2Q1SA

Crystal structure of the bordetella bronchiseptica enzyme wbmf in complex with nadh
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
351
structure length
336
Chain Sequence
b'NASKLANTNVMVVGGAGFVGSNLVKRLLELGVNQVHVVDNLLSAEKINVPDHPAVRFSETSITDDALLASLQDEYDYVFHLATYHGNQSSIHDPLADHENNTLTTLKLYERLKHFKRLKKVVYSAAGEETDIVSLHNNDSPYSMSKIFGEFYSVYYHKQHQLPTVRARFQNVYGPGEILGAGRWRGTPATVWRNVTPTFIYKALKGMPLPLENGGVATRDFIFVEDVANGLIACAADGTPGGVYNIASGKETSIADLATKINEITGNNTELDRLPKRPWDNSKRFGSPEKARRELGFSADVSIDDGLRKTIEWTKANLAVIEQIMRKHDSALATYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative nucleotide sugar epimerase/ dehydratase
molecule tags Sugar binding protein
source organism Bordetella bronchiseptica
publication title Predicting protein function from structure--the roles of short-chain dehydrogenase/reductase enzymes in Bordetella O-antigen biosynthesis.
pubmed doi rcsb
total genus 128
structure length 336
sequence length 351
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q1sA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2q1sA02
4F6CA 3D1LA 4BO5A 3DBHB 1SB8A 1DFHA 1PR3A 3PFFA 1SZJG 1KC1A 1HL3A 3AY7A 3ULKA 3ZWBA 5JFOA 4ZQFA 3WGQA 3VPHA 1B14A 4BNIA 1GZ6A 1WWKA 1GQQA 3O9ZA 4CMHA 2Q3EA 2RHCA 3EUWA 5IN4A 2BKAA 3KYDB 1JVBA 2VWPA 4WLOA 4M86A 4IY1A 5A4DA 3NDIA 3I23A 4GVLA 4XD2A 4N18A 2O3UA 4CM9A 3UOGA 2DPHA 2PZMA 3KSUA 3AFMA 3L9WA 4IXWA 3ZNNA 4BGUA 4FS3A 2X22A 1PEDA 2ZYGA 1IHXA 1B3BA 3TZKA 1P77A 3LVFO 1NPTO 4E31A 2UVDA 3H65A 4HKTA 4L9RA 4OGWA 2YFQA 2JD1A 2VT3A 2O4UX 4YJDA 4YAEA 4H16A 3UFXA 4HBGA 1I3MA 2AW5A 1K6IA 5FEUA 1LDBA 2Q1SA 4A27A 2CSUA 3D5TA 4R1NA 3VPSA 4EEZA 4GMFA 1AHIA 5KKAA 1B7GO 4XWYA 3U49A 3I9KA 3MJEA 1MLDA 2H63A 4CV3A 1Q7CA 3JQBA 3OIFA 4J7UA 5GMOA 2PH5A 1DDOA 1E3LA 1A4UA 1B8PA 1FDVA 1VJ0A 4ND3A 4XGIA 1P1HA 3WG9A 2W2KA 5C7IO 3ONFA 4PLYA 1QYXA 1BVRA 3LLVA 3U4IA 2OBNA 5F1PA 2NTNA 1LTHR 4TVOA 4EJMA 3OJEA 3UCXA 5IF3A 2D5AA 2J3JA 1N1EA 2JFFA 4IIUA 4UULA 1YB5A 1HYHA 4GBJA 1IULA 3WYCA 4D41A 2OP1A 3GFGA 4MINA 4TRJA 3SC4A 5JAIA 3ZV5A 2JD0A 1B2LA 3AK4A 4M89A 3ZDFA 1M6HA 2B35A 3DAPA 4UREA 1C1XA 4MVJH 5HTOA 2ZB4A 4YACA 2WDZA 3UKOA 3VH3A 4CODB 1DBVO 4IPTA 4Q3AA 3QA9A 3NUGA 4IDEA 5TC4A 4IXTA 1NHWA 4LW8A 3R0IA 2W90A 2I67A 3NRCA 3W8DA 1ZKMA 2WYUA 3K30A 5FYDA 1A9YA 3VKUA 5EPOA 2FRDA 3NJ4A 5TIIA 5A9RA 5DNAA 4MVJM 4OXYA 4DTIA 4DYVA 1Z82A 4FFMA 2JCVA 5AQ1A 1ZJZA 1E5QA 4MIYA 5AYVA 1X1EA 2X5OA 5HWSA 1PX0A 2C2XA 5C37A 1QR6A 2VTDA 2VYVD 3RUDA 1GZ4A 3EGOA 2UUPA 4NNJA 4R4JA 3BMNB 1V6AA 3IJRA 3D4OA 3CXRA 3AOGA 4ZD6A 4C4OA 3LC2O 1YE3A 3DWFA 5IZCC 2F1KA 5A5EA 1LDYA 5KCZA 1NR7A 1SOVA 3ROKA 3DR3A 1NXQA 4IQ8A 1PWXA 1R15A 4PLHA 3GEDA 5A06A 4BNTA 3IS3A 3E8XA 4INAA 4ND1A 2CVOA 1DJNA 3VH2A 1ZVMA 1LC3A 5FI5A 3HWRA 2EJWA 4F46A 2WWRA 5F1KA 1HDYA 1MXFA 5I7VA 1R37A 1IYZA 3WNVA 3VDRA 2X6TA 4BQRA 4OOFA 3PHGA 4DLLA 3GUYA 4XR4A 3TQHA 3K9QO 5JO9A 1X14A 5KTKA 9LDTA 2D1YA 5FFFA 2E48A 1V3UA 4PVDA 5ES3A 3PWZA 1Q0QA 3UW3A 2CD9A 3AY3A 3ETGA 1K2WA 4W9NA 1D1SA 4CLOB 4YAJA 3MJ4A 1I01A 2D59A 2RCYA 2Q4EA 3KO8A 2PKQP 4WASA 1SAYA 1D8AA 3SJ7A 5TX7A 2JL1A 3NAQA 3ICPA 4L4SA 4MVJD 4QECA 1UR5A 2ZTUA 3WFIA 2EEZA 3ZNQA 3EZYA 8LDHA 1NAHA 3PDJA 2Y68A 3EHEA 4KQWA 2C7VA 4XQCA 3D3WB 2VZ8A 1SBYA 3PIDA 3SJUA 2OBYA 1OC4A 2YHUA 3PHIA 3Q9UA 1NWHA 5G4KA 2DUUA 1CDOA 3AI2A 4CL8A 3HUDA 3UCFA 4WECA 1A27A 3K8ZA 3OF2A 5G4LA 1Y9AA 2C7GA 2CVZA 4CV2A 3GF4A 4E0BA 4D0SA 3GDOA 1U7TA 2QZ9A 4OM8A 4RVUA 4XYBA 3W4KA 3AFNA 3JQ9A 4RPJA 4RPKA 2NVUA 4ZQEA 4RVHA 2BI8A 1SPXA 5JMWA 4Y6PA 1FK8A 4IMPA 4OL9A 2E37A 3KSZO 4NHEA 5A3JA 2NU7A 3V5NA 2UV8A 4ZHSA 4XR9A 3PYXA 4D43A 4D3SA 4XDYA 2P4HX 3ZU3A 1EZ4A 3V1YA 5COAA 4JBGA 3L6OO 2RH8A 4IBOA 5EQFA 3ENNA 4AICA 4AJ2A 1PS0A 5EINA 4J6FA 2VUUA 1A71A 3W6UA 5F5NA 1YOVB 4BB5A 1CETA 3CIFA 4AJHA 2VYND 5DP1A 1GTMA 2AEFA 2Q45A 3QWAA 4YTEA 4EDFA 5B12A 1DIRA 3ZHZA 2GDZA 1P3DA 3MTGA 1KIFA 2P9EA 3RCBA 1HRDA 1V8BA 1H6DA 3ST7A 3WFJA 7MDHA 4GQAA 4WCFA 3DQPA 2FZEA 2Z5LA 3ROPA 3WB9A 3TZQA 3PP8A 4NBTA 2VUSA 3G17A 1UXIA 2PZLA 3MEQA 2A35A 3BTVA 4MVJA 4IM7A 2X58A 3GGPA 6ADHA 5DBIA 1DHTA 2GZ3A 1VI2A 5GZ3A 1HYEA 3PIIA 1FDUA 4FPXA 4XYEA 4RVDA 1K5HA 3E5RA 3F5QA 3H5AA 5DZSA 1IE3A 3H9JA 1X1TA 2Y1CA 1I32A 1R4NA 5ILGA 2C54A 3GEGA 2VZ9A 3RC9A 1KVUA 1M76A 1GUYA 3F3SA 2DTDA 3AOEA 3HN2A 1DOHA 5U1PA 4W7HA 1HDCA 4E6PA 1GL3A 4C7KA 1UH5A 1K6XA 1N7HA 4ZA2A 2GN9A 1NR1A 4OKNA 4Q3CA 3E48A 5L4LA 4BNXA 3L4BC 3I6QA 5IFLA 2HAEA 1F14A 4EEXA 2VHXA 1UXJA 3HFGA 1PGOA 5EL0A 1KOLA 1T24A 2OO5A 5DCYA 5B37A 3ZN2A 5U9CA 4NG5A 1E3WB 1ISFA 3V1TC 3NGXA 3E6AA 3KETA 1P1FA 2W4QA 1DC6A 2ZB3A 5JY1A 5KVVA 1XU9A 1JQBA 3WGOA 1AN9A 2D0IA 1BXGA 1PWZA 1ZK2A 2WD7A 1X7HA 2I6TA 5AXBA 1E7WA 1VSVA 3OETA 4EJ0A 1T2FA 1M66A 3QVTA 4WCFB 3QWIA 4XZ3A 1HZJA 3BMQA 4BKOA 4M8SA 2VHZA 4YT4A 4K28A 4M55A 1YKFA 1A5ZA 3FHLA 3T4XA 2EERA 2G1UA 1EDOA 5CEEA 1WMBA 3TPCA 3E9NA 3WSVA 2XOXA 5CP8A 1V3VA 4IMRA 3OJFA 3GPIA 4GH5A 3NYWA 4AVYA 2Q2QA 3H5RA 4E5KA 5K6AA 3GR6A 1CIVA 1LXCA 1KVTA 3KBOA 3DZIA 3H4VA 3HQ4O 3C24A 2OP0A 1RM0A 4O0LA 4WUVA 2X86A 2B36A 1IPFA 3BHMA 3OFSA 1ULUA 1ZK3A 4KUHA 4N5LA 3BTSA 3CZRA 4EITA 1YQGA 2HK8A 1DAOA 1QSGA 4YPOA 1F8GA 2B0JA 1LSSA 3L77A 2HMVA 4B7UA 3ONDA 4HY3A 5T67A 4A5OA 1BVUA 4Q39A 1Z6ZA 4R3WA 3LC1O 1MFZA 2GUGA 4XQGA 4BIIA 5B4TA 3O4RA 3O26A 4GKVA 1P44A 4BGIA 4BO2A 3D4NA 3Q0EA 1ZH8A 5IXYA 2ILTA 1X0XA 4RDHA 1LEHA 3AWDA 4JCOA 1P1KA 2GPTA 1J5PA 3RI3A 1VJTA 4DREA 1DRVA 3AUSA 5IG2A 2W2LA 5GY7A 3GVPA 1NQAO 2HJSA 1A9ZA 1KVQA 3NDRA 3PQEA 4L74A 4TRRA 3VZRA 2WMDA 2H5LA 2PK3A 4NH4A 4W4TA 2BHLA 3RUEA 3HDQA 6LDHA 1KEWA 4J2OA 4W82A 1GUFA 3TNLA 4RV9A 4H15A 3I52A 3FF4A 5JDCC 3QHAA 3OM9A 3QWBA 5DCWA 1C0KA 2AG5A 4RLSA 5AXDA 4BNZA 5DP2A 2JCYA 1LDNA 4BKUA 3ITDA 3BMOA 3L9XA 3GAZA 2B69A 3QVSA 1LRJA 2WTBA 3OIDA 3MJTA 4M1QA 2YYYA 3MZ0A 3ZWYA 4XCVA 1CERA 4CMIA 1XEAA 2DQ4A 4WOJA 4YVFA 2D5CA 1AXEA 2C07A 2VRBA 2PLAA 4AL4A 1XDWA 2CZCA 3FSRA 3U4CA 3E18A 3UUWA 4WNIA 2HUNA 2PFGA 1NVGA 3DZBA 1NP3A 1XU7A 3KYCB 1ZK0A 3WS7A 4PZCA 2QIOA 2OHXA 2Z95A 5DOZA 4NFSA 1OMOA 4LRSB 1BXKA 1I0ZA 4XYLA 3LT0A 3DOOA 1JDJA 5IDYA 4YJHA 5JNLA 4KQXA 4LCEA 4OIMA 3QQPA 2VNAA 1RWBA 1ENPA 1L7DA 2Q1UA 2Q4BA 4NDNE 4X54A 3VPXA 4R54A 4DQVA 4Z0PA 3CKYA 1E77A 3DO5A 2XXBA 1SCUA 4ZQBA 3CMCO 3IC5A 4O63O 4LSWA 4JX8A 2VNSA 4N7RA 5DN9A 1ONNA 5TJ9A 1Z75A 3TL3A 1YWGO 1P1JA 1GZ3A 3QRWA 4JN6B 3MWDB 3VAZA 1O6ZA 3TSCA 4DUPA 1I33A 1BSVA 1GCOA 5CG1A 2JFHA 4YJGA 3K31A 4YDRA 2AQKA 3CE6A 5I8WA 1PZGA 3RU7A 4E2WA 3U0BA 4R41A 2C5AA 5DCUA 3WOHA 1HYGA 1DC3A 1QG6A 4BO4A 1RYDA 3ZV6A 2O7QA 3BMOB 4CM4B 1NFFA 3N7UA 4E5MA 3ETDA 1ZO8A 3AU8A 2X0RA 3QVOA 4BO6A 3U09A 3WLEA 3ADOA 3RQSA 4BNGA 4GL4A 2VZ0A 4CUKA 2P9GA 2GGSA 3AUTA 3KZVA 4W7IA 3P2YA 1DC5A 4IJKA 3AI1A 3ZV3A 4JP3A 5JAQA 5A1TA 2OOSA 3ANNA 2C2YA 4Z0HO 4PGFA 4NJMA 3CUKA 4OXKA 1LUAA 5JAMA 3EDMA 3E9QA 1U3WA 2NACA 3H6KA 5TT1A 3QY9A 4ALNA 2YV3A 1B26A 1Q2XA 3GVXA 4RVFA 1H9AA 1JLLA 1I36A 4XB2A 4PFJA 1EK6A 2EF1A 3F4BA 5H83A 4D46A 3BMNA 3FN4A 3N58A 4ITUA 4BNMA 1LLCA 4CMEA 5CFZA 5JC1A 3AM4A 4LK3A 5K9ZA 5JW6A 1SEPA 5G0WA 1K6JA 1C3VA 3BHIA 5A9SA 1YL7A 5JCJA 2W2LD 3KXDA 4YT8A 1LSUA 4ALIA 3SX2A 2Z1MA 3ZU2A 5ER6A 4PLTA 5KJFA 3NTOA 1DC4A 3RD5A 1ZBQA 1HKUA 1U3TA 4RL6A 1GFSA 3JQ8B 5ICMA 3V1UA 1WAMA 2EJVA 2ZQZA 3O38A 1ENOA 3WDSA 2NQTA 1D3AA 5GZ1A 2UUOA 3M1AA 2PWZA 3KYBA 1TVEA 1B16A 2D2IA 3CMMA 4FIZA 4IQ0A 3RBZA 3K96A 3RFXA 2QZZA 4CQLB 4CUZA 1P1RA 4UEJA 4MIOA 1V3TA 2I3AA 1U5CA 4WNCA 2OORA 3QV1A 4JQCA 3P19A 1QMGA 2WD7B 4WEQA 4QFCA 4BMNA 4L73A 5F3RA 3DMTC 4OSPA 4BNWA 1KEUA 3LLSA 3S2GA 4ALJA 3WWYA 1PS9A 1EFLA 3JQFA 4Q3BA 3MWEB 1WZEA 3KLMX 5CDTA 1YB4A 2EP7A 2Y1FA 1DLIA 3FNGA 3HE3A 3GUCA 3ZWNA 3WIEA 4BKRA 1PQWA 3CTMA 4PLZA 2Y1DA 4XQ9A 2DM6A 2RHRA 4UEKA 2HMTA 5HA5A 2IODA 4I5GA 3I9NA 4Z9YA 2CF6A 1EBUA 1AGNA 4R68A 5TT0A 2O4CA 3I6IA 1YS4A 1CF2O 3JQGA 1RM4A 1EUDA 2HRBA 3NTQA 4XJSA 3S55A 3GT0A 2VWGA 2JKVA 3VHRA 2GRAA 1OZAA 4NJOA 4NQZA 3TN7A 2D3TA 4RZIA 1YJ8A 1E3SA 3JQAA 4YB8A 4PG5A 2J3KA 1AUPA 3ROQA 3NT4A 5L4SA 1Y6JA 1HXHA 2Y66A 5KJ6A 5FF9A 2HQ1A 2A92A 1H9BA 1DRUA 4FC6A 1U8XX 3IUPA 1ADCA 4MIEA 3ORFA 3C1OA 1GR0A 4TMFA 1GU7A 4ZGWA 3W4JA 3KUXA 1LQUA 3ZWPA 4D7AA 4CV1A 4G65A 4O6VA 4U7WA 2XPCA 4E5NA 1FF9A 4GX0A 3GN2A 2HK7A 3PGXA 4IZHA 1G0NA 3PHHA 4MJLA 3D3EA 4UVEA 4QXMA 3EAGA 1NQTA 1UP4A 3I83A 1N9GB 1PJTA 4IIVA 3GMDA 1MUUA 4G81A 3S2EA 4E21A 4AJKA 4CMBA 2DBVO 3D7LA 3FNEA 2FR1A 1T1RA 5C5IA 5KNLA 1PJQA 3RASA 1EFKA 4XIYA 4F6LA 1G6KA 4CL3A 1LRKA 2X5JO 3HHPA 5CDYA 4NU6A 2YY7A 1Q0LA 1Z45A 1WPQA 4GVXA 3HADA 3OICA 4U8GA 2AQ8A 4GSKA 4CM9D 1XQ6A 3DB2A 3KVOA 1TEHA 3ENKA 4GMGA 4AJEA 2CDCA 3B20A 2NTVA 3WX0A 4HP8A 1EMDA 3V2GA 2W8ZA 3ICCA 2NLOA 3UH1A 1AHHA 1ZXBA 3IKVA 4RF4A 5L53A 3QVWA 2G17A 2VOJA 1E3EA 3QWHA 1ZIDA 5H81A 1O95A 1PJ4A 5BNIA 4IDBA 2BD0A 4S3MA 5BR7A 1PSDA 1YVEI 1ZK1A 2BFPA 2VOEA 2ZB8A 2I65A 1ZZEA 3AM3A 4XA8A 5T8KA 2CUKA 2PZKA 4Y8VA 3BZUA 3H5NA 4FJ1A 2PGDA 4CQLA 1LDEA 2QQ5A 2VHYA 1KEVA 3RVDA 1FDWA 2PD4A 3VZSA 4IDGA 2NU9A 4L0QA 3SC6A 4M87A 1ZW1A 2DBQA 5I7SA 2I3GA 3M1LA 3JQCA 4BL5A 3PRJA 3FCOA 2PNFA 1O5IA 4JJGA 1H2BA 1HDXA 1Q7BA 2IYOA 4K9DA 4CLOA 4RQUA 2G76A 3GRPA 4IGFA 4QFDA 2EIHA 3HB4X 4CM4A 3HDJA 4N54A 4KUEA 3RC1A 3W1VA 3VVBA 4E32A 5IAAA 4P22A 4XX0A 5L7WA 4Z3DA 5T64A 2EKQA 2FN7A 1A72A 2HJRA 2O23A 3JQEA 4DQUA 3GLQA 3GZ4A 1QP8A 3B1JA 1C1XB 4MP3A 4J0FA 2IDZA 1J49A 4DL9A 1IUKA 4GX2A 1G0OA 4HFMA 4BB6A 4CM7A 2FPPA 3BHJA 1NFRA 5IJZA 1AXGA 2DT5A 1N5DA 1A4IA 4HNGA 4WK6A 2XAAA 1UAYA 1DJQA 2X9NA 3F6YA 1TT5B 4K1LA 3PHJA 2DBZA 1MG0A 2CDAA 1SMKA 4KUGA 1E1LA 4I08A 1WP4A 3L6DA 1NNUA 2H1SA 5JYDA 1YJQA 2FSVA 1PJBA 3HB5X 4J9VA 4Q9NA 1PL7A 1PIWA 1U5AA 2DTXA 2P2SA 4AJIA 1V35A 1IZ0A 1DFIA 4IJWA 4I1IA 2QYTA 3OJLA 1GAEO 1FJHA 2QYSA 3PJEA 3SLGA 4GX5A 1DPGA 1UZNA 3JQAD 3RROA 1GCUA 1Z7EA 3AY6A 4BO8A 2DU8A 1Y8RA 3KYCA 3VC7A 4Y6SA 1XCBA 3ZZNA 5FWNA 1PGNA 1VKNA 2Y1GA 5CPBA 1HTBA 2PY6A 3DTYA 2JJYA 4CV0A 2AQIA 4ZRMA 3WBBA 2Y1EA 4DQXA 4ZVVA 4G5HA 1HSOA 3NV9A 1IZ9A 4PG4A 1OOEA 2H6EA 4R01A 4D79A 3INTA 1M75A 1YDWA 3RKUA 1X0VA 1PTJA 4Y6RA 1W0CA 1WVGA 5KIAA 4YRDA 4E5PA 2RIRA 1FMCA 5B4UA 3AUAA 2JCXA 3BYZA 3EY4A 1ORRA 2OMEA 3RSHA 1MX3A 2YJZA 2FOIA 4GWKA 4RPHA 4B7CA 3L6EA 2HRZA 3K6JA 3A1NA 4ZU3A 4NBWA 5DULA 3VH4A 2BRUA 4NZ9A 4TVBA 1FDSA 3RWBA 2FPIA 2P91A 1NASA 2DBRA 3W8FA 5BNFA 4Z3KA 5EQDA 4D44A 2FPGA 1A7KA 5GZ6A 4FOOA 3OEWA 1IHYA 4YR9A 4DA9A 4JIGA 4E3ZA 5I7FA 1MGOA 4L4XA 3QLJA 2DTEA 5BNTA 1U3VA 5CHEA 2Z1NA 3DHNA 1KVRA 2FP4A 4P4LA 3CEAA 2JD2A 3WICA 2J5QA 4CR7A 4B4OA 1R16A 4CPDA 1DRWA 1HT0A 2V65A 3WYBA 5I9NA 2A4KA 2FHSA 4CMKA 4UUNA 3U4DA 4ZN6A 4CMEC 2FWMX 1LDMA 4MP6A 1YL6A 1DIBA 3OBBA 2AQHA 3O8QA 3ETEA 3OP4A 1ZNQO 3Q6IA 1EVYA 3TZCA 5EMHA 3G0OA 1QKIA 5F5LA 3I4FA 1JW9B 3BA1A 1N2SA 3RKRA 1N7GA 4MVJE 3JQ7B 4AFNA 3NDJA 3FPLA 4EYEA 1PS8A 4FR5A 1VL8A 5HRUA 2NADA 4RO0A 2QHXA 3RUIA 3PJDA 1BDBA 4MDHA 4OQZA 3M2TA 3GQVA 3OQ1A 4WEOA 3T4EA 5IZ4A 1T2AA 3K2BA 4KOAA 4B4UA 3W6ZA 1E6UA 4IDAA 4BO9A 5TRTA 1EEHA 1I3NA 4BNNA 4O1MA 3OH8A 1JAYA 2PTGA 2XF8A 2Y0EA 3BAZA 1UP6A 1EE9A 4BMVA 3HNPA 1YBMA 1P74A 1TXGA 4XYGA 4WLVA 3RIHA 2NU8A 1XWFA 2Q49A 3L0DA 2JFGA 4K6CA 4YRAA 1Q0HA 1B8UA 2AHRA 3WQSB 2BELA 4R9SA 5IXSA 4CMJA 1D7OA 3H8VA 4BNFA 4EJ6A 4TWRA 4FOSA 2BGLA 2GZ2A 1YOVA 4HXYA 1SO8A 2Q50A 3DHEA 2ZIZA 2HLPA 1UDBA 2TMGA 1U4OA 1D4FA 1B15A 4YBZA 4J2HA 1UXGA 4B3JA 1PGQA 4GLOA 1Y81A 3TFOA 3QJ5A 1I3LA 3FNHA 4J90A 3RUAA 1YRLA 5T5QA 2XXJA 4RVGA 1R4MA 3WIDA 4AJ4A 1PU2A 3KEOA 5KWEA 1TI7A 1H2HA 1X15A 3RAJA 1JVSA 1PR9A 4OHUA 3ZCXA 1EUCA 1E3IA 1RPNA 2R00C 1JWAB 3E9MA 3VH1A 4YRBA 2RH4A 1LX6A 2G0TA 2I66A 4NI5A 4UUMA 3A28A 3VZQA 5EERA 5EIOA 2I99A 3FTNA 1N9GA 4II2A 1PZFA 2JAPA 4BS9A 1DEHA 3U5TA 3F1LA 4K6FA 3GHHA 3JCZA 1N92A 1P45A 3QW2A 2GN8A 1DIAA 5JMPA 4CLRA 3DBLA 3M2PA 2HSDA 3STHA 3EVNA 4YJFA 3FNFA 4PG8A 1ADGA 2O3RA 2IZZA 4Q3EA 4A10A 2HMUA 5AXCA 5JS6A 1BW9A 4BNYA 3GMSA 3BIOA 1KEPA 1ZEMA 1ADFA 4XEHA 2QRJA 2C59A 1S7CA 3PPIA 4KWIA 3WGZA 3PLNA 3E82A 2PR2A 2BI7A 2EKLA 4BQPA 5KVSA 4Z0TA 1ID1A 5DDIP 3UF0A 1HSZA 1HZZA 5JE8A 4L75A 1H6AA 4PLGA 4HFJA 2BH9A 3WGTA 1DLJA 4JLWA 3Q2IA 4EI2A 4D42A 1BRMA 1BGVA 4WGGA 5B1YA 3AJRA 1ZJYA 3GK3A 1R0SA 3C7DB 4DIFA 3TJRA 5KJ1A 1JAXA 3PXXA 4BKPA 1MP0A 1NPYA 1V9LA 4BHTA 1TB4A 4OXNA 1HETA 1Z74A 2GN6A 1IY8A 2C0CA 4EUHA 2OGUA 2NVUB 1U3UA 2B83A 4NIMA 1ISIA 4RF5A 2A9FA 4U6QA 4FGWA 3DZFA 1C1DB 3GH3A 3TWOA 3ZV4A 4FC7A 1DXYA 4UUPA 1I30A 4J4BA 3UAGA 1QV6A 3GEMA 1ARZA 3T7CA 3ASUA 1TA4A 1OBFO 3KLPX 4QUKA 4BGVA 2EW8A 3BMCB 4RQTA 5CDGA 1VRWA 5COQA 5ER9A 2J3HA 5HM8A 1R4MB 1MFPA 4AJPA 3KEQA 1XLTA 2X8LA 4RF2A 4A0SA 3FWNA 4CLEA 2AE2A 5DBGA 2V6FA 1MA0A 3WJ7A 1T2EA 2B4QA 4IDDA 4YAGA 2GYYA 3ZHYA 2HK9A 2Q46A 3H7AA 3RU9A 4BO7A 3JYOA 5L3ZA 3UVEA 1ZFNA 4FBGA 4BV8A 5JCJD 4PN3A 3ZHXA 2HCTA 3IKTA 2J3IA 3JYNA 5ICSA 2NM0A 3I9LA 3H9QA 1I2BA 4J0EA 4DPKA 3WXBA 1EE2A 3PK0A 1ZXLA 2BF7A 4DMMA 1XKQA 4I9NA 2X1HA 1ADBA 3X2FA 4D45A 1JA9A 3S8MA 4ALMA 3KM0A 2PH3A 4IQGA 4DC1A 1HDOA 1U4SA 3IUSA 2DAPA 2E4AA 3SLKA 4KZPA 3IP3A 1QYVA 4Q3DA 1HWYA 1OFGA 5AOVA 2V7PA 4HWKA 5EJ2A 3U9LA 4RDIA 5DT9A 4IJUA 3KTDA 3VDQA 1E6WA 2GLXA 4R3NA 2QG4A 2DFVA 4KMSA 1GPJA 1NHGA 3HSKA 3OQ6A 1BHSA 3C3XA 4BO1A 4RF3A 3FPCA 2Y05A 1B0AA 3JQGB 1G1AA 1VC2A 3ZNOA 1KC3A 5JDIC 4CUJA 3JD4A 5A03A 1U8FO 2CDBA 3JD2A 3ON5A 2AXQA 5I9LA 4FFNA 3ZWWA 3ZNPA 5MDHA 2GD1O 1SC6A 1RJWA 4II3A 5ILOA 3KRTA 3JQFC 3DEYX 3COSA 3GHYA 2ZTMA 3AUUA 4D3DA 3QVXA 3F5SA 4R69A 3H9UA 2B4TO 1J6UA 4MKZA 4PLWA 2D8AA 4WCDA 4A2CA 4RPLA 1F0YA 4Z9FA 3PYMA 3ZWOA 3LZ6A 4UVIA 4XB1A 1D1TA 3PHLA 2ZK7A 3R6DA 3A06A 3G1TA 3B1FA 3NX4A 2VN8A 2DKNA 1YGYA 2DUWA 1WZIA 4HADA 4IS2A 4TQGA 2CMDA 3WJAA 1RKXA 3GY0A 1PZHA 3GDGA 4QTZA 4GAEA 3NKLA 2OL4A 1EVJA 2WD8A 2CY0A 1ISGA 3B1KA 4NU5A 3UN1A 8ADHA 4R16A 3Q11A 3JQ8A 3GNQA 3QIVA 1ISJA 3C85A 2OUIA 4G2NA 4F45A 9LDBA 3JQBC 4RVSA 1Y1PA 1IPEA 4YEDA 4NFYA 2Q2WA 5L40A 2CVQA 1GUZA 4W6ZA 5HBRA 3JSAA 3DOJA 1M67A 2PGJA 5TSDA 4J16A 4E12A 1MC5A 3RBXA 3C1AA 4AJOA 3GGGA 1LLDA 2H9IA 1JKIA 4P8RA 3ROMA 5A9SB 3HDYA 3LYLA 3G49A 5F1OA 2UAGA 5TQVA 1TLTA 5T8KC 2X0IA 3QE3A 4YCAA 1E5LA 3C8MA 1Y9EA 2ZQYA 3PGJA 4B3IA 4FGSA 4AJNA 4E4YA 1O8CA 2PD3A 4O5OA 1Y8QB 4FB5A 2FZWA 1E0DA 1DAPA 4YJHB 4YYZA 3GG2A 2CNBA 4A03A 5BSHA 4BV9A 2W2KB 3HDHA 3ASVA 1SB9A 5JC8A 4KWHA 5ENDA 4BOYA 1VL6A 1CYDA 2NVBA 2ZTVA 4JBIA 4WLEA 2EP5A 1ZSNA 1L1FA 1PQPA 1QRRA 2NWQA 3IL2A 1MC4A 2O2YA 4DLAA 3NTRA 1EBFA 1KERA 3GVHA 4R5HA 1T4DA 1F12A 3F4LA 4CMCA 1R0KA 1UDAA 1VM6A 3C1TA 5A05A 5JXWA 2O2SA 3EYWA 1GEEA 4M49A 2Q2VA 1NVMB 3P5SA 4YWJA 1ENZA 4I9UA 3GG9A 2YQ4A 4QO7A 4IS3A 2BGKA 1XG5A 2YZ7A 3BTUA 4FJ2A 1JKJA 4NBVA 4XIJA 2PKRA 1X7GA 3I4CA 2GZ1A 3QP9A 3MJCA 2ZATA 2ZYDA 5K0ZA 2ZB7A 4NPCA 2GF2A 2I9PA 3GDFA 4B8ZA 5G0UA 4J49A 3DDNA 4I5DA 1JU9A 1GYRA 4WJZA 4FDAA 3KYDA 4AJLA 4R9RA 4XQEA 1I2ZA 4DBVO 4OYRA 5F21A 4NJMB 4J7CA 2AA3A 1QYWA 5IDWA 1L7EA 3BTOA 3DXFA 4GPD1 3LF1A 4IGEA 4XYMA 4B4VA 4CM5A 1WLYA 5MGBA 2WE8A 3ZU5A 1YQDA 4CR6A 1LU9A 3D4PA 3JD1A 3AM5A 4E13A 3ZWAA 4P4GA 4M54A 4J1TA 2GSDA 2IXBA 3FRJA 3WTBA 3H3JA 2YQ5A 3HJAA 2YFHA 5CAEA 3RUFA 4C7JA 3LT4A 3JV7A 3MCVA 3JYQA 2R2GA 4QO8A 4E5YA 5IDXA 2AE1A 1GQ2A 3DAGA 1HE4A 5G0SA 3IAHA 2BFAA 3A4VA 5L7YA 4BUCA 3WTCA 2DLDA 4ZICA 1LA2A 3DFUA 1X7DA 5ADHA 4KDEA 5CDSA 2BFMA 3BXXA 1YDEA 3BMQB 4EW6A 1MXHA 2ET6A 3W4IA 5L45A 1CWUA 3MOGA 1ML3A 2NVWA 1Y5RA 3WMWA 3DBVO 1H93A 1LSOA 1Q1NA 4ALKA 5TLSA 4AJJA 3VTFA 5KJEA 3RC2A 4FJ0A 4EGFA 3JQ6A 1E7MA 4J7XA 1O0SA 1U2DA 5JY6A 1Y8QA 1C0LA 3TDKA 3I5MA 5CG2A 2P5UA 3WWZA 4ALLA 1E3WA 1HDRA 1H6CA 1XYGA 2GR9A 2P68A 4BNLA 4ZQGA 4J9UE 3ITKA 1BG6A 2GNAA 4EUFA 4EBFA 2VCYA 4LMPA 4PZDA 3GAFA 3AU9A 3WBFA 2I76A 4OKIA 4JNKA 4ILKA 2I5PO 4DXHA 1OAAA 4N5NA 1DO8A 4PLPA 3AOEC 1R66A 3KB6A 3DMTA 1IL0A 1NYTA 5TS3A 4B3HA 4KTVE 3TZHA 2O3TA 1UP7A 4MOWA 4PLFA 2G82A 1HLDA 1Y8RB 4OSOA 2X0JA 3NJ8A 3F1KA 3VTZA 1P31A 4FFPA 1Y7TA 1Q7GA 2AG8A 4YAIA 1VKOA 4XDZA 1HE5A 3FTPA 2WJPA 1ONOA 3IIEA 3ABIA 4OMUA 1MV8A 1QLJA 3RFTA 2PZJA 2IEBA 4O59O 3V2UA 4E2YA 2IEDA 2J5KA 4XKJA 5H82A 3WQRA 4NK4A 4LCJA 3PEFA 5EN4A 4PZEA 5C7OO 4U5QA 4E2ZA 1E3JA 2E49A 3CZMA 1H6BA 3GRKA 1EK5A 4LVUA 4PCVA 4FD3A 3FI9A 3MJVA 1LLUA 1NVTA 4YJFB 4DPLA 4CQMA 2QRLA 4CR8A 1LSJA 1U28A 5JYEA 3WLFA 3I1JA 5BSFA 1ISHA 4ND2A 1U2GA 3V2HA 4RORA 4IDCA 3KSDO 3GOHA 2OXIA 4I5EA 5IZCA 1U7HA 2X0NA 3IMFA 4YQZA 3L4SO 4U6SA 5L9AA 2SCUA 1UAGA 4JGBA 4LN1A 1P0CA 1EQ2A 2EGGA 3CSDA 5T6BA 4RLHA 1GDHA 5ENVA 5KOIA 3PDUA 3DBLB 4YT2A 4DVJA 4P38A 4UEOA 3IQDB 2DC1A 4YT5A 3WSWA 4BO0A 3JQAB 1ZK4A 3DBHA 2CF5A 2ZJ0A 1YB1A 1U1IA 3D64A 4RPGA 1LJ8A 4R51A 3A9WA 1W4ZA 2C20A 1BDMA 2NUAA 4TZTA 4BMSA 4ESOA 1XELA 4HV4A 2UYYA 1NWCA 3K73O 3TOZA 2E6UX 1NPDA 1CRWG 2DVMA 1UUFA 3DC2A 4CLDA 4OAQA 5G0VA 3RUCA 2HU2A 3ADPA 5THKA 1Z73A 3GPDG 1NBOA 1ISMA 4WLUA 1BXZA 3EZLA 1R4NB 1VLLA 3HN7A 2J6IA 1NAIA 2HMSA 2IRWA 2WYVA 3JQDA 4RGBA 4UAGA 5G2OA 3RJ9A 4B8WA 2X23A 1KBZA 3PVZA 3ZWVA 4FFOA 2Y93A 1PQUA 2IZ0A 3N74A 1YBVA 4QX6A 1M2WA 2VTEA 4H7PA 4WCFC 1GQYA 1YXMA 1YL5A 3JD0A 3MOIA 1VL0A 2GO1A 1WXDA 3B6ZA 3OA0A 3P7MA 4FFRA 1JTVA 4FFLA 5I8ZA 4DLBA 5B4VA 4TROA 5K6AC 5TGDA 2Y99A 1YQXA 2DFDA 2X4GA 3BMCA 1YBAA 1DSSG 2J8ZA 3WGGA 1F17A 1R6DA 3LC7O 2V6MA 3PFWO 3V8BA 3NEPX 4NK5A 1H0KA 2YHIA 4JXKA 1K0UA 2PGLA 3IP1A 3RJ5A 4ZRNA 1PJ2A 4OO3A 1B8VA 1W6UA 4D0RA 4JJIA 4Y67A 1TT7A 3TF5A 5LDGA 5A3VA 1DHRA 1UZMA 2HO5A 4FCCA 1T4BA 1KY4A 2BMAA 2PV7A 4ROSA 1ENYA 3M6IA 3JYPA 3G1UA 2YW9A 1LLQA 4PLCA 4KDFA 1E6EA 4ONEA 1JN0A 4CJXA 2ZKLA 3S2FA 4W99A 3DAFA 2F00A 1IB6A 1HE2A 4CLXA 1E1MA 5JDIA 4Z9XA 5A04A 4BNUA 4ND5A 2NV6A 3PQFA 3GVIA 4YJGB 3KV3O 4UVGA 3AI3A 2YDXA 3CPSA 4E30A 5ITWA 4LMRA 5HS6A 4JK3A 1C0IA 5KKCA 1DB3A 4ZQHA 2Q1WA 2E82A 2EG9A 3FBGA 5ITVA 1HE3A 4FN4A 3FBTA 4OQYA 4J4HA 1ZEJA 3DZHA 4U0JA 1KY5A 5BQFA 3IJPA 1GV0A 1UDCA 4MP8A 4YQYA 3GZNA 3DBRB 1T2CA 4FQ8A 1C0PA 3L07A 1VE9A 4J1SA 5BT9A 2J5RA 4DIOA 3OEYA 3H2ZA 4BNHA 3Q3CA 3EK2A 1BWSA 1RM3A 2VWQA 1CQJA 4QQRA 4CQMD 4CM8B 4Y9DA 1JKFA 1UXHA 1GEGA 2G5CA 3EW7A 3WGHA 3RC7A 2W98A 3K92A 3IOYA 5AVOA 4GI2A 1N8KA 1F8FA 2EHDA 4WLNA 3ZW9A 2AEJA 3SVTA 3VPFA 5IN5A 4LVCA 3DZKA 4GLLA 1WDKA 3WNQA 2LDBA 1QV7A 1PZEA 2YDYA 2O48X 3OJOA 4QEDA 1ZMTA 4FW8A 4TRNA 3PJFA 1QXSA 1JWBB 2O3SA 4XRGA 3WMXA 1ZSVA 3UHAA 5A9TA 2VUTA 4IINA 4GKBA 1LDGA 4BGEA 4NMHA 4YXFA 3HG7A 1HDGO 5JCXA 4IDFA 1NQ5A 4MVJI 2NNLD 4TKMA 4YA6A 5JO0A 1LQTA 3I9MA 1T2DA 1O94A 2EXXA 3TOXA 4BNVA 3FR7A 4DYDA 4CMIB 3GZNB 4J91A 3OQBA 3EMKA 2HDHA 4E33A 4J1NA 1I8TA 3VZPA 3GN1A 1TT5A 3HZZA 1KYQA 3JQ7A 4A7PA 4GGPA 5BSEA 5I7EA 3RUHA 4FSHA 2PKQO 1WDMA 2V6BA 2NTJA 4HX5A 2HMWA 2JAHA 3H9GA 3SBOA 4YAKA 1CJCA 1VSUA 5TJHA 4B7XA 4PG6A 4PLVA 3RBVA 4RJTA 2EKPA 2QRKA 5CEFA 3PLRA 3ZHBA 2B4RO 1QLHA 2FR8A 1DFGA 2EV9A 2UDPA 4TRMA 1PL8A 3P2OA 5THQA 2Y0DA 3WR5A 2Y1OA 3RFVA 2YV1A 4JBHA 2PA3A 3WGIA 3JD3A 5JDCA 2X9VA 5JAZA 4MKRA 3B70A 1EQUA 3JYLA 3C7CB 1VPDA 5BSGA 4J4TA 1WW8A 2BGMA 2YHIB 3F46A 2BLLA 1RYEA 5LCXA 3ZWCA 1I3KA 4PG7A 1DIHA 2ZTLA 4J43A 4DPMA 1MG5A 1LBEA 4CM6A 3QWFA 1C14A 4KTTE 4J3FA 3S1LA 1R0LA 1XIVA 3OA2A 5TF4A 1HF3A 3OMLA 4UVDA 2O50A 2GCGA 4XGNA 4IJVA 4OJNA 3UCEA 1A7AA 1BTOA 5A5FA 1WNTA 3T7EA 5LDHA 1XSEA 4QT0A 4Z6KA 5LC1A 1PJSA 4R1TA 2VQ3A 1W8DA 1FDTA 4MKXA 2P9CA 1GADO 4Q3NA 1O9BA 3H9EO 3O03A 3NGLA 1ZUD1 3LU1A 3VKVA 4GSLA 1PJ3A 3FWZA 3NT5A 3WGYA 4JP2A 1BMDA 4GWGA 5I9MA 3TL2A 1NM5A 2C82A 5L7TA 1IOLA 1ONPA 2WSBA 1DIGA 3INRA 1J0XO 4BNKA 1KS9A 2NQ8A 4CM1A 1GD1O 3LT1A 3WQQA 3JQ9C 5U4QA 1FXSA 2IYPA 4S1VA 4MPDA 2GASA 3PYLA 4WPGA 1OC2A 2X7HA 4K26A 4PVCA 1AE1A 4MVJG 2HKIA 4LSMA 3PTZA 1HEUA 2D4AA 5DBFA 3ZWMA 5C7LO 1O89A 4PIVA 4N5MA 2C29D 3DL2A 1X13A 1K89A 3E5MA 4A73A 2RAFA 4PRKA 1BXGB 1GY8A 1U9JA 2VRCD 2P5YA 3JTMA 5JPIA 3OSUA 5L95A 1LI4A 5C3MA 4MVJP 5TNXA 1K3TA 3ANLA 5EESA 4TSKA 3G3EA 3DHYA 2C5EA 3OIGA 2O7SA 3W8EA 3Q1LA 3DZGA 4WKGA 3R3JA 1XA0A 2V6GA 3GFBA 4B4WA 4F3YA 4L76A 3DZJA 4CM8A 4OH1A 4CQMB 3U3XA 1E7SA 1HLPA 2WM3A 4BNJA 3OECA 5AXAA 4NBUA 1OI7A 1LRLA 2RBEA 3AW9A 1GV1A 4UVHA 5L51A 1HDZA 1YONA 4TKLA 3C7AA 5KVCA 2Y0CA 1I24A 3TFQA 1MB4A 2P4QA 2QW8A 2LDXA 4RZHA 1NQOA 1V0JA 2YUTA 1QYCA 3L4BA 5IDQA 1E7QA 3WYEA 2VYNA 3I9OA 3Q2KA 4BKQA 1R12A 2WEKA 3SEFA 4I9HA 1YH3A 3LK7A 2DPGA 4NBRA 4NFHA 1W73A 3GNTA 1XGKA 4LISA 1LC0A 3CINA 3E03A 3DOCA 1ZCJA 4LGVA 3X2EA 2FY8A 3LF2A 3U4HA 3ZW8A 4L4RA 2WE7A 2AMFA 4IUYA 1E1NA 1EVIA 4ZJUA 1NX6A 4D3FA 2IXAA 1ULSA 3ANMA 3K2EA 5G4KB 1QORA 3D5QA 1YO6A 3PZRA 3D0OA 1LNQA 1E7RA 5KJCA 2O3JA 1I2CA 5KVQA 4RCVA 5HS4A 5CEJA 3PWSA 2ZCVA 4DC0A 1PL6A 1WDLA 2X9GA 3K5PA 1P9LA 2EW2A 1EVZA 3ZU4A 3ZGYA 1N1GA 3DONA 3F9IA 3VPGA 4XGKA 2IE0A 2VRCA 3MJSA 1P0FA 3S2IA 4AJ1A 2B37A 2IZ1A 4CLHA 3DTTA 1P33A 4DMLA 1B3RA 4DRYA 1BW9B 3TZ6A 1H94A 2JHFA 5CPFA 1E1KA 4BVAA 4TZKA 4DWVA 5A02A 3LSYA 4ID9A 1WMAA 1XR3A 1KVSA 3LDHA 1UJMA 3OJ0A 4GGOA 4W9NC 4A26A 4CLRB 2WYWA 4DIBA 3LQFA 3DFZA 1ZSYA 2POQX 1EUZA 2JHGA 5COBA 3ZWXA 2EWMA 4AG3A 2NU6A 4XJTA 2FR0A 4R1UA 3DBRA 1C1DA 1GYQA 1NTOA 3QSGA 1E7YA 1SEVA 3G79A 4ND4A 3INGA 2TMDA 3UXYA 4XRRA 4R1SA 1XQ1A 2EGHA 2FMUA 4NR0A 3ZI0A 4URFA 5CDUA 2CFCA 3R3SA 2VT2A 4L8VA 5JSFA 1XHLA 4BO3A 1QYDA 3TRIA 4PRLA 2VWHA 1ZMOA 3PJGA 3PZBA 3D3WA 4EUEA 4DBZA 4IZIA 1UZLA 1I5RA 2YV2A 2R00A 3UICA 4QSMA 1GPDG 3PI7A 1SOWA 4EZBA 3VVCA 3ZH2A 2R6JA 3ONEA 2ZYAA 4I8XA 3O8QB 7ADHA 3F47A 4U0KA 2PD6A 2QX7A 1SNYA 2BFOA 1PJCA 2ZCUA 3DMYA 1NFQA 1T1SA 2ZJ1A 3UGKA 4HUJA 3U62A 4OOEA 4JROA 4KP7A 2AEMA 4WOKA 4Y98A 4B79A 4HFNA 3NT2A 3PWKA 1Z7BA 2X5KO 3FD8A 4UUOA 1F06A 2GN4A 4CMGA 4WLFA 2Y67A 3IDSA 4LRTB 1CQIA 2VHVA 3MTJA 3Q9NA 5J23A 1GYPA 2OFPA 3LT2A 3HFSA 3GNSA 2B5WA 5JLAA 3CH6A 3OHSX 1RM5A 4MO2A 5FI3A 5G0TA 5T57A 3FR8A 4CMAA 1KETA 4J1QA 1H5QA 3GA0A 1E92A 1PGJA 3PQDA 3GC6A 5DOVA 4P4NA 2OZPA 4E2XA 2B5VA 4MVJF 4R5MA 2Q1TA 2O3QA 4CM3A 1M6WA 4HFRA 2A94A 3H2SA 3KOUA 4DGSA 1PGPA 5JBIA 1UXKA 4HNHA 5L4NA 2Q99A 2VYVA 4H3VA 3H3FA 3R1IA 1Y5MA 1S6YA 4I5FA 2VHWA 2FSSA 1P1IA 1VJ1A 3EVTA 3GGOA 1CEQA 1EDZA 2GERA 3KHUA 3GVCA 1PJLA 3VOSA 3E1KA 3SXPA 5DF1A 3EC7A 1T26A 4GX1A 4WE3A 3I9JA 1J4AA 2NSDA 3A14A 3I3OA 1I10A 4JJFA 1T25A
chains in the Genus database with same CATH superfamily
1PCXA 1E62A 1Z5VA 2J4CA 3PE4A 1Z35A 4MV3A 3T35A 4XUGB 4BO5A 3DBHB 4KPUB 3E7PA 3WL5A 1DFHA 1P7WA 3AIOA 3T9BA 5JNUA 1PR3A 3OM0A 3J81A 2F6RA 3PFFA 3R3WA 3G2MA 1SZJG 3ULKA 4LNUB 5T7BA 3SSAA 5IAOA 1DBSA 4I4NA 1CFZA 2OAP1 3KZMA 4ZQFA 2GFQA 5JFOA 1R74A 1KI2A 3PNPA 1TFRA 4BNIA 3OPNA 1WWKA 4NX2A 2AMYA 3O9ZA 1TIKA 2C4KA 4CMHA 2ETVA 4IJ5A 4ZAFA 2BKAA 2VWPA 4WLOA 5T4BA 2H7CA 4QYXA 4R8KA 1UMBB 2CHVA 2V7EA 1RP1A 3MD0A 4URUR 3ZBQA 3DL0A 1KMQA 1AZLA 3GMIA 3KSUA 4E70A 4EPVA 3AFMA 3BF7A 1VLVA 2MOKA 4JKIA 4D5EA 1PEDA 3E7DA 4BFCA 4P92A 4PPFA 1N4AA 10MHA 1KYVA 5MFPA 3TZKA 2VPZA 3GD7A 3OTIA 3GLSA 1I7LA 3BGSA 3HA5A 3U7QA 2BGWA 1M5UA 5E6UB 2UVDA 3H65A 4HKTA 2B3DA 2GMWA 2H1HA 2ZPTX 1OXUA 3V4SA 4GKJB 4RCZA 1PWYE 2JD1A 2VJPA 1MJNA 1XZQA 5KZMB 4XFJA 2R1VA 3PXAA 1WBBA 4AWAA 4QM7A 1RI1A 3IMEA 2Q1SA 4HCJA 5EGNA 3P4YA 2CKDA 2VSYA 3EZ2A 2CLDX 1TZBA 4R1NA 4OU4A 2WWGA 3KVNA 2J0SA 1B7GO 3PS9A 4LHXA 2FJ0A 3OEHA 3TXYA 3HO1A 3U49A 1L7VC 2YRXA 4ZOLF 1WSWA 2X1MA 2J0UA 4B3XA 3OJWA 1UDWA 2ONCA 3W7AA 1JX6A 1N6LA 4H7KA 1ZD2P 2PH5A 2PMCA 1FDVA 5DWQA 4V3BA 5F76A 3RNLA 3T95A 4RZ3A 3ONFA 3RVRA 4D1YA 4PLYA 1OXTA 4MWZA 3U4GA 5DLQC 1B1CA 2RKWA 3LLVA 5E1DA 4ARIA 4GPBA 5CT4A 4PSKA 2D0DA 2YNMA 2NTNA 4LF7B 1LTHR 1H1LA 2L42A 4EJMA 3I37X 1L1RA 2J3JA 2XLBA 3N0RA 4Q4AB 9MHTA 1A8QA 1ORHA 1Y3FE 1YB5A 3MGCA 1WP9A 5ALHA 3FOWA 1IULA 1M83A 2RGEA 3PEVA 4D41A 2I2DA 3BSYA 3NM4A 1DO2A 4HYEA 3SEZA 4A91A 5IKXA 3IHWA 1YBFA 2GK3A 3BIFA 3N1UA 4M89A 3JVIA 3VAAA 2OD7A 1M6HA 4BBPA 2B35A 2H07A 2N46A 3CX6A 4J8PA 4KLCA 4MVJH 3E23A 5AVSA 3RW9A 3EPJA 3SYRA 1K7XB 3CW2A 1ACLA 4W5WA 3UKOA 2QLTA 3MK31 1P4RA 3CZQA 4XD7A 5JH7F 4M60A 1EXNA 1G4UR 2I6FA 1LPSA 1SG6A 2DKFA 4IXTA 4F3KA 2H54A 3KALA 4BRWA 1V41E 3R0IA 3SZMA 1PYDA 2A1UA 2I67A 5AJVB 1XZHA 2VI5A 2P1DA 4AO7A 2SNIE 3KU4A 2DLNA 5FYDA 1TD1A 4TQAA 1XNJA 2O57A 1FS4A 4G84A 2FRDA 1RR6A 4HRYA 5J4YA 2R6HA 5K8IA 5A9RA 4OXIA 2VPXA 4DTIA 4A6EA 4DYVA 2X4IA 5AQ1A 4GIBA 5IUNC 2B30A 4IIXA 1X1EA 1DJOA 1QR6A 1V6CA 1C50A 2B20A 4O1HA 4U5XA 2VYVD 3ZE9A 3TGLA 1KPIA 1QC5A 3EGOA 1Z36A 4NNJA 4TMZA 3BMNB 4IV8A 1V6AA 3IJRA 4OM7A 1ESMA 5IM5A 5L3QA 4IOKA 5AM2A 1I7DA 3R9KA 3OZAA 4ZD6A 1WBJB 3LC2O 1YE3A 2QRUA 3DHVA 3DWFA 1KL7A 1F38A 1QKKA 2IDMA 2C57A 1QB7A 3F5DA 1ZOLA 3DLCA 3G5MA 2NUPB 4LVOA 2F1KA 5A5EA 1DRJA 3G6WA 3H04A 5CK4A 3T7SA 2O8FA 3SVZA 4FMBB 1MAUA 1OBOA 1PWXA 4IQ8A 4QWWA 1ZKDA 3BSFA 4BJ5A 3S1SA 5EHIA 3E8XA 3QYAA 2BCEA 4ND1A 1UJNA 3NIBA 5TR9A 3GJZA 1DJNA 1ZVMA 3IBSA 4MMXB 5TVGA 4ARAA 2P6MA 4U2FA 3S5JA 1RRGA 2WWRA 1RXWA 1MXFA 2Z2JA 1F3LA 5SYMA 1SQ5A 4MKIA 2IV2X 3WZMA 4DLLA 3RSLA 5CXQA 4ADSG 2ACWA 4HJXA 4RD0A 1Z07A 4NAUA 2AUTA 5KTKA 5ABPA 9LDTA 2NO7A 2E48A 3GA5A 1MPXA 2ZANA 4OAOA 1CUBA 1RWQA 4PVDA 5DTIA 2V8OA 5ITSA 5K8TA 3UW3A 1PWEA 4LE1A 4WA7A 1LY1A 1EJ0A 4LG1A 4BDTA 5F64A 1D2EA 4YAJA 2HTFA 1I01A 1VHWA 2OM2A 5CUQA 4FK8A 1SG0A 3LNTA 2PE5A 3LPNA 1WUJS 4YRFA 5AR1A 2VH1A 3SJ7A 1QHFA 2JARA 3OKPA 3TTXA 5TX7A 1OVMA 2JI9A 2K7ZA 3LBNA 1D4AA 5DSZA 1SBCA 5JMTA 3VKFA 1DCTA 3R20A 4I2VA 4L4SA 4WBSA 4IIJB 3R74A 2YXBA 1UR5A 2FK8A 2H4WA 4MW9A 1VL1A 1BEZA 3QEKA 4Q9JA 4MUKA 1R8QA 5DXFA 1MIHA 3DBIA 1QCYA 2IW1A 5JECA 8LDHA 1NAHA 1RXUA 1V2GA 3PDJA 2Y68A 4LGCA 2X4DA 1FRFS 4F56A 3EXIA 1X7WB 2B99A 2C7VA 2VJBA 1XMPA 1EWRA 2NNWB 2ZTSA 2VZ8A 3PF9A 2WKPA 3BKXA 3BWXA 4MV0A 2BVNA 1OC4A 4GR5A 1H8EA 2ZJAA 3NBXX 3HGTA 3WADA 2PQ6A 2DUUA 3DL7A 4K6MA 1IRIA 2DQSA 2IJGX 4I7EA 4RKQA 3TMYA 4XIGS 5TPWB 2G8LA 4NZNA 3OF2A 2A0XA 2O8CB 1QHEA 4KFSA 4QDTA 3TQTA 4DDMA 4JWKA 4E0BA 4RJLA 3BD7A 1T8PA 4D0SA 1S2NA 1WRBA 3ILHA 2G88A 4RVUA 4BRUA 5C8YF 2ZR0A 1JKXA 2F1RA 2ZIXB 1DC7A 3LKVA 1Z5NA 3I04M 1MU0A 1OYWA 1XTIA 1D2GA 2VATA 3QEOA 3U3DA 2JIPA 1IM2A 1SPXA 2VJOA 1PW5A 5F1YA 2CFTA 1GIAA 1FK8A 3ADKA 2EW1A 3V46A 2E37A 4ED9A 1T8WA 2H08A 3V5NA 5GM2A 5CCBA 4XR9A 2WF8A 5KYUB 1FQWA 2P4HX 1M0SA 2C4WA 5COAA 3D2AA 4WNAB 3TIGA 4GMHA 1JG2A 2RH8A 1CUIA 1DMSA 5GOTA 1EDDA 1BMTA 1RZRD 1R0WA 5EQFA 4NSNA 2CFOA 1UWVA 2X4LA 3QEJA 2GCEA 1D6NA 3KVYA 4J6FA 2GKOA 5DNEA 3W6UA 3O3CA 3W3AA 3V3TA 5F5NA 2IKQA 1NN3A 1YOVB 3SZOA 4RULA 3CIFA 4AJHA 1L4GA 1N2XA 1RYNA 3WMFA 5BN5B 5J2TF 1M0WA 2AEFA 4Q9IA 3HCOA 4M1TA 1T6BY 4N01A 2NMVA 3RS2A 2GDZA 1NBEA 4AUMA 3K09A 3WFJA 7MDHA 3VSEA 4WCFA 3DQPA 1ZU4A 2Z5LA 3QBTA 2MSKA 1HURA 3P2EA 3PP8A 4TV8F 3G17A 1K7EB 2PZLA 3MEQA 2CB0A 4KSYA 3PCXA 2JLAA 4IM7A 2WNSA 2ZT8A 1NVUQ 3GGPA 1DUVG 4MPTA 2QUBA 3AEUB 3R3VA 1GTSA 1VI2A 2DHDA 2GJSA 4HAWA 2Q6IA 4RVDA 2HCBA 3LX4A 2XY4A 2F3SA 4G63A 1EVKA 3T7AA 2INGX 2JEZA 3TD9A 3K9FC 5JJLA 3H5AA 4U2EA 1F6BA 2PRSA 2A8YA 4MV4A 4RACA 2F64A 5DMXA 1X1TA 3U37A 5BR8B 1H4TA 4BP8A 5ILGA 1TCBA 4UPDA 1ZOOA 2D0OB 3OCJA 1AUVA 2VZ9A 5IJ9B 1M10A 5LIPA 2A9VA 3L41A 4M36A 1T43A 3RTAA 4D8WA 4C4XA 2VQEB 3A11A 1VYVA 4C7KA 4D6YA 1UH5A 5EJ6A 3CX3A 2HOQA 2B7BA 1W47A 1EIWA 2D5LA 5ULLA 5A7HA 5LA6A 2HLHA 3L4BC 4HQKA 4A0FA 1KARA 2F48A 4EEXA 4EMUA 4H0CA 2F67A 1SXJC 4RLFA 3ZBTA 3HFGA 2CEAA 1EYZA 3WBJA 1T24A 4QFMA 2ZBPA 1EM8B 4RKRA 4JI3B 5AVWA 4NG5A 2GCNA 4LA4A 1R4ZA 3KETA 1P1FA 1DC6A 2Y76A 5BXYA 1Q6YA 3GCZA 3NIGB 1JQBA 1V3QE 3ZU6A 4BQNA 1AKNA 2IT1A 4J2TA 3K9LA 5HGJA 1T34A 2D0IA 2G4VA 2RB4A 1ORVA 5DXAA 3TEMA 4G0UA 2WD7A 5JBNA 3LVBA 5HHTA 1Y4ZA 2VAWA 3AP2A 5HR5A 5KC8A 3T61A 5EJEA 5EE3A 2I6TA 2QTRA 1J2JA 2UZ3A 4HTFB 3ICEA 3NASA 4KYVA 4JVLA 5EMMA 1ST2A 3AIKA 5T3UA 3OETA 5AUOB 1HK7A 1B0ZA 1M66A 3BZBA 3KNZA 2FZ5A 3F97A 5AHKA 3NBFA 4X7PA 2VHZA 1XTQA 1IN7A 5AKEA 5FEMA 2XCSB 3UB4A 5DWDA 4HDNB 4IXDA 4D9FA 3SM3A 1B6SA 1NI4B 1ACJA 3QZUA 5DX0A 4TVSA 2ZRAA 2QV7A 4JJ6A 2R79A 1EDOA 1HFKA 1EGMB 4EHLA 1WMBA 3TPCA 5CEEA 3KSAC 3E9NA 4HO1X 2XOXA 4ZZ2A 1J22A 1VOTA 1LW6E 1QBKC 1CY8A 2E7ZA 1W85A 1KAHA 4E5KA 1I7QB 3GR6A 1CIVA 4EDHA 2UYCA 1KVTA 4QJ4A 3KBOA 1XCMA 4ZO6A 4UOZA 5F4BA 3DFFA 2BR5A 2HC9A 2ZRLA 4MR8A 3E3MA 2R97A 2VDLB 1MDBA 5A4MS 4OQEA 4MUJA 4Q16A 4N5LA 1XTUA 1ZK3A 3UMRA 2GHQA 3BTSA 2ERCA 2YMLA 2DUJA 2W6PA 4PC6A 3ZHTA 4BQSA 2ASVA 1L5ZA 1I4OA 1QSGA 3SX4A 3VR6H 1F8GA 1SCAA 1NKSA 2IH2A 5CBKA 2G71A 1JQ5A 1RZUA 3KE8A 3QYPA 2CLCX 1NXVA 5LXTF 1SN7A 1YE5A 2R2AA 2O0LA 3F74A 4M7RA 4UZEA 2YN2A 2RDMA 2CHGA 3AR3A 1EX1A 1G7CA 1X7YA 1QGUA 1G6OA 4BO2A 3O26A 4BGIA 5IANA 3IIMA 2DWQA 3FDZB 1DIOB 5IXYA 2WM8A 2BMFA 2O2JA 2R66A 3AF0A 3M34A 4QUDA 2JBHA 4TQ9A 2BN4A 4GQIA 4RVCA 5EJGA 1AUOA 4JCOA 3IIIA 1E2FA 2GPTA 1J5PA 3RI3A 3NHJA 2HJGA 1JT2A 2O1WA 1YB7A 3DVAA 3NBMA 1XKLA 3OTWA 1M7GA 4QDXA 1EFUA 1WSBA 3C16C 4LF6B 1V8OA 3V97A 2W2LA 3B1ZA 3CUEF 3GVPA 3QXJA 4LXIA 3AERA 4IVPA 1U7XA 2R4QA 5JNTA 1BO6A 1NSFA 2JHAA 5B64A 4YJ2B 1WD7A 5AH0A 3MTBA 1J56A 2BHLA 3RUEA 1K7SN 4DF3A 1T3HA 3A05A 4MRAA 4F38A 2YN0A 1FUKA 2AFHA 2I9KA 3FWHA 1RYFA 1C9YA 4J0DA 4W82A 4BE4A 3UH0A 1B8NA 3P9RA 5JZ9A 3FCUB 1CQZA 1S3SA 1E94E 3MC1A 4H15A 4QHYA 3FF4A 4RE6A 4DLVA 4QATA 2Z9DA 2X6QA 4M1YA 5CNIA 5DCWA 2A1TS 1N5JA 4J0IA 5B30A 3FMIA 2JCYA 4BEWA 3A9VA 3L40A 1K9SA 3NMUF 4X60A 1E2BA 4ZMSA 3ITDA 1BDHA 1XNRB 3PD7A 2C8KA 4KH1A 3S1AB 4DMGA 1EBBA 1DAKA 1LRJA 1KA9H 2QUIA 3OIDA 3Q0TA 3RLIA 4PS0A 3IR6A 4C0XA 4BBJA 3WK8A 4CMIA 2FPKA 2O8FB 3SHOA 2I91A 2DQ4A 4WOJA 3W1WA 1W52X 3B8EA 2C07A 3IOMA 5SZJA 3GLKA 4EA9A 1DQNA 2PLAA 1UBOS 4Z54A 1QIKA 1GJRA 2VP3A 2BEWA 3DLPX 3N39C 4K2AA 3UUWA 3DQQA 4GG1A 1BE1A 2HUNA 4AJ9A 6AT1A 1NP3A 4UNIA 4NCKA 3VDMA 4JODA 3T0GA 4EFNA 5LMUB 1NYRA 2XNJA 3KYCB 1AB5A 5FV7A 5CFNA 1ZK0A 3UJ3X 3WS7A 4S1WA 4IIJF 4UBJA 2Y3IA 2OHXA 4L3VA 5H7XA 2ZR8A 5DOZA 1OMOA 3EXEA 4HQRA 1WKVA 1NUUA 2C94A 2YWRA 3IPAA 2I8LA 5FPSA 5IDYA 2B8TA 2Q6VA 5EHGA 2IEAA 4YJHA 4LCEA 5LA6F 3QQPA 1RWBA 2VNAA 1ENPA 1L7DA 2Q1UA 2Q4BA 5FPQA 2ZWMA 1DARA 1H2FA 2WOOA 4Z0PA 1E77A 3DO5A 4L9AA 2QT0A 4NHOA 1XVLA 1SCUA 2C2ZA 3KPYA 4ENVA 1U81A 1VE1A 2O8VA 3HJGA 4CIDA 1FSGA 1I4DD 4F7WA 5KNBD 5KTPA 1Z06A 4N12A 2PMKA 3UMYA 1VLHA 3UAXA 1YVRA 3OZRA 1M1YE 3AEKB 3ZVMA 1IOZA 1J8QA 5E2BA 1V7PC 3FKJA 3SZ3A 4N7MA 2Q0SA 2GKGA 3I2JA 1I33A 3ONWA 4RFLA 4DUPA 3LPCA 3GPLA 2DERA 2JIOA 2Z58A 2FTKE 1NMQA 1JLRA 1JQJC 4Q1AA 1OVGA 5ALIA 3FRHA 1H2WA 3D43A 3L7NA 3TRKA 5DCUA 4MYCA 2JA2A 4BO4A 4CGZA 2I62A 3NTXA 4YMHA 3L1JA 2Z9BA 1RAFA 3AQIA 2GLTA 2OSVA 4OHZA 3PGLA 4KK4A 3U17A 5JXGA 4KU4A 1EGHA 3QEAZ 1HE8B 2AEEA 2GD6A 2BLNA 2X0RA 1PR4A 4HK4A 3WLEA 1FA9A 3FWKA 3J7TA 4PCLA 1XEXA 1NVBA 1SBQA 3RQSA 2QTLA 2VZ0A 4GL4A 2P9GA 5LU8A 3UQZA 3EVZA 2WKWA 3AUTA 1O9GA 4KJXA 2PUAA 3LFHA 3UK7A 2DR2A 4N9QA 3AFGA 5H16A 1GARA 3AI1A 4PG7A 3HBFA 5MGNA 2PUTA 5TF0A 3ANNA 2C2YA 4JGGA 1J99A 1Z08A 2B25A 2FZCA 4NJMA 4O5AA 4Z0HO 2QRGA 4OXKA 5NLLA 5AJWA 1UMDB 4X62B 3UXHA 3P32A 1KDZA 1M6VB 2QTVB 4J76A 4W6QA 3DLHA 4JT8A 2VXCA 1Z4JA 4F9TA 4XD7D 3QY9A 1JLHA 4JEMA 1Q2XA 5M29A 3Q72A 5E1OA 4XB2A 1I36A 1YIDA 4TV9F 5CVJA 1PUIA 1B6RA 1QQTA 3AEYA 2R1TB 3FN4A 3N58A 4BNMA 4CMEA 4BQEA 1M34B 2VDRB 4DM7A 4EVSA 2Q5QA 4LK3A 4RX1A 3VFDA 2PH1A 2X0FA 4K81B 5JW6A 1QH1B 2XUIA 3OVMA 1K6JA 3IDFA 3MPUA 4GZ3A 1I4WA 2WD9A 3CWQA 1WXEA 4NNPA 5DK6A 2F43A 2O1SA 2EX1A 3KXDA 4R2LA 1VJ5A 3H9CA 4CU2A 1BU5A 2CL0X 4TKUB 5CVUA 3ZU2A 1A69A 1QCDA 3RD5A 1ZBQA 3REQA 4E5DA 1HKUA 4II7A 4UD2A 1C9KA 3LCUA 2AIRA 3WWEA 2H5EA 3U26A 3JQ8B 3LTEA 1QHIA 2BKVA 5A4AA 2EJVA 3VDQA 2ZQZA 1IK4A 4FMDF 2YJTD 3M6XA 4IFTA 5FTLA 4MR9A 3TRHA 1BCSB 4ZYZA 3ZXSA 2J6HA 5C4GB 3RT9A 4M0LA 3AESA 1E2LA 3CLSD 4IHJF 2D2IA 1B16A 2PZBA 2Q6LA 1BCSA 2Z5GA 3D5EA 5DX8A 4LHEA 1TTTA 3LT5A 4CQLB 1U7PA 5FADA 1V3TA 2HJWA 5IU6A 2W2XA 4L5JA 4Z49A 1QRAA 4ER3A 3IUYA 1J0EA 2OEPA 5EE1A 1QMGA 3NIWA 4QFCA 3IQGX 4L73A 3ZE7A 1TJYA 1Z0JA 4NEGA 1PX2A 3VSBA 4ALJA 2QE7A 4GPAA 1XAJA 5D6NA 1J8VA 1EFLA 1FL9A 2GZAA 5A2GA 3DVLA 4MWOA 3GJ8A 1WZEA 4RKYA 1HC7A 1YB4A 2FDXA 3KJIA 4LDPA 4MWBA 2WWVD 4HDKA 3LDUA 2JPDA 3Q15C 2ACEA 4BKRA 2HSGA 3SC2A 5DN6D 2Y1DA 1TM7E 2IE8A 2DM6A 4L6AA 1J09A 1Q0RA 4V02A 2BDEA 4UEKA 4EABA 1U3DA 4K0RA 1RABA 1AKTA 4IHKA 2X40A 4AY2A 3E3AA 3FFBA 4Z9YA 3O4HA 1IWPB 2BEUB 1HFWA 1Y7LA 4WL0A 2DR0A 1AGNA 1PHPA 2FB9A 2WVAA 3AFOA 3HPQA 3OBIA 4R68A 3E3NA 4RYLA 4Y2JA 3X1KA 1T5BA 3W9SA 1UCFA 3KG2A 1YS4A 4I2NA 7ABPA 1CF2O 2ZIXA 2FFRA 3A9UA 1QZZA 1NMZA 2GD0A 2WW8A 4A2PA 3UM9A 4G5RA 4PX2A 4RAQA 1S96A 3DWEX 2JKVA 4TL9A 1PR5A 2GRAA 4H18A 4JYBA 2QLBA 3VHRA 1XZFA 1JS1X 3EY9A 1PFWA 3TN7A 1Y8ZA 4EPTA 1QDLB 1QQAA 4AURA 1JQKA 1VP3A 4PG5A 4BP1A 5L4SA 4FYXA 3AEUA 3PDIA 4BMZA 5IJWA 5JWHA 1TC2A 1SULA 1ZZGA 2FZLA 2NT4A 1DAEA 1SVLA 2HMYB 4DNPA 3WYDA 1A9OA 3ELBA 1O87A 2HQ1A 4BAUA 2A92A 5GTDA 4N48A 1Y9ZA 2JDIA 3S7TA 2DFKB 3BDAA 4V0KA 2F90A 1K6EA 5HFNA 3C1OA 1GR0A 3D0RA 3LH5A 3QENA 3ZHCA 3OZVA 3DF9A 1CV2A 2EX0A 1BFDA 3KUXA 5E6SB 3RTBA 3ZW9A 4CV1A 4EM6A 4YXWD 4UFPA 3GEPA 4G65A 4O6VA 1ESNA 4LEIA 3L8YA 4LZWA 4RK1A 3SXUA 5I7AA 5FWXA 2CJPA 3EZFA 3UEOA 1N1MA 5ECDA 2HK7A 3PGXA 3R5TA 1B41A 4M76B 2BL4A 4LYGA 2JHCA 3UK2A 1M1UA 3FPHA 3SYKA 1KYXA 2R6R1 4QODA 4RTPA 4X61A 3LXMA 1SCKA 2AV6A 1PJTA 3V1LA 4B0PA 3N6VA 2EKZA 2OBMA 4UZSA 5ALJA 3S2EA 2Z8YA 4JYZA 4TYNA 2DBVO 3FNEA 2WWFA 3Q5GA 3UHPA 4BQIA 2Q0XA 4FBLA 1Z5UA 3TW0A 4F6LA 2XITA 2J9YB 4UNSA 5CD1A 2FSIA 1NP7A 5KYXB 3LQ1A 1Y3AA 2ID7A 4NU6A 1WQ3A 3F8SA 4JI5B 2FMTA 1Z45A 3THSA 1AGRA 2PGOA 2W6ZA 3G8BA 4YRKA 3JAMA 2AQ8A 4CGYA 4FFBB 1N34B 1L4MA 4Q4JA 2I78A 3TJZA 1XQ6A 1IY0A 2LPMA 4RNCA 5FIUA 4EGSA 1YC5A 5HZKA 1PWHA 1WBDA 2JIDA 4AJEA 2JLZA 4COKA 2CDCA 4Q4HB 4ZO8A 3WK6A 1TJ5A 1MTZA 3WX0A 4CIYA 1EMDA 1ZD5A 1A9XA 2J5BA 2NLOA 2YINC 1KZ6A 3Q10A 1BE6A 3HCCA 2VBIA 1CS0B 4A4DA 3MYRA 2DSNA 4K9KA 5HRAA 2JH3A 1TCAA 1O95A 3UWPA 4IDBA 5BNIA 2BD0A 2OHFA 5BR7A 3IE0A 1O6GA 1ZK1A 5FPKA 1JHMA 2BFPA 2ARKA 2WJAA 1B74A 2P35A 2ZB8A 4GXTA 4H7JA 3F3MA 2J30A 3R9IA 2RD2A 3AM3A 3TR0A 4JYAB 1YKGA 3G23A 5T8KA 1TQ2A 2VYQA 4B09A 4AAYA 5IJ0A 3K1ZA 1M34A 4Z7OB 3L5OA 2UU9B 4BNDB 3RVDA 1JXOA 1KEVA 2AFIA 3AXTA 2VFAA 5KTNA 2G09A 1R5NA 1JIXA 3RARA 2QG9A 2HRDA 5KOHA 3CLSC 5JSKA 4RK0A 1G8AA 4B4DA 4BL5A 3FCOA 5M7EA 2PNFA 1AS2A 2C1EA 2NSJA 4QNRA 4BLOA 1CK4A 5I48A 4G1UC 1H2BA 4JJGA 2JLVA 5CHYA 2VIIA 1RFGE 3DE2X 5FWYA 2GPWA 4O0MA 2OGSA 2G76A 3GRPA 3I58A 4QFDA 2EIHA 2J9FB 5CA0A 1IBRA 4CM4A 3HDJA 3OZDA 3ZQKA 1BDIA 1KAQA 1TDJA 3RC1A 3W1VA 4ZFNA 1OTHA 4V24A 1TAQA 2A5JA 2ISSD 2RONA 5T64A 4GOMD 3EMVA 2PVPA 3TKYA 3ZD8A 4B47A 3WL7A 4B17A 3ZQJA 1V1RB 3A1TA 3DE4X 3GLQA 2NZYA 3PCRB 1QP8A 1T6YA 9GPBA 4LXXA 4J0FA 2PWAA 5DJ5A 3G9UA 3HLYA 1QPGA 4I46A 1U0SY 2W93A 5IWAB 2J41A 4DLZA 2IV3A 4BB6A 4C4TA 2R9VA 1MW9X 1AXGA 3W3AD 4HNGA 1A4IA 3FHOA 4WK6A 3RVQA 3F6YA 4K1LA 1E8MA 1QS0B 4YGXB 1E99A 1E1LA 1Z29A 4JT9A 4ND6A 2PYDA 4ZI7A 2I7XA 3OOWA 1PJBA 1DXOA 1GQOA 1MQAA 3KYIB 1S3FA 1V7CA 3MGAA 1U5AA 3MMPA 4QPNA 1XROA 4K0KB 2ECFA 1IZ0A 1DFIA 3I2HA 1XD2B 1NW7A 1YR6A 1HBJA 1NXTA 3FLMA 4TTPA 5JNWA 3QXHA 1P7VA 2XWSA 3CNOA 3SLGA 1UZNA 1IRXA 5EUQB 2H51A 5H5JA 1NJSA 2N1BA 4K5QA 1Y8RA 4QYIA 3V4ZA 2DHRA 2IP4A 3ZZNA 2QB5A 3OIUA 4JVSB 2PY6A 1QFZA 3AVUA 3PUJA 2ZJ6A 2AJDA 2Z8XA 1B4DA 3ECAA 1LVHA 5CTJA 3C5CA 4Q9HA 5AJUA 1RE0A 1Q16A 2ZI6A 3VOTA 1U0NA 2BSXA 3NV9A 4C20A 4RTOA 3AUKA 5BNZA 1EFHA 2H6EA 2NP6A 3INTA 1M75A 1WCIA 2GS9A 2ZJOA 2I2XB 1ZJ6A 3G7NA 3NWOA 3BM5A 3ETHA 5EP3A 5KIAA 1G19A 2WTXA 2W5UA 2NZ2A 4OGLA 5IAEA 1YZHA 3BYZA 4BBAA 4J0HA 3A6JA 4B3CA 1ORRA 1S0UA 5GJVC 4ZVPA 5FBHA 1QNLA 3H1PA 1J8FA 3LXRA 4GWKA 5H3CA 2HRZA 4MYUA 2GXQA 3K6JA 3WISA 1KQOA 4XTRA 3RTCA 3ZHVA 2R8XA 3OESA 4ZU3A 4JP5A 3CH5A 4JT2A 4NBWA 5EFZA 5ALYA 1CT9A 3NP7A 3VH4A 3L06A 4F4HA 3R7WA 4TVBA 4QGGA 4OATA 5ALSA 3T9EA 3RV3A 2B61A 1T2UA 3E9YA 3MRSA 3O1LA 1HG0A 1JHZA 4MI6A 2JGDA 3W2GA 4YDQA 2JFVA 2QYOA 3EQZA 4XPZA 3GUZA 5GZ6A 4IDXA 2YJ6A 4CT0A 1NJFA 3SR4A 3TAHA 4DA9A 1NUQA 2C8VA 1FFGA 1Y4UA 1A8PA 1M33A 3NG1A 2JGJA 3T1QA 3VDXA 2P6OA 4YYEA 2FPXA 2H29A 1N7JA 2Z1NA 4R8LA 2FP4A 1NW9B 1YZGA 2A84A 3CEAA 2C4VA 4DXDA 1IJEA 3GCWA 3WJ2A 1XQXA 3FOZA 2OCGA 4HB0A 2C0PA 3HY4A 3Q3HA 4KFTA 4B4OA 4L0DA 1P5JA 4CPDA 5B55A 1CEEA 1SU7A 2YTZA 4UCQA 3BJEA 5HP4A 1WMDA 3C3PA 4FOPA 3WYBA 8AT1A 3KLOA 2WP0A 5I9NA 3DVQX 2WB2A 4Z7JA 1OIXA 3WB2A 5JNRA 2B8EA 3U4DA 5JCOA 1EPUA 4EGQA 3CLUD 5K4GA 2ORED 2FWMX 1G20A 2XMPA 4GVPA 4XQ0A 1J9GA 1DIBA 3WYEA 3O8QA 5DISB 4DADA 1ZNQO 2BKLA 1EVYA 1BS2A 3S2YA 5EMHA 2JZNA 5EYPA 4IDOA 3F6BX 1N5KA 5HZHA 4PZPA 3NDJA 4AFNA 1L8AA 5GWXA 3PNMA 4PYIA 2NPFA 1S1MA 2QDXA 3BH0A 1SVSA 3HCFA 2QHXA 3CB4A 5L3SA 2BBOA 4MLCA 4QRDA 4DCPA 2WU1A 4GXQA 1PFQA 1U28C 2J0VA 3EVAA 4OQZA 2IYXA 4ZGGA 3T4EA 4GZLA 5EWLA 1APBA 1WA5A 3EGEA 3TLJA 3L82B 4L2IB 1DGQA 1Q92A 1YS7A 5F9MA 1BS1A 4MLZA 3E2MA 1CJUC 3K2BA 4LDJA 4B4UA 4X66B 3CW8X 2H9YA 3QXCA 5CDFA 4QVIA 1OWLA 4GS5A 1VG0B 1RFLA 3NC4A 4O1MA 4RE5A 3AL0C 1W581 2XF8A 3C8DA 4C05A 4ZI3A 3FLAA 3P9KA 3TMAA 1EE9A 3PL5A 3HNPA 4EKYA 2V9PA 1XAHA 2G3YA 2CKMA 3DMPA 2YIJA 3IEVA 1UJ2A 4XYGA 1SUDA 2RJOA 4WLVA 5D3KA 2Q7OE 4UBKA 6GPBA 1XWFA 3LD9A 2JFGA 1QH0A 2AHRA 1LF5A 1FMFA 4DSNA 1QJCA 1REQB 2ZSFA 5ELLA 1WOYA 5GV7A 4X1KA 1SUSA 3X1MA 1NF9A 3NCHA 2QTCA 2GZ2A 1F5NA 3ETLA 1YZFA 2PFSA 3DHEA 1U80A 3QJYA 3WK7A 1Q21A 2A5YB 4UHHA 1UDBA 1YU9A 2ZYHA 3TRFA 3PKIA 1U4OA 2OAEA 1B15A 2W4MA 4TWAA 4YK7A 1JIQA 3QUSA 4B3JA 3EQ8A 3T7TA 2IGBA 1LV7A 1Y81A 2MMGA 1VL5A 4IHAA 2XUHA 3TFOA 1DEKA 2WB4A 2ZRQA 3BMXA 1JAZA 1N6PA 3FNHA 3L7KA 3QJ5A 4LBYA 5E9AA 5T5QA 3IT1A 5ARDA 2O2IA 2QR2A 3BH6A 3BHNA 3WIDA 4AJ4A 2CC2A 3OZXA 5TE9A 1TI7A 5M34A 1H2HA 4F8JA 4ZYUA 1PR9A 4GHWA 1D2NA 1L4UA 2W83A 3ESDA 2Q7DA 1EU1A 5K8JB 1EUCA 1E3IA 1RAGA 1RPNA 2ZBVA 3IULA 4H7DA 1DG3A 4C4ZA 4EG4A 2C0QA 5T4FA 2G0TA 2I66A 3H1BA 3RWOA 4NI5A 3QUTA 4DNFA 1AD2A 2DP4E 2ZITA 1ZONA 1E64A 3V7NA 13PKA 1BGWA 4P3YA 4NXNB 4ISBA 4IH4A 5FUYA 3BQMB 3DE3X 5EERA 1XB2A 1J24A 4G0QA 1H65A 5EIOA 1N9GA 3BWCA 1B23P 2X7XA 2XB6A 2XEDA 4B35A 2FPLA 3TEFA 1DEHA 4RD4A 4ENTA 2Y77A 1NLFA 3F1LA 4H17A 4K6HA 1N6OA 1E4VA 3GHHA 1GG8A 2IP1A 4TS4A 1N92A 3STTA 1I5EA 3WYFA 4Z53A 3G13A 1DIAA 3VHLB 3PXDA 3Q5DA 4P82A 5GONB 3AHHA 4XOIA 1W36B 3T1YB 3PB3A 2VJAA 3RK0A 3QI2A 4A10A 5C52B 4C0AC 1FS6A 3CG0A 1M2KA 1BW9A 3H42B 2R3SA 3PQ6A 5LFAA 3JQPA 3GMSA 3NZEA 1L5RA 1TC1A 5AKKA 2W6MA 1G41A 1FUIA 1RI3A 1WL8A 4BIMA 1KP3A 2QRJA 3PPIA 3WGZA 1USKA 1I2AA 2A0FA 3PLNA 3HZHA 1OX4A 3N76A 4PC3A 3AUXA 4MCIA 5KVSA 3CVXA 2PRIA 3BRWA 721PA 2CLLB 2O0JA 4LZNA 3MTDA 3DTVD 5TY0A 7AT1A 3THYA 3WGTA 1DLJA 3RU3A 4YMUA 2PWPA 5KPJA 1EESA 1HO3A 4UJ3A 4YJ2A 5FT9A 5ESWA 4EI2A 1P3Y1 3BGDA 5E9QA 1BRMA 5EZYA 3BGIA 3G8YA 3TQQA 3ZKWA 5B1YA 4RTJA 3MT0A 3WLOA 3ZVNA 4RZQA 1ZJYA 3SDBA 1Z8DA 4B3BA 2D0PB 4PGAA 4BKPA 1OLXA 2NYRA 1KR5A 2RJ3A 2CJXA 3KT0A 4TWJA 5LL6P 4URZR 4GLBA 3DD5A 1TIPA 1EP9A 1VG9B 1Z74A 1L4BA 1E79A 1IY8A 1WUTA 2GN6A 2QQFA 3B9RA 4IYRA 2NVUB 1TCUA 1V1MA 2N9UA 3QKTA 4RHFA 1GXSA 3G82C 2GBGA 2IHNA 5ARBA 1ZCAA 2I54A 2EX4A 4BEVA 4K9LA 3HRKA 3TWOA 4WSOA 2JLSA 3ZV4A 4UUPA 2V7GA 1Z5GA 2FCRA 1JWLA 3DS8A 2PXCA 4B9EA 2Q3MA 2ZETA 1CQWA 4FGKA 4QUKA 3F7MA 2O06A 2C31A 3BGWA 1Z62A 1EIZA 1PE0A 2EW8A 3V00A 1N36B 1ICEA 1VRWA 2NGRA 2VNHA 3G7UA 3KAKA 3RLFA 4TWZA 1Q1BA 4MWSA 1U7DA 3ELYA 3KEQA 1G2QA 2Z04A 3IP7A 4FZ3A 4C0JA 5BP7A 1TQ6A 1QH8A 1KEEB 2O8BA 2FEAA 1F7VA 2B4QA 3AJDA 3G0CA 1WY7A 4GBMA 4IDDA 4YASA 4C7BA 2ZAIA 2HK9A 4ENUA 5H70A 3RKSA 1ZH4A 5L3ZA 3UVEA 1RCTE 5CYGA 4KR3A 3LUJA 4WNAA 5G1OA 4KR7A 1ETUA 1GNRA 1U2GC 4KC0A 4WI1A 5EJMA 3IKTA 2WMNB 1NLMA 2RHTA 1AX9A 4FB4A 1ODFA 1I51A 1EE2A 1I4TD 3AZOA 3DMHA 5ED0A 5LQKA 4W7SA 3QE0A 4DMMA 1KEKA 1IVNA 2X1HA 1ADBA 3X2FA 4D45A 3T5MA 3BBLA 4TVKA 4ALMA 4BC0A 5M5BA 2X8WA 4TYWA 3KM0A 5J63A 4AQDA 1QIHA 2VPTA 1NM5C 1U4SA 4Z5XA 3IUSA 2E4AA 4R0NA 2E4UA 1Y6FA 1ZNXA 1ML4A 2A2ZA 4KIWA 1U7OA 1KXZA 1P5RA 4KZPA 1EP2B 4Q3DA 3IAM1 4MLDA 3PEYA 5LXTB 2QN2A 5EJ2A 3T1OA 4YONB 1OKKD 3LX6A 4AROA 2EJCA 1E6WA 1P9NA 4OQXA 4A1FA 2Q5FA 3HSKA 1P1BA 3OQ6A 3DFMA 1OXSC 3EEQA 4WVFA 4BO1A 4DHWA 1OJ7A 1GPAA 1B0AA 1C7QA 1IZYA 2YW2A 3FGNA 1D03A 1VC2A 4CE6A 1KC3A 2FW6A 3A2NA 3X2SA 1ZBDA 4CUJA 3FY4A 2GLUA 1RKQA 2SCUB 1U8FO 2CDBA 3I1YA 3Q3JB 4FMCB 1ES9A 2DLCX 2REOA 2V0NA 5CX1A 1QGZA 2K7FA 5DE3A 4FFNA 5DNYB 3A4MA 4LNAA 4HH1A 3AF1A 3UYLA 1RRFA 4E7OA 1U2EA 1ZGHA 1ADJA 5ILOA 3D0KA 4FFVA 2C2HA 3ND7A 5DN6A 5K5EA 3T7KA 3ZGLA 1D0SA 5KKNB 3TQOA 1E9AA 1O57A 3LC0A 5K2OA 5I4CA 2QRMA 3AUJB 4L9SA 2XNCA 3D3KA 1G9XA 4M4SA 5KX5B 1F7UA 3D6FA 2O7VA 2R8OA 4CDMA 1F3OA 2DT8A 2NIPA 4PZLA 3VJKA 3F5SA 1ZMBA 2JGRA 4FYKA 5EPEA 1XFAA 2IXDA 1UAAA 1J6UA 4WJLA 1E3DA 5H3HA 4ARSA 4IDQA 4Z9FA 4UBMA 2VCEA 1EGVB 1YFJA 3GI1A 4OFZA 1E9RA 2RC6A 1N2OA 4L0CA 4OHPA 4UVIA 1E61A 5TQ0B 4CKBA 3PHLA 1FFXB 2C96A 2JLCA 3F8TA 3UMBA 2Q41A 3M9XA 4R3UC 3B1FA 3RK1A 2GK7A 1WZIA 4TTVA 1S2IA 4IS2A 4TMWA 2BEVA 4TQGA 4Y2YA 1IG3A 1O95D 1UQRA 1U2SA 1NUSA 4YI3A 5KNDA 1U9IC 3GLHE 1W76A 4KL8S 2C3YA 3QEMA 3QV2A 2DE0X 4M6WB 4LQCA 4MWDA 3CF6R 1Y63A 3ZZ1A 1IMOA 1RAEA 4DKXA 3HR7A 3UN1A 4AULA 4R9VA 1FEZA 3UC9A 4C5AA 2PR7A 2WICA 2IL1A 3EUFA 2YFKA 3JQ8A 5CGZA 3WLRA 2FSVC 1HH4A 1ZDMA 4KSBA 2XB4A 4XJXA 3T06B 1G20E 4YEDA 4PYLA 2VHJA 3EFBA 3GA7A 4TTJA 2Q2WA 3ND9A 2WMYA 1Y1KE 3MN1A 2PGJA 1O3YA 2PQ0A 3OFNA 2G28A 4AJOA 1CB0A 4RS3A 2HYIC 1SM4A 3O8OB 1KH1A 4LXTA 3ROMA 2WU0A 5ALWA 3HDYA 3UMSA 3LYLA 2AG1A 4TSFD 4K9RA 3E9DA 4LNHA 1DRKA 2I2WA 1E5LA 1FZQA 2H59A 4ECAA 1FQOA 2ZQYA 3PGJA 4UTPA 1EK2A 4HNAB 1CW2B 1ETHA 1NT4A 3DA8A 2MU1A 1SD5A 3GJXC 3DOEA 3P8ZA 4UM9B 4O5OA 1EG7A 2E89A 1L7NA 2FZWA 2PL3A 1Z0KA 2PRZA 5FL7A 5KSPA 3PUXA 3RHTA 4YYZA 2M1ZA 2CNBA 2AOUA 1AXRA 2BKUA 3SJBA 4Q3LA 4F9FA 2C4UA 2EHJA 1SCIA 2VEOA 5EKDA 1S2LA 1J0DA 2BBWA 1WXWA 2ZE6A 3T12A 3VX3A 4CBVA 2W2KB 3V8RA 3AHJA 3EC2A 1SB9A 4JDUA