2Q1SA

Crystal structure of the bordetella bronchiseptica enzyme wbmf in complex with nadh
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
351
structure length
336
Chain Sequence
NASKLANTNVMVVGGAGFVGSNLVKRLLELGVNQVHVVDNLLSAEKINVPDHPAVRFSETSITDDALLASLQDEYDYVFHLATYHGNQSSIHDPLADHENNTLTTLKLYERLKHFKRLKKVVYSAAGEETDIVSLHNNDSPYSMSKIFGEFYSVYYHKQHQLPTVRARFQNVYGPGEILGAGRWRGTPATVWRNVTPTFIYKALKGMPLPLENGGVATRDFIFVEDVANGLIACAADGTPGGVYNIASGKETSIADLATKINEITGNNTELDRLPKRPWDNSKRFGSPEKARRELGFSADVSIDDGLRKTIEWTKANLAVIEQIMRKHDSALATYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Putative nucleotide sugar epimerase/ dehydratase
publication title Predicting protein function from structure--the roles of short-chain dehydrogenase/reductase enzymes in Bordetella O-antigen biosynthesis.
pubmed doi rcsb
source organism Bordetella bronchiseptica
total genus 128
structure length 336
sequence length 351
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q1sA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2q1sA02
2AE1A 5B1YA 1JW9B 4XZ3A 2X5KO 4IJUA 1ONPA 2Y66A 1M2WA 1DJQA 4RF4A 1JA9A 2Y1DA 3DB2A 3D64A 3BTOA 1RWBA 4WLUA 2O50A 4LCEA 3TZ6A 5THKA 1P74A 4DLLA 4LW8A 5B4TA 5JDIA 4D3DA 2G1UA 3HN7A 4MIYA 3WB9A 1DIRA 2AMFA 3Q6IA 4A2CA 1LTHR 3G0OA 1YE3A 3D3WA 3O4RA 4DIFA 3H9GA 2NU9A 3EVNA 2AQ8A 5BSHA 2X0JA 4M8SA 2VRCD 3LQFA 3PHHA 4R16A 5COQA 3U4DA 4D43A 1YL5A 3S1LA 4P38A 1DOHA 1A4UA 3K9QO 3I9LA 1NNUA 4XQCA 5JCXA 3ADPA 3ROQA 5JC8A 4EYEA 1KEPA 3JQCA 4RJTA 4ZQHA 2X23A 5KJEA 1WZIA 2C2XA 1UAGA 3BMOA 4HKTA 4MKXA 5EERA 1RM3A 2GSDA 3HQ4O 4D0SA 5K9ZA 4I1IA 1J4AA 2UVDA 2FP4A 5HS6A 3BMNA 3F3SA 4MP8A 1XU7A 4QUKA 4R69A 2HRBA 1QMGA 4XQEA 2P9EA 4OJNA 1EVYA 4OGWA 3UOGA 5MGBA 2G17A 2HJRA 3GK3A 3HUDA 3I83A 3KTDA 5A9SB 1V3TA 4IGEA 1FDSA 2ZKLA 1DFGA 4LVUA 1YQXA 1RKXA 5CEEA 2PGJA 4J4BA 4Y6PA 5L45A 1LU9A 2P5UA 2HMUA 1WAMA 1E7RA 3G79A 1HLPA 4UAGA 3HB4X 2NTJA 1KC3A 1E3LA 4YT8A 1SPXA 3VVBA 1PJ4A 3HDHA 1BXGA 5IZCA 2X7HA 3JYOA 4EI2A 1KEVA 2A9FA 3I9MA 4ALIA 4XB2A 3WJAA 4S1VA 1N8KA 3KXDA 5TS3A 4ID9A 2W90A 3ZV4A 1NAHA 3Q3CA 4WLOA 3WJ7A 3AI1A 3MJ4A 3ZWBA 2ZTMA 4BGIA 3N74A 3WGYA 1SOVA 4MP3A 4BKQA 4TKLA 4RCVA 4WLVA 4CM9A 3QA9A 1X1TA 3NAQA 1MFZA 2AEJA 2GR9A 3QVWA 4XGNA 5JYEA 2EW8A 1PL7A 2PD3A 1D1TA 3AK4A 4H15A 1E92A 4FGWA 4CM5A 3DTYA 3AOEC 4IIUA 3TPCA 3H3JA 3P19A 1PZEA 1FDVA 3JCZA 4AJIA 5JMWA 2PTGA 3JQ8A 3I23A 1P1RA 1QYXA 5AYVA 3S8MA 3TN7A 5TJHA 4IQGA 1H6CA 3HWRA 2EEZA 1E3SA 3DONA 4INAA 3ZNPA 4CMHA 3DZKA 1ULSA 2OBNA 3P2OA 5I7FA 1UP6A 2YHIB 4AJNA 2BI7A 4FCCA 4J1SA 4PRLA 4R4JA 3ABIA 3ZWOA 2NNLD 4MVJI 2IE0A 3DBLA 4J16A 4EDFA 1I10A 5CFZA 1CF2O 2JFFA 3CXRA 4E32A 5EINA 1P31A 2ZATA 3PXXA 1U2DA 2PWZA 4CM8B 4XYMA 3CZMA 1BMDA 3VTFA 2RHRA 3Q9NA 3IP3A 3WSVA 5KVSA 4OOFA 3B70A 5KOIA 4OL9A 1H6BA 3G17A 2GCGA 1IPEA 1T26A 2O3QA 5B37A 3PVZA 3HFSA 4OH1A 3BTUA 5FI5A 4BHTA 2VNSA 1P9LA 4BNGA 3FD8A 4JGBA 1E7YA 3VH3A 5KNLA 1I3NA 1U7HA 3FSRA 2DPHA 4NBWA 3T4EA 4J6FA 5ICMA 3U5TA 2FRDA 2C2YA 1GPDG 4Z9FA 5HBRA 5L4NA 4FGSA 3CIFA 5IAAA 4EITA 2C5AA 2X58A 4Q3DA 5DN9A 1RM0A 1LDEA 2ZB4A 4WCDA 1QP8A 3OSUA 4LMPA 1GZ4A 4QFCA 1T1RA 4BNJA 3KLMX 1PGPA 1HRDA 4DMLA 4PLGA 3IMFA 1B3BA 4UULA 2YZ7A 3DBRB 1A27A 1O95A 2Q2QA 3DAPA 1CIVA 1ZEJA 1P0CA 4CR8A 2IXAA 4WASA 4ITUA 3VPFA 5JLAA 1XQ1A 2B35A 3VH1A 1ZK3A 2VYVD 3ZHBA 3MCVA 5JDCA 3RVDA 4CODB 4ROSA 1GQQA 4FW8A 4U8GA 2VRCA 3ENKA 1M6HA 4PIVA 5BR7A 4J2OA 4JJIA 4WLFA 3ONDA 4MVJP 3WGQA 3OQ6A 3H7AA 2HMTA 4HNGA 3AY6A 1LUAA 1V3UA 1ADGA 4MIEA 4ND1A 1P1KA 3JV7A 3GZNB 4XQGA 4FC7A 3EAGA 3JD1A 3JSAA 1IL0A 1LNQA 4DTIA 3COSA 4RDHA 1PS9A 4R41A 3GNSA 4PLZA 4RPLA 2WE7A 3GT0A 1H9AA 4MVJD 5H81A 1MG5A 1J49A 2XOXA 4ZQEA 1NVMB 3E9NA 1MG0A 1Q7BA 3TDKA 4J9VA 1GD1O 1JKFA 3JYPA 5EMHA 2IEBA 3WBBA 1PU2A 1RJWA 2NSDA 3GGGA 4IJKA 4NFHA 1GL3A 4TZKA 1G0NA 4K6FA 4YT2A 2GN6A 2VZ9A 4WGGA 1XWFA 3KV3O 4E5MA 3PQEA 1HL3A 4CPDA 1BVUA 3ZGYA 2JHGA 2WWRA 1VI2A 4Y6RA 2Q1UA 5G4KB 2ZQZA 3O26A 3HN2A 4BKRA 4II3A 4XIYA 1E7WA 2UYYA 4BMNA 4CMIA 5ADHA 4PLYA 1O5IA 2GN4A 5TQVA 3JD3A 2JD1A 1QLHA 1NQTA 3ZI0A 2BFOA 5DZSA 4ZVVA 4XYLA 5A9RA 4XGIA 4KUGA 3O8QA 3AU9A 1ISIA 4PG5A 2J5RA 2RIRA 1ISGA 1S7CA 3CZRA 5G0UA 3D5QA 3I4CA 1DC4A 1SAYA 2DTEA 2Q46A 4R5MA 1I0ZA 4ND5A 3RBXA 4CUJA 1T25A 3GNTA 4E33A 3MOIA 4GL4A 4IDAA 3NTOA 1Q2XA 3K96A 2EKQA 1CETA 3RUFA 4GX0A 3OF2A 5H83A 3RROA 2C5EA 4E5KA 1AE1A 3H5RA 1XQ6A 4WUVA 1ULUA 3KSUA 4ZU3A 3N7UA 2AG5A 3PFFA 3KEQA 4YXFA 1IY8A 1ID1A 5ENDA 2LDXA 1B7GO 4DWVA 2FOIA 3L07A 1ZXLA 3U0BA 3CTMA 2VYND 4U6SA 1A9ZA 1RM4A 4Q39A 2C20A 3DL2A 4C7KA 5I8WA 4YPOA 4UVIA 4HX5A 2BD0A 3HDYA 1PWZA 1F14A 4OIMA 5ER9A 5KIAA 2GD1O 2Q49A 1I2BA 3SXPA 4CLRA 2F1KA 1R4NA 2GZ1A 3ZWPA 3E82A 1FDUA 1A4IA 1A9YA 1R66A 5BNFA 1P44A 3LVFO 4WJZA 4BNTA 4XR4A 4FSHA 3WIDA 4BGVA 3VTZA 4YT4A 2H63A 2J3HA 1V35A 2PKQO 1PR3A 1AUPA 4CR6A 1E5QA 2RBEA 3OBBA 4R9RA 5CDSA 3QW2A 3RASA 3GVXA 1S6YA 1BWSA 1D4FA 2E82A 3HB5X 5CPBA 3H9QA 3VPGA 4BO2A 3IIEA 4B3IA 3ZWMA 3DZBA 1K6IA 1TVEA 3PIDA 4YCAA 2X0RA 4I5FA 3DOOA 3UCEA 2PKRA 1EBFA 4YAJA 2J3KA 4XX0A 2VHZA 2Y1CA 1YS4A 1PGJA 1BXKA 1OI7A 3NT2A 4RPKA 4Z0TA 3WBFA 3FPLA 3H65A 3I9JA 4FFNA 5FI3A 3WIEA 1U8FO 5T8KC 1ISFA 3OHSX 1DIHA 3H3FA 1MC5A 1ARZA 3R3JA 5L4LA 3V1YA 2WEKA 1T2AA 2C29D 3E5MA 1HXHA 1LDMA 5AVOA 6LDHA 3ZN2A 3DBHA 4DMMA 5J23A 1KVRA 4IIVA 1UP7A 1W8DA 4B8ZA 4GKVA 3VZQA 3ADOA 1H5QA 4FC6A 4MJLA 1NP3A 1JU9A 1RYDA 2RH4A 4NU5A 4KQWA 1UDAA 5KVVA 1BVRA 4B4WA 3U4IA 3WGTA 9LDBA 3LT0A 4A7PA 1GADO 2VHVA 1C0KA 4B7XA 4G65A 4IJVA 2RCYA 5A5EA 2VT2A 2NVUA 2VYVA 3ENNA 2HK8A 1HDZA 3R3SA 2PNFA 1WDLA 1DRVA 1UR5A 3PFWO 3DWFA 2O3RA 2AEMA 2HU2A 2B69A 3ONFA 2DLDA 1TT5B 2GO1A 4PFJA 1YH3A 4XJTA 4XB1A 4DQXA 4KDFA 1DFIA 4CQMB 4JIGA 1WPQA 2C0CA 3LDHA 3BZUA 4YAGA 5A4DA 5GMOA 4W6ZA 3LK7A 2CDAA 3ZU2A 2CY0A 2Q1TA 1PJQA 1NVGA 3DHNA 4EUEA 3BTSA 2BFPA 2NVWA 5TGDA 3WX0A 4RO0A 3A28A 3QRWA 3JD4A 3OP4A 4LGVA 3DXFA 4NBUA 4RVHA 3RI3A 3ZHXA 4MVJA 2P91A 4QSMA 4E2XA 1PJLA 3D3WB 1LLDA 2W2LD 4NFSA 4NIMA 3UVEA 4J1NA 3AUUA 1T24A 2VNAA 1A7AA 1U28A 2AQIA 3H9JA 2CD9A 1LLUA 2GN8A 4BGUA 2NVBA 2AXQA 3ZW9A 1TB4A 4EUHA 2EG9A 1NR7A 4G2NA 2Q2VA 4CMGA 1VLLA 1P3DA 1FXSA 2FR8A 4E6PA 5LCXA 4L0QA 4IY1A 3F1LA 1JKIA 4B4UA 1NFRA 2NTVA 5COAA 5FF9A 3GVIA 3BMOB 4DQUA 3EK2A 2X6TA 3JTMA 3DZHA 3ROKA 1J5PA 2IYPA 3MTJA 5EN4A 4N54A 2VTEA 2I5PO 4OSOA 3RUIA 2RH8A 3JQGA 3S2FA 5CEJA 2CNBA 2HK7A 1BG6A 4D45A 3AOGA 1KETA 2YV3A 3PQFA 2WD8A 5JO9A 2Y0CA 2P2SA 3HNPA 2WJPA 2FWMX 2B5VA 4IQ0A 2PD4A 1D3AA 4HADA 3NT5A 2DVMA 3Q11A 1EEHA 2QHXA 3ZH2A 3GG9A 4PZDA 3NT4A 4PG7A 2E4AA 1DIGA 1F06A 3DOCA 4IBOA 1E3JA 3L4BA 3W8DA 2WDZA 3GPDG 3E48A 4GMFA 4IQ8A 4UEJA 1PQPA 1BXGB 3OIFA 3W4KA 4LISA 3DMTA 3FTPA 1I32A 5JW6A 4B4OA 1CYDA 3L77A 3L9XA 3O9ZA 2V7PA 2UAGA 3IC5A 5I7VA 5KWEA 3UUWA 3NRCA 2J3JA 2VYNA 3E1KA 5KVQA 1HSZA 5DF1A 4AJ4A 1WZEA 3RKRA 3RFTA 4ALNA 1AN9A 2ZJ0A 4ZD6A 2VCYA 4IZIA 5F21A 3QIVA 1G6KA 3KYCA 1H2BA 3KO8A 4QO8A 4CLOA 2GN9A 1PJSA 2A94A 1C14A 3TWOA 5JFOA 1I2CA 2CDCA 3IOYA 4Q3AA 2UV8A 3GZ4A 1ZH8A 1N9GA 4IZHA 2PH5A 5L53A 3W4IA 2D3TA 4XRRA 2DBVO 4KUHA 4BO7A 1DO8A 1SZJG 4K6CA 1YDWA 1WDMA 1Y8QA 4GX1A 4YDRA 3ROPA 3JQ8B 1WMAA 4K1LA 1EUZA 2NACA 3X2FA 4ND2A 4BNWA 4U5QA 4N5MA 4PRKA 4RZHA 1PJCA 2B4QA 1BW9A 4NK5A 1HZJA 5CPFA 5KJCA 4LRSB 4UEKA 1BRMA 1E0DA 4DYVA 1KEUA 2BI8A 3ZWWA 4BNKA 2AA3A 4ZRMA 1MXHA 1G0OA 3X2EA 1HYGA 4TVOA 2NM0A 2EP7A 1HDRA 2CUKA 3MWEB 4KOAA 1PZGA 2SCUA 1NM5A 3SC4A 1U9JA 3I9KA 5F1PA 1HLDA 3GUCA 1AXEA 5JAQA 5T67A 4B8WA 2CDBA 4J2HA 5TF4A 3F5SA 3EUWA 2HMSA 3U4CA 1KIFA 1GYPA 1B15A 1QXSA 3E6AA 4GX5A 3WNVA 3GPIA 3PHIA 2VZ8A 2OBYA 1ADCA 1B26A 2E37A 2NU7A 5DCWA 3ETEA 3UCXA 4S3MA 5DDIP 4DPKA 3GMSA 3TSCA 3I3OA 3W6UA 4XEHA 2JD0A 4XDYA 1BHSA 3GEDA 1F17A 2GZ2A 1TT7A 4AJKA 3BYZA 3BHJA 3GVHA 5I7SA 2ZCVA 3OFSA 5EPOA 5EQDA 1UZLA 2X5JO 3PLRA 2EP5A 2YW9A 3WGGA 4YAEA 4Z3DA 2EV9A 1XIVA 1YWGO 3WMWA 2BHLA 3ZW8A 3RFXA 1NYTA 3OA0A 2W2KA 5KTKA 5BSEA 1YVEI 4A0SA 5IXYA 3FHLA 3JQFC 4N18A 2W2LA 5JBIA 3IL2A 1ZW1A 1HTBA 5L7WA 1H94A 1P0FA 1XG5A 1KYQA 1LJ8A 3WICA 2EJWA 3CPSA 5CG1A 1HDGO 1P1JA 4YQYA 4DXHA 5CAEA 1O9BA 1I01A 2YV2A 4FFOA 4NNJA 4IS3A 1VJ1A 4L8VA 3F4BA 4FJ2A 3DZGA 5TC4A 1E1LA 5F1KA 2CZCA 1RYEA 2GYYA 2HJSA 3JD0A 4FQ8A 3GRPA 3E9QA 1E1KA 2A4KA 2X22A 3MZ0A 5DCUA 2ZQYA 2C7VA 4R01A 4CLHA 1DHRA 2IYOA 3NDIA 4MKRA 3WQRA 3CEAA 1XHLA 3H4VA 4WCFC 1I3LA 2O4CA 3BA1A 3QWIA 4IUYA 1NBOA 1GZ6A 4KUEA 1ZK4A 2EIHA 4MVJH 4RF2A 4DVJA 4NDNE 3I9OA 4RF5A 4BKOA 4J4HA 4M86A 2BFAA 5F1OA 2DUWA 2Z5LA 1DAPA 3NYWA 3AY3A 5IF3A 4LRTB 4O5OA 5GZ3A 4IGFA 4Z9XA 4CV3A 4R1SA 4HP8A 2JD2A 7ADHA 1HEUA 1Y1PA 4BL5A 3BMQA 1LLCA 1H6AA 4A26A 4XWYA 3D4NA 2F00A 1R12A 4GLLA 5FEUA 2GF2A 3RBZA 3RUAA 3TZHA 4Q3CA 4CMIB 3QVXA 2Z95A 3E03A 1MFPA 4M89A 5HM8A 5JAIA 3Q0EA 3H2SA 4R5HA 3OJEA 4NMHA 4FB5A 1SBYA 2B0JA 5DT9A 1OBFO 1X7GA 2AE2A 2QQ5A 2C54A 4MVJM 3WMXA 1Z73A 1IHYA 4K9DA 3AFMA 4ZGWA 2EERA 4GWKA 5JE8A 2UDPA 3LZ6A 4OKNA 3GY0A 5DBGA 4O0LA 3CUKA 3RUEA 1R0KA 3MJVA 4OAQA 2WSBA 4HY3A 1OOEA 2C07A 5CG2A 1EK6A 2DBQA 2VT3A 4OKIA 2PGLA 2BGMA 4GSLA 1X7HA 4RDIA 5L7YA 3UW3A 5CEFA 4Q3NA 1PJ2A 4BNFA 2O2SA 2XPCA 1LDBA 4AJOA 4IDCA 3DFUA 3L9WA 2EF1A 4XIJA 1SCUA 2PGDA 4IJWA 3B6ZA 4R9SA 4BNXA 1HDOA 3UGKA 4ILKA 1Q7CA 4RPJA 3VDQA 5MDHA 1QORA 3R1IA 2OOSA 4NFYA 3EMKA 2Z1NA 3IUSA 4M49A 3IKTA 3WFJA 4PVCA 1NQ5A 4PLHA 4CMEA 3A1NA 1NQOA 3GUYA 4P4LA 4D42A 1CRWG 4CLRB 3GVCA 1R4NB 3RAJA 4LVCA 4GVLA 1T4BA 4CMKA 3GA0A 4IDDA 3SLGA 2EHDA 4J9UE 4UREA 4RLSA 8LDHA 1PSDA 1R16A 2E48A 3SEFA 2X9GA 2VWPA 2P9GA 3NKLA 5BNTA 5JSFA 1SB8A 1DIBA 2CMDA 2NV6A 3IDSA 2BELA 1AGNA 4L4SA 4C4OA 1C1XB 5EQFA 1YL7A 5DCYA 3C85A 4ZICA 4PVDA 1NPDA 1U5AA 4IPTA 4NJMA 1VKNA 5ENVA 4OYRA 3ZWCA 1PGQA 1BTOA 1JWBB 4Y6SA 4FOSA 4ND3A 1J6UA 2X0NA 4QFDA 1ZK2A 4D46A 3TL3A 5K6AA 1XKQA 2BH9A 3FI9A 1U7TA 4GQAA 1YBAA 2DQ4A 5FFFA 4XA8A 3PYMA 4D44A 4CV1A 2G0TA 1EVIA 2DTXA 5ES3A 3OECA 1XDWA 2DPGA 2OL4A 4BNMA 5U4QA 2GDZA 2ET6A 2Q99A 3U09A 2GZ3A 3DFZA 1PJBA 5BNIA 3DBHB 1WP4A 1E6UA 3PEFA 3D5TA 2HQ1A 4Q3EA 1R6DA 4IINA 1HE2A 4CL3A 2AW5A 1YB1A 1Z74A 3EY4A 4YQZA 5DBIA 1P77A 2VWGA 2CF6A 2OZPA 4JP2A 1H9BA 2LDBA 2YFHA 3IAHA 3K2EA 3LYLA 3OEWA 4TRJA 4XRGA 3WTCA 4ZHSA 2NVUB 2OO5A 3KM0A 1GQYA 3F9IA 3RFVA 2J3IA 4CMAA 1DLJA 2GNAA 3E9MA 2JKVA 1IZ9A 1KVTA 3PWSA 4FJ0A 4P8RA 4A10A 5EESA 3ANLA 3GR6A 4E2WA 1L1FA 4YAKA 4AJPA 4DA9A 3AM5A 2FY8A 3VH2A 2B37A 2O3TA 2VHYA 4D79A 1T2EA 3LSYA 1FMCA 1QG6A 2NTNA 1Y81A 4EUFA 5T57A 2EKPA 2Q1SA 4MIOA 1GPJA 1PX0A 1N7GA 2QRLA 1PTJA 3ASUA 1LX6A 3KB6A 4KWIA 4WE3A 2JCXA 2VUUA 1ZK1A 2D8AA 2WM3A 3GMDA 3JQ7A 1AXGA 1U8XX 1VL0A 4FFRA 3SC6A 2NQ8A 4NG5A 2WYUA 2I65A 4L75A 3VPSA 3VHRA 5IFLA 2Q4EA 1UP4A 3RJ9A 2XF8A 4WCFB 4MINA 5AXBA 3RUHA 1NASA 5JDIC 5I9NA 2NUAA 3ZHYA 4FS3A 3R0IA 1CWUA 2PZKA 2FPPA 2R00A 3DO5A 3TOZA 3C1AA 1Q1NA 4YJGA 4EEXA 4RZIA 1LSSA 1FDTA 2EW2A 4NHEA 1E6WA 5IXSA 3T7CA 4AL4A 3DZIA 4CM3A 2ZYGA 2ILTA 1DC6A 3DHEA 1ZK0A 1LEHA 3GHYA 1HYEA 4EEZA 2PR2A 3ICCA 3BTVA 5B4UA 3VZRA 5I7EA 1EFKA 5ITWA 1GDHA 3KBOA 3CMCO 1ZJYA 4BOYA 1P1HA 5IDQA 2EWMA 3GAFA 3LT2A 4KDEA 4RVDA 2FZWA 1QV7A 1Y8RB 1U4SA 4AG3A 3AWDA 2POQX 4I9HA 4WNCA 3PLNA 4JBIA 1UXJA 2QZ9A 3GG2A 4O63O 3DTTA 5ILGA 2VOJA 3C1OA 1Y9EA 1Y5MA 2DBRA 3GDGA 5HWSA 1RPNA 3M6IA 2VHWA 3PWZA 5A05A 3OEYA 3PGXA 2FPGA 1VL6A 1V6AA 4WOJA 3T7EA 5I9MA 3EDMA 2PKQP 5A1TA 5DOZA 1C0IA 1IPFA 3S2GA 4TKMA 2D4AA 3PTZA 4R51A 3C7DB 1E7MA 4BQRA 3NTRA 4W9NA 4JQCA 4WEOA 4X54A 4Y98A 3WGOA 5KCZA 1N1GA 4FR5A 2NU6A 1E5LA 2WYVA 3HE3A 3A14A 5IZCC 1DLIA 5LDGA 1NHWA 1UJMA 3JQBA 5C7LO 1VL8A 2VUTA 1CJCA 4KTTE 3KYCB 4CJXA 4NBTA 4YVFA 4DBZA 3GQVA 5LC1A 4MVJE 2I3AA 1KY4A 2QYSA 3IP1A 1YKFA 3AI2A 1LC3A 1VPDA 4EJMA 4HV4A 1FDWA 1FJHA 3F5QA 4OXKA 5L51A 1DSSG 1N9GB 1D7OA 3Q2KA 4TZTA 2Y0DA 4YB8A 2EJVA 3L0DA 1I30A 1WVGA 2P68A 5BQFA 1ORRA 4ONEA 1W4ZA 1P33A 1R15A 2OGUA 4DYDA 4CMJA 1GYQA 3JQ9A 3P2YA 1MA0A 3HHPA 1V8BA 1X0XA 4BQPA 5GY7A 4FFLA 5IG2A 4NBVA 2O3SA 2H9IA 2Q4BA 3DDNA 4O59O 2HUNA 4K28A 4E13A 1UZMA 1D8AA 5K0ZA 4JJGA 1OC2A 2IDZA 3VH4A 4NPCA 2BGKA 3VPHA 5G0WA 3WGIA 1LDYA 5B4VA 1GEEA 3NDJA 3PJFA 1E3EA 1QYCA 4U0KA 3FBGA 4YJHB 5C5IA 4OM8A 4RVSA 3MJSA 2HCTA 3C1TA 4EW6A 5G0TA 2RAFA 1XGKA 3GFGA 1TA4A 2YYYA 4TRRA 4U0JA 4ALKA 1LDGA 1Z82A 4J90A 4ZQFA 1E6EA 3VZSA 3CE6A 3PI7A 4JXKA 1GCUA 1HDYA 5KKAA 2W98A 1MV8A 2JCYA 1HE5A 2O48X 3FF4A 2FPIA 3OMLA 4Q3BA 3G3EA 2JAHA 3LT1A 1WMBA 2BFMA 3JQ6A 3IKVA 3QLJA 3TRIA 5EIOA 4E4YA 1W0CA 4FBGA 2I9PA 2ZYDA 4OXYA 2Y05A 3AUTA 1T2CA 2OFPA 1R4MA 3QWHA 4AJEA 4CM8A 1HZZA 3WLEA 2PLAA 2E6UX 5AXDA 3HFGA 3ZWXA 4F45A 3I52A 1DBVO 2WD7A 1T2FA 1YONA 4L76A 3QHAA 2C82A 3WXBA 5TX7A 4LSWA 4CLDA 1J0XO 5CDYA 1C3VA 4UUNA 3UF0A 4A03A 1IULA 4E3ZA 3FTNA 4FN4A 2W2KB 4FFPA 2OORA 3A06A 1LLQA 1MP0A 3RC1A 1YBMA 4J4TA 1B8PA 5EL0A 4DLAA 1E3WA 1PJTA 2D59A 2AQHA 3FWZA 4RGBA 1U3WA 3TL2A 1LSJA 2GLXA 2I6TA 3M1AA 4BKPA 4XR9A 2JJYA 1WW8A 4YYZA 9LDTA 1O0SA 2WE8A 1I5RA 5ITVA 1PR9A 4RV9A 4W7HA 1UZNA 2YV1A 1PQWA 3W1VA 2ZTUA 1PQUA 5JDCC 3MWDB 4KP7A 5GZ6A 4YRBA 2AQKA 1HKUA 4ALJA 1UAYA 3KOUA 2YQ5A 3JYNA 4HFJA 4J1QA 1U5CA 2FSSA 1LRJA 4J7UA 5L40A 3FNHA 1LDNA 3VPXA 4ESOA 3L6DA 4MPDA 4YACA 3TFQA 5U1PA 3AUAA 3WYCA 3AI3A 1NFQA 4D41A 3FNGA 4ND4A 1B8UA 3B1JA 1L7DA 1LRLA 4J7XA 1F0YA 5COBA 3V2GA 2J5KA 1Y6JA 4WOKA 4WECA 3UHAA 3L6OO 5A06A 1DJNA 1HF3A 4CQMD 4DRYA 3SJUA 3FCOA 4LK3A 3FR8A 1KVSA 5T5QA 2NADA 4LN1A 3ZNOA 4CQLA 3BMNB 1T2DA 2I99A 1EE9A 1ZSYA 3BMQB 4KTVE 3AY7A 2QYTA 1MGOA 4Y9DA 1E1MA 4F6CA 5IDWA 4HFNA 1UDBA 2DTDA 1LBEA 4R1TA 1XCBA 4N5NA 3OJLA 3NV9A 1KC1A 2CF5A 3HSKA 4WLNA 1HSOA 1GEGA 1BXZA 3F6YA 3TNLA 4A5OA 5EJ2A 1A5ZA 4CM4A 3NGLA 3SX2A 2CVQA 3AW9A 1L7EA 3B20A 2IZZA 3K73O 3FWNA 3UKOA 4BO6A 3ZU5A 2X5OA 2X8LA 1NQAO 2Y99A 3DEYX 3IJRA 2PY6A 4DUPA 1LC0A 4M55A 4YWJA 2OUIA 2HKIA 2B4RO 3DOJA 3U62A 5DP2A 2QZZA 5A03A 3F47A 3Q2IA 1UXGA 3H5NA 3WWZA 1PS8A 3PJEA 4PLWA 3RKUA 3WDSA 3I6IA 4A73A 3C8MA 2EGGA 4A27A 3VDRA 3PZRA 1MB4A 1GAEO 3PDUA 4BKUA 3ETDA 4B7UA 2HSDA 3WYBA 3GDOA 4BNIA 2C7GA 5KJ1A 1IE3A 1Z6ZA 3QWAA 4NJOA 4YJFA 4AFNA 3PHGA 1Z45A 3F4LA 1LA2A 2X0IA 1ISHA 3ITKA 4OHUA 1Z75A 1P1IA 4I08A 4JX8A 4CM7A 4R68A 2ZB7A 2FN7A 4GH5A 5CDUA 1YXMA 3N58A 1MUUA 4DREA 1O8CA 1MC4A 3WR5A 4OOEA 1B8VA 1LXCA 4TRMA 5A9TA 4YJDA 1ONOA 1EUCA 2Y1OA 3F1KA 3KRTA 3RUDA 1QLJA 2O7QA 3AOEA 1B16A 2O3UA 4QECA 3QWBA 3LU1A 7MDHA 3I6QA 5JO0A 3DBLB 3DAGA 3V2HA 1NPTO 1EBUA 3KZVA 4CM9D 3GVPA 4RL6A 4ZQGA 3I4FA 3OJOA 4AJ1A 4L73A 4NU6A 2VRBA 2Y93A 3CMMA 3E18A 3OJ0A 2ZJ1A 3EZYA 3KYDA 4GX2A 1W6UA 3JQAD 4PGFA 1NX6A 4P4GA 3I1JA 4TVBA 1I33A 2YFQA 8ADHA 1IYZA 2I66A 1EK5A 2I76A 1HWYA 5TNXA 3BIOA 1ZKMA 4BIIA 2P9CA 1NR1A 1P45A 2DAPA 5BT9A 1C0LA 4AVYA 2HAEA 1B3RA 2H1SA 1QSGA 4IDBA 4BVAA 4BB5A 2NU8A 1TI7A 1JVSA 3AFNA 2J5QA 1BSVA 1U3TA 1ENPA 1ZSVA 1ZJZA 3DMYA 3C7CB 2FR1A 1B14A 1CQIA 5G4LA 3CSDA 3RIHA 2JL1A 3QE3A 1X1EA 3KVOA 2A92A 2ZB8A 4JLWA 2Q3EA 1ONNA 4BO9A 3DAFA 2ZTVA 4G5HA 4RLHA 1KERA 1H93A 1VKOA 3H2ZA 3S2IA 3WSWA 1O6ZA 3RUCA 1N7HA 4RVFA 2AHRA 3GHHA 2O23A 5JAMA 1V9LA 1N5DA 4TSKA 3K2BA 1QV6A 1HE4A 1KY5A 4XKJA 5F5NA 3LLVA 4I5EA 4CLEA 2QG4A 5L3ZA 1ZSNA 1PIWA 1Q0LA 1Q0QA 1Z7EA 1ZNQO 1M75A 3EC7A 3JQ7B 3K5PA 2EKLA 1QYVA 5HTOA 4RQTA 5F5LA 4WLEA 1B0AA 1DEHA 4MKZA 4W99A 2YUTA 3WG9A 4XJSA 1UXKA 3GAZA 1NHGA 4H3VA 1CDOA 1O89A 3OICA 4PN3A 1B2LA 4D7AA 3ZU4A 4BNNA 1LQTA 1ZFNA 1JAXA 3A4VA 4CQMA 3MEQA 3RJ5A 3KLPX 3S55A 4YJGB 4H7PA 1DRWA 4DBVO 1YDEA 4E5NA 4M54A 5ER6A 1EQUA 1XA0A 4PG6A 2HRZA 1E1NA 2PZLA 1UXIA 2O3JA 1XEAA 4BNVA 3ZDFA 4BB6A 4RPHA 1X13A 4HFMA 1TEHA 2UUOA 4Z0HO 3P5SA 4YTEA 1XR3A 1ADFA 1XELA 1SNYA 2B83A 3KYBA 4JCOA 3VAZA 3SVTA 4PLFA 4BO5A 3BAZA 3EYWA 3WTBA 4YRAA 2X86A 2XAAA 3ASVA 1Q7GA 3KSDO 5A04A 1TLTA 5G0VA 2OP0A 2Y1GA 3UAGA 1PL8A 3ZZNA 5TIIA 2TMGA 1BDBA 4OSPA 1ISJA 2AEFA 4CV0A 1PGOA 4DIBA 3LT4A 2DC1A 2D1YA 1BGVA 4G81A 1DXYA 2BLLA 2PV7A 3O8QB 3UN1A 1PGNA 4MO2A 3RD5A 2IRWA 3UICA 1XLTA 4QTZA 4ZQBA 4DGSA 3TZKA 3QV1A 1T1SA 4E0BA 3TOXA 2PD6A 2YDXA 3B1FA 3GNQA 5TSDA 1PZHA 3F46A 4UVEA 3PYXA 3L4BC 3QQPA 2R2GA 5KJFA 4LSMA 4DC1A 3MOGA 2FZEA 2PZMA 3OIDA 4CL8A 5A3JA 1OMOA 3DMTC 2CVOA 3ORFA 3QWFA 4PG8A 2VTDA 1DAOA 5AOVA 3NJ4A 5L9AA 3HADA 4ALLA 4XQ9A 5BSGA 3QVSA 2D0IA 3ANMA 3NEPX 5ILOA 2DFVA 2DUUA 3K92A 3BMCA 4R3NA 4C7JA 4NH4A 4UUMA 3KSZO 3EW7A 2WYWA 3Q9UA 2GPTA 2BRUA 2VOEA 3IS3A 1FK8A 3D7LA 1GQ2A 4JBGA 1NTOA 3NGXA 4URFA 4GWGA 4NBRA 2NQTA 3PZBA 5I9LA 2WMDA 3R6DA 4KZPA 4GI2A 4DC0A 3ULKA 1VC2A 1Y9AA 4HWKA 2VQ3A 3VKUA 4BO4A 1OC4A 4GKBA 2E49A 3FRJA 3OM9A 3QVTA 3BXXA 4I5DA 3JQAA 2GASA 3ZV6A 3QSGA 4BNHA 1U3UA 5KVCA 4N5LA 4TQGA 2ZTLA 4P22A 1YOVA 1GYRA 1X14A 3E5RA 2P4QA 1ZVMA 4B4VA 5JNLA 1M6WA 5HRUA 1EFLA 2D5CA 1YB4A 2G76A 4BNZA 4MVJF 2JHFA 4AICA 1R0SA 1PEDA 1YO6A 4EJ6A 5JYDA 1N1EA 4OMUA 4PLCA 1HDXA 4NR0A 2PZJA 3STHA 1GCOA 1CEQA 1O94A 4J3FA 3GEGA 4F46A 4CM1A 1JTVA 2AG8A 1NPYA 4IMPA 1U2GA 1DIAA 4WPGA 4XYEA 1GUFA 1SB9A 1T4DA 4I9NA 3WGHA 1R4MB 3WYEA 5T8KA 2P4HX 3RWBA 1ENZA 3D4PA 2W8ZA 3HDQA 3ZHZA 1C1DA 2DU8A 5HS4A 3HG7A 2WD7B 1Z7BA 2D5AA 1XU9A 5DNAA 2VZ0A 3BHIA 4YRDA 3RU9A 3LLSA 3GLQA 1I2ZA 2Y1EA 4HXYA 1ZZEA 1PJ3A 2YJZA 3ZCXA 1VM6A 4BNLA 3Q1LA 1WDKA 2HLPA 1H2HA 3B1KA 4EJ0A 3U3XA 1LQUA 4I9UA 1M67A 5CDGA 1E3WB 1K6JA 5T64A 2RHCA 4CV2A 2EXXA 1V3VA 3QP9A 4ZA2A 1FF9A 1V0JA 4IXTA 5T6BA 1LI4A 1K89A 5THQA 5U9CA 1JN0A 5JMPA 5IDYA 2GRAA 3D1LA 1QR6A 3MJCA 4IDEA 2HMWA 4XCVA 5C3MA 4Y8VA 2JCVA 3W8FA 3ONEA 4W4TA 3PJGA 4MVJG 4Z9YA 3AM4A 1EE2A 3SBOA 3MTGA 2BGLA 5JC1A 4BMVA 2VN8A 2HK9A 3VKVA 5B12A 3AM3A 2OXIA 4IDFA 1EDOA 1QYWA 4CMCA 3HDJA 4J0FA 1I24A 4RVUA 1N92A 4ZRNA 4OO3A 5JS6A 4XDZA 4Q9NA 1ENYA 3NJ8A 2QW8A 5TT1A 1I36A 4E5PA 5KKCA 3OQBA 4WEQA 2DBZA 3NDRA 4E2ZA 2H6EA 2XXBA 1KEWA 3JD2A 3U49A 1GU7A 5JY6A 1ML3A 3UH1A 4JNKA 1IOLA 1OFGA 4CQLB 1KS9A 2G5CA 2OHXA 1AHHA 3L6EA 2ZB3A 4UEOA 3JQGB 1VE9A 4QO7A 4R1NA 3T4XA 2DT5A 1NFFA 1K6XA 4FDAA 4Z6KA 3AU8A 4I8XA 3C24A 5L7TA 2YQ4A 4UVGA 3KETA 1H0KA 1D1SA 4PZCA 4QQRA 4TWRA 4GAEA 5IN5A 3V1TC 2A35A 3C3XA 4II2A 3WNQA 2DM6A 3VC7A 2ZCUA 3K8ZA 4AJHA 5AQ1A 4CM4B 3FPCA 2FMUA 4U6QA 3OETA 1JQBA 2Q2WA 1DDOA 4FFMA 3DQPA 4PLTA 2JFGA 1X7DA 3ZWAA 3VOSA 4FPXA 1ZMOA 4DPLA 3RC7A 1XSEA 3PP8A 2CVZA 1JDJA 5A9SA 3JQDA 1EVJA 3DHYA 4GLOA 2QRJA 1WXDA 3L4SO 3O38A 3RBVA 4B3JA 1IHXA 5A3VA 4B3HA 4OQZA 5IZ4A 4CLOB 1NAIA 2ZYAA 5JY1A 1U1IA 3INGA 4DPMA 1K2WA 1PWXA 2HDHA 4GVXA 3W8EA 3OA2A 2G82A 2V6GA 4XYBA 2JAPA 4U7WA 2Z1MA 3WS7A 2V6BA 3PQDA 4LCJA 4TRNA 4J1TA 1HT0A 4YJFB 5JCJD 4CUZA 6ADHA 4O1MA 3V1UA 1Y7TA 3OQ1A 4JROA 1DB3A 1PS0A 3TZCA 1I8TA 1Y8QB 4BO3A 3QY9A 4NI5A 2OP1A 4PCVA 4CMEC 3SJ7A 2IZ0A 5TRTA 5TJ9A 3RC2A 1ISMA 2FHSA 1NWCA 4L4XA 1BW9B 1ZCJA 4BS9A 4BO8A 4BV9A 2BF7A 3UCFA 3OJFA 4FOOA 1UH5A 1EUDA 3ANNA 3QVOA 4BUCA 4E5YA 5IDXA 4IXWA 5KJ6A 3V2UA 4BGEA 2O4UX 3WGZA 4J43A 5TT0A 2Y0EA 4RVGA 2D2IA 5IJZA 2ZK7A 2XXJA 1XYGA 3PGJA 4UVDA 1KOLA 4HBGA 1YJQA 1YRLA 1NWHA 3KYDB 5CDTA 1GZ3A 4L9RA 2IXBA 4BMSA 4FJ1A 3G49A 2J6IA 4PLVA 5DULA 3ZNNA 4AJJA 2O7SA 5C7OO 4CUKA 4EGFA 4ALMA 5K6AC 1C1XA 3D4OA 3PDJA 1SOWA 3RQSA 2YHIA 2H5LA 2R6JA 4PZEA 1A7KA 1UXHA 1MX3A 3DBVO 3M2PA 4J7CA 4RPGA 3GC6A 4CR7A 4NZ9A 1JAYA 3DZJA 3K31A 4IM7A 4XGKA 1ENOA 4L74A 3GN2A 3WQQA 3ZV3A 3TZQA 3ITDA 4NQZA 4J91A 4HNHA 4M1QA 5G0SA 4TMFA 3FN4A 4Y67A 1BDMA 1I3KA 2IODA 3TF5A 1A71A 3EZLA 4EZBA 4RQUA 3GGPA 3GOHA 4FD3A 5DP1A 3WQSB 2Y1FA 3WWYA 4QT0A 4DLBA 3ZNQA 5AXCA 3TFOA 2W4QA 3CH6A 3VVCA 1X15A 4GMGA 1GTMA 1WNTA 1YJ8A 4TROA 5FWNA 2IEDA 1K5HA 3MJTA 1TXGA 3H5AA 1N2SA 4JBHA 1QRRA 1VJTA 3NX4A 3PK0A 4GPD1 1LSUA 3LF1A 2B4TO 5JPIA 4QX6A 1ZXBA 4YR9A 1F12A 2WTBA 4IS2A 4I5GA 4YT5A 1E77A 1CERA 3DZFA 2YDYA 3PIIA 2FSVA 4CM6A 3K30A 3JQFA 4E2YA 4UVHA 4YBZA 4HUJA 4BV8A 1E3IA 4YAIA 3GGOA 3D0OA 3MJEA 3DBRA 3AJRA 1CQJA 1EVZA 1M76A 4R1UA 4BO1A 3P7MA 4E12A 5AXAA 3INRA 4NK4A 1DC5A 1DC3A 3K6JA 5F3RA 1QKIA 1KVQA 1GFSA 1DFHA 1SMKA 2J8ZA 2X9NA 2X4GA 3ROMA 5BSFA 2BMAA 3ZWNA 4IMRA 1GV0A 3JQEA 1HE3A 2R00C 1LRKA 3RU7A 3LF2A 1NXQA 2IZ1A 1YGYA 2YY7A 4GSKA 5C7IO 1MXFA 3LC2O 1SC6A 2FR0A 1KVUA 1JWAB 2NWQA 3EVTA 3V8BA 4WCFA 1UUFA 3GZNA 1GUYA 3KUXA 1DPGA 3D3EA 2YHUA 2V6MA 1VSVA 1OAAA 2X1HA 3HJAA 4ZN6A 1IUKA 3GRKA 1GUZA 1GV1A 5DOVA 1JVBA 3U4HA 1UDCA 4BNUA 1OZAA 1YB5A 3RC9A 3GFBA 1WLYA 2Q50A 4BNYA 4RORA 4UUOA 3BHMA 5CHEA 4R3WA 5A5FA 4E31A 2B36A 4KQXA 1GY8A 1R0LA 4DIOA 2CFCA 3AUSA 1H6DA 3GH3A 3IQDB 1YL6A 3C7AA 2GERA 5FYDA 2VUSA 1ZIDA 4N7RA 3ZWYA 3O03A 2O2YA 1Y8RA 4F6LA 4PLPA 3NTQA 4WKGA 1SO8A 4L4RA 2HMVA 3OH8A 5G4KA 3U9LA 4DL9A 5JCJA 1ZO8A 2JFHA 1RM5A 1M66A 4QXMA 2Y68A 5L4SA 3KHUA 1G1AA 4YEDA 4W9NC 3DR3A 1R37A 3M1LA 4KMSA 2ZIZA 2I3GA 1C0PA 2UUPA 4MDHA 5JXWA 4W7IA 3BMCB 5L95A 3INTA 1X0VA 2PH3A 3JQBC 4Z3KA 1QYDA 3PHLA 1P1FA 4PG4A 4ZJUA 2VHXA 5GZ1A 4OQYA 4W82A 3UXYA 3V5NA 4D3FA 1AHIA 2VWHA 1K0UA 4O6VA 3IJPA 4CMBA 2QIOA 1EDZA 1IB6A 4BO0A 1MLDA 3PWKA 1DRUA 3GF4A 3PJDA 4JK3A 2Q1WA 3TJRA 4XYGA 1SEPA 3DC2A 2C59A 2V6FA 3EHEA 3FNFA 2Q45A 3VZPA 1W73A 1VSUA 1JLLA 4D3SA 3JQ9C 3OIGA 2V65A 3NUGA 3ZWVA 3W6ZA 1YQGA 3I9NA 3LC1O 5I8ZA 3JQAB 2QRKA 1EQ2A 3H9UA 5G2OA 1VRWA 2DFDA 2P5YA 4NJMB 5CP8A 2HO5A 5C37A 5TLSA 1YOVB 3FNEA 4J49A 4WNIA 3EGOA 2NLOA 2EGHA 3ON5A 3M2TA 4MP6A 4B7CA 1DHTA 1YQDA 3QJ5A 1Q0HA 5HA5A 3CINA 4UUPA 3GEMA 3PPIA 3PRJA 2GGSA 4LMRA 3E8XA 3H8VA 3IUPA 3FBTA 1ZMTA 2DKNA 4XD2A 4RF3A 3TQHA 4D0RA 2B5WA 2Y67A 4JJFA 1Y5RA 2TMDA 2I67A 1EZ4A 1A72A 1WWKA 4M87A 3WFIA 2PFGA 3JYLA 2PA3A 1PZFA 2QX7A 4H16A 4E21A 1HDCA 3H9EO 1HYHA 1PL6A 2VWQA 5DBFA 4B79A 5A02A 3FR7A 4YJHA 4R54A 3ICPA 2OMEA 1C1DB 5ICSA 1YBVA 1ZEMA 4GBJA 3RCBA 4OXNA 3ZU3A 4CLXA 4FIZA 4IDGA 1ZBQA 1E7SA 3PHJA 3WOHA 4JP3A 1ADBA 3WLFA 5LDHA 1EMDA 2CSUA 2X9VA 3PYLA 3RSHA 4YA6A 3S2EA 3CKYA 3KEOA 4WK6A 1IZ0A 3SLKA 4DQVA 4GGOA 1NVTA 4K26A 3ST7A 4F3YA 2PK3A 1K3TA 4GGPA 3HZZA 4AJLA 1I3MA 3A9WA 3ETGA 3GN1A 1LSOA 1E7QA 4E30A 4EBFA 1U4OA 4AJ2A 4MOWA 1HETA 3H6KA 5H82A 3UFXA 3GDFA 4P4NA 1VJ0A 3LC7O 2BKAA 4KWHA 3W4JA 1F8FA 1KBZA 1JKJA 2GUGA 4J0EA 4QEDA 4HFRA 1U3VA 1F8GA 3I5MA 1GR0A 4Z0PA 5JAZA 3JYQA 1ZUD1 3G1UA 4JN6B 1TT5A 3G1TA 5IN4A 3ZV5A 1SEVA
chains in the Genus database with same CATH superfamily
3WVNA 3HUFA 4O4JA 2Q9CA 3RGWS 2FPPB 3QKTA 4DR2B 4FYIA 2ODAA 2QJOA 3KOWA 3SNKA 2J45A 2RGYA 3COYA 3KWFA 2IF2A 3ASYA 3D64A 1RWBA 4D6YA 1AZLA 5E6RB 2WFLA 1V8PA 5AVKA 2ZBGA 4ZPXA 4F5YA 1ZNZA 2A1TS 1V47A 2VR1A 4HT3B 4F92B 5JCOC 1JHXA 2E85A 2H29A 2NNWB 1T3ZA 1JZTA 4MIYA 1Z83A 3NIGB 1J2TA 1B8NA 3NOOA 3OQHA 1BEZA 4P86A 1CUCA 5H9VA 2NUTA 4C5CA 1FSFA 4PYRA 2XVXA 4QDUA 1FNCA 2HT6A 2NU9A 3NTLA 1FLVA 1VI6A 3IT3A 1UBGA 2C04A 2XMZA 5BSHA 2EX4A 1QZZA 3QFFA 5AOCA 4HQNA 3X2SA 1Z7GA 3DV0A 3LQFA 2JW5A 4JC0A 4R16A 4B74A 1M2VA 5E3IA 4D43A 1UC5B 4MTLA 1VG1A 2B25A 4OXQA 1DOHA 4R05A 3WLJA 4ZTBA 2FGKA 3I9LA 4JVNA 1NNUA 1BHO1 5KTOA 3BICA 5JCXA 1NRWA 2WY2D 4ZYZA 1CX9B 1KEPA 1TC2A 2FSGA 3HR8A 4LHEA 1ZINA 2CJWA 3RHTA 2GXSA 4C01A 4D96A 1AUQA 4EG4A 5JSZB 3T5GA 4KYVA 2V7QA 2X23A 4AM8A 4M1TA 2VP2A 1UAGA 5HRAA 3FWYA 2QGNA 2RBKA 3FSJX 3QMWA 4H1TA 3GX1A 4I1IA 5EAIA 4DAOA 1J4AA 1HC7A 2FP4A 4YK7A 5HOQA 1CKEA 1ICEA 3EARA 4FM9A 3WL6A 4HAYA 4CVNA 4R69A 1VYHA 2VHUA 2P9EA 4PQRA 2FNAA 3CCFA 5P21A 4ZTZB 1W36C 3UOGA 5KTYA 3FCYA 3WNCA 2HJRA 5A9SB 1D2GA 2DR3A 4ZZ0A 2ZUBA 1XRLA 3QI7A 4XX1A 1YQXA 1OZGA 3UO8B 1KBOA 1RKXA 1XRRA 1YQWA 4OBWA 3RSSA 2PL1A 4FZVA 4Y6PA 4BFSA 1V4VA 2X2OA 3LYHA 5E9JA 1T2NA 3WHKA 2YNMC 1A95A 5D5PA 1E7RA 3G79A 4UPDA 1G3MA 1KC3A 1QIFA 3JVDA 1JFSA 1XQWA 1ECPA 3VVBA 4WBNB 4R2JA 3NI2A 2X7HA 3SEAA 1OHHD 1WPXA 4ENUA 3HTXA 4LGYA 3I9MA 3R41A 2JFBA 3FDZA 2D2XA 2AJCA 2B34A 4GW3A 3WJAA 4RADA 1QNFA 3ZKAA 4ALIA 4BNDB 1WS6A 1ANKA 5EZ6B 4KGDA 1WULS 3ST7A 3FTQA 3T9BA 4ID9A 1FC0A 1HE1C 1NAHA 4AS2A 4BQIA 4WLOA 3AI1A 2WSSA 3BRSA 4ZC1A 3CLRD 3NW9A 4LG1A 5ALLA 5I47A 3N74A 1RAHA 3T6KA 2JZNA 3VPCA 4WLVA 2XBLA 3L0OA 5CYPA 1WSWA 2RG1A 1M73E 1NQWA 2ST1A 3QA9A 4QGHA 5IJ0A 2V59A 3P1JA 1QWOA 1VHJA 1CUXA 1RI1A 3QE9Y 4PANA 1BA3A 2ZIUB 3VPDA 3FHOA 1C9KA 5DYNA 4EQZA 2EW8A 3EIUA 4LQCA 4C43A 3LQYA 1U7XA 4EB6A 2J5XA 3AK4A 4QUJA 3WYDA 4FGWA 1OPXA 1YZHA 5SICE 4CM5A 3TNFA 3AOEC 3TPCA 5DGHA 1PZEA 3C8DA 3JCZA 1Z4KA 3JQ8A 3LQRA 2IH4A 1JAHA 1QYXA 1GAWA 4HNRA 4B31A 3DE3X 5TJHA 2OCPA 4LZJA 5I7AA 1YVPA 1JEQA 4LDRA 4L5JA 4OG2A 4M9QA 1SBCA 1TJYA 2UVPB 3A6JA 3ZNPA 1I13A 4Q7EA 2OBNA 5ALGA 3P2OA 4EFDA 1XCGB 3QGMA 5FO1A 1GA6A 4H0NA 4AJNA 2R4UA 1V48A 2JGMA 4PRLA 1UK8A 3M33A 2V7XA 4YDHB 2DWOA 5CFZA 3TW8A 5KBYA 3LPDA 4F4HA 3K6SB 2B1JA 1NJGA 2ZATA 2XJ9A 1A4RA 5EINA 4AZSA 1IQRA 3A70A 1U2DA 2PWZA 3B6KA 1LJUA 4XAQA 1XHFA 4XYMA 2ZUFA 1BMDA 2QXYA 2RHRA 1ZA2A 2WAMA 3QMPA 1N34B 3SSOA 4OOFA 4YGYA 1RYYA 3B70A 5HBGA 2CHQA 1FFHA 4H6VA 1H6BA 1FP7A 5EMNA 2GCGA 4RD3A 5FIUA 2YWDA 4YMIA 1HQKA 3CEPB 3QHPA 3OCYA 5DRYA 3A3NA 3HFSA 4OH1A 4X00A 3BTUA 2FQXA 3E3OA 1KXZA 2AB0A 1ZWKA 1P9LA 2VNSA 3NHFA 3GD7A 3CWZA 2DSNA 3FD8A 3KXIA 1E7YA 1T36A 1SBNE 1KKMA 3D2BA 5KNLA 3BGWA 1I3NA 4LC9A 3S44A 3T4EA 5LL6P 1QQAA 4J6FA 5AK3A 1PK8A 1GLNA 3A37A 3W3AD 1RHKA 5ICMA 2PUDA 3OPYI 4HH1A 3CA8A 4OPMA 1S2MA 1OIVA 1YACA 4X1IA 3EVCA 4QOIA 1CQXA 1JQEA 4G56A 3W79A 4QKQA 1XNRB 2X58A 3CR7A 1RM0A 2B30A 4FGKA 3ZCVA 2PVCA 2RHBA 4WCDA 1QP8A 3B7GA 4JJAA 4L15A 3LDFA 2ZR9A 4N6NA 4XEUA 1GZ4A 4QFCA 1MDBA 1DDGA 2GRUA 4AF7A 1PGPA 1HRDA 2XQJA 2O8DB 2CT8A 1B3BA 2F3QA 2ZXEA 1AB5A 1A27A 3EUAA 5IHXA 1MB0A 1KY2A 4MW7A 2PT7A 1O95A 1MTZA 2E4YA 2Q2QA 1E3QA 1ZEJA 2DHEA 1P0CA 4CR8A 4JEMA 2IXAA 3HCWA 3HCOA 1EK2A 4HDMA 4U3JB 2ZAMA 2PVSA 4ZEOA 4ECEA 4LRXA 4YUXA 1TUGA 2B35A 2XCIA 2XUFA 3OCJA 3I2IA 4HLCA 4JQSA 3MCVA 4KHZA 4QGFA 5E4FA 1UPXA 1FLNA 5AI6A 5JDCA 3N6VA 1KOJA 2MMCA 3M4JA 3THRA 2GAFA 1TW2A 2EG5A 3QEKA 1EBBA 4U8GA 4E5DA 1Y1QA 3M6XA 2VRCA 1ZVVA 1M6HA 5ALJA 1RKVA 5BR7A 1E2IA 1T6BY 4JJIA 3OE7A 3TR5A 4IGIA 1SQ5A 4WLFA 3WGQA 5BV1A 1P61B 2NP6A 3H7AA 3RV4A 2ODPA 1LUAA 1WW3A 3R40A 4IXDA 4HTAA 4EA6A 4PICA 4ZZ1A 3AO0B 3JQPA 4MIEA 1SRQA 3HM2A 2VJAA 3JV7A 1Q0PA 2O2HA 2PMDA 4FC7A 3JSAA 1IL0A 1KJWA 1LNQA 2R11A 3Q0IA 1Z07A 4PLZA 1W4BA 1XFDA 4UMEA 2P6OA 1KR2A 3L5KA 2XOXA 3QXXA 4JQZA 3E9NA 4ZQEA 5FUXA 1QHSA 3BERA 3W6PA 3OQOA 1MNAA 1Z9BA 1GD1O 2G83A 2PXCA 3O8LA 1JKFA 3JYPA 3I4LA 4RBNA 3OKFA 5EMHA 5D2CA 4XUDA 5IAOA 4MICA 2BCEA 1PU2A 4KXYA 1RJWA 2NSDA 5C32A 4IDNA 2GJ8A 1UKZA 3P96A 4TZKA 4YT2A 4WGGA 2VZ9A 2QTVA 3K9NA 4PY2A 4RFVA 4U2CA 3B6EA 1CC1S 4E5MA 2G06A 2JNWA 1FUUA 3PQEA 3PQ3A 1BC5A 1DKMA 5E2AA 2SKEA 2PDAA 3RFUA 5JZVA 3K70B 1LWNA 1WG8A 2WYIA 1Z36A 1AMUA 2R47A 2GDJA 3O4JA 4LFBB 2IXTA 4XWWA 3L79A 2Q1UA 1XLTC 3R0VA 1XPUA 1PFWA 2YWRA 2P41A 1F4VA 3CT6A 3HN2A 3AESA 4RK5A 4BKRA 4G01B 1HO3A 2JH8A 4DM7A 3IE1A 4CGZA 3ND6A 5JYBA 2CJYA 2JD1A 2AR7A 3JD3A 4I4NA 2BFOA 5DTQA 5IJWA 4XYLA 4ZVVA 4XGIA 2D5IA 4PO8A 4NLLA 3OZIA 4JT8A 5FBQB 3AU9A 2VDWA 2H1VA 3VR5A 2J5RA 3ZDBA 3I8SA 3V8NA 4LJSA 2H1CA 1UBRS 2Z4RA 3HJBA 3D5QA 2Q3MA 3BDVA 2DKOA 4EHIA 1I0ZA 4PPNA 2IHZA 1YAHA 5T4BA 5C8ZA 5K51A 4CUJA 1T25A 3I1YA 2A8YA 3MOIA 4GL4A 3NTOA 1T8WA 2BFNA 1VLJA 4GSYA 2I8AA 1NJ5A 5AW7A 2WOOA 2B1RA 1KL7A 4JLVA 2OBXA 3UUGA 3VKWA 4GX0A 1U6IA 5H83A 4DG8A 5KOJB 3TKLA 3KTOA 1AE1A 3NHUA 1NI5A 1XDSA 4LJ9A 2AFRA 3Q2OA 4S0ZA 2WM2A 4F9GA 4URYR 3KSUA 2VSYA 1Z5ZA 1EGAA 3N7UA 3PFFA 4JLUA 3HK2A 1HTWA 1PLKA 3KEQA 1NW8A 3EGVA 4CKBA 4N0EA 5JG7A 1ZM2A 4ERNA 4KPEC 3Q8LA 5ALEA 5CDHA 3I62A 5I4IA 1P80A 1ZXLA 2C84A 3D6NB 3U0BA 3CTMA 2VYND 3PICA 4P81A 1RM4A 1WB4A 2PUTA 1T0PA 4N0QA 4TMKA 4M1WA 3VXKA 4DWOA 1EHCA 4YPOA 4UVIA 5KIAA 3NWEA 1NLUA 3DEKA 2BFWA 4NCIA 1GRCA 2F2TA 5C5CA 3RC8A 4CLRA 2F1KA 1R4NA 3ZWPA 3GLIE 1USUA 3RVQA 4D0LB 1SXJB 1KEZA 3PE3A 1V4BA 2G8LA 3LXXA 3V7YA 2JLUA 2VDNB 1YS7A 4H3HB 3NBUA 4EKGA 5JADA 4BGVA 4LOLA 4Q4CA 4L95C 2OAP1 3AUXA 4FE3A 3TAXA 4HGOA 1D5WA 2GM4A 4IMJB 1KDTA 2JVIA 1K1EA 1YULA 2RBEA 4GPEA 3QW2A 4OQDA 2GBLC 5EOVA 1MPXA 3U39A 4Z4CA 3T34A 2FW6A 3W78A 4HAUA 1XZMA 3GVXA 2UUAB 1GL9B 1RHMA 3HB5X 4PYKA 5DIZA 5GV8A 3MHPA 3H9QA 2ZE7A 3ZWMA 1V41E 4U8HA 1CE8B 1K6IA 1U81A 3FPAA 4OCZA 1L6IA 2EOAA 3NAMA 4B1FA 3AT1A 3T5AA 5JZOA 2RB5A 4QOSA 2GXQA 4Y30A 2K2WA 3KR1A 1IWOA 1I1OA 2ZRJA 2XHEA 4M1MA 4N1AA 4O4LF 1WZCA 2F3RA 3FPLA 3H65A 2NYUA 3QX9A 1S9DA 2HMAA 4FMDB 1GNLA 1RC1A 2AVDA 1ESZA 2BMEA 2N46A 2ZYIA 3BD6A 2A9QA 1MC5A 4C0BA 4P3YA 4B45A 1NR5A 3ZQ6A 2WJVA 1KNQA 1PWEA 3AF3A 5DEIA 2VDOB 1ULBA 1T43A 3ETHA 3LUKA 1HXHA 2ZROA 4LHVA 1E69A 6LDHA 4N0MA 3ZN2A 2W37A 5HF9A 4CF5A 3DR5A 2DY1A 1KVRA 4ESHA 1UP7A 3K0AB 4CW7A 2Y27A 3VZQA 2QEQA 3ADOA 3C4JA 4MJLA 3L7JA 5HJ5A 1UBOS 1XA4A 1NP3A 4ETWA 1RXSA 5C2JB 1JU9A 1RYDA 2R8BA 3LBNA 3V32A 4RUKA 1SQSA 1BVRA 3WGTA 2VJMA 4RMJA 1TMOA 4I14A 2VHVA 3DG9A 1C0KA 3MMZA 4H7JA 4NYIR 1H69A 1ZCZA 5CXXA 2HK8A 1HDZA 3R3SA 4WZ6A 1KQPA 1WDLA 3M4YA 1UR5A 4DCOA 4YRGA 5KKNB 2W4IA 3GDWA 1RJDA 2HQBA 3UYLA 1S8NA 2R7MA 3DMFA 3KOYA 4YUZA 2FB9A 1F5SA 2C9DA 2B69A 5EKUA 4AN4A 1XVVA 5CTAA 1U0BB 1NLYA 4H4CA 1TT5B 5KYXA 3D4BA 1D6JA 2W4MA 2YHSA 3FAZA 3PPYA 4O4JB 5DM1A 1EFPA 4CQMB 3PX7A 1M5TA 2RDMA 4YS6A 1NBMD 1WPQA 2Q4OA 2C0CA 2XH8A 3BZUA 5GMOA 3ZD9A 3R8CA 4RAQA 1CR6A 3RTBA 1Z29A 4D26A 2Q1TA 3VR6A 1RYMA 1H1DA 1S96A 2C3YA 4FOLA 1B43A 2WFLB 2ATIA 3IVXA 3C70A 1MMFB 2O9JA 3QRWA 1JGTA 4LGVA 3TSYA 1HKHA 1KP9A 3DXFA 4E08A 5DGTA 4G2TA 3QF7A 5B58T 5CLQA 4U7FA 1ABBA 2NUTB 5LDDC 4QSMA 4RHXA 4YP6A 5CFQA 2W2LD 1NN1A 1ORVA 2NU9B 1EZ1A 1T24A 3KU4A 3LBAA 3ML1A 4F06A 3HN6A 5BUZA 4D3YA 4ZYWA 4KZKA 3LOQA 3UHOA 3DV0B 3ZW9A 8GPBA 1W29A 3KLBA 3HYLA 4CIBA 1M2VB 1A9RA 2Q2VA 4BQNA 4KODA 1RABA 1VKJA 1QP0A 4CMGA 1VLLA 4OHCA 3R77A 4HAZA 1T9DA 1POXA 2E89A 3S1AA 2F3PA 3R44A 1Q91A 1Z5WA 4L0QA 1PQYA 5FNVB 4IY1A 1IDOA 4ZO7A 1C3OA 3AP3A 4WA7A 2XE7A 4ON9A 4MS4A 4MUNA 4YP5A 1AIPA 1YRHA 2Z9BA 4REOA 1O2DA 1TLLA 4JBNA 4DQUA 4EHAA 5KSZA 3DZHA 3NOQA 4G1MB 2WP8J 4YO8A 1D0SA 2IYPA 3BGSA 3RLIA 1DZIA 3JZMA 2VTEA 1EFDN 2I5PO 2J3EA 2PANA 3AWIA 4DJFC 1P2VA 4IEFB 3S2FA 1IOVA 2CNBA 3MGGA 1BG6A 2AG1A 1EEXB 3AOGA 4M9XA 1RKBA 2B99A 5ABPA 4E51A 1OLSA 3BL5A 2JIMA 3KQOA 3KV1A 4QNRA 2E3JA 4KWEA 2B5VA 3PPVA 4V0ME 4JXZA 3CB4A 4DEVA 3T52A 1W52X 2YYZA 4PZDA 1KTVA 1UQUA 3LV8A 3NT4A 2R1UA 1F06A 2CHGA 3RT1A 4FWTA 1BH2A 1YHYA 3QENA 4OY3A 3TKYA 1V8FA 5JARA 3X1XA 4UEJA 1PQPA 4DWJA 3I12A 4WK0B 3JWHA 2Z43A 3OT1A 3TXYA 3DMTA 3FE2A 3FDZB 3IOMA 5FB3A 5FWDA 2Q6IA 2X4IA 4RFSB 5IT4A 4Q5IA 5K03A 5JW6A 4B4OA 2AMLA 2Z5VA 3IC5A 4DADA 2SKCA 4DIEA 4MV0A 1E9FA 3JWGA 2FG6C 3O93A 2YWCA 2J3JA 2OY0A 1JLHA 2EZ8A 3E1KA 4Y9SA 5CK5A 4J1TC 4IV8A 4ALNA 5LNK6 2VCYA 3R5SA 2YASA 3QIVA 2W0SA 1H2BA 4ZOLB 3GU3A 4E94A 3KO8A 4CLOA 5EXTA 4WNAB 4UZEA 3JPWA 5B64A 1PJSA 1ZVKA 1C14A 5IXJA 1VIAA 1PF7E 3CUSA 4NMWA 3TOCA 5FOTA 2QD4A 4QTUB 2B61A 5CLJA 2NTYC 4K9NA 1LBIA 4KIWA 2GAAA 2O7RA 2PH5A 2HHJA 4EB6B 1JL3A 5DW3A 2V4ZA 1E79A 1SZJG 5DXJA 4K6CA 2DPYA 1Y8QA 4AKTA 4GX1A 1CUZA 4YDRA 2E1PA 3JQ8B 3D59A 4Y7DA 4C76A 3WFZA 1HX7A 3P9CA 2NACA 3LVBA 4ZODA 5EPEA 3X2FA 2DETA 3GBSA 5KNDD 2XB2A 2J9YB 3FZNA 2I6UA 4CG0A 2W2TA 1PJCA 4RZHA 4KV7A 5LP1A 3PUIA 4J03A 3U7FB 2Z0MA 4NK5A 3KJFA 1X2BA 5C0OE 1J33A 3WKDA 1DXHA 2JG3A 5CPFA 1UOPA 4LI0A 3S2YA 4UHHA 1DEKA 3DWIA 5JFGA 5T4EA 3ZWWA 4BNKA 1JXOA 3I8OA 2DBYA 3N5CA 4XLZA 3TW8B 4GF5A 1N8TA 1PT6A 3IPLA 1FFAA 2CUKA 3L49A 4GR9A 1NUSA 3WMFA 3B6JA 5BVHA 4RTOA 3KKPA 1Z62A 2C4WA 3BCHA 3ZGOA 1KEEA 4FMCB 1MZPA 3RWOA 4FEYA 6YASA 4MMYB 2J46A 3H1PA 4C5BA 2JIBA 1P7PA 3CYFA 5GM1A 1UZUA 2WZDA 5I9IA 1MAHA 1AXEA 5JAQA 2W9XA 2JJ8A 5A4IS 4H7KA 3TTYA 3F5SA 4NMMA 4MJXA 5EZYA 2HMSA 5B7NA 4JEIA 4RS4A 2GA8A 1VYTA 2B4KA 1KIFA 1OVGA 1QXSA 3WK9A 4CNBA 4N76A 2QS9A 1Y1KE 1PNRA 1JR2A 4WOCA 1SXPA 2VZ8A 1EWKA 4KYTA 3ADDA 4QVKA 3VTAA 3ETEA 1OUMA 1UM9A 1ILWA 2RGEA 4DPKA 4QJ3A 2WTXA 5SV2A 3RS8A 3TSCA 3C2QA 5IAGA 3AVQA 4X1IB 1BHSA 3T41A 3V4LA 2GZ2A 1NUTA 4O08A 2PN1A 2XEXA 3PGVA 4GMHA 2L82A 2I4MA 3OFSA 1BFUA 3PX2A 1N5RA 4JENA 4UM8B 2YW9A 4ZCIA 5A4AA 4Z3DA 2D6FA 1J0CA 5HNKA 3ESRA 3WMWA 4GKAA 4PPFA 1LF0A 2J3QA 2BHLA 2PSSA 3BZBA 1QUEA 1NJ2A 2Z09A 1EDEA 3P27A 1U1FA 1Y3DE 5K8CA 4HDMB 3S7ZA 3LC0A 1YVEI 4A0SA 3GRVA 3NFYA 2RHTA 3LUDA 4KIJA 1SQGA 2O2EA 1JEEA 3KALA 4MHOA 5JBIA 4NE7A 1UWVA 5C1IA 1R10A 1O57A 4IG9A 1X1BA 2A5YB 2EFYA 1FMJA 1KYQA 3WICA 4B6JA 4DLUA 3ESYA 3A6LA 2XRFA 3FJOA 5EFZA 1REQA 1VJDA 5C4GB 3H86A 2DMRA 3NAGA 1GHTA 1I01A 5CM9C 4FFOA 5CFRA 1QHYA 1DUVG 4QIHA 3KDPA 2QAGA 4ZZ2A 4BVLA 1TYCA 2MSCB 3EH2A 4G9BA 3ZE6A 1WTAA 1E1LA 5TVKA 3RFCA 5FPSA 2GYYA 3JD0A 1DADA 5HCUA 3TPZA 1MC1A 1NSFA 2R6DA 1CIJA 1E1KA 1YJCA 2OV3A 2X22A 1MV5A 1VL1A 2WAYA 4Z9BA 4IWYA 3ZD6A 4HQ6A 1BMQA 2VYQA 4R01A 5REQA 1A96A 4PCLA 5I48A 4URZR 4MKRA 4G84A 4QEKA 5M3BA 3H4VA 4BP1A 5ICFA 4DA7A 1IHPA 3N0WA 1UAAA 2GYVA 3MPUA 1GZ6A 1T9GR 3EVAA 2CJPA 4GPIB 4MVJH 2EIHA 5BQOA 3I9OA 4CEHA 4J4HA 5CXQA 2BFAA 4GZMA 1DAPA 5B3JA 2QTVB 4Y2JA 4BFZA 3HCCA 4LRTB 4O5OA 3HXMA 4CV3A 2XUHA 4R2KA 2JPDA 4LHZA 1JLRA 4R1SA 3GH1A 7ADHA 4QAJA 4WKOA 5AVWA 1QTQA 2XUQA 2BFEA 4YAFA 5LA6B 1GKKA 3KOOA 3L7DA 4GLLA 3RUAA 3MMNA 3ECAA 5BQ5A 3BB4A 2Q7DA 3NEAA 2VQFB 1JSLA 4IUBS 3DZDA 1ZN9A 4G1CA 4NMHA 1AN0A 4FB5A 1W4CA 3GRFA 2RE8A 5KWIA 3GROA 3MCTA 1TVMA 3WLOA 4R0MA 3ZDDA 1GN8A 2X13A 3IPXA 3AFMA 3K3PA 2YINC 3PA8A 2ZBQA 5KVAA 4TQUS 1Y82A 3LZ6A 5IEBA 3QELA 4MAAA 2PM8A 3FPEA 3RUEA 2BUCA 3INNA 2P3SA 2CV0A 4ZKDA 1CLEA 1IDN1 3QUTA 4IG4A 4X65B 1AKTA 2PT5A 2EDCA 1R6UA 4Q02A 1EWYA 1L1RA 2YN0A 3D3KA 3HLTA 2CZQA 3HBNA 5F9HA 4OKIA 3SVLA 2PGLA 3M82A 2RGNC 3REOA 1GFWA 4RDIA 3U17A 3UW3A 1ZR4A 3H2YA 1PJ2A 4Q3NA 5JNVA 2O2SA 3GCXA 1MKYA 1LDBA 4OQNA 4EPTA 1V9CA 4ZOAA 1DKNA 1T9KA 4C4RA 1SCUA 5FULA 3B6ZA 3NIDB 4J0JA 4R9SA 2AOVA 3B1ZA 4BNXA 4F8JA 3UGKA 4F3TA 4IKPA 3LH5A 3GV0A 4ILKA 4IICA 4O2AF 3VDQA 4CKBB 2B3TA 3DYIA 5BOSB 1YDFA 1K4YA 2XA1A 4NFYA 1LPSA 3FPKA 4JR2A 5THXA 5CD9A 4J0HA 2QMYA 3II6X 2GHIA 1H8ED 3AHGA 4PLHA 4YR7A 3SQMA 3UK0A 4EWLA 4CMEA 2NIPA 3C5WP 1AKEA 3ZTYA 1CRWG 3U1TA 3LQKA 4CLRB 1R4NB 1Z6TA 3E8MA 1R3UA 2IUSA 1RVDA 3RAJA 3LTNC 4GVLA 4A8JC 4PYIA 1BQ4A 5FLXA 1YA6A 4D4LA 2FFAA 2DR0A 2A3NA 3WNZA 1SVSA 2REQA 3AEXA 1R16A 3WGMA 2P8SA 3FJYA 2VWPA 1YZ3A 3AH8A 3BE4A 2GNOA 1M1YA 2NV6A 1E2FA 2AC7A 2CHUA 1DT3A 3IDSA 3MAAC 1M6YA 3ODPA 4Q01A 1C1XB 1IBKB 1YL7A 1OX5A 1QGAA 2MJLA 2XLCA 3DVRX 1YNSA 2BLNA 2PX5A 1NPDA 2DFNA 1R6VA 3EAQA 4PVDA 1KQNA 2M1XA 4IPTA 3TM4A 1Q1BA 4NJMA 4BN5A 2BFDA 4IH1A 5ENVA 2R6HA 4JLPA 1JWBB 1A2QA 2GFHA 4ARIA 3ETCA 3H97A 4DIKA 2PUFA 2XGOA 2X0NA 3DO6A 5IKPA 3QBVA 4D25A 4V0QA 3M1IA 4CHTA 3D7NA 2X15A 1U7TA 4GQAA 3GAMA 4LE2A 1JU4A 1W35A 2IEZA 4OVKA 2XY4A 1QPBA 2J48A 3NNDA 1XDWA 3C6BA 3GLTA 4ZCQA 5HFJA 1WUIS 3SNHA 4AW9A 5U4QA 2GDZA 2OLEA 4HQ0A 5E8JA 4DDWA 3FNBA 1IMOA 2GZ3A 2YWXA 1I0IA 3ER6A 1DP4A 1RADA 5EKXA 3WBKA 1OJ7A 4IJSA 4CKCA 2A1UB 4BPRA 5KTSA 2AW5A 3LIIA 4JODA 4HNUA 1TZJA 4DLKA 4P58A 3EY4A 2Q07A 4YQZA 1IEWA 3GJ7A 4RZSA 1P77A 3CXUA 5KWJA 1FVHA 2G5PA 3G2KA 2OZPA 2VJMB 3H5LA 3K2EA 4MYCA 1MQ9A 5EJAA 3PGKA 2C2KA 2Q8NA 1O77A 2CL6X 1A5BB 3DHVA 4N40A 2UZ0A 3KM0A 4HDOB 1GQYA 4E6EA 2I22A 4N0DA 3RAPR 4OQ4A 1T15A 1N7IA 2H65A 2J3IA 3RFVA 2ZXUA 2QG6A 3BK7A 2IWHA 3LPCA 2XHZA 2DOKA 2JKVA 3DOUA 1IZ9A 3E9MA 4PS0A 3ZOKA 5J43A 2XVMA 5JS1A 2ISSD 1JJFA 1CY6A 4DIUA 4LDJA 3RWMB 1Y8AA 3GO4A 1EFPB 4JHXA 1L1FA 1OYYA 1G6HA 2OG1A 3C1UA 3AM5A 3DP9A 4KNVA 5IVDA 1KE2A 4D79A 2C77A 2IU4A 1G2IA 2AZDA 5FPPA 3QU2A 1SCIA 1S5PA 1R5OA 2F4NA 2FRVA 1K6MA 3RRNA 2ISCA 3FTFA 2NTNA 1IAVA 3ZG6A 4CG2A 4FYXA 2DYKA 5T57A 1P72A 1YZKA 2P7IA 1PX0A 3KB6A 1T8RA 1TZ2A 5DYWA 1QO9A 4CKEA 4CIYA 2IY7A 4L4UA 4WE3A 5EXSA 2EJTA 2Q6VA 2JCXA 1IVYA 1ZK1A 2VUUA 2WM3A 4ZO9A 1U8XX 3SC6A 1JF8A 5CJJA 3JAKA 4IXMA 4OATA 1N3YA 4DN6A 2COUA 3T0GA 5FWXB 1PFVA 2AGVA 2QL5A 3QNWA 4HO1X 5JUWA 1YR2A 1YFJA 2IHKA 1Q16A 2PYDA 3FVRA 3RK1A 1UOOA 5IFLA 1XP8A 1NI4A 1UP4A 2WINI 3DWEX 4M0EA 4WCFB 1UT5A 3SFTA 5JSHA 3DGEC 4M0UA 4ZU6X 4BLPA 4ZQIA 2BBWA 2AMVA 4OFBA 3R0IA 1D2HA 4IQ4A 2IXFA 3W77A 2R00A 2EJUA 1I5OA 5HIIA 2JRLA 3QOYA 1IZZA 1IN4A 1HMYA 4OFZA 4TL7A 3S1AB 4IVQA 3PU6A 4TYNA 4V2UA 2EW2A 3RF6A 3COJA 1C3OB 4B6GA 3G9ZA 1H8HD 2XCOA 2J9GA 10MHA 2XCRB 1KO1A 3T7CA 4MS4B 4QVIA 1BFKA 3ONNA 3AR4A 4RZUA 4CM3A 4OGLA 1VYUA 2ILTA 3CT4A 1NW6A 4MV4A 5EVJA 4F84A 1X7WA 2P9QA 1I2DA 2RK4A 2VPZA 3CLVA 3R7LA 1XCLA 2JIDA 2XMSA 1UOEA 4P83A 3ZCUA 1PBNA 3H1AA 3ICCA 3BTVA 2Q6KA 3ZV3A 2VS1A 1KYYA 2CKDA 3JRXA 5JNWA 1QH1A 5I7EA 1E3MA 4EY4A 2Q5HA 1C9NA 4W9RA 3HXLA 4BOYA 1P1HA 3VTKA 1OLSB 5IDQA 2QL7A 3GAFA 3R8XA 3K05A 3LT2A 4KYUA 4K7JA 2HDNB 3QVVA 1OLUA 1PJRA 4S35A 2G07A 2XMRA 3T1VA 3C7TA 4AG3A 4UNNA 2FPSA 4HG2A 3RIGA 2POQX 3GT4A 4WNCA 3PLNA 1H2YA 1UXJA 2QZ9A 2WVGA 2XTMA 3GLUA 5ILGA 2AKAB 5DW0A 4Q7KA 1D0IA 1A9XB 1EXVA 1EAMA 1R9JA 4IUCS 4B47A 3WLSA 5HWSA 1RPNA 2QY6A 2X4DA 4IO0A 1T6ZA 3HYTA 2BMWA 3AJ9A 3STUA 3PGXA 4XWOA 3T15A 2FPGA 4EMBA 1D4OA 3OT1B 5G53C 5I9MA 3F6SA 3UB3A 2PKQP 5A1TA 1B74A 2IYYA 2JK0A 1C0IA 1SU4A 3E7FA 4QBTA 4TS4A 2BKVA 1O1YA 4EPRA 1FNBA 2G7ZA 3PTZA 1QM5A 4TLEA 5A4KA 4TKVA 2PAFA 2PMCA 4CF4A 4CDMA 3U7QA 1E5LA 3NH9A 3BF8A 1DLIA 1M2KA 1AGXA 1Z6QA 1HPLA 1IY1A 2PQMA 2XB8A 3JQBA 3KQHA 4LWZA 1NVKA 1CJCA 5IK2A 3O8RA 4FS8A 3K70D 2B6HA 4YVFA 2KBFA 1HFKA 4JB3A 2AOXA 4P31A 3N0VA 1YKFA 5HZKA 1S1CA 4HV4A 3ICWA 1Z2EA 4OXIA 2HJWA 3TLMA 3C8UA 3B5JA 4U02A 2I6QA 4MR7B 2P9ZA 5DLEA 1GT91 5TDHA 3T0IA 2R5FA 4RWEA 4YB8A 3L0DA 4B34A 1WVGA 2P68A 1M72A 2XZOA 2PXAA 1G42A 3C14C 3FROA 1W4ZA 2CD7A 1R15A 1NSTA 4DYDA 3C5CA 4CMJA 2PKYX 3PUYA 4CCAA 2GO7A 5JAUA 1VCIA 1OE0A 2XE6A 1IWPB 3GRZA 3PUWA 1PVDA 1V8BA 2WK1A 3EIOA 3I34X 4QC2A 3KD2A 5ALNA 1VE7A 4BQPA 4WJKB 1P7CA 4KI7A 4LKRA 3GGDA 2IU6A 1RWPA 2Q4BA 5TV2A 3GIDA 5F7ZA 1A8PA 3NBMA 4FQ5A 1EB8A 1WIWA 1ZGZA 4IOLA 4M1ZA 3B1WA 5K0ZA 4GO1A 2ZJZA 2FX2A 3C3DA 3BGOS 1JNYA 1AA6A 2HIGA 3TGWA 3N3BC 1F9EA 2R66A 3NVDA 5F1YA 3H99A 3R0ZA 3MTEA 1QBGA 2F1JA 4NARA 3LJKA 1T3LA 1ZZGA 1IIBA 1RRKA 2P2GA 4U0KA 4AF6A 4AZ3B 1KEEB 2G6TA 3MJSA 5FBVB 5ALTA 1E1QD 4G1VA 5BV0A 4EQ6B 3T4UA 4G5OA 2NVOA 1TA4A 2YYYA 3PGMA 5C3UA 3RVKA 4IJMA 3PFNA 4J90A 4ZQFA 2O8BA 1E6EA 2UXCB 1WX1A 4JXKA 2BIFA 3SQLA 1UJCA 2VSXA 2DX7A 1QKJA 1E89A 3OP1A 2W98A 1MV8A 5ECGC 1DBPA 1RXWA 4EFNA 4B3RB 2HSJA 3V8QA 3QEMA 2QU7A 2F59A 5K2OA 4EI9A 3G3EA 1IXKA 1TRKA 1M74A 1COWA 2BFMA 1Z08A 2QXUA 1N2EA 1UM9B 3IKVA 1BWQA 2CJFA 3JQ6A 3N8HA 3TRIA 4E4YA 1COZA 1QCZA 2GPWA 1OROA 2ZYDA 2FW1A 2OFPA 1GPKA 3IPAA 2VNKA 4CG3A 4A2QA 4CM8A 1QGOA 4L6AA 4C08A 2QN2A 1KKLA 4YDSA 2E6UX 1PR2A 1YVDA 4L5CA 4OI1A 3THOA 4YP7A 5K45A 4H35A 3I52A 3O7MA 1TKBA 4LHXA 1KIMA 2I2FA 2WD7A 4DNOA 1IEVA 1YONA 2QT9A 3UFXB 5LLDA 5FAKA 1XKLA 2C82A 1Q44A 3I6MA 1YK0A 3KB1A 4L7VA 2MSEB 2NYRA 821PA 1J0XO 5KUTA 5DMHA 5KYWA 1V7QA 1BGWA 4KQIA 521PA 1CNEA 3CLUD 2OR3A 5CX4A 2OORA 3A06A 5KYGA 3DF7A 1LLQA 1FDRA 3GNLA 2WAOA 2HFJA 4B3XA 3CH7A 5D1NA 2ANBA 1OFHA 3NHRA 3CX8A 1ZESA 1U3WA 2GD2A 1DQYA 2NZ2A 5JTUA 3RTEA 1YZTA 3CN7A 4LF6B 2JJYA 2PU5A 4YYZA 4MDFA 9LDTA 2WE8A 3CVUA 3IELA 4X8MA 4BN0A 1REQB 1UKAA 4TTQA 3F3YA 4ZV9A 2WTUA 4K2HA 1PQWA 1R18A 3W1VA 3I72A 1L4UA 1PQUA 2ZTUA 5IYZF 2QAGB 4QOJA 2NT3A 4YRBA 2BTQA 2H4WA 2JFPA 4HS4A 1W2WB 1ZAYA 4HFJA 2YWBA 1M34B 1UM8A 2RGWA 1U5CA 3G7SA 1Z2NX 2EVWX 4MGHA 4DNPA 4OHRA 3GLKA 3VPXA 4BTVA 2PH1A 5REQB 3ZWDA 3N0XA 3N87A 2QMQA 4JJ4A 4MPDA 2JKYA 4CE6A 1BWRA 2IY8A 5JCOA 1N2HA 1HGXA 1JPNA 1T5TA 3FHJA 3KD3A 1PD0A 1TE2A 3ZBUA 3FB1A 1DBSA 3WYCA 2VQ6A 4D41A 3Q3VA 5KSWB 1JIVA 1DU4A 1MO2A 1B8UA 1OZFA 2GEVA 4G0QA 4OP3A 5JXGA 4G0UA 2VSQA 2MR6A 5JR3A 4Q9HA 4CEHB 1W59A 2J5KA 1QO0D 5GJBA 2P27A 2NXEA 3GJ0A 4H59A 4CQMD 2R4QA 2ID4A 2GILA 1OSNA 4UTXA 5EIWA 2ILVA 2GAOA 4FHGA 1KDRA 1LTQA 3TVDA 4C4SA 3LG2A 4NEHB 4UAUA 5F51A 4LN1A 1GAXA 1GPNA 3KHSA 1GTVA 4JH0A 2C61A 3OKCA 2BYTA 3HSSA 2BFEB 3MJHA 3AY7A 2FEXA 2QYTA 5AJYA 3PX3A 1J0DA 1JH9A 1MGOA 1O4VA 1JQDA 4ZT7A 4Y9DA 1UBNA 2WF8A 4R6WA 3OAAD 3IJEB 3OJLA 3LTEA 3DLAA 3MGCA 1YJ5A 3F6YA 4RHTA 1OAKA 1CUUA 1K7EB 1KSHA 3VZCA 2XWPA 2QVYX 2CLCX 2JJ1D 4HPWA 4ZMSA 2WLTA 2ONYA 2VL7A 2BGRA 3BDIA 4R1PA 1RPAA 3PNMA 4LRWA 1RPTA 3HDGA 1ABFA 3EPLA 2XRYA 1JYFA 3U81A 2KQUA 1FCJA 3GFPA 4MEAA 3FWNA 4UCXA 5E4JA 1GPH1 3UKOA 4A0HA 4BO6A 3L8CA 2X5OA 5CBKA 2E4XA 4UXIA 3ND8A 3P9QA 2NMVA 2DPXA 5EUQB 4GYWA 4M55A 2OUIA 3M6MD 4RJLA 2V7QD 3H87A 3DOJA 5F7OA 5DP2A 4K9PA 4ARAA 2J33A 2QMZA 3D6VA 4DLYA 3H5NA 3TD2A 3V1KA 3WDSA 3WWZA 4NSNA 2QTHA 1G20B 4LWQA 4LWOA 1SCUB 4A73A 1CV2A 5BV7A 1YI1A 1G5IA 3C8MA 2DWCA 2V96A 5DWDA 5K4AA 3VDRA 3P9PA 1GITA 5JJLA 4A16A 3FSGA 2JIPA 1GAEO 2FG7C 3PDUA 4B3SB 3M8KA 4BKUA 3O4IA 2HY7A 3SKYA 3ETDA 1GCAA 3NCHA 3T0FA 2HBZA 5DHQA 4M60A 4MRMA 4C03A 1IRIA 2OCDA 3GB9A 2XMBA 4FSXA 2DERA 4BNIA 1IN6A 1IE3A 3VUEA 2I7VA 3F4LA 1LA2A 4Z8XA 2X0IA 4KQ2A 3IBTA 2B6NA 4BTLA 2OD2A 3NORA 1V1MB 3SHFA 3UG6A 4J2TA 2AUTA 4CM7A 1YZYA 1BIFA 4BGPA 2ZAIA 2REQB 3DOFA 1TM4E 2WJZB 3ABZA 4DREA 5B57C 3WR5A 5GINE 2PG3A 1NJSA 1XTJA 1B8VA 2I6XA 1M1YB 2IIVA 3NHMA 1EUCA 3F1KA 1JAZA 4PZLA 5AW0A 4RW0A 3KRTA 3RUDA 1B41A 1FP4A 1L4MA 3DEAA 3AOEA 3DNPA 2O3UA 3DXYA 4QECA 1K63A 2OESA 1LK5A 1PRYA 3CS3A 4P33A 4PO1A 4COKA 4QM7A 2Q9AA 3I6QA 5HXAA 3VR3A 1FDIA 3CUEF 3V2HA 4P98A 2H9YA 1YCFA 4G89A 3S81A 2OG2A 5E7JA 4RL6A 1GUBA 2Q0QA 3R3VA 4GI7A 1YA8A 1XJWA 4KQEA 4Y6QA 3BE6A 1Z6YA 3E18A 3OJ0A 5I3ZA 2ZLBA 3DGFC 4S04A 1K68A 1D7AA 2P62A 4GX2A 3B6IA 1HI9A 3WV4A 2H4HA 4P4GA 4TVBA 5LOVF 1I33A 2EKZA 4B0PA 3VSDA 8ADHA 3RRZA 5TQ2A 1EK5A 3KXPA 1G21B 5KYTA 2GEDA 4X44A 3SC2A 2B7LA 3O8DA 5TNXA 1SKMA 1WB6A 4IP0A 2P9CA 4MIKA 3ZCPA 4RY9A 4CKCB 1WQ3A 1P45A 3GUZA 3M7IA 3W5CA 2HAEA 4WFQA 2H1SA 4IDBA 4BVAA 4ENRA 5KTNA 3P8ZA 4Q66C 4UU8A 2J5QA 3DL0A 3GFSA 4QUEA 3CONA 2GHRA 2Z30A 4OJQA 4R9UC 5BOVA 3ZDAA 3UYKA 5IKMA 3RIHA