3C6QA

Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
305
structure length
305
Chain Sequence
MLTIGVIGKSVHPYWSQVEQGVKAAGKALGVDTKFFVPQKCDINAQLQMLESFIAEGVNGIAIAPSDPTAVIPTIKKALEMGIPVVTLDTDSPDSGRYVYIGTDNYQAGYTAGLIMKELLGGKGKVVIGTGSLTAMNSLQRIQGFKDAIKDSEIEIVDILNDCEDGARAVSLAEAALNAHPDLDAFFGVYAYNGPAQALVVKNAGKVGKVKIVCFDTTPDILQYVKEGVIQATMGQRPYMMGYLSVTVLYLMNKIGVQNTLMMLPKVKVDGKVDYVIDTGVDVVTPENLDEYLKKMEELGIPIKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Sugar ABC transporter, periplasmic sugar-binding protein
publication title Open to closed transition of a thermophilic glucose binding protein
rcsb
source organism Thermotoga maritima
total genus 108
structure length 305
sequence length 305
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c6qA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c6qA01
1DC7A 3R0JA 3O1JC 4YO7A 1ISRA 3GBPA 2JB9A 1F4VA 3MM4A 4Q6WA 3RVJA 2WJWA 4XASA 1IIBA 4YWHA 1LJUA 2JVJA 1Z2DA 3NNSA 3TMYA 3VNBA 2QXYA 2IOYA 3H5IA 4ETMA 3O1HB 3L6UA 2LIVA 2RJOA 2NT4A 4H3HB 1C0EA 2QR3A 2FMIA 1M2FA 3DGEC 3QX9A 1Z15A 3W9SA 1ZGZA 1JDNA 4LE1A 4O1HA 3KCNA 3CZ5A 4KVFA 4OATA 4RY8A 1YIOA 3SAJA 6CHYA 1VRVA 4IF4A 1NXOA 3F6CA 3Q15C 3HK2A 3C97A 3BILA 1UDRA 1R8JA 1ZESA 2FKAA 3FDFA 3DGFC 2FLWA 4NICA 3IP5A 4MS4B 1LBHA 3KG2A 1TVMA 3S99A 1F51E 1BAPA 4Q7EA 4EYOA 2JBAB 2LUOA 3OLZA 1PNRA 5CNMA 5DKFA 1BA2A 9ABPA 5JNTA 2VK2A 2A9OA 1BDIA 3FGZA 4MR7B 5T3YA 3HVRA 2FMKA 2E4UA 4G0OA 4RXUA 3ROTA 4E7PA 3CRNA 1E2BA 2MSWA 5TQ0B 3EJWA 3OLWA 3SG0A 5KQLA 3HJFA 1GCAA 2FLKA 1NXTA 2KYRA 3RVPA 3LUHA 3N53A 3LUGA 3F73A 1ZDMA 1Z26A 1D5WA 1KRWA 4N47A 4PZ0A 2HQRA 1QNLA 3TX6A 3QEMB 3QLUA 4MGEA 5IUNC 5IUKC 3RH0A 1XHEA 3OLVA 1ZGGA 3DZDA 2E4ZA 3H5OA 1JBEA 4F8JA 3T38A 3CG4A 4EVQA 4OTZA 4EVRA 4YV7A 3EQ2A 4MR9A 2PUEA 3HDVA 1DBPA 2PL9A 4WXEA 3OO1A 3JVDA 3K9CA 5HSGA 4JB2A 2IKSA 4W5TA 4IGAA 1YMUA 3JS5A 3HM9A 5GQSA 2FSPA 2X7XA 3CTPA 5B3JA 4F12A 4W5NA 5FWXB 1BDHA 3O2QB 5IBQA 5TQ2B 3BRQA 2QZJA 3QX8A 3CS3A 4RK1A 4Z4EA 2QSJA 3CKMA 5KI6A 5KWSA 1TLFA 5CNKA 1T34A 3JVIA 1P2FA 4GNRA 4ZMRA 2QVGA 3CFYA 5E3JA 3O21A 1ABFA 1ABEA 1C4WA 4RKQA 2ID7A 5EWJA 1LJLA 2FN9A 3A3KA 1EAYA 2MYUA 4KK3A 1AB5A 4P98A 5CNIA 1B00A 2FQXA 4QYMA 2FQYA 1MVOA 3LFTA 4KQ9A 4Z9AA 5T7BA 4KQCA 2DRIA 4LE2A 4Z9BA 5EWLB 3QLUC 5FWYB 3ILHA 2GWRA 1SXGA 3JPWA 1VKRA 1DZ3A 3LKBA 4EYGA 1QP7A 5HKOA 4M88A 3LOPA 5TPWA 4O1IA 5FBHA 1E6MA 3F6PA 3G85A 3IPCA 1EHCA 1Y1LA 2OQRA 3BREA 4MPTA 5KC8A 3CG0A 1QMPA 2ZAYA 3HCWA 2W42A 4XXHA 4EY3A 5B3JC 4YLEA 2RJNA 1JLKA 5BQ3A 5KQPA 2FTKE 1RXIA 2NZVG 3KLNA 4MQEA 2E4WA 2L18A 5TPZA 3GBVA 1JDPA 2FEWB 4UHJA 3GA5A 4PICA 3NHZA 4PYRA 2PUDA 3HSYA 2MYPA 5EWLA 3TO5A 3K4HA 1QO0A 2F8SA 5DLEA 1DCKA 1JL3A 4YCSA 2LP4Y 3RVRA 1ZHHA 4KPYA 4TLLB 2VUIB 1I3CA 3H1EA 4LZLA 4Z4FA 3MF4A 2PUGA 3KHTA 3VNAA 4WT7A 4NCBA 3HDGA 1XHFA 1NXPA 2PJUA 3H5WA 1YS7A 3KLOA 3C3KA 3O1IC 4MYRA 5KC9A 1TMYA 3P9YA 3ROFA 3D8UA 1U2PA 2J48A 3DLBA 3URMA 2LBPA 2PE5A 4L4UA 2PLNA 1PEYA 4MS1B 4RWEA 4RK5A 3EODA 3E3MA 3RVKA 8ABPA 1PHRA 4PE5B 2E4VA 3GRCA 3B2NA 3IP7A 5EWMB 2AYXA 2E4YA 3NBMA 4G0XA 2JK1A 3RVOA 3LUFA 4RZSA 3CNBA 1APBA 2TMYA 1L5ZA 1Z12A 1YMVA 2A9RA 4NCAA 1JHZA 1Z18A 2YHAA 4YR7A 2JRLA 4MR8B 2NZUG 4KV7A 2PUAA 1PUXA 2JVKA 3C3MA 2FMFA 3O74A 3CZCA 4MRMB 4IMJB 3RVMA 3N6VA 3NNNA 3Q7RA 3UK0A 1RXEA 4IILA 3KYJB 2LPMA 3I42A 3MIZA 4OBBA 2GKGA 4RK4A 5FBKA 2WRZA 1JX6A 1OXBB 2XDYA 1MAVA 3H5VA 5JS1A 4N0QA 5IX8A 3OQOA 2B4AA 4MLCA 4UHKA 4N0PA 4MS4A 4WUTA 4G0QA 4G0ZA 3IPAA 3IP6A 4Z4IA 1J56A 1LBIA 2PMCA 1D2AA 2JBAA 1M2EA 3N8IA 1SRRA 3QELB 3QLTA 5F64A 2F8TA 1ISSA 1NXSA 3N0RA 2ZWMA 4KFCA 1DP4A 3EQZA 1QP0A 4TLMB 3RVNA 5JNWA 4MR7A 4WXMA 4RSMA 2WJAA 5JNVA 2WY2D 3RVLA 5TQ0A 4G86A 5GOTA 3GT7A 1GUDA 4LRQA 1JYFA 3EGCA 3T8YA 3RVSA 4F3TA 1FFGA 1XWWA 4EGSA 3MA0A 2MYTA 2PUFA 4G97A 4KREA 2M1ZA 2I6FA 3FFWA 3N75A 5KQGA 2L19A 3QEMA 4D6XA 4Z0NA 1DJMA 4EVSA 3Q7TA 1ZH2A 4LDAA 5TQJA 4RDCA 3MYYA 3FMVA 3KKEA 1A2OA 5IEBA 1ZAYA 3M6MD 3RQIA 4DADA 5BRAA 4F11A 2IDMA 3LUKA 4IRXA 3OQNA 1K68A 1Z2EA 1LK0A 2FXIA 1KRXA 1AB6A 5JNUA 1EFAA 1GUBA 5FWXA 5TQ2A 1ZITA 3OLXA 5CHYA 3H6GA 4EUKA 1FFWA 5IUJC 1E6KA 1M5UA 3LUCA 3LUDA 5DCLA 3O2SB 3EAFA 3SNKA 4N76A 1PNTA 4QICA 3MMNA 2V0NA 2PL1A 4ZJPA 2NUBA 4RV5A 4RXMA 1MIHA 2P4UA 1JYEA 5HQJA 1NY5A 1QQAA 5D2CA 4KRFA 2FEKA 3FFTA 1ZVVA 2OENG 1EWKA 1USKA 4O5AA 1JFTA 4HNSA 3CLKA 3OMWA 5IC5A 4LDZA 5DGCA 4Y9TA 1FFSA 5FWYA 5CNJA 2R4QA 4W5OA 5HM6A 1VLZA 3LUJA 3OM1A 2IPAB 3MQ4A 4D6YA 1NATA 3F7NA 3OMXA 4Z4GA 2PAFA 3N0WA 1RNLA 1S8NA 4FE4A 2ID9A 2A9PA 4EYKA 1QPZA 4OLAA 2RGYA 1USGA 4N41A 1CHNA 3UKJA 5BR1A 3BRSA 1QKKA 3C6QA 1SD5A 3H1FA 3C3WA 1KMIY 5TE9A 1RPJA 2QVCA 4JB0A 4QYWA 1L5YA 2GX6A 3TD9A 3GL9A 4DQDA 3RVQA 1YK0A 2B1JA 1Z17A 4E7OA 1H9CA 4EYQA 1HEYA 1YK1A 4RXTA 3JY6A 4WZZA 3HV2A 3OLYA 4D74A 2IYNA 3A10A 4JOQA 4ETNA 3H75A 1QP4A 3GYBA 4HNQA 1DBWA 3G1WA 1FQWA 3L49A 4XFKA 4JASB 1GLGA 2GI4A 5TPZD 1YS6A 4ZYLA 3T95A 3DLHA 3SM9A 1SXHA 3LKVA 3Q7SA 1QO0D 1A0OA 2JVIA 3D02A 4NQRA 1RZRA 3KTOA 4N03A 1NXVA 1JFVA 2FMHA 5JS2A 4ETIA 1A04A 1BDJA 3GWGA 1K66A 2A9QA 1PEAA 3M9WA 4KK4A 3Q41A 4MS1A 3I09A 4XAQA 4MQFB 5IEJA 5C5CA 3JTEA 1URPA 2IPMA 4XARA 2NT3A 4KNYA 4W5RA 1Z25A 1DBQA 2MSLA 4MLDA 4TMYA 5EWMA 1CYEA 1TM2A 1MB3A 3IDOA 3TB6A 2N9UA 4H3KB 2QU7A 2IPNA 4YS6A 2HSGA 2WB4A 1NTRA 2MYNA 1VPWA 1U2QA 3FFXA 4RKRA 4MR8A 4ML3A 4MR9B 2BGGA 4Z4CA 1D1PA 4KMRA 2M98A 4F06A 5I4CA 4MRMA 3QK7A 1JH9A 2HQBA 1DRJA 2L2QA 5ABPA 3HUUA 1YTUA 3HXMA 4MQFA 2RDMA 3SQNA 1U8TA 3CHYA 4JP1A 2FQWA 3ILYA 3H5TA 3SY8A 4IMIB 5DTEA 4HYEA 1RZRD 4Z4HA 4OLBA 2IPLA 5C5EA 3GV0A 7ABPA 1FSPA 2FVYA 2R47A 4YP9A 4YGXB 4Q6BA 2CD7A 3A0UA 4YRZA 2VYCA 3QELA 4WWHA 2R25B 1TJYA 3LUAA 4B09A 4QPJC 1BVHA 1USIA 3H6HA 2JCGA 1Z16A 4RY9A 4P1ZA 4XLTA 2GBPA 5EWJB 2MSKA 3BBLA 4NV3A 4DN6A 1JWLA 2FEPA 1P6UA 2CHFA 4L85A 1M5TA 3IP9A 5JNRA 4JAVC 4FB4A 1D4ZA 3EULA 4MS3B 1P8AA 3NHMA 1NXWA 6ABPA 4LX8A 3HZHA 3QLVA 1Z13A 3UUGA 2E4XA 1EWVA 2PUCA 1JF8A 2HPHA 2P9HA 1NXXA 4ZPJA 4G0MA 3EDCA 2PKXA 1W9HA 5TPWB 2AYZA 2L17A 1U0SY 4RS3A 3HO1A 3OO0A 1WETA 4RY0A 4RK6A 5BRJA 2QW1A 1ZN2A 2WMYA 2H0AA 4MAAA 2O20A 2QV0A 3O2JA 4JA2A 4KZKA 1OXKB 2Q5CA 4RK7A 1SXIA 5KQMA 3KYIB 3KSMA 3M9XA 4HNRA 4OG2A 3N0XA 3Q9SA 3LTEA 3OM0A 4MQEB 4S04A 3T6KA 1JFSA 3CU5A 2YHBA 4MS3A 4GPAA 3KS9A 4RU1A 3A0RB 1EWTA 2FN8A 2PUBA 4TN5A 4W5QA 3H1GA 3KJXA 3JPYA 1GCGA 1DRKA 4G0YA 4CBVA 2CWDA 5IULC 3OQMA 1W25A 1D1QA 2CHEA 4LE0A 3HEBA 1MB0A 2WWVD 4G0PA 4H60A 1DCMA 3LMKA 1U04A 1E6LA 5PNTA 4FE7A 3E61A 1QQBA 1ZY2A 1DC8A 2FW0A 1KGSA 1P6QA 3QLVC 2HJ9A 3DBIA 3NNDA 1CEYA 2H3HA 2R48A 3QEKA 3HUTA 3I5AA 5JNSA 1ZH4A 3H5LA 4PEVA 3I45A 4RK0A 4ZMSA 1DCFA 1DG9A 5ED4A 2HQOA 3HS3A 1YVUA 4Z99A 2VUHB 3O75A 4S05A
chains in the Genus database with same CATH superfamily
3TRIA 4WSOA 2JB9A 1KJ8A 2O2ZA 5GONB 2ZT7A 4EARA 1ZIDA 4OJYA 1K7YA 3C85A 1JJ7A 2RK6A 2RGNC 3KEOA 1JECA 5BN3B 2JH9A 5IF9A 5JZMA 4JXZA 2PSEA 1PV4A 5JADA 1L7PA 5D6OA 3WLAA 4DQKA 4RFSA 2FSGA 1WSDA 2O9JA 3QSYA 5IHXA 3RJTA 2QZ9A 2QR3A 5H82A 2RGDA 2W8BB 2PSJA 3QX9A 1EFTA 1VHWA 2HC9A 3V4SA 2R4UA 3I0ZA 2AXEA 1TMKA 2FZKA 3VR1A 1EGMB 3A9UA 2PKQO 1QFSA 4OQMA 3G0CA 3ZBUA 1VRVA 2NYUA 2ANBA 4PRLA 2QVLA 1XPRA 5KAMA 2J9XB 5EP2A 3T12A 2NNWB 1U1GA 2AD5A 2H92A 5LA6F 4X41A 4MPJA 1N5IA 2WKPA 5JDIA 1DAKA 1F51E 1KQPA 1TNDA 2Q4OA 3V8VA 4ERXA 4PLCA 4TVSA 1M6YA 2FWJA 1V3TA 2RGAA 3A11A 2BF7A 3AP2A 3D4BA 5EL0A 2HDHA 1CWUA 2WNSA 3GJ5A 2AJCA 1T36A 2NZWA 3PWKA 1DC5A 1XFAA 3ZEAA 4YJHB 1NY6A 2EEZA 2EP5A 3CRNA 1J5XA 1ZM2A 1T1JA 4R3UC 1AA9A 3K1AA 4C5AA 4GZ6A 4ZYWA 5IH7A 5LMUB 3U3OA 4TL8A 2X0IA 1X8KA 1N2ZA 3TSCA 2Q3HA 2EARA 2RHWA 3ZK7A 1I6KA 3BT7A 3FMIA 1F8YA 1JSLA 1NWHA 4IX1A 4ITUA 3NHSA 1VLJA 3AU8A 5REQB 1O3YA 1X87A 1LVUA 1DB3A 3ZUPA 1Q0PA 4E4TA 1JQ5A 3B6KA 3THXA 5TR9A 5IUNC 4AJIA 5INTA 1XCLA 1OIVA 2VNJA 1WMSA 2RC6A 3OLVA 2FZ5A 2VPXA 1ZGGA 3BZBA 1NPDA 3FDJA 5DT2A 4D3YA 5K0FA 4KEAA 2E4ZA 4WKOA 2C9BA 1SC3A 2YZ7A 2WIAA 5B7PA 5IC4A 1RFGE 2CJPA 1JU3A 3TLZA 1QTNA 1CLEA 2BN4A 3D2LA 1VI5A 3IVGA 2DGDA 2YJTD 3WA6A 3Q7EA 5I7HA 1QO7A 4TYNA 1W581 2COKA 4IGAA 5L7WA 1J0AA 2QX6A 2PMFA 2FEMA 2J85A 3CBGA 1D0IA 4HH0A 2UDPA 2O1EA 4R84A 1ODSA 5JAOA 3LHIA 2HL6A 4IDNA 3L0ZA 2FUKA 3M5PA 1C30B 3G7NA 4RQUA 5CLQA 2WM2A 1DX6A 1IHUA 4WN9A 2WAOA 3PR3A 4DLKA 3JVIA 4XQCA 3M3PA 1EQAA 5H81A 1RAGA 2IYYA 2JCBA 4DZRA 3T4PA 2O59A 1ZCBA 3D6NB 3H8SA 1FFCA 4NX2A 5EWJA 3GJRA 1GTRA 4M7RA 2XBMA 1O95D 4YT4A 5T4EA 4OFBA 2F9FA 2P3SA 3GIWA 2HY7A 4QO8A 1RQGA 4AJHA 4DDKA 4J1TA 2DSTA 5FUMA 1LSUA 2IEAA 2ZB2A 4XB1A 4DJTA 4YYEA 3K16A 4PQEA 1HMYA 1KI3A 1XAHA 4C6HA 1RRCA 4X3OA 3LY5A 4JI3B 4IXWA 2R5NA 4BX0A 2AEMA 1H8HA 1I2ZA 3LOPA 1VIYA 4FS3A 4TT3A 2V55B 3O4GA 1AK1A 2OCXA 3RBXA 4EY6A 4QM6A 2I1WA 1EFLA 3KB1A 1UP6A 3EIFA 1Q7BA 4MGYR 3BREA 4Q9AA 2JLVA 3QKSA 3HCWA 4AKTA 1PYDA 5TJHA 3EZ2A 5ALEA 4CM8B 1V11B 3OTGA 5E6SA 1LNQA 3CVWA 2QUBA 5K3AA 3L1UA 1KZHA 4AMZA 5TPZA 3R7FA 5B7NA 3SF0A 1O97C 1RC8A 4FEYA 3GLVA 5J2UA 1O9BA 2B4TO 1JHXA 2IJGX 3HJTA 3C87A 4CHGA 2O2SA 3ZOKA 4LGYA 1SJ9A 4D9CA 3E4CA 3QA3E 3ZWVA 4KGVA 3TNFA 1QH1B 3BWMA 4C05A 4V0OA 3NPMA 3CRZA 3NC1C 2ALJA 3DNMA 5I8ZA 1MZVA 1PR2A 2NPIA 3DTVD 2Q7XA 1MW8X 4JB3A 3QBDA 1L7DA 2PJUA 3CF4G 3KLOA 2I7XA 4YUXA 1RZVA 2Y99A 2P1DA 4CDMA 5LJLA 3G82C 3DLBA 1CY2A 1QGOA 3FHOA 3LWZA 4IDOA 4ND6A 2PQ2A 3ACCA 3SR3A 5KREA 2BOVA 1PEYA 3EHEA 4ZOQI 4H15A 4JP5A 1E2UA 2EFEB 2VXBA 3K2EA 4GPTA 5MN4A 1VYTA 3UWPA 2BGTA 3LKZA 3EG5A 1QG4A 1KVRA 5CVUA 2HRDA 3D7LA 3PXGA 3VPSA 3U61B 4C30A 2GEDA 5U4QA 1WV1A 3SF8B 3S81A 3KBBA 3F6EX 4GM1A 2D0DA 4C2BA 3IODA 1JQDA 3DT9A 3CY6A 2ORIA 3MD0A 2X19A 4I6EA 1WHSA 2PUAA 2VHEA 3STUA 1Z5NA 4CTMA 1LSSA 3DD1A 1SKBA 1RKVA 3D3WB 4BZQA 5A4FS 1SQ0A 1Y8QB 3AM5A 3HI6A 2XADA 3N6VA 4ZAVA 4C7VA 4QD3A 4DLWA 4K2HA 2EHDA 2MIIA 3WFZA 1MRNA 2FPLA 4FYMA 3FR7A 3E0QA 1RZ3A 4DWVA 3KFLA 4M9SA 3D0OA 5DHRA 4HDOB 1HL3A 3WJAA 4F71A 3H5VA 1JSRA 3EMVA 3PSHA 1I80A 5DSZA 3RU2A 4EJSC 5IX8A 1Y48E 4JY7A 1V4BA 1E4YA 2EAUA 4LY9A 1PK7A 1BS9A 1K6IA 4GBJA 4JKOA 5F64A 1NVKA 3OJLA 4Q3OA 5DVZA 1KYVA 2W11A 1TQ4A 4A6DA 2QN2A 1NYQA 3IFSA 2JGKA 2IHJA 1QP0A 3GDOA 4MWBA 2XUIA 3S8YA 4M87A 3V9PA 5B12A 4HJXA 4HXYA 4X8LA 1DMSA 3WQBA 4IP0A 4CV3A 1C9JA 3AL3A 4OJTA 2IBTA 2HT1A 1NW4A 1Y5RA 3A6KA 2AQ8A 4XM0A 4NAHA 4YCNA 1JNYA 3I9NA 3G0IA 5LP6B 4HCJA 2B30A 2AE2A 4BFTA 3HCNA 3FBGA 2WV9A 2EATA 2GTHA 2Q2WA 3MA0A 3O9ZA 5P21A 1AUVA 3RFFA 1JVNA 4HR7A 1T5SA 3ZE0B 3F6BX 3HXKA 1II8B 2OP0A 2R6CA 1JG6A 5E6RA 3RLIA 5EZ5A 3V1KA 4JLOA 5IJ9B 3KXLA 3O5AA 1C80A 1XPUA 3P9ZA 2EL7A 3VV2A 2A9FA 4GPZA 5HRAA 3PUYA 1W5EA 2OGZA 5DI9A 3FF1A 3IBSA 4B6JA 5IVHA 2GNAA 4CODB 3FMVA 5FRDA 3KKEA 2QLMA 4F8YA 2RIRA 5EZYF 1LS1A 3I04A 4CGYA 2V6JA 1ZAYA 4RPGA 2DWPA 4MRVA 1WXFA 1YVEI 2PT9A 3DZBA 2EGUA 3Q40A 3L0OA 4GOXA 4Z8XA 4V2UA 1VE1A 5JXHA 1LDNA 1NUAA 3QVOA 4RSGA 1YDGA 5JH7A 4S0XA 5HUQA 1U98A 1ZM7A 3U9LA 4BJ5A 3FYTA 3NV9A 4IQGA 5HKKA 1V16A 3KYBA 3H8WA 3OHSX 2PJRA 1OLSA 2PXHA 2NTYC 1KDOA 2CK3A 3G9UA 4GYWA 1Z4OA 5JU6A 5JYBA 3EAFA 2A4KA 3HB0A 3K8YA 4FQ5A 3GUCA 3WWEA 3M83A 1HDZA 4C3OB 1BMQA 1N5DA 2Q4TA 2BTQA 2ZYRA 3ESDA 4TMXA 2R6JA 1B1AA 3Q3CA 1JI0A 1QE5A 4LNUA 3AK4A 2IUFA 3R7AA 4MQMA 4MB0A 2JH8A 2ZRLA 4H27A 2BFMA 4N3BA 5EVCA 3KSAC 3MS7A 1D5CA 1RAIA 4N5IX 2DHDA 3EXEB 3TTWA 1G98A 3KYCA 2X7HA 3QKUA 5KYTA 4D4JA 3CLKA 3K1TA 4GL4A 4A0GA 4B82A 1ISIA 3NM4A 4BNKA 2VQ6A 3L40A 1WXQA 1MRSA 1C9YA 2D4HA 5AUPB 4D6YA 1W1UA 5ERYA 2PR2A 3FI0A 4I1PA 3UENA 1S7GA 3COZA 1G20A 2PGDA 1XDUA 4QQ8A 4X92A 3RK1A 1QPZA 5ITWA 1Y98A 2B5OA 3FF4A 1JS1X 4DJFC 1KBQA 2GD2A 4YROA 3C6QA 4ER3A 1VBFA 5CEEA 1ADFA 1QF6A 1RRGA 2FWAA 1V6AA 2O8DA 2ZRDA 1RPJA 1M0TA 2QVCA 5IM4F 1L5YA 1DLIA 1DV2A 5F78A 4DQDA 4JJAA 5B7QA 2M6SA 1K4YA 4F3NA 3FMPB 3DVQX 1HEYA 1C0LA 2C8KA 2HA0A 2Y0BA 3EC1A 3P0RA 4NG5A 5I8WA 1WSWA 4Y9SA 1CP2A 1UC9A 3I8OA 1BVUA 4LXXA 4RD3A 4RD4A 3KWJA 2QE7D 4C4PA 2R4TA 2AMYA 2AVDA 3MWFA 4KQXA 1CP3A 1TQ6A 1PV2A 4RF5A 4BV9A 2HV9A 4ETWA 2GI4A 1IHDA 4PQYA 3EISA 4GD3Q 4K9LA 3L79A 4QELA 1E1KA 1SOUA 1WZ2A 2R86A 5JCJA 3EXFB 1QX4A 1KJQA 3RU7A 1AC5A 2LDBA 1KH2A 2RHOA 1U8ZA 2V5AA 3BWVA 3KR9A 2J9FB 2KBFA 2Y3IA 4WIAA 1R5NA 3UUEA 3U6BA 3I62A 3ZU4A 1ANKA 1YB4A 2NO7A 4BVJA 1Z2NX 3SJAA 3SYMA 3U19A 3AYXB 1VPDA 2DKFA 4XPIA 5DTQA 4DA6A 5KYVA 3ZWKA 3GWGA 1K66A 4MTLA 3G0OA 2P8SA 3AESA 1PFGA 2J09A 1J8FA 3OX2A 4KR7A 1UC4B 4GM0A 1E3SA 3CINA 1ABBA 1ZK2A 3FPKA 1VKNA 2WUFA 2YOGA 4Y6PA 3S3TA 2JLSA 3CLUD 4CR7A 4KPGA 4NMLA 1D4OA 3IP1A 4UJ3A 4Y1EA 3VH4A 2EYQA 2HHLA 2II6A 5D7NA 2RH8A 1VPWA 5D1NA 3ROQA 3SIPA 3V2IA 2CV0A 1B8UA 5KTTA 4DSOA 5F35A 2FHSA 5DWQA 4LYJA 4X8HA 4M1QA 5E7IA 1RM0A 1KZ4A 1CIVA 1TUIA 3DVSX 4MQ6A 4BXOB 1FF9A 1GPDG 2Z2KA 4TKZA 4F5ZA 1A9RA 5EUMA 1YI1A 1NVTA 1CK4A 4RAQA 1FTSA 8MHTA 1FEZA 2QS9A 4ZO4A 5IP5A 2GAIA 1FFHA 2IPLA 3A4VA 3DKRA 4RGBA 4TRMA 1K7CA 3AEUB 5ESRA 2JD2A 4YGXB 5GM2A 2PRIA 1FTWA 1Q57A 2ZDHA 3MJVA 1GGNA 4L5IA 1JRLA 5HZGA 3FNGA 4E33A 2YWBA 5KQRA 3IUJA 4GOLD 3ESCA 3KAQA 1ESCA 2HAEA 2JCGA 4BQOA 1FRVA 1TM4E 3U4QA 1BMDA 3ZWCA 3FTEA 2ZGVA 3B9QA 3IAHA 1C4KA 1SPBS 5D3QA 4DN6A 3PWTA 4X45A 1HDEA 1RAHA 2GYUA 2PANA 2RGBA 3GFOA 3PU6A 1E9AA 1FX0A 1V5GA 2PUCA 2EIXA 5DIZA 2JGFA 1KC3A 3H83A 3CZQA 3EDCA 3K8OE 4OQNA 3W2EA 4S1TA 3RWBA 3E1SA 3ESBA 1KERA 2JEOA 3AETA 3I05A 2XZLA 2VRCD 1CQJA 4URUR 1N2CA 2O2XA 2H2WA 3PVZA 5HF5A 4BZWA 4BFLA 2Q5EA 5BRJA 3CVVA 5GVSA 2WMYA 3QKRB 1RPNA 1XAJA 3WAKA 3E05A 5KQMA 1OXKB 1XEFA 5IN5A 4BQIA 2WICA 2Q8QA 4MVJA 1HF3A 3ITDA 3PNVA 2QM0A 4NCIA 5IC6A 4RLFA 4UM7A 2C7GA 4R7ZA 3CF4A 3TQCA 1FJGB 2X2PA 2I3AA 3QYPA 1O8BA 4MS3A 3KS9A 1RPZA 3MCVA 1A95A 1OFUX 2AEFA 2HK7A 1YO6A 2P30A 3QI7A 5GP1A 4DPKA 3THWB 3B48A 5AUQA 4DG5A 1T25A 2IHZA 1RWNA 4NBKA 2C2XA 1AVTA 4N48A 2GBFA 3ODPA 1NWCA 1R6UA 2QRNA 4IJKA 3ZE2B 5G4KA 4QZVA 3WGHA 1JLHA 1VM6A 2JI4A 4Q4HB 4AZTA 1P3JA 3GDFA 3U1BA 1DCMA 1E6LA 1D2GA 5EKUA 1TT5B 1D9ZA 1GKYA 3KOXA 3FVVA 3PENA 1FTYA 1OC4A 1SBHA 1U3CA 2VTDA 3HFGA 3M49A 3QLVC 5BMOA 1U28A 5CX1B 2EG5A 1QS0B 4XYBA 4DARA 4RDIA 2ZIAA 2E5LB 2VSXA 2Y2VA 4WFIA 3A3YA 2HQOA 4YFVA 1RHRA 2B20A 4CKWA 5IPFA 1UQUA 3HB7A 2AXPA 2IHVA 4YAIA 1IH8A 1CZHA 2BMEA 2O5RA 4MVJI 1U65A 2EQ5A 2NSYA 1NW3A 4CM9D 1SY7A 2C94A 5ALUA 1P2TA 1G21E 4N5NA 4EEZA 3V8MA 5ITVA 4V1CB 4B40A 2YBDA 4KAAA 2VPPA 1DBSA 5C35A 1MX3A 1N3LA 2JLRA 4DOMA 2VJMA 1NI4A 5TGDA 2JVJA 1ONBA 3GQBB 4IHQA 1OROA 1AKTA 2QIPA 3A1EA 1JU9A 5AIBA 4BWVA 1VBNA 1GZ6A 1IZ9A 1C2YA 3JASA 1KO7A 4YRTA 1ULBA 1NNLA 1XRRA 5C1BA 2OZLA 5J2TA 1X0VA 5AM5A 4BO8A 4P7FA 3NJ8A 3PR2B 4ESOA 4HB3A 4QYIB 1NRIA 1F2VA 1QF7A 4DLZA 4DCTA 1JKIA 1M33A 3R5FA 1SGWA 2EL9A 5I7UA 2OCGA 4PO1A 4N0MA 3GLRA 3N8HA 3Q15C 4QU0A 3W5VA 1XB2A 2PZBA 5KB3A 3PNPA 4TXMA 1LPMA 4B6SA 4MS4B 5IJAA 3AEQA 4XGIA 4JHLA 2RGGA 4GWGA 3L1IA 3C1OA 3M0EA 4IDCA 1E2MA 4MJ7A 3AKEA 4FFSA 1C9DB 3K92A 3AY7A 3ONWA 1MAUA 1KEVA 2PJDA 3G6KA 1QUEA 3QFFA 4HF7A 1PBTA 1GZ4A 3N7UA 1N6HA 1E0SA 3OAAA 1TEHA 4RMGA 5IAKA 3RREA 2RCNA 4S35A 4KW7A 3V4RA 3W8DA 5J4LA 2O8VA 1KYWA 3KAKA 3M33A 3MJRA 3S1AA 4EW2A 3EXG1 1GCAA 3JALB 2JGJA 3KKQA 3RC9A 4QPNA 4KN8A 1YDEA 1E6CA 1NW6A 2ERXA 3OMLA 1DXOA 3R5KA 3CCCA 1HWYA 2GASA 1TTHA 2ODBA 4NAUA 2G72A 4FWIB 5ALYA 1IXSB 2VPYA 4HH1A 1LPNA 3BAFA 2RH9B 3NUQA 4OM7A 4REQA 3BXHA 1GGJA 4WV3A 1U9IA 1SKYE 2AA3A 2Q6OA 1QTIA 1S1MA 3IUMA 1Z5VA 1VA4A 3EHDA 2JJYA 3QKTA 1DWQA 4IH9A 1JDJA 3ELWA 4EVQA 3OY7A 3AUSA 5E9AA 4E1BA 3ACBA 2DTDA 1P9RA 4NU5A 4OLFA 3ZIAD 2UZ4A 1J00A 5DMHA 3T7IA 3ZX5A 3GGDA 5K3DA 4UZSA 2IKSA 2E9SA 1I3MA 3JS5A 4FHDA 1FB5A 2DLCX 1X39A 1GPKA 2FNAA 3EOAI 4AMUA 3GLIB 3SX4A 1S01A 3OP1A 4E5NA 3U4MA 1Y6GA 1T0UA 3F6YA 2FPIA 4Q7MB 1Q1GA 3ET4A 2PZJA 4JVLA 2DKOA 1EZ4A 2G88A 3AL2A 4FMCF 4O4HA 1MU0A 1FU8A 3UPDA 1DPFA 3PQ6A 2AJLI 4HWRA 1GTVA 4WK6A 4GDMA 3ZZ0A 3AKZA 1I13A 3O21A 2Q6LA 3QPBA 1NNI1 3HN7A 3HCCA 3KU4A 4BUCA 5I48A 3DAFA 1P0IA 4KBYA 3ZY5A 5IJXA 2Z4RA 2EIHA 3P0IA 4BUJA 1JGTA 2FXVA 3OOSA 2WQZA 1MVOA 4KPUB 2FE4A 3ZWQA 2DRIA 5JAQA 1G9TA 2E89A 3AZOA 3W1VA 5JH7F 1ESZA 2I65A 4YRMA 3TTXA 1E1LA 3PHBE 2W2VA 3ICOA 5JECA 4NEGA 1BXRA 4M88A 4YJ3B 4YIKA 4Y1GA 4O2BB 3C3BA 5EHIA 1C2TA 2JFPA 2AKEA 3E84A 4F9GA 1YL6A 2R8RA 1UZNA 2H5JA 3H2BA 1DSSG 4WTOA 4EY3A 4KSCA 4XSGA 2NAPA 3A3PA 5FJIA 3ASZA 4HK4A 1DBVO 2NZVG 1GUYA 5JEDA 2FSSA 1KNXA 3HNPA 3KXIA 4S2UA 4QQKA 4WDRA 2P5TB 4FFPA 1M66A 1PLKA 4GOJA 4QX6A 4LRYA 3TO5A 1YB2A 1LV8A 2FUG1 3H16A 3NJ4A 3T3OA 5L4SA 1XOIA 2NSLA 1R6TA 1U7HA 1LU9A 2ATEA 1DEAA 4ZVOA 1WBBA 5BT9A 1DC3A 4HWPA 3MF4A 4C21A 4G01B 1QAOA 1G0NA 1EXMA 1UFKA 3QOXA 4WT7A 1L4HA 2VF5X 3T3EA 3W9YA 2I2DA 3H5WA 5AW9A 4BNTA 2ZJZA 4F60A 1CD5A 5KBYA 2WSIA 1KAHA 3ROFA 4YQYA 5TEVA 5IZCC 3FKQA 1T9KA 2O2YA 3TM5A 2VLIA 5E3IA 5EGSA 3RKRA 1RADA 4DVJA 1MUUA 1U4SA 2GD1O 1GAEO 3CLHA 5EZ6B 3D8BA 1EXNA 1I0ZA 4XYEA 5C3MA 3INYA 2WHEA 2DLNA 2GEUA 4PWZA 1NULA 4E2FA 2JLQA 1BCRB 2JAUA 1E4EA 8ABPA 4GNKA 1Y8CA 2VA9A 4OX9Y 1EX9A 3MWDA 1N6PA 1OASA 2I3DA 4OQPA 4WAUA 4BFWA 1SCQA 1RLMA 3O4VA 1VG9B 5FPHA 4RWZA 3BICA 1YMVA 4E11A 3KBOA 1JHZA 1TTQB 4E1AA 1PT5A 1H3NA 3G9QA 4DG8A 4OSEA 1PUXA 2XUOA 5FOQA 3AP1A 1NRJB 2BP7A 2OAP1 1X92A 3RM3A 1GRNA 2Q3EA 3M6WA 4UTRA 1X77A 3MVEA 4HKTA 1XAIA 2J41A 2JJ1A 3CZCA 4HWGA 4IMJB 4JEHA 3TLJA 4BB0A 1DI0A 5L45A 1RAAA 3VBCA 3SICE 4BNXA 1D8AA 3CO0S 5KYWA 3AVYA 1UKCA 4JC8A 4MV9A 3RC2A 3VPXA 3I42A 4NZMA 1VMIA 1VDZA 3CW2A 1JVBA 3EXIA 1QVZA 1IM2A 2JGLA 3SC2A 4UDXX 4Q3CA 1G8SA 1QB7A 3FDZA 4PZPA 4M2LA 1N75A 4PTZA 1RKQA 4N0PA 4QEDA 4TSKA 2ZJ6A 3UVEA 3W34A 2H1FA 2ZJYA 3FNQA 1LBIA 2P3OA 1HKHA 4IVNA 2JS7A 1SRRA 3GVHA 3Q5GA 4C0SA 2QUZA 3N2GA 4CTNA 2OBFA 2Q5FA 1IN7A 1IPHA 4CMAA 1VPEA 2NTNA 4LOHA 4H7IA 4UXJA 1NVXQ 2XV1A 3M1AA 3ZGZA 3UW3A 1E61A 2WU4A 5JD4A 1QRDA 2UZ0A 3D3JA 1ZVJA 4I0WB 2IH5A 4DREA 4IIJB 3NCTA 1NQVA 5GWXA 2Z98A 4Q7JB 2CT8A 1A9OA 2G5CA 1IBCA 3U44A 4B2IA 4DWOA 2MYTA 2WG1A 4UC0A 5C34B 2G71A 2M1ZA 1CS0A 2CNLA 2JLZA 1S02A 1Z7GA 4DUGD 4HT3B 2ZUFA 3R2JA 5BWLA 1YKSA 4D6XA 5EI5A 4TS9A 1U6KA 1N2GA 3DFFA 3GCZA 3S8EA 2LRHA 4AJKA 1NSTA 3L2OB 5FB3A 4OQQA 1U0OC 4ZGBA 4LOIA 1OXMA 3A4IA 3D5EA 3HCEA 3L07A 1PE0A 4XJXA 4RGVA 1XTBA 2ZJ4A 3EQ7A 1P7YA 1R50A 5BRAA 3VPBA 1BH6A 1DEOA 3MOIA 3R74A 1JWAB 5FA5A 4F3RA 1KJYA 2XTAA 4H7HA 3MHTA 2IXAA 1DOAA 4JEMA 2QUIA 1M75A 1MOSA 3ONEA 1XQVA 4QBGB 2QTBA 5GJVC 4NRDA 3WKBA 4HAXA 3LH5A 4QGFA 3ZBQA 1RHQA 2ORWA 5AJXA 5E8JA 1FFEA 1YR6A 4U2FA 5AICA 3FVRA 1W0CA 3FPLA 4U4AA 5HJ5A 4PHHA 3N3AC 4CJXA 4LCJA 5J3JA 4G5HA 4IXDA 2E0IA 3FYDA 3IT3A 2D1FA 3UMGA 5LMZA 5LWQA 5G1NA 1QC5A 2NSHA 2NU9B 2IQ5A 1RYNA 2CXXA 1NQAO 5ES3A 3WKEA 2PSFA 4BL5A 2NP7A 4MVJF 2DC1A 3OETA 4M22A 2CUKA 4M89A 2VSYA 2IK8A 1JQEA 3PITA 4WINA 4BB6A 1MGOA 5K3FB 5E8RA 3DE2X 1A97A 1ZM4A 1USKA 4K86A 4KQEA 2IL1A 4YX9A 1JFTA 4CR6A 2BMAA 2IEZA 2XA2A 4UARA 4B2PA 1DIHA 1UPAA 2IP4A 5DGCA 1GPBA 2WTEA 4NKRA 2DBQA 4U7WA 1KEPA 1RQLA 4IFEA 4YRSA 1M8KA 1JDTA 2IPAB 4DXHA 1G8GA 1NFQA 2F7SA 3RCBA 3JZFA 4MWSA 1DXYA 1WJGA 1FL9A 4RZ3A 3LD9A 1S8NA 1KNQA 1ZNXA 3DQQA 2ZUTA 4EYKA 5GM1A 1ZUWA 2PV7A 1V8PA 1BW9A 5CW1A 2QGFA 1MN6A 1LD3A 3CBQA 2GR9A 5F7JA 4TYQA 4PM4A 1KMIY 2Q3DA 3DW1X 4B3CA 4F86A 2WT4A 3M82A 1KP3A 1T5HX 2GX6A 1U90A 2B61A 3BXFA 1IOWA 3SQWA 3MGAA 4LNHA 4B6FA 4HQKA 4P86A 4CM1A 2WLTA 5FLKA 4IVPA 4MV4A 2QOEA 1D2EA 4BVGA 1J9EA 2O7RA 3KZKA 2HX1A 3DV0A 4DCGA 2ST1A 3AW9A 3LECA 1V9LA 4PRZA 4IUCS 5CEFA 1BU5A 3E1GA 3NZEA 3IC5A 5FTNA 5FV4A 1OVMA 1RXYA 1DC6A 3G59A 3VSEA 4L9WA 5KTMA 3VU9B 5LKRA 3W5CA 2DG2A 2FV8A 5JDCA 2AWOA 4JFAA 3D6MA 2DP4E 2GSWA 3O7MA 4KI7A 1JEEA 1T6XA 3ONNA 1LLQA 4E5YA 3KZXA 1QRRA 1B41A 3T3IA 3K6JA 3N0TA 3PQ2A 4J6EA 1JPJA 3U31A 2YNMD 3OCVA 2QRUA 4QAJA 4Y67A 4RPCA 5C8DA 2ORVA 2O57A 4MV8A 4TWJA 4X1KB 4X7PA 1BX0A 1CUYA 1JR3D 1PP4A 2ZIUB 3E58A 3FA2A 3OZSA 4Q3EA 2H7VA 2NT3A 4AKSA 5HE8A 1Z6YA 3T3PB 2J9GA 3PYXA 3AVPA 3NU1A 3QWIA 4QQRA 5BSVA 3MD9A 1H2YA 1YIDA 4KIGA 2EJTA 1TM2A 4P93A 5T57A 3WNCA 3ZEIA 4EHFA 2OCAA 2IPNA 4DDWA 3ZR4B 1VB3A 3EBLA 2A3RA 2OFOA 4YCBA 5T6MA 4RKRA 2HO4A 3PXDA 2F1RA 4IIYA 2Y1KA 3KV1A 4MR9B 5K7SA 1KKLA 1TQ8A 4D3FA 3MJTA 3JQFC 4TMTA 1M6EX 1AV7A 4MRMA 5F7XA 2BKXA 5ITZA 1CUBA 2H4JA 3E7WA 3P9CA 4JBWA 4NABA 1Z7YA 4LXTA 1FDUA 3AJ8A 1FMJA 4C5BA 1KDYA 1CR2A 1KIMA 4GL2A 4PG5A 3U13A 3X1XA 5E4JA 4RV9A 4OHCA 1LLUA 1Q21A 3MXTA 4WFJA 2UZ1A 4HYEA 1VYHA 3DQPA 4LHYA 5CA1F 2JJMA 3IEPA 2PYZA 2ZLBA 4PV7A 5FA8A 1F48A 3T1OA 2ZIVB 1KZ7B 3DOJA 4MYHA 3ZHRA 1HDRA 1U63A 3OCXA 4AZWA 5I51A 1IFXA 1W35A 2O7SA 4GMDA 4RJ2A 4DLBA 4UBMA 5JSZB 2RH5A 2QMUA 4GQAA 2X2OA 1ECPA 3VGPA 2V7EA 1KJJA 2FWMX 2JFZA 2WFZA 3B6IA 3KAJA 4LOJA 4QEZA 1Z08A 1V8BA 2EKPA 4HNVA 2R8BA 4EVIA 2OMEA 1P8AA 4BVFA 1G19A 4HNTA 2XNDD 3NT4A 3FGOA 3P0HA 5HCNA 3EK2A 3CLRD 3GPIA 4AG6A 2YJ6A 4L15A 5GMOA 1DO8A 1G4AE 3OJXA 2FPPB 2E4XA 4G4IA 1KH3A 3STVA 1JKFA 2WD7A 2IYQA 4KG7A 3EPPA 4ZCSA 1NXXA 2VHUA 1U3WA 2ZE8A 3KD3A 3M1IA 4RD6A 5HDQA 3TAHA 4J0EA 2IZ1A 3TDMA 4EENA 4O4HF 3LDAA 1IATA 4PZZA 2QW1A 1W4BA 1SCUA 5KMGB 2A33A 4HNAA 3V55A 3RBZA 3CR7A 3RS8A 3WB9A 3FYUC 3OHMA 5CDSA 5HFNA 2AZXA 2VAXA 2VPQA 4MQEB 4PSKA 2WG2A 3ORQA 3QE0A 1X38A 1JFSA 5KVSA 4Z54A 1V37A 2NV6A 4OL0A 4I1SA 2ZFUA 2I66A 2NPOA 2ZR8A 4JB8A 1NKTA 2O4UX 1FS6A 3WX0A 4ER6A 5ICGA 1HNXB 2P78A 3UFXB 3IIJA 3PEFA 1VIDA 4UD2A 3HNRA 2IBMA 4FFDA 4U00A 1NN3A 2FDRA 2AFIA 3D4PA 3BK1A 2EBHX 1N6OA 3UMBA 5CYGA 2PBLA 5CVCA 3FMGA 5DB4A 2Y76A 4J1QA 2WWVD 1W0KA 3QHPA 3P2JA 1JKJA 3GVPA 5I4KA 1TCBA 3L8EA 1MO3A 5K1ZA 2I99A 2H5EA 2PRYA 4QUAA 4ZVUA 1G55A 4MTCA 1JEJA 2Q8PA 2VJKA 3W8EA 4GVLA 5KPJA 3AC0A 3NANA 2CKDA 3HRIA 1H0KA 2OHVA 2YQZA 3ST7A 1WXDA 1I4LD 1ML4A 1I9GA 3DEHA 4KODA 1R4MA 4LC0A 1H4SA 1U6IA 2E85A 4Z9YA 1EB9A 4U6QA 2NYAA 5B1HA 3T5BA 2ECPA 3CJQA 1EUCA 5B4UA 4QDUA 3ITNA 5SY4A 5JPDA 4OQYA 4B3XA 3CEPB 2HWYA 1CZNA 1H3FA 4HWSA 2FKNA 3FUCA 3HQ4O 4E6EA 3LP6A 2MU1A 3PUJA 4M9ZA 4FDTA 5G1PA 2H63A 4D0RA 2ADMA 3AJ9A 3T1NA 5AVUA 1NM5A 2VYNA 2FJ0A 2XYRA 3I9KA 4UMVA 3VNBA 2D8MA 4ETMA 2CLHB 3C3CA 5IN4A 1XDBA 1GG2A 1LZKA 1Q1QA 1YRHA 2XIQA 1ZSYA 3EOZA 3UHPA 3AJDA 2P8JA 2WKSA 3DGEC 4D8VA 3LZ6A 3BSYA 3I3SR 1Z15A 4WOKA 4M9RA 1ADJA 4DM4A 4LE1A 3ABZA 5B37A 1YS4A 1UJ6A 2QT9A 2EFJA 3HADA 3O3MB 1AN9A 2XMSA 5LVAA 4U2BA 1G8JA 1M6NA 3B7GA 1ZH0A 4LOAA 3AHJA 1GGKA 4Q4JA 3SYRA 3JQ9C 4YMGA 5JBQA 1OB2A 2PYIA 3L06A 1CUHA 2XOKD 4NICA 4PSCA 3PQDA 5TC4A 1XZEA 4O33A 3A9RA 3ICQB 4NS4A 5CIQA 3DEAA 4HDMB 4BP8A 3VNVA 3PIDA 5C37A 1F6BA 1PLJA 1P0CA 3L7BA 2BR3A 2Q28A 5H9WA 2HREA 3IQGX 2N1BA 1WNTA 2NQTA 4RDHA 2XZTA 5DXFA 4RXUA 2IDJA 1H1DA 3ZVLA 1B2RA 1X1AA 1SVIA 1E2BA 1OH6A 2GD6A 2DH6A 5CT9A 4CMKA 4LRXA 1E7MA 2QD2A 2VNIA 4QU5A 2V3WA 1NLZA 5JUWA 4XVCA 1BRMA 1XTVA 4D9HA 5K05A 5E6UA 4MHOA 1QG0A 1SVWA 3EGVA 4J7XA 1D5WA 2I7DA 3DWIA 1KRWA 1MJFA 1QGAA 1T8TA 2TSYB 4HL6A 3BIOA 3LRPA 3K5IA 4TKVB 1OKKA 4AZ3A 4KQ2A 4P5EA 4Q01A 5K51A 5KNBA 4UNQA 3WKDA 2CUNA 2BR5A 2EFCB 1P0FA 4R98A 1W2GA 5K0EA 1IONA 2PL9A 5FKJA 4F9EA 5D5HA 3EPKA 4F2PA 5JT1A 4CMHA 1FMCA 4BJHB 2BFBB 2YRWA 4DDMA 4KMOA 1T9HA 2HNAA 4PX9A 4JLAA 4XX0B 2GN2A 2R97A 1EQ2A 3BRQA 4D42A 5K0ZA 1OBCA 3CS3A 3Q9UA 1PEDA 3TZEA 1XA4A 3MJ4A 3ZV5A 4I1VA 4FW8A 2YVQA 1U94A 3DBHB 4HFRA 1QQ7A 4M0MA 3DDUA 4BC1A 2ZROA 1Y9EA 2K4MA 1NW8A 2CXSA 1YKFA 2JIBA 1MW9X 1TVKB 1DBIA 2D06A 4GH5A 2GM3A 5DP2A 2O8BB 2O5EA 4X7MA 1DUSA 4NY1A 4D1YA 1QHHA 3RIYA 4MB6A 4HDSA 5KTNA 4UHBA 1MD9A 4UNNA 4QYMA 1RJFA 4YRRA 5T7BA 2RGUA 2VBGA 1ZUHA 3DNPA 3N2ZB 4DG9A 4LE2A 3B20A 2H4XA 4A73A 1HO3A 4N01A 4E08A 4QJBA 3ZPXA 1TZBA 1SO8A 2LW7A 4B7CA 4B71A 4RTSA 1DIGA 2YBEA 3I6YA 2VNHA 2GDJA 3A9TA 2JFBA 6PFKA 4N7BA 4CEIB 2BFFA 5I6DA 4TKLA 2VL7A 4WNIA 4R0NA 4DEVA 4IEFB 3WIEA 1JIQA 4CLOB 4MPTA 2GCIA 2QF7A 3CG0A 3KRTA 4QDTA 2JHAA 5CA0A 4WKNA 2W42A 3UMFA 1A8HA 5EN4A 1JXQA 3IT0A 4BEVA 2RJNA 1KOFA 1THZA 4B7AA 2XKJE 5DNYB 4WKCA 1SHUX 1Y3BE 2FFBA 2ZI7A 3D4OA 4RQAA 5TB5A 4RHEA 3WDMA 3RT9A 3S1LA 2PZ8A 3GI1A 3K31A 4RY2A 2C9DA 2JGNA 2QBYB 3WRYC 2GMWA 3B82A 1EVIA 3GP8A 1TZJA 5I5GA 1KVQA 3AEZA 3HKEB 4KYVA 4LJ7A 3F71A 4AF7A 2WP8J 2ZUCA 4YYZA 2FMTA 2DFVA 5KDDA 4G56A 1UZMA 1UOPA 2OBBA 3C3AA 1NBMA 2AUMA 2Q6VA 5HIMA 1JG2A 5G3ZA 1MEOA 3Q87B 3OZ7A 4RENA 1NG9A 2PGXA 2XA9A 3CIOA 1UMBB 2PUVA 3O4RA 2Y66A 3KQLA 4TTPA 2VK8A 1XHFA 4Y2JA 1FPQA 1NKVA 3VTAA 4IZOA 2R1TB 3P9YA 5BUSA 3O4IA 4FEAA 2IUEA 4NWIA 2YFQA 2QRVB 4R7GA 4K1LA 2WBLC 2Y0PA 2HRBA 1CDOA 1EZ1A 1I51A 2J07A 2C07A 3IAS1 4PINA 4K6MA 1TRKA 1NNUA 4CM4B 4HLCA 4AQ7A 2ZDQA 4U9UA 3EVEA 5FBWB 2YFHA 4GKAA 4DMHA 3LO8A 1SEPA 2WF7A 5LXTB 2NQ8A 3PDUA 3ABRB 1XP8A 3F2VA 3A05A 4O5OA 1P9OA 5EAIA 4JHXA 5HTOA 1XELA 3IUPA 3L18A 3NC4A 5AKYA 5MFZA 3DWGA 3GFGA 1RKUA 2QMQA 3NBMA 4G24A 1TECE 1XRQA 1JJBA 3W6ZA 3HGQA 3R7SA 4GPIB 5FBVB 1FNSA 2ZBUA 3CXUA 4FLMA 2JRLA 1B0ZA 1FYWA 3IE0A 1WXXA 2CCKA 4URVR 1KJWA 4NYMR 4LQ4A 1BU8A 4O0MA 3WHPA 4A0QA 4W9MC 2ZPAA 2R8ZA 3U3MA 4F1KA 2IUYA 4DLYA 2MT9A 2EBUA 2H1RA 2X5OA 4YO8A 1TYDE 1JJFA 3G02A 1ZIXA 3VOAA 1KP9A 2JFYA 3PRYA 2JLWA 1PZFA 2B4AA 1ULZA 1UKVY 4DM3A 2A78A 3TLEA 2FX3A 2H1WA 3BM5A 3PHJA 4KSBA 5FADA 5J4VA 4RX1A 2QPAA 4IO0A 2Z3WA 1NXSA 4OHOA 2KLBA 2QWXA 4URWR 5ESWA 1V1MB 2Q9BA 4K9RA 3WIBA 2H2HA 1OE0A 4FPXA 3FOEC 2JAOA 3HRKA 1L7EA 3O8OA 5CJJA 2WY2D 3RVLA 2O8CA 1TM5E 3Q0IA 4YTEA 4PNPA 4Y2VA 1XZGA 1U7TA 1E1RA 4L5CA 2F59A 4MKZA 4YMVA 4A82A 5ADVA 3K53A 2FPGB 1PCXA 4CKBA 1JQLB 5JDIC 4Y1FA 4F3TA 3LQ1A 1FYXA 1NYLA 1QGUA 1XCOA 3CVJA 3ZY4A 3HV0A 3LVRE 5L6LB 1QU2A 5FBLB 2P41A 4R8RA 4BMSA 4ZT3A 4ADSG 3E3NA 3MXOA 3ZY2A 4IJUA 1DWOA 1F2UA 3TLBA 4R1OA 4XUCA 1R0CA 4OXQA 4RHYA 1CF4A 4IIDA 3F7TA 2HHAA 2XX3A 3JQQA 2K5UA 3MJEA 1UDBA 1X7XB 3GJYA 3PI6A 2Q0XA 2Q3FA 3F3YA 2G1UA 4HH3C 3U4GA 4ZFNA 1FSZA 2I91A 2XXAB 5BVGB 2CFIA 3IBFA 2K2QB 3LE8A 3HBMA 3M6MD 3VJKA 3TNJA 5JI2E 4BN0A 1THMA 1K5DA 1OUMA 2AK3A 3AUKA 3JU3A 4TS3A 5JW6A 1Z2EA 1X94A 3K2BA 3VA7A 3LXXA 1DXQA 1XDDA 3F8WA 2C20A 5FWXA 3RAGA 4DNQA 1GZSA 4ID9A 1JTEA 1DRWA 2DWQA 3QPVA 5L3QB 3H97A 3CPSA 3E27A 4GLLA 4U0KA 1KR2A 4ALLA 2Z2IA 4CM7A 4ARBA 5IUJC 1MAHA 2BIFA 1LWNA 5LU8A 1MABA 4KXQA 1EU1A 3RO7A 1YVPA 4CLRA 1R0WA 1LDMA 1C7ZA 1TJ5A 2A2ZA 2IDKA 3MGCA 3MMNA 3X1WA 3WHLA 1BKYA 4TKMA 2Z57A 3U0VA 3FPFA 4OOEA 1H23A 1MIHA 1VG8A 1YWGO 3WNZA 1W73A 2F8MA 1PO7A 5AVOA 3WLSA 1QQAA 3KEMA 1SVNA 4BN4A 2GM4A 1HC7A 3E5NA 3FYCA 3DWEX 1EWKA 1NOIA 3TMKA 3L43A 3HXPA 3EY4A 4P4SA 3KQKA 4FFMA 2O2HA 3KR1A 5GINE 4LDZA 5I7SA 4NBNA 1HNWB 1VI6A 4EJFA 4R54A 2VVTA 1JAHA 1SELA 2G9ZA 3HKCB 4M9UA 3EDRA 3CVYA 5CXSA 5JR3A 1YRQA 4MUFA 4RKEA 2JIZA 2IXTA 3ISJA 3UYKA 2VNSA 2SBTA 2JF0A 4OLAA 1UBMS 1CHNA 2BSQA 1IAQA 1JA1A 4LJ8A 3HLKA 5K6RA 3UAWA 2POCA 1N8NA 5EGNA 4YRGA 1B1CA 3QQ5A 4ENVA 1VMEA 5KNCH 1DELA 2YHIA 4Q1CA 1AKEA 5I9LA 3TD9A 4GIBA 4LYEA 1SA0B 3RHFA 5JRJA 1GA1A 1W1WA 1V6CA 2UVPA 2ZAIA 4F5DA 2BGLA 3MAJA 4RTJA 1U3DA 1YK1A 1L1QA 1ENOA 2IHYA 2F43A 1VC2A 3TVDA 2IYNA 5IASA 3Q1KA 1Y4DE 3RHTA 3H9CA 1T4BA 2KLHA 2Z8YA 2QVYX 1J49A 2PKQP 4L1KA 5EXSA 1QUFA 1S89A 1HMPA 3L49A 4JASB 1E64A 2JNWA 2PZKA 3L6BA 2OHXA 1D2MA 4IMPA 4IS3A 4DV4B 3MWEA 3PZBA 2ZBDA 3SM9A 1QDLB 3WLJA 5HRUA 3EXAA 3NYIA 3UMCA 4Z9XA 4QWMA 1Q1ZA 3UT6A 4BZZA 5KOJA 4RTOA 5JQGB 1A0OA 2JVIA 3O84A 4LSWA 2J4FA 4BE9A 4ZI7A 2I6GA 2PVCA 3L1HA 1XMSA 2AOTB 3H0KA 2ONKA 4LJRA 5BWMA 3AV3A 1NVVR 2PQMA 1R4ZA 4WA7A 4XD7A 4Q05A 5FA6A 4AJ9A 1G2PA 2AMJA 4KJZA 1WDMA 1UBJS 1VSBA 1F8GA 1KYIA 1K8XB 3FGNA 4MA0A 5DOZA 3ZNOA 4YT2A 5C5CA 1RC1A 2OOKA 1GRVA 3QBEA 1EFHA 1XL0A 1O1YA 3L02A 1G41A 4MLDA 3BHNA 1ZR2A 1XAGA 3U5ZB 2HA6A 4ZOLA 1C8BA 1MB3A 3VR4A 2OD9A 4FWBA 5A0VA 5CLGA 5GVRA 4B43A 1VCHA 5HYVA 5CCDA 4KLCA 2X5JO 3JRNA 1L5WA 1K7FB 3DJFA 4JOSA 3PEEA 1LF0A 4KAJA 4RVFA 3VR3D 1RWPA 5HMLA 2HJGA 2RGXA 2X22A 4IINA 4UVIA 1JH9A 3UWDA 2J59A 4ZYTA 1GUFA 4I81A 2IU0A 3BFJA 5C8YB 2KPOA 1CRZA 1W36D 4ARZB 1G59A 1KSHA 2BBSA 4MB2A 4RV4A 3W6PA 4Q18A 2R96A 1MQAA 3UH0A 4BO2A 3FPCA 1BH2A 2QKYA 4IMIB 4JJFA 1MPTA 1SUEA 3SDZA 3F3KA 3VNRA 5C5EA 3W5BA 1O2DA 1KJIA 1ML3A 2CLIB 4EYSA 2GVDC 3INNA 3BMXA 2XE7A 5FR2A 5A7GA 2VYCA 3S2SA 3CYFA 4EGAA 1A8SA 5DGIA 2YQ4A 3DUWA 1QK5A 1GZ5A 3EEBA 3RVBA 4RY9A 5M3BA 6AT1A 2MSKA 1DKPA 3HJCA 3KK0A 4NV3A 2C5GA 1E99A 4UFPA 1E6WA 1OT5A 4OU5A 2QL9A 3COPA 5H02A 3M3DA 3TQSA 3WYCA 2ET6A 4EKNB 2AFHB 2DY0A 4ENPA 3QE9Y 3PGLA 1RACA 1HE4A 4RADA 3VR2D 4RCZA 4B48A 1EXVA 4DPMA 1CY0A 2P9HA 3AB7A 1B8NA 2OILA 3MTIA 3TRFA 3HJHA 5JFGA 3KOMA 3IOBA 4OYLA 3U7HB 1OGIA 1P17A 3G8YA 3IERA 2XRZA 3L9XA 1H1LA 1Z5PA 1CY7A 5EJ9A 1PS0A 1R0RE 1JI3A 1VOTA 2F3RA 1RIFA 3T15A 4E5UA 3WSVA 3TG8A 1ZQ9A 1FSFA 3E8XA 5DLDA 3U48A 1QFXA 4IEEA 2FEXA 1NP3A 2HGZA 4LI0A 1S8FA 4CMBA 1CR6A 4KDEA 4LC1A 3CRVA 1QOZA 2PRZA 4FD3A 3TLAA 1FUYB 3VDXA 3VHXA 2XUAA 1Z0AA 1FLNA 4BNZA 3ROZA 3BFXA 1R5OA 4LXUA 1LC0A 1H2XA 4PSDA 1IC6A 1NYTA 3JD4A 4RU1A 5FO0A 1EXWA 1U9CA 3AVQA 2WWFA 1XPJA 4FP9A 4I3FA 1ZJ4A 3K0HA 2GZ2A 4QNMA 2BELA 4JLUA 4QHYA 2D62A 4LYHA 1HXHA 4N8SA 4QE3A 4JT8A 2ARKA 4PG6A 2F2TA 2FPXA 2QAGA 4XQ9A 4YK7A 4C1NA 3I5XA 4JZYA 4EP1A 2R62A 4UCWA 5KWJA 4Y2UA 4M83A 2AI1A 3MQFA 4HRAA 1IN6A 1VP9A 4O59O 3B6JA 1FU7A 3V1LA 3MUOA 4DF3A 4EJSB 4IIHA 3HU1A 4UNRA 5CA0F 2W6IA 1CQXA 4L57A 2RBGA 1NONA 2VDPB 3WOVA 1B42A 3IMCA 4PZAA 1KGSA 3G2LA 2H5IA 4DIFA 2ID4A 5DCYA 2YMPA 1NU6A 1RQNA 1KEEA 4QXOA 4EWLA 1X7WB 1XK6A 1DCFA 2QSUA 3AX6A 3UT5A 1GNLA 4ARAA 4F2HA 4ENQA 3O75A 3OQVA 4BVEA 4YHHB 3AI2A 2VS1A 1CT9A 4RTPA 2CF5A 2VJBA 5EE3A 3VSBA 3IULA 3TQIA 4JLJA 1FS4A 1RJEA 2D0OB 5J2UF 1GGMA 2B1QA 3F78A 3A6DA 4KIFA 1B8OA 1DRUA 3GFBA 3NG1A 3OE7A 3UHFA 1Q6ZA 3EPLA 3GJQA 3UBTA 1W8IA 4KRGA 3LCJA 4Z8YA 1TK2A 2EQBA 3MWLA 1AURA 1NRXA 1QORA 3O1HB 2OEPA 2VAWA 1VLVA 3NT2A 4FX2A 1ZQ1A 2BD0A 2FMIA 2LD4A 3B5IA 4RQBA 5AIAA 2ZJ5A 1EEHA 3ZHUA 1A9XA 3VNUA 1GZ7A 3QUQA 1QYVA 3B2QA 2CXUA 1M0EA 1MO2A 3EUWA 5K20A 1PJLA 2AUNA 3ZHSA 1SXJB 5K0JA 1K2VN 4RY8A 3A06A 1YRWA 3LVFO 4D3ZA 4MMYB 2OK7A 1YFJA 1WQ3A 4MV6A 5KOIA 4XIYA 1Q22A 4QARA 5K01A 1ZBDA 4LSGA 2ZBQA 3EUAA 3AKYA 4TLCA 1RPTA 2Z9CA 2JZNA 3M6XA 1GPLA 1U7ZA 3EFOA 4BN5A 5CLJA 4JXXA 1EH5A 1FYFA 4PCUA 3TSAA 2PSHA 3OZFA 4J07A 2TMDA 4Y0AA 4PAQA 3JWEA 4UASA 1A76A 5BR4A 3OKPA 5CXQA 2B37A 1SKUA 4CYMA 4EABA 1B3RA 1OAOC 2A9OA 3M6VA 4IMRA 5AWFC 4C9BA 5DRTA 3QP9A 2I2AA 2Z3VA 2E87A 1A2KC 2XB6A 2HSDA 2VT3A 3I2JA 3I4FA 2FPSA 3JQAB 2W6ZA 2UVQA 3ZNQA 4YJ2A 3UUWA 5DM70 5F3WB 1CRPA 4B6EA 3O9VA 3T52A 4CT5A 1O9HA 2RC5A 2XRYA 3ESZA 3PYLA 4JL6A 3MMPA 3PTLA 1HDCA 1ZRNA 3N53A 4FFRA 4MVYA 1N9GB 2AIRA 3GJ3A 5EVJA 3QPAA 4LECA 4ZT7A 5ELXA 2IHNA 4FJ2A 2F6RA 2PD4A 2O2DA 3QXSA 4FC6A 1FP1D 4KE6A 4ZQGA 4N47A 4YDQA 3RAFC 4IWXA 2EX4A 3A27A 1U2EA 4P3YA 1G6HA 4RTQA 1U8UA 1L4BA 3N2KB 4FYKA 4YMIA 1E8DA 1Y1QA 2CXHA 5ERXA 1E8MA 3BN3A 3SYLA 1Y7IA 1KC1A 3LZDA 1HX7A 3JQCA 3NM6B 4JQCA 5B2FA 3L1JA 1DBPA 3PQEA 2G83A 3QEOA 4HAOA 5CURA 5JE8A 3TL3A 2DETA 1C41A 4V0ME 5ESDA 4HGZA 2ZPTX 2C7QA 3NP7A 1ZMRA 1P5JA 3RFVA 4B83A 1XNJA 4QOSA 5I3CA 4DABA 1U2DC 4HBGA 4DT1A 4BLSA 3R3VA 2QSJA 4H7FA 2Y67A 3L7LA 4KPEC 1OBHA 4RH0A 1N6NA 3QY0A 5KS2A 3U7QB 1LFAA 1UJ5A 4MWOA 4YAJA 2EWMA 4PLZA 2G8NA 2JFWA 3WHIA 2JD0A 1EIWA 2ZU0C 3K0FA 1U0RA 1XEXB 2VDQB 2ZSAA 1CCWA 3LQ2A 1BKSB 2PR7A 4JP2A 4ZQHA 3BJMA 3IP3A 3TEMA 1B93A 2J3IA 1R2QA 2O8FB 1EE1A 3NIDB 4RGYA 3K05A 2FFRA 3KE9A 5HMMA 2HOQA 4ZAFA 1ND6A 1OV4A 1V8OA 1H85A 1XZ8A 2OGSA 3QYJA 4FQ8A 2YIDA 4JK3A 1BXGA 4L0DA 4X5OA 2GWRA 2HU8A 2HJWA 4JT4A 4NZOA 3I4CA 3NBYC 1UODA 3P71T 4NYMQ 1VE9A 1VXRA 2C3OA 3CRQA 3KC2A 4UDNA 2Q7DA 1N5RA 3LX5A 1RR6A 4O1IA 3AGPA 2P2GA 4Q4AA 5FBHA 4BNDA 3OTQA 2V97A 1TF2A 1M7BA 2WZBA 2P67A 2BCEA 4MUNA 5CG2A 4EFMA 2X2FA 4G9BA 2Y1EA 2Y27A 5TGTA 1KDVA 3SXPA 3V8RA 3V4PB 4OXKA 3VYVA 2YY5A 4COOA 2AJ8A 2I4NA 2TRSB 2OQVA 1M0SA 1H69A 3AERB 3ZDFA 1RXIA 4GUAA 4DW8A 3GBVA 3BD6A 2FQQA 1H2AS 3C43A 3SQLA 3H3FA 2HV8A 3QY9A 8LDHA 4F38A 3G68A 2M1XA 2DVMA 1G8HA 2C9OA 4DIKA 1CQPA 2HI0A 4G25A 3VVBA 3MERA 4KQJA 5LBIA 4Q3KA 5B7GA 4K9NA 1O96B 5IXYA 7ADHA 1A9PA 4QFBA 4MW6A 1AHPA 5D3ZA 2I3BA 1LW7A 2J48A 3AKDA 4FJ1A 4TN1A 2JKYA 1HSZA 4RA6B 1E0DA 2BZ0A 2JJ8A 4BNHA 3VO9A 5IYZB 3WLNA 3M70A 4WXYB 3B7WA 3VR5H 1V1JA 3BX1A 1H2EA 3LC0A 4OB8A 3ANMA 2HEGA 2Q5OA 3EODA 2A86A 4PQGA 4RK5A 3TZCA 4BNVA 1C3VA 2FUG6 4RMIA 1WMAA 2ZSKA 4IIGA 5E0OA 2V59A 2RKBA 3COWA 4HAUA 4JJIA 3KFXA 1DIOB 4FFLA 4YV0A 5KIAA 3NRJA 1YB6A 1F12A 1R12A 3TRKA 1C1DB 1D04A 4U02A 3EVTA 1IBRA 1O54A 2X40A 3R24A 3C3DA 2JLXA 4NXNB 2CN1A 4LY3A 5A02A 5JCOC 1Q83A 4QQNA 1QCDA 3FMOB 3GGJA 3NOQA 1FSGA 4FR0A 5EESA 2D5CA 1FXWA 3WSTA 4YR7A 1I3KA 2J4CA 4DMUB 4KQWA 4OGLA 4EA8A 3O8DA 2GBIA 1U2RA 4YJDA 1KQ3A 3A2NA 4DIDA 4ZI7F 3UAXA 5CVJA 2IXFA 3MTAA 3GVCA 2IWRA 4UFOA 4MINA 1QBKC 2D2FA 5JZOA 4FZ3A 3AY6A 3GLHA 3I3OA 1XDSA 1XLUA 1TMOA 3R41A 3VVCA 2WRZA 4HGOA 5E4TA 5BMVB 1A50B 1CJUC 1NJ6A 5C0OE 4CKEB 3CUYA 1LQ2A 4N0QA 1X9GA 1LX6A 4S1NA 1ZOPA 3TECE 1R18A 3EGIA 4JI6B 5KOHB 3S40A 5H4GA 5BUCA 3RAEC 2KBEA 1AKVA 4ZOLF 2ZZNA 1QQ5A 1E2QA 1UBUS 4BO5A 4D79A 1AK9A 2YJ5A 2Q5JA 2YZNA 2RONA 1ISSA 4JJ8A 5L95A 3L4EA 2I22A 4OBWA 4YHBA 1CRQA 1GVNB 3A6ZA 5KSYA 5JRZA 5TDHA 4J3FA 1Q50A 3Q8WA 3WP0A 4ZYYA 2QYOA 4H6PA 4IFTA 1J8YF 2GHIA 3I34X 1A69A 3F4LA 2GAOA 2DJ5A 3FOFC 1ECCA 2RAFA 5EHGA 5JO9A 3SSNA 4EELA 2P0EA 2VP9A 2YFYA 3FB1A 4AD8A 2VHQA 3MUEA 4FXPA 1I0LA 4CPDA 1CETA 3UG6A 1CF2O 5HZKA 1WKCA 2Q62A 1A9QA 1KO4A 3HPQA 2WFAA 3MBOA 1YC5A 1SC9A 2OC9A 4HLQB 4TMVA 3WIUA 1EK0A 5KQGA 1RBYA 3FSJX 4MCHA 1E2DA 2J1LA 2A30A 4W1SA 1PZHA 1ZW6A 2EP7A 4LOKA 1L1EA 5GADl 4ND8B 4TVBA 2WU3A 3KB6A 1RMYA 1G7RA 4M1WA 1NT2A 2YYYA 3ZVKA 2OOSA 3JZDA 2IH2A 2J3EA 3HJUA 2QVZX 4DDHA 5K99A 1A98A 4HO1X 2XLCA 1JMYA 3E23A 3I2IA 3LUKA 4GX5A 3ZHXA 2OCBA 3OQNA 4A3SA 5JC1A 1A1VA 4NG4A 4FDAA 2EKZA 3FBTA 1XLTA 5ICMA 2H1SA 2P7HA 3WRXA 1BEZA 3EG9A 3C2QA 1RYFA 3AFGA 4L72A 4V03A 2VDUE 2BGUA 4B3BA 2QTAA 5FBZA 2WFLA 2FMXA 4UNSA 3LOQA 1FP4B 3NAGA 1NVVQ 3LUCA 5LBTA 2XQJA 1BKDR 2YXEA 5DCLA 5JMTA 5K2OA 3H4TA 5IXJA 2HZBA 3CRW1 1YGYA 5I9TA 1PNTA 2DFNA 3B85A 4AJ2A 1KEZA 5A6SA 1AQ6A 3MEQA 1P81A 4QM7A 1HZZC 3PUZA 5IM5A 2ENWA 2NPFA 3OKAA 4HB2A 1D07A 1OFIA 2AJDA 2BMDA 2FUNB 2JJQA 4WXHA 3RUPA 1EVQA 2BGNA 3UQYS 1JPUA 1O97D 3G5AA 5D51S 3CX3A 4ZVMA 3NEPX 4EG5A 2NOAA 2X58A 3WLMA 1G2IA 2C4MA 4XTCS 2DCUA 4ZO6A 4ZQFA 4O5AA 5AVRA 3YASA 1JLLB 2MWMA 5EMKA 1OU4A 3S5UA 3OQ6A 2GWHA 1FFSA 3EMBA 2VQDA 3LLCA 2OORA 3IAM1 1RWKA 4Q82A 3OM1A 1GFSA 1HURA 2VSQA 2EW8A 2CHUA 3L0SA 2Q5LA 3ND5A 2QPTA 2D00A 4HGPA 4HFMA 1U9ZA 3D4NA 4UJ5A 1Z8DA 1MC1A 1GR0A 1NR5A 3FAZA 3X3HA 1V4NA 2WI8A 3EQ6A 3LC7O 5JNLA 3O92A 1PTJC 1X7GA 4X91A 3VR6A 2B25A 1BCSA 1OI2A 4OVKA 5HKKD 1G17A 5BNTA 4JC0A 1Q17A 2G36A 4L75A 4Q4LA 3TFWA 3CB2A 4EG0A 5C7OO 3ILSA 5AXBA 1VZ2A 2QHXA 2ZYAA 2RG1A 4OUDA 3FTPA 3TM4A 5CDGA 4BHTA 1YZTA 2Y2UA 3WMXA 3B89A 2CNOA 3PT9A 4XD2A 4Y6LA 1QV9A 1TO1E 1YU9A 4MAFA 1PFVA 3EZLA 2YXPX 2NZJA 4IF6A 5BQPA 3R3SA 5JARA 4HQFA 5EHQA 2WF8A 2WYUA 5TT1A 4US2R 2QTRA 3KUDA 3K9FC 4HTFA 4M46A 3VBEA 5IJWA 2H2IA 5AM1A 4XVRA 1ZSNA 3S2UA 4BB9A 3ZXSA 2QRGA 2G67A 1XRLA 2D2XA 1W29A 1VKOA 2M32A 2GPTA 4M1MA 5HUHA 3DLCA 3E03A 4M36A 2RGCA 4YT8A 4G23A 1IEXA 3IYLW 1H0HA 1S8AA 1NHGA 1RWOA 3ZW7A 1GTG1 2WU8A 2XBUA 1YACA 4CT4B 2RHLA 3ZHVA 1DAFA 3O95A 4C08A 4L8VA 3FTFA 3EXHA 1T9AA 2DQ4A 4QTUB 2A5DA 1VG1A 2ODPA 4FVTA 3L41A 1ESMA 1STOA 2AZTA 3ZLVA 1P91A 1N32B 4FD2A 1CR1A 1X9HA 3TLGA 1EG7A 5LFAA 1NKSA 1YS9A 1CYEA 3IE2A 4JIGA 2ZR9A 3RRFA 3TJRA 2PZEA 2FPUA 4Z0PA 1CUDA 1GKKA 3QRWA 1EYZA 5KYGA 1CV2A 3TGWA 2K87A 4MUMA 4CI0B 1QTRA 1U11A 3OEYA 5IDXA 3TZQA 2LDXA 4BO9A 3D7MA 2C54A 3O9MA 2CLMB 1NIPA 5JPCA 1TEZA 4YJ2F 2YV3A 1SG0A 2OFXA 1G21A 3NTOA 1ZOLA 3IAEA 1PL6A 1FVOA 1E66A 3I01A 1I94B 3TFQA 1ECJA 1RJGA 2ZI4A 5K9ZA 2P2CA 1ADYA 2NO9A 2X14A 5JSFA 1FYEA 4FS8A 1NV9A 1FQKA 2PU7A 2PWAA 1DAGA 3ILYA 4PSAA 4TLDA 4RETA 5DHAA 5DTEA 1O95A 5JC8A 3GVIA 2R47A 2WC1A 4BKUA 1E4VA 1PD0A 3GZNB 1RVV1 4RIGA 1OFGA 3B1KA 2A88A 3QELA 4NBSA 1ZK0A 4BO1A 1NMYA 2OGUA 2R65A 2W0MA 4HLUA 4Q15A 4TTIA 4Z7NB 4QUBA 2PD3A 3ZWNA 1S6YA 1Z62A 1NQUA 2UV8A 3AR6A 2VP6A 3DOOA 4TQGA 1VI2A 3MTJA 3DNFA 4R5HA 1FCJA 4JGIA 2CLDX 5KQSA 4L0MA 3D6TB 3NWPA 5BSKA 3EZNA 3GEBA 1W6RA 2WR8A 1ODTC 3OZEA 4KNWA 3PXAA 5J9FA 3FJYA 1Z5ZA 5TNXA 1EFCA 1G42A 4Q16A 3OCWA 4RVUA 4BFCA 3FMFA 3T1YB 3JD1A 2IYRA 2DFLA 2DAPA 2WLSA 3I61A 2FCRA 1B0AA 2FUCA 3C8MA 2XUJA 3GLTA 4NFHA 2EV9A 1SCNE 1W0JD 4GVXA 3G0HA 1ZN2A 4ZGWA 3O2JA 3M2TA 1MAAA 1S4QA 3M9XA 5F5LA 1GG5A 5T41A 4DA0A 4B3GA 3SZUA 3Q9SA 2IWHA 3T6KA 1M0WA 4RZIA 3E5MA 1M2JA 1XQXA 3BE8A 4TTSA 1TGVA 5IAEA 4ZJYA 2UUBB 3EDOA 2GSDA 1P2GA 1VJTA 1EXDA 4BLOA 1HK7A 1G5TA 1TGYA 2C5BA 2W58A 2W98A 2WWIA 4L28A 4XOIA 3OP4A 3SVTA 4W5QA 1C81A 1P4HA 1JQBA 2OZEA 3QGMA 4GICA 4Q21A 4Y3UA 1V5EA 3W4IA 3T1HB 2JHPA 1QCYA 3P94A 5HX7A 5FI3A 6ADHA 5KYYA 4HH4A 1D1QA 4A5OA 4JDUA 1GQFA 2V7VA 2TS1A 2W6MA 5DSXA 4X1YB 2Q29A 4JX9A 2E4AA 4H60A 4WLOA 3BGWA 1C1XB 4X61A 1VCIA 5DNEA 4MICA 5JSYA 5IU6A 2RKWA 5D3MA 4B2LA 2XZPA 2IRWA 2VR1A 3E61A 3WVNA 1AO0A 2XRMA 1CUWA 3IUYA 4Y6QA 3QMVA 4JDPA 4OD0A 3WKAA 1GPUA 5CDHA 2HIMA 3PIIA 1UBCA 2XYGA 4POOA 1ZXBA 3IT2A 1U7WA 3ANYB 4PO8A 4B34A 3A6LA 3H5LA 4CG3A 3T1TA 3B2EA 2O06A 3AT1A 3T7JA 4L16A 4Q9IA 3IILA 4ILKA 4UAVA 3CWZA 4F5EA 3LT1A 3AFNA 3R9IA 4M9QA 1IXRC 5CGZA 3QVTA 3FCXA 3PHLA 1BGXT 4Q7LA 2RK3A 1CJTC 5E9WA 5LDGA 2ZP1A 3T9CA 2OE2A 5J5CA 4UREA 5LR6A 3U7GA 3C7AA 2A7XA 3UC9A 4I4TA 3GW8A 3IJEB 1Z5WA 4B5LA 2DFTA 4FKBA 5AESA 4D81A 4OAOA 1Z0UA 2QXYA 4H1WA 4Q1EA 2O4CA 1AGXA 5CGQB 5E4FA 1JAYA 3ZWBA 3VAZA 1WABA 4P3XA 4TXLA 4DJDC 2Q07A 4F2DA 4GO1A 5HJ2A 4OJMX 3AEKB 4E2ZA 3GRUA 4WBNF 3W9SA 4NBRA 4B3TB 2GQ0A 4HN4B 2D2EA 3I92A 2AE1A 3OPNA 3IIKA 4FXOA 1M67A 4J0IA 4MVCA 4WY2A 3TOCA 4BQRA 1A8IA 2XWJI 3P4UA 4XWTA 3F6CA 2EP8A 4XPZA 3PJDA 4MKRA 4PN3A 3STWA 3RTAA 4C07A 1RVDA 4ZPXA 3MTGA 1EGQA 1Q1AA 4GPD1 4ZZ2A 3ZYZA 4BASA 3DW3X 3FOWA 2WHYA 3R5JA 3A1DA 1FW8A 1WXWA 1SZCA 3TINA 1W59A 2VAVA 2DHQA 3PFHA 5HVNA 2K6GA 5AVWA 3GMDA 1FXWF 3C39A 5C4MA 4Q02A 2PXXA 3HKDA 1R1DA 1NUSA 1U8AA 1BDIA 5KNCD 1OLUB 3QU2A 4DJAA 2IYTA 2E4UA 2WJPA 4LV6A 3TIFA 2PPVA 4EI8A 4QXAA 1MJNA 2X23A 3ABIA 4IZIA 2P3LA 4NH0A 2GN9A 4TTJA 1K8ZB 1NPTO 5F1OA 4ZK2A 3FLBA 1GQSA 2X8JB 2HGSA 4CL0A 3RV3A 2NU8A 3LUHA 5DWDA 1V0JA 4TMZA 1XN1A 3VHRA 4OF4A 5HF8A 1F2TA 2HU5A 3PC8C 2EZ9A 4DRXA 3S55A 4EO7A 1KVTA 4DIUA 4LIPD 5IUKC 2QAIA 2EX1A 2H9YA 4GXNA 3REQB 3RHZA 4ONEA 5CCXA 2Z30A 4QGHA 1IBKB 4F97A 4I9HA 4R83A 4BBAA 5BNIA 4OAQA 2XVAA 5A3SA 5JSQA 5A4KA 4EVRA 3PJEA 4UOZA 1W47A 2IX3A 2WIFA 1IAVA 4UVDA 3SS7X 4ND1A 1E6UA 1UPFA 1S3IA 3OIFA 121PA 3BL5A 1U1EA 5CX4A 5EPEA 3S29A 1TCVA 3JVDA 3KLPX 3OM9A 4DDTA 3MWJA 2BEWB 4Z3DA 1FJ2A 2FSPA 5B3JA 2VCHA 3DTTA 4ARUA 4PYLA 5IBQA 1T8YA 4D46A 2R5WA 3UMYA 4RM3A 2FSIA 2X41A 3ABQB 3BTUA 4ZRDA 1YQGA 4URFA 3UN1A 3X0DA 2IZ7A 1N9ZA 5KWSA 2VHZA 4AN1A 4X71A 2NVUB 4FGJA 1T34A 1IN4A 1M1YB 1PVVA 1UK8A 3MCTA 5F9FA 4ACBA 1SU6A 1NE2A 3Q8MA 3LNTA 2VUSA 3A3KA 1UPCA 4QECA 4I50F 4AJOA 6Q21A 1XQYA 3SZOA 4KK3A 3ICPA 2X2EA 2VWGA 4NK4A 4XIIA 5BXQC 5FLEX 2EXXA 3ZY3A 1F7UA 1BWSA 1PNQA 5EHNA 2ZETA 5SYAA 1J9GA 3G7SA 4Q9KA 3W5SA 4BEJA 2IU4A 4JT9A 4W6ZA 3BMNA 4LY0A 5H3HA 1KZGB 1K8QA 2YN4A 5CM2Z 1R66A 3A1SA 1JU4A 3OPXA 5NULA 4PNEA 5LN1A 1DZ3A 1Y8ZA 5JJKA 2NXJA 4U2DA 1SCBA 1DARA 5G0WA 2YVLA 3CEHA 3AWDA 4I1RA 4WQMA 4B87A 4MWGA 2IYEA 3U4IA 2H0QA 5LQNA 1G2QA 4C7BA 4F1WA 2IELA 3IQZA 4EG1A 5IZ4A 4MRSA 2E2WA 4E13A 4EF5A 4Q1DA 3G85A 4C7OA 2H9IA 3TH5A 3OT5A 1MC8A 1GITA 2NX2A 2IITA 2OPHA 4C29A 4EM6A 2ZAYA 3HFSA 1ZU5A 2W22A 3QUTA 5ALQA 4YRLA 4RACA 2BBTA 5HKBA 1JLKA 3FBWA 1VE5A 5E3HA 3KQOA 3SHVA 1L4KA 1ACMA 2E4WA 2L18A 3KQYA 4FBGA 1ZIYA 3ZHYA 3P26A 4ABYA 3M6AA 4GKJB 3JATA 3NHZA 3K6RA 4WN3A 2H18A 2BHRA 3BHMA 3K4HA 4LXYA 3LM8A 2OG1A 2R7MA 3HVJA 4OQLA 4XLZA 4X64B 2KW5A 5FNVB 2HEIA 4FYHA 5FI0B 1F8FA 3QXJA 5ICEA 1FFXB 1SVOA 2BYTA 1OIXA 2CCJA 1PSWA 4B47A 2J3DA 3OCYA 2A92A 2BEVB 4X6XA 1XF1A 3R0ZA 2WPDD 3LX4A 2W7TA 4DHEA 3NATA 1P31A 2BCJQ 2H51A 3RS0A 2GPBA 5K0BA 3QZUA 4N1AA 5UKDA 9MHTA 1X80B 2LBPA 5I7VA 5LWHA 5C1IA 4FNAA 4GRAA 4L4UA 4PTLA 3AO0B 4B4KA 2R6R1 3C6MA 2C2HA 3M89A 1TA0A 2XMCA 4PGGA 4YCAA 3SDSA 1K6XA 2B7BA 2VF4X 3RSHA 1NBAA 1BJRE 3KR0A 4Q9LA 4DA4A 4ND4A 2Y4OA 1NVFA 1NIJA 4PHCA 1X8LA 4R1UA 4UW9A 3CKYA 5GONA 1PQUA 4CMJA 2QMYA 4ZVQA 2UUAB 1FA9A 4P2BA 2H2AA 4ND7A 5AHRA 1R9NA 3AM3A 3L0DA 1IPFA 1BSVA 4QDJA 4D9GA 5BN3A 5B55A 2C7RA 4J2TA 3DVRX 2C9ZA 2GUWA 3GLUA 1DT5A 4HVTA 4YNBA 5DGDA 1RW4A 2ZXEA 4PLGA 1Z4MA 1Q2UA 2FMFA 2IZZA 3B60A 3M81A 5I7FA 2IQIA 2VBIA 2W8BA 1UBNA 2HIHA 4ZKEA 3SMVA 4MNTA 2ZUDA 3JVVA 3DKVA 1YQWA 1MA0A 2J5RA 1RXEA 1DEKA 2P9TA 3C6XA 3FYUB 3JWPA 3NHYA 3TLXA 5MGBA 2OKGA 3MIZA 1Y42X 3G1TA 4FGWA 3QE2A 5HFJA 3HA2A 5DT9A 5K3BA 3WJ7A 4YP5A 1OXBB 1NBWB 4UCQA 3VYTB 2R8OA 5JJLA 3D43A 3NTXA 4OI1A 1WB4A 4G8BA 4FHFA 2DT5A 2FOIA 3CF0A 4EITA 5EJ8A 2FX2A 2AFHE 3M4YA 3LBYA 3HHPA 1AS3A 1Q95A 3C15C 4NPHA 5CAEB 2F8TA 3C4JA 1HQYE 2VDMB 4QLAA 1Y1KE 5KKNB 2XGJA 4EW6A 4RYLA 3RVNA 1BRTA 4HRXA 2PN1A 5I7AA 4YJHA 1ZP6A 3ISTA 5KNDH 2Z2JA 2JGMA 3ACDA 2Z5GA 3THRA 2ZSUA 1E3DA 1IUKA 2FR0A 1XTRA 2GHRA 2QP9X 4PS1A 2VRCA 4RVGA 5C3UA 5CVTA 1W5TA 3F67A 4MQBA 3GPCA 3MB8A 3N8NA 4MYUA 4ZV7A 1NP7A 3KT0A 4LRQA 1JYFA 1RYEA 2J30A 2E55A 1GDHA 2ZSDA 2ACEA 3C5CA 3ZX4A 3Q9NA 5REQA 4UU7A 3UATA 4G97A 4UBOA 3PJFA 3VX4A 2C4NA 2A35A 3A6EA 1SBZA 2PH5A 5AKJA 3EIWA 4F6CA 2WM8A 1V26A 1YH3A 1YZVA 4GLOA 1AMOA 1FW6A 1QGZA 3SR0A 4NQZA 1W5BA 4JU9A 1GA4A 3KOOA 2FYTA 3EIEA 3MAAC 2IPOA 3LDGA 1KI1A 3L0PA 4WLVA 1ZNWA 4PTYA 5DOVA 4BWYA 3GJ8A 1NV