2Q1SA

Crystal structure of the bordetella bronchiseptica enzyme wbmf in complex with nadh
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
351
structure length
336
Chain Sequence
NASKLANTNVMVVGGAGFVGSNLVKRLLELGVNQVHVVDNLLSAEKINVPDHPAVRFSETSITDDALLASLQDEYDYVFHLATYHGNQSSIHDPLADHENNTLTTLKLYERLKHFKRLKKVVYSAAGEETDIVSLHNNDSPYSMSKIFGEFYSVYYHKQHQLPTVRARFQNVYGPGEILGAGRWRGTPATVWRNVTPTFIYKALKGMPLPLENGGVATRDFIFVEDVANGLIACAADGTPGGVYNIASGKETSIADLATKINEITGNNTELDRLPKRPWDNSKRFGSPEKARRELGFSADVSIDDGLRKTIEWTKANLAVIEQIMRKHDSALATYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Predicting protein function from structure--the roles of short-chain dehydrogenase/reductase enzymes in Bordetella O-antigen biosynthesis.
pubmed doi rcsb
source organism Bordetella bronchiseptica
molecule tags Sugar binding protein
molecule keywords Putative nucleotide sugar epimerase/ dehydratase
total genus 128
structure length 336
sequence length 351
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q1sA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2q1sA02
2V6FA 1YVEI 4IS2A 3VPHA 2NUAA 4O6VA 2WJPA 3IJRA 3W4KA 3R6DA 5EL0A 2OUIA 5L7YA 1O5IA 5TF4A 4E5YA 4IM7A 2I76A 4FJ1A 4GL4A 3MWDB 4W7HA 5T64A 2JFGA 1GFSA 4IUYA 3PZRA 4GMGA 4HFJA 5EQFA 5HS6A 5T8KA 4OO3A 1QSGA 1ZEMA 4K1LA 4DC1A 5L95A 1JDJA 1WW8A 4FFRA 2I99A 4MPDA 3AWDA 1V3TA 3OJOA 2E6UX 2Y99A 5GZ3A 3ADOA 4E33A 2FPGA 4BKOA 4KWHA 3JCZA 9LDTA 4Q3AA 4E12A 1Y5RA 2IXBA 4XGKA 4QTZA 1LU9A 2I65A 4Y6RA 2PV7A 3TZHA 2AQIA 2IEDA 1GCUA 3FWZA 5AOVA 3DFUA 1PWXA 2YYYA 2I3GA 5JCJA 4I8XA 2ILTA 4DRYA 2OBNA 5FYDA 1LUAA 3JQEA 1EZ4A 1JVBA 4RVUA 4D42A 1JAYA 2PZKA 3OFSA 1U3UA 1Z45A 3JQ6A 2UV8A 3ANNA 1NVTA 4W82A 5T6BA 1ZSVA 3OEYA 3HHPA 1V6AA 3HDJA 3ADPA 5H82A 4KDFA 4XEHA 1XWFA 4Y98A 3ZHBA 1O89A 1I2BA 2QG4A 1CJCA 1WMBA 2W2LA 4E2XA 5JY1A 1NVGA 2ZYDA 5F1KA 3WQRA 3I9JA 1XIVA 3G79A 3DO5A 2X9VA 3GRKA 4E2WA 5L45A 4YQZA 3PDUA 5KJEA 2DBQA 3COSA 4R41A 5I9NA 2E49A 3WGYA 4JROA 2PD3A 1I2ZA 3LQFA 1DB3A 4ND1A 5BNIA 4CM1A 5KKCA 4CQLB 1L7DA 3DBRB 4PZCA 2DPGA 3DZKA 5JLAA 3GRPA 4E5PA 2NNLD 2DBVO 4BL5A 2J3JA 4FB5A 5CEEA 3R1IA 5MGBA 3PXXA 4WCDA 4E3ZA 3K31A 1ZFNA 3QY9A 3WGZA 4KQXA 4CQMD 1I8TA 3JD3A 4J1TA 2QHXA 4TRNA 7MDHA 1EVJA 4GPD1 2Q1UA 4DBVO 1H94A 5L7WA 4WPGA 1ISMA 3GNTA 4EGFA 1HWYA 3OA2A 1Q0QA 2B0JA 4A5OA 1KETA 4Z0TA 1SZJG 4B3JA 5DZSA 4L9RA 3N74A 4L0QA 2B4RO 2C07A 1NPTO 2HMSA 5DN9A 3VH4A 2EGHA 4BNGA 3GG9A 2RH4A 4NZ9A 4RLSA 3T4XA 3BAZA 3NEPX 3JQ9C 2IYPA 5DCWA 3TFQA 2G76A 3V2UA 2GN6A 3GFBA 3I4FA 1D1TA 4BGEA 1U7TA 3DL2A 4JN6B 3OQ6A 4DC0A 1PQUA 1QLJA 1JWAB 4WJZA 4DMMA 1T2DA 5JBIA 1JTVA 4Z3KA 3OQ1A 4MVJF 1XLTA 1DC6A 3AUUA 5K6AC 3WTBA 5JDIC 1WP4A 1I36A 3FWNA 3CKYA 2C5AA 3X2EA 4PG6A 5G4KB 5G0SA 4ALKA 1DC4A 3OBBA 5A03A 4E5MA 2CY0A 1CWUA 2J3KA 2VHVA 4J90A 2ZB3A 4NBRA 1NHWA 3L6OO 3E6AA 3UKOA 4W7IA 1PJTA 4CLHA 1MXHA 4XR9A 3HADA 4YRDA 4U6SA 3K8ZA 3DAPA 2XOXA 3D3WB 1BDMA 3V5NA 1C1XA 3PPIA 4P8RA 4I5DA 2HRZA 4DREA 2B4TO 3CIFA 4A0SA 3GZ4A 5JW6A 3BTSA 2O3JA 1L7EA 2AG5A 2BD0A 2RH8A 1R4NA 4FJ0A 4Q3EA 5EERA 1ADCA 3I9OA 4FFNA 5KJ1A 3CUKA 1IYZA 2OFPA 4CM8A 4DXHA 1U9JA 2DPHA 3PJEA 1P33A 3H3JA 4P4LA 3JQAD 4NK4A 1HL3A 1ID1A 1GZ4A 1V35A 4F6LA 1EDZA 4IY1A 3FBTA 2QZZA 5JNLA 2Q99A 4U0KA 3MTGA 4HADA 2O4UX 4GMFA 4KUGA 1E1NA 4B4UA 3OJLA 1EUCA 3EZLA 4QO7A 4IBOA 5JDCC 2CUKA 3G1UA 3KRTA 1E1LA 1EFLA 3FBGA 1HYHA 1UAGA 3M2TA 3JYPA 4WGGA 3UCFA 1VM6A 3ON5A 4LW8A 5EPOA 1J49A 1JKFA 2NQTA 1P1IA 4XB2A 2I3AA 4CMIB 3GF4A 5DBGA 3DONA 2OGUA 5CDSA 5ICMA 1JA9A 2G5CA 4XCVA 1KYQA 4XDYA 5CEJA 1QV6A 3Q0EA 5AVOA 2PD6A 1XDWA 4R68A 4RVHA 5A9RA 3MCVA 4Z3DA 1G1AA 4PG4A 4R5MA 1QYWA 2O4CA 2WD8A 2YDYA 4HFMA 2NV6A 2QRJA 3ULKA 4HP8A 3OETA 2P9CA 2LDXA 1E3SA 4CM4A 3NT5A 1ONNA 1SBYA 1T4DA 5C5IA 4YWJA 3UICA 1C0IA 3PJFA 1B8PA 2E4AA 4GWGA 2CDAA 1HEUA 2PH3A 3QVOA 5CHEA 3VPFA 4URFA 1HKUA 2P91A 3BXXA 3LF1A 7ADHA 4WEQA 4EUFA 5ENDA 1Y1PA 1B0AA 2VRCA 2NVUA 1ISFA 3TZ6A 1BW9A 4DBZA 4BKRA 3PHLA 4XYGA 1HF3A 2HO5A 4LMRA 3WSWA 5A05A 5AQ1A 4II2A 2F1KA 2D5CA 1K6XA 4MO2A 4ZU3A 1C14A 2JHGA 2VTDA 5G4KA 1CERA 1I10A 4R9RA 3RU7A 2PWZA 3ZHYA 3ZNQA 5HS4A 3ZV3A 2EKPA 5C7OO 1ZK0A 5ER9A 1JWBB 3G49A 2UUPA 4EI2A 4RVGA 4BGUA 4MIOA 4F46A 4BV8A 1NAHA 2NU8A 3DZGA 5JSFA 4UEOA 3AI2A 4HV4A 1K0UA 3WR5A 2EF1A 4M1QA 4J0FA 3DTYA 4HNGA 3RI3A 1Z74A 3WGOA 2EP5A 2GZ1A 5G0WA 5IJZA 4GI2A 4NJMB 1DRVA 4OHUA 4H7PA 4YAEA 4GSKA 2CSUA 3V2GA 4WECA 2GUGA 3AFNA 3TL2A 3RBZA 2W8ZA 4MP8A 2PZLA 2D8AA 1GUZA 1T2AA 4MVJG 1GY8A 2BELA 1ML3A 2CVQA 4DYDA 4CL8A 3ROQA 2YW9A 3LU1A 3JQAB 4JBIA 1CF2O 1NPDA 2C59A 5COAA 4CQMB 2PNFA 1NWCA 3B20A 3QRWA 4WNIA 5IN4A 2OP1A 2WD7A 4PZDA 3EVNA 3HB4X 2HRBA 4GKVA 4CR8A 4GX5A 4PLFA 2UDPA 3TNLA 3JQFA 1F8GA 1MV8A 2QQ5A 4PG5A 4QXMA 2WYWA 4CQLA 4CM5A 1VKNA 2FHSA 3TZKA 1OZAA 3KB6A 1AE1A 3BZUA 3ZU3A 2R6JA 3FNGA 1XYGA 5DCYA 4D44A 1C1DB 3AK4A 4C4OA 4W4TA 3FRJA 2AE1A 1ENZA 4DLBA 1E77A 3BIOA 3ZWXA 3DEYX 1IHXA 1KVRA 2Q1WA 1PJLA 3E8XA 2JFFA 4PLZA 5L53A 1GEGA 4BMNA 2B5WA 2VHYA 5HRUA 3W6UA 3R3JA 1YKFA 4E32A 1KC3A 4XIJA 4Y8VA 3IAHA 4Z9XA 2DC1A 2ZJ0A 5U4QA 3GN1A 4B4OA 1IY8A 1EQUA 4EBFA 3JQ7A 2HAEA 1PJ4A 4ZQHA 3WJAA 1CQIA 1N9GA 1W6UA 3H9UA 1ULUA 3LLVA 3GT0A 4AJEA 1O9BA 4FGWA 5T57A 2JD1A 3QLJA 2O7QA 3C7DB 1UH5A 5L40A 2EKLA 4YDRA 3FTPA 4QX6A 4DPKA 3GA0A 3UOGA 4ILKA 4DQVA 3INTA 3NTRA 3ZWOA 4BNVA 2NSDA 1UUFA 1HE5A 2J3IA 3ONDA 4XYBA 3QA9A 3AUTA 1I3KA 2VRCD 3RFTA 4BO8A 1LSUA 4R1SA 1VI2A 3DTTA 1PS8A 2EP7A 4YT4A 4FFLA 1ORRA 2XXJA 1NBOA 4XQ9A 4IINA 1EQ2A 4JNKA 4BO5A 3KETA 4BO7A 2WTBA 4TVOA 3TL3A 1YDWA 2GPTA 3LT1A 1UDAA 4FD3A 3RUDA 4ALLA 3B1JA 4WE3A 4IGFA 3A14A 1LRLA 1R6DA 4YR9A 2FR0A 3IUSA 3PRJA 2EW8A 3I5MA 4XQCA 1LDMA 3ORFA 3D0OA 1Q2XA 1J5PA 3S55A 1VL0A 1KY5A 4GLLA 3ZH2A 1JLLA 4YJHB 3GNQA 1PZFA 1DRWA 1BTOA 3B6ZA 1E3JA 3BMQB 1ISJA 1PJ3A 3EW7A 4IJKA 4OXNA 3WG9A 3PGXA 4CMHA 4G2NA 1I32A 2BLLA 3TWOA 4MJLA 1A72A 1JQBA 3WYBA 4UVGA 1LDNA 4AL4A 4FDAA 3IOYA 3ITDA 5DDIP 1E3WB 1DLIA 3BTOA 3IS3A 3KO8A 4RPKA 2AA3A 3VTFA 3VZRA 1DIGA 3ENNA 1RKXA 2DFDA 4R1TA 1TEHA 3NV9A 5JFOA 3FPLA 2NM0A 4XR4A 4J6FA 4ZQGA 2EERA 2Y1OA 1U3TA 2Y0CA 3HNPA 3Q6IA 1FDWA 4HNHA 4DL9A 3MZ0A 2JAHA 3EC7A 3SXPA 1HLDA 3IKTA 3I52A 5TRTA 3WIEA 1DFIA 1JN0A 4ZGWA 1ZSYA 2B36A 5KVCA 4QO8A 1SEVA 3DMTC 2RCYA 3IQDB 3Q9NA 1BXKA 2PZJA 1E7WA 3WDSA 3U4DA 4MP6A 5G4LA 4DWVA 3E1KA 1VL8A 4CLDA 1YONA 5JCJD 3O38A 2NTVA 1Q0LA 2O2SA 2I5PO 4EEZA 1A7AA 3PK0A 3E18A 1PX0A 3RFXA 4BNJA 4NFYA 4GBJA 1AUPA 4J3FA 2X5KO 3I6QA 1R0LA 2Y05A 3P7MA 3OJEA 5F1PA 3WNQA 4D0RA 3IUPA 3F4LA 4C7KA 1PGJA 2TMDA 3LLSA 2BFPA 5K9ZA 3EK2A 5I7SA 4DLLA 4A26A 3TZQA 4IXTA 1Z73A 4E21A 3ZHXA 2C29D 4GVXA 3GZNB 4Z9FA 2P68A 2UAGA 1BMDA 5U1PA 3ZWBA 2VNSA 3AM5A 2BFOA 3K2BA 3NX4A 4I5GA 4DA9A 3DC2A 1YBVA 4RQUA 1EBUA 4IDGA 4CUJA 3RVDA 4D45A 5IDXA 3HG7A 2FY8A 4NDNE 3WBBA 1LLDA 5A9SB 4PLVA 1V9LA 3KM0A 3GG2A 5A06A 3W8DA 2PR2A 4PLTA 1IL0A 2GLXA 2RAFA 5TSDA 3K92A 4ZJUA 3U4CA 5HTOA 1KVUA 3QSGA 4UUOA 2D59A 3ETGA 4CV0A 2V6BA 2NU6A 3RBVA 1ZXBA 1A71A 2NADA 1QLHA 3SJUA 3MJ4A 1ISHA 4U8GA 4C7JA 3L77A 5B4VA 2A94A 2FMUA 1FK8A 3K5PA 2ZJ1A 4J4TA 5A02A 2NU9A 4JXKA 2VHXA 3AFMA 4BNNA 2EKQA 2G0TA 3DAGA 3O8QB 3AU9A 4QFDA 2Q2QA 4M49A 1IZ9A 4TWRA 1R0SA 1XU7A 4DLAA 1R66A 4BUCA 4YYZA 1YDEA 2BFMA 2YV2A 5IG2A 4TMFA 4XGIA 2VZ9A 1QRRA 1RYEA 1VSUA 4BB6A 3M1AA 5IXSA 1RJWA 3E9NA 4CODB 2XXBA 2VOJA 3K30A 1RM4A 1GQ2A 2YUTA 3LYLA 4J7XA 5GZ6A 3AW9A 2NVBA 3RC7A 1T24A 1E6WA 1DXYA 2ZIZA 3AJRA 3MJEA 3PP8A 4GX2A 5L9AA 3S8MA 1ARZA 1VJTA 4NU5A 4RVSA 1DC5A 2B37A 1KEWA 3C1AA 3TDKA 3ZV5A 4ND2A 1IOLA 5FWNA 1DFGA 5L7TA 5LDGA 4BB5A 4JGBA 3RUHA 5C37A 4BNMA 4A10A 2Q3EA 3A4VA 1D1SA 4OSPA 5KVSA 1X0VA 1E3WA 2HQ1A 1K6JA 2PTGA 3GAFA 4I1IA 4CUZA 5T8KC 1SAYA 1GTMA 1Q7GA 2GCGA 4PLCA 3STHA 1X7GA 3UH1A 3PQEA 4WCFC 4YPOA 1PZHA 3KYBA 1YBAA 3CSDA 4YJHA 1IPEA 1UP6A 5GMOA 2O3TA 4ZD6A 4YT8A 3D5TA 1DHTA 4WNCA 1V3VA 4RF3A 4N5NA 1Z6ZA 1F0YA 3KYDA 2Q46A 4MIYA 3OICA 3B1FA 4EW6A 2CNBA 5MDHA 1PGQA 4IPTA 4CLEA 3C85A 3GAZA 1T2FA 5JAMA 1ZNQO 3M6IA 2CZCA 1KVTA 1O0SA 3AY6A 4XX0A 1JKJA 4D79A 3GNSA 1T1SA 4B4VA 3C8MA 3DZHA 1GDHA 4WOKA 4I9UA 3EUWA 2JAPA 2WE7A 1I01A 2O2YA 4KWIA 1T1RA 1FMCA 4PRKA 2RBEA 1EUDA 2ZQYA 3E48A 5KVQA 4A7PA 1A5ZA 4B8ZA 1TXGA 2H6EA 4CMAA 5TX7A 3ZV6A 1DAPA 2VWGA 3ZCXA 1TT5B 1PTJA 3DZJA 1E1KA 1XQ1A 2Y0DA 1NQTA 1MLDA 4LRTB 4BNHA 3F1KA 2Y1FA 3GPIA 3EY4A 4FW8A 3ZV4A 1TT5A 1BXGA 4FQ8A 5T67A 8ADHA 3ABIA 1O8CA 1ONPA 4RPHA 3ZDFA 2FZWA 5JAQA 4ZQFA 2BHLA 5JMPA 4BKQA 2XPCA 5JY6A 2X8LA 2B83A 3NJ8A 3EAGA 2JCXA 2A9FA 1PWZA 1YB4A 3AOEC 3E03A 1UXHA 3WBFA 2VYNA 3IC5A 2NLOA 4NR0A 4FBGA 2C2YA 5EIOA 1DRUA 3K6JA 3OIGA 3DMYA 1SO8A 1RM0A 1AHHA 2NVWA 3CE6A 1K5HA 1W0CA 2V6MA 4KQWA 3ZWAA 1NM5A 2CFCA 1PJCA 2JL1A 3L4SO 2IZ0A 2LDBA 1FDVA 1I3NA 2ZYGA 3L6DA 1YE3A 1B15A 2V6GA 2FOIA 3I9LA 3PYLA 1AHIA 5KVVA 2DQ4A 4O59O 3QWBA 5DCUA 5C7IO 1NQOA 1RM5A 4D7AA 5KJCA 1A9ZA 4KTTE 1BSVA 4BHTA 2ZB8A 2FR8A 3JQCA 3LSYA 3GUCA 3QWAA 2O23A 4JJFA 4NHEA 4ZQBA 9LDBA 4CM8B 2W2KB 4BO3A 2EIHA 4DYVA 3N58A 3D4NA 2HJSA 1NP3A 3PHIA 1ZK3A 1N1GA 1BVRA 1PJBA 1GQYA 3VKUA 2Y1CA 2ZATA 3HFGA 4E2YA 2EHDA 1WDKA 5DF1A 3BTUA 1PL6A 2FSVA 5JDIA 3NTOA 5DULA 1AN9A 4QEDA 3VH2A 3IJPA 4EYEA 1E7QA 4YEDA 4PN3A 3K2EA 3RBXA 5JYDA 4BMVA 2Q49A 1P45A 2DUWA 4RJTA 4FCCA 1GR0A 4INAA 5CFZA 3FSRA 3L6EA 3U4HA 3VH1A 4TSKA 3FNHA 5IXYA 2O3RA 2VHZA 3UW3A 1HE4A 1SPXA 1ZIDA 2FSSA 4CMEC 5BSGA 3OEWA 1U3WA 1U7HA 3VOSA 2CVOA 3H65A 3JD2A 5JC1A 5I9LA 2HK7A 5AXDA 4ALMA 4ESOA 1UP4A 1TT7A 3SLGA 3W1VA 3F6YA 5I8WA 5EQDA 1VRWA 4R51A 1P31A 4PGFA 3WFJA 3DBVO 3LC1O 2W90A 4O5OA 1SNYA 4BNXA 1T2CA 2W4QA 2BMAA 5TLSA 3DBRA 2B4QA 3NKLA 1MC5A 3VAZA 3DZFA 3H4VA 2P4QA 4CM9A 1TI7A 2TMGA 4DUPA 1GZ6A 4CMGA 3OSUA 4R1NA 1Z7BA 2E48A 3DBHB 4AJPA 5CG1A 2X1HA 5GZ1A 2G17A 3NGXA 4LGVA 4JQCA 4OQZA 2AE2A 3C1OA 1KERA 3LVFO 3E5RA 1X7DA 3JQBA 3F5QA 4OH1A 2B35A 1E92A 1GCOA 3ENKA 3T4EA 2Z95A 3H7AA 3WIDA 4IJWA 1GYPA 2VWQA 4RF5A 4RGBA 4ND3A 3ZI0A 4J7CA 5BR7A 1EBFA 3ROPA 4ZVVA 2DKNA 3ZNOA 3E9MA 2VZ0A 3WQQA 1B2LA 2OO5A 3QWIA 3CH6A 2PFGA 5HWSA 1TVEA 2Z1NA 4N5LA 3RJ5A 2GNAA 3WWYA 5A9SA 1WWKA 3GFGA 3L9XA 1UXGA 2ZYAA 1RM3A 1QYDA 1E3EA 2X0IA 4CM6A 1FDUA 5IF3A 1GV1A 1A7KA 3GVIA 4TROA 2GZ2A 1GL3A 3ITKA 3LDHA 2WD7B 1V3UA 3OQBA 3RASA 5BQFA 1SOVA 4JLWA 4D41A 1E7YA 1DSSG 4UEJA 3ANMA 2JD2A 1D8AA 2DBRA 4HX5A 3RSHA 5L4SA 1M67A 3KV3O 1QORA 1Y8QB 4UUNA 1P1JA 2QYSA 4WLEA 3RD5A 3T7CA 4YCAA 1HDCA 1HSZA 2VN8A 3K96A 4BNIA 4KTVE 2CF5A 3AUSA 4BNZA 1ENOA 2VNAA 4D46A 4IJUA 4J4BA 2VWHA 2CDCA 4LSWA 2A35A 2YZ7A 4NMHA 3UF0A 4CL3A 3NTQA 1F17A 3ZN2A 3O8QA 3ZW8A 1E5LA 5GY7A 2Y1GA 4M8SA 2GN8A 3I23A 1KC1A 1J0XO 1R12A 5JPIA 4GAEA 1K89A 6ADHA 4Q9NA 2VZ8A 3Q2IA 4XIYA 3KEQA 3ZWMA 2VRBA 3MOIA 3ZNPA 4BO2A 1Y8QA 5A3JA 4IZIA 2WE8A 1M2WA 2ZTUA 5COBA 4NG5A 4OKNA 3PYXA 3PEFA 3ZW9A 2WDZA 5IAAA 2VWPA 1QV7A 5B4TA 4Z0PA 2IODA 4M87A 4BNLA 4BNUA 2P5YA 3DXFA 1DO8A 4XJTA 3FNFA 4WLOA 2Q1SA 1B7GO 3DHEA 1ZCJA 4CMCA 4W99A 4Y6SA 1EVIA 3H3FA 3I4CA 3O26A 3RROA 3ZU2A 1MB4A 2Y1DA 4QSMA 1QMGA 2VQ3A 3GVCA 1ZJYA 2AW5A 4XA8A 4KMSA 4W9NC 3DDNA 1NFFA 1ZW1A 3RC2A 4ZRNA 4DIFA 4YJGA 4RZHA 3NRCA 2J5QA 5IDWA 2A92A 4IMRA 2DVMA 2E82A 3GMSA 4L4SA 3V1UA 4B4WA 3BMQA 2RHCA 1FF9A 3CMMA 5AXBA 3VDRA 1HDGO 3OH8A 3UVEA 3BMOB 2F00A 3KEOA 2GSDA 2X0NA 3RC1A 3KHUA 3EZYA 1P1KA 3KZVA 1A9YA 3AY7A 3NJ4A 1WXDA 5H81A 1O6ZA 1I0ZA 5J23A 5TGDA 4MDHA 3GHHA 3Q1LA 4IDEA 1WLYA 1U4OA 3JQGB 1LQTA 2BKAA 1MA0A 2VOEA 4HKTA 4D3SA 2EJVA 3RKRA 5CDUA 1XCBA 2QIOA 4WEOA 4RPLA 4H15A 5ITVA 2GR9A 5DNAA 1U5AA 3DHNA 1W73A 4FC7A 4AJJA 3WSVA 3MOGA 4ID9A 2DM6A 4E6PA 2ZCVA 1HRDA 1PQWA 3LT4A 4E4YA 3RUAA 4JBHA 4KP7A 3EHEA 5BSFA 2GN9A 1BG6A 1WDMA 3ZU5A 4AJ2A 3NUGA 4P38A 1KOLA 5EMHA 2JFHA 1VLLA 1LNQA 4YJGB 1EVZA 2W2KA 4RO0A 5TS3A 1PSDA 2OXIA 2GD1O 3ICPA 1MUUA 1U1IA 4J1QA 2HMTA 2PLAA 2C7VA 4F45A 2FPIA 2D3TA 4IS3A 1NQ5A 2HKIA 1PR9A 4CMKA 1ULSA 3ROKA 3WWZA 5KJ6A 1H9AA 1MC4A 3PLRA 4UAGA 5FEUA 3FPCA 3V1TC 4HFNA 3RIHA 2DAPA 2ZB7A 3UUWA 1E7RA 2Y68A 4YB8A 4PVCA 2PKQO 2AHRA 1TB4A 3ONFA 4OOEA 4Q3CA 1R4NB 4UULA 3JTMA 4FFPA 3S1LA 4CMBA 1AXGA 3QIVA 2Y66A 2PGDA 3AU8A 4IQ0A 3F46A 3HDQA 3PHHA 1KS9A 3BHIA 1NASA 4NFSA 3B70A 3DFZA 3SEFA 3DHYA 3ZNNA 4IXWA 4FPXA 4MIEA 1P9LA 3F47A 2V7PA 3WOHA 1DAOA 3HDYA 1IB6A 1P0FA 4YBZA 3JD0A 1EK6A 3L4BA 3K73O 1OI7A 4L73A 3TPCA 1YH3A 2RIRA 1BHSA 1PR3A 4II3A 1K2WA 1XSEA 1H5QA 2VT2A 3PFWO 4MKRA 4YAKA 4B3HA 2VYND 3CTMA 3I1JA 1OAAA 1YOVA 4XYMA 1KIFA 5I7EA 1N7HA 2DU8A 3VPSA 1GUFA 1C0PA 4GSLA 3ZWCA 5KIAA 1WNTA 2HK8A 1PGOA 4D43A 3H9QA 4E30A 1VJ0A 4CLRB 1OBFO 3AI3A 3K9QO 1LTHR 4JIGA 3KXDA 1HZJA 1BXGB 2D5AA 3UCEA 1CQJA 3GK3A 1E3LA 4EUEA 5K6AA 4Q3DA 2X58A 4CMEA 1QG6A 4WLFA 1PJSA 4Y6PA 4J2OA 4Q3NA 2B69A 3VHRA 3ROMA 2BGLA 3ZWPA 5KNLA 3BMOA 4PLHA 1KVQA 4JP3A 4NBUA 2PY6A 3DMTA 3H2SA 3GEDA 3GDFA 2GYYA 4CV1A 1Q0HA 3D4PA 4XRRA 2GZ3A 1PJQA 4CLOA 1T26A 3DBLA 3WXBA 3WMWA 1X7HA 4I9HA 3A1NA 4IJVA 4BS9A 2O48X 5A3VA 3DB2A 1PL8A 4AJLA 3QJ5A 1NR7A 4ZA2A 3QV1A 5I9MA 1LLUA 1UZMA 2Y0EA 1HXHA 4R9SA 1U8XX 4CLOB 3CINA 1X1TA 1CIVA 4BMSA 1CETA 1T25A 1D7OA 1Y81A 3OJFA 2C2XA 4K28A 5TC4A 3WGIA 2WYVA 1Y8RA 2QRKA 4CPDA 3TSCA 1G0OA 3KLMX 3RJ9A 1U4SA 4R4JA 3HN7A 3L0DA 1F12A 4FOOA 4OAQA 5IFLA 1B3RA 3KSUA 1R37A 1Y9AA 5A5FA 2D1YA 4J16A 1W4ZA 3SBOA 2YQ4A 1NYTA 3LT0A 5JE8A 5JAZA 2Q4EA 4J2HA 4AJ4A 3RC9A 1U3VA 2UYYA 4Y9DA 2NU7A 3WGHA 2OL4A 2Q2VA 3PIDA 3R0IA 2OP0A 5TJ9A 5F5NA 1C3VA 3C3XA 3PFFA 4OOFA 1EUZA 1BRMA 2DLDA 4FJ2A 1A27A 4YJFA 5T5QA 4H16A 4PLWA 1XA0A 5F21A 2DUUA 2IE0A 4PG8A 3FD8A 3AM3A 5BSHA 2DBZA 1GZ3A 2PD4A 1PIWA 1ADBA 5COQA 1NTOA 1HYGA 4DTIA 3HSKA 1YGYA 4OSOA 3EDMA 1PL7A 4OYRA 4BNTA 1MG0A 1VSVA 4CM9D 4ZN6A 4HFRA 5L4NA 1JKIA 4BV9A 5K0ZA 1CDOA 3DOCA 1DIHA 2YHUA 3ZZNA 5JXWA 3DZIA 3RFVA 3UXYA 3U9LA 4R1UA 3HN2A 1I30A 1ZK1A 4IDCA 1HSOA 5ADHA 2CVZA 5DP1A 3AOGA 1PZGA 3EGOA 1SB9A 4ROSA 2GGSA 1JVSA 1ISIA 3JQ7B 2X5OA 3G1TA 2BF7A 4E5KA 3OJ0A 3PGJA 3KSDO 4PVDA 5CDTA 1JAXA 2YFQA 5LC1A 3JYNA 2FWMX 1YS4A 2D0IA 4G65A 5L3ZA 2AG8A 4N7RA 1ADFA 3ZGYA 1LRKA 1A4UA 3C24A 3RUCA 3HUDA 4R16A 4OJNA 4E5NA 3GN2A 3PYMA 2P9EA 3WICA 3OIFA 3DR3A 5ENVA 4KUHA 3HZZA 2V65A 1UJMA 4AG3A 1Y7TA 2EV9A 2BRUA 1LC3A 4NK5A 3X2FA 2J6IA 2O3QA 1OC2A 3IMFA 2X86A 1GUYA 4EJ0A 4U0JA 1NNUA 4TZKA 1B16A 1EVYA 3P2OA 3S2GA 4ALIA 3FN4A 5TT0A 3P2YA 1R0KA 5L51A 3MJSA 1W8DA 4NBTA 1G0NA 3SJ7A 4AJ1A 3JQAA 4KUEA 1GYRA 2O7SA 1FDTA 4F6CA 4XKJA 4B7UA 3M2PA 4TRJA 1EK5A 1RWBA 2JHFA 3JQ8B 3JQDA 3RUIA 2EW2A 3D5QA 3FI9A 3ZU4A 1ZZEA 3GEMA 3ETEA 1Y9EA 4R54A 4TKLA 4TVBA 4DPMA 2O3UA 2ZK7A 4OL9A 3D64A 4RQTA 1ZMOA 3W4IA 1DOHA 1AXEA 1H6BA 2AQ8A 5EJ2A 2DTEA 1UDCA 4MKZA 4PFJA 2BH9A 2HCTA 3Q9UA 4YAIA 3SVTA 1HE3A 2GF2A 1YXMA 3W4JA 4FC6A 4FSHA 3Q2KA 1NWHA 4EJ6A 1HDXA 3O03A 3OIDA 3SX2A 1LQUA 2AEJA 4MVJI 4U5QA 4UEKA 3LF2A 1C1XB 1MGOA 1LI4A 4R01A 1K3TA 1WAMA 1OFGA 2D2IA 3OMLA 3TQHA 3KSZO 1Y8RB 3IP1A 4U6QA 3U0BA 3VPGA 3PDJA 4DGSA 4LN1A 1YB5A 1B26A 3CXRA 1UP7A 3PVZA 4KOAA 5TIIA 1K6IA 2ZTMA 2X6TA 3I9MA 3NGLA 2A4KA 4XJSA 4Z0HO 3BMCB 2I67A 3FHLA 3H5AA 4NI5A 1LSSA 1P74A 1U2DA 5DP2A 3I6IA 1EDOA 3VKVA 2X0RA 1VL6A 3GGPA 1DBVO 1BW9B 4JBGA 1YQXA 1NXQA 5BSEA 3UAGA 4XRGA 4UVDA 1VPDA 3MTJA 3O9ZA 2QYTA 3S2EA 1I2CA 4LRSB 2OHXA 1SOWA 5DBIA 5H83A 2YV3A 3BA1A 3OHSX 4LSMA 4P22A 2C0CA 1GEEA 4CM4B 1J6UA 3LC2O 2WEKA 2PH5A 3RQSA 2GDZA 3GDOA 4CV3A 4ZHSA 3D3EA 3BMNB 4LVUA 2I66A 3S2FA 4BO4A 1AGNA 3PTZA 1M66A 4P4GA 1PEDA 1H6AA 4IDFA 4BKPA 3H2ZA 3GLQA 4ZQEA 4RORA 4PIVA 4JJIA 4IMPA 1N92A 1E3IA 3U4IA 3TFOA 3MWEB 4JP2A 4ALJA 1ZKMA 1BDBA 3D7LA 3AY3A 4IZHA 1BGVA 1IUKA 4MVJM 4DIBA 1GPJA 2QZ9A 1F14A 4NNJA 4IQ8A 5THQA 2J5RA 3F3SA 1LBEA 4BQRA 1HLPA 4R69A 1XHLA 4B7CA 1NR1A 3VTZA 2VUUA 1NQAO 1SMKA 2FPPA 3AM4A 4ND4A 2VT3A 1P1RA 2Q45A 1KEUA 3NT4A 5CEFA 1KVSA 3Q11A 1D3AA 2VUSA 1I24A 4I08A 5G0VA 3FF4A 4YA6A 3IKVA 3HB5X 4YACA 1Y6JA 1NX6A 1G6KA 4HWKA 4TRMA 3TRIA 2RHRA 1MXFA 5CP8A 3PWKA 3QWHA 1HZZA 2AMFA 5FFFA 3JQFC 5JC8A 4CM3A 5FI5A 2CDBA 3KBOA 3ETDA 3ONEA 4NH4A 3F1LA 3KYCA 2IZ1A 4A27A 1WDLA 3H9EO 1S7CA 3H5RA 1LSOA 3OF2A 2X4GA 2Q4BA 1Q7BA 2HUNA 3GUYA 4UUMA 3WB9A 2FZEA 4QT0A 3D3WA 4B7XA 3QVWA 3W8EA 4BNKA 3BHMA 3MJTA 3HE3A 8LDHA 1VE9A 4J49A 3BMCA 3RAJA 4AICA 2X7HA 1YWGO 3DZBA 4E31A 4RDIA 5DT9A 1QKIA 4FOSA 1E1MA 2C20A 2EG9A 4K26A 3HQ4O 4IGEA 3C7CB 4HXYA 4CQMA 2Z5LA 4N18A 1XELA 2H63A 1XU9A 5KKAA 4XB1A 3EYWA 2YDXA 4XWYA 4BO9A 4GX0A 2HMVA 3CPSA 5IZCC 4MVJP 3WQSB 1ZJZA 2JCVA 5IDYA 3WMXA 1O95A 4PLGA 4R3NA 5JCXA 4FFOA 4EZBA 3E9QA 1LLQA 1PS0A 1DIRA 1QR6A 1XG5A 1LDBA 2OBYA 3BHJA 1A4IA 3JD1A 4BQPA 4J1SA 4MINA 2NQ8A 5ILOA 4NBWA 3H9JA 1J4AA 5ICSA 3QVTA 4ITUA 5B4UA 4J91A 1HE2A 4YQYA 1OMOA 4IIVA 3KTDA 3JQGA 4RZIA 2YV1A 3VC7A 4J7UA 3FR8A 4LMPA 3KYCB 1Z75A 1B8VA 3TOZA 2GERA 4J43A 3VVBA 2HLPA 2HU2A 1GADO 1I33A 1NPYA 2H9IA 1E6EA 5IZCA 1P1HA 2Q2WA 2OOSA 5LCXA 4IQGA 1HDRA 2YHIB 2DFVA 4IIUA 1N8KA 1X15A 3V2HA 5IZ4A 2H1SA 1P44A 1TLTA 1MP0A 1H93A 2ZB4A 5EESA 3KLPX 1R16A 4S1VA 4NJOA 1H9BA 2BGKA 2H5LA 1PQPA 1IULA 4XDZA 4S3MA 2ZQZA 3JV7A 2X0JA 3INRA 5A5EA 1N2SA 1PS9A 2JJYA 3L07A 2HK9A 2NVUB 5CPBA 1P0CA 3VDQA 3I3OA 3QWFA 4CMIA 1F06A 2EXXA 2WSBA 3U49A 1DLJA 5EINA 3WYCA 4Q39A 4ZICA 4OQYA 3Q3CA 5ITWA 3JSAA 1H6CA 4BVAA 2FP4A 4YRBA 4I9NA 1WZEA 4DIOA 3RWBA 3EMKA 5IDQA 1DHRA 1U2GA 1YL7A 4GWKA 1M6WA 1HDZA 4X54A 5DOZA 3IL2A 2BI8A 4HUJA 3U5TA 2AQKA 2IXAA 1M75A 4TZTA 4GX1A 4L4RA 4MVJE 3VH3A 1BXZA 2JD0A 4I5FA 1PGNA 1NVMB 1ZBQA 4OXYA 4CLRA 4MOWA 4QFCA 3C1TA 1GD1O 1I3MA 2NTNA 2NTJA 1IHYA 5IN5A 2ZCUA 3VZSA 4BO1A 4QECA 4JJGA 1UZLA 1H0KA 2PKRA 3VPXA 4UVIA 3F4BA 3HWRA 1HYEA 4A73A 5AXAA 2I9PA 3DWFA 1Q7CA 2WM3A 3G17A 4WLNA 1TA4A 1YOVB 4OIMA 4UVEA 5A1TA 3WGGA 3GY0A 1LDYA 2PGJA 2WMDA 1WPQA 4EEXA 1LX6A 4J9VA 4TRRA 1UAYA 1E6UA 1V0JA 1P3DA 1QP8A 4L8VA 3V1YA 1GYQA 2FR1A 3RKUA 3GQVA 1KBZA 1LSJA 4WCFA 3ICCA 5HA5A 1E7MA 4D3DA 4BKUA 1ZSNA 3BMNA 4IDAA 4E0BA 2QX7A 3AI1A 1LXCA 1M76A 1YQGA 1LDEA 4MVJH 4YAGA 4ALNA 1I3LA 2JCYA 1ZH8A 1NFRA 2W98A 4E2ZA 5FF9A 4GH5A 5G0TA 4PLYA 2FRDA 3U09A 1CYDA 3RU9A 1U8FO 2J8ZA 3KUXA 2X9GA 5JAIA 4Y67A 1NFQA 1LDGA 4K6FA 1UXIA 3GEGA 4LISA 3WYEA 2C54A 4BNYA 2W2LD 3RUFA 4NJMA 3PI7A 4JCOA 5HBRA 1ENYA 3PIIA 2VCYA 1XKQA 1M6HA 3N7UA 2GRAA 3PWZA 2PGLA 3DOJA 3QVXA 4CR7A 4BNWA 3R3SA 5JMWA 2PKQP 4L4XA 4RV9A 3FR7A 3WNVA 1B8UA 3H9GA 1ZMTA 3GVXA 4LK3A 1D4FA 1X0XA 1FJHA 3INGA 4RF2A 2QW8A 1SB8A 4GGPA 1EEHA 2ZKLA 2XAAA 2X22A 3ZHZA 1R4MA 3OP4A 4HBGA 3GR6A 1N7GA 4U7WA 1E5QA 3ZWVA 3ZWNA 1DEHA 1VJ1A 1JW9B 2P4HX 3WX0A 3KOUA 5CAEA 4L76A 4Z6KA 1OOEA 4NFHA 3WFIA 3ANLA 4CUKA 2DTXA 1QYCA 4OXKA 1MG5A 4M55A 4MKXA 1WZIA 3ASUA 3CZMA 2Y67A 4G81A 4RDHA 4L75A 5ER6A 4EUHA 4PZEA 1MFZA 4MVJD 4WKGA 5TT1A 3H5NA 3IDSA 3W6ZA 3DQPA 4CM7A 4O0LA 4YVFA 1U28A 1H2BA 5CDYA 1PJ2A 1F8FA 3JYQA 3I83A 2C5EA 1YJ8A 1DJNA 1ZO8A 5TNXA 5CPFA 4YAJA 4CV2A 4PLPA 3PQFA 2C7GA 3ZWWA 2YFHA 3MJVA 3FCOA 3GHYA 3PHJA 2SCUA 4XQEA 4UVHA 4BIIA 3MEQA 2JKVA 3GC6A 4A2CA 5KJFA 4XGNA 3HDHA 5AYVA 4JK3A 1GPDG 2HJRA 3G3EA 4FGSA 1EE9A 3TN7A 5F1OA 1OC4A 4AJHA 4M86A 5BNTA 3UFXA 5JYEA 5G2OA 1UDBA 2YJZA 4YXFA 1DDOA 1ZUD1 3QQPA 1QXSA 4K9DA 2OZPA 3WLFA 3PWSA 3IIEA 2EGGA 6LDHA 4M54A 1T4BA 3HJAA 3QP9A 2J5KA 1ISGA 1BWSA 2ET6A 3TF5A 2Y1EA 4J1NA 4RL6A 4OMUA 3U62A 4DMLA 3G0OA 2PA3A 2NWQA 3WTCA 4OGWA 2G1UA 5KCZA 4BGIA 4EDFA 2IDZA 3T7EA 1Q1NA 3FTNA 1L1FA 1ENPA 2G82A 1P77A 2WWRA 3PJDA 1SCUA 3C7AA 5F3RA 1WMAA 1U5CA 2ZTLA 4AJOA 3TZCA 1KEPA 2D4AA 5C7LO 5L4LA 1BVUA 4ND5A 1CEQA 3QW2A 1XEAA 1UXKA 4RCVA 1VKOA 1B3BA 3V8BA 4MP3A 5TJHA 2HMWA 3O4RA 5THKA 3WGTA 5ILGA 1EE2A 3TOXA 4M89A 4YTEA 5TQVA 4AJKA 1XQ6A 5I7VA 5JS6A 4WASA 3NT2A 4ONEA 1ZEJA 4YJDA 1EFKA 4BO0A 4UREA 1N1EA 4PRLA 4I5EA 4TKMA 3ASVA 2AXQA 5FI3A 2J3HA 1PZEA 1PU2A 1ZXLA 3W8FA 4NQZA 3WJ7A 3WS7A 4GQAA 4RVFA 3PQDA 2R00A 2Y93A 3M1LA 1C0KA 1FDSA 3OM9A 4LCJA 5B37A 2P9GA 1E0DA 3VZQA 3GOHA 4N5MA 5ES3A 5A04A 4NIMA 1GU7A 4H3VA 2Q1TA 4CJXA 2P2SA 2YY7A 4NU6A 3SC4A 4XQGA 3KYDB 4XYLA 4UUPA 2X23A 4O63O 2UVDA 1YL6A 4B8WA 2R2GA 1XGKA 4N54A 1FXSA 1YQDA 3UCXA 3GVHA 3MJCA 4RF4A 3D1LA 3VZPA 1QYVA 2ZTVA 3CEAA 2CD9A 3RCBA 4DPLA 5KWEA 3LT2A 4AJNA 1HTBA 4K6CA 1X1EA 3S2IA 4AFNA 2R00C 3NAQA 4NBVA 4E13A 3P19A 3LK7A 4WCFB 1YL5A 1IE3A 4O1MA 4XYEA 4RPJA 1ZK4A 1LA2A 4DQUA 3GGGA 1QYXA 4Q3BA 1DIBA 1ONOA 3DBHA 1GAEO 2NACA 3QHAA 3PHGA 3KVOA 2EWMA 1UZNA 3AUAA 3JQ8A 3UHAA 4F3YA 1YJQA 1GV0A 2GO1A 3NDRA 4WLVA 4BOYA 3JQ9A 4RPGA 2AQHA 3IP3A 2DT5A 3GGOA 4RVDA 4ZRMA 3A06A 4PG7A 4R5HA 3L4BC 5I8ZA 3P5SA 2YQ5A 3BYZA 4D0SA 1DFHA 1VC2A 2X9NA 3BTVA 2Q50A 4PCVA 2EJWA 1R4MB 3EVTA 3UN1A 1YBMA 1YB1A 1Z82A 5DOVA 1N9GB 1HDOA 3SLKA 1ZK2A 2EEZA 2HMUA 5A9TA 3ZWYA 4W6ZA 3PLNA 5JO0A 1V8BA 4AJIA 4B3IA 2I6TA 5EN4A 4FIZA 4BO6A 5LDHA 2IYOA 1UXJA 4L74A 1X14A 4EJMA 5AXCA 5C3MA 3CMCO 1DJQA 4IDBA 3GMDA 2OMEA 5HM8A 1ZVMA 4WOJA 4QUKA 2IEBA 3FNEA 2VYVA 3HFSA 3QVSA 1DPGA 4FFMA 2HSDA 4HY3A 2CF6A 1KY4A 2E37A 3LC7O 1YO6A 2BGMA 3ST7A 3CZRA 1C1DA 5BNFA 2P5UA 1N5DA 2XF8A 3JQBC 4IDDA 4OM8A 5KTKA 4GGOA 3NDJA 2FN7A 2UUOA 4GKBA 4MVJA 1NHGA 3I9KA 2IRWA 1IPFA 1Y5MA 3JD4A 3GH3A 4D3FA 1O94A 2WYUA 1MX3A 3H6KA 3UGKA 3D4OA 1I5RA 4YT2A 2YHIA 1P1FA 1R15A 2X5JO 3PZBA 5G0UA 1T2EA 1LJ8A 4EITA 4FN4A 3GDGA 4KZPA 3JYOA 4TQGA 3A28A 1HDYA 2IZZA 2VYVD 4OKIA 3L9WA 4BGVA 5CG2A 3GVPA 4YJFB 1LEHA 5I7FA 1NAIA 2BFAA 1XR3A 3GZNA 1Z7EA 2CMDA 1JU9A 1MFPA 2POQX 5CDGA 1C0LA 2GASA 1YRLA 2B5VA 3F5SA 4CR6A 1DIAA 3OA0A 4WUVA 4G5HA 3AOEA 3PJGA 4WLUA 5F5LA 3F9IA 3QE3A 5BT9A 3GPDG 5A4DA 2PZMA 4XD2A 4R3WA 3WGQA 4Z9YA 4YT5A 2C82A 4A03A 3OECA 4DVJA 2VUTA 3DOOA 5JO9A 5JDCA 2OORA 4LVCA 1EMDA 4FR5A 1ADGA 1HETA 4NPCA 1H6DA 3LZ6A 4GVLA 1WVGA 3E5MA 2AEFA 4JX8A 1LC0A 5B12A 3NDIA 4WK6A 1B14A 4J0EA 4RLHA 2PK3A 4AVYA 1HT0A 3H8VA 1IZ0A 1H2HA 1KEVA 4DQXA 4KDEA 4BNFA 4GLOA 2VTEA 1E7SA 2VHWA 3DBLB 3TJRA 2O50A 1LLCA 2BI7A 1SC6A 2DTDA 5DBFA 4J4HA 3B1KA 4LCEA 4XZ3A 2HDHA 4FS3A 4QQRA 3DAFA 4CMJA 2QRLA 1CRWG 3I9NA 4P4NA 3E82A 3JYLA 1RPNA 1UR5A 1DC3A 1RYDA 5KOIA 3WLEA 4YRAA 1PGPA 3VVCA 5U9CA 3NYWA 1X13A 4W9NA 4J9UE 2O3SA 3RUEA 4B79A 1LRJA 2Z1MA 3A9WA 3SC6A 2AEMA 2GN4A 4CLXA 1S6YA 3U3XA 1SEPA 5B1YA 1GQQA
chains in the Genus database with same CATH superfamily
5IKOA 3VPHA 4X5OA 4XOIA 3UO8B 2WJPA 4JQOA 1JR2A 3R6DA 2E7ZA 2OUIA 3ECCA 3GGDA 3MCWA 4BB9A 5IWAB 4JYCA 3B12A 1DAKA 2D2FA 2E9SA 3LHIA 3AJ9A 4IM7A 2W6JD 4LWQA 2BH2A 2I76A 2NO0A 2CXPA 3LO8A 4JP1A 4GL4A 3V42A 1JXMA 5J47A 2JFGA 4NP6A 2O7NA 4HFJA 4YI3A 4OO3A 3PUVA 1ZEMA 5L95A 1NL3A 1JI0A 1HFKA 4ASUD 1WW8A 4F60A 1MA3A 4EFLA 1C4WA 3NNSA 2I99A 3AWDA 1V3TA 3UWDA 5L3SA 2E6UX 1EPUA 2EEPA 5GZ3A 4MQUA 4N01A 4LCJA 2FPGA 2C00A 5ED4A 1H05A 9LDTA 1KA9H 2PMKA 1S2IA 4FD2A 3KUUA 1IN7A 3QVJA 5CLIA 1F51E 3AH8A 3ZLTA 4E12A 1K8YB 4QTZA 2PV7A 4B3SB 2A1UB 2QW1A 3QYAA 3ZX5A 3FWZA 3OMWA 3IT2A 3DFUA 2H1LA 2PSFA 3M82A 4C2BA 2ILTA 3I01M 4DRYA 3KYIB 1SU7A 1LUAA 1LKZA 2IHTA 1BKDR 1EZ4A 4W5HA 5JI2E 3ECSA 2V4MA 1SBTA 4C20A 3WDLA 3TDMA 4B7ZA 5AVVA 1U3UA 4IIHA 2QPAA 3JQ6A 3FDIA 2WHEA 2JW5A 3CHYA 2C78A 1XAJA 3HDJA 1E62A 4KDFA 3B2EA 4Y98A 3AVYA 4RA9A 1I2BA 3HO1A 1WMBA 3NOXA 1UBMS 4XCQA 3U7HB 4RD6A 1UKCA 2D1FA 4L4YA 1A4RA 1XTRA 3SZOA 1H69A 4W9RA 5F1KA 4ECAA 4JH0A 1H1TA 3ASYA 2X9VA 1XD8A 3SMVA 1TTHA 3R4CA 5DYNA 4C0AC 2P6RA 1BVYF 2B4AA 1YJAA 3C8ZA 3O94A 2E49A 2I3DA 4MW4A 4RH0A 1T1GA 1DG1G 1L5HB 1ODTC 5A62A 2D00A 2JJQA 1Y6ZA 3NWJA 3C1UA 4JROA 2V4ZA 1GTJ1 3LQFA 4JYPA 1Z9BA 3IP7A 1W8IA 2F9MA 2ZLBA 4NY1A 4D5EA 2ZJOA 1MORA 4JNCA 4M1YA 2DJ5A 2DPGA 5JLAA 4E5PA 3GRPA 3OLWA 2IU6A 1IBRA 3P9SA 1EIZA 2NNLD 4KC0A 2GB4A 4B75A 1HX7A 5FJIA 4BLOA 3S81A 2HBZA 2Y8EA 4R9NA 4B0OA 1WUKS 4OAOA 3SDZA 1QFZA 2OM2A 1YQEA 3V4FA 5HOEA 4G1UC 3DUFB 4EY4A 1ZM3A 2BEVA 2JK0A 5ALYA 1I8TA 3DVAB 1Z17A 4CQMD 4FGUA 4X1IA 2QHXA 2P0YA 2Z2YA 3N76A 1KP3A 3GUUA 4GPD1 3QE0A 5EKSA 4DBVO 4F56A 3MQ2A 5FOQA 4HH1A 5DCLA 3R4VA 2RGAA 5I7RA 3UYKA 3OA2A 4A5OA 5KSPA 1ZM4A 2C9CA 3EIWA 1U2QA 2BP7A 3MN1A 2BHTA 2O8VA 3Q85A 3N74A 4K5QA 4L0QA 5LJIA 1WCWA 1NPTO 5CM2Z 2BKVA 5JD3A 2HNKA 4OYHA 5DN9A 2EGHA 3M83A 1HOXA 1XROA 2PEYA 3RYCA 3GG9A 2RH4A 4RLSA 2VP2A 2XB4A 1OPRA 2H59A 3ORRA 1CQPA 3A1VA 5DCWA 1US8B 1X7XA 2G1KA 4HS9A 2IV3A 4ARVA 3QXJA 2ZWOA 3DDHA 3GFBA 3I4FA 4OHPA 4Y2QA 2K7ZA 3SYKA 3U3RA 3SM9A 3G0BA 3VNSA 4DC0A 1Z4PX 4H7DA 3R0VA 3GLRA 4DMMA 2R1TB 5JBIA 4U7JA 4B81A 3QKSB 3AERA 4MVJF 1J33A 1OV6A 1NF3A 2IX3A 5DM2A 4OX9Y 2PUJA 4MDEA 5HXAA 4YRZA 2NO4A 5LWHA 3CKYA 5DK4A 1LB1B 1Y6RA 3JZDA 3OKFA 3W8NA 3V2IA 1D2GA 4F96A 1DC4A 2IOQA 1CY2A 3OBBA 4OJTA 4AP5A 1M2VB 2J31A 1FA9A 3EZNA 2CY0A 4J90A 2G25A 3NBZC 3ELYA 3S0JA 3RM3A 4NBRA 3PENA 1YKGA 4H6PA 1XZEA 5J2UB 4S05A 2JBAB 3I6YA 4CLHA 1MXHA 5KPJA 3HADA 3R8CA 4KXYA 4RVCA 3A0UA 3S7TA 3D3WB 2ZSUA 2WJGA 4S04A 5AJHA 4C3ZA 1D4ZA 1C1XA 3GFFA 1OXSC 2E1RA 4PX9A 3RJMA 3FGZA 2FJPA 3AKEA 1NU6A 4PQYA 1F7VA 4HEJA 3U4QB 2B4TO 4B43A 2IHVA 2OCXA 4QYIA 5ETJA 4N0DA 5JW6A 2O3JA 1L7EA 1Y3CE 2BD0A 1V11B 3I2KA 2JHAA 1LV7A 5DTJA 1NGSA 1WF6A 4N8SA 1DTWB 4NAUA 2ATXA 3H1TA 3GRYA 3TGPA 4MAFA 4EMTA 4EP1A 1M34E 3PJEA 4QBKA 3A3OA 2PLNA 4NK4A 1SUAA 3R7NA 4EQ6B 4C7OA 3BSFA 1IDOA 5AKEA 2Q3LA 3FBTA 1XQ9A 2QZZA 3WLLA 1IVNA 2XMBA 3PQ5A 2GXSA 4U0KA 5EIBD 1SCKA 4FMDF 5BQ3A 1Y3BE 4GMFA 1MOZA 3AKDA 2VDPB 1EAYA 1LK5A 1Z12A 1UKVY 4QO7A 3TK1A 3UW1A 3L43A 1G4HA 1P2DA 3BJRA 3IQFA 3I62A 4YH1A 1OT3A 3ENZA 1EFLA 2XA2A 3HCRA 1G2QA 5GVRA 4BB0A 2O07A 4LBVA 2X5NA 1G18A 4LW8A 4WY5A 3RS2A 2V0CA 3GJ6A 1YR8A 1E89A 3L6RA 4XB2A 4FDVA 5J1TB 4FWTA 1B2RA 1B43A 2G5CA 2NSJA 3CX3A 5CFQA 3Q0EA 1L8OA 2O0LA 1R8XA 2LR0A 2UZ1A 2K2QB 4CQNA 5IM4A 4H77A 1N2CB 4Z3DA 1UT8A 2ZYSA 3QTLA 5EYPB 1OYYA 1AQNA 4HH4A 4PGMA 4X24A 1ORWA 4B1FA 2PQ0A 2WD8A 2YDYA 2CXXA 2I71A 3R6TA 3NVAA 3SHOA 4A91A 1Q1ZA 3DB1A 4QUEA 3SYTA 2ZRHA 3QXCA 1VSBA 1Z6XA 2FN8A 3TX2A 3OETA 2FFAA 1I1OA 5ALZA 3LOUA 2FKNA 2PJUA 3U0VA 1E3SA 4JYBA 4N6NA 1YR6A 5JJKA 3HCEA 4JWTA 2VBFA 4INOA 4YWJA 1BQ3A 4NBNA 2C5LA 3UICA 4QAQA 5IBCA 1OBVA 1XLWA 3EDOA 4UE2A 2Z8YM 4DLVA 3AUKA 4GWGA 3R9XB 4ZI2A 5A4AA 5LP6F 3QVOA 1S01A 1CK4A 4HXFB 4RH3A 2MMGA 4HNRA 7ADHA 4B3XA 1YRYE 1L5MA 1U5BB 1UBRS 1B0AA 3H4IA 1XRQA 1ISFA 3Q98A 4FZ3A 4D8XA 4HNUA 1TZMA 4N8EA 2ZITA 3LLCA 4EG4A 3PQ7A 1XV5A 4XIFA 4BKRA 1JZQA 2WZBA 1N6PA 3PT9A 1Y3FE 4AMGA 4EA7A 2X8JA 3VKFA 4ZTUB 2YFKA 1Q7RA 1HF3A 4NONA 3ZCQA 2HO5A 1JR3E 5HQJA 4LMRA 1XWIA 1QCCA 3G1WA 1FOEB 3MGGA 1FTYA 4OQXA 4MV0A 2VIIA 2AX4A 1YZLA 1U02A 5IABA 1OTHA 4LI3X 2VTDA 1CERA 1RBMA 3MG9A 4Z54A 5BSWA 4ZI3A 1EWKA 3ZNQA 1TTTA 3DD1A 4P82A 1H3FA 1WETA 2HREA 3NHMA 1N6HA 1G66A 1RHQA 5IH7A 3L7MA 1N9ZA 4Q1VA 4MMXB 5AUPB 3X1ZA 2GYUA 1KK2A 3GZJA 2UUPA 1SGWA 1J2EA 4C4TA 4L2IB 4MIOA 1RSZA 3N05A 1J42A 3NZEA 2E21A 1W9HA 3DZGA 4HYTA 8GPBA 3EIQA 4PC6A 2XBLA 3BGOS 2BAGA 3HU3A 1VE5A 1QNFA 3DTYA 3M4JA 4HNGA 5TV2A 2HCRA 4RK5A 3GLSA 1QGYA 4OHUA 3PQ6A 5HFJA 3LKVA 4QLBA 4GSKA 4AMVA 3AFNA 1GGEA 4MP8A 1MO2A 2CV1A 4REOA 2QGNA 2D8AA 2XQKA 1YQUA 3O8DA 1ECPA 3G9TA 4MVJG 2BELA 3KKZA 4JI7B 3NASA 5AKLA 2HV9A 4N47A 3O4GA 4CL8A 3C6BA 3ROQA 4DYDA 2BW0A 1QVVA 4JHXA 5DGIA 2B8EA 4RCYA 2YW9A 4ZT7A 1WF3A 3JQAB 4BE7B 5EWMB 4ZO7A 3R76A 4DR1B 2YOFA 2FZCA 4ENPA 5FWDA 3C4VA 2DX7A 2RH9B 4WNIA 5IN4A 3SHWA 1RT9A 3TNYA 1N33B 2UXCB 1IG0A 3PF9A 4B3FX 3HUUA 3HB4X 1JDNA 2HRBA 5BMVF 4KN6A 1A7JA 1OSNA 1NI4A 4UBOA 1DAHA 1JQ3A 4KE8A 4CQLA 2FH5B 4XQ0A 2V5VA 4D9NA 4NHOA 4Y1GA 4B5KA 1AE1A 1Z38A 4MI9A 1CDDA 2R6JA 1GZVA 3LBNA 5E1OA 5FPPA 1XYGA 5DCYA 1PBNA 4G8CA 2D74A 5DVZA 1ENZA 3DMDA 4YI5A 1Z6GA 2IXGA 3DEYX 1KVRA 3QITA 1PJLA 4B40A 5KYKA 3IAM1 3EPKA 5B1HA 1GUAA 3I73A 2B5WA 5HRUA 1XEWX 3W6UA 3RRYA 5K20A 3IPAA 2Z09A 4E32A 4IG9A 4XIJA 4OGFA 3FMIA 2OLJA 3K5IA 4Y8VA 5LLDA 3GN1A 5EQJB 5FTNA 4DSTA 4AKIA 1HTTA 5SY9A 3N07A 4XCXA 1PJ4A 2F1RA 4JY7A 4TS4A 4ZQHA 3KKPA 1JECA 2WHPB 2FG5A 2M6KA 1CQIA 4JI5B 2OB2A 4H08A 3GRCA 3PE3A 3HXQA 1ULUA 1TPZA 1NDUA 1O9BA 3OD5A 4FGWA 2P35A 4JLNA 4QOIA 5L6MB 2QB5A 1RQLA 3FTPA 2WKPA 3EAQA 3O9MA 2HRDA 3UOGA 4LWZA 4DQVA 1SVLA 3ZCPA 1A7UA 1EUDB 2X3FA 4E4RA 3INTA 2VDLB 2V58A 3PNBA 4WI1A 2HSZA 4MV1A 4XYBA 1P0QA 4FNOA 5IXJA 2PZEA 1JE0A 1I3KA 4UDOA 5CLGA 3RFTA 3MWKA 2WU3A 4H7FA 1PS8A 3N6XA 1KDVA 5KNCH 4FFLA 1ORRA 3P2MA 1L7BA 4PNPA 4EO9A 1VZ3A 4YHBA 1F6WA 2LVBA 3G8AA 3V8EA 2X4IA 3UK0A 5AW4A 5ICEA 2NP6A 4BO5A 3V00A 3TL3A 1J90A 1YDWA 4FD3A 3MT7A 1OXVA 2H57A 3D4IA 1D9XA 5TE9A 4WY2A 3NAZA 1LRLA 1M6EX 3OFVA 2EC5A 4YR7A 5JEDA 2VDNB 4FEEA 4P4SA 1FP6A 1L7VC 2EW8A 4AULA 4LHXA 1GSHA 1QCZA 2VNHA 1AX9A 1IN8A 2OR3A 2WAAA 4GLLA 5SZIA 2YICA 3GNQA 3ZH2A 4F2PA 5KQGA 1DRWA 1XAHA 1J0DA 3BMQB 4V39A 3OPYA 1P6UA 1I4LD 4EVIA 2VP9A 3FTFA 4CMHA 4XD7D 5BN5A 2IPOA 5IKXA 4W9MC 2PBLA 4MJLA 1N36B 2I2FA 4UZSA 1Y4DE 4RD1A 4DM7A 3BJZA 1T6YA 4AL4A 3SX0A 2XA9A 4U9IS 3SIRA 1SXJC 2Q0HA 1LFDB 1DLIA 1JQ5A 2HBQA 2HXYA 3IS3A 3ZTTA 4EAAA 5AM0A 4CEIB 1TZJA 2OYRA 4RPKA 2VSYA 4U2DA 4IIFA 2V9PA 1DIGA 1MOQA 1PN3A 1WZCA 4LDPA 4UBIA 3RSQA 4CIVA 4HX2A 3LUPA 1GNLA 4KIGA 3QPWA 3EZGA 3OLXA 2SKEA 3NFRA 5G3YA 1NJ8A 2BONA 2V6JA 4B3GA 4QGHA 2CHGA 5EIXA 2Y1OA 4FMBB 2Y0CA 3HNPA 2FR8C 2V9ZA 4GZ5A 1FDWA 1XFDA 2WLSA 3OCYA 5DRYA 1S9DA 4FLFA 3ZJTA 4KACA 3KV1A 1DAGA 5F73A 3SXPA 2PRKA 3L0IB 3NMUF 1QOZA 5MHTA 2V8BA 5FBQB 3MPOA 5KVCA 2BV3A 1DKRA 2QN3A 4YQFA 1E79D 4ARIA 3PSAA 1WXXA 4X7PA 1PSZA 1IFXA 4JBLA 2PZJA 3H4TA 5T4HA 4UARA 1XTSA 2C99A 3CPEA 4XFDA 2YIVX 3CW2A 3WDSA 1SKUA 2VPZA 1CUSA 1D4OA 1VL8A 3E1KA 3EGWA 4UBKA 1YONA 2E4YA 4PC7A 2FETA 1W0JA 4F06A 3GWGA 3NW9A 3LTNC 3EWAA 2PUWA 2O06A 3H1PA 1G9XA 3RFXA 1CQJB 3M3HA 4L9AA 4DUGD 3LI2A 4X8LA 1Z4JA 1IUNA 4F7WA 3T0FA 3EX7C 3AX6A 3OJEA 5F1PA 1N0IA 2CD7A 1J21A 3F4LA 2WNIA 1PGJA 1SBHA 3LLSA 1XJ0A 2BFPA 3EK2A 1A2OA 2YYAA 3KZOA 4C21A 4Z1MD 3WDKA 2G0AA 2ONCA 3KQPA 1KMMA 1VE6A 3W2HA 1GIAA 4ZHQA 3L0OA 2IEAA 1HQKA 3VTKA 2ZKIA 3SJCA 2Q5QA 2E4XA 2WG0A 4BLRA 1ZUNA 1ZCAA 2GILA 2R5WA 1B76A 3STTA 1AN0A 3K2BA 3NHRA 3BL6A 1KPHA 2FUEA 1FW8A 3UT0A 3U1BA 4NNPA 4EVSA 1USKA 2WUGA 1IQ0A 2XSZD 1GDDA 4CUJA 3OHMA 1KZHA 2YUIA 2FCRA 4BQNA 2SKDA 1DRJA 4Q4LA 4NDNE 5LM3A 4HLUC 4WAUA 4ZO6A 2QA5A 2J3EA 1V5WA 3OSZA 4PLVA 5TY0A 2EZ9A 4Z7OB 3KM0A 3WP1B 1CUVA 3P2KA 3W8DA 3G5LA 4TZ0A 1IL0A 3AEKA 2RAFA 5CB4B 5TSDA 4ID3A 5CBPA 4ARCA 1E2JA 2VPXA 4NULA 1KDTA 3TKYA 3TYXA 4L78A 1KVUA 2WSYB 3QSGA 1N2JA 3PQ4A 5IK2A 2D59A 4CV0A 2V6BA 4F4HA 2NU6A 5J4LA 3W9UA 2HU5A 2QORA 4NJEB 1Y34E 1JZTA 2NIPA 1A71A 3HKEA 3P9RA 5HK8A 4C05A 2V7TA 4UNPA 1W35A 2GZRA 3SJUA 2YWHA 4ENUA 2FEOA 3RTAA 3KVYA 5DTQA 4O2LA 3L77A 5D84A 3LO5A 4ZRDA 1FK8A 3K5PA 5AI9A 4DR3B 2XB6A 5I7HA 4QVIA 1XZPA 2I54A 2G0TA 4G0NA 2Z5GA 5JH7F 2NO5A 1Y8CA 3DAGA 1M73E 1O3YA 2YXBA 3CLRD 3MD0A 3O8QB 4M0DA 4E2FA 3VJRA 2RB4A 1VJRA 4QFDA 1RQXA 4TWRA 3NVKI 2GEFA 2EW1A 4JGGA 1ZRMA 1R66A 3A6FA 3HZOA 1T4CA 3W0LB 2BFMA 3EE6A 3MS4A 2CK3D 1VLZA 4P36A 3M4XA 1VSUA 2BSAA 5CVDA 3DYVA 3EVZA 2P9QA 4N5DA 1Z22A 4QDTA 5F7ZA 2XXBA 1Q3KA 3CKKA 3WLAA 1RM4A 2DQSA 3PX7A 3EQ9A 3O21A 5GZ6A 1XMQB 3RC7A 1KP2A 2GK7A 5JR3A 1QIFA 4JLDA 1P9NA 2A6PA 5AD1A 4Y9UA 2D7DA 5K8UA 4FFBB 3BE6A 1JQEA 1T36A 5A0VA 2J7KA 5DX1A 3IE0A 2QAIA 3G5AA 5AK0A 5ICCA 2O8EA 4CI9A 2ZTHA 1GGKA 1DKOA 2ZRIA 2B37A 2G9QA 3MTBA 4KOEC 4ESEA 3ZV5A 3F7TA 1MQAA 1N5MA 1OA0A 3BN3A 2LCFA 5F77A 1GLGA 4F84A 5L7TA 1C9YA 4OMFG 4BB5A 3I64A 1PWYE 4COKA 3CF6R 5D1NA 4ZTBA 3VQTA 1UFOA 1ZGCA 2OD7A 1ZGGA 2EHJA 1X0VA 3FTCA 1G3MA 1RLJA 3P9PA 4P3YA 1EI9A 5IP5A 3X1DA 3A2KA 3KZMA 1OZGA 1I3CA 1CY6A 2GBPA 1AS3A 5CM8B 1XD2A 4IEIA 4Q03A 4CUZA 4EJFA 2GCGA 3STHA 5BT8A 1S8AA 2AMLA 4EZIA 4DRXB 2A58A 4S0XA 1EK0A 1X7WB 4DJDC 3KT3A 1U8UA 1IXSB 5C1PA 5F98A 3HR7A 1XCOA 3LPDA 4F9FA 1JHPA 4EYKA 3FGOA 3W9YA 5LKRA 1I1NA 4IQFA 2O3TA 3QLVC 1J5EB 1EX6A 3B5EA 4WVFA 4YT8A 1DHTA 3CKLA 4BLUA 4Q6BA 1F0YA 2JFXA 1ZQ9A 4BMDA 3ZJVA 1R7RA 2P4EA 4EW6A 1OILA 4CLEA 3GAZA 4C08A 1N8SA 4S0ZA 2AEEA 5JAMA 2UZAA 1VTKA 3D8UA 4L51A 4D79A 821PA 4DJ5X 3OAAD 4N76A 4PO8A 5KNBH 2BEUB 1C7FA 3ROZA 3W34A 4LY0A 4D9FA 3EUWA 3Q3IA 2JAPA 1Z6PA 4PHCA 2WP0A 4Q82A 1IEQA 1AKRA 2XA1A 4XPIA 5JNSA 7REQA 3NNNA 4HNVA 4M9QA 3HLYA 3LPLA 1K5DA 2XITA 4MLZA 3KS9A 2ZQYA 4X93A 5KVQA 1K7CA 4ENQA 2E5FA 3O4FA 3BZWA 1FL9A 1OZHA 1JBKA 5EIEA 3URMA 2ZIUB 2OM6A 3ET4A 1KPGA 3B82A 3G2OA 4M9CA 2C1ZA 1W76A 3ZCXA 1GU1A 1TT5B 1KS2A 4DHEA 1IBSA 3I5YA 3EIFA 2Y0DA 2VBCA 3QIAA 4LRTB 4XUEA 1EA5A 3MMNA 1YZGA 2QMUA 3F1KA 4ZPXA 3IVAA 2CFRA 3P32A 2PO7A 1TT5A 3W7AA 5I7WA 5JALA 1JQKA 3HP7A 3TUJC 8ADHA 4U9HS 2BMJA 4CCYA 1O8CA 1ONPA 1R0ZA 1IDN1 4MS1A 3TW4A 4F97A 1JZSA 3O1JC 2O8DB 2FZWA 4V02A 3QHPA 5LKAA 5FL7A 2IOHA 1DT3A 3I0MA 4ZQFA 1SUEA 1RFGE 2XPCA 2E5WA 2X8LA 4BAZA 2AOTA 4BCDA 4O5AA 2A14A 1RIIA 4U7PB 3ZBUA 1QCDA 1PWZA 1YB4A 3R5XA 4RIEA 4D6PA 1IB0A 1RQPA 2ZUTA 4RVOA 2NLOA 4KPEC 4GE0A 4DCPA 1X1BA 4RA6B 1WCXA 2GPJA 1SO8A 2VH2A 3KFXA 4NCNA 4BP1A 1YAJA 3AF5A 5JSYA 1ZM7A 3ZWAA 2CFCA 3AVWA 2NO7A 2WB2A 2LDBA 3KPVA 2CHUA 4MR9A 1X9HA 5KTPA 3IBSA 4YMUA 4V3BA 2ARKA 2JAUA 1MEOA 2FX3A 3L7BA 4MWSA 4XDHA 2FOIA 2QGZA 3I9LA 4ROTA 3PYLA 4LK2A 4HQFA 4HVCA 1AHIA 1X70A 1PDWA 4TLBA 1IQRA 4RW0A 5KVVA 1RWXA 3MW8A 4RKRA 5DCUA 1NQOA 3E53A 1FFEA 1P1CA 2RK3A 4KNVA 5F4ZA 1WOMA 5KJCA 1NOIA 2WAMA 3BWCA 4HAOA 3PGA1 1BSVA 4I9GA 2FWAA 3ER9A 4JJFA 1I0IA 1S3SA 4BO3A 8ABPA 4BRUA 4JL8A 3JALB 2EZ4A 2FSUA 3BC1A 3KCNA 4X1KB 5KTNA 4IQ4A 5KX5B 2CGEA 4E03A 4DRXA 1ZC3A 1XF1A 5BQPA 1U63A 2HJSA 3EXIA 4ZXFA 4B76A 3B9RA 2G7ZA 1PJBA 1G8AA 1YR1A 3A6EA 3HBJA 3UWSA 1GQYA 3V55A 3HM9A 1FSZA 1JR6A 2AJBA 1WDKA 4QEKA 3W5SA 3MTAA 1PL6A 3WISA 1US8A 1X7XB 1CZRA 2DP4E 4I4TF 3DJYA 3EVFA 3LPMA 3ZK7A 1E2QA 4LJRA 1NLMA 3BB1A 1CG6A 1E7QA 1F38A 5LZ8A 3CQ9A 2XZTA 2Q3CA 4PTZA 5DNWA 3RBXA 4BMVA 1Y6GA 2DUWA 3MINA 3N6RA 4FCCA 3RTGA 2HD4A 4NE7A 3B6JA 4DUYB 1DAFA 2XDQA 3C6MA 4OI2A 3U4HA 1JFRA 4TSKA 4HZGA 5IXYA 4LJ6A 5KDLA 2VHZA 4LHZA 1R0XA 1SPXA 1SXJB 2A0XA 4H1VA 3K70D 4UU0A 1U7HA 2CVOA 2EWVA 1LS1A 2G5GX 4ALMA 1UP4A 3E22B 3A9CA 3GJTA 3R5FA 2PX4A 4H0CA 5AMXA 4EFNA 2G9UA 3D3NA 2Q3FA 3EWSA 4RULA 4S35A 4R51A 5FWXA 3KVRA 2QTNA 3NNDA 1Q3TA 4Y7CA 3HDTA 1H1LA 2W90A 1SNYA 3DWIA 3MUFA 4O5OA 1T2CA 4LFBB 4MUJA 2W4QA 2BMAA 1G8GA 2I1LA 3F3KA 1SC9A 3DZFA 4KPUA 5KMGA 1GPYA 4RKWA 3H4VA 4CM9A 3IULA 1NKSA 1GZ6A 1U0SY 1P61B 1AUXA 2G63A 2SHKA 3IE2A 3WOVA 4CMGA 2YZGA 4YC7A 3L8DA 1Z7BA 4NCXA 3DBHB 4HGNA 2R68A 4IVRA 5IUJC 3H84A 4JQCA 4BFLA 4LY3A 1KERA 3LVFO 1L8XA 1KGSA 2ZU6A 3E5RA 1RWMA 2PX3A 1CUXA 3BGVA 3F5QA 5DN6D 2QUKA 4FW9A 2Z6UA 3ZDEA 1GCOA 1VL5A 1CFZA 3CFYA 4JXJA 2Z95A 1XXHA 2YMLA 3H7AA 4IJWA 4IIYA 4RF5A 4TMXA 3WIDA 4XWOA 1RABA 1T9ZA 1OAOC 2ISCA 3R3XA 2FRVA 5LDHA 1H4SA 3EZFA 3AIKA 3VA7A 4ZMSA 1RWNA 2OO5A 3H17A 5BMVA 3CH6A 2PFGA 3EXFA 4IZ6A 1RLTA 5HWSA 2Z1NA 4HAWA 3KQWA 3IOBA 3RJ5A 4EJSB 1BIFA 1CJMA 4WA7A 4R8MA 3L9XA 2WUVA 3GLHB 1UXGA 2ZYAA 3H13A 5CCXA 1I7PA 2FUCA 4TTAA 1LZKA 4P54A 4G0QA 3HA3A 1KSFX 1FDUA 3H0CA 2Y92A 2XCIA 2JZCA 5IF3A 4GQBA 1JIIA 1GV1A 2IHNA 2A1UA 3HDGA 5CVJA 2GCOB 4G4IA 4B6GA 4Y2RA 3DNPA 5JRZA 5AOCA 3UJ7A 4YMGA 5BQFA 1W2HA 4X20A 4HYQA 4PAQA 1VMKA 5KYWB 3FIJA 5KHLB 1CS0B 4PNZA 4X62B 1NONA 4X6LA 5U4XA 4ZHQB 2PPLA 1D8AA 3ANMA 1HEIA 2CUTA 2WMNB 1DBPA 1QORA 1R8YA 1Y8QB 2J30A 4IFTA 3K1ZA 3HXPA 4JB8A 3DVQX 3BH7A 3WZ2A 2QYSA 5IS2A 2R6HA 3E05A 2ZG6A 2XMDA 3N3BC 2WIKA 1HSZA 3INYA 1QIMA 4FYHA 3AUSA 4JVMA 6YASA 1PNTA 2WTAA 3T1NA 4GR4A 5FR1A 5FNZA 3FAZA 4IJUA 1ZLYA 2VWHA 4J4BA 1OY1A 1BN6A 2BBSA 2YZ7A 4R8LA 4ZOCA 1IJKA 3JWEA 3UF0A 3IQXA 2GN1A 3HUFA 3Q9LA 4DV5B 2D7JA 1QANA 5BR8B 1ZMRA 4YBRA 1ZD8A 3OPXA 1V8FA 4UC0A 1YJ5A 3R0QA 4KYTA 3MVEA 2Z2ZA 3L7YA 1O2DA 1SG6A 1UK7A 4AS1A 3QYFA 1GOTA 4ZCPA 1T34A 1ZOLA 2DPLA 3FCYA 2QF7A 2ZR9A 2J9FB 4NG5A 4CKEA 4ZYWA 1XCPA 5HBGA 3HKCB 5B4TA 1XNQB 1X8KA 3NHBA 1ZNZA 1CKEA 1VPLA 4IGIA 4EB6A 1WQ3A 5TMPA 1T6ZA 4JEUA 5T7BA 5JMTA 3X44A 4YRNA 4E51A 4G5QA 4WLOA 2P6PA 3AHFA 1R5NA 3U7QA 2C98A 2WP8J 2K5UA 1QQAA 1WP9A 4W99A 1CUGA 3QG1A 4Y6SA 2D1RA 2QVYX 2WJIA 3OT1B 3PGVA 3RWMB 1N2GA 3HJHA 2AW5A 2HB6A 4X84A 3P96A 1ES9A 3QKUA 4ZRNA 4BFZA 4YJGA 1C30A 1CB7A 3KR9A 4UTOA 1Z6QA 3L2OB 1WRBA 1HFJA 1UK8A 4UASA 2D0OB 1N9KA 5JNTA 2NSLA 5IDWA 3UXEA 3DS8A 1OHHA 2HJHA 4IMRA 1P62B 2XJ9A 4ARAA 1KMCA 1N4DA 4MLPA 3V1UA 1E3TA 1CJSA 2IY9A 1CDZA 1EHCA 1SRQA 3BMQA 1HE8B 3CMMA 5AXBA 4E70A 2XUKA 2JJ8A 1QTRA 2ORWA 3BMOB 3KEOA 1VSQA 3QELA 4BASA 5DI3B 2Y1XA 4JA2A 4XTRA 3KHUA 4GPEA 2OT3B 3EZYA 1E0KA 4XWTA 3AY7A 3NJ4A 1QIKA 3TE6A 1O6ZA 4L3WA 4RTPA 1OLSB 3O91A 2QPLA 4WZBA 2IX9A 3LCVB 4NDZA 1N5JA 4DYHA 2WKQA 5DYGA 5FD8A 3KXPA 1KO5A 3JQGB 3R5HA 4KQ2A 4HKTA 4Q19A 2WU8A 4Z9BA 3MWYW 4AMYA 3HYCA 5CDUA 1XMIA 1XCBA 3HCBA 3TLCA 3RT1A 4JBYA 1T9BA 2FEWB 1N2OA 1AQLA 1XRSB 2BRUC 3AF3A 4QARA 5I9TA 4QPJC 4YLEA 4DF3A 1G5HA 4MWEA 2F59A 3PR3A 5ITVA 1U5AA 4FC7A 5DX8A 3EZ2A 3S8YA 1Z5GA 4DCOA 3TD2A 1OUMA 3SBDA 3MOGA 4ID9A 3EPPA 5JZ9A 2VTVA 5TQ2B 1LW6E 1HRDA 4QUDA 1J1IA 1M2FA 4JBHA 4KP7A 1OX4A 3CV3A 3RUAA 4X65B 2X5XA 1CRPA 3E0XA 3EMBA 5F7XA 1WDMA 1J09A 4M8LA 4AJ2A 1Y4SA 4ZDJA 1ZVKA 3ND7A 3NR2A 1NY6A 1IZYA 5EMHA 4ZOLA 3OJXA 4BX0A 1ZI8A 4B47A 1M54A 4I0WB 1K4KA 2FPMA 2Y2VA 3WA6A 2L18A 3GT4A 2W2KA 4RO0A 3FOEC 1H5NA 3W7BA 4OHVA 1U1IA 3ABZA 5DNUA 2P4UA 3NHAA 4I55B 4J1QA 4NYJR 4D0NA 2PLAA 5JXGA 5BV8A 4F45A 5DWQA 1IBCA 2FPIA 3AMVA 2HKIA 3CNBA 1ULSA 1KE1A 2VXOA 2XTNA 2JKYA 1H9AA 2FLKA 3K9NA 5FBKA 4UAGA 3SK0A 3ZGNA 4G0OA 4HFNA 4RBNA 3UUWA 3FTQA 1FFCA 2QY9A 4YB8A 3IBGA 1DMRA 1AD2A 4CT5A 1U3CA 1L5SA 2Q6VA 3E7FA 4M0MA 4N7JA 3ONFA 1DUVG 2R66A 4Q3CA 4UULA 1GGMA 4MV8A 4ZZ1A 4AO6A 2CLEB 1A88A 2CKMA 2ZSHA 1FFXB 3CB4A 1ECFA 3E15A 3AV3A 2D3WA 2I0FA 3PQ8A 1OCEA 1CF9A 3AR4A 4HXGA 1KS9A 2FTKE 3TR6A 3C70A 3ZDYB 3DFZA 3WNBA 2P7HA 3EG9A 4FPXA 3R6LA 4MA5A 4I7EA 1G8YA 2C4MA 4KWTA 5TQ0B 4ZCIA 2J0QA 1UBJS 2IP2A 4JUAA 4ZAFA 3R0JA 3ZIAA 4AUKA 3HDYA 4ZO4A 2P2DA 2A9VA 3KOWA 2XUZA 2ANCA 3O2QB 3STVA 3BE4A 2EVWX 1EK6A 4Q9LA 5KUTA 4ER5A 1EJ0A 3ETNA 3G5MA 1NDQA 5I7AA 3D6FA 4Q37A 2IW1A 1IXZA 1QFYA 4D9IA 1SUBA 1QDUA 1YB7A 1XL0A 2VT2A 3GJXC 2JI6A 2PUBA 1M2NA 4QDUA 3CTMA 1RWPA 1E9BA 1OAAA 1YCGA 2W2TA 3AESA 3RRMA 5BN1A 3R3HA 3PLAE 2B9EA 5D3QA 4XYMA 1N7HA 4RFSB 2CNWA 2W2OA 3FKSA 1QHSA 1MO3A 4OGKA 1LBSA 4QASA 1KKLA 1TU0A 2ASVA 3GXBA 2FN9A 3GLVA 3O92A 5FBVB 5AW1A 1XXHE 2I2AA 4GSLA 2MYUA 1I4DD 2QQ0A 3ZHRA 2HK8A 4MICA 5JADA 3UWKA 1J2YA 2I7VA 1RAAA 2Z98A 4KXVA 3VR2A 4CLRB 2I6GA 3ZG6A 2ZS8A 1PW5A 1TEXA 1LTHR 3AI3A 3K9QO 2FPOA 2DLNA 1AHNA 1HZJA 4JIGA 4UDYX 3D6NB 2ZP1A 5E6UB 3O8RA 5DHAA 5JYBA 5ELLA 2IL1A 4FYMA 1VFPA 1O8BA 5FUYA 3PNVA 3P20A 2MTBA 3SQLA 1O95D 4EZEA 2BDTA 1EX9A 3Q7QA 5TF0A 1IN4A 1KAGA 3IP6A 4ME6A 4EDHA 2YW2A 4QJBA 4CMEA 1W59A 1JHDA 4WLFA 4FZJA 2AJCA 1PJSA 1D04A 4OHOA 4J2OA 4P53A 3WV5A 2YJTD 2YBEA 4D6YA 3DDOA 1TAHA 1MV5A 1V4NA 2BGLA 3DE5X 3ZWPA 5K6TA 3BMOA 3U7GA 1TJ5A 1KVQA 4OFZA 3DC7A 5C9ZA 5C1IA 3K9GA 3OZRA 3TIVA 4BBAA 3AVOA 3FFTA 1HORA 4KE6A 4EEKA 5JSKA 1GKKA 5DM0A 2GYYA 3K8YA 3ZKWA 2HJGA 2XVAA 2N75A 2XYVA 1PJQA 1SKQA 3O5AA 4FWBA 2YH2A 2IU3A 2R25B 3HMQA 4V0OA 3P97A 3GPLA 4IJVA 5A3VA 3DM5A 2AUTA 3QJ5A 4ZVUA 3TIIA 2XMQA 3CEMA 4LRUA 4ZA2A 2C9OA 2PRJA 4UBJA 2JJ2A 4Y2HA 1MEEA 2AC7A 1U8XX 1CLUA 1E96A 2NZ8A 3R8FA 3CINA 3EDCA 2M6LA 3RSCA 1OKKA 4W5JA 3HMKA 1JEYA 1D7OA 1EK1A 3I6BA 4AKHA 2YJ5A 2CEAA 5GONF 2B4YA 2OE2A 1A4XA 3OJFA 5A5DA 2GESA 2WYVA 3EW9A 3U3MA 3ESZA 1UJ5A 1T3GA 5LMNB 5G1OA 2AR9A 3D6UA 4Q1CA 1E2UA 4B44A 1LWOA 2Y76A 5BQ5A 4WN9B 3W90A 3SI7A 1J0BA 4GM1A 2ZSAA 3HN7A 1R0BA 4MKFA 3CZCA 3GFSA 3RAGA 2QD1A 4L5CA 4C7VA 1R37A 2VJMA 1ANKA 1W4ZA 2QJOA 3SBOA 4E11A 4KNYA 1Z15A 3ZGZA 4KJZA 2HUPA 4F86A 1J22A 1TK2A 2HOQA 4KIWA 3FYCA 2NT3A 4B6QA 2BMVA 1CVIA 2CFTA 1FU8A 2NU7A 1M8GA 3MWFA 4YFVA 3BCRA 4D9HA 1FSGA 1QGOA 3RU2A 5CCEA 3S2SA 2OP0A 3PPXA 3FHTA 3UV6A 5HW0A 4LXXA 1QHIA 2A9JA 4N39A 3C3XA 4TS3A 3WGNA 1YZHA 4OOFA 5BY2A 1OREA 4PPYA 1QOPB 1G8MA 1Z0UA 4J03A 4FJ2A 3JU3A 4OY3A 5T5QA 3NDBB 1O5TA 2QQFA 2NMVA 3U3OA 2IE0A 5CMLA 5EQTA 5FL3A 3UANA 2GA9A 1JDTA 4JJZA 4MSUA 1VYVA 1IQUA 1CZOA 1JJBA 1PJ8A 1QTNA 4PC1A 3REQA 4X20B 3ZE1B 4F2WA 1F2DA 1ADBA 2XNCA 4QGGA 2AV6A 1XDDA 3MIIA 4CIAA 5AVYA 1F1BA 1Q0SA 3CZAA 1T3ZA 2F4VB 2QTCA 3V4VB 1UBLS 4KNWA 2JCBA 5K0ZA 3KT0A 3DOCA 4AK9A 2JFUA 4URWR 4PYLA 1P7WA 1KJ9A 2UVQA 2JVJA 3QEMA 5SYNA 2JLCA 1X77A 2OGZA 5F9HA 3K70C 3RFVA 3ORSA 4LOAA 5CGZA 2VYFA 3MA0A 1KXZA 2XF2A 3O74A 1T5TA 3PR2B 4GOOD 3HN2A 4ZI7F 5B6JA 3QHQA 1I30A 5REQA 4OK3A 5BSVA 2CVZA 2VNKA 5LLSA 3AOGA 2NU9B 4EHBA 4YRLA 1SB9A 2BE7A 4NF2A 3FI0A 3NANA 4KSYA 5AOBA 1ISIA 1OF1A 2DULA 4F6RB 5EZQA 1KOFA 2OHIA 3G1TA 1N3YA 2JI7A 4PFKA 4E5KA 1TD1A 1T9AA 4AY5A 4GF5A 3OCXA 3U56A 3USCS 2HEIA 3T35A 5DBHX 1BJRE 2C3PA 1W25A 2FWMX 2J87A 3JYNA 2B2XA 2IHYA 1YS4A 3QBVA 4MPTA 4U2CA 4I1OA 4OI4A 4OU4A 5MN5A 2ZI5A 3ZGYA 4D3XA 1A4UA 3W6NA 3REQB 3RUCA 5AESA 1QPBA 1ECLA 1J70A 4XWKA 5KDDA 4OJNA 1YZVA 4CKZA 1QP7A 2VDRB 2P9EA 3WICA 2ZIXA 2YQZA 5H4HA 5LXTB 3L84A 3BZBA 4PIPA 3FPGA 4HPXB 5ENVA 3WMEA 5C8XA 2I2DA 1A95A 1FQWA 4X8MA 4AG3A 1YS6A 1BGXT 5LIRA 1IWBB 1OJLA 1MF7A 4K6MA 1MENA 4MHSA 4YWHA 5NULA 3HEMA 4RK6A 2O3QA 1Q5PA 2XE6A 3DO6A 2CLMB 3IMFA 4A8JB 3HK2A 1DXOA 4EJ0A 2EARA 2C96A 1QHNA 4Z4CA 2OPHA 1EVYA 2DECA 1D0VA 1X8JA 1Z2CA 3IAM6 3L5KA 3NAMA 3FN4A 4JCCA 5JJ5A 4F4IA 4O4JA 1AA9A 1TUBB 1D2EA 1JLMA 1I0LA 2O7SA 1FDTA 2C0PA 3K0BA 2WM2A 1FSSA 1NQXA 1S3GA 1YS2X 2XKJE 1RWBA 2IF0A 4G09A 3JQDA 4AI6A 2GRUA 4XEUA 1NRXA 3KUCA 3RWOA 3LFHA 3VUFA 4NZNA 5LP6C 1Z18A 1FPMA 5EZYF 3UV7A 1Y9EA 4OLJA 3M1YA 4CU5A 2XTZA 1AC5A 2CNOA 2OUKA 2PT5A 3AY0A 3IUNA 3LWDA 2W6IA 2O3UA 1WABA 4TKLA 4TLLB 1UBKS 3EFOA 4OL9A 1YHYA 5DT2A 2A86A 1SHJA 1ZMOA 1DOHA 1BHQ1 2AQ8A 4WMLA 1QHHB 2EIXA 5B1SA 1UDCA 4MKZA 3E23A 2BH9A 4PFJA 5D87A 5DXAA 1YVPA 2D5BA 2IQ5A