4OU4A

Crystal structure of esterase rppe mutant s159a complexed with (s)-ac-cpa
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
319
structure length
319
Chain Sequence
SGSPGVEQHTQAFLEALEQGGGKPLEQLSPKDARAVLTGAQASVKVDLSGIEVKERTIQANGQSIKLQVVRPANVKGELPVFMFFHGGGWVLGDFPTHQRLIRDLVVGSGAVAVYVDYTPSPESHYPTAINQAYAATQWVAEHGKEIGVDGKRLAVAGNAVGGNMAAVVALKAKEAGTPALRFQLLLWPVTDASFETASYKQFADGHFLTTGMMKWFWDNYTTDAKAREQIYASPLRASSEQLKGLPPALVQTAEFDVLRDEGEAYARKLNAAGVTVTSVRYNGMIHDYGLLNPLSQVPAVKAAMRQAGTELKVHLQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Pseudomonas putida esterase reveal the functional role of residues 187 and 287 in substrate binding and chiral recognition
pubmed doi rcsb
source organism Pseudomonas
molecule tags Hydrolase
molecule keywords Alpha/beta hydrolase fold-3 domain protein
total genus 117
structure length 319
sequence length 319
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2014-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ou4A00
2XMRA 3HEAA 2PSEA 3L1HA 2QM0A 4HVTA 3HABA 4CIAA 1ETHA 5LZ7A 5HK9A 2H7YA 5JAPA 4DMHA 4BTVA 1LPPA 3LIIA 4L0CA 1DX6A 4JNCA 4H77A 3IIIA 5JARA 3ZLTA 2AJLI 2GBGA 4GI1A 2ACEA 4X71A 4RGYA 4E46A 3I2FA 3D2BA 2AJBA 2Z8ZA 4KEAA 1ODSA 3IBTA 2I3ZA 4X92A 3QITA 5T4BA 5K3CA 4B81A 2XUQA 3WMRA 5A7FA 5D7BA 1F0NA 1CV2A 3QPCA 5KWIA 1EX9A 2E3JA 1N5RA 4DLNA 1GPKA 1WB5A 4EY4A 1F6WA 4BBZA 1EK2A 3WA6A 3QBJA 1ZI9A 3NUZA 1XRNA 1W4LA 3AJAA 4GECA 4K6HA 3DDUA 3AUKA 4CG1A 1YAHA 1W75A 5AICA 3EQ7A 3ESAA 2XMDA 1M33A 4LXIA 1AUOA 4LHEA 5SYMA 1HDEA 3I2IA 2C5FA 5AKXA 3DNMA 2PM8A 1ZI8A 3G9TA 4DMCA 4BRZA 2GYVA 2ROQA 3G0IA 1ZIYA 5AKIA 3WIBA 4QLOA 4EY8A 2GBCA 3GBSA 5AP9A 3QZUA 1E66A 4CCYB 2C4HA 2XQKA 3C87A 1O6FA 2D5LA 2XQJA 4HRYA 5CBKA 2VJCA 1HKHA 1I6WA 1XZBA 5HKBA 1VE6A 2PVSA 1MNAA 1F0PA 1GXSA 4UHHA 3IURA 5FPQA 2X5XA 4H35A 4GBGA 1IVYA 2ZYRA 5EFZA 2QT9A 1HLGA 2DHDA 2WIFA 5ALRA 2O2IA 4BAGA 3NOXA 1XZGA 4BDSA 1MPXA 3K6KA 5E4YA 3WK7A 2WSLA 2IIVA 1DWQA 2C0PA 2XUPA 5EHXA 4OYLA 1H2YA 1XLVA 5K3AA 3T4UA 1BROA 3LCRA 2WG2A 1YA8A 1B41A 3I1IA 4GWLA 1YAJA 3G8YA 2XMGA 2XE4A 5AKKA 4B0OA 6YASA 1YB6A 2ZJ7A 1UFOA 1FFEA 1LPOA 4EBBA 1K4YA 3KD2A 4BAUA 4NZZA 1TCBA 4UBIA 2V97A 2Y6UA 3LS2A 1IUNA 2H7CA 3BIWA 4C4ZA 2XUIA 4DGQA 4M0MA 1WOMA 5FUMA 3O4IA 3WIOA 1BU8A 4X97A 2HA5A 1HQDA 1QE3A 3X3HA 1CUJA 1QIMA 3Q8WA 4OYYA 4B85A 1U8EA 2PSFA 3D7RA 3BIXA 4YK7A 1QO9A 1E8NA 4A23A 5YASA 3IUMA 1LPNA 3D0KA 1IUOA 4LXHA 1VXOA 5CT6A 4XIIA 4ZWNA 4FNMA 5HF8A 1QIFA 2VJBA 4DNFA 1EDEA 3QVMA 5D6OA 2C58A 4DSZA 4C4XA 1QJ4A 2HA0A 1A88A 1BEEA 2VJAA 2H9YA 2W6CX 4GW3A 4HTAA 4OU4A 2OQIA 1YA4A 2EDCA 3B3QA 1QTRA 1MX9A 1MAHA 1EK1A 1T4MA 2VSQA 4MXDA 1JFRA 2QXTA 4HAIA 5ALGA 1OXMA 1QOZA 5LZ9A 3O9VA 4AO8A 2J4FA 2XUHA 3WI7A 4ARBA 2XMQA 1GKLA 3QPDA 5HCUA 5LKAA 1XZCA 5T4EA 4Y2QA 3DS8A 5ALIA 2BGNA 4G4GA 3D59A 3TEJA 3FOBA 4Y2JA 1BN6A 1ZI6A 3FLBA 4TGLA 5A6VA 1TCCA 4FLMA 4W1SA 5ALEA 1CLEA 4IH1A 2WG0A 4GEGA 4F0JA 2XUDA 1ZGBA 1U2EA 1AZWA 2CMFA 5T4HA 2B4KA 3M81A 5AK3A 2JGIA 5ALZA 2QMQA 4PNZA 2XUAA 2RIPA 3C43A 2HA4A 4AMZA 2VF2A 5K3EA 2P8SA 3WJ1A 2HRQA 5DJ5A 2CUTA 4X85A 1CIJA 2FX5A 4XX1A 2C5GA 1PV1A 3JWEA 4Y2SA 3DLTA 3HLKA 4ETWA 1DQYA 1JMKC 1EDDA 1LPSA 4HXGA 1TCAA 4DNPA 2WJ6A 1USWA 3IUNA 3FLAA 1CUYA 2AJCA 5AOBA 3IB3A 1IZ8A 5ALDA 5FV4A 3OG9A 3WYDA 2R11A 3VJKA 1GKKA 5KREA 5AM5A 4JEIA 1AC5A 1P0IA 1ZGCA 3DJYA 4MQLA 2JF0A 2O7RA 4ZREA 4X94A 5DWDA 5JATA 4B9EA 2XQIA 1QIGA 4P93A 4B6GA 4AO7A 3AIMA 1DTEA 5DYYA 5AK6A 2XQGA 3W9UA 2WG1A 2VTVA 4CG2A 3CN7A 2ES4A 2HM7A 5HKAA 5FKJA 4UHEA 5CW2A 4EUSA 4N5HX 1H2ZA 4KE8A 4CIBA 3V1KA 2VT7A 4H7EA 1WCYA 2WKWA 2YXPX 3K2IA 3ZI7A 3WL6A 2XUKA 5D3KA 4OD0A 5FRDA 4A5SA 3STUA 5HFAA 1GPLA 4U2DA 4GXNA 4WCVA 4QE3A 1EXWA 2R8BA 5I7UA 5A2GA 2V96A 2GBIA 4U2BA 1UKBA 3MVEA 4X3CA 2X8BA 2GYWA 1IUPA 2B61A 4RNCA 4EY5A 4C6HA 1N8SA 4CCWA 4H0CA 3C45A 5AI5A 4ZV9A 5AKGA 4MJ3A 3JYHA 4A16A 3STVA 5FDFA 3FVRA 3GFFA 1ZD5A 5ALOA 2WIJA 3HZOA 4PSCA 1QIEA 1IMJA 2PL5A 3C8HA 2JGJA 4C89A 1G42A 2QOEA 1K8QA 4K6KA 4J0IA 3UMJA 2O2HA 2QUAA 3HI4A 4EHBA 3KWJA 1LPMA 2QRUA 2HDWA 4AZ3A 3L1IA 4PQEA 2G63A 4X95A 4KJXA 1CVLA 3F9CA 4AXBA 3PFBA 2O2GA 2LIPA 1XZMA 1DWPA 3BDIA 4X6UA 1DINA 2QUBA 1E8DA 2DR0A 3CCBA 4DM7A 4DSAA 3U1TA 1EB8A 2WUEA 1H2WA 2WHRA 3MGAA 4RE6A 3PUIA 3G9UA 5AKZA 5IVHA 1KU6A 2RONA 4MQMA 1XZFA 4IHAA 4BZZA 4H7HA 1EVEA 1SC9A 1DX4A 1DU4A 1C7JA 1R50A 2WU3A 1UT6A 3C6BA 4U2EA 3WA7A 3I6YA 4WDQA 5CMLA 1QIIA 1WB6A 2WU4A 3WWOA 1A8UA 5JZBA 1CUVA 3R3VA 1EA5A 2HU7A 3ZPXA 4BE9A 1CUSA 1SOMA 5AIBA 1ZICA 4XVCA 3GA7A 4FFWA 4BVKA 1J06A 1ZD4A 2XUGA 4E14A 2XMZA 1UK9A 5CXXA 5I9IA 4AN0A 1SCQA 1IZ7A 4Y2UA 4DNQA 4QWMA 2OCGA 1NU8A 1XZIA 2VATA 1ZJ5A 3AFIA 1JJBA 1ODCA 5JIBA 3I2GA 5AK5A 4HXEB 1UOQA 1Q83A 2VEOA 3R0VA 3G0BA 4ZGBA 1BEZA 1X70A 2W22A 1XZLA 3D3NA 1EI9A 4TPKA 3BJRA 4N8SA 4F60A 3WZLA 5FPPA 3DYVA 5AI9A 2WUDA 2ORYA 4MWSA 4WFJA 4X00A 5JANA 3VKFA 3O95A 4PW0A 3IDAA 4CG3A 4HXFB 1VLQA 4YPVA 4G9EA 4N8DA 2OGTA 4PF1A 4X6XA 5CXUA 5EIAA 3W04A 4G9GA 1T2NA 1YS2X 2QJRA 3QMWA 4QDZA 5E2IA 2Y1KA 2HADA 3M82A 3AIKA 1LPBB 2WIDA 4UBJA 1UKAA 3IA2A 1AGYA 2GYUA 2BUAA 3F67A 2ZSIA 3FLEA 3FBWA 5F4ZA 2ACKA 4J0DA 2ZYSA 5DTJA 5A71A 3SK0A 2PPLA 1QIKA 1AKNA 1UKCA 2BAGA 1WB4A 3ILSA 3MUOA 4UHBA 5K3FA 2PU7A 4DNOA 4LIPD 3KXPA 1ZJ4A 1YASA 3G7NA 1CRLA 3ANSA 1TKRA 2QJWA 2GZRA 4G8CA 1A7UA 1WM1A 4KE6A 4Q82A 1LZKA 1UWCA 1LBTA 5DNUA 4QZVA 2RI6A 4Z49A 3H2JA 4BCDA 2BKLA 4L3WA 3KDAA 4ZRDA 4OB7A 1JT2A 2CBGA 4PO3X 4BC1A 2YASA 2WJ4A 1Q0RA 4HZGA 2PSDA 4Q3LA 4KE7A 2I78A 3E0XA 5IVDA 1Y7HA 4J03A 2HA7A 4HRXA 1YR2A 1ORWA 5BOVA 5IVKA 2WLSA 3R3YA 1XLWA 5EI5A 2BCEA 3R40A 4FFVA 2OCIA 3P2MA 2UZ0A 4G5XA 1MX1A 2XB6A 3WWPA 5AI4A 1CUBA 2QZPA 4Y9SA 5JALA 4BVJA 3AILA 2K2QB 5BWBA 2BUCA 5HK8A 3EQ8A 3CN9A 3DKRA 2BUBA 4B9AA 5KWJA 2Z3WA 3HXKA 3A2MA 3ZV7A 1W76A 5CH5A 5FOQA 4JUIA 3QMVA 5LZ8A 4J7AA 4MEBA 4AB1A 3WL8A 1UXOA 4P08A 2XMSA 1SCIA 2Z5GA 1YS1X 3R3WA 1CUWA 1X2BA 4H18A 5D3ZA 3STWA 1VZ3A 1W52X 4QA9A 3D4LA 1XZAA 2IITA 3N2ZB 1E89A 4IH9A 4AX4A 1LBSA 1H23A 2AJDA 3DEAA 1GQRA 4I4CA 5ALJA 3V1LA 4GLBA 2X76A 1QTIA 1TIBA 1GZ7A 4UHCA 2XI4A 2JIDA 3C6XA 5H3HA 5JYCA 3O4JA 1KU0A 5KBYA 5DNVA 3ESDA 1XQXA 2OCKA 3GROA 5ALFA 4FMPA 5CH8A 3VDXA 5K3BA 2HL6A 3W06A 2HIHA 3QM1A 4GHWA 3KOOA 1P0QA 5JZSA 3ESCA 3WK4A 4E15A 3PUHA 3PDCA 2OAEA 1XRMA 4M0FA 4UUQA 1Q84A 3BL8A 1G4HA 5JAOA 1S8OA 1K63A 2OQVA 2EEPA 4ITVA 4BYMA 5EGNA 2JGLA 3FYTA 2WFLB 4FWBA 1XZDA 5J3JA 4BP8A 3C70A 2XLCA 4JH0A 2G5TA 4WFIA 3PFCA 2QKYA 2V98A 2B9VA 3G0DA 1R3DA 4H7KA 3GZJA 2WUFA 2ZJFA 4RE5A 4B83A 1QLWA 4L9AA 1CR6A 1MO2A 1QFMA 1R88A 2CJPA 2DSNA 2XT0A 3H17A 4B0PA 5C7YA 1MU0A 1CUDA 4AMYA 2ZJ6A 1E8MA 4J0HA 4UBOA 5LKRA 3H18A 3BF7A 3ICVA 1W1IA 1XRPA 2QTBA 4Y7DA 4C01A 2Y6VA 1L7RA 2RGUA 4BC0A 4MEAA 2JGEA 4G8DA 5LLSA 1XRLA 3IULA 4Y2TA 4W1QA 2HHAA 3TRDA 1J07A 1VA5A 2Q0XA 2DQZA 1PJAA 5E4JA 5HQ3B 3S8YA 2HRRA 2XUFA 2WUGA 4OPMA 3WL5A 1JU3A 1X2EA 1CUFA 3HRHA 3OC0A 2PUHA 3U0VA 4KAJA 5LP1A 1QIHA 2FJ0A 4WY8A 1XRQA 1ISPA 1SFRA 1Y7IA 1R9NA 3EBLA 3F97A 1THGA 1L7AA 1D07A 4X90A 2J3QA 1CUIA 3DOHA 4B7ZA 5I8PA 3R3ZA 5JD4A 1XQWA 2AXEA 1JJFA 3WK6A 1VA4A 2CB9A 1FFBA 4FBLA 4L72A 2EDAA 5LIPA 3BDVA 2OAGA 2PKYX 4AZ0A 1TAHA 4P92A 4C88A 1GPNA 3WQHA 5ALTA 3O9MA 3H2GA 5ALQA 3WKEA 3I6ZA 4N5IX 4BP9A 5AKHA 5FXMA 3HYSA 4H7IA 1WHTA 5HZGA 5AM1A 4BCCA 3FYUC 3ZLVA 1HBJA 4I3FA 4Q1VA 3DOIA 4C87A 4UFOA 3B5EA 4CFSA 3G9ZA 3H2IA 4W63A 2B20A 3E1GA 4UBNA 1TQHA 5BWCA 1ODTC 2Y2VA 4X91A 3L1JA 4H7DA 5AO9A 1G5FA 1MTZA 5IKXA 1XFDA 4BRSA 5ALXA 2WILA 5AKJA 2J4CA 3W9BA 5JADA 1G66A 3O4GA 1MNQA 2XMBA 4UBKA 1ZOIA 4FOLA 2HFKA 2G5PA 3I1YA 1LNSA 3STTA 2VAVA 4DTCA 3WK8A 3A2LA 1XROA 5AJHA 1DT5A 1U65A 3F96A 5AM0A 5CTAA 3H2HA 3H04A 1EB9A 1F8UA 2WIGA 1XZKA 4Q3OA 3WWDA 1FFAA 1A8SA 4X6YA 3BJMA 5JD5A 4DYHA 3HACA 3MUNA 4BATA 2XDWA 1RYYA 4Y2YA 1LLFA 2HA6A 3RK4A 3V1NA 2ZSHA 5ALKA 3UUFA 1GT6A 5IVIA 3YASA 4CCYA 1ZD3A 4K6GA 3EF3A 1R4ZA 4J0JA 4EA6A 3STXA 3OM8A 4KYVA 2HU5A 1EH5A 4B82A 4Y2PA 4MWTA 1GGVA 4FTWA 5AM2A 4UFNA 4BVLA 4ZV7A 3WWCA 5AM3A 4P9NA 4LXGA 4U2CA 3F98A 3HSSA 4NS4A 5C8ZA 3STYA 3BXPA 1AX9A 2HA3A 3FCXA 3DD5A 1XRRA 3I2HA 3PI6A 1UOOA 5C81A 4G4JA 3FYUB 3V9AA 1LZLA 3FWHA 5DYWA 3N0TA 4Y2XA 5DTIA 2O7VA 3F8SA 3DL4A 1XZJA 4Q34A 2I03A 2JGKA 3OPMA 5AH0A 4QDTA 5A7GA 3OURA 3T52A 1XZHA 1VKHA 1BE0A 5ALYA 1BN7A 4EY7A 5IH7A 5JAUA 3VISA 5CRIA 1CUGA 2RHWA 3DKKA 4O08A 1BCSA 4LYDA 4PSUA 1AURA 5AOCA 5HF9A 2H1IA 5ALMA 4OB6A 2WIKA 1XQYA 4KRXA 1W6RA 5A7HA 4G1FA 1JMYA 3FSGD 4KAAA 3RKSA 1P0PA 1UZAA 2GBFA 5HF5A 4BTLA 3LIPA 4FLFA 2QS9A 4PSDA 1OILA 4Y2RA 1CUZA 2WHQA 4IH4A 3HJUA 4BAZA 3FVTA 2WFZA 4W1PA 1MN6A 2C7BA 3C6ZA 1QO7A 4KRYA 2DHCA 2YYSA 3QMMA 2XQFA 4TVKA 2OXEA 3WL7A 1TK3A 5CURA 1TRHA 3E4DA 5FP0A 1AMNA 5BV7A 4WDRA 4J0CA 5LZ5A 3ED1A 4H7FA 3E3AA 2VJDA 5C8XA 3R3UA 3I2KA 4UHDA 1J1IA 4GDMA 4JYMA 3S2ZA 5EIHA 5EHNA 5EIEA 5ISMA 5AI6A 4U2GA 1UK6A 2AJ8A 4Y2VA 1FFCA 1CQWA 5AHXA 5DNWA 3WWEA 1VZ2A 2PU5A 1ZIXA 2VT6A 3WK5A 3RM3A 4FHZA 3LP5A 5ALSA 5JASA 2PBLA 3DL7A 2WJ3A 5SYNA 5CT8A 4AQDA 3I28A 3WLAA 4F5ZA 1CFJA 3FYUA 4BE4A 1DT3A 2PSJA 1EDBA 4IO0A 5CT5A 3PF8A 3WKCA 1CUAA 4KAFA 1SCKA 1YCDA 4QWWA 4BDTA 4K2AA 2OPHA 4HS9A 1GQSA 3WK9A 2ZYIA 1ACJA 2ECFA 4FKBA 1VXRA 7YASA 1E5TA 1N5MA 1QGED 4B84A 2JEYA 2OCLA 5E4TA 4DIUA 1LGYA 1UK8A 3R3XA 5AIAA 4QDXA 1VOTA 5HFNA 3AZPA 4WY5A 1HPLA 3W05A 4D9JA 1NX9A 5CT9A 3PE6A 4UPDA 1YB7A 4MYSA 3UUEA 3H1AA 1NU6A 4QLAA 5AKEA 1MX5A 5ALHA 4EY6A 2FJPA 3SC2A 1FFDA 3HC7A 2OG1A 4UHFA 1OCEA 4S0XA 3AZOA 4B80A 3C8DA 1XKTA 1MT3A 4Q3KA 3G9XA 4H7JA 3A2NA 3RARA 2OGZA 4IQ4A 5JZ9A 1Q0ZA 5ALVA 4FNGA 3BE8A 4J0KA 5CT4A 5ALLA 1BS9A 5ALWA 3M83A 2G4LA 3DQZA 3ZWQA 4F21A 3W2TA 4ZI5A 2WHPA 3Q0TA 4M0EA 3H1BA 1WPRA 2OLEA 1VE7A 2PSHA 2VA9A 4UBMA 3TJMA 3H0CA 5C8VA 3BF8A 1QZ3A 4G4IA 1B6GA 1L7QA 5DYTA 3OOSA 3WYNA 2PX6A 4E11A 5HF6A 1PFQA 5A62A 2JGFA 3DCNA 1AQLA 4INZA 3IUJA 2V9ZA 3WZMA 3I6MA 4ZXFA 4DMFA 1CUHA 3TGLA 5T4FA 4WJLA 3GELA 3D2AA 5FLKA 3BWXA 1N1MA 2GZSA 1MJ5A 3IUQA 3R41A 4AN1A 5ALUA 1ACLA 1DQZA 1RP1A 4OB8A 2BFNA 1EHYA 3A70A 2FUKA 3C5VA 1UK7A 4I19A 1JI3A 1BCRA 3C5WP 2QXUA 2HA2A 5AOAA 4MYDA 5LZ2A 1QONA 4UFPA 5JD6A 5CH3A 3WKDA 2PUJA 5DLPA 5JAHA 1ORVA 1R9MA 4LYEA 3CCCA 5ALNA 3FSGA 4YX9A 2J3DA 4UBLA 3QYJA 2IX9A 3O4HA 1WHSA 4QDUA 1J2EA 2OGSA 1R1DA 1JKMA 3ZLUA 4EZIA 2JEZA 3SX4A 1CUCA 1WPXA 4BB0A 4XJVA 2Z3ZA 5K5EA 3NGMA 1Z68A 3OTQA 1XQVA 4FDMA 1C7IA 2DHEA 1XKLA 2VQ6A 4BZWA 4J0GA 2NW6A 1THTA 3G0GA 3ICWA 2HU8A 1CUXA 4EB0A 3H2KA 2DFPA 2Y2UA 4OUKX 2WQZA 3CXUA 3FNBA 1FJ2A 3GUUA 3EIOA 4OCZA 2CZQA 4G8BA 3ANTA 3LLCA 4N8EA 2C0QA 4DMKA 2YH2A 2WFMA 2JBWA 3V1MA 4CI9A 3O0DA 1QFSA 2CEKA 2DCMA 1CEXA 5AI0A 2DQYA 3AZQA 2JGMA 3RLIA 3VVMA 4QNNA 3QPAA 1MAAA 3DYIA 3EQ9A 1XZEA 2XUOA 4XWGA 1JJIA 1A8QA 2D0DA 3AINA 3KSRA 1O6GA 1U4NA 3G0CA 3I2JA 4ARAA 3WKBA 2BJHA 2WFLA 1K6EA 3VVLA 1VJ5A 1CUEA 3G02A 1QIDA 4X7BA 5AK4A 2Z8XA 4C4YA 4FBMA 1EVQA 4AO6A 1EINA 1UOPA 1P0MA 4PV7A 4RPCA 3D2CA 4JYPA 4KACA 2RAUA 4NMWA 4FLEA 1H2XA 3WJ2A 2I3DA 2HFJA 1LPAB 3C6YA 5LYYA 5LZ4A 1H22A 4KE9A 3PICA 2XUJA 3VXKA 3FAKA 4W1RA 2RHTA 3AIOA 1DWOA 4LKOA 3QH4A 4Q05A 1CQZA 2WTMA 4YASA 4NVRA 1K5PA 1YSCA 3D5EA 3NWOA 2XMCA 3PF9A 2WM2A 5ALPA 1CUUA 2H7XA 3FCYA 3K9BA 3VJMA 3M3DA 5HQ3A 4OSEA 4J3JA 1JU4A 4U2FA 3B12A 1KEZA 2CKMA 3WKAA 4X93A 1QIJA 2BGRA 5EHZA 4QEKA 3VJLA 2XLBA 1FSSA 2ONCA 2ZVDA 5K3DA 5AI8A 4W9RA 5K3FB 4V2IA 2QR5A 3KWFA 1RWQA 3JW8A 3A6ZA 1Y37A 3ESBA 1ZD2P 3SWWA 2WHPB 2VAXA 4K5QA 4BCBA 1HL7A 3IVMA 5AKYA 3H19A 4OU5A 4WFKA 1XLUA 1E3QA 5ESRA 4QDOA 5EHQA 1BRTA 2WTNA 1CPYA 2QVBA 2ZYHA 4ROTA 3V48A 5AKLA 1C4XA 5AM4A 4KR0A
chains in the Genus database with same CATH superfamily
2N3ZA 3E7FA 2B0JA 3FNIA 4JL6A 2WYHA 2PSEA 2ZR8A 1N1DA 5EKDA 3RS3A 3U9SA 4Q1DA 2JHCA 4IDAA 5TQVA 2W37A 3A58B 1MC5A 2UUPA 1N3IA 1SBIA 3JTMA 4L9SA 5BSUA 4DMUB 2G70A 1RWBA 1WUJS 1FQJA 1XTZA 2R751 5LZ7A 4CIAA 1LBHA 3UB3A 4TTQA 2OFPA 1H8EA 2Z1MA 3GAAA 5KQSA 3WGIA 5JAPA 5EC8A 4H3HB 5HW0A 2ZWAA 1OYWA 3NALA 4U63A 4KPUB 5IJ9A 2VR1A 1XT6A 5TRTA 3ZQ6A 1GG9A 1R4MB 4L0CA 1UUFA 1VIAA 2GO1A 3KU1A 4FW9A 4DDHA 1DX6A 1PJ4A 1V11B 2R4UA 3DW3X 5M04A 5IASA 4H77A 4MR8A 2WVAA 2PGLA 3IUYA 1NF8A 5JARA 2JKYA 1HT2E 1ZNWA 2Z56A 5KDOA 2GBGA 1NNLA 4Z2YA 2QSJA 4GPBA 2ZZMA 2M98A 1NW7A 4MIEA 4DHEA 2XBMA 2G3YA 1L8QA 1J42A 3AETA 3M49A 4P6VF 1YT5A 2NYUA 3PUYA 3KZVA 1GDDA 3FRHA 4IFBA 5KTMA 1N92A 3LY8A 4C4SA 1A8HA 4CM1A 1Y5RA 3PD0A 3DSRA 5JHHB 1ZONA 2D5IA 2C42A 5FYQA 5AW4A 3T4XA 3UYKA 3H1PA 5GWXA 4OXIA 4RTKA 1TOAA 5K3CA 5CB4A 3PEUA 2IIPA 1D2AA 1NIJA 1JXQA 2XUQA 1Y6QA 1F0NA 1SQGA 3QPCA 4K03A 4MCIA 4MRSA 2EZ4A 1O94C 2CUZA 4IG9A 3F1LA 1MD9A 4FZVA 1H2FA 4MUYA 3U7IA 4EJ2A 1JDBC 1LK7A 2EFCB 2VYVD 5H83A 4Y6QA 2IX3A 2FE1A 1LBIA 4KQFA 5DO9A 4EY4A 2HQRA 2O2ZA 1YU6A 4XPZA 2D4AA 1GN9A 2RD2A 3ELYA 4F9GA 4ONEA 1ZXLA 4B3GA 3WIUA 4MRMB 1QP8A 2CXHA 3IPXA 4TKUB 4YRDA 5IMSA 1NQWA 4X3PA 3NUZA 1QRSA 2XT9A 1G59A 3FLMA 2EW2A 2PKQO 4GECA 4O2AB 3ZJ4A 4YIHA 3MMZA 1UBTS 3RW9A 4JLNA 3A9SA 3O26A 2FMFA 1P7YA 4Q02A 4BB6A 1QC5A 3UATA 3ZBUA 4CFZA 4CG1A 4RFVA 1YAHA 1W75A 4B7XA 3GJ0A 2G1KA 4HYTA 4DLSA 5GONF 2EGGA 1MHTA 3I9OA 1VGVA 4OHCA 1XZQA 2R1ZA 5CDTA 4LHEA 4R0VA 4ESOA 2CV0A 2RGNC 2QRGA 3L7YA 3VKHA 3DLAA 3OZBA 4TV9B 3CLSD 5C2JB 4CHTA 3HV0A 1YI0A 1HDEA 4TXLA 4HWRA 3UK0A 4HDRB 1BS2A 4DMGA 3H9QA 3AR3A 3HSYA 3PHGA 1GQYA 3TRKA 3W5IA 2BFBB 4DMCA 2DFLA 1BE8A 2ROQA 3MGBA 1AZSC 2E4WA 3WWYA 5T6BA 1C8BA 4QLOA 2ETXA 2W8BA 5IMBA 5AVZA 2OCAA 4QXQA 4JXXA 1FU4A 1TZKA 1EX1A 3VR5H 4CCYB 1NJ8A 2Q9UA 5A6SA 2X9QA 1YIAA 3C87A 3R6LA 4EUHA 4N5NA 5K2OA 3EXG1 2ZUUA 4JS0A 4QREA 4HRYA 1L5LA 1PKEA 2WV9A 2OXRA 3MG9A 3UC9A 1BU5A 3D8RA 4POOA 5CBKA 5IUJC 1GA1A 1HKHA 3BD8A 3BXFA 1BMDA 4OQDA 4BKPA 2GWHA 4IJWA 3PE3A 4UXIA 2DSTA 4B17A 3TQOA 1JL3A 1R0KA 1SK8A 3J80A 2A30A 5CA0B 4UHHA 4QG3A 3D6MA 7MDHA 5K09A 3IQHX 1KFCB 1OC2A 3QNWA 4OHKA 3GGJA 1ZN7A 5JE8A 3ZHUA 1KO7A 3AI7A 2ZYRA 2QT9A 1DOAA 3DB1A 5HQTA 1ZJYA 1FLAA 3HL4A 4CG0A 3NTLA 3W6PA 4ZJZA 4GRDA 4BJ3A 5L9AA 1CS0A 3ANNA 4AS2A 2AG8A 5EMHA 3EOAI 2O2IA 3QKRA 3MWEB 2ECKA 4A0HA 4YI5A 4CM4A 3ST7A 5AJYA 4KPEC 3RTBA 1BXKA 1KGDA 4BNDB 3NOXA 3L18A 3T9CA 1FFSA 1NM5A 2W4MA 5KWVA 5L3SA 1QMGA 2FJUA 2HQSA 2OO5C 4D81A 4Q6BA 1V6AA 4Q03A 2HK9A 3K6KA 2HXGA 5H4HA 3SIRA 4BWYA 3WK7A 2WSLA 2IIVA 1ZOSA 4AJPA 1X13A 2XUPA 1VSBA 3COYA 3I09A 4YAUA 1RQ7A 1H2YA 1TJ4A 4KMOA 1OU4A 2DUNA 3T7AA 2B7BA 2VL7A 1KMMA 1SU8A 2Q62A 2WG2A 3GNTA 1YA8A 4FGUA 4QRHA 2Y0BA 3I1IA 3V46A 2JLBA 2ZUTA 1HRKA 1REQA 2AFIB 3ROKA 4C0AC 5FEMA 1CY0A 5HZKA 2QK4A 1UBOS 2IU0A 1T5BA 1Z6TA 3QWIA 3ZKWB 2YBEA 3IE0A 2CLEB 2CDBA 2TMGA 1TA4A 2XNDA 4Y8VA 4EJSA 4IS2A 1FUKA 1QHSA 1RCTE 2NU9A 5TV2A 1E0JA 4XCXA 4B0OA 2ZJZA 3LO8A 1H05A 1R4AA 2Q3JA 2ZI7A 1YB6A 4X0EA 1EE9A 4LYYA 3VPHA 5A4MS 3L07A 2GVNA 4JR2A 3T3DA 1TVKA 2ZJYA 2QRHA 4TLAA 4F56A 4MUNA 2W6OA 3VO8A 1C9MA 2E4VA 4MPPA 4PCVA 4E4TA 4JB3A 1IOVA 1I3MA 3JYNA 2Y6UA 2HSDA 4LDNA 4NK4A 3R7WA 1W1UA 4XQGA 2H7CA 1ILWA 1RYHA 1Y7PA 2V55B 5DHUA 4GZLA 4MMZB 4NEQA 2CV2A 2BVNA 2H5JA 1FDRA 1GLGA 1Q1QA 2CLMB 2XOKD 3CEHA 1SD1A 1X7YA 1MQSA 4ZO7A 5KMGB 1BVUA 1RI1A 5C1OA 4CFYA 2O3JA 1HQDA 1GCIA 1N9KA 2IE8A 4QNRA 2Y92A 4F71A 3UMCA 1YR7A 1UEXC 3X3HA 5D1NA 2VRCA 2ZAYA 5ESXA 1PT9A 2R62A 4CU5A 1JT9A 3FZYA 3JQGB 3O7WA 5IP5A 2P11A 5LP6C 3ULKA 5J2TF 3VUEA 4UTNA 1EXDA 2H2HA 1UBRS 4KV7A 5C9ZA 5IJ0A 1C0IA 2I7CA 2PSFA 1QYIA 2G28A 3BIXA 4MTCA 1P5FA 4QULA 3IQEA 4E51A 2PXHA 1YZTA 4R7ZA 5FFMA 5L45A 1J5PA 3HBFA 2C9DA 2ZBUA 3LHSA 3PFFA 4IF4A 4KBFA 1LPNA 4O1IA 4IRMA 1GNVA 3CQ9A 3WIBA 1Z7EA 2R96A 4B3TB 1WF3A 4TTVA 4TX1A 5DN6D 5J4YA 4L76A 4B6EA 5HJEA 2QYHA 5ADVA 4H1WA 3VU9A 4TRJA 4Q16A 2RH5A 3LGAA 3FDXA 3F49S 2FPGA 3QF4B 3A4TA 3SDSA 1RXSA 3CRMA 5BSFA 3L0PA 1C1HA 2ZR9A 4Q3AA 4Z9FA 1T5TA 2B7LA 4II7A 2GSWA 3QVMA 1HE4A 4GT1A 3OM0A 4XWTA 4YCSA 1E0KA 4Y6RA 2G1PA 4IXWA 4OXXA 4C4XA 3A6LA 1I3CA 1NFQA 1QJ4A 3NFRA 2HHLA 3L4KA 4KXXA 2PVCA 3IR7A 5A3RA 2ZTUA 4HQFA 2HA0A 3U39A 1A88A 3MMNA 3H4MA 1J0AA 5JXIA 4CT5A 2JFHA 4V0OA 2AXQA 4UDYX 3AVQA 3LCUA 4BO5A 1M2KA 4OU4A 1Y8RA 5L7TA 1JDJA 2AF3C 1FYFA 2RGXA 3C5CA 4WESB 5SV2A 1BIFA 4JUDX 4UNNA 4ZOLF 3V8PA 4ZDIA 4RTOA 2B1IA 2ZUWA 4PCAA 4AVYA 4QOEA 1KY3A 1P9RA 4Q9DA 1U0LA 5BN3A 1QS0A 3RT9A 4ZPJA 5L40A 2O8EA 4BYGA 1KIMA 1CJSA 3CJRA 4IXTA 1H42A 1M6WA 1MO4A 2B5OA 2IZ7A 4M76B 1IHDA 3I6QA 4EPTA 4X84A 2IYXA 2CNWA 4ED9A 4IQGA 2W70A 4M7PA 5CU7A 4MP8A 4FI3C 3HDYA 1Z0JA 3S44A 1Y9EA 1QV6A 2HN9A 2RHMA 5G0WA 2C92A 4DCGA 3B7PA 1Z6GA 4FGLA 2OHIA 4BQEA 3RYIB 1U7HA 5KJ1A 2POQX 1OFHA 1ZM2A 2VO1A 3O9VA 2HLNA 4UM8B 4BMNA 1DJMA 1TJ3A 4ARBA 4N7BA 2AEJA 4R69A 5HCUA 3T99A 1XZCA 3FMGA 3IALA 5I5GA 3FNQA 3KV1A 3SG0A 2RGGA 3AL0C 4F3YA 1RBMA 2FWRA 3DS8A 2BGNA 3D59A 2HTFA 1G6OA 3TEJA 3N2KB 1Q19A 4NDZA 1V8PA 3FOBA 1L7VC 3LYHA 4Y2JA 4IKEA 2QNBA 1Q44A 1RCFA 2OV8A 5TVKA 3KAKA 5IEBA 5DIFA 3NKVA 2FN9A 2A0UA 4M0CA 1F12A 3W6UA 1NUUA 4QAQA 4NDNE 3P71T 4JA2A 2C78A 4F0JA 1IBCA 2FMIA 2V7PA 1XVLA 3NX4A 1ZGBA 1KZ6A 1ZMXA 2FQWA 1JECA 3L92A 3QBVA 4IDOA 2CMFA 1AG9A 2FFBA 2P6MA 3GAFA 2VBCA 1E98A 1Y48E 3E9QA 2F4VB 1G3UA 1E60A 4MW2A 3AM4A 3KV3O 3G0OA 5ALZA 2QMQA 4PNZA 3CV3A 2XUAA 2XYGA 2VUIB 3I6BA 3AR6A 2XDQB 3HPRA 4LWOA 2PS1A 2XNHA 3PJGA 2NZVG 1C80A 3L7KA 4R40A 4AKEA 1ZKMA 2AR7A 3FPGA 4D9GA 5AW1A 3OJ0A 2HA4A 3I0NA 4OQ4A 4AMZA 3SXJA 2Q7OE 4WI1A 1MW8X 3VU3A 2HRQA 4BZQA 1T0UA 4JEMA 2Z3VA 4XX1A 3GR6A 2C5GA 2D1TA 2WWIA 3A0RB 4N12A 5KS2A 3LY7A 3FIJA 3OIYA 1JJVA 1M2HA 3HLKA 3DE5X 2I1QA 3A36A 3VHRA 4F97A 3CLSC 3L4BA 5DH9A 1LPSA 4X1IB 5JLJA 4WZAE 2OQ2A 4UXJA 5GM2A 5LP6A 1EWVA 2JA1A 3M0EA 1TF2A 1Z4PX 2TS1A 3HA2A 4ER3A 4GBMA 5L6MB 1T0IA 3IUNA 1PAUA 2AJCA 1J56A 2WWHA 1HL3A 1R6XA 2YWJA 2IF0A 5IZ4A 2R79A 2CLFB 3WYDA 4CM5A 1FTNA 1PO7A 1PRYA 1ZMTA 2FMXA 3CGWA 2HF9A 3ZWKA 4ZHQF 1LKZA 3G1UA 4JEIA 2HWKA 1ZGCA 3K4PA 2VHZA 4HDKB 1B14A 3DJYA 2B98A 4WACA 3RIEA 3USES 2VTBB 2BSXA 2H1SA 3TK1A 1QAMA 1NONA 4ZYWA 1WP4A 2JF0A 1DLIA 1JDPA 4X65B 1P80A 3MEQA 2DM6A 4O1HA 1PD0A 3AL3A 4ZREA 1YACA 4KXQA 4M0LA 4DWOA 4RVOA 1SXJC 1HDIA 1WXWA 3P5SA 4HWPA 1F20A 1G21A 4X94A 5BOSA 3KVRA 1G2PA 1ORTA 2FDRA 1RMTA 2QU7A 2XQIA 4UTRA 5AW7A 4MVJM 3GCZA 1CULC 5ESDA 1WMEA 4L7QA 7REQB 3KL4A 4UEJA 1RZUA 2RJNA 4ZDKA 5D6NA 5C3UA 4LMRA 3VBEA 2VF4X 4QOFA 4V0SA 1FUYB 4WNYA 1V5GA 4EHKA 3LBIA 5JT1A 4OHBA 5KCMA 4EYEA 4HDSB 4P4SB 3JX9A 3RNOA 1S02A 2O5RA 2YFHA 4I1SA 4CM8B 2NWQA 2QVXX 4TUYA 2G6BA 4B31A 5KVVA 1O0BA 1JP7A 3C7TA 4HYEA 4ENTA 1VG1A 4AJ2A 4ZVRA 4CG2A 3PDUA 3RSQA 2OZPA 4B3JA 4ZEMA 1PNRA 3D6FA 3NM6B 1LI5A 2ES4A 1YRBA 3U44A 3KZOA 3DUFA 2XNJA 3KYBA 2ZJAA 5FKJA 1XDZA 1PWHA 2RARA 3M6UA 2B1JA 3OPYA 4QFCA 4UHEA 3SEFA 2AEEA 4URXR 3RUAA 1IB6A 4C05A 4J8PA 3GMSA 5DHTA 4EUSA 5CA0A 2CMDA 1PNQA 2D2FA 2CF5A 4E5SA 4KE8A 3DE6X 3IP5A 4CMAA 1GTRA 4RXTA 3CUUA 1IK4A 1L3CA 2VT7A 5IJ9B 3QELA 4H7EA 1EGQA 4E21A 3U5ZB 3KK0A 4TKZA 1HM5A 2XUKA 4BFXA 1CWUA 2QRKA 3W5JA 4E08A 3GOHA 1CS0B 2G0NA 2GCGA 4L2IA 4RHYA 1NQXA 4LTMA 3U5TA 2WWFA 5BVGA 4NCAA 4D97A 3FJ1A 3AR8A 5MN4A 3STUA 1KVSA 2QEQA 2P9TA 4YB8A 1QG6A 1SCBA 2ZAIA 3BWCA 4UNRA 4PYJA 1ZZGA 1ENOA 1M2JA 2QRNA 5BUQA 2B4QA 2O1SA 2AW3A 3TQIA 2FUCA 3A1FA 1GILA 3VPBA 1Q6YA 4R9NA 1EG7A 1X0XA 2R8BA 1O2DA 3LYLA 2GNPA 4RK0A 2HRDA 3ESQA 1RJ9B 1V71A 2IEZA 3EWIA 2ODPA 1ZM7A 1EBBA 3IVAA 4F86A 1HTBA 4KR9A 2ANBA 2HJRA 2GYWA 4RPGA 4LVCA 2VKTA 2AMYA 3SGLA 5HRAA 1WXHA 3KJHA 3QVGA 2V0NA 3QU9A 1ML4A 1IUPA 2B61A 2ZVJA 3IC5A 4MVJF 4Y1RB 1VGRA 1J5XA 4A5OA 4M38A 4LJSA 4B4KA 3ZVKA 4CCWA 1N2IA 1SC3A 4H0CA 3C45A 3FPJA 4JC5A 5AI5A 4C3UA 4Q7LA 1A97A 1JLKA 4MJ3A 3UJDA 2I54A 2J0UB 3JYHA 4FZ5A 2RGRA 1O5TA 1LTQA 3FVRA 2IUUA 2WICA 1U94A 1E62A 2X6TA 4E5PA 4EUKA 5ALOA 2ERXA 3V6MA 2WWXA 2QAIA 4EVIA 2WIJA 1DAOA 2DWCA 2XTJA 1NDHA 3KETA 3PRKE 3EXFB 4AMVA 2BKUA 2UYOA 1QIEA 3KRTA 3P52A 4B09A 3H05A 4UJ3A 3UT0A 4A0FA 4ZAZA 3TZCA 3VYRB 1PUXA 2FUNB 2JGJA 4C89A 1G2QA 3GFVA 1JQLB 4UW9A 3R7WB 5B36A 5ETJA 3O8QB 3CH4B 4O8CA 3KPJA 3R0JA 3FPCA 1K8RA 4ND5A 1I2AA 2G76A 2RIRA 3DP9A 3X1WA 1GSIA 2GEUA 2X0FA 4J0IA 1YHNA 1CQIB 3A3OA 4ZFNA 2LUOA 3AL2A 2PUCA 3UV7A 1SY7A 3FIUA 4FUQA 1DXOA 1IONA 2Q27A 1PL7A 2QUZA 4GC5A 4JVMA 3B3FA 8AT1A 1EUQA 2AT1A 2WKRA 2DPMA 3GA0A 4AZ3A 5TXGA 1R6TA 1PR3A 5K9ZA 4GRAA 5J2TA 3AUAA 1A9XA 2G63A 2QMOA 3M5CA 2BR5A 2Z83A 1I4WA 2HHHB 2VTEA 1VSQA 1Z0ZA 2P3SA 3N8DA 2VH1A 3U60B 2UXBB 4ZMSA 2P4HX 3F47A 2BTEA 3N76A 3E9CA 4I08A 2BEWA 1KDPA 3S8MA 2P9QA 4NY1A 1N6OA 3ROMA 1XZMA 4ASUA 2I2BA 3QFRA 4IY1A 3BDIA 1JEDA 2V7UA 2P1RA 3AUFA 3V9PA 4BU0A 4L9WA 2IWHA 3PK0A 1E8DA 4MO9A 2ZS8A 2MOKA 3EEFA 4DM7A 1QP4A 3OX3A 1YC5A 4KR3A 3K8QA 3U1TA 1GU0A 3OQ6A 3VU9B 3OLYA 1PV2A 5I3ZA 1VBNA 2AHOA 1H2WA 2WUEA 4RE6A 2ZSDA 3PUIA 2RH9B 5ECWA 1E1DA 2XVYA 4PQRA 4MV3A 3ZTYA 1RRFA 2RONA 3MBKA 2FPWA 1R6AA 4MS3B 2VJKA 5BO5A 2CB0A 4PQGA 3JQCA 3FMIA 3LT2A 1KEEB 1M10A 4A2PA 6REQA 1AS2A 2P9GA 2J7KA 4QQ8A 1U5BB 2ZAMA 4FFMA 4IUDS 3NT4A 4OO3A 2FKNA 5IAGA 4ENRA 4RTJA 4N5MA 3V34A 1UT6A 2ZUVA 4UUMA 3C6BA 1C9DB 1E3MA 1QV9A 1RMQA 3KSMA 1LUAA 3R1IA 2AX3A 3I6YA 4HQNA 1T9DA 4IGFA 1YDFA 1DIHA 1WXIA 2GNAA 1QIIA 3PWTA 1ECGA 1HG0A 2C8KA 4HZUB 1WB6A 1JX6A 4Q93A 4UMEA 2HDOA 4R1SA 3WWOA 1BMTA 3U1VA 1CS4C 3EAQA 4MJXA 1T5HX 5EQTA 4JLWA 5IT9A 3G89A 1UMDB 2E1RA 2YMPA 3UKDA 3FVVA 4A6DA 4M0PA 3EGWA 1EA5A 3KZKA 2HW8A 2P1DA 4XM2A 4MQ5A 4J6FA 1Y3HA 3UYLA 3EULA 1I7PA 1CUSA 1QHGA 2NM0A 3VO1A 2ODTX 5DCLA 3QBEA 5AIBA 1EP2B 3FWNA 4MVJE 4OSOA 4XVCA 4RZHA 1XYGA 5JSYA 1AMUA 1V43A 4P82A 4LVOA 4R8VA 3GEIA 3LHDA 5D01A 2XTMA 4DQKA 2XUGA 5EJEA 3BRWD 1VRCA 3OP4A 4K0KB 1KAGA 1P1KA 1UK9A 3L84A 5CXXA 3ZZ0A 1FVXA 1E2KA 3HSKA 2WTEA 4UE3S 5I9IA 4EI2A 4R9RA 1IZ7A 2ZQ5A 4BNGA 3CISA 2BV3A 4QWMA 3DTNA 3EVTA 3A1DA 4Q7KA 3HP4A 3KT3A 3JSXA 2VATA 1FBTA 2DH5A 3NYRA 4K40A 2W2PA 4EUFA 4BGEA 1U0FA 5EZ5A 2NSYA 5A9SB 2HQBA 1JQ5A 1ODCA 1Z88A 3K1ZA 1LY1A 3FDFA 2V6IA 2ZRBA 5BSTA 4K81B 1NSTA 1Y4ZA 1JHUA 1K4MA 4KMRA 2GILA 4Q7MB 4MAAA 2VEOA 1ZK1A 1XBTA 1QHNA 1U2SA 3LYUA 3NO4A 4NATA 4W99A 2PANA 4UTVA 4ZGBA 5ICGA 4DG8A 2W6QA 2B3TA 4ALKA 2RHHA 2VHCA 2K5UA 1DIRA 1XZPA 2O05A 2W22A 3D7KA 4IS3A 2P4EA 4QODA 1G0NA 4LY0A 1DIBA 4ZP1A 5IF3A 4QGBA 1EI9A 3BHNA 3OZWA 4TPKA 1CF4A 3VHXA 1RHQA 3EUEA 3WBFA 1A71A 1JJ7A 1G291 3IDQA 6PFKA 4HGNA 1I9GA 1J4AA 4YDQA 4N8SA 1LSOA 1TZJA 3IAM6 3NNDA 1C8LA 1NP7A 1SKBA 2F7SA 4KPUA 1TVCA 4PWZA 3E8XA 2GASA 2IGTA 3DYVA 3TOCA 3IR6A 5AI9A 3WZLA 1DKRA 3BMNB 1E2BA 4C88A 1B8OA 5AVTA 3DAPA 2ORYA 4XD7A 1P3Y1 2G5CA 4S24A 2VBIA 3K8YA 3O3CA 4MI6A 3RSLA 1G5TA 4X00A 1JHVA 4MEJA 4E6PA 1U0JA 4N3GA 1JWAB 2PS3A 3WY9A 4OFXA 1MIHA 4WAUA 1G8HA 2XF2A 3IIKA 2BZGA 5M7EA 4MCHA 5CLHA 4YRKA 3FOEC 1CNEA 5JSQA 1RXEA 4YPVA 3EFOB 1OX4A 2VRCD 1ES9A 2VHVA 4QXOA 4YJ3B 1N32B 1RP7A 2O8CB 5KNDA 3LUCA 1N7IA 2F8LA 2UKDA 4N8DA 5K4GA 3O1HB 4JT9A 3OZCA 5EIAA 2DPXA 4G9GA 3PGVA 2HCBA 2EERA 1PJQA 2IDJA 1G63A 2A0WA 2HREA 3B1JA 3RIGA 3QF7A 4RGQA 5AVOA 3BXXA 2QJRA 4HBZA 4AAYA 2CZGA 3GJYA 3MJSA 3OQHA 4PYIA 2AE1A 2NU6B 3R0QA 4Z3DA 1WKVA 1NUPA 1V5IA 2IQIA 2RG7A 3AKDA 1YB2A 1U3FA 3L6DA 3BCUA 5DRTA 1C9YA 3U4CA 3FUCA 3DA8A 1NAIA 3E58A 4RIFA 2QE7A 5JZMA 4DR1B 2C8JA 4UVHA 1A77A 1P0CA 3K73O 4A8JB 1SD5A 2WTAA 3FZEA 5MGNA 5EOVA 3QEJA 4RA9A 2A57A 4JX9A 1AGYA 1F2VA 1CRPA 1JFSA 1G9SA 1QO0A 2GYUA 4D9CA 1OT5A 1PYOA 4O2BB 2WF7A 1Z4QA 2P27A 1VHJA 3MTBA 5I7AA 4J0DA 4V02A 5FH9A 1O9HA 3WE7A 1U98A 3UPTA 5DTJA 1X3LA 2XR1A 2LNDA 2Q9CA 3AQ4A 3DDZX 4JJ7A 4G5FA 1EVLA 4QATA 4HTFB 2PWZA 2CL6X 4KO8A 4NG5A 1V4NA 3ELDA 4WXYB 4YAEA 5BXQC 1XCBA 4W8GA 4XYMA 3GL9A 4DMMA 2BAGA 1PJTA 1XSEA 3ET4A 4L72A 5FT9A 3JQQA 1EDOA 2ZFUA 3SHWA 4B73A 4LF8B 1EIWA 3MT9A 4YV0A 2I91A 1FNNA 4ZO8A 1WSWA 2YWXA 3ILSA 5K3FA 3IJEB 3CH7A 4ZHQB 3MIIA 1EFUA 1FP4B 2JIBA 5JBNA 1KEUA 2A0FA 3DMFA 3OU7A 1TKRA 2QP9X 3L7DA 4JJKA 2C5SA 4M36A 4UVDA 4XR9A 1A7UA 4HMQA 4FILA 3OPYB 2R86A 4KE6A 5KNCH 4B46A 5CFLA 4DQ0A 3D8HA 1XD2B 3LBHA 2I4TA 2PYZA 4OFBA 4IOMA 1ATIA 2V1XA 1EE1A 3QVTA 4ZOBA 1RKXA 1T1JA 5BSWA 3RAFC 1TI7A 1Z0UA 1NRJB 4P0PB 5BR4A 3MGKA 4WE3A 1IHUA 4EATA 1EESA 2A7XA 1HG1A 3G49A 3QELB 4L15A 4IZHA 4H2DA 1I9CA 4YR9A 1VPLA 2BKLA 2FE4A 3C85A 4DCUA 1OMOA 3DOOA 4IILA 3KDAA 3BK1A 4LXXA 5BVGB 2AKEA 4ZYLA 1GXSB 3VPCA 3WAJA 3HXTA 3QLJA 4QUBA 4TXJA 1U2DC 2EX1A 4BC1A 1RC1A 4ZV4A 2CXRA 4U7FA 3FNEA 4BGDA 2HK6A 3DHWC 5A3SA 1C14A 2UUCB 4TSRA 1JA9A 2VDWB 4IWYA 4CLHA 4YYZA 4E4YA 3IBGA 1PL6A 4MLDA 3T5AA 3FPSA 4G56A 4Q3LA 1TVMA 4XD2A 3OZIA 3WB0A 4ZVQA 2AQHA 4Q21A 1W581 2PA0A 3PT5A 1FSGA 3GAMA 2YJ5A 3W5SA 4LK2A 4EDFA 4J03A 2HA7A 1P2FA 4IDGA 2GO7A 3D6AA 5KOHB 3AIIA 5FIUA 1VBFA 2CJWA 3SBXA 4CV3A 1XLWA 2YNMD 3EZNA 5BXYA 1H65A 1JVBA 3UQZA 2JARA 1Y3AA 5JQWA 1GO2A 5CJJA 5DTQA 4MQEA 3LTEA 1V11A 3ROEA 2BC9A 1EHIA 2AS0A 1ZH6A 1J20A 2ECOA 2UZ0A 3C2QA 2VP0A 2XZPA 5CA1B 4LX8A 5JUWA 4MZXA 3QNMA 3DKIA 2Z2ZA 4KO2S 2B2CA 2X9GA 1SUDA 4M8KA 2XVXA 5AI4A 2QZPA 3UIEA 1UPAA 2DQKA 3L1KA 2D7DA 1RAIA 3HKDB 5IH3A 3C1AA 3LP6A 1NASA 1ORDA 3UHAA 2K2QB 4I1UA 1LTHR 5HK8A 1IIBA 1EWKA 2NN3C 3N74A 3NTRA 4HDCA 4M21A 3IDFA 4U6QA 2RBEA 3CN9A 1E3SA 5ICEA 1HUQA 5KKNB 1KI6B 3FI0A 1DDIA 5CB4B 2GJAA 3L8MA 2J0VA 3UOGA 1XEXB 3L04A 4L8FA 4DA7A 5B64A 5KTPA 5TMEA 4K88A 3WO0A 2H1OA 1KQ3A 3PIRA 5BY2A 1NT4A 2YIDA 4TTPA 1OAOA 1W0KA 4JQSA 5K4HA 4JJ4A 4JSYA 5LZ8A 3TZKA 3ZIAA 3PXAA 2YHIB 2YQ5A 4DLUA 4NBKA 4QUAA 4R51A 5JPDA 2I66A 2QMUA 1NP6A 2J6HA 2QSZA 1S3SA 4Z9XA 1U2DA 3P45A 2QGZA 1JA0A 1LWOA 2CNLA 3HU3A 3LDUA 1GGMA 4YP1A 1UXOA 2WSSD 3GT3A 4P08A 3UHJA 1QHXA 3OE5A 4C7JA 1FK8A 3AF6A 2I99A 2JAWA 4XD7D 2IZOA 3L43A 3ZWOA 1JKIA 1DO8A 1H9AA 2IY7A 4AJIA 1WZIA 3S1LA 4B4OA 1WHSB 1D2RA 2OR3A 4GKVA 5BSGA 3W77A 5KYUB 4QT0A 4AJLA 1EWRA 4H18A 2G72A 4KQ6A 3PYXA 4IINA 4NYMR 5H59A 1RFLA 1NNI1 3IHTA 1PK8A 2QRPA 3UZUA 4JDUA 3VRHA 1O08A 2XA9A 1H6DA 4PTYA 3OKPA 4Z3OA 2LKDA 1UKEA 5JD3A 3TDMA 1VZ3A 1D2HA 1Y98A 5JG7A 3ZUPA 4QELA 1Y6GA 1YCGA 4M0DA 1OV6A 4B4WA 1R10A 3EVAA 3MRXA 5A4DA 5A4KA 2HD4A 1PLKA 2FSFA 1NYTA 1CRZA 3F7OA 3NGLA 1LJLA 3KB1A 5P21A 3KTDA 3VH2A 6ADHA 4FR2A 1YVEI 2EYUA 4QUJA 3GLFB 1E89A 2HRBA 1KQNA 1DO2A 2PKXA 2QMEA 3KLOA 3MGCA 4LQCA 4KYTA 4YS6A 3IL2A 1Z83A 4AX4A 4WBNF 4G63A 2BTQB 3I4FA 4BUZA 4IIEA 3DWEX 1GT91 2AJDA 3LQYA 3DEAA 3O0TA 3G79A 5LSAA 3O8DA 3JPWA 5LDDC 1GQRA 2ZBEA 1R64A 5EZYB 4B35A 1U6JA 3GB9A 4GLBA 5ED0A 2GPWA 2KB0A 1TX4B 1GZ7A 2AKYA 3VZRA 1FFGA 2PT5A 1JR3E 5JW6A 1D6NA 4PPFA 3E8SA 4UHCA 4DG5A 5IAOA 1EDZA 3KQSA 3EF1A 4OUDA 1U11A 4AS3A 2PZLA 2WD7A 2JIDA 1PWEA 1YBAA 5D00A 1C4KA 3ZDAA 5H3HA 5JYCA 5EUCA 3O4JA 3AKZA 1KQOA 4CKWA 3KPWA 3IP7A 5F2NA 1J2TA 1KJNA 1DXQA 2G07A 1CERA 1NW5A 2NTNA 5FL7D 2O6HA 4B6PA 4DHWA 1GYPA 3RVQA 1SMKA 1K98A 2GPJA 2ZYUX 5F98A 3DMYA 3ZGXA 4FKZA 5LVAA 3GUCA 1K5DA 1YCHA 3VDXA 3ZDQA 4RCVA 4OIFA 2HL6A 3P9RA 3W06A 3QKRB 2QW8A 3R7SA 3SDZA 4GHWA 2HHJA 2GERA 3HCAA 2MYUA 4OMFG 1N6IA 2ASVA 4BNDA 3KOOA 1TO1E 1YNSA 4BX8A 3M5PA 4KZPA 5A4JA 2H1LA 4MNTA 4A7PA 3A28A 5EIWA 3VKGA 3OTOB 3E8MA 3M9LA 4RKFA 4E15A 2PUFA 5KYTA 1AT1A 1JPJA 2Q4EA 2GM9A 1BHJA 2V8BA 1NBIA 4HJXA 3MCVA 5JR3A 2R6FA 2FEWB 4OJNA 4Q9AA 4R2WA 1XRMA 4HHEA 3HJHA 1Q84A 1E2MA 2ASEA 3AHCA 3V8RA 1DVRA 1MO5A 2V03A 3N2KA 3RJMA 1NW6A 4PCUA 5GONB 2Y1GA 1P9WA 3I1JA 1Y9AA 2CVOA 2AFIA 2X5OA 4BYMA 2R8RA 2FUEA 4KO4S 1YULA 2YOFA 2Z43A 4P5EA 3NDBB 5EGNA 3ZKWA 3COPA 3R9WA 4BO9A 1JI0A 1S8NA 4JBIA 4LRXA 3ZWVA 3DCYA 4XSHA 1RE0A 1SBZA 3Q6MA 3BMNA 4KI7A 4M8IA 4U39A 3IA7A 4I9UA 4MW9A 3D7SA 1ENYA 4PHGA 3VI3B 4K3VA 3SJBA 4F2WA 1DB3A 1VL0A 2NG1A 1WSAA 3NHYA 2LD4A 3AHFA 6NULA 2KWIA 3VH1A 2XLCA 2OEPA 4B8YA 4JH0A 3UPUA 3W1VA 1H6AA 1P73A 2ZXUA 2XAAA 3FFTA 4ALLA 3NXKA 1JR3A 3KDPA 2V7XA 1QGAA 1VLZA 4N65A 4TKVB 3NBKA 3WHKA 5HKOA 4M2LA 3LLUA 4XGRA 2JZNA 3MQFA 3JRWA 3ZGYA 1KO1A 4XTCS 1VG8A 2BELA 3QW2A 4KIUA 2B9VA 3G0DA 1Z6YA 4YEDA 4JHXA 4BLRA 3BIFA 5ER6A 4D80A 4YRBA 5HS4A 3VV2A 2GJKA 5KUTA 3ODGA 5D5HA 2WUFA 4ALNA 1NWCA 4URVR 4RE5A 4RA6A 3W1WA 1O77A 3TKYA 2D59A 3GEEA 2GHTA 3TMAA 3IDSA 1G1AA 3L7LA 5ALMA 2WQ7A 4B83A 3C5HA 5FTNA 4FJ2A 1VG9B 2YWFA 4ZRNA 1WLSA 3FH0A 3QWFA 3CR3C 1RYNA 1WCXA 2DSNA 2E18A 4M1QA 3B38A 2L19A 2XT0A 3UV3A 5JSFA 4LJ7A 5IJ0B 1PZFA 3LNTA 4KXMA 5IKPA 3RVBA 3L7OA 2QW1A 1XN1A 3INGA 4MB6A 4QYWA 3TLGB 3D3QA 1HNZB 2EL7A 4H1TA 1Q7EA 4NPHA 4AZVA 5JEEA 1Y89A 3I5UA 3MAAC 4WNCA 4O6VA 3IO5A 1YR3A 4J0HA 3DCJA 5BVHB 4ZK2A 4JYCA 1AXEA 4IIDA 1FRZA 4KK3A 3VFDA 3ICVA 4HDKA 5F1OA 2DLCX 5JH7A 4CKEB 4TZ0A 4BJ5A 1RQXA 2GRUA 1V95A 3ZBPA 4R1QA 4FN4A 2BMEA 4LYAA 3C3XA 4CTNA 1T2FA 4YJFB 3UK7A 2G7ZA 4ZEVA 2DUUA 5LIRA 3K2BA 1X42A 5G41A 2JGEA 4ZCMA 3U4QA 3TQQA 1JLRA 4G8DA 3LQ4A 3FCAA 5LLSA 5DRYA 1J39A 2PNJA 4F6RB 1ONPA 3VYVA 1A2BA 1Z37A 2LIVA 3G2HA 3ZWWA 2RI1A 5CFQA 1GAXA 1J07A 2X6QA 5E4JA 2DQZA 4WMLA 2XUFA 1Z08A 2WUGA 1KI7A 3G2JA 2BGTA 4F3CA 1X2EA 3VDRA 3I01M 1CUFA 3OZVA 3OC0A 3P9SA 4W7HA 3RO7A 2Q1XA 2G77B 4AJHA 4WESA 4R8SA 3AGQA 5KTNA 4KAJA 1R0ZA 4UUBA 1QDUA 5FA8A 1U6IA 4KN8A 2XGMA 3GLHB 3NC4A 5HUHA 3GCDA 2EGUA 1ISPA 2GJ4A 1RWWA 3NMUF 1COWA 1Y7IA 3CLTD 3GJ3A 4NFHA 3ZJTA 4YGYA 2DX7A 4U9IS 1KRWA 1THGA 1F4PA 1Z5VA 2QT1A 4NWIA 1G2IA 1MUUA 1PDWA 3M4JA 4DQVA 4NSNA 2A9QA 4NP6A 2H3EA 4UHKA 4FYIA 3ZN2A 4NOMA 3RAJA 3K9GA 4KN9S 4X90A 5AJTA 1V2GA 4US0R 4WZBE 5TQ0A 3RUPA 1XNQB 1KETA 2J7PD 3KUXA 3EXG2 4WK0B 3S68A 2BSQA 2OCXA 4JLOA 2DWQA 4HV4A 2OV4A 3CMMA 3WICA 5BUSA 2H57A 1A4RA 1Z8DA 3N0XA 4LOKA 1MX3A 4UZSA 1M0EA 5IUKC 2Z04A 5E9WA 1ZYUA 3PJRA 1XQWA 4JDPA 4REOA 3IBFA 2IELA 2CB9A 1VA4A 2C3PA 2ZDHA 3HA3A 8GPBA 2NUPA 4F7WA 2EDAA 1L5ZA 1CYDA 4IBOA 1JR2A 4NG4A 2OKCA 1D2MA 3JQ8B 2R6AA 4CMCA 5CW1A 2FLVA 3P0HA 3UW1A 4UCWA 3BHJA 1TAHA 4JKYA 4R3UC 3B1KA 2RGNA 4U02A 5K0EA 4PC2A 5HBGA 2V3VA 5I9MA 1K6JA 5LBIA 3WQHA 1TLLA 5ALTA 3O9MA 5IZCC 4NBVA 1WP9A 1MEEA 4I50F 1U6KA 4RKEA 4G4SP 4GI2A 1EQUA 1NVEA 2A1IA 4PFSA 3OHMA 1FJHA 1YCFA 4N5IX 5G02A 4BP9A 5AKHA 1QGZA 2AG5A 4KQCA 4RCYA 3CEAA 1FZTA 2FZLA 5J43A 2E4ZA 1R8YA 2XADA 4BVFA 4QPDA 4YA6A 3WB2A 4C21A 4OLBA 1K5HA 4B6OA 3D4PA 3H3XA 3TSCA 1A5ZA 2VDMB 4OV6B 5BQOA 4TOIA 3CO5A 4HB0A 2VWQA 3ZLVA 1ZD9A 5FQNA 4B6QA 2R00C 4RK4A 2AK3A 2G9RA 3LQKA 4GOLD 4WADA 3QGMA 4C87A 5HUJA 4PANA 4DEXA 5CIYA 3DLHA 4QYIA 3CT6A 3SMVA 3OWXA 1DEAA 4KTVE 4OVKA 3H2IA 1DBIA 1RAAA 2XWSA 1UM9B 2W6ZA 3I5AA 4GICA 2R48A 4GD3Q 3PE4A 4LTNA 3HM9A 1X0VA 3GN2A 3PXCX 1PJ8A 4UBNA 2C54A 3O3OB 2CSXA 4X91A 4I4LA 2JLZA 2MINB 2VDUE 5FTJA 3WSVA 2IEDA 1V8FA 4U7PB 4LC0A 3L93A 1U1CA 2SECE 5DBOA 2D1SA 2GFHA 4H6XA 1MTZA 2IBTA 2JFNA 4NCNA 2JHPA 2ZRIA 1AUPA 2PWPA 3TLEA 1A2OA 1C1DB 3OM9A 5ALXA 3ZVMA 4S3MA 3ZNOA 1QUFA 4G4SO 2G7MC 1TW2A 2V4MA 4LJ5A 2VXBA 1TU3A 1TD9A 1G66A 2JL1A 3DULA 1DJLA 2C2YA 3LW8A 3PGKA 4G0PA 4NECA 4YP7A 3R5JA 5IULC 1MNQA 1G7CA 3PEFA 1ZOIA 2OO5A 4RTNA 1W6UA 5HTOA 1SPXA 1ADCA 3FPLA 4AUEA 3P9PA 4HQLA 4IDCA 4KQKA 3ZHCA 2RH4A 2PYDA 4WY2A 3MBOA 4O0MA 3P8ZA 5EXEA 2DPLA 1LNSA 2OFWA 3KSUA 4IUYA 4MQ4A 4HQKA 2VAVA 3STTA 1USKA 4TL7A 5F4BA 2GARA 3A2LA 1TVEA 5GGYA 3S2EA 1GU7A 3H0KA 3EXHA 3IPAA 3V80A 4Q7QA 2FNAA 5EIFA 2X2EA 4Q9NA 2ECQA 3T8YA 1VLJA 3WAKA 4YCCA 2GT1A 3QUSA 2HK7A 1KNQA 1QC5B 4XWWA 1JG7A 4QRDA 3KTAB 1U65A 4NXMB 3MB5A 3SF8A 2E1PA 4JXJA 2GZHA 1UDBA 1Y4UA 3BXHA 1IBRA 2PVPA 3H2HA 5HNKA 4I4IA 1PBTA 3IDOA 3QBTA 3KBOA 1T26A 1E18A 3L06A 4QDKA 3PDWA 4CM8A 4Q3OA 3NHBA 3LUPA 4G97A 3KZCA 3PR2B 1WY7A 2OAQ1 1N78A 3EVNA 5IAAA 2YJGA 1YR8A 3R4CA 4BATA 1XVTA 3T1VA 1Z3CA 1LLDA 1P6QA 3N86A 2V7QA 3FWZA 2DFTA 4LJRA 2W8BB 2BM1A 3GCXA 1QGDA 4RQBA 5FWYB 3KT0A 1PEKE 4HZUA 4BQOA 2JLWA 3ER8A 4YCNA 2WMNB 5ALKA 1ZOLA 3YASA 5L7WA 1IXYA 5IX8A 1MGPA 4CKWB 3KEGA 4X1KB 5FCDA 1RJDA 3K0SA 1WDLA 1GRNA 1K86A 2HY7A 3STXA 2IV2X 5SY9A 4KYVA 2WJHA 1OJLA 1EVIA 2HU5A 4NABA 1LV7A 3CWZA 3WNZA 3EPHA 4JA0A 3NDIA 4Y6SA 1ICEA 1DUIA 1VJRA 2XHZA 2P75A 2PMFA 4B82A 3HJNA 5MFPA 2I22A 1WR8A 4WKNA 2QF7A 4IHJA 4TZTA 4L2IB 4FTWA 4RFSA 2A1TR 2W98A 4WZ6A 5K3SA 3UK2A 4ENSA 2GM4A 2GN6A 2YN4A 3WWCA 4P9NA 3GFRA 4TN1A 1X15A 2QZSA 5K6AA 3F98A 3RVLA 3IAXA 3LXXA 2GR9A 1TQ8A 1FTQA 1YHZA 2FLWA 1OFUA 4UD2A 2Q45A 3EFHA 3STYA 1IQUA 4OQYA 1V8ZA 2GCPA 2PTHA 2HXSA 3QKSA 1U2ZA 4WBNA 1XRRA 3AUYA 1XQ9A 4R8KA 2YS7A 5DHAA 3RLIA 3PI6A 1UOOA 2QYOA 1DV2A 3MWEA 3QXCA 2GN9A 3C14C 4ZPXA 4O2BF 1U02A 3ZEIA 1Q50A 2BEUB 2A2ZA 2G36A 3FYUB 5H0IA 4MRRA 2V6GA 5EJAA 4EI7A 2BCGY 2WF5A 1YVPA 3KP1A 4QVIA 1YQEA 1UJBA 4P22A 4C4OA 1AKEA 4WWHA 4MVJA 4O4IB 4ZYXA 1R0XA 4KBGA 3U7EB 2DERA 1JDNA 1Y8QB 1W88B 2QTMA 3DE4X 4UM5A 3LK7A 4IEFB 1TJNA 2GRJA 1H9BA 3FI9A 3L8FA 5FNZA 5IXYA 3VA7A 2YZNA 3LOUA 1VCIA 4OFZA 4C07A 5B2FA 4D9IA 1RYMA 3FPKA 2I4RA 4B4DA 1IH8A 2HRZA 5EJ5A 3E3MA 4B3MB 5GGXA 2IW3A 3NDPA 1BWRA 1DPFA 2REXB 4IJVA 5AH0A 4F6LA 1I01A 5F9HA 3IT1A 1O94A 3G2OA 4C6SA 3LX6A 3GLIA 3G82C 2GKOA 1D6MA 2A14A 2BMDA 1XJ5A 3EH2A 1XZHA 3TBFA 1U2TA 4CMJA 4TM7A 3IOBA 3GWZA 1GRVA 1TVKB 3OZDA 3HVUA 4WLFA 4KIJA 1W36D 2J9ZB 5IH7A 2VF7A 4PYMA 3QVXA 4JB0A 5JPIA 4IDHA 3K70D 4ON9A 1ZESA 2ZRNA 3NH9A 3VISA 3R4VA 4DUYB 3ZXSA 1OI7A 5AXDA 4YJ3A 5KPDA 5C18A 2MSNA 3AR7A 1RI4A 4O08A 1E1QD 2XQVA 4QUKA 3UWPA 2LVBA 1VKZA 3QV2A 2OTCA 3D4NA 1QU3A 2D4HA 5DN6A 1SOWA 1PFVA 1PUIA 2ZGVA 3LG2A 1Q12A 4LJ9A 2GHIA 2H1IA 2Q6LA 1NW3A 2WZDA 4N0EA 4PLGA 4XJSA 3BN3A 1Z2DA 3B60A 1NATA 4G1FA 1JMYA 1ITZA 3RWOA 1X1CA 3ADOA 1Y5LA 1Z2NX 3EXHC 3K5WA 4OGLA 2YIVX 4K1LA 5A5EA 1BXRB 3O31A 2QL7A 3R6WA 4HKTA 3T5GA 3T7CA 1NP3A 4KAAA 4LWPA 4G23A 1OBCA 4KAXA 1Y1KE 3B52X 1M0WA 3HE3A 2IDKA 4MR7B 2WF9A 1A5SB 4UMFA 3WLSA 4GP7A 1KXZA 4BX9A 4PG8A 4P5DA 4D9MA 2ETVA 4BE7B 4XUCA 4PSDA 1AE1A 3T12A 3DXYA 4Y2RA 1Q21A 3FBGA 4URHA 2Z6QA 3A6HA 4WSOA 1FMFA 1UDXA 2H1FA 2QTTA 1GCOA 3GEMA 3FVTA 2FR0A 1BEUB 1BHO1 2WFZA 4W1PA 3N6RA 1L1QA 3H9CA 4N18A 5EJMA 1QXSA 4YO8A 1MN6A 3UJ6A 1QZUA 4RDHA 3C6ZA 3FTPA 1JEQA 1NN0A 1W94A 1YJCA 2W6JA 4MS4B 4M53A 1RJGA 3ZGNA 3OJXA 3EVGA 3UPDA 1PR2A 4MTLA 4DBLC 2WHEA 1PP4A 1SHUX 4AJ9A 2XQFA 1RI3A 2IPOA 4JK3A 4ZHQA 3HBLA 4GS5A 2ID4A 5CURA 1P3JA 1X80A 3PNVA 4LJYA 4C0LA 2EC5A 3HCNA 1L7XA 3F3SA 4H1HA 1ULBA 4WDRA 2A84A 1ZC3A 5LZ5A 5E2BA 2G4VA 4WLOA 4H7FA 3E3AA 2VJDA 4LISA 4XIYA 3TAUA 2AD1A 2PA3A 3DV9A 4U00A 4OQQA 5C8XA 5LP6F 3R3UA 1XK7A 3N5KA 4ND8A 5F7ZA 5THQA 4RL6A 4UHDA 1AF4A 1XIVA 5AVVA 1XXLA 2BDUA 3C41J 1S96A 3WGZA 3KJNA 4X1YA 2CVZA 1AZTA 4U2GA 5EESA 4EKEA 2ORWA 3R5FA 4OLAA 4Y2VA 1B76A 1CQWA 1PZXA 5AHXA 4AMUA 2O2XA 2O4UX 1A9RA 3AHJA 4OOFA 1QZXA 1VZ2A 4BB9A 4FDVA 4BLOA 1RTTA 1S4QA 1L4EA 2AYXA 5KYYA 3K9LA 2PZBA 1ZX1A 3JQ8A 4TQUS 1HKUA 3TLKA 1CY1A 4C7OB 1B8PA 3RGGA 3C97A 1O9GA 3VZPA 2VOEA 5HOEA 3OMXA 1ZNYA 5EWJA 2QTVA 4QFDA 1T0JB 3GFOA 1YZUA 3T95A 4RJLA 4EI8A 1R3UA 2WJ3A 5SYNA 3SSAA 2F1OA 4L5IA 5K0NA 3BL5A 2X15A 5CT8A 1PCXA 1KBOA 4O4LF 1Y4SA 1KVTA 2WY2D 4HNUA 2JIZA 4F5ZA 3ZHBA 4KVFA 2N0SA 3S2GA 5TT0A 3X1ZA 3K0AB 2QUKA 2J9XB 1Y3BE 2NU8B 3ETJA 4MKIA 5CPFA 2BFMA 1YZKA 4MW1A 5DYGA 2OM2A 4NENB 5FNVB 1EDBA 4PNPA 2MCFA 1JLHA 1M73E 4AL4A 1B74A 4ZZ0A 2YVQA 2VNIA 4JJZA 2A1TS 3NFYA 3CX3A 2FW8A 4KAFA 3SKXA 4WV3A 3AYXB 2NUAB 4N6OA 3EVCA 1YCDA 4QWWA 1B93A 3LD9A 1UBMS 2R47A 1DFGA 2O1XA 3GQVA 4MGKR 4HS9A 3D43A 2F3UA 2OP0A 4KR6A 1YXMA 4HC4A 2D1FA 4AURA 2HGSA 3FR8A 4FU0A 2KYRA 2WJAA 3JYOA 4E0BA 3DZHA 1RAEA 1FC0A 3LKZA 3T3GA 4DQLA 4F8YA 4QO7A 3Q41A 1ACJA 2ECFA 2WP0A 4IOLA 3ROXA 5EJGA 1VXRA 3TTXA 3HH8A 3TGPA 4JEHA 3DMNA 4JI7B 3ZH2A 1IXZA 1QCDA 1BMQA 2GZ2A 3AHDA 3WLEA 1XOIA 2PH7A 2ZYWX 2NXJA 3NG1A 2FCRA 1WWKA 1X14A 3G2IA 4M8SA 2OCLA 3RC3A 3HCDA 1LGYA 2CLOB 4ZAYA 1RLIA 1UK8A 3R3XA 5F52A 2NZ2A 3KQNA 4J2HA 4WBXC 5HFNA 1D3AA 1HTTA 2F64A 1VMIA 3L2OB 4QU8A 5DX8A 3ZV3A 2BCJQ 1F2UB 4WY5A 3CY6A 4D9JA 8ADHA 2YDYA 2NQ8A 4IJ6A 1ADBA 4UARA 4BIIA 2RGEA 1X87A 1A9QA 3AFGA 4P3PA 1Q7RA 1XWWA 2YHIA 2ZJ1A 3GJ4A 4AKGA 2Y99A 5HKKD 1AUXA 4ZO9A 4S2UA 4ZALA 3OZUA 2IHTA 1UBNA 4RKWA 3UUEA 4ZJUA 4RHFA 2GJSA 3WNBA 3H1AA 1U0EA 1NVTA 1A9OA 1ZD1A 1AA9A 2Z0MA 3BREA 4DPMA 2XKKA 2ZCUA 2AXNA 2LCFA 3I05A 1G8KA 2NPOA 4BECA 2A35A 4QLAA 5CHEA 1U8XX 1MX5A 4PO9A 5ALHA 2PLAA 3IVCA 4EY6A 4I9NA 5CVTA 4KPGA 1QMPA 3ZW7A 3UW3A 2FN4A 2ZRMA 3M6AA 4EL5A 4BPBA 1YZFA 2B8JA 2OG1A 2HLDD 3C7DB 3CIFA 1DDOA 1DEXA 4ZZIA 3HBNA 2CHEA 4I36A 1Y1TA 1N6RA 3T5PA 3OCYA 1PHPA 4FOTA 1FQWA 3C8DA 3M2TA 1MT3A 3G9XA 3JQ7A 3DBOB 2QT0A 1GZHB 3EIUA 2XJ9A 3K9FC 1U9IC 1OTYA 1V7CA 2PZKA 1Y1PA 5BT8A 4XM1A 3P2YA 5B6PA 3REOA 2CYAA 3GRCA 1BWPA 4V0NA 3VNUA 2H2DA 1TJYA 2EG9A 2PFKA 1XPOA 1KC3A 4QJ4A 4XARA 1KDYA 4GXRA 1T6YA 1NUSA 2AH5A 1T34A 3FN4A 3G5UA 3QY9A 1BRMA 3BE8A 4NFSA 1ESEA 4J0KA 5HEKA 5IARA 3ZOKA 5ABPA 5CP8A 1SBNE 4LDJA 3W7AA 4RO0A 1BS9A 2ZPAA 5K0FA 5I7EA 2LDXA 5ALWA 3M83A 3ROPA 2AQKA 2JJ2A 4FZJA 1SG0A 3DQZA 2XGJA 3ZWQA 1G3MA 3DUFB 4YALA 1Y1RA 1BJTA 1O95A 3NOVA 7GPBA 2R0QC 3H5VA 4U6SA 4XVHA 1NOIA 1KS2A 5F2OA 7ABPA 2VDKB 3GJSA 2QPLA 3RE1A 4D5GA 2OLEA 4AFNA 1VE7A 3TIGA 2NSDA 4HSGA 4L6CA 1PQUA 5BRAA 1QCYA 2TMKA 3RRJA 2GWRA 5D7NA 4E03A 3QLTA 3W3AD 3CPHA 1E3JA 5LB2A 2HYDA 3TJMA 4DJAA 5GADl 3T0FA 1RLTA 3H0CA 1R37A 5IHXA 4PX3A 1NLMA 1M1NB 2VDRB 3AVVA 2QGNA 3GPCA 2AXPA 1FFHA 1Z56C 2AFHA 4LNUA 2Q5QA 4GKJB 3QXJA 2GK3A 1B6GA 4C1NA 1UWVA 2K2WA 4ZT7A 1A9YA 5KOHA 3IAEA 1E4VA 1JZSA 1XWIA 3E2MA 1Q0TA 2E48A 3K94A 1T2VA 1YQDA 2HCFA 1SU6A 3IFSA 2HX1A 4O4LB 5G2OA 3ADDA 2Q9BA 3MF4A 1PR0A 3ICOA 3LM8A 1T3SA 1ZRSA 1SZDA 1GZVA 3RVRA 2JW5A 3NONA 2V9ZA 4JSTA 1MA3A 1K2WA 2I71A 2VDJA 4KQIA 5AJVB 4ZXFA 1WXEA 1BD4A 1PL0A 2EBFX 2X22A 4MX8A 1B16A 2IU6A 2V54A 1OBHA 1NZFA 1J2UA 4AJ1A 5EYPA 3GT4A 4UC0A 1U9IA 5FJIA 5FLKA 3VH3A 5JNRA 3OZXA 1MJ5A 3THWA 3KJQA 1Z6PA 3TOXA 1CNMA 1ACLA 3M70A 3S70A 2QRZA 1Z4OA 4R9SA 5F7XA 2VP9A 3QWAA 1MF7A 4UPEA 4OB8A 1YZQA 3Q88A 4ZYTA 1EHYA 2WJYA 4HYQA 3C5VA 2QD2A 4IRUB 2BF4A 1EPUA 3OPNA 1J33A 2X1MA 3HYRA 1C7RA 1F5SA 3C5WP 4RVCA 4G26A 3HXMA 4YAWA 5CDFA 3RC2A 3F73A 3P9KA 4DQUA 5B1HA 4IG4A 4MYDA 3SHQA 4UM7A 1SCUB 3C3JA 4WZZA 5CH3A 5JD6A 3V32A 4JI2B 2PUJA 1U0SY 2XIJA 3EZLA 2GCOB 5EPUA 1AK2A 2JVJA 4BVHA 3HXOA 1DXYA 1ORVA 1R9MA 1BC5A 3LT1A 5JAHA 4LYEA 3FSGA 1ZJWA 3ND9A 1KZYC 5DYIA 2XEXA 4RPJA 1VLVA 1ZNQO 2JFOA 4QOIA 2YHBA 1BA3A 4QDUA 1E77A 4A9AA 1SUFA 3FXAA 4NR0A 1CHNA 1ZRNA 1OFVA 2AFHE 3ZK8A 2OQRA 1GU1A 3HHPA 1R5BA 4JP3A 4S04A 2PS9A 2IH4A 3ZLUA 4EZIA 3H8WA 1D9ZA 2CXNA 3UN1A 5BVHA 1CC1S 3Q8KA 2VUTA 1WPXA 3ZD8A 3F3YA 4BIMA 3AFNA 1IK6A 3IT0A 1I2ZA 3FOAA 1OXBB 3QJGA 5DGTA 3NGMA 1Z68A 4KQ9A 1BS1A 2MHCA 4G5HA 1ML3A 4U7GA 1Q11A 3HKCA 4KQ1A 4A91A 3U09A 4BMVA 4X24A 3H5AA 3ASZA 5IABA 5CNMA 1RMYA 1FMCA 5C1PA 4DR4B 4JLKA 3WDSA 4B8WA 4LRUA 3RSSA 3TTVA 2A8YA 2W11A 3Q2OA 4N39A 3OBIA 6REQB 1XTBA 4J0GA 1Z2PX 2GAJA 1KE2A 4ARZB 1E5LA 3CO0S 3IMFA 4PZCA 1B00A 1T24A 1THTA 2C0CA 4P31A 5LBUA 4FEYA 1MJNA 3X44A 2GYYA 1L7MA 1YMVA 1DC8A 3ET5A 1CUXA 3ICWA 4JBHA 4XIJA 4Y0VA 3H2KA 1V7QA 4O29A 5FPTA 3AVTA 2NXEA 1OGYA 4K6OA 1E9CA 4OUKX 3CXUA 4KUGA 1RHJA 1VSVA 3PYLA 3QW4B 3FNBA 3GUUA 2EF0A 1WZCA 3EIOA 2C2WA 3UFBA 4DEVA 5KZMB 5FF9A 4MUGA 4ZANA 3KJGA 1WRBA 1Z28A 4L8WB 4GGMX 1EK0A 3VNAA 2E37A 2IZ6A 1XMPA 1BA2A 4FDAA 3Q7RA 3U7QB 4HX9A 4DMKA 4IZIA 1G38A 3P96A 1UPFA 2FPPA 1O96A 1PLLA 2C4KA 2IUFA 2YH2A 1ELOA 2WA2A 2FN3A 1N6HA 2OG2A 2OHJA 4MSUA 1QHEA 5BSKA 1C9JA 2C7GA 2A0YA 2WPDD 3V1TC 5CVCA 1GG8A 4KH1A 4PC7A 3V1MA 2Y1XA 2OHHA 5TQ0B 3O0DA 3GRFA 4Z8YA 4CTJA 3EXIB 4X44A 1J00A 3K4HA 1LA2A 4NX2A 5JXJA 3RRXA 1FFWA 3SC3A 2DQYA 4E12A 1U7TA 2DFDA 1GPYA 1TUGA 1QRUA 2FI1A 3T1YB 5EWJB 2B21A 3AZQA 4G84A 5JCJA 1MZPA 3C3BA 3SPXA 3SIWA 3VVMA 4QNNA 3WSTA 4ESEA 3MTEA 2DTEA 2JD1A 2SICE 3SYRA 1PQPA 1R66A 4IEEA 4IIYA 3IIMA 4C3ZA 2FEAA 2I76A 2FW1A 2Z1DA 3ZBTA 1YFJA 5GONA 1CDOA 1MAWA 3EQ9A 1JHMA 1XZEA 4UAGA 5FTWA 2JGDB 3DFFA 4K0RA 2G82A 1JJIA 1HMPA 2G0TA 1VE5A 1EG2A 1GN8A 1IOLA 2YFQA 3KZXA 3ROTA 2D0DA 2BFPA 4B3CA 4NONA 3WZ2A 3KSRA 5AXBA 2R60A 3OZTA 3WG9A 3OE7A 4P4GA 3V8EA 4QM7A 2ONKA 4ARAA 1O9BA 4N01A 4ZK6A 3KL2A 3KR0A 1N8KA 2FQYA 2BJHA 3WKBA 3O21A 2OLJA 4MOWA 1JB9A 1E1YA 1VJ5A 3DKPA 5H7XA 4D9KA 2H18A 3KR9A 3M7IA 1NA5A 4R1UA 3LXMA 2Z8XA 2NACA 4WK6A 5HMMA 1I36A 3SZLA 4CR6A 2Q0QA 2Q6IA 4AO6A 3KSZO 1UOPA 2PZFA 2G5GX 5IBQA 4PNEA 4RTQA 3SEQA 2XGGA 2J59A 2CWDA 2XYQA 1T8WA 4JYPA 4N54A 3V4ZA 4KACA 4QD3A 2RAUA 3IKJA 1GQ2A 1P2UA 4QYIB 4ZEWA 4C0JA 4YUAA 4OG2A 1C0PA 4AN4A 1XLTC 1H2XA 1W46A 3NHPA 3PXEA 1U0GA 4G37A 4ZQIA 4RF2A 3WJ2A 3NWPA 4AF7A 4EW3A 5C35A 3IUEA 5LOVA 2QTWB 1R18A 1WXDA 1BCRB 2QQ0A 2Y4NA 1LPAB 5GPBA 2PUWA 1XCGB 5A02A 1F2UA 4BJHB 1W48A 4U0JA 3PICA 1OROA 2G04A 3VXKA 3ENNA 2FDCA 1RHUA 2EBWA 5SZHB 2A5DA 2FW7A 2ISSD 4AMGA 2YL2A 1GV1A 4ZYZA 4Z0PA 1Y7LA 4WRRA 3USZA 2J9YB 4OHVA 1Z6AA 2GZ3A 3BDAA 1SBQA 3Q1KA 4MWOA 4A0RA 4TKUA 2RHTA 1U8TA 1UFVA 3VVCA 1XPRA 3AIOA 2NU6A 2VBGA 1R5NA 3HNOA 1DWOA 1Y8CA 3ZCVA 5FOVA 3VTAA 1JLLA 1EVZA 2XTZA 1MLDA 3QH4A 4Q05A 4RWZA 5TR9A 4KPYA 3KLMX 4OA8A 4EBFA 2QRMA 1YOVB 1T2AA 3EH1A 2ZT8A 4RH1A 2OFFA 5AW5A 3F6CA 1DP4A 3AR9A 3Q6IA 2WYIA 3IESA 1RM5A 3HFGA 4NCXA 3WP1B 2BFAA 4R16A 2PMDA 5HYVA 1DAEA 4MITA 4ZI7B 2CXSA 4OP2A 3PA6A 5ALPA 5SZJA 3TG8A 3R7DA 3JASA 4LBZA 2D7CA 1K89A 4ZI7F 3R20A 4CQLA 4QYMA 4XGNA 3ZWCA 4CL8A 3C98A 4FQ8A 4J3JA 1JE1A 4QSHA 5C5CA 3G8CA 3X1KA 2QW0X 2RGDA 4QJ3A 1QM5A 4OQMA 1UL1X 4GOMD 4OMDA 4MMYB 1LW7A 2VNSA 3PD1A 2X58A 3DPIA 5BYBA 4D5EA 3NANA 4D9EA 4DLWA 4GX2A 5JO0A 3GDWA 3KHSA 2JJ1A 4QBGB 4WN9A 4M8NE 2BY4A 4MDHA 4MKFA 3PFWO 4W9RA 1C3OA 1OZGA 1OZ0A 2G9ZA 2LXNA 5HCNA 2O0JA 2UZAA 4BNNA 3U7HB 4ENVA 4QU9A 1D5WA 2YXLA 1IL0A 4B34A 2Z2IA 1S01A 1Y37A 1Z0AA 2G1JA 3ESBA 3SICE 1BH2A 4F84A 4RBNA 5FWYA 1UODA 1TCUA 2WHPB 4L4YA 1KO8A 2QZ4A 2V6MA 5EGSA 3M4XA 3WGLA 3G3EA 4V39A 3ZHZA 1M1UA 4BCBA 2F3TA 4LE1A 4OLFA 1Y6RA 2QZJA 2HBQA 2XX3A 4G89A 3HHEA 3DFZA