO 1OH8A 1X87A 3K71B 1T5IA 2NAFA 3OQIA 1M2GA 4QSMA 4PZAA 3V4SA 3ZKAA 3GA7A 1WLSA 3GV0A 5AW2A 3QF4A 4RABA 1W36D 5KQSA 4OREX 4PZCA 1J20A 2GVNA 4JWKA 2CLMB 1EAMA 5I8WA 1ZUNA 2XNDA 2EL9A 3D4IA 2R5NA 4EO9A 4TQAA 2GJ9A 1NP3A 1QIFA 4N7BA 1Q1AA 4XGKA 5KBYA 4L4YA 4N18A 1PJCA 3UAWA 3GEIA 1J25A 3U3XA 1BMTA 2R25B 2O50A 1IM2A 4C29A 3KD3A 3TFOA 5BSVA 1QWOA 2H9YA 1OTHA 3IYLW 3BC1A 3P4UA 4HWGA 5AW7A 4KC0A 3J81k 1DHTA 5K0BA 4M1TA 1T26A 1YNOA 2G06A 3SPXA 1IE3A 2X3FA 3HCNA 4JCCA 3ZY4A 1WZNA 1ESDA 3OIVA 3STHA 3WAJA 1LS6A 2EQBA 4GMXA 3I9NA 1N32B 3HI6A 4WZAE 1NSYA 2XTNA 5EXSA 3P2JA 3PX2A 1S7CA 1IRIA 3RTBA 4ML3A 3U4QA 4YRZA 3L06A 5E9WA 3ZY2A 4MR9B 3UUEA 2ZR7A 1RKBA 4BU1A 1KU0A 1EDBA 1KJNA 1GO2A 4LC0A 3SVTA 1RLOA 4IQ0A 2VHWA 3PENA 3QJYA 5AJYA 3BN3A 1F20A 1U81A 3L18A 4NAHA 5IAKA 5CFNA 4QU5A 1GPNA 1KAOA 4UU0A 4OUDA 1VRCA 2YMLA 3LQFA 2Q5IA 2PEZA 2YJ4A 2OLJA 1PX2A 1UBNA 1X14A 2JI4A 4FVTA 1K08A 4MV4A 5DEIA 3KWMA 1U3WA 4BDTA 1E2PA 4BTEA 4L5AA 5LQUA 3SJUA 3WKBA 5J2UA 1BFDA 3O38A 2QQ5A 4HWRA 4LYDA 3WX0A 3OQPA 1A9TA 3ZDYB 1WV1A 2WYUA 2B83A 3AJEA 3INYA 4B79A 1GHTA 2GN0A 2BGJA 2QL9A 4QBHA 3U3KA 2AR9A 3OX3A 3MB5A 4F85A 3HGTA 1C30B 2WILA 5GJWC 3IQDB 3QVKA 1GLVA 4DZZA 3HADA 1GDTA 1H4VB 2VPYA 4IO1A 3OFJA 3PQEA 1SPBS 4MIYA 3D8NA 3E7PA 3I12A 5EJGA 2QTRA 3HLTA 4INPA 1DOZA 3FDIA 3N0VA 2RGUA 3UH1A 1X19A 1RJGA 4R2WA 3DL0A 2ZROA 1QOQB 2ZRCA 4UE3S 2K4MA 4JBYA 5D1NA 1GU1A 2ZANA 5HMLA 1HTTA 1YD7A 3KJNA 3ZBPA 1UBCA 2QN8A 4TTAA 1BHO1 3L7LA 3STTA 2H2FA 4YRLA 4W5JA 4BFZA 4MW6A 1G7SA 4OL9A 3OT1A 3DDSA 5FTWA 4DGQA 5C8DA 2XLBA 5TPWA 1KK3A 2G67A 1YRHA 3OJLA 1GRCA 4MVJD 2YXNA 4RKWA 4S1WA 3VH1A 4EL0A 1G5PA 1WCWA 2YN4A 3Q87B 1CK4A 3B6ZA 4D9HA 5AOBA 2WTNA 1ZR2A 1UBEA 3TLAA 4H6VA 2ORWA 2WJHA 4H3SA 1DAEA 3HCDA 1O4VA 1GNPA 4R1PA 2E4YA 5FNVF 3TFQA 3F5DA 5DNCA 2VXBA 1NJ2A 3CEHA 3ERCA 1SRQA 4XGRA 1MEOA 3ENZA 4QBTA 1AS3A 1KMIY 1PFUA 1X7DA 4CIYA 5KNCH 1R5JA 4ZTUB 1IONA 1I3CA 4TSFA 1P2VA 2AC7A 2LW7A 2WT8A 5A3VA 4DREA 3REFA 3MWDB 1YFJA 3QWIA 2IYZA 1SG0A 1Y3CE 1XGKA 2YFHA 4D43A 3DD1A 4IEEA 3NKFA 5ECGC 2VUHB 4BUJA 1OKKD 4YJ2A 4F5YA 4FFDA 3BCUA 3ND6A 4BNIA 2FE4A 3QU5A 5TPZD 1MIOB 2I2FA 3OKFA 4ONEA 4DQ0A 4EPXA 2LE0A 3E35A 2JK0A 3GJXC 1VXOA 4EZIA 3K32A 1IRXA 3LVFO 1PQYA 3PR2B 4IJVA 1YT5A 3I09A 2GH1A 2WTBA 1F60A 3U61B 1ZVQA 3CINA 3UT5A 2FWAA 3HCOA 4KQ6A 1T9ZA 2L0XA 2G9VA 3VNSA 1SFRA 3EGOA 1JAHA 3I6ZA 1AN9A 1NXXA 4KLAA 1P73A 3RF7A 4LTMA 5DLQC 4DRXB 3ZTYA 4F71A 5IXSA 5G1OA 3QE9Y 1HNZB 2OSVA 5BUSA 1NY5A 4NQZA 4F12A 1U9JA 4PLTA 2ONKA 4GSLA 4LXHA 3OQOA 3D1VA 3UGKA 4BGDA 3OBBA 4HRXA 1PW5A 2M6SA 4LY9A 3JASA 3NRJA 3I5XA 1W47A 5AM0A 2WG1A 5BWOA 2UZIR 1L6IA 2FR1A 4QBIA 1GUFA 2ID4A 2A1UB 4NBLA 4RXTA 1C0KA 3MOGA 2VJLA 3H1FA 2YCBA 4KLZA 4TXHA 1DCKA 1VJGA 2PUFA 4YAUA 1K63A 2HZBA 1TEVA 2QUIA 3BXOA 2NAPA 3ANTA 3DHYA 3NAMA 4H27A 4MQ4A 4WK2B 5DZSA 1YZ3A 2G8LA 3I9FA 5K51A 3RWOA 3TQFA 1PG0A 3WXBA 2OM2A 4YBZA 5CVVA 4B6GA 3CSSA 3DGEC 3W5BA 1GSHA 4CEJA 1QH8A 1XJ5A 2DPLA 5KX5B 3R3SA 4F2HA 2DHCA 3GJTA 3ZWKA 1I32A 3EEYA 4NDZA 1GRVA 2OUIA 4YT5A 4BBAA 3KDPA 4FYKA 4OQZA 4TT8A 3Q12A 2GNOA 4IXWA 2ZTSA 4GZMA 3IP5A 3LX4A 1Q5PA 1XTSA 1KZ6A 4R8VA 4G0QA 3I1YA 2BMAA 3HVUA 4IGEA 1NQUA 1YBVA 4PLWA 4LBVA 2VEDA 4LYFA 4CF3A 3FROA 2J7PA 2VK2A 2HU7A 1JHUA 3VU0A 2IGTA 4LISA 4DJ5X 1DIHA 1NDQA 1THMA 1LTKA 4KKXB 1VIDA 4I6EA 421PA 3ZY3A 3BWBA 2O0JA 2A9QA 2CXTA 2HA0A 1OROA 3IOEA 3U17A 1WQ4A 2GHTA 1BGXT 1YQEA 2QJRA 3RT1A 4GDFA 3ZN2A 3WLMA 1KETA 3KQQA 1MNAA 3BUSA 2PKEA 1M7BA 2F4NA 3H7AA 1A96A 1HYBA 3FUCA 5I7AA 2II6A 1RYFA 2JGDB 2HJRA 3NBUA 4Y1RB 5E2IA 2G72A 2P5SA 3KKZA 1WCXA 3PXXA 2OCXA 1I4EB 4LJ6A 4RIGA 1ZSYA 4KI0A 2LCQA 4BE9A 1N5DA 4ENVA 2QLTA 1N6NA 1JLRA 2Q07A 2FWNA 2FPXA 3CXRA 4G1UC 4K5QA 2IYPA 3HFJA 5EP2A 2RD2A 4IHAA 2FOIA 4BMOB 13PKA 1H0KA 4L50A 1MAWA 2P5UA 4EI9A 2LNDA 1ADYA 2YMQA 2XKAA 3MFYA 3OLXA 1M1XB 5DCWA 5L95A 2BHLA 4DHEA 3F1LA 4LJRA 5AP9A 4X1KB 1XZBA 2BKUA 5KYWB 2ECPA 1RPTA 4RK4A 4G5RA 3NRBA 1LS1A 4PRYA 3LXMA 1V4NA 3SJAA 4NABA 4XYBA 1Q0QA 4GBJA 1BRTA 2XVAA 2AIRA 1DRJA 2WSMA 2YCLA 5ALIA 1PL7A 1CZLA 1R88A 2VH1A 3WWOA 4V0RA 4HL6A 4P4SB 3WRWA 1N2EA 3E9EA 1LDYA 4QAQA 3U40A 5LP6F 1DRWA 4L8GA 3OTOB 3QA9A 1YUBA 3UHFA 1J9GA 1V3UA 2A7XA 2RBGA 2ZSUA 3ZI4A 1JHOA 2HQSA 3IXMA 2B0JA 5BWMA 1JTVA 2PE5A 3RHSA 4ALNA 3FUXA 2QLLA 4QBKA 3V1MA 3HRIA 5FL7D 3RJ5A 1SVLA 3C6MA 1GPLA 2FZGA 1ZBDA 2JG3A 1QE3A 1EK6A 3OFSA 3DWFA 4BS9A 3P2IA 1FK8A 5B55A 5HUHA 2H2HA 3Q9SA 4KFSA 2Q3HA 1OFTA 2EJWA 4WZZA 3KXDA 2OK7A 3OZCA 5CNMA 1N3YA 4I1UA 4ERNA 4RMHA 1FU8A 2D5BA 2BPOA 1VFNA 2A8YA 3R0JA 4DLBA 4CQMA 3DNMA 1QFJA 2AE2A 2QTHA 4R9NA 4KIGA 1L7DA 2D2FA 4GOND 1D04A 4CL8A 3I9V1 1R6UA 4EVSA 1MZPA 3DP9A 4BEBA 1XQ9A 4PFSA 4MVCA 2WIFA 3R0VA 4QXQA 1SRRA 4TMZA 4WD3A 5BOVA 5T8KA 5BR7A 1H1TA 1BJKA 1Q7EA 3KKEA 2G17A 4MMZB 4BZZA 1PVOA 1MPTA 1G9XA 1V3TA 2E82A 4E13A 3HMKA 3WIOA 2C2ZA 3OQHA 4EP1A 1A1SA 3NHRA 2DT8A 1PEYA 2GBFA 3SFZA 4PZ9A 3CRW1 4E21A 4J29A 4U7JA 3UHPA 1M33A 5CJPA 1P9OA 2WFLA 1W4LA 2CXXA 1GFZA 5ALTA 3JQEA 2OO7A 2FWPA 1MQ8B 2YXEA 1E4OA 1VC2A 1XT6A 3NWOA 4M0EA 4CCSA 4J0FA 2PS1A 5AM4A 1AU9A 3ADDA 4H1WA 3AEZA 3F78A 2CSXA 2HCRA 4QARA 3K09A 2WYVA 3IP8A 1K6EA 3ONVA 1XO1A 4L72A 1Z5GA 3DVAB 1E3SA 1JDBC 2FHSA 5K2MA 1FQWA 4KZPA 1R4ZA 1A71A 1NV8A 3PQ8A 5LPNA 1QNFA 1GXSB 5HK9A 5HKAA 3QU2A 3E70C 5B1IA 2W8BB 1DV2A 2ZRLA 1M5RA 3WOHA 1GNRA 1A5SB 2ZRGA 4WASA 1B74A 3CB4A 3ZDRA 2WKWA 3H8VA 2BFFB 4O8ZA 3JD3A 4DA4A 3NPAA 1FVXA 1G8KA 3FNHA 4WA7A 3QIAA 5KJFA 4KO2S 1RRFA 3MTQA 2Z8YA 2OR3A 3RC8A 2RK4A 2X8LA 3EN0A 4UTRA 3OJWA 1MTOA 1HRKA 2YS6A 2YH2A 2ZQYA 3MMZA 3OCUA 4KQIA 4M0CA 4RKEA 2ISSD 3Q8KA 1AVTA 2FZEA 4HVTA 5ALOA 2JJQA 3WHIA 2PZ8A 4DUZB 2VTDA 1EGHA 1SM4A 1NN0A 2DSNA 2K6GA 1I8TA 1P0QA 2PZKA 3H5VA 4PFKA 5J1TB 3EBPA 3UA3A 2H06A 5TVGA 4C87A 4RV9A 1LU9A 5LVAA 1BXGB 1T5OA 3TRKA 4R1LA 2H1HA 4ZU1X 4FDVA 1U0GA 3GROA 5CDUA 2BY4A 5ALYA 3IE0A 9LDTA 1OGJA 1XCBA 3DDZX 3JALB 1V6CA 3KQLA 2QM0A 1E64A 1NRJB 1YF3A 2D59A 2W00A 3N87A 1GL6A 2P2DA 2Z6VA 4HDQB 4GPTA 2VPTA 4QASA 3ONWA 5F1OA 5BRNA 3HM2A 2ZRBA 4KQWA 1JU4A 4TWRA 1P5FA 4RHCA 5EP3A 2PQMA 2OHOA 2AX4A 3W6NA 4B8WA 2HJVA 1YULA 2Y1WA 2JFOA 3B51X 1VLVA 2PKXA 2I6FA 2ZE7A 4JYMA 5IWAB 2R1TA 521PA 3F6YA 1HDGO 3INGA 3OOSA 4FWBA 1Z06A 4X8MA 3O21A 2XDAA 2IXFA 3O95A 2XUFA 2PT7A 4ANFA 4RA9B 4FXOA 5LMZA 1A9XA 3KV1A 2FWRA 1UH5A 1Y4SA 4G07A 1YJXA 2RBEA 4EHDA 5JT1A 2FP4B 1P4JA 2B98A 2FFAA 1P61B 1Z7BA 3E18A 3LYLA 4FD3A 4Y2TA 3RHZA 1MOZA 3MJDA 2FX5A 4A03A 1DIAA 3ZH9B 4HVAA 4XGQA 5TMPA 3DVQX 4WERA 5TNXA 3TPZA 2D6FA 4RD2A 5JS2A 2AMYA 2Z30A 4RC9A 5M04A 5GZ3A 1RMQA 2BI8A 3BD8A 2RFLA 1XD2B 2AR0A 3C85A 3MG9A 4EDHA 1QU3A 4HAXA 2KM1A 4K9NA 4W82A 1GGMA 2IE0A 3DH0A 4W9NA 1QM5A 1X1CA 3SAJA 4HDMB 1E1CB 1BKSB 1YSCA 3A58B 4DLAA 1QLJA 4ER3A 2LKCA 4PGFA 3ZQKA 2Z1DA 4XVRA 1R5NA 1FRQA 3AUKA 4PYKA 5SV2A 4CIWA 1I0LA 1QK5A 4J0KA 4W5WA 1T6YA 4EB6A 1A9SA 3QELB 4EUSA 1TLFA 3H6GA 3PF9A 3TLGA 3DCNA 3TOVA 3C8MA 4CM4A 2PUVA 3I1IA 3M5WA 5JUWA 4B76A 1JPVA 3N0WA 1XNRB 1FMCA 5BUCA 3GGJA 2Q28A 1Y4DE 3EGWA 1UADA 4DMMA 2ES4A 4JVOA 2LZ0A 1NVKA 1OREA 4EA8A 3L0PA 4JP5A 2V7QA 4YMVA 1W0KD 2P3OA 2Y92A 3D4BA 1DLIA 3AF3A 3I8XA 1ESCA 2YJTD 3COWA 3I92A 4YCDA 1P31A 2DHDA 4RZXA 2C4NA 1PHPA 3C8UA 4BP9A 3AF0A 5G0SA 1XLWA 4BFVA 1IPEA 1Y7TA 2FMKA 1DKNA 4URYR 1OI2A 4JLKA 2HBRA 3JD0A 4JHXA 3RAFC 2DECA 1XZKA 2AG6A 3EH1A 3O90A 1M7HA 3IMEA 4Q7MB 3FRHA 5DIFA 3W5VA 2YHIA 1F2TB 2VHUA 5TS2A 3PQ7A 1VJTA 1G8SA 1YB2A 2NSHA 5KNBD 4HQRA 4X93A 2R84A 4JKOA 4LVNA 4QSHA 3X2FA 4Y2XA 2OZPA 2RARA 1CR2A 2FR0A 1AKNA 2YWDA 3CR7A 1OH6A 4IMPA 1R4MB 1TOAA 2X9NA 2UVDA 5MN4A 5HJ5A 1W7AA 5NULA 2PQ0A 4K0KB 4EHAA 3LF2A 5E8RA 4PWYA 4H9GA 3HFGA 2RHMA 2GHIA 1PR3A 4ETMA 3SIWA 1NRXA 3W3ZB 4YEDA 5FHRA 3TG2A 4RPHA 3WLOA 3RKRA 4DNPA 4MGEA 1C29B 4BEJA 1KOJA 1TUBA 1U1EA 4OHCA 3RYCB 2ZBPA 2O1SA 3THWA 5BPHA 3MQ4A 1KJJA 3ZJUA 1KMQA 2VYND 3BFJA 4L73A 2EHJA 4KACA 4DWWA 4J16C 4LCEA 3AYXB 2VNSA 3SIXA 3L4KA 2HWUA 3UJAA 1FFDA 1UK7A 2Z4RA 4NFYA 3T7TA 3DP7A 3K2QA 3UK0A 4DCTA 3O1IC 4JJEA 1UFKA 4P83A 2BRUA 1I1QB 1K5PA 1N1MA 4R1TA 5KYVA 5AKHA 1RQGA 1ISFA 5FI0B 3DXFA 4B6OA 1QYRA 3ZCQA 2ZYTX 4IJMA 1Q0PA 2QRQA 3A6KA 4IR7A 1E6LA 2FRDA 3IJRA 4JKYA 4EAQA 4XWWA 2W6IA 3CUSA 2I6SA 4M55A 4B4KA 1W4AA 2ILTA 1VB5A 4Y8VA 4BFUA 4BO5A 3GLFA 4BVFA 4MDEA 2FQYA 3IT2A 2G70A 1ZESA 2BR5A 3H86A 1TGVA 4BQRA 4DV5B 1AG9A 1KI6B 3ZWAA 3O2QB 2BFEA 3HCRA 2VZ8A 4YO8A 3UWKA 4R9VA 2EGUA 2EVWX 2I33A 3KQMA 4PS0A 3HCBA 3FNEA 4B4OA 3FTDA 1FC0A 2EJTA 3V00A 3E1KA 4JLNA 5HGXA 2CEKA 1OXBB 5I51A 2HWWA 2B5OA 1UINA 5K03A 1GG2A 1QRRA 1PT5A 2J30A 4QTUB 4EELA 3RW9A 4HCJA 5IJ9B 1QP4A 1UAAA 3NVDA 1PTJA 4ZEOA 1Z3IX 4NJEB 1RLUA 3V7FA 3T4PA 1J00A 4DQVA 3ZQ6A 1YC5A 4HH0A 1N5JA 5EHIA 1LY1A 2FDXA 3V97A 2PSFA 2Q99A 2W2XA 3MNFA 4UQLA 1IM5A 2B4KA 1F06A 3ZE2B 4AF6A 2HBQA 1ZCBA 1JFRA 3ACDA 4DR5B 5B3LA 1H0SA 3JWIA 5DBOA 5FBRB 3QYJA 4DLUA 4P4TA 3FOEC 2PA0A 4AJLA 1C1XA 1B6TA 1UFVA 1FPQA 1V41E 2VF4X 3C3YA 3F6PA 4AJ9A 1W4ZA 2JGRA 3EH2A 4N0PA 4LFCB 4ETWA 3AWDA 4JT4A 4WKPA 1K0UA 4UAGA 4V0LA 5BSHA 1O2DA 2PIAA 3E9MA 5EKTA 3V7UA 1USKA 5GOTA 3ZS8A 4DDMA 4BGVA 4US2R 4D56A 3UPDA 1AT1A 1X38A 2FV8A 4U7DA 3QUAA 3CUWA 5I9BA 3I42A 3TD2A 4P5DA 4W6QA 5D00A 3TTUA 1RAAA 4MB2A 4WNAA 2P9YA 2JHAA 1AMNA 3VYWA 3TQRA 2PWBA 4EMUA 1PSDA 5HKKD 3LWDA 2VRCD 1V11A 4IINA 2GF9A 2J0SA 4BNXA 2J46A 4JT8A 4E5VA 1YZYA 1QFSA 4CODB 4YJ3A 1EGAA 4J91A 4BLOA 1DZ3A 3Q1LA 4W8OA 3PVSA 1JJIA 2OHJA 2JAHA 3WMGA 3T0IA 3JQDA 2V7GA 1UPFA 2B78A 1NNLA 2UVPB 3OP4A 2VRCA 2C98A 4J76A 4M1OA 1OVGA 4CG2A 1I2BA 2V3VA 4FLMA 4LNUB 4TTIA 4ZI5A 1A9QA 3CRRA 3S40A 4D82A 4A6EA 1NC1A 3RROA 1PGJA 4BMXA 5IZCA 4MUNA 4JBLA 2D2XA 2LDXA 3T5TA 3UMVA 5P8WA 4FONA 1ML3A 1N2CE 3G8YA 4BMYA 1J8VA 4ENQA 3B53X 2C5HA 4IOKA 2IY7A 4RACA 3O9VA 3V4OA 4ZGGA 1G8GA 3OLVA 3ZZTA 1ENPA 1WQ1R 2VRWA 2JJ8A 1Z75A 1JWLA 2C4UA 2PA3A 4LGVA 4ND8B 1FIUA 4KVGA 3R6DA 1N6HA 2QAGB 3BILA 4Y0AA 5FP0A 3VGPA 1QC5A 5DCYA 2CXQA 2IEBA 3OHSX 3LY5A 1ABBA 2DLCX 5B6PA 1KQOA 1W9HA 4I0WB 4PIPA 4IDCA 3JYNA 3IUNA 1MABA 3LL4A 4M2LA 2XUHA 1XXLA 4N49A 4OL0A 5GPBA 1VL1A 1Q6ZA 2DLNA 3EAQA 2VDKB 3QKUA 5B1EA 4A2WA 2Z0MA 1TTQB 2JNWA 5FI3A 5C5IA 4IZ6A 5TV2A 3OLQA 3ZLJA 2XVZA 3AB3A 2QU7A 4OU5A 5AKIA 2GAJA 1N2ZA 2C7GA 1P2DA 1W5BA 2H1IA 2XTJA 3AHGA 3DCYA 2CLSA 3W90A 3WNVA 4Z7QB 1WZEA 5AVYA 1WKCA 2Z8XA 3CHYA 3NLLA 2OBYA 4HDKA 4DG5A 4MUMA 3BD7A 1NHWA 3PCXA 3DLHA 2E49A 4B4DA 4BNUA 3QLVA 4X5OA 4G23A 9GPBA 4R01A 1IU9A 5FBKA 1UMBA 1UFQA 1QMGA 2HKIA 5EXXA 4HUQA 4N9WA 1MB4A 3PRYA 4CKYA 3WADA 2PUAA 1OI3A 3VUEA 1XWFA 2BHRA 3GLRA 3LYUA 1USGA 3UJ9A 1L7XA 2D1FA 1Z08A 3VJLA 1XWWA 2O9JA 4R6WA 5HSGA 5IK2A 2NU7B 3V9PA 3A2NA 5COAA 1H8HD 1ZU5A 5EYPA 4DILA 1JVNA 2P2GA 4ZMRA 3T9CA 1GZ3A 3DAYA 4HEJA 4K05A 4Q1CA 4Z7NB 3ZHOA 5LD2B 2PJRA 3JRNA 2I4IA 1RE0A 4BVJA 1XD9A 5JAQA 2RAPA 4E14A 4WADA 4K0RA 1KC1A 1U4SA 3NUQA 4P0TA 3ACCA 3IEKA 4RK0A 2A67A 4ZO4A 3S2GA 1EK2A 3ZZ0A 4BNHA 8ATCA 2IW3A 3H0EA 3K5PA 1KZYC 1NE2A 4YMLA 1JB9A 3WKEA 4CU2A 1WXDA 1KYXA 4PHFA 2AF3C 3BK2A 3WB2A 2CVHA 2PFKA 3DMPA 1ZAKA 1IJKA 3AUTA 1EDOA 3AVQA 3I04A 4RJ2A 4ZVUA 5HTKA 4TMYA 1M8PA 2XCOA 3SXPA 1KBQA 1RT9A 1HYEA 3MGCA 2OCAA 4L02A 4MRNA 3SIRA 4CI0B 4HEQA 3WLKX 5LQDA 2I22A 3A3KA 3T7IA 1GQOA 1NMQA 1S2DA 1CUZA 2DT5A 1Y7IA 2NYVA 4FT2A 1JAXA 3GMDA 1QGDA 4YACA 4M9CA 3LVBA 4QYIB 5C5CA 3AKYA 1UZNA 1YQUA 2FX3A 1UPAA 2WNIA 4FE4A 1GADO 5H70A 3UAGA 1K7XB 2Z3WA 1JALA 1XZFA 1DBWA 2P6OA 2VJYA 3CNBA 5K3AA 4DMFA 4GKBA 1RYBA 3D8UA 1CW2B 1BN7A 3G0DA 4HGNA 3HYLA 2JFZA 3C3DA 1N2OA 5B53A 3WDKA 1AQLA 1W59A 4MW4A 4TYNA 1E1CA 4LPKA 3U31A 3K9FC 3ER8A 1YOVA 2KJQA 5CVEA 2KSQA 1U0SY 3IAS1 4FLEA 2C58A 1H5UA 1SIWA 2NQ8A 3PGXA 4O08A 5DYTA 1KH2A 3ABQB 3H2BA 2PBFA 3LWBA 3VU9A 3WO0A 1YJAA 2HU5A 1PZMA 1MHPA 1UMDB 2BUBA 2J1LA 1RI2A 2NNLD 3G6WA 4U00A 3EPJA 1FP4B 5K3DA 3U60B 1SHTX 4JLUA 1NSTA 1IXYA 2X2OA 3CH4B 1E6MA 2OENG 1U5BA 1IVSA 4Q3AA 3VSBA 5C1PA 3W5HA 1IQRA 1HT0A 2JA1A 5T4BA 4ENRA 3MXTA 4NH0A 2VAVA 2Q3DA 1FSSA 2XB9A 4Y2RA 3S29A 4MR8A 3WMFA 4DIOA 2RB4A 1NKSA 3VR4D 1GPH1 4V2UA 4KN5A 1XFAA 2X3UA 3PDIB 4J3NA 3SF8A 3ETDA 4AUMA 4RZUA 2WU8A 3ETEA 1B6RA 3H1EA 2QK4A 4NMXB 1DPFA 1HX7A 1FX0A 2ZZMA 1Y3BE 3GG9A 1XDZA 4CFSA 4EG5A 1GNTA 5BSWA 2KW5A 2QEQA 4KR7A 2FPPA 3K7EA 4INAA 1U1DA 2B30A 2QTFA 2Q29A 4EGJA 1GVHA 2JZCA 5IJZA 1A4IA 5IM4A 1MJHA 2J5XA 2BWJA 1XRQA 1ZD2P 1G1MA 1O1YA 1EVQA 1FFXA 4EATA 4DCOA 1U1CA 4POOA 3E0QA 5AOVA 4WOBA 4NWIA 5SZJA 4YLEA 4E07A 4ZDWA 4CM8A 3ZJYA 2A88A 4QGFA 3GMTA 2DG2A 4IFTA 4L0MA 1XAGA 1ZD5A 2G88A 2QL7A 3QKWA 3O84A 5EAIA 1DQSA 4J0EA 2CSUA 2AEFA 3DPIA 3OKPA 4WESB 2OPHA 3WTBA 1Z4LA 1NM5A 3ZGLA 3DDHA 1AUQA 2K87A 5THQA 2V6FA 5CB4A 1OI7A 1V4BA 3GJQA 5JCXA 3CT6A 4J6FA 1TI7A 3KQYA 2JIZD 4H60A 5I9SA 2DMRA 1YA4A 3U9TA 1E3TA 1KQ3A 1ODFA 2NP7A 3WLLA 3IIJA 3OVMA 3PA8A 5JPIA 2HY7A 2Q49A 2J3MA 3H0CA 4HPXB 1EM6A 5DTJA 3T3MB 2IUUA 5AI5A 1PR6A 3E8XA 4E11A 1UXIA 4NYMQ 1F4LA 4EWLA 2NVWA 3VZRA 4RTMA 2GVDC 1G20A 3TZBA 4DV6B 2FPWA 3MWGA 4UBIA 3B78A 1ODIA 2CJWA 1U6JA 1VIMA 2CJXA 1QAQA 2C3UA 2H1RA 3Q7PA 4FBLA 4KODA 5CVDA 3O3MB 3GFOA 2ZWOA 4QQ8A 3WYGA 3L49A 4U7FA 4FOLA 1W0KA 4Y9TA 4D4LA 2O2HA 2CDNA 2AJTA 1SU7A 4XSGA 5IH3A 4RTPA 2V8OA 1MO3A 1W1WA 1W35A 1MJGM 5HE8A 2ODBA 4FFLA 4J16A 5FOUA 2Q8NA 4P81A 2E89A 3UT6A 1V1RB 3AF5A 3F6RA 2YUIA 2R6AA 3OCWA 1AKYA 4BJ3A 1Z5OA 5D5HA 1GGKA 5A4AA 3G9QA 2PWYA 4FIZA 1HUQA 2H1LA 1LC0A 2XADA 4EBBA 1HNNA 3L7DA 3LLCA 4OHXA 4JT9A 4LFAB 3UB3A 2RJ3A 3Q3VA 2I2AA 1P62B 2YDXA 5B58T 4OM8A 3EWAA 5CIQA 1KWKA 4Q21A 5A1JA 3QVMA 3P9YA 4L4UA 5U4XA 1EVKA 3IL2A 2WM3A 3KKPA 2MTBA 3B6MA 4XB2A 1QQ6A 2XSZD 4M7PA 4PGAA 1GNVA 1B0UA 2VQSA 4R8RA 4NATA 1G7RA 3KEOA 1NBAA 4U3JB 2QTLA 1N1GA 3L6BA 2A57A 4G1MB 3O3CA 3Q6NA 3TPCA 1N78A 1E9VA 3KBOA 3I3SR 4IJWA 5DI3B 2P9QA 3B3FA 5JDIC 1A7KA 5IC5A 2GLXA 2OAEA 2X9GA 4JR2A 2PGIA 3D6FA 5C31A 3JQCA 4F38A 2YR0A 5AI4A 1ZBQA 3SOZA 2ZJ1A 4KPEC 4X9XA 2Q9CA 3IP9A 1KOLA 4OPMA 2XQKA 2FSVA 3FMFA 1IY9A 3H05A 3B12A 2UUPA 3OLYA 3TW4A 3PNSA 5CVJA 4DYDA 3SR3A 5DNEA 2R6FA 2VF2A 3OSUA 1GOTA 3D8HA 4OLBA 1ZN7A 2HCBA 4RF2A 1Y5NA 2Q1UA 3FKSD 3MXOA 1SCKA 3AZPA 5KYXA 4WKOA 3UJNA 1P2UA 5J3JA 2CZGA 2HX1A 1Q7CA 2NYRA 3CLSD 3KEFA 5LDDC 2IXDA 3AEXA 4Q7LA 3EQ6A 1PFWA 1GGNA 5DNAA 1QUEA 2ACEA 4RSMA 1CUDA 2PT6A 1QOPB 1PTKA 2NMVA 2B20A 1G5HA 1NURA 3A36A 1M34A 3IEIA 1OFGA 4ADSG 2R8XA 1C0IA 3DAHA 4DLTA 2FY8A 1FEZA 3ABRB 4I3FA 4XDGA 3K0AA 4KNWA 4DDWA 2GAFA 1PZEA 3LT2A 1N5RA 2NTVA 4ZT4A 5LDGA 4GOJA 3TQSA 4ZVPA 2FUG6 3EOZA 4GMGA 4LXQA 1EESA 2ENUA 2P9GA 3PNQA 1I9GA 2NXNA 1OZHA 2VOJA 3KAQA 4WNYA 1V0JA 3C97A 3X0DA 1BXRA 2R6DA 4O3FA 2VSXA 2Y76A 1AHHA 2YWXA 5JS8A 4MUHA 4RDIA 3UWSA 5DNWA 2XODA 1DAMA 2BGTA 3DV0B 3MPOA 4B73A 2C9MA 4MPTA 4NJMA 4EFLA 3EPLA 3AJRA 4TTTS 1IN5A 1UIRA 4E22A 1II0A 2DBRA 5AKJA 2EX4A 3BRCA 3IHTA 3RSGA 3U2QA 4G81A 5H3CA 3LGAA 5TQ2A 5I4IA 3HNRA 2EIHA 4KE8A 5L8VA 1ESZA 1FUUA 4QICA 1JXMA 2M32A 2WM2A 2PH3A 5JI3E 1YQWA 2IHKA 2CY0A 1GNQA 2FSUA 3ZE6A 5LUAA 4MV7A 1KQNA 2P3QA 4ZOCA 3RBZA 3OU6A 2B34A 4MJLA 3RUCA 5EZ6B 5B3JC 4BMZA 4PR0A 2RMKA 1HNWB 2W90A 5E9AA 3VPHA 1Q19A 4UM5A 4ZCQA 4E4RA 4QT4A 3ZDFA 1E2HA 2WC1A 1U11A 3QHAA 5KQLA 4MNTA 4HB4A 4W5RA 1Y5RA 5DLPA 2BHNA 3SS9X 3V2IA 4YDSA 1GTZA 1C14A 1CVLA 2WWYA 1TUIA 1UXGA 3EMVA 5CK5A 1XVIA 1ZS9A 1P1FA 1D9ZA 2CHFA 4PZPA 3EZLA 1NYTA 3SK0A 4OJKA 4QYWA 1TZMA 1L4BA 1P9WA 2ZJ5A 3SQOA 3WNDA 1TM4E 2F67A 1BDJA 3VSDA 2VJBA 5JWOA 2EZ8A 2CDRA 3OZAA 1JJBA 2XT6A 4PGMA 4RCYA 3LSYA 4L5BA 1N75A 1VL2A 3PS9A 1DJPA 1H94A 4AMZA 4ED9A 3EIWA 1M73E 3RWBA 5EJ8A 3SBXA 5HYVA 1OXMA 2ZI3A 1OPRA 4ZI2A 3ZI0A 3RAEC 4PAOA 3QOWA 4JMLA 2IF0A 4TSFD 2DHRA 2PXCA 1ZQ1A 5GP1A 4HT3B 1VZ2A 3HBAA 4J2OA 4JVSB 3G59A 4X1YA 4FC7A 3ZU4A 4Y3UA 3ESDA 3TINA 4WI1A 2Q1WA 3PHLA 4ARAA 4BRSA 4C0QC 4FHDA 3WMWA 2HMUA 2XMQA 2CEAA 2VWGA 1P19A 4HLQB 3SC2B 2WSSA 1F0PA 1T2EA 3GAFA 2PKRA 3P1JA 4M1KA 2ZB7A 5EN4A 2H4HA 5FA6A 3TBFA 4DEXA 4XYLA 1LPNA 2PRZA 2BUCA 2AHOA 3B6EA 4QYIA 2OG2A 4DMGA 1X1SA 1C4KA 1EZ1A 2M6RA 3FBWA 1WB9A 2J0EA 3F7OA 1QQBA 1C1DA 2B94A 3HKCB 4JLMA 3CVUA 4RO0A 1SKUA 2J7PD 1NLFA 3CLTD 4IMJB 4JJFA 2JJYA 4YHBA 4HAIA 3JARB 2PXAA 2XXBA 1HE1C 4HWTA 1H69A 4MRMA 3WZ2A 1YVUA 4DJJA 5DGHA 4DG8A 1S7GA 4PCAA 1OX5A 2FQ1A 3PQCA 2CVFA 2HYDA 3RM3A 1QRSA 1BKDR 3N6VA 2FCAA 2VT2A 3E5RA 4X65B 1KVTA 3AV3A 3H2SA 1JQJC 2BF7A 3R0IA 3D59A 3QEJA 2VRNA 3I6YA 4TS4A 1KIAA 3HNOA 1U1FA 2VNJA 3H5NA 3SIPA 2QRPA 3HXOA 3BGVA 4YRCA 3ORYA 2ARKA 2TRSB 3P52A 1FFEA 4TYYA 2XCTB 1N57A 4FEAA 3RUDA 3W8DA 1K66A 1CRPA 5EZYB 2OFFA 4EKDA 5CUQA 2Y1OA 3ABIA 1SMKA 1OXKB 2QMEA 5H83A 3O1HB 3V6MA 3HKEA 2PMBA 3F6CA 1BVYF 3O3OB 2Z98A 4FR2A 5JD3A 1SQFA 1B73A 3C3XA 3NATA 5TMEA 3X1WA 1QP7A 3LJKA 3T41A 1LLCA 2A94A 2D2IA 1RAHA 3Q2IA 3EWIA 4HK4A 4QHSA 4QQKA 1P9NA 1Q20A 1I33A 5FTJA 1Z6XA 1U0FA 2O2GA 4F4FA 4YTEA 4PLGA 1P0PA 1IOVA 4RMGA 3TJMA 1VG8A 3C5WP 4BQQA 3DBRA 2W6ID 2OLKA 1NAIA 2AVNA 1EWKA 4M9SA 4UEWA 3HUFA 2W2LA 2PYDA 3UXEA 4OJYA 4F4CA 2V7EA 4H7IA 4DSZA 1GG5A 1U8EA 5M34A 1Y8RB 5F5XA 1I4LD 3TW8B 5C8YB 2ZYRA 5CM9C 3QQPA 3UMYA 1S2IA 4X7RA 1M74A 4P53A 1CUVA 5ALUA 2IF2A 2HRQA 1NBMA 3C6KA 3KO8A 5DP2A 4IKOA 1U8XX 3D81A 1R0WA 4P86A 1Y80A 3PFHA 2MIIA 1ZD8A 4UZEA 4RA6A 4WQMA 1JIJA 4R68A 9MHTA 4XEUA 2BYTA 1XG5A 2FJUA 4YBRA 2X2PA 2WT4A 3LC7O 4YRAA 2Q9BA 2P1DA 1KQFA 2EKPA 4INZA 4KG7A 1LCIA 2GZ1A 2IITA 2W11A 3OQJA 2ZPUA 1TKBA 3GBPA 3NTOA 5KJEA 3SLRA 3OCYA 1NQ5A 1NDUA 3H2YA 3NPMA 3P2MA 3BIFA 4LNUA 1DCFA 1NYQA 3LT0A 5HIIA 3RG8A 4A6PA 4F72A 2GETA 1SUCA 2DQSA 1Q14A 4QEDA 3TZCA 4C89A 4Q3DA 1J5PA 1FP1D 1KDRA 1IDOA 1KY5A 1RHQA 2RI0A 2XGSA 5AKEA 3CX4A 2AG5A 3G0OA 4GRDA 2JW5A 4Z4CA 5I7HA 3CCBA 1V6SA 1Z83A 5BN5B 2H3HA 2JJ1A 3SMQA 5KNBH 4MKGA 5B1HA 3BK1A 5E6UB 5J4LA 3I62A 2ISCA 4Z99A 3V80A 2JH8A 1DUVG 1UZUA 4OQMA 1CUFA 2BM8A 3DR3A 3O6VA 3K16A 3CNLA 2HA2A 3QI2A 4GMHA 4O4IA 5I5GA 4AJ4A 5HZKA 1Q11A 2YRFA 3ZIAA 3M6MD 5KEIA 1BROA 1F2UA 2DFPA 4QQFA 4UVEA 3HRKA 2AZMA 4DCVA 1RNLA 4BRZA 1Q0SA 2HEGA 3GG2A 1T1JA 4YJHB 3AHIA 5T4HA 5KTPA 2YVAA 1VFPA 3VKUA 2Q2OA 5REQB 4JQYA 1ULUA 2OUKA 3PNYA 4UKDA 1I4DD 3MMXA 1C3JA 1ULAA 4DMLA 4IKEA 3FCUB 3ECSA 3L46A 3VZDA 1JX6A 1TEHA 1IG0A 1VCNA 5L7YA 3OICA 2JGKA 1QXSA 3HY4A 4RVFA 4R3NA 3BF7A 3UQYS 2GPYA 4N5HX 1W4BA 3COSA 5FPTA 3RVJA 2MT9A 2GM9A 3URKA 2A3NA 3JY6A 4OHMA 2ZKLA 2DY0A 4HDNB 1K7YA 4R40A 3WKDA 4BKOA 1U7WA 2WD9A 4OU4A 3T61A 5A02A 1VL0A 3CEAA 3BWXA 4AMGA 5HM6A 3UAVA 5JCJD 2GBGA 3DWGA 4AKEA 1JFSA 1HT1E 1RJEA 2ZAIA 4C7OA 5LQSA 1TJNA 2W98A 1MU0A 3EXHC 3GJ7A 4PLZA 4BUZA 5IEJA 5GONB 3V8NA 1YVRA 1JPNA 4COOA 3N70A 3FPSA 1SG6A 1U0OC 2ZAOA 3O8QB 4KDEA 1MV8A 1QYVA 4PYOA 5J40A 5JH7A 2JHCA 3CZ5A 3T9EA 5CXXA 3GW8A 3EWNA 1E2DA 3MC1A 4FN5A 2QUKA 4J6EA 1MXHA 2QQGA 4E6EA 5J47A 3O5AA 5TMBA 4WOPA 2RKOA 4BVKA 2VAWA 2BGLA 1CP2A 3SNKA 3BH0A 3ZEAA 3C7AA 3VHRA 4E2ZA 2MYUA 2FPKA 4N5DA 1KGDA 1RQ7A 2J85A 4JJ8A 2LBPA 4ROSA 1D1TA 4B2YA 4D5GA 2EFYA 3BMNB 4PYMA 4BLQA 3VNBA 1W1UA 5LJLA 1ZD1A 2O8CB 1CETA 2MSEB 4BPRA 4Q34A 3AF2A 2ZT8A 1YS2X 3AESB 2FWIA 1AV7A 3WHPA 5KOYA 3CURA 2QRLA 2XYVA 3GOQA 1EDZA 3EUWA 1KO8A 3NT5A 1E1QA 2JI6A 2W83A 2Z8ZA 5E3IA 1F8FA 2YVQA 4ZMBA 1ORTA 2O0KA 4A5SA 4X8LA 1CUEA 4EM6A 1Z4KA 1V71A 2JRLA 3KFXA 4E33A 1XV5A 2W2PA 5HCUA 2VXCA 2RJNA 5HS4A 1IBCA 1X8LA 2I4MA 1ZSVA 1TPYA 4Z9FA 4NV1A 4EHFA 2LCIA 2WAXA 1HOXA 3CKYA 2WWVD 4DCUA 3GPCA 3LPMA 2EKDA 5LUBA 5EP4A 5UKDA 4BV9A 5HHTA 5B4UA 1BQ4A 1EFUA 3N74A 3FD8A 3NNSA 4HB2A 4V24A 3OFKA 4YAGA 1WKBA 5EHQA 2E1RA 3AERA 1N9GA 1Q84A 1XF9A 2OT3B 4N8DA 4V1CA 2ZRKA 5CM2Z 2WSYB 3NTRA 3BTUA 4TQGA 5JLJA 2NZVG 1IIBA 3SX4A 4TMKA 3R5SA 5ITZA 4P0PB 1FSGA 5KYYA 1EP9A 2H1WA 4S1OA 5ALZA 1G3RA 2FPGB 3OZUA 5JRDS 4GGPA 2I1VB 2JBAB 3KZMA 3W9YA 3SQLA 5KQRA 3DULA 1ZUWA 4IILA 3AJDA 4CNQA 5BR8B 4KFCA 3GRYA 4EG8A 3FUUA 1DB3A 3HKBB 2R97A 4JLDA 3ORHA 4CF7A 1Q1GA 5CH8A 5HBRA 4OI0A 3F9CA 4X6LA 4YJFA 2FQXA 3X1ZA 4E1BA 1PV1A 1RACA 3GJZA 3K9QO 4GLFA 1IXKA 2YWGA 4JBWA 2NZYA 4IPTA 3G1UA 1B16A 1Z2AA 1E4YA 4QJ5A 1RRPA 2C7BA 2IHUA 3ESBA 1MO4A 1FS4A 1ULHA 4U9HS 4OHZA 2Q4OA 1D2GA 2NGRA 3KFLA 5DASA 5J4YA 1G5FA 3FIUA 1I7NA 1SIOA 5AVXA 3T3NA 4LC1A 3D2AA 4X92A 4DV2B 3ELUA 1M76A 2GAAA 4D3DA 4DLSA 1LD3A 2QT0A 2ZJ3A 3H6KA 1J42A 1ABEA 3QXHA 4KPFC 2IEGA 1O77A 4WXEA 1KVSA 4OQ4A 4OO3A 2VA8A 3GRRA 3MS4A 3WOVA 3C3AA 4RVGA 3DXZA 2HDOA 2BEWB 4RVUA 4DUYB 4OHYA 3P97A 2Y1KA 4KE9A 2X6RA 5F7JA 1HXHA 2X42A 4H7KA 5L3SA 4JB0A 1AKRA 2XKKA 4PU0A 1MEEA 2YV4A 5CA1A 4DAEA 2ZUUA 3L4BC 1TT5A 2KYRA 3TQHA 2BMJA 4DVJA 5BURA 1SC6A 4KPUB 4KQKA 1P1KA 1W2HA 1XP5A 2C78A 1QHIA 3P0EA 1QRUA 2RHBA 3INTA 4EENA 1ACLA 2HJHA 1E6KA 2IPAB 3M6AA 1BD4A 2OHHA 4IAOA 3G2MA 4DMUB 1QCZA 2B1GA 3EQ7A 1QTNA 1B2RA 3KR1A 4PVCA 2WF6A 3WLHA 1UPXA 2EWMA 2WYHA 3IVMA 1APBA 1PG5A 4ECEA 4G4SP 2VRBA 5HRCA 3EXHA 3R5HA 4V0MA 2OD2A 2QYHA 1E4EA 2WUDA 3H17A 2ZTVA 3H5RA 3Q4GA 4DRYA 3HYTA 3QPUA 3D2BA 1EI9A 1FA9A 4N01A 4YRPA 2GBLC 3H8JA 5CW1A 4Q1BA 4B2PA 1ODSA 4UUMA 3GJ6A 4GO1A 3G2IA 4JROA 3TRFA 4DKXA 1RWBA 2IP2A 1CDOA 4WSOA 1QOZA 4ZWNA 4A82A 1LVUA 3TTTA 1Q7TA 3QUBA 1U5CA 3IR6A 4FGUA 4Z0NA 3K8QA 4F8EA 3VA7A 2XIJA 3OIFA 3TSZA 721PA 2XVMA 1F0KA 2VHQA 4P35A 4YRFA 4JVNA 5DTQA 3IIKA 1KJ9A 1PX0A 3EXG1 3FVWA 2DULA 1E7WA 1ISIA 3ABSB 1DEOA 1PS9A 5ALFA 1OE0A 2ZSBA 4M3NA 5M3BA 3N53A 1KDYA 4NAUA 1ORDA 4WACA 5TXGA 1OSNA 4EGCB 1XEXB 2FE1A 4UOZA 1QHYA 4I5FA 2AFHE 1GG9A 1WZCA 4ERXA 3MT7A 2C9CA 1I3OA 1U3TA 5EKXA 1UPBA 3U9LA 4PZLA 4RK7A 2GFHA 3U4IA 3HZOA 1I7DA 1XTRA 2PGOA 1HFEL 3U16A 2HF8A 4MMXB 1HT2E 3MJFA 3ROFA 2IV3A 4ND3A 3UJCA 1EUDB 3ADCA 3K72B 4L8FA 2NUPB 1B41A 3MCWA 4EA6A 1OX4B 2F3UA 1E6CA 4ZARA 2Z4SA 2Q3FA 2X6QA 4MVJM 4O4LB 2YV3A 5L40A 2I9KA 1DQPA 2B1IA 2RHLA 3COYA 4D74A 5LZ5A 3RT9A 4EYQA 1H9AA 1KFKB 2B25A 2QTAA 3G8CA 3G2LA 4YJ3F 3TQOA 3N07A 3QX7A 1F3OA 3WBKA 4QXAA 4AJHA 1U8ZA 1TUEA 4Z9YA 1GR1A 2C8LA 3K1JA 1YI8A 3IKMB 3NHBA 3QV1A 3A6JA 2Y0DA 4YGYA 1N9ZA 3S5UA 5E3HA 2ZZNA 6REQA 1ECGA 3FPHA 4PC3A 6LDHA 1PJTA 5FT9A 3AUAA 1XLTC 3U3DA 4GYKA 4NE9A 4ZJZA 4EUNA 5IAAA 3ZCVA 3QU9A 1MW9X 3QWAA 1NKTA 2PMWB 4F5ZA 2QIPA 1HRDA 4NZZA 1NMZA 1V5WA 4DV7B 2NACA 2XE8A 3F5FA 3GCDA 1Z18A 3V1TC 4EB3A 1K9SA 1W5FA 4RMNA 1ISMA 1ZJ4A 3PE3A 3NGMA 1AZTA 3I2IA 4IG9A 2C8VA 1E77A 1MAUA 4TTRA 2QD4A 2EZUA 4XDZA 3ZW8A 4HUJA 5T5QA 1IC6A 4Z9AA 1X8KA 1JHVA 1ZD3A 5JSFA 5CCBA 3K1AB 4DCMA 1P0FA 1N2HA 5FL7A 4I9NA 1XK6A 1GLNA 5J4KA 3ZUPA 1N6KA 3BH7A 2QE6A 3OQVA 2YQ5A 2WVAA 2YWCA 4XPIA 3CUTA 3BE8A 1E1YA 2EP7A 5JSQA 3AY7A 2YIVX 3N9IA 4MCJA 1MIHA 3OO1A 4MYHA 1T4CB 1NMXA 1VBFA 3KV3O 2X19A 5I8ZA 4HXYA 3ED1A 3VVCA 5A9SA 4FB4A 1NUUA 1O03A 2C2XA 1O5IA 4QNMA 3W34A 1ZINA 1PEDA 3I2JA 4RY0A 5AJWA 2GKGA 3BB4A 2QORA 1OJLA 1I7PA 2Q45A 1BU5A 3E3AA 4JEUA 3SVLA 1LX6A 3CNOA 3FWHA 4LF5B 4ZXFA 1LSUA 4G4GA 1OB2A 2HXYA 4YQZA 2RB5A 3EGIA 2W4IA 1F5SA 3DMRA 3URMA 4MWZA 2UYYA 3TZHA 5BMVF 3PDCA 4JSYA 5DLEA 2OA0A 4XXHA 4Y6PA 4AQDA 4M98A 3VSCA 5DK4A 4BWFB 3W05A 4B0OA 3G7SA 4RZQA 2X76A 4XSHA 4DZRA 1ZJYA 1X86B 3U44A 4Y6GB 4LQ4A 5CEFA 3BJEA 1U94A 1V9SA 2C9YA 1X0VA 4EG7A 1LQTA 1T29A 3QVJA 4YNBA 5E95A 4JZYA 3SJZA 4AJPA 4POAA 5A1TA 5IYZA 4BPBA 3GHHA 4LF8B 3NWPA 2QAGC 5DYYA 4DOMA 1O8CA 4MK4A 3EFHA 1N33B 2PUCA 1N2CA 3ETHA 1YB1A 2AFIE 2GASA 3EQZA 1K8QA 2JAQA 4LZAA 3K9WA 4D0SA 3CSDA 4OD0A 3ESXA 4YRJA 1N2XA 4B4VA 4BO6A 4TSRA 3ADOA 4RGQA 4RADA 3IAFA 3PHIA 1OU0A 1W0CA 5COQA 2QENA 3FSEA 5TR9A 5EZSA 1ZH0A 5HM8A 2VJDA 2H2GA 2FFHA 2HIHA 2O05A 1YZHA 2QX6A 1ISRA 3KAJA 4UBJA 4B34A 4P4GA 1VXRA 5FQOA 3GY0A 3S1LA 3U7IA 3PFKA 3W6PA 2XWQA 5GQSA 4YAKA 4QFMA 3BQMB 1TJ5A 3GDFA 1K5DA 2N47A 1DTWB 1X1TA 3FDZB 4LOLA 3MCZA 2YHAA 1DUIA 5IASA 5DGTA 4B43A 3AOEA 2HO5A 3GLFE 4O8CA 4Y2JA 4MGHA 1ADCA 1G8YA 3TMKA 2IC5A 2OXCA 1KI3A 1M0SA 3H11B 4F97A 5KTMA 5MGNA 2V5AA 2O8FB 5I9TA 3MJ4A 1OUMA 2Y8EA 3HB7A 3VDMA 5CMLA 3FMGA 1O6ZA 2BTQB 2X8BA 1TFUA 3IELA 4XW2A 3OECA 5FA8A 3V42A 1SCUA 3SKXA 1DCTA 2OXRA 2Q0HA 4A0GA 3WRYA 2ZJZA 1TVKB 2O52A 3CS3A 3E84A 2IJGX 3AFGA 3FZGA 1QS0A 3HDQA 3PXGA 3I6BA 1UP6A 4UNQA 4YS6A 1T0BA 2AKEA 4HNTA 3FJ1A 3LVRE 4BTVA 1TQ2A 1NVGA 3B8HA 3I9MA 2G3YA 4UHCA 4GSKA 3PFWO 4Q18A 4RTLA 3UXYA 1TAGA 1F4PA 4W8HA 2ANBA 1JJAA 4YWHA 3BGDA 3E3LA 1P6XA 2GMWA 3K0FB 2DBVO 3FLAA 3DM5A 2OM6A 4LHXA 2EX0A 5JSZA 1WU7A 2OZEA 4U2BA 1ZHHA 1RHJA 4F1KA 4XPIB 1ECCA 1YBHA 1M67A 2PVCA