2Q1SA

Crystal structure of the bordetella bronchiseptica enzyme wbmf in complex with nadh
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
351
structure length
336
Chain Sequence
NASKLANTNVMVVGGAGFVGSNLVKRLLELGVNQVHVVDNLLSAEKINVPDHPAVRFSETSITDDALLASLQDEYDYVFHLATYHGNQSSIHDPLADHENNTLTTLKLYERLKHFKRLKKVVYSAAGEETDIVSLHNNDSPYSMSKIFGEFYSVYYHKQHQLPTVRARFQNVYGPGEILGAGRWRGTPATVWRNVTPTFIYKALKGMPLPLENGGVATRDFIFVEDVANGLIACAADGTPGGVYNIASGKETSIADLATKINEITGNNTELDRLPKRPWDNSKRFGSPEKARRELGFSADVSIDDGLRKTIEWTKANLAVIEQIMRKHDSALATYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Predicting protein function from structure--the roles of short-chain dehydrogenase/reductase enzymes in Bordetella O-antigen biosynthesis.
pubmed doi rcsb
source organism Bordetella bronchiseptica
molecule tags Sugar binding protein
molecule keywords Putative nucleotide sugar epimerase/ dehydratase
total genus 128
structure length 336
sequence length 351
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q1sA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2q1sA02
4H15A 4M54A 5KNLA 4BNKA 1U2DA 4EGFA 4ZJUA 3GY0A 5K6AA 1E1NA 1F06A 4NBUA 5JAMA 6ADHA 2EHDA 4E2XA 3WICA 3HWRA 1LQTA 1TA4A 3PHGA 1GEGA 2ZCVA 3ZWYA 3EVTA 1VKOA 2P4HX 3A14A 4Z9YA 5A03A 1YQXA 5ADHA 4M55A 1UAYA 5COQA 2OBYA 1QYWA 2JJYA 3KYCA 1UXGA 1C1XB 2V6FA 2EWMA 5ITWA 1ZSNA 1BGVA 1SAYA 4YAGA 1NWHA 3Q3CA 1LEHA 2GZ3A 1YBMA 5JO9A 1B3BA 1PZFA 5F5LA 5JY1A 4CR8A 3W8EA 2X5KO 3FTNA 4IIUA 3IOYA 5TT0A 4FJ0A 1MC4A 4O5OA 4WUVA 4J16A 4KWIA 1T2DA 2DTDA 4LCJA 2W4QA 4AJHA 2VWQA 4LCEA 3W4IA 2WYUA 3CUKA 5BQFA 4MP8A 3CE6A 3ZI0A 2BFPA 4NBWA 1PZGA 5T6BA 4I5FA 3ANNA 1U3UA 3TZHA 3LK7A 1E3EA 1DC6A 5K0ZA 4PG7A 5ITVA 1NHWA 1GYPA 5I8ZA 2FZEA 4IJVA 4D0SA 4NBRA 4FQ8A 4OAQA 1DFIA 4PZDA 4FS3A 3OBBA 2CY0A 3WGHA 3CKYA 3V2UA 4CLRA 3K5PA 1A9ZA 7ADHA 2HAEA 4RF4A 2PKRA 2GN8A 2VRCA 1SMKA 2R00C 1XDWA 2XF8A 3JQ8B 1LRLA 1Z45A 1M2WA 2ZIZA 4QXMA 5CP8A 1YQGA 1HKUA 2PZJA 4P4NA 2JHGA 1E7QA 2DPHA 4Y67A 3ZWMA 5T57A 3M1AA 2CUKA 1YOVB 3H5AA 2FHSA 5A06A 3WR5A 1ADCA 3E03A 1XQ6A 2ZCUA 3RFVA 3GZNB 3ZN2A 1RKXA 5LC1A 1ZK4A 3UCXA 3CMCO 3GN1A 3WNQA 1GPDG 3KEQA 2E48A 1PJ2A 2IYOA 3F1KA 4XYEA 1MC5A 4XQCA 4YXFA 4DQVA 3VHRA 3GLQA 1I10A 3RD5A 2JFFA 2PH3A 2RHCA 4KMSA 3D4OA 1KOLA 2IZ0A 4EI2A 5K9ZA 3RUEA 1W4ZA 2BELA 1YVEI 1ZK0A 1MGOA 4JBIA 1IYZA 2C0CA 4K1LA 1QXSA 4E6PA 4I5DA 2UUPA 4Q3NA 4L73A 2Q2VA 3ZHBA 2OFPA 3JQEA 4GWKA 5A9SA 2NU8A 3JYQA 1AGNA 4DPLA 4MP3A 2GDZA 1MFZA 4MVJA 4XWYA 2D1YA 3VZPA 3ETGA 1Z7BA 3HZZA 1DXYA 2ZYGA 4R1SA 2WE7A 3C1AA 5ES3A 4PG4A 2B4TO 2FP4A 4BKQA 1OMOA 5IG2A 2EG9A 2JD0A 1HDYA 3ORFA 5DCWA 4XB2A 5I9NA 2OHXA 1NTOA 1GZ3A 4N5LA 4NBTA 4YJGA 4M89A 4ZVVA 3ZNPA 1LBEA 3CINA 3INTA 3I9MA 4ZHSA 1QYDA 2Z1MA 4NK4A 2P5UA 3GDFA 1X1TA 2I65A 3UF0A 4OO3A 3WBFA 1FDWA 4JROA 4K26A 1UDBA 2PV7A 4UVDA 1I33A 4JLWA 3DBHB 1LRJA 1B8VA 5TGDA 3U9LA 3V1TC 4NQZA 1Z74A 2AHRA 4PFJA 2Z95A 5IFLA 1ZFNA 5IZ4A 2E4AA 1JKIA 1V3VA 2WWRA 4TRMA 1VJTA 5JS6A 3GFGA 4CM5A 3KZVA 1PJTA 1Y5MA 2X23A 2PZMA 5DOZA 2FZWA 3RC7A 3F9IA 4CJXA 1O5IA 2I67A 3R0IA 4IJUA 3A4VA 3AU8A 3GUYA 4CLEA 4L75A 2O3QA 2C29D 2P68A 3CIFA 2OXIA 4I9NA 4FOSA 4MVJI 1OFGA 2P2SA 4RPKA 4AJNA 3UH1A 4E13A 4E5PA 2EW8A 4BIIA 2UV8A 4DYVA 1DC3A 2CVZA 4CQMB 1PSDA 4B8ZA 1PL6A 2EV9A 4RDIA 3DWFA 2RHRA 3QA9A 1C1DB 4FFRA 1WVGA 1UUFA 3NT5A 4UUPA 5JNLA 3P7MA 4R1NA 1NR1A 4DIOA 2ZJ0A 4OIMA 1LSJA 1HLDA 3CEAA 4J0FA 3DBRB 2JD2A 4ID9A 3WLFA 3L6EA 1EVIA 4ZQFA 4WCFC 4AVYA 2PZLA 1B15A 3RJ9A 5IXSA 4IS3A 2EF1A 3C7CB 3TZ6A 3L9XA 4CR7A 1E3WA 1MXFA 1PJ4A 3JQ9C 4DMLA 3F4BA 1ZMTA 3BXXA 4A03A 2TMGA 4YDRA 3KYCB 4GQAA 5U9CA 1B2LA 4YWJA 1OAAA 4HY3A 1QRRA 5L45A 1F14A 4BNMA 1NFFA 4PLHA 3UN1A 4MDHA 5JYDA 1Y6JA 4ALLA 4CODB 3OJLA 5KVQA 4IMRA 1HTBA 2NTJA 2OUIA 2WD7B 4J4TA 1YXMA 3BHJA 1EUZA 4IQ0A 2F00A 4IGFA 2WEKA 2A9FA 1IE3A 4GVLA 3HFGA 2DBZA 3UHAA 1DEHA 4GH5A 1WWKA 3DHYA 4YT8A 1BXGA 5KVSA 1DPGA 3P2OA 3PDUA 4AJJA 3DTTA 4E2ZA 1EDOA 3RBZA 4CQLA 2D5AA 2Q1UA 4XYLA 1WZEA 3U5TA 2OGUA 3OJEA 4B4UA 1K2WA 3I52A 4XA8A 4YT2A 1O6ZA 3RIHA 4QECA 5DDIP 3B20A 1CRWG 2DFDA 5C7IO 2CNBA 2BFMA 2FRDA 1PJ3A 1Y8QB 1QV7A 3DOCA 4RVGA 4TROA 1E77A 1XKQA 5CPBA 1HT0A 4ZQBA 3BMNB 3SX2A 5EINA 4DLBA 1GUFA 1QG6A 1R66A 1JTVA 3OF2A 4YAEA 5I9LA 1DIRA 4Z6KA 2Y05A 3EVNA 3D3WA 4J91A 2RBEA 1ENOA 3GEDA 5IJZA 2GYYA 4LRTB 2QYTA 3V2GA 3KB6A 3VH1A 4RPJA 1AHIA 1HSOA 1ZMOA 5JDIA 4N54A 3ST7A 5L95A 1VC2A 3T4EA 5BSHA 1GTMA 1LDBA 4Q9NA 4KQWA 2IYPA 3JQFC 4E33A 1ZK2A 4MKXA 4G65A 1FJHA 3QW2A 5TIIA 4D79A 4FW8A 4DBVO 1NP3A 4D43A 1P44A 2WDZA 4EDFA 2DAPA 4HV4A 1T1RA 3ADPA 2Y67A 3I9JA 1I8TA 3G1TA 3QP9A 4TKLA 5B1YA 2VT3A 5B4TA 4D42A 1E6WA 1RM5A 3FNGA 5B4UA 2PZKA 2J8ZA 2FPIA 2Q46A 4BNZA 4PG6A 3GA0A 5T8KA 3X2EA 4BQPA 3WTBA 1PL7A 1M75A 1XCBA 1TLTA 2AE1A 1WNTA 2G82A 3BTUA 5JLAA 4XYMA 5H83A 4GMFA 4F45A 3MJVA 2VN8A 3DBLA 1IULA 5G0VA 1LXCA 1MA0A 5F1PA 4RLHA 1JQBA 2BI7A 3DR3A 2HU2A 3JQAB 4FGWA 4G5HA 4IDEA 1IY8A 3DFUA 2RCYA 3TN7A 4YRAA 1WXDA 3JQBC 3N58A 2HLPA 3S2GA 2FMUA 4QX6A 1G6KA 1X0VA 3WXBA 4ZQHA 4B7CA 2RH4A 3AK4A 4GX2A 4E2WA 4RCVA 3I4CA 1P1KA 4MVJH 2I3GA 3PZRA 1G1AA 1H6BA 2J5RA 3OQ1A 3KSZO 3AM3A 5THKA 3RCBA 3UXYA 3RQSA 5G0TA 1V8BA 2QRKA 4CMAA 5L4NA 2E37A 3GRKA 3GVIA 4O6VA 4CUJA 1DLJA 3AY7A 3GDGA 2VOJA 3R3JA 2NUAA 3PXXA 5JO0A 1HE5A 3EDMA 2P4QA 4JNKA 4B4VA 3E9QA 1A7KA 4YJHA 2BMAA 3W6UA 1NBOA 1K0UA 1S7CA 2HO5A 2PK3A 2P9CA 3BMQA 3CMMA 1EFLA 4J7XA 4A5OA 3ABIA 1QLHA 2QX7A 1N9GA 3EZLA 1QKIA 4Q3AA 3ENKA 4WLEA 3PHIA 1ZVMA 2Q4BA 3FHLA 4L74A 1DRWA 3S2IA 2OO5A 4BMSA 1H9AA 4JGBA 3WIDA 4C7KA 5KJ1A 3PP8A 4O59O 3HADA 2D3TA 1KVSA 2FR8A 5KWEA 4CMKA 2Z1NA 5JMWA 2ZYAA 1J5PA 3N74A 1ZSYA 2CDBA 3D0OA 4RQTA 5U4QA 4UEOA 3MJEA 4XDZA 1E5LA 3ZH2A 4YJHB 2PR2A 3LC1O 1E6UA 1PQWA 5DNAA 2O3UA 3Q9UA 1MFPA 1O95A 4BNTA 4J7CA 2VZ8A 4GX1A 1CF2O 4CL3A 2GASA 2NADA 2UDPA 4HX5A 5TX7A 3GHHA 1HZJA 4R68A 4IDAA 3PWZA 1KC3A 1MG5A 5T8KC 2J3IA 1EK5A 2I5PO 4KUEA 3WTCA 3QY9A 3FNFA 3G1UA 4MKRA 2PTGA 3WFJA 4A2CA 1UXJA 5G2OA 1LRKA 4EZBA 1SOWA 2C07A 4II2A 3BMNA 1E7RA 3OMLA 1XU7A 4HP8A 4XZ3A 4BO6A 4BNIA 4FGSA 4XYBA 4GI2A 1EVZA 3ETDA 4BOYA 3BTSA 2X5OA 2H1SA 4E3ZA 4NFYA 1Y1PA 2VOEA 3DZJA 1HDXA 4ONEA 3CXRA 3PGXA 1PS0A 5HS6A 4IJWA 1T2EA 1ENPA 3OIDA 4FJ2A 2ZK7A 1QYCA 4YT5A 1WP4A 5L4SA 3MJTA 1KS9A 2HDHA 4XCVA 4IZIA 2EKQA 3WGIA 3JD0A 1HE2A 1I01A 4TZKA 2Y99A 3JQDA 3E9NA 4J6FA 1JVBA 4M86A 4Q3EA 2VYVD 4EEXA 1GQQA 1YJQA 3GG2A 3HN7A 3OECA 3W8DA 3RROA 1D4FA 2AEMA 1KVQA 4ALMA 3V8BA 4CMJA 1KVTA 3CH6A 5IN4A 4O0LA 4GKBA 4FJ1A 2PH5A 2WD7A 5ICMA 4QTZA 1WAMA 2YHIB 3KTDA 4EUEA 2PKQP 3NJ4A 1Q0LA 2X9VA 1YO6A 4NFHA 3K2EA 3ETEA 5C7LO 2A35A 3WSWA 1KY5A 2H63A 2X7HA 2AA3A 4B79A 2B4RO 1A71A 4CQMD 5IF3A 2OZPA 3QSGA 4WPGA 1DLIA 1P0CA 2NLOA 3IDSA 3ZWNA 4M8SA 1LC3A 2XXJA 2VYNA 4IDCA 3GAFA 4MVJF 1GCOA 1BXKA 4A0SA 1B8UA 2UYYA 1K6IA 5TLSA 1P1HA 4H3VA 1OC4A 4NBVA 3VTZA 3A9WA 3DAFA 1I3MA 3BA1A 1VE9A 3VH2A 3G17A 2G76A 1OBFO 2PY6A 4NJOA 2EIHA 3TDKA 4ALJA 1O0SA 1T1SA 3E82A 4DIFA 1BWSA 1XELA 4AJ1A 1ADGA 1SC6A 1A9YA 4BHTA 1NPYA 3RFXA 1YWGO 4J2OA 5KCZA 4OXKA 3PVZA 1ONPA 3FSRA 4DWVA 5IAAA 1GL3A 4J2HA 4PLZA 4XX0A 3WB9A 1L1FA 3TOZA 4DRYA 3R6DA 5KVCA 1QORA 4MJLA 1V0JA 4QUKA 1YB4A 3ITDA 4WGGA 3WMWA 3IC5A 3ZZNA 2HSDA 3U4HA 1DHRA 1N7GA 4OKIA 5BNIA 4BO1A 2V6BA 3WSVA 5EPOA 2GN9A 1EZ4A 4EUHA 1Q0QA 4Q3BA 2HUNA 4PGFA 1NAHA 4ZN6A 2VNAA 3T4XA 3GNQA 3JQBA 3PK0A 1N1GA 3QWBA 1V3TA 4OQYA 1ZIDA 2CDAA 4GL4A 3JD2A 1HXHA 4KQXA 3IUPA 4ZQEA 5L4LA 3SLGA 4GMGA 3O8QA 1ADBA 4BGUA 5EIOA 2PNFA 5KJFA 8LDHA 4TKMA 1D8AA 4HXYA 4FD3A 4BNJA 4NZ9A 4RVDA 1BTOA 3BTOA 1UZMA 3PI7A 3RUHA 1R4NB 1YDWA 3I4FA 4RVHA 5F3RA 4WJZA 1W0CA 4BS9A 1ONOA 1ZW1A 3HJAA 4XR9A 5DBGA 3Q0EA 3U0BA 4R9RA 4BB6A 3EHEA 1PGNA 1J49A 4D3SA 4HWKA 2ZQZA 4BO9A 4C7JA 3GNTA 4TQGA 4WNCA 3ULKA 4FBGA 4OGWA 5L53A 1QMGA 1QYXA 4NNJA 1DFHA 2NU7A 2DBVO 4HUJA 1P1JA 2H9IA 3NTRA 3JV7A 2GPTA 1XR3A 3V5NA 3MWDB 4CV0A 5H81A 3VPSA 1SCUA 3RU7A 1F12A 1I36A 1IHXA 1JWBB 2BGMA 2W8ZA 4H16A 3F47A 2DKNA 4M49A 5JDIC 3DDNA 3GPDG 4ALNA 4IINA 3GFBA 4F3YA 2ZB4A 3O9ZA 3AM5A 4CV1A 1P33A 3CZRA 4TRJA 5U1PA 4NFSA 3DZIA 3JQAA 5MGBA 3DMTC 5CDSA 4CM1A 1KEUA 5JFOA 2C5AA 3ZU5A 4B3IA 3F46A 3OETA 2B36A 3WGGA 4EJ6A 2V7PA 5J23A 3WBBA 1Z75A 1ZEJA 4A10A 4JK3A 1IL0A 1P1FA 1LA2A 1LSSA 2OOSA 4IDBA 4Z3DA 1JAYA 3VZRA 4EJMA 2YFQA 4GWGA 3HUDA 1PJLA 4N5NA 4PG8A 3KHUA 4JBHA 2O3JA 3WG9A 1ZO8A 4RF2A 4UUOA 4PZCA 4XJSA 1P77A 2B5VA 2H6EA 3ASUA 5TQVA 1ISGA 2X4GA 3ANLA 5L7WA 4WECA 1SOVA 2J5QA 4IY1A 2YY7A 2IRWA 4OOEA 2O4CA 1XGKA 3W4KA 1SZJG 2Y0CA 3BYZA 1Z82A 2EXXA 4W6ZA 2Y0EA 3OJ0A 1A5ZA 3OA2A 2PD3A 3QE3A 1I30A 3LU1A 3QVOA 1ML3A 6LDHA 4DIBA 3AFNA 1HYEA 3DAGA 1ULUA 3AUTA 1NPDA 3LLSA 1E3IA 4W82A 4NI5A 1G0NA 2I99A 1YONA 3QLJA 3JQGA 4PLYA 2FN7A 3HDYA 1K6XA 1M6WA 5B12A 4CMCA 5KJ6A 2ZTUA 1EBFA 4U0KA 3E6AA 2HRZA 3I6IA 4DBZA 1SPXA 4WCFA 1CWUA 1DB3A 4P38A 3GDOA 3NTOA 1J0XO 3H5RA 1GU7A 3WQRA 3OH8A 4F46A 1D1SA 3AM4A 4MINA 3ICPA 1I2BA 3NEPX 4E32A 1H2HA 4NK5A 1YOVA 1T24A 2RH8A 3KV3O 4JIGA 3IJRA 3FNHA 2QG4A 2YV2A 4IQ8A 3TWOA 2CF5A 3O03A 1EVYA 3JQ8A 3L77A 3NGLA 3A28A 1Y8RA 3VPHA 4CMHA 1JU9A 1W8DA 1DC4A 1UZNA 2FWMX 4MVJE 2CF6A 1EUCA 1UZLA 4H7PA 2X8LA 2YQ5A 3V1YA 4BV8A 2X9NA 3OQBA 1S6YA 3DTYA 1E1KA 3NUGA 3AJRA 2EKLA 3FR7A 4YJDA 1YGYA 4B3HA 3VPFA 1DIGA 4HNHA 3OEYA 3SBOA 5JSFA 2GGSA 1ISMA 4YA6A 2QZZA 3PTZA 4YCAA 1HEUA 1CIVA 1QV6A 3IQDB 3ZU4A 4Z0PA 2VZ0A 1R0LA 3W8FA 1NWCA 5HTOA 2Y0DA 1VJ0A 4Z9FA 3AY3A 3DBLB 4CQLB 1NQ5A 3IIEA 4OXNA 4D46A 1WLYA 3DAPA 1X7GA 4U6SA 2IZZA 3WGZA 2HJSA 3JQ6A 4BNYA 5AXAA 3I3OA 3RKRA 5JC1A 4JP2A 2ZTVA 3GVPA 3KSUA 4YEDA 5JCJD 3WX0A 3EY4A 5EL0A 1GFSA 3RI3A 1NVTA 3KOUA 5CFZA 4PN3A 1NNUA 1I2CA 1E92A 2NVWA 1P45A 1AXEA 2ZB7A 5DT9A 1HE3A 2VHVA 4EW6A 3GMSA 4QO7A 3TJRA 4YBZA 3WIEA 1Q7CA 1JWAB 5EQFA 2X86A 3S55A 1NXQA 5G4KA 3JD1A 4W99A 2G1UA 4IXWA 3U62A 2Q45A 1HZZA 5DP2A 3ZWXA 4ND5A 4KP7A 1T4DA 1DAPA 2YHIA 2J5KA 2QHXA 4IJKA 4JBGA 2X6TA 2EP7A 1ARZA 2B0JA 3I6QA 4XIYA 1GQYA 3DXFA 3SC6A 4DXHA 2WM3A 2Q50A 5JXWA 5TNXA 5TJ9A 5T5QA 2DBQA 3C7AA 5DBIA 2V6MA 4KDFA 4WASA 1LU9A 3KSDO 3MJSA 4BNHA 4MOWA 1B8PA 2Y1EA 1E1LA 1R16A 4PLPA 5JDCA 5IXYA 2GD1O 1CERA 1H94A 4RV9A 1DIBA 3GF4A 3WMXA 5F1OA 3Q2KA 4K6FA 4RZHA 3VZQA 5A4DA 3EC7A 4EUFA 1OZAA 3VVCA 1VM6A 2EEZA 1YL5A 1YQDA 2JD1A 1VI2A 3D4PA 2EJVA 3PRJA 4GLOA 5HS4A 3TF5A 1SO8A 4BO8A 2JHFA 3F3SA 4M87A 4LW8A 4ND3A 1R37A 1LSUA 2R00A 2WYWA 3JQGB 5JAQA 4DPMA 3HG7A 1NQOA 5HBRA 1BXGB 3BAZA 3PQDA 4D7AA 1M76A 2EGGA 2IZ1A 3F1LA 3D5TA 4KTVE 3H9GA 5EJ2A 3S2FA 5A02A 4B7UA 5I8WA 3L0DA 3UVEA 4L4XA 3MOIA 4XJTA 3RUIA 4F6LA 5KVVA 3UUWA 2C2XA 2VHWA 1E7WA 5A04A 3K8ZA 2O23A 4MVJM 4OSPA 2YUTA 2FSVA 4AFNA 3IUSA 2FR0A 1E7MA 2BFAA 1V9LA 5BR7A 4FFLA 3ZU2A 1YJ8A 1AXGA 3IP3A 2OMEA 4YAIA 3UCFA 3MWEB 2A94A 4CMBA 4HFRA 3VH3A 1U9JA 4PZEA 5HRUA 3H4VA 1B3RA 2PGDA 1X7DA 3NAQA 1T2AA 4DL9A 3GZNA 4PVCA 1U5AA 1V35A 3TFQA 3HDJA 3KBOA 5FI3A 3ZNNA 2LDBA 1U4SA 1YS4A 2P91A 3AOEA 2R6JA 5BT9A 2DU8A 3I9NA 1Q1NA 1GD1O 4O63O 3NDJA 2ZTLA 4D3FA 1C3VA 3FWNA 3VVBA 3BMQB 4XDYA 4J1QA 3GH3A 4TRNA 5JCXA 1C1DA 3AOEC 2Q1SA 2Q99A 4R5HA 3ONDA 3IS3A 1QYVA 2NWQA 4GLLA 4DQXA 3GVHA 4YJFA 1Y5RA 3RFTA 4XB1A 1A27A 1E3JA 1K3TA 1U3WA 3QWAA 3UKOA 3BTVA 5COBA 5K6AC 4GX0A 3IKVA 1PWZA 3LZ6A 3K2BA 2AQIA 5CDTA 1HLPA 1NQAO 3WJAA 5JCJA 3TRIA 4Y6PA 2NTNA 3K31A 3U4CA 3JQAD 1FMCA 1BW9A 2D59A 3ZHXA 1RWBA 4W9NA 5L9AA 4MIYA 5GZ6A 4LSMA 4CV3A 5I7EA 2W90A 3RKUA 3NKLA 1PX0A 2O50A 1JKJA 1JW9B 3D7LA 4J9VA 3EGOA 4GBJA 1PU2A 2C7GA 4AJLA 2O7QA 5IDYA 5COAA 1QSGA 3GAZA 2CMDA 2DLDA 2IODA 3M2PA 3WYEA 1U5CA 2A92A 1WMAA 3E8XA 1CQJA 1R4NA 3ICCA 1B26A 3JQCA 3RWBA 1IZ9A 2DUWA 2VYVA 3UCEA 1SEVA 4QFDA 4Z9XA 4L4SA 2HMWA 4DREA 4BO0A 3ROKA 3U3XA 1N7HA 1PJQA 1U7TA 1I32A 2F1KA 2D4AA 4RL6A 2PD4A 2AQHA 3WDSA 4BMNA 4K6CA 2BH9A 4CL8A 2GLXA 1HDOA 3IJPA 4JP3A 4ZA2A 4OHUA 4Q39A 1Y9EA 1IHYA 1PJCA 3HDHA 4YRDA 3GNSA 4L4RA 4P4LA 1EDZA 5JDCC 3KEOA 3PEFA 2HQ1A 4R54A 1VL6A 4NDNE 1PS8A 1LI4A 4JN6B 5BNTA 1XWFA 1B16A 4BUCA 3Q1LA 1VSVA 4Q3DA 3S2EA 1BDMA 1UAGA 4PLGA 4K28A 5B37A 1ZJYA 2X0RA 4EJ0A 3RSHA 4E31A 2B69A 2ZQYA 7MDHA 1IPFA 2O2YA 3FNEA 4K9DA 1GADO 4CPDA 1KIFA 3C8MA 1YE3A 1ZKMA 2IEBA 4CM3A 4CUZA 1X13A 2D0IA 3E48A 5FF9A 3JYOA 5EMHA 3Q6IA 1T2CA 5HM8A 1EMDA 2Q2WA 2EERA 4JXKA 4KTTE 4BMVA 3AUSA 2GO1A 5KJCA 1EE2A 1PR3A 1I3NA 1EE9A 2FOIA 4HFJA 1KERA 4PVDA 2BKAA 5G0UA 3VDQA 1PJBA 4E4YA 1GUZA 2JCVA 1YBAA 3PJDA 3KETA 4WLVA 2JCXA 1NR7A 2JFGA 4IZHA 2NVUA 3EUWA 2VHXA 5A3JA 4EITA 5EQDA 1T25A 1JLLA 4LSWA 4CLDA 4J1NA 2WTBA 4MVJD 4Q3CA 3VPXA 1VLLA 3DMTA 5TF4A 1NAIA 3DZFA 5IN5A 4R1TA 1H2BA 2X58A 1HRDA 1PGQA 3ROMA 4WKGA 2O3RA 1GEEA 1TT7A 1T2FA 2ZB8A 4J0EA 1ZUD1 1SB8A 3WJ7A 3TZKA 4NH4A 1F8FA 4BNWA 4UVEA 1SBYA 5CPFA 4MO2A 5A9RA 1I2ZA 4UAGA 5DOVA 3GOHA 2LDXA 1R0SA 4CMEC 3PFFA 1FDVA 1CJCA 1K6JA 3AU9A 2Y93A 4CM8A 4DUPA 3FRJA 3M2TA 3ROPA 1B14A 3L9WA 2HK7A 3OJFA 5GY7A 2B5WA 1LQUA 4HFMA 1DJNA 1K89A 1L7EA 2PLAA 4OQZA 4U0JA 4OSOA 4Z0HO 3OEWA 4WCFB 5TSDA 3VKVA 4B8WA 1RJWA 4DA9A 5A3VA 4CM6A 5ICSA 3CZMA 4BO7A 5KKCA 4PIVA 3I9OA 2VUUA 4XRGA 3DBRA 1U1IA 3OIGA 4I5EA 4R16A 2VUSA 2ILTA 4GAEA 3N7UA 1LTHR 4CR6A 2O4UX 1U2GA 1WZIA 1E3WB 2C5EA 2FY8A 3LDHA 4CM4B 1D1TA 2VWHA 1A4UA 3ZHZA 2GR9A 3GHYA 5KIAA 4BGVA 3NT2A 4MVJG 3ZDFA 4W4TA 3PFWO 2VRBA 2HMVA 2BF7A 2JL1A 2V6GA 4BO3A 1PJSA 3R3SA 2VTEA 2TMDA 1C14A 5CDUA 4P22A 2WMDA 1CQIA 4A26A 3TL3A 3LC7O 1BW9B 3LVFO 3DHNA 2O3TA 3PWSA 2GSDA 4AJ4A 1D3AA 4U7WA 3AUAA 3AWDA 5IZCC 3HNPA 3LF1A 3T7EA 3PJFA 4N5MA 1R4MA 2HK8A 4BV9A 4FC7A 4UUMA 2OP0A 1FDUA 2HMTA 4XD2A 3QVWA 2O3SA 1KEWA 2BGLA 4A27A 4NJMA 5JPIA 1MV8A 5GMOA 4GGOA 3SC4A 1P31A 1HF3A 1BVRA 3EK2A 4NPCA 3I23A 2H5LA 4OYRA 4B3JA 4C4OA 3K30A 3RC9A 2YDYA 4HNGA 1UXIA 1Z73A 1QR6A 3P19A 3GN2A 3FBTA 4CM9A 2HCTA 2X0NA 4TRRA 4YJGB 3M6IA 2XXBA 4DYDA 2ET6A 1MUUA 1WMBA 2PFGA 4FFMA 2B4QA 4MIOA 3ZW8A 4CM8B 1OC2A 2HJRA 4CLHA 1R0KA 4UEJA 3QWHA 2D2IA 5F5NA 3B70A 4IBOA 3OHSX 2Z5LA 3WGQA 3OJOA 1A72A 4MVJP 3ZWVA 4D41A 2FPGA 4BNVA 4MKZA 4LMRA 1J6UA 4QSMA 3DL2A 3BMOB 2AQ8A 4AJ2A 2PKQO 5KJEA 4DGSA 1PZEA 3DB2A 4CMGA 1JKFA 3V2HA 3H7AA 4Y9DA 5CEEA 1YL6A 2GCGA 3E18A 2EJWA 1I3LA 4E12A 4RJTA 4YRBA 5DCYA 4DTIA 3B6ZA 5CG2A 3GG9A 1DDOA 4IDGA 1X1EA 1DAOA 1TI7A 3GMDA 2CVOA 3HHPA 4FOOA 4L8VA 5G4LA 3OP4A 5CHEA 3GC6A 4BVAA 1B0AA 3TZCA 1LDYA 1XSEA 4BKRA 4J9UE 1Q2XA 3MCVA 3LYLA 4ZRNA 4B4WA 2YHUA 3PJGA 3WYBA 1GZ6A 2HKIA 1HDZA 2I3AA 4UULA 1LLQA 3FD8A 4ZQGA 3ZU3A 3ZGYA 4HFNA 3KO8A 4BB5A 1LDEA 3KUXA 3C7DB 3UGKA 4G81A 3WQQA 3PYXA 1E3LA 3BMCB 4FR5A 2YDXA 3ZWOA 3WGTA 1ORRA 3T7CA 4JX8A 3PGJA 4TSKA 1U7HA 2ZB3A 3ZNOA 1U8XX 2X1HA 1HDCA 1RYEA 2QRLA 3HB5X 3LLVA 4PG5A 4R1UA 4UVHA 1ENYA 1FDTA 1GY8A 4IDDA 4IQGA 4J3FA 1F0YA 2EP5A 1M66A 1DJQA 3AUUA 4CLRB 1IZ0A 4IMPA 3CSDA 2AEJA 4J4BA 4N7RA 5G0WA 5KOIA 1XHLA 5HA5A 3NV9A 4DVJA 3MTGA 3G3EA 5ILOA 3LT2A 3OFSA 2QYSA 4J49A 2Y68A 1PEDA 1R6DA 1TT5B 3L4BC 1ISJA 3PIDA 5TT1A 1TT5A 3STHA 5JE8A 4BO4A 3I5MA 4RVSA 1NM5A 3PYLA 4DLAA 2B83A 3EMKA 4RZIA 3TSCA 3RUAA 2IXAA 1CETA 1P3DA 5EERA 3W1VA 3GEMA 1VL8A 3CTMA 3WWZA 4P8RA 2Y1GA 3O8QB 1ISFA 3G0OA 3PHHA 4LVCA 4URFA 2GRAA 2NTVA 1HDGO 4WEQA 3VDRA 5JC8A 1AE1A 3ZWWA 3UICA 3I83A 2Q49A 3WQSB 1PL8A 2WE8A 4LMPA 3U49A 4U5QA 4D44A 5JW6A 2YYYA 4XR4A 4YTEA 3GR6A 4BNXA 3WGOA 1UP6A 4FB5A 3HE3A 3TOXA 4FC6A 1T26A 3RBVA 4YJFB 3H2SA 4BKPA 2QIOA 2NU6A 2X5JO 2X9GA 4A7PA 3O26A 1BSVA 3TPCA 4CLOB 4DQUA 3ZWPA 5L3ZA 4AL4A 2PGJA 3PQEA 3BZUA 4S1VA 3FN4A 4KUGA 2W98A 4YVFA 5EESA 1C0IA 4W7HA 5I7SA 2AE2A 3QVXA 4ZU3A 1A4IA 3PLRA 4DC0A 4AJOA 1H6AA 2W2LD 3F4LA 2IE0A 4RQUA 4IXTA 1JN0A 3SVTA 5ENDA 3U4DA 4YYZA 3LT1A 1JDJA 2W2KA 2X22A 4FPXA 1T4BA 4RVFA 1I3KA 2C82A 4XGIA 1P74A 4I08A 3QRWA 1PR9A 3MEQA 5AXDA 1TB4A 3NX4A 4XQ9A 3RUFA 5G0SA 3WOHA 5CEJA 4XGNA 5AOVA 4CMIA 3CPSA 1W73A 1BDBA 1RM4A 4L0QA 4IS2A 4ALKA 4PCVA 4A73A 3B1FA 1ZSVA 3IAHA 3VZSA 5C37A 1YRLA 2AXQA 3H5NA 4CQMA 4L9RA 3PIIA 3H9UA 3ZW9A 2Y1CA 1MXHA 4I1IA 3JQFA 4KDEA 3FI9A 5I7FA 5A9SB 1TXGA 3DEYX 4QO8A 4RF5A 1LDMA 1DBVO 1UP4A 1QP8A 4LISA 5DN9A 3HQ4O 4CV2A 3ITKA 3ZV3A 2VRCD 1EBUA 1ZK1A 2YQ4A 1DFGA 1K5HA 4XQGA 2YV1A 2IEDA 2B35A 2UUOA 1HL3A 2RAFA 1KVUA 4ROSA 4YR9A 1XLTA 1LUAA 2C59A 3PYMA 3TZQA 3DZKA 3GK3A 2AMFA 2W2KB 3AI2A 3RASA 2D5CA 2IDZA 1CDOA 3DZBA 3NDIA 3INRA 3FR8A 4FIZA 1DIHA 2SCUA 3IKTA 3NTQA 5DCUA 1IPEA 3GVCA 4NG5A 5B4VA 2AW5A 4J1SA 2J3HA 5A5EA 1E7YA 1HWYA 1GUYA 5CG1A 3Q11A 4CLOA 4OMUA 1A7AA 4UUNA 2VUTA 5G4KB 1LDGA 4YT4A 5KTKA 3EAGA 2YFHA 4BNUA 1NYTA 1XYGA 4D3DA 4R5MA 4ALIA 2DM6A 2QRJA 2P9EA 3ON5A 3WNVA 1DO8A 3GRPA 3WWYA 3O4RA 3H2ZA 1FDSA 4Y98A 3ZV6A 5C7OO 2EGHA 1GV0A 1P1RA 4NIMA 4RVUA 2C20A 4E0BA 2Y66A 1U3VA 2E49A 5HWSA 2A4KA 1XQ1A 3C24A 2GN6A 3AI3A 1KY4A 4E2YA 1DHTA 1EQ2A 4NR0A 4II3A 2WJPA 2FPPA 3K92A 1N1EA 2Q1TA 1FK8A 3MOGA 9LDTA 2JAHA 4X54A 4XYGA 2POQX 4UEKA 3ZWAA 4BGEA 2JKVA 4XGKA 2I9PA 4BNGA 3TL2A 9LDBA 3JQ9A 2YZ7A 2ZTMA 4ILKA 5JY6A 4XKJA 2Y1OA 3DMYA 3JTMA 5CEFA 4ND1A 4ZRMA 4NU5A 1W6UA 3HN2A 4WLNA 1Z6ZA 3RU9A 3I9KA 4N18A 4PLTA 5C5IA 4OH1A 3PJEA 4CM9D 2YJZA 3KXDA 3ZV4A 1MP0A 4IUYA 1P0FA 2BI8A 1XEAA 2GF2A 2ZATA 3GPIA 2BFOA 3AW9A 3ROQA 1ZH8A 2QW8A 1O8CA 4YPOA 4RO0A 2BLLA 4QT0A 4TVOA 5IDWA 1Y8RB 1F17A 5IDXA 2CFCA 3RBXA 3ZWCA 3PHJA 3UAGA 4FCCA 3DOOA 4R01A 4FN4A 3G49A 1NASA 1R15A 4YAKA 1EK6A 2VTDA 2DC1A 4PRLA 1ZCJA 5KKAA 3O38A 1KC1A 3RC1A 1L7DA 1ULSA 4XRRA 2NU9A 4BO5A 3VTFA 2JAPA 4GSKA 1TEHA 1ADFA 1SEPA 2AQKA 3JD3A 4PLFA 1EUDA 2DQ4A 4CM7A 4AJKA 3VPGA 3H6KA 4RF3A 2NSDA 1Q7GA 4E21A 4ESOA 3QWIA 3GEGA 1I0ZA 3K6JA 4ITUA 1RYDA 2QQ5A 4NU6A 1VPDA 4BQRA 1NVMB 1LX6A 3INGA 1N5DA 3WYCA 2AG5A 1YKFA 4R41A 3DHEA 4DMMA 1XU9A 2GERA 1D7OA 3H9EO 4DPKA 1GYRA 1NVGA 3W6ZA 3H3JA 5TRTA 4RPGA 3D5QA 5A1TA 2Q4EA 4FFOA 4HADA 3HB4X 1IB6A 1E5QA 1EEHA 2V65A 3AY6A 1ZXLA 4R4JA 2GNAA 5IZCA 1U8FO 3NT4A 3K9QO 4D0RA 4KZPA 4RPHA 3A1NA 1E6EA 1BMDA 4Z0TA 4JJGA 2P9GA 5FFFA 4AG3A 1ZK3A 2CD9A 2E6UX 2DUUA 2ZJ1A 3GT0A 3PDJA 3E5RA 2VCYA 3JSAA 4U8GA 2GUGA 2QZ9A 4WCDA 4J7UA 4ZD6A 2DTXA 1Y9AA 1E3SA 1HETA 2O48X 3UOGA 4E5NA 4TVBA 1HSZA 3EYWA 1P1IA 3I1JA 4OM8A 4QFCA 4BGIA 1SNYA 4R51A 4B4OA 1DRUA 1BXZA 1I24A 1YB5A 4FDAA 4Y6RA 5DP1A 1OI7A 4WOKA 4GPD1 1WPQA 2ZKLA 3QV1A 3PQFA 5FWNA 5C3MA 1NFQA 1NHGA 3H3FA 3ANMA 5ER9A 1KYQA 3L4SO 3UFXA 3ZWBA 4M1QA 1GQ2A 1O94A 1AHHA 4BKOA 3H8VA 2VT2A 1VRWA 3NRCA 3V1UA 3ENNA 3LF2A 1GYQA 2I66A 1R4MB 1PGPA 1BVUA 1MLDA 1KETA 2X0JA 4RGBA 1CYDA 4BNNA 1WDLA 1UR5A 5DBFA 3MTJA 1LLUA 1V6AA 5LDGA 3ASVA 4IIVA 3JYLA 4G2NA 5ENVA 3F6YA 5T67A 2JFHA 3D1LA 1N8KA 2FSSA 3FF4A 1FXSA 1QLJA 1GR0A 3DFZA 1N92A 5A9TA 3QVTA 2J3KA 4AJEA 1OOEA 1AUPA 3H9JA 1KVRA 4QQRA 3DONA 2ZYDA 3FPCA 4IDFA 4BL5A 4P4GA 1E1MA 4ZGWA 5CDGA 3OA0A 5DULA 3DBHA 3OQ6A 1J4AA 4MIEA 3PPIA 2VYND 4PLCA 1HE4A 1PIWA 2UAGA 3U4IA 4J43A 1NX6A 3AOGA 4TZTA 1GPJA 4MPDA 4OOFA 4OKNA 3L4BA 4EYEA 3JCZA 4DLLA 4DC1A 1NPTO 3DZHA 1U28A 5DF1A 4LRSB 3JQ7B 4F6CA 3E1KA 5JAIA 2VHZA 3ZNQA 4Y6SA 1IUKA 1PQPA 3QIVA 3WS7A 1C0PA 1WW8A 4JCOA 2NACA 3W4JA 1JA9A 3NJ8A 4KOAA 4NHEA 1U3TA 2BRUA 1JAXA 5LDHA 1GV1A 3LSYA 4PLWA 4FFNA 4GGPA 1X14A 1IOLA 2VHYA 4GKVA 2DFVA 4PRKA 2E82A 5T64A 2NVBA 1X15A 4WOJA 2VNSA 4IGEA 4CLXA 4NMHA 5L7TA 2WYVA 2R2GA 5IDQA 4D45A 4CMIB 2NM0A 2VWGA 2C2YA 2HK9A 3RUCA 4HKTA 1F8GA 3FWZA 1X0XA 5L51A 4WLFA 3JD4A 2C54A 3GVXA 3L6DA 3F5SA 4J4HA 3G79A 4YACA 5EN4A 1C0LA 1H5QA 3RVDA 1PS9A 3QWFA 3K96A 3EW7A 1NFRA 1M67A 1ZXBA 4TMFA 4U6QA 3K73O 4IM7A 4J90A 5TS3A 2HMSA 4UVIA 4W7IA 3C1TA 4E5KA 5A05A 4UREA 2WSBA 2RIRA 1TVEA 4EBFA 4ZICA 1PQUA 3DBVO 4IPTA 2D8AA 2I6TA 3E9MA 1NQTA 2VQ3A 1UDCA 1Y81A 2FR1A 4PLVA 4CUKA 1RM3A 3GQVA 4O1MA 4GVXA 5FYDA 4JJIA 5F1KA 3JYNA 1UJMA 4UVGA 3QVSA 3LT0A 2Y1DA 5BNFA 3FTPA 5MDHA 5I7VA 2HRBA 1PZHA 4S3MA 1XG5A 2BHLA 3OICA 1KEVA 8ADHA 3D4NA 1MG0A 1ISHA 3BMCA 1GZ4A 5AVOA 3TQHA 2NQ8A 2EKPA 5L7YA 4J1TA 4Z3KA 4B7XA 3VKUA 2VZ9A 5DZSA 3H9QA 1YBVA 3KYDA 2DVMA 4RPLA 4WK6A 4ND4A 1R12A 4L76A 3QHAA 4QEDA 1AN9A 1ZZEA 1Q7BA 3D3WB 3KLPX 1YL7A 2IXBA 2OBNA 3M1LA 3D64A 3OSUA 3U09A 2J6IA 1FF9A 3SJUA 4R9SA 3RUDA 2GZ2A 3WFIA 2WD8A 3AI1A 4OL9A 4LN1A 4YAJA 2NVUB 3P2YA 5BSFA 1HYGA 1VL0A 3GZ4A 3WLEA 3FBGA 5A5FA 1P9LA 3ADOA 4RLSA 4AJPA 3KVOA 1O89A 3SEFA 3KYBA 5BSEA 4LVUA 2Q1WA 4WE3A 1H9BA 3DO5A 5JAZA 1KBZA 2NV6A 2PA3A 3BHIA 1UXKA 3QQPA 4FFPA 3NDRA 1SB9A 3DOJA 4XQEA 5AYVA 1DSSG 2XPCA 4I8XA 4XEHA 1H6CA 1VKNA 3LT4A 5AQ1A 4I9HA 2HMUA 1PGJA 1YH3A 3C3XA 3ZHYA 1CEQA 1LJ8A 2CDCA 2DT5A 1M6HA 3OIFA 4RORA 3VC7A 3R1IA 4BKUA 1E7SA 3D3EA 5FEUA 2CSUA 2XAAA 1V3UA 3X2FA 1LLDA 3JQ7A 1C0KA 2EW2A 3RC2A 4JQCA 3MZ0A 2O7SA 3LQFA 3KLMX 4E5YA 4FSHA 1RPNA 4BNFA 1ZNQO 1X7HA 3C1OA 1ZBQA 5JBIA 1ISIA 1LSOA 1ID1A 3GGPA 5BSGA 1N2SA 3E5MA 1ONNA 4RDHA 5THQA 2GN4A 1UDAA 1ZEMA 1MB4A 2O2SA 1DIAA 1RM0A 3BHMA 3LC2O 3VAZA 1JVSA 4R3NA 1ENZA 3PZBA 4JJFA 4R3WA 2OL4A 1C1XA 4WEOA 2P5YA 3KYDB 4GX5A 4CMEA 5CDYA 3VOSA 1EFKA 3NYWA 4I5GA 5CAEA 3ONFA 1UH5A 2NQTA 1WDMA 2PWZA 5F21A 1GCUA 2DBRA 3SJ7A 2Q2QA 2B37A 3OM9A 3ONEA 5TC4A 1XA0A 1WDKA 5LCXA 3TNLA 3Q9NA 4AICA 4R69A 1GDHA 1PWXA 4TWRA 1O9BA 2YV3A 5JYEA 2G17A 3UW3A 3HFSA 3P5SA 3L6OO 1H93A 3KM0A 2C7VA 3NGXA 3ZCXA 2W2LA 3I9LA 4OJNA 2G5CA 4W9NC 4BO2A 4GSLA 3DQPA 3SLKA 4I9UA 2AG8A 4CM4A 2BD0A 4Y8VA 4BNLA 3F5QA 5GZ3A 3SXPA 5ER6A 1LLCA 3MJCA 4NJMB 4YQZA 5JMPA 5ILGA 2X0IA 1PTJA 3PHLA 1EQUA 1UP7A 3B1JA 2Q3EA 1PGOA 1G0OA 2OORA 4E5MA 2CVQA 5GZ1A 2OP1A 1VSUA 4LGVA 1HDRA 3EZYA 1YDEA 1H6DA 1H0KA 3QJ5A 3MJ4A 3BIOA 2Y1FA 3L07A 3PLNA 2I76A 2BGKA 2PD6A 2UVDA 1LNQA 4LK3A 3KRTA 1DOHA 1BHSA 1DRVA 3DC2A 1Y7TA 3HSKA 3BMOA 3IMFA 3GGGA 1U4OA 4KUHA 5AXCA 2DTEA 2G0TA 1VJ1A 1KEPA 3H65A 4HBGA 4EEZA 3PWKA 3RJ5A 2DPGA 4KWHA 1DC5A 1YB1A 3A06A 3Q2IA 3B1KA 1E0DA 1GAEO 5H82A 4AJIA 4ND2A 1BG6A 2JCYA 3C85A 4MP6A 5FI5A 3IL2A 1B7GO 1BRMA 3AFMA 1Q0HA 4OXYA 5L40A 1Y8QA 3IP1A 4INAA 3RAJA 4WNIA 4XIJA 3S1LA 4WLUA 3JYPA 1ZJZA 3HDQA 2AEFA 3GGOA 3FCOA 3GUCA 5AXBA 1LDNA 4WLOA 2PGLA 3VH4A 4YB8A 1LC0A 4E30A 1I5RA 4YQYA 2CZCA 3FPLA 3TFOA 1EVJA 1N9GB 1UXHA 1HYHA 1XIVA 2J3JA 2VWPA 5TJHA 3WGYA 3ZV5A 1MX3A 3S8MA 5I9MA 2NNLD 2XOXA 1Z7EA 2GZ1A 3COSA 3DZGA 2YW9A
chains in the Genus database with same CATH superfamily
2ZT6A 1NXSA 4PC1A 4E15A 4DB4A 3ZTTA 2C8LA 3H9CA 3M83A 3U9TA 4OVKA 3TIGA 4S1PA 3VNRA 1XOIA 4TWZA 4F9EA 2ZUFA 2Q0HA 3LV8A 2JGLA 5AKXA 3O82A 3SNKA 2WHPA 3ISVA 1A9SA 3QPUA 4I50F 2FZ5A 3M89A 3AESA 3IBYA 3ORSA 1LQTA 3ABSB 3PHGA 3OLYA 4GR9A 1PK9A 4GPBA 4UCXA 1JEYB 3EVTA 1GGNA 2B2CA 1VKOA 2G3YA 3D43A 5ELLA 5FUVA 3A14A 5A03A 4Z9YA 5A4FS 2Q21A 4TL9A 5DXFA 3VA7A 2JATA 4JBLA 4M55A 1UAYA 1YB6A 1CZRA 2XHEA 1D0SA 3ECAA 2WOJA 2JDID 5K0EA 3KYCA 1C1XB 3M9LA 1X6VA 2EWMA 4OF4A 1QB7A 2JEOA 4WKNA 1BGVA 2WTMA 1TC1A 1UM8A 3A1DA 4IGKA 4MRVA 4Q66C 5HXAA 1XXLA 3Q3CA 2GZ3A 3BM5A 1OR8A 2PGNA 2W2TA 4LQ4A 4CIVA 1T5OA 4CR8A 1S9HA 3AUJB 1TZMA 2RSLA 1JQAA 1UQRA 2ZYHA 4H35A 3W8EA 1CY6A 3IOYA 4E94A 4FJ0A 1G18A 1QR2A 3QFHA 1JDBC 3KTOA 1ULAA 3CJQA 1IY2A 4BBZA 3G2OA 1BJRE 4LCJA 4UCFA 5ARCA 4LCEA 2BSAA 3LRPA 2JLYA 3V48A 1FMTA 1FTQA 3IVMA 3VGJA 4A9AA 1PZGA 3D2BA 4I5FA 2AR9A 3ANNA 4LOJA 4B34A 3SC2B 1GWNA 4ZCMA 1SGWA 2QSYA 1PK8A 3I6ZA 4OQEA 4LV6A 1DC6A 3VV2A 5L3QA 4JWKA 1U3FA 2I2DA 2J9RA 1GYPA 1MT0A 1MX1A 5M3BA 3E2PA 3FGOA 3PC3A 3KAKA 4EUKA 4PZDA 5T41A 3I8SA 1P3JA 4FS3A 3N2LA 3IQWA 2CY0A 4F5EA 2HK6A 2XNKA 3C16C 2XBMA 1ATZA 2J7PD 3PG5A 1KO5A 1ZBDA 2BFCA 2PDAA 3K5PA 1KO1A 4JI0B 2FPWA 5D3KA 5LMCA 4YMVA 2IS2A 3AESB 1RCUA 1JALA 2G8LA 4DMFA 3CA8A 1JDVA 1M8JA 2GN8A 2Q41A 1SMKA 5LA6B 4B0OA 2R00C 2P6RA 3CH5A 3E9DA 2OCPA 5ALQA 4DSAA 3QX7A 3A3YA 3JQ8B 3LYAA 3QY0A 5DISB 1USUA 2CMKA 2ZIZA 1YQGA 2QGFA 1HKUA 4XDHA 2DCUA 2YXEA 4AROA 1VCMA 2RGAA 1BU5A 1L1RA 1QIHA 2DEUA 1VIVA 1T35A 1IU9A 4C6RA 2N46A 1YOVB 4JZYA 4RM3A 1MDBA 3WR5A 2IYVA 2V7TA 2ZCUA 3RFVA 1JFVA 4HI0E 1RKXA 1Z13A 4HZIA 3GFFA 3IIIA 3UCXA 4MQFB 3TLAA 2WMOB 1G8JA 2IYOA 5BR8B 3EXHC 1MC5A 3ZBUA 4ZVOA 4OY3A 4DQVA 4ZIRA 4KMSA 5B30A 1XX6A 1KOLA 1RDFA 2OD7A 2IZ0A 3WO0A 5FA5A 2HWWA 2BELA 1YVEI 1MGOA 1V25A 4K1LA 1QXSA 2ZR9A 2PSEA 1QKKA 1Z7YA 1PYOA 3OPVA 4QGGA 2EDCA 2O8FA 2ORWA 3VJRA 4CNQA 2WUEA 4GWKA 3VU3A 3KOMA 4W5WA 4Q4JB 4IR7A 1AGNA 4WJLA 4HDKB 5K8VA 1S4MA 5DJ5A 6CHYA 2GDZA 1IZYA 3C97A 1WB6A 3IOCA 2D1YA 4F12A 3ETGA 4G1VA 1Q91A 1Z7BA 2ZYGA 4NESA 3UPTA 4CKEB 1E64A 2FP4A 1J2JA 3ESZA 1OMOA 1TKRA 3CISA 3N2EA 1JBKA 4BKQA 2OXEA 1DX9A 2N42A 3ORFA 2A7XA 2OHXA 3MTBA 4KQIA 2OYSA 3WKCA 3DL4A 4M89A 5C5CA 2O0HA 4YAOA 4UTZA 4OGFA 2Z6VA 3INTA 5D84A 5EZYA 3DMNA 5IULC 3C1UA 2Z1MA 3M8KA 4LJSA 3JPYA 4OHBA 2G4LA 1FFYA 2XNJA 4EK9A 1X1TA 3UF0A 1DT3A 4HTFA 4LXYA 1KOGA 1FSGA 3L06A 1EWQA 3IUQA 1GHTA 2C9CA 4JROA 1PJ8A 1UDBA 2O1XA 2ZRGA 4UVDA 1OLXB 1XBTA 3PV0A 4JODA 1VJ5A 5TGDA 3V1TC 4PFJA 2XMDA 3M3DA 3AVTA 5IZ4A 3CX4A 4I1RA 2UXDB 4RZUA 1XZPA 3LE8A 1JKIA 2G07A 1D09A 3AEUB 3KQSA 1KK0A 2AOXA 4YIHA 4RA9B 5CYGA 3GFGA 1RQLA 3NVDA 4RTJA 1MC1A 4FNOA 1M2GA 3PDIA 1U9IC 2CBGA 3M6MD 1WCIB 4J1TC 4DV2B 3BJMA 2PZMA 4JLJA 3M0EA 2E87A 4ZTZB 3RC7A 1EJ0A 2JGNA 1EU1A 1SBHA 4CJXA 4IJUA 2WV9A 1O4VA 2QWXA 4INOA 2BJVA 5AI0A 4A2PA 1YSCA 2J3MA 3FIUA 2C29D 3CIFA 1UWVA 3Q3IA 4HXEB 4NYJQ 5AKIA 2OXIA 2P2SA 4AJNA 3UH1A 1MC8A 4BKMA 4BVJA 1S96A 1JEEA 2OHIA 2CUZA 1DO0A 1UK9A 4CE6A 4C76A 4CQMB 1LLFA 1PSDA 3IA7A 1PL6A 3ZJVA 3M4YA 3VAAA 1FXWA 5BMVA 1M9NA 1C1DB 2WY2D 4FFRA 3NT5A 3QF4B 5BORA 2CWWA 2G1PA 1QBGA 3P7MA 5JNLA 5IHPA 1NR1A 1SHTX 2DPLA 3M70A 3A1VA 5JQGA 1LSJA 1GPMA 1HLDA 1LH0A 2D0DA 3C43A 4LYEA 4PPNA 5KNDD 1GLNA 2JD2A 3W5SA 1E9CA 3WLFA 2DR0A 5B3AA 1W75A 3EZ9A 3NBAA 1CUJA 1RFLA 4WCFC 1XZGA 4ZYUA 5LXTF 3OE7A 2RHWA 5CA1B 5IXSA 4Q7JB 1EWYA 4IS3A 2ZPAA 5D00A 1XEXA 1C0EA 3L9XA 4EW3A 1E3WA 1FRQA 2RH9B 3JQ9C 1CJMA 2R65A 5GGYA 4DMLA 3R8FA 4F3TA 4XVHA 3UYKA 1W4AA 2IOFA 1R3DA 3L0IB 1RI5A 1UBRS 3DNPA 2TMGA 3PDHA 3KYCB 4Z2YA 4ZZ3A 3E0QA 1W7AA 2X4DA 4HY3A 4W1SA 2HM7A 2XUIA 2E4UA 2JI6A 1WTCA 3G7NA 2HNKA 4P36A 4QGFA 5AKJA 2V0GA 4MDHA 1QX3A 3ZDZB 4M83A 3I28A 3RVBA 2E4XA 3N6VA 2JAWA 1TK9A 2MSEB 4DCGA 2PMEA 3S40A 3RGGA 1K66A 2FVXA 4IMRA 3VJMA 5A1JA 1HR0B 3FFAA 3HPRA 2OGTA 2WD7B 3D6JA 4I55B 4J4TA 3WWEA 3BHJA 1EUZA 4E7OA 3S7ZA 1PT5A 4HRXA 3A1CA 4ZZ0A 2A9FA 1IE3A 3KKKA 4MULA 1CDEA 5AMXA 2BZ0A 4GE0A 2IP2A 2X6QA 4COOA 4TV9B 1AZLA 4YT8A 3PGVA 5KVSA 2OHHA 3PDUA 3T9DA 3OZUA 1XQ9A 2WAAA 3CXUA 3G9XA 4G8BA 4BCBA 4CF5A 4E14A 1YCHA 4KYVA 5K4HA 3RBZA 3IBCA 4N41A 3AP1A 2XMSA 3PXDA 4MV3A 4R8LA 1Q7RA 2K6GA 3U5TA 2NNWB 1ZR4A 1V5EA 4OV6B 3OU7A 4MA0A 4BP8A 2WOOA 1FC0A 1P18A 1YZQA 1Z68A 5BVGB 2FW8A 4XA8A 2FEOA 2C96A 2EFHB 3MS4A 4I9GA 3IT0A 2XRZA 2QRUA 4KRFA 3DP9A 4Y1GA 2JGFA 4LNUB 4LIPD 4RVGA 1U0LA 2NXJA 3KZMA 1HT0A 3MWJA 3N07A 4ZQBA 2WFLA 4CNBA 3Q40A 2OMKA 1JG3A 2X8JA 4AXBA 4P0QB 4FD2A 4XPIA 2BGIA 1I3OA 1QFJA 3KTFA 5FP0A 1JTVA 4UMEA 2D7DA 2OCKA 3D3WA 1TQ2A 3DYIA 1T8WA 3GEDA 3LNCA 4LRTB 4X3CA 2QYTA 4XUGB 2PJZA 3V2GA 4RPJA 4EYOA 1GPH1 3VTKA 4PHGA 4N54A 3MRVA 2D3WA 2GK4A 3G5TA 3N70A 3WGVA 4RACA 4C07A 1XTQA 5AW2A 2FXVA 1NMZA 3JQFC 2NUBA 2DHDA 4MZDA 4O08A 3WMGA 4G65A 4B3GA 3QW2A 3STTA 3WGJA 4MCJA 2R1VA 5IVPA 3TX6A 4D9CA 2NPFA 5FPHA 5DYYA 1LNZA 1LF5A 2HA5A 2WDZA 3FLMA 4RXUA 4MS3A 3SD7A 4EMSA 4HMOA 2X4IA 2FQ1A 3ZE8A 3ZXIA 4MW0A 4TKLA 1I8TA 3G1TA 1HQKA 3EG9B 3NBXX 3TI9A 3ZPXA 1JSCA 3WDKA 1PVOA 1ZI9A 1Q1QA 1K3FA 4O5AA 1RM5A 5B4UA 1IZZA 1JLRA 2I2CA 5D2CA 2DHEA 3DCIA 3Q8LA 2M1XA 4PXAA 2GKGA 2PSHA 1PR6A 4BQPA 4CI0B 3P2IA 4M7RA 3AVPA 4H0FA 5JLAA 1WNTA 2FMHA 2P2CA 4KLRA 4U9IS 5KAPA 1AO0A 3RYCA 2C5HA 1IN7A 4DRXB 3L82B 4PZ0A 4BB9A 3WLPA 4GMFA 2JLUA 3JWIA 3MJVA 2P75A 3EYAA 5ITZA 3EFHA 2XKJE 1PT6A 2VHJA 1IBCA 1LXCA 4KRYA 4YLEA 3EIOA 1CNMA 2BTQB 2ORED 2ZAMA 3SHWA 2HQBA 1JUDA 3T7JA 1Z29A 1NGSA 1Y37A 3DR3A 3RYFB 1NJ1A 1IK6A 2EF0A 2R9VA 3SDSA 3AGPA 1XEWX 3DDUA 3V6LA 1IY8A 3DFUA 2RCYA 4D9NA 2O59A 1QLWA 2RKOA 3L7BA 1WSBA 3H5VA 3N58A 2GJSA 5LPNA 1QH8A 2LE0A 5B1SA 2FMUA 5EE0A 2PNJA 4YO7A 3S1AA 3S2GA 3LPAA 3UMJA 4LECA 4NBKA 2GK6A 4ZQHA 4EQ6B 2HBYA 2FR8C 3AK4A 3T3GA 2HV9A 1JJBA 4RCVA 3I4CA 3UPDA 4C5CA 3DTVA 2EYUA 1WV1A 5EE3A 2HRQA 1G1AA 5HPYB 1PTKA 1HH4A 4EKEA 1V2GA 5KC9A 5CFLA 2BE7A 4FGJA 3D6TB 4LYYA 3KSZO 5CEJA 3RCBA 1CUUA 5B3JA 1VL2A 3QKRB 1BJTA 3I6BA 1NYRA 2Q9AA 5FO0A 2E37A 3GRKA 1KYZA 2QLTA 1C3OB 3HXLA 3JSXA 2DQZA 4O6VA 2UVPA 4X3PA 1DLJA 3H87A 1KSGA 3ZZ0A 3GDGA 4CUJA 4KO4S 3WNZA 2NUAA 5JO0A 1EFPA 2P4QA 4F06A 2I62A 1MH9A 1UFRA 4YJHA 4ABYA 5IK2A 3SEZA 1YCGA 1BH2A 1GZDA 1NBOA 3FNBA 3EPPA 3RRFA 5DYNA 1OLSB 3T1NA 4A5OA 1ZWLA 3ABIA 4N0PA 2QX7A 5LOVA 3EZLA 3HGMA 4M6WA 4Q3AA 1AX9A 3DAHA 6GPBA 1Q21A 3ENKA 4WLEA 4ZYZA 1XAGA 2Q4BA 3FHLA 3JAKB 2REQB 4CF3A 2Z83A 4DV6B 4JGBA 4C7KA 3WIDA 1E2FA 1N6HA 2R7AA 2Q5CA 2W8BB 2YASA 4B84A 1J39A 1KVSA 1JG2A 2AFVA 3WI7A 4MB6A 2Z1NA 2VKQA 4C7BA 4CMKA 5LDDC 4JV5B 2IY8A 4H6PA 5E8RA 2OEPA 4JLMA 3NBUA 4D9EA 1D7AA 2PAAA 3OJCA 1RC0A 3OX3A 3P9YA 3QG5A 3MJEA 2REOA 3NHPA 4GZMA 4XDZA 3VTAA 4UTNA 1QFZA 2PFKA 5IKEA 4TYYA 2PR2A 3LC1O 2OILA 2XUZA 2GCOB 3K6RA 3KKZA 2OOKA 4A23A 2O3UA 3AY0A 3Q9UA 3ZOZA 2VJLA 4O1HA 4EPWA 2ZTHA 3GJQA 2VZ8A 4GX1A 3U4AA 4P84A 2ABWA 3ZEAA 4YCJA 2GASA 4PO1A 1V1MB 1QO0A 2OGSA 1QK3A 2UDPA 2C3OA 3M5DA 2KE5A 2EL7A 5AVWA 1NLMA 4KO3S 3BK2A 2KI5A 3TQRA 1HZJA 5LSAA 1MG5A 1R00A 4D4GA 1RPJA 4QXOA 1EK5A 2VJMB 3WTCA 4Z7JA 4GYJA 1QK5A 2KM1A 3DUFB 1UXJA 4MO9A 3BD9A 4WKPA 4KLCA 2ZRIA 2AZTA 2I22A 2JG3A 2XRFA 3RC3A 2ZDGA 3CSUA 1SOWA 4II2A 4OJQA 3BMNA 3ZKWB 4UFNA 1E7RA 2WJ3A 4P7KA 1BXRB 5D85A 4LTDA 2QAGC 4N40A 1LI7A 5F73A 3MT9A 3AUYA 4NFYA 1N6LA 1Z4IA 3SDBA 1Q12A 2Z9DA 2H2IA 1B93A 4IVPA 1FFXA 3LPLA 3T4PA 3VNSA 2WKQA 1L8AA 3H8SA 4FI3C 4UQPA 3VSEA 4HLUC 1CT9A 1DJPA 4YGXB 4EHNA 1VMKA 1UKEA 5CYPA 4YT5A 2CB0A 3NGMA 3FYCA 1SU7A 2H18A 2I7VA 1E98A 1KS9A 4IZIA 4Q3LA 3BPSA 4IX9A 4KN9S 3G5LA 4XVCA 2OUKA 1I01A 4Z9BA 4E2FA 2Y99A 3WGIA 1XEFA 3E9NA 5BXQC 1JVBA 2QQEA 2WJZB 3HN7A 3RVMA 4DR3B 1MEJA 4JJ6A 1XJWA 3VHLB 1V4NA 5DHUA 4QJ5A 3PLAE 5DU2A 4ALMA 1FQKA 4CDGA 1H2XA 4TSFA 3V8BA 1K5PA 1G3UA 4B7ZA 2ZJ5A 4JP1A 5IN4A 4O0LA 1MRSA 1W35A 4MS3B 1WE2A 1JT9A 2GEJA 2YHIB 3NJ4A 3ZV7A 4B7AA 1Q0LA 1KFKB 1UEJA 4NFHA 1WXXA 1ULHA 5C7LO 2A35A 1RFGE 2H63A 2J30A 2X7HA 2AA3A 3DG9A 1QX4A 4I8DA 4L5JA 4P1ZA 4GNRA 4CQMD 4OHOA 2QX9A 5DIFA 3ZWNA 4TMXA 5LYJF 2WHRA 1LC3A 2XXJA 2VYNA 5FWXB 4TLMB 3VKHA 4QEKA 2BFBA 4ZARA 2ATIA 4MVJF 5E38A 4JGGA 3L8DA 5J2UA 2UYYA 1P1HA 2EBFX 2GKOA 1N5LA 4H77A 3OE7D 2G1AA 4F4IA 3L8MA 2XEDA 3EGIA 4OI1A 3A9WA 5JVDF 4KEAA 2HA4A 4WK2B 1I3MA 5JCOA 4KN6A 3VH2A 3G17A 3AJEA 2YVKA 5IC6A 3ZHOA 3RTDA 1TF2A 3NHUA 5BSMA 2M98A 1X7WB 4Q9AA 4ALJA 2WPDD 4NX2A 1J99A 2PX5A 6PFKA 1BWSA 2Q2NA 3NPAA 4ML3A 2DFTA 1PQ4A 2FU5C 2EYQA 4BHTA 1XZAA 3AZPA 1NPYA 2JLCA 2L69A 3REGA 4J2OA 5LZ4A 2HR1A 4OUDA 5KCZA 3L8CA 3MELA 3FETA 2I6FA 2UZ1B 1N77A 3U3OA 1DV1A 2PIAA 1EG7A 4KXVA 1WVIA 4PLZA 3SXUB 5JFGA 1QFMA 3R6DA 5KVCA 1QORA 3L7OA 4UHJA 1V0JA 3W6NA 3CNQS 1U6KA 1FJ2A 3ITDA 1ODJA 1TMGE 2PQMA 2QIPA 4NLLA 4UPDA 3IC5A 4ATNA 2XDQB 3R6TA 5KQGA 3HCOA 2I8CA 2ZS9A 3L41A 1AV6A 1X70A 3U4HA 4DWOA 4G89A 1M2VB 2V6BA 1JXAA 3H2HA 1EZ4A 1PFWA 4OK3A 4C0KA 2MMCA 4Q3BA 1K7EB 2P2ZA 4WZ6A 2BF4A 5L3SB 1NE2A 1X92A 5FJIA 5K8IA 3HVRA 2VHUA 5LP6C 4NENB 1N1GA 4R8SA 5LQSA 3KS9A 2XCQA 3N7AA 2VK2A 1KI7A 2CDAA 1JDNA 2P9QA 2GX6A 2C31A 2ROQA 3IJEB 3JD2A 5HF8A 1K06A 4FNAA 2LKDA 1MOSA 1TKBA 3IUPA 4ZQEA 4JVNA 3CLTD 5IH3A 5FLXA 2VXCA 3O8QA 4GMGA 4KHZA 2WIDA 3PKZA 5ALJA 1KMQA 4TKMA 4IXDA 2KHZA 2Q5JA 3MRSA 4YP1A 3ZX5A 4BNJA 5BYKA 5A0TA 1D4OA 4RVDA 2K7FA 4IKOA 3C4JA 3BTOA 2I7DA 1KRHA 4Q9HA 1SUCA 4HDRB 3T8YA 3ZY5A 4DHWA 1GPAA 2O8EA 2HHAA 2C3YA 4RVHA 1P4GA 3IUBA 4MUAA 5T3YA 1GKKA 3B8HA 5ALKA 3UATA 3HJAA 5DBGA 3Q0EA 3IBSA 2JEZA 5NULA 3P4XA 3EHEA 3UJHA 1XALA 4QJ3A 3B5JA 4HWKA 3PNLA 3BSFA 4DLRA 5KNCA 4TQGA 1N6NA 1H2WA 9ATCA 4YUXA 3SWWA 5AM0A 2BBSA 3KU1A 3T9AA 2MOKA 3A4IA 4MGYR 5I8PA 2NU7A 5J2TF 2H9IA 4KXWA 4YCDA 3JV7A 4GEGA 1ZR2A 1XR3A 2LVBA 3MWDB 4AMGA 4CV0A 3BIXA 3A27A 5DN6A 3ZLTA 1JWBB 1IHXA 1NI3A 4D1YA 2W8ZA 4H16A 2FPSA 5CB4B 2JFQA 3Q7SA 4DMUB 4KC0A 1T0JB 3DDNA 3EVAA 1SUAA 1MB2A 3GPDG 3GFBA 3ZR4B 4ENVA 2FW0A 2ZB4A 3O9ZA 4QU8A 5BW6B 5L6MB 3ZC3A 2X77A 4FZ3A 1CUXA 4NFSA 5FFMA 5KTMA 3CBGA 3QH4A 1FFCA 1LFAA 1RRFA 1WB4A 2IUEA 1KEUA 3A2LA 5FTMA 1A82A 2E4VA 3ENQA 1FBNA 4LZOA 1M2NA 5AKZA 2DB3A 3BT7A 2JGDA 1ZGBA 3BERA 1TYBE 2I1LA 4JK3A 1IL0A 1LPOA 4IDBA 4Y7DA 1AKTA 2A5FA 4A0RA 1TM4E 3HUDA 1W6RA 4N5NA 4QSHA 1BKDR 4PG8A 3ROZA 4JBHA 3WG9A 1G8FA 4KHPB 3WLMA 2DE0X 3EAFA 4PZCA 2B5VA 1F6BA 2GVZC 3V4SA 5BW5A 3BE6A 1JKJB 2Q5QA 2SBTA 1KPGA 3OZCA 4GLFA 4WXPA 3SIWA 2CEKA 2I80A 3MWEA 3EXIA 4OXRA 4MYTA 2WTXA 2VATA 4NFLA 4YI5A 2JFBA 3UJ3X 3ZCQA 1D4ZA 1G6Q1 1XB2A 3BYZA 3HACA 4Q93A 3LXMA 1CBUA 4TZ6A 1Z82A 2EXXA 4W6ZA 3L7MA 3UQYS 2HA6A 2R8PA 2AF3C 2O6HA 3B9RA 4LI3X 5A0FA 4ASUD 1UC5B 2PD3A 3F7NA 3QE3A 4MUNA 1I30A 5BSKA 4DLTA 4UMDA 3U7JA 4J8PA 1ML3A 4DIBA 3AFNA 3DAGA 1TYZA 1ULUA 3O2JA 1NPDA 3WK8A 3T9CA 1CQXA 2PX4A 1GGVA 2ERXA 4KWTA 3THXA 3QPAA 4AIRA 4XPIB 3B5EA 1ZD2P 4PBSA 5TPWA 2A9RA 1YONA 3UO8B 3VJLA 3QLJA 3O7MA 3BGDA 2IJGX 4JKYA 1G7SA 4U7HA 4B1FA 4ASUA 3TIFA 2AMJA 2OXCA 1OUMA 1XYVA 2FZ4A 4MQ4A 4ZAXA 1I1OA 3I6IA 1BD3A 1X1BA 2VCHA 2F1RA 4WCFA 4EARA 3VISA 1AKVA 3SVLA 5FAXA 1N2OA 1X7ZA 3EG9A 3PDWA 5CBPB 5IF9A 5AK6A 5EQTA 1J0XO 2AUTA 5H1YA 1P7PA 1XPJA 3HCDA 2VT7A 3FYUB 5TVGA 1LK7A 3SLRA 2BFFA 3OH8A 4GWLA 4JEUA 3T12A 3WLRA 1D1SA 4F46A 1X39A 2IUYA 2NV0A 4MINA 1A2BA 4GVPA 2V0CA 4E32A 1YOVA 1OH5A 4BXOB 4NPHA 1L7BA 3KV3O 2W4IA 4JIGA 3EOBI 3IJRA 5CK5A 4U2KA 5K3BA 4HGZA 4Q1EA 4CIYA 4XOUA 3WLIA 4OJKA 1V5WA 3LBIA 4AS3A 2DCMA 2ODTX 4TYPA 2Q4RA 3JQ8A 3L77A 5ESRA 3GJ0A 1Y8RA 2YJGA 1PNVA 1JU9A 3U7QB 1W8DA 4MUHA 5GAJA 3A6EA 1ICIA 3F5FA 5CM8B 4MVJE 5L6LB 2CF6A 1OAOC 3PJRA 4GRAA 3SXJA 1NKTA 3FB1A 3ZCRA 3OQBA 4BRUA 4ESHA 3AX6A 1KNXA 2WQZA 4B85A 4JI2B 3PEYA 2IBSA 2AYYA 3DTYA 3I01M 1E1KA 3FR7A 4IQ4A 3SS8A 5BWBA 5I7RA 3A6PC 3VPFA 1WS6A 3PPVA 1WMSA 3H05A 3R9IA 3DXZA 2PZAA 3UWKA 5JSFA 2VUIB 2GGSA 5J4YA 4AYXA 1BFKA 1G8SA 1ULTA 2PLFA 3HRKA 4PQEA 3OX2A 5CVTA 1HEUA 4UM9B 1CIVA 1GRCA 1QV6A 4P7GA 3TSAA 4OHCA 3ZU4A 4Z4QA 4UEQA 4UASA 1MN6A 1Y7LA 3W8FA 1KRXA 2IOYA 4LKRA 2FWRA 3AY3A 2W6PA 3GZJA 5E6UB 1Y63A 4RY9A 4EFKA 1WLYA 2I3BA 1WXEA 1G8KA 1L3IA 2HJSA 4L0MA 3D7KA 1CZLA 3I3OA 4DY6A 1X86B 4H08A 1WOYA 2FDCA 1TPYA 2ZTVA 3SG0A 2X5NA 4IL5A 4ZYLA 1QUEA 1Y0BA 2WA2A 3IXMA 5E3HA 1CUSA 3WX0A 3EY4A 4C87A 2XXAA 4OXIA 5FPPA 4BCDA 5JI3E 4PN3A 4Q6WA 5K5EA 2XUAA 2NVWA 2CCJA 4QXAA 2ZSAA 3MIIA 2AC4A 4EW6A 3LPCA 4HNRA 1GJRA 1XMIA 2QUHA 4YBZA 2VTBA 2X86A 3GGCA 1T0HB 2OAEA 3GDWA 4ED9A 1OX6A 1SUDA 1W34A 2RGXA 4W99A 3T7TA 1WZNA 2ZDHA 4ANFA 2ZSDA 2M6RA 3K0BA 1R6VA 3LUFA 4IXWA 2HYIC 1Z0KA 4CF4A 3AIKA 4CHGA 1HZZA 2PS9A 1ZIOA 2V3VA 2MDTA 4IJKA 5ALIA 3F6SA 1GA6A 1M3SA 3KEFA 3Q2OA 4AK9A 1AS2A 4MWEA 1GAXA 5FOVA 3WY9A 2G28A 3HVUA 3TXXA 2OXRA 4JEMA 5HQTA 2GBIA 2Q50A 1COZA 3JW8A 2XITA 5TJ9A 2V6MA 3K94A 1Y1SA 3MJSA 3H4IA 4QNMA 1I7DA 1B8PA 3BQMB 4A2QA 2Y1EA 5BN3B 2AI1A 1R16A 2P5TB 4PLPA 3SF0A 1BX1A 2VPQA 4OLFA 4TQUS 4KSYA 2H4HA 4DWJA 1H94A 1DAKA 3WMXA 4A0HA 3BEOA 2YKGA 3NXKA 3Q2KA 4BFSA 4G0OA 1VKHA 5JJIA 1AOXA 2C84A 1A8QA 2D54A 2GLTA 3RG2A 3VZQA 1M2JA 1LBTA 2IBMA 2QTRA 2ZWOA 2AV6A 2QVCA 1NA5A 3HM2A 4CKBB 1VI2A 4FMPA 4GLOA 5HS4A 2SICE 4HAVA 4C0XA 5C5DA 3FPHA 3BWDD 3JR3A 3W78A 4M87A 2W37A 1LSUA 4PYOA 1T8TA 4R6XA 4Y18A 2AJDA 1L8XA 4KR2A 4XH9B 1N2EA 2FP4B 1BXGB 1NQOA 1XZHA 3AUFA 3BAZA 3DMRA 1M76A 1UINA 3F1LA 4ARAA 4BX2A 3EEOA 3ANSA 2QU8A 3D5TA 3H9GA 1L5ZA 1C2TA 1ORIA 5A02A 2TMKA 3AF6A 4DWWA 4RD0A 2YJ6A 3L0DA 1JJ7A 1TTPB 2PO5A 4DR6B 5KVVA 4NICA 5CK4A 2XI4A 3L7YA 1EDDA 2IVFA 3O8CA 1GNPA 2QE7A 2J9ZB 2O23A 3UB2A 4IGAA 5TB5A 1RLTA 2GBFA 3BWYA 3OTIA 2J6HA 4FX5A 3I58A 2FLVA 4OSPA 4V0QA 2AN1A 3P52A 4D0NA 4IOMA 1L4KA 2GZSA 3O3OB 2FR0A 1E7MA 2BFAA 2H0QA 4IMIB 2WIFA 1RXVA 1ZNZA 2H48A 3UJBA 1ZW6A 1YJ8A 1AXGA 1TMOA 3ZU2A 4R2KA 1RI2A 5GJVC 2MINA 4ZHQB 2ZAYA 4YMIA 3MNFA 5D6NA 1U0SY 3PXCX 2F7SA 4Y9RA 1L5NA 3H4VA 2PGDA 3NAQA 1U7ZA 4Y0VA 4GDFA 3S68A 1U5AA 3KLNA 3FDFA 1YQWA 1XRMA 1M0TA 2ADMA 3FPGA 3KBOA 3QNWA 1U8TA 5EHNA 4ZXPA 1YIAA 5FI3A 5IAJA 3OIUA 2A84A 1P5FA 3T3PB 1ZJ4A 3AKYA 5HE9A 3V00A 1U4SA 1XZQA 3K09A 3VPDA 1X9IA 1Q1NA 4QQNA 3WKDA 4RTLA 2X8BA 2PXXA 3HMQA 4KAFA 5AVXA 3VVBA 3KL2A 4EYGA 5FHRA 2QX8A 3DFMA 1WMEA 1ESDA 3HJRA 1W49A 3ORYA 4J1QA 3AOEC 4PSVA 2Q1SA 5JVDA 1XPOA 5K4GA 3CEMA 3BFPA 4REQA 4XOIA 4GLLA 4FHGA 3TDNA 4ZVNA 2AK2A 1GRRA 4C89A 4MI3A 1U3WA 1VIMA 2NYUA 4Q4JA 2F3RA 4RZ2A 1N57A 4X8HA 3NI2A 2IWRA 4TYWA 1P4SA 5K6AC 3B6KA 4GX0A 1E1YA 4LVNA 4V0KA 3LZ6A 2JHAA 1I9GA 4OYYA 4YUZA 1L7QA 4PHFA 4M2LA 1HLPA 3CM0A 3TMAA 3LFHA 3JVVA 2A5LA 3KSBC 5BWMA 2ZYWX 2PVCA 2NV2B 5EIBD 5J5CA 2RC6A 3NETA 4IV8A 1FMCA 2PWAA 4W9NA 1QU3A 2D6FA 2AK3A 3ACDA 4TMKA 4M99A 4N7BA 3TMYA 2GBGA 4BX3A 4URVR 3AERA 2ZWMA 2XHZA 4INZA 3CB2A 1FNBA 1PX0A 3NKLA 4EA6A 1JKJA 1ZRSA 2C7OA 1WUYA 3FFTA 4FSDA 4BJ1A 3QKSA 1PU2A 5DLDA 2C7GA 1LB1B 2EIXA 2H1HA 3P32A 3QMMA 4GLJA 3L1JA 4H31A 3JVDA 4D8XA 4R7GA 3DULA 1H4TA 2H1LA 2XODA 3WNBA 4WHMA 2EGUA 1TKAA 2CMDA 2Q5LA 4HGOA 2Q3HA 3OIYA 2IODA 1VMEA 1U5CA 2A92A 3IDQA 2EEPA 3E8XA 4BAUA 2HWXA 4FNGA 4HDSA 4JI1B 1JJAA 1B26A 5B6PA 4XCXA 3E1GA 1MDFA 3DT6A 5M7EA 3QU4A 3UKJA 1XXHE 1JLMA 2GBCA 3I4LA 2AUMA 2HTFA 1Z83A 2MU1A 5K01A 1SCAA 3GU3A 1N7HA 1U7TA 3K9GA 1IH8A 3LPNA 4HQRA 5EE9A 1I32A 5LA6A 4QTUB 3DMDA 5BV1A 5F35A 1AZSC 3V8RA 1CR4A 1GPLA 1NP6A 2V3WA 1HI9A 1Q20A 4K6CA 3KXPA 1HDOA 1RHMA 1J0DA 3NEYA 4G5SA 4ZA2A 4OHUA 2V1UA 5FTWA 3UXEA 1PJCA 2HD4A 4MKGA 2QR5A 4RELA 3RIXA 1RWKA 4MLZA 4QA9A 5DHSA 3B1XA 5AVTA 5SY9A 1EDZA 1U11A 5JDCC 3BL5A 3DLIA 3KEOA 3PEFA 3RW9A 1WETA 1ZOPA 3M49A 5DV9A 1PS8A 4MHSA 4LJ4A 3ED1A 1T9DA 1LI4A 4JN6B 3ZDYB 4P81A 2L82A 1UAGA 4PLGA 4M0MA 4Z1MA 4DSZA 2CBXA 1ZJYA 4E31A 2DZDA 2FEAA 2QP3A 2JIBA 2ZQYA 3PE4A 3HP1A 4K9DA 1R5OA 4CPDA 5AVQA 3Q4GA 4Q7LA 1LPAB 4Q4HB 4CUZA 2ISSD 1PUIA 4NE2A 4H1WA 3JALA 1RPZA 1VDMA 4UHHA 2JW5A 3BXHA 2QJWA 1R9MA 3JYOA 5HM8A 5AO9A 1OW3B 5JXGA 1IBMB 2BSQA 2Q2WA 1B74A 1Z28A 3BAFA 2XVAA 2YWGA 3AUSA 4JHXA 4P31A 5B2EA 1PR3A 5KJCA 1FA9A 1I3NA 1I4LD 1OJ7A 2ZSBA 3GLTA 3PFNA 4PVDA 4RAQA 4G0XA 1PJBA 3WOVA 4Q4LA 1CR6A 1HLGA 3WWPA 2Y4NA 1BDHA 1ECGA 2JCXA 3RSLA 1VBKA 3UMBA 4IZHA 1KEZA 3SK0A 1D1PA 1E9SA 2PX0A 3CPJB 5TGTA 3DPIA 2H2GA 2E85A 3W7BA 1T25A 4CLDA 3R5JA 5IT5A 4J1NA 1E89A 2WTBA 1XTIA 4MVJD 1PAUA 2PX6A 3J7AC 3ILSA 5TF4A 1TJNA 4JXJA 3SSMA 4UNSA 1P9RA 3OWHA 1RJ9A 3WAGA 3KJQA 3ND5A 3OLWA 3S2UA 5K4AA 4R1TA 4JKOA 4X1KA 1PGQA 4RE5A 1TUIA 2Z0MA 1DEKA 4WKGA 4MRMA 4JI4B 1GEEA 1TT7A 1T2FA 2ZB8A 3IPLA 3DNFA 4J0EA 3RTBA 1QIEA 2I54A 3EVBA 4RWEA 2PT9A 4G8CA 3S5UA 1SB8A 3WJ7A 4YDSA 4BNWA 2RI6A 4JJKA 4UVEA 4ZVQA 4DE5A 2NO5A 1BWQA 1Q3HA 1SBNE 2VSXA 2XIJA 4WVLA 3SJAA 5CDFE 4PZLA 1I2MA 5CNJA 2COKA 2PJUA 2WJIA 4QBFA 4YN3A 3EVDA 5TMDA 1QWSA 1E61A 2R5NA 4HYYA 2DMRA 2Z8YM 3KKMA 1XNJA 4I6GA 5I9BA 4D57A 5LQKA 3X1YA 1TA0A 2HK7A 3OJFA 4GM1A 4CCYB 4ENQA 1RAIA 2LP4Y 4ROTA 4Z0HO 5TSDA 4RKRA 5KNDA 4QYSA 3FVQA 5ICFA 2WZCA 2JA1A 2AJBA 3W8NA 5LQNA 1PO7A 4LWQA 1A4RA 3PBKA 1O94C 5KKCA 4XSVA 1UWKA 3HSYA 2C3UA 1A96A 2XTNA 3OIGA 2HCBA 5IP5A 4X95A 2ILTA 2BGUA 5JPCA 1LTHR 4CR6A 4EELA 2O4UX 2JI7A 3HBFA 1U2GA 2W2OA 3HLTA 3MYYA 2VWHA 3NORA 3ZHZA 9ABPA 5K8JB 4ZMSA 2BEUA 2BC9A 1J42A 5EFOA 4AKEA 4N8DA 1FP4B 3IV6A 2WWHA 4FBMA 3PFWO 1T2UA 2VRBA 2KJQA 2A0XA 2YYSA 4UNRA 2H7YA 4GBGA 2JL1A 2VDMB 4BO3A 3GH1A 1ZI6A 4TVKA 1WQ4A 1BOOA 2O7RA 3QZUA 4MCHA 4I4LA 4QAQA 1JSXA 3L8YA 3V8MA 3AEZA 2G77B 1BW9B 3LVFO 3FROA 4KBYA 2GSDA 2NZXA 1BYUA 1D2MA 4ND7A 2QZJA 1D3AA 1XRQA 1YB7A 2XUPA 3UHPA 1KEKA 1UOOA 3AUAA 1V11A 3AWDA 4R40A 5HCIA 3A1WA 2E5WA 3IEIA 4Z8YA 4N5MA 4OJYA 5F9MA 5KUTA 1QIJA 4BV9A 5E2BA 2ID4A 1NIPA 4M0CA 1XDDA 1YS9A 1XWIA 1Z4KA 3PPYA 3V1MA 1FDUA 1CZUA 2FSIA 1H5NA 1JLHA 4LJ6A 4FXPA 2COUA 4X1YB 3HGQA 2B34A 3QVWA 2VDRB 3HGTA 2ZU0C 1FFGA 3KZKA 1M10A 3OKAA 5HDQA 1MV8A 2G5PA 1KDVA 5GMOA 4GGOA 1JI0A 3SC4A 1VI6A 1BVRA 2F9FA 3CR8A 4C4OA 4AT1A 2EZ4A 1YGPA 2DOKA 1E2IA 1CXZA 3JU3A 3HRHA 4HNGA 2VHCA 3RVKA 4B31A 4PE5B 4YCSA 4RCZA 2HFJA 4U4AA 2ZP1A 4NCJA 3N2GB 4TRRA 5IW8A 4DUYB 1GZHB 3O2NA 4F92B 4AMZA 4TMYA 2ET6A 3I1YA 3VZCA 5HQ3A 2V0NA 1WMBA 5IVHA 1LS1A 4MIOA 2MSNA 3DFFA 5G02A 3T35A 3ZW8A 2PMDA 3AUXA 5HKOA 2CWDA 1NOIA 2X1MA 4H3SA 4EL0A 3R5XA 4MW5A 4AYTA 4O2AB 2VEOA 1ZJJA 3EUFA 3QEMB 2SKEA 4MYUA 1TGYA 2ZRHA 4IBOA 4L8LA 3CW8X 3OHSX 4F85A 4QKQA 5EXTA 4DLNA 2Q4OA 4R2JA 1KHTA 4DLWA 3K9FC 2AOTB 2GPNA 4NQRA 2HJHA 2YVAA 5JAOA 4JJEA 1ESMA 1H23A 3PQ8A 5CT8A 3EPJA 1A72A 3ZWVA 4D81A 1RRCA 5E1MA 4YPFA 4BNVA 1EAMA 4BC1A 1NTRA 1HL7A 2FUNB 1QGDA 3SSOA 2IHZA 1RR6A 3TQCA 3BMOB 1F2TB 4MHOA 3BE5A 4CG3A 2OHVA 2ZJOA 3AKDA 5L3RA 1XAHA 4DUGA 5LJIA 1JKFA 3MMZA 3H1AA 1U7WA 1PHPA 3K0CA 3E18A 4YMGA 2EJWA 2GPSA 2YUIA 2QD3A 1I3LA 3EXAA 1D03A 3HKCA 4E12A 1M2HA 2GTIA 1Y98A 2XD9A 2VDUE 4G9EA 4KMMA 1U1DA 1X1EA 1DAOA 4KIUA 2C88A 3MGKA 3MJDA 4ARZB 2XZPA 3K4HA 5LNK1 1IWPB 4NEHB 1T6XA 3I09A 5AI5A 5G4LA 2CUTA 3IQFA 1VMAA 4X7RA 5CHEA 2BCEA 1N2GA 4Q7MB 3TB4A 4BJ6A 3TZCA 1LDYA 1XSEA 5DGHA 5EZSA 4J9UE 4LZAA 2BAGA 3WB2A 2HPAA 4V38A 2W42A 3WWDA 1QOPB 2HDNB 1YMUA 1GZ6A 3FTFA 3HEBA 3RYCB 3VR4A 1MQAA 2ZJZA 2HQOA 2VPIA 3ZGYA 3KO8A 2QM7A 1DDGA 2VAPA 1RBYA 5MHTA 5A0VA 4M0LA 2BR5A 4XJVA 3V7WA 3WQQA 1E3LA 2YDXA 4OMCA 4WY5A 3WGTA 4C0AC 1KU6A 1YJBA 3T7CA 2QJFA 5DHQA 1J8VA 5FTKA 4EIWA 4DDWA 2C00A 2OV6A 4OBBA 3DAOA 1NYLA 4GQBA 3GIWA 4I1YA 1Z4MA 5BV7A 1RYEA 1X87A 4Q5IA 1YMVA 5DTJA 2VYCA 1E20A 1VPEA 4R1UA 3SYMA 1ZRMA 3HFJA 1U8EA 1FDTA 4IDDA 5EXPA 4IQGA 1F0YA 2IOQA 3KFLA 3QXJA 1M66A 2PZFA 3F2VA