1PF7E

Crystal structure of human pnp complexed with immucillin h
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
288
structure length
288
Chain Sequence
ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of human PNP by immucillin-H
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
total genus 87
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pf7E00
1U1FA 4L0MA 1PK7A 1JE1A 2A0XA 4FFSA 4R31A 4G89A 1Q1GA 4DA7A 4L5CA 4WKBA 1A9RA 3UAZA 1G2OA 1C3XA 4DANA 3LGSA 3KU4A 4DAEA 3GGSA 4D8YA 1JE0A 3C74A 1Z34A 4UC0A 3BGSA 1K27A 1B8OA 4H1TA 3UAVA 3KVVA 3PHCA 5EFOA 1LV8A 4R2WA 2Q7OE 1PW7A 2OC4A 2QPLA 2QTTA 1ODLA 4L5YA 1V3QE 1VHWA 4NSNA 4F1WA 3IEXA 3SCZA 2HN9A 3OCCA 5CYFA 1Y6QA 1PWYE 1OVGA 2XRFA 2A8YA 4LZWA 3OZCA 1CG6A 4GKAA 5IFKA 1YRYE 4GMHA 1ZOSA 1V4NA 4LDNA 3UAYA 1K3FA 5K1ZA 3T94A 2OECA 1XE3A 1VMKA 3LA8A 5CCDA 1I80A 4L6IA 5I3CA 1V2HE 4ECEA 4GLJA 3FUCA 4JOSA 1A9TA 1JDSA 4QARA 1PR0A 1T8YA 1Y1QA 4WKNA 4QFBA 1Z37A 4OGKA 4TTAA 3TL6A 4BMZA 3DP9A 4JP5A 1PR5A 1SJ9A 5CCEA 1YBFA 1JPVA 1Y1TA 1U1EA 4DARA 4YO8A 3OZEA 4QASA 1OU4A 1VFNA 2AI2A 2AI3A 4NY1A 1A9PA 1B8NA 1Z35A 4DA6A 5EUBA 2HRDA 3OPVA 1PKEA 3DDOA 4TYMA 4OF4A 1U1CA 1RXUA 1ZL2A 3O6VA 2GUWA 2PGAA 5B7NA 3OOHA 4D8VA 4KN5A 4PNPA 1ODIA 2HWUA 5C80A 3OZDA 1A9QA 1JYSA 5F77A 1T8RA 3U40A 1PK9A 4P54A 1NC3A 4MCHA 5F7OA 1JDVA 4EB8A 5EPUA 4BN0A 1T0UA 1VHJA 1RFGE 3DJFA 1V45E 1A69A 4TTJA 5DK6A 4TXLA 1T8SA 3QPBA 3KUKA 3NM5A 3OOEA 5F7ZA 3ODGA 4DAOA 1PR4A 2QSUA 3ONVA 1SQ6A 4DABA 2A0YA 3NM6B 4JWTA 2I4TA 1PBNA 4OJTA 4TXNA 3F8WA 4QEZA 4TS9A 1RT9A 5CXSA 2IQ5A 1PR1A 1T8WA 5KB3A 1Y6RA 3FWPA 1CB0A 1PF7E 2AC7A 1RR6A 3BL6A 4EARA 3DF9A 2H8GA 1U1GA 2HSWA 5F76A 4BMYA 4E1VA 3DPSA 1OTYA 3EEIA 3UT6A 2QTGA 4TS3A 4K6OA 3NBQA 1TGVA 5F7JA 1TCUA 4LNHA 3OZBA 3KVRA 1Y1SA 1Z39A 4OGLA 1V41E 4F2PA 1ODJA 1RCTE 4WKPA 4NS1A 4I2VA 1N3IA 5JPCA 5IU6A 4LKRA 4LNAA 1Z36A 4GLFA 3LBAA 1A9SA 3OF3A 4QATA 4G41A 1OUMA 1WTAA 3KVYA 3FOWA 3BJEA 2ISCA 4MARA 2QDKA 4F2WA 1Z5PA 1Z38A 1JDUA 3KHSA 3NM4A 1NC1A 5CYGA 4RJ2A 1U1DA 1YQQA 5B7GA 1PR2A 1QE5A 1SD1A 3PHBE 4TXJA 4DA0A 4D8XA 5F78A 3FNQA 4PR3A 1JP7A 1RXYA 4TTIA 3P0FA 3FAZA 4M1EA 5F7XA 3INYA 1SD2A 5ETJA 2A0WA 3P0EA 4F3KA 1Z5NA 3K8OE 1LX7A 4YNBA 1RSZA 2BSXA 1YQUA 1NW4A 2P4SA 3EUFA 5F73A 5B7QA 4U2KA 1LVUA 3BSFA 1OTXA 1TGYA 4L5AA 4WKCA 4MCIA 2B94A 1TCVA 3K8QA 4OY3A 3FB1A 3MB8A 4WKOA 3MMSA 3GB9A 4D98A 1ULAA 5CXQA 1TD1A 4YJKA 4BMXA 4X24A 3EUEA 4M3NA 4QAQA 1JDTA 3E0QA 1K9SA 1V48A 3IOMA 1Y1RA 4TXHA 1FXUA 4TXMA 1RXCA 2ON6A 3E9RA 4F3CA 1Z5OA 2RJ3A 1OV6A 3EMVA 5FAKA 1ULBA 4D9HA 1PR6A 1RYZA 3D1VA 3E9ZA 4M7WA 1YR3A 1M73E 3PNPA 4DA8A 2I8AA 1A9OA 4YMLA 2AI1A 3ENZA 1JDZA 4R2XA 3O4VA 1ECPA 4OEHA 3UAXA 1RXSA 2OXFA 3PNSA 3UAWA 5B7PA 1Z33A 4IP0A 2OC9A 1ODKA 4G8JA
chains in the Genus database with same CATH superfamily
4ZZ2A 1RIFA 1C7ZA 3JQPA 4H35A 2D2IA 3KQYA 1V3VA 3HHPA 3FLEA 2DTXA 2NTJA 4Q9LA 4QG3A 4UHCA 4NEGA 4I50A 4U9UA 1ESDA 1X7ZA 4XD7A 4KDCA 3TW0A 1LFAA 3CEMA 1PYDA 3R3JA 2HSZA 2OYCA 5HKKD 2AFRA 4AP9A 3P0HA 3H11A 3I6MA 1MH9A 1NKSA 1HTTA 2FLWA 4GLBA 2AMYA 1N1GA 4JUDX 3UAZA 3TRDA 1HNZB 4DMUB 3HEMA 3ZZTA 2PU7A 3NIGB 3EMBA 2XB4A 4MIYA 3VYTB 3ZQUA 4D8YA 3UWMA 3H3XA 5AUQA 2BONA 2ZUDA 3DXXA 3WMXA 2HZ7A 3MB5A 3PC3A 5DBGA 1YQTA 1YJCA 3ZE7A 1RWWA 4UPDA 3UWDA 2Y68A 1MOSA 1TUIA 3DH0A 1NM5C 1JJ7A 1ID8A 3EGDA 1J8VA 2JI8A 1E2HA 3G8BA 1IN5A 3PHCA 4C4OA 2V0NA 4DOMA 1GN9A 4FYXA 2B8NA 3RARA 2IXTA 2AW5A 1GGFA 1U9CA 1N5KA 1Y3BE 4NVRA 3BZWA 5CHYA 1LBHA 3DEIA 3QLVC 2YHSA 4DNXA 4EBFA 1QDLB 4IGIA 4D82A 3SIXA 2NZ8A 3D0KA 3GLTA 4CU2A 3WGGA 2XWBF 4I0WB 4EENA 2BPOA 2VTEA 2ATIA 5BW6B 3IBTA 1TM4E 1P2TA 1QU3A 1CY2A 5A9SA 4XDGA 1MTOA 4F1WA 1BWQA 4XB1A 3TMYA 2C4WA 3VDXA 3GEPA 2H08A 2VJAA 3K6KA 4FR2A 2J09A 4CUKA 1VSTA 2CV2A 3CLVA 3WLFA 2HLDD 2HBYA 1RKUA 2AA3A 5LYJB 4H7FA 1PK8A 3QYPA 1VI2A 2QHXA 3T5AA 4OKNA 4CIWA 1V3TA 3VH1A 3IE1A 2C7GA 3LWZA 3TTTA 4F97A 1H6AA 3RADC 3K0FB 2PX0A 1I3LA 5ITZB 1OLOA 2QG9A 3R77A 3G7NA 3AHDA 5EIHA 1JU4A 5JTUA 1JQKA 1Q77A 2Q4DA 2ZOSA 5FTNA 1R8JA 2VHCA 2EKPA 3O3NB 4Y6OA 4PAWA 3GXBA 3ZU3A 1FFWA 4GI1A 3RT1A 4KOAA 3HKDA 3MBOA 3HJGA 3HUFA 5KOHA 1XKQA 4KXNA 3OH8A 2D4HA 3L4SO 3OLWA 4H1UA 5EPOA 4GBJA 5FTLA 1V47A 4HRYA 4GPZA 2Y0PA 3BKXA 1YZFA 2DQYA 2A0KA 3PGVA 3T94A 3V33A 5IABA 1T26A 3CVYA 3A7DA 4LI3X 4DIFA 2IH2A 1R00A 1K7CA 3A1DA 3M9LA 3QVGB 1PNRA 5JAPA 2BTOA 4JL6A 1ZY2A 4G2NA 2C97A 5JJKA 3GRYA 5I4KA 1LBIA 1TYEB 2H85A 2HIHA 2PFSA 3AP2A 3L6EA 5BT8A 3ABRB 4R6WA 1HG1A 2CJPA 1ZWKA 4FFDA 5C1PA 2YV4A 2JBAA 4AQ7A 1W0KA 3HVIA 4J1NA 4Y2JA 4XYEA 3LUGA 2XRZA 2VDRB 4M55A 4KGDA 2XB9A 3KTOA 1N5MA 1UJ5A 5KOJA 2WWYA 1WV0A 2INGX 2VSXA 3HFRA 5CNMA 2R7MA 2ZPAA 3KYDA 3DM9B 3USCS 3W9SA 3GELA 2GJ4A 2UVDA 2X41A 3PDUA 4DYVA 4QPNA 3UW3A 3K4PA 1OXMA 4JJGA 4XCQA 3PIIA 2O2GA 4BNIA 3O84A 5EHIA 2GCOA 2Y2UA 1Z37A 4WAUA 4OVKA 1QYCA 1NIPA 3U1BA 2DT5A 3OCYA 1PR5A 3PGA1 3PA6A 5LQSA 4MQFB 4HJXA 3F1KA 1JPVA 1E2BA 4BGEA 1R0SA 2WWTA 3PZRA 5CLGA 5F23A 5L53A 4RTJA 1KVSA 1UFOA 3OM0A 1NVMB 3MUOA 3X1XA 5B37A 2HHHB 3ASVA 4GYJA 4JIGA 3ET4A 2WE7A 3A4IA 1GCGA 3KQLA 2CUKA 4UDOA 3RSSA 4BLUA 3ONDA 4TYMA 3ZZNA 3IPCA 3CCFA 3K0EA 4MTLA 3UCXA 4CTJA 3S6JA 1ZL2A 1P39A 4H7KA 4JLWA 1QQBA 1PJ3A 4YRZA 3AK4A 1S8AA 1SWVA 1PJ4A 1YJ5A 2QM3A 2IUYA 3RYHA 1CS4C 3OOHA 4CLOB 1D4ZA 4Q34A 2CJWB 1U7XA 3IPYA 3DKRA 2PZJA 3BJZA 1XMOB 1L5QA 1TE2A 2VHTA 5JIBA 4GKJB 2V7QA 2A4MA 1E2DA 3LBHA 4QOFA 1JI3A 4RORA 4CM4A 5JYBA 3BD8A 4CKEB 1PN3A 1QFZA 2DFNA 1A9QA 1Z0UA 2H1LA 4K0RA 1NJ8A 2Z1MA 1QZUA 3CZCA 3WBFA 4DMCA 4HQOA 1W2WB 4JJ4A 4DV1B 1RI3A 5B3JA 2G9ZA 4AJEA 4UQLA 1I4DD 5LXTA 4B43A 4UMVA 2WJIA 4P7FA 4NHEA 2WM9B 3MTBA 3IE2A 1Z16A 1EFAA 3TTSA 2BCGY 1XAGA 3H99A 4NENB 2NO7A 3OHSX 4RFSA 5MGBA 4GVPA 2J5BA 1XPUA 3HUTA 4HYYA 1MIOA 5IAEA 1ZIPA 1NYRA 1T8SA 3VR1A 4KPGA 4U7DA 3QM1A 4PC2A 5KNCA 5H4GA 5I9BA 2J0UB 3LX6A 3LLUA 2OOSA 3UWSA 4D41A 2CMGA 3EEFA 1H8EA 4M0DA 4OUKX 2HYIC 3ZDXB 1PBTA 1IVYA 1L4FA 2ZB7A 5TPWB 1B23P 3PF8A 2X3UA 1QYXA 1L3CA 3HS3A 1Z7GA 4HLCA 3UTDA 3PSHA 1FRVA 2QJOA 2HU8A 2R8EA 4CI9A 2PMKA 4FGSA 1RPTA 5AW0A 2H4YA 4UM7A 5K51A 2FXVA 5K01A 3OETA 2MSKA 3N3BC 3T9FA 4J0EA 1K97A 1W75A 5CFLA 5IAAA 4NCIA 1E2JA 2PV0A 1Z8NA 3E2IA 2P9YA 3UOAB 4RK6A 1MB9A 3VA7A 1IG0A 3D6VA 4FILA 4FN5A 3TNJA 4EM6A 3LDHA 2F48A 2XUFA 1NBHA 3RK4A 2AMJA 4X93A 2HWXA 1WCIB 3EXHA 5M3BA 4RAQA 2ZPUA 2GYUA 4M76B 4ERXA 1ZZEA 3T0IA 4CV1A 4URVR 4FWBA 2C94A 3QLVA 5I3ZA 1WMFA 3RU7A 4LSMA 1FVOA 5T8KA 2P3LA 1JFFA 3EQ7A 4M8NE 5JUWA 3IEUA 4JJEA 3R9WA 1PQ4A 3E3LA 7ABPA 2AKAB 1M1ZA 4M37A 4DCCA 3A4MA 2VTBB 1VXOA 3A1VA 2R8RA 1XAIA 2RK4A 3KAJA 5AW4A 1E5QA 1BMFA 1GTSA 4LFBB 4LK2A 4CM9D 1GZUA 4YRMA 1P61B 4BC0A 5B1DA 2P91A 3LYHA 3BA6A 1O54A 1XZNA 1NGSA 2VJCA 2XXJA 3NBQA 4J7XA 1B73A 5FOSA 3DTTA 3DVAB 3Q7QA 5BMVA 3GPDG 3I45A 4X60A 3ANXA 2WJHA 3HA3A 3L0ZA 1ES9A 3NC0C 2PNJA 1W29A 5C37A 1IL0A 1F7VA 5DXJA 2H52A 2PGLA 1ONOA 2R1TB 2YWGA 4RVSA 1N0VC 4ZYTA 4KGXA 4YUWA 1JHAA 4G3XA 4YX9A 3L82B 4OSEA 3UGQA 1JTFA 2AJLI 1RPZA 4I2NA 1PDVA 1T4CA 1QFJA 4L02A 4YACA 2UUAB 2XQJA 4TZ6A 5DOVA 4IFIA 2JJQA 1LI7A 1ND6A 3JAKB 1WEHA 5AKJA 4YCCA 4BZQA 1UZAA 4NAUA 4O1MA 3V46A 2QV7A 5LJLA 2FSFA 4IYRA 1QCZA 1UADA 1XX6A 3W06A 1NURA 1C80A 3SNHA 4CV0A 3TTVA 3PBKA 4E46A 1QDEA 1F5SA 4JN6B 5F2NA 2CV0A 1IDOA 2CE2X 3AXTA 1Z36A 2GZDA 1ILEA 2J9XB 5FJIA 1YD7A 1BXGB 1J1UA 3KOWA 1XVAA 4XOIA 1QLHA 3KELA 1KFEB 2ZBFA 2JK1A 4GEGA 2WY2D 5I7HA 3JQEA 1AB5A 1VG9B 3Q8LA 4L76A 4R7TA 4A8JA 5K3FB 1KKMA 1TDJA 1NR1A 3IUPA 4F85A 2GF9A 1UMDA 3TTWA 4LC0A 1UEXC 2H16A 2C5AA 3H2HA 1IN1A 4OYYA 2XTJA 1QF9A 1Y8RA 4ZZIA 5AQ1A 3MGGA 1TZ2A 1PW5A 2BMWA 3HO8A 4NBKA 1XU9A 1LCIA 5TEWA 4OFXA 3FTPA 4UHKA 1M8GA 3FMVA 1V95A 1S96A 2YJZA 3AI7A 4WJZA 4HSGA 5CYPA 2BFDB 1GPWB 2QQEA 4OPMA 1ZEMA 5J2UB 2B5OA 3FYUA 1MRSA 4U8HA 1LRKA 1HZZC 2IYFA 3LQKA 5BQXA 2XUAA 3LZDA 4KWCA 1IXZA 4LOAA 3S68A 2C4HA 3KHUA 4E1BA 3QMMA 2FPRA 2O07A 2WNIA 3E7PA 2UZ4A 1SXQA 2BGTA 4K0KB 4UAJA 1I10A 2PSEA 2F1HA 1PR2A 4OGWA 2VR1A 4DA0A 3LE8A 1UR5A 1QFMA 4GBMA 4P38A 2H1OA 2PCLA 1SCQA 3TAUA 4AUEA 5HKBA 1BD4A 3S2GA 1JP7A 1OH7A 3ZN2A 2Q1XA 3B8HA 2N3ZA 3HK2A 1V1RB 3Q7SA 1UAAA 3SR3A 3KKPA 1YZVA 3KXPA 2VHQA 1PL0A 3OQ1A 1D2RA 2H29A 2GZHA 3UWOA 3KSBC 1NP6A 4D9IA 5BYAA 1M6VA 4PVDA 2GO7A 1A50B 1SUDA 3RU2A 1LPNA 3R7BA 1DUIA 1EE1A 1G17A 1RTTA 2FHPA 4CMEA 3QEOA 1RZ3A 3DM5A 1E2MA 1RSZA 4YK7A 4ZQEA 1Y5IA 3TLYA 3PQFA 2QG6A 1HXHA 5THXA 4JUCA 3O8QB 5K6RA 3ER8A 1UBUS 2VH1A 5B7QA 1USVA 2HYDA 2JGRA 1IHPA 3I2YX 2PY6A 1H1TA 1BHO1 3M6IA 5L3QA 2GZ3A 5GMOA 5JMWA 3O73A 4RH3A 2W2MA 4LRYA 1JEQB 5DYNA 3WKBA 5IM4F 1M0SA 2ECFA 1W4CA 1G41A 2AYXA 3TRKA 4DDTA 5LU9A 3FRHA 2DBVO 1NMYA 1OXKB 4GWLA 4BNTA 1KY2A 3GW8A 3GYGA 3ZTTA 3ZY6A 3OM8A 1UPBA 2ZQZA 4JT9A 1N32B 5EXEA 1C2TA 3QIVA 1TECE 4M8KA 1B4DA 1XZQA 1YJAA 5CGQB 2QBYA 4HTAA 2J3LA 1X9GA 5CXQA 3VR3D 1VP3A 4KZPA 2CHQA 1UMBA 5EEGA 2REBA 4OQDA 3HCDA 5KTRA 5LN1A 5AD1A 2W6JD 4JKIA 5G0UA 4C4YA 3E70C 2GJ9A 4W1PA 3R4CA 4WSOA 4B3IA 4DMKA 2PRZA 2WMOB 3QVKA 1QH1B 1MRZA 1PTJA 4LV5B 2BLLA 4JROA 5T4HA 3V1NA 4Z53A 4B4UA 4N0PA 2ZITA 3LS2A 3UAOA 4JC0A 5AICA 4CNBA 2QSYA 3EUEA 4KQWA 3DBRA 4QAQA 4F3YA 5JI2E 3OTOB 3E15A 2CCKA 4CLEA 5ARDA 2BDTA 3A9VA 3EZ6A 4ZT5A 2FH5B 4B4DA 1DU4A 4WDRA 4C0QC 2XECA 1RZRA 3P94A 4BJ5A 5CCBA 3P9KA 1M7GA 3PXAA 3I9NA 4HB2A 5BNFA 4UM5A 1J1ZA 1WEKA 1TT7A 2X8JB 3UJ7A 1EFVB 4EKGA 1T29A 2YS6A 2FN7A 1C30A 5FPYA 1ZAYA 4RM3A 2JD0A 3DFZA 4KLAA 4DUGD 4FB5A 3CH4B 4HAYA 4YAEA 4UUMA 3E9RA 2AOWA 2I2AA 2IYTA 3GJ5A 4EJ6A 1DTSA 2PS1A 1UQTA 3M4XA 4ZOAA 1OHHA 1ZSVA 3ABQB 2DQZA 1J23A 5A04A 3DTYA 3NBFA 3PQ7A 1QGUB 4UMEA 4KR2A 3D7MA 4QOGA 2GILA 3NALA 3ZOKA 1CUVA 2JAUA 2PMDA 4KV9A 4AROA 2X2PA 3EDOA 5CEEA 1NF2A 2FRVA 1KETA 4DDVA 5KS2A 5AYVA 5JRDS 2Q4OA 3BGOS 5LLSA 5ICGA 10MHA 2CXXA 3RBAA 5BWLA 4AC9A 1Q91A 2CVZA 2Z5FA 2O23A 3F7MA 4O1HA 1GTJ1 4BO0A 3OE7D 4EDFA 3BN3A 3HNRA 1XXHE 1GPMA 3KDSE 1BX3A 1RRPA 1L2TA 2F4VB 4UJ5A 4KLCA 4WNCA 5B3AA 5EJIA 1FK8A 1YSCA 4G1CA 1GQQA 2RHJA 4O8CA 4D81A 1RXSA 1JKJA 2OXFA 2JAOA 2QZJA 2XVZA 2FN3A 3BK7A 3BWCA 1VMIA 3AFMA 4RHXA 4ALLA 2WPNA 2ASEA 2FR1A 4I50F 4KQFA 4O0LA 4YAOA 4D0RA 1DADA 1E8DA 3DTVA 1KMHB 3JWGA 5AVWA 4GYKA 1IATA 4R1MA 4ZDJA 2C0PA 1JE1A 1XFDA 2A0XA 2GPNA 2O1EA 4P7GA 3STWA 2GPWA 4IDAA 3W9BA 1P7YA 4P35A 5DW3A 3IAM1 2DR2A 1EA5A 1NXTA 3QW4B 3R8FA 5JNUA 1BC5A 4J4HA 3MK31 1LK5A 4DV2B 3U13A 2IY9A 2NTEA 2H4XA 3A3YA 5CT6A 4Y1RB 1KBOA 2H4ZA 1W5FA 1Y8ZA 2VYND 5EMJA 4YRKA 4N9WA 1FJGB 4FIDA 4LDPA 1C41A 3OX1A 3LGSA 5BPFA 2ZJ5A 1WXQA 5A4KA 4NYMR 1Z6ZA 1XL1A 4I1UA 2IYLD 3HY6A 3DZDA 1HRKA 1YQGA 3DZFA 3L8FA 4BVFA 2WAAA 3TLGA 3LHSA 1YI1A 2BKVA 4K6HA 1PWZA 1RBZA 1B8OA 1VL2A 3NEAA 3TLZA 2VPQA 1LDYA 4BZZA 4PBSA 4W5JA 1Q44A 1J25A 1OFTA 1PEYA 2HT1A 5EXSA 2A2ZA 1OWLA 4Z9BA 4EB3A 2BYTA 4Z54A 4PICA 1DX4A 4K86A 3I2IA 3LX4A 5KSPA 1USGA 3JQAB 1AN0A 3UPUA 4NQRA 2A14A 3FSRA 1C3JA 3K5IA 1U94A 5M2QA 4GKBA 2FY8A 5IVHA 2PSSA 5CBPB 1Z0JA 1Z63A 3CF2A 2Z9CA 1WULS 1ZCJA 5BR1A 3BD6A 3AR6A 8ATCA 1U65A 2EQBA 2VDNB 1M8PA 2OUKA 3OU6A 2HA2A 2P9FA 2ZROA 1O95A 3FUWA 4PTZA 3ZJ5A 4HX9A 4ZEMA 3HA2A 4HB3A 5IKPA 5JO9A 2COUA 4LWQA 3R0XA 4POAA 3JQBA 2W22A 4QBGB 1JIUA 2XMGA 3VJLA 4B0OA 1JTEA 3DEZA 2J85A 1RJ9B 1RWOA 1BE6A 5GM1A 5JBQA 2F8LA 3W78A 3WWOA 4CKYA 5A4JA 1CIPA 2B4AA 3WGUA 1S89A 4LXIA 5IFKA 2WUDA 3PDIA 4YI5A 3CMCO 1U8YA 4QPJC 4XX0B 5BY2A 3USES 2CE7A 4INJA 4YAJA 4D0LB 4QECA 5REQA 4J7UA 4GM0A 4ZHQF 3DLTA 4DR5B 3T9BA 3H2BA 5DIFA 4FWIB 4TMXA 2WTNA 1OZAA 1ESZA 2RI1A 2RH9B 2QRMA 4N0EA 2C78A 2QUAA 3FUUA 2C9BA 3DS8A 1CLEA 1NVFA 4JBHA 3B3FA 2EDCA 2IUTA 4RY2A 3T0GA 1K3FA 4BGUA 5TMBA 4BKQA 3PV0A 3QEJA 5AKXA 4D3YA 3FTQA 2ZQ5A 3DEKA 3EVEA 4ASUD 1F9EA 1GQYA 4FFPA 3GAAA 4LUCA 1RHJA 2ZPTX 3G7SA 3OO0A 5EP3A 4N65A 1L8XA 5JYDA 4JBWA 3N86A 4QZVA 3G3EA 3TINA 4RBNA 4HGOA 2WA1A 2XIJA 3PICA 1LW7A 1T9CA 1UBKS 2OCPA 4L6IA 2WWGA 3MPOA 4XWWA 4DV3B 3EBPA 2HCJB 5I3CA 3U62A 1I3MA 1EP2B 2IX3A 1A8IA 3WI7A 1I2CA 1KJQA 1WW8A 1EI9A 2I2WA 1LTHR 4H77A 4RPKA 1QRTA 4TWBA 1N8TA 1HQCA 3CG4A 1IQ0A 1VJ0A 3N2YA 5FI3A 4DE5A 1QK4A 3L6CA 2HR1A 2OFWA 4AUKA 3AUUA 3VKUA 1L7BA 3D8UA 4FS8A 1PTJC 4JH0A 2A1TR 2NO0A 1HDCA 3H9UA 4BX2A 2G07A 4D25A 1DFGA 2Z98A 4A2QA 2P9EA 1FQOA 1S8NA 5ECWA 2JD2A 3ESZA 4UM8B 2X5XA 1UJ4A 2Y4NA 1U2PA 5BV2P 1Y1QA 5HJ5A 1AVTA 4F8YA 5F4ZA 1SBHA 4CCSA 4G8CA 4JT4A 5JMOA 4CGYA 1YMUA 5CCEA 1D6JA 3WQHA 1YBFA 3EVDA 4UFOA 1PV2A 1GCOA 1WL8A 4N7BA 1S3SA 2F9MA 5ALXA 1MT3A 1OU4A 1VFNA 3DB1A 4RY9A 5A0FA 1BVRA 2WU8A 1WCXA 2Z3VA 2YHAA 2PLNA 3KOXA 4IQFA 5BQ5A 3I0NA 1OZGA 2CUZA 4OQNA 3F6YA 3OPVA 2Y1GA 2YWHA 1LH0A 2WJ3A 3U7JA 4CM5A 1AXGA 3S8EA 3H18A 2L69A 3OEWA 3OQIB 5DTJA 4D7AA 1DAMA 2C99A 2NU8A 1X19A 1XKXA 1DQSA 2BFNA 4PFJA 4XQGA 3MGKA 1GZ3A 1FUKA 4J03A 4C7JA 4QLAA 1TEXA 2ZIUB 4AO8A 1R4MA 3FCUB 3PENA 1YTLA 3L43A 4ALJA 1JILA 3ZDBA 4D0SA 1NJGA 3WLOA 1ZM2A 1JXOA 3B89A 4KE8A 4D9FA 1QHSA 1ZXBA 4E2ZA 3W6OA 1Y5RA 3GT7A 3V55A 3ZIUA 3QENA 3ZV3A 1M5RA 5C80A 3COYA 4GT1A 4LY6A 2P4HX 3JSAA 4HOYA 4P3YA 1QBGA 3NS7A 4DDWA 3PR3A 1QCCA 2C3OA 3ETJA 3H11B 4HFNA 4XH9B 3COJA 4OSOA 4BECA 3GZ4A 3CZ5A 3VDRA 5K0GA 3NBKA 5F1OA 4CIAA 2JKVA 3K0HA 1N7GA 3AZPA 4U7WA 2NP7A 4DMHA 2W6ZA 4D4JA 2JLUA 1MEJA 4P53A 2YXLA 4HEHA 1L1EA 1MKYA 4R7GA 4YP7A 2MJLA 1V45E 4M0UA 4YQZA 2I7XA 1I30A 2JFQA 1M8KA 4JQOA 4MRRA 2P2GA 4WI1A 5DV9A 5BR7A 5JSFA 4RTOA 1NVKA 1S02A 3NORA 3ZGLA 5KNBH 2XQGA 3EEBA 4KLRA 1DC5A 1R0KA 1VECA 4U4AA 2DSTA 1TJYA 5CDTA 2HDNB 2XKKA 1BW9A 4MVWA 1L7XA 2ZYRA 4XWOA 3HYSA 3P9SA 2N42A 4LK3A 5TEVA 3CHYA 2NAPA 3NRJA 5IAJA 2EP8A 1P1KA 3CR7A 2ISQA 3STHA 1KGSA 2C4KA 1SQ6A 4B3CA 2FUG6 2GVDC 5I4IA 3ZU2A 3DT8A 1GILA 5HBRA 4K9NA 1XB2A 1F60A 2VSNA 1HNWB 1FP6A 2QN2A 3U3ZA 4F38A 4HZUB 4FFBA 3UJ9A 4AN1A 2ZJ0A 3OQHA 1DCTA 3K9LA 3D4IA 4HMPA 1Y9AA 2ZS8A 1JR3A 3OIUA 3QX8A 3UK2A 3LQ4A 1ADBA 1Z4KA 1VJ5A 3FF1A 1VE9A 3GEHA 1L8QA 3KLNA 4MUBA 2TECE 3VSDA 2EKQA 1GU7A 1PSZA 4ZI5A 1BGWA 2MINA 2Q3LA 3NYIA 4CMCA 1I33A 3BRWA 4TL9A 2VDWB 1K88A 3FWPA 1Y9EA 3RC8A 2Y1LA 4A6PA 1IK4A 2A94A 4HDMA 3DUWA 3LCVB 4I08A 4X7MA 2W43A 2FU5C 3PX2A 4YFVA 2FK7A 4MW6A 2G40A 1TK3A 5F35A 3EODA 4RPCA 7MHTA 3HCBA 5KNCH 1BCRA 5LC1A 1G38A 4H15A 2GCOB 4Q12A 4HUQB 3C7CB 4I99A 3IIMA 2KLBA 4FYKA 2O3QA 4BTLA 1X9HA 4C3ZA 2CMFA 4PPGA 1H42A 1OTYA 4NABA 3QKWA 1A0OA 2XEDA 2HKIA 1HOXA 5LNK6 5FDFA 4G6ZA 2D3TA 2YHUA 3ANMA 4KEAA 5AJYA 2QMUA 2CT8A 2R6HA 5AW5A 2ZTUA 3L4JA 4HXEB 3AVVA 5H70A 4IXWA 2IUSA 3EZ2A 2CYAA 5BSHA 2Q49A 3CF4G 1ZH8A 1G1MA 1KI6A 2AXPA 5ERGB 4AN4A 3N2EA 1U7TA 3N39C 4ZK2A 4ZREA 5EY5B 2BGKA 1J39A 2CHGA 2KB0A 2XKAA 1Z08A 4Y2YA 1NF3A 1GTRA 2QQ0A 3SM9A 3BHMA 4ZYUA 2LP4Y 4QUKA 3OIVA 5GV7A 5CD9A 3LLCA 4IRUB 3P0JA 2JGFA 5DP2A 1G5PA 2JI4A 3ILXA 1ACMA 4FW8A 4M1QA 4U5QA 2X0NA 5CB4B 5LKRA 1DJPA 1Y3DE 1FNNA 3JS5A 5EIOA 3VYRB 3H0EA 3B2NA 4HSEA 3CUWA 2DKOA 3SM3A 2BFFA 5BPHA 3N75A 4NE9A 3KXKA 3A3KA 2IYZA 5IANA 5HUQA 2NP6A 2XYGA 5I51A 1HE5A 2C5BA 4A03A 2GPAA 3LPMA 4M8IA 5EN4A 2PSJA 3MJTA 1A9SA 5FWYB 2JJ2A 1D1TA 1WY7A 3N1UA 3A27A 2VL7A 5KC8A 5KTPA 2HB6A 2R7KA 2PDAA 3KNZA 1E4VA 4J16A 4OXRA 3F49S 4E5MA 4ZDIA 4RIFA 1J42A 4P4TA 1VKRA 1H69A 1SUCA 4Y98A 4D9JA 1A2BA 1CB7A 1D0SA 3JD1A 1MB3A 3N6RA 3OA0A 3UKJA 2XYRA 1M2GA 5LOVB 3TOSA 2OHVA 4XM0A 1JDUA 1V6AA 1P2VA 3PYMA 3WYGA 3M1YA 1VG0B 4KPEC 3ZNPA 1BN6A 1SH7A 2GI4A 4Q6BA 1P18A 3AETA 4KIFA 4FLEA 4MQ6A 5J2TB 1PEDA 1T25A 2OENG 5F2OA 5IJ0A 3RE1A 3O4IA 1I36A 2C7BA 3KOOA 4AKSA 1W4ZA 2B1RA 3A0RB 1VLZA 3MJSA 3QG1A 1L5SA 3MLBA 4GI7A 1UBTS 3KB8A 4IG4A 2O2IA 3LUPA 5B6PA 2W6NA 2BGWA 5ECDA 2ZJ2A 4D8XA 1BFKA 1J8FA 1AZWA 2GK3A 1XQ9A 4ZZ0A 3ZVMA 2QMYA 3IAUA 3BK2A 1Y48E 5NULA 1YZNA 2ZYWX 1Z45A 2VEOA 4ZOCA 3W3ZB 2BFPA 1KSHA 5ES3A 4HFJA 3HL4A 2PAAA 4L1KA 2CDRA 4DJDC 5K0FA 1K6IA 4RPHA 4Y6RA 4B6SA 4PU0A 4LV8B 1WB9A 2BFOA 3DO8A 3VR6H 4I8XA 2WIGA 3SXJA 2BE7A 4Q1BA 3D6TB 3EFBA 1XJCA 4JHLA 4JQYA 4MIKA 2F4NA 1P9OA 2VLBA 3AETB 1JIXA 3FOBA 1KK3A 5L4NA 1MPXA 4FM9A 2ZCVA 2WIKA 3AX6A 3R3HA 4CTNA 4RD6A 1L7AA 3L7BA 5GP1A 4L8VA 1M74A 5KYXA 1XK6A 1YRLA 2GM3A 2HF9A 3C1AA 2GBPA 3P4YA 1LVUA 3S99A 1QG4A 3T9CA 4XJXA 3WYFA 1JDBB 3M6AA 2Y0DA 3L1KA 1WXDA 4CDNA 1J2JA 1PDWA 1E1MA 2ONZA 3CLUD 4I8IA 4L57A 3OU2A 3IHWA 4X45A 4D26A 4EYKA 5JQGF 5D6NA 1FW8A 3FIUA 1ZJ4A 2SKEA 5DO9A 1BTOA 4A8TA 1TTTA 2G6BA 2WG2A 5DYIA 4JV5B 1CJUC 3NHBA 4I5FA 2UZ0A 3CJQA 4NBSA 3CA8A 2WVGA 2XTZA 3QKUA 2Q2WA 4MUFA 3PYLA 4P4LA 2VJYA 1EBUA 3OPYB 1QK3A 3Q0EA 4JB3A 4TWZA 3TTUA 1C7QA 4UXHA 2KS6A 3D1LA 3R7FA 4DV6B 1MXFA 3D0OA 1K7FB 1NT2A 1LS6A 1ZHHA 3PFCA 4BPRA 4P92A 3ZV6A 2X1HA 2A84A 3FNRA 3C97A 3PXCX 4BMXA 3ROKA 1YKGA 1K8RA 1E9CA 1P2FA 2VHJA 1G6Q1 3PNYA 4UM9D 4ZD6A 1KZHA 2ZUTA 4BATA 1NL3A 5IF3A 4MWSA 4WLEA 3WGZA 4YGXB 3KB6A 4X24A 3VH3A 4FBMA 2J0UA 3PR2B 3PNKA 3HPQA 3KQNA 3H17A 1U0HC 4BNKA 2DFTA 4EI9A 1SRQA 4MO9A 1GZ6A 3RFFA 4RK4A 1YOBA 2YNMA 5FRDA 3A8TA 4B6GA 4KGZA 5LWQA 1KE2A 3QWHA 3FWZA 3FJOA 1IBKB 1IBSA 4DR6B 4FNMA 1VLHA 3JTMA 5AVZA 3D4PA 2GCIA 2OD2A 3KQHA 4FDVA 5FBWB 3I2JA 2QOEA 4S1TA 4BB6A 1MQAA 4ZQCB 3ZXXA 1ZHOA 2ZB3A 2C7OA 1Q17A 1G7SA 1E0DA 5C5CA 3EXHC 3IHTA 4U7HA 3E9YA 4DM7A 3K72B 1X7GA 4BHTA 2FPXA 4IGFA 1QQAA 1T0IA 3FN4A 3P9CA 3CEPB 5DNUA 2X4IA 2LNDA 3E05A 2HM7A 1U3CA 2X13A 2X5JO 2Y6UA 3FDZA 4GVLA 4Y6SA 5AJTA 1KWGA 1WVMA 4J1TC 3N0WA 1B15A 2A5JA 5C3UA 1PNOA 4K28A 3PP8A 4ZCIA 2MYPA 1QP8A 2ANCA 4HB0A 4IIUA 1GPLA 2RK6A 1S1MA 1TQ2A 4PLWA 1NRXA 5FOQA 4W7SA 2CXUA 4QOEA 1OCEA 5JE8A 4QWWA 2O2SA 4XGKA 3QLEA 1G6OA 2W8BB 3BEOA 3DHEA 2CMHA 4JZYA 4EVSA 4EL0A 6NULA 5CT5A 3SSOA 3U1TA 5GJWC 2D1SA 4RVHA 3SQDA 2A9RA 2FMUA 5BWOA 3A14A 2AZXA 4EVIA 5L7WA 2J6CA 1E7YA 4B09A 3L02A 2JHPA 1WD7A 3WRWA 2BH9A 3IX7A 1PT5A 5DGXA 4FJ0A 3O8QA 1KK2A 1PL7A 1KFJB 3K53A 2WOJA 3VU0A 2OBNA 2PXHA 3NHKA 1SIOA 3OQVA 1VGRA 3PD0A 1IXRC 4D80A 3IUEA 4RX1A 4NAHA 4DVJA 3EPPA 3OC6A 2FKNA 4I3HA 4LJLA 3HCRA 1WZNA 3ZDEA 2GB4A 2R8BA 3QI2A 1WXHA 4G4IA 5HIKA 2H2AA 2CCGA 1WMAA 3C70A 3GGDA 3O0DA 1Q1GA 2D1RA 2W8BA 3DO6A 3RJ9A 4C0BA 1CRZA 1HEUA 4DA7A 2X58A 2JG3A 1A9RA 1KIMA 3JQFA 1IVSA 4N7RA 4EO7A 3WWEA 3UXHA 1CUDA 1DUVG 2X5KO 4BLPA 4DVGA 2XCSB 1GA6A 3F7TA 2QX7A 3W34A 4CCYA 4DAEA 3HTXA 4DLLA 3KZCA 4BB0A 1Z6QA 4J0FA 1T2EA 4PGFA 4UC0A 4OAPA 1ADYA 4FUTA 3SDSA 5FOUA 2XT6A 3OD5A 2PRYA 1P0FA 3E4CA 3DHYA 1WHTB 1V2GA 3KOZA 4JFAA 3RU3A 4WJLA 3FPGA 4R3WA 2X0RA 4E51A 2R84A 2ZR8A 4BNDA 3UAVA 3BORA 1U63A 2ADMA 3B3JA 1O95C 2AXQA 3DAYA 3DD5A 5K0CA 4DB2A 1FU7A 1GPJA 1TQHA 3KZMA 2NWQA 3JD4A 1RXVA 4YRDA 1JEAA 5KX5B 2DPLA 5F9FA 5E4YA 5J4VA 3U61B 5FI1B 3CWCA 3LV8A 1V26A 3EN0A 5KPDA 3CV3A 1UCFA 2H63A 5DYYA 4PANA 5SICE 1UBEA 4D97A 4L5YA 1UKYA 3V7NA 1QX3A 3GL9A 3VYSB 2QV0A 1QAOA 1XQ1A 3INNA 4YYZA 1XPJA 1VI5A 2GUGA 3OKAA 2ZYIA 2P79A 1I14A 5CVUA 3EGIA 5FP0A 3ZG6A 5K4HA 1RWNA 3A70A 1U2DA 2GZSA 3HJAA 2F7SA 4G36A 4IVPA 3IKLA 4JD5A 1OVGA 1UKBA 2X15A 3T1TA 4FGLA 4QQRA 2XTMA 2QWXA 4FDMA 1DKOA 4YRQA 3MJEA 1G8AA 3AV0B 3B9QA 3E81A 3L0DA 3MYYA 4L5BA 4B76A 1VP9A 2LZ0A 1JQDA 3TF5A 4YJGA 3LNTA 3JQDA 4MCAA 4HFRA 1WMEA 2QT1A 1G8KA 5BSFA 2UZIR 3A6PC 2PIDA 3U0VA 1SBQA 5D00A 1NUHA 4CHGA 3ZD9A 5BOSA 4CL3A 1SOMA 4GX5A 5FUWA 4HGYA 1U1IA 3HJFA 3SFTA 1NE2A 2FX3A 1OZ0A 1W85B 1MO4A 4L3WA 3VZDA 2I65A 1NU6A 4CTMA 4E88A 4J0IA 3GRCA 3RQSA 4JNKA 4UTXA 4KFSA 3SHQA 4OYHA 1I7QB 2OUIA 3VR2D 3D43A 3I6QA 1JHMA 1YDWA 3GGCA 2J6HA 1EK1A 4J3FA 4CM8A 1UDXA 5D85A 3VUFA 4EUNA 3IVCA 4HEA1 1TCAA 2WTEA 1DC7A 1HYHA 3BYZA 1J5PA 2AG8A 5EE3A 3TW8B 2EL9A 1MHTA 5AI5A 1C50A 2FPMA 1Z2NX 1F2TA 3D54D 5AUNB 1YVPA 1Z2EA 2IC5A 3IBSA 1R4ZA 4OHVA 1U4SA 2G8NA 3FXAA 3Q8XB 1Q3HA 4R2IA 3MWDB 4KI0A 4EFNA 3G79A 5DNEA 3WLQA 3UF0A 2G63A 2VJDA 4V39A 4C7OA 1I2MA 4LIPD 2CYCA 3JATB 2JPDA 3LPNA 1BJTA 4QOJA 4RWEA 4TMFA 5CVCA 3ZK8A 4A0FA 1X7XA 3Q2OA 5INTA 1P9LA 2RFLA 3Q10A 3Q3HA 3TFQA 2QP9X 1VCMA 3AF2A 4PQEA 1DLJA 5DOZA 1JQ5A 1T2VA 1T8YA 4R6XA 1I4TD 2C2HA 5K3BA 1O8BA 2QRQA 1OLXA 5LBIA 2BCJQ 1PJ2A 1OBFO 2YRXA 4IKOA 3UW1A 2PGJA 3BB1A 1JQBA 4KFTA 2C00A 3ORSA 2C82A 1H8HA 5TE9A 1TJ5A 3PQ8A 4U2EA 2HFKA 4RH0A 5K5EA 2POQX 2PV7A 1F06A 5B58C 3PIRA 3HJBA 1EDZA 3RKRA 2JIDA 2HBZA 2ZIVB 4URYR 3CVWA 3TOCA 1BHSA 5JH7A 4ARZB 1N36B 4ITVA 1PG2A 3MUNA 4RS4A 4XQ9A 3NNSA 3DDOA 4YR7A 5LB2A 5JYEA 4QM7A 1G60A 2BP7A 4B32A 3WA7A 2YJ4A 2PVSA 2R6AA 2Z1DA 3KYIB 4LHYA 4UQPA 5BRAA 3EIHA 2GUWA 1LC0A 2ZTLA 2D62A 1I13A 1A98A 3HM2A 4IDPA 5LLDA 4PIPA 2A9JA 4MI3A 4WXPA 4V2IA 3O91A 4MQ5A 3KBBA 3OFVA 2JFBA 3P2IA 4C89A 4BAUA 1OU0A 5ICEA 4R3UC 5F21A 4JB2A 4ZAWA 3BSSA 5LZ5A 1DCMA 2XRYA 3BE4A 3G2JA 3AUJB 2QS9A 2YFYA 3ER9A 3A1NA 1QR2A 1JYSA 2FEXA 3V8MA 3SLKA 1HE4A 2P3SA 1X74A 4ESEA 2PUHA 4L4SA 3RFCA 3SC4A 1TVMA 1SG6A 1ZU4A 1YBMA 1X6VA 3EVNA 3TVDA 1JHOA 1R3DA 1NVUQ 3ILSA 4Q0MA 1TW3A 1DEKA 4BNLA 4CM6A 5A02A 4RF4A 3QSYA 1UZLA 4XX0A 1I4WA 4N39A 4AY5A 1TAHA 2AJCA 2VATA 1Q0TA 1ISSA 3L9XA 2JAPA 4OHBA 4RF2A 5DK6A 3SOZA 4FJ2A 1P4SA 3QPBA 4QBFA 3NM5A 4RY0A 3O2SB 3OE1A 5DT2A 3MBIA 1FVFA 4YJ3A 4EAQA 4NFHA 1C3OB 1PFVA 3BQMB 3QVXA 1D2HA 1Q0RA 4ZTBA 2H65A 1WETA 5HGJA 4MEBA 1BO6A 1RTKA 1S7CA 3H3FA 3MGCA 3PLRA 4PZDA 1E3DA 3J81A 1YZQA 2OCKA 2ZBUA 4KAXA 2FUG1 2J4CA 4U6NA 5JZOA 1WUIS 4YQYA 1SK8A 4DCUA 2OWDA 1D5WA 4MS3A 2VXYA 2A1UB 4HAIA 4NCNA 5A05A 3EXG2 5AKEA 3V4PB 1AGYA 1MV5A 5IH3A 3OY2A 1F4PA 3BWEA 1YE5A 2CLOB 1JUDA 2VUTA 3H6KA 4TS9A 2CFCA 3RYIB 4BCDA 1E1QA 4AECA 3GPBA 2HT6A 3RYCA 3RVKA 4KH0A 5TX7A 1JKIA 4MI9A 3AY6A 3ROXA 3ROZA 1UT5A 1QZZA 3EIUA 4OFBA 2PVCA 1P3JA 5B57C 4L0QA 2PE5A 3LYLA 3ZWWA 1MG0A 1RQRA 1CB0A 2D2EA 3UO8B 4G26A 4OO3A 3JTEA 3KKQA 3M33A 1ZPDA 4BXOA 3GRUA 4OAOA 4CXMA 3UPTA 2R96A 1UDBA 5FBVB 2ZZMA 4FDUA 4P4SA 1I1OA 2YQ5A 4B31A 3TB4A 1MVOA 1NQOA 1WCYA 3LP8A 1DO0A 2AR9A 3W5HA 3DL2A 1E96A 4IJ6A 5EE5B 4XIIA 3AVWA 1XUOA 1H2EA 2Q3DA 4DLNA 3GFGA 2C1XA 4FZ5A 4Q4JA 4A4DA 1N5LA 2QTGA 4YMTA 4ZRDA 2P77A 5A5FA 1E3TA 1ECCA 4NJMA 4C3UA 1Z22A 4B44A 2HJHA 5DLQC 3RS5A 2UVPA 2OEPA 2BRUA 3ZH9B 2FWRA 2YDYA 1I4OA 4F84A 5CDFE 4RVFA 4X1OA 3RHTA 3CIOA 4US1R 4Y2HA 3PPYA 4CN8A 1RJ9A 2WYIA 1QGYA 3EA5A 3SYKA 4HTFB 1N1DA 4Y2RA 5EP2A 1P4GA 3BMOB 3SICE 1KDVA 1BE1A 1XRLA 2IOYA 3WBJA 1MX3A 2VJBA 2H57A 4HGRA 2GEUA 2HQBA 4BO2A 1BDBA 5AHOA 3E35A 2W2PA 1L4HA 4RIIA 4BQQA 1TOAA 2GPSA 2FZGA 4RA6B 4MS3B 2UYQA 4ZALA 2E6UX 5B30A 2RHRA 3FNGA 3IOYA 1L7PA 1JXMA 1U0RA 2YV1A 3KEOA 4EPWA 3CRVA 2WILA 2VKQA 5KWSA 3ADPA 1XNHA 2BEJA 3BK1A 3OZUA 4QVKA 3WLNA 1PEKE 1NLMA 5JFOA 1IIRA 1XKTA 4PAGA 3NWBA 4LECA 3MWKA 2C92A 4INOA 1PVOA 1U2RA 4JGGA 5E3IA 3I6ZA 3ZPXA 1MC4A 1YUMA 1NJ2A 2FYTA 1DMSA 2BKLA 4UTVA 3UXEA 2C5LA 2XWPA 2CHUA 2Q3BA 2YJ6A 1WVGA 3RJTA 4GSKA 3GLVA 1QRDA 2C31A 4B7CA 1OUMA 2NV2B 4Z7NB 4C05A 1OFHA 1NQUA 1QC5B 3W4KA 3B6KA 2DPMA 1Y1LA 3GARA 3N6VA 3QF7A 4ERNA 4IICA 1Y8QB 1VCIA 3IEMA 1DAHA 5J4YA 4UM9B 3CLTC 5DH9A 2ZJOA 1E79A 1ESNA 2OZPA 3BGIA 1RJEA 4KRYA 2QGZA 5DB4A 4HADA 3WNVA 4YHBA 1SOUA 1M6EX 4Y7CA 5EQFA 3GJ6A 2G72A 2IFTA 4TRNA 3LVRE 4M9ZA 5FKJA 5G0SA 5CA0F 3FCAA 5CYGA 5LMCA 3TIIA 1GVHA 2I34A 4TRRA 5I7SA 3KYBA 4AMBA 4LJ7A 2GJKA 2PAFA 3I05A 3A6KA 3RIHA 1BZYA 2PUWA 1HRDA 4FZ3A 2XI4A 4G86A 3RVLA 4XIJA 5GVSA 1FJ2A 3ZUPA 3EJ6A 5AVUA 1TB4A 4H16A 1EE2A 4OI4A 5HA5A 2BHLA 1F17A 4RZHA 1A8HA 4OUDA 3Q41A 3FAZA 2N1BA 1U31A 2VUUA 3NIBA 3RYIA 5B64A 2E48A 1TADA 2P65A 3OLCX 4F45A 1QZTA 6GPBA 3WLAA 3VSEA 1QHEA 2C4MA 1BJRE 2J9ZB 5TF4A 2PHZA 4RA6A 1VCOA 3UJPA 2ZDQA 3PC8A 2F2TA 2P41A 3EF0A 2ERXA 2JS7A 1L7NA 3HKEA 3LVQE 4TN1A 3SZOA 3VBCA 1PP4A 1LPAB 2F17A 7REQA 1DOAA 3IMFA 4HBGA 1XJ0A 1TM1E 2K4MA 4NZ9A 4A26A 4P22A 3FKQA 4G5XA 2P4SA 2NYAA 4RU1A 4JJAA 3FNEA 1SUEA 1NP3A 5BN4B 3H1FA 4K2AA 4JMLA 4HH4A 1CUXA 4P3PA 3GVCA 5JQGA 3ESYA 1B2LA 2QD2A 3L1JA 5ADUS 3TVTA 4ER5A 3MTIA 5AHXA 4A6XA 1FQWA 3FVRA 3HLYA 5ALGA 4CG2A 3DGFC 4PG8A 4AWAA 1JT2A 2P1RA 2RHBA 5CDUA 2WT4A 4WKCA 3PGXA 2B94A 3FYSA 2OQ2A 1GYQA 4LZAA 2ZIAA 1GAXA 3TKLA 2B8WA 3OQMA 4RE6A 1AJEA 4BMSA 2G28A 3Q88A 5BXYA 4X1KB 1NN3A 2GAIA 4IXNA 1SC3A 2G83A 3C1UA 2Q1YA 3EBOA 2WFLA 3NUGA 3DLAA 3PHHA 4L0CA 1C0EA 2JEYA 1EGHA 3ISJA 1GO2A 3OJOA 4YI3A 2HREA 3MHPA 5A5EA 4TQGA 2POCA 4QTZA 2X9LA 3ETEA 4B45A 2W2OA 5DLEA 1PJRA 3BM5A 1TQDA 4O29A 4AZ3A 1IN7A 3UMYA 5DN9A 3NVAA 4BV3A 1W36B 1T3LA 5DE3A 4BWGA 2AB0A 1H1LA 1EXMA 1QHYA 2QZPA 2FNAA 3ESQA 1PZEA 1V5FA 3F7OA 4I1RA 4YBZA 3SQLA 1YZUA 1OKKA 1ST3A 2GS9A 3QBEA 1Z7BA 5IJZA 4ZVQA 5EG5A 2C9MA 3RVNA 3SHOA 2XBMA 3BWVA 2XCUA 2GMWA 1XRNA 3EXFA 1DG3A 1LPPA 4DDMA 1PV4A 1I7SB 2Q3HA 2G36A 2AWOA 4FI3C 4N5IX 5A3VA 2Q6OA 3SIWA 2NZXA 4FFVA 3EPJA 3OX2A 4IR7A 3ZJTA 4KR6A 1G59A 3IMCA 1X80B 1V48A 3IOMA 3KEQA 3HFSA 3DMTC 3AKCA 3IDFA 1E1NA 5ESXA 2FSSA 3RJMA 3WLEA 1HLDA 1YIAA 4QYTA 1Z2AA 3HSKA 4F8EA 5JLJA 4C6SA 8ABPA 5IMSA 2XOKA 2BT4A 3DDWA 3FUTA 3GZTB 4N5LA 4TKZA 3V8EA 4AZ0A 4ER7A 4HFMA 3S2YA 1IRXA 1CJCA 1IK6A 1OA0A 2XMPA 2EX1A 3WTCA 4P5DA 4S1NA 3V48A 2CEKA 1HDXA 4HGQA 5CH8A 1OQAA 4R2MA 3UH0A 4PLVA 4PZLA 1K5GA 2ZU6A 4DR2B 4X66B 2BFMA 2YZMA 3ETCA 4IO1A 2BGRA 2H31A 2LDXA 2O5RA 1O96A 1V4BA 4OP2A 4H7EA 5G4LA 4GAEA 1JFVA 4OATA 1DFIA 3HN6A 1RJFA 2HL6A 4QODA 5E6SB 1DC3A 1P0IA 3PNPA 4L72A 2V97A 2JFUA 3HR4A 2PLWA 4C43A 3D6AA 3E9EA 1IUKA 1EKXA 4JBNA 1V9CA 3AH8A 1DIRA 1NBMA 2I99A 4QO8A 3TI7A 1SVKA 1N5RA 1X1DA 3WHIA 4HEA6 5I5GA 3NAMA 2CVQA 2M6SA 4K03A 1QHGA 1RP1A 3HEBA 5TMEA 2PD4A 1B6RA 3ZWDA 5E3HA 5JXHA 3P32A 2DFDA 4CF5A 4O25A 3LCRA 2G77B 4J1QA 2Q3FA 2XCQA 3OTQA 4PRKA 4YIHA 5K7SA 3B82A 3DVQX 1TVKA 4LS3A 2O2JA 1CLUA 1XCBA 2HXYA 4LAFA 3FPAA 3Q98A 4Q47A 1S2MA 3JZAA 1T3TA 1I7PA 5AH0A 3RHZA 4JOCA 3SE7A 1HFJA 3HUDA 3NH6A 4DWOA 4C7VA 1JR3E 3LSYA 1K4YA 4ZO8A 2BEKA 5CA0A 5AVOA 1GUAA 2IF2A 5BN4A 3LYAA 4ZAZA 5EJ7A 2YWRA 5AJXA 2OHFA 2V6FA 2BZGA 5IJ0B 1KPIA 2FP4A 4E3ZA 4D99A 2XE7A 2JJMA 1NV9A 2VAPA 4I66A 2C0CA 4HXYA 4AZ0B 4LY0A 4QHTA 4DDHA 4ZYLA 1XNQB 4NOJA 1H0RA 3GIWA 3ICEA 5I5EA 5IZCA 1EE9A 1T2FA 2F1RA 2R48A 1JJIA 2PWYA 1E20A 3M81A 1N6OA 1GL7A 1FPMA 2BWJA 3BSWA 2G6TA 4M1SA 5DTQA 5EYPA 1GQSA 2FSHA 2QZSA 1RE1A 3OQPA 2OBYA 4J0CA 1HLGA 1JVBA 4QEKA 1SKBA 2PLRA 4HNAA 2PMEA 1QH8A 3TQFA 2D8MA 3R9KA 4MULA 2X7JA 1DDIA 4P08A 3ZWKA 3DDZX 1Q50A 2AKYA 2IIBA 4N82A 1QONA 4H1VA 5BWCA 5KYYA 3LQFA 3ZNOA 3ZEIA 1S3IA 3WMFA 4BEBA 3WAGA 1E0AA 2R0QC 1Z5UA 4F60A 3U26A 4HWTA 2QPLA 3H97A 1Y7TA 4MQMA 4ZCMA 1EVEA 2YWDA 4CQLB 3GBVA 3IESA 1L4BA 2ZB4A 3PDJA 1IY0A 5F51A 4AS1A 4MRMB 1HQKA 1GPBA 5KYUA 1EK2A 2DUWA 3DWEX 2Q6KA 1KI8A 1SEVA 4M99A 4GPAA 1JWBB 1PNVA 2UUOA 4R81A 3RRBA 4K6KA 3PPWA 4WZBA 2BKUA 5JSHA 4TMZA 4WLOA 4Q3EA 4CJXA 2II6A 1CERA 2ZI4A 4WLNA 4F6RA 4DV0B 4P0QB 3Q9LA 4NXNB 1GZ7A 2IUFA 5JZVA 5IT0A 1FMCA 2Q5QA 2HJ9A 1QU2A 1Z4PX 3HLTA 2J59A 3AJEA 3QBJA 4HPWA 1Z7WA 2CLDX 4RQUA 4X00A 3ZTWA 3DNFA 1R3UA 1XDGA 3S70A 1I1NA 1GYPA 1Y4DE 2GN4A 2I67A 3ZBTA 1BEZA 2NVUA 2CUTA 2UYOA 2RB5A 5BQPA 1QKJA 3AM3A 1VFPA 1I9GA 4DJEC 1T6BY 5TNXA 4B3SB 4DEXA 3K4HA 5IT5A 4RHTA 4ZEWA 4KFRA 5L4LA 4YO7A 2HLPA 4YQFA 3AVXA 4Q02A 3AVPA 4EWLA 1IBLB 4BVAA 1N6KA 1C8BA 3FDIA 3KEMA 4RPIA 1K08A 4UHFA 4ZVSA 3M34A 3CZPA 1GWNA 2HK8A 1PWHA 4UARA 4YJ2A 1TMGE 1ESCA 2DU8A 5FX2A 2RE8A 2V7WA 3KG2A 2FEMA 1NBME 3HCPA 4M7PA 2HCRA 1ZKMA 1N0UA 1X1RA 2FLVA 2JLBA 2IPNA 4FCWA 4GD3Q 4NE7A 3JARA 5IMBA 2IX9A 1FZQA 1QNFA 2CFIA 3GNLA 3UMMA 1NN1A 5T64A 1Q83A 3G0IA 4HN9A 3MT9A 2LVBA 5ICMA 2HU2A 3D4BA 2QDXA 4V03A 1PQWA 2BM1A 1CQIA 3ILVA 2YZ7A 4XR4A 5HF9A 1YRHA 1UUFA 5LWHA 1X7YA 2BTQB 4RY8A 2GAAA 3ROGA 4RPJA 3NBYC 3K8ZA 4DTIA 4I6GA 4CDGA 1EJBA 4Z3DA 4CMKA 2JJ1A 4KQ1A 4OB6A 2BMJA 2QM7A 1IOLA 1WHTA 1LPBB 1J90A 4E6EA 1PQUA 4OGKA 4TTAA 1Z25A 2QSZA 1Q14A 2OFOA 3SC3A 4JA0A 2J0EA 1KMQA 3KVOA 5T4BA 3ZI0A 4G5GA 3SS9X 4P81A 3DBIA 4C08A 4YCJA 1U0BB 1MIHA 1YV9A 1IPHA 4DR7B 1JV2B 4WNIA 3MPUA 2FOIA 1G7RA 5FFNA 3S2FA 4JY7A 3NMUF 3IDZA 2GCPA 2OV8A 2HA4A 4HNVA 1U6KA 2V7VA 3IBGA 1UPUA 2P40A 5IC5A 1NATA 3V3TA 4PX5A 5EUBA 5GWXA 4G1FA 4B6EA 4HAWA 3ZLUA 1EVYA 1J09A 3JWJA 3KCNA 1TUBA 2TRSB 2PS3A 4JL8A 2BFWA 2HADA 1JU3A 3EGXB 2ODPA 4HBZA 5EIBC 3UA3A 5K3EA 4DLYA 1CR4A 4MV5A 1EUCB 3CU5A 4HNAB 2CHFA 2WT9A 2WDZA 4LE0A 4HDKB 3SS7X 1OJ7A 3W5JA 5AVKA 1EIWA 2FFRA 3B7GA 1EP3B 3BHIA 2V8OA 1P72A 3D2LA 1AM4D 2F43B 4NJEA 1J9ZA 4XD2A 5JT1A 2X4DA 2GEKA 5CDHA 2JIZD 1XHLA 2UVQA 2H0AA 3GEMA 3QTTA 5CK5A 4CMIA 1R0BA 2EZ9A 2VYQA 4PINA 1RHRA 3AEQA 1J24A 1SBZA 1ODTC 2MYNA 1GKLA 2O3SA 3I5UA 1T2AA 3MILA 3TD9A 4BEJA 1U8TA 5CLFA 3NGLA 5AJWA 3RI3A 4MRMA 2FEPA 5BNTA 1A5BB 5AW7A 1C9EA 5BRJA 4MCHA 5DX1A 4EB6B 2E87A 2VYFA 2I5PO 4EB8A 5CFRA 3SP1A 3DEFA 4EUEA 3QUSA 4F9GA 3I1IA 3LKZA 3SJUA 1BN7A 4LXTA 3VTAA 4ALKA 1G9TA 2FPIA 3FTFA 1WSDA 1OX6A 1Y3CE 5FO0A 3B12A 4X44A 5FFMA 3TSCA 1SVWA 3THXB 9ABPA 4JENA 2OZKA 4W4TA 1STOA 1F6WA 2ZE5A 2PCJA 5FLEX 1D2MA 3SSAA 3OFJA 1Z6PA 4LKOA 5CJ2A 3QZUA 3M6MD 7ADHA 5IG2A 1FFHA 4TX1A 1ABBA 2X5OA 4BFCA 2J7PA 2ZI5A 3K0BA 5HUHA 2P6OA 4JQSA 3FFTA 2GM5A 4R9SA 1IEVA 4HPXB 5K0JA 3EOAI 3OT5A 1YS4A 3WSTA 3CUKA 4EKYA 2TMGA 4YJ3B 3RS8A 4CLDA 3H04A 4XCVA 4CKCB 1PUIA 1C3OA 3I42A 5BMVF 2W6CX 3OP4A 2A0FA 3OJFA 2ZRQA 5D3MA 2GPJA 5A5VA 3Q6NA 3QFSA 3WMRA 5FUXA 4DG5A 5CB6A 2HJGA 2DOKA 1NVAA 3GJRA 1HOTA 2VJKA 3OECA 2WKQA 4D3ZA 1W36C 1U2GC 2AXNA 2VBFA 1PQYA 3D5EA 4OGGA 2ONYA 4Y9TA 2DM6A 4ISBA 4H7DA 5EMKA 1EUCA 2GXQA 5BV8A 4L08A 1NLUA 4PYKA 3OQJA 1PX2A 5FLXA 4NNOA 1V7PC 1XDDA 1NBWB 1S2GA 1JG1A 1RAAA 4DW8A 1E2QA 2WJVA 1MQ9A 2YWXA 3E8SA 5EE9A 5ALWA 4F7DA 3A3PA 2NNWB 2NUTB 1YK1A 2WKRA 3CB2A 5CX4A 1V16B 1OE0A 2P6UA 3HY4A 3B3AA 2O4CA 4DYDA 3NHMA 3ZE1B 8AT1A 3C87A 4X8MA 4XIFA 4Q7QA 3U0BA 3BFVA 2VO1A 3CNQS 4YMVA 3MA0A 3L6OO 3MLEA 1MR3F 1VG1A 4AY2A 1L6RA 2A88A 1VHLA 2B4RO 1MENA 3QXHA 4ZVRA 4JUIA 2QLJA 1EFKA 2JIZA 1W5TA 1NMEA 2PL3A 4O2AB 4QPDA 1IBRA 1Z0SA 4R83A 4OQZA 4ZXPA 2BFEB 3G2OA 3K9QO 4QICA 3TVYA 3TFWA 3WFJA 1WUKS 3IOCA 4AFNA 3WMEA 1CETA 3ITKA 4J07A 1B76A 5AHWA 3WQSB 2EZ4A 2D1TA 3C24A 2VDOB 4QFCA 1Y81A 2DUMA 2WBLC 2R79A 1BA3A 4YV1A 3BZBA 4NG5A 2LUOA 2ODTX 3CTPA 3CN9A 3KDAA 1HDEA 3BCRA 5IVIA 5IBCA 5L3VA 5JNWA 2IYPA 3UJNA 2KYRA 2A86A 3G2QA 2ZYSA 4HWSA 4RADA 3BH0A 4X71A 2OCGA 1N7HA 3DZIA 3K3PA 3F5QA 4D74A 1XAHA 1PZNA 3TUZC 4C4ZA 4EATA 2LWIA 1F0PA 2QQFA 1CNEA 2WAXA 3P1JA 3PC7A 4TTVA 4TL7A 3VUEA 3I6BA 1MVLA 2C04A 2J9GA 5ALIA 1XCJA 2OTCA 2AFHA 2AN9A 3L92A 4LKRA 3KR2A 3D8SA 1CDEA 4Q21A 4YCNA 3LBAA 3CE6A 1W5SA 1ORRA 1ONNA 3CT6A 3NB0A 3QPDA 1II0A 4CF4A 1YWGO 2P4QA 5JNVA 2RHMA 3F6SA 4CVNA 1FS4A 3FDXA 2GN0A 2HXGA 1YVUA 4QRIA 1FLAA 1SKQA 5D1HA 3CUTA 1Z9BA 9MHTA 3GJ8A 5KNDA 4DNFA 1UBCA 2X0KA 4ZA2A 1CS0A 3P7MA 3BGWA 1QHXA 1QVRA 1UM9A 3OIYA 4HNSA 4HX5A 4MARA 3ASZA 3RC2A 1PSWA 1M66A 2E4VA 2H4JA 3QOWA 4H3SA 2XNHA 5JVDA 2X76A 1DCFA 4RMNA 4QUHA 5JTTA 2GD6A 3MXOA 4C4RA 4QHSA 3HXQA 1L0BA 4ZGBA 1G1AA 3LP5A 4MV9A 1T9HA 3ENWA 2JKZA 4X91A 3RHSA 2DLNA 2GEJA 4C6RA 3FDFA 3P20A 1XN1A 3LXXA 3SLRA 3LCUA 5JY6A 4LY3A 1YO6A 3SZLA 2R4QA 1GEGA 4BNZA 3FZNA 1QBKC 3FWYA 3R2JA 4JAVC 4B7ZA 3WGYA 4GEKA 2XCRB 1MB2A 4ZAFA 5ABPA 4WE3A 2DUJA 4A91A 1YQDA 3OX4A 3CRMA 3OF5A 4WESB 4XEUA 4AYWA 4YAFA 4EJ2A 1YR2A 4D57A 4LWOA 1XC7A 2W98A 2CHEA 4BQPA 4ZYVA 4W1SA 1TA0A 1U28C 3SKVA 4NZNA 3U9TA 2BHRA 2GA8A 1DXOA 1ZSYA 1ZM9A 2WTBA 3S5UA 5I9NA 3UVEA 1BS9A 3HKCB 4RA9A 5GIPE 1VJTA 3VH2A 4J0HA 5F7XA 2I80A 2VP0A 3URMA 2H7CA 4B6OA 4DJTA 3QA9A 3KWLA 4ZOEA 5ETJA 3KAQA 2A0WA 1OFGA 2G82A 3ZHCA 4W5TA 1E64A 1YGPA 2O8NA 2YZNA 1LGYA 3PE3A 4YY3B 2ZW9A 2CBGA 2IEDA 4J0KA 5DGIA 2RGAA 1LBTA 1N9KA 2AJ8A 2RGEA 3NIDB 3O82A 1N9ZA 2WI8A 3LPAA 2OORC 3W1EA 3X1WA 2OGUA 4J6FA 4GECA 4FOTA 5TVGA 3V42A 4RVOA 3T7IA 3F73A 4N3GA 3FWHA 4PC1A 1FDTA 3ITNA 3ITDA 1RC0A 1U5BA 5JXWA 4ZT2A 1FP2A 2ZYHA 3AVOA 1SPBS 3CZQA 1DT3A 1LEHA 1TGYA 1W0CA 5K05A 1BOFA 4JI2B 3OTGA 5MFPA 1D1QA 1NQWA 4CMBA 2CJYA 4BE7B 3DZHA 1K92A 4PEVA 5CFOA 1J20A 5H7XA 3DL4A 1G20B 1ZJ6A 2CLLB 4K5QA 3SVLA 4QIHA 3ZE6A 4PSAA 2J5RA 3K1AA 3ENNA 5SYAA 5EXPA 2GD2A 3D6NB 1QDUA 3JD2A 1LDGA 1EX9A 2Q2VA 3FM9A 4IVRA 4J4TA 3V4FA 1NZFA 1EVKA 2VRBA 3NAQA 4M1YA 1FSFA 2P2LA 3W2FA 3DLBA 4YCSA 2VYCA 5HGXA 3D6HA 2GEVA 2WVAA 1GT6A 3D3WB 3T54A 2FVXA 2L19A 4U39A 3LQRA 5HILA 1H5NA 2DBYA 2D0PB 2GHTA 3MQ4A 4WCDA 5AUPB 3E0QA 2ZG6A 4H6WA 5KYNA 2Y1FA 1O94A 3C3PA 3CUYA 1DIGA 2FDXA 2VKTA 3CO5A 2BIFA 3FETA 4DL9A 3DW3X 3BTUA 3A1SA 4NU6A 4PWZA 1BYIA 4A73A 1WS6A 4UDYX 5BWNA 2WD8A 1IG3A 3TPZA 6LDHA 4M38A 1SK9A 3GXOA 4MGYR 1A3CA 1PL8A 2D74A 4B6RA 4HV4A 3FYTA 1RXCA 1P60A 2HY7A 3HCOA 4YJ3F 1W35A 3JALA 4RPLA 1Z56C 3KQKA 1JEOA 3RWOA 5D84A 4YUAA 5M34A 6ABPA 1C1XA 1FU4A 4A7PA 3LYUA 3F90A 3ZHXA 3AMVA 2IS2A 1GNPA 1JG2A 1YULA 2J3EA 1C0PA 1I8TA 3U81A 2IHTA 3W5SA 3I30X 3ZDFA 1C9KA 3U7FB 3K9BA 3C41J 3ZW8A 4GDFA 4N3CA 3OZAA 1WD5A 3UXMA 4M86A 2YHIA 1X2EA 2HSEA 3U3OA 5HMMA 4JEHA 3LPLA 1C3VA 3TLEA 4CMEC 3WV5A 5FV4A 2HUNA 4K6CA 4F5WA 1U11A 5FYDA 3QY9A 4HWKA 1A9OA 1GGMA 2X6QA 5DTMA 4F5EA 2GXUA 4YAUA 1KAGA 2QD1A 4FMCF 4L9AA 1JW9B 1P0MA 1C1XB 2JIBA 5IDXA 3BB3A 1LSJA 3PS9A 4RA9B 4TSKA 4EF6A 1IOVA 1XAJA 1JIKA 4G8JA 4MW7A 3SBEA 2DFKB 3X43A 2EBFX 5CM9C 1XA4A 5JW6A 2AH5A 2A59A 2QTVA 2WHEA 2PH3A 2O9JA 3CH6A 1Z5VA 5DLDA 3RK1A 2HU5A 4KO1S 4MVXA 3CKKA 2FP3A 1GUFA 1ZNZA 1GFZA 1SXGA 3PXGA 2XUGA 1RKVA 2TMYA 3IQFA 4M0MA 2VDVE 3D3EA 1YJXA 1G8YA 2FF7A 2I6UA 4RQTA 1A9YA 4B4VA 3INRA 1QOQB 2C4TA 2IGBA 3URKA 1M67A 2EBHX 4TZ0A 2VAWA 1ML3A 2XLCA 1O89A 3FHLA 4Q7MB 4BVEA 5CA1F 1SHJA 1YOVB 4JX9A 5GJCA 4Y8VA 4REQA 1C3XA 1PGPA 1Z5GA 2QGNA 2XAAA 4CM7A 4HCJA 5JAMA 5LXTB 2RSLA 1CR6A 3H86A 4KQIA 1XQYA 3OA2A 2VXCA 4M1MA 1VL8A 3E84A 2RHOA 4YEDA 5J2TF 5EHXA 4ZYZA 3D8BA 4RVUA 2VS1A 3VPDA 5BQFA 5BV1A 3KV3O 4TUYA 2QU8A 2GN8A 2Z2IA 1I1QB 1ZVQA 4OQLA 1E62A 2G70A 1XDZA 1OLUB 3NT2A 4US2R 2QVCA 2IH5A 1YXMA 4D9NA 5HIMA 3VH4A 1YFJA 2NU7A 1Z47A 5F2EA 4FOSA 3CUEF 3C7DB 1C1DA 3RYFA 4IIEA 2ZM6B 2DPXA 2WWRA 1NPYA 1RQLA 3OT1B 4FNAA 4OB8A 4US0R 2YMMA 1SKAA 1A5SB 4IIJF 4IINA 3T5DA 4QUIA 3LHFA 4C0SA 1TXGA 4RGQA 5E1MA 2IDMA 4RGVA 2RI6A 4BX3A 4Q7LA 1BS2A 3KR1A 3UH1A 4DZZA 3UGJA 2YJ5A 1H8HD 4D92A 3O8DA 3N53A 5ESWA 4YCLA 5K03A 2HN9A 1DJQA 1M6YA 3HNPA 2H9IA 3LT0A 4BO4A 1MORA 2XMBA 1UANA 1QKIA 4AZWA 3H2IA 4IJVA 3ZQ6A 2PKWA 2X2EA 4B9AA 3RYTC 1JEYB 4BMCA 4ILKA 3GN1A 1VC2A 2VH5R 2E55A 1JL3A 1NASA 1YZTA 2IHZA 3SK0A 3G68A 1VSVA 2WFLB 1Z8HA 3UQZA 3WL5A 2Q07A 1KBQA 2CNNA 2H54A 1H85A 3OKPA 4JI7B 2GRJA 4GMHA 1EXWA 3N2NA 1EEHA 1V6CA 1EJ2A 1T36A 2D1FA 4JR0A 4PAMA 3ZE8A 4QGSA 1NYQA 2ANBA 3HJTA 3K6SA 4QJBA 1V4NA 3CCBA 5EUMA 4FX2A 5D6OA 3WGJA 3S1SA 1FDWA 1N4DA 1ZNQO 5EQTA 4DCPA 1HX7A 1YCDA 3A6ZA 3KALA 4K1LA 1PX0A 3ETHA 3W3AH 4EPRA 4EHJA 5KNBA 3GROA 5LU8A 3RUDA 1B6GA 1CQWA 2YIVX 3E03A 3NHUA 1EJ0A 1FNCA 1JFFB 2WHYA 5E8JA 3QH4A 4B8ZA 1FFCA 3GLGA 3ROMA 3Q8KA 4WJKB 4LSWA 3U09A 1LPSA 4ZKDA 4P6VF 2J3KA 3KFLA 5A9RA 4N76A 3I1JA 3MUEA 2G8LA 3CS3A 3O74A 4I1OA 4Y67A 4PHGA 2F3UA 2GFQA 5E3JA 1PAUA 2HI0A 1Z4JA 2X42A 1TZKA 1KORA 1H05A 2HGSA 3N0TA 1KDTA 2C83A 2O06A 3I1FA 4JP2A 4OAQA 3S5JA 3VVLA 4N01A 3D64A 4JOSA 2YFHA 2YVKA 4MV8A 5LPNA 3HJRA 1U8CB 1IXSB 1ZGHA 3L18A 3S2UA 4EJMA 1F8XA 2QN8A 3I8SA 3USZA 4ENVA 3ESBA 4RJJA 2QTVB 4TM7A 1Y9DA 5KAPA 1HQYE 1M76A 2E6KA 2O2DA 3PC8C 1I0ZA 1H1LB 4E5SA 4JODA 4HRVA 1XTSA 3GY0A 2BDUA 2WAOA 2QYOA 3N05A 2BMFA 2ECOA 3KPJA 1ENPA 3KOYA 4AW9A 2QL7A 4OMDA 4XTCS 3TL6A 4G0PA 5GJVC 4OSPA 1I5RA 2JCVA 2AX4A 1IONA 1HSZA 2GO1A 4EMTA 2XE4A 3WBBA 4OQXA 4GPEA 4ZVMA 1I3KA 1C3LA 4EEZA 1JBQA 1RYNA 1QP0A 1B8NA 2BM9A 2KHZA 3QMVA 4FIZA 4EKDA 4CQLA 4B47A 1QS0B 4W9NA 1U8XX 1QXSA 5DN6A 5BYBA 4DCOA 3P8ZA 3FGZA 3NI2A 4EO4A 4EUFA 1GCAA 1XTQA 4G1MB 2G09A 3PUXA 1HSOA 1XO1A 3F5SA 3O95A 1K66A 3PPXA 4HLUC 1VYUA 4PSDA 4PYQA 4XFKA 4R5HA 2PGAA 5KYYB 1HE1C 1ZM3A 2JA2A 2D00A 2QAGA 3CKMA 3DBRB 4N49A 1FFDA 4UCXA 5LMZA 3CKLA 4QOSA 3AERA 2Q2QA 3U7HB 2C2XA 1P5ZB 1JHPA 1FW6A 3I3SR 4DA9A 1Z26A 1C0LA 1MFZA 3T34A 4ZAGA 4YAWA 1ZICA 3GJ4A 2W6PA 2O14A 4HVLA 3LY7A 4J3NA 2X8JA 1ZU5A 2JFZA 4HQKA 4LQLA 3WK7A 1SCJA 1O4WA 1P1RA 1C30B 4ME6A 2UUCB 3B48A 1AQJA 5A4MS 1M2OA 3D6UA 3D4OA 4JS0A 1RQGA 2RBKA 1PI3A 3ZJVA 1JDVA 2BBWA 3ZGVA 421PA 2EJUA 3A6GA 5FOVA 2W6IA 2X9VA 4FXPA 2D2FA 1HZJA 1J6UA 3OMXA 5DK4A 3S1AA 4RIEA 1F2DA 4S3MA 4TVKA 3WZ2A 5B6JA 5TLSA 4UOZA 3CPHA 1YRAA 3NOXA 2RHGB 5EJGA 4TTJA 3RIGA 1F5NA 4BNMA 3EC2A 4EJ0A 2QAIA 2WWVD 3W1WA 1TM3E 4R05A 4YP5A 4G8DA 2NPIA 5JDIA 3ANLA 3N8GA 1QH8B 3IP6A 2O8DA 3CLKA 2YWBA 1S8OA 2ZT5A 1K6EA 3IBYA 2UUBB 1JNYA 5CPBA 4K9OA 4ZVUA 2BSAA 1Z07A 3TLXA 5IC6A 3U1VA 4JBLA 1XRJA 2PBZA 4TT3A 1PJBA 1EFPA 4B5KA 4QQNA 4JWTA 5CM2Z 4B3BA 3B9PA 3TTXA 5ALFA 2NT3A 4MYDA 2AFIA 2A5DA 1P2UA 3QF4B 4RTPA 1ETHA 2BTQA 4PNZA 3A04A 3F8WA 3GA0A 3BWYA 3GZNB 5JD5A 3X1ZA 4G67A 2XYVA 5JXJA 4QPZA 1HWYA 2OFXA 1ZLYA 2Z9BA 4NTZA 1Z12A 4U8GA 1GA1A 2YWCA 4KQHA 1RW4A 5I7VA 3HDGA 2PZEA 4NG4A 5DNDA 3C3BA 3SU8A 2VZ8A 3UJAA 5LIPA 3U31A 2YBDA 3D0QA 4L5JA 5U1PA 3KUUA 3H5IA 1U2TA 3L0IB 4Q4HA 4Q9NA 1RAFA 1M8FA 4N3BA 4C1BA 4E21A 1E58A 1FDOA 3RF6A 4LXYA 2I2XB 5M5BA 1NF9A 4MITA 4BJ6A 3LW7A 2BW0A 1U1GA 4J43A 4N6OA 3N2GA 1N9GB 3EZLA 5LP6C 1JLRA 1Z74A 1QO9A 5ERYA 2PX6A 4G0OA 2C61A 2VH2A 3NT4A 5EVJA 2NUTA 3CEJA 3FKJA 5KOYA 1K4KA 3X3HA 3R8CA 2KJQA 4BKOA 1J22A 3N9IA 4CG0A 1KYWA 1IHDA 2TSYB 1N6LA 1JDNA 2XUOA 2WMDA 4QTYA 2PM8A 5J4LA 1X7WB 1TGVA 3MWYW 2JFYA 1MG5A 1QHHB 2C88A 2EYQA 1N2CE 2ZR9A 3CNOA 2HNBA 2HRQA 3DEAA 3N8NA 1Y7IA 1K5PA 1UJCA 2QAGC 2XH8A 4IGAA 5ECYA 3VDNB 3RLIA 1U6IA 2BFEA 4LDQA 3HBNA 6YASA 3GLGE 3BL5A 1D6SA 2R44A 1ECJA 4GZLA 2D7JA 5IDWA 4W9NC 3QU7A 4O6VA 3F7NA 1NW7A 4Q7EA 3A4VA 4OV6B 4LGVA 1D2CA 2H4WA 4O02B 4CEIA 2RIPA 1B7GO 2V59A 4LJKA 1BS1A 4C3OB 2BZSA 1OC2A 2Q6LA 2QUZA 1X1TA 2FSPA 4PYRA 3KO8A 4MUHA 1OH5A 1RJDA 1RYEA 1ZD3A 3RWMB 1XLUA 2CHVA 3V00A 1U2ZA 1RCUA 2AWNA 2PMBA 4MWGA 1FMJA 3EEOA 2ZB2A 3ISTA 4D45A 1X1EA 4AJ2A 5M29A 1BQEA 3ZWYA 2IHJA 2IS6A 3KJFA 1QRSA 2PD3A 3CF0A 3F46A 4YB8A 4GMKA 5DBOA 4ALIA 5C5DA 1X70A 3OC0A 4WIAA 2XY4A 2AN3A 3E27A 3FYCA 5DXAA 5BN1A 1SCBA 1Y37A 2B36A 2NTNA 1PTKA 3FUXA 3NDRA 2NYUA 4YC7A 5ILGA 5KDLA 2EX0A 3GGPA 1POXA 1D4AA 2YUIA 3G13A 5AM3A 4M2LA 1E9RA 1YUNA 3L0YA 2CGEA 3VPBA 4BLTA 2JLSA 2Q1SA 2NAFA 3DE6X 3IVRA 3ND9A 4NARA 1H3NA 3K9GA 2V4UA 4W63A 3A1CA 5B4UA 4C6TA 1E6CA 5CVVA 3GFVA 4JBIA 1JR2A 2BHTA 2IRWA 3AGQA 4L15A 1XJ5A 1ZGCA 4WNYA 2VNHA 3A9CA 4KAJA 4PPQA 4EPXA 2B30A 5JXGA 3H16A 2FPGB 1FJXA 2FUKA 3ESRA 3UMRA 3M49A 1J8DA 4H4CA 3RCBA 1I32A 4LC1A 3ROFA 4B4KA 4A2PA 3TW4A 4YV2A 1XZHA 4HNUA 1NV8A 2F8SA 4OD0A 3LH5A 3NJ4A 4KIJA 1VIAA 4OOEA 4PPFA 1RWKA 2FQYA 5FOXA 5K8CA 1T35A 5CITA 2CXPA 1K89A 1E89A 5FBKA 5ALSA 1XDWA 5HW0A 5SV2A 2J7KA 5LOVF 3FNQA 4KMMA 2ODWA 4HGZA 2EBWA 2ORWA 3DOIA 1ZGBA 3K09A 4GW3A 4MKZA 1MQSA 1SY7A 3PJEA 5EKXA 1W6RA 5FPHA 2QW8A 1SHTX 3H65A 4YV0A 1RRGA 2AUNA 2VJNA 3R7WA 1LRLA 4AB1A 3S40A 4I6EA 1P45A 3V6MA 4BV8A 1CR1A 1X39A 2P75A 2ZJ3A 1V8DA 3P0EA 4OHWA 5FPTA 3GCDA 2FCRA 4F3KA 4WBXC 3T3NA 2QL5A 3OOSA 3U4DA 5KU1A 1NFQA 1SIBE 3UT5B 1UXGA 1CWUA 2BR3A 2NVOA 3ONFA 4HVCA 3KB1A 1L6IA 2ZT6A 2D5LA 3ZDYB 2DT8A 4KPFC 1ZR4A 3OFNA 3EUFA 3UTCA 3FOCA 1E6EA 2CK3D 1X1QA 2YASA 4TKVA 4KPYA 2X14A 4U2KA 3BMOA 2HBRA 2PD6A 1N3BA 5E1BA 5JD3A 3VOAA 4A23A 1N2ZA 3AJRA 3TGPA 3PYXA 3COVA 4BASA 1S6YA 2J33A 3PU6A 3IVMA 4PPNA 3UIEA 4L5AA 2ATEA 4RD4A 4UVGA 1JWAB 5IBQA 4E0BA 5EZQA 4DQ0A 4JI0B 4V0OA 1NY6A 1XNRB 1DG9A 2C9DA 3F74A 4AJLA 3P26A 1UAYA 5T3UA 1NYLA 4DLZA 5LA6F 4EG1A 3UYLA 1QE0A 1Z7EA 3LJKA 1EWVA 3QVOA 5DHSA 3RANA 3FMFA 2CD7A 1A82A 1I01A 3L5OA 3DAHA 1R12A 2HPAA 2OHHA 3Q5DA 5B58T 2N46A 3CLTD 3HQ4O 1YDFA 3I2GA 1QG6A 1U7ZA 1JDBC 2NVWA 2P9GA 2XCLA 2OBXA 4RWZA 1NXVA 4KNYA 2FW9A 3SF8A 3LL7A 4CV2A 5FV7A 2F62A 2YIJA 4KQCA 1A8PA 2HDOA 3KKNA 3Q5EA 1PRYA 2EFYA 3EIWA 4PO9A 2GAFA 1ZVMA 4MMYB 2AS0A 1R0ZA 2P9HA 2OXTA 2NPFA 5HXAA 3COSA 3KT8A 3W79A 3RAEC 3MS2A 4O4LA 5F5XA 4F06A 3LVFO 3DOHA 4L51A 3ZYZA 3QHQA 2F67A 2R3SA 4Z3OA 4IIFA 2E5LB 1ULUA 3NHAA 4KTVE 3V7FA 5I47A 1K7SN 4C9BA 1AUPA 2PO5A 1GNLA 2Q3MA 3K70C 4LYDA 4BP1A 3QX9A 4Q03A 4H59A 3DZKA 1WE2A 5AW3A 3W2EA 1SUSA 2P2DA 3NV9A 1OSNA 4G9BA 1EWRA 2EV9A 2B6HA 2P0YA 5ALNA 3O4JA 1WUJS 1YBHA 4C0AC 4N48A 1ZUIA 2ZYGA 3C0KA 3GA7A 5ALYA 1YQXA 4M9UA 4DC0A 1VKZA 3PT9A 1SIWA 4COOA 2B4TO 4RFVA 4D43A 4MJXA 2OT3B 3H2SA 4K8RB 4BNNA 4GMGA 1OV6A 1YQWA 3AR2A 4H3VA 1H6DA 4OUDB 3U3XA 3MS7A 4CEJB 1WZIA 2YIMA 4XPIB 2UAGA 1M3SA 3ZY2A 1ADJA 1JKFA 3QKTA 1WW3A 5EJAA 1B26A 4IDEA 4P34A 3KKOA 3TEMA 4NU8X 1V8PA 4HB4A 1P9NA 3DBLB 3OICA 1D04A 3P2YA 3VNBA 1TJPB 5D5QA 5KOHB 2FPPB 5KBYA 2R87A 2ZP1A 2GOYA 2OM6A 2DCUA 3ON5A 2OY0A 4D9EA 5ALTA 2ZJBA 4XASA 4JKYA 5EINA 3E0XA 1SXIA 1G3RA 2JHFA 3IOEA 1UIRA 1JAIA 1YDEA 3OCXA 1MO2A 2E49A 3STXA 1L5WA 3I9OA 3S2ZA 4X7PA 1NX9A 4UTOA 1Z17A 4KG7A 2NZVG 3T5TA 2QMHA 3AUXA 2JGEA 3BTSA 3PX7A 5AMXA 2J30A 2XWJI 2FRDA 3CVOA 1F6BA 1DB3A 5CDGA 3P9YA 4ER3A 1R4MB 2C2KA 2WNHA 1PK7A 1P3DA 2ZXFA 1GPH1 3U3KA 4WOBA 5JZMA 4PCLA 4LF9B 2XMSA 3CH7A 3DBLA 1T1RA 4OLBA 2OBFA 1O2DA 2C98A 3KJIA 4MJ7A 2NO4A 1N2SA 3OTHA 3RFXA 1UKAA 2XYQA 2PQ0A 1XTRA 1J33A 2WHQA 3HEAA 5IBRA 3P9QA 3RKSA 3J7AC 2Y9PB 3H2KA 4OI0A 3EGWA 2JFFA 1ZBQA