4OU4A

Crystal structure of esterase rppe mutant s159a complexed with (s)-ac-cpa
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
319
structure length
319
Chain Sequence
SGSPGVEQHTQAFLEALEQGGGKPLEQLSPKDARAVLTGAQASVKVDLSGIEVKERTIQANGQSIKLQVVRPANVKGELPVFMFFHGGGWVLGDFPTHQRLIRDLVVGSGAVAVYVDYTPSPESHYPTAINQAYAATQWVAEHGKEIGVDGKRLAVAGNAVGGNMAAVVALKAKEAGTPALRFQLLLWPVTDASFETASYKQFADGHFLTTGMMKWFWDNYTTDAKAREQIYASPLRASSEQLKGLPPALVQTAEFDVLRDEGEAYARKLNAAGVTVTSVRYNGMIHDYGLLNPLSQVPAVKAAMRQAGTELKVHLQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha/beta hydrolase fold-3 domain protein
publication title Crystal structures of Pseudomonas putida esterase reveal the functional role of residues 187 and 287 in substrate binding and chiral recognition
pubmed doi rcsb
source organism Pseudomonas
total genus 117
structure length 319
sequence length 319
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2014-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ou4A00
4UFOA 3AINA 4WFJA 5CXXA 5AKKA 4AB1A 3I1YA 1MTZA 2HA5A 4ZXFA 4J0HA 4OUKX 3WMRA 4MYDA 4EY8A 1XLVA 1LPPA 2XQGA 5CH8A 4DSAA 1CUAA 1OILA 3IURA 1QJ4A 4GLBA 3H1AA 1G66A 2XQFA 1CUFA 4FDMA 4O08A 3GELA 1DINA 2OXEA 4UBLA 4W1RA 5AOCA 4FTWA 4BYMA 1HLGA 4Q3OA 4BCDA 5JANA 1DT5A 2DHCA 2WKWA 3G9ZA 1H23A 3GFFA 3R3XA 3D3NA 4FMPA 2H1IA 4J0IA 4UUQA 3A70A 1MX9A 5A7GA 5IH7A 1QIFA 2WG2A 5D3KA 3VVLA 3C87A 2Y1KA 1DU4A 1XZEA 4MWTA 2B61A 4X85A 3WK4A 4YK7A 2AJDA 5ALGA 3STWA 3WK9A 3OOSA 1J1IA 3I6MA 1M33A 4JEIA 4OB7A 3DQZA 2WHPB 3WKEA 3W04A 4FFWA 5EHQA 4DYHA 3QBJA 4QWMA 1IVYA 4X6YA 4QDZA 1XLWA 4G1FA 2C5GA 4OYLA 5E4YA 2XB6A 3R3ZA 4X95A 5H3HA 2HM7A 1EHYA 1CLEA 1XKTA 3LIPA 5C8XA 4V2IA 5AK5A 2JIDA 1JMYA 4ZGBA 2CZQA 1WB5A 4DIUA 4QDUA 3R3UA 5A7FA 5FXMA 1VE7A 4J0JA 3V1LA 1HBJA 4P08A 3BDIA 3IUNA 4DLNA 1EDDA 3SK0A 1YA8A 1NX9A 1MN6A 5DYTA 1F8UA 1IUNA 3FLAA 1XRMA 2ACKA 7YASA 2V97A 3UUEA 4BC0A 2RI6A 3V1KA 4NMWA 5F4ZA 2XUOA 3OC0A 4E46A 1XRPA 3QMVA 1ODSA 2VA9A 4UBJA 1F6WA 2OGZA 1VXRA 3AIMA 1N1MA 3AZQA 4BP9A 4DTCA 4BAUA 2XUGA 2DQZA 5DNWA 1EA5A 1THGA 1QGED 2H7XA 4UBKA 4LKOA 4ROTA 1RYYA 2PPLA 1TAHA 2OLEA 2VJDA 2QUBA 3CN7A 2VT7A 4AMYA 4DMKA 3DKRA 3VJMA 4C01A 1P0PA 1LPBB 3R3VA 1T2NA 4X6UA 1HL7A 3WWDA 1MPXA 1VKHA 3HC7A 3WA6A 4H18A 2O7RA 3E1GA 1JJBA 5CT6A 2YYSA 1ACLA 2GBCA 2O2HA 3W9UA 3Q0TA 2G5TA 2UZ0A 3G0DA 5CT8A 1ORVA 2JEYA 1A8UA 1Q0ZA 3GZJA 4PNZA 4YASA 2WU3A 1IUPA 2HU8A 3TRDA 5LZ7A 4QEKA 1SFRA 4U2BA 2FJ0A 3I6ZA 3D2AA 4EY7A 1JMKC 2XUQA 1IUOA 3QZUA 2XE4A 2WUFA 2E3JA 4PSCA 5FLKA 3HRHA 1QIIA 4JH0A 2QZPA 3STVA 1R9NA 4X97A 2WG0A 3IUJA 1BU8A 5CT9A 4UBNA 3V48A 4M0FA 3R3WA 1TIBA 3PFBA 1XKLA 5ALZA 4BVLA 3IUQA 4GEGA 2DCMA 2OCIA 3ZLUA 3BXPA 4B0OA 4IH4A 4IH1A 3QYJA 1E3QA 1R4ZA 4HS9A 3H2IA 3OTQA 1LGYA 2BUCA 1QZ3A 3PDCA 3BL8A 2XMCA 4KACA 4CI9A 2PUHA 5DJ5A 1BN7A 2HRQA 4C4YA 1HDEA 1D07A 3KDAA 3W06A 2OCGA 2ES4A 5K3FB 3L1HA 5AI8A 5AM4A 4IH9A 4U2GA 1DWPA 3IBTA 3QMWA 4B81A 1DTEA 1DWOA 4MYSA 1YS1X 2QM0A 5ALOA 2C58A 5IVHA 4AO6A 1GQRA 5T4HA 1K63A 2OCLA 3STYA 4QDOA 5AI4A 5FRDA 1LLFA 5IKXA 5ALQA 3H04A 1THTA 2OGTA 3U0VA 1BE0A 3WL6A 4DNPA 5C8ZA 2VAXA 4G5XA 4FKBA 3HJUA 4F0JA 5K5EA 2GZRA 1NU6A 4EBBA 5FPPA 3FSGD 4BAZA 5HFAA 2AJ8A 4WJLA 5LZ9A 2XMRA 1P0MA 3S2ZA 1JJIA 1GKKA 3WL8A 2PUJA 2ZYIA 3F8SA 2XMGA 3HI4A 5ALWA 3WYDA 1QO9A 1VJ5A 4NS4A 5AOBA 4I3FA 4BZWA 4UFNA 5CW2A 3DJYA 1XQVA 2BAGA 5ALMA 3ANSA 4BE9A 1QONA 2PSFA 5ALPA 3T4UA 1QIEA 3AZOA 1UOQA 3R3YA 1AURA 4G8DA 3I2IA 1RWQA 4PSUA 1C7IA 4EY4A 1BS9A 5AICA 1C4XA 4BZZA 1LPSA 2AJCA 3D0KA 2IIVA 1XRLA 2QT9A 2VSQA 1UKBA 1JJFA 1AZWA 1EVEA 1XZBA 5I7UA 4Y7DA 1K8QA 3QPDA 5D3ZA 4QLOA 3AJAA 4FLFA 2QRUA 1EI9A 3BDVA 2P8SA 5HFNA 1QIHA 3QMMA 5BWCA 2JGJA 1K5PA 1EXWA 2C0PA 1O6FA 3GROA 1XZMA 5IVIA 4RNCA 1QOZA 1QIKA 1AQLA 1JU4A 5LP1A 4DMFA 5AIAA 3I2FA 1GZ7A 5ALNA 3VVMA 3W9BA 1R9MA 4MQLA 1LBSA 1G5FA 3LIIA 2G5PA 5SYNA 4EZIA 2PM8A 5JARA 3I6YA 2XUHA 5D6OA 4K2AA 3VJKA 4F60A 4LYDA 1CUYA 1O6GA 2H9YA 1W75A 1TK3A 4JYPA 1E89A 1WHSA 1EX9A 3O0DA 4IHAA 5A7HA 4BC1A 3WWCA 4X6XA 2CKMA 4XVCA 1CUUA 5DNUA 2QKYA 5FDFA 4PW0A 2GYVA 4LXGA 1CQZA 5JD4A 4LHEA 2HA0A 5JD6A 5AJHA 4JYMA 5C8VA 2EEPA 4RE5A 4WFIA 2WILA 3HEAA 4BRSA 2WFLA 3H2HA 4DMHA 3ED1A 3G0GA 5AP9A 3WI7A 1JU3A 3Q8WA 2CB9A 2HADA 3G7NA 5CT5A 1ZI6A 3JYHA 2HA4A 5ALLA 5KBYA 1PJAA 4N5HX 1CUHA 1WM1A 2G63A 4EA6A 1GPLA 4EB0A 1X2EA 4PSDA 4KAFA 3FLEA 4ZV7A 1CFJA 4OSEA 2QXTA 1WHTA 4BP8A 5A71A 4GW3A 2V98A 2B20A 5HK9A 5AKIA 5LYYA 5JD5A 4YPVA 3O9MA 1XQYA 2BKLA 4RPCA 4ZREA 2G4LA 4EY5A 2WTNA 5AM0A 3FAKA 5BV7A 4TPKA 1BN6A 1CIJA 2QOEA 4MEAA 3EBLA 1BRTA 2HFKA 2XUDA 1KEZA 4BDTA 2XUIA 4D9JA 1AMNA 2OAEA 1R1DA 5DYYA 4QLAA 4UPDA 1ZGBA 3RM3A 3D59A 2VJBA 2VJAA 4A5SA 2WIFA 3O95A 4UHDA 3TJMA 4U2CA 1ETHA 4B6GA 5EIHA 4HXFB 4BRZA 2VATA 1EB8A 5E4TA 1QIJA 3DOIA 3ANTA 3GA7A 5A6VA 1U4NA 3ZLVA 2WSLA 5KREA 4G8CA 4AX4A 3FNBA 1VZ2A 3FYUA 5AKXA 1GQSA 3RKSA 2Y6UA 5ALRA 1HQDA 2WM2A 3ICWA 4KAJA 4HRYA 2J4FA 1E8DA 2CBGA 2JF0A 2ZJ6A 1JI3A 3G9UA 5AM5A 3RARA 3QVMA 1CUZA 4W1PA 4B9EA 4P92A 3I1IA 4M0MA 1HKHA 3EIOA 5K3BA 1UOPA 2WIJA 1JFRA 1W4LA 5CT4A 1YB7A 2IX9A 3QM1A 1H2WA 3CN9A 4BCCA 4KE9A 2GBGA 3K6KA 5DLPA 1A7UA 4H77A 1UT6A 1PV1A 1K4YA 2VEOA 5HF8A 1UFOA 3WQHA 2HA2A 2I3ZA 3O4JA 1UXOA 3A6ZA 1G42A 2J3DA 5ALTA 5CH3A 2W22A 4KYVA 5ALXA 1MJ5A 2Q0XA 1XZFA 3D2CA 3OM8A 4U2FA 4QA9A 2XMSA 3M83A 3YASA 3H1BA 1AC5A 3PUIA 1TRHA 4ARAA 4CG3A 3HABA 4ZV9A 2CEKA 3L1JA 4FWBA 2Z3WA 5K3DA 1E66A 3F96A 4KE6A 4HTAA 4I4CA 4PF1A 4X94A 2R8BA 3AUKA 3VKFA 1E8NA 4UHFA 3LP5A 1WPRA 5E4JA 5J3JA 3AIOA 1MNAA 3C6XA 3WZLA 3H2JA 2H7CA 2QMQA 1FFCA 4CCYA 1JT2A 4X90A 1TCCA 5CH5A 1B6GA 4H0CA 4P9NA 2XQJA 4U2DA 1ZIXA 3ICVA 3VDXA 4F5ZA 1YB6A 2ZVDA 2J3QA 5AM2A 4GXNA 5DYWA 3G9TA 2HFJA 1K6EA 3KXPA 3WWEA 2RONA 5AM1A 1XQXA 3H19A 4Q05A 5ALSA 4A23A 3FBWA 4BAGA 5LKRA 3OG9A 2AJLI 3VXKA 4FNGA 2EDCA 3FYUC 3BF7A 3JWEA 1CUVA 2FX5A 3H2GA 1J2EA 3DS8A 3PUHA 2HRRA 5LZ2A 1XZKA 3ZWQA 3LS2A 5HK8A 3H0CA 3AILA 5IVDA 2ZJFA 5ALEA 3FWHA 4BDSA 2ZSHA 2FJPA 1UWCA 5JADA 1AGYA 5T4BA 2C7BA 1C7JA 2XMZA 2PU5A 3O4IA 1CRLA 4ETWA 5A2GA 1ODCA 1WOMA 3WWOA 2HL6A 2QXUA 1QTRA 1Y7HA 1XRQA 4Z49A 1B41A 4LIPD 2GYWA 3FYUB 2ZYSA 4DNFA 1LPNA 1CUWA 1VLQA 5YASA 4WDRA 2WHRA 4ITVA 1XZJA 4G9GA 4K6GA 4XJVA 1Y37A 2ROQA 5FUMA 2PBLA 3KSRA 3WK7A 4BVJA 3ESCA 1MT3A 2OQIA 3FVRA 5DTJA 5IVKA 4E11A 5FPQA 2VT6A 4HZGA 5ALDA 2WHQA 2OQVA 1UOOA 4Y2JA 1LPOA 1GXSA 3O4GA 2K2QB 1S8OA 4Q34A 1SC9A 1ZD2P 4DNQA 3I28A 1F0PA 1W76A 2LIPA 2DFPA 2QVBA 3K2IA 1H22A 1U2EA 1ZD4A 4EUSA 2WFZA 4W63A 1WCYA 2YH2A 3K9BA 4W1QA 3HYSA 2VAVA 4C4XA 3C5VA 1E5TA 4Y2YA 1VOTA 3V1NA 5AH0A 4H7FA 2X76A 2XT0A 4X91A 3BJRA 4OU4A 4GI1A 5AKEA 5SYMA 3AIKA 1GPNA 5ALUA 5K3AA 2QUAA 1QFSA 5CURA 2B4KA 4Y9SA 1LNSA 5ALKA 1XQWA 3D7RA 1IMJA 3VJLA 4CG1A 3QPAA 2YXPX 1ZICA 2IITA 1IZ7A 4QWWA 4CCYB 5BWBA 3M82A 4DM7A 4G4JA 5AKYA 2BJHA 5ALYA 5CRIA 4YX9A 4BB0A 3IA2A 2WUEA 2R11A 1CUSA 5AI5A 1XZLA 1G4HA 3C5WP 3ESAA 5AKHA 3NUZA 2QJWA 1L7QA 2GBIA 1HPLA 2QTBA 5HCUA 5KWIA 3ESDA 4LXIA 4XWGA 4H7EA 3KWJA 5JZBA 2V9ZA 4H35A 3W05A 2GBFA 1BEEA 4UHBA 3B3QA 4XX1A 4QE3A 1Q84A 2YASA 1FJ2A 4Y2RA 5LZ5A 2JGLA 1J06A 1U65A 1BCRA 1CUIA 1XLUA 4E15A 1WB4A 3M3DA 1P0QA 1SCQA 2O2GA 5JATA 3DEAA 3DYIA 1CUGA 4EY6A 5HKBA 1XZHA 1TQHA 5LZ8A 1X2BA 3IULA 2XUAA 4KR0A 3ZLTA 4IO0A 3DYVA 3H2KA 3PF8A 3DKKA 2WIKA 2JGKA 3H18A 3QITA 4KEAA 1LPAB 2I3DA 2Y6VA 4UHHA 3V1MA 2PX6A 4Y2QA 1DT3A 3IB3A 1ZGCA 3DL4A 1U8EA 5JAOA 4KJXA 2ZYRA 3C45A 4K6KA 1FFBA 3D2BA 2XUJA 5AHXA 1ISPA 3BWXA 1FFEA 1ZI8A 5HF5A 3WK6A 4BE4A 5AK3A 1VA5A 3ESBA 2WQZA 4C88A 3N0TA 3WLAA 3DDUA 3FVTA 4Q3KA 4B0PA 3WWPA 1MO2A 2XQKA 3STXA 2PU7A 3STTA 3PE6A 1A8QA 3LCRA 3WJ2A 3S8YA 5JYCA 1FSSA 1UZAA 2C4HA 2XLBA 2HA6A 4HXEB 4Y2UA 2FUKA 1ZOIA 2OPHA 5KWJA 3RLIA 2W6CX 2X5XA 3HZOA 2QR5A 5AKGA 4DGQA 3DLTA 3LLCA 1EDBA 4F21A 2ACEA 5JAHA 1YCDA 4B83A 5D7BA 4J03A 5HZGA 4TVKA 5AKJA 5EHXA 2OGSA 4WDQA 3PF9A 2Z5GA 5LZ4A 1QTIA 1F0NA 4H7HA 1YAHA 4QDTA 4JNCA 3P2MA 5HF9A 5I8PA 3I2GA 4X00A 3I2KA 5EIAA 5AM3A 4GECA 4FBMA 4EHBA 2O2IA 3IUMA 5DNVA 4PO3X 4INZA 1VXOA 4ZI5A 1TKRA 4WCVA 5AIBA 2JGMA 3KWFA 4GWLA 2HU5A 3WZMA 4AN1A 5HF6A 2PVSA 3WJ1A 1SOMA 3E0XA 4N8EA 3SX4A 4B7ZA 4G4IA 4HVTA 4AO7A 4Q82A 5AKZA 4LYEA 1DQZA 1DWQA 1OCEA 4JUIA 4RE6A 1BEZA 1XZDA 3SWWA 2WUGA 4Y2PA 1N5RA 1ZD3A 2BGRA 1Z68A 5AK4A 4GBGA 1Q83A 5JAPA 1FFDA 1YS2X 1N8SA 1USWA 3UUFA 1R3DA 1H2ZA 5K3FA 4KRXA 4Y2XA 4HXGA 4CIBA 4K6HA 5JIBA 5FP0A 4CIAA 2Z8XA 1EB9A 2BUAA 5ESRA 3G9XA 1XZCA 1ZI9A 5EFZA 3U1TA 1MAHA 4NVRA 4CCWA 3VISA 3C8DA 3M81A 4GDMA 4X3CA 4KE7A 4KRYA 1N5MA 3N2ZB 5EI5A 4E14A 2PSEA 3UMJA 4B85A 4UHCA 5DTIA 1GGVA 1UK6A 3C70A 1XZAA 4BBZA 4WY8A 4J0DA 4Q3LA 5K3CA 4N5IX 1KU6A 4Y2TA 4W1SA 4AQDA 1QIMA 1IZ8A 4B84A 1MU0A 1L7AA 2GYUA 3MUOA 5I9IA 5HKAA 4AO8A 5FV4A 4C87A 1XZIA 4W9RA 2PSHA 2H7YA 4H7KA 1EDEA 3O9VA 1YSCA 1T4MA 2WFLB 3DCNA 1DQYA 1NU8A 5K3EA 1WB6A 3IDAA 4C4ZA 3AFIA 2DR0A 4M0EA 5EHZA 4OCZA 2RAUA 2XUKA 2JGFA 2GZSA 1FFAA 5ALIA 4G9EA 5JZSA 4C6HA 2VF2A 1ACJA 1XRNA 4BATA 1CUEA 4AZ0A 3C43A 2C5FA 4BVKA 4CFSA 2DHDA 4UBOA 1BROA 1MX5A 4ZWNA 1XFDA 1W6RA 5EGNA 1MX1A 3D4LA 1X70A 2BUBA 4DNOA 2RIPA 1XROA 1YA4A 4QNNA 1A88A 5CBKA 1QO7A 4X7BA 4X93A 1ZD5A 4AN0A 3C8HA 2XUFA 2WLSA 4AMZA 2BFNA 2WG1A 1W1IA 2WFMA 2JGIA 1AUOA 3BIWA 2EDAA 3G02A 4N8SA 5FOQA 4G4GA 4OYYA 4Q1VA 3BJMA 2PKYX 3DL7A 3WKCA 3RK4A 5AO9A 1RP1A 2BCEA 3WK8A 1OXMA 3G0CA 3R41A 1XZGA 3A2NA 1CV2A 2VQ6A 3QPCA 5LLSA 5C7YA 3B5EA 1CEXA 3MUNA 1SCKA 2D0DA 4H7DA 5JAUA 2OAGA 2JBWA 4H7JA 3BE8A 1UKCA 2OG1A 2Y2VA 2OCKA 1QIGA 4K5QA 3C6BA 4H7IA 2JEZA 2WIGA 2XMDA 3HLKA 4IQ4A 4PV7A 5CTAA 3CXUA 4LXHA 1LPMA 5AKLA 3PICA 3TGLA 1CUBA 1MAAA 2CJPA 5JASA 2Z3ZA 4C89A 2B9VA 1QIDA 4OB6A 2AXEA 3G0IA 1EINA 5AI9A 3L1IA 4XIIA 3SC2A 1GKLA 1QE3A 1ODTC 4L72A 3WIBA 1BCSA 5EHNA 1UK9A 3WL5A 1KU0A 2RGUA 3JW8A 5A62A 1VE6A 1L7RA 5AI0A 5HQ3A 4J3JA 3KOOA 4BTVA 3WIOA 2WJ6A 1CPYA 2XQIA 3DNMA 3F98A 4FHZA 3MGAA 1CVLA 3NOXA 3STUA 4UBIA 5E2IA 2JGEA 4MQMA 1ZJ5A 1UK8A 2O7VA 1YAJA 3ILSA 4B9AA 1DX6A 3NGMA 3ZV7A 2XLCA 4HRXA 3DD5A 3C6ZA 1Q0RA 3F67A 3WYNA 1A8SA 3R40A 5LKAA 2VJCA 2VTVA 5AI6A 4G8BA 3I2HA 4J0GA 2PSJA 2RHWA 3W2TA 2DHEA 4MEBA 4J0CA 5C81A 3D5EA 2Y2UA 3A2MA 3BF8A 5T4FA 5AK6A 1CUXA 4HAIA 4N8DA 4KAAA 2XMQA 3H17A 2HA3A 3FSGA 3HXKA 1LBTA 4OPMA 3WKAA 3CCBA 1CR6A 4AZ3A 3CCCA 1CUJA 4NZZA 4WY5A 2PSDA 2XDWA 1LZLA 5ALJA 4AXBA 4DSZA 1TCBA 4CG2A 4OB8A 4B82A 1GPKA 1LZKA 2QS9A 5ALFA 5ALVA 3HACA 1VZ3A 2ZSIA 3EF3A 3MVEA 6YASA 1AKNA 3T52A 4Y2VA 1WPXA 3ZI7A 4Y2SA 2HA7A 3EQ7A 4UBMA 4PQEA 1CUCA 3OPMA 4TGLA 4J0KA 3F9CA 3I2JA 2DSNA 4J7AA 4WFKA 2HHAA 4FOLA 2BGNA 5AOAA 2WJ4A 3WK5A 5FKJA 3FLBA 1ORWA 1ZJ4A 2CUTA 3G8YA 4P93A 1AX9A 2D5LA 2WTMA 1EK2A 1J07A 1ZIYA 2C0QA 3G0BA 4I19A 3AZPA 1UK7A 2J4CA 4BTLA 3TEJA 1DX4A 4UFPA 3BIXA 3IIIA 4X71A 2ECFA 2QJRA 1EH5A 3KD2A 5JALA 2ORYA 4L3WA 4L9AA 2HIHA 1EVQA 4UHEA 2WHPA 4A16A 4FLEA 2V96A 4B80A 1EK1A 4OD0A 4ZRDA 2XI4A 4QZVA 5ISMA 4FFVA 5CMLA 4ARBA 3GUUA 3NWOA 1TCAA 3EQ9A 3E3AA 3V9AA 3FOBA 4FLMA 1XRRA 5JZ9A 1H2YA 3PFCA 4MXDA 4KE8A 5DWDA 1CQWA 2ZJ7A 3HSSA 5BOVA 5EIEA 1H2XA 2ZYHA 5HQ3B 2I03A 3PI6A 4S0XA 1GT6A 1JKMA 2I78A 3FCYA 2WUDA 3QH4A 3E4DA 1QFMA 3X3HA 2PL5A 3F97A 4MWSA 2NW6A 5CXUA 2HU7A 3B12A 2ONCA 3WL7A 4DMCA 1P0IA 2DQYA 1E8MA 1UKAA 2AJBA 3GBSA 5ALHA 2XUPA 1Y7IA 3EQ8A 3FYTA 3WKBA 4QDXA 1VA4A 1R50A 3DOHA 3ZPXA 1W52X 2X8BA 2CMFA 4FNMA 3A2LA 1YR2A 4OU5A 4U2EA 2RHTA 4MJ3A 3FCXA 1YASA 4X92A 1PFQA 4RGYA 3WA7A 5T4EA 1QLWA 5LIPA 2WIDA 4FBLA 2WU4A 3WKDA 1SCIA 3C6YA 4GHWA 3IVMA 1MNQA 3O4HA 2WJ3A 2Z8ZA 1R88A 1CUDA 1I6WA 3OURA 2HDWA 3R0VA 4L0CA 4BCBA 2XMBA
chains in the Genus database with same CATH superfamily
1QCDA 2QHXA 3AEZA 3DLAA 3IYLW 2W98A 1VFPA 1A8PA 3OLCX 1ODKA 1PSDA 3QI7A 5AKKA 4KDEA 2I6SA 2ZIWB 3A3NA 3AR5A 1OJLA 2HUPA 3I1YA 3OE1A 3Q1LA 4IINA 2V5VA 3LWDA 4QPPA 4Z3KA 1U02A 2PD6A 4ZI7A 1NJGA 1DUIA 2C8VA 3QWBA 5CA0B 1B1CA 3CJRA 1LBIA 1EXVA 4J0HA 4MYDA 2ZQ5A 1W88B 3HXTA 4G85A 5JS2A 3RAEC 4RQBA 2GEFA 3D81A 4KQHA 4UAJA 3ICEA 3RW9A 4UE2A 4Z4GA 2PFGA 2GPWA 2M98A 1E1KA 3M1YA 2O6LA 3HNOA 3KSAC 2UU9B 2NZYA 2PGJA 2VCYA 3ABZA 4H1VA 4M89A 4B6JA 5EMJA 1YBAA 3BXEA 1Q7GA 2YMQA 4RIEA 1I1OA 2P78A 1Y6RA 1Z2AA 1CJSA 3U44A 3K4HA 4EVRA 5A06A 1SVLA 1FBTA 3QLJA 3QVUA 3OWOA 4O08A 4DYVA 1FP1D 4JXXA 2VPPA 2XY4A 2WMDA 3GELA 5EEHA 2OXEA 5DBGA 5EP2A 4D4LA 2PSSA 4G97A 4W1RA 4W7SA 4X1IA 5AOCA 1HLGA 2XNDD 5L3VA 1G5IA 3EEYA 2ZM5A 3RJTA 1KEVA 1VLMA 1CG6A 4GMKA 2JD0A 3CB4A 4C4RA 5LMNB 5JANA 2ZBQA 1HFJA 4IKOA 3JVDA 3WSTA 4ZVVA 1CY7A 3E23A 1H23A 3AJ8A 3ANXA 4NOKA 3RROA 4QVIA 1F7UA 4P2GA 3D3NA 3WGNA 2C5HA 5PGMA 1X8LA 4FPXA 3ZKAA 2UUBB 4U8HA 2B3DA 4UTVA 4EG4A 1MX9A 1H0SA 3TBHA 1EE1A 1J0BA 2V7WA 2HJHA 1AUVA 3J80A 4PFKA 3PQCA 3PHCA 3VVLA 3AP2A 4EO4A 3GIDA 6AT1A 3HDYA 2COKA 4EI2A 1DARA 3LRTA 3EIWA 3JWHA 1IHOA 4MWTA 3JQFA 3GWZA 5EKDA 2WPDD 3HUEA 1Y4AE 3QKRB 1X14A 3VPAA 3LH5A 5FFMA 4Q1FA 1FP4A 4DLYA 4CKBA 1BG6A 4RKQA 4RMHA 4DLSA 2R68A 2NU9A 4YK7A 4TV8A 5TB5A 2HJSA 4BNZA 4MI1A 2HSZA 3WK9A 1LI7A 1UDAA 1JXQA 1QDEA 4B4WA 3DGEC 5CCBA 1SKYB 1ZKMA 5H0IA 1S2DA 3I6MA 5LBTA 1GPH1 3ENWA 4JEIA 2PZGA 4OB7A 1NXPA 5T3YA 4DG9A 2PBZA 1RCTE 3W04A 2ZIUB 3F5FA 4L4UA 4P3YA 1TUIA 4FFWA 2AOUB 1TUGA 3AOEC 2ODTX 2Z5VA 3QBJA 5SZKB 4QWMA 2O3JA 3PFGA 5JBNA 4QM6A 6Q21A 4RK0A 4LF8B 1H0RA 1R0RE 1X38A 3JQBC 1IVYA 3ISTA 2HMWA 4X6YA 4ZOEA 1HT1E 3CLTD 4IGFA 1FNSA 3BULA 2RDMA 1HZJA 4IICA 4G1FA 1IPHA 5TY0A 4Q7QA 5HJEA 2JEOA 1OXVA 2PT5A 1M2OA 2YYAA 4UU0A 2VK1A 4J75A 3AMVA 3FWPA 2XB6A 3IIMA 5BSUA 3VZDA 4A91A 4FZRA 1ISHA 1HETA 2DERA 4MCHA 4E7PA 2QSZA 3CFYA 3N59A 2SBTA 3QGMA 4Y30A 1NVWQ 2NYUA 3HDQA 1IJFA 2HZBA 3IAXA 2Y8EA 2IPLA 2VDKB 3LIPA 5F2OA 3I73A 4AUEA 3ROTA 3U6KA 5KNDA 1UPBA 2A9JA 4BO1A 4K0KB 4ZMRA 1GARA 4EVQA 2ZTMA 1ONBA 3NM6B 4TV9B 4YRRA 3G88A 4QDUA 3R3UA 5LA6A 4FOSA 4K9MA 3BL5A 4JBYA 3SG0A 2KLHA 2R7KA 5GJBA 1IPEA 1TT7A 1JA9A 2LGJA 3K2BA 3BDIA 5HS6A 4BLSA 3U6BA 1PFUA 2PO7A 1RC0A 3SK0A 5ELMA 2OO5A 2WOJA 1TM7E 3CW8X 3OOWA 4HDRB 4ONEA 1GGKA 3GJ8A 1N3BA 3HB5X 4J1TC 4NV0A 4RD1A 3T0FA 3RU9A 1IUNA 3FLAA 2CJFA 3OPVA 3RSOA 2ACKA 4ACAA 2YQ5A 5LQMA 2PE5A 4CF4A 1EX6A 2PYDA 5DBOA 3UUEA 3LGSA 1DKOA 1FMTA 2BISA 2CNWA 4FI3F 4GO1A 3WDKA 3DZDA 2RKBA 3DHNA 1PW7A 3CURA 1QGAA 2QMYA 3IALA 4UUPA 3RVMA 2Z8YM 3BKXA 3R0QA 2V3VA 2XUOA 4EENA 5J4YA 1ISMA 5DWVA 3PC8C 2H4ZA 3CSSA 4I55F 4DQUA 5JWOA 1ODSA 1U3UA 3GZNA 1C1XB 2D0IA 2XCLA 3UK0A 2RK4A 3D8UA 5JDCA 5JHGB 2JCXA 3AHDA 3F4KA 3OZAA 5JAIA 2ZS8A 3R09A 3UYKA 4XYLA 1CIPA 1D6JA 2R48A 3NHUA 4FR0A 4V0SA 3R9KA 3O74A 1LRJA 3KE8A 1J9ZA 1JEQB 1Z38A 2RH8A 1ZUD1 2DUUA 5ARDA 2DQZA 5DNWA 4AZVA 3OU2A 1Y42X 5J43A 5JH7B 4R8KA 5EJAA 1EA5A 2X9VA 1DEOA 2H7XA 2L19A 2XE7A 1LLQA 1NMXA 4ROTA 1RQNA 1OFTA 3EX7C 1TAHA 4X45A 1KERA 4ARUA 3T9AA 2FFHA 5K4GA 4FZ5A 1N36B 3U3JA 1U90A 2JIZD 2WV9A 2XB2A 2BD0A 3BHIA 3DLPX 5HBRA 5A4MS 2FB9A 4UZSA 4LGCA 2YZ7A 3AEKA 1BXZA 2JJ8A 3DKRA 3KQYA 3UV3A 4OY3A 4MYHA 2JLVA 4ZHQF 3R3VA 2GNOA 1SWWA 2YNMC 2VJKA 2RKOA 4MVJA 1G8PA 3UJ9A 5LUBA 3EXEA 4HN9A 3HC7A 2J9ZB 3L7AA 4H18A 1PG5A 3C3JA 5ERGB 3E1GA 1OI3A 2O2SA 2X19A 4J0EA 1JBEA 4ZP1A 5TMBA 3ZBUA 1SOWA 4TLCA 2PUGA 1O58A 1E77A 2VJNA 2YYSA 2C4WA 3JARB 5THKA 3CKLA 2PEYA 2JFVA 3OKAA 3CB2A 2RBKA 3OLQA 3W9UA 5A4KA 1CEYA 2G5TA 4LE1A 1CJTC 1KI2A 3AY6A 3T95A 4LFAB 1P1RA 2PUCA 1H1DA 4BNNA 1V5FA 3ELDA 4RENA 1YRAA 2V4MA 3OSUA 1MO6A 2E4ZA 2JEYA 1A8UA 1JUDA 3AXTA 4H9GA 4UPVA 4EJFA 2QTMA 4LOKA 4KPGA 4OQXA 3L7LA 4A1OA 3BCRA 1IUPA 2I1WA 5HFJA 4JIGA 2H17A 2R87A 1M1YE 1EWYA 3AVXA 2BFCB 3D8HA 2ZJ4A 5DTRA 2C42A 3NRCA 5EIFA 2XUQA 3CLSD 3IBCA 5A02A 5IRCD 1N6IA 3F9RA 1T91A 4MPJA 2WUFA 4ZQHA 4L5BA 5BRJA 2IYYA 4AJNA 4ZI7B 4N49A 1G0NA 5L45A 1M1UA 5F7ZA 2B8TA 1WSBA 4JH0A 4LOJA 5CFZA 3IEVA 3ADPA 1U3WA 1JGTA 5BURA 1EFPA 2VHCA 1XJCA 4ACBA 1NATA 1H8EA 1JZSA 3QTTA 5IU6A 4HFNA 2I8AA 3SC6A 4G07A 4FXPA 4AAYA 1DUVG 1LI5A 4IRXA 4NCXA 3V9PA 4DC1A 4L75A 1D4ZA 4P4SB 1RLUA 2NSJA 5TS3A 3W2EA 3HXMA 3I62A 5IAGA 4B74A 1DKLA 3E05A 2VRWA 1EP3B 2D2FA 3PFBA 5H82A 4XLLA 2PNJA 5CDTA 4EPVA 1A0OA 5ALZA 3ZJ4A 4TZ0A 2VYCA 4L0QA 5DBEX 3FI0A 4GEGA 3RD5A 4ZIRA 2HLNA 2QUJA 5HBGA 4N6NA 3TLEA 3U5ZB 5F1YA 3JQPA 1Y7TA 1I14A 5AVJA 1NRJB 4IOLA 1ECBA 2QUHA 3USZA 4IFEA 1H2RS 1N8NA 1QZ3A 4MIEA 1U04A 2XIQA 3EVZA 3K96A 4CEHA 1K68A 3SFTA 4FW8A 4JXZA 2XMCA 2FE4A 2HCBA 2MIIA 2HU2A 2OCAA 2C95A 4ZYVA 4IIGA 4NARA 4U6NA 2QW8A 2HRQA 4IHQA 3EHEA 4AKTA 1AZTA 2Q7OE 1TU4A 1C9DB 3DBHA 1B14A 2Q50A 3GJ4A 1D0SA 1TU0A 3HZRA 3ZY5A 4AS3A 2X2OA 4K9QA 5KTNA 1NQ5A 4AP6A 1FP4B 5IUJC 3W06A 5KYXA 2MYPA 2KS6A 2Y92A 3K0CA 5K3FB 4CKBB 1C81A 2YW9A 3JAWA 3OZIA 3GX1A 4TV8B 4KIGA 4LDJA 2NU9B 4JU9A 3FIJA 2Q2NA 1G9TA 2G7ZA 3FDZA 3LFUA 4QBIA 4Y3UA 5LD2C 1U8UA 2WD7A 4P8RA 3MQ2A 5CGZA 2EFCB 4KSYA 1GZ5A 3RVLA 1DTEA 4CN8A 4XFJA 2GN2A 1SMKA 5ALOA 3A1VA 3E4CA 1VPTA 3K1YA 1OTHA 1NQTA 2C3UA 3JQAA 5EIBD 1YT5A 1JG2A 1TZKA 4AZWA 2I9KA 3S1LA 2ZB3A 5AW8A 4AO6A 1GQRA 4MS1A 5IFLA 4TRJA 1FNMA 2II6A 3PIIA 4PVCA 5FO0A 2JK1A 5IBPA 5FTKA 1M6YA 1WP4A 2H4WA 1GU7A 1QHGA 5KSOA 5DTEA 1NUTA 1NSYA 4QDOA 5AI4A 5CDSA 2R6DA 4NYMQ 1NA5A 1M2OB 1L5FA 3EZ6A 3TOZA 1JHZA 1HG1A 4MQBA 1PK7A 4QRHA 2V6GA 1NUPA 2EV9A 4RVSA 3NHRA 5IKXA 1LBQA 2ALJA 2P27A 2P30A 1ZM2A 1BE0A 3BSYA 2BDUA 2WFAA 3WL6A 2A2ZA 1Z6PA 3EXHA 3OMLA 4IUCS 4UDYX 3SU8A 4DKXA 4DCUA 2A1UA 4XIJA 4F0JA 3KZXA 2Q4RA 5K5EA 3GPCA 1FU8A 1T5SA 3PA8A 4DQ0A 3H5WA 4KBFA 3GFVA 2WT9A 2C92A 3IMCA 5LA6B 4PYOA 3R7LA 1M2VA 3MWEA 4HH1A 1EIWA 3BMQA 2G36A 1H6AA 2O57A 5EHGA 5EY5B 4HGOA 4DADA 3S1SA 1NVKA 4GQAA 1EWQA 1P0MA 2DF8A 2K4MA 2OVBA 2VQ3A 2JFBA 1ZC3A 1NKVA 4DS3A 1JJIA 4ZYLA 2GXQA 2NZXA 3FOEC 2XOEA 3P2IA 5JOQA 2E49A 1KXZA 3F8SA 4RBNA 3W2HA 1AGNA 2OMKA 2IHUA 3I37X 4WSOA 4EYEA 1DG1G 3KTAA 4QOGA 1R4AA 3INRA 3ADOA 2CNNA 3M9WA 3W1WA 5B3JA 3WYDA 2ZYGA 1MW8X 1GA6A 3X1ZA 5H80A 4UM8B 4N41A 1JEOA 2JJ2A 1VJ5A 2VNAA 4YP0A 3GMIA 1BKSB 3GZNB 1GRNA 4FMDB 3I6QA 1EXMA 5AOBA 4EHDA 3S81A 5CIQA 5CW2A 3A0UA 4CCSA 4CUKA 1CKEA 4KWTA 2DRIA 1VYVA 2FOLA 2ZYWX 5EIOA 1C8LA 4Z0PA 1YUNA 2RAPA 4BFTA 4R71A 1GTRA 3ANSA 1T24A 1NOKA 1L5VA 2B98A 4NNJA 3GK3A 1QS0A 3SXJA 1GG8A 2Q1XA 3I0ZA 3WQSB 3H5OA 3GPLA 4IMIB 2UAGA 1KO4A 3A1NA 2DY1A 2BH9A 1I4TD 3LXMA 1WY5A 3BSWA 4LZLA 4OO3A 1AV6A 3OTIA 3EF0A 2Q2OA 1QIEA 1ESMA 3PNPA 3AZOA 3P9SA 3AR8A 4IF4A 2QU8A 2ZIZA 4NPAA 7MHTA 3R3YA 5GM1A 1YJCA 1JNXX 5DNDA 4B6QA 4PPFA 4Z51A 4R0MA 1PUJA 2CJWA 2Z30A 1J8QA 3MB8A 4PLGA 1QRSA 4CETA 3WMEA 4MX8A 5KWVA 1SIWA 3JRXA 4PSUA 3D0OA 3AEKB 1XWFA 5D01A 2EERA 2P1RA 1WMBA 4NDZA 4OSOA 4NEQA 3U1VA 1Y63A 3O1IC 1SA0A 5DULA 5DNAA 1C4XA 1OZGA 2ADMA 2PY6A 2AJCA 3FX2A 3SX0A 2OV2A 3GLTA 3HM9A 3N9IA 4MUAA 1DADA 5BRNA 1Z0UA 1Y5LA 1T9CA 2QYHA 1PJCA 3DXZA 4M1TA 1Z4OA 4D96A 1RXWA 2PMDA 2QT9A 4MVJH 821PA 2GCOA 2J3JA 5ITZB 1JJFA 2CFOA 4LZAA 4FYMA 3LUDA 1JIVA 4MUXA 5CJJA 4A8HA 4U9HS 4GM1A 4S05A 1XZBA 3B8HA 3NNSA 1FYVA 3NTUA 4CKXA 1GTSA 5I7UA 1A9TA 1P81A 3QXHA 1VE1A 5AW6A 2YHAA 4IO1A 2J4DA 3L4EA 1XU4A 2A58A 3QPDA 4OJQA 4QLOA 5FA8A 3U4HA 2B30A 3VR6H 1YQEA 2QLFA 5DGHA 3NV7A 5JS8A 3NALA 4YFVA 3CZPA 5C3MA 1E3IA 2LTAA 3GUZA 4OQYA 4ALNA 2WINI 4WNYA 3HVHA 3C24A 4H08A 5EE5B 3O4RA 3HCOA 2YWCA 3DHYA 3VU1A 1TTPB 1H5UA 2FJUA 1TAGA 4NNOA 4PU0A 3QMMA 4PZUA 5GV7A 1YRQA 2BGUA 2IU4A 4MW5A 3GVXA 5K0BA 1WD7A 3IPYA 1XBTA 5KNCD 1F8YA 1K5PA 4Z9FA 3CUUA 2C0PA 3EOBI 1O6FA 3GROA 1NF3A 1XZMA 3CO0S 4BX2A 5C53B 1QIKA 4B4KA 4E30A 1EFPB 1A3CA 2VS1A 1AQLA 4TMWA 2ZUBA 3BH0A 2BRUC 1R27A 1Z35A 1N7HA 3IUPA 3CH5A 3RASA 3AR4A 4MVYA 1B8NA 1JDZA 5KYNA 3N6XA 4TN1A 1ZSVA 5AIAA 3Q8KA 4ITRC 1GZ7A 4Z7OB 3O7MA 5F5XA 4ZIRB 3KSDO 5DGXA 1UL1X 4EMSA 3WGIA 3MLEA 4DJJA 4MQLA 2OXCA 4GKBA 3ZWQA 3RG2A 1NW7A 3D3JA 3K9WA 1JF8A 2D6FA 1UIRA 3RQSA 4ASUD 3L8FA 4L5JA 2IKQA 3H8VA 1LSUA 2G5PA 3G82C 4UXJA 5SYNA 4YIHA 4BE7B 5KQRA 2PM8A 1N7IA 3I6YA 4KLRA 4F1WA 2XAUA 1QFXA 4GKVA 2ZI4A 3DVSX 4CEHB 1CULC 4XYMA 3T7KA 2VJOA 3FOCA 3FTQA 4DLKA 1J9EA 1NUQA 2YUIA 1ESCA 4LZWA 4G9BA 2VRNA 3PFIA 1KAEA 2H9YA 2KI5A 5GOTA 4A8JC 3QUQA 4F4CA 3A1DA 1ZOOA 4EW2A 1VGQA 1W2WB 1KI9A 1C30A 2I7XA 3DBHB 3K8YA 1P72A 4IHAA 3QVKA 4BC1A 1O5IA 3SBEA 3PCRB 1OXUA 5HEKA 1R18A 4YMVA 3GLIE 5JYEA 2IW1A 1R0XA 5KYYA 3GLUA 3K6JA 4ZCIA 1YACA 3JAWB 4PC6A 1VCOA 4KITB 1WB9A 5EHIA 5JNVA 5ES3A 3FDZB 2DMRA 1IY0A 1VJCA 2WD7B 1N2CA 3U7FB 1NR5A 4G0WA 1PT5A 4KN8A 4LI3X 1Z07A 3WADA 1I2MA 4B3BA 1YTUA 3LT1A 3MT9A 3SQOA 2ZAIA 2YXNA 3D3KA 1WXEA 3AK4A 4W99A 4DPMA 1ZM4A 1S2NA 2M6LA 4BFLA 2FR8C 1KQ3A 1Z6AA 4US0R 2P35A 5DLYA 2P6UA 1DTWA 4DRZA 3VAZA 1VHQA 2ZWOA 1A2BA 1KYWA 3ADKA 4UHJA 1XYGA 4RD2A 1LSJA 4I4IA 5AJHA 1LBEA 5C8VA 2CFIA 2AN5A 2EQAA 1Z25A 2MMCA 4R9NA 3OX1A 4RPGA 4LHZA 1KDZA 3RSQA 3BB3A 4FK8A 4E1VA 1KKLA 1SC6A 2CFRA 5JXGA 1FDUA 2GO7A 2I6TA 3DO6A 4WVLA 1NQXA 1WMAA 4BRSA 3QY0A 4PPQA 1UWLA 5C1OA 1J00A 1BE6A 4GPD1 1KJ8A 4DMHA 1TT5A 1T3LA 3M2PA 4KMSA 3MIIA 3A4IA 2R4UA 3EXHB 2H52A 3D6HA 5EJFA 1J39A 1OBCA 1W8IA 2A1UB 4CDRA 2Q5HA 3DFUA 4LJRA 5T6BA 2HADA 1T1GA 1U3GA 4EVSA 1BE1A 1R4MA 2Q21A 4E88A 2ZS9A 1GADO 4JJKA 3VR5D 1M2VB 3MWEB 2IYEA 1E79D 4JDUA 4MV4A 5CT5A 5TGZA 5IC6A 1ORHA 1G2OA 2HA4A 2X0DA 4LF6B 3IUBA 3SBDA 2ZR9A 3V6LA 4CM1A 1R2QA 3UMMA 2W7TA 1JXAA 1PGJA 3I8SA 2ZT5A 3MTQA 4ZCSA 3B20A 3PQEA 3WRXC 4C0JA 1QNLA 4EA6A 1C3EA 1GPLA 1PT8A 1USKA 2FWAA 2MU1A 2PX5A 3B1JA 2QTHA 3OZCA 4IKEA 4ZDJA 1Z7EA 5FBQB 2REBA 3KTAB 1O1YA 4MWDA 1O97D 1A5ZA 1OIXA 1ZD9A 2FK7A 4MV9A 4OSEA 4GI7A 1IBKB 1I30A 5DU2A 4DCTA 5I48A 3WRYC 1KWKA 4EX6A 2WWYA 1XA4A 1TGVA 1EUDA 5LU8A 1RRMA 2H48A 3VX4A 3ZQ6A 5I9SA 2ZQYA 3K0EA 1P2UA 3IMEA 4PYIA 5JZMA 5AKIA 2Z4RA 3RVSA 1PNQA 5CLIA 1QGYA 4YRDA 1Y4ZA 2QVGA 4D9HA 1EESA 2GDZA 2FN9A 3ASYA 3QEMA 5HCNA 4IHKA 1IIRA 2Q6OA 3C3EA 4F8EA 4GZ3A 3O9MA 1ICEA 3DM5A 2XJ4A 4RK4A 3SYKA 5JO0A 2QTTA 3GEBA 1M0EA 2CWDA 4Q7MB 2QAGA 2R1VA 1J2JA 1LWOA 2BKLA 3AWIA 1QS0B 5DHUA 3CVOA 2G4LA 3R6DA 2B25A 4JC0A 4NSNA 3ZWNA 2QMHA 2X9LA 4TQUS 2NUAA 4YV2A 1ECLA 2YY5A 4LHWA 2GPBA 5AM0A 5CITA 3FAKA 5KAMA 5BV7A 4P33A 4TPKA 1CIJA 3GP3A 4II3A 4AD8A 4KQ6A 3V8VA 4C06A 1D5WA 1UP7A 2IT1A 2QOEA 4ZT6A 3QUBA 1MD9A 1GGJA 1P6QA 3UJAA 2I29A 2HFKA 1SBYA 4Z4FA 1KH3A 5A4AA 3RSZA 1D6NA 2CJWB 4BX3A 4WBNA 3V8BA 4O4HA 2OAEA 4M37A 2QRJA 3JVIA 5H16A 4R6WA 5FI3A 2RGAA 3T7AA 3OZUA 1ZGBA 4L95C 3MWFA 1KH1A 3A9TA 1PZHA 4YDSA 1PQ4A 1SA0B 3FHLA 2V5AA 3RM3A 3D59A 1QHIA 5E6RA 2GPTA 1L5KA 2RGXA 4NCHA 1E0DA 1E59A 2RH4A 1JAZA 4F71A 5C5EA 3OZWA 4TM7A 4D9BA 1COZA 3O95A 4ZZ3A 2WYUA 4FC7A 4UHDA 4I1SA 5JO9A 3N0XA 4QUGA 2VDLB 4BQPA 1ETHA 2QM7A 4B6GA 4Z2YA 5EIHA 4WK2B 3KQQA 4P83A 1Z4PX 1P73A 3SJUA 4KQWA 5KNBA 4GMXA 4L9WA 5E4TA 2GM9A 5LN1A 3W8NA 2IWHA 4DCJA 3DOIA 1KOJA 3ZJ5A 1YR1A 2IQ5A 1N5KA 4G5GA 4OAPA 3ANTA 4DC0A 1U0NA 4MGHA 1P18A 2XXBA 3IPAA 3LK7A 3M8KA 5TMDA 1SEPA 1UXKA 3RTBA 3W90A 1U4NA 5C5CA 1M1NA 2V74B 2ZXEA 4U0KA 4DQXA 1OX5A 4DPKA 3Q7EA 1KSJA 5FLYA 1XIVA 3GRYA 3PA6A 3BGVA 1AGPA 1QHHA 4LA4A 4X65B 1M7BA 5ETJA 2ZROA 1WV0A 5I9MA 2R6R1 4GYKA 2B1IA 3FZEA 2VA8A 3RKSA 2Y6UA 2BGLA 3KT6A 3NORA 5ALRA 4AY4A 3NLLA 3DE7X 4IMRA 2H2WA 1JR3E 1VPVA 2CBGA 2JF0A 5BR8B 2AW3A 3TCKA 1G8AA 2VPTA 4FYVA 4RHYA 2P2SA 3KPJA 4JENA 1QYIA 2DFKB 3EWAA 4JOQA 3VO2A 4DILA 4E5DA 5JSYA 1Q1QA 1V9CA 5AM5A 1B6SA 4RQUA 2QAJA 3RV3A 1RBYA 4FR2A 3TRFA 1ISJA 2PIAA 1XTQA 1R6XA 1Y48E 2O0HA 4P92A 5EFOA 4XM0A 5EQDA 4WXMA 3WMFA 4GI5A 4QNRA 8AT1A 3WR5A 3EIOA 4EH1A 3AUJB 5I9LA 1C9MA 3A6FA 4JQOA 3JX9A 5DP2A 1NXVA 3ZI0A 1HRDA 1TYBE 3DT9A 1R7RA 2QYSA 5CT4A 1T0IA 1P6XA 4MGKR 4JBHA 1SZDA 1E1NA 2VDVE 4N5MA 1H2WA 4KK3A 4AF8A 4ZVUA 4YEDA 5FBVB 1U2DC 5IAKA 1FYDA 4KE9A 5KSZA 4M0UA 4F5EA 4M1ZA 3L04A 1A7UA 1N77A 4FOTA 1UT6A 1BD3A 4NYIQ 1ESZA 4IIJA 1S2MA 3OPYA 3B6ZA 4RKWA 4OHPA 4RVFA 4YO8A 3LUCA 3WBFA 2FSHA 1C30B 2KBFA 2VEOA 3Q9UA 4M1QA 1GYPA 1UFOA 3LVBA 3MUEA 1HE5A 4QASA 1ULAA 4LHVA 5DH9A 2DWOA 1UXOA 3PJDA 5TT1A 1AN9A 3Q7SA 2JFQA 4XIYA 4G41A 4UNRA 3CX3A 2J3DA 3N87A 1C41A 1N1EA 5AVZA 4JELA 4Y6LA 5CH3A 1U3VA 4FEYA 1W44A 3LUHA 4GPEA 4BB9A 4HQKA 1N2CB 2Q0HA 1P6UA 4UE3S 1KJZA 4JI8B 4M3NA 4V3BA 5L6LB 2F48A 1QQBA 3NCTA 3D2CA 3V2GA 4U2FA 2RAFA 3WLHA 4ALJA 1DBQA 2PD3A 2XMSA 3M83A 1DTWB 2WU1A 2QN7A 3H1BA 3NEYA 3YASA 4C22A 1E1MA 3RDPA 3MINA 5IS2A 2A67A 3FVQA 4LY9A 1TA4A 1VMAA 4J1SA 4CG3A 4F38A 1VCNA 2W6MA 4IOMA 3HABA 3C74A 3P5BA 4RLQA 3N3BC 1O77A 5H4GA 3KTFA 1FYWA 1NRWA 4AYXA 4KUGA 1S7CA 1PFVA 4D41A 3COVA 2CEKA 2JGNA 1OH6A 2F1RA 3PHJA 4RTRA 1ZCAA 1NVVR 4FWBA 2ORVA 5K3DA 4EATA 1P4AA 1QJCA 2W2KA 4QYTA 1D4OA 2VP0A 1TT5B 1C3JA 4R31A 4X94A 2R8BA 2W83A 2WUWE 4RKRA 3VUFA 4TLMB 1RI2A 3EZ2A 4BFXA 1G8YA 1PUXA 1R4MB 1XP5A 2OESA 3T5CA 4F56A 1MA3A 1MC5A 3DZGA 4D3ZA 4M2LA 3VNSA 3HNPA 4KR2A 4F45A 1WPRA 2FMIA 3QU7A 5HKKD 3U7QA 3AETA 3C6XA 1MH9A 3H2JA 2FPRA 2H7CA 1V5GA 3BJIC 4FJ2A 1YI0A 4N65A 3AHHA 3OBIA 3U3DA 1J5PA 2P6NA 5JS1A 2BDEA 3OJFA 2CT8A 1CW2B 2J6CA 4HLUA 3MCTA 2PH5A 1SCUA 4I3GA 4UVEA 3TEMA 4CDMA 2WTEA 3CU5A 5CH5A 4CQMA 9LDBA 1N32B 4P9NA 3BFPA 3BD9A 1P7WA 4O4LF 1COWA 3ZS9A 1OX4A 3M49A 2BHSA 2G5GX 2EBWA 2X9GA 3ON5A 2PXXA 1EGQA 3QWHA 1JAYA 1IL0A 2F3TA 4DG8A 1IOVA 1BA3A 4JV5B 1NP7A 1FLAA 3ZDAA 1EUDB 4HCJA 1X7XA 1LLCA 2F9FA 3CYFA 3EA5A 3NUGA 1YB6A 3TKYA 4B3DA 1E2IA 2J41A 3GAZA 3LC7O 2ZSDA 4TVBA 5AM2A 4LJ9A 1A8HA 4CLEA 4FS3A 2I5PO 4W8HA 1RQ7A 3DAOA 3QEMB 3KXPA 2BMWA 4PCLA 1L1RA 3DZJA 2RONA 3HWRA 1A4UA 1A27A 4Q01A 1SKAA 2Q5QA 3GVIA 5B1YA 5ALSA 2QAGB 4A23A 4B09A 1QTQA 2MT9A 4U7WA 5CLQA 5KSWB 2EX4A 1DMRA 1WO8A 3N8NA 4JT9A 2NUAB 4L6CA 3CW2A 5F73A 5LDGA 3TW6A 4B45A 1ZHOA 4PS0A 4YCMA 1NW4A 3INNA 2EDCA 2Q4DA 3BF7A 1CUVA 2FX5A 4YAFA 6CHYA 1FFHA 2DKFA 3D6TB 4RTKA 5L4NA 4C0LA 1J25A 1WP9A 1XTSA 3WGLA 2FW0A 5LZ2A 3GNQA 4LWOA 2AOWA 4WBNB 3Q8LA 1C9NA 2W93A 3HV0A 4QHTA 4B4DA 4O4HB 3B3AA 2G88A 4WKPA 1CR1A 1H4TA 2M6RA 1QR6A 1WZUA 3DV2A 4XQCA 3TRJA 1XPRA 5IBCA 3W5AA 1NTRA 2CHUA 4KTTE 4IDGA 5BYKA 2KW5A 4XZ3A 5E6RB 4KQMA 4CR8A 1EWKA 2C4TA 3WYEA 1OZFA 3FPLA 4BDSA 2X86A 1XWIA 5TQJA 4KMRA 1TTHA 3PLAE 2FW8A 1MJNA 3LQ2A 3BMNA 1HH4A 3IVAA 3VNAA 1C7JA 2R65A 2QDKA 1I2CA 1WMFA 2XMZA 2P2CA 3ANYB 1Q3TA 3LM8A 1L3IA 4C78A 1CRLA 3RV4A 5A5DA 1SAYA 5TNXA 5CLJA 1ODCA 3RSSA 1U2GA 4IILA 4EGCB 4JLWA 1XEXA 3PFNA 3ZVLA 2HL6A 3LXRA 4RCYA 1GCIA 1YA6A 1KEUA 3M9LA 3T35A 3V4RA 1YBFA 3GFSA 4YALA 5CNJA 4AKGA 1SBCA 1EFAA 1M1NB 1PT6A 1WUHS 2O2YA 2P9GA 4PNPA 1F0KA 3UHPA 3VHQA 4LCBA 4MPRA 4RWZA 4DCCA 2HWKA 5BV1A 4C76A 3HH8A 5GQSA 2Z1MA 1QHHB 3U19A 3U0BA 4AK9A 1ITZA 1WKBA 2YIJA 1E1QA 1PJBA 1LPNA 4LI0A 2UUPA 3IS3A 4Z8YA 2KHZA 5GGXA 4BPBA 2OFXA 3O4FA 1VLQA 1TYAE 2GAOA 2DBZA 3UMRA 2R79A 1G20E 4Q5IA 3TM4A 3UFBA 4RK6A 1FUUA 3SXUA 1A4XA 1NUHA 2R6AA 2E87A 2OYRA 2QRPA 3OCCA 5B1DA 3T4XA 3JV7A 4DV0B 4H17A 5FBHA 1I4DD 3HYTA 3KSRA 3ZY2A 3HXPA 3IXMA 2ASVA 4IVNA 2XAAA 2OQIA 1DDOA 3MCUA 3HHPA 3BA1A 3CV3A 1I1NA 3IEIA 2P6OA 1E7WA 2JJ1D 4KQCA 3C2QA 3WTCA 5IM5A 4LF7B 2EJVA 3L0PA 1M10A 3RSGA 4AWAA 3ABSB 4G0NA 2Q3DA 1IRIA 4JLBA 3EZLA 3AFMA 4WECA 1QTNA 1KVRA 1RYFA 2AKYA 2CHEA 3DP7A 3O4GA 4FOOA 4NAUA 4XA8A 2VAMA 3ZWAA 5BUQA 1GNVA 1L4FA 1AHNA 4PNHA 2I4MA 2K2QB 4TQAA 1YR7A 1ZCFA 1OFGA 2G17A 4RZQA 5ILQA 1A97A 4URXR 5EJ9A 1IQPA 3G1UA 2XBMA 1SC9A 1ZD2P 3UWPA 1AG9A 1NJ8A 5JSHA 3IUSA 3IUYA 4WXHA 4TT3D 3KJIA 5CVUA 4KQKA 4N6OA 1PVOA 2RI0A 4IIJB 1PJZA 4YBZA 4ZGWA 1ZUNA 4R8MA 3OPYB 2A0YA 1Q7BA 2C00A 2I1LA 3E9QA 3LDHA 2PX8A 3UH0A 4AKHA 2MMGA 1GQOA 5DNCA 3CF2A 1X7ZA 3H8SA 2JASA 4OHVA 5C0OE 3EZ7A 3IBSA 3QLUA 4WFQA 5KQPA 2VDOB 2C2OA 5L6MB 4R1QA 3ROZA 1VYUA 1JIQA 4FFNA 1VHJA 1UP6A 2HEIA 4QGSA 1NLMA 1U2EA 4X8MA 3SHQA 1ZIOA 1ZD4A 2DUWA 4EUSA 3K6SA 3EAGA 5D5QA 2Q2VA 1WCYA 1K9VF 2YH2A 3W2GA 3EVDA 2YJ5A 2XTNA 1Q0PA 2CUNA 1DBPA 4GQBA 4FB4A 3A9VA 2JLBA 4N03A 3V8PA 4D43A 3RGWS 2ZZKA 4R4JA 5LM3A 4DWJA 3H1TA 1EWRA 3ETCA 4YRMA 1W5AA 4BRUA 3MN1A 3PXEA 1VLJA 2O2XA 4RVDA 4C4XA 1E5TA 5C8YF 2V0CA 5IXJA 2WWRA 2DP4E 1UPCA 4P4TA 4EFNA 4F9TA 3LT5A 3V1NA 1JIUA 3L7JA 3LAWA 3MINB 5CNIA 2E6KA 4BUJA 3COWA 2Q4EA 3B2NA 3D31A 1DKMA 4EHJA 2XT0A 2GF9A 4L07A 2ID7A 3DKIA 4X91A 1W30A 4OHOA 4CM4A 3DOEA 4TWJA 2HHCA 3MOGA 5AKEA 4HMOA 2QUKA 4V38A 2VHQA 4P4LA 1PSWA 1GPNA 1P61B 1MG0A 4TTRA 4RYDA 3SSNA 2YKGA 4Z4IA 2W2KB 4Y6SA 1K88A 3X2SA 5AUNB 1M8KA 3BCSA 2BKUA 3NOOA 3V46A 3SLRA 1GILA 3WV4A 4CMCA 5C1DA 1LNSA 2J0VA 1EXDA 3SJAA 5ALKA 2JFHA 3D7RA 3EMVA 4AURA 1NBMA 2QWXA 3DCYA 4OGKA 1KJQA 1UDRA 3FCEA 2UZ4A 4CG1A 3KD3A 1MG5A 2X23A 1MMFB 1GLGA 1JWAB 2YXPX 4X24A 3VPFA 4BB5A 4HDQB 5K9ZA 1WTCA 2IHKA 4OM8A 1HLPA 3CNEA 4I2NA 4YJFB 4YT2A 4QWWA 3L92A 3NDRA 1MOSA 1ZVQA 1Y3IA 4LKRA 4IR7A 4NHEA 1USVA 1CTQA 4DJ5X 2R751 1P2VA 5IKOA 3ESZA 2WF9A 1SCUB 1KEPA 1SM4A 3LA6A 2EJWA 1UBKS 2OAQ1 3DAPA 2WNSA 3FDXA 3HPQA 3LL4A 4L2IA 1L8LA 1F20A 2K87A 3H4IA 2BJHA 2C2GA 3KYCA 1OX4B 3NBAA 3UXYA 2VDNB 3BQ9A 2AVNA 1Q2XA 1AGXA 1PWZA 1QE0A 1YV9A 3DFFA 4ARCA 4RK1A 4BB0A 2YRFA 3O8CA 1X7XB 1QX4A 4EF4A 3UMSA 2ZZNA 1CRQA 1E6UA 4D4MA 1ZH8A 3L93A 2P0EA 2VZLA 4PHTA 4LPKA 5I7WA 3PRKE 1A82A 3BN3A 2WUEA 1XYVA 4FXOA 2J07A 5EE9A 4I1VA 1CUSA 3MMNA 4UEKA 5K0NA 1YU6A 4GOKA 3LBYA 4W5JA 3E7XA 1G4HA 1KJNA 1CZKA 3ESAA 3Q9LA 4RH1A 1AXEA 3ETDA 4OP3A 1G3UA 5AKHA 1LDBA 5FWAA 1KAOA 1QZUA 2VG8A 4YI5A 4OXQA 3UMCA 1L7QA 1SBQA 4QYMA 4OX9Y 5CXQA 3KOUA 5BMVA 4AWXA 2QTBA 2GD2A 4WLFA 1J8YF 1TGYA 4KH0A 1CX9B 2XNSA 2YJZA 3TTSA 4XWGA 3IMKA 3EYWA 2ZUVA 5JZBA 2PLFA 1MXFA 3VR2D 1JV2B 3IEUA 2W48A 3ZDRA 3SQMA 4K05A 4MGEA 1OX6A 2PKEA 2GBFA 3H83A 2EC5A 4HDCA 2FEAA 4URZR 3DE2X 2V4ZA 3B3QA 2Q1SA 3GJ5A 4XX1A 1T4BA 4QE3A 2CHGA 1CNEA 1C7FA 4MSUA 3TEFA 1LRKA 2YASA 3LW7A 4Y2RA 4EMUA 1B26A 1MVOA 2IF2A 4IIYA 2JGLA 4FZJA 4FSHA 1HXHA 3LPDA 1U65A 1CUIA 1VKRA 2IDKA 1BX0A 1KOLA 3SQWA 2PUAA 4MYUA 2H16A 3H5TA 3IV9A 3LTEA 3BMNB 3NC0C 4I36A 1Y3HA 4WLEA 4ZCRA 3AX6A 4FILA 1DHRA 1AT1A 1P0QA 4F86A 3U4MA 4W8GA 3O8NA 1PW5A 3SFZA 4B33A 5K20A 3B8EA 3V8NA 3TQFA 1KI4A 3QELA 3K8ZA 1FK8A 5CIWA 2FSVC 1WIWA 5AJVB 1XEXB 3LHFA 4MUEA 4OHXA 4QU0A 2AN9A 2Y1FA 3MIZA 4QOFA 5G1OA 5IF3A 1TQHA 4MI3A 4D99A 5KTRA 2H4XA 1TQ6A 1VP3A 2QRMA 1ZNYA 2XKJE 1PBTA 1U0LA 1C29B 2ZSBA 4UATA 4ZA2A 1YFKA 1Y1LA 1EAYA 3EMDA 5DE3A 2NVOA 4OH7A 1CS0A 1G7TA 1PR3A 3DYVA 5CCEA 3PF8A 4WOBA 3ESYA 4BNLA 2H59A 2QLBA 2DH5A 1IAQA 3KU1A 4QULA 1ZYUA 1SVSA 4IIUA 2D5CA 5B7QA 3H18A 2ATVA 4V0LA 3QITA 4NAHA 3ZHUA 1AUQA 3OTHA 4KEAA 1I6KA 1PG0A 4IMJB 4O4JA 2DPGA 2I2CA 1B8OA 1H69A 2C99A 2Y6VA 2P2YA 4NENA 4UHHA 3SXUB 5KTTA 5DCUA 5A5FA 1VBKA 3H6GA 1LNQA 2A9FA 3NFRA 3WHIA 2PX6A 3ND9A 1QVAA 3E8MA 4RXUA 3TM5A 2PTHA 4QUBA 1N0UA 3PR3A 4KJXA 5JAOA 4XDZA 2O9JA 2PWBA 3FPCA 3Q7PA 4K6CA 5C18A 2C61A 2GXAA 2X42A 4J4TA 4YJKA 1ZL0A 3R9WA 1FFBA 5IH3A 3TOCA 3CGGA 5BNIA 5KHLB 2ZCJA 2I6GA 4KO2S 1KJ9A 2LPMA 4TZKA 3ZV5A 5C37A 1WEHA 1ADCA 2OY0A 3OA2A 3T8YA 2PMFA 2ZYUX 3ZE9A 3ETGA 1DIOB 2A0FA 4TSKA 2H4FA 4YLGA 1WBDA 1ZI8A 3RWOA 4XM1A 2I4IA 3A3OA 4TMZA 3WK6A 3BWEA 5P8WA 4BE4A 3BWBA 4HSEA 4G0UA 4FKMA 4ER0A 2YMPA 3ESBA 3E35A 4R5MA 5M29A 5MN6A 3QUAA 2OQ2A 4C88A 3IOBA 4XPIA 3N0TA 1LKZA 1D0IA 4KVFA 4DHEA 2ZVQX 4P0TA 1SVUA 3ED5A 4FM9A 3I04A 1LFAA 1M1ZA 1VG8A 2PD4A 3C8MA 4CYMA 1X7ZB 5K01A 1I2AA 5JCOA 3HP1A 3KLMX 3FPEA 1KJYA 4PHFA 4J3FA 3KOZA 1X7WA 1RWPA 2TECE 4I1IA 5HP4A 1MHTA 1P9RA 5FD8A 1WUTA 4B0PA 5FAKA 1MO2A 2XQKA 3TSYA 2NADA 2PU7A 2OOSA 4FMCB 3K6SB 3O83A 4BMNA 1WTAA 1S9DA 4Q1AA 3PE6A 5T64A 1L4NA 2GSWA 3WGGA 4S12A 1E5QA 1Z08A 5B1EA 5LLTA 1V4NA 1UBUS 3KKQA 3LCRA 3W6ZA 3KEOA 1F4PA 2FWNA 3QNWA 4FN4A 1QYVA 2MSNA 1W85A 1V2HE 2ZJ8A 3OIGA 4LZJA 3RKUA 3ZHZA 3NRBA 2H57A 3LGAA 4Z9XA 1N0HA 1UZAA 4KG7A 3KVOA 4CU2A 1BFKA 2C4HA 3EG9A 1E2QA 2XLBA 4P35A 2GHRA 5C9ZA 5FPKA 4HXEB 4KR7A 1X1DA 1ND6A 2PXAA 5DEIA 2R9VA 2BKAA 2C3YA 1XCGB 2VPZA 2ZBEA 1INLA 4CM4B 1T6ZA 1XAIA 1RJEA 4RIFA 2OPHA 3PGMA 3Q0IA 4AJPA 1I2DA 3FSRA 4WA7A 3RLIA 2NNLD 4KK4A 3HZOA 3OX3A 1P9LA 3DLTA 4B4UA 1RFGE 2FDCA 1LQTA 3BHMA 1JFTA 4HAVA 4KI0A 4L08A 2ACEA 2F9MA 2F62A 4ZKEA 1NUAA 1D03A 1I3KA 4HLNA 5CVDA 4C2TA 4FYXA 2SECE 2G9RA 2XWBF 2EYUA 4HEQA 5HZGA 1MT0A 5I7AA 1HTBA 5AKJA 4QTTB 2GN1A 4BQNA 3T1YB 2GR9A 2B37A 4WRRA 2W37A 4WK6A 4P38A 4GMGA 3F3KA 3PDIB 2Z2ZA 4HP8A 3PF9A 1L5SA 5H02A 2Z5GA 3CUYA 2NPFA 5KI6A 2OXFA 4KXFB 1Q11A 4AS2A 5LZ4A 4AY2A 1SXHA 3IQXA 3EC7A 3REQB 2UUOA 2JFOA 2ONYA 1N0IA 3D3QA 3VR4H 3L4BC 3PFFA 3WHKA 4Q4HB 2AG8A 4L2IB 5DRTA 4JAVC 1BQEA 3IQFA 1OH7A 1G9SA 3BQMB 3IP8A 2KYRA 1DIAA 5M04A 1DOAA 1DAHA 5C80A 1KIAA 2O05A 2PMCA 1UXIA 2X4GA 2FGJA 5DM70 3A1CA 4FFMA 3ZXXA 5IZ4A 2BE7A 3N1UA 1DX9A 3QFFA 5FORA 4OQFA 3LCJA 1GZSA 2ODWA 1R12A 2VHJA 1D9ZA 1FFGA 4GSKA 4NFLA 2QRZA 3CF4G 4EZBA 2YV1A 2HMVA 3OLXA 1Z37A 2HU5A 3PGKA 3WXBA 3K6RA 1SOMA 2PZMA 3QRWA 4E5PA 4X54A 2D59A 5CR9A 2NUBA 3BZUA 1IM8A 2AFHE 4YCAA 4B7ZA 4EUKA 5BMVB 5C7IO 4XXHA 5K0ZA 1KDTA 3L0YA 5KAPA 4HNUA 4JUAA 1DHTA 2YV5A 3TAXA 1RIIA 3T7IA 4HDMA 2Y93A 4B40A 4D0LB 4GU5A 1IXSB 1L6IA 1EFVA 3ECCA 4GR9A 4HQFA 4NMXB 4AO7A 1E4YA 3KKEA 2O48X 4MICA 5AKZA 1A9ZA 3C8ZA 2YOGA 3TIGA 1CJMA 5EQJB 2OBXA 4D9FA 3QTLA 3P0FA 2ZWVA 4CR6A 1KGSA 5DDIP 1DWQA 4PYJA 3BRSA 2QTLA 2EKLA 4G5FA 3C6KA 4LUCA 4V0RA 3SX2A 5DXAA 5SZHB 2I54A 1KFBB 5JZVA 3N5CA 3L8YA 2O1SA 3R8XA 2BSXA 2EFGA 1SU6A 1WBJB 3NG1A 4MJLA 3CRRA 5GZ6A 4Y2PA 4CFYA 5KNDD 3FJOA 3TXXA 1NWCA 1OVMA 1T3TA 3IDSA 5TMEA 1Z68A 3T3GA 4V02A 2VNSA 1YS7A 1Q83A 4OGGA 2K2WA 5AK4A 3W4IA 3WLLA 3BRWD 5FI5A 2H7VA 1N8SA 1USWA 4QGAA 4RAQA 1CD5A 3OKFA 2H08A 4O02B 2F4NA 5DYIA 1XNHA 3X1WA 3QELB 2AEMA 1JVSA 1K66A 2WI8A 9GPBA 4CIBA 5DSXA 1P45A 5DIZA 2PUVA 4X1KA 5JIBA 2W4MA 3M2TA 3T54A 4XAQA 2D5AA 2J30A 1EB9A 2OEPA 3PI7A 4JJ8A 1N34B 5EE0A 3KYJB 1Q44A 4OXYA 3G9XA 5DW0A 4MVJM 1MAHA 4NOLA 1DG3A 2F9LA 4NVRA 3ZCRA 4LJ6A 4EY3A 1L7DA 3PUXA 5T3UA 2GXSA 3LYHA 1GDTA 3JTMA 3Q5DA 3VOSA 1KORA 1Z17A 4ZZ2A 3PCXA 4ZXPA 3C8DA 4NNPA 3M81A 3ITKA 4HDAA 2YRXA 1QYRA 1TX4B 1L4EA 2AIRA 2P5SA 2Z56A 4UKDA 3SNKA 4EPRA 2DFTA 3P32A 4PG4A 3S2IA 1VBFA 3K1TA 2FYTA 3GV0A 2XXAA 4JA0A 3I0MA 2NO9A 2KE5A 4KE7A 4JZYA 2GN0A 4C04A 3VSDA 4JJFA 4O4JB 2PSEA 4RHUA 4NENB 4LJLA 3KSBC 3TSOA 5KSYA 2CK3D 2CLCX 5ESDA 4KFTA 3NEAA 2HKIA 5CFLA 2Q6IA 2QDXA 1KVUA 1HC7A 4XQGA 1ADFA 1T2DA 2IUEA 2ZETA 3C8UA 3GT0A 4DSUA 4BBZA 3MJEA 4NHOA 4WY8A 3FRHA 4Q3LA 3GLFA 2QN9A 1YC2A 4MTLA 4CODB 3OKPA 1GAJA 3DTNA 1VRVA 4EHIA 1W5FA 1KU6A 4Y2TA 5JFOA 4MKZA 5F3DA 2DOKA 3GRCA 4B3IA 1K0FA 4TLDA 1LNZA 3R7AA 3AW9A 3E1KA 1LTKA 4KQJA 1J21A 1GL6A 1JPJA 1L7AA 3MUOA 3TB4A 4LYHA 3TXYA 3ZTYA 4B71A 4ZT7A 4Z0HO 2V5UA 4YXFA 4REQA 2I6XA 4AFNA 1NGSA 1T5DX 1VI6A 4W9RA 2EX0A 1RIFA 1UMKA 2AN3A 2PSHA 5BW8A 2PUTA 1BHQ1 1EDEA 4H7KA 5EAIA 3K2QA 1TMOA 1QNFA 1XQ1A 1Y9DA 2PLNA 3HKBA 5DBFA 5SY4A 5IJXA 4EHNA 4HWRA 5MGBA 3DCNA 1AKQA 4D42A 1NU8A 3L0IB 5E0KB 5K3EA 4V0NA 1VMEA 1ECCA 4C4ZA 3U3KA 4YRBA 1VB5A 4GX2A 3TX6A 2X14A 2DYKA 5ALIA 3PX7A 3GLKA 3OJCA 3SHTA 4A6EA 2AFIA 4ZAVA 5G0TA 5MGNA 3KKPA 2B4YA 1THZA 1ZEJA 2O1EA 3LVFO 3L0SA 4MYCA 2OV6A 4DIEA 1KOGA 3LWZA 1X7WB 4HFJA 5FR1A 3NBYC 2V58A 4I5GA 1J90A 4IJMA 4L85A 3W6NA 2C9CA 3SPXA 4ER5A 3T3NA 2CXNA 2HK6A 1YXMA 2LVBA 5KVSA 4BVKA 1BDBA 2W2TA 1BROA 1FTWA 3ZU3A 5FPHA 2QTRA 1GSHA 1RRCA 4ZWNA 2CXOA 1IN6A 4W5TA 3S8MA 1W85B 4H59A 1WXWA 1DQSA 2NM0A 2F64A 4HAYA 3PWZA 5AQ1A 2ZAMA 3G23A 3G2MA 1ISRA 4YDRA 1E2GA 3EG9B 3CZ9A 5DK6A 3AUAA 3V2UA 3PYXA 1ECFA 1B6RA 5UKDA 1UM8A 4A9AA 4EZEA 2IHNA 3V4LA 2HPAA 3EIUA 2IOFK 3EGOA 2CKDA 5THQA 3U4GA 1QO7A 4X7BA 4DNXA 1LY1A 4CV3A 2IYAA 4WLOA 5F7JA 2JATA 2VHZA 2HK8A 1H8ED 2WLSA 4BWVA 3MSXA 2JLXA 2JVIA 4Y6RA 2Z6QA 1QU3A 1YBMA 2NV0A 1S1MA 3V33A 4BWGA 2WG1A 1ML4A 1N2XA 2O8VA 2WIAA 4RHXA 3V4ZA 3AVYA 2MSKA 1AUOA 2A4MA 3GBPA 2XGMA 1F38A 5ECGC 5TXGA 2W6OA 2WM9B 1EP9A 4N8SA 4OYYA 1C1HA 3BJMA 3I58A 2X3YA 5IVPA 3WKCA 4EVIA 3ENKA 4JVLA 4MINA 2AXNA 5ENDA 3QG5A 3KSZO 1I2ZA 1WMEA 2BCEA 4MUGA 3O90A 5ER6A 5H7XA 2VRCD 5AW4A 5BSGA 3MMPA 1OU0A 1X1EA 1Z4QA 2CF5A 3G0CA 3DLIA 3KOXA 4W5RA 4PRKA 1FFYA 1NZJA 4G84A 1U28C 4RS3A 1OYVA 3DQQA 4MA0A 1JA0A 1FP7A 1JYFA 1N6NA 1E63A 1UXHA 3QLEA 2FFBA 2PCLA 3A1TA 1U0GA 1KKMA 1M34E 2Q1YA 3IBYA 3LKBA 3KG2A 3DTTA 1E3EA 1CQJA 3ZWWA 3WNZA 3QPCA 4QO7A 5CA1B 3C7DB 4ILKA 4DW8A 1ID1A 1BXRA 2G83A 4MVJG 4RJKA 1CEXA 4ZI7F 1CY0A 2EKDA 2BFDA 2IKSA 4M9SA 4NU5A 4JR1A 5AVVA 4PLYA 1RRVA 1KZGB 2OAGA 1PL7A 2ZBDA 3GFQA 2HIAA 5C5DA 3I83A 3B6JA 1CQPA 2XYGA 1UKCA 3BE8A 1RKBA 3R4CA 2W6ZA 2VHTA 3KZVA 5D85A 3SEQA 3GRRA 2OP1A 4K5QA 3C6BA 1TRKA 3CVXA 1NHWA 4FR5A 4TX1A 5CDYA 2REOA 2UXCB 2WIGA 4G5QA 1MBZA 1WZ2A 3DUFA 4R1SA 2QZZA 1XPJA 3HLKA 3V7WA 4NFHA 4HRAA 4IQ4A 3JQAD 1TQDA 2WKRA 1ZUHA 1RKVA 2AXPA 3GAFA 2DUJA 2JGAA 3CXUA 5DZSA 4E1BA 4C7OA 1RM3A 1YR6A 1TMYA 3DHEA 2HGSA 4HDMB 5AKLA 3RB8A 3V2HA 1S3GA 1EK6A 3PICA 4MRNA 2R85A 1EFTA 3ORYA 1Y8AA 3UCFA 4K3VA 3D7MA 5MHTA 1RT9A 3DNFA 3ZGOA 2E4XA 3TNJA 4RCZA 1NPTO 1YZNA 1NY5A 1G2PA 2B9VA 2J9RA 3H5NA 1GFZA 4MQ6A 3RUCA 3VR3D 1QIDA 2C4VA 3ZX4A 3QX3A 1T2EA 4JYCA 1ZRMA 1PBNA 2QL9A 4C3ZA 4EHHA 4KU4A 3JSXA 3KJEA 4ICIA 3HCBA 5FX2A 4RJIA 2RG1A 2Z43A 3L1IA 1OWOA 5G4KA 3GP5A 1C3LA 1UC8A 5F23A 1GKLA 1QE3A 2MHCA 1DZIA 1H9BA 4CF3A 1KXJA 4U5XA 5EHNA 3TLXA 2Q1UA 1H5QA 2Z95A 1KQFA 4MVJP 2IHZA 3ZK7A 4U0JA 1JLSA 1JZQA 3KSUA 4LZZA 3LG2A 2VZ9A 4M8IA 1KU0A 4P3XA 4QAQA 2HIMA 3CLTC 3T99A 3CVWA 2H31A 1MJFA 2N75A 2PGAA 3QOYA 1VE6A 3R6GA 4FQ8A 4GYJA 5EXEA 1I01A 5HMMA 4DLVA 4BLWA 2FE1A 5HQ3A 3AJ9A 1Z4LA 2X22A 4TXHA 5E6UA 4BNJA 3IRUA 4YCDA 4GLJA 1Y9EA 4NV3A 3VH2A 2ZT8A 1MH1A 3UUWA 4X1KB 2WTAA 3BS4A 1O4VA 3DWFA 2RAVA 3ML1A 1H5NA 4JOBA 4KQ9A 5C52B 1SKMA 4P0QB 2IVZA 5DASA 4EEXA 1FRZA 3NHSA 3EYAA 4HXYA 2G1UA 3F98A 1KOFA 1VDZA 2VNJA 1K8YB 3I01A 4MS4B 3KETA 2J0SA 4DBLE 3SSAA 3HP4A 3K1AA 3NBMA 1Q3HA 1F4VA 1HT3A 3H3JA 4GFDA 5K8JB 1NV9A 3IO3A 2QI9C 4HWSA 1P2GA 3STUA 4MRPA 5CXSA 1NYLA 5JY6A 3H2YA 3NHJA 1I3MA 1RKQA 2JJ2D 3G6KA 2YUTA 1V95A 1XOIA 4HAWA 5EJ2A 3T12A 2BE9A 2JGEA 1JU9A 3GH3A 4FZ3A 2XXAB 5BN3A 5FPSA 2V9CA 3GFGA 1XMPA 1YUMA 2GPSA 1YS9A 3KUDA 3PC3A 3BFJA 3M4NA 3FTFA 3P4UA 2O0JA 4B9AA 5BPHA 3TGPA 3HFRA 1P1JA 4Q12A 2PT6A 3BBLA 1GZVA 3Q9NA 2C9MA 4ZN6A 4Y1RA 3FLMA 4FFPA 2G8NA 4KREA 3GLFB 4R3WA 4YP5A 4BNMA 2VTVA 3W1EA 4LVNA 1B8UA 5JS6A 3GY0A 4Q1CA 4Q3DA 3TX2A 621PA 1TEZA 3PJRA 4HAUA 3VOTA 4FSXA 4NY1A 1R9JA 2PZEA 1YD7A 2G5CA 4HMQA 5LA6F 4A7PA 3NNDA 1PR0A 4GZ6A 3V7NA 4BKQA 3JWGA 5HW0A 2HLPA 1K92A 2DHEA 2GCEA 4PZYA 3OJ0A 3HTXA 2C4NA 4REQB 4J0CA 1J49A 2QPTA 1GVHA 4KV9A 4D3DA 5KS2A 3D5EA 1ISSA 2A9QA 3ZWCA 5I3CA 2MJLA 2XTAA 3L06A 4IDFA 3ZVNA 3RUAA 1AF7A 3FYSA 1OAKA 3OT5A 1LD3A 5T4FA 5AK6A 1FC0A 4S2UA 3FN4A 3S1AB 2JLCA 1I94B 4AMVA 3D4PA 3LHSA 3OM0A 3FDIA 2GHQA 1ZLYA 2DHQA 2XMQA 1U7DA 2HA3A 3OM9A 4F3YA 3FSGA 5L3ZA 5AUPB 1MJHA 2AFIB 4KIJA 3OE5A 1OYYA 1VPEA 2RARA 3RS2A 2ILVA 3AJRA 4FMDF 3NONA 1B0PA 3B7GA 3EE6A 1IBLB 5B55A 4XB6B 4E5UA 1CF4A 4OPMA 3X1KA 3V3TA 2XGSA 3C14C 2WWVD 4UMVA 4D9IA 4F5DA 1HDOA 8MHTA 1DWUA 1F60A 3I6BA 2IY9A 3GUCA 1LZLA 3KO8A 1CEEA 4JJEA 5HMLA 3REGA 1V71A 4ZAFA 4DEVA 3E58A 1H3FA 2FSFA 2VSOA 3AUFA 3ENVA 2AKAB 4U7PB 5D87A 3TYXA 3HBNA 3QUCA 5ULLA 4F5WA 2WWXA 4R1LA 4B82A 4MKIA 3FZNA 1P1BA 3PWSA 2VR1A 1N4AA 3DR3A 3A6PC 3ASZA 3D7NA 4IM7A 3E9RA 4HB4A 2EWWA 3UK2A 1VZ3A 3ZOKA 3EBPA 5HZMA 5AHOA 4HYTA 3EF3A 4F4FA 5LP6F 4I4TA 2IH5A 4OI0A 5EP3A 5TR9A 2RHDA 1O7JA 4TMKA 2Y4OA 3ZIDA 2HHHB 3EQ7A 1L4KA 1V6AA 3UHFA 4LCJA 4F4HA 3V80A 1UQTA 1KMCA 2CCKA 4TZTA 1SUPA 4LSMA 4RJJA 2JLAA 1YI1A 3TH5A 4E07A 3O3MB 2RHCA 4YRPA 3EIEA 1VE3A 3I2JA 4XGNA 1NVTA 2DSNA 2EGUA 1QRDA 4YRFA 5FTJA 3M6UA 1UDXA 5AOAA 2BGNA 2A9KA 1KQPA 2P2NA 2OHIA 4YBRA 5GMOA 1ORWA 4O63O 2KQUA 3RFTA 1L4GA 5JCXA 1OC2A 3CPEA 4OATA 5IM4A 3QJ5A 5F76A 3NKFA 1U0EA 3IXQA 4DL9A 1AX9A 2C2MA 2D5LA 1EQUA 1WF3A 2D2XA 5AT1A 2WTMA 1K8RA 4A0QA 4WJZA 1F2UA 3KVRA 5DN6A 4NJMA 3PNMA 5C7OO 5K0GA 3G0BA 3AZPA 1GG9A 3GCXA 1Z62A 1FX1A 1T3ZA 1JI0A 2J4CA 1CQJB 2VPIA 3RFUA 1DX4A 3TTTA 1CZHA 3PDUA 5EJ8A 5HZKA 2BBTA 3E7FA 2Y71A 1BXRB 2ECFA 2FUG6 2QJRA 1SZCA 1QB7A 2GM5A 4KGVA 4P4UA 4X20A 1M74A 5IBRA 3V7FA 1EH5A 2BFDB 2W58A 1V3TA 3G2IA 5AHRA 2VUSA 3K0CC 3P9YA 1KR2A 3VSBA 3C6QA 5D51S 3KD2A 4BFCA 4HO1X 3EC1A 4NL4H 3FGOA 3RCBA 3S7ZA 4WZAA 1Y8RA 1JR3A 3A6DA 3AUSA 2NPIA 4FW9A 1EVQA 1UC5B 3G85A 1P4SA 3IOCA 3MJHA 1DOZA 4IV5A 4M1MA 1LJ8A 4Q9HA 4EOGA 4JB8A 9MHTA 1Y6ZA 4R8SA 2O7NA 4KOAA 2AMVA 2FCAA 3KIPA 5GIOE 3DUFB 1CY4A 4A16A 3I4CA 4BGIA 4B80A 1OC4A 1UZLA 2FZ4A 1W36B 3N8GA 5E8JA 4C7OB 1U8ZA 2ISCA 2QLTA 2Z6VA 2MSLA 4ZRDA 3UAYA 1A98A 3PEUA 2FFAA 1SVWA 4QZVA 5IX8A 1KTIA 2EXXA 4RORA 1JJ7A 4BQEA 2G71A 2YX1A 3QUTA 2IHJA 4YQEA 4HNAA 3WLQA 1UKYA 4C0WA 4TTIA 5BSEA 5ISMA 4FFVA 1ZGHA 4MW7A 1S7GA 4W5NA 2NU6A 3PEVA 2CB0A 1HMPA 1USGA 2J6HA 3HU3A 4QNMA 1KIMA 3NHZA 4Q1EA 1XCPA 3SIWA 4ENVA 5L3SA 5J1SB 3QEBZ 5J47A 3BZBA 2AF4C 4OMFG 5KYGA 5CMLA 2Q5OA 5G4KB 2TMGA 1BKYA 1OYOA 2J1LA 3R6WA 4ARBA 3Q41A 4KXLA 3V9AA 3ZYCA 2QLNA 2B21A 3KDSE 4U6QA 2QZJA 3LTNC 3I23A 1RTKA 1JLMA 3AI3A 1Y33E 4NESA 1JILA 2H06A 3N2KA 5KB3A 4IWXA 4KE8A 4I9HA 5IC4A 3H9JA 4NBSA 1H42A 3AHEA 5IN4A 2Q6LA 3UFXA 3TBFA 2E18A 1H2XA 4HNRA 1FTYA 5HQ3B 2P3SA 5E6UB 4KDRA 4HBZA 9LDTA 3V1UA 4BRWA 1Z88A 1SC1A 4YRQA 3ET4A 2REQA 3BK1A 3JYPA 3R77A 3E9NA 2CF6A 5ED0A 1P1CA 1BKDR 3IP5A 4NP6A 4OFZA 2ZE6A 4J94A 4MW9A 3SDSA 2CFCA 3L8EA 1EVKA 3UJBA 1ZISA 1UH5A 1OY1A 4X7RA 3K1AB 4EYSA 1KJJA 2JLYA 4HNVA 1HDGO 3IC5A 5KJEA 3AOEA 3EDQA 1SB8A 3F7TA 4FFSA 4LMRA 1YZLA 1LLUA 9ATCA 3G3EA 1RHKA 4ND1A 2Q0SA 4XVRA 1FVFA 4BUCA 2XR1A 4MLPA 2ONCA 5EJ7A 2GILA 3JQBA 1A1VA 1FMLA 1NNI1 3K05A 4NBTA 3DDOA 3B52X 3ELUA 2DQYA 3CVYA 1FNDA 2AQIA 1WPQA 5BN3B 4TL8A 4GAEA 4N0PA 2EW8A 5TVKA 2GA8A 5BXYA 1WU8A 2XOKA 3QLVC 3GBSA 3ZWDA 4LWQA 4XWOA 3DMHA