2KM1A

Solution structure of the n-terminal domain of the yeast protein dre2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
117
structure length
117
Chain Sequence
YKTGLLLIHPAVTTTPELVENTKAQAASKKVKFVDQFLINKLNDGSITLENAKYETVHYLTPEAQTDIKFPKKLISVLADSLKPNGSLIGLSDIYKVDALINGFEIINEPDYCWIKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein DRE2
publication title A S-adenosylmethionine methyltransferase-like domain within the essential, Fe-S containing yeast protein Dre2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 21
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2009-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2km1A00
2KM1A
chains in the Genus database with same CATH superfamily
1REQA 1R4MA 3VPGA 3AQ4A 3LCUA 2AD1A 4JLMA 1RAAA 2KM1A 1LDYA 1GZDA 2XDQB 3I92A 4ZQEA 5BUSA 4IIXA 1P1FA 4PAOA 4NX2A 4XIYA 1C9KA 3GEIA 1QQ7A 2FHSA 5L4LA 3HFSA 2QRNA 4D1YA 2X0KA 4F9GA 5BPHA 3DKPA 2FVYA 1EVLA 2X4IA 4XD7D 1Z4OA 3IBGA 2AHRA 3IIEA 3D81A 1S89A 2R8XA 3BJEA 3FKJA 5FR1A 2H63A 4I46A 1BFKA 4CKCA 5TMPA 1OLXA 1W5AA 4I2VA 4KQ6A 3ZZTA 3AR2A 5DO9A 2O2SA 4I3GA 1W2HA 2YIMA 5HUJA 2PX0A 2I76A 2QTGA 3EQ9A 3L7MA 3RUHA 1PX2A 2Y6VA 5ALZA 3AVWA 2HX1A 2RHMA 3O90A 3QWAA 5BVHB 5KSYA 1TT7A 3NEYA 4PX3A 1VSVA 2O3QA 1T2VA 4LPSA 3WLQA 5JO0A 2QN2A 2EZ8A 4PAWA 2GTHA 2Q21A 5E2BA 4E1VA 1CUUA 4YRQA 2ZYDA 3SZ3A 4KOAA 4YMSA 2W6IA 5J40A 1SBNE 1OTYA 1PFKA 4EUHA 1G7TA 1Z2NX 4F8JA 3RYCA 3PHGA 1P8AA 2PUHA 2CSUA 2HB6A 3E9DA 2PDAA 3QMPA 3LPLA 4MQMA 4MDHA 2HQOA 2OOKA 5CX1A 2G7MC 5T41A 4URVR 1H6DA 2QUIA 2B4RO 3TQHA 2RKBA 1EYZA 5LOVB 4I1PA 2R7KA 1DIBA 1JDPA 2HA0A 2O8FB 1ST3A 3LXMA 4JQSA 5E0KB 3TQOA 4PPFA 3JD2A 2V5UA 1KI6B 1M73E 4B2YA 1V35A 1GZSA 3WGIA 3K15A 1IN8A 3NAGA 2VPWA 3PNVA 5JXJA 2V0GA 4JFAA 3IP3A 3HG7A 4UNSA 3CU5A 3PIDA 4RHTA 1O4VA 3KOOA 3REQB 5AVVA 1MAVA 1XRJA 1YZUA 2DPHA 2V7QD 3HC7A 3KDAA 5D5PA 2JLZA 2W6ID 4TKVA 4QQKA 4I5GA 2P5UA 1MJGM 3BB1A 3OBIA 3ORYA 3OQVA 2V6GA 3OQIA 3A9TA 3NAZA 2FZGA 4RK5A 4Y6PA 3G5TA 4HATA 4MPTA 3NEJA 2K2WA 1ORIA 1IHUA 4N65A 2DFTA 2VT7A 4A0SA 4QSMA 5I51A 3GJXC 5JSFA 3F6PA 1JIKA 1AY0A 4BNMA 3ETHA 1E5TA 1PR9A 5FBQB 3UN1A 1QZUA 2B36A 4EUEA 5KSOA 1GTMA 3OCJA 1RLUA 1HTBA 2FWAA 4UZFA 1CY4A 5EQDA 4IQ0A 4LMAA 2M1ZA 3FTQA 3W04A 3WLMA 4AIIA 1Y81A 3WXBA 1XJ0A 3EOBI 4YASA 1QRUA 4L02A 1Z5PA 3Q41A 5FOXA 3L02A 2YFKA 3PK0A 4X54A 3TD6A 3WGTA 3JWHA 1QLWA 2OCXA 2UVPB 1LCIA 4LQ4A 5JRDS 1WW2A 3GJ8A 2Y27A 4QGAA 4ZCTA 2WINI 2BZ0A 2P4HX 2G88A 5C37A 3UJ6A 5K09A 5LKAA 2EQBA 3BHNA 1RCUA 2D00A 3PQ4A 1E9CA 1PV2A 1R6UA 4OI1A 3W8EA 9ABPA 2PMCA 4PX2A 5C4GB 3O6VA 3HH8A 2CMGA 1GUAA 4UEQA 1G20A 1TK3A 1YH3A 2WF9A 4Y2PA 4BLUA 4OM8A 4JJ4A 2ZCVA 1T6ZA 3KEQA 2LP4Y 3GAFA 2WU0A 1N8TA 1LU9A 1O0SA 2F7SA 1KDZA 2ZE5A 1TEXA 1P3DA 1W44A 5EINA 4QQNA 3CGWA 5CAEA 2LV8A 2OFXA 3H87A 2I65A 4G41A 4FD2A 3HKEA 3X1DA 1OLSA 1SRRA 1UZLA 4NJEA 4D0LB 1QE5A 1E3MA 4ZCRA 4OFWA 1E9RA 2D4AA 4KV7A 1QANA 4MYDA 1OZ0A 5AWFC 1N0UA 1IOLA 4L08A 3SAJA 2DWUA 3I2FA 2Y9MB 2WDPA 3DR5A 5AW3A 5U9CA 5JJCA 7ADHA 3L7CA 2OZVA 2VT2A 5BWNA 4QECA 4GGOA 3IKVA 4N5HX 1ZUWA 4WFJA 3PFCA 2JLAA 4UDYX 4F6CA 3A14A 3EXHA 3H8JA 4QUKA 1S9DA 3SX4A 4CV1A 1J8YF 3JARA 3CWQA 1NOJA 3W4IA 3QEBZ 3EZNA 4FYKA 2YQZA 5AKEA 2VDLB 2JGIA 3GH1A 3STYA 3U13A 4B6GA 3OZSA 1VLQA 4JUCA 4MGHA 1VL6A 3NONA 4GM1A 5JVDB 3FNBA 4ILKA 4D8WA 1L4LA 2A57A 2ZRPA 1UXKA 3HMQA 1T5TA 4FB4A 2DY1A 4KP7A 5DBIA 2VFAA 2EIHA 1OCEA 2EKZA 4F4HA 4EL5A 1AK9A 2VNAA 1DKLA 3HO8A 3LVFO 1YR3A 1QNLA 5KU7A 3KSAC 1EK5A 1BHSA 1NVFA 1KKLA 1W0CA 2I3GA 3C3JA 3LTEA 4IAOA 1XALA 2PPVA 3KR1A 1DKQA 1LPPA 2O6HA 1RYBA 3KJIA 1Y1TA 2CL0X 3AJEA 3GRCA 1G42A 4QGFA 3ZY5A 3OLXA 5IPFA 3V48A 1OGJA 2RBGA 2D1FA 4DIOA 2PH3A 1S3IA 4FI3C 3ZXSA 4MS4B 1FYDA 1UPBA 2MU1A 3HZRA 2GLUA 3C5EA 1YGYA 2RG1A 1T8RA 2G71A 4WVLA 2AQKA 2OECA 1ZM2A 1M2EA 1M2KA 1NMZA 2J3KA 2FRDC 3AETB 3BERA 3CZ9A 4WBNA 3PGKA 5HYVA 1V5WA 2B94A 4D3YA 5HM8A 3D4BA 2R4TA 1BX1A 1DBQA 1KGDA 4U4AA 4C0BA 2XT9A 3W1EA 1OA1A 4GMHA 4INZA 2FN8A 5BQOA 1P4SA 5FDFA 3S81A 2YX1A 2ECFA 4EA9A 2ODQA 3B1WA 2J9FA 3OEYA 4REMA 5EIFA 4NV3A 1GL9B 4D9HA 2GRAA 1G7RA 5H68A 3A1VA 3H4VA 5KWIA 2I4RA 2XCLA 1L5YA 3U1VA 3FWPA 3BXHA 2DPMA 2JL1A 2DTXA 3R3VA 4FTWA 4IDQA 4R9SA 4TT8A 1T4BA 4CIDA 2AE1A 5CVTA 3L8MA 1X13A 1QX4A 2A5FA 1VCHA 1WZ2A 2Q4OA 3PFGA 3B1KA 4MW2A 2AI2A 2H18A 1UOPA 4IVNA 4KFRA 1I3LA 2XD9A 2W2KA 1DIOB 3B52X 1XD9A 3TJRA 1SHLA 4ZZ0A 4L9AA 3HQ4O 1IZ8A 2WYUA 3GA5A 3FHJA 3S7ZA 1KS9A 1T0UA 2XLBA 1U3DA 3WDSA 3UWKA 1SZPA 4JHXA 2GUGA 2Q28A 2AEMA 3LLUA 2QJOA 3OURA 1GNQA 3OUZA 4QTTB 4DJ5X 4ZYVA 5JAZA 1I0LA 2WP0A 4BB0A 4C4RA 5K8IA 4EBFA 3LQYA 5AM3A 5EP2A 5JV5A 3V1NA 1SKQA 4FFWA 4RPGA 2FWJA 2BR4A 4ABYA 5L3QB 1CUBA 3Q3VA 1NLYA 1UDXA 3M4JA 4Q3DA 4QU0A 2F9FA 4BFCA 1HE1C 1VKRA 2FKAA 3QFSA 5HIKA 3OX1A 1NW8A 1Q77A 5LLTA 5BV1A 1BGWA 3FRJA 5FORA 5C7LO 1YB4A 3PPYA 1D4FA 4FFVA 2VJLA 2VHQA 5IDXA 1W30A 1ODLA 3QVTA 3HP1A 4N1AA 1CHDA 1Z13A 2AEEA 4BMDA 2XB8A 1JIUA 2YXLA 4WK4B 3S2YA 2OG1A 2G63A 3ETLA 2Q1SA 3W0LB 1XVVA 4EW1A 3GUHA 1NBOA 3RBVA 1QYVA 2YJZA 1P45A 1X3LA 2DT8A 4P2GA 3G9ZA 4Z49A 2J0SA 3H19A 4GYKA 3FJYA 4ZT5A 3H7IA 1ZMTA 3HNOA 2IYRA 3FGNA 5PNTA 1KDRA 2Y99A 1KH2A 3AJ9A 3ZNPA 1CZRA 1LSUA 5HJEA 4ZD6A 3SHWA 3IR7A 4GYYA 3PC8C 5KNBA 1JBQA 3AM4A 3TLKA 1XXHA 1C0LA 2HNAA 2RGEA 2AUTA 4B5KA 2VPPA 3NAQA 3LGAA 4MA4A 4BVFA 3LBHA 1FLVA 4RVUA 3H18A 3UO8B 2ZUFA 1KFJB 2GEDA 2H0QA 1YRQA 1V2GA 3AHIA 4RTRA 4J0KA 4R2IA 3CZRA 2AA3A 4BUCA 3KT6A 1VLVA 1ZICA 3H0KA 4BWVA 4RJJA 5E4TA 5I9LA 1Y6FA 2CUNA 2FQQA 5FLKA 1QG4A 3DTVA 5IJAA 3TRKA 2BF7A 3A6JA 5ITWA 5ADHA 1FXWF 3RS0A 1G2PA 2PCLA 5DGHA 3TNJA 5JT1A 1L7DA 2O0MA 1ZVVA 4R7ZA 1M34E 3OZRA 1ILWA 4IIDA 4BMYA 1ESZA 1QGUA 1QVZA 1IEVA 3H16A 1L4KA 2FPPB 3JRNA 4CT5A 4WHMA 3QHAA 1A9OA 3EBLA 2OAEA 1X7GA 4HWOA 5KNBD 3OTGA 3PNBA 4Q39A 4K81B 4Z0TA 4CM7A 2RH4A 5IS2A 3ZLTA 5C51B 5FQOA 5K9ZA 1MA3A 2VWGA 3PEFA 3BRCA 4M8LA 1C1DA 3CIOA 1BXKA 1N7GA 3EF3A 4OK6A 2KHZA 1CLUA 2GVDC 4TV9A 1E0SA 1OXUA 2A33A 4NICA 2VRCA 4D26A 1MVNA 3TGLA 2Z04A 1G55A 2GCOB 3DTVD 2OMEA 3H2KA 4MWEA 4ACBA 1SHTX 1UPFA 4D9EA 4PLTA 4WZ6A 2P90A 2Z98A 4CM8B 1VRCA 4DJJA 2HI0A 1D0VA 3E81A 3LECA 5IEBA 3O4GA 4EHIA 1IHPA 1UFRA 5EL0A 1KKUA 4LZNA 3DDSA 1E98A 1UPXA 1B8NA 3RC7A 4HKTA 4DRZA 2FY8A 5ETJA 4UQPA 2BTEA 4BVAA 4BTVA 5LDGA 2C2XA 3HFRA 1U7PA 4H7PA 3G9UA 2VKQA 4D8UA 4XB2A 4CF3A 2H4JA 2NUAA 5F76A 2AXPA 1FP7A 3BPSA 1KHTA 1U9JA 5YASA 3ROZA 1MJGA 3FH0A 2ZYGA 2MJLA 4KE8A 1ZK3A 3EFBA 2F55A 1JE1A 2VRCD 3AEQB 3DF9A 1GPJA 3GBPA 4PQYA 5CUQA 4JJ6A 3NYWA 4MRRA 4YH1A 4DN6A 5CDSA 2W6OA 1NN3A 1P1JA 1NL3A 1P2FA 1TECE 4Q1VA 1I6KA 3TMAA 1O57A 1EGAA 1Z5OA 5TB5A 1VKZA 1AKNA 4LDNA 4PYMA 3W9UA 5I6DA 2JGRA 4RY0A 4FX5A 4P34A 4CMJA 3LP6A 2XY4A 3W8FA 2IWHA 3O1IC 4XGKA 3VBEA 4QFCA 3P5BA 2I2XB 1NXOA 3A1FA 3N70A 2QS9A 3QF4A 4R4JA 1RM3A 3ZS8A 1CJSA 2IGTA 4RGVA 3VR2D 3FMIA 2Z83A 2RMKA 2OESA 3E0XA 4FFLA 4EKIA 3V4SA 2O3TA 3K0BA 2OCDA 4MV0A 2JAPA 3ZJ5A 3EPRA 1G5IA 4L51A 1BD4A 4PBSA 1DQYA 1I3OA 2JCVA 3I6MA 4L73A 3D1VA 4RZXA 4OREX 5F64A 1KNQA 1FFCA 4PIPA 8OHMA 2ZE8A 5F7JA 1GFIA 2GFHA 2IPAB 4M1KA 1FYVA 3MOSA 4YB8A 4DJTA 5GIOE 3IKTA 1NUSA 5CPFA 3MAAC 5EIBC 5JDCA 5FLXA 3K0SA 3HXQA 3JVEA 5EMMA 4YV1A 2C2MA 1R0KA 5KYWA 5IVHA 4U9HS 3VJMA 2P9JA 3OKFA 2A9KA 4E2WA 3EGEA 4QTZA 1UZUA 4GX2A 4QM7A 1OXTA 1OAOC 2J41A 4GL4A 3LI2A 3QVWA 1IXKA 2XMCA 1VZ2A 3COSA 3UY4A 4D3SA 5J1TB 2P35A 3HFJA 3C45A 1MGOA 3S0JA 3FTFA 2WWYA 1RKUA 2VF8A 4MITA 1Z0IA 1GU0A 1R50A 3LDGA 1MGPA 4GRAA 4RYLA 4RY8A 2VC2B 1U0TA 2BFBB 1IYZA 4GFDA 1CZNA 2AI3A 2YDXA 5JAQA 3QSYA 2LDXA 4K28A 4TTTS 4E11A 2O2DA 2VZLA 4BFUA 1M75A 2ANCA 3IE0A 2FU5C 5JFOA 3ONDA 2O57A 1N0HA 3FF4A 5HMMA 1A9PA 3V3KA 2QRHA 1GUDA 2M98A 3RO7A 3GGCA 1JEOA 2C97A 2MMCA 2WZDA 2PMFA 1TO6A 1I7PA 4QFBA 3VU1A 2ZTHA 2O3JA 4WOCA 1TM4E 5IBCA 1II0A 2WJHA 4IG9A 4GXTA 1NJ8A 1C8VB 3NHZA 2LCQA 4WK6A 1A4RA 1GLGA 1SK9A 2CUZA 2QP9X 4KQHA 5TF4A 3RTCA 2EYQA 1SURA 2QTTA 4EB6A 4LY6A 4LK3A 1G8KA 3ANYB 2CLMB 5K0ZA 2HNKA 3G0GA 4LRSB 1BCSA 1W4BA 2XYHA 4UAUA 4CU2A 1XPRA 4KSYA 2BLLA 4Z2AA 1QOZA 3QX9A 3WDMA 3BWVA 1FFGA 3T7RA 3ZD9A 1RAGA 3DE3X 3M6UA 3UAOA 1M2NA 4ZALA 3ASYA 2AOVA 1O97D 5HRUA 1Q0UA 1EVKA 1HMYA 1Y4UA 2J5XA 1HX7A 1CG6A 2G8NA 3L0OA 4YRTA 2AF4C 3AIKA 1I0IA 4D43A 1UMDB 4QHSA 4DIKA 2ZIUB 4YRDA 3VVBA 3R0QA 1Z6AA 2MOKA 2PV0A 2VLIA 3MEQA 4UULA 3Q7QA 4ITRC 3AY7A 1F8YA 3FRHA 4B4VA 5A4JA 1U8UA 1VZ3A 4PPNA 4BNJA 3CZ4A 3LUJA 3PXUA 1HUQA 4G01B 4WUTA 3SXJA 4B48A 1RJFA 1VRWA 2DQZA 3H1FA 5K3FB 2JHFA 2A2ZA 1WY5A 5KTPA 1N34B 2DBQA 2V7VA 2LRHA 3E3OA 1PGPA 3GEEA 4LSZA 1FSPA 3ESRA 3E1SA 1O3YA 4PO3X 2AWNA 3AK4A 5IYZA 1WZCA 3WYAA 2IHKA 2K7FA 2R6JA 2VTEA 1ZC4A 5KOYA 10MHA 1W581 1DJNA 2C2HA 2QRLA 2WJGA 2AK2A 2R6GA 3AVPA 5DOZA 3S2UA 3T6KA 4HYTA 1UDWA 3TRDA 4R83A 3BBPA 1B4DA 1Z34A 3PC6A 1L7MA 4WBXC 2Q1WA 5CIWA 3UFXB 3F6YA 4GKKB 5ALTA 3DCNA 2AMVA 2ECOA 3TXYA 4YCMA 5CD9A 1D2NA 2HLHA 4XWKA 2C42A 4IH4A 3JD3A 1HR0B 1U8FO 4CETA 2B82A 3RPEA 2GCEA 1KZHA 2KBFA 2DR0A 1L7BA 2FN7A 2G17A 4PVCA 1LK0A 4B0PA 5CT6A 4ZMBA 2NSJA 1LV7A 1ZC3A 1I2MA 3ZGNA 4BO5A 2HSEA 3K16A 1KBQA 2WAXA 4EJMA 2X0JA 4XDYA 3PPWA 5GWXA 4B6QA 4CT4B 2H0AA 3ILXA 1P62B 3DT8A 4V0QA 4ZQCB 3KM0A 5LZ9A 4MV8A 1ACMA 1BXRA 1F9EA 1E60A 1IBKB 4XQ0A 5JCOC 4N7MA 1N3LA 2ZAYA 4HXYA 4I1RA 3SSNA 2CJXA 1VC2A 5BV2P 1N33B 3Q6NA 1M2OB 5B3AA 3SS7X 1TQ2A 4ZEMA 1KYTA 3TJMA 1ULZA 4GKAA 4FFNA 1UEIA 3P4XA 4U7JA 4YJ3F 2OG2A 1OFUA 2RFLA 1BEUB 3EBPA 5BOSA 3QH4A 2JFVA 3PQ7A 3FUTA 5DBFA 1SQ6A 1KARA 2FWPA 2RAUA 2F67A 1YBFA 2FX3A 2R2AA 3AF5A 4H4EA 1JLHA 2GPJA 1EFPB 1WKCA 2HCTA 5TJ9A 4R0MA 4LY0A 2WP8J 3AMVA 1R8XA 2ZDQA 1GU1A 2IIBA 2R7MA 2ZWOA 4BO3A 2JVKA 5KMGA 3Q7TA 5AHKA 5FI1B 4JBNA 4F5EA 1KI3A 2GK6A 4K87A 4H77A 2H52A 5IAEA 5B55A 3RSCA 3LQQA 1TKBA 2PZBA 4OQEA 1X42A 1ILEA 3DMHA 1B2RA 1VJ5A 1G3RA 1T4CA 3NI2A 3OJFA 1I1OA 2W8BB 4NYMQ 3U44B 1TW3A 2G7ZA 2NU7B 2Q5JA 4I81A 3B3QA 2RAFA 3RTBA 5EXPA 3CRRA 3IP9A 3WLHA 4YAFA 1GTRA 2QZSA 1SVSA 2O7RA 2UUBB 1GXSB 1WNTA 4EQZA 1I36A 3VYTB 2WFLA 5AW0A 2JAQA 2XNSA 4MI9A 2BELA 4UZSA 1FNMA 1LVUA 3D7RA 4NCXA 4NR0A 4ZPXA 5JBIA 2WWIA 2YIDA 5BR1A 4ZEOA 3TTXA 1ULTA 2WLTA 4S04A 3AUAA 5K3EA 3HZZA 2V1XA 4FCTA 1PSDA 4M9UA 4LQLA 3RV3A 5DW0A 3DE0X 1WKBA 3NUGA 1JLLB 3U4QB 4IQ4A 2GAJA 2A1IA 3A1CA 3AY0A 1FUIA 2ZYHA 3ZEIA 4FWIB 3A1DA 2WJ6A 3A9WA 3MWDA 3N2EA 1MRZA 4I9GA 5F5LA 1H93A 2CE2X 2OR3A 3KD2A 4XQGA 4CM5A 2P0AA 1VGQA 3QX7A 1QTNA 1LDBA 1PWXA 1JXMA 1JU4A 3IEXA 2C96A 1QIKA 4QT4A 4XRGA 1AN0A 1MW9X 5B53A 2XBMA 4KUEA 1UKCA 4QNNA 1Z73A 3H9CA 2BMWA 3H2HA 3SJZA 2JRCA 5FKJA 1O94D 4EMTA 1YTUA 1JPVA 4TM8A 3BF7A 4F1WA 1JQJC 4OGFA 5ALMA 5A3VA 3ZN2A 2IWRA 5KNDA 2NNWB 4E94A 4J0HA 3S2SA 1LF5A 5MF6A 1MAHA 2JD0A 1NUUA 2IHNA 1A4XA 1MJ5A 3QBVA 1SHUX 3T7CA 3FUUA 2FMIA 3BAFA 1NF3A 4AG5A 3HKCA 2JLXA 3D4IA 2UUAB 3OCWA 1T36A 4ISCA 4Y30A 5K8CA 4DCJA 1S0UA 1ZCBA 2JGDA 1LV8A 3R0XA 3FHOA 4M1EA 3I2GA 3HBNA 1UP4A 2XMZA 1QLHA 1U8ZA 1A1SA 2PVCA 3GLQA 1KJNA 1LS1A 1S7GA 3EXAA 3NHWA 3OA0A 5F5XA 3GEMA 3CHYA 2TECE 5ALPA 4N0PA 4ESEA 1E6KA 1ACJA 1KFBB 1ZS9A 1TKRA 3FNGA 4GF5A 4G07A 1YO6A 4N9QA 4TWZA 4L6CA 2IH2A 2Z6AA 1OPRA 4B35A 4QG7A 1TJYA 1VMIA 3OX4A 5E8JA 4KN8A 4RQBA 4CHTA 3KT0A 3TZEA 2ST1A 4EZEA 4Q7QA 1IXYA 3ZVRA 1QG2A 3CEJA 3AEUB 2G9NA 3RVMA 3CR8A 1YQTA 6NULA 5KNDD 1G16A 1FMTA 4R81A 1PS0A 1N7HA 1QKIA 5EHGA 2IV3A 6REQB 5BWLA 4E4RA 2E89A 4LE0A 5KTSA 5K7SA 1PQUA 4ZOEA 3WYEA 1IMJA 3MQ4A 2ZRCA 3BTUA 3LO8A 5FOSA 5TX7A 2PZKA 3E03A 2D0DA 2I78A 4HYYA 1UBCA 5LJLA 3UJNA 4L50A 1H0RA 3MOIA 3RW9A 3FB4A 2VF7A 1NA5A 1T5SA 5EMKA 4I4IA 2QRPA 1PJQA 3MWLA 3ZWVA 1JHMA 1KI4A 3W5CA 1W85B 4LJYA 4JU9A 4RIGA 2D1TA 1SVKA 2H92A 4PZ0A 3V1MA 2XQIA 1N1EA 3C16C 4GXNA 4J1TA 2QL9A 1U65A 2FPMA 3OLCX 4JB3A 4RFLA 4B46A 1BFUA 2DPXA 4BMPB 4C89A 4NZ9A 2GBCA 1TAUA 1XYVA 1L5QA 2IOFK 4AYXA 4XASA 3QVLA 1AQ6A 1DIRA 1KH3A 2NAFA 2QM7A 3AR7A 5IH7A 3CH7A 4S05A 2XXAB 3L46A 4IHJF 3LL4A 4WLOA 2XRMA 3AVTA 4OHBA 2H4FA 3CEHA 4RJIA 5C81A 1L1FA 6YASA 2HA5A 2PO7A 5H7XA 1W1IA 3GEBA 4QELA 1U28A 3SHTA 4NY1A 5TSDA 3PQCA 5C3UA 2CXQA 2JK1A 2WJAA 2XA1A 5AW1A 1I2AA 5DISB 2BT4A 4DR6B 5EGSA 4TN1A 3FPKA 4PXAA 1JSCA 1YVDA 2IELA 3IA7A 2DH5A 2HADA 2IE8A 3PYXA 4FYMA 4Q7JB 4D98A 4Q9KA 5A05A 5HKAA 4P3OA 3DAPA 1LLFA 1V8BA 3NCHA 3OZIA 3BIXA 4HR7A 3GGOA 2NTJA 4NECA 4RYDA 4X66B 5JW6A 4P0PB 1Q22A 4QOHA 1I2CA 3CC8A 4HX5A 5DNWA 3FVWA 1B2LA 1V5FA 4DARA 3N39C 2GF0A 1US8B 3H13A 1JQLB 3QUCA 5B6IA 4CG0A 4R1MA 1MIOB 4ZAZA 3PHCA 1Z4LA 2Y2UA 2XBLA 3DM5A 3ESXA 3PLRA 1MKYA 1N1DA 1R0XA 2JEOA 4ZQGA 2Q9UA 1N5KA 1B14A 2QNBA 3B6EA 3OZDA 3ZOZA 3ZWQA 1P1IA 2IPMA 4EPTA 1CQPA 4V39A 3W3ZB 4DR3B 1C7RA 2QD3A 3BWMA 1BVYF 3AKEA 3LVQE 1M2FA 3F7TA 3LUCA 5FFFA 3KUDA 4LE1A 4R6WA 2B1JA 3CLTC 4G4SP 2DBYA 1GZ3A 4J9UE 4X1IA 1VSUA 3TK1A 3V42A 3SXPA 2PU7A 4FM9A 4DT1A 1SXHA 4HQLA 4LX8A 4EABA 1D0SA 1HLPA 3C3AA 3CRNA 3WJ1A 1ZD5A 4MRMA 2HFKA 2X9GA 1WG8A 2G77B 4HN4B 4I8DA 5IAOA 3WLOA 3HSYA 4C6TA 4YJ3B 1LPBB 1V1MB 1WXFA 2Y2VA 3EW9A 3MQFA 1DAIA 2AHOA 4MARA 2IKQA 3DUFB 4R2JA 1M76A 4IGAA 1R9MA 4PFJA 4GI2A 4OA8A 5K8TA 1PN3A 1RHKA 1KYWA 3TR0A 4LOAA 3TEJA 2A67A 4MUMA 3VJRA 1NXSA 3FVRA 3MD0A 4QXPA 3EFHA 3JALB 4JA2A 2O19A 3WB1A 3NXSA 2NT3A 1CNMA 2NYUA 2ZT6A 3GNLA 1RMYA 3PGMA 2PZMA 4J4TA 4W63A 4XCVA 1XTKA 1CW2B 3OFSA 4XUCA 4B2LA 1IBRA 2YR0A 4OHWA 3BZWA 5E4YA 3W7BA 5JS1A 1CRWG 2ASVA 4MINA 1M34B 1WS6A 2VHTA 3Q0TA 4YCBA 1WB9A 2VYFA 4BVEA 4DPKA 3RJ5A 2EFEB 7YASA 3T9CA 5ICMA 1M8PA 2PS1A 1FQWA 4HGYA 2BZSA 1NBIA 2I2WA 4GZMA 4RDCA 4AU1A 3P9ZA 4M0PA 3T52A 1OHHA 2AXEA 3H11B 2QR3A 4OVKA 3S70A 1VG9B 3ZWDA 4IVPA 2RGCA 4OY3A 3SJUA 1H9BA 5CEEA 3QLVA 3KYJB 2VXBA 4EMSA 5K8JB 3DO8A 4NV0A 1O8CA 4TV8A 2G0NA 2Q5LA 2AEFA 4YV0A 4PVDA 3K6SB 2NO4A 3CGGA 1NZFA 4PQFA 1LPAB 4PYOA 1GADO 1L5MA 3LSTA 1WP4A 1JA0A 1IPHA 1N0VC 3GHHA 2MTBA 4HWPA 1AT1A 3MPOA 2PD4A 3WNQA 4FXOA 1FTWA 3NIFB 4C4YA 2J3DA 4U7PB 4Q3BA 5JMWA 5F73A 3FAZA 3G7UA 4NFSA 6GPBA 1NUAA 4ZRMA 4CNBA 3MCWA 2P62A 1JWBB 4KO4S 3NS7A 4MV7A 4AD8A 1BX0A 2Z8XA 4JKYA 5DHFA 4YRPA 4NKRA 3QE2A 1TZ2A 4BEBA 1CLEA 2C7RA 2E4ZA 3K2EA 3BQNB 3MWFA 4LZOA 1FMFA 5DTMA 4C2BA 3IAM6 4IJ6A 5L95A 1WAMA 2TMGA 2WUGA 2XNCA 3JQ7A 1EEHA 3G6WA 1DRVA 4IDCA 4QUBA 4DLKA 4HO1X 2J5KA 5DEOA 3SIRA 2NN3C 3F8TA 1H3NA 2BBTA 2O3RA 1XVAA 3TZHA 1WCWA 3HVJA 4I1IA 1FU4A 1SBQA 1XZNA 4MMXB 4XCXA 4RNCA 3SQDA 4F7DA 1IZYA 4TXMA 2D3WA 1AGYA 1JR3A 1ZN9A 5B4UA 3GLIA 3VU0A 2RHHA 2VHEA 3IB3A 3FXAA 4YACA 1BS1A 2JAWA 4G2TA 4WA8A 2BR5A 3KAJA 1ZX1A 5DX0A 1J5PA 3KJNA 1N0WA 4YFVA 1V95A 2FPIA 5E1MA 4MH0R 3K8OE 2FJUA 3T1YB 1L4NA 1SCDA 4BYMA 4EPWA 2QVXX 5JTUA 3BA6A 2H65A 5JPIA 2NADA 2RKWA 3MG9A 5FPTA 2H4XA 3V32A 3NLLA 3Q40A 3OSUA 3H5OA 3ORHA 2GYWA 3E3LA 4HDNA 2YMLA 5IFKA 1J39A 3CVWA 1E3WA 4GL2A 3A31A 4HI0E 4O2RA 1AUVA 4EHFA 4G97A 2ZE7A 4AJ2A 3MVEA 3TTUA 3T38A 1IUOA 4TS4A 1DXOA 3BTVA 4RZ3A 1LZKA 3P0EA 1EDDA 1HDIA 2LCFA 1OXKB 4HB2A 4F3YA 2IT1A 3J81k 1TIPA 1HE2A 3RS2A 2HCFA 2ODTX 2IPLA 3CLUC 4IIBA 4M6WB 1JR3D 4FHDA 2FB9A 4OKNA 1II9A 1NYLA 1YVUA 2OE2A 3WGKA 5HQ3B 3U4DA 4EJ2A 1ZR4A 2XXJA 1G6OA 1PD1A 2Z3ZA 3BRWA 3KOWA 4G0QA 3V46A 4CLHA 4C7OA 4RA9B 3T3MB 4DXAA 1NVWQ 3JQFA 1N5RA 2O8BB 3BXOA 3AGPA 4NZMA 5EYPA 1B3BA 5TR9A 3KJXA 2GJ4A 3DHNA 3V8NA 2QTVA 4JI5B 4X1KA 3AVUA 2ESRA 3HXTA 2YHUA 3ILYA 1DCKA 2WAYA 1ZIXA 5FUYA 3UT5A 2XAUA 4Z9BA 3RFTA 1QS0A 2TS1A 4ZXPA 1KDVA 1VSQA 2R79A 2XIJA 4LISA 2CZGA 3F3SA 3DBHA 4MUGA 1QFMA 1DIAA 2C88A 3K8YA 1W34A 2D1QA 3FDJA 5LQRA 5ECYA 2Y1WA 4F72A 1B42A 1TQHA 2ZIVB 2ZYSA 3GRYA 2DQKA 2I62A 3ILSA 3WL8A 2CBGA 5F7XA 4YUWA 2J4DA 3IMKA 1TVKB 3G9QA 4IHJB 3U3OA 1A9TA 4E5SA 5KSWB 2I6XA 3HKDB 4FT4A 4UXHA 5C8YA 3UF0A 4BMCA 2AN9A 1GNPA 3BRWD 4IXNA 3S1AA 4OAPA 4QT0A 5FWYA 3T9AA 4DBZA 4QARA 2AN3A 2BEKA 3F3KA 3L41A 4X24A 1NXXA 1XU7A 3TSAA 4Y1EA 4HN2A 4D6YA 1M0WA 4MV6A 4D42A 1SOMA 3IE2A 1ZJYA 1KZ1A 1NYQA 5A0VA 5HQTA 3M83A 1D5CA 1DPFA 5LUBA 5BN5B 1L5KA 5KWSA 1ZONA 2C20A 2O50A 2ZBPA 4OI2A 4W5QA 2IXTA 5T4FA 1RT9A 4GPBA 1L5FA 1KY2A 4R1LA 5IXJA 1DFIA 1YT5A 1I1NA 3CF6R 2VYQA 4A8JC 4E5YA 1JFSA 4NE9A 2E85A 1F8FA 2E4XA 2BGRA 4IXDA 1TPYA 4HB3A 4Q9JA 2X42A 1OGIA 4JZYA 3S99A 2QP3A 4IOKA 4E46A 4BEJA 1OBOA 1JXQA 4YUZA 3B89A 3VNAA 1XDDA 3ZR4B 4FSDA 4C29A 1E0KA 1GZ6A 1S2GA 2BKAA 4L57A 4Q3EA 2H2DA 5IU6A 4C0AC 4IOMA 3DMTA 4MKIA 5DM4A 3TPCA 4YAGA 5DLDA 3B6ZA 1ECBA 2ORED 4DZRA 2V96A 1V9CA 4QODA 4DLNA 3C1OA 1VG1A 3ZHSA 3L9WA 2GN0A 2UZ3A 4Z0HO 2RONA 2O7QA 3V1LA 2W6CX 1L6RA 3UIEA 4RJTA 5DVZA 1QZ3A 3UMGA 5FWXA 1XCOA 1ISIA 3CUUA 5BSHA 2YYYA 2OO5C 3CVJA 3F1LA 3TUZC 3EWIA 1G4AE 2C5BA 3LG2A 4QEKA 5BWMA 2CV2A 1M6VB 5LL6P 3MWJA 3EY9A 5LZ2A 3KSDO 1ONPA 1QYDA 2WM8A 5H02A 1KZYC 1YJ5A 3DKIA 3PA8A 4NZYA 2I8LA 4RORA 2YZ7A 4NWIA 4O4HF 5HKKA 3U5ZB 1T43A 2W98A 4C3ZA 1VE9A 2G4LA 5JC8A 2J59A 3CWCA 4DTCA 1YZGA 4DJFC 4OQYA 2DHRA 3ENNA 4S35A 5BRNA 3CONA 5CBKA 1X87A 3E0QA 2POQX 1K8XB 1P91A 3ZNQA 1PSZA 3C14C 3V6LA 3LCRA 1CF2O 1CVIA 4X6LA 2BFAA 3NKFA 2CUKA 2QMOA 2IZZA 5CB4F 2A9OA 3OKPA 4DR5B 4KO8A 4RXTA 1IZ0A 1P1RA 1Q7BA 3FHCB 1D4OA 2ISQA 1PLKA 2D62A 4GPAA 3R7AA 4EMBA 2BSQA 1PG0A 2NSHA 3IKLA 1QORA 4JUIA 1YS6A 1C5KA 2ZSAA 1XMPA 3MUFA 1MT0A 4G0ZA 5E95A 4ZI3A 3D8UA 2EP7A 1NQ5A 1P5RA 2VWHA 5IT9A 4KYVA 1HLFA 3V4OA 3UKOA 3DE7X 4X95A 5HKKD 1J9ZA 1K4MA 4BE4A 2VQ3A 3HVIA 2ISCA 5DGXA 4A0QA 4AY5A 1X80B 2NUBA 3S2IA 2C84A 3W5UA 3FPJA 3GOQA 1Z4MA 2QG9A 2PD6A 1WPQA 3KKLA 3NP9A 4HUQB 1N6IA 3SNKA 4DG9A 5AXAA 1ZK4A 1PCXA 1QRRA 4AMVA 4DY6A 3TS1A 4DM3A 3R44A 4NFHA 5CXXA 1UKZA 5ERYA 3JATA 1HH4A 2VHVA 1SCKA 1T4DA 2PCJA 4GXRA 1TADA 5M29A 1U90A 3JTEA 2G9UA 3RFXA 3HUEA 5THKA 4U3JA 1IK4A 5KX5B 4JMPA 2XNJA 1ZKDA 2X0IA 3AM3A 3D64A 4PHHA 3MWYW 2ZJ6A 2FF5A 3JD4A 1QF7A 1T5OA 3FFWA 1L8LA 3H17A 3UYLA 1GPUA 2H7VA 2QYSA 3W1VA 2PSJA 2BCJQ 1ISHA 5A9SA 5F3WB 1QIGA 5AVYA 2ZQZA 3UUEA 4MLZA 2Q46A 2CLIB 1NQAO 3D3EA 1I4EB 2Q4EA 5K0TA 3DXYA 4J7CA 5THXA 3ONVA 2J9YB 4AQYB 1AV6A 5TEVA 5TF0A 3N2NA 4KH0A 3CF4G 1AN9A 4KUGA 3LE8A 2OXTA 2CZCA 2GK3A 2I4TA 2QAJA 4P31A 3T9FA 1JDBB 4F96A 4QE3A 1EX1A 4WQMA 2G0AA 1H6AA 2ZXUA 1U0OC 1A72A 3AUKA 5D87A 4QRIA 1KERA 2JIPA 2HQ1A 2W2LA 1Y7IA 4WCFA 4OX9B 2X5OA 1M3SA 2QBYB 3AZOA 4ZCMA 2X0FA 4O8CA 3S7TA 2GARA 3MOGA 2Y1EA 3PSAA 1DO0A 3P0IA 5J2TF 3UFBA 1QUEA 1F0PA 4ZVVA 1RQGA 1YDHA 3EQ6A 1DQRA 4OFZA 2PGDA 1E6UA 4OSPA 5EG5A 3VDNB 2XUFA 4CL0A 5J58A 2HCBA 1WXXA 1V5GA 4X6YA 1K5HA 3KZCA 4FOSA 2NV6A 4KWCA 3VHRA 5HK9A 2E1PA 3AL3A 1PR5A 3HB5X 3JQGA 5BUCA 2Z8YM 1OX5A 5CLHA 1INLA 4HTFA 3CX8A 3WWCA 5BQXA 3ER8A 3T4XA 1A9QA 3FNQA 5HZKA 1BKSB 3BD8A 4BCBA 1O2DA 2XA2A 4PCLA 5EHQA 2IYTA 1YHNA 1WU8A 3HGQA 4XGIA 4CDGA 1DAPA 3DZDA 4ZEVA 2P79A 2ZR0A 4OHZA 5KI6A 2W2LD 3PQFA 3UYKA 3TAHA 1I6MA 4P7FA 4LI3X 1EVYA 3LMKA 2UZIR 2E5LB 4NMWA 4JI7B 3IT0A 4FZ5A 1ZA1A 4JL5A 1SVOA 1SNYA 5JZVA 1U5CA 5EXTA 1OYWA 4BP9A 3E5RA 4E5MA 4MCHA 4TL6A 1EX9A 2BD0A 5B2EA 2JFUA 5ESXA 4OJNA 1L5HB 4IIYA 4WGGA 1T1EA 4ZOCA 5TJHA 4DLVA 4DV5B 2PL3A 5A06A 2PUTA 2W2PA 1FTSA 2RH9B 1ULSA 3AJRA 1I51A 3CZPA 4P5PA 5CLIA 4AJ4A 1SBHA 4M1MA 1C9EA 2AFHA 2IHZA 1BXZA 2BEUA 2QY9A 4QU8A 5DRYA 2VQDA 1ISJA 4F4UA 2E4AA 2WAOA 2PANA 3SS8A 3PNOA 3N2GB 4FDUA 5IJ0A 3CX7A 1MG0A 5BSEA 2R6FA 4HF7A 2VK2A 4DA9A 9LDBA 5KC8A 4WOBA 1XPJA 4Z8XA 2UVDA 1F2VA 1O9BA 4UOZA 2OILA 2GERA 2VZ0A 4KR3A 1IC6A 4XM0A 2PMKA 4YNBA 1AO0A 2GHTA 4KQFA 4D74A 5CYFA 1DTSA 1NDUA 2VUSA 1AZTA 2X8WA 2IYZA 2O59A 2FWBA 1JSXA 1Q15A 5E1DA 4X93A 1GR0A 1A4UA 1L5VA 1GRVA 4HG2A 3L4KA 1V41E 2VI5A 4ZVTA 2Q3BA 3D3JA 3U26A 1Y42X 1MD9A 1X6VA 3OEWA 1T1RA 5FYQA 3PNQA 4MVJH 2OP0A 3UHJA 4UJ5A 4EF6A 1Z35A 3G7SA 3FPBA 2Y0BA 4C7KA 4DE5A 2OD9A 1LC0A 1PHPA 3FYUB 1Y7HA 4V24A 1E18A 3KVRA 2IHBA 1TM1E 5FULA 2VTKA 2OHJA 1JALA 1LPMA 1EWKA 3A06A 3BMNB 1C3OB 3KVYA 1HSZA 4LXIA 1EP9A 2YKGA 3DAGA 1G66A 1OWMA 4P7BA 3O9ZA 1M1XB 4LDZA 2B0JA 4OLBA 1RM0A 2QW8A 3L77A 1DC3A 2OTCA 4MHTA 2PZEA 1JR6A 2GB4A 3AR9A 1JVBA 4GQIA 4ZI7F 4EY4A 3ROGA 1JW9B 1XKLA 3F4LA 1GQFA 3R3SA 3C7TA 4QJ5A 3OQOA 4GE3A 2QP4A 1JIVA 3R7NA 1UANA 4BWGA 1J42A 1I4TD 2ZI7A 3L5KA 3PWKA 2A7QA 4PNPA 1FJGB 2FLKA 4YAJA 4UBJA 5HE9A 4E3WA 1ZFNA 2WHYA 3UBMA 1FP4B 2PS3A 1PG5A 1S2DA 5GV7A 5JD6A 2JFPA 1L5ZA 2QMHA 2I5PO 1YK0A 5KQRA 2Q4BA 2QT1A 4D4JA 1W36B 2PKXA 1C1XA 2BTQB 2IEIA 3NC0C 1G20E 5LB2A 3R5KA 4CLEA 1AKYA 1CB7A 3BQMB 4Q34A 3QKSA 3VZPA 5EHXA 4UTPA 1RHRA 4IZOA 3SF8A 1Y6ZA 4BNKA 1XTTA 3KBBA 2B1GA 1X7DA 3I83A 1R0BA 3RSGA 1X7XA 1DE0A 2QRVA 4W1QA 1HDZA 3T5MA 2E3JA 1ZCFA 1E1KA 3HI6A 5IDQA 5LVAA 4Q16A 3RS8A 1RPTA 2QUAA 2JAUA 1AK1A 3IVRA 1RXVA 1Q1ZA 4KXUA 1PT6A 1CE8A 1LLQA 4MGYR 4DDWA 3UMBA 3DGEC 1NMXA 3ZEAA 2CMHA 2W00A 4R1TA 3UMFA 4CM3A 3UXMA 4WH0A 2YY6A 1AK2A 2VUIB 4K6CA 4WXEA 3QLUA 3UG7A 4C22A 1QH8B 4D6PA 4L6AA 2F48A 1Z0AA 2C9DA 4R2KA 1CUEA 4G9EA 2PEZA 2D2EA 1DEKA 4LJ8A 4TXHA 1GYPA 1BKDR 4PQGA 4ZT7A 4Q47A 1HQDA 5CB8A 4LUCA 2B99A 4JYZA 2RH5A 4L8WB 5H0IA 1EK0A 1TUEA 3G2LA 3WLPA 1R7RA 4DAOA 1FFHA 1YJAA 4ARZA 3UT0A 1JXOA 4LZLA 3GUUA 1XQ1A 1ZUIA 3KV3O 4ZC1A 1JAYA 1WTAA 4DFDA 2R4QA 4CMKA 2WJWA 1JJAA 5KTYA 1E2GA 1NHWA 1Y7LA 2WKSA 2JFGA 3V4PB 1CZLA 5LP1A 2VQFB 5KNLA 3PR1A 3GT7A 4YRFA 5JJBA 2H1OA 2GBLC 3PUYA 4UNRA 3PITA 3CO5A 3PXXA 5GMOA 1R4NA 1SU8A 2ZB8A 1WXDA 3K9BA 3TZ6A 3TR5A 1EP3B 3DDZX 1ZJZA 2QXUA 4CFSA 1T6BY 1DZIA 2VJAA 1YA4A 1N9GB 1YJQA 1P29A 3RF6A 4ETWA 2FUG6 1SK8A 2JVJA 3ICWA 5ICEA 1E8DA 1X1BA 2DHCA 2WKQA 3QVOA 2BY4A 3DE6X 5KYUB 1YB6A 2JA1A 4N54A 4FYVA 2IHYA 3IOYA 4ZVPA 1S01A 4DJDC 1AUOA 5EKXA 2Y4NA 2AI1A 1EM8B 1ZCJA 4NENB 2QN1A 2R1VB 3WNBA 1ONBA 3P45A 1USWA 4KO3S 4ZCIA 1Z2OX 2OQ2A 1R1DA 2WFMA 1K63A 3K20A 3WBJA 1FS5A 4D3ZA 5EIEA 3ROFA 3FFXA 2C9BA 2Z9CA 3QMWA 1SVUA 1WSWA 2O8VA 4BNFA 5TPWA 3C6ZA 1EVEA 5FXMA 1L9XA 2H0RA 3C24A 3GARA 2DKNA 4PLGA 2AC7A 2XA9A 3FWNA 4O4LF 2K7ZA 2ZSEA 3GQBA 3OPNA 4PS1A 4Q93A 5EVJA 4D0GA 3D1JA 4D4IA 3I61A 3B20A 2P9HA 4RCYA 3UV3A 5J3JA 3HUFA 4L95C 2OC9A 3LHDA 3SM3A 2W42A 5C9ZA 4P36A 3CNHA 4AMUA 1JYEA 3GC6A 3PXGA 5J2TB 4CIBA 4M9QA 2OV4A 4JDUA 1EG2A 1PS8A 1KDPA 2C5SA 2H11A 4KRXA 3BS4A 3DNMA 3CF2A 4LNUA 4UUAA 4RFVA 5J2UA 3OP1A 2OBBA 3NJRA 1Y82A 4JH0A 3GLFA 4XX0B 3U3RA 3A3YA 1P3JA 1ZRSA 4UVDA 4HFJA 3BC1A 3RYFA 2VP2A 4NQRA 3PLAE 3BX1A 1FMJA 1H22A 1K08A 2YV5A 1Z06A 3GPIA 3B7PA 3OM0A 4QPPA 4ZO4A 4BX2A 4KR2A 1FDOA 3C3EA 4IY1A 1XWFA 2X1HA 1OW3B 1PBTA 5IBQA 3TRJA 4CMGA 3OCCA 3TSWA 5DGTA 5HHTA 1HOXA 4CNQA 3QTTA 1X0VA 2L42A 3IAM1 4XAQA 2GPBA 3OTQA 3V8BA 1V9LA 1UZNA 2PFSA 2PWAA 3MN1A 4MEAA 1MRNA 4MGIR 5KNCA 5HMLA 3R0VA 4XWWA 2PZAA 2YJ6A 3OETA 3CVOA 4HP8A 3U7HB 3LQRA 3AP1A 1SXIA 3UH1A 3WAKA 2YWDA 2RI0A 3AHJA 3AL0C 2QK4A 2WE8A 3I12A 1ECPA 3E5NA 2NXEA 3OU6A 5JJKA 1UQRA 3AVOA 1ESDA 3I9MA 3HCAA 4M87A 1RXSA 3DHWC 2DUMA 4I3FA 4ME6A 4WKPA 3RVNA 3TXXA 4JLBA 5K8UA 2CT8A 4MEJA 3DZIA 3BGSA 4TRMA 3LUBA 1VPVA 2ZJ1A 1KRXA 1S1MA 2X6QA 2IHJA 3LPAA 3ZE7A 1SULA 2M6LA 2G6TA 1KP2A 2E1RA 2LIVA 1BS2A 3AKCA 3DXFA 3R23A 4R8SA 5K4HA 2J6BA 2O1SA 3J7AC 4D57A 4MQEA 2O5CA 3PRJA 1OGYA 5F4BA 4I9FA 2BFNA 2A1TR 2BEWB 5IKOA 1QYRA 1RNLA 3SSOA 3UHPA 5ARBA 2O8EA 2P2YA 4L4YA 4NBTA 3NHFA 1W9HA 2QLBA 3N86A 1N3YA 1Q6ZA 1XXHE 5E7QA 5EHNA 1I01A 5C3MA 5KNCD 1XPOA 5CP8A 4PYIA 3UNXA 3UK1A 4BPBA 1L8AA 1RWOA 3RKSA 4PWYA 4BIMA 3SX0A 3DLBA 5KJ6A 2V6JA 4JP3A 4L8VA 4MV1A 4BQNA 1I3KA 4MKZA 1WXHA 2W6MA 3QMMA 2P67A 4QIHA 2J32A 2PUCA 3B3FA 1M8GA 4G1BA 3H0CA 4GOMD 4CBVA 1TZMA 2B25A 3ZWWA 1SCUB 2TSYB 3MRXA 5TQJA 1CVLA 4NS4A 1Z0ZA 4E5UA 1AGPA 4DLXA 4EGAA 3SS9X 1GSAA 4DR2B 1ZJ4A 3DLIA 1O89A 3IR6A 4XW2A 1HFWA 1FLNA 2NZYA 2VRWA 3H8WA 5AK6A 2XWSA 1FNBA 4B3HA 3IQXA 1MC8A 1KP3A 5DXJA 4NAUA 1XSEA 3CF0A 3ZY4A 2CY0A 4BXOA 1XD2B 1SOAA 4OQFA 1JDVA 2UKDA 2ISSD 2WTEA 4UPDA 4D44A 5HOQA 2GNOA 4GECA 1CXZA 5AJXA 2OAP1 1WJGA 4LFBB 2O8NA 4D80A 1VKHA 1IIRA 3RLIA 4U0KA 1JEJA 2YRFA 3CEMA 4JI1B 4BIIA 4GKJB 4JMLA 1FS6A 1N77A 4G23A 4YPFA 3IBCA 2QJRA 3VPDA 3G9XA 4ZI7B 1KSHA 3CBGA 5KO2A 1XN4A 1OX4A 2J46A 4LWPA 3B51X 5CGZA 4MAAA 5DK6A 2WIDA 3LBAA 4YDHB 4QICA 3L7IA 5C35A 2EEZA 3Q8LA 5GJCA 1QTRA 4B7CA 1Z2EA 1R6VA 5TARA 4IKEA 3KETA 5KPJA 3IEIA 4CQJA 1R12A 2Z43A 5JAIA 4KWEA 3WGMA 4Z1MA 3A9UA 5G3ZA 3C8HA 3SXUB 4WJZA 2JCSA 3S2ZA 2BI4A 5I8WA 4B6PA 2NOAA 1J5EB 1WXEA 1LRJA 3O8CA 1GPAA 2QM8A 4LQCA 1SXPA 3A10A 2BTOA 3JV7A 3M6IA 3MJEA 4HVCA 3V4RA 4R98A 2AFVA 1ZRNA 1NVAA 1J1IA 2Y0DA 3AX6A 2GAFA 3GZ4A 3PJGA 3BH7A 3CEPB 1JLKA 4QRHA 3TW4A 2IS6A 1ZRHA 4GD3Q 4LYGA 3UJ8A 4LSGA 1ADFA 3WL6A 5G0TA 2H1RA 2QMZA 3P1JA 5HWSA 2J4FA 2QD4A 3UATA 4KR9A 5KYGA 3SHOA 2R44A 3O4HA 4IDDA 3R9IA 2IYUA 4LXXA 2WQ6A 3GAMA 5LP6C 5JBNA 4QUGA 3VOBA 4QOIA 1Z6GA 2O1EA 3BIOA 5CA1A 2B3TA 3EWSA 4NJMA 3R4CA 4WVFA 3AP2A 5TQ2B 3UJBA 1LDEA 2YWFA 5FTMA 3MMZA 4BKQA 5HSGA 3UPUA 1PLJA 4EG6A 4RIEA 3CVVA 3NR2A 5H1YA 5FFMA 4Q66C 1XQXA 4KLZA 3RBXA 3MT8A 1UMCA 2GBGA 3EH2A 2VHUA 3H9QA 4EHAA 1RW4A 4RVDA 1NVXQ 1AA6A 4XR9A 2JLVA 3BMCA 3FYCA 3V2HA 3OFJA 3USES 1LLUA 5FOVA 1AV7A 1P6XA 2ADMA 3UHOA 4UU8A 3UOWA 3K8QA 4IOLA 1UM9B 4XFDA 2FPRA 2FGJA 4ZOLA 1E1MA 2C5FA 2ZPUA 4ERXA 5IJXA 3CUTA 3QWFA 3HKBB 4K9LA 1RI4A 3AV0B 5A7GA 4Q4CA 3BG5A 3Q9LA 1NWCA 2ZUEA 3MF4A 5JASA 5D5QA 1RACA 2FR1A 3C48A 3OZEA 2I8AA 4XB6B 3M6LA 2IYLD 1VIDA 4KIGA 4HX2A 5J43A 2HJVA 2JJ2A 2MR5A 3I4LA 4MVWA 4CDMA 3MAJA 3AG5A 1GEGA 5J5AA 4LHVA 1NI3A 2HBYA 2VPTA 3P4UA 5AK4A 2X1LA 3RS7A 3OZGA 4HDRB 4DNOA 4U9UA 1GNVA 3IX7A 3NU1A 3CNOA 1D3AA 4RLFA 1G6Q1 2E7ZA 2GTIA 1CHNA 1T6NA 4Z0PA 2VP9A 1G5QA 4LJKA 3UV7A 5J47A 3TCNA 3UA4A 3SHVA 3OVMA 4QYTA 5TC4A 3HR8A 3NEPX 1GNSA 2AWOA 1YZ3A 1X8XA 2CDNA 1PJ2A 4L0MA 4S1NA 1G6KA 5DU2A 1RIIA 1LA2A 1Y3CE 1R6BX 2VJNA 2W22A 3EXEA 3UWMA 2EL9A 3VTKA 4E5PA 4O4LB 4A6XA 2O54A 3QKRB 3HHEA 3OLQA 4J1QA 3AI1A 2CFCA 4JUDX 5F1PA 3URMA 1SUSA 2XE6A 4HZGA 3EPHA 4LDPA 3PE4A 4PBRA 1MH9A 1MX1A 2JJ2D 2DM6A 4EPXA 3N1UA 1CIJA 2FOXA 1ZGBA 1JEAA 3EXFA 4JEMA 1IY0A 2IEBA 5LCXA 2OZLB 3WAJA 2CXTA 2ZZMA 3ENZA 3O8QA 4ZREA 5F21A 1K6XA 3F1KA 4MRNA 1EFDN 2FVXA 4NCIA 5KTNA 3AU8A 3V00A 4EARA 3EASA 4A6DA 1Q0QA 5FEMA 1NN0A 1TDJA 4IGEA 5F1KA 3VKUA 4KLRA 5JMOA 3UGJA 4ND4A 1GDTA 1E2BA 2VHJA 5I9TA 2Z4TA 2WPNA 2X2PA 2C2GA 2QWXA 4WBNF 5HVNA 1GAXA 1G1MA 2BDEA 1ZRMA 4CCAA 4KL8S 3MWGA 5D01A 1TC2A 4QZVA 2FRDA 2XYRA 5D3KA 1YZVA 2HMTA 3K9WA 3EH1A 3EGWA 3VHXA 5BORA 1IVNA 2GEBA 2H06A 4KPUA 4OLJA 1BVHA 2ILVA 2Z2JA 2VJDA 1PW7A 1BVUA 1J8DA 1XE3A 2XLCA 2FOIA 3I5AA 1Y48E 4RLSA 1YE8A 4J2OA 3LIIA 2J0UA 4FBMA 3H5IA 1VJDA 4QVKA 4ZA2A 3PQ8A 3ZE8A 4YQFA 3B2NA 4ZI2A 5IAAA 2OPBA 3DYBA 4MO9A 1Q0LA 3KL4A 3KJQA 2VSFA 2VK1A 3FCUB 5TT1A 1FEZA 3RUDA 2XZTA 2CXRA 2KLBA 2LCIA 2HJ9A 3K92A 4BL5A 1REQB 1R4MB 1DRKA 4V03A 3G2IA 3DWEX 3Q8XB 3QE9Y 1S9HA 4ZWNA 3B60A 3AR6A 3DAOA 3K9GA 5LQSA 2I6FA 4GEGA 4NHOA 3TAXA 4N9WA 3JQ8A 1AM4D 2BFDA 3RTAA 5MGBA 1XN1A 2C5AA 4JP8A 1S7CA 1W8IA 3L0CA 5EJIA 1RMTA 1X86B 1GZUA 3CX6A 3PEVA 3OIDA 3PPXA 5IKMA 3KOZA 3G8DA 4FR5A 4CKCB 1OLXB 2NU8A 3S4YA 1OT3A 1NJ2A 2ZREA 4C05A 5BNIA 2H48A 2Z58A 1JYSA 1MO2A 2B4YA 3JPWA 1E4EA 3PD7A 3VSDA 1TYCA 1PJRA 5HRCA 4DREA 5E6UA 3PHIA 1A7AA 2WHRA 1GARA 4PYLA 4C76A 3QE3A 3ABZA 4CIAA 5D51S 2PRIA 2YIVX 5D6NA 4J3FA 1JTEA 3DDCA 5DHSA 4DLTA 5H16A 1BE6A 3P2JA 4Z53A 1Q0RA 1UC9A 4B3IA 1PKEA 1D1QA 1JFLA 1PGQA 5K4AA 1ONNA 1HE3A 4D8VA 1B00A 1KAHA 4JKIA 1T1SA 4KIUA 1XEWY 3O2NA 4FCWA 1H5NA 1Q74A 1TLFA 1X1AA 2OCYC 3RYCB 2HIMA 4RSRA 3A0UA 2PMWB 4D9IA 2HSWA 1SBYA 2WWXA 3IJRA 3KU1A 4CQLA 5CX1B 3N8GA 4BNDA 4DV7B 3H4MA 4FS3A 5GVSA 2VZ9A 4QAJA 1QH1A 2FUKA 4Q24A 3VBCA 4LC0A 1OB5A 3DXXA 3PC8A 3T95A 1NJ1A 5IP5A 4LF5B 1YR9A 1KPGA 3OPXA 2JLQA 3I01A 2XUPA 4AJKA 4RH3A 2PGNA 1CY8A 3DC2A 4PNHA 3BORA 5ICFA 3OQMA 3T34A 3AONB 5B37A 1K1EA 4G37A 5AOVA 4ZOAA 5C4MA 1BMDA 4TKVB 1DPGA 1VJGA 1I5RA 3KKOA 4LHWA 1VBNA 4Q1EA 2X6TA 1NW7A 3VH4A 3CR3C 1DCTA 1Y6QA 2P4UA 1MRSA 3H9EO 4X20A 3X0DA 1ITZA 3EZ2A 2PQ6A 1PE0A 1V11A 1UEJA 2E49A 2VCEA 1P3Y1 2C4WA 1QNFA 2J48A 5D00A 2WLSA 4RZ2A 2WUDA 3VR6A 1VI6A 1B16A 5IHXA 5LD2C 1KOGA 4ENRA 4KAFA 2G9VA 5GM2A 3VZDA 2XCQA 1RPNA 2XYQA 2YN2A 3C5HA 3L8DA 4Q1DA 5JAMA 1UBNA 3HCDA 2YICA 4H4CA 1HDYA 1KC1A 3Q1KA 1UMKA 3IOMA 4KFSA 4M7WA 4TV9F 3A27A 2JVIA 5HBGA 3PJDA 3PXAA 1CR0A 4RKRA 4YQZA 4GZ5A 4B1FA 2CLSA 4DA7A 1XZHA 2ZRAA 4MWCA 3FKSA 1P5ZB 2Z3WA 2YN0A 2CBXA 4JQZA 1S8FA 1W48A 2HRDA 2J9ZB 2PKEA 3FKQA 5AOBA 4E4TA 4A27A 2C4UA 2EERA 3IAFA 4YCAA 4YJ2A 4EF4A 5GJBA 1SR8A 2Q8QA 1YKSA 2X77A 2X3FA 4ACAA 1N5DA 1KAGA 4UNQA 2F43B 5KYYA 5MN6A 1QPBA 2NV2B 1IDN1 2GVZC 4B82A 2WWWA 1SVLA 2B83A 3FW1A 3ZH2A 3WV4A 5ABPA 4Y2QA 3RIXA 5CAEB 3DQPA 2B8JA 5KWEA 3AZQA 3E9EA 4TS3A 1WBJB 3VYVA 2C7PA 3HKEB 1OLSB 3PC3A 3PKZA 4EG7A 2ZTLA 1UBTS 5SICE 2IZ7A 3EIOA 4C03A 2CXOA 1V9SA 3LS2A 1NN5A 2OCPA 3FKSD 3DMFA 3HZOA 4L76A 4JXXA 1CTQA 4WACA 3VSCA 1KFKB 4AO6A 3TDKA 4D82A 4E70A 2NVOA 1A82A 4I6EA 4IRMA 4YECA 5HNKA 3CLVA 4IG4A 4XGRA 1E6EA 3DZ8A 3W3AH 3AW9A 5LC1A 2X0DA 3ROQA 3AF3A 4EA6A 2B21A 3UHFA 1BDHA 1R8QA 3EXHB 3PG5A 4L9SA 5TDHA 3GDGA 1H2BA 2YUTA 4P84A 2OSBA 3JARB 2WTUA 4A2CA 1SC3A 3CKLA 2HHAA 3DCIA 1CZKA 2YASA 1JNYA 1H05A 2PPLA 3IHWA 4OXRA 5AKGA 1SVWA 3WBBA 4IL5A 5EJMA 1YOBA 4EG0A 4RESA 2XCRB 4YYEA 2PRSA 4WLVA 1W5BA 3BRSA 3ULKA 3B8HA 1O5OA 3DE5X 4AS2A 2E4VA 4AICA 1JAZA 2G04A 4E22A 4ZTZB 4ZVRA 4JI6B 1A04A 1SGWA 1DWOA 1D2GA 3C6KA 1DHTA 2ZATA 3R6WA 4LZZA 2FP4A 1KOLA 4BP3A 4B80A 2V4UA 1ENPA 1M7BA 2BMDA 1GLNA 1WVIA 2DUNA 2NU6B 2CBZA 2EKPA 2WD7A 3G85A 4UFNA 1HMPA 3JCZA 2R7AA 3BWXA 2IF2A 3QOXA 1MABA 2CJPA 4HD8A 1C9MA 2V9CA 3DOJA 3RD5A 1HT0A 4BX8A 3HSSA 2PJZA 4MP8A 1RRMA 4E5NA 1QR2A 3EIEA 4A73A 4RVFA 2AKAB 1GPBA 5JD3A 4EPYA 5TLSA 3NWBA 4E33A 1OAOA 5DIFA 5AVJA 3RSFA 4PCVA 4L0DA 2VXCA 2F6RA 2JAOA 4LYDA 1I24A 3GCWA 2J0QA 4HSGA 4L5BA 4YCJA 2Z08A 3LWBA 4WBNB 1LSOA 3UW3A 3ZGZA 4CMCA 1C9JA 3THXB 4MJ3A 2NNLD 2QQFA 4H7IA 3S2FA 5E6SA 4EK9A 1JMKC 3H3XA 4IGFA 4OHFA 5LD2B 5EPUA 2J9FB 3SKVA 1OA0A 2AD5A 3FWKA 3BWDD 1N75A 1PKXA 1WPRA 3LUKA 2JIMA 5B7QA 4RPKA 4X9XA 1GGNA 1QIFA 3P5SA 2KPOA 1EK1A 1MAUA 2VUTA 3H97A 2Z5VA 4YMTA 4HGZA 1TTTA 2B98A 2B5OA 4OJQA 5B3LA 3KLMX 3M8KA 4BNGA 1J0AA 5U4QA 5EIBD 5CNMA 1CRPA 3U3JA 3ND9A 3C5WP 3TW8A 3GEHA 2ATIA 4CMEC 1F51E 3ZLJA 1ZZEA 3GMDA 2W2KB 3RVSA 1DAHA 1DC6A 5KTTA 4D9KA 1E5LA 5AM2A 5AQ1A 1RPAA 2A8YA 1NJ6A 2IEGA 3NZEA 3R4VA 4HADA 2NZ8A 1SUWA 2NGRA 2R6R1 4PZPA 1C3LA 5HG0A 2NO7A 1H5QA 3GRAA 3DFZA 5FEUA 1FDRA 4LZPA 3LYAA 2FQXA 3F46A 4MWBA 4ZCLA 3JZIA 5L3VA 2GYVA 1RYEA 3IEKA 5JQGA 4B8WA 3C3PA 1H2XA 1R00A 3M6MD 1AKVA 2VRNA 3SLKA 1T8WA 4P6VF 5ELMA 1MV5A 2D8MA 4EATA 2VYNA 4CI9A 4DLLA 1NUHA 1G1AA 5GIPE 1QP7A 3MB5A 4LNAA 1GYRA 3JQEA 4H1HA 3TO5A 4NCNA 1CQIA 2QQGA 4MJXA 1JV2B 3F7OA 4KKVA 4XZ3A 5IW8A 2HRZA 1LPNA 3WB2A 2YHAA 4MMZB 5H80A 3O2QB 5AXCA 4DA8A 4O2AB 2B9EA 3K30A 2D2IA 4N39A 4PRYA 3ZK8A 4BO7A 4NYJR 4JU8A 4Q6WA 1XUOA 1D2CA 1ZD3A 1IZ9A 4RO0A 5JSQA 4NDZA 3TD2A 3QYAA 4CFYA 4MS3A 2L2QA 4PZEA 1NIJA 5ALNA 5BVGB 5NULA 2H7XA 3PYLA 3QVKA 3THOA 4BQEA 1NNEA 1HG0A 4QQ8A 5CCDA 1T9AA 3QXXA 5IYZF 3OOWA 1CR1A 1ZI6A 2Q4DA 2GRJA 3ELYA 4I1OA 3RVKA 5K0NA 4MDYA 2VK8A 3BWEA 4RTKA 3NMUF 1LTHR 2IGBA 4KZPA 1OI2A 2XGSA 3THSA 3AUFA 2R48A 1YS7A 4UAJA 1KEPA 1BCRA 2C4MA 2XGGA 1LQUA 1RYHA 1XXHB 4OHRA 4R6XA 3NKVA 3KOYA 3KE9A 1NVGA 2X9VA 1NPTO 4X8OA 5MN4A 1YU9A 3NORA 3VO1A 1DAMA 2WF7A 2PKWA 2CNKA 3GMIA 3RRMA 5JS6A 3NT2A 3D0QA 3TGPA 1C7IA 4Z86A 3PNKA 3FPFA 1JPUA 4PIVA 2C78A 3ILVA 4EIWA 3DTVB 2W5UA 1TI7A 3HRIA 1FDTA 3QLTA 5JRJA 2JFFA 2BFOA 1JECA 2EFYA 3A11A 1N5LA 3GDFA 1KIAA 5EESA 2YRXA 4CKWA 3G23A 1SBTA 3HYSA 4UDXX 1JDSA 1I6WA 5EXDA 3RUEA 5KHOC 1U0RA 1VI5A 1ZMXA 3F5SA 1TW2A 4H4DA 4RHUA 4ZO8A 2R66A 1QGUB 3UJ7A 4BQQA 5AUNB 2A0FA 2Q7XA 2PXCA 4D9CA 3UMVA 2CGEA 3MK31 4XLTA 5IANA 2PKQO 4I2NA 1PL8A 1T3SA 2OWEA 2DYKA 1Y33E 4JLWA 1LBTA 4IINA 4NU5A 4QYIA 4V0KA 5JCOA 2YWXA 4C7XA 1FFSA 2DRIA 1Y8QA 1PJSA 1XZPA 1Y4ZA 4JI4B 4OMDA 1C1DB 1JT9A 1ECJA 1XROA 3TM4A 2YWCA 1F12A 4TV9B 2JLCA 4CKBA 2WI8A 1UPTA 5DYTA 4C30A 1VBMA 2XB9A 3LC0A 2W7TA 3OE1A 4D81A 4R1QA 4AWAA 3H2SA 1IPEA 1O03A 3IL2A 3FNHA 4YCDA 1X92A 3F7NA 5DPMA 5IN5A 3FHTA 4DSNA 1O08A 2PMDA 4S3MA 4MV4A 1AX9A 2W2XA 2MR6A 2ZBQA 4X3CA 3HUUA 2HMSA 4Q18A 3RR2A 3T4EA 2HHCA 2ZUWA 4WUVA 5A6VA 4MLDA 2H2HA 2VT6A 5HR5A 1XDBA 4DMUB 3ZZ1A 1E7RA 3QPBA 2H5JA 2GCIA 1F3OA 4MLCA 2PBLA 3ASZA 1JEQA 4GHWA 1Z0UA 2NUAB 2HC9A 1VP9A 2I33A 2YYZA 3E5HA 3QOFA 3W9BA 4IRUB 3STVA 3OCZA 2IPNA 3N6XA 2C94A 4IJWA 1T8YA 3B5IA 4CLDA 2BUBA 1FF9A 2B78A 4G0YA 2GN1A 421PA 4NEGA 1XNJA 1XKTA 4NG4A 1AZLA 4R8VA 4EGCB 3JAKA 4FBGA 1YZYA 4EKDA 1JR3E 2COUA 2HWYA 3MXOA 4K03A 1CR6A 1SQFA 2FSFA 3G0BA 1GA4A 1H4VB 1LLCA 1EG7A 1JAXA 1TRHA 3I42A 3TLEA 3V7YA 4MWOA 3DLHA 1MB4A 1E5VA 3GZNA 4FILA 4XIGS 3W2TA 5FOUA 2OP1A 3IBTA 4HDSA 3VISA 4AZSA 2Q3CA 1AE1A 3TMYA 1EUCA 2ZRIA 1ADCA 2Y9PB 3DQQA 3Q6MA 5CXSA 1U5BA 2AZDA 2WJJA 1X39A 2FH5B 3EZLA 2GYYA 4KBFA 4V3CA 1M1NA 3KAKA 4D97A 4EYEA 1DVRA 3FETA 4FMCF 2JIBA 3JVIA 3R5HA 3RDPA 5B64A 3HO6A 5JCXA 2LR0A 3FMOB 4H1UA 1DBSA 4A5OA 1HV8A 3OKCA 1SQ5A 4C7JA 4N01A 4V0OA 2Z5LA 4II7A 3IVAA 1JIJA 2XOKD 3BD7A 3N0VA 7GPBA 4RULA 3Q7SA 3L7YA 3HSKA 1UZMA 2OZEA 3CWZA 5JXWA 1AS3A 1G2OA 4KYIB 4RDXA 1TYAE 5K5EA 1CJUC 3ZWXA 1FW6A 4H7KA 3KYCA 4QGHA 1R6AA 4YJDA 5F3RA 3MS2A 1QVWA 4K6HA 4OHMA 3QJ5A 5KVAA 2B3DA 1PDVA 2OC4A 4MX8A 4PYRA 2A30A 1JFFB 2QVLA 3EVGA 2BKXA 3L05A 3WOVA 4YJGB 1UBOS 2P7HA 1V37A 2IEDA 4ENWA 5TQVA 3S8YA 4TLLB 1OBHA 1T4GA 1TQ8A 3ADCA 2DTDA 1T8TA 5FA8A 1ZNXA 4TZKA 5AP9A 1KI7A 2BM0A 3M4YA 4FP9A 4NXMB 4IW3B 4MYCA 2P2SA 1SA0A 1C30A 2Q1YA 4J03A 4EJ6A 2J5RA 4FUTA 2PL1A 4BZXA 1C8BA 1POXA 3CLKA 2CNWD 2GAIA 2QVGA 4BFYA 2NYVA 3Q5EA 1YC5A 4MYHA 1A8IA 3C4JA 5EMNA 5DYNA 3WXMA 2RGRA 1MXHA 1SKMA 4KV9A 2JLYA 5AI5A 4HJRA 1XZ8A 2A0WA 2Y1FA 4TUYA 3RSOA 3UK0A 3GFBA 3W06A 3EVNA 1N6RA 1Z18A 1USUA 2CK3A 2QSUA 4Q1CA 1ZH2A 2AMFA 1DMSA 2LWIA 3EMBA 3K0HA 3QNUA 1FTGA 2HLNA 4QRDA 5IKEA 3ECSA 4JEHA 1GKLA 4E0BA 3GQVA 2H8GA 3GJRA 3I8XA 4EAAA 4EB6B 4NHEA 1HEUA 1HT3A 3BZUA 5EC8A 1Y6JA 3M5WA 3OHSX 4ZMRA 3HGTA 1BCSB 3K70C 3DL0A 3I0MA 3VHLB 1NG9A 1U7XA 1Y1QA 4PSKA 2H9IA 2VF2A 1D9ZA 1ZLYA 2PGIA 1WVGA 2X0RA 2H1VA 3COPA 3GP5A 3VDQA 1PR2A 3A6PC 4FHEA 4TLDA 5AHXA 3L0DA 2D06A 3QEOA 1PHRA 3R0JA 2REBA 2VJQA 4KJXA 2HGZA 2Y1CA 3C70A 3L8ZA 3MNFA 1Y5MA 4NAVA 3BREA 4OD0A 1GGMA 2FJ0A 2CV0A 2YFHA 5EHZA 3O4IA 3O4FA 3WLJA 3VVLA 3HWWA 1FSSA 2GO7A 1I13A 5G4KB 1E5QA 1XU9A 1GZ4A 3BK2A 2GF9A 1PZEA 4OXKA 4PR3A 4X91A 5GQSA 2B6NA 1DKOA 4XUEA 2VPXA 4PX5A 2JGLA 3DOOA 3TD9A 4F8YA 2EX0A 1UOQA 1XRQA 1T91A 1DIHA 5ERGB 3TNYA 4NU0A 3A1SA 3DXZA 4IXMA 4ZICA 1V8ZA 1NJGA 3ISTA 3FOZA 3OCUA 3ROTA 5FP0A 4CIWA 3AWIA 2BDUA 3RSQA 1EXWA 3RIMA 1L1QA 1PK7A 2LW7A 5J9FA 3MT7A 1SIWA 3I6QA 2OCKA 4YWJA 1C0PA 4UD2A 4XIIA 4N5IX 4CQMA 4HT3B 4WX2B 2Q4TA 2AMJA 4BV8A 3M70A 4GR9A 3JSXA 3NBXX 1OLUA 5AVUA 4NZOA 5H3HA 4UQOA 1KO8A 4C0SA 1YA8A 5HCUA 1SVIA 2PJUA 4F9TA 4Z7JA 3F3MA 5EE5B 5HIAA 1PYGA 2QR5A 1P9LA 2FUCA 4RSGA 4A0GA 2XKKA 1K8RA 1SXJE 4GGPA 4GX0A 4Y6OA 4KC0A 1XZQA 3RQIA 1V39A 1NE2A 1MJFA 2XTJA 3EVCA 3F8SA 1OXBB 3LHSA 4B83A 1MQ9A 5ALOA 5ARCA 4DIUA 4J43A 4JIMA 2CVFA 4N5LA 4QX6A 5B12A 1I2BA 2FZ5A 1QBGA 3ZZMA 4RDHA 4BEVA 3G5UA 5K0JA 5LBIA 1W59A 4L4SA 3WLKX 4CQMD 4QOFA 3RS3A 4V2IA 2I3ZA 4PC3A 2OGUA 1MQAA 1LLDA 2BWJA 3BCSA 3B36A 2BFCB 2IJGX 5BOSB 2K5UA 1LSSA 1IDOA 4FU0A 2C9CA 2R5WA 3KTOA 4HH0A 4KXFB 3OEED 4U6NA 2J6HA 2HUNA 2WD8A 4HTAA 1QFZA 1XB2A 4OP2A 5AH0A 2AZTA 3RVQA 2JHPA 2I99A 1RHUA 2A5GA 2ZIGA 3KQSA 4F4DA 2WTAA 3PENA 3Q7PA 4HYEA 2ORIA 3E15A 4UUBA 4PE5B 4QXQA 4QFDA 2V0CA 3GL9A 2NUTA 5K0EA 2BMVA 3HYTA 4ARUA 5DSTA 3CVYA 1DLJA 2JZNA 4DV2B 2QZ4A 1QCDA 5EZ5A 3ZBUA 3C3KA 4UPVA 1N25A 1E64A 2H4HA 2PX4A 2R8PA 4R41A 4C04A 1T4CB 2E4YA 1H2YA 4GC9A 4N0QA 3G8BA 2O2CA 2QVCA 4HMOA 4PRLA 2R6DA 2DC1A 5FUQA 4K3VA 2J3EA 1YCGA 1QG6A 1PS9A 2CVPA 1JIIA 1DBIA 1WUTA 2G3YA 4RD2A 5EGNA 2HYDA 4G0UA 1KWKA 4KACA 4TV8F 1VDZA 3EWAA 1DAEA 4MSUA 1A76A 2R65A 4J90A 1WDTA 2PAAA 3C3YA 3AEYA 1GUYA 2OV1A 4FT2A 5EUQB 3RTEA 1M2GA 4ENQA 3NGLA 1IN1A 4Y9SA 2W9XA 4DS3A 1LFDB 2F3RA 4Z4HA 4G6ZA 4J0CA 1KMHA 1TT5A 3DLPX 3BXPA 3QTLA 4PTZA 2BJWA 4BTLA 3PXEA 2D7DA 1KRHA 1WXWA 4HGRA 2VRBA 3MWDB 5DYGA 1D5WA 3PRHA 2REOA 4M8KA 3GRPA 4FMCB 1LXCA 2P2DA 1CY7A 4YRZA 3CF4A 6LDHA 1P0PA 1PV1A 1E99A 1UT8A 2ODBA 5HGJA 4LFCB 1EBUA 1YQWA 3SHFA 3VYSB 4TTPA 1KVSA 3AFMA 2XJ4A 3H0EA 2XD4A 2ID4A 4RMNA 4RVHA 4Z8YA 1XTBA 2Z2IA 5BV8A 4M55A 3HPRA 4EVIA 4X62B 3EX7C 4D4KA 3LL7A 2F3UA 2YNMD 4F86A 1OXMA 4P58A 1DQPA 1IY8A 1VHJA 3RRZA 2MSWA 5FI3A 3UCXA 3KQUA 4QOEA 1CJMA 5IRCD 4DLBA 4ENTA 1T1GA 1W0KA 1Z5GA 2PO5A 2WBLC 1KJYA 3OZWA 2XVAA 4FE7A 3KL2A 3S5JA 2YDYA 1NBMA 1ZEJA 2YWGA 2V7EA 4QUHA 1EK6A 3HKCB 4FFRA 1T36B 4BUJA 1R18A 5JNSA 5HP4A 1L3BA 2JGDB 4IHAA 1MU0A 3QU7A 1XYYA 5A0TA 1Y3AA 4BKPA 5IVKA 1W4ZA 3WB0A 2G9ZA 1FJ2A 3I32A 4IXTA 1YK1A 2ZAIA 2JLRA 1K66A 2AFHE 4MZXA 3L7AA 1KEWA 3N8HA 4HWTA 3OIVA 4W7SA 1LI4A 5A2QA 3KWMA 3VXKA 4C78A 1FXUA 3AIMA 1RYFA 4EM6A 1O0BA 1D2EA 1EGMB 3YASA 3EZ9A 5T64A 3GFPA 2OFWA 2QB5A 1AKRA 1XTQA 1DNPA 2RK4A 1DU4A 1B8VA 1ODIA 1IAQA 2C4VA 2F9MA 2QRQA 5FBHA 3T7TA 1DBWA 3UM9A 3ZHRA 4ZGBA 3K35A 4AS1A 3A4MA 1CUXA 5KQMA 1W0KD 3TBKA 3S6JA 3VDXA 4URYR 3QUQA 1KZ7B 5JALA 4BLQA 3ZDZB 3IQDB 5KYXA 2H7CA 4WOPA 5HF8A 1A77A 4IJVA 5L3SB 3B1FA 1QF9A 2VPYA 3VX4A 4IFTA 3ZCPA 1WEHA 1TVEA 1BJRE 2HM7A 5G1OA 4UZEA 4RMHA 5CVEA 1LRLA 3WQRA 1MB0A 1DT3A 3SZMA 3WJAA 2OBNA 1QO9A 2WZCA 2O48X 1R0ZA 4ZEWA 1LJLA 3NBMA 2ZUTA 5TIIA 2C5HA 3EMDA 2XUZA 4Q3OA 3AOEC 2FZVA 1ZSYA 2V5VA 2BONA 1ZZGA 1U0FA 3H04A 3KELA 3GNSA 2PTGA 2ZKIA 5LYJA 3LYHA 1Q3TA 3A6EA 4WI1A 5DYYA 2OQVA 3SFVA 2IODA 1HYEA 5C8YF 4OOEA 3BMQA 4PS0A 3PX2A 3RNLA 2X41A 4PGMA 1YSCA 3CLUD 5F5NA 5FLEX 1SHKA 4NAHA 2H1SA 2IITA 1D1PA 3Q15C 1E3SA 4O4IB 1FFYA 2A78A 1YJBA 5EIOA 5EJ9A 3SIPA 1A4IA 3K1TA 2DU8A 5ALRA 2H07A 5JXHA 4A2QA 3DE1X 5I5EA 4Z9AA 5EN4A 4KQJA 3FYDA 3HJHA 1JZQA 4BLSA 4YPVA 4M8NE 5C46F 3QP9A 4KQCA 2ECPA 3S44A 1BKYA 4P80A 1X2EA 1I30A 3L7OA 3MRSA 1JQ5A 3R5JA 4TLMB 3IOCA 1V4VA 5BW6B 3WMFA 1QV6A 1K3FA 4M37A 3A3OA 3NVAA 3F4BA 1U8YA 4RHEA 3W8RA 3GLUA 4LTDA 2JHCA 1CJCA 2P5YA 4A6EA 4EA7A 5B7GA 4YIHA 1R5JA 4O6VA 5LUAA 3G3EA 3W5BA 2X15A 4TWRA 5CGQB 221PA 3AKDA 4GOKA 1GOTA 5AHRA 5F33A 4EGJA 3UJPA 2ZYRA 2NZVG 5JYDA 3NRBA 1G6HA 4OYHA 2YJ4A 5B1SA 2A3RA 1VHTA 2AG1A 2QQEA 4IX1A 4EO4A 4C6RA 2CHQA 2D0OB 1K6IA 1NRWA 3WMWA 2O06A 4DQ0A 1JJ7A 3KKNA 3IQEA 4G89A 1SPBS 3LRTA 4OHVA 5CH8A 5EKDA 4N3AA 3VPSA 1B1AA 4X64B 4C08A 1YWGO 3ZWCA 2O8CA 4G1VA 4XTCS 3P0HA 1O58A 1SAYA 1TYDE 4F2GA 2OAQ1 3OJ0A 2VS1A 3WK9A 1Y3DE 3F6SA 3KQPA 2P1ZA 2QN3A 4X1IB 5GPBA 5CDUA 3GD7A 1PZGA 1DL5A 2JLBA 1WCV1 3OO0A 4RD3A 4DT1B 2GHRA 2G25A 1Y6RA 1YR8A 2ZIWB 1AXEA 3L6RA 3IQWA 2W11A 2HO4A 5DH9A 1NI4A 3M49A 2AJLI 2ZRDA 1U4NA 3DDOA 1GTZA 2O6LA 2OO5A 3MLAA 4MRMB 3PQ3A 4QOSA 3D3WA 1SC1A 3ZHVA 3ZDRA 1LDNA 3UXHA 2JHAA 2C8JA 5JUWA 3UMRA 3E4CA 4C6TB 3NTLA 3ZV3A 1DELA 1T0BA 4REQA 1JG6A 4EY6A 5CH5A 3Q2IA 4DDUA 1K8QA 1KAQA 2BVNA 1NASA 4FSXA 4XSVA 1ZL2A 4UTVA 2AG5A 3BGIA 5EMJA 9MHTA 3OU7A 1T0HB 2J08A 4BOYA 4JLDA 1EDOA 4N0MA 2BI8A 4HB0A 4XH9B 1O94C 4EHLA 4ENPA 1D2RA 5AR1A 4LVNA 4W5HA 1K89A 2FETA 4FFDA 3U9SA 4E15A 3GRFA 4DYVA 4PZAA 3DW3X 3PF8A 4L8FA 1DIGA 1P81A 1Z3CA 2FNAA 4JJ8A 1A5AB 1JLRA 1UBMS 2DXIA 2W90A 3JYLA 4XFKA 1PFYA 2X22A 3DZJA 2D54A 3SQXA 1WL8A 2IXAA 4NU6A 4QKQA 1X8KA 2A0XA 1G0OA 2WWFA 1W7AA 3WJ2A 1KJWA 4R68A 2D5BA 2E18A 2WWHA 2WZBA 4D02A 2Q7OE 3O91A 4RAOA 3DFUA 4QAQA 3PQ6A 4E6EA 3D8BA 1H2EA 1A50B 2V8BA 1FFXA 16PKA 3CLSD 4V0SA 4ER3A 3P2OA 4DMKA 1THTA 2W2TA 4N5MA 3M7IA 3BF8A 4Q1FA 2PRYA 1FYEA 2FV8A 2Y0EA 3GV0A 3EEOA 5MHTA 1CF4A 4K9KA 4MVJM 1RBQA 1L7AA 2AXNA 5CNJA 5JS7A 3G59A 3V9AA 1N5JA 4W8GA 3G6KA 2LGJA 2GT1A 3PD1A 3GLFE 1WMBA 1XI2A 4AP5A 1SBCA 3C2QA 2HMUA 5AI9A 5BN3A 4QWWA 4HAUA 1P7YA 4DRXB 5KAMA 4W4TA 1QOQB 3WLLA 3AQIA 1ZI8A 4UBIA 1I7DA 1WXIA 2GFQA 1MZPA 4CCSA 1X1SA 2P9CA 4UQLA 2GILA 1J7KA 4RX1A 1ZGJA 1Z6PA 4NOMA 3IPLA 3A7EA 3JQ7B 1E1RA 1XQ9A 5LMUB 4CF4A 2L17A 1XQYA 1PZNA 3GXOA 5EWMA 2OB2A 3GJSA 1XL1A 3KYBA 4OK3A 3VR4H 2Q2OA 3AVXA 5JO9A 4LV8B 1WB5A 3LNTA 2JGJA 2IDZA 4GICA 5LZ5A 4O63O 1NF9A 3ELBA 3NW9A 2OV6A 1G63A 5E7IA 4DBLE 4E32A 1NW4A 2FPGA 4TYYA 2FPIB 3VR5A 2W2NA 1C7JA 1UJ5A 3O73A 1DINA 3JAWA 3KHUA 1XQWA 2QLJA 2XQJA 3LT2A 1J6UA 4RWEA 2WJZB 3DONA 2QX4A 4GEKA 3TAUA 5AFSA 2ZSJA 1GUBA 1P2UA 3FM9A 4RM3A 4UMFA 4ZDKA 5LQCA 3AGQA 4TSKA 2WMYA 4PQEA 4UNIA 5AXBA 3BN3A 2J8ZA 5HIMA 4CEJA 2ON6A 4GOOD 2QORA 2D1RA 3OECA 4PLVA 1B23P 2W2VA 4QASA 4ZJPA 5GZ6A 4P4SB 2P4EA 5E9AA 2QSZA 2XYGA 3D59A 5E0OA 1FRQA 4IH1A 1GAWA 1OIXA 4J1TC 5BUQA 2XZPA 3H4IA 4TMZA 1IWBB 3CA8A 4AS3A 3E53A 4F60A 1PJ4A 3AR5A 1DDOA 1PGOA 1ZPDA 2HWKA 3RU7A 3A1NA 4CCYB 1EEXB 1ZGCA 1SC6A 2YFYA 1WBBA 4MIEA 4AROA 2X2OA 3A25A 5CXQA 5DYWA 4C7OB 3VR5D 2FPUA 1Z4QA 2V7WA 3DL2A 5EKSA 1F2TA 3DBOB 1PQWA 2JAXA 3I5MA 4UD6A 2M6SA 3LZCA 3CNQS 4NZPA 5EYPB 3TN7A 3ZXXA 3N2KA 2QTVB 4RC9A 4Q4HA 1U28C 1JZSA 3B1JA 4L0CA 3OQ6A 3BFXA 3WR5A 4YCCA 5H3CA 3NV7A 1JQDA 5K51A 3UT5B 3ZQ6A 5A9RA 1QS0B 3C7DB 2XNHA 2Q29A 4HQKA 4IYRA 5ELXA 2N75A 1NHGA 1OH6A 1KFCB 1TUBA 4GX1A 3DBHB 3SQNA 2X9NA 1TJ4A 3GJ5A 4QPCA 3ZY2A 3QHQA 1M2JA 3IDZA 2PLAA 2V58A 4W5OA 2GKSA 1DG9A 5AJWA 2ZJ4A 3LUDA 3EVBA 4HFRA 3ESDA 1Q83A 2AJ8A 2BF4A 2GA8A 4I1UA 1E1CA 2OOSA 3RB8A 3JAMA 1JXAA 1CQZA 1FE8A 2WKRA 1FUKA 4LRUA 3SDSA 5C8YB 1E79A 4RGBA 1C7QA 1EX6A 1L8XA