4OU4A

Crystal structure of esterase rppe mutant s159a complexed with (s)-ac-cpa
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
319
structure length
319
Chain Sequence
SGSPGVEQHTQAFLEALEQGGGKPLEQLSPKDARAVLTGAQASVKVDLSGIEVKERTIQANGQSIKLQVVRPANVKGELPVFMFFHGGGWVLGDFPTHQRLIRDLVVGSGAVAVYVDYTPSPESHYPTAINQAYAATQWVAEHGKEIGVDGKRLAVAGNAVGGNMAAVVALKAKEAGTPALRFQLLLWPVTDASFETASYKQFADGHFLTTGMMKWFWDNYTTDAKAREQIYASPLRASSEQLKGLPPALVQTAEFDVLRDEGEAYARKLNAAGVTVTSVRYNGMIHDYGLLNPLSQVPAVKAAMRQAGTELKVHLQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Pseudomonas putida esterase reveal the functional role of residues 187 and 287 in substrate binding and chiral recognition
pubmed doi rcsb
source organism Pseudomonas
molecule tags Hydrolase
molecule keywords Alpha/beta hydrolase fold-3 domain protein
total genus 117
structure length 319
sequence length 319
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2014-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ou4A00
4Y2RA 2VJAA 2DQYA 3FOBA 4UBNA 4CCYA 3SC2A 2ECFA 5JANA 1QFSA 3D7RA 3DYIA 5D7BA 4BDSA 2AJCA 2BGRA 2HDWA 4H0CA 3ESCA 4UBLA 3B12A 5BV7A 1VXOA 2VJCA 2PSHA 3F67A 2BUBA 2WIFA 3R41A 4OYLA 1E5TA 2GZSA 1SCQA 3AIKA 4NVRA 1QIDA 4H7HA 5HF6A 4N8DA 4BCDA 1XZDA 5DJ5A 3PF9A 2QKYA 5ISMA 3WK4A 1UT6A 2VQ6A 2XUJA 1EH5A 3IULA 3WL8A 4ZXFA 3WJ1A 4GHWA 1CUFA 2Y2UA 1JJFA 4BTVA 2PUJA 1AZWA 2JGMA 4IO0A 4O08A 5K3FB 3C8DA 3WWDA 3QVMA 4JUIA 2RI6A 3AZQA 4F0JA 4QLAA 2CMFA 1ETHA 4QDTA 4BVLA 1LPAB 1WPXA 1H22A 2C0PA 3P2MA 2QXUA 5ALYA 3KDAA 5AH0A 1EB9A 4H7IA 2WIGA 1R1DA 4X3CA 5D3ZA 2C58A 2GBIA 1CUVA 3I1YA 1UK9A 4OD0A 3G0CA 4D9JA 1N5MA 3M82A 3VJLA 3L1IA 4FBLA 3PE6A 2VAVA 3GBSA 1AURA 2XQIA 1DWPA 4X6XA 1XKTA 4PF1A 2OXEA 5LYYA 5K5EA 1MO2A 3WKAA 1KU0A 1CUEA 3G9TA 4J0JA 5DYWA 5DNWA 1A7UA 3FBWA 3UUEA 3B5EA 4WY5A 5HKAA 1BEZA 3M83A 4FLFA 1IUPA 2XMGA 4PW0A 2PU7A 4DMHA 4C88A 5BWCA 1K6EA 4LIPD 5EIAA 3S8YA 4CCYB 4ZV7A 4B9AA 3R3YA 5A7HA 4OCZA 1HQDA 5AJHA 2BGNA 1ZI6A 4OU4A 3E1GA 4JYMA 4Y9SA 5ALXA 2JGLA 2J3DA 5BOVA 2XUDA 1K4YA 2XUGA 5AM5A 5KREA 4W1QA 1RP1A 4FKBA 5C81A 3H0CA 4FNGA 1YAHA 3HABA 3C6XA 4HZGA 5K3BA 2EDAA 1F0PA 4GDMA 1YR2A 1P0QA 3WWPA 1CUCA 3AFIA 2HA6A 2GBFA 3FWHA 3LLCA 4C89A 3ANSA 3IUJA 1EDDA 4KRYA 1ZD4A 4ARAA 2BUCA 1LPOA 4AO7A 1PV1A 3K9BA 4QWMA 4Q82A 3TGLA 4B81A 4MYDA 4X97A 3BDIA 3ZPXA 3QPAA 2AXEA 3G9UA 2PX6A 2JGJA 5AKGA 2OG1A 1ZGCA 2VJDA 4PO3X 1CUZA 3I6YA 3GROA 3IBTA 3OOSA 4K2AA 2DHDA 4DMCA 4BATA 1VE7A 1LBTA 3H19A 5FRDA 1XZBA 4AMYA 2HADA 4DM7A 4UHCA 2RIPA 5C8XA 1N5RA 1B6GA 4MYSA 5E2IA 1GZ7A 2ZJ7A 4MQLA 4U2DA 3HLKA 5AKHA 4QLOA 5JZSA 3IUQA 4B83A 2K2QB 4IH1A 2PPLA 4RE6A 1QIEA 3ZLTA 1IZ7A 2QUBA 3V1LA 1N8SA 3FNBA 3LP5A 4DYHA 2GYVA 1BE0A 4G8CA 4KACA 2XLCA 3DYVA 2V9ZA 3STTA 1XQYA 3AZPA 1QE3A 4I4CA 3EQ7A 4X91A 2UZ0A 4FTWA 5KWIA 5C8ZA 3N2ZB 3G0BA 3H18A 2C4HA 4FBMA 3QBJA 3CN7A 4G4IA 2RHWA 3OURA 2OQIA 2QM0A 3OC0A 2EEPA 3IB3A 4RNCA 2XQFA 5AK4A 5FDFA 1XLUA 3L1JA 1C7JA 1JT2A 5EHNA 5CT5A 3OG9A 5A7FA 5LP1A 5JAPA 5ALSA 1I6WA 1O6GA 4LKOA 1E8NA 1YSCA 4WCVA 4EZIA 4P08A 3QMVA 4W1RA 2OAGA 2GBGA 3A70A 1W52X 2RHTA 1JU3A 4W1SA 3KWJA 4JNCA 3Q0TA 3DOHA 4MWTA 1ZD5A 4DNPA 4X71A 1NU8A 5CURA 4DLNA 2DSNA 2XT0A 5FPPA 3F96A 2ES4A 4G4GA 2C5GA 1UZAA 3WZMA 5HF9A 1XZJA 1W6RA 3DQZA 3NOXA 4GEGA 4UPDA 4J7AA 4G8BA 3D4LA 4BVJA 1JI3A 1CUXA 3HXKA 5CT4A 4HXGA 1CV2A 3RM3A 4IQ4A 4H7DA 1VXRA 4M0MA 2WILA 2JF0A 5JAOA 2WQZA 1SC9A 1K8QA 5AKEA 1J06A 3VJKA 3AUKA 4GLBA 1ORWA 4B6GA 1LBSA 1QOZA 1XZEA 3VVLA 5AKZA 5JZBA 1CPYA 2HA4A 2CZQA 1CQWA 1NU6A 1XLWA 2XUKA 5ALHA 4EA6A 5AKYA 1ZICA 5LZ2A 1CR6A 4BP9A 1BCRA 1USWA 1TIBA 3F8SA 1GPNA 4J0CA 3WA7A 1W4LA 3HYSA 1XZHA 1XZCA 5HQ3A 3VJMA 2CKMA 4LXHA 1EXWA 2DQZA 3HEAA 4LHEA 1F6WA 4BAZA 3C45A 4BP8A 3QITA 2XQJA 5AM3A 5LZ7A 1E89A 3O4HA 1QO9A 2WG2A 2ZSIA 3C5VA 4EB0A 2OLEA 4DSAA 2WG1A 4F5ZA 4BZWA 4YK7A 4B82A 1QTIA 1VZ2A 4QDOA 4C4YA 3IURA 4BYMA 5ALJA 3I2GA 1MPXA 1X2EA 5AI9A 4ZGBA 4KE9A 4IHAA 2H7CA 1EA5A 3H17A 4QDZA 1XRPA 2H7XA 2XI4A 1Y37A 3R3XA 2B9VA 3PFCA 1UOQA 2XUHA 1ZJ5A 2OCLA 2WJ3A 2O2IA 1UFOA 3ESBA 4CI9A 1UKCA 2I03A 4FMPA 4BC0A 5DYYA 2WFZA 2IITA 2J4FA 5FP0A 1CUJA 3WYNA 1VZ3A 5ALNA 1BEEA 4RGYA 3G9XA 3LIPA 2XMSA 1FFCA 4UHHA 2XUAA 1R9NA 3V48A 2BKLA 4UUQA 1CRLA 3QPCA 4FOLA 4X92A 4PQEA 3ZLVA 1VLQA 4FLMA 2XDWA 4KR0A 3DNMA 4X93A 4HRXA 4PNZA 2WIDA 3DS8A 1HPLA 1P0PA 1KU6A 5HF5A 1XZMA 5JD5A 4UHBA 1QJ4A 3KXPA 2FUKA 1FJ2A 3W9UA 4FWBA 3WMRA 4Y2JA 1EX9A 1RYYA 4KE6A 2QS9A 4QDXA 5CTAA 1YAJA 1ODCA 1EK1A 2HU7A 2JGEA 4BE9A 3E0XA 2QZPA 5HQ3B 1VA5A 3PUHA 2XMDA 5K3FA 5J3JA 1HDEA 3H2IA 4GXNA 3FCYA 1R50A 5I9IA 3ESDA 2ZYRA 4QDUA 5ALIA 1CUAA 1WM1A 1W76A 3H2JA 2QT9A 3V1NA 1X2BA 3GZJA 4LYDA 1Q0ZA 2WFLA 5BWBA 1QIMA 1P0MA 2RGUA 2O2HA 4P92A 4WDQA 3TJMA 5LKRA 1ORVA 4AQDA 5D6OA 4MWSA 3R3ZA 2Z3WA 1MJ5A 2JGKA 3G0IA 5F4ZA 3STUA 4E11A 3ICVA 1BU8A 4TPKA 3TEJA 2OPHA 3DDUA 3AJAA 5ALKA 2QTBA 1E8DA 5E4YA 3C5WP 2ZYHA 5AKXA 4KAAA 4J0HA 1F0NA 1U8EA 1J1IA 3GA7A 4I19A 3L1HA 1BCSA 1XRRA 3WK7A 3HI4A 1NX9A 1HKHA 3FSGD 5A2GA 3B3QA 3AINA 5ALQA 1XZLA 4QWWA 1H2ZA 2QOEA 4CIAA 3C6ZA 1DWOA 3WJ2A 4HXEB 4U2GA 4CCWA 3WK8A 5LZ4A 4XIIA 4HXFB 4HS9A 1WB4A 4J3JA 2BCEA 2R11A 1JJBA 1AGYA 4FFVA 4MEAA 2HL6A 1JMYA 3QZUA 1GQRA 4G9GA 4OB6A 3HACA 1BS9A 2H1IA 3WL6A 2Z5GA 5HFAA 5ALOA 3MUNA 3M81A 1CUGA 7YASA 2H9YA 3LS2A 1XRNA 2WHQA 2ROQA 4V2IA 4OUKX 2C7BA 3R40A 3H2KA 1ZIYA 1E3QA 2JEZA 3I2JA 2WHPB 3I6ZA 3ESAA 1B41A 4G1FA 3S2ZA 3E4DA 4CG3A 5ALMA 2VA9A 2XLBA 4ARBA 4GI1A 4WJLA 2R8BA 4W63A 4M0EA 4M0FA 2FX5A 4X6YA 4FLEA 2VTVA 3BIWA 4HVTA 1E8MA 1XRQA 1UKBA 4KAJA 1T2NA 5ALZA 4K6KA 5A62A 2JGFA 4BC1A 4UHFA 2WFLB 3IIIA 3A2MA 2PKYX 1AC5A 3HSSA 5JIBA 5A7GA 4X00A 5DYTA 3D2AA 4OSEA 1LPNA 4U2BA 2HA2A 4BB0A 3WWCA 1Y7IA 3K6KA 5AM4A 4UBIA 5ALWA 5SYMA 5AIBA 1PFQA 3TRDA 2B61A 4WFKA 4X94A 4UFPA 4BBZA 4GECA 1Q0RA 3FYUB 1G5FA 2DHEA 4F21A 5DNUA 4G8DA 5LZ5A 4AN0A 1A8SA 1SCIA 1ODSA 3O4GA 1XZGA 2HFJA 4HRYA 5K3EA 2RAUA 2VJBA 4INZA 1QLWA 1H2YA 5LZ8A 2PL5A 5JADA 1U2EA 3DLTA 4OB7A 4S0XA 3BF8A 5EHXA 3WWOA 1T4MA 5AKKA 3YASA 4N8EA 1WB5A 5AM0A 2VATA 4X85A 4BE4A 1UXOA 4Y7DA 3I2FA 5CXXA 3WK5A 3WZLA 5EHQA 4Q3KA 2VT6A 1A8UA 3G7NA 3AZOA 1JU4A 5JD6A 1FFDA 4J0GA 3H2HA 4AXBA 2OCKA 4X95A 4JEIA 2PBLA 4QA9A 2WKWA 2ONCA 5HKBA 1DT5A 3I2HA 3UMJA 1EDBA 5CH5A 2DR0A 3EIOA 2VAXA 2QR5A 4QEKA 3FCXA 3W2TA 3V1KA 4UHDA 3FLEA 2YYSA 2X8BA 3AIMA 3K2IA 2JEYA 2HHAA 3QPDA 1BN7A 1K5PA 5FOQA 4L3WA 3ZI7A 5SYNA 2HA5A 2HIHA 3ILSA 1UWCA 2FJPA 2NW6A 4DNQA 3O9MA 3FYUC 5EIHA 4G5XA 2WM2A 1C7IA 4J0DA 1THGA 2HA3A 4Y2VA 2QXTA 1GKKA 1Y7HA 4BDTA 1YS1X 4L9AA 3IUNA 3A6ZA 1EHYA 4NS4A 1LLFA 4Y2QA 2E3JA 2QMQA 5AKLA 5E4JA 4DNOA 2Z3ZA 2WU3A 2XQGA 3EF3A 2G5PA 1JJIA 4PSCA 1P0IA 3WLAA 3H1AA 2YXPX 2X5XA 3JYHA 5CT6A 1WCYA 4ZI5A 2CUTA 1TK3A 3SX4A 2WJ6A 2Y2VA 2WLSA 1XQVA 2WHRA 3U0VA 1L7QA 4DMKA 4B84A 5EHZA 3STXA 4KAFA 5CH8A 3QMWA 4C87A 4HTAA 4FNMA 4FFWA 4AB1A 4P93A 5AOAA 4MJ3A 3GUUA 1M33A 3H04A 1VA4A 4PSDA 4E46A 1RWQA 5JASA 5AI5A 2AJLI 1DINA 1U4NA 1YB7A 5EI5A 1ZJ4A 1DX4A 3HRHA 3KSRA 1WPRA 3BIXA 3VKFA 3ICWA 1YASA 2WSLA 2YH2A 2OQVA 4J0IA 3C6YA 3H1BA 2I78A 2HA7A 2O7VA 3WL7A 5ALVA 3O95A 2OGZA 4C01A 2VSQA 4YX9A 1A8QA 2CEKA 2CB9A 3MUOA 1EI9A 1XRMA 4BAUA 4TGLA 1IZ8A 2RONA 2ACKA 3WKDA 4B0PA 4XWGA 3WWEA 1G66A 5YASA 1FFAA 4Y2UA 5CW2A 4H35A 5HZGA 3D59A 3H2GA 1Z68A 4ZREA 2WIJA 3FSGA 1BROA 2BAGA 4Q3OA 4KE7A 4UBKA 1THTA 4AZ0A 1OXMA 2OGTA 3CN9A 3HC7A 5C8VA 3I28A 3Q8WA 1IUNA 1J2EA 1UK7A 3WI7A 2PSFA 5AOBA 1R9MA 1CUSA 2G63A 4AX4A 4Y2TA 2Q0XA 5C7YA 5D3KA 5ESRA 2OAEA 4C4ZA 1DT3A 2VT7A 4DSZA 5I8PA 1MTZA 1SCKA 4Q34A 5AIAA 1DWQA 3W05A 1XZIA 1AX9A 3R3UA 3F9CA 1TRHA 3QYJA 3WKEA 4DGQA 5KBYA 5AI6A 5FV4A 5H3HA 4UFNA 1HL7A 4FHZA 4H77A 4KEAA 4BCBA 1ZI9A 3M3DA 4Q3LA 4J03A 5HK8A 3FYTA 1UOOA 2QVBA 4KJXA 5FKJA 2BUAA 5AK6A 3BF7A 4LXIA 4GW3A 3ZLUA 1QIIA 3KWFA 4Z49A 5JATA 5DTJA 2XMRA 1AUOA 4ROTA 4UBMA 2Z8XA 4P9NA 3JW8A 2ZYSA 3E3AA 2V98A 3HJUA 3WQHA 4LXGA 4WFJA 1AQLA 1WOMA 1OCEA 2ZJFA 5AKIA 5CXUA 4KE8A 5DTIA 4X90A 3LCRA 3ZV7A 3CXUA 1G4HA 4K5QA 3C70A 5AK5A 5AI8A 3N0TA 2B4KA 3PDCA 5HCUA 2GBCA 1CUBA 3C43A 1EINA 1H2XA 3ANTA 4U2CA 1QGED 2PVSA 3LIIA 1EB8A 2GYUA 1IUOA 1UK6A 5ALPA 3BL8A 2G4LA 3EQ8A 3KD2A 1SOMA 2WJ4A 1QFMA 4OPMA 4QE3A 3RKSA 5AKJA 3WKCA 1LGYA 4XX1A 1DQYA 2B20A 1QZ3A 3ZWQA 1QIFA 2BFNA 1ZD3A 5DWDA 4PV7A 1CFJA 5ALLA 4Y2YA 5FLKA 2GYWA 1ZI8A 1QIGA 1F8UA 1TKRA 5DNVA 1VKHA 2W22A 1CUUA 1UOPA 1VE6A 2C0QA 1H23A 4DNFA 4B80A 3PFBA 1FFEA 2XMQA 5AI0A 3D5EA 1MAHA 4OU5A 1OILA 1WHTA 1ACLA 3NUZA 4KRXA 2WUDA 3A2NA 2WFMA 2WIKA 1QO7A 1DTEA 1LPMA 3I1IA 4CG2A 2WG0A 1GPKA 3DCNA 2VEOA 1N1MA 1VJ5A 1CQZA 5ALRA 4C4XA 1QIKA 3O4JA 3OPMA 2Y6VA 4X6UA 1DQZA 4ZWNA 3U1TA 4UBJA 2D5LA 4RPCA 1GQSA 5EIEA 1XKLA 4WDRA 2I3ZA 2Y6UA 4OB8A 2ZSHA 1GKLA 4ITVA 4EY5A 2QJWA 5AICA 4ZRDA 2PSEA 4GBGA 3BJMA 1ZIXA 4UFOA 4FDMA 2BJHA 4AN1A 3PF8A 2JGIA 5AOCA 3PICA 1L7AA 3OM8A 3WK6A 2V97A 2Z8ZA 2DCMA 3RK4A 1BN6A 2CJPA 5AM2A 4W9RA 1LNSA 4BTLA 1MX9A 3EQ9A 5K3DA 3R3VA 3SWWA 2FJ0A 4UBOA 5CMLA 1CIJA 1QIJA 3KOOA 3DEAA 1MN6A 2PSJA 5A6VA 3WKBA 3I6MA 3D2CA 3F97A 4BCCA 4EY4A 2XUIA 3BWXA 1MX5A 1XZKA 4NMWA 3I2IA 2GZRA 3IUMA 1IVYA 1ZGBA 5LLSA 3DL4A 3DJYA 1CUIA 3RARA 3WL5A 1GXSA 3FVRA 5E4TA 3CCBA 1R3DA 4IH4A 3O4IA 1AMNA 4AO6A 1H2WA 4MQMA 1W1IA 1EDEA 4BRZA 5JYCA 1QIHA 1AKNA 3WA6A 3PUIA 4BRSA 1MAAA 4H7KA 1XRLA 3G8YA 2QUAA 1XFDA 4WY8A 2PSDA 2HM7A 1EVQA 6YASA 2WHPA 3QMMA 3WIBA 4C6HA 2IX9A 1MU0A 2OCGA 3T52A 1JMKC 3QM1A 5T4EA 1XROA 1GT6A 1CLEA 2DHCA 3JWEA 3IVMA 4Y2PA 4H7FA 5K3AA 3W04A 4JH0A 2I3DA 4A16A 1XQXA 3NWOA 4OYYA 4UHEA 1O6FA 1CVLA 4H18A 1QTRA 4B85A 5FPQA 3VISA 1D07A 2O2GA 4YASA 1ZD2P 4G4JA 2XQKA 5EGNA 1K63A 2WU4A 3FLBA 4G9EA 2Y1KA 1PJAA 3V9AA 5ALUA 1TCCA 1Q84A 3STYA 3ED1A 4EHBA 3A2LA 3G9ZA 1S8OA 2WUFA 3G0DA 4IH9A 1KEZA 2XE4A 5JD4A 1FSSA 3VDXA 2WUGA 1C4XA 1YS2X 1J07A 4K6GA 2P8SA 2PUHA 1LZLA 4WFIA 3F98A 5AI4A 5ALFA 4QZVA 2XUOA 1QONA 3W9BA 1FFBA 5JAUA 1IMJA 5CBKA 1CUYA 4Q05A 4N5HX 1U65A 3C87A 3MVEA 2HRRA 1XZAA 3O9VA 4CFSA 2XMZA 2HA0A 5AK3A 1A88A 2AJDA 3FVTA 4MEBA 1XZFA 2XB6A 4ZV9A 4J0KA 4Y2XA 1JKMA 3X3HA 4ETWA 5ALEA 1CUDA 2WUEA 4GWLA 4B9EA 3STVA 4TVKA 1ACJA 3EBLA 4F60A 4AMZA 3C6BA 4LYEA 5AP9A 3VVMA 4E15A 5CRIA 1E66A 2IIVA 1TAHA 5IVDA 1YB6A 4HAIA 1WHSA 3BE8A 1BRTA 4X7BA 1EVEA 4AO8A 3DOIA 1UK8A 3WK9A 4U2FA 5CT9A 2D0DA 5LIPA 5AM1A 2CBGA 1VOTA 1CEXA 4PSUA 3GELA 4H7JA 3RLIA 2XUPA 3D2BA 5FXMA 3WYDA 1R88A 4I3FA 1GPLA 4B0OA 1XLVA 4EY6A 2ZJ6A 2WTMA 5IKXA 5T4FA 2AJBA 2HFKA 3R3WA 4A23A 1TQHA 3FYUA 2EDCA 2G5TA 4B7ZA 5T4BA 4CG1A 3DD5A 3DKKA 3GFFA 4DIUA 3T4UA 1LPPA 4QNNA 1LPBB 1MT3A 4JYPA 3IA2A 2XUQA 2OGSA 2ACEA 4K6HA 1UKAA 4YPVA 5JZ9A 3BDVA 5JARA 4BVKA 4A5SA 4CIBA 1JFRA 2ZYIA 5ALGA 2J3QA 4RE5A 5EFZA 4KYVA 2DFPA 2J4CA 5JAHA 3G0GA 1ZOIA 1L7RA 3AILA 2PM8A 4L72A 4E14A 3MGAA 3WIOA 3OTQA 2C5FA 3C8HA 4Q1VA 5LZ9A 4XJVA 1GGVA 3BJRA 5IH7A 4EY8A 1YA4A 2ORYA 3W06A 5HK9A 3IDAA 4U2EA 5DLPA 1LZKA 4EBBA 2OCIA 3FAKA 2HU8A 2XMCA 4H7EA 3QH4A 3BXPA 3STWA 5CH3A 2JIDA 2HRQA 3D3NA 5IVHA 5T4HA 4N8SA 4BAGA 5JALA 1X70A 5FUMA 2QJRA 3I2KA 4BZZA 3G02A 3FLAA 2LIPA 1R4ZA 4N5IX 2V96A 5IVKA 4DTCA 5HF8A 1MNAA 3VXKA 1XQWA 1TCBA 2HU5A 1TCAA 4L0CA 3DL7A 3V1MA 5AO9A 5ALDA 3R0VA 3D0KA 5ALTA 4W1PA 2O7RA 1HBJA 2JBWA 1EK2A 1HLGA 1DX6A 2WTNA 1CUHA 1YCDA 2XMBA 3CCCA 4MXDA 1MNQA 3NGMA 1SFRA 2YASA 5CT8A 5HFNA 2AJ8A 4AZ3A 5IVIA 5LKAA 1MX1A 5K3CA 1W75A 2H7YA 5A71A 1LPSA 1ISPA 1ODTC 3UUFA 2XUFA 1DU4A 4DMFA 2ZVDA 3O0DA 2W6CX 4Y2SA 2QRUA 1CUWA 1YA8A 3SK0A 5I7UA 2X76A 2VF2A 3DKRA 2PU5A 3PI6A 4XVCA 5AHXA 4NZZA 5KWJA 1G42A 1Q83A 4EUSA 4EY7A 3HZOA 3AIOA 1WB6A
chains in the Genus database with same CATH superfamily
4Y2RA 2I4IA 1IXZA 1FDOA 2X5OA 2QN2A 1D2EA 3D64A 2IKSA 3FCOA 3GP3A 1HKUA 3HRIA 4UBNA 4ZCQA 2D1SA 4CCYA 5CG2A 2A84A 3FZQA 4X64B 1U5BB 3BMOA 1QFSA 4IUCS 4ZYWA 1V3VA 3P2OA 4INPA 2Z1NA 1WBBA 4QQNA 4RIFA 4F5DA 3U5ZB 3DYIA 2IXGA 2WUVA 1YE8A 2D5IA 2LDBA 4CKCB 1HOXA 4L85A 2IEDA 3GBPA 3PRKE 2BT4A 2BGRA 4GOOD 4QJ4A 5K8LA 4PLVA 3QE4A 3LKBA 3V1UA 4X7MA 2VH2A 4I6GA 3AERB 3IJPA 4W99A 1E1QA 4E1AA 1L4FA 2NQ2C 1QAOA 1EUDA 1QK5A 3EXHA 3RTGA 3OMXA 4AZTA 2DC1A 2PY6A 4JENA 3T61A 2OZLB 1EX1A 1WV1A 1DEHA 2D5CA 2Q46A 2C4KA 3L7AA 1WCIA 2WP0A 3AEQA 1MOSA 4RC9A 3OMLA 4K6MA 1Z3IX 5TQ2B 3E82A 2GO7A 4TSKA 4G0QA 2FSSA 2ZRBA 5F21A 1KKUA 3D54D 1Y3IA 4RY2A 1Q5PA 1NMXA 1WMBA 2GJ8A 2GZSA 2IZ1A 4D9CA 4KG7A 3MJTA 3EAGA 1YRAA 4YRZA 5K2OA 3N3BC 3KAJA 3QTLA 1QIDA 2RH4A 1GCOA 1B74A 2CW5A 4LHVA 3B1WA 1KF0A 1E63A 1U7OA 1P0FA 1XZDA 2C20A 2YBEA 1XNHA 1C0KA 3KVOA 1GV0A 2OR3A 3CS3A 2RFLA 4QYIA 4G0MA 1YR9A 5JCJA 2RDMA 3CSUA 4QXQA 3WHPA 2VQ6A 1FVHA 4MDHA 3O8OA 1EH5A 4GOLD 2WVAA 4M1OA 5H59A 4HNQA 4PHHA 5LD2B 1K6MA 1EQ2A 3B7WA 4ZYTA 2ACVA 3TVDA 5KKNB 3GEHA 3LL4A 4HATA 1ZR2A 4U7JA 4Q1BA 3OD5A 1RKQA 1YVDA 1FFGA 1ZMXA 3P0HA 4ZMBA 4DR7B 5LOVB 1FC0A 1GV1A 2JGMA 4IO0A 4G89A 4MH0R 3PZRA 2D5AA 1P0CA 2PANA 2QAGB 3KJZA 5IEBA 1Q1ZA 1KSGA 4D4KA 3OTIA 4JBXA 4YJ2F 5K3FB 1RDFA 2IH4A 3FR8A 1SZDA 3ZC3A 1PR6A 1M6YA 2QZZA 3CEMA 1E58A 3DEKA 1WVIA 4JUIA 3TOCA 3HTXA 4H3VA 2IY9A 2QIPA 3UICA 3GI1A 1VBFA 3E15A 3NASA 3RIMA 1ULHA 1GNTA 2J5RA 4Q18A 3GPIA 2WT4A 3CKKA 4TWZA 1QVAA 5K8UA 5FBKA 3L93A 4C6RA 3SHWA 3OWXA 1TW3A 5I48A 2ZCVA 4LI3X 1ADYA 4D4JA 4MWBA 2NO0A 2RGNC 2WA2A 1NVGA 1WMEA 4O63O 3RUIA 4IS3A 4NENA 5EJEA 3THXA 1GM5A 2GCOB 2PQ2A 3SXJA 3CZRA 3U3MA 1LPAB 4FE7A 4WBNF 2C7GA 3VR4D 1GY8A 3HR4A 3KBOA 1SXJB 3RHSA 2QSZA 3DOCA 5ALYA 3RF6A 3KDAA 1HR0B 4A36A 1KZGB 2H4JA 3OZEA 1A9XA 4P2BA 3CLRD 5FTKA 1JQLB 4OK5A 3ZXSA 5EXXA 2EKPA 4QSHA 4DLYA 4D9HA 1ULTA 1IE3A 3EPPA 4YRCA 1P2UA 5HFJA 3ZY4A 2B1JA 1W5BA 5EE9A 1QX4A 3FHOA 4LI0A 3RKRA 4X3CA 2OKGA 2V45A 2VHVA 4JT9A 2JK0A 3KKMA 5D3ZA 2VJNA 4EVQA 4TT8A 3HE3A 2QLMA 2GBIA 4N6NA 1CIVA 1GZDA 3DWEX 4W7HA 3QELA 4CBVA 1KSHA 1NW5A 5D3MA 5IJZA 4QPPA 1J39A 4LZNA 3I1YA 4EJ6A 2Y93A 5IJWA 1OT3A 3P9NA 4AAYA 5BOSB 1OH7A 4PTLA 1KY2A 2QWXA 3SC3A 4CMKA 4YMIA 3RQIA 2X3YA 3I30X 1FLAA 3PE6A 1RU3A 3LGXA 3B6KA 4OY3A 1KPHA 1HX7A 4M8SA 4CMJA 4UUMA 3HXMA 4GYKA 1XKTA 4XJXA 4JN6B 3MCVA 1I4WA 2OXEA 5I9MA 3OZWA 2NQ8A 4Y2HA 1B3RA 3SE0A 4BMDA 4XE5A 3AFHA 3A36A 2ZRQA 1Y7PA 3F4BA 4R1PA 2J3EA 4W5QA 4MYRA 4KZKA 5CLFA 2NO6A 2OO7A 3DAGA 4IDGA 1I3MA 4PYMA 5EXTA 1KU0A 1CW2B 1SKAA 2Z9DA 3JQBA 3LMKA 3BWCA 4JU9A 3S55A 2ZRAA 4N5DA 1QF6A 3NKVA 3OIYA 1OUMA 1HG1A 4BX0A 2CLMB 4Z0TA 2GESA 3DUWA 4CV2A 1QRAA 1G41A 3WIDA 3B3AA 2ZS8A 3AHGA 1E1NA 3EOAI 4PYLA 4IGIA 5KQLA 3L1UA 2VSFA 4CMGA 4B32A 1WWKA 1X7WB 3LUCA 4PW0A 2PU7A 3AQ4A 4YBRA 5BWCA 5I4CA 1ANKA 2XQVA 1T9GS 1AHHA 2OVBA 1YXMA 1Q12A 3DKPA 1WQ1R 4EG3A 5A6SA 4BZPA 3S8YA 5EIAA 1GP2A 3FJ1A 2NLOA 1RJGA 5KJ6A 1XCJA 4Q4DA 2EKQA 5DIFA 4OX9B 4GX5A 4OCZA 1EP3B 2I22A 5AJHA 2G9NA 3N8NA 2BGNA 2YMPA 1IBRA 3MBOA 3JCZA 4OU4A 3ZD8A 4CLDA 2NTNA 4N0EA 1KTVA 5M7EA 4OEHA 1K7XB 2WT9A 4Y9SA 5FJIA 2BZGA 2JGLA 3F3KA 2P9JA 2OEPA 2WP8J 4NZOA 4CFZA 1ODKA 2WKQA 3MQFA 3B6EA 1ZXXA 1AK1A 1GA1A 1E2LA 2M9MA 3JALB 1ST2A 1Y89A 1HTWA 2IOFA 4PAWA 1V1RA 3AKZA 2IELA 5KREA 4GWGA 4W1QA 1RJ9A 4XOIA 4Y0VA 1L4HA 4KWHA 4FKBA 4LSMA 2LP4Y 4IMJB 2CZCA 5FWDA 4P22A 4CE6A 4F6CA 3WB0A 1G5HA 2NT3A 3H0CA 4F7WA 1YAHA 4NBTA 2RH9B 3PXAA 4L8LA 1W6UA 4YB8A 3RPEA 1DKLA 3PWSA 4G3XA 4PHCA 1E9FA 2OBYA 2P5YA 1DC5A 3ZVMA 4M0CA 2OG2A 1FUIA 3I0NA 2OHHA 3WLIA 4CUJA 2NX2A 4J2TA 1KZ4A 3GAZA 4QXPA 1QORA 2HA6A 3FGOA 2GBFA 3R7LA 1EX6A 1RM4A 1TMGE 3W7VA 3ANSA 4G0VA 1EDDA 2XOEA 4YRTA 3LX5A 3OKCA 4GPBA 1JLLB 1KHHA 4AO7A 4Q3BA 2PT6A 5CLLA 3Q7RA 2EBHX 3WLEA 1PFUA 2GTHA 2H2AA 3K9BA 1GGKA 4QWMA 1MAUA 4PXAA 3TIGA 1SAYA 1N9KA 2GOYA 2QD2A 1Z2DA 1LW6E 3BDIA 4FC7A 4K88A 1CY4A 5H68A 1QH0A 1BNCA 1YBFA 3N0RA 2E7ZA 2PX6A 5FFMA 5BW8A 2P62A 4MCHA 1ONOA 2CXQA 1V5IA 2GCIA 4MO9A 3RTCA 3AM1A 1JVNA 5MDHA 2P6MA 4L75A 1VECA 2FPPA 2XIQA 1RD4A 2Q4TA 2Y77A 3I9FA 1G98A 3CF0A 1A5AB 3NUQA 4L76A 4M21A 4HPJB 2VPXA 4RADA 4X1KA 1D03A 4X62B 4Q7QA 1GRNA 3VSCA 3UC9A 2QQFA 2ZOSA 1C8BA 5LQDA 3N6XA 3M2TA 1NP3A 2BTQA 2Y67A 3KHKA 4N5MA 2NV0A 3CZCA 2DEUA 4MJLA 5F78A 2R8XA 3PX7A 1G21B 3WLTA 3ZX5A 1XZBA 2FEMA 4QFBA 2BFFB 3ETGA 5DLYA 1T4GA 1L4KA 3TCXB 1TPYA 1HNXB 3A58B 1GZSA 1M5UA 3BZWA 3EGWA 3K5IA 4RL4A 3HK2A 1WP4A 1GDDA 4EHIA 3VC1A 1B6GA 5E2IA 3WB1A 2ZS9A 1GZ7A 3IQEA 1JXAA 5CNIA 3ZHOA 3ZCRA 4MQLA 2PVCA 2EVWX 3IP6A 4XWWA 4QUIA 4R1UA 3OU2A 5AKHA 3HEBA 4BO6A 3DHNA 5JZSA 2DFKB 4AO8A 3MGBA 5IKMA 5CDTA 2PPLA 1FXSA 5K0FA 1OZ0A 1U90A 3A11A 3MIZA 4MQEA 4ZHQF 5CCBA 4AQ7A 1KOJA 2XZLA 3IV6A 2EZ8A 1LFAA 3JARA 1DJMA 4BKOA 1R6TA 1A7JA 3AESA 3DMDA 4MUHA 2VXYA 4CT0A 1AS0A 4DLTA 4O4JB 5M34A 3CRMA 3BIOA 5CJ2A 5F3RA 3S6JA 4ZANA 2FN8A 3K0AA 2GKSA 3B1FA 3DFMA 1RBMA 4YJ3B 2QUBA 3Q10A 3M6UA 5DSTA 4HZIA 3VR4A 5EWLA 1F4PA 2R79A 3KOWA 5BR1A 1C0LA 2XCUA 4MDEA 4K6CA 2F9LA 4XIGS 1E6UA 1DUIA 2ZT8A 3KCQA 2QRVB 1YKFA 1BE0A 4XDHA 5LC1A 5KNBH 2XLCA 3I8OA 3TZLA 5JBQA 4MR7B 3L5KA 5E8RA 1NFFA 1FTQA 4ZO7A 4DDUA 5B1EA 1XQYA 2YHSA 3SJUA 3QSYA 2DZDA 2ONZA 5CVTA 2H1FA 1GCGA 3EQ7A 3Q7TA 4NH4A 1N8TA 3I3OA 2N75A 2DBQA 1DDOA 3PEUA 4FTWA 4F84A 3N2GB 3FNIA 4RW0A 1KAMA 3G0BA 4DIBA 1NUHA 2AZDA 4S1TA 3VNAA 5LOVF 2V59A 3ZTWA 3WLMA 1GEEA 3FM9A 4FBMA 3MTIA 5BV2P 2FG5A 2VUSA 3ASUA 1K6IA 3EBPA 3PSAA 1U11A 5BRAA 4DR6B 5KWEA 3KQMA 2Q3HA 1IN7A 2QLNA 3R2JA 4I55F 2XT6A 2RHWA 4LBYA 2A5LA 2RKOA 3OQIA 3IAXA 4OP2A 4UCWA 3I12A 3OC0A 1EUQA 4RNCA 3FF4A 2FPOA 4KMMA 3P2EA 2DQKA 4LJRA 4FI3C 2IV7A 3FPAA 4AI6A 4TVBA 2J5XA 1PJBA 5AK4A 3AOGA 3HN6A 3SHFA 1N7GA 4EPVA 5FDFA 4PLFA 3H1EA 1JT2A 3C3BA 1UOEA 4I5IA 3EC2A 5A7FA 2HQ1A 2KQUA 5FA6A 5JAPA 1KTIA 5DK4A 2D8MA 2Z2ZA 1VP9A 4WBNB 1TB4A 3ROQA 5EQDA 1L2TA 4YT8A 3PNVA 3EULA 2EGHA 4MV4A 4GMDA 2P9FA 4RKWA 1E8NA 5EKTA 5B7NA 1LJUA 4YMHA 1H6BA 5BT8A 1V4BA 5AW3A 3BXHA 4EZIA 1DOAA 3V4SA 4LZJA 3ZNNA 1HLFA 1PGOA 4FXOA 3WLPA 4KLAA 4YRIA 2GBGA 1Q0UA 2IYYA 1QU2A 3PTLA 4FGLA 4QFCA 2RHTA 1KRHA 3W2IA 3T6KA 2A8YA 2ZCJA 3DV0A 4GRIA 4DLSA 1BGWA 2GD2A 1UXHA 3MCUA 3EG5A 4DNPA 3UXYA 3DL2A 1F4VA 2DXIA 4EVIA 5LP6F 1NLZA 3TFOA 4F2PA 4DV3B 3AFMA 1Z7YA 4X71A 1TE2A 1NU8A 1WP9A 3CVUA 5C1OA 2YJGA 1H6DA 3HVKA 1BS2A 4XD7A 3S5JA 1K9SA 1U3FA 4U7HA 4QU5A 4KOEC 4GMKA 2Q4DA 2EKLA 3R09A 4IOKA 5COQA 1OYWA 2H29A 2WDPA 4RZSA 1ITZA 1XDUA 1U80A 2ES4A 2P3LA 2PUCA 3MC1A 3TPZA 1NVVR 1V8DA 2VVTA 3T3IA 3VR2D 3WIVA 2FPPB 1UZAA 2D06A 4MW0A 3WZMA 2VJOA 2GN0A 3CX4A 1BDJA 3DQZA 3NOXA 1H0SA 3HDHA 1TCUA 1HEUA 1WF3A 2P68A 1U2DC 3ACCA 4FKMA 4J7AA 3WGNA 5HWSA 2EKDA 1HF3A 2Q2OA 5B3JA 4ZZIA 5A06A 4BVJA 5SZJA 4O3MA 1FRFS 4BWVA 4M1KA 3RVBA 3RHFA 1KMNA 3MINB 3H5OA 3KVYA 1U0LA 2A3RA 1P73A 3HCEA 2PXAA 4LZAA 4O4JA 4ZZ3A 2FRXA 1TJ5A 2P1ZA 5A6SB 1BXGA 1SD2A 2LPMA 5EHGA 4BMPB 2FEXA 2QB5A 2Q9CA 2IYWA 2XW6A 3C4JA 1FDVA 3LFUA 3N2NA 4HLNA 4JKIA 4LYGA 3RVNA 4EM6A 3HFJA 2AUTA 5A3VA 4BVBA 1VXRA 2ZI5A 3BE5A 2QMEA 4LHZA 4X8LA 5AVKA 5CA0F 1AV6A 4XKJA 2C95A 2WQZA 1SC9A 1K8QA 5G41A 3ZGOA 4BFWA 3FTEA 1SA0B 1ZK1A 2OECA 2LVBA 2JGNA 1FFXB 5EKSA 3ZU4A 3GLFB 2RGYA 4MMZB 4WFQA 2C07A 3F6PA 4TLDA 4CLXA 1ORWA 1H2EA 3TTVA 4EI8A 5J1SB 5E7JA 4DUGA 1LBSA 1DAGA 2GJAA 3NS7A 1TM2A 2XYRA 4WEOA 2YRFA 3ZK8A 4JYCA 1A4RA 2R7MA 3GD5A 3D8SA 1XZEA 1QANA 2J8ZA 3KYCB 2E87A 4EITA 1EAMA 3IAFA 4RELA 3QU5A 5E9WA 3MPOA 3UT5B 1JH9A 4AKIA 5TIIA 3D4OA 5HRUA 1JPUA 2CJFA 1GILA 3ETCA 1TEHA 2CZQA 1CQWA 3NBAA 2EX1A 3QUTA 1IHYA 3RASA 5ICCA 2I2XB 1ZIOA 4ZTBA 1EK5A 1ISSA 1X7DA 1G55A 3PT9A 2FSHA 2Q4RA 1V39A 3PFIA 4IDPA 3KJHA 1RJ9B 1EG7A 4LWQA 3MMZA 5AKYA 1TUIA 2QLJA 1C1XB 4L8YA 1CJKC 2ID8A 2W6PA 2ZIVB 3OEWA 1R0LA 3CSSA 3JQGB 3Q98A 4M0PA 3FB4A 2VJMB 1G3UA 4UREA 1YJXA 3AONB 3GWGA 1PG2A 4JT2A 4RQAA 1KE2A 3QWIA 5I7FA 1E4EB 5FF9A 3WYGA 2ZR0A 3FRIA 5HZKA 1QC5A 1XPRA 1B1CA 1G4UR 3P7MA 4ZCMA 5DLDA 1H1LA 1SBIA 1ZKDA 1FP4B 3HYCA 3KC2A 3PBKA 4JMLA 4CEHB 1B15A 1QHSA 2IRWA 1KO8A 1MO5A 4HF7A 4AY5A 3OF3A 1DEKA 2G25A 2IGBA 3V4PB 3PD1A 2EFJA 4YMWA 5KYTA 1ZVKA 2OFFA 2NUPB 5ADUS 4L6CA 5FBVB 2DBRA 3CNQS 3HYSA 5KQMA 3HKDB 3T94A 2XDQA 2Y68A 2VTBB 2O8FB 3GJ0A 1XXLA 4YMVA 2GPAA 5FAKA 4X1OA 5HQ3A 1VLJA 5KNLA 4IKEA 3VJMA 3ZHSA 2CKMA 3EZNA 3LA6A 4LXHA 1PGNA 4MVYA 3WB9A 3KT3A 3KZNA 3UV3A 5JDCA 3CRNA 4JOBA 3A3YA 3RBVA 2AZ4A 4LHEA 1KYXA 1N2BA 4YUAA 1TM4E 1MJHA 1H05A 2Q8NA 3GG9A 1YTLA 1A9RA 4FDLA 4LGCA 2VPQA 4A9AA 2O6LA 2PGOA 4N47A 1YKGA 2V0CA 2WV7A 4XR4A 5CB4A 1R5OA 1X80B 3I8SA 1DCTA 1TJYA 1RI1A 1PUJA 1Z4MA 5BRNA 5DM2A 9LDBA 2YWJA 1QDEA 2VWHA 2IJGX 2NYAA 2DG2A 2GERA 2P0EA 1Q0HA 5ARDA 1NFRA 3IALA 5EEGA 4D92A 1QQ7A 2J6HA 2P79A 4N01A 2J3KA 2RAVA 4OKIA 3F78A 3T7CA 3H0KA 2WG2A 3D3JA 3RYCB 1I30A 1JNYA 4TVOA 1DLJA 3L43A 4HGZA 3D4IA 1J0BA 1OZFA 1G8FA 1UT8A 2V7TA 4EB0A 2X2EA 3KNZA 2PWPA 1BKYA 2BKUA 4YK7A 3A31A 4B82A 1L1QA 2QX4A 1BG6A 4JT4A 3ET4A 4C4YA 3IURA 1I7NA 3GLFE 3OCUA 5ALJA 1JHRA 1N8KA 3I2GA 4GS5A 4XYLA 1SCUA 5AFSA 1X2EA 1HQYE 5BURA 4W6ZA 3AGPA 1E6KA 5AI9A 3SYKA 4U7FA 5LLTA 1J21A 3ZIAD 3NVMB 4KITB 3K8QA 3WFIA 3WJ7A 3PDJA 1E2IA 4IHAA 5JFOA 1J24A 2IYTA 2PZ8A 4MQ5A 5H8WA 4ZVMA 3OT5A 4B4VA 1XRPA 3EIHA 3ESYA 4OIMA 2O52A 3TOZA 1I24A 1UZNA 2UZAA 3DONA 3HBFA 4KI0A 4WSOA 1Y37A 1UINA 3GGOA 3U9TA 5IZ4A 1JKJA 2B9VA 2ZVJA 2LR0A 3LT4A 1S1MA 4IXTA 2QDKA 2OCLA 2WQ7A 3VZBA 1QQ5A 3CLVA 4TYYA 3WRWA 2D2IA 4E32A 4I2NA 1UKCA 4IIJB 2FSVA 2XXBA 3VO9A 4RDXA 4CEJA 3H87A 4O1MA 4Y9DA 4OHRA 2WFZA 1J09A 3O03A 3OX3A 5JAMA 3S1SA 1OLSA 3WGKA 1YZNA 2CFIA 4J16C 1OFHA 3TL2A 2INGX 3D02A 2Z9CA 3H99A 4QTTB 3NTXA 5GV8A 5TY0A 4W7IA 3WYNA 3JWJA 4A2QA 3GF4A 1PJZA 3V4ZA 2C5HA 4H15A 3SGLA 4PSKA 1W0KA 3DTVD 5T41A 2K7FA 2OK8A 3JWHA 4EPYA 5I4IA 1NUUA 2V3VA 4ND6A 2I7TA 1P7VA 1W93A 3LUDA 2VSOA 1QPZA 4YUWA 4ZU6X 2XUAA 1ZSVA 3BQNB 2NACA 2K87A 4A82A 4B48A 4F3RA 2O8EA 2BJVA 4LHWA 1ZNXA 2Y05A 4EFMA 1W5AA 2PIDA 4WUTA 2DKNA 2FWRA 3KD3A 4XD7D 3AHCA 2GLTA 4E21A 3EWAA 3ZZTA 1KQOA 1OX4A 2HMSA 1W4RA 1KEEB 3OE1A 4X92A 6LDHA 3DZGA 1O87A 2PGAA 3Q1LA 5HE9A 4DEXA 3QVWA 2PHZA 1N2IA 4XYEA 3B60A 3OZIA 3TSZA 2WSMA 4KR7A 4TV9F 4MAFA 2QW1A 4ZEWA 3LW7A 4UTVA 5GV7A 4MQ4A 2CV0A 2CDCA 3ITEA 1Z2CA 2IS4A 2IU0A 1HPLA 2F8LA 4EH1A 5AW7A 2PO5A 5DFAA 3INNA 1P0PA 1KU6A 1UMDA 2C03A 3N75A 4IIJF 2GHQA 3I76A 4LDQA 4RLSA 3RU2A 1ZSNA 3TIFA 3EVZA 4ARZB 3VV3A 1XZMA 4KX5A 3S2FA 3TD9A 3T5AA 3OD1A 1C3OB 1E1RD 1QJ4A 4TLAA 4NCAA 3KXPA 1V2HE 4EOGA 2C78A 3GRCA 4KPEC 4I5GA 3O26A 3TTYA 1PZHA 2FUKA 1K0FA 3A1UA 3QOXA 4ID9A 3VTAA 4QUEA 4YRKA 3TZKA 3GLIB 1FJ2A 3TQTA 1UMCB 3NEJA 5IW8A 1JHAA 5CBPA 1H1TA 4I3GA 4D3FA 2FPKA 3GOHA 1TTPB 3RSLA 3ZXIA 2DT5A 5JZOA 2BMDA 1G0NA 3EGIA 2GGSA 4KSBA 4BVEA 1XMOB 1ZH2A 3DW1X 3VPHA 1T8WA 5HILA 3CY6A 4JLNA 4X24A 5GZ3A 2VPYA 1OAKA 1II0A 1MQ9A 1NUQA 3FVQA 4LVUA 1YMUA 4YV2A 3RSCA 3I64A 1VLZA 4EARA 5HQ3B 1V3UA 4N3AA 4I3HA 4LY3A 4DUGD 5L3RA 1ESCA 4QUHA 3FLMA 1GZUA 4RZUA 2EJTA 4NEHB 5F5LA 4AQYB 3CBQA 4PPNA 2E4ZA 4OXYA 3FR7A 4UNSA 2VK2A 3DTYA 4JP5A 3U9LA 2HT6A 2QTZA 2HF7A 2I4LA 3E8XA 3P4YA 1WM1A 1W76A 2VBFA 2QT9A 1JHOA 1L5WA 3D8NA 1I3OA 4B5KA 4CLRA 5DNEA 1XU9A 2CBZA 4JEUA 5I3ZA 2MMGA 3R0XA 4WNYA 1N2OA 3OUZA 1G9XA 2HWYA 1MFPA 2BKAA 4HGYA 2CUNA 4RYDA 1C1YA 1SZCA 2CNWA 5BRJA 2O2HA 1EBBA 3DUFA 2IPAB 4LWZA 4P92A 3IVXA 4JX9A 3AJ8A 4UTZA 1EVJA 4QPJC 4BVFA 5DYGA 1M2NA 5DCUA 1KI6A 5LKRA 3E7DA 3NM5A 3EDQA 2XRYA 3CKMA 4KIFA 3PWKA 1AZTA 1SHKA 4JBYA 1BOOA 4S2UA 1T91A 3DBOB 3E6AA 1D2CA 2ZFUA 3GDOA 4MWSA 3R3ZA 2C2GA 1JG2A 5D6OA 1N5IA 1NQWA 1QNFA 2C8JA 2AVNA 3STUA 2ZBFA 3C14C 3ICVA 3X1WA 2OPHA 3AJAA 1ML4A 1ZOSA 3QVKA 4I2VA 3FNRA 1HYBA 4OXNA 1TU0A 3RWMB 1QMPA 1L7BA 1N6RA 3C5CA 1ZW1A 2EJVA 1YC2A 3OZ7A 3R5FA 5I7EA 1A95A 4UDNA 2DH6A 2I4OA 3NTUA 1C4KA 4OO3A 3ZIUA 5HJEA 2YVKA 5KPJA 4EFLA 1QFJA 5LFAA 1EKXA 3L01A 4S1NA 2QD4A 2J41A 2WBLC 1LSOA 2XCIA 3IA7A 3PXEA 4INJA 4WOCA 2HGSA 4BNMA 4DCTA 1OJ7A 4G5SA 4QOSA 1DO2A 3IVRA 4XB2A 1LVUA 4HLQB 1F8YA 2EW2A 5LXTF 5DM1A 2JHFA 1PHPA 5KTYA 1WOYA 2XYVA 5FI3A 2CSUA 1BCSA 1XRRA 1WBJB 1Q7GA 4UHJA 3T1TA 4LXXA 1Y5RA 1VJTA 2DETA 1A8PA 4UDXX 4S0ZA 4UMVA 1XJCA 3F7MA 1ZM4A 3SZGA 4URYR 2O2CA 4RXMA 1M1UA 4X0EA 4B33A 1W34A 4HPXB 1MP0A 4V02A 1P1FA 1JB9A 1VRWA 2EJBA 5CLGA 1UANA 1LBHA 3WJ2A 2OFPA 2VZ9A 4HXEB 3LUHA 4J90A 2Z1MA 3CHYA 3TLXA 4CCWA 3LTNC 5E1BA 1UJ4A 4P4TA 4LC0A 2I71A 3KQSA 2O8NA 4HXFB 3KJIA 1RKVA 4PZ9A 1OWLA 2XEXA 4S1WA 2BCEA 5CJJA 2R11A 5JSYA 2IOHA 1G0OA 4V3BA 4WZZA 1JMYA 1L3IA 3R0QA 4PGHA 3WNCA 3ZIAA 3IYLW 3O6VA 1I4TD 1ILWA 4E5PA 3EUAA 4RIGA 3NBFA 2EQAA 2IW3A 4OB6A 4U7GA 5KMGA 3IDZA 2UUCB 1AKVA 2UVDA 3RT1A 2E48A 4GQAA 3SSMA 4W4TA 2VNAA 3NT4A 3X2EA 8LDHA 5JLJA 3BSFA 4BNKA 2ZITA 4XRGA 2ZIAA 4L16A 5ALOA 1V96A 4RZXA 3VHRA 2WWRA 4BMYA 3FI0A 2EQBA 1U5AA 4IG9A 4EECA 4J49A 5J40A 1KMIY 3LS2A 2ROQA 4YCSA 1NSTA 1SOUA 3E9RA 4OUKX 1JE0A 4OXKA 4AK9A 2XSZD 3OX2A 4WADA 3ZW7A 4TS9A 4B2PA 5JMOA 1M6WA 3H2KA 4LKRA 5BW6B 3GT4A 1GN9A 2C2ZA 1JALA 3JQ7A 1RYFA 3ANYB 4WZBB 4Z9YA 5CG1A 1XTZA 4YXFA 3DMGA 4P0PB 1OXTA 3EDCA 5DTMA 4UOZA 2ZRFA 4G1FA 2EW1A 3OCCA 4NZPA 4NBVA 1NBHA 4TQGA 3GJ7A 4L5BA 4NBNA 2DLDA 3E4DA 3S27A 2YWGA 4E5YA 4X9XA 5CBPB 5KX5B 3L79A 3MELA 1VHJA 1CTQA 5ICGA 3PTZA 4Z5XA 1BXGB 4DV4B 4MKZA 9MHTA 3K6JA 1YZVA 1ZVJA 3B36A 3N7TA 3GJXC 1LVGA 2FSPA 4J76A 4B6OA 4GGMX 4JGIA 4E0BA 3Q7SA 4R0NA 2CLEB 2I2FA 2VTVA 2IWRA 5JUWA 3KKOA 3CG0A 4HVTA 1L5RA 5DGTA 1XRQA 3O21A 3GU3A 5CB4F 2ZRPA 4RF2A 1B42A 1EFKA 1EFPB 5HBGA 1G38A 3DR5A 2G76A 3DGEC 3ISTA 4DLWA 4TM7A 5KSPA 4G07A 4BC1A 4YMLA 4UHFA 2ZJ8A 5DYIA 3L0ZA 1P5RA 3U7RA 2OCDA 5AW6A 1D6SA 3FWYA 3IIIA 2VWQA 4ZYYA 2MINB 4P8RA 1EFCA 2PKYX 3VPCA 1JIIA 2W2OA 4CLRB 4OJTA 3OT1B 3KOYA 3PRHA 3S68A 5HTOA 1OSNA 3WZ2A 2WM3A 4OGKA 4DILA 3W79A 4KTTE 1T3TA 4OSEA 2GNOA 3AUTA 5JAQA 5HKKA 3A6KA 4MB6A 1QG6A 2J9FA 1I01A 2AYYA 3RFCA 3WWCA 5AM4A 1T6YA 5BN4B 2Y0CA 4Q9IA 5AIBA 1MB2A 2FJUA 4MLZA 1T1EA 1G8KA 2PKCA 2QTHA 2QNBA 2YNMC 1X0XA 4PY2A 2B61A 1WS6A 1WZNA 1X39A 4IIUA 4UMFA 3G8BA 2Q0QA 4UM9D 5JLAA 1H4SA 1ZU4A 3RS9A 3UPTA 2GSWA 3BWMA 1E94E 1JEQB 3JS5A 1GVNB 1E1LA 3JQAD 3W3AA 3UYLA 4HN2A 5ES4B 3QEJA 4I1IA 4PZUA 5DVZA 3ZVKA 4HADA 1Y8ZA 3ZHCA 2LWIA 3OJWA 2HX1A 1GPAA 3VNRA 2VYND 4BTEA 1JEDA 4O4LB 2AFHA 3V6MA 1G5FA 1T29A 1FB5A 1GZVA 5LZ5A 4MS4A 4GYJA 2VJYA 2D0OB 3D7SA 3DFFA 4TT3D 3VDRA 1M1ZA 1RBYA 1V7ZA 4AN0A 1VL0A 1U7PA 4C0AC 3GGJA 4Q66C 4D9IA 4DV7B 1X77A 2HFJA 3FMFA 4LYAA 2NUTA 2RAUA 4BO3A 3H7IA 2BSXA 4INZA 1LQTA 4F4DA 3OQNA 4TZKA 4JI2B 1TT5A 2NXNA 4HCJA 1G8PA 2I99A 4ZRNA 4BMZA 2WM9B 3P45A 3GRFA 4BVHA 1JH8A 2OORC 2PQ0A 4OB7A 3V4LA 1YDEA 1BDMA 2WYOA 1BWPA 1G64A 3BF8A 3UUGA 3AF2A 5I01A 2VTEA 2DHRA 4US1R 1T4MA 3IAS1 4XM0A 3RTEA 1J00A 1RLOA 5AKKA 4YIHA 2F59A 3VFDA 3VTFA 4PBRA 3E22B 3KR9A 2ALJA 3MCZA 1Q50A 4HQNA 5KHLB 2PZBA 2E2WA 2DWPA 3E84A 1VSVA 3EW7A 3LC0A 4RLFA 4AP9A 4GWKA 4YR7A 3F73A 3SBOA 1Q11A 1V4NA 2K6GA 4I46A 1IN5A 4BGEA 2ZDQA 1H2AS 3I05A 1UBKS 1UXOA 3ZWOA 1W0JD 3WZLA 5EHQA 3AB8A 4Q3KA 1NRXA 3NBUA 2VT6A 1RMYA 2IXAA 1Q95A 3D6FA 3EMKA 3RBAA 2QTNA 5DNCA 2SCUA 1CF4A 4KVZA 1YZYA 5KU7A 3GRVA 1BJTA 4F7DA 3ETDA 5IYZF 1V45E 2JK1A 1CKEA 2P8JA 4WVFA 3SSOA 4J0GA 2FH5B 4AXBA 2OCKA 1G8HA 5AESA 2C2KA 2RAPA 3C3AA 3LY8A 2Y1CA 4D8UA 2PXHA 1JHXA 1L5ZA 4QC2A 5BSKA 1GUZA 4R9UC 5BWOA 4G5HA 1HNNA 1HYHA 1RI2A 3PIIA 1YUBA 1Y5IA 4ZJPA 4OQDA 2HIAA 4QA9A 1X1RA 1E77A 3CUWA 3HV2A 5AJTA 5JD3A 1SUFA 3V8PA 5LBUA 2JFHA 3IKJA 1P9OA 4RQBA 1CFZA 3G68A 4TLEA 2FW6A 1GTMA 3R3HA 3O7WA 1GKIA 3U7EB 2A9VA 1KVUA 1MV8A 4YAIA 2C88A 3MWJA 3X44A 1CRQA 3BKWA 5KNDH 4RMNA 3ZXUB 3SFZA 2C04A 2LCFA 3TNYA 2VAXA 4L73A 1ZU5A 2CDAA 2VXBA 4QEKA 5F1YA 4EKDA 4UNQA 3SXUB 3W2TA 4E6PA 3C7TA 4LF8B 4MP6A 2V6IA 5G3YA 3M8KA 3O5AA 3UATA 2HQOA 4UHDA 4HNTA 1E2PA 1XMVA 2QVGA 1NULA 4NYJR 3DGFC 2R6ZA 5CDFE 1UJ5A 2X8BA 2HHAA 3GJQA 3PFNA 3LF2A 1IWOA 2HF9A 4EL0A 1EXNA 3MRTA 2AMJA 2MINA 1BN7A 2YICA 2JI9A 1PVVA 2GM9A 3DAHA 3FHLA 4MGIR 1VI6A 3ZY2A 2GBPA 4L3WA 3ZI7A 3R8CA 4IWXA 4RABA 2GTIA 2ZREA 4EELA 2R6DA 4QULA 3B6MA 4L8GA 4CV0A 5HJ7A 1SHTX 4IYRA 1UZUA 4YRBA 1RQ7A 3C4QA 4M0KA 3TUIC 2FJPA 5K8TA 1F17A 1A4UA 1X7GA 2O2EA 3FYUC 3HVJA 3OCXA 3O9MA 1OXVA 1HI9A 1R27A 1LK0A 3RROA 3NVKI 3QUQA 4TX1A 2J07A 3FY4A 2WM2A 5DBIA 4Y2VA 4AD8A 2R25B 4Z99A 4LPSA 2J87A 3I9V6 1SEVA 1JA9A 2R1VB 1L4BA 5BUZA 2P2SA 3GGGA 1PGPA 1Y7HA 1TNDA 4PWZA 3T9FA 2AG8A 3VH2A 1NBWB 1E2UA 2WJHA 3AR7A 4AC9A 4BDTA 3VR5D 3U3JA 4L9AA 2P11A 5U4XA 5KHOC 4M76B 4OKSA 1KNQA 4WKCA 2BKXA 5KYUA 3EBOA 2II6A 4M7WA 4DCUA 1PFVA 3SZLA 5DXAA 1B8PA 4DLBA 1X7XB 3AM3A 2VPTA 1Z8DA 4FFMA 4G41A 1AB6A 4LVCA 4O2AA 3FYHA 4GKKB 3N0WA 1ZNQO 4C22A 1KYWA 1YDHA 5EL0A 4DNOA 2MDTA 2Z3ZA 1L7MA 3L8EA 5FHQA 3OBBA 3D6VA 3GHHA 1WVMA 1ONBA 2H6EA 4IOJA 3KTDA 1P77A 1T8UA 1JJIA 1XTBA 2XVXA 4LOAA 1G18A 1G4AE 4PSCA 4B2LA 3WLAA 2NXJA 3A9SA 3NBMA 5IBQA 4TS4A 3WBBA 1KNXA 1GUDA 5B2FA 3HPRA 2ZJYA 3A1DA 3FTNA 2BCJQ 1LV8A 2BZ1A 2CUTA 3DMYA 4JR2A 4TL9A 1PK7A 1ZN7A 3NOOA 1CHNA 2CDBA 1TO2E 2OBXA 3M9LA 5JMWA 3A9CA 2YQ4A 5LXTA 1DGQA 4YLEA 1VJCA 1XO1A 1L7QA 2ZTUA 3M70A 4KN5A 2E55A 3W6PA 5CITA 1UP4A 3BMQA 3QIAA 5KYXB 1ZCAA 1UBGA 5IDWA 2IYPA 2OHVA 3EY9A 4IXWA 1WSWA 4KAFA 5JRZA 2JGAA 3PLNA 3QMWA 4BV9A 3CW9A 4YP5A 4CM5A 3BIJA 3WSTA 2MYUA 1SKBA 4H0FA 4OHOA 5FIUA 4FFWA 3Q3IA 1OQAA 3R6TA 4TTQA 1D4FA 1XCBA 3ZWBA 3OAAD 1CLUA 5AOAA 1DXOA 5IKPA 4B7XA 1TUGA 3GUUA 1ZMTA 3T1OA 3DFIA 3QV2A 5JI3E 2YUTA 3M1IA 3ICPA 4PSDA 4L95C 4E46A 3EVDA 1RWQA 2IT1A 3O8OB 5AI5A 4A0HA 2AJLI 5EI5A 1U31A 2Q5EA 4XDZA 3OZCA 2I67A 5JCOC 3K5HA 1H1DA 3KJNA 2ID4A 1N3IA 1FS6A 1ZC4A 3WGUA 1ZAYA 3K70B 2WTXA 4RY0A 1FJHA 3ICWA 2WSLA 3UAYA 2CCKA 3NHAA 5KVCA 1IOVA 1EWTA 4V1CI 3C6YA 2IEGA 5FPHA 4RESA 5IM4A 3NHUA 4LHYA 4ZOLF 3TBKA 2O7VA 2OMEA 3I1JA 4EATA 1QHYA 4LRTB 4GD3Q 4MP8A 2OGZA 2JJ2A 3TSCA 3A3NA 1A8QA 4ZICA 2HCRA 2IXBA 2CEKA 4NBRA 4GLLA 4P38A 4RXUA 1U9YA 3URMA 4BAUA 4D3ZA 3LNCA 1YGPA 3ZHTA 3R8FA 5F1OA 1Q3TA 4JFRA 4WZ6A 1XDBA 2A5JA 2WHXA 4PLHA 5GVRA 1LA2A 4ERXA 3X1XA 5FPSA 3ILYA 2C2WA 4XWGA 2NZUG 5JQGA 5LWHA 2XB2A 1U0HC 1DDGA 2H2GA 2C42A 3CQ9A 4LA4A 4Y2UA 3RYFB 5HGXA 4A0QA 3WIEA 4KCGA 4HX5A 3T1VA 5HZGA 4ZZ1A 1P4HA 5H82A 5EJGA 4AY2A 3BXEA 3K7EA 4TV8B 4F1KA 3COSA 4ITRC 2PJDA 4I55A 5FCDA 4KXFB 3EIXA 4FI3F 4L5IA 4RMGA 1BMDA 1QR6A 1X8JA 4AMGA 1P44A 4FFBB 4EZBA 1RAGA 1EIZA 1WUYA 1ZMRA 3GEEA 4M1EA 1QTNA 4RVOA 2GPNA 1DAPA 2BONA 1YZGA 1YCGA 4MKRA 3IFSA 5EZYA 4KYIB 4YCCA 2GA8A 3OJEA 2H4YA 2XNDA 3O3OB 1W0JA 4WVLA 1NMSA 2VA8A 4AZ0A 2NPFA 4PGMA 4EJSB 3CU5A 3QVTA 4L8VA 1MXFA 1H6CA 4DUPA 1YBHA 4Q02A 3RBZA 1NXOA 3BA1A 3K4HA 4KQFA 4V0KA 4FEAA 2PSFA 1FMTA 3PL5A 1B8NA 3AOEC 1A8HA 5AOBA 1RQLA 3FPSA 1R9MA 5FO0A 3IUEA 2GXUA 4PYIA 1NAIA 5MGNA 2PKXA 4FYXA 2I6GA 5EQTA 4BX9A 3KZCA 4CVNA 2P7HA 4RJLA 1LRLA 1GGFA 1N75A 2IY8A 3HL0A 1NR5A 4LHSA 4Y2TA 5DGIA 2Q0SA 3LZDA 5TC4A 5D3KA 3ZOKA 5TVGA 5ESRA 3TI7A 1SVNA 1WIWA 1S7GA 3H2SA 4R6XA 2OAEA 4P7KA 3AVTA 2CVFA 3T9CA 2WABA 4B8ZA 1DT3A 2IHKA 5AVYA 3HXLA 2VT7A 4MS4B 3SF0A 4CIDA 3BE6A 1KZ7B 3E23A 4Q34A 2GK7A 3RC7A 2CK3A 3RV3A 4CDGA 2BHLA 3FW1A 5F33A 1Y1TA 3WDLA 3LD9A 3ZK9A 1GG2A 3CLUC 1IEXA 4MHOA 2RI1A 4Z9FA 3V8RA 3F9CA 4NJOA 1Y3AA 1RRFA 2HEIA 1W5EA 2BWJA 2O0HA 3HWSA 3ZG6A 2O50A 1RJDA 2NADA 3V7WA 2AFIE 4RPGA 3ZZ0A 1NUAA 4YVFA 5BN4A 3RVPA 5H3HA 1YCHA 5JDIC 3PXGA 5JCXA 1HL7A 4FHZA 1AS3A 1YR8A 4HH4A 5F1PA 3O74A 3Q8XB 4OH7A 2CLOB 1Z2OX 4CTKA 3EGXA 2O23A 1KI9A 2QAGA 4I4TA 4PWYA 1D2NA 3UT6A 3T9DA 4TXMA 3RU7A 2Y1EA 3FYTA 1NYTA 4LOLA 4E2WA 2V5UA 5GTDA 2PGIA 4BMXA 2JIBA 4KJXA 2UUAB 1N2GA 4XSVA 5KMGB 4FYJA 1AKYA 3RYIB 3UB3A 3KWFA 4Z49A 2ZYWX 4CKZA 3Q3JB 1VLHA 2XMRA 1ZR4A 3V7FA 2AS0A 3P97A 4I9UA 4J7XA 1SXQA 1A5SB 1THMA 2V98A 4WOJA 3VHXA 3OT4A 4P3PA 4LXGA 3RT9A 3VR5A 3PFHA 4BLVA 3QA9A 3I01M 1TCVA 2UVQA 1LTKA 3EVEA 2ZIXA 4NPCA 4FOTA 2R2AA 4DWVA 3K9FC 4U00A 5CXUA 1MHTA 2OORA 5DTIA 1NT4A 1M8GA 3C70A 5AI8A 3N0TA 1U6JA 2XECA 3PGKA 4JASB 4D9GA 3WLJA 3JPWA 2ZATA 3GFSA 2Q3JA 3M6AA 3IXLA 1X7ZA 1I80A 1XD2B 2HCJB 2C5BA 3ANTA 4JUAA 1QGED 4U2CA 3K0BA 4XGIA 3BRCA 3NHBA 4A2PA 4DZTA 3O91A 5DHUA 3P19A 1E0AA 4YJGB 1NUTA 1IUOA 2PK3A 1UK6A 2ZSUA 2ZIZA 1VIMA 4ND3A 5ALPA 3SEQA 4BQSA 2NUAB 2H1CA 2EATA 5E9QA 1XELA 4B4OA 2QL6A 4AIRA 1E3SA 5LD2C 3U3DA 4CN9A 1KDPA 1LTQA 3IEXA 4AZ3B 2HMAA 4OYHA 2P9CA 4QE3A 1GGMA 1OWNA 1O3YA 1QRRA 4X20A 1GQYA 1NQXA 3JWPA 4RKEA 4FMDB 1X19A 4AF7A 5FOXA 2YNMA 1QVWA 4M22A 2BFNA 1ZD3A 3TQRA 1GYPA 3B1ZA 1M54A 2D1FA 3DCYA 4P3YA 3DZBA 4RY9A 4JHLA 4WINA 1UBEA 5JEEA 4R54A 2NQTA 4PV7A 2CNDA 1CFJA 3IP9A 3F6SA 3SBDA 4B6RA 3TLEA 4Y1RB 2XGSA 4Y2YA 3SI7A 4HBGA 1N9GA 1HFWA 3DLHA 3OZTA 2B21A 3TMYA 3BL6A 4PPQA 3X43A 1ZI8A 1KY3A 3ZE9A 4LE0A 3ZI0A 4GT1A 3T3EA 4BNFA 4FR2A 3C7AA 5A1TA 1RQGA 1QIGA 4XX0A 2QUHA 2IZOA 5ADHA 4DJAA 1F8UA 1TKRA 3P9RA 2ZETA 1YI1A 2Z43A 4H1WA 3AJ9A 4P82A 1I10A 5TF4A 2W22A 2R8ZA 1UOPA 2HB6A 1OYOA 2GZDA 4IHJF 4J3NA 4B34A 2W6MA 4BLUA 1HM5A 4EDHA 4KFTA 3G49A 3HO6A 4GOKA 1TEXA 4NQRA 2SECE 4B80A 4HQFA 4LJLA 2GZMA 2XMQA 1FRZA 2V7BA 1NF3A 3E4CA 1ZHFA 2AHOA 5BR4A 3FMGA 4PICA 2CHUA 3FSJX 3TN7A 2FN4A 3L6UA 3BOSA 1PWXA 3QU2A 3VR5H 4B74A 5K6AA 3QKIA 1KXJA 5HDQA 5A9SB 1FUUA 3PQ3A 2JJ1D 3UBMA 4D3YA 4OU5A 1EK6A 2JH3A 4ENRA 2AC4A 4ZQHA 3ORRA 3OF2A 4QTZA 4IAOA 1WHTA 2CDRA 4ZJUA 2IQIA 4X3OA 5AJUA 4KRXA 1FMCA 4JC8A 1JKFA 1OLUA 4P1ZA 4EYEA 4N76A 5JNVA 3BTUA 5F9FA 2UYHA 1JJ7A 4CG2A 3UA4A 4EFNA 2O48X 3VYSB 1EAYA 3DCNA 2VEOA 1IQPA 5BN3A 3LLVA 1SUEA 4YLGA 1FX1A 3THRA 4JP3A 3VR2A 4F6RB 1VGRA 1CQZA 3EZFA 3JD2A 2VXOA 2RHBA 2E6KA 1J20A 4PS0A 3UY4A 2AKYA 4BZXA 2MMCA 5IJ0B 4JT8A 3E70C 2WNHA 2Y6VA 1P19A 4REQB 4PCLA 1P60A 2H2WA 1YJ8A 2IODA 4UBJA 1M72A 5BWNA 1QQBA 1FP2A 4WMLA 4XSGA 5EIEA 4JJIA 4OQFA 4PYNA 5JWHA 1YQDA 3S5UA 4WDRA 3USZA 4UNNA 5BNFA 3PJDA 2DE0X 1W44A 2HSGA 3D8HA 3K05A 2XDYA 4FIZA 2PCLA 4EY5A 3BHJA 2IYLD 3EGEA 5H4HA 5BMVB 3K20A 5AICA 3FHCB 1IYZA 3D9QX 3W90A 4GBGA 2IXDA 1EHCA 4YCMA 4RTOA 1XP8A 2R44A 2XXJA 3BMNB 1A9XB 1Y42X 4J6FA 2NSDA 4UFOA 1DAOA 4DMMA 1RAIA 1RPAA 2BJHA 2QRZA 1CY6A 1Z7WA 3ISJA 3PF8A 3ZDFA 4CNBA 2CXTA 2Q6LA 1CR4A 3PICA 2P9YA 1L7AA 4DA6A 3TLMA 4EG7A 3OM8A 3S29A 2H4XA 4OF4A 3LUBA 5L6LB 2P2LA 3BJEA 3AXTA 2H4ZA 3G2LA 3OO0A 1GAWA 4LJ8A 4DBZA 4EYOA 5WRFA 2DCMA 3IPLA 3ML1A 3L77A 3ROZA 3QLUC 1AXGA 4JLDA 4H3KB 4JJKA 1U63A 3GVPA 1BQEA 2BI4A 4BTLA 1MX9A 4L2IB 3MJRA 3FMOB 4ZOCA 1DCFA 4QDJA 2H7VA 4OAPA 4YXWA 3OC6A 4BNTA 4KDRA 1JHMA 1NIPA 2D2XA 1QS0B 3DO5A 3FFXA 3O73A 4CM4A 1O8BA 3LVQE 3CLSD 4GPIB 1M73E 2AW5A 1A9PA 1M2FA 3OLCX 2FMFA 1CIJA 1SKYE 4P58A 4PGAA 5CMLA 3KOOA 4BQRA 2C4VA 2FRDC 1ZCBA 2R6R1 3GLRA 4QXMA 4XRRA 3BFVA 3I53A 3R5JA 2Z6VA 5L6MB 1COWA 2B98A 4MEJA 4GYWA 1OC2A 3ZJ5A 3E9QA 4Q19A 5G1NA 4RK5A 1WY5A 3BXOA 1E3EA 1ZM3A 4WZBE 2X5KO 2NU6A 4R1TA 4EY4A 3ZQUA 4DL9A 3I9LA 3WQBA 5HS4A 1K2VN 1MH1A 1O0SA 2XUIA 3KHUA 2BF7A 4LYYA 1MX5A 4K9QA 4QGAA 2H3HA 2RH8A 1XZKA 5EAIA 4V1CA 1DRWA 1GPMA 2WUWE 1TF2A 2YXLA 3MT8A 2C2HA 2H08A 3IUMA 4BNUA 4LOKA 1DBQA 1ZGBA 5CLIA 3RB8A 4DJJA 1DFIA 1IUKA 3JU3A 2OILA 4GI7A 5LLSA 4FFNA 2OSVA 2B30A 1EPUA 5AVRA 3ZYZA 3HJBA 3BJZA 1KS9A 5CFLA 3MWYW 5JRJA 3NKFA 1PI3A 4JQOA 2XTMA 1RLUA 4NMMA 4OH1A 1Z8HA 1WZCA 3RARA 5BMVF 4GP7A 1YFKA 2OUKA 1JU9A 3SIRA 1PTJA 4EX6A 1Z2PX 3QU9A 2ET6A 4XLLA 1AMNA 2JFQA 2ZIFA 1XTKA 1E9VA 1H2WA 4NNPA 1UM8A 4N1AA 1QIHA 1VDMA 3PWTA 4HDMB 4BQQA 1R4AA 3F6YA 1W0CA 1RI3A 1AKNA 2PL1A 3IHWA 1I3CA 1QOQB 2FZ5A 3C6MA 2IZZA 2JARA 3A0RB 3D31A 5F64A 1L5GB 3CZ5A 3COVA 3GVIA 1P7WA 1ATIA 3P4UA 4UZFA 1Q0LA 3NMUF 4H7KA 1XRLA 3CF2A 4IY1A 2C84A 5C7LO 5TR9A 3AW8A 2QUAA 3KYBA 3CBGA 4PG5A 1XFDA 2DBZA 3DSRA 1JAXA 3AL0C 4MQBA 3LUGA 3TLZA 1P3DA 1Y63A 2OUIA 3I34X 4X1YA 1JIKA 1DIBA 1PZGA 3SS8A 1E5VA 2XV1A 2ZR7A 4MUNA 4E12A 4MS1A 1O0BA 1KK0A 2FFQA 1QUEA 4JR0A 5HM8A 1Y1PA 4BO4A 3WIBA 1LQ2A 3O94A 4R9RA 1H9CA 3DPSA 4RM3A 4D4MA 2BR5A 1YJBA 5C8DA 1EXDA 2O5CA 2V7GA 2VUHB 2ZSEA 4C0XA 3G0HA 3HWX1 2OCGA 3T52A 1JMKC 4C7VA 5I9NA 1IZYA 3DMPA 5T4EA 3L7DA 3U16A 5DCWA 1SC1A 2O57A 4IWNA 4WGGA 2H31A 1S3GA 2VDJA 1Q16A 2SBTA 4RVHA 1HDOA 2IYOA 1G3RA 3LLMA 2IP4A 3BCSA 2J48A 3LDHA 5KNCH 2Z9BA 2Y3IA 2VQFB 1JA0A 2WE8A 2PX3A 1R6DA 2D59A 4H7FA 3N8GA 2ZRJA 1LKZA 2GRUA 1IY2A 1M2VA 2I34A 4IINA 4X3PA 3JYOA 1W87A 3AP3A 5G40A 3JQ8B 1QHGA 2VYFA 3AWIA 3GO4A 2A9FA 1ZP6A 2WVGA 3A6JA 3UXMA 1SKYB 4O0LA 4B45A 5DTEA 4EKIA 2ZRMA 2QSUA 3QMPA 5JNRA 1HLDA 4F3NA 5G0SA 3NH9A 3R0JA 1NDHA 4EGCB 8MHTA 2EWWA 2PYZA 4H18A 1H93A 121PA 3Q9NA 4WXMA 3AF3A 4F4CA 4EB3A 1SBYA 2FE4A 2J9GA 4TUYB 5EZ5A 3SR4A 3RWBA 3RYCA 1XBTA 4CM8A 5I7OA 5FPQA 5BN1A 2RHRA 1XAHA 4AJ4A 2WRZA 3G6WA 4PQRA 3ZKWB 4Q48A 3CNLA 4YASA 1SUCA 1J2UA 3FCSB 3V32A 1RC0A 5H02A 1IDN1 4FYYA 4BNIA 3DEHA 2C77A 4MW4A 4X20B 1P31A 1TUBB 2XQKA 3DZDA 4JA2A 4FEGA 3RFUA 1B0PA 1HG0A 5CX4A 5IMSA 3QK7A 2O7QA 3I5YA 2ZUEA 2AD1A 4QOHA 1QO0D 4BKUA 1SCAA 3QTTA 4R1OA 3IIEA 1GUYA 2VUUA 2NSYA 3MB5A 1OTHA 3ZX4A 1GRQA 2BEUA 2WJZB 1PJAA 1HDRA 3DOUA 4BEJA 1S4QA 3ED1A 4WZBA 3TUJC 4CKCA 5E3IA 1RE0A 1LQUA 4ENWA 3EG9A 1OBVA 1Q0SA 5HXAA 4JV5B 3TFWA 4CU5A 1PS8A 1KEZA 2J3IA 1RLTA 1JFSA 2XE4A 5JD4A 4NARA 2ZE8A 2HK9A 3MCWA 4HWPA 1BHQ1 3E7XA 3HBMA 2BLNA 2WPDA 3PV0A 4IJ5A 3SU8A 2BFBA 2PUHA 1LRKA 1YK0A 4FZ5A 2W42A 1LZLA 5ITZA 1UJBA 5LCXA 1QV7A 3HO8A 4KGXA 1EFDN 5AI4A 2FFAA 2IPMA 1GTG1 2JKVA 2NZYA 4FFPA 1F2VA 2OHIA 4IDHA 4KDFA 4FXPA 4RH3A 3W9BA 4LDZA 1OH8A 3L7OA 5JAUA 1T6NA 2QT0A 1U2SA 1VIAA 2NU7A 3DH0A 4YRNA 5CBKA 1XTVA 3CTPA 3PQ4A 4MI3A 5AVSA 3WHKA 1U65A 2V58A 3KT6A 4B3XA 1RWVA 2BFWA 3L41A 2Q41A 3MVEA 1VSUA 3BT7A 3MSCA 4HJRA 1ISFA 4M53A 5DOZA 1IN1A 2ONKA 3VAZA 2ZWMA 3BHNA 2XA2A 5FWAA 4EQZA 1TGYA 2P65A 2QMZA 3ZHVA 4E94A 1UPXA 2ZB2A 5L3QB 2FWIA 2BKVA 3BERA 4QYTA 3RGGA 2EZTA 5BWLA 1XMIA 1YBAA 1EVKA 1KOFA 2WJPA 1ND6A 1WABA 3E22A 3CRQA 3I09A 4ZVOA 4ZCLA 4HDSB 2P7IA 3B3FA 4UXJA 3T7AA 4H1UA 1P91A 1SXHA 1ZUWA 3RU3A 3QJYA 3GP5A 3V8MA 2H07A 2CL0X 4JI0B 3GVXA 2IUEA 1C80A 4GR4A 1RJFA 3VZDA 2O8EB 2QUZA 4ZKEA 4YR9A 1E1MA 1Y6FA 3Q5EA 3IVAA 2WF8A 3X3HA 5BSVA 3DMRA 2H11A 1FNBA 4ZODA 4UU0A 1X1EA 4YXWD 4B9EA 5JC8A 1ZVVA 3ESZA 4R0VA 4RSHA 2K7ZA 1U81A 2NUTB 3MGCA 2O7NA 3C3DA 4TVKA 3TXAA 1AA6A 2VDVE 1XK7A 2VL7A 4F60A 3C3KA 4AMZA 3UENA 3C6BA 4X45A 2L69A 5AXDA 4ZN6A 3HCPA 2AFHB 4NABA 1PVDA 4NFHA 3FVWA 3GJ5A 1E66A 1A71A 2ORVA 4KBGA 4MPPA 1TAHA 5CU7A 4YQZA 1TADA 4GFDA 3ZWCA 4EL5A 2H1OA 3OQHA 3W4JA 3OPYA 2YV4A 3T7KA 5EJ6A 2PKRA 1CRZA 3D6MA 2WTAA 3NM4A 2UXDB 2PYIA 2GILA 3U62A 1O9BA 2HMWA 1Z4KA 4HO1X 3BE8A 4KB5A 2AHRA 2IH5A 1ORIA 1EVEA 2KLBA 1IN8A 3DOIA 1ZW6A 4G1BA 3BYZA 3PL1A 1NT2A 1UM9A 2I8AA 4BV2A 3U7IA 3IR5A 1OFGA 3MUEA 3SC6A 3HKEA 3N0XA 3WK9A 3LWZA 5KSWB 1FMJA 1QZUA 4U2FA 2RGNA 3ZCVA 1HH4A 2HLDA 3BK1A 4EUHA 1KIMA 5C3MA 1CP3A 1DAIA 1M75A 2AR0A 2JFPA 4DRXB 1Z0SA 2ACWA 5AHRA 4U02A 3KS9A 4KPUA 4KUHA 1Z73A 4UNIA 1RPNA 4H7JA 1Y6GA 4QREA 2DYKA 5LMZA 1ZQ1A 3RK1A 5FXMA 2I62A 4ZQBA 1K66A 3GK3A 1NURA 3ZZ1A 4KNWA 4IIHA 4A0FA 4B0OA 1Z0JA 1XLVA 3BGIA 4AZWA 4DWOA 1Y1SA 3FZGA 1OI7A 4ENQA 3JQRA 2GCOA 1YU9A 2X0KA 2ZJ6A 3LDUA 4RHFA 1QP7A 2D8AA 3QFRA 2IHUA 4KUEA 1FRVA 3ASYA 3LBIA 2PT7A 4LCEA 3VKUA 1FJXA 2YW9A 1SXJA 3GIDA 2AJBA 2WZDA 3BMCB 3C3JA 4B7CA 4A23A 3LKZA 2IXTA 3JVVA 4Y7CA 5JXGA 2EDCA 1IK4A 2G5TA 4GU5A 5CLHA 5CM9C 3WGHA 1LNZA 5G4KB 4B6JA 3ADCA 2FR0A 4MQEB 5JAIA 1G8MA 4CG1A 3JRNA 5HIAA 1MTOA 4OX9Y 1UMCA 5KX5A 3NHPA 2QI9F 4GR9A 2ZIGA 1GN8A 2WNSA 1JKIA 2OXIA 3UWKA 4AJHA 4FT2A 4CW7A 1BQ3A 3UMVA 4JQSA 4DIUA 3O8QB 4XASA 4MLDA 3AR3A 4RVDA 3RCBA 3BTSA 4BB9A 2C96A 3AUAA 3E3NA 3O3MB 3PE3A 1MT3A 2VK1A 3A1CA 1X74A 4KSCA 4R2MA 3TLYA 4RTQA 2ZB4A 1U28C 1YL7A 1ZWKA 2RCYA 1G7RA 2RJ3A 1YB5A 2KW5A 1OI4A 2ACEA 1A2BA 3L8DA 2ZYDA 3ENNA 4K6HA 3ASVA 1QG2A 2C8VA 4MUEA 2PKQP 1WPGA 4P98A 5JCOA 2Z6AA 2YJ4A 5JZ9A 1YE3A 2HDHA 2B37A 3BDVA 4RS3A 2YHUA 5HOEA 3UK7A 2W90A 3DZFA 4HTFB 1V9CA 3T3NA 3WRYA 4N41A 1JLHA 4BGUA 4CIBA 3TZQA 1NSFA 1IXRC 4RE5A 4BU1A 2QZJA 1T3ZA 4MI9A 5JAHA 3G0GA 1L7RA 3AILA 3BA6A 2PAFA 3PHCA 3ZLBA 1IY0A 2CXUA 1IRIA 3MGAA 3OQ6A 4QOFA 4WN9A 3JRXA 3OTQA 3UKOA 3WIOA 1RFLA 5DLEA 1B14A 5DGCA 1X9IA 1UP7A 2A1UB 1IONA 1GGVA 4MS1B 1O96A 2ORYA 2CD9A 5HK9A 4AVYA 1Z12A 3UH1A 3DE6X 1TYDE 3BQMB 4CGZA 3W9SA 3TOVA 3A05A 5D00A 1F38A 4A0SA 4LJ6A 5B64A 2WWYA 3OESA 1E9SA 2FSVC 2Q6VA 3PXXA 1IIBA 1JRLA 1RZVA 3GLKA 3ONWA 3NOVA 4H60A 2JATA 4P2GA 3TYXA 3FAKA 1NA5A 4K87A 2VDKB 2O0JA 2MHCA 3F49S 3HYNA 3IESA 4ZVLA 3T5BA 4DUYB 3FX2A 4CL0A 4R9VA 3RHZA 1UC9A 3ROTA 5AVTA 4PRKA 1LJ8A 2IA5A 1P5JA 4OQYA 1BMTA 2XMCA 3SKXA 3P32A 3D7NA 1Z0DA 1O6CA 3SX0A 4B75A 4YJFB 4XQ0A 3MTBA 1ELOA 2IE8A 1N0WA 2VYQA 3TQQA 3TDMA 4MTCA 4RV4A 5K0EA 3VVBA 4U3JA 2DBVO 3ORSA 1KQPA 4MGEA 2I7VA 3IO5A 3JVIA 2PYDA 3VSEA 3QLVA 3R9WA 5B58T 1G20B 3AC0A 4OHVA 1NM5C 2QK4A 1P7YA 2E5LB 1WDTA 2QJRA 1VFNA 1DAHA 3HP1A 3I32A 4D6YA 5I9SA 4LF5B 1QC5B 1Q3KA 3VPFA 3G02A 2BFMA 1JG4A 2IUTA 3DWFA 3GJSA 3WGMA 5B7PA 3W5AA 2V4MA 5IVKA 1UDRA 4KGVA 4DV0B 1N2HA 2QYSA 2RCNA 3BFXA 4DTCA 4HYQA 1QH8B 3SOZA 4H4CA 2W83A 2HU5A 1TK9A 1WLYA 1F6DA 4IJQA 3PJFA 1HL3A 4I5EA 4PC6A 1KYIA 1XCMA 1I7LA 5L7TA 3WYEA 4U7TB 1CF9A 2C82A 1TM7E 2Y4OA 3ZZNA 3MS4A 3WGZA 3VU9A 2ZEJA 3BBLA 2JI6A 3D0KA 3UT5A 1PSWA 2FSGA 1N5OX 4LC1A 5A3SA 1HLGA 1DX6A 2GZ1A 2RE8A 1AXRA 1JDZA 5D01A 2L0XA 5JJKA 1BVYF 1YCDA 3Q9SA 1OI2A 5EIWA 1Y6RA 1KZ9A 1JHQA 2OVFA 2IUSA 4I66A 1NQAO 1PJ3A 5KYGA 3BCRA 3NGMA 1QGAA 4GPAA 1Z5ZA 2GF9A 3C3YA 1NE2A 1T1GA 2C99A 4RHCA 1Y3HA 5M3BA 3L4KA 3U48A 1GCIA 2X22A 4GIBA 1P4SA 2BEUB 2W6JA 4KO3S 5CHEA 2EEZA 5IDVA 5J2UA 1MW8X 3VKGA 1F60A 4V0OA 3SQLA 4AYTA 3TK1A 2EBWA 3QFTA 5LYJB 2ABWA 1ZK3A 1ZS9A 1J9EA 2BEWB 2G70A 4JELA 3DDSA 3O3NB 1EWKA 3DFZA 3JSAA 4P6VF 1SVUA 7AT1A 1FLNA 3LXRA 1XDWA 1ISHA 2FZGA 3JQFA 3L4SO 2JCSA 4M0UA 2V03A 3HKDA 4IGAA 3CNNA 2JFBA 4DM3A 1X1DA 1Y6JA