3C6QA

Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
305
structure length
305
Chain Sequence
MLTIGVIGKSVHPYWSQVEQGVKAAGKALGVDTKFFVPQKCDINAQLQMLESFIAEGVNGIAIAPSDPTAVIPTIKKALEMGIPVVTLDTDSPDSGRYVYIGTDNYQAGYTAGLIMKELLGGKGKVVIGTGSLTAMNSLQRIQGFKDAIKDSEIEIVDILNDCEDGARAVSLAEAALNAHPDLDAFFGVYAYNGPAQALVVKNAGKVGKVKIVCFDTTPDILQYVKEGVIQATMGQRPYMMGYLSVTVLYLMNKIGVQNTLMMLPKVKVDGKVDYVIDTGVDVVTPENLDEYLKKMEELGIPIKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Open to closed transition of a thermophilic glucose binding protein
rcsb
source organism Thermotoga maritima
molecule tags Sugar binding protein
molecule keywords Sugar ABC transporter, periplasmic sugar-binding protein
total genus 108
structure length 305
sequence length 305
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c6qA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c6qA01
2GWRA 1M5TA 2JBAB 3M6MD 2FVYA 4MS4A 4KK4A 3MMNA 4KPYA 2HJ9A 3NHMA 6ABPA 4LDAA 3HXMA 5TQ2B 2HQRA 1SD5A 2KYRA 1J56A 4S04A 3DLBA 2F8TA 1U2QA 3GBPA 4Z0NA 4YR7A 3C3MA 1ZH2A 4IGAA 3HK2A 4IMJB 1ZVVA 1ZESA 3RVNA 3LMKA 4O5AA 4IMIB 1GUDA 1USGA 5EWMB 3TD9A 3VNBA 2GBPA 4Z9AA 3LTEA 3HUTA 3JS5A 5TPZD 5C5EA 4MR8B 4KMRA 2O20A 5KQGA 2F8SA 2R47A 3EQ2A 1Z13A 4G0YA 1JHZA 1H9CA 4WWHA 1NXVA 3N0WA 1L5YA 1Z16A 4W5RA 3K9CA 3LKBA 4YP9A 4PE5B 3TB6A 1QMPA 4RK1A 4RZSA 5TQ2A 4G0QA 2RJNA 4EVSA 3JY6A 1SRRA 3GT7A 5D2CA 4YV7A 1BDIA 3FMVA 1ZHHA 3BRQA 3C97A 3O1IC 3NNDA 1B00A 4N41A 1VKRA 4GPAA 4XARA 1SXHA 1TM2A 1BAPA 4EYGA 4MS3A 3NHZA 4FB4A 2JRLA 3DZDA 2QZJA 1VRVA 2IDMA 3QEMB 2M98A 2V0NA 3CHYA 2PL9A 4OG2A 4H3HB 5EWJB 2WWVD 1MIHA 5IBQA 4RSMA 1OXBB 2E4VA 1ABEA 3F73A 2PUDA 1DBWA 3CLKA 2E4XA 5TPZA 3HS3A 3RVJA 4B09A 2IOYA 3H1EA 3EDCA 1GCGA 1QKKA 3I45A 3Q41A 4IRXA 5FWXB 4W5OA 3OQMA 3C3KA 2LUOA 5EWLB 3N0RA 4L85A 2E4ZA 2FXIA 6CHYA 1Z2DA 3JTEA 3QLVC 2MYUA 5FBHA 3RVMA 4E7PA 1FFSA 4QPJC 4Z4EA 1A04A 3EODA 4JAVC 2CHEA 4N0PA 3QLVA 4HNQA 3JPWA 3RVSA 4EYOA 2E4WA 3OQOA 3N8IA 5JNSA 2JBAA 4G97A 3HM9A 3I09A 2LIVA 1E6KA 2FEKA 2MSWA 2PKXA 5TQ0B 1EAYA 2ID9A 4IILA 3T6KA 3HDVA 3GL9A 4RK7A 1QQBA 2JVIA 3OLZA 1U8TA 4F06A 3KHTA 4LX8A 4JA2A 4O1HA 1C4WA 1YVUA 3RVOA 3FFWA 1DC8A 1RZRA 3KCNA 8ABPA 4EUKA 2PUFA 4G86A 2TMYA 7ABPA 1ABFA 2IPAB 3ILYA 4ETIA 2QR3A 4MS1A 1CHNA 3QX8A 1MAVA 3JVDA 3Q7TA 1I3CA 3RQIA 1JH9A 1PEYA 3QELA 5DGCA 2RGYA 2QVCA 2WMYA 3EGCA 4MRMB 1RNLA 1TLFA 2RDMA 3D8UA 3QLUC 4W5QA 3ROFA 3OLXA 3SY8A 1XWWA 2B1JA 4QYMA 5TPWA 1JFVA 4D74A 4RK0A 2AYZA 4OTZA 5HKOA 1QPZA 2PUBA 3IDOA 4RK5A 4N76A 4LDZA 1L5ZA 3CNBA 2HSGA 3LUCA 5IULC 4MGEA 1ZH4A 2WJWA 3TMYA 3LKVA 1BDJA 5KC8A 3M9XA 2N9UA 1NTRA 3H75A 3LUJA 5JS1A 4NCBA 2MSLA 1XHEA 3KYJB 4GNRA 1LK0A 2ID7A 4D6XA 1UDRA 5KI6A 3MIZA 2WJAA 3DLHA 1ZGZA 1JF8A 1KMIY 3DGEC 3CRNA 1GCAA 2A9RA 1QO0D 3OO0A 3CG4A 5FWYA 2FEPA 2M1ZA 4Z4CA 4Z4FA 3ROTA 2FMIA 2GKGA 2QSJA 2WRZA 3L6UA 4F8JA 5HSGA 1YMVA 1R8JA 1Z17A 1DBPA 2X7XA 2J48A 3GYBA 1M2EA 3FFXA 3OO1A 1P6QA 4WXEA 5IEBA 3BBLA 5T7BA 1QP0A 4G0MA 4MAAA 1BVHA 3EQZA 1YS6A 1ZY2A 3LUHA 1PNTA 2I6FA 3O74A 2HQOA 3LUKA 3I42A 5ABPA 2NT3A 4EYQA 3BRSA 5EWLA 1TVMA 2JVJA 3RVPA 1SXGA 4KFCA 1Z25A 1W25A 3O75A 4RXMA 4S05A 1T34A 1QP4A 4Z99A 1LJUA 2L19A 3E61A 4RKRA 5CHYA 5DKFA 2PAFA 4YO7A 4Q6WA 2L17A 4MS1B 3GWGA 5CNKA 5IC5A 1EWVA 1SXIA 4ETMA 2PUCA 3N6VA 5IUKC 2PJUA 3L49A 3MF4A 5CNIA 5BR1A 2IPLA 1EWTA 2A9QA 1DBQA 5KQLA 3NNNA 4HYEA 1DCMA 4WZZA 2PUEA 2GX6A 3SNKA 2QVGA 3E3MA 2BGGA 3EAFA 1Z12A 2VYCA 2LP4Y 3HDGA 4EGSA 1RPJA 3HJFA 3N75A 4WUTA 3FDFA 4XXHA 2L2QA 3B2NA 3LOPA 3HVRA 3H5LA 4JP1A 4ML3A 1USKA 1KGSA 3UKJA 3UK0A 3QLUA 5PNTA 4PYRA 3N53A 3G1WA 4MLDA 4MRMA 5JNUA 1RZRD 3H1GA 4KQCA 3GRCA 1DJMA 1HEYA 3CTPA 4PZ0A 5CNJA 2WB4A 1QQAA 4RKQA 3FGZA 1Y1LA 4MQFB 1ZGGA 4Y9TA 1NXOA 1BDHA 3FFTA 2PUGA 1CEYA 4MR7B 2NZVG 2MSKA 1JYEA 5BQ3A 1FSPA 1ZITA 3C3WA 4PEVA 3KG2A 2FN8A 3T8YA 3QELB 1FQWA 2E4UA 3I5AA 1CYEA 3UUGA 1XHFA 3H6GA 4YWHA 2P4UA 5C5CA 4RV5A 1ISSA 1E6MA 2NT4A 2H3HA 2E4YA 3M9WA 4H3KB 4M88A 2HPHA 1NXSA 2XDYA 3KYIB 5I4CA 2PLNA 3OM1A 3OQNA 2B4AA 2PUAA 1JDPA 4F12A 4G0XA 4RY9A 2HQBA 4L4UA 4MQFA 4RS3A 5ED4A 3QLTA 3URMA 4XFKA 3RVRA 2QU7A 5HM6A 3HSYA 1EHCA 2CHFA 2WY2D 4H60A 4KNYA 4RY0A 3HO1A 3A10A 3JPYA 3O2SB 5BRAA 2OQRA 1LBIA 1ZN2A 2QW1A 1DRJA 4PICA 1MB3A 3D02A 4TMYA 4Z9BA 1M5UA 2P9HA 3EULA 3MM4A 3Q9SA 1USIA 4Z4IA 4RDCA 4Z4GA 4N0QA 2VUIB 2IYNA 3LUGA 4UHJA 4LE1A 2PE5A 3N0XA 1D5WA 4DQDA 2MYPA 3BREA 4YRZA 4RXUA 1F51E 5E3JA 4ZYLA 4KZKA 3RVKA 3QEMA 1NXPA 4E7OA 4OLBA 4OLAA 4MQEB 3QK7A 4EVQA 3LUDA 1W9HA 5TPWB 3CFYA 1C0EA 2H0AA 1PHRA 4Q7EA 4QYWA 1DRKA 1A2OA 2YHAA 4Z4HA 5B3JC 2FKAA 3H5TA 1YS7A 4XLTA 1U04A 4EYKA 1E6LA 2R48A 3CKMA 3H6HA 3CU5A 4MR8A 1F4VA 4QICA 3T95A 1DZ3A 5FWXA 1GUBA 3P9YA 4TLLB 9ABPA 1TJYA 1K68A 4FE4A 2L18A 1OXKB 3G85A 3H5VA 4KV7A 1U0SY 1URPA 3Q7RA 2CWDA 1U2PA 5F64A 4LE0A 1QO0A 1NY5A 3CZCA 1A0OA 2RJOA 3GA5A 4RWEA 4CBVA 2LBPA 5BRJA 2FSPA 2Q5CA 1NXXA 4WXMA 3KJXA 3W9SA 4MQEA 3OMXA 2FLWA 4ZMRA 3F7NA 1JDNA 4NCAA 3HUUA 4FE7A 4KQ9A 4MR7A 4ZJPA 1S8NA 1JFSA 2JVKA 1Z18A 1NATA 3NNSA 4MS3B 3S99A 3QX9A 4MLCA 5EWJA 1YMUA 3IP9A 3HCWA 1APBA 1JFTA 3ILHA 3OLWA 1LBHA 1E2BA 4O1IA 4G0OA 1JWLA 3RVLA 1QP7A 5IEJA 2DRIA 5TQ0A 3NBMA 3LUFA 2JCGA 4ZPJA 5KQMA 1PUXA 3T38A 3HZHA 1IIBA 4JOQA 1ZAYA 3O21A 3HV2A 4RY8A 4XAQA 2QV0A 4MYRA 3OLYA 1PEAA 5GQSA 1Z26A 1DG9A 1JBEA 2LPMA 4JB2A 4DADA 4RK6A 3CG0A 3H1FA 3A3KA 2FMHA 4JB0A 3TO5A 3O1JC 3OMWA 1EWKA 1M2FA 1YIOA 4WT7A 4MS4B 3H5IA 2R25B 4RU1A 4N47A 3CZ5A 2MYNA 4RK4A 5T3YA 4W5NA 3R0JA 2FN9A 3O1HB 4LRQA 1VLZA 5JNWA 3SG0A 3MYYA 4W5TA 1NXTA 1K66A 4KREA 4Q6BA 1FFWA 2FQWA 1DC7A 2FEWB 3MA0A 1D4ZA 2QXYA 3KKEA 2FTKE 4TLMB 3RH0A 2CD7A 4HNRA 5JS2A 5FWYB 5CNMA 4ZMSA 1LJLA 5FBKA 3OM0A 5JNTA 1DCKA 1QNLA 3JVIA 4KVFA 1BA2A 3H5WA 4MR9B 4P98A 5KWSA 4LZLA 2YHBA 1ZDMA 3SM9A 3HEBA 2PL1A 5EWMA 5IX8A 3KTOA 4P1ZA 4OBBA 3TX6A 1AB5A 3DGFC 4YS6A 5JNRA 3IPCA 2FQYA 5KQPA 5KC9A 1YTUA 1Z15A 4YLEA 1DP4A 4XASA 1MVOA 1TMYA 2OENG 4JASB 4YGXB 1JX6A 3MQ4A 4F3TA 3LUAA 5IUNC 4G0ZA 3A0UA 1Z2EA 4KK3A 4LE2A 3SAJA 1D1QA 3A0RB 3H5OA 3IP5A 1P8AA 2FQXA 2GI4A 3O2QB 2IKSA 3QEKA 4NQRA 5GOTA 1D1PA 4F11A 2A9PA 5DCLA 4YCSA 2JB9A 2NUBA 1FFGA 3BILA 3CS3A 1ISRA 5TQJA 4DN6A 3RVQA 1DCFA 2PMCA 3KLOA 5HQJA 4HNSA 2IPMA 5TE9A 4G0PA 2NZUG 1KRXA 2VUHB 2FLKA 5DLEA 3F6CA 3K4HA 1KRWA 4KRFA 3SQNA 4D6YA 4ETNA 2FMFA 2MYTA 4N03A 1JL3A 2FMKA 3IP7A 2VK2A 1RXEA 3IP6A 2W42A 2IPNA 4TN5A 1EFAA 3OLVA 3VNAA 4EY3A 1AB6A 1NXWA 1RXIA 3F6PA 4MPTA 3GV0A 2R4QA 4NICA 3Q15C 4NV3A 3IPAA 4EVRA 2A9OA 2JK1A 4RXTA 5IUJC 4OATA 1JLKA 1P6UA 3KLNA 3C6QA 1GLGA 1MB0A 3KS9A 1WETA 2ZWMA 3LFTA 5DTEA 3Q7SA 3EJWA 1PNRA 5JNVA 1VPWA 4UHKA 4IF4A 1JYFA 1YK0A 1P2FA 3KSMA 5B3JA 1YK1A 3GBVA 4MR9A 2AYXA 2ZAYA 3O2JA 1D2AA 2FW0A 3DBIA
chains in the Genus database with same CATH superfamily
1W96A 1T5LA 2GWRA 1YOVB 5CCEA 1QK5A 4HB2A 2G5PA 3T3IA 1GGVA 2FSHA 1NI4A 2IYXA 5KNBD 3DO6A 4JJ4A 1WCWA 4XYGA 4O29A 3KDAA 3WXMA 2YQ5A 4PX3A 3S8YA 4MRRA 4Q3AA 1U6KA 4AO8A 2Y9PB 1VIAA 4YR7A 2AC2A 4DBVO 5ALSA 4TLBA 3VBEA 3HL0A 3TSYA 3NOVA 5IM5A 2GPTA 1BVRA 1EQ2A 3G8YA 3JYPA 3RNOA 3RVNA 4J16A 1IY0A 2AXEA 4I19A 2REBA 1E1CB 2H51A 3MPUA 4XWTA 3LTEA 2XIQA 3LOUA 3ZHTA 5C5EA 5FOTA 3IELA 1EE1A 1G21B 1LWNA 3D2CA 1BFKA 3EQ2A 3IKVA 4IZOA 3RRXA 4CCSA 5DNDA 4G5FA 1MEJA 3ANNA 1UT6A 1LA2A 2NVWA 3CC8A 3N7AA 3AVXA 3I76A 2X1VA 1CTQA 2J5XA 3WLPA 4DCUA 4F3RA 3KXKA 3B3FA 5JECA 5H0IA 3PFGA 2P6NA 2RJNA 4F56A 2ZYGA 4CTJA 1IM8A 2HJSA 2FK7A 1EK6A 2ZE7A 5LZ9A 1Y9EA 5TGZA 2PH7A 4C2UA 1RYFA 4AJ9A 3GRZA 4QOIA 1SCBA 1QF9A 4ND6A 1B00A 1XAJA 3TQFA 4G1UC 1RJFA 4ILEA 4JKOA 3KPUA 3IOBA 1UXIA 1D0SA 1XKQA 2Q27A 2VEOA 2XYHA 5FHQA 3JALB 1ZJ4A 3HYRA 4YIKA 1BAPA 3I2YX 2DHRA 1O94C 2FPIA 4Y2GA 4PAWA 1H0HA 1RJWA 2Q0SA 1X7WB 2EIHA 3E48A 4K5QA 2HHJA 4XEUA 2VJLA 2OHOA 3WQBA 5KX5B 3JWJA 5LYJF 4KLRA 1KYZA 1V2GA 3A9CA 1P73A 2H5JA 3G9ZA 3W2IA 5AI4A 1NF8A 4MRNA 2ZDQA 4TSFA 1TK2A 1AZSC 1FU4A 2V6IA 4OB6A 2QZZA 1U9ZA 1J97A 3DMTA 2YS6A 3E4DA 1CUCA 3VTKA 5BNWA 3DXXA 1SNYA 4M1OA 4DJAA 2MYUA 4E7PA 2O6HA 3ZLBA 2BEUA 3IAM6 1V48A 3EODA 3HKBA 3OEEA 4JAVC 4AJIA 4PLZA 4BNNA 2ENWA 4RMIA 2BBOA 1ZM3A 3LPDA 4TL6A 3JPWA 3MMZA 1N2EA 1JEDA 1GSAA 1C41A 1O03A 2W6PA 3JQ9C 4P36A 4YDQA 3U0VA 5BSHA 2I87A 1DLIA 1CULC 3COSA 1A4RA 3IDAA 4ZAYA 3WC4A 1ZCBA 4BEVA 5IF3A 2MU1A 3K94A 1E6KA 4KDFA 5G0VA 4IZHA 5KAPA 1VL0A 3RIYA 1SQGA 1U7TA 1XVIA 5BWLA 1C7QA 3OBBA 1O6CA 3PNOA 4G1VA 4B6FA 2QW0X 1U8TA 4KZPA 2R8RA 3P9CA 4MEBA 1DOZA 3THYB 2O3JA 2GHRA 4TQGA 1KMNA 1JDZA 4QZVA 4FOSA 1TZ2A 1P7PA 2I2WA 3M1AA 2IITA 3ZU6A 2TMYA 2BFCA 1TAQA 2QPOA 4B6PA 4CL0A 1XCLA 7ABPA 1JPVA 1WUJS 4LXQA 1CIPA 3RVBA 2GCIA 2O8VA 3VYWA 1K97A 2B2XA 4PO9A 3IVCA 4AWXA 4Q1FA 4C4YA 2IPOA 1JLLA 3JQPA 1KE1A 4JXXA 1LW7A 2FOLA 3D1VA 2A58A 2W70A 4AM8A 1WPXA 4C0XA 1QQTA 1AS2A 4XVCA 1WXDA 5CXQA 4BNDA 3TD6A 1DAGA 4DR6B 1QGED 4V1CI 5LVAA 3IDSA 4G41A 1GR0A 3PF9A 3QU9A 1CR1A 1TUGA 3RO7A 1GPWB 2VXCA 5HJ2A 1FBTA 4BNHA 2ACVA 1XQ6A 2ADOA 2WF6A 3LW8A 3OZXA 3RGGA 3WNCA 5JS8A 5JS7A 4RTMA 2ZZKA 3HN2A 2FR8C 2PSDA 2ZPTX 3PJFA 3E22B 4KWTA 3KWMA 1DWQA 2HLDA 3U4IA 4OQLA 3H75A 3ZDEA 2P0YA 2Z56A 3ASUA 2ZWVA 1J21A 3AKYA 1PGNA 3SXUB 3EY9A 3E05A 3ZWOA 4D41A 3B78A 4I9HA 1E20A 1QGUA 4M1YA 3KDPA 4BO1A 3K05A 1VSTA 5BW6B 3BSYA 3RJ5A 1IPHA 5DHRA 1ZZEA 2EQ5A 3GJXC 5HILA 1QG6A 1OTHA 2OV1A 2AKAB 2PRKA 1BCRA 3CUWA 2OILA 4YRTA 2QUIA 3WWDA 2ZJAA 2IP1A 2V5UA 5JI3E 2J0SA 1WHTA 2EGUA 5K0LA 4J9VA 2CN1A 4JL6A 3RYHA 4A2CA 1VYUA 4LV6A 5CITA 3LH5A 4DUPA 3QPAA 2XADA 3U5ZB 2OLKA 1R8JA 1UC9A 1R7RA 2X7XA 5K6AA 2ZAOA 3ECCA 1G42A 2XUAA 1WOMA 3G2NA 2ALJA 4NABA 1ZG3A 1LX6A 3A6ZA 4EEZA 3M8KA 4U9HS 1W36D 3TPFA 2V54A 3KT8A 3KKPA 2J07A 3PDUA 1W87A 1RSZA 2FSFA 2I29A 1EBFA 2NXJA 4KO8A 2ID4A 4LXGA 4KR3A 1M2KA 4PO8A 3F97A 4KO1S 4IVNA 1OLUA 4JQSA 3A31A 2W6ID 5AW0A 3ITKA 3I30X 1YUBA 2LD4A 3IEPA 2IP2A 2PGOA 4GGOA 3PVSA 3AZQA 4L4XA 3PXUA 3LA8A 3UJBA 4ABYA 5ELMA 1TOAA 4PHFA 5GMOA 4UTVA 1C1XA 4WBXC 3EUWA 4IXDA 4UFOA 4LOIA 1BMQA 3Q1KA 4HFNA 1KSGA 3IR7A 2XJ4A 2ZW9A 5GV7A 3HFSA 1E9FA 3DL0A 4GFDA 2QKYA 4IDEA 4QOFA 3KAKA 4DSNA 1P5ZB 5C51B 1U0OC 4LVNA 4MWGA 5H83A 5IYZA 4YFYA 1PVDA 2C5GA 2E82A 1VE1A 1W30A 2M9MA 2W9XA 4ITRC 3SPXA 1CVLA 5LZ8A 4HNAB 1N1DA 4QE3A 3CNNA 4U2CA 5KOHA 3LWDA 4XGRA 4RV9A 3I64A 3EZLA 3LOPA 1FDOA 3W1EA 1ODLA 1VSUA 1G0NA 3WGIA 1Q1NA 1NJ2A 2VQ6A 3AUKA 3TQCA 4XEHA 3ZV5A 3AKDA 5F5NA 4DCGA 3KQLA 2BKVA 4BQSA 3M81A 3NTLA 1HT0A 4BQFA 3H1GA 3IUEA 1KAOA 3AOGA 4BMCA 3B12A 3E9EA 4TQ9A 4AP6A 4JD5A 4S0ZA 2CJWA 3AERA 3D4OA 4QPDA 4X3OA 3REQB 4ERXA 5HKKA 2R11A 2ECPA 2V96A 3CO5A 3WXBA 2BYTA 3J81A 1HR0B 1WG8A 2QP3A 4ARZB 2HA2A 5HE9A 3C8UA 3IV9A 1JKXA 3ZDDA 5I3CA 2DULA 1Z9BA 2HH9A 1FLDA 1BX1A 1UKYA 4DMFA 4F2WA 2VBGA 5CVVA 4R01A 3NAMA 3I9FA 1J0CA 3I73A 4MP6A 4B43A 5KYXB 1CUSA 1IM5A 4M86A 2MMGA 3O90A 3AM1A 3BCSA 5EHXA 1U7ZA 5BR8B 2I2DA 1I4WA 1G1MA 1NIJA 4DMCA 1RFLA 1R3DA 2PZAA 1Q1AA 3B6MA 3C6MA 4Y0NA 4CYMA 4DTIA 4IWNA 2ZUWA 2QM7A 1B6TA 4HAWA 1ADYA 1K2WA 1KDRA 2AVNA 4L0QA 4O6VA 1ODJA 4FZVA 2GK7A 3CZRA 4DNPA 1TMGE 4M99A 5HM6A 4CUKA 4TT3A 1X2EA 2PLWA 3CYFA 4POAA 1M6VB 1WSBA 4ZVLA 3DDZX 4FFLA 4KXFB 3ONFA 3PKJA 7AT1A 1M73E 1NNSA 2OBBA 5KO2A 1BHSA 3AZOA 2XCSB 1HKHA 1M5UA 3Q40A 2GTPA 4IIJF 3VKUA 3MB5A 2OYRA 4KWCA 4V0SA 3E9DA 4J29A 3QE2A 2HMWA 3GDFA 4MZXA 4MPRA 4KDCA 4ZV4A 1Q0PA 2QRLA 5LWHA 4IAOA 4RHCA 3BN3A 1Q1EA 2YJ5A 3DO8A 1WVMA 3MT8A 4QPCA 1AHIA 5BSMA 4M9CA 3S8EA 2J59A 1V25A 2V74B 4HX9A 1NW7A 3LFUA 1SRQA 1UC8A 2DE0X 3ZGYA 4HWKA 1F7UA 1EX7A 4Z4HA 4WZAB 1B8PA 4XLTA 1PT5A 4CV3A 4D5EA 2B1GA 1ISGA 1JIXA 1L7DA 3CKMA 5HIMA 2CNLA 4C5CA 3WQRA 4NMWA 5KINB 1EVKA 1T35A 3M7IA 3WLEA 3ZE0B 5GJBA 3GJQA 4I8DA 2VNHA 2BD0A 2YMLA 3DMTC 4IQ8A 4OKNA 1T9GR 1F6DA 4RIFA 1DKNA 3BMNB 1K7XB 4BFSA 3G1TA 3NIWA 4EW2A 1DRUA 1YULA 2OV2A 3Q7RA 3VKGA 3PNKA 1JJFA 3ZJYA 3HTXA 3MQFA 1A96A 5CA1F 3O47A 5CW2A 2HT1A 4PHTA 3OSUA 4B3XA 3MWDA 3BZUA 1KJ9A 2JLXA 3EUFA 3ZCRA 1VJ5A 3MUEA 3W5IA 2IQ5A 2WPDA 4F7WA 3KJGA 4AO6A 2I71A 2OV6A 5DTMA 1XVTA 2EJVA 1EK5A 2H4HA 3BL8A 3RV4A 5MHTA 1R6VA 5DI3A 1R0YA 5BOSA 5BP7A 2Q5IA 2P2ZA 1JFSA 2RHLA 4AK9A 4B6RA 2EYQA 4I55A 3D6UA 2D1SA 1YA4A 2C7GA 4L50A 2QG6A 2H7CA 3ND8A 4MVJI 4O25A 5IARA 2HSDA 2DMRA 2CE2X 2ZIVB 4GMXA 6PFKA 4QUBA 5CIWA 1O6ZA 1WNTA 4X1YA 2WWTA 2PWPA 3LUFA 3OZRA 5K0ZA 2D0PB 3OP1A 5FOUA 4EEXA 4D25A 4HN2A 3HZHA 3DKRA 3EA4A 4ZOCA 2BDEA 3TUIC 2ZS9A 2PSJA 4RVOA 4A1FA 3DOIA 1R4MB 1YFZA 4LHEA 5CGZA 3TGWA 4YMUA 1ODSA 4J7XA 4HFJA 3ZWNA 4MYRA 4MUKA 4EG8A 3M5CA 1SD2A 5DLPA 3GJ5A 3ILSA 2GNPA 5BURA 2IS4A 3CUSA 1S3FA 1X92A 3MK31 4KAJA 4ATNA 1RC1A 4DA4A 5C1PA 3NHAA 1CY2A 2G6BA 1PFYA 4OAPA 5C2JB 4FMCB 5FBZA 4G8CA 3A25A 3F3KA 2C3OA 1KK0A 4EFKA 2P9YA 1OKKA 4X0EA 5JEDA 3HJTA 2QYSA 4RE5A 4B6OA 3I8XA 1NMXA 3HU2A 3UJCA 3U6BA 2V58A 5HZKA 1S4QA 3W6OA 2QMHA 2WOOA 3SBXA 1V6SA 3B3QA 2MDTA 4EHAA 2CUKA 1EVLA 3KTDA 2IH5A 1MENA 3RH0A 4HPWA 1FMJA 4Q3OA 1KIFA 2IX9A 4YP7A 5JRJA 2Q1SA 3R3SA 5BN1A 2UZ1A 1SK9A 2N3ZA 4GOMD 1Q92A 4IUDS 1G6HA 2R6JA 4UZFA 3NPAA 3AM4A 4JI1B 2G82A 1RJ9A 2D06A 3CN9A 2PL1A 2DPGA 3CXUA 4B40A 1XF1A 2HDOA 2UZ0A 1B42A 2ZITA 3SYMA 1M72A 5F78A 2XUIA 3B6KA 4PU0A 4N5HX 1E32A 1NVAA 3D0KA 3AG6A 3RAGA 4LSGA 3UCXA 5IDVA 1LDYA 1OZ0A 1L5GB 4JFRA 1M6HA 4XJVA 4FMDF 1T9AA 3DL2A 3Q72A 3JQ7A 1DP4A 5GGXA 1V4VA 2ZRHA 3GQVA 1P9WA 1EWYA 3PVZA 4KUEA 3U3KA 3L9XA 2UZAA 3GEMA 1COWA 1JVSA 4PYKA 3L93A 1ZJYA 1V8BA 2WG0A 4YRBA 5F5XA 1QANA 3P0RA 2DLCX 4Y2SA 5F1YA 1RZVA 2PGLA 4D98A 1FTYA 1OY1A 1I4OA 1NBWB 1XV5A 4IIFA 1P61B 2ORED 4FYHA 3S2GA 1EFUA 1TCAA 2WHPB 1XAIA 2W7TA 3QXGA 4C9BA 3E53A 1Z5ZA 4AS2A 4UBIA 4DPMA 1U2DC 3RRFA 1GNPA 1VKOA 1OSNA 4ZEWA 2VHQA 3D3JA 1KY3A 4M9UA 3O3OB 3VSEA 2X5NA 4TLDA 3WGJA 4UHDA 2W6ZA 3UOWA 5LC1A 3MGBA 3DCIA 4FGLA 1BE6A 2FW7A 3CPEA 2NMVA 4FR2A 1VI6A 3UT6A 2JFZA 1BTOA 1NVFA 3I37X 2D13A 3SVZA 2JGAA 1RXEA 1GZ3A 2PKQP 2ZTUA 3C15C 4GZMA 4KDEA 1NNEA 4E33A 4LQ4A 4JLBA 4TMZA 4J1TA 3FZGA 1WULS 1OH6A 3F98A 3L40A 4X41A 1RKBA 2XYVA 4TMVA 1XMSA 1OZHA 2P40A 4OATA 3GFGA 3RVDA 1AY0A 2GPAA 3DAYA 2IQIA 4U2BA 2HLNA 4PCVA 3ZVLA 4BGDA 5AHWA 2COKA 1FEZA 3THSA 1JVBA 1PG0A 3IODA 4L8GA 2GN2A 5HQTA 3AJ9A 1VMAA 5BVHB 4A6EA 1QHEA 1OFUX 1QK3A 2ES4A 2XZDA 3DPIA 3AMVA 4FYMA 2X7JA 1Y3CE 2XE8A 2XOEA 2A5DA 3DULA 4MR9A 3W4JA 3ICWA 1VZ2A 3NG1A 1M5TA 3MXTA 4FR5A 2FVYA 4DA6A 5EJ8A 2AHRA 2BR5A 1Z6PA 4MKIA 4WZAE 1GPDG 2P68A 3EG9A 4DYVA 4X3PA 5ADWA 3VZSA 4IHJF 5JC8A 3RAJA 3IYLW 2IWRA 4DMKA 5DFAA 3F3MA 1FYWA 1JPNA 3ZXSA 3RD5A 5JO0A 2NACA 1Y3FE 3YASA 2YVLA 5K4AA 5K51A 4KKXB 4P5PA 3A32A 1ZRHA 4EW3A 3ZD8A 3NDJA 5THXA 1QSGA 2HZBA 2OAQ1 2IUEA 2Y71A 3PUYA 4FD2A 5FNVB 2YWHA 3RFVA 2DWOA 3RHZA 3ZZTA 1ZR2A 3L18A 2J7KA 3D4PA 1BHO1 4K3VA 1CUWA 4WNYA 4UOEA 1M8KA 2IYSA 3RM3A 1LUAA 2QUZA 2OORA 3G59A 1GT6A 3RIXA 3GLKA 3LS2A 3GPBA 4MGZR 3W8NA 3QU2A 1G21E 4G0YA 3ACBA 4MLZA 3UFXA 2J3DA 2QM3A 4C0QC 5CYOA 1DG1G 1FLAA 4XYBA 1ZQ9A 5HYVA 2F17A 5BN5A 3JYHA 3EDOA 3IJRA 2RKWA 5AVUA 4R2WA 4DKJA 1FRZA 2CMHA 3LY7A 3UF0A 5KCZA 3NAQA 4JQCA 2XUDA 5BMVF 3GLGE 4L51A 1IOLA 4ILKA 4QELA 5E2BA 1V5GA 3GVPA 4TSRA 1FMFA 5E6UA 1WHSB 2AH5A 4YONB 4FMCF 3BE5A 1WRBA 3EVTA 3ZLTA 4ARZA 1JEAA 3MJDA 1FRNA 3OZDA 3OZTA 4KLZA 4JB8A 1MAHA 1TM2A 1G20A 1NW6A 4LXTA 1AQ6A 3W2FA 4E15A 1KWGA 2YL2A 2O8FB 1L4YA 1JG1A 3E9RA 3V1YA 1FTGA 2CLLB 2J5RA 3RS2A 4UHCA 4QHYA 2WWVD 2XB6A 3JQAA 3RANA 3BFPA 5CVDA 5B6PA 2GD6A 3ZGNA 1RDFA 4GI2A 4PQFA 2HJHA 3CF4G 1EGMB 1GCGA 4DRYA 2G07A 4JT9A 3FD8A 2A94A 5FBLB 1YBMA 3E5RA 4Q5IA 4G0VA 2QI9F 2LUOA 2X2OA 4HH4A 1X1QA 2FXIA 2JFWA 5EOVA 2GEDA 4DA0A 4MAMA 4AJOA 5IPFA 5KZMB 2OHIA 3MJ4A 5CB4A 1TA9A 2WIAA 5DMXA 2F64A 1B43A 3NAGA 3QYPA 1M0SA 3OQOA 2AG1A 2FUNB 2CUNA 2ZK7A 3FWPA 3K0CA 4FT4A 1PL6A 2JBAA 2WIJA 3D43A 3HU5A 4J3FA 1ML4A 1TVKA 3FBGA 2R6DA 1TZCA 2ZU6A 3I09A 3ZXUB 4CTOA 3RC9A 1HFEL 2VSNA 4PRLA 2Q2QA 5AI8A 4UQOA 1H4SA 1J4AA 2NV0A 4JMLA 3VNUA 4QM6A 4BLWA 2O4CA 4JUAA 2QN9A 1MX1A 2H1IA 4PZEA 4Y18A 2O8DA 2GKOA 1WHTB 3GL9A 1DELA 3VNRA 4CLHA 4FZ5A 3STXA 4I5EA 2EEZA 3ZLJA 1V7ZA 4QQNA 3GXOA 1NTOA 4LX8A 2G04A 4PC7A 2I3ZA 5IZCA 4CV2A 5EJ6A 5SYNA 4ABTA 1DTSA 1X2BA 1JN0A 3QU7A 2HSJA 4M0EA 1EDEA 2Q7OE 3ZDYB 2HLHA 2AMFA 1CY8A 1NQ5A 1MAAA 3CONA 3HR7A 4OHBA 2ZVQX 3QVGA 4JC8A 4P4GA 4BBZA 4BS9A 4Y6RA 1T0HB 1J07A 2Y67A 3WHPA 4TYMA 4EUNA 4HK4A 1VHLA 2AJLI 2QS9A 2ZRCA 3EC2A 3K73O 4NPHA 5DNEA 3S2YA 1XWWA 4LI3X 3SY8A 5BN3B 1I2BA 3BICA 2HHLA 1VSBA 2ZYIA 5HIIA 4KTTE 4UDNA 1KY5A 3VSDA 3ICVA 3ZHQA 4C3OB 4UOZA 1OOEA 3AX6A 4HNAA 1I0LA 3E81A 1MN6A 3VOTA 3KJNA 1G41A 3C6ZA 4AZ0B 5K09A 3PTLA 2KSQA 1XNHA 4QTXA 1U0GA 2Y6VA 1RD4A 2P9JA 4R1PA 5KU1A 5CT4A 4FHFA 4HXEB 3UTCA 3UATA 4GNRA 4QTZA 4DCJA 4B7XA 1GG9A 1OC4A 3RTGA 3E0XA 2NZWA 3EPHA 4CEIA 5LBUA 3ZNNA 2J6HA 1RXWA 1ZGZA 2RGRA 2Y8EA 1WHSA 4M9ZA 4R9NA 4TT3D 3EVAA 4HP8A 4YAIA 1IBLB 3U9LA 2X6RA 1PDVA 1ZJ5A 1J90A 1CFJA 4YY3B 2QRJA 3LQKA 4HWSA 3K9QO 1RI2A 2XD9A 4FQ7A 1AN0A 3LYHA 2C1ZA 3TL3A 2I2XB 1YDWA 3KOOA 5ESXA 2ZJ2A 4DM4A 1W5TA 1E1QA 1VHWA 1KO7A 3MRXA 2PSEA 3R9XB 3MRVA 4XGIA 4C20A 2CHUA 3A3YA 4GI1A 3OQVA 1ZNZA 3ICEA 1MX5A 1Y63A 4OHMA 4WZBE 1TEXA 3SK0A 3WYGA 5K0TA 1O57A 3N2ZB 9ATCA 3SLKA 3RS5A 2DBVO 4ND1A 1VL2A 4NOJA 4Q1DA 4ZVSA 1Y1TA 4ZCRA 5JAPA 1Y4AE 2ZWOA 5JJCA 1VXOA 1UK7A 2PX4A 1YU9A 4C7BA 3ESQA 3PGMA 2YS7A 1CJSA 1AQJA 1YBAA 2XUJA 4CN8A 4DZRA 4QFMA 3M4NA 1J8VA 3ZBUA 4B82A 4FLMA 5FTLA 4RLSA 4DJJA 2VRCD 4X1IB 2ZE8A 5IVIA 3QPBA 1QUEA 1YB1A 2O1XA 4JYMA 1BE0A 2DQZA 1IZZA 2JHFA 4MVJF 3ZZ0A 4YA6A 2ECKA 4AZVA 3L49A 3GR6A 4WK0B 5F2KA 4E0BA 5HIKA 2O1SA 5D84A 5DGDA 3L0IB 4XVUA 3MWGA 1M1YB 4M8LA 4XFJA 1N5MA 4ZOAA 3VHLB 4K87A 5KQLA 3A58B 4JBHA 1RHJA 1Q7CA 2A0UA 2QVGA 1E94E 2BMWA 3E3MA 4WBNB 2JGFA 1Z2AA 2AZDA 2AJDA 4IH9A 5JUWA 2OBXA 2Z1MA 4KXYA 3SE7A 4M0PA 3HVRA 1XAGA 1YJBA 3KAJA 4FWTA 3QVSA 4JROA 3M1YA 2EKPA 3NT5A 3RT7A 1F0PA 4YT8A 1GTG1 1HT2E 1RYBA 1TGVA 4YCBA 3WZMA 3OPYA 2PT9A 4UZSA 5G4KA 1QE5A 1IFXA 4EMTA 1ST3A 2X7HA 1HEYA 4RULA 3DXFA 1JA1A 2WB4A 1HDRA 1KJIA 3ROQA 2ZUEA 3PNPA 2FX5A 4IDOA 2XTZA 2F1IA 1YS2X 1L3IA 4P5DA 4RJJA 1P2DA 1A2QA 1XKTA 1Y82A 2QL9A 2Y1WA 2H1HA 1KDOA 3LNTA 5I9MA 4BN0A 1XPJA 1RXUA 1ZAKA 4LHXA 2ZAGA 2Z8ZA 2XF8A 2LR0A 3T8YA 1RWQA 4OCZA 1X14A 2Z1DA 1UWKA 3H6GA 3QU5A 3TIIA 2BI7A 2XCRB 2J9FA 2XTJA 4L4YA 4YJDA 2BCJQ 5AXCA 4BVEA 1ISSA 3F9RA 2NTJA 1SXJC 3HE3A 1JHDA 1G5TA 3PUVA 2G09A 4RHUA 3DVSX 5KYYA 2QRMA 1I30A 5A4MS 1UBTS 2XDYA 1RPZA 2RHBA 1RHUA 2CDCA 4ZQGA 2YMQA 2I8AA 2RHDA 4O4IA 1JDPA 3A9SA 3WYBA 5GZ1A 3VOSA 2PRYA 3U4CA 4ZT4A 3EQ8A 1P1FA 3OIYA 1A1VA 2GM4A 3GNTA 3DB2A 4TXNA 3HA5A 1P2UA 3E35A 3ESXA 2BHLA 1HLFA 4MI9A 3A10A 3JPYA 1I01A 4IIUA 2A7QA 1ISJA 1GZUA 4MINA 4TWIA 5JCPA 2E5FA 4PICA 4XQEA 3MCZA 3O73A 2JLVA 4WY8A 3QKSB 1AF4A 3Q9SA 4NOKA 5KNBH 4X61A 3QE9Y 1ZRMA 5GJWC 2XCOA 1KFCB 1TAGA 3JRWA 3SZOA 1G19A 1KFEB 5BWOA 3ZJUA 2GD0A 2PZLA 4MVJE 3IVAA 3ZWPA 5K8IA 1J0XO 3GW8A 3AR2A 2MYPA 4KE8A 3THRA 2R1UA 1V11A 4WVFA 3RVKA 4OLBA 5C8YA 1P39A 3QK7A 4EVQA 3PSAA 4QXAA 3WMWA 1RPAA 1G8GA 1X94A 3JYNA 4KBGA 4DDUA 1WXXA 3OE1A 1A77A 1PHRA 2NO9A 5ALMA 5K8LA 5BY2A 4P3YA 1OAAA 1Y5RA 2GEKA 2GRJA 3ZZ1A 3PDIB 2FUEA 4QVGA 2BRUC 4IHQA 3W90A 1MABA 1QXSA 4ENUA 3HKDB 2LGJA 4FE4A 2HDHA 3FFBA 1V8FA 3TJMA 3T0GA 2FGKA 3VU8A 3KQOA 1P4SA 4XI9A 1GIAA 2P2SA 4DR4B 1LPBB 2BISA 1U2PA 1NLMA 2IYUA 5E7QA 1GDHA 1L4NA 1N5IA 3FLAA 4I4NA 5FA5A 4GUAA 1M6YA 5KMGA 3RBZA 3MILA 2XNDD 1X70A 4XTRA 2Q3JA 2BKXA 2XOKD 3UO8B 4F9FA 1I3OA 3NWEA 4DUZB 2JG3A 1T9BA 2BKUA 4TGLA 3PHIA 4RPJA 2Z08A 3K5HA 4LV8B 3PFFA 4HNVA 4TL9A 3N58A 5EZYB 5BXQC 4EJ0A 5LWQA 4A0QA 2C0PA 1ZLXA 2IH4A 1DAOA 3CCBA 3QTLA 3CMCO 1RTTA 1Y8QA 2HBRA 4N9QA 1E2BA 1P0IA 4O1IA 2O0KA 4ENWA 4I8XA 3E70C 3H7AA 1XZFA 3AHHA 5FUVA 2NNLD 5LQSA 4QQ8A 4DDMA 3AF6A 2OFWA 1LDEA 2PL5A 2YMMA 4H7JA 4PINA 3UJAA 4ALNA 1R3UA 2WWXA 3ETLA 4YMLA 1YJCA 5JT1A 4GGPA 3IEMA 2FEAA 3QUTA 1ZZGA 1XMOB 2GHIA 3CO0S 5JJBA 1DEKA 4OMDA 4CCWA 3OURA 1XRLA 5BMVA 2AOXA 3WA6A 3DWIA 3QEOA 2YRWA 1JHQA 3LAWA 4LDQA 3BGIA 1TM4E 1K7EB 2ZRBA 3MCAA 2D54A 2PUTA 1GL9B 3IH5A 4JBGA 4F71A 3TKAA 3OMWA 4J75A 4YLGA 3EF1A 3S2FA 2QLFA 5J5VA 4H7HA 1T4CB 1JGTA 4KXVA 1V71A 1YIOA 3RJ9A 3W6PA 4V0ME 2DTEA 3HYTA 5T8KA 3RB8A 3CZ5A 1Y3AA 5T3YA 2FZ4A 3MNFA 3BERA 2O14A 2PXXA 1E2FA 3MQ2A 2YHIA 5FOWA 2EJTA 3LY5A 4OJNA 3U4DA 2ATVA 2IGTA 1K66A 1BD4A 4OI2A 3ETGA 2Q62A 1K08A 3VDMA 1E6CA 1Z0IA 3O38A 1Q3HA 1XWFA 3NS7A 1JZTA 1TU4A 4ZCPA 3PC7A 3OZBA 2BGLA 3GT4A 4Z51A 5JNTA 1J2RA 3TBFA 5TMDA 4NOLA 1GAQA 3EVNA 2IHKA 3ONWA 3OFSA 4NZ9A 4MV6A 2JGLA 1EGAA 4BWYA 3GOHA 2XDAA 1UEXC 3ZWYA 3AUFA 3T7KA 3KTOA 2INGX 2QTLA 1Z28A 1S2DA 4KO4S 4WCFA 1JT2A 5H82A 1UINA 3I39X 1PR1A 1HC7A 1PL0A 5HS6A 3IPCA 1WY7A 1YD7A 3BAZA 1D6MA 4YCLA 5ECYA 3K4PA 1CUJA 2HBYA 4G2TA 4E5NA 4YCCA 1JG7A 4ZYTA 1AGRA 4D97A 4PYOA 4A9AA 1CJMA 4PFSA 1TMKA 3WL8A 4B8WA 1A82A 3QUCA 2YV2A 4PC1A 1VHDA 3FNRA 3WRXC 2YOGA 1P3Y1 2VZ8A 4PNHA 3SC2A 3AGPA 3V4SA 1JR3D 1ZUD1 4FEGA 4QOSA 2AMVA 1Q1GA 3CRVA 4IJKA 4QEZA 2ZSHA 3HBLA 1G98A 3OQIB 4FWIB 1W4CA 2YWBA 4BC1A 3L1VA 3U49A 1H2RS 2IBMA 2TS1A 1QIGA 3H87A 1AKEA 4D5GA 4J3JA 2IF0A 3FNGA 2PQ6A 1CF9A 4FX2A 2NP7A 3KUKA 4G0PA 4Y2RA 3CZQA 2W4IA 4YI3A 2X40A 1HOTA 4XWYA 4CIDA 1N2CB 4PQRA 1MD9A 2C2HA 5AUOB 3AB8A 1L1EA 4F3KA 5IKXA 2O2GA 3DEIA 4A0FA 2AF3C 2NTNA 4H77A 4KGZA 2WJPA 1II8B 3OJFA 1GU1A 1AA9A 1QX3A 5AK6A 3UFXB 3VNAA 3S1AA 4U4AA 3V2IA 1XRPA 2QVYX 2X1HA 4UNIA 1P1JA 3IKLA 3WO1A 2X4LA 2C7PA 1DHRA 5FI5A 1OXTA 4M2LA 2NAFA 1Y33E 3KR2A 5IUJC 2JLRA 2V97A 4UUOA 1JE1A 5E4JA 3ENZA 2JD2A 1CLUA 1GLGA 2X1LA 4UE3S 4WDQA 3ICCA 4WCDA 4CQNA 1NNLA 3EVZA 2ZIXA 3AEYA 4BFVA 4CLRB 1DBVO 3V46A 3V1LA 2J45A 5GV8A 3I92A 4NHOA 1FP1D 3G2OA 4JKIA 4UBLA 3T9FA 3ESRA 4DSTA 2ZBDA 3MWFA 4YP6A 4BE4A 5K6AC 2OCKA 3H19A 5EJGA 3T9AA 2D1FA 2AXPA 1VL1A 2OECA 3H5AA 3QJYA 1MZPA 3ETDA 1Z4NA 4YUZA 2G88A 4KPYA 3KQWA 2AEJA 1H93A 3DV2A 2VAVA 4R5MA 3CVYA 1DQPA 1TEVA 4KEAA 4L73A 4TWRA 3UJ3X 4LGCA 4KB5A 3K0FA 3V2UA 4OFZA 1YQDA 1KK1A 3WLSA 1GAJA 3GLFA 2FFHA 1N1MA 5HVNA 2VR1A 1YR1A 3GBPA 1IUNA 4LZPA 4NOMA 2OQVA 4E5PA 1YQ9A 2OV4A 3QGMA 5JBIA 2WE7A 3OE7A 4MA0A 4CKXA 5A0FA 1RI1A 2Q9AA 3BSSA 5FTMA 3WLIA 1NU8A 3EDMA 1SIUA 2WF7A 4OQ4A 4BV3A 3LMKA 4XVQA 1LLFA 2QTRA 3H3FA 4IIBA 2BE9A 4OKIA 4WFQA 5IYZF 5IZCC 4BMYA 2X2EA 4MTCA 2R47A 5FI1B 5CVTA 4CHGA 2Y93A 4QOEA 3M6WA 2F8SA 2VI5A 4GPEA 3CURA 3DQPA 2R7KA 4MKRA 2ZSKA 2VYND 4XSVA 3DAGA 5K3AA 4YHHB 3KQNA 4C4AA 4DIDA 2X8AA 1AOXA 1YQUA 2H6EA 4H0NA 1CR4A 1JHYA 4KL8S 1W5SA 4N5NA 5I9BA 4BWFB 3M6UA 1XJQA 4GOLD 4UCFA 5TMBA 1JHAA 3WQHA 3T7SA 2X0DA 4X7MA 2ZBUA 3DLCA 2YNMC 2OFPA 1QFZA 2XTMA 5JLJA 1J39A 2QTVB 2P41A 3RQSA 2FJUA 4OSPA 2ZTVA 3O8OA 4QOHA 5EFZA 1P29A 1P3JA 5L3RA 3TD2A 4I50B 1V7CA 2YZMA 3ZCPA 5CEFA 3UOAB 1F2UB 1H05A 2W2VA 1CZOA 2O3UA 2M98A 4OG2A 3FCXA 2PL9A 2ZTMA 4OYYA 5EWJB 1CCWA 3LSYA 1EESA 4Z9FA 1D6NA 3I58A 1QZUA 4V2IA 5NULA 1BU8A 4CEIB 4LZWA 1HLPA 2FUG6 4FW9A 3RVJA 3SVTA 3RABA 4KLNA 2F59A 2PTHA 1G8YA 2XA2A 3VU3A 4Z4QA 1KMMA 1OYYA 1EG2A 2W11A 4C6SA 5EWLB 3U4MA 2ZVJA 3ZDFA 5LR6A 1T8UA 1Z2DA 4PGMA 3NKVA 2IUTA 2XUHA 3WGHA 4RVUA 1FFSA 3HP4A 4QPJC 4Z4EA 3DNFA 5C4MA 2I4NA 4INPA 2VH5R 3LDFA 1YT5A 3M5WA 2CK3D 3AB7A 3ROXA 1R88A 2VP2A 3FLMA 1Z0ZA 5JISA 2IW3A 2OTCA 4OXRA 1SG6A 4M6WA 1HMYA 3ESYA 4BZQA 2I2BA 1BOFA 1V8DA 1IAQA 1YHNA 3PHLA 4BJ1A 3VI4B 5JNSA 3HM9A 1E2HA 1X86B 2XRYA 3ROGA 4HUJA 3HDJA 5BNZA 1MO3A 1PJ4A 2GTHA 3VZQA 4I9GA 3KUDA 2RONA 4W7HA 4DV1B 4LF8B 1Z36A 1NL3A 1DAHA 5BVGB 1IZ0A 1KP9A 4UHEA 2F3SA 1P33A 2YV4A 1DC8A 4H4DA 4R8MA 2O2JA 3DYIA 4BZXA 2FETA 1P75A 2GYWA 3WGQA 1M8FA 2RHJA 1B74A 4G1BA 1Y81A 3VPCA 2AK2A 3ZU4A 2F67A 3WISA 1BXRA 1AC5A 3ELYA 5AVWA 5FEMA 4BNMA 1YFJA 1GNTA 1DO0A 3PX2A 3UICA 2OAGA 4GLJA 1JH9A 1PWEA 7MHTA 2GPYA 3DFKA 4MH0R 2PZMA 1TLFA 2RDMA 4W5QA 1RYEA 3N7TA 2AE1A 2XEXA 5DTJA 3SICE 2GUWA 3CLTD 3CZMA 4UREA 2DFDA 2REXB 1CUXA 5SZJA 4CXMA 2JFBA 2WF5A 5FF9A 4UTPA 4UNQA 3D7LA 1NJGA 1ONNA 3D9QX 4GYWA 3EXEA 4N76A 1LVGA 3C6XA 2YQZA 1A5AB 2WLTA 3N05A 1GKLA 1PQUA 4WN3A 5CA0B 4MI6A 4MGEA 4S1WA 3C85A 3IDZA 2VSQA 3L7DA 5D8DA 4G4GA 2OSVA 3WGOA 4B76A 3NHUA 2ZXUA 1QYWA 3P2OA 1AZWA 4US2R 2FFAA 1OYOA 3GLGA 3A2MA 3IA7A 4AMYA 2RHGB 3HEAA 2GA8A 1LLUA 2XY4A 5HE8A 3ZJTA 4LVUA 1TUBB 1WD7A 2QUKA 3KL2A 1KMIY 1XQXA 2BDTA 3VR5D 3E5HA 4MYUA 1XDWA 5I7AA 3R5KA 4GI7A 2JA2A 3TH5A 4DJTA 4FIDA 2FMTA 1FK8A 1K5DA 2HF9A 1W2WB 3KQSA 4OHZA 3AEXA 1ZH6A 3FFAA 4HSGA 1JSRA 3RW9A 4CM9A 3MLBA 4J2OA 1NSTA 4F38A 1VJDA 1A9OA 4Z4CA 2JGNA 1AK9A 2UUOA 3NBUA 1FFYA 2BF4A 1VGVA 3S1SA 5HSGA 3KETA 1KI3A 1N4DA 5DN6D 5BSEA 5HNKA 2GEUA 4RTOA 2PS9A 1DADA 1M54A 1VDMA 3OO1A 1Y5LA 1QP0A 1K3UB 1MNQA 2F9LA 1VPEA 4MYTA 2ZT6A 4GPD1 4N6NA 4UXJA 5DYYA 2NU9A 4ZAWA 4U3JA 5DRTA 2UU9B 3DDWA 4PLVA 5GJVC 3WL4A 3ZXIA 1N7HA 4BFWA 3GFBA 3L1JA 4MPPA 1ZEJA 1L7QA 1M0WA 2G71A 2G5TA 3GLRA 2ATCA 4IH1A 1L4MA 1Z6AA 3QH4A 4RKRA 2OPHA 4EQZA 5IS2A 1N1GA 4AY6A 1C3VA 2KE5A 1ZMRA 2ZE6A 4FC6A 2PBLA 2O2SA 4MB6A 3SDBA 3ZGXA 1C1YA 1XZGA 4LIPD 1THGA 4OQYA 1J2EA 3IBGA 1M1UA 4LFBB 1A5BB 4H2DA 3GP3A 4CEHB 1S2NA 2A9QA 1NX6A 2D4AA 2QTFA 3GPIA 3RPEA 1LF0A 2AGVA 3TR0A 4G9BA 1GITA 2APJA 1SQ5A 2JJ2D 4ZGBA 3KTAA 2IXDA 1PDOA 2VYCA 1GZDA 1U0LA 2I99A 4ZIRA 3CSSA 2WJJA 5ISMA 2FEMA 5T8KC 2GN8A 3I72A 1CNEA 2JKYA 1NBAA 2YXBA 4H17A 5EGNA 2AL7A 2I67A 4AZ3B 4E2ZA 4YJ2A 1IQ0A 4DPKA 4HG2A 1GDDA 1T3SA 3LPAA 3JATA 1B76A 5FL3A 4RVHA 1TJNA 5LDHA 3N2EA 4Q4DA 4ND8A 1MVLA 4JIGA 1BMTA 2O0LA 3T0IA 3ZWBA 4KRXA 3IA2A 2AT1A 3AEKA 3P27A 4OQEA 3EC7A 5B53A 4EG3A 2GCOA 5K0FA 1Z0JA 2O8BA 2ZRLA 2DFPA 1D6JA 2ZB7A 4GXRA 4IBOA 4LCBA 4LGVA 5B1SA 3ZVRA 4CQLA 4DMRA 1A3CA 2IUUA 2QLMA 4XGQA 3GLHB 4C7XA 5MDHA 1JHMA 3ZVKA 4GMGA 4BVHA 3QELB 1FQWA 2YXLA 2RAFA 3HY3A 3OBIA 1XPOA 2KW5A 2V7XA 4ZHQF 4LNHA 3L0OA 1S9DA 5JQGF 5BYJA 3TRJA 5DDIP 3UN1A 3F6RA 1YZUA 4RV5A 5HRCA 2VPPA 4O2AA 2WU4A 2MINB 2QP4A 2ZSIA 3D8NA 2BZSA 3H0EA 1FDTA 2X76A 3E22A 4M88A 5TNXA 2M32A 3B20A 4D8WA 2BOVA 3KYIB 2ORWA 4HAXA 1TA4A 3ZE9A 3R3WA 2PLNA 5C52B 3ICQB 2PQMA 5IXYA 1QYDA 2VK1A 4Q3BA 1HYGA 1MC8A 2ZIGA 4HB3A 1W76A 5D3QA 1PZEA 2QW8A 3C4VA 4I5GA 4KMOA 4F12A 5HQ3B 4ZU3A 1MG5A 4RS3A 2C99A 1MHTA 1G60A 4M98A 1G2OA 2QU7A 1KPGA 4OHPA 3RVRA 4NZPA 2CVFA 1O8BA 2Z04A 4H60A 3QX3A 2VNKA 4AU1A 1IUPA 2ZQZA 1CFZA 1RQXA 2R2GA 3AV3A 3GGOA 4ZVKA 3L02A 2H4XA 1XZIA 2HWKA 2J3QA 3HEMA 3ODPA 4TKLA 1MP0A 4E2XA 1KFKB 3DW3X 2OCYC 1QONA 1ZONA 1N6NA 2AG5A 1HORA 2R5WA 3L6DA 3LDGA 4NU5A 4X60A 2Y9MB 1PV2A 3A2NA 3ICOA 3WFZA 3VR5A 3E9YA 3THXA 1MTOA 1WXHA 3OOSA 4EY8A 2A5GA 5I7SA 3F3YA 2QVBA 3LWZA 4JOSA 2HYIC 4MGHA 1ZW6A 4MJXA 3BE8A 1J8DA 5E3JA 3K8OE 1KNQA 1T5IA 3OWXA 1AUQA 1KRHA 1OAOC 1XTSA 3PUXA 4KE6A 4P4SB 3RRYA 3A27A 1IRIA 3RWOA 5CT8A 3TRKA 1ZCFA 2QRZA 4B3BA 3KXIA 4Q7EA 5F9MA 1QQBA 4YCDA 5KMGB 2YKGA 1YS7A 2E89A 2FSGA 4B81A 5DW0A 3O95A 2I6XA 3TLEA 2GLUA 2NVUB 4HLUA 3VMMA 1EH5A 1X77A 2AC4A 1A7UA 4TRNA 1VBNA 1PJAA 2C7QA 6NULA 2CNWA 2Z3VA 4ARIA 3DOFA 2O8CB 5TS3A 2I34A 1PR2A 2QG9A 1Y9AA 1T0BA 1T2CA 1E4OA 2JS7A 1J0AA 2VA9A 3LECA 5CT6A 3Q7PA 2Y1OA 3IAXA 5AMXA 3VH1A 2HQ1A 1BW9B 2X0KA 1W7AA 1PFQA 4A10A 5BRJA 5KYGA 3FTFA 1KKMA 4LF6B 4AT1A 1HLDA 1SMKA 1XRJA 5AVOA 4ZMRA 4PGAA 1HT1E 4H6XA 4LJ9A 2IYRA 1QP8A 2XWPA 4FSDA 4KQ9A 4LRXA 1HDCA 1Y1RA 3NWPA 2J32A 2B4QA 4HNUA 4X3CA 3D3KA 1DLJA 2P1ZA 3PXGA 3SEZA 4TSKA 5IJ9B 1D9XA 1ADGA 2XZTA 2VRCA 3CM0A 3NBFA 1Y9JA 5EHGA 4LF5B 2V45A 4JXKA 3K6SA 3NUZA 5BQOA 1YVDA 2NYVA 4J4BA 2JATA 3UUWA 3DE2X 4UE6A 1HDGO 5ALHA 4H35A 1NXQA 4HV4A 5T3UA 1WKCA 1RLTA 1U2DA 1RWVA 2WUFA 3B9PA 2RI6A 3WLKX 5BSFA 1DTEA 5A3SA 4DCTA 3VR0A 1G3IA 4NF2A 2AXQA 4YDSA 1XWIA 1YBHA 4OUDB 1CJUC 2SKDA 1RHQA 1Q21A 1E61A 2X1MA 3PITA 4ACBA 4RY8A 1KAGA 3L04A 1Q17A 5KWIA 1RJDA 2XWQA 1ZGHA 5A5EA 2AFVA 5G41A 4CFSA 4GI3A 4G23A 1ORVA 5CYGA 2WWYA 2JANA 4EJSC 2YJGA 3GDHA 4R8SA 1E18A 1JG6A 3OJXA 1E2MA 3UJ6A 4E94A 1UPCA 1NAIA 2FP4B 3L0BA 3T3DA 2OHJA 5FULA 3W6ZA 1ZFNA 1I6LA 1P0QA 3AHDA 4E30A 1CQWA 4K0KB 2Z2JA 2K4MA 1XD2A 3LP5A 5KOJB 1HEIA 5E95A 2P5YA 4MOWA 2VIIA 2ACKA 3HWWA 1DTWB 3U48A 3QF4B 3WWPA 1SXPA 3N87A 1SH7A 2MSEB 2ZJ8A 1EUDB 4CM4A 3CLUC 2EV9A 1KJJA 2N0SA 4IICA 4P4UA 5IDXA 5LIPA 2Z0MA 2O4UX 3MD0A 3OCCA 5FL7A 3D7RA 3ZHCA 4FQ8A 1CEEA 4IQGA 5CB4F 1XAHA 1DCKA 4D4IA 1NZJA 4KVFA 1BA2A 3GRVA 4G85A 5G1NA 4I2NA 2HX1A 3W3AH 3WGGA 4X62B 3OH8A 3PTAA 2VUTA 3B9RA 1C8VB 5DYGA 2UAGA 3HDHA 3SEAA 3WDMA 4TKMA 3I12A 4CN9A 1HY3A 2SHKA 1YQGA 1GVHA 1N9KA 1K8QA 2HT6A 1WQ4A 1FMLA 2IU6A 2IYLD 4N39A 5A05A 3AJDA 1SZCA 1XTVA 3PICA 4YS6A 4OEHA 5CFZA 2GOYA 5E4TA 1NRWA 4PX5A 1GZ5A 5CXUA 3T99A 2XVAA 1RBZA 1KSHA 1VTKA 2Q45A 1VIMA 5C3MA 2ZFUA 2Z5LA 5LQCA 2CVHA 3LDAA 3KALA 5CEEA 1RYDA 2A9KA 4P2BA 3OX3A 3U17A 4NULA 1KZ7B 1JA0A 4ME6A 5TSDA 5KAMA 3SAJA 1QV6A 2C20A 2IPXA 4G26A 1HSZA 3EDRA 3UMMA 5DSXA 2EKDA 3IP5A 4ZOQI 1I4EB 1TNDA 5LQAA 1GA6A 4HAZA 1LDGA 1W47A 1Z4JA 2VPWA 3BIXA 4N4AA 4D8YA 5IASA 1HRDA 1V16A 1JXOA 2HREA 1KXZA 3AEUA 1T9GS 4UM8B 4WECA 4DQUA 4ZDKA 5BV2P 1IHOA 2PMCA 5C4GB 4JYPA 1FSSA 1NGSA 5FA8A 4O3FA 2MJLA 1V3TA 2H3EA 4XCVA 2NQ2C 1SUIA 1FU7A 2VBFA 2D3TA 4GVXA 5KDLA 3TLKA 1TGYA 1UBEA 3KAQA 4J94A 3D0QA 2I9KA 4NFHA 3VR6A 3P0EA 1KU6A 2YBEA 1YI0A 3OCYA 3CRRA 1BX0A 4R6WA 2W42A 3PGKA 3ESBA 3F4BA 3VR3A 4KN5A 4N8SA 1RIIA 4L4ZA 3V80A 3ZBPA 5HJ7A 3RS7A 3PQ7A 3DWGA 4P7BA 3G5AA 3E8XA 4UARA 2YY5A 4QDTA 3LP6A 5EKDA 2O54A 1J25A 3JYOA 4W7SA 3TEJA 4H27A 2QX6A 4Z3KA 4PZ9A 2CV0A 4OHCA 1U98A 3RK0A 3RF7A 3IEXA 1TCBA 2BBSA 1M33A 4IRMA 4AUEA 4KWIA 1U3WA 3BHNA 3IV7A 1PNRA 1Y5IA 1ECPA 3R9XA 3UHOA 1OXSC 3ZQKA 3HWX1 1Z45A 2Q3BA 2ZJBA 4FBLA 2BPOA 4TS4A 5E2AA 5JPCA 2VP6A 1A7KA 4M0LA 4U6NA 5B3JA 3WKEA 2NUPA 3WY9A 4Z6KA 3DWFA 2CDNA 2VOEA 4FFSA 3SMVA 4G01B 2ZT7A 1Z34A 2FW0A 1H1LB 1JAHA 2HNBA 3VZDA 4A6DA 5AW8A 1I2AA 5B4VA 2W37A 3JD3A 1VDZA 1WJGA 3Q85A 3CEAA 1NDUA 1DAKA 1E9SA 3TSCA 2JDIA 2CJPA 3Q4GA 3EXHA 5I7HA 3ETNA 4P54A 4Q12A 5GOZA 5I4BA 3QTBA 5C0OE 2AD5A 3EF3A 2HQRA 3TRDA 2BGIA 3VO9A 5A4IS 4GRIA 4PBSA 1UPFA 3ENVA 3G2HA 1QRUA 3CPHA 2BI4A 4EZIA 2CHGA 2D5BA 2F62A 2Q9CA 3IE0A 3ISTA 1EWRA 3NTRA 4HUQB 3I6IA 6YASA 4FCCA 5CDSA 1OU4A 3HKCA 1EU1A 4IDPA 5KVQA 5LLSA 3STVA 4OV6B 1OVMA 2PSHA 2ERYA 3R7AA 4L74A 1B73A 3MCUA 3SC4A 3U1TA 1B2LA 1PS8A 3ZJ4A 3QEBZ 2IHTA 3TD9A 1C0LA 1O94A 4KMRA 4MR8B 1N6OA 1TA0A 1X19A 2PBZA 2HIMA 3ADOA 1S01A 4ZWNA 1L4GA 2EGGA 2BJWA 3GXBA 4PY2A 1H9CA 1XDSA 4FXOA 4GZ5A 2E3JA 4TTVA 3FYDA 1SU7A 2Q9UA 3LK6A 3TOXA 3CX6A 2EFYA 3JY6A 2B3DA 2ZREA 4EZBA 1EXVA 4PC6A 1X13A 1IPEA 4L27A 2RGAA 2ORYA 1G4UR 3HBAA 4C5AA 4JLOA 1UEIA 1EJ0A 4CMEC 5HKAA 2J85A 3M4YA 3NC1C 1YGYA 3NC0C 4XVRA 3WNZA 3WLHA 1ABBA 4LJRA 5DBHX 2IHZA 4X8HA 5CW1A 1CR0A 1RVDA 2RD2A 1JFFB 3KEOA 4XUGB 4D8TA 1ZI9A 2C2YA 4BQQA 1PJQA 4LRWA 4YAUA 3TOVA 2K6GA 1VG1A 3CPJB 3UWPA 4PYIA 5JYBA 1V9SA 1TVEA 4P0TA 3FYCA 3GHHA 3G17A 2VHYA 5C1OA 4L2IA 4TVOA 4QUKA 4FINA 1OA1A 2H65A 3HBJA 1G2IA 2B92A 3A6FA 3CY6A 4FCTA 4EYEA 3VKWA 1LD3A 1GRCA 2JIPA 4CM1A 3C8MA 4O2BA 3HGMA 3O8BA 3Q41A 4DMLA 1GFSA 3MMSA 4FN5A 1EVIA 1ISFA 2IP4A 3GOQA 3H4VA 4WNAB 2EP5A 3IHWA 3L4SO 1GA1A 3ZK8A 4P4NA 5FBHA 3R6GA 3WTCA 5FWAA 3E9MA 2C5EA 4A0SA 3B1XA 3HJGA 1WXGA 1O6FA 2QZ9A 3R41A 4U0KA 4I9FA 5ILOA 4RKYA 4FNOA 2FW9A 4LY0A 5FOQA 2NYUA 1EEXB 5F1OA 2JRCA 4EFDA 5I7FA 4J49A 2OXCA 4KPUA 3M0EA 4Q82A 2JJ2A 4D9HA 4DJDC 1OF1A 1PFUA 1Q7RA 2FEKA 1CDDA 2B9VA 1L4EA 3BMOB 4L76A 4Y1RA 2RARA 5FKJA 1B6SA 1R16A 1UT5A 3VR6D 3O31A 4I2VA 4RDHA 2XXAA 3VKFA 2NGRA 3GJ0A 3RBAA 4YX9A 4KWHA 1OLXA 4GZ6A 4WOPA 5JSZA 1T4BA 1KYYA 1QAQA 3BK2A 4O1HA 2J08A 1OX4B 2JCBA 4OHOA 2OMKA 1V4NA 4X1KA 3RHSA 4EP1A 1R4NB 4HVAA 3QY9A 4XJSA 4G36A 1TIPA 3KQPA 1C7EA 4LUCA 4KR2A 1EDDA 5F21A 1GKYA 3AVVA 1BGWA 1I3CA 3AK4A 2VZ0A 3B1VA 3DDHA 1RYZA 3VDNB 1R37A 2WUDA 3G2MA 3FUVA 3OF2A 4N12A 3ROFA 2EP8A 3L46A 4MVYA 2DKNA 2H4FA 4I14A 1GPLA 3AEZA 3NT2A 3PR1A 4CG1A 3IT0A 5A3JA 1JJBA 1GEEA 1U8XX 2PTGA 2XYQA 3GD5A 3IR5A 1DRWA 1TF2A 2Y0BA 3HPQA 4M1QA 3CLRC 2XE4A 4NYIQ 3SM3A 3R74A 3IL2A 4DILA 5CDGA 3IAS1 1KEKA 1VIVA 4FYWA 3PFCA 5E6SB 4YQZA 2WKPA 1KDZA 4KP7A 4Y67A 4DIMA 3P2EA 4PAOA 4J91A 1LSOA 2ZRNA 4PXSA 4D3FA 4K9RA 1YBVA 1QDLB 3P19A 4ZAXA 4B33A 3FTEA 5JZMA 4NCBA 1FFEA 3Q3CA 2C5LA 3HQ4O 2CE7A 4R05A 4X7BA 4RFLA 2G3YA 3DH0A 3HB7A 2PX2A 3L8YA 3TQHA 4XPZA 1R0ZA 2IYWA 4PHGA 4GMFA 2EVWX 1VC2A 5DCYA 3VSCA 2ZIZA 1E89A 3A4NA 3BBPA 3CMMA 5FTKA 4R2LA 3SS9X 4DSZA 1XZHA 2CT8A 5FFFA 1S4MA 2IZOA 4BKOA 1YR7A 4NS1A 2BFEA 4GUDA 1PZNA 3NHLA 1K88A 1GGJA 1K3TA 1NF3A 4AMUA 2CFOA 1FC0A 2HL6A 4XIJA 3SXPA 4MCJA 5GP1A 3IUQA 2PGNA 4CUZA 3VU9B 1UXOA 1SB8A 2EXXA 1VHTA 4B2YA 5DV9A 4ZV7A 4QGBA 4TMXA 3SC2B 1YIAA 3IOYA 1YS6A 1Q7GA 3QG5A 5IBRA 3SXJA 4DSUA 3U09A 4RTRA 2I2CA 4M36A 2NO5A 5JJIA 2CNNA 4EZEA 4MEAA 2NP6A 3HRHA 5TF4A 3OTWA 1E5TA 3ZWQA 2CXXA 3A9TA 1ULUA 2HK7A 3JD0A 3ORYA 4OPMA 4BLPA 5DNUA 4KFCA 2AZ4A 2ZU0C 3DT8A 4RMGA 4B4WA 3UB2A 3WRVA 4IUCS 4GOOD 4NENA 4YRCA 2H85A 3H1TA 3R75A 1RI3A 5LOVF 1NP7A 3F6BX 4E46A 4IIJA 3PRJA 3UJPA 1EWVA 1DGQA 3C3YA 2UVPA 2DC1A 5CLFA 2PD6A 5BNFA 3C48A 3RR2A 1IZ7A 1L9XA 2AD1A 3C3BA 4H3SA 4IL5A 5CHEA 4K9LA 5CPFA 2H4ZA 1NVUQ 1RQ7A 2ZYSA 1X9IA 4LBZA 3EXHB 4FX5A 4HYEA 4IEIA 3AP2A 4CG3A 4DLNA 3GVCA 4EJMA 4FJ2A 1DJLA 1QZ3A 1WW3A 2BGGA 2Y76A 3NM6B 1TQ6A 3HDGA 3DP7A 4A5SA 3HN6A 2V7UA 4EGSA 2HIAA 5AVXA 4PANA 4BNWA 1VZ3A 4FS3A 2YJZA 4XYLA 2D2FA 1FTSA 4N1AA 1US8A 1KGSA 2AHOA 2SCUB 4WLNA 3IRUA 1L9KA 1V4BA 1NF2A 2A1UB 2J9YB 2YFHA 5PNTA 3UMVA 4A16A 3EVEA 1B1CA 3LT0A 2QTCA 4H0FA 4KV9A 4NEQA 3IULA 4OU5A 4BEWA 821PA 4CIBA 3GRFA 2P2LA 2ZIUB 3UHFA 1NPDA 1WUHS 4LV5B 1T5BA 4EHBA 2GCGA 1NU6A 2Q6IA 2FDXA 3JR3A 2WUGA 1M2NA 4JITA 4MW1A 3FDZB 2WNHA 1G7CA 3R7BA 4RIGA 5AM3A 4C14A 4Y2YA 3INRA 4AP9A 2VDUE 4HDKA 1T0IA 4MP3A 1JYEA 1MB9A 1LLDA 1XTPA 5LYJA 3VZRA 4H3VA 2O07A 2GHTA 3FRJA 5BW4A 2Q0XA 1RQ2A 5A1JA 5J4HA 2QRPA 4YWHA 2FK8A 2G63A 3WK5A 2LNDA 4JKYA 4J3NA 3E23A 2J3LA 1XCOA 2VRWA 3CISA 2ZBEA 1J42A 3CZ9A 4F96A 3TLZA 4C3VA 1DAFA 3PPXA 4HVCA 5I6DA 2D5AA 4J07A 3OQNA 3UM9A 1EM8B 1WQ1R 4G1FA 2D7JA 4GR5A 4WH0A 4MUNA 4UMFA 5CB4B 4U39A 4KR7A 1X1EA 1O2DA 4Q3NA 1WOYA 5AJVB 3RF6A 4JJ8A 4XFKA 2C1EA 5J2TB 3HSYA 1WLSA 2CHFA 4WKNA 5FL7D 2B4TO 3LQ1A 3V2HA 4INZA 2QW1A 3QQPA 3CCCA 1YFKA 2H31A 1GG8A 1TMOA 1YRYE 2F4NA 3LV8A 5F3DA 2IGBA 4IIXA 2H00A 4Z9BA 1CE8A 3MM4A 2CEAA 2SKEA 3K35A 1GFIA 2DTDA 1SC9A 5JDIA 1DDIA 3FROA 3P7MA 4F93B 1E62A 3NJ8A 3N0XA 3QF7A 5JMPA 5LMNB 1N34B 3ZHYA 1D5WA 3EIQA 4ZVQA 1GHTA 4HAIA 3W78A 1MUUA 4L16A 3L9WA 4Z0PA 1RKQA 4F2HA 5MFPA 1OZGA 3GN2A 1FL9A 1GPUA 4AKTA 1FNMA 3VA7A 4HYQA 3VJMA 4WCFC 1KEZA 1D2MA 3OIGA 4PLWA 1E2QA 4EUEA 3P9QA 4HATA 1ZOPA 2NU8B 1R4AA 3RK1A 3PT9A 3FVTA 4MI1A 2I4RA 4ONEA 1X7ZA 1VYTA 2ZYVX 3P9YA 4HS9A 5JH7F 1DWPA 1TYCA 3EGDB 4AKEA 4JLAA 3FPFA 2WD9A 1CHDA 1N2GA 5ANRB 1ISMA 1RPNA 2WJYA 3DT6A 3H5VA 2HTFA 1R4NA 3I5MA 3K2IA 3SJUA 2HRZA 1PWZA 1VE6A 4WJLA 4HDNA 4IDNA 1QM5A 2Y4OA 4GOKA 1E3DA 1TU3A 2WT9A 3OC6A 4BNUA 2FSVC 2VZLA 1XNQB 5FPKA 4RWEA 1BGXT 1SEPA 3Q9NA 5K0CA 3L2OB 5K7SA 1M8GA 1UPTA 3V7YA 2IEGA 4DY6A 1Y8QB 3QKIA 4P82A 1Y7TA 4UUPA 5JSQA 1NBMD 2C0QA 4RFVA 1L4KA 2ODNA 4A03A 2XQGA 3RC3A 3GUCA 4P8RA 1OKKD 3NGLA 2CLEB 2JFFA 1E6UA 4LS3A 4G5SA 3ILHA 1CUYA 3HU1A 3DQZA 4K05A 5CK4A 5LBIA 1WKVA 3WNBA 3ZCQA 1T2AA 4L5YA 1EFPA 3NHKA 4ZDJA 1U6JA 4OAQA 2GPJA 2G06A 2PZBA 3BTVA 1EJ2A 2DFTA 2ST1A 2W4QA 4PRKA 3PJGA 3K8YA 3Q5EA 4JUIA 4YRIA 2VDOB 5KNDH 2R68A 3LBFA 4FKZA 5LPNA 2H2GA 2M6SA 4MVJA 4CW7A 5C46F 3VDQA 2W2MA 2QD3A 1BWRA 4FZRA 4HMQA 4TLAA 4AFNA 2ZI7A 4ZQIA 2C7RA 1JU3A 2VA8A 3E6AA 2BEUB 2QD2A 1JU9A 2FJPA 1IXKA 5D3ZA 3OLYA 1PEAA 1LK7A 3IAHA 3K1TA 4NCHA 3ROPA 3L01A 1H6DA 3NTUA 2C84A 4C0BA 3CF0A 3O0DA 4ETWA 4PLHA 5AIBA 2C96A 4LSZA 1ZU4A 3PIIA 2CNWD 2ZDHA 3R23A 1GKKA 1P7ZA 4ZICA 2QTMA 2FMHA 4QLOA 3TO5A 1I2MA 2JF0A 2WLSA 5FP0A 4ZXPA 2XT9A 1B3BA 5AKEA 4QFDA 2CNOA 1EZZA 1V3UA 2ZZNA 3ABZA 1KTIA 2IRWA 4L75A 2KI5A 2JLBA 4BRZA 1FYVA 4I1SA 4OQZA 3H18A 1IHDA 3PYMA 2NM0A 5LA6A 4NU0A 4DLXA 3EPKA 1CK4A 1W48A 2D1YA 4Q4HB 3W2EA 4DG5A 2AQ8A 1C9EA 4MMXB 3CN7A 3Q10A 2ZCUA 4X00A 3E7DA 3BQNB 4AP5A 3EN0A 4FLFA 4EK9A 2WABA 1BH6A 2C2XA 2XUZA 3PKIA 5G53C 3VYTB 3LX5A 3QOFA 3QE3A 5B64A 1N92A 2JI8A 1QKIA 1L5QA 2B7CA 3GF4A 2JI9A 2QEQA 4MUGA 1HTTA 1HV8A 3S5JA 1NMQA 1SC6A 3AEUB 4F7DA 1JLHA 2PCJA 4TTRA 2VJPA 3SEQA 4BVJA 3QOYA 3QX7A 3CNHA 3FMPB 5TVGA 2IH2A 3OFND 2YN4A 1TT7A 3WGYA 1EYZA 1PJTA 2EWWA 2I54A 3QIAA 3TS1A 2VZEA 5H4GA 1FCJA 5EJ4A 4JASB 3C3DA 2D1RA 2P78A 3IUJA 3ND6A 4FYIA 1JX6A 4Q18A 5EAIA 3ISJA 4AY5A 1FP4A 3N2LA 2BUAA 3FDIA 4LI0A 5IJWA 3NASA 3NOXA 4BO2A 1R0XA 5GZ3A 1NASA 1NJ1A 3DTYA 1PL7A 2GEVA 1X8LA 3O7MA 4LE2A 2OCBA 1D1QA 2XQJA 4OH1A 3BJIC 2ATIA 2Z9CA 3EVDA 4QULA 5L45A 3VKVA 4B80A 2YWFA 4FR0A 2OL4A 1RJ9B 3LX6A 4JHLA 3OCJA 1N36B 3AVWA 1ECGA 3SJZA 2WWWA 4TKUB 1PT9A 1T8TA 2JK0A 1QGZA 3HJCA 4DLKA 1IOWA 3F5FA 3THWB 1GN9A 1WXQA 2PUJA 2ZYRA 4KLAA 3EGWA 5LKAA 3GJ6A 3W5JA 4TYWA 5CLHA 1DKQA 5IABA 3J7TA 5F1PA 1C80A 3OZSA 3U40A 4E07A 2CFCA 2X13A 1YE8A 3ZGVA 3GLIE 5JHHB 2VBIA 1JW9B 3E58A 3GCGA 3V55A 2DU8A 2P79A 5TS2A 4FNGA 4D3DA 1W59A 1L5SA 4KQ6A 3QG1A 4TN5A 4F4HA 1CEXA 1OA0A 1GO2A 3EIUA 2UYOA 5KREA 2BF7A 3A4LA 3SFVA 2EG5A 3IPAA 2EL9A 2PRJA 3KQMA 1PGQA 2JK1A 4ZOBA 3LNCA 3U3OA 1E2GA 2YN2A 3L82B 3KVNA 2OR3A 4GR4A 2FQ1A 1IEWA 4XRGA 1VE3A 4GZLA 2H1LA 3OMLA 3MUOA 4UMVA 3T1TA 1QNFA 1W85A 2QNBA 2ZLBA 3D2LA 2HV8A 3ED5A 1GPMA 1L7NA 1ULTA 4Y7DA 2XHZA 2BAGA 1YK0A 1Y8RB 4WNAA 3BGOS 3RLIA 4MUMA 3TVDA 1YK1A 5J2TA 4RVFA 5CD1A 3T7EA 1E2DA 2D4HA 3OHMA 4JFAA 4XPIA 4EUFA 3F2IA 1PZHA 1AT1A 1FJ2A 1D2AA 4CLOA 4IO1A 1F8YA 1GEGA 1I6MA 4U7WA 5J9FA 3V97A 4HQNA 3KYCB 3PXCX 3DNMA 3F9CA 4L2IB 1ODTC 3FI0A 1KZ9A 4Q39A 4QJ5A 4Q4AA 4ZP1A 2GZAA 3AZPA 3ZW7A 4EHJA 1T5OA 2B94A 2WM3A 4LPSA 5ALEA 5CRIA 5TQ2B 5BR4A 1Z29A 1J56A 1XDBA 2W6JA 2Y1XA 4X6YA 5AJXA 1C3JA 3ZH2A 3FOEC 4FYKA 3HVKA 1V11B 1L8OA 5ED0A 5CFQA 2WTUA 3ROMA 1J5XA 1J6UA 3QKWA 1NMZA 3BMNA 3HVHA 4WFKA 1U8YA 2YZ2A 3JCZA 4IIEA 1RIFA 1K5HA 4D46A 4DQVA 4IMIB 2Q5EA 2QX9A 5H59A 2RH4A 3VNBA 1OXVA 2H2IA 3HUTA 4QXMA 4YASA 2UUAB 1WBJB 3TLJA 2PVSA 1Q0HA 4Q4JB 3L6OO 1I9CA 4EPVA 5ADVA 3IQIX 3SCZA 3FUUA 2AFIB 4BNJA 5J2UF 1R10A 3A4TA 3AKZA 1P72A 1OIWA 5JOQA 2DUJA 5K8UA 1YQWA 4RK1A 2CXUA 1MA0A 3HI6A 4EVSA 4KW7A 4DV4B 1QDUA 5EIBD 3E2PA 4Q1EA 2YNMA 3GT7A 3DJFA 2IBTA 3C8ZA 2QL5A 3K70C 5EIOA 3Q2KA 1XYGA 2CZCA 1TLLA 1YCGA 1VHQA 2QX8A 2RH5A 5HDBB 4CQMD 4EGAA 4RGBA 1XVLA 1KETA 4BATA 5ALDA 1ILEA 1WDWB 3U5TA 1NUTA 4BTEA 4MVCA 3G0DA 4QO8A 2FZVA 1OH8A 4AF8A 1XZEA 3OESA 4F3CA 3VSAA 1LV7A 3BTUA 1ULBA 4UM5A 3HYCA 4WLUA 1AKMA 3HMKA 3SBOA 5FUXA 4BMZA 4NC9A 2VPZA 3A26A 4K0RA 5E6UB 1LTHR 2IUYA 2R84A 2DLDA 2GJ9A 2HA3A 2ZJ4A 3AF3A 3AI2A 2JLSA 2RK6A 1ZEMA 4JJKA 3VOAA 1YOBA 3FPEA 1KOJA 3M34A 3QPUA 4C0HA 2Q8QA 4DPLA 1DFGA 4BP8A 4EATA 3CKLA 3LHDA 3ZKWA 1CYDA 1N75A 5TJ9A 1JALA 3AINA 1Z4KA 4CL2A 2PUWA 3ENQA 1CY7A 1GSIA 1RLMA 4RCZA 2ZOSA 3D6AA 5F7XA 3VPHA 4DT1B 3ENKA 4NE7A 4EM6A 1FYEA 1W2GA 4HNQA 2VPXA 3ZEAA 4ZHQB 2VT6A 4FSXA 4IFEA 4MWEA 4M7PA 1P0MA 4B3HA 1JEQB 2W2KA 1UK6A 3MVEA 1FSGA 2P6OA 4XUDA 4F5ZA 5JIBA 2PZ8A 2WIBA 2EX4A 3IPRA 3KX2A 5TQ0B 1M7GA 2WKQA 4M89A 1U8AA 2I0FA 5DI9A 3H8SA 4RF4A 4E3WA 5DNCA 2VSYA 1V45E 3IB6A 1BXRB 1NVWQ 4KSYA 3C16C 4B4VA 1Y42X 2O2CA 2I4OA 4LHSA 1UQRA 3SQMA 2Q5HA 4PXAA 1UFKA 3ULKA 5B3KA 5JDIC 3ADCA 1WW8A 5ENDA 4UUMA 3WHLA 4EUKA 4WFIA 4YO8A 4MICA 1HYBA 3F3SA 1QH8A 1NSYA 4MROA 4PPFA 1QYXA 1WXEA 1Z8DA 3L6EA 3LC0A 5HUQA 2EARA 1MRSA 2GBFA 2EKBA 2FEXA 2GK6A 4J0JA 1CRQA 1IATA 3AXSA 1YQQA 2IXGA 4OJKA 4GOXA 1XZ8A 4D4HA 2QVCA 3AEKB 3EGCA 4RMJA 3EB9A 3FSJX 1YR8A 1SVOA 2A4KA 3HRIA 3OKFA 4OA5A 4WPGA 1KI2A 2EBUA 1J8YF 2BGTA 4XFDA 5DGTA 3KZNA 1JFVA 3D3WA 5EA2A 1KVQA 2WHRA 5EESA 3SX0A 2JAQA 1G3MA 4FILA 3IOEA 3AOEC 1LQ2A 4LDZA 2C8JA 1OGIA 1T8PA 3CNBA 4WJKB 4N0EA 1Z08A 1TUBA 1V1MA 2IOFK 1OU0A 1CUAA 1DO8A 3EZ2A 4OYHA 3NJRA 4EX6A 4IEFB 4EQ6A 1NUUA 3E9QA 2EX1A 4CIXA 1BU5A 1XN4A 2KLBA 2WV7A 3ILVA 1O4WA 1L0BA 4PRZA 4JYBA 4AKHA 1BN7A 3T9CA 2MR6A 3F1LA 2FWAA 2B4YA 3PUKA 3R3VA 5EI5A 4BLRA 3MS2A 4V1CB 1YS9A 2D2VA 2UZ4A 4X95A 4QWMA 3KO8A 3CVJA 1WUYA 2C3UA 1MQ9A 1H66A 4FCVA 4LMAA 1EZ1A 1HL3A 1QZTA 5CAEA 7YASA 1IHPA 1SKMA 3LBYA 1H85A 1TM5E 4R7GA 2K7ZA 3G8AA 2A88A 1WIWA 3ETJA 4KGVA 3NLLA 2XA1A 3L8EA 3DDSA 3DD1A 2OFFA 3U2QA 1EX9A 3W5DA 4K86A 4Z4FA 2FMIA 3FUXA 3L6UA 2F9MA 2GM5A 4OHXA 4R4JA 3O91A 3LCJA 4RELA 3FUTA 2R60A 4ZT5A 1X6VA 1O95C 2YFQA 1OFIA 1E0JA 4LYGA 2ZTSA 4MW9A 2QA5A 3ABIA 5BSUA 3R3XA 4ZRMA 2VDLB 2P5TB 2Z2IA 2O7RA 4JVMA 1D3AA 2V5AA 3WGZA 2HQOA 3B7PA 2D0IA 2E0IA 3KXPA 3N86A 3N8NA 1M6VA 4UVIA 3QQ5A 2W6OA 3G2IA 3RVPA 1S3GA 4HNHA 1VQ1A 5JY6A 1U28C 3SP1A 2Q5LA 4DDWA 2F7SA 5HK8A 5LP6F 4CCYA 4OL0A 3E61A 1C2YA 3A3OA 3V4OA 4E4TA 2RC6A 3RKSA 2I91A 3P4YA 3DZGA 1VPDA 2QE7D 2WWRA 2Y27A 2RB4A 1TQ8A 3VV3A 1IQRA 1T9CA 3K70B 2FQQA 3PA8A 2PUCA 1H9BA 2BFBA 3SU8A 1KI6A 3C5EA 4WXRA 4BL5A 2VJYA 2CVQA 2RGUA 5BQXA 4HADA 1BZYA 3G9XA 4MIOA 2GXQA 5HJEA 1SA0A 4NJMB 2YTZA 2IPLA 4OHKA 1ZVVA 2DUWA 5JPIA 1LPMA 3NR2A 3PC8C 1K6MA 1LSJA 5DBIA 1AMOA 2IHNA 5A0TA 3ELBA 3NBKA 2I3BA 1Z63A 3EAFA 1BC5A 3H2ZA 3HA2A 1OB2A 4D26A 1RPJA 5FPSA 3LDUA 4XXHA 3OPXA 3MS7A 3FDZA 2Y1DA 4IQFA 2C4HA 2JH8A 2V6FA 1ULAA 5HUHA 1XKXA 1HMPA 3K72B 2NU8A 2QTWB 4BLSA 4B3TB 4X54A 1IVSA 2ZE5A 2BFDA 1WZNA 1HLGA 3TSWA 6GPBA 5KQRA 3O6VA 4K2AA 4KQCA 3ME5A 1NM5C 2EHJA 2YWDA 3CTPA 2R9VA 1U8UA 3R4VA 1NBHA 3FTNA 3QTTA 2D2EA 3AT1A 5EMNA 2VAMA 2ODTX 1ISIA