3C6QA

Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
305
structure length
305
Chain Sequence
MLTIGVIGKSVHPYWSQVEQGVKAAGKALGVDTKFFVPQKCDINAQLQMLESFIAEGVNGIAIAPSDPTAVIPTIKKALEMGIPVVTLDTDSPDSGRYVYIGTDNYQAGYTAGLIMKELLGGKGKVVIGTGSLTAMNSLQRIQGFKDAIKDSEIEIVDILNDCEDGARAVSLAEAALNAHPDLDAFFGVYAYNGPAQALVVKNAGKVGKVKIVCFDTTPDILQYVKEGVIQATMGQRPYMMGYLSVTVLYLMNKIGVQNTLMMLPKVKVDGKVDYVIDTGVDVVTPENLDEYLKKMEELGIPIKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Open to closed transition of a thermophilic glucose binding protein
rcsb
source organism Thermotoga maritima
molecule tags Sugar binding protein
molecule keywords Sugar ABC transporter, periplasmic sugar-binding protein
total genus 108
structure length 305
sequence length 305
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c6qA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c6qA01
1DCKA 4OBBA 4KRFA 1PUXA 3TX6A 3H6GA 4D6YA 2LP4Y 3GBVA 1DJMA 4OLBA 2FEWB 2E4UA 3O75A 2CD7A 4DADA 1DG9A 3A0RB 3CTPA 2PL9A 4EY3A 2JVIA 4EYGA 4O1HA 3KJXA 1T34A 2HQRA 3N75A 4WWHA 3M9WA 3BRQA 4YV7A 1EWVA 3OLYA 3EAFA 1U04A 2A9QA 1DC8A 2FEKA 1A2OA 4RKQA 4RK1A 3OQNA 3SQNA 2X7XA 3HV2A 3H5IA 4KQCA 3QLUA 4MS1B 4KFCA 4RS3A 1KGSA 1NATA 4H3HB 4D6XA 2ID7A 2PUCA 2QW1A 3I45A 2R47A 1IIBA 3IP7A 3SAJA 5JNSA 1B00A 3OO1A 3D8UA 2E4XA 4ZMRA 3T8YA 2LBPA 4EUKA 5HQJA 1NXOA 3HVRA 1J56A 3JVDA 4KNYA 1D1PA 4OTZA 1XHFA 2FTKE 2P4UA 3SM9A 1HEYA 4RK5A 5TE9A 3ROTA 1JFTA 1CEYA 4GNRA 4TLLB 3KYIB 1DBWA 1L5ZA 5C5EA 2IKSA 2NZVG 2GWRA 4Q7EA 3MA0A 4G86A 2FMFA 4TMYA 1M5TA 1Z25A 4MR9A 1Z17A 3DLHA 1YK1A 2FKAA 4HYEA 4LX8A 3O74A 1ZN2A 2IYNA 5EWJA 3HO1A 1EAYA 3FFWA 5CNKA 3NNSA 3MIZA 1JH9A 5I4CA 1DP4A 4MQFB 1PHRA 1MB0A 4JP1A 2JB9A 3F6PA 4LE1A 6CHYA 1VRVA 2IOYA 4F8JA 4MS4B 4WXMA 1JX6A 3LUJA 3GT7A 1LBHA 3C97A 1DRJA 3HCWA 3KYJB 4IMIB 1MVOA 1P6QA 1RZRD 1ZH4A 3BBLA 3CLKA 1GUDA 3HUUA 4G97A 4RXMA 3OMXA 1BDJA 3EGCA 4LDZA 3OO0A 2QXYA 3EQ2A 1E6MA 3I42A 4QYWA 4RSMA 4G0QA 2IPMA 5IUJC 6ABPA 1DRKA 1YTUA 2FQYA 3KSMA 2H3HA 3NNDA 4DN6A 3NNNA 4XLTA 5FWXA 3HUTA 3LKVA 4MRMB 2MYUA 3BILA 2E4ZA 1ZESA 7ABPA 1KRWA 3EULA 2YHAA 1DC7A 1GCAA 3CKMA 4P98A 5TPWB 1SXIA 3OLZA 5TQ0B 4FE7A 3N6VA 2QU7A 4KREA 2AYZA 1Z26A 2PJUA 4QYMA 1RXIA 3KKEA 4Z4FA 2WJAA 4YLEA 5JNTA 4RK7A 1ABFA 4LE2A 1BAPA 1LJLA 4RWEA 1E6LA 4HNQA 1ZAYA 1ZVVA 3P9YA 4FE4A 4KMRA 1UDRA 5ED4A 1NXWA 3LUDA 4QPJC 2FVYA 5CNIA 3TB6A 2GI4A 2XDYA 5TPWA 4KZKA 3OLVA 4KVFA 3H5WA 1JDNA 2JBAB 1QP4A 2RJOA 3EODA 4PYRA 5T3YA 1P8AA 4MR8A 1RXEA 2B1JA 1JFVA 3DZDA 5B3JC 4LDAA 5KQMA 2FEPA 5TQJA 2P9HA 1QO0D 4Z4GA 5IEJA 2WRZA 3JS5A 4Z0NA 1SRRA 3Q7RA 2QSJA 3Q7SA 3QLTA 1TJYA 3F6CA 4RU1A 4EVQA 1NXTA 3RVMA 3EDCA 3CU5A 3KLNA 3O2QB 1JFSA 3IP5A 3OQOA 2J48A 4YO7A 2F8TA 3HDVA 1SXGA 3LUCA 5KI6A 2KYRA 2HQOA 2JRLA 3G1WA 1F51E 1VPWA 3FMVA 1U2PA 3TO5A 3L49A 2MSWA 2QV0A 3DGFC 5DKFA 2JBAA 4QICA 1YMUA 1XWWA 5DLEA 4G0OA 2WJWA 1FFGA 1NXVA 3E61A 5FWXB 2JK1A 3KHTA 1GUBA 3L6UA 3CNBA 5JNRA 3LUFA 3IDOA 1Z18A 3M6MD 3HEBA 1TVMA 2B4AA 3ILYA 2GX6A 3KCNA 1W25A 3C3KA 4L85A 1DBQA 3JPWA 4YRZA 3RVPA 3RVJA 4WZZA 4WUTA 2TMYA 3N0RA 1USGA 4LZLA 3LMKA 4N76A 5DTEA 1M5UA 1PEYA 2O20A 5DGCA 1YIOA 2RGYA 1TLFA 1QO0A 4Z9AA 3NHZA 1QP7A 1DBPA 3R0JA 3UUGA 2FMKA 4RK6A 2VYCA 4E7PA 1ZITA 4PE5B 4RY8A 4XXHA 2PUDA 3DLBA 2FW0A 2YHBA 5EWMA 4NV3A 5TPZA 5C5CA 3HM9A 5FWYA 4OATA 1NXSA 3CG0A 1QQBA 2PL1A 4W5NA 2LUOA 3MQ4A 4D74A 4IF4A 2HJ9A 3C3MA 2CHEA 4KQ9A 3NHMA 2W42A 3T38A 1ISRA 4MGEA 3BREA 5KQGA 2A9RA 2IDMA 3QK7A 5JS2A 3IP6A 4MR7A 1U0SY 2A9OA 2GKGA 3CFYA 1KMIY 1QMPA 1K68A 4MAAA 5KQPA 2FMIA 3KS9A 3KTOA 4EYOA 2PUFA 5KC8A 1YMVA 2FQWA 1QNLA 2F8SA 3A0UA 3O2JA 4EYKA 1ZDMA 1C4WA 9ABPA 1QKKA 3OLWA 2OQRA 1JBEA 1TMYA 2IPNA 4Z9BA 5IEBA 1D1QA 1Y1LA 3ROFA 3E3MA 3CZ5A 3HK2A 3H1FA 2L2QA 1LJUA 3RQIA 3SNKA 4UHJA 5GOTA 4NICA 4G0XA 3I09A 3GL9A 4MS4A 1ISSA 5FWYB 1Z2EA 3Q41A 2CHFA 3KLOA 2VUHB 3QEKA 3OM0A 4G0ZA 1S8NA 5D2CA 3N8IA 2HQBA 3DGEC 4KK4A 1RPJA 5IULC 2GBPA 1FSPA 1A0OA 2L19A 1VKRA 3RVSA 4JB0A 1Z12A 4OG2A 2MSKA 5BRAA 1EHCA 1APBA 2I6FA 1H9CA 4CBVA 4YCSA 4MS1A 1Z2DA 2L17A 5JNVA 3H1GA 5IUKC 1E6KA 5IUNC 3A3KA 1I3CA 4RXTA 5GQSA 4LRQA 4EGSA 1JYEA 1L5YA 3MF4A 4S05A 4TLMB 4EYQA 4F3TA 4MYRA 2FLWA 1RZRA 2R48A 4G0PA 2NT3A 1E2BA 4ML3A 3UK0A 8ABPA 1LBIA 1Z13A 2QR3A 2LIVA 5IBQA 2PKXA 3O1HB 4MQEB 3QLUC 4Z4EA 3MYYA 5HKOA 1MIHA 2JVJA 3EQZA 3IPCA 3HZHA 4MR9B 5JNUA 4O5AA 1FQWA 3K4HA 2Q5CA 5TQ0A 2ZWMA 5BQ3A 4W5QA 5TPZD 1CYEA 4IGAA 1AB6A 1W9HA 3RH0A 3RVRA 1OXKB 4MLCA 2FSPA 4YGXB 1URPA 2ID9A 3A10A 4RV5A 5CHYA 1ZGZA 1C0EA 5KWSA 2MYNA 4ZMSA 3H5TA 4MQFA 1RNLA 1USIA 3H6HA 4H60A 3FGZA 3GBPA 3RVOA 2AYXA 4HNRA 1ZHHA 5BR1A 4RK0A 2A9PA 4ZYLA 4NCAA 3CHYA 1R8JA 3RVLA 1ABEA 1D2AA 1FFWA 4S04A 1QPZA 3W9SA 4MPTA 1EFAA 1SD5A 4EVSA 2DRIA 4KV7A 3F73A 2NZUG 2WY2D 4M88A 4ETNA 4FB4A 1JYFA 3URMA 4N0QA 1YS7A 3CS3A 3LUHA 3C3WA 3MM4A 4MR8B 4DQDA 4B09A 3I5AA 4PZ0A 3LUGA 4MQEA 2CWDA 2E4YA 3H75A 3GYBA 3JY6A 4JOQA 2OENG 2IPLA 3TD9A 3GRCA 2PUAA 1K66A 3H1EA 1QQAA 2PLNA 3EJWA 2PMCA 5E3JA 1GLGA 1M2FA 4XFKA 2M1ZA 5EWJB 3RVKA 4ETMA 4Z4IA 5B3JA 1DCFA 1DCMA 1DZ3A 3H5VA 2MYPA 3JPYA 3OLXA 1FFSA 3OMWA 2RDMA 3JTEA 2PE5A 3T95A 4W5RA 2IPAB 1XHEA 2PUBA 2QVCA 2R25B 4P1ZA 1U2QA 1LK0A 4YWHA 3IP9A 3FFXA 3G85A 4W5OA 3VNAA 2WWVD 3QELA 3FFTA 2LPMA 1VLZA 4O1IA 3HS3A 3HSYA 4GPAA 2HSGA 3NBMA 4YP9A 4G0YA 3Q15C 2JCGA 2PUGA 2L18A 4MLDA 5KQLA 3MMNA 1Z15A 4RDCA 4ZJPA 5HM6A 4IMJB 1JDPA 3LFTA 2BGGA 1PEAA 3IPAA 3ILHA 5TQ2A 3O1IC 3F7NA 3QX9A 4IRXA 4WT7A 2R4QA 3DBIA 4TN5A 1WETA 2E4WA 4NCBA 1BA2A 3GV0A 3OQMA 4IILA 2RJNA 4Q6BA 5JNWA 3QEMB 5EWMB 3TMYA 2JVKA 2MSLA 1AB5A 2WB4A 2MYTA 3H5LA 2PAFA 1PNRA 5KC9A 5T7BA 4N0PA 3D02A 3VNBA 4N03A 4HNSA 5F64A 1P2FA 5JS1A 1NXPA 4Y9TA 3UKJA 5PNTA 4OLAA 2WMYA 3B2NA 3QLVA 1MAVA 1SXHA 4PICA 2ZAYA 1EWKA 2FN9A 4KPYA 2QVGA 3GA5A 4JB2A 5HSGA 1BVHA 2NUBA 3O2SB 1YS6A 3T6KA 4MR7B 4MRMA 4F11A 5BRJA 1YK0A 3OM1A 4XASA 5TQ2B 3CG4A 4H3KB 4Z4CA 3K9CA 1USKA 3BRSA 5DCLA 3LOPA 3N53A 2E4VA 3QLVC 4RY0A 5IC5A 1CHNA 4E7OA 4EVRA 4MS3B 5EWLA 4RK4A 1NY5A 2M98A 4F06A 4N47A 1EWTA 4KK3A 2QZJA 4JA2A 3HJFA 2V0NA 1NTRA 2PUEA 5CNJA 4N41A 1D5WA 4RKRA 3LUAA 3LTEA 1KRXA 3QX8A 3N0XA 4L4UA 4RZSA 1YVUA 4XARA 5CNMA 3RVQA 3QELB 1JF8A 1U8TA 4ZPJA 3O21A 1BDIA 3HDGA 2NT4A 1GCGA 4RY9A 1TM2A 5ABPA 3H5OA 4LE0A 1NXXA 3M9XA 1MB3A 1JL3A 3Q9SA 1JLKA 2VUIB 2FMHA 3N0WA 2VK2A 1OXBB 1P6UA 4W5TA 3FDFA 4WXEA 4Z4HA 4XAQA 1M2EA 3HXMA 4JAVC 2FQXA 2H0AA 3C6QA 3O1JC 3QEMA 3JVIA 3Q7TA 1JWLA 4UHKA 3RVNA 2FLKA 4YR7A 5IX8A 3LUKA 4JASB 3LKBA 2HPHA 3SY8A 1ZH2A 3CRNA 4ETIA 1ZGGA 4Z99A 4F12A 2FN8A 4MS3A 5EWLB 3S99A 2N9UA 1QP0A 5FBKA 5FBHA 4RXUA 3SG0A 2FXIA 3GWGA 1JHZA 4Q6WA 3KG2A 1ZY2A 1Z16A 3CZCA 4PEVA 1PNTA 1A04A 4G0MA 1D4ZA 1F4VA 1BDHA 4YS6A 4NQRA
chains in the Genus database with same CATH superfamily
2W6OA 3VFDA 1EXDA 1ZGAA 3GJ6A 4K26A 4PLYA 1RC1A 4UFPA 3G23A 4CKWA 4BKQA 4KV9A 3ROKA 5KNBH 2X7HA 2V7QD 2XHEA 1LF0A 3X1MA 2UZAA 3JALA 4OLJA 4UXJA 5I9LA 4IJ6A 3KJXA 1VBKA 1NX6A 1Z4OA 2NACA 4YP1A 4GMDA 3VRHA 3GGDA 2QRMA 5CM2Z 1M72A 1DC8A 2J33A 3B7GA 2PBLA 1GTVA 4EENA 2BLLA 1XNHA 5JVDF 3KPYA 4FS3A 1YKFA 2IQ5A 3KO8A 3ZI4A 2HU7A 2EWWA 4LI0A 4OHRA 2ZUTA 3SQNA 2X7XA 5IFLA 2OBMA 5EPUA 2IH2A 3QLUA 1V1RA 1D5CA 4DLAA 3NR2A 5THKA 2Y2UA 1J1IA 1Z39A 3RYHA 2BZ1A 4RVHA 1HX7A 3OZVA 4J4TA 2A1UA 2AI1A 3C16C 4QDZA 1R6BX 5DWDA 4MB6A 4M2LA 3CGGA 3T7AA 3K0AA 4J0FA 3I45A 1EZ1A 1NQWA 2H07A 1X1BA 2YJ5A 4JB3A 3R7SA 4B83A 5KU1A 2FK7A 1B00A 3DKPA 4FYPA 5IDXA 3T4UA 4EUKA 5HQJA 4LJRA 1NVDA 3U4GA 1HDXA 5EMLA 2WWHA 4QDUA 4F72A 4WBNF 4F91B 3SVZA 3KKMA 4GC9A 3SM9A 4CF3A 1A96A 3RJ9A 5ADHA 1T9KA 2RAFA 4V02A 4WOCA 4Y67A 5J63A 4RK5A 1L1FA 3PHJA 4HDQB 4B3SB 2ZULA 2C2OA 2BUBA 3NXSA 4D80A 1DBWA 1WVMA 1XTQA 3RM3A 1PFVA 2GWRA 2GZSA 3PLRA 3MA0A 1M1XB 5G2OA 2FDCA 1R0YA 5BSRA 3QPVA 3VR4H 1A50B 4WSOA 3TPFA 1ZS9A 2ODWA 1GR1A 1Q50A 2CFTA 4LECA 1U3TA 3K7EA 1TM4E 5KJEA 4WKGA 5EWJA 1RZVA 1U3WA 3CR8A 2G07A 3FYSA 4M55A 4P7BA 4HQFA 2JFOA 1SEVA 2VPYA 5JASA 2W6QA 2W71A 2XXBA 2ZIEA 5C8YF 4PS1A 1ZU5A 1J42A 3PL1A 5KIAA 3T7CA 1I0ZA 2E2WA 2J3QA 1SC1A 2Q5OA 3CPSA 3HB7A 3KEGA 4Q15A 2R86A 5LLDA 4E1AA 2P9CA 4CQNA 1Z45A 1MVOA 1E64A 2QE7A 1GYQA 4IIDA 1TKBA 4C4ZA 1GITA 5CD9A 2OKCA 2C5HA 5ILQA 1BDJA 1GPWB 2VT2A 5FXMA 3WI7A 1DOAA 1Y82A 4HF7A 2QE6A 1AS0A 1EUCB 2OB2A 3BRWA 4UNPA 2JH9A 1G291 4YQYA 4G4SP 3T06B 1QK3A 2XCSB 4HFJA 5JZMA 3KJIA 1ZSVA 3RODA 1A9SA 4B46A 2NO0A 4JEUA 1NMSA 4BFYA 2AOWA 4RPJA 2HM7A 4NFYA 3SR3A 2WJ6A 3V4LA 3DH0A 1DKUA 2EEZA 3EULA 4BX3A 1SRQA 2EJBA 4PZ9A 4A6XA 3IUPA 5JXWA 1U8YA 2JZOA 3F5QA 1HE3A 1QHGA 2CCKA 4I3FA 3Q6NA 4PZAA 1T0HB 4YJ3A 1K4KA 3VZPA 2GRAA 3EVZA 2JHPA 1U8CB 2NTVA 4H18A 3GA0A 4QTYA 2CK3A 2F1HA 4X41A 5L7YA 1RXIA 3WB1A 1SJ9A 4JLAA 2J3EA 4IUBS 3FF4A 2WWTA 5IDYA 5LUBA 1BWQA 3C8DA 1KE2A 5JQGF 1MO3A 4LE2A 5DIZA 1LJLA 1N2JA 1E6LA 4TVOA 4RGYA 1BE1A 2BELA 2IXEA 2M32A 3PICA 4QYIB 3UH1A 1N8KA 1SO8A 2Z8ZA 3PJGA 2YWDA 3HBJA 2P6UA 3FM9A 3L06A 5A6SA 2G08A 2XF2A 3AVQA 2G1UA 3CB4A 5INTA 1C3VA 2FG6C 2P6NA 4G85A 1XZGA 1SKQA 5ESWA 5LU8A 1M0WA 1QZXA 2B94A 3NGLA 4HADA 1WP9A 4KZKA 1ADJA 1TT5A 2XB6A 5FPSA 3TCXB 3OT1A 4E14A 1S2NA 7GPBA 2JBHA 1PT8A 2O14A 4DR2B 1PDVA 2X42A 4KPEC 1QVZA 5GWXA 3IO3A 1F9AA 2C5GA 5C1PA 3KQPA 2UDPA 4LZOA 2WWRA 2OCLA 3S55A 3ANTA 4R2XA 4RH0A 3CT4A 4HRAA 3GEGA 1Z33A 2VQ3A 3I2HA 1I94B 1Y8QB 3GAAA 4EUFA 3N2KB 1F9EA 4ARAA 4W9MC 3FNFA 3KUXA 2ZT5A 2P2SA 1I1NA 2V8OA 3QA9A 3HGMA 3NONA 4Q48A 5EZQA 3RNLA 4CCWA 5CDUA 1VMEA 2Y1GA 2VZ8A 4GO1A 4D3SA 3CZQA 4PLVA 4LIPD 5FKJA 1EE2A 1RJFA 4BTEA 4UPEA 1CCWA 2I6SA 3AM5A 3GJ8A 4C7OA 3BXEA 2PLRA 2G17A 2WAAA 2AL7A 1G5PA 2BPOA 2PMBA 4ME6A 3TEMA 1VPWA 1H4SA 3OJXA 4O2BA 1GWNA 2QV0A 4Q9HA 2FW7A 1O9HA 4ENTA 5LP1A 4YQZA 4GXTA 5FDFA 5LPNA 5ADVA 3LO5A 2O8NA 1NXVA 4N3NA 4XSGA 3BK7A 2JK1A 1IHDA 4KIGA 2VDQB 3HB1A 3UUFA 1E7SA 2DXIA 4LBZA 3L7MA 3HYRA 3Q2IA 2V6GA 5LQNA 5H4HA 1YAHA 2G5TA 3GP5A 4GLJA 5JFTA 1DFGA 4ITRC 3Q3JB 1GZDA 4NI5A 4OPMA 4O8CA 5EMHA 3O8OB 1IL0A 3CA8A 4KRGA 1S3GA 4ZZ2A 4C87A 1NNEA 2G25A 3VJLA 3A70A 3DZGA 5BN3A 1HC7A 3LMKA 4I19A 2A9JA 4M76B 1AG9A 3CX8A 4OXKA 1ZD9A 4YMLA 4RIGA 1LX6A 2RGYA 3H84A 6REQA 1QP7A 3HYSA 3FMPB 1O0SA 2VCEA 3CH6A 1F20A 1QSGA 2II6A 4YTEA 1COWD 3JASB 1DG3A 3IPRA 4XIFA 3O8QA 2FRDA 5P21A 1JHXA 3R6WA 4XJTA 1NXSA 1C7ZA 1FUIA 5FA5A 1CR0A 3UM9A 5HQTA 3EEIA 3QU2A 3TZEA 4AZ0A 2LDBA 2YZ2A 3PNBA 2V0GA 1J9EA 4K6HA 3VHQA 1CU1A 1ZCBA 4OYLA 1WPRA 4RZ3A 5D1HA 3PRHA 3Q2OA 4J7UA 3V2HA 4Z7OB 4HQ6A 3A6JA 3BE6A 1QMPA 4NZ9A 3AVWA 4GMHA 1WUHS 3K8OE 1IWPB 3TLEA 2V9CA 4KDCA 4CKCB 1S4QA 3OTWA 3ZPXA 4GXRA 3K2EA 5E1MA 5CVCA 1WW2A 1S9HA 2QAJA 2QMHA 4HK4A 4IW3B 3FXAA 3WQBA 1IN1A 3F3YA 5KOYA 1T0UA 2CJWA 4HPXB 1EDZA 2Q6KA 2BZ0A 1NW8A 1SUFA 2Y0CA 1OE0A 3O3CA 1C2TA 1YRLA 2WSMA 4IYRA 2NXNA 2ERYA 3ZWDA 4FYVA 2GN9A 1NAIA 1JR4A 4DGQA 1MAWA 1MO5A 3PKJA 3KOOA 4BV3A 3M1IA 3QPWA 2JFUA 3PGKA 1XMSA 5EUBA 3SE7A 1FOEB 3B8HA 3DZFA 3W8NA 4DMUB 5EP2A 1LZKA 3MHPA 3RC7A 3WAKA 1EJ0A 2HT1A 2BKEA 2ZJ5A 4J3NA 4Y9SA 3DBHB 4URHA 1XRMA 1K8RA 1JVNA 1A95A 2HTFA 3D6NB 3DONA 3IQHX 3QTLA 3KLOA 5BPFA 5LP6A 3VR4D 3PE6A 2YXBA 1DC4A 3HLYA 4F9FA 2KSQA 2X5KO 4RV4A 5KOJA 1E4YA 4BC1A 1FRZA 5GIPE 4IDHA 5C8DA 1XMOB 3E82A 4JJZA 4Q4JB 4UARA 3NTQA 4I66A 1FNBA 1XPRA 1E2GA 3PPXA 3R0XA 1LTHR 3U3XA 2I8CA 4M38A 1QFZA 3U62A 1UBCA 3FVRA 4MYDA 1W48A 5IASA 4HWKA 3DQPA 2DHCA 1WY7A 2VJBA 3B9QA 4CBVA 2WSSD 1W36C 1P81A 1MO4A 2R5FA 2ODPA 3WZLA 4AKGA 2ZCVA 2DWUA 3JTMA 4LYEA 3RS0A 1D07A 1L5YA 2QLTA 3UH0A 1E2FA 1KXZA 3EE6A 1BEEA 1EK2A 4GX1A 4ZOAA 1LPSA 2HCBA 3TTYA 4XYMA 1SXJB 3AG5A 3KKOA 4JGGA 2EAUA 2NT3A 1G2IA 4UCFA 4ERNA 4A2CA 3I6BA 4RIFA 1UJNA 3RYIB 3USCS 1FFYA 3H05A 4O4IB 4V0SA 1JA1A 2NSLA 3GBSA 5JC8A 1HETA 1M8JA 1NASA 5BN5B 3KQYA 1YZTA 3OE4A 3I4CA 3OPQA 1IJBA 4IIYA 1FU7A 4W4TA 3WJAA 2G67A 3S2FA 5JD4A 4BMNA 1QVWA 1SHTX 2CVOA 2SICE 2C4WA 3UGJA 4MVCA 4XVCA 4FDLA 2OAGA 1SD2A 2F55A 2R68A 1M6VA 2QW0X 1YZFA 1ORRA 5AVJA 2XKJE 5KAPA 4N3BA 2HDWA 3K94A 3PQ5A 1RRPA 2WWFA 1QIIA 2DSNA 2FCAA 1QGOA 4JBIA 5DE3A 4RENA 3I61A 3P1JA 4LJSA 1D4FA 5D00A 4OA5A 2O4CA 3GX1A 1Z73A 2D3WA 2RHTA 3PNMA 4YJDA 1IY8A 4DBLE 2ZJ0A 1V4NA 3AKDA 1OV4A 3FBGA 1SKYE 3MD9A 2HA7A 1C3OB 1VBNA 5H81A 1XYYA 1SCKA 2DFKB 2D6FA 4PO3X 5LYJA 2PT5A 4E21A 4C7OB 1SQGA 2GT1A 2B3DA 3FPCA 2NVUB 4MWZA 4UVIA 4E2WA 4OI1A 4ENUA 4F6RB 4A15A 1QBGA 1ID8A 2MMGA 3OAAA 3ONEA 4CCYA 4B1FA 1XAHA 4WK0B 1IOWA 2LTAA 4U5XA 1SQ6A 5HIIA 5C7YA 1XLTC 3H2HA 1OZHA 4G5RA 4OI0A 1R16A 3GLRA 4FD2A 1IAQA 4MDHA 1VE7A 1W75A 4OQNA 1N2OA 1G6Q1 5ALNA 2GAOA 3RRMA 3LKDA 3X2EA 1P60A 1R64A 3JSXA 4FW9A 4KXWA 3WIUA 3B89A 1VM6A 4AB1A 1BXRA 2YY7A 3CVYA 4OGKA 2FOXA 3JCZA 4L5YA 3KT6A 4KXXA 1VHWA 2PE5A 2OP0A 5HX7A 2YVAA 3ZCVA 4CN9A 2QVCA 2R25B 4E2YA 2QI9C 1A2KC 5AI8A 5KQSA 3N86A 3QW4B 2HQ1A 3KFXA 3DVRX 1D8AA 2ZITA 1CQPA 4R3NA 1XNGA 2PGAA 2XTJA 3RRZA 4MRSA 1JEYB 2QRZA 3IUQA 2ZAOA 4L16A 1R0WA 2XE7A 2XMBA 3A4MA 2CUKA 4UBIA 4A0SA 2IA5A 4I5DA 2GSDA 4EI8A 1GA6A 2A92A 2JCGA 1JKMA 4MTCA 3L41A 1PJCA 4JGBA 2W6ZA 3LWBA 4U2EA 1XU4A 3SDSA 1HT3A 2VDPB 1JDPA 1FXSA 3A1FA 3CQ9A 5BUQA 1IMOA 1HR0B 5B1HA 4KP7A 4J4HA 3OWHA 3EQ8A 3NVDA 4ZP1A 2ZS8A 3IUEA 3KE9A 1MG0A 3GDGA 4NYJQ 3CEHA 1N8SA 3BL6A 3RIXA 5EWMB 3ECAA 3V46A 2ZJYA 2V7TA 4ER6A 3M89A 4G1MB 1PNRA 2G1JA 4GT1A 4N39A 3DNMA 3SU8A 4LPKA 2Q7DA 4B3XA 1B8VA 1QHEA 1GPLA 3G2KA 4TKUA 3SXPA 1Q21A 3NGMA 4MK4A 4OLAA 2VT6A 3BFJA 3TW8A 1O2DA 4C4RA 1QE0A 3CB2A 4BYGA 6REQB 4YCLA 3RAFC 1YS6A 3I52A 5D1NA 4G8DA 5BRJA 1T2UA 2GD6A 3ENQA 4M1QA 4RPGA 1SKUA 3RSOA 5DO9A 2WVJA 2HKIA 5TQ2B 4IDFA 1ECJA 3F2VA 4XQEA 2C1ZA 5BURA 3OP4A 4PO1A 4L7VA 1QV9A 3ZCTA 1D4AA 1EBBA 4M1TA 1NR1A 4Y6PA 1R0ZA 2B99A 1GRQA 1B43A 1S9DA 4IKEA 1VDMA 1VL6A 5EWLA 4CLXA 1NY5A 2R6GA 2QTRA 4UBOA 1OLUB 1MC8A 4DILA 4C7JA 1AKVA 4IWNA 3H17A 4A73A 5EHZA 2H8GA 4TTVA 1M34E 3E3OA 4E15A 4PY2A 4N41A 5I7RA 1JHQA 1W35A 1MXFA 3FKSD 4KB5A 2VF7A 1NPTO 4UMFA 5IKXA 4XD7A 3RS3A 4RCYA 4DWWA 2H2AA 5ALHA 5HRUA 3SQLA 2H6EA 2FFBA 4HBZA 4AX4A 2J5KA 3M3DA 4G09A 5EQFA 4TWZA 4EW2A 5IJAA 5I8PA 1R27A 2OPHA 1UQRA 4GKAA 5JD6A 1XJ5A 5KTRA 3MBIA 1VL1A 4K6CA 1F2UA 3HWWA 2AHOA 2LW7A 3IH5A 4I5GA 4M1ZA 1EFHA 1NW4A 1T0PA 2PJDA 4G5YA 4RNCA 4EMUA 4EY5A 1JWLA 3MCUA 3FCCA 3HXKA 4DA9A 5IX8A 1R37A 3VUEA 1SMKA 4U3JB 4CN8A 1XZFA 3JQ7B 2C2HA 2YWHA 3TGLA 4W5RA 4ZAYA 1RWPA 1M2KA 2CYBA 2FZLA 2JNWA 4YBRA 3RSSA 3IL2A 5BWBA 2UU9B 3JAWA 1KEZA 3ML1A 4EKDA 1XXHE 4F5DA 1AQJA 5CFLA 3HUFA 1V47A 3H5RA 4HB3A 3GDOA 4MDYA 2O9JA 4OP3A 4PPFA 3LYHA 1P0QA 3PNPA 4ZQBA 1CUFA 3SFZA 3KVYA 1WL8A 5ALGA 2ZTSA 5B1DA 4MDFA 1DBSA 2JGFA 3DHNA 3QMVA 1V26A 1U28C 2ZWPA 5TF4A 3NUZA 2PSEA 4ZVQA 5CBKA 1J23A 1D4OA 3L6OO 1G59A 1NP7A 1V4VA 3A0RB 5DYGA 5KYGA 4FLFA 2NYRA 4FFWA 2PX4A 1YHZA 5BQ5A 5DBGA 3EGDA 1Z8NA 4LYJA 1ZK0A 1Y5LA 1MOZA 4XH9B 4C4TA 1PJBA 2A9QA 5BSFA 1UPAA 1U7OA 4EA7A 2Y92A 5D8DA 1DMSA 4LF6B 2C8VA 4XCXA 1QIEA 4EMBA 2J9ZB 2VWQA 3N2ZB 3WIVA 1N6NA 3H7IA 1CVIA 3IAFA 5BRNA 2LIPA 3K0BA 3V8MA 5T64A 4G9GA 2VSNA 1QHFA 5I51A 2XBMA 2PVPA 2PWBA 2ZSDA 5KTSA 1DOHA 4LF7B 5IH3A 1MNAA 3NBAA 4D96A 4HWSA 2PUCA 3A6EA 4GQIA 4O5OA 4WLEA 3U7HB 2A1TS 3A4NA 2Q49A 3GJ7A 4KXFB 4PTYA 1W85A 2P41A 2XKBA 2OG2A 4XGIA 4XTCS 2R65A 4FZ5A 2JATA 3AF2A 1VJ0A 4P81A 1TJPB 5CXXA 1QRSA 4OV6B 13PKA 1GU7A 2F90A 2A58A 1TO6A 4E5SA 2F59A 3TLZA 1I32A 2CDRA 4BMSA 1FS4A 5B5SA 4U7WA 3R40A 2YZGA 3ZK8A 1PHPA 1RPZA 2IYRA 2ONKA 2WT8A 4YT2A 1JHUA 3OQ1A 5BN1A 5HOQA 2VZLA 2XOKA 4R40A 3NALA 4JLPA 2GZ1A 1GZ3A 1W0KD 3ABRB 3PPYA 1DNPA 4OBXA 4QEZA 2PD4A 4MV1A 4R9RA 4YAUA 4U7DA 3HNOA 4CLOA 2G4LA 3R7DA 5K8IA 8GPBA 1HKHA 1DELA 4BN4A 3K16A 3HMKA 5COQA 3L8ZA 5JE8A 5K3FB 1QFXA 2IYNA 3C8HA 4AG3A 4HXGA 4MRPA 2B92A 3IV7A 2ZRBA 3KEQA 4GICA 1IK4A 1Y5RA 3UC9A 2QTVB 3JVVA 3UYKA 4E09A 5H3LA 2WB2A 4PRZA 3SNHA 4YR9A 1HRDA 3UANA 1KSHA 3PRJA 2O0MA 2VXYA 4OJYA 1NVWQ 1R8XA 1YJQA 4Y2JA 1Y6GA 5JI3E 1ICEA 2AJTA 2BVNA 1KC3A 2B5OA 3ABIA 1PNOA 3PGLA 5AOCA 2QIPA 3DC2A 4BFSA 3OMXA 4BNUA 4YRGA 2F3RA 2PM8A 2YFQA 3PDHA 4WXPA 3ZJTA 4DABA 4IDDA 1EIWA 4YXWA 2A4MA 4YAEA 2BR5A 3TZ6A 2P4QA 1WV1A 2PDAA 1UFOA 4QQRA 3SBXA 4ZEVA 3BSWA 2Q1YA 2VJMB 5JAZA 3I01M 1NKTA 3PJEA 3RT7A 4CIXA 1JG2A 1Y8CA 4I4TB 2M6SA 4CMEA 1ZOPA 4DMRA 2FSGA 5FADA 3DVAB 3OOSA 5CB4A 2XXJA 3CKMA 1CUHA 2X1MA 3ASUA 4F56A 3IC5A 3O73A 4GQBA 1NYTA 1B2LA 4Z1MA 5TPWB 1E3QA 3MT9A 3L0DA 5B1SA 3EC1A 1STOA 2CNLA 3SKXA 4BVGA 4CIWA 4AMUA 4UEOA 2VZ0A 4IXWA 2O19A 4BWGA 4G1CA 3BH0A 3LXMA 1KKLA 2Q0QA 3VKVA 2NU6B 3BCHA 4DV3B 3U5TA 2YJGA 3WV5A 2WYIA 4EI7A 3DXFA 3CZPA 3TVYA 1ATIA 2F7SA 4GC5A 1Q0UA 3F6RA 1LSUA 1QC5A 3LHFA 3PNLA 2BFCB 5B7PA 1RQ7A 1ZVVA 4NXMB 5KKAA 1D8TA 3BCSA 3LX6A 5AXAA 4C0HA 1LPNA 3K2IA 1BDBA 4ZOLB 8MHTA 4KBYA 1ADYA 2X58A 4OUDB 5CHEA 2DFPA 2GHIA 2X5NA 1UDAA 3CEAA 3QVVA 2AOTA 1L1EA 1QWSA 3PCRB 2OVFA 5H83A 3BJIC 4TVSA 4HWGA 3ADPA 3WMRA 1USWA 1SCJA 3KAKA 5JVDB 3TW8B 5EEHA 1QH1B 4X24A 1V71A 4B2IA 4ID3A 1QP4A 3Q8MA 1E9VA 2J3JA 4Y1RA 3ZJVA 4DJEC 5A5GA 4QPCA 1JFVA 3H9EO 4P53A 1DFIA 2GGSA 4MHTA 1Q7CA 2RHCA 2Z08A 3MJDA 1YOVB 3RRJA 2ZIXB 3DTVD 4S3MA 4P4GA 4M1KA 3PEVA 4F2GA 4K8RB 1SKAA 3RG2A 4UBJA 1U3CA 1D2CA 2VLIA 3RTGA 1DUIA 3IUNA 3DDZX 3L1JA 4A6EA 1HSOA 2HQOA 2X5JO 2DERA 1J49A 2EYUA 4KQGA 5JAOA 5LLSA 2ORYA 1OBHA 2QGFA 3ZY2A 1NBMD 1YQWA 2HL6A 3WQRA 1A2BA 1VSQA 4LC0A 5LYJB 3IMCA 4QNRA 4FR0A 2C00A 3VPGA 1WD5A 1M54A 1ODCA 2DLNA 1JR3D 1AF4A 3CWQA 3MAGA 3QIAA 4PYNA 1GIAA 1I4EB 4YT4A 1GUBA 3KSAC 2DQSA 4LSGA 1MO6A 1Z6XA 2XX3A 4M46A 5JDIA 2CVFA 3GVIA 3GZ4A 3P7MA 3B38A 4PBTA 3RK4A 4AL4A 1T5SA 2YQZA 3AP2A 3M3PA 1A4RA 5KTYA 2C57A 5JG7A 2LNDA 2YV1A 3FJYA 3UUEA 1DBQA 1X7ZA 3RVPA 5C52B 2O52A 4HXEB 3IP3A 5CYGA 2DETA 3N0RA 1USGA 1LBSA 3QKRA 3LU1A 3RW9A 2J4FA 1RIIA 2VSYA 1OB2A 4Z5XA 1OW3B 2ZIUB 1E0AA 2FMUA 3K92A 1E6UA 4QYTA 4BCCA 2AVDA 1E3MA 1QK5A 2BEUB 3JQFC 5H80A 3JZFA 5AK5A 5LIPA 4OQ4A 1RWWA 4LMBA 5FWYA 1G5TA 4Q7LA 4TQAA 4UNIA 3HI6A 2BGKA 4D82A 2P69A 1MQSA 2QUKA 4NJEB 4WK6A 2Z2KA 3TQTA 1OLSB 3HKEB 2HJ9A 1WDTA 5IM4F 3EUAA 2EFEB 1QJCA 2VJQA 4XWKA 1Y48E 1G21B 4N5MA 3RB8A 1J22A 1OWLA 3ADDA 4Q3CA 4AM8A 4BX8A 3OBIA 3HP4A 4OU4A 2CL0X 2QX7A 1TCAA 4WFJA 3ZWKA 5JSUA 3L7NA 2R751 5DYWA 5J4YA 4EMSA 6GPBA 2C3MA 2WIGA 3NHAA 5T41A 3ZV5A 1V1MA 3F7OA 5ICEA 3HRIA 3DFKA 1PN3A 2R7MA 2ZYTX 2W93A 4DQKA 4BPRA 3IALA 4TUYB 1U9IC 3DW1X 1DARA 2J9XB 1XD2B 4CKZA 1E5VA 4G67A 4QOJA 2PN1A 3COPA 3WHPA 3AONB 4X92A 3WG9A 2QN7A 4YO8A 3BS4A 2J5QA 2OWEA 3H97A 3I01A 5EIAA 3EF1A 3CRQA 3K70D 1MMFB 4NU0A 5A9TA 2UVPB 3MWEA 3EZYA 5BMOA 3B78A 4TMXA 3A2LA 3D2LA 2HJGA 3GJ5A 2NOAA 4PLZA 1R4NA 3CF2A 5LQAA 3UFBA 1T9ZA 1DEXA 2OBFA 3E4DA 1RWMA 2RH4A 2ZBDA 1DRUA 4RKYA 3W3AD 2O2EA 2ZJOA 4IICA 3FW1A 4L22A 1V39A 1L4EA 1YRHA 3C5VA 3R3SA 3Q3GE 5C1IA 3VZSA 4E03A 2YNMD 2X5XA 3GEBA 3OD5A 4OSEA 2J5BA 4PZCA 1H0RA 3FVQA 2V58A 3G13A 1MEJA 1M0SA 3LC2O 3KSRA 5DTRA 2BTQA 3QFSA 3NI2A 4TMVA 1RZ3A 5BY2A 1O96B 2OT3B 4GX0A 3VVBA 3B7PA 4HGOA 3R7FA 4MWBA 3GLGA 2Y2VA 2Y4OA 3MGCA 2H11A 3SZ3A 2B21A 3IBCA 1JFFA 1OJ7A 5MGNA 1KJQA 5IUKC 1AUXA 2OHIA 3CZMA 1KEKA 5HUHA 4HDSA 1RLJA 3BEOA 2ZTMA 3VV3A 3BZUA 2QD3A 3DW3X 3A6PC 4L9RA 1X1SA 5HKLA 2C5FA 1ZOOA 3TKAA 1TK3A 1E7WA 4LF9B 1NWCA 1TUGA 2HO5A 3GCWA 3DQZA 3N05A 1E2BA 2BLNA 4NS4A 3KZCA 3R7WB 3PA6A 4EY8A 2JHCA 3BGIA 1ZGHA 1E6CA 4E6PA 5BNIA 1KEWA 4H7HA 1OIVA 3WIBA 4AROA 3GEMA 4JNCA 3S6JA 4QUDA 5KTNA 1IXRC 3SGLA 1NQVA 1PZXA 1YI0A 3WHIA 1CUXA 2BJWA 4MV6A 5ISMA 2I6XA 2ZSFA 1W59A 1CQZA 1XWIA 2OAP1 1TQ8A 1G18A 1O6GA 3FTCA 3KRTA 5BW6B 5TPZD 1JQDA 1I6WA 2RK6A 2SHKA 4IGAA 5CYFA 2WHRA 4D8XA 4HGZA 2B30A 1JXMA 1W8DA 2B6NA 3LZ6A 2EKQA 5E4TA 3RU9A 1O9BA 2YINC 3DMNA 2NU9A 1D2NA 1U0NA 5AIBA 5I4BA 4GPTA 4RV5A 5B53A 4NTZA 5CDYA 1NZJA 1ONOA 3DAFA 4CIVA 2PMFA 5LB2A 3FPEA 4F9TA 1WY5A 3AV0B 3E9MA 4H60A 4MMXB 4X6YA 3ICQB 2QUIA 4H1UA 1HURA 3LT5A 5K0LA 2BHTA 5DGXA 1ABEA 4N4AA 4Y9UA 5PGMA 1D2AA 4CG3A 2GARA 2BMJA 4MQMA 3A9TA 5F2EA 1E58A 4MPTA 3WLPA 5C8XA 1HQDA 4HKTA 4ETNA 4XX0B 3EZGA 3D0KA 1ND6A 3FPJA 3QHPA 4GZ6A 4UTOA 5DX8A 3S1LA 3ADCA 1E8DA 4KXYA 5J4LA 5AH0A 2FHPA 2JCYA 1OH6A 5ICFA 4V1CA 3PFGA 3C85A 4UEJA 2CWDA 2R8PA 4X1YB 1V2GA 5EERA 1JQJC 2E0IA 2I2CA 3G2QA 3FF1A 3HA2A 1KMCA 5IARA 4LGVA 1P9NA 1KU0A 1EM6A 3DYBA 3PXAA 4KWIA 5EE5B 5IU6A 2P9TA 3JD0A 5J4VA 1Z6AA 3EJWA 2K2QB 4NRDA 2XMRA 4U0JA 2NP7A 1AJEA 2BUCA 1I8TA 1X13A 4L5JA 4RZQA 2WJ3A 3UGKA 5IM5A 3NANA 1T13A 1Q6ZA 1VB3A 4H0FA 1SKBA 3R7AA 1NMZA 4BNXA 5F77A 2Q3JA 2XVAA 3OMWA 4FSHA 4K9NA 5KX5A 1EQUA 4B8YA 4BVKA 1XN1A 1DSSG 2FZGA 3HDQA 4NECA 4WIAA 3MB8A 4GYJA 5LOVA 2AOXA 1C7FA 1CEQA 1DZIA 4KITB 3UB3A 4DR1B 2KPOA 3O03A 1VOTA 3FFTA 2WIBA 3ESYA 1DKRA 5TMPA 1COZA 4RF2A 2BFNA 5FD8A 4QFCA 4ACAA 4ZGGA 3K53A 4YP9A 2MSEB 4IQ4A 1Z37A 1HOTA 2ISSD 1C0IA 1NHGA 4H15A 1DWUA 3DO8A 4YCBA 3EC2A 1LDBA 3LFTA 2RHGB 4PPNA 4XR9A 3UMBA 4LDPA 1Q11A 3BWMA 1NYRA 2YZNA 3LGXA 3O1IC 4MUMA 4ZO8A 2OM2A 1QGYA 4EB3A 5HBRA 1FXWF 2HLDD 2NO9A 3RHSA 2WB4A 1RWNA 2ZE7A 1AQIA 2MYTA 3AUFA 3IQZA 2D1YA 1GTL1 3VNQA 1JG1A 3PQ4A 1GT6A 2OXFA 3TK1A 1MW8X 3IODA 5DXAA 4EG4A 4HNSA 2Q6LA 4ZDKA 4KQEA 1PUJA 4F8EA 3DPIA 3E9DA 1ISMA 3JAWB 2DPXA 3S70A 4IUDS 1JIJA 2DH5A 3AEUB 4JIGA 2RGDA 1QO9A 1GCIA 2YXEA 2AEEA 3FKJA 3I2GA 1UMBB 3QE4A 4GBED 4C5BA 4DXHA 4FWTA 3TW4A 2OESA 2ACWA 3QOXA 4UCWA 5HNKA 1M5RA 1CERA 3F9IA 2A86A 2X13A 4FT2A 5EJ9A 2XGJA 1UKBA 1NUUA 2PBRA 5C7LO 4XOIA 2IOHA 2P9ZA 2Q3FA 2VBIA 4ALNA 3WLIA 1FDOA 3HJAA 1UT5A 2Q1TA 1JA0A 3PC4A 5DISB 2Q4OA 5JOQA 1UKCA 2HPVA 2I7TA 1KFBB 2G04A 2IU4A 3ODPA 3LLMA 1HE2A 3VU9A 5KEIA 3HJNA 1QYIA 1RM4A 5CU7A 3WQHA 4EEKA 4L2IA 3ZWOA 4IJQA 2WFLA 2P40A 2ZVQX 2I3GA 3EAGA 4DUZB 1J7KA 1FPQA 4Y2YA 5GMOA 3ESQA 2C2WA 4FONA 1YO6A 2BRUC 3IBSA 4M3NA 3N0XA 3D2AA 3IT1A 5F9MA 4EFMA 1IZZA 1GZ6A 4E1VA 1NMYA 5HFNA 3MLAA 3TLJA 1TLLA 3S7TA 1U2GC 2V7BA 3ZHCA 4CLHA 2NT4A 4O08A 3QKSA 2XUFA 1N5DA 2I2BA 4MUYA 4E4RA 3LJKA 4IHJA 4Z7QB 3H5OA 2P30A 1QH1A 3E0XA 2WTXA 3DBVO 3ZW7A 3M9XA 2E5WA 3H13A 2YW2A 4ZYVA 3RUPA 1EKXA 3QHAA 2QRPA 2IGBA 4WZBE 3UF0A 1XCGB 3N0WA 1TZBA 2RHWA 4HQOA 4ODIA 3OQHA 4LSZA 4J7CA 1ORIA 1RTTA 1NNUA 4MUHA 1GSAA 1E8NA 3AUKA 4UREA 1RBZA 3BGWA 4CM7A 4D6PA 4OFWA 3LX8A 4UHKA 2FLKA 1N1DA 1LV7A 2PT7A 4IJWA 2DR2A 1X9GA 3ID6C 3LFHA 5JFGA 1UP4A 2XNSA 1KIMA 2GUGA 2W2PA 4TX1A 3S99A 3VSAA 3FOAA 3HEMA 3PX7A 5ES3A 1U5BB 1K6XA 4NDNE 1FYVA 4NZZA 1LDNA 5BN3B 1ONNA 3FOCA 4WK2B 3VYTB 3CZCA 1J99A 2AI2A 4AX8A 1BDHA 4ALLA 2P2YA 5LYYA 3CLUC 2BGRA 4X8OA 3U13A 1NLZA 4OVKA 4PZPA 2CXOA 1A77A 3D8HA 3H8JA 4K9QA 4LDNA 2X22A 1JJBA 2AG8A 2JVIA 1BHSA 5EHGA 4UUBA 3CPJB 4XWTA 3ZGLA 4EW1A 2QORA 4Y1FA 3IVAA 4XPIA 1QWOA 1Z88A 2O5EA 2H7VA 1YTLA 4DY6A 2W0MA 4BP1A 5B58C 2ZE5A 2ZKLA 4LBVA 4B4UA 4BNKA 2ORIA 3OA2A 1AZWA 1P9RA 2J30A 1ZCFA 3I12A 3NAQA 3NWOA 1GU1A 5F3DA 3NIWA 3OQNA 4D44A 1D6MA 2FPSA 1LJ8A 5TEVA 4E07A 1A9XA 1JZQA 2OHXA 2Q2OA 2G7MC 3HVJA 4W5WA 3UWKA 3WLEA 4EG7A 1UBMS 1VFPA 4A03A 2ZI4A 1J8QA 2FJ0A 5HIMA 2AE1A 1U0BB 1HL7A 1TZCA 3IQXA 4XUCA 1G9TA 2ISCA 2OILA 4Q16A 5TJ9A 4HGYA 3AKYA 2BW0A 5FAXA 5C35A 4WCFB 3E23A 1IIBA 3NM6B 4ZXFA 1E89A 2JAHA 3JQ8B 3TBKA 1Q7TA 2R0QC 4M0LA 2XNKA 2E4XA 4BO8A 3E8SA 2LBPA 2BFEA 3OPXA 3PFCA 3R75A 4D46A 1CS0B 3R3HA 2PZBA 4AF7A 1Q95A 4NATA 5FPQA 4OTZA 3HCAA 4FSDA 2ZTVA 1NU6A 3ZE7A 1QC5B 3DP9A 2W7TA 3N6XA 5K2MA 1S1MA 3MTJA 2C7QA 1R3DA 4E11A 3G7UA 4BJHB 1RYHA 2X41A 1TC1A 3E7FA 2ZRNA 4PIPA 5CB8A 1T35A 4MCJA 3JWIA 4TL6A 3EQ6A 4N65A 1PRYA 3CLHA 3NPMA 1L1RA 1XCJA 4JLOA 3B1JA 2D1TA 1F8YA 2AJLI 2IELA 3DKKA 4JK3A 4JLWA 4KGDA 4P54A 4U7HA 5AD1A 4JGIA 1ZN2A 3STWA 1VPEA 4KGVA 4MA5A 1L5HA 2ZWAA 5IT0A 5HQ3A 2I80A 3FLMA 2N3ZA 5I4CA 1MB0A 5E4YA 2JB9A 4LE1A 1P1KA 2XOXA 1TL7C 3DLAA 1L4GA 5AJZA 4OHKA 3CLTD 4CEHB 3I9JA 1G3RA 1V5GA 3GFGA 3BPSA 5BYKA 3KYJB 2W70A 4IM7A 5HS4A 1AKUA 1WZNA 2EU8A 2M9MA 2ORWA 3QSGA 4GLBA 4OJMX 4UU1A 5DW3A 4DBLC 2VDMB 1PR0A 3B1KA 4RDHA 4BVLA 4I55A 5U4QA 1K7YA 1WZ2A 4G0QA 1R66A 2ZR8A 4JVNA 3OKFA 3Q5EA 1EUCA 4KN9S 5ALQA 1YTUA 4QDKA 2O2YA 5FTLA 3TQOA 1HOXA 2J3DA 4CMIB 3V9PA 1XCPA 3BHMA 3FOBA 3F4BA 2DYKA 1KHTA 2ZUWA 4AW9A 1U1FA 2FJPA 4BLUA 1EFKA 4MP3A 3GPBA 4M21A 5B7GA 1OY1A 2J85A 4X84A 1N75A 2GH1A 3N6VA 2BKAA 3THSA 1MA3A 3PPVA 3VUFA 1X7ZB 2VNAA 3S8YA 1T2CA 1VQ1A 3VO9A 1JEEA 4QZVA 2JG3A 1KY5A 1NWHA 1V8BA 2REOA 3EEBA 3WGGA 4ZYWA 3DZJA 3WDKA 4J6EA 4ZVUA 3VOBA 4KQWA 4FUQA 2R2AA 1C0KA 4CKBB 1PI3A 4M8LA 3HJUA 1NXWA 3NFRA 1T3SA 1PVVA 1R5BA 1G42A 2QLLA 1CUBA 1Q7EA 2NUAA 4YJ3F 3C8UA 1C2YA 1GSHA 4TKVA 1F0YA 3L7IA 1YIDA 2WWXA 4X20B 2M2IA 3AERA 2VHJA 2XQVA 2HMSA 1SUEA 1U2GA 1FVOA 5BSKA 6Q21A 4EB6B 4EUHA 3ED1A 2GB4A 2ST1A 3WLSA 1M7GA 2MR6A 4FLEA 3CW9A 4XEUA 5HILA 2PQ0A 4BLPA 3ZE2B 1KSFX 4Z0NA 4MJ3A 3VSEA 2E87A 5KYUA 4MQ5A 4ZQCB 5KJ6A 2VAPA 2PZLA 4V3CA 3P2MA 3GEHA 4EAQA 1K4MA 2VI5A 3A28A 3Q3HA 1C4XA 4P58A 1NSFA 2C42A 3THRA 3HCDA 4RTLA 2BGNA 4R2WA 1SOUA 1K8ZB 4EGAA 1N1GA 2PUTA 3HMQA 4KO3S 4IZHA 3PQ6A 1BJKA 4KACA 1ID1A 5C4GB 3KXDA 1MEEA 2EEPA 1H0KA 2MINA 2ZIFA 3G5TA 3I9V1 2QX8A 4Q4LA 5EZYA 4BBAA 4XWWA 2A5YB 5G02A 2JCXA 3EBPA 4BKUA 2QMUA 3EGEA 4JJAA 3TCKA 4ASUD 2X6QA 2GF2A 5GJCA 3SX4A 1U0FA 3U19A 2AR9A 2ZTUA 1FSSA 1ULZA 1MJGM 3LUFA 1GGFA 2QRGA 3MJSA 3VPCA 5ES4B 3V80A 5KNLA 1YV9A 4I14A 2C31A 4EF6A 2GD2A 4JX8A 4RMGA 1OGJA 4TTRA 1VJRA 1X39A 3KVRA 3I4FA 4I50A 1E1CA 3JZMA 1NRXA 3CUWA 1BE6A 4MV7A 4O8ZA 1O6ZA 4XYBA 4N76A 4CEIB 1NJ1A 1WULS 1DIBA 2AF3C 4I9NA 2O20A 2HWWA 3VU9B 3A9WA 1K86A 1XZIA 2PTGA 3LWDA 4O4JA 3OI7A 4ROSA 4XGNA 2ZYAA 3DZBA 4ZVMA 3IDQA 1Q0QA 1MZPA 1ODKA 3AJ8A 1V3TA 3O91A 4WZAE 1RRCA 1EJBA 1FJ2A 1G20E 4XUDA 2PYDA 1U0RA 1LB1B 2XJ4A 4MJ7A 4O6VA 2KLBA 3KXIA 3R20A 3ZHSA 3D5QA 4X62B 1U7PA 2P5UA 2WABA 4OATA 3U2QA 1SVUA 1B23P 3KJQA 2EFJA 1A9ZA 2YWEA 2CHQA 4D74A 3IAUA 4NCNA 5KHOC 3KAJA 4QLOA 3PVZA 2AUTA 3DHEA 1Y34E 1KMMA 1AXRA 2IVZA 4HX9A 4N6OA 3UN1A 3WE7A 1MG5A 3BREA 2DUMA 2DCMA 4RDIA 1YQUA 3FI0A 2VF2A 1SWVA 3M2PA 1HFKA 2PGXA 2C98A 3CFYA 1ZUWA 2XB2A 5KQPA 3V1UA 3TD2A 4ZHQF 1HTWA 1IPHA 5EAIA 4HDRA 5HM8A 2BMDA 3KS9A 2JK0A 3MWDA 1Y42X 2XODA 1XZQA 3IMGA 4LHYA 1OWPA 3EZ7A 5EZSA 1ACLA 1B0ZA 4BHTA 4R1QA 4TV9A 4BTLA 2H4JA 3AF5A 3CZRA 5I7VA 3QH4A 2ZRAA 4YRJA 3WZMA 1JT2A 2P9GA 1OHHD 3PTZA 4OL9A 1M73E 4N3GA 2HAEA 3TTVA 4OB6A 4E4TA 1H66A 3NBKA 3O4VA 1CUWA 1KFKB 2OECA 4GI7A 5ERXA 5IEBA 1R5OA 1KY4A 2YV2A 1WMFA 3DTVA 3LOUA 3WHKA 1K7XB 1TA4A 3RDPA 5GOTA 3BHJA 3H2JA 3KTAA 4OO3A 1JTFA 3WWOA 4Q5IA 3U39A 1KPGA 2DTEA 4MS4A 3CIFA 1DKPA 3Q41A 5JARA 1PWHA 3JQDA 4G0ZA 4OQMA 1J70A 5HJ2A 3KXKA 1TUBB 4JELA 1O57A 4TMKA 1TW2A 4MA0A 3KB8A 2QUZA 1A0OA 2R7KA 3ZNQA 1KARA 2HF2A 2JFBA 1M1UA 2Z2XA 2EDAA 2DFTA 3ESAA 4L72A 5DSTA 1ZOSA 1Z5OA 2GR9A 3CF4G 1CS4C 4FMCB 4RMIA 3FZEA 5FUXA 4AZTA 2OV3A 3AL3A 5B1YA 2FDXA 3IE0A 5TX7A 4LOIA 1X7GA 4S1NA 1LBTA 2BP7A 4YRSA 3EVGA 4Z49A 1T6XA 1PX0A 2XQJA 1JYEA 3CR7A 1AT1A 1XQ1A 4CU5A 1NDQA 1L4UA 5HDQA 3DOOA 1BGVA 3G2OA 2EL7A 2FEMA 1JVBA 4G2TA 5GIOE 4G0PA 4PANA 1JHOA 2KS6A 3WTBA 1ULAA 5THQA 2DE0X 2FSFA 4RBNA 5CVDA 1VJCA 8ABPA 4G36A 5KYYA 2GXUA 2R1UA 3QBDA 2ZUUA 3CXUA 4K6FA 1T1JA 4B3RB 1V5WA 1UKVY 1I5EA 1ZMXA 4GKJB 1NT2A 2VUTA 3KBOA 1FYDA 5F78A 1FQWA 2WNIA 4NL4H 3RK1A 5CA1B 2EG5A 4AKSA 1KTIA 1I3OA 1XA4A 4GLLA 4ARIA 2PVCA 2CB0A 2XYHA 4DT1A 2Q4EA 5JO9A 3GR6A 3MTEA 4AO6A 1W4ZA 3T9FA 1MDFA 3AVOA 3H5TA 4KWTA 1E7QA 3B48A 4XCVA 3NDRA 5JC1A 3COJA 2IBSA 5LCXA 3UKDA 1GYRA 1MOPA 3T5CA 2R8OA 1MFPA 1RXSA 1G55A 3MEQA 4INOA 4HGPA 3V8RA 1MT0A 1WOMA 4HGNA 3OFND 3SC2B 4YWJA 5DU2A 5ARCA 4MVXA 4MRAA 2IDZA 1ZCZA 3VYRB 1J00A 4V0QA 1XMQB 3GLIA 3TKYA 3LUHA 4B6EA 4GMGA 2GM5A 3ZCQA 3K9HA 2FFRA 2VJDA 1PKXA 2VO1A 2XEDA 1CLUA 1V0JA 2E4YA 2JIOA 3NHLA 3SICE 1EFTA 3SSOA 3T7JA 4Q7QA 5B57C 3HFSA 4GU5A 1PO7A 4E30A 3GUYA 4BKPA 4UC0A 1E3LA 4URVR 1XBTA 2YIVX 5FF9A 5TIIA 1MHTA 4KPUB 4CLOB 2ZI3A 2HPZA 1K66A 1T9BA 2JLQA 4YCJA 3EDQA 2IXGA 2VP9A 2C9OA 2ZRFA 3PIDA 5E3JA 4YRIA 3FBTA 3A1DA 3K1YA 4DHEA 3TQHA 2FUEA 4ENQA 1TA9A 2QMEA 4ETMA 2CEAA 3EFHA 1ZD5A 3B60A 4MWDA 3AXTA 4Z4IA 3Q0IA 4URFA 1YE8A 4NBUA 2MYPA 4QRDA 3UJ8A 3WWEA 1ESNA 1LTKA 1R0LA 2X2OA 1AKYA 1N2HA 1QTNA 1VCHA 3QVXA 1CXZA 4JENA 3P9CA 1E5LA 1G0NA 1QRRA 2PT9A 2GZ3A 2ZIVB 5G0SA 1WCXA 1Z7WA 3MRXA 3WICA 4B4KA 3HZOA 4MVJI 3Q85A 2QW8A 1KI9A 3HS3A 1QANA 2J5XA 5KTPA 1EGHA 5AUNB 4G0YA 4UTNA 3ZGOA 3C4QA 5CFPA 4EY7A 1DXOA 2SKDA 2BFFA 2YWRA 1DBVO 2WJ4A 5HM6A 3AFNA 5C31A 2BGGA 2I3AA 5AW1A 4M60A 1JIXA 4OK5A 3SX0A 1O03A 2CN1A 3DBIA 5HK8A 2VAVA 2VRWA 3IT2A 1JP7A 1R0XA 2YV3A 4ZAXA 3RVDA 5AUOB 4RO0A 5JAMA 5CB4F 1P7WA 2K5UA 1GPAA 4MCAA 1L4HA 2OXEA 3AR5A 5T7BA 3ESCA 2G5GX 3KR0A 1Z4QA 3D02A 5WRFA 1WB6A 4N03A 5IN4A 2O8BA 3IJEB 2XB9A 1I24A 2JFQA 2YWCA 2BDTA 1GKIA 1MC5A 2CJXA 1F0NA 1OU0A 1MAVA 3D0RA 4HYYA 2P2LA 2ZRLA 4H0CA 1GA4A 4CU2A 4MEJA 2NUBA 2Q21A 3O2SB 3RYCA 2I1WA 1VTKA 3C6BA 4FFDA 3V1KA 2GOYA 1KPHA 1HRKA 1YK0A 2OK8A 3LCMA 1X7WB 1RRGA 3NTOA 4DCNA 3W8FA 4DCMA 2Q5EA 3NPAA 2Z1DA 3QQPA 4GZ3A 2AFIB 3EXFB 4UE6A 5G3ZA 4DMLA 3AIOA 5I5GA 1T2VA 2X3UA 3QBJA 4NFSA 1TE2A 1QIGA 2P91A 1WW8A 4LCBA 1L3CA 2ODEA 3EVAA 1AGNA 4RK4A 3VI4B 3L43A 2PBZA 3NBUA 4M9SA 5LLTA 5CA0A 3AUAA 4Y7CA 1SM4A 2QAIA 2HRQA 2C83A 3WV4A 2QMOA 5EHNA 2W0SA 4U5QA 1JQAA 2GPSA 3IHWA 4HTFA 2Q28A 4HDRB 4N6GA 4B6GA 4MUBA 2OBBA 1M76A 4LV8B 5E0KB 1N0WA 4J0EA 3BXHA 4B74A 4WINA 4EUNA 2FQ1A 2WHPA 5MHTA 1IXZA 1U8TA 1MO2A 3DKIA 4DV0B 1XTUA 4UZSA 1E4EA 1I4TD 2KB0A 2OHJA 1PT6A 2YYAA 5EY5B 2JLCA 1MB3A 1CNMA 1XLUA 1ZM9A 4NH0A 1IY1A 2VUIB 2XITA 2V1UA 5CD1A 1FMFA 2IGTA 4LY6A 2WPDA 1Y8AA 4IFEA 3I2FA 4ASUA 4BKRA 4UOEA 4Q34A 5HDBB 2GHRA 3IRVA 3FYTA 4JAVC 1OBOA 1ULTA 2H1VA 3C5WP 1QBKC 3FNRA 3JQ7A 3SQOA 3DDSA 3K9LA 5D3MA 2CFSA 1V45E 3NEPX 4QNNA 5F33A 1IN7A 1C1DB 2A78A 4MKRA 5KB3A 3M2TA 2C59A 1ZFNA 2JAXA 5FQNA 2ETVA 2XCRB 1H2BA 4PFQA 4RPCA 1GAXA 1ADBA 1PWYE 1RVDA 1JZSA 4AVYA 5HWSA 4EKEA 3FTEA 1VMKA 2X3FA 4BNGA 4GM1A 1O77A 2C9BA 2CUNA 1BWPA 2UYGA 3T9CA 3OO1A 3UJ6A 1UPFA 4I3GA 5BO5A 4RKEA 4EJSA 2FSUA 4O4LB 5C4IA 2VPZA 2MSNA 3O8DA 2E37A 2I62A 3K09A 1W76A 1ZXLA 3PDIB 4O1HA 2NU8A 3EGDB 4GDFA 4GI3A 3LHKA 4W1RA 2ZYHA 2VAWA 2I2XB 4X60A 4JJIA 4EJMA 4CQLB 3LQ2A 2XF8A 3MTDA 4H6WA 1E1YA 1YACA 3OPNA 3SIPA 4B73A 2TMDA 3UJ3X 3PZRA 4CI9A 1VIYA 2CT8A 3VTZA 4ZCTA 4Q4DA 3JZDA 4Z54A 2CUZA 1ZLXA 2R60A 3A1NA 3UT5B 1CWUA 5COBA 1C1XA 5KYYB 1DV2A 1XVTA 3EXHB 2R6CA 2QD5A 1ADFA 1E4VA 1Z6PA 4IDBA 4KO8A 4PAGA 3GLHE 1QQ5A 3VPAA 2P0YA 1Z5PA 1XDSA 3AETB 3TUJC 1R50A 3AW8A 3JR7A 5HW0A 2JS7A 2GMWA 1FFCA 4LGYA 1XGKA 4E5VA 5B2ZA 5JXGA 2G71A 2PPVA 3C48A 2CXSA 1NV8A 1BMFA 3WLMA 1FTNA 3T8YA 3QEBZ 4E4YA 1JJAA 4OHYA 3H0CA 1J0CA 1ENYA 4CUJA 1CF2O 2XLCA 1HFEL 1N8TA 4K9PA 4UQLA 3DZHA 4KR0A 5ELLA 1WXEA 3GGGA 4B80A 2ZWOA 3TWOA 1VE9A 4JL6A 1C50A 1M6HA 1WB5A 2ATCA 3V1YA 4B7AA 3RAGA 4BZQA 4DNQA 2FPPB 1JFTA 3FOWA 3IAS1 4UBKA 4QDTA 3FTFA 3K5PA 1Z25A 4ZCLA 1EDBA 2BGJA 4FOPA 3TQQA 1RKQA 2HJRA 3EQ9A 5H4GA 3WBKA 2Z3ZA 4CVNA 2ZBEA 4D4KA 3O74A 2IZ6A 4NNOA 4LHWA 4F71A 1K2WA 4OXRA 3PIIA 2OK7A 2WU8A 3BFPA 1BGXT 1EAYA 2VHZA 3ZHVA 4EW6A 4IH4A 1C0PA 1NYLA 3HVUA 1DP4A 2CJFA 3VOSA 1X1QA 5KPDA 1I36A 1TT7A 3ZYCA 2IOYA 4D9BA 4HT3B 1UPTA 5UKDA 2ATIA 4MS4B 3RYHB 5HZGA 4UU8A 1C3EA 1EXMA 3L8GA 5AVUA 3CXRA 2HXSA 3VGPA 1VA4A 1ZH4A 3KPVA 1GUDA 1XRPA 4RXMA 3S2YA 2VK4A 3EGCA 3ROQA 4CM1A 4I1PA 2QXYA 5JSHA 5DSXA 1V16B 3ST7A 5G4LA 4YX9A 5K8VA 4LK3A 4XDHA 4L73A 1BA3A 3L18A 3NVMB 4G5QA 4DIFA 1KA9H 1II9A 5HG0A 3U48A 2WDZA 2P9YA 4JEHA 1OH7A 1F0PA 2VHEA 4UDOA 1DC7A 1GCAA 4LHZA 4TTAA 5KYVA 1TYDE 2I91A 2XGGA 4AYTA 3R9IA 1V11A 3PVSA 4Z1MD 4WLUA 3BSSA 4OKNA 4PYKA 3OVMA 5FI1B 4P4LA 1S2MA 2NZWA 3QXHA 2QY9A 5AKYA 1IQUA 1U28A 3DWIA 3V4VB 2YC2C 1FTQA 4EX6A 4P0QB 1FCJA 1VMDA 2IJGX 2K4MA 2ATEA 3F3MA 3G5LA 1OOEA 5JNTA 3W2GA 3G8DA 4FYHA 4YJFB 2IHYA 3WLTA 2UZ1B 4K2AA 5JYDA 3TF5A 2IODA 2FW1A 3TSYA 4FHGA 3NWPA 3P9YA 1IY2A 2IZ0A 2RGRA 4HN9A 3INNA 2ZTHA 3WMGA 1IN5A 4NP6A 4AFNA 1T3HA 3E9RA 1WZEA 5TMBA 5FUQA 2AE2A 3MJVA 2ZYRA 4BCDA 1IHUA 4N1AA 1NN5A 5NLLA 3LTNC 2GI4A 3C87A 4JI8B 1BD4A 3AF1A 1AH2A 1WXHA 4UVEA 1OBVA 1W34A 2HFJA 3DCJA 3FRIA 3H83A 3LY5A 4Q4AB 4YUAA 2A7XA 3KHUA 2IVFA 1RRVA 4MXDA 1WABA 1CZHA 4J0KA 1NZFA 1RP7A 4XZ3A 4WBNA 1XCOA 1C9NA 1DTEA 3U40A 1V1JA 4QSMA 1FTYA 5CJPA 3ZVRA 4F2WA 2IP2A 1BS2A 5C3UA 3QPDA 1QF6A 1QKJA 4XIIA 2BN4A 1QUFA 5FLEX 2QSJA 5DEIA 1N6HA 1IOVA 2Q5IA 1H8HD 2IKQA 4YT8A 3FLAA 1ZYUA 1E20A 3IEUA 4PGFA 3H2SA 2WTBA 4INPA 5FYQA 5JCPA 2UUBB 3GRRA 3Q9LA 2ZIZA 4UM8B 2ZB7A 3KFVA 5K0BA 2JRLA 2Y6UA 2ZUBA 2YFYA 1HDEA 3PE3A 3TO5A 1B3BA 3T5GA 1I7QB 5JU6A 1QOZA 3DGFC 2RGAA 1L9XA 1VE1A 1XWWA 3FFBA 4PG4A 3ZK9A 4DEYA 2AMJA 2O0JA 2OZEA 1K6MA 1B8OA 4OEHA 5JALA 3W4JA 3KHTA 4QYIA 5A5DA 4K2HA 3KT3A 4MVWA 3UENA 3A36A 3GJYA 3K0FA 4FFNA 1XMXA 4U0KA 3E1SA 4CKYA 5LOVB 3AYXB 2QN8A 4KGXA 3MTGA 4TV9F 4YJ3B 4A8TA 4DANA 1OGIA 2IEBA 3HYCA 4TLEA 1AXEA 3BXPA 2H4XA 2BMFA 2RGBA 4JQYA 5EE9A 3PENA 1NMXA 4BNMA 5JSFA 5LDHA 4IIFA 1W73A 3P0RA 4QBGB 5CT8A 3RC1A 1JW9B 1JI0A 1WXIA 2QU8A 3JD2A 3RVJA 4Z53A 4BEJA 2Q4RA 4JHLA 4KVAA 4Q7JB 5IZ4A 3G7NA 4PAWA 1LEHA 1L4YA 4HFRA 4F4DA 4HD8A 2Z5VA 4IDPA 4E2ZA 4EWLA 3KP1A 4NBLA 2C5EA 3QVOA 4LMRA 2PY6A 3PGVA 1JQ3A 4UD6A 5LMZA 5K3BA 1NOIA 3GD5A 1YDMA 1KR5A 3HKDA 1D7AA 3CJQA 4H1HA 2G0AA 4JJ6A 1ZC3A 3CCBA 2WYVA 3G17A 3PSHA 1GR0A 4UBNA 3A1TA 5CDHA 4GR5A 4D4LA 1EFUA 1FRVA 2WT4A 3NC0C 1M2JA 1K27A 2LVBA 2X0JA 5DX0A 3W3AH 2GAIA 1IHYA 2QNRA 2Y6VA 1Z38A 1EFDN 2QTGA 4PC2A 2VRCA 4JU9A 1ZL0A 3D3JA 4B82A 1LU9A 2PX6A 4KFRA 4ED9A 3JAMA 2J41A 1NBHA 1CYDA 2J1LA 2VH5R 3PB3A 4OAPA 4WKBA 5TGDA 3OJOA 1JDUA 4Z1OA 4AS3A 4UFNA 3EA5A 4J0QA 4JLMA 2OV6A 3FG9A 4II7A 5L3QA 2QBYA 2R7NA 1V8PA 1HQYE 4YXFA 4S1TA 2BH9A 4C14A 1L4BA 3MJTA 3R4CA 1GPYA 4PQGA 5SY4A 3H4IA 4DLUA 4KE6A 3S40A 3IPLA 1DINA 2PT6A 1EHIA 2NU7A 2Y9PB 3OUTA 4BVJA 1A88A 3R77A 5FBWB 3WP1B 2JLVA 1GTG1 1HK7A 1THZA 2P35A 1VGVA 2FG5A 2V97A 3O94A 5F21A 4DMHA 1GV1A 3ONWA 5IK2D 3TOXA 2HI0A 3CUKA 3LPCA 1CIJA 3RQIA 4UOZA 3ZEIA 1CNEA 4TXNA 3KQUA 4D99A 4KU4A 1PGJA 1P1JA 5E9AA 4AT1A 3DOUA 3EIEA 2IZZA 2H06A 3P0HA 4JLDA 3CKYA 2JCSA 4X8HA 4GWLA 1JBQA 4CUKA 4F7DA 4ZV7A 3GW8A 2V98A 1RJDA 3UHJA 3VZBA 5JQWA 5H0IA 4ZGBA 3REFA 2HQBA 3PD7A 1E4OA 2BM8A 2ALJA 1RCUA 2FV8A 2X86A 4TV8A 3WTCA 5FTNA 3LDGA 4FIZA 2ZJ8A 3G3EA 4LDJA 1AUPA 4B75A 3IVRA 4ILEA 2I3ZA 4DCVA 3A4IA 4WGGA 1RYYA 1VKRA 4AN4A 4ZT5A 1S02A 2AN4A 3ONFA 4L6AA 2ECOA 2VPWA 2ESRA 1L5RA 2MSKA 4ND2A 4Q1BA 1DIGA 5EFZA 3V1NA 4ZU6X 4DV7B 1H9CA 2XEXA 3F8SA 2XIJA 3EXHA 3OZAA 5IC6A 1QLHA 3NDPA 4G5OA 4MQUA 5SY9A 5T5QA 3F67A 3RG8A 4CG2A 1DAHA 1JFFB 3K3PA 3GAMA 1QQ6A 3ACBA 1OZGA 4Z3KA 3ZDEA 3CCCA 1JIIA 3MRSA 1DO2A 1XFAA 1DXYA 1W5EA 3D31A 2B83A 1KO1A 1FTGA 3FGPA 3FPAA 3K9NA 4TL8A 3E03A 2FLWA 3GPDG 1YAJA 4DJAA 1S2DA 4LDRA 4U63A 4ML3A 4HCJA 1N78A 3E7PA 4R01A 1X7DA 4OHXA 5K20A 1JYSA 3MB5A 4KXNA 3F0TA 2C99A 4Z4EA 3QUAA 4D42A 1XK7A 2I9PA 1Z22A 4DCJA 3EAQA 5K4HA 4TYYA 5B55A 2B8TA 2PUHA 2BOVA 2CB9A 1F38A 1II0A 1G4UR 3DMRA 4Q37A 1Q1EA 1NQXA 1AURA 2A5FA 4MZDA 3O82A 1EGQA 5H82A 3OPYB 1C81A 1TKRA 3PFFA 3RH0A 5DX1A 4EGCB 3R2JA 1KZ6A 1GFZA 5CFMA 5JADA 1WBJB 3SHOA 3L07A 4H6VA 1KZ4A 1U80A 4JUAA 2GZRA 1TLTA 3C14C 1IH8A 1YA6A 1D09A 1KDTA 4RDXA 1N5JA 2ZKIA 4HNRA 3OWXA 9MHTA 2RH8A 4H1TA 3KJNA 1BKSB 3VR3D 4B6QA 4DCPA 4NCAA 1P1HA 3PDWA 4GZ5A 1OTXA 2O8BB 1A8IA 1OT3A 4TS3A 1Z29A 3NETA 1FSGA 2ILTA 4FNGA 1XTZA 4IGEA 4KCGA 3VZRA 1WSAA 2XVXA 3S1AA 4RLHA 3NIFB 4P31A 4H2DA 3CO0S 1RKBA 1HZJA 2JKZA 3KQTA 3LM8A 2W2KA 4TXLA 2EFYA 3NVKI 1OJLA 1DB3A 2GO7A 4YLGA 3ZZMA 3AWIA 5KCMA 2XUDA 2W6IA 4OMFG 3THYA 2PS3A 1KO8A 4X1YA 4JOQA 2WAXA 3WXBA 4HDNA 4C06A 5K7SA 3KKKA 5DIFA 2P6RA 1SUAA 2O1EA 2VSOA 2YRXA 4WW0A 3DEJA 3VR5H 2XKAA 3IVXA 3U1VA 2ZXEA 1PNVA 4R7GA 4XUEA 3U44B 3GGPA 3L0ZA 3TR6A 2HCFA 3UG7A 4GOKA 4M1WA 3PGMA 1DIAA 1P7CA 3NHRA 2P1DA 2VRCD 4BGIA 3VDNB 4AQ7A 2IUSA 2VPIA 3ZXUB 3A37A 1K8QA 1N2CE 3OLCX 4ZQEA 4BNZA 2P3QA 3VMFA 1G4HA 2Z8YA 3KDSE 1QX4A 4O63O 3L7DA 3SCZA 1R6XA 4IDAA 2PH7A 4AZVA 2RGNA 4AN0A 2H4ZA 2B0JA 2V9ZA 5FUYA 4BNDB 3HSYA 4F11A 2HSGA 1JQLB 2RHRA 2WWWA 3AGQA 3K05A 3Q15C 3WRWA 1OLUA 2EW8A 1RAAA 5DXJA 1X9HA 4K8OA 5J47A 1TFUA 1M6VB 4Z0PA 1Z15A 2Q6TA 1IN8A 4UVHA 1E5QA 2M6KA 2JFVA 1S8OA 5ERGB 1VIDA 1IZ8A 3QX9A 1ESCA 4HZGA 3QWAA 4IILA 1NMEA 2FMXA 2IHZA 2XT9A 2JEOA 3L3BA 2MSLA 5TGTA 2VXBA 1ZJZA 4K9LA 2J31A 3VU1A 1FJGB 1R5NA 5BNZA 3QJ5A 4QVIA 1P4SA 2FEOA 2O8DA 2XJ9A 1OGYA 3ICOA 5HRAA 2C7PA 4RSHA 4CM9A 2WG1A 4S1PA 3VH4A 2WHQA 5KMGB 4KPYA 1G8PA 3GA5A 4JB2A 3VPHA 1TUIA 1XEWX 4RH3A 4DE5A 3NEYA 4AS1A 3KSDO 3R3UA 4J9VA 4BUZA 5HGXA 3EBOA 3CO5A 5EOVA 3AHHA 1TAHA 2GBFA 1O95A 1H6CA 3ABSB 3GJZA 5HF6A 3TCNA 3ZLBA 4B3MB 2ZVJA 2ET6A 4QFDA 4C9BA 1VRWA 3R41A 3DZIA 3EPPA 2C4HA 1PG2A 4K03A 4TOIA 4Y0AA 1G5IA 4D02A 1HYQA 2FP4A 2SBTA 1PT9A 3A4YA 4E7OA 4BFLA 4RQAA 3UJAA 1ST2A 2AYYA 4RJ2A 3M81A 3QU5A 2GHQA 3DDNA 1TCBA 4WNIA 4FDMA 3WAJA 3BL5A 1OKKD 3B1YA 4HY3A 4GLOA 3RTBA 2EZ9A 3S5UA 2QG4A 4UEQA 4YMGA 3I9V6 3EW9A 4UKDA 3VH2A 3ZHRA 5I8ZA 2O2IA 3PE4A 3BQ9A 1KDPA 3CC8A 2RARA 4PO8A 1J0AA 4I1SA 3TG2A 5IXJA 3DM9B 3OF3A 3ANYB 3SWWA 2OSVA 1K0UA 1XZMA 1KORA 1QCYA 4JX9A 3Q9NA 2VC2B 2OQ2A 2AZ4A 3E35A 4FFMA 4UOQA 3ZDDA 1DTSA 2J8ZA 2I54A 4FGUA 3BB1A 3C3XA 4X65B 3K2QA 4QASA 4ZAVA 3NTLA 1TFRA 1TM2A 1D1SA 3OZ7A 5KNCA 4P8RA 1F7VA 3TQFA 4M37A 2QPTA 3QMPA 4I1YA 4C6TA 2F3QA 5AKXA 3MTBA 4AF8A 1NVGA 3A04A 2LDXA 2VH2A 3FDFA 1U1GA 3SLGA 2JARA 5IANA 2WWGA 5ICGA 4MKGA 2H0AA 4H3VA 3LHIA 2WIJA 3EFOB 3Q7TA 1ZCJA 5FNZA 3L6BA 4HRXA 1VLMA 1XQXA 3PNQA 4CTNA 3CRNA 1B0UA 3VAYA 4C6SA 1CP2A 3L1HA 4OU5A 4F12A 4NESA 5BMVB 4QBHA 3V6LA 4I50B 4QG3A 4BV2A 1UFRA 2C7GA 3ZWMA 1NZDA 3IAM6 5F51A 1IPFA 1Q3TA 3BGDA 2XQGA 4PV7A 3IAS6 1L8QA 1MGOA 1XMVA 3QUSA 1PNTA 3E9NA 3TX2A 4KOAA 1A2QA 3F3KA 4OHWA 5KTMA 3TR5A 3PXXA 4KRFA 5IW8A 3RFTA 3NGXA 5E2AA 4CI0B 2FI1A 1SB9A 3SQMA 2E4UA 5AHOA 3ICCA 4B0PA 3TD6A 1NVKA 5JH7A 1NVMB 1C7JA 3MTQA 3IEVA 2I6QA 4NPCA 4NYMR 3RJMA 4GNKA 4QU8A 1QONA 3N75A 5FO1A 1T8SA 1T1SA 1ULSA 1ZK4A 3B6IA 1T5OA 2WILA 4XFJA 3UHAA 2PXHA 5A4KA 4MQBA 1KU6A 3T15A 2FJUA 3EPLA 1H93A 2UKDA 3LW7A 1B1CA 2VK1A 4RPLA 2K87A 1X8JA 3RSLA 4NONA 2V4UA 4MQLA 4ZT6A 3QW2A 4KFUA 3I72A 4CMBA 5LQKA 1D7OA 2HJHA 1M7BA 2WA2A 3EHEA 4GOJA 1YVRA 3WK8A 5IJ9B 2V3WA 4ZI5A 3OC6A 3E3LA 5LA6A 4UTVA 1U4NA 1Y7IA 2ZI9A 4F1KA 3IP7A 4R1LA 4PHFA 3SOZA 1SXJA 2X0EA 4ACBA 2VUSA 4FIDA 3MINB 4DEXA 4DPMA 4ZK2A 1KETA 3DV9A 4RTKA 2OGUA 2J0UB 2QM7A 5G1NA 3L9XA 1N2EA 4ZT4A 3ANMA 2Z30A 3ZJ5A 2PKQP 3IA7A 3VSDA 1DPFA 1BJRE 3DEKA 4QBFA 1WLSA 1SVIA 4XE5A 4C7KA 1TTHA 2OCKA 2NZVG 3GT0A 3G0DA 1FXUA 1XKQA 4J8PA 1OX4B 1UK9A 3PQFA 1C0LA 3FSGA 4XQGA 4DA0A 1BE8A 1Q77A 3HH8A 4DLLA 2XA2A 1M0TA 1FVXA 2P4SA 1SEPA 1PW7A 3NV9A 1EUYA 4TYMA 3W04A 1MH1A 1KVTA 1X77A 4M6WB 5T8KC 3ROMA 2GCIA 5B1EA 5JSZA 1H4TA 3HO1A 3AO0B 3K1AA 3TIVA 3N8DA 1KO4A 3HJCA 4V0KA 4EK9A 1EE1A 1T8WA 2XMGA 1H3FA 3BQMB 3DF7A 1PP4A 1P7ZA 5FBQB 5MFPA 1REQB 2VEOA 3PUIA 3VC2A 4MYHA 3NBFA 3U4HA 3EYAA 5ALSA 4K87A 5F3WB 5GJVC 1Z2NX 2XCLA 1UBJS 3HA5A 1BKDR 2PAAA 3W5BA 4YP0A 1GNRA 1NUPA 4BX2A 2GFIA 3MMZA 3MHTA 4PSAA 1UPXA 2CV2A 1YB7A 2YJ4A 3HCNA 4Y6RA 3WHLA 2YNMC 2PKCA 1JMYA 1TJNA 3LGSA 4Z7JA 1LW7A 3U9SA 3VGJA 5E6RA 5EZYF 4CFZA 5EZ5A 3R0IA 1Q0ZA 3J7AC 3K9GA 4DN6A 2B8NA 1EZ4A 2X23A 1YB5A 4LGCA 1G98A 4JY7A 3BILA 2E4ZA 1OFTA 3MILA 3Q5DA 4FHEA 3BWDD 3Q12A 4FYWA 4I4NA 2YBDA 4ITUA 4KEAA 1EAMA 1BN7A 3Q0EA 4NZMA 4P98A 1YUBA 3H9GA 1FRNA 3FSGD 3GLFB 3ASYA 3I2KA 3INGA 5BQOA 2Z2ZA 1E3DA 3WISA 5DFAA 3LDAA 1ZEMA 2WTNA 3D8TA 1UFKA 3U7QA 3CRZA 5C80A 4BJ6A 3QUTA 3GARA 3KYCB 4L4SA 4U8HA 5JZ9A 4QJ4A 4WMLA 3V6MA 1JE0A 3FVTA 1TQ2A 2OM6A 2V7WA 1EJ6A 1XO1A 1QF7A 2JL1A 4LNHA 5C7OO 4IY1A 3CE6A 4HNQA 2DY0A 3IULA 4L8FA 2YFHA 4D41A 4MV9A 4QIHA 1YASA 2PFGA 5DM0A 2LCIA 2V0CA 2H8KA 4XIJA 4KH1A 1JEYA 3LUDA 1YJ8A 2QSUA 1CUDA 1LC0A 2RC6A 1LXCA 5CNIA 1WHSA 1JVSA 4EHFA 1SU4A 2IXDA 3OETA 4MUIA 5EHQA 4JUIA 4M22A 1YOBA 2NO7A 4QPPA 2AG5A 3M33A 3AKEA 3HCOA 1Y9EA 1EDEA 4ZIRB 3E3NA 2X9QA 3K0CC 3FD8A 3BJRA 1S8AA 2HNAA 4R1UA 3SJAA 3SEZA 4OREX 1TMKA 5DHQA 1ETUA 3L5KA 1ADGA 2WD9A 2XMPA 3D0QA 3ZKWA 2A8YA 3NBZC 2C94A 5D5QA 1YQDA 2J6CA 4CMJA 3RABA 1LVUA 3JS5A 5DB4A 1SRRA 3DOIA 3GRUA 1JU3A 2DLDA 2PLWA 3U49A 3V1TC 5DM60 3DR5A 1Z56C 2DGDA 2WD7B 4FYXA 3ESRA 2BGLA 3AXSA 3IUSA 3KLNA 3MTIA 3RVMA 4D26A 3EPHA 4U9IS 1Z5VA 3I1JA 1IJKA 4UE3S 3W8RA 4S1VA 4O2BB 1Z4PX 4O4HF 3SJBA 3F5FA 5IDQA 3M82A 4G0NA 4LW8A 4O3MA 3L7AA 1PWXA 3FNBA 3HWRA 1YMUA 3MFYA 3WADA 1L7DA 4HPWA 5GY7A 1W44A 3DBLA 1FA9A 2LCFA 3FWYA 4CL0A 3Q8KA 4DAEA 1Y8QA 3I05A 2E89A 1BE0A 2NPIA 2V7VA 3OFKA 5DM70 4JBLA 3PC2A 1ZGJA 2XRMA 1LLFA 1EHYA 2NO4A 1OFIA 2VA9A 4Y2XA 3SMVA 1M8FA 4FGKA 2IYXA 4L9AA 2C1XA 2CSUA 4L0QA 1W4LA 2VYFA 3SYLA 3E6AA 3M70A 1E9CA 1PG5A 1RMTA 3C5CA 2XOKD 3N1UA 2VP2A 2V6JA 2PPLA 3FKSA 1YIOA 2ZPAA 4GUAA 4JIMA 1M8KA 1YJ5A 1IONA 1DBPA 1PK7A 1QAOA 3KC2A 3SHVA 1EGAA 1EUDA 4P7KA 4S0ZA 5AJYA 5FH9A 3TLKA 1MENA 4XXHA 1FUKA 1TM5E 1XCBA 4QGBA 2XZOA 2IFTA 5FV7A 3VPDA 5JR3A 2ENUA 2ZRMA 1QJ4A 2EFDB 2CLOB 1T0JB 3WL3A 5BUSA 2PL1A 1WCWA 1GGVA 4H7KA 2XD4A 3PHLA 1N32B 5DF1A 1CPYA 1XVLA 1CDDA 4OI2A 1PS8A 1EG2A 1YZGA 2ZPTX 3JQ6A 4K9MA 3QE2A 1JTEA 5K1ZA 2HBQA 1IHPA 3NXKA 4O2AA 1JMKC 1GT91 1O7JA 1TUEA 2C5LA 1LBQA 2Q5HA 2PGLA 4OM7A 1T5BA 5I6DA 1IB6A 4DGSA 5CMLA 2IQIA 1XJ0A 1K68A 1NOJA 2J3MA 3E53A 3PHBE 4KW7A 4G0UA 3HJBA 3OESA 1EB8A 1GAWA 2P9JA 2W00A 3CF6R 4GYKA 3U3MA 2A35A 2Q6IA 2VJYA 1S4MA 4OXYA 2VSXA 4TV9B 5CVUA 1MFZA 3SHWA