4OU4A

Crystal structure of esterase rppe mutant s159a complexed with (s)-ac-cpa
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
319
structure length
319
Chain Sequence
b'SGSPGVEQHTQAFLEALEQGGGKPLEQLSPKDARAVLTGAQASVKVDLSGIEVKERTIQANGQSIKLQVVRPANVKGELPVFMFFHGGGWVLGDFPTHQRLIRDLVVGSGAVAVYVDYTPSPESHYPTAINQAYAATQWVAEHGKEIGVDGKRLAVAGNAVGGNMAAVVALKAKEAGTPALRFQLLLWPVTDASFETASYKQFADGHFLTTGMMKWFWDNYTTDAKAREQIYASPLRASSEQLKGLPPALVQTAEFDVLRDEGEAYARKLNAAGVTVTSVRYNGMIHDYGLLNPLSQVPAVKAAMRQAGTELKVHLQLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha/beta hydrolase fold-3 domain protein
publication title Crystal structures of Pseudomonas putida esterase reveal the functional role of residues 187 and 287 in substrate binding and chiral recognition
pubmed doi rcsb
source organism Pseudomonas
molecule tags Hydrolase
total genus 117
structure length 319
sequence length 319
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2014-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ou4A00
4BP9A 4J0CA 4UHBA 3QZUA 2I03A 2WIJA 3AIKA 3WK4A 3CN9A 4FHZA 5LLSA 2XQKA 1XQWA 3QBJA 4X6UA 3WZMA 4U2EA 4Y2SA 3D0KA 2XUQA 1HPLA 2XUFA 4PSCA 2HU7A 2XUPA 4RE6A 3WKDA 2LIPA 5AIAA 1QIJA 4B84A 3ICWA 4L72A 1N1MA 4B82A 4HZGA 4OU4A 2GZRA 3QPCA 4QE3A 5FP0A 3U1TA 3BIWA 1W52X 4ARAA 5LZ7A 3O0DA 4E46A 1MX9A 2OG1A 5FPQA 5CURA 3C8DA 1EH5A 2JGJA 2ORYA 4OB8A 1R9NA 4AN1A 1XZKA 1XZAA 5C8ZA 1XKTA 4QEKA 4RPCA 3IUJA 2BFNA 4G8CA 2FUKA 4UPDA 1R88A 1QIIA 2WG2A 5AKEA 1MAHA 3R3YA 1LNSA 4H0CA 3BDVA 3DEAA 4ZV9A 4TPKA 3D2AA 1VXRA 5ALUA 2XUIA 4UUQA 4BBZA 5AOCA 1DT5A 3HLKA 5AKKA 3AINA 3IUNA 4ZI5A 1RP1A 2W6CX 4BB0A 1CQZA 3R41A 1BS9A 4B9AA 3R40A 1N5RA 4MWTA 2WTMA 1UKCA 1CUXA 1XROA 3HACA 1JFRA 4C4YA 2DSNA 2ZYIA 2VATA 4BYMA 5ALHA 4X91A 2ZSIA 1FFCA 3G0BA 4BDTA 2XLBA 1GPKA 4QDUA 5ALNA 2ZYRA 1CR6A 4XVCA 3ZWQA 4QLAA 4AZ0A 1VLQA 1WPXA 1EB8A 5HFAA 1N5MA 1QO7A 1OILA 1ZIYA 3A70A 4H18A 2VF2A 3ESDA 1EA5A 3OPMA 5ISMA 4AB1A 4PF1A 1EDEA 3WWDA 1JT2A 1XZIA 4WY8A 3FLBA 2QOEA 5AIBA 2QXUA 3QPDA 3O4HA 1QTRA 4PNZA 1L7QA 3NGMA 3Q0TA 2PX6A 4H7KA 1H2YA 1DX4A 2QRUA 4H7FA 3KWJA 4DYHA 2ZJ6A 2PU5A 1G66A 3DL7A 4MYDA 1IUNA 3AFIA 3QITA 3R3UA 1XZCA 1EINA 4BE4A 5A6VA 1WB5A 4TVKA 1LGYA 5EIAA 1LZKA 5LP1A 5DLPA 1P0IA 4F60A 2WHPB 5AKXA 4KEAA 5FV4A 5K5EA 1DWPA 2XQFA 2C0QA 4EY7A 3CXUA 4F5ZA 5HQ3B 1J06A 2QTBA 4KAAA 1G5FA 3ESBA 3U0VA 4DGQA 4G9EA 2EDCA 2R8BA 3IURA 2HU5A 4FTWA 3VVLA 5HKBA 3V48A 4J0KA 2HA6A 1DT3A 4FWBA 3H18A 2XUKA 5ALRA 3HYSA 2RGUA 2OCLA 1DU4A 3AIOA 3E1GA 1ODTC 3OURA 1XRMA 3JWEA 2CBGA 2K2QB 5JARA 4UBJA 4RNCA 1XZMA 4J0DA 1XFDA 1TCBA 1XLWA 3VDXA 1MJ5A 3O9VA 4PSDA 3PFBA 3W04A 4Y9SA 1U65A 1NU6A 1QFSA 1BN6A 5ALGA 2QJWA 4IO0A 4H7EA 2C5FA 3WWOA 1DWQA 4EBBA 3PDCA 5LZ2A 1R9MA 1CUJA 1ZJ5A 1U8EA 2OGSA 4B85A 4UHCA 2OCKA 4P92A 3S8YA 1ORVA 1L7AA 4BP8A 5BV7A 2I78A 2Y1KA 4AN0A 2HA4A 4CG3A 1Z68A 3G9ZA 4WY5A 1QONA 1CUFA 3PFCA 2XMDA 3HC7A 1ZD5A 3VJMA 4ZREA 3PE6A 4BC1A 2HM7A 3IUQA 2PM8A 1Q0RA 5T4HA 2PL5A 1OCEA 2BUAA 4NS4A 1ACJA 1R50A 1LPBB 1QIHA 1XRNA 3FYUC 3OG9A 1WHSA 4JYMA 3C8HA 2OGZA 3R3WA 5LZ9A 3IDAA 3WK5A 1OXMA 3FLEA 3FOBA 4FNGA 2QUAA 1X2EA 4Q3KA 4QDOA 1VJ5A 3HXKA 3WZLA 4AMYA 2XLCA 1QIFA 1ACLA 1XQVA 5K3CA 3PICA 3G8YA 5ALJA 1YB6A 3VVMA 1LPSA 4HRYA 5CXUA 2VAVA 1J1IA 5FRDA 3WK8A 4MEAA 3ZPXA 5SYNA 1VOTA 2CJPA 2O2GA 3F98A 2QXTA 1GZ7A 4G8BA 3AZQA 3B3QA 3K9BA 1MNQA 5K3FA 1HLGA 4Y2QA 1X2BA 2VJAA 2DFPA 4OYLA 4OUKX 2YASA 2HDWA 1LPPA 2XE4A 2IIVA 4NZZA 4U2FA 4YASA 1A8QA 3STVA 2XQIA 5HZGA 4AZ3A 1TAHA 4F0JA 3G7NA 1UK8A 5JANA 1UKAA 2HU8A 2CEKA 3ZLUA 2OAGA 5LKAA 3FAKA 3QPAA 3WYNA 2OLEA 5CXXA 5ALPA 3EF3A 5C8XA 4OPMA 2WLSA 4M0FA 4W9RA 3IIIA 5T4FA 1AUOA 4Y2YA 1FSSA 1ORWA 4HXFB 3WQHA 1GT6A 3T4UA 2WJ4A 2DHDA 2WILA 1WHTA 5C81A 4WFKA 1AGYA 1B6GA 3VISA 4CG1A 4K6HA 4XX1A 5FDFA 3GZJA 1ODSA 1EK1A 2C0PA 3MGAA 1ZGCA 2QR5A 2G5PA 2QMQA 5EIHA 3BXPA 2WFZA 3WK6A 5CBKA 4MQMA 2WUGA 3A2LA 4XIIA 4N8SA 5AO9A 1BU8A 4FBLA 4W1SA 3WKEA 3DOHA 4K6KA 4K5QA 3TEJA 2WU4A 4KACA 4X3CA 4B0OA 4WDQA 4Q3LA 5ALVA 1QIDA 2B20A 4JUIA 5ALZA 1KU0A 1Y7IA 5CW2A 2JBWA 1P0PA 4QZVA 2ZVDA 5EHQA 3C87A 2YXPX 3WLAA 2XMRA 5IVHA 4DMHA 5CH3A 1LPMA 3O95A 2DR0A 3BJRA 2HIHA 4EA6A 1BCSA 4O08A 1BCRA 1E8MA 4N8EA 4D9JA 3NUZA 3E4DA 3AJAA 1QIMA 1BE0A 5YASA 3PF9A 4G8DA 2JF0A 3V1KA 4UFNA 2ACEA 1EXWA 1EVEA 3EIOA 4C88A 1RYYA 2JGEA 4B9EA 2WJ3A 1YAHA 4KRXA 3F8SA 2O7VA 4HXGA 5K3DA 3SK0A 5AOBA 2ZJ7A 4LYDA 1PFQA 5AKZA 1SOMA 4GHWA 2WG1A 4XWGA 5CT6A 3FYUB 1EI9A 2PU7A 3ICVA 3DKKA 2BGNA 3I6MA 1W4LA 2RHTA 4G4IA 4P93A 4X6XA 3C43A 3VKFA 2V97A 1AURA 3OTQA 5EIEA 3FSGA 1AMNA 4FLEA 4DSZA 1ZD4A 3UUFA 3H2HA 3LLCA 3I2FA 2G4LA 1Q83A 4U2DA 1HQDA 3D3NA 3KXPA 3ANTA 5CT8A 1ETHA 4X7BA 3QMVA 4H7JA 1UKBA 1HKHA 5K3BA 3DS8A 3L1JA 2VJBA 4Y2UA 2I3ZA 1K5PA 2PUHA 3G9UA 1U4NA 1H2XA 1AZWA 2PKYX 1XZLA 2WHRA 1AKNA 1QIGA 1CRLA 1ZD3A 4ZV7A 5HF8A 1SCQA 5HCUA 2HA5A 4H7DA 1XQXA 2W22A 2DQYA 1CUGA 4P08A 2V96A 3I1IA 2AJ8A 2JIDA 2XQJA 4LKOA 2R11A 4FDMA 1EK2A 4L3WA 4S0XA 4CCYB 1UT6A 2XUJA 5DYYA 2XT0A 5I9IA 4BAZA 2XMZA 4KE7A 1ISPA 2D0DA 2I3DA 3H1AA 6YASA 4C87A 4Q05A 3C5VA 1IUPA 1YSCA 2OXEA 3V9AA 4N5IX 2ZYSA 4FFWA 1AQLA 3Q8WA 4QDTA 1LBSA 1USWA 1CUUA 4Y2JA 4DMCA 4Q3OA 1XLUA 4B83A 2NW6A 1YS1X 4A23A 5BWBA 3MVEA 1KEZA 1UXOA 1SFRA 4Y2PA 3WIOA 4WJLA 1TKRA 2GYWA 3GELA 3I2HA 3AUKA 4M0MA 5AI8A 5EFZA 1R4ZA 2ONCA 4DNQA 5CT4A 4CI9A 4GWLA 5E4JA 1UOPA 4M0EA 1XRQA 5A2GA 1CQWA 1Y37A 4DNOA 3G9TA 1GPNA 1H22A 2J4FA 4PV7A 4X92A 2EDAA 5JD6A 5ESRA 5H3HA 1VKHA 3A6ZA 1Q0ZA 2QZPA 4C01A 2ACKA 2PVSA 2P8SA 3ZI7A 4UBIA 2AJLI 1KU6A 4EY4A 3F67A 2OCGA 3UMJA 2IX9A 5A62A 3C70A 3IA2A 3LIIA 4UHFA 5IVIA 3O4JA 1YR2A 4OB7A 1TQHA 1GQSA 3E0XA 1A88A 1Q84A 5CT5A 2HA0A 3S2ZA 4C4ZA 4W1PA 2B61A 4QNNA 4X00A 2WFLA 1MT3A 3O4IA 5ALFA 3FLAA 1BN7A 5ALXA 1THGA 2GBGA 3I2KA 3RLIA 2HA7A 3HRHA 5JALA 5ALMA 2ZJFA 5BOVA 1XRRA 2WIGA 2O2IA 2XUDA 5AKHA 4BZZA 5AK6A 3QMMA 4I3FA 4FLFA 2QS9A 5DJ5A 5JAHA 4H7IA 4PW0A 5DYWA 4A5SA 5ALOA 4Y2VA 1J07A 4I4CA 4B7ZA 1CUBA 3DKRA 1F6WA 4X6YA 2QM0A 3D4LA 3OM8A 1JJIA 5KWJA 2ZYHA 3DOIA 2HL6A 3B12A 3D7RA 2G63A 4X94A 2PSJA 4DTCA 2VT6A 4BCBA 1TK3A 1UOOA 5DNWA 5AKLA 2ECFA 2ZSHA 3FYUA 3IULA 4EY8A 1XRLA 3V1LA 4BRSA 5D3KA 3V1MA 4DLNA 5DNUA 3RK4A 5A7HA 3WKBA 5ALIA 4J0GA 5ALSA 1I6WA 3M3DA 4BATA 4X71A 3KSRA 1TRHA 3I6YA 5I7UA 5FKJA 1XZDA 3EQ9A 1YCDA 4JEIA 5AOAA 1FFDA 3W05A 5JADA 2O7RA 4BCDA 1SCIA 1ZGBA 3LP5A 4AX4A 4BE9A 3D2CA 5CH5A 2V9ZA 3I28A 1THTA 2H9YA 4AO8A 4RGYA 2XB6A 1CEXA 1UOQA 3CCCA 1GXSA 4FOLA 3QH4A 2RI6A 3HI4A 1E89A 3F96A 1K4YA 4LXIA 2VQ6A 2QT9A 3G9XA 4MXDA 3DD5A 3WL5A 4X95A 1TCAA 2D5LA 4P9NA 5D6OA 3STUA 3SC2A 4V2IA 2RAUA 4W1QA 2OPHA 4GW3A 1DQZA 3WK7A 3WWEA 1BROA 5IVDA 2H7CA 1F0PA 4UHEA 3HSSA 3VJKA 5HKAA 4LHEA 4DMKA 2GBFA 3DYVA 1XZGA 4HVTA 1JMYA 3KWFA 1JU4A 4PSUA 3R3XA 1JJBA 5AI6A 4ZXFA 1YB7A 4KE6A 5HK9A 3ED1A 2JGMA 5T4BA 2WKWA 2WUDA 1ZOIA 5AM3A 3R0VA 1A8UA 1GGVA 4H77A 1CUIA 4HRXA 3CN7A 4QA9A 2DCMA 1F0NA 2C7BA 4MYSA 3I6ZA 2PBLA 5EHNA 3DNMA 4E11A 4X90A 1QGED 2AXEA 1CUSA 3SWWA 1CUAA 1CFJA 4ETWA 2OCIA 3C6BA 3KDAA 1EDBA 1MAAA 2VSQA 3WJ1A 1FJ2A 5HF9A 1GKKA 2XMQA 3AZPA 1JJFA 3STYA 2VEOA 3M81A 5AKGA 5LYYA 3WI7A 4BVLA 1RWQA 2XUOA 3H2JA 1XQYA 4CIAA 4UBKA 4NMWA 4Y2RA 3ESCA 4ZGBA 4J7AA 1HL7A 3D59A 3HJUA 1WOMA 1WCYA 3DL4A 3BE8A 4FNMA 5JAOA 1R3DA 4HAIA 1C7JA 3FWHA 4E15A 4JH0A 2CUTA 4N8DA 2WG0A 2BKLA 2X5XA 3DJYA 3BWXA 2Y6UA 5JAPA 1CUVA 5AM4A 3N2ZB 4MWSA 5CRIA 5CTAA 3NWOA 1B41A 4GLBA 1VE7A 2PPLA 4Y2XA 1GPLA 1G42A 5K3EA 3PI6A 4X85A 5ALLA 1YS2X 2WFMA 2WHPA 4INZA 2BCEA 4LYEA 4UFPA 4G4GA 3MUNA 4QWWA 3JYHA 1W76A 3TGLA 2AJBA 3HABA 5HQ3A 4BAGA 4QDZA 3GBSA 1TIBA 2OAEA 4U2CA 4KAJA 3FVTA 1LPOA 2J3DA 2OQIA 1CUEA 3H2GA 4BVKA 5A7GA 1O6GA 1UZAA 2BJHA 2VJCA 5ALTA 5AK3A 3H1BA 5CT9A 3A2MA 3STXA 2XMSA 1MNAA 1X70A 4KE8A 4EUSA 1ODCA 5HK8A 2XMBA 4J3JA 5JZBA 4J0JA 4K6GA 3D5EA 5F4ZA 5AM1A 2OGTA 3WL6A 3FNBA 1LLFA 4G9GA 1E8NA 4WFJA 4EB0A 2HA3A 3QM1A 5A7FA 3BF8A 3ANSA 4W63A 1BRTA 2V98A 4MEBA 2Z5GA 1WB4A 1QO9A 5AHXA 1E3QA 2X76A 3EQ7A 5AM5A 2JEZA 4IH1A 3WL7A 5K3AA 3A2NA 2UZ0A 2YH2A 3RKSA 4L0CA 5ALWA 1XZFA 3QYJA 2VTVA 1ZI6A 1QFMA 1EX9A 3LIPA 1E8DA 2C4HA 1XLVA 2XUGA 4GBGA 3QMWA 2WHQA 2H7XA 1J2EA 4U2BA 1ZJ4A 3H0CA 5JYCA 4J0IA 1NX9A 1FFBA 3STWA 2GBCA 4G4JA 3PF8A 5AH0A 1LPAB 1QIKA 5EGNA 2WUEA 2GYVA 3NOXA 3ZV7A 3N0TA 1QE3A 5AM0A 7YASA 2H1IA 1W1IA 3FCYA 5JZSA 1AC5A 3C6ZA 4ZRDA 4NVRA 1H2ZA 2O2HA 1VZ2A 1QZ3A 4KRYA 3EBLA 4J0HA 1MX1A 4IQ4A 1EVQA 1DTEA 5CH8A 3L1HA 1DWOA 3ZLTA 5AM2A 1UK6A 5LKRA 2BGRA 5D7BA 1Y7HA 3F9CA 2WQZA 2DHCA 4Z49A 5HF6A 4KE9A 3AILA 3WIBA 4B0PA 2HFJA 5AKYA 1C7IA 5AICA 3QVMA 4FMPA 4IHAA 4CFSA 2FJPA 3WL8A 4EY5A 1XRPA 1UK9A 3X3HA 3VXKA 3DLTA 1VA4A 1JKMA 3HZOA 1CVLA 1HBJA 2VAXA 3G0DA 4YK7A 1ZI9A 4J03A 1XZBA 4IH4A 4CIBA 4C6HA 1BEZA 3WMRA 4W1RA 3GROA 2CKMA 3VJLA 3P2MA 1QIEA 4Q34A 4MJ3A 1ZI8A 4BTLA 3EQ8A 2QVBA 1S8OA 3W2TA 1K8QA 4WDRA 5K3FB 4C4XA 4WCVA 3H2KA 3G0IA 5EHXA 4E14A 5HF5A 1UWCA 4C89A 3FCXA 4ZWNA 1CUZA 1LBTA 1M33A 3GUUA 2B9VA 2WUFA 2J4CA 2PSFA 2FJ0A 4UBLA 1T2NA 1DX6A 1VE6A 2BAGA 3WWPA 4FFVA 4A16A 3STTA 1YA8A 3ILSA 1L7RA 5AP9A 1K6EA 2PSEA 3I1YA 3DCNA 1T4MA 4HS9A 2JGLA 2H7YA 4B80A 1NU8A 5E4YA 3IVMA 5AKJA 1MO2A 1G4HA 4FBMA 4Q1VA 1YA4A 5JD4A 1MN6A 1GKLA 3I2JA 2CZQA 5JATA 5HFNA 3C5WP 5C7YA 4AO6A 4BC0A 2HRQA 2E3JA 3G0GA 4OSEA 2DHEA 4DM7A 1SC9A 3WA6A 4UFOA 4ROTA 4DNPA 1D07A 3DDUA 4H35A 3HEAA 5JD5A 5IKXA 2HRRA 5CMLA 2VT7A 1P0MA 2Q0XA 1MU0A 5FOQA 3V1NA 2VA9A 3WA7A 2WU3A 3DYIA 4EHBA 1LZLA 3TJMA 1UK7A 3E3AA 4ITVA 5I8PA 5ALQA 4OD0A 5AI5A 5DNVA 2JEYA 5LZ8A 3BDIA 5DTIA 2WM2A 1P0QA 2WIDA 2HFKA 4OB6A 2QUBA 4B6GA 1VA5A 2JGIA 3L1IA 1CV2A 2WTNA 1WM1A 4B81A 2Z8XA 1CLEA 3F97A 3BJMA 4UBNA 5ALYA 1CUCA 3M82A 2X8BA 4MQLA 4KAFA 1EB9A 2PUJA 3UUEA 1F8UA 4UBMA 4DNFA 3K2IA 2XUAA 4AQDA 4K2AA 5T4EA 4I19A 3WYDA 1W6RA 1A7UA 1JI3A 3W9BA 4RE5A 3WKAA 2Y2UA 5C8VA 4JYPA 3PUHA 3SX4A 4HTAA 4XJVA 2XQGA 1GQRA 3O9MA 2WSLA 3GFFA 4KYVA 5E4TA 3W9UA 3BF7A 1XZJA 4G1FA 5AJHA 1XKLA 3MUOA 1QTIA 5KREA 1E66A 5FUMA 2XI4A 5J3JA 4G5XA 2C5GA 1U2EA 3KOOA 5KWIA 4DSAA 3AZOA 1ZD2P 4X93A 1CUHA 5DTJA 4BCCA 5ALDA 2XUHA 4CCYA 2GBIA 2PSHA 1AX9A 1IUOA 2PSDA 5BWCA 2GYUA 4AMZA 5A71A 2DQZA 3IBTA 1ZIXA 4LXHA 2J3QA 1IZ7A 4U2GA 1CPYA 3LS2A 3K6KA 4GDMA 3C6XA 5FLKA 5LZ5A 3DQZA 1PV1A 3AIMA 3W06A 1CUYA 1MX5A 4FKBA 1JU3A 4GEGA 3C6YA 1W75A 4UHHA 2WIKA 5KBYA 1H2WA 3PUIA 4TGLA 4UHDA 2AJDA 1YASA 4OYYA 1CUDA 1CIJA 4GECA 5FPPA 5AI9A 3KD2A 1VZ3A 2RHWA 1XZHA 3WKCA 4IH9A 2XDWA 1N8SA 5JAUA 2Y2VA 4YX9A 2CMFA 2JGFA 1VXOA 4Y7DA 4Y2TA 5EI5A 2OQVA 5AI0A 1TCCA 2Z3ZA 3GA7A 4HXEB 1K63A 1C4XA 3H19A 5AK5A 3FBWA 5LIPA 1PJAA 3D2BA 5AKIA 4UBOA 3ZLVA 4EZIA 3BL8A 1IZ8A 3B5EA 3RM3A 4KJXA 3WK9A 3I2IA 5SYMA 2C58A 1EDDA 4YPVA 4EY6A 1SCKA 2RONA 5AK4A 5DWDA 1BEEA 3H2IA 3O4GA 4Q82A 3LCRA 4L9AA 1R1DA 4QLOA 4QDXA 4LXGA 1QLWA 1DINA 1JMKC 2RIPA 4QWMA 3FYTA 3IUMA 4BDSA 4BAUA 4AXBA 1QOZA 1O6FA 4GI1A 2IITA 2BUBA 3CCBA 1IVYA 2B4KA 2JGKA 2G5TA 4ARBA 5JASA 2CB9A 3R3VA 4PO3X 1FFEA 1H23A 2VJDA 2GZSA 4PQEA 4F21A 1MPXA 2Z3WA 1DQYA 4H7HA 4AO7A 3FVRA 1QJ4A 2HA2A 4JNCA 3G02A 1UFOA 3ESAA 2HADA 2YYSA 2Z8ZA 5ALKA 4OCZA 3TRDA 2AJCA 5DYTA 3BIXA 2ES4A 3FSGD 4CCWA 4DIUA 3T52A 3RARA 2WJ6A 5D3ZA 3WJ2A 4GXNA 2XMCA 5LZ4A 2FX5A 2XMGA 5ALEA 3R3ZA 1FFAA 2WFLB 3JW8A 3M83A 1E5TA 4LIPD 5JZ9A 5EHZA 1EHYA 4WFIA 4BTVA 1WPRA 4DMFA 5E2IA 2BUCA 5IVKA 4CG2A 1HDEA 1ZICA 2QKYA 1MTZA 4N5HX 5AI4A 2EEPA 3H04A 3WWCA 2Y6VA 3OOSA 4BZWA 2WIFA 1XZEA 3I2GA 2QJRA 4BVJA 2HHAA 4OU5A 1A8SA 3G0CA 3H17A 5JIBA 5IH7A 3C45A 3YASA 1LPNA 4FLMA 4X97A 1IMJA 1WB6A 4KR0A 1YAJA 2ROQA 5FXMA 3IB3A 3OC0A 1CUWA 4BRZA
chains in the Genus database with same CATH superfamily
1K5GA 2HJSA 3G9QA 3OX4A 3V4SA 3AVYA 3OZCA 1ZM4A 2FAXA 5HFJA 3QZUA 1CB7A 2R66A 1KVUA 3NNDA 4C7XA 5K8CA 5IASA 2WIJA 4DLXA 3WK4A 4M1KA 2HNBA 1OGIA 4TXMA 1DV1A 4XX0A 1LD3A 5FI0B 3CN9A 3WBFA 1LV7A 2MMGA 3A3NA 4TS4A 2L2QA 2FB9A 4OQXA 4P3YA 1E9AA 1X6VA 5DHRA 4YV2A 2E1PA 1NXPA 1ISMA 1YOBA 1ZK1A 3LZCA 2I6FA 3O3CA 4IHJB 3U3MA 4L75A 3GFBA 2Q3JA 4KRGA 5JT1A 3QBJA 4X6UA 1QRDA 5AMXA 2BFBB 3SYTA 1NQ5A 1BDIA 3CEPB 4PRKA 2WUVA 4U2EA 3H13A 1JHQA 3QWFA 1B8UA 1IH8A 2VJYA 2VJQA 1I7PA 3MUEA 2NNLD 4U6QA 3TUJC 3UJ3X 3C1TA 1GQFA 3NBUA 4DCJA 5CVVA 2DUNA 3EXFB 4OXNA 1TEVA 4BX0A 1GPMA 1GPYA 1SD5A 2ZPAA 3WKDA 2D8MA 3ELBA 4WKGA 4ITRC 4I6EA 4JXKA 3ICWA 3LUBA 5JDCC 4BZPA 2PLNA 1CBUA 2AD5A 3E4CA 4NYMR 1NT4A 2JLQA 3QVGA 2BGJA 3THRA 3GA0A 1WEHA 3EPLA 1E2NA 2X3FA 3X2EA 2RK6A 3MSXA 1NKVA 1Y48E 2BM8A 3AUAA 3VOAA 3CVVA 2FQQA 3O0DA 2N1MA 4XPIA 5IT9A 4HF7A 1USIA 2CDRA 3GG9A 5I7FA 5ARDA 1NJSA 2O2EA 5HIIA 1NNLA 1S8NA 1E1NA 2X2OA 4JP5A 5EMLA 1HE5A 2I8AA 3CC8A 3O7MA 4YP1A 5FPQA 5AVOA 3C8DA 4OKNA 3N86A 2JATA 3OIGA 4QU9A 2ZANA 1JQEA 4P7JA 5CDYA 2A86A 3RYFB 2JGJA 3U6KA 2FWJA 1SD1A 2IH2A 3Q41A 2MIIA 3OLXA 4QGBA 3JQPA 2BJWA 4RKFA 2IYEA 2PO5A 1F8GA 5C8ZA 1GVHA 4I9NA 4RPCA 4ZVQA 1XX6A 1NG9A 2DB3A 2A0WA 1I5RA 3EC7A 3R7SA 1KYIA 3P9CA 3ZDBA 1UT5A 1I3CA 2PJRA 5FX2A 1HI9A 1R88A 5EUBA 4M1SA 5AW6A 3EIUA 2D5CA 4M9RA 1VFNA 2AFVA 3GX1A 5AKEA 3KKLA 3LHFA 4YT8A 1W96A 4AKTA 1TM5E 3BDVA 3SHQA 2KQUA 5LNK1 4JUAA 3E9CA 4IGIA 4TPKA 5HJ2A 5ALUA 1EFPA 1U2PA 2J6CA 1T35A 2OV3A 4UUQA 5EUQB 2W70A 3TE6A 2RGAA 2REOA 3U9LA 3RIEA 5AW9A 4CIVA 5AOCA 1DT5A 4V02A 5FYDA 3ZKAA 3PIDA 3BEOA 3K9QO 3R20A 2DJ5A 4GNRA 2JI9A 2WJGA 4EUEA 3IUNA 1VG9B 4HDRA 3QEKA 3PHLA 3M6UA 1C81A 3WFZA 2W6CX 4O2AF 1XVTA 2XJ9A 5JYEA 4YTEA 4D9EA 4RZQA 3R41A 2UUCB 3PJGA 4B9AA 1DHTA 4C0WA 3GPCA 1UJ5A 2CC2A 2C7VA 1QHXA 3JRNA 2C7PA 1FTGA 1LSJA 4QGFA 2QVLA 1RXCA 4BKMA 3AFOA 3BQ9A 4DA0A 4L1KA 3NTRA 3HACA 3BWEA 4NK5A 4LBYA 4REMA 3A10A 2VNIA 1AH2A 1ZPDA 1RAEA 2ZYIA 3GOQA 3H9JA 4RVSA 4BQQA 2VATA 2O6HA 3Q8LA 3QPBA 4XDYA 1KJ8A 3TGPA 1C0IA 3AI3A 4D45A 1GQYA 3G7UA 2AG6A 1JA1A 2A1UA 3B52X 5TQ0B 5IK2D 5KNBH 4HUTA 1E0DA 4UMFA 4GYJA 3KLMX 4MYTA 5BSHA 1FDTA 4OFBA 4ARCA 1W7AA 2Q1UA 4JU8A 1Q3HA 4QDUA 3AV3A 4JLOA 4C0HA 3OE5A 3DV0A 4XIJA 1VJDA 1K0UA 1J1ZA 3ELUA 2EERA 4EFDA 4NXMB 1ZCAA 2XH8A 4L7QA 4E30A 2DTDA 5JOQA 1TYDE 1QFYA 2F1KA 3RB8A 2I4LA 2NMVA 5CUQA 4BNJA 5SZKB 2ALJA 2WM8A 3ABRB 1EB8A 4PSKA 3TI7A 2ZTUA 4MYUA 4TTSA 5EVCA 5FBRB 1Z47A 2YS7A 1RAFA 3QKTA 4ND2A 3L1UA 3DOEA 1DCFA 2ID9A 1IZ9A 2AMYA 3CUSA 3K2EA 3D3EA 5ES3A 3IUSA 4EA8A 4BNDB 3VC1A 2YOFA 3ESDA 3G2NA 1QANA 3FLMA 4D57A 4DMUB 4DQUA 3SN6A 3R23A 4G25A 1LW7A 5GJBA 3QUTA 1AN9A 4MW9A 3ZIAD 5ISMA 3PKJA 3CQ9A 1EP3B 5LP1A 3KYJB 1Y3CE 4MV5A 1PTJA 3A1SA 3E7FA 2IW3A 2ZQ5A 1E3SA 4TV9F 5IUKC 1Z56C 3OEYA 3VPFA 4WY8A 2QOEA 1V1JA 1A5TA 3VC7A 1ONBA 3I72A 2QXUA 5FNVF 4EHKA 3O4HA 4PNZA 2CNKA 1NR1A 1JR3E 3M6XA 4LX8A 4CDNA 3E3MA 3C48A 4QHSA 3HU2A 3Q0TA 2E9SA 1N7GA 2PWPA 3LQ4A 4LNUB 3VRHA 5IFLA 5EJ2A 4NFYA 4B2PA 1J8DA 4MS3B 4N49A 1H2YA 3MQ4A 3O47A 4CEJA 4HDNA 4K2HA 4LRSB 1H1LB 2JLWA 1FTQA 2JIMA 2PV0A 3NEJA 4AULA 3MBIA 4R3NA 3TGWA 5FOXA 3W5DA 3MN1A 3DL7A 4MV9A 4O1HA 2VJOA 3CUKA 4MVJD 4MYDA 3D4PA 1WDKA 3LQQA 1C8LA 4OHOA 3TOZA 3EB9A 3OPVA 4YMIA 5K05A 1GV0A 2OV6A 4PZDA 3VH1A 4PYKA 4NBRA 4DDKA 1EINA 4BE4A 5DN9A 4GP9A 4RVGA 4TLEA 3NXSA 1G41A 5E7QA 5A6VA 4L76A 2ORIA 2B82A 1NUUA 3E9MA 4TVKA 4UEKA 1LGYA 4WACA 2ZIFA 5EIAA 2AW5A 4YT5A 1A5ZA 1BZYA 3I4LA 3LL7A 3ZWDA 1WY7A 4KMSA 1T6ZA 2F1HA 1KI6A 1TEXA 2WHPB 5K2MA 1C0KA 5CIQA 5K5EA 1TZBA 2KB0A 1CD5A 2PMFA 3EVAA 1Q1BA 3MPOA 3X1XA 1OV4A 1SHUX 2WEKA 5IVPA 5IDYA 2C2OA 4EHHA 2XQFA 1Q21A 1L5YA 2W98A 2WWHA 1AGNA 1RNLA 1ZK2A 2PWBA 1XU9A 2ZSJA 3VZCA 5H4GA 1CQPA 1N0WA 1NLFA 1YWGO 2VNJA 3SS9X 3SSOA 3TRKA 2J3KA 4O2BA 4YA6A 1RCFA 3CXUA 3EWNA 3GVCA 2WMDA 1J06A 3JQGA 3SXPA 4L6CA 2EFJA 2W0MA 2WYVA 3I9MA 4IRXA 4QGHA 1KJIA 5DFAA 4F6RA 3GJYA 4IDGA 3CV3A 4NCBA 1YZQA 5CBPB 4CKEB 3ET4A 3FUWA 3O4VA 5CX4A 5KOJA 3ETNA 3UW3A 4FKZA 4PANA 3PU6A 1FDVA 1WF3A 2VRBA 1U7DA 1X15A 3DXZA 2R48A 1T8UA 1MJGA 2VDWA 1XG5A 5HRUA 2LGJA 3JQBA 2RMKA 3V48A 5HKBA 4A15A 4EF5A 2B9EA 3HZHA 4I1VA 4J0KA 4ZVMA 2HMAA 1V35A 2AA3A 1MZVA 3ZCQA 2Y0CA 4FMDF 4MV1A 4MARA 1Y1RA 2HA6A 1E1KA 1DT3A 2HWXA 2B1GA 1P45A 3H18A 2H1WA 4FYXA 5E7MA 3LYHA 5FEMA 2AWNA 4LZNA 1YFLA 4KMOA 2FK8A 1MAUA 1O5IA 4BFYA 4LJRA 3S1LA 2J0UA 2OYSA 3VNUA 3HYSA 5KVVA 1U63A 1SUWA 3H42B 2RGUA 3S3TA 2Z4TA 3LC0A 1ZXXA 1N7IA 1RQLA 5JECA 2ZUBA 4WOCA 3RVBA 4HL6A 2GERA 2Z9BA 4JELA 1F3LA 3K1AB 4FDUA 1XJWA 3B9PA 3GARA 4HJRA 5GOZA 1XCOA 3E1GA 2AFRA 1Q7EA 1ZGZA 3NAZA 4IIXA 3BSSA 5B3AA 3X1JA 2XOKA 3FZGA 4OKSA 4B6OA 5HZKA 3GLFA 3FPSA 3LRXA 1J23A 3OFNA 3BRWD 4RDCA 4US0R 1AT1A 3T3IA 2IH5A 1EWKA 3L02A 4XUCA 5CGQB 3HCPA 2C83A 2Q5HA 2X4IA 3AY6A 4WEOA 2GPNA 1XZMA 4H3VA 3K9CA 4KCGA 1OX4B 1NBWB 1Z7WA 3VU0A 5IBCA 4K0KB 2HDOA 1YBFA 2MYTA 2P3QA 3G8CA 4KP7A 4P7GA 1W85A 4ZIRB 5WRFA 4R2KA 3FWPA 5G02A 2GPBA 1G8PA 2QYTA 1XK6A 3DUWA 3K9NA 4QQFA 4ESOA 1WMBA 1FMTA 3OWHA 2VEDA 2X2PA 1AXRA 3PFIA 3PFBA 1USUA 3QXHA 5DCUA 4NYIQ 1TW2A 1KBQA 1PR9A 1FPQA 4D9CA 3FPLA 1U65A 1NU6A 5A9RA 2ZUCA 1Y3DE 3LT0A 3DFMA 4MMXB 3P2YA 3UV7A 2C5FA 2GXSA 1DWQA 3MLBA 3E3NA 4HH4A 4PO8A 5KTOA 4EBBA 4C05A 2G0AA 1TUIA 4AMGA 4KLZA 5LZ2A 3PP8A 3PE4A 4D2IA 2ZM6B 2FPPA 4A26A 1N8TA 3LX6A 1R9MA 5IDQA 1DZ3A 3PUWA 1CUJA 4MGHA 1T3GA 3E2MA 2YXDA 2YC4C 4H3HB 1CF9A 4MRMB 5H82A 3QE9Y 1ID1A 1R9GA 1HMPA 1NKTA 2EBUA 2OCKA 4QEZA 4RPKA 5AWFC 3P0IA 3I4FA 1PEAA 3S8YA 1TO2E 3IKJA 2ZITA 1L7MA 1NW7A 3W6OA 1W8IA 1YDGA 2ZIEA 1L7AA 4UPEA 2RGRA 4M98A 2JFQA 1YB5A 4JVNA 3OQVA 4BP8A 4R2MA 1O87A 1ZMOA 2I78A 4CU5A 1KAGA 1ST2A 4AN0A 5C9ZA 3B6EA 4ZEMA 2CZGA 4KN5A 3Q3IA 4K9DA 5IW8A 1GZ6A 3OZUA 1SUEA 2NUAA 2D2VA 1YZLA 1N4DA 2YW9A 5CVDA 2FX2A 5U9CA 3CH7A 3VJMA 3HNPA 4X1KB 3QLVC 1V3VA 2NO5A 4ZREA 4BC1A 3UGJA 1EWTA 1ELOA 2EC5A 3WGTA 5KVAA 3D6TB 3OWXA 4E07A 2W6OA 1K5DA 2BEJA 3WNDA 4FOTA 4ZRNA 4HB4A 1AGXA 3CPJB 4AUNA 2VBCA 1CZLA 2PZAA 5KOYA 3GDWA 3DM9B 4EX6A 2QTTA 4P98A 4NS4A 2V03A 1TW3A 4QBIA 4MYRA 4NY1A 4D25A 1WSAA 1DLIA 1DIOB 1KXZA 2CVFA 3FYUC 2HBRA 3OG9A 3X43A 3C3JA 3UOGA 3TTVA 1UIRA 3BILA 1OXKB 1AO3A 4HLUC 4JYMA 2G6TA 4G2TA 4MRNA 4NCNA 4JJAA 4X1IA 3V1TC 2HHJA 1TPZA 2GTPA 3R3WA 4EI2A 3A6LA 5LZ9A 3ZGOA 1GO2A 1TUEA 2PAAA 2F3SA 4FNGA 4Z1MA 2OCBA 2ZUUA 4AQ7A 4YCAA 5ICSA 4DIFA 5ITVA 4F84A 1NN3A 3KOYA 1X2EA 1ZN7A 5JU6A 2DUJA 3QWHA 4PLYA 3CKMA 1VJ5A 4PYQA 3UT5A 3WZLA 1VSTA 1PZNA 4B1FA 1KRHA 3MAJA 3TTWA 1U3WA 2HLHA 1XQVA 3MLAA 1M6VB 4RXTA 1QX4A 3Q0EA 2HR1A 4JSRA 4IIFA 1YB6A 5DM4A 2WV7A 1KO7A 2JLSA 2Q07A 2NYUA 4QFDA 3TW8B 5EP1A 4RADA 2VAVA 1TA0A 4MIYA 5D51S 1Q7RA 3ME5A 4P4GA 3T0GA 5IAKA 5KNDD 5THXA 2C5HA 1B15A 1E7QA 1FLVA 1PO7A 3JQQA 3EXHB 1NNUA 4G2NA 3KQUA 2DQKA 2Q9AA 5GONB 5BWLA 4C7MA 4CV3A 4LSMA 4KW7A 1G1MA 1GZ7A 3B3QA 3AZQA 3G8DA 4IDFA 5GZ6A 1MNQA 2QTMA 1AGRA 1KHHA 4Y2QA 4DZRA 1JQ3A 2XDYA 2VJAA 3ZK9A 1K2WA 2R7AA 2DFPA 4WK0B 1VDZA 2H52A 2KE5A 3AM3A 2YASA 2HDWA 2P5SA 1EYZA 5CD9A 4AC9A 2XE4A 4OHYA 2IIVA 3IPAA 3D43A 1R18A 3VR0A 3S6JA 3JWJA 2XD9A 3DZFA 3KR9A 2HSDA 4XVQA 5HZGA 4DADA 1IQRA 4AZ3A 3BMCB 1G59A 2X8JB 1KIAA 2VP9A 1Z5NA 1UKAA 5JANA 3ITKA 2HU8A 3EEIA 2Q5IA 4OQQA 4GZ6A 5ILGA 1T6BY 2B3TA 1AJEA 2OAGA 1Z2CA 2QR2A 1BW9B 1SUAA 1UBLS 1OFGA 1Y0BA 1Z82A 2RH8A 2Z6VA 2X0KA 1YRWA 4OYRA 2GN0A 3TSOA 5LKAA 3DZHA 1N2OA 5F1KA 4BFLA 1IBLB 2O8CA 4OHMA 1K8RA 1TKBA 2OLEA 2JFGA 4MA4A 5ALPA 5LUBA 1GNTA 4K81B 4HNUA 3O6VA 1W2WB 3AL3A 4M88A 4YJHA 1LK7A 3ZHXA 3W8DA 5TR9A 4OPMA 4YAJA 4L8YA 4PGMA 1HLFA 1PT6A 5FBQB 3W5UA 3ZNOA 3IIIA 3JR7A 3OJXA 4JT8A 1NVXQ 4WLEA 4EHNA 1NYRA 2ZSFA 4WI1A 4GOKA 2PUVA 4Y2YA 1R12A 3AY3A 2J46A 4JQYA 1ORWA 4NJEA 5DHFA 3WQHA 4AS3A 1DDGA 3IIEA 3LLUA 1Y4UA 3JZFA 2G9NA 3T4UA 2PSSA 4GEKA 2QBYB 1QP8A 3TD2A 1J5PA 2IQ5A 4WGFA 3SU8A 4KITB 3ZJTA 2WJ4A 3FOAA 2DHDA 3NG1A 2I87A 2QRJA 3BCHA 1QGUA 1C7FA 1JJAA 1Z5ZA 2OBBA 4GVXA 1SUCA 4HPJB 1T1RA 4P38A 1Z0ZA 1UWLA 1B6GA 5E2BA 1PP4A 3E0QA 1PBNA 3L7NA 4K6HA 5DSZA 5KTPA 4ARUA 2QL6A 1JVNA 5EJ8A 3LUDA 5TARA 3D02A 4WL0A 2QR5A 3R0ZA 4XLLA 2ZRQA 1L4NA 1K6JA 2Z83A 3O3OB 3WYGA 4LZLA 5JNLA 5BSTA 2C78A 3EARA 1OB5A 2IEZA 2ZRIA 4YI5A 1FFYA 3WK6A 4MQMA 4ZAGA 3A2LA 1HNWB 2GAOA 4N8SA 9GPBA 1W0KD 1ZUHA 3ZJVA 1QKJA 2I2DA 2FMUA 4FBLA 3SQMA 3WKEA 1ZISA 5C5IA 3TYXA 2DPLA 1QUEA 4E03A 2QQ0A 4YRAA 3H1FA 4E5UA 2WU4A 3S2IA 3UT0A 2COKA 4X5OA 4ZVNA 5ADWA 4YP0A 2FFAA 4FGJA 1BQEA 3ADDA 2DFDA 3G1TA 4DDVA 4QTUB 3DF9A 3DT8A 1PE0A 5ALVA 1XVUA 3QEMB 5LP6A 3V46A 3RC1A 2B20A 2HO5A 2GHTA 3K8ZA 3O9ZA 1ZMTA 1C9EA 4JUIA 4CUJA 2IS4A 2NO7A 3HVKA 3B2NA 2YL2A 1IB6A 1KFEB 1Y7IA 2QZSA 4E7OA 1J0XO 1GAJA 4KQFA 3UATA 4QZVA 3EXEB 3O3MB 2E6KA 5E1BA 2FV8A 5L7TA 3VPHA 1G3IA 2XT6A 4FZ3A 1P17A 4W5HA 2CL7X 1MZPA 4GX5A 3EMBA 3UWMA 1EFCA 3ZTYA 2H1CA 2NSYA 2RIRA 3FKSA 1L4EA 3GW8A 2DR0A 2QTRA 4WN9B 3RFFA 3JQRA 5C18A 2QZJA 4EMBA 3QOWA 2QN3A 2C9CA 3EVEA 3P9NA 4D9JA 4R1UA 1G55A 4WCDA 4DSNA 1QV7A 1Y1LA 5LQCA 3IBGA 3F3KA 1PQYA 4R8MA 4PTYA 4FI3C 1AKMA 3R7DA 1F06A 1J6UA 3IHTA 4C1NA 1VLMA 4MQUA 3AHFA 4GM0A 1G0NA 4FYVA 1B0UA 3GGJA 5JXGA 1QQ5A 4Z53A 2EATA 3V3TA 5T7BA 4QYIB 3ZU2A 4H1WA 3MYRA 3QI7A 1CJCA 1GKUB 2VTKA 1Q44A 3IHLA 1XE3A 1EXWA 2FOIA 1EVEA 1B16A 4L5IA 4FD2A 3LXUX 4DDUA 1XVIA 3NC4A 4G97A 3DHWC 2JAXA 2MR5A 3DW1X 3H8VA 4G5SA 5T8KC 4LMRA 5DI3B 3K0FA 4KIJA 5KO2A 4PX9A 2R8EA 4WOPA 4HGYA 4O63O 2IP4A 3FVQA 4JXZA 1YQ9A 3C8MA 4WZAE 2YVUA 3C1AA 2FE4A 3RW9A 1YFZA 1I4LD 4MGIR 4KG7A 4MB2A 5K3DA 4DLBA 4W8HA 4IJ5A 5HR5A 4MWZA 3VAAA 2P35A 1M2OB 2B2NA 4RUKA 1U1IA 4XCQA 4BO2A 4I1YA 2JGNA 2NO1A 3Q85A 1P2VA 2UVQA 2BGMA 3FPHA 4NI5A 4ZVSA 1ZM9A 1ONNA 3KDSE 3MTDA 3IKLA 2JI8A 4JBHA 4MX8A 2A94A 4XWAA 2WG1A 4LTDA 3UANA 5JTTA 4XWGA 3H6KA 5CLQA 3NYQA 5T3YA 3N2LA 1NONA 3F6CA 5BPFA 3ICVA 2BGNA 4NH4A 2RHTA 2IPXA 4G4IA 3ZWVA 1IN1A 1KJJA 4X6XA 4HQRA 2CBZA 3TKLA 5BUSA 1XD8A 4WESB 3GNSA 2D3TA 3U3ZA 4DA6A 1ML4A 4KWIA 1AURA 1NMXA 3GHYA 3KAJA 4NPAA 4GKJB 4MYHA 3FSGA 3DVLA 3ZBQA 4KBYA 3ZWMA 1AMNA 4G23A 1XSEA 1OLXA 3A05A 4WZAB 3W5HA 1U8XX 5C4GB 5JXIA 1U2TA 4LY3A 5H80A 4QELA 1P7WA 3DE2X 5CHYA 1S3GA 1SG9A 1ONSA 1R6XA 1RRMA 1ZD4A 3K6RA 3L8EA 4RJTA 1UDCA 4C0KA 5B6IA 5BP7A 1KRWA 4AU1A 1FP7A 3CO5A 1UJ6A 5CM8B 3ADPA 1VE1A 2R8ZA 1Z36A 4BMYA 3INRA 1ZUD1 4TS3A 3I2FA 5HRAA 1Q7CA 5LYJF 3SCZA 2I3GA 1G60A 1W5FA 3BGWA 1HQDA 3KJHA 2Q3FA 3D3NA 3ZV5A 1ETHA 5JPDA 4OX9B 1K6MA 4X7BA 4GLFA 4YUAA 2H92A 2X9NA 2EJBA 3B2EA 2IBTA 1KORA 3A1VA 3DFIA 4CPDA 4DEYA 3DS8A 3FI0A 2VJBA 3L1JA 2NTEA 4ALNA 3S2YA 1ABFA 1U0FA 4ZXPA 1YI8A 3CLKA 3IR6A 3KWLA 4IHQA 1H2XA 2ASEA 1AQJA 3LAWA 1EUCB 3NHLA 1JFTA 1XRSB 4CGZA 1X1CA 1W9MA 2WHRA 3AEUA 4WBNF 4OI1A 4BFSA 3PVZA 4ZV7A 5HF8A 2HX1A 1FFHA 2NVBA 4MUJA 4EQZA 4GXTA 4TWJA 4IV5A 3NV7A 1XPUA 1WP9A 4I5DA 1Z33A 1QZZA 2V5AA 4IBOA 1XQXA 3PJEA 5CGZA 4DKJA 3P1JA 4C3OB 1PUXA 3FFWA 1QAQA 1CUGA 4P08A 2V96A 3C8UA 5IJAA 1ZN2A 2QENA 1JIIA 3LZDA 4HWGA 4S2UA 3DQPA 4D3ZA 2VRCA 2VK8A 1OFTA 3LUPA 1H4SA 1KZGB 3F2VA 5KJ1A 3AFMA 5LLDA 1KMQA 4DR4B 3PEYA 2SKEA 4C6TB 4F9FA 5EESA 2F1OA 4S1PA 2DSTA 2XA2A 2CD9A 1LDEA 4OMCA 5DHUA 2ACVA 1DARA 2XQJA 1BQ4A 2UZIR 2R11A 1KDVA 5HCIA 1ZWLA 5L7YA 3OVMA 4TN1A 3NBMA 1OZAA 3BMOB 3P2EA 4WZBE 3OEHA 4AUMA 2H4ZA 4CCYB 3W8FA 3OIFA 2H9AA 1UT6A 3CRQA 1WKBA 5C8XA 1TF7A 3ZHZA 2XT0A 1Q1NA 3W1VA 3GRUA 4DIBA 2E4AA 2XMZA 5CR9A 4MQ5A 4KE7A 4HADA 1N9GA 2MSNA 4LHWA 1ZDMA 4GM1A 1FVFA 4MUEA 4TKVB 3C98A 4XFJA 1NQXA 2QTLA 4WBSA 4L78A 2IS2A 1T3LA 2YWFA 2D0DA 2FW8A 1D6SA 3LVFO 3QU7A 3LHSA 1FUEA 3H1AA 4MIKA 4A10A 1X80B 3PDIB 4A8TA 2GESA 4F2WA 5JCXA 5LNK6 1U31A 1RBYA 5LPNA 3KQOA 3UWSA 5TGZA 1EVZA 3VHLB 1KR2A 3FYDA 1SXIA 1YQUA 1V5GA 1NMEA 2N46A 2YOGA 3IJEB 2YJ6A 3D1JA 4KMRA 4N5IX 2Z1NA 4TVOA 3VVBA 2YUTA 1ILWA 2PO7A 1NJ5A 3WYEA 5AW7A 4KVGA 3V34A 1IAVA 3P97A 3IAM1 3ZQJA 1KQGA 1GTJ1 2RFLA 3B3GA 3L0BA 4EL5A 3HNRA 3GAMA 3N3AC 1D6NA 4DMCA 3KPWA 3VZBA 1SKUA 3R5XA 5I5EA 3G5MA 1QZUA 2NW6A 3HYCA 1Q0UA 1OI7A 4B83A 4C7JA 3BAZA 1TO6A 1ZIDA 2AQIA 1FFXA 2IWRA 4MS4B 1NJFA 2Z98A 3AJRA 1PUIA 4OUDB 4BBAA 3PNYA 1RI4A 3RIMA 4DN6A 1GITA 4QVIA 1KEZA 1NXOA 4DG8A 3JQFC 3PT9A 4Y2PA 1WZ2A 1NRXA 2GNOA 2OORA 3T4PA 5EZYB 2Q3LA 1UC5B 3GELA 4NZPA 4CJXA 3ANLA 2P7IA 1SVIA 1C3OA 3AUKA 3TKYA 3ANMA 3KD3A 4QQKA 1X7XB 1BWPA 3A7DA 1O58A 1WAMA 2J5QA 2YJZA 2ONCA 1XO1A 2CE7A 1BE8A 1SC1A 3HQ4O 4CIXA 5CDFA 4NP6A 5CT4A 3ZE7A 1MVNA 3FGNA 2ISCA 3RVRA 4DR1B 3G2LA 1Y8QB 4ZK2A 5KTRA 3KTAB 5TB5A 2NXNA 3ML1A 3F5DA 3MWDB 1U3CA 3TZHA 1CQWA 2QI9F 3I6BA 3GCXA 1Y37A 5JS1A 1BFUA 1C9NA 1E6UA 4TWZA 1GPNA 3WLHA 5KEIA 1H22A 4TVSA 1RWPA 2IDZA 2PRZA 2WP8J 2X13A 1MQ8B 3I34X 3HSYA 5JD6A 4ZALA 2BTQA 3DMGA 3KYCA 2A9PA 2X1LA 2VYVA 5JJBA 4LI0A 2GCIA 4OHFA 2P6RA 2BY4A 3KOZA 3GGDA 4BN0A 3QEAZ 1VKOA 5DW0A 5JSFA 1FYDA 1Q0ZA 3HB7A 3TG2A 2VH2A 4XGNA 4INAA 4C01A 2WQ6A 4LZZA 3C5CA 3U3JA 1QHNA 5EKSA 3ZWNA 1Z9BA 2VPXA 3RVNA 2OFOA 1UMKA 1JIKA 1JQKA 1LLCA 1PD0A 3LUAA 4QVGA 2QXYA 3R8CA 5BSUA 3C6QA 1YDFA 2QNRA 3ND5A 3WGLA 1KU6A 2GSDA 1XPOA 2FFHA 1ECCA 1RI2A 1Z12A 2WF9A 1QK4A 4EY4A 4XWWA 1Q1GA 1ZM7A 2CZCA 1BU5A 3VVCA 4B6PA 4DBLC 3KBBA 2EFEB 3MB8A 4PZ9A 2FNAA 4V0QA 4OI2A 1EIZA 5FI3A 5HIMA 3S8MA 4AJHA 2Y92A 3K0CC 5IUNC 4CKWB 1DAFA 3PYLA 4L08A 3LIIA 4JZKA 3AEXA 2FR8C 4MV4A 8MHTA 4ND1A 4NV1A 4ZVUA 4LAFA 1DJLA 3E7DA 1N0HA 5D3MA 2F64A 1JDTA 3IAS1 5E95A 4R4JA 3O4JA 3PC4A 4E21A 1G1AA 3SFVA 4OB7A 1RQRA 3FMPB 4I55A 4HH1A 2AX4A 3E9RA 5REQA 2ZRDA 1WXQA 1J8YF 4B73A 4DCVA 1FW6A 1KC3A 2NPIA 3A26A 3KQLA 3ETEA 4M38A 1DIHA 1V1MA 5GVSA 2O3TA 4IW3B 4WNIA 4YALA 3U16A 2HA0A 1P2DA 1T8SA 3FX2A 2B61A 1NNEA 3U48A 2WFLA 1U04A 1MT3A 3K4PA 3Q5EA 2F3QA 4QT0A 2V3WA 5KYYA 1U5AA 2FRVA 4TTJA 1GCAA 3CE6A 4IRMA 4Q7LA 1EFTA 3RG2A 2A6PA 1KAOA 2WT9A 3KBOA 5ALXA 1NF3A 1M1NB 1THGA 4DHEA 3RLIA 3DMFA 3KAPA 3GU3A 4YJGB 4D6XA 3O1LA 1A4XA 3HU5A 4DIMA 5JALA 4ZAXA 1SBNE 2D1QA 2YV4A 3LOQA 1K3FA 7AT1A 1UPBA 2GBLC 3F3MA 4ON9A 2FP3A 1XHLA 1GAQA 4PAQA 4Q4LA 5JS2A 1PNRA 3T3OA 4Q0MA 3ERCA 2PUTA 3NFRA 4QOEA 3FZYA 4O4IF 3C85A 2IBSA 2FMFA 2G5GX 2YJ4A 3G59A 4RPGA 4CWAA 4O2BF 3RVJA 5BO5A 4YCMA 3DMPA 3EEQA 2JRCA 3HI6A 3TTXA 1Q77A 2RHJA 3K30A 2W6QA 3BWVA 1KO5A 2VDRB 1A7AA 1P5HA 3U9TA 1JV2B 2A0UA 4FYPA 2O8BB 2R751 3MTQA 4KQ9A 4UNIA 5ALOA 2Z6UA 3A3PA 1J07A 1Z2AA 1VG8A 3TMYA 1XAGA 2AWOA 2UZ1A 4DQXA 4BKPA 1JDJA 2HUNA 1E58A 2XRMA 3BGVA 4CQMD 3VSAA 3UB4A 3D4LA 4QUAA 1MIHA 3H65A 1FW8A 3HB4X 3KAKA 3Q9LA 3T9FA 4WQMA 4CEHB 1EFVA 4G0QA 1OH8A 2A5FA 2H06A 3K6SB 3B12A 4K03A 3D7RA 2AN9A 5DSXA 1NXXA 1CW2B 3DE6X 1V16A 1N1GA 3WRWA 5C1PA 2OP0A 4Q4HB 3G1WA 4NOKA 3STHA 2C2YA 2OHGA 4C4SA 3AJDA 1A4UA 5AKLA 1K66A 2MTBA 1JFFA 3EY9A 4MR9B 5C7IO 4BGVA 2P3OA 3H9GA 3RTCA 1N2HA 4U7DA 1IN7A 4OOEA 1JYFA 3IULA 4GMHA 5KYXB 3N6XA 4BOYA 1U7PA 3L7AA 3CLUD 2WPDA 3UEOA 1PW7A 1YO6A 3B89A 3TLXA 3V1MA 1EVKA 1MRZA 1YKFA 2CB0A 2O0HA 2PS0A 1ISHA 2JLBA 2PQ6A 1DRVA 3DH0A 4IDDA 2IEYA 4JBIA 4EUKA 5JSZB 1H6AA 1CR4A 1W25A 1F2UB 1I6WA 2P9TA 2PTHA 3GFVA 3M3DA 5E1MA 4BATA 4EATA 1KZ4A 5K0FA 4UUMA 2QAJA 5MHTA 4WZAA 4HAWA 3V8NA 4X71A 3KSRA 2DR2A 2WRZA 3VOSA 5BNZA 2AMLA 1AS3A 3IBFA 2J6BA 3NB0A 5FKJA 3WL4A 2D5BA 4AJPA 1YCDA 4KGVA 1EBBA 4JEIA 5JJIA 2J59A 1Q7GA 3W05A 4EF6A 2WWFA 1JRLA 2FSIA 3DL0A 3F8TA 1BS2A 4FR0A 2BI7A 3AERA 4RQUA 2BBWA 3D2CA 4NU5A 1HDOA 4KR9A 2QTNA 2O54A 1OIVA 3NCTA 5G0TA 1GU1A 2AN3A 3JYPA 3SYRA 1FJGB 3Q7PA 3ZYZA 1ZD9A 4R2IA 3M8KA 3A14A 5E3JA 1O8BA 4PQGA 3G82C 3CCCA 1NWCA 4WXPA 1S9HA 3GJ6A 3Q3HA 4E4RA 1KK1A 1TC1A 1GNLA 2DM6A 2WYUA 2YY5A 1DPGA 4X45A 2ZYUX 2RI6A 3ZX5A 4FWIB 4ZI3A 1RKQA 4KZKA 5B1EA 2R1ZA 2R86A 4LXIA 4JI2B 2VC2B 3V8BA 4L8WB 4A0QA 3GAAA 3HJCA 5JWOA 2IEIA 5JVDB 5TMPA 1DEKA 1UM9B 3PQDA 3WL5A 2NVUA 2WKSA 4MKRA 1YZYA 3UYKA 2OECA 3V8QA 3P4UA 5IN5A 4M6WA 3PXAA 1Y3BE 3BRQA 1OJ7A 3BH0A 3RS3A 2P8JA 3UF0A 1LC0A 3BULA 1SIBE 3N2NA 4RJLA 5D6OA 3WQRA 2XYHA 3SC2A 4R7ZA 3AESB 1SOWA 1Y98A 3EAGA 3GLHE 2OPHA 3D2LA 1WMEA 2ZZKA 2EL9A 3DE1X 3N76A 3AYXB 1FUYB 1ISGA 3OE7A 5B30A 4ASUD 4E32A 2C2HA 1EVJA 1G8HA 4W8GA 1D2NA 3ZTTA 1E1CA 1N0IA 3U56A 2FPRA 2CNDA 4MW4A 1Y6FA 2EGHA 3ZY5A 4FDTA 1JILA 2H7CA 4I50F 2WJIA 3LWDA 4QM7A 3QTTA 4NABA 1BVRA 4WXHA 1S1MA 2GAAA 2C4UA 3VJKA 3I5YA 1A1VA 1YD7A 1Y1KE 3LP8A 5FBHA 3EC1A 3RJMA 4YDHB 1JA0A 1BKSB 3ES9A 3ZCSA 2G4VA 5T57A 4BQNA 5HKAA 3LDAA 4DMKA 1RAHA 2GBFA 3DYVA 1M72A 1RYDA 3PFHA 4F1WA 5KWEA 4HVAA 3HV0A 4XVHA 1G9XA 4R69A 2D00A 3ROEA 4HWRA 3H3JA 2FEWB 3KWFA 1JWAB 1O95A 1X42A 3GLHB 1AN0A 2P1DA 3ESZA 3KFXA 3R3XA 5FQNA 3PTAA 1YOVB 3EZ6A 3SE0A 2ADMA 1E2MA 4J9VA 4NECA 1D2CA 1COWA 3MXTA 4EDHA 5J2TB 3WISA 2ETXA 3WS7A 2CYCA 9LDTA 1V5IA 2V7QA 4KO4S 4KTTE 4DPLA 4ZI7F 2PKXA 3RSLA 2HYDA 1DC4A 4WZBA 3RBVA 3V7NA 1ZEMA 3D8NA 1DBRA 1K7XB 2ECOA 4NOLA 5ECWA 4FGWA 4EJMA 2IYSA 7MDHA 3PCXA 4KV7A 4JQOA 1Q95A 1FY2A 3IQWA 1M2NA 4BNIA 1P6QA 1S4MA 5KX5A 1XDDA 5T41A 1KAQA 2J87A 4LHXA 2FMIA 1LI7A 1ZGJA 1O96B 1BJKA 2BEKA 2OCPA 3GEMA 5KNCD 1RADA 2J9XB 4OUDA 2O5EA 3AONB 2DCMA 1F0NA 2DLNA 3B8HA 4UDYX 2I4TA 4JVMA 3W6ZA 4HN4B 4P0TA 1V1RA 3CJTA 2C7BA 2XQVA 3IUYA 2IW1A 5EHNA 1K9SA 2NYVA 3RU2A 2GHQA 4TLLB 4MTLA 4YRCA 3DUFB 1ESMA 1TD1A 2Z5FA 5IJ0A 4R7TA 2CNWD 4H4CA 1DJNA 1GSAA 5JCZA 4MW0A 4D96A 5IEBA 4GE3A 4LMPA 5B1HA 4EW1A 1CUSA 2BELA 1BJRE 4GQAA 4ZODA 5FL3A 4NZNA 1WOYA 2ZE5A 2HIMA 1D8AA 4NEQA 1D2RA 4DCGA 3DPSA 3THWA 4NZYA 1TRKA 1T3TA 2HJHA 4V0NA 3GPBA 2JK1A 1JPUA 3TQIA 1BGWA 4JK3A 4DAEA 1XLTA 4ECEA 4ETWA 3K2BA 5K8JB 1YNSA 3FDZB 5JSHA 1UEIA 4LTNA 1NXTA 1USVA 2VSYA 5JY1A 1JAZA 4KBFA 1LTKA 3CTMA 1T2DA 5K99A 3L05A 4GLJA 1SVNA 3HN7A 2IEBA 2YUIA 3M4JA 1TJ4A 5DGCA 1CJMA 3OCUA 4K46A 4D97A 4TL6A 2XA9A 5IH3A 5EMMA 3D64A 3G8AA 3KFVA 3MAGA 1WW3A 3FFTA 3WLOA 1DS6A 1QP4A 2D1RA 2PN1A 4O8ZA 2C95A 3ASZA 3WI7A 1JHVA 2BMVA 3WMEA 5AJZA 1RWQA 1SHKA 3R7AA 3FCAA 4D9NA 2XUOA 3DZIA 1I80A 2JJMA 1QPBA 4Q1EA 1XMXA 1YRBA 5EPUA 1JIJA 2ENUA 1MKYA 1BXGB 4YLGA 4I8XA 4ESHA 2AG1A 2QDKA 3GP3A 3ESCA 4H1VA 3TSZA 2VP3A 3F4LA 1HR0B 4ZGBA 2WA2A 4KUEA 4GQIA 2WD7B 1YVEI 1BFKA 2P3SA 3THXA 4GX1A 4W9NC 4CQJA 1SVMA 1AKVA 2IYPA 3BE8A 2QX4A 2P91A 5JAOA 1V39A 2RI1A 1N5DA 3FWHA 4U9IS 4DM4A 3A9RA 4JH0A 4PZYA 1GGJA 4DLUA 2OHHA 2CUTA 4EPVA 4CKWA 4TYMA 1W88A 4OG2A 2X40A 4J0QA 1IY0A 1SB8A 3KQPA 1QHGA 2NSLA 2DOKA 4FYWA 4PFSA 3BWXA 1JG2A 2PIAA 4J43A 4XYEA 4Q48A 4CTJA 1Y4DE 3V00A 5C37A 5LA6A 1PR4A 4EQ6A 1JXQA 4C08A 5JAPA 5CB8A 2FMHA 3UK7A 4OM8A 5A4DA 4UJ5A 1ZKDA 1UAAA 4B3XA 3HCCA 1KI2A 3QXXA 3KOMA 3IOCA 4QUIA 4CQLB 3LCUA 5FUYA 1C80A 5F2NA 3MJCA 3FRJA 4P33A 3AVXA 4HDKB 3RYIB 4HLDA 4MW2A 3EA0A 4X65B 4DQ0A 1B8PA 2DE0X 4NR0A 3GZNA 2PPLA 1PHRA 1SC6A 4MPPA 1G42A 2CK3D 1Q92A 4G5QA 4ZI2A 3RBZA 3E3LA 4HLNA 1K5HA 1RPAA 4EHFA 2P79A 3KKPA 1T4CB 4INZA 1KEEB 1F4VA 4K87A 4RAOA 4DG5A 4LYEA 4HB3A 1OBHA 1YULA 4LYJA 1ZH4A 4UFPA 3SVZA 3SR0A 1FU4A 1D3AA 4I5FA 4RD2A 1P1HA 4YFYA 5AESA 1G291 3PX2A 3RRFA 3TGLA 4BMDA 5AFSA 1TD9A 3P7MA 1P5FA 1QAMA 3L18A 3WIVA 2BFDA 2KS6A 4U8HA 2QP3A 3CXRA 2HXYA 4QDZA 3SQDA 5J5VA 3GBSA 1CE8A 1YS6A 4BFCA 3QUQA 3GT7A 4QXPA 4XXHA 1QYWA 3GF4A 2OAEA 3C74A 1CCWA 4NCIA 4TTTS 2VKTA 5JCPA 3FVTA 4MUFA 1LPOA 2J3DA 1V48A 2OQIA 2PWAA 4R40A 3H05A 4BVKA 2Z43A 1GUYA 4YRBA 4YDQA 2HPHA 3KE8A 3ZGZA 2OKCA 1H66A 2I2AA 4N48A 3P9KA 2UYCA 4XR4A 4H16A 1TQ2A 2JFBA 5L45A 2DY1A 5CT9A 4XR9A 5TLSA 1E3TA 2CNOA 4LZAA 2XMSA 1G2OA 4GOXA 1I5OA 1DUIA 3PNMA 5HG0A 2XD4A 4JLWA 4KE8A 3MS7A 4R2JA 4WUVA 4Q1AA 1Y6GA 1YVPA 2AXNA 3VC2A 2FN3A 3R9XB 4LRQA 4MGYR 4CFYA 1TAUA 4EUNA 2A9OA 1YE8A 3SHTA 1WQ3A 3SM9A 1T36A 1AQ6A 1T0HB 3WL6A 1DJQA 4F8YA 4YCLA 1QU3A 2M9MA 4X24A 1Z15A 1FRNA 1FC0A 4YJ3B 2VUSA 1TOAA 2YYYA 3DAGA 1JSXA 1HA3A 2ZVPX 1EFAA 1FSZA 1QYVA 3UOWA 2HA3A 4EPWA 1K9VF 5A7FA 1JWLA 3M1IA 2QN7A 3ANSA 4Q9NA 3ZQKA 5JDIC 4Y1EA 2G0NA 3QHPA 2G1JA 2V98A 4OGLA 5A4MS 4H31A 3Q40A 3LDUA 2GETA 3OD1A 4EAAA 1E3QA 5KJEA 1T8YA 3O74A 4HD8A 4YMGA 1XEWX 1UZLA 5LQDA 2BE7A 4AJLA 3CVOA 3WL7A 1X1QA 4XQCA 1SIOA 1XDGA 3NDPA 3OLZA 1G20A 2PYZA 1MVLA 2JAQA 4BB5A 3OZSA 5JY6A 1PD1A 5D00A 2OWDA 1H5QA 1V9SA 2QN1A 3GT4A 4ER3A 1EESA 1VSVA 3RKSA 1L4UA 4ENTA 5LUAA 3LX8A 2PUDA 5KOHA 3UAZA 2XXJA 4PC7A 1XTIA 4LHYA 5EE5B 4BMSA 3CVUA 1TT5B 1OWLA 2VTVA 3G79A 3SJAA 1LU9A 1F51E 1ZI6A 1KJYA 1YC5A 3ZU4A 3BD7A 1U7UA 1EX9A 1NMSA 3ZD8A 2FZGA 3EEYA 2C4HA 2H7VA 3UV6A 2XUGA 3BFVA 5BY2A 1QVVA 1LLQA 2PGLA 4U7PB 1AMOA 3WLKX 1I3MA 2WHQA 2XVMA 4CEIB 4K1LA 3V97A 3R7FA 1J2EA 4TTAA 1Y42X 4M0CA 4V1CA 1Z5VA 1QSGA 1GLNA 5ICEA 2VUIB 1BH6A 1IBRA 1P80A 1ZJ4A 4UQLA 4UJ3A 4C0QC 5JYCA 4J0IA 1NJ2A 1XUOA 2ONYA 4G85A 1OZ0A 1T25A 1FFSA 3H6GA 3E18A 3EWIA 4ZO8A 2VYCA 3FNEA 2Y1DA 3BMQB 1P2FA 3A6DA 4UNQA 4X84A 3UJAA 4CM8B 4IVQA 2PFSA 1F2VA 3IAFA 3K9HA 1A96A 1KYXA 3DMYA 3II6X 1GSIA 1M2JA 4GBMA 3I5XA 3AESA 3HFJA 1RAIA 1SA0A 1CR0A 3CLSD 3AEZA 3PF8A 4L8VA 4UEOA 5F51A 3U7RA 4D44A 1VLJA 5HWSA 1LTQA 4YRZA 1RTKA 4JFRA 4DJFC 1L5NA 1KSFX 2EBHX 5BUQA 3L41A 1DDIA 4L3VA 1ZA2A 1ZRHA 2IUTA 4FFRA 4QU5A 3W78A 4YRRA 1TZJA 1HDGO 2BZSA 2GEUA 3EZ9A 5G0SA 5H81A 1KERA 2QUZA 3NOXA 2NPFA 3ROPA 2YNMA 4URFA 3ZV7A 2JI4A 1OH7A 1L8AA 2PH7A 4OBEA 4YCJA 2GEKA 3D6NB 3M2PA 1LJUA 4L95C 3GFPA 2X14A 1GWNA 3CX6A 3D3KA 1U2GC 3SVLA 1H2AS 4YP5A 4EJ0A 3C0KA 3KR2A 4ZRDA 3CRMA 3AR4A 5KCZA 4WINA 1VG0B 4CCSA 1HT2E 1JKJA 3SZUA 3CH4B 3KOWA 2H1SA 2H1FA 2IELA 1TM2A 2CSUA 1IHUA 1RU3A 2A14A 4L4SA 1P31A 1QZ3A 4R98A 3UQYS 3WOHA 3ZS8A 2I0FA 1CFZA 5ED0A 1EZZA 1PT7A 3EDCA 1H0HA 2AOVA 4JUBA 3VPXA 1NC1A 1SRRA 2HGSA 2P0YA 2A7QA 1KH2A 1F6BA 1EVQA 1DTEA 1DKMA 1T5SA 2Z1MA 3WRXC 3R6DA 1IOWA 5H9WA 3ONWA 5AM2A 3DP9A 3F4KA 3HVJA 3BT7A 2G6BA 2R6HA 2BGRA 1OXXK 5F78A 2J7PD 1EWQA 1N1DA 3F9CA 3CA8A 3UMGA 1QU2A 3PQ4A 1EWVA 1Z0IA 2RGWA 4TRNA 3EVGA 4WKCA 5DN6A 2H5JA 2G04A 5CDTA 2VT3A 1PJZA 3GFSA 3AILA 4RM3A 1AXEA 4U7GA 3MTEA 2IS6A 3UC5A 5JI3E 2I3AA 4RTQA 2IJGX 2W42A 1M66A 3ZBTA 2YFHA 4B0PA 1WHSB 3HJNA 1PI3A 3HO6A 3KYDA 1QRTA 3CIFA 4LJKA 4DLRA 1XTTA 3JWPA 3WLEA 1GKIA 2XV1A 4FMPA 4YAFA 3O26A 2QRPA 3PC3A 2XKBA 2DY0A 3VBEA 5IBQA 1JAXA 1QR6A 4PCAA 3EPJA 4X3OA 3ZHCA 3K73O 4B43A 6AT1A 2O8DA 3R5KA 3DE5X 1VA4A 3PUYA 3OX2A 1GCUA 1ONPA 1VJ1A 1R66A 3DMTA 3EJ6A 3NKFA 3O31A 1B3BA 2WV9A 4JBWA 3HZOA 4NEGA 2QM8A 3IAM6 4NZMA 4DAOA 5A1TA 3ED5A 3EJWA 5H83A 3JVDA 3EC2A 1TAQA 1ZI9A 1WMFA 1H8HA 1XZBA 2A5YB 2ZI6A 3DKPA 2IP2A 4IH4A 4R1NA 1EBFA 1YVDA 3NP7A 3WDKA 5TQVA 3UMVA 3PGLA 4IZHA 4U9HS 1Q0QA 4W1RA 3WRVA 1RQNA 5KHOC 3VJLA 1PG5A 2W71A 1DNPA 3P2MA 2GCGA 5FR2A 5H3LA 3I5MA 4Y1RA 3VKVA 1H94A 5LSAA 4IV0A 4D0LB 3EQ8A 4J1SA 2ZYWX 1LUAA 3OF3A 4XRRA 5JYBA 3W2TA 2V9PA 4QOIA 1VTKA 4X8HA 4RIHA 1K8QA 1LLDA 4DR7B 4R41A 4C4XA 1XPJA 1PQPA 2O8FA 3LXXA 3WHKA 1XL1A 4RH1A 5D85A 1XWFA 4QUEA 4GZMA 2HJRA 3ZGNA 4DCCA 4ER0A 3RVPA 3DAHA 1TU3A 4EP1A 5FTMA 5HKOA 1AQYA 2XOXA 2XW6A 2C4MA 2ZBGA 1IXKA 3KLBA 3BFKA 3PS9A 4H6XA 3C7TA 4BN4A 4M0LA 2H3HA 3MF4A 2UVPB 4HQ0A 4OQEA 3NXKA 4JX8A 2Q49A 1NQOA 1EFLA 2H2IA 3BVPA 1IDOA 3LI2A 4FXPA 1D4AA 1I01A 1LBTA 1NATA 1OX6A 3GUUA 4QOJA 2WUFA 1XCPA 2JD2A 4AM8A 4Z4IA 2A57A 2P9BA 2AC7A 4Z5XA 4MWEA 1BD4A 4TM7A 2HGZA 1H8ED 3K9LA 3K35A 4TVBA 3TM5A 4NENB 3OJLA 2RGBA 2DMRA 4OXIA 5ITSA 5K20A 4Z0HO 2XDQB 1Z4MA 1RIIA 1B0ZA 3U4IA 4Q9KA 1UANA 4OGKA 1E79A 2ZROA 2CLIB 3IQXA 2W2NA 4REOA 3RS7A 3EZNA 3K3PA 1CERA 4MRAA 4RYLA 5DGDA 2PMEA 3VOBA 5BR7A 3HDVA 1L7RA 1U0NA 3P4YA 5M29A 3EGIA 9ATCA 2R65A 4CXMA 3CT4A 2OOKA 3I1YA 1VRCA 3MJDA 1EGMB 2KMLA 3DCNA 1G8JA 1KK2A 3EDOA 1NDUA 4IEIA 4YMTA 2JAPA 3OT1B 3UW1A 2JGLA 1JL3A 2Z57A 3LL4A 4OXRA 2PX0A 2H7YA 5E4YA 3GGSA 1GA6A 3FUXA 2PT9A 3JQAA 2QF7A 4D9BA 1MO2A 4EHIA 4FBMA 4NBLA 5HE8A 2KX7A 3L4BA 1DAEA 2PGNA 2XOKD 2QSJA 4GVLA 2C7OA 1MN6A 2BSQA 1N6RA 3I2JA 1WHTB 1FIUA 2PIDA 5AUPB 5A2QA 2WAMA 4QBFA 1QYCA 2B1QA 3Q6MA 1JZTA 2UYGA 3HXOA 4R8LA 5DX1A 5G3ZA 4AO6A 4BC0A 4C2BA 3G0GA 3H5OA 2VPTA 2HV9A 3AEKA 4OSEA 1ATZA 1J9GA 5BNWA 4OO3A 3VOTA 4C3VA 2JCVA 1EVLA 1SC9A 1YR3A 4ZA2A 2I66A 4B7AA 1QHSA 2IHBA 1JPJA 3A11A 4RFVA 1E0JA 2XB8A 3IHKA 4Y1GA 4AYTA 3SY8A 3RSSA 1U8AA 2Q1SA 1JJ7A 3UCEA 5L53A 1N2GA 2EP8A 2QGFA 3HEAA 2O1SA 3GXBA 3I83A 3B1FA 5JD5A 3N2KB 5IKXA 2VT7A 2Q0XA 1X7YA 1MU0A 2AQHA 2ZIXB 4FPXA 3U39A 3JAMA 1WBBA 1A27A 1N77A 2J3LA 3PD0A 4LV6A 3DYIA 2GN1A 2JGDA 4LTMA 5AXCA 3KJFA 5AJWA 5A5GA 1UPFA 2QRNA 4WCFB 4MUYA 3IV6A 1I0LA 2JEYA 4EARA 3OO1A 3BDIA 2X0RA 5KQRA 1PJ3A 3CRW1 4B76A 3HGQA 2WM2A 2NUPB 2HC9A 4YJ3A 4FB4A 3UBTA 3TB6A 2MINA 2WIDA 2BRUC 2F62A 2QUBA 2GK4A 3DVAB 1MD9A 2R6GA 3PE3A 2XNKA 3O7WA 2GM5A 1R5JA 2JH8A 1C4KA 2VG8A 3L1IA 4HY3A 1A8HA 4O4JB 4ZT2A 2JCBA 3CUEF 4F2HA 5LOVA 3H8SA 1ZINA 2WP0A 4MAMA 4CMBA 4CV0A 1E4EA 1SOUA 3ZJ4A 4EB3A 1O94C 5IHXA 3H1EA 3IVXA 5THQA 3TECE 3UXMA 4WX2B 1HTTA 2NZXA 2W2PA 4LGCA 5CNMA 3GLQA 5EKTA 4F2GA 1GTMA 1NBEA 3DBLA 1CUCA 3KUDA 2FVXA 3RTDA 3G5LA 4UULA 4B46A 2R4TA 2X8BA 4YWJA 3S99A 4AIIA 3KKEA 1ZJ6A 4C4TA 4GP7A 3UGTA 4A4DA 2M1ZA 4Y9TA 1QKKA 4HXYA 4UUPA 2IE8A 1JEYB 1RC8A 2IHJA 1F8UA 2J0EA 1XMJA 3KEQA 4UXJA 4YGXB 2C92A 2I76A 2R6R1 2XUAA 1HMYA 4G4SO 2H1RA 4OJKA 4AQDA 1CF4A 1TTQB 2E0IA 3PYXA 5T4EA 3WDLA 1WUTA 5JC1A 1UH5A 4UTZA 4EJ2A 3DULA 1PKXA 1KI1A 3BB3A 3M2TA 3TLJA 1E2HA 3S28A 1ZMXA 4LQDA 2FZVA 4NNOA 3NIFB 1JI3A 3GIDA 3QWBA 4Z1MD 1FYVA 2ZUWA 3L40A 4CLRA 1JHRA 1SXGA 3KLPX 3WGJA 2DTEA 3CSDA 2Y2UA 2GA9A 5K0GA 1S8AA 4DV7B 3A37A 1U7OA 1U9JA 2H1OA 1VCOA 3R6GA 3SX4A 1QMPA 3KJEA 2P2ZA 3KEMA 4RJJA 2FPUA 1J25A 2XQGA 3DTNA 2FLWA 2ZWAA 4MVJH 2FP4B 1EKXA 1SWVA 2NTVA 3HRIA 3HO8A 4LRXA 4TQGA 4FR2A 3QXGA 4PLZA 3UO8B 4JP3A 3GFFA 3GLGA 1YS7A 2PGXA 1ZHHA 4DEVA 2BR4A 2ZI3A 3W9UA 3AG6A 2EJUA 2LR0A 1GCOA 1XZJA 3BF7A 4LJYA 5DTRA 4ES6A 5AJUA 1QTIA 4M60A 3UQZA 4ALKA 1QHHA 1PZHA 1T8WA 4URVR 3COVA 4G5XA 3V1YA 3WLTA 2GUGA 2IE0A 3L8CA 1YBAA 1C3VA 4Z6KA 2YWRA 1XMOB 1E9BA 3KOOA 3MJRA 3R75A 5MGBA 1F17A 1WSBA 2ZT7A 5DB4A 1VLLA 4DSAA 5JSUA 3QF4B 4MDYA 3GXOA 3W2IA 2D6FA 3KT8A 1A71A 3GEEA 3QIAA 3SF8A 3ZV4A 2ZAOA 5HSGA 3I01M 4FT2A 1CUHA 1N2ZA 3DTYA 4LDPA 5DTJA 5ALDA 4IGKA 4ZT4A 5KSOA 2VHWA 1GEEA 3G2QA 4LSZA 5F64A 1LA2A 1KYZA 2HF8A 3ZS9A 1PR2A 5B6JA 4AD8A 4B79A 4N6GA 1WA5A 1PZXA 4D9FA 4OA5A 5K7SA 1NLUA 3Q3EA 3VH3A 4B31A 3QE3A 1IUOA 4FHDA 2IUFA 4S35A 2BSAA 4F4IA 4MWOA 1O8CA 3TBFA 1SUBA 3ZW7A 4ZZ3A 4JEMA 2GZHA 4Z51A 3JD0A 3CZ4A 4F71A 3MTAA 2FSUA 2QTAA 2XZTA 3EGOA 5A03A 5JNWA 2FQYA 1UMCB 5JQWA 1UC9A 1PR3A 3EK2A 3FWYA 3O8LA 5LXTA 1DG1G 2NYRA 4JGBA 3K6KA 1DLJA 5FLKA 5LZ5A 3NHAA 2I2CA 1PV1A 3RBXA 3AIMA 1Y4SA 5ITZB 3DDOA 1D5WA 3JWHA 5JRZA 1ZJWA 2XEDA 1ZRMA 3TPFA 3OPYI 1MX5A 2YZ7A 4HVLA 2RH5A 2RGEA 3C6YA 3DPUA 2HK8A 4URXR 2XE8A 4QQRA 5TRTA 2YIJA 3PUIA 3QXJA 1A9ZA 2VUUA 3PQ2A 4II2A 2AJDA 2XSZD 1UEJA 1YASA 1ADFA 1CUDA 3AJ9A 4QYSA 3AR5A 4GECA 3PQ6A 5FPPA 3JQ7A 1W35A 2X3UA 5EFOA 2ID8A 3ZU3A 3SS8A 3K0AA 4R2XA 1M0SA 4OQMA 3PUZA 4AAYA 1PTKA 4MVWA 2DGDA 4XJTA 3P2KA 4H1UA 5IRCD 1NW9B 3PRJA 4FNAA 2R4QA 3FHOA 3COSA 4O1IA 2IODA 1JP7A 1RC1A 4ARZA 1DFGA 1N8SA 2XNDA 1SUDA 4EVRA 5JAUA 1QX3A 3W6NA 2BR3A 1A77A 1II9A 3CE9A 4UAUA 5FI1B 4HS4A 5B4VA 3JZAA 5K0CA 3AP1A 5CA1B 5JHHB 5FBKA 5JEDA 1M6WA 4PYMA 2EAUA 1OWMA 1XP5A 1TE2A 2FLVA 4FQ7A 3CKKA 2A0FA 2ONKA 4JI1B 1Z4IA 1TCCA 4HXEB 1WXFA 4M4SA 3GUHA 1X7HA 2BHLA 3SQOA 5GINE 1RI5A 4M86A 5AK5A 3KXKA 1I2AA 1M73E 3AVPA 3H4VA 2IKSA 4XTCS 1PJAA 5GV7A 5F12A 3U7GA 4QJIA 2IY8A 2O7QA 4PZEA 1YR9A 3GCWA 1PLKA 2Q6VA 4JLUA 3ZLVA 4D56A 4DV5B 4H60A 4MUXA 4U3JA 3ZHRA 4LY9A 1M10A 3F47A 1XEAA 2XYGA 5SY9A 1ONOA 1JDPA 4ZAVA 1K27A 1PSDA 1S2DA 1JIXA 2V6BA 3B5EA 3KSBC 1A5SB 1XCLA 3BH7A 1NSTA 2AOTB 3VNRA 4DA9A 5BWNA 4H3KB 4MUIA 2VOJA 3LPAA 1NXSA 5F21A 2OQ2A 4UNNA 5FF9A 1CRZA 4PIMA 2AD1A 5EIFA 5SYMA 4ZC1A 3B48A 3NHPA 4RPJA 4F72A 4MW5A 1QB7A 3AB8A 1IC6A 4F2PA 1PLJA 1IM8A 1WV0A 4L22A 2I4OA 2QT0A 4J16A 3GRYA 1Z35A 3E15A 4EKDA 1G38A 3SX2A 1RE0A 5IDWA 2VWHA 3QU5A 5JWHA 3FKSD 1JWBB 4QGAA 5DWDA 1EJ0A 3IDOA 4HBZA 3OICA 2HWKA 4U6SA 3SR3A 4HHEA 2H0RA 1RWVA 4MV3A 1U1DA 3AVQA 4UCFA 4QDXA 4BEWA 1M7BA 3N07A 4LXGA 2Q6KA 4I4NA 5CCEA 1RLMA 4DC0A 1IY9A 1IHYA 3SIRA 2FWIA 4DUZB 2ZT5A 4QWMA 2QTVA 3FYTA 2OZPA 1WXIA 4IQ0A 5M34A 4BAUA 1WG8A 4YUZA 4ZICA 3CWZA 1O9HA 3HXMA 4F85A 2HDNB 1Z45A 3MOIA 4WECA 2DHQA 1O6FA 2K7ZA 4PZPA 4DUPA 4GI1A 1OLUA 1TA4A 4CBVA 3KQWA 1WV1A 1C30A 4MUNA 4TUYB 3X44A 5BW5A 5MF6A 4TTPA 1OWNA 1E69A 2CB9A 3EUFA 2UUAB 3FNGA 1S89A 3NBXX 4PO3X 5LA6F 4HEA1 1FFEA 3D1LA 2VQSA 3DBIA 4ND3A 3D6VA 4PC2A 3ZTWA 4EVIA 1G7SA 5DBOA 1XQ1A 3OCVA 2C7QA 5CXSA 2V45A 3RT7A 2VHCA 1RRPA 1K7YA 1CEEA 3KM0A 1MOZA 2RJOA 3IIKA 1D6JA 2H4YA 4WJZA 2Y1OA 5SY6A 1WU7A 1SJ9A 2MSEB 2JIRA 3I6QA 4PRYA 1DQYA 2NXCA 3Q72A 1XF9A 4YRFA 5K0SA 4DJJA 1YU6A 1E2PA 4FVTA 2HCBA 2JARA 1E9VA 1R4NA 5JAQA 2JKYA 4JI4B 2CVZA 2D1FA 2C4KA 2P41A 2XCLA 3OLQA 3O03A 3TIIA 3P0HA 4XTRA 3G02A 5D1NA 1TLFA 3UYLA 3V4LA 1WUYA 1YJ8A 3KT3A 3O75A 4KWTA 5DDIP 1J8FA 4HKTA 5KNDH 1JEEA 1DFIA 1UFQA 3VR3A 1VL5A 3FSGD 4FJ0A 1DIRA 5DWVA 5GOTA 5IM4A 5TMBA 4G3XA 3OESA 2YJ3A 3DSRA 4RK6A 1JEAA 2I91A 2AUTA 2PX4A 3F6YA 3RARA 5KMGA 4WCFA 3PJRA 3OZGA 4KKXB 1OROA 2XMCA 3BYZA 3TTUA 3ZGVA 2PRYA 4D3DA 3ROMA 1JSRA 1M1ZA 4CR6A 2C3YA 4G1EB 5FA8A 4ZEWA 4OJQA 4EB6B 3ET5A 1OBCA 4BYGA 2HSEA 4YIKA 2QAIA 3BE4A 1FFAA 1W94A 1DAOA 4R9NA 5B4UA 3O8BA 1R74A 1UPTA 4MLCA 1I4TD 3L9WA 3M83A 4QUJA 4YIHA 1E5TA 1EZ4A 4XWYA 4HYEA 2ZJ4A 4RM2A 3DTVA 4JITA 2VCEA 3AVTA 2FSFA 2LNDA 3AETA 1FCJA 2W93A 4NKRA 4MKXA 3VYSB 5JRJA 1XMIA 3NGLA 2Q62A 3RF7A 5AR1A 2JKZA 3LC2O 1NOJA 1TF2A 2FPKA 3HKBA 4F86A 3TRFA 5CEEA 2R1VB 1Y4AE 3K8OE 2WTAA 2QKYA 4E70A 3T38A 2JCGA 2JLYA 1JS1X 4YV7A 1W581 1GNPA 1PR5A 3T6KA 3L6RA 2G7MC 2EEPA 5BMVF 3H04A 4RQBA 3ZHOA 721PA 3QYAA 3UCXA 5B6PA 1GPDG 2Z5VA 4BZWA 2GPJA 4P8RA 4TMZA 1IQUA 2BFFB 3AY7A 1G21E 4O0LA 1GZSA 1K8XB 1T5OA 2GI4A 2QJRA 1U8YA 2ZDHA 3ELYA 3GUVA 1DVRA 2R00A 3R76A 2D3WA 2X8LA 4N01A 2WKPA 2HHLA 4MVJE 3AP3A 4F3CA 2VRCD 2VPZA 1AZLA 1W6UA 5P8WA 1P18A