2KM1A

Solution structure of the n-terminal domain of the yeast protein dre2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
117
structure length
117
Chain Sequence
YKTGLLLIHPAVTTTPELVENTKAQAASKKVKFVDQFLINKLNDGSITLENAKYETVHYLTPEAQTDIKFPKKLISVLADSLKPNGSLIGLSDIYKVDALINGFEIINEPDYCWIKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein DRE2
publication title A S-adenosylmethionine methyltransferase-like domain within the essential, Fe-S containing yeast protein Dre2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 21
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2009-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2km1A00
2KM1A
chains in the Genus database with same CATH superfamily
4X84A 4PZCA 3CNEA 1QPZA 5DX0A 5ECWA 1GUZA 2GJ8A 1MF7A 2AZTA 3QM1A 4R1OA 5ALWA 1SUCA 4S3MA 5CP8A 2XF8A 3F6YA 1TQ8A 5F21A 1GGKA 1PWEA 1VE9A 4RHCA 1HNZB 2I65A 1CRLA 4GSLA 2K4MA 3VPAA 1LDBA 5EZQA 4BGEA 2RH5A 3CNHA 3ETJA 1HDIA 4V3BA 5H81A 4NNPA 2EKLA 3JU3A 5G0SA 2G0NA 2OGSA 2I6TA 1JBKA 3VKUA 3WGUA 2PEZA 3OX3A 4CIAA 1AJEA 4IIDA 3NOOA 3HL4A 4PX5A 4NBWA 3PFGA 3RIXA 3KTOA 4BNTA 4B3XA 5CDFE 2FJ0A 3FYUB 2V96A 2LKDA 2PQMA 4Y2VA 4QZVA 1TEZA 1OZAA 4G4SO 5DNEA 2ZTUA 1MTZA 4X60A 3FMFA 1J8DA 2YOHA 3FBGA 1V9LA 3E23A 3LPAA 1OYOA 3NRBA 3N8HA 5DNWA 4BV3A 3GLFB 1NHWA 2EKBA 4RJJA 2XSZD 2UKDA 3H2JA 2FY8A 3ESBA 2XWSA 3QXGA 4I1IA 1ZPDA 1PJTA 4RK0A 2X5OA 2EFGA 2XUHA 1KVSA 1PZFA 4PAQA 2RHRA 3FVWA 3HP4A 4Z0TA 3TIGA 1T2UA 5CVCA 3V1UA 3ZCRA 4RLHA 5ESWA 3G2PA 4A0SA 3Q0EA 3TR0A 3R24A 4RETA 4HRYA 5DI3A 5L7TA 2P6MA 1NRWA 1W5FA 5JXWA 1ODIA 2NLOA 1FDRA 2WIDA 3E7FA 4I8XA 3CS3A 4IEIA 4XRRA 2F8SA 1IBCA 3KPVA 1XP8A 4L51A 4QO8A 5AKLA 4M54A 3U37A 2DE0X 1U0JA 2OAQ1 1UMKA 4BJHB 1JXMA 3B12A 4YJ3A 5IWCA 4EVQA 2IYTA 4RD2A 4MYCA 3P94A 3DA8A 2BKLA 3HDGA 1NM5A 1E9EA 1K5DA 1HQCA 3IHTA 1JZQA 3QVVA 4HOYA 3RJMA 1JYSA 5CD1A 1BXRB 1AKYA 3MCUA 2Y1OA 4GXQA 2NSDA 1PFVA 3RBVA 4C01A 4NZZA 4E08A 3OIVA 5FPTA 3AWDA 4HGQA 1ATIA 2BH9A 2JEYA 1SA0A 2CMDA 3F9CA 1JW9B 1MO6A 2OG2A 2ZR8A 3BGOS 3EXEB 3KS9A 3QKTA 2JKVA 4LCEA 4ZYXA 4KR3A 3G8DA 1VECA 2QTCA 2NXNA 3F6RA 4GMHA 5KNDA 3VR6A 4DV6B 3F3YA 5J5AA 4KHZA 5MN6A 2XCQA 3MZ0A 5IT5A 5AXBA 1V2HE 1QX3A 3MWDA 1CRPA 1WPGA 3VR4D 2J0SA 1O9GA 4ENQA 2E4XA 2Z30A 3EVTA 1N0UA 2Z9BA 1NLUA 2DPYA 2JGRA 3FYTA 3OWXA 4KACA 4K9RA 5FBVB 4OSEA 1A5ZA 3DCIA 3IE1A 5H83A 3WNZA 3CW8X 5FORA 3PFIA 1K4KA 3PA6A 2MINA 4RHFA 3DJYA 5CG1A 1UINA 2HZ7A 5C7YA 4XGKA 3WX0A 1FA9A 3I42A 2BFWA 1VHTA 3VM6A 1YTLA 3U3XA 4IIJF 3ZNOA 3LXRA 3FAZA 4PC7A 2PUFA 2H9YA 3AEQB 1T2FA 2ZWAA 3F47A 5BUCA 3PEEA 2HMTA 2P11A 2RJ3A 1KEEB 3CE9A 3CRNA 3FMOB 4JL5A 5CM9C 2XXAB 5JECA 1JFSA 1N6IA 4MS1B 1WL8A 4O5AA 3S5UA 3S1SA 5I9LA 3D64A 1QHHB 5HCUA 4DM3A 3EGDA 3M1AA 1XMSA 1QIFA 4G09A 1UDAA 4TVBA 4N9QA 3QVOA 2EX4A 2XLBA 3Q3JB 3HEMA 3CZQA 1PUJA 4KIWA 2EJBA 1YA8A 4UEKA 2B8NA 3T9BA 5KOYA 3KQUA 2O19A 5ALGA 1CY4A 3O9ZA 2PMKA 3W3AA 3UMVA 4DV4B 2CNDA 3DCYA 1T35A 5LWHA 2IXDA 1D8AA 3MTEA 4URFA 5K0NA 2HLPA 4KQIA 1E4EA 2ZWIA 3DZGA 3V7FA 1UODA 1TKCA 1USWA 1P0MA 1Q3KA 3B6MA 1FF9A 2EBWA 4COKA 1GT6A 2WMNB 2XD4A 1U3GA 1SUAA 3HBLA 3BIOA 4F2PA 2BN4A 8MHTA 2PUTA 3KSZO 2WM2A 3AZPA 4D79A 4LRTB 2XGJA 1IHUA 2Y1FA 3QUSA 4AXBA 1NUQA 4LK2A 3PQEA 3DM9B 3K70B 4O0LA 3WLNA 1AK2A 2QF7A 2PNJA 1B74A 3L7YA 3MBOA 4FLMA 5KO2A 1JTEA 3UZUA 4AZVA 2H4XA 2WHXA 2PX3A 1YMVA 3BH7A 4DR2B 5CCBA 1RRMA 2XZDA 1YF3A 3RVMA 4YK7A 1QWOA 3CMCO 1SXJB 5L7YA 4YRCA 3UOAB 2DFDA 3ZW7A 1NJ6A 1WHTB 1BDJA 5HEKA 3UIEA 2WSYB 1XLWA 4M6WB 1W87A 3LX5A 1F2UA 5DGTA 4HYYA 1UK7A 1QS0A 4M9CA 1L1RA 3ZGZA 2LTAA 4I99A 5C7IO 2D2FA 1NN1A 5KYXB 1CEQA 3M70A 2IEAA 2ZYDA 3KQHA 2PD4A 2ZRMA 1BMFA 4LYFA 3RC8A 2A0KA 3GQBB 1GXSB 1QP8A 3KHSA 3W3ZB 2NQ2C 1QFSA 3GGDA 3TLBA 4BRZA 4LF9B 1YKGA 1JT9A 3K5IA 1SCAA 2CL5A 3TX6A 4PV7A 1WDWB 5HCNA 3RJ9A 4QBGB 3FD8A 4RDXA 4RZ2A 2Z2YA 4BP3A 2WJVA 2TS1A 2IPXA 3AEYA 1KMMA 2QZSA 1E94E 3BDIA 3HN7A 3Q6NA 3A36A 1RWWA 3E15A 3DVAB 1OC2A 1ANKA 2AC7A 4M1SA 5JO9A 3JALB 4DYDA 3MJFA 3A2LA 4KRFA 1SBCA 1B6TA 1VPEA 2XUFA 3LHDA 4G1UC 4OPMA 4GZ6A 3DLPX 3ANSA 1L5HA 5LP6A 1Y9ZA 4Z51A 4RVSA 1REQA 5C8YB 1JKMA 2YBDA 2ADOA 1ZVQA 1Y63A 1QLHA 2DF8A 2YCLA 3AEKB 3GLHA 2HK8A 4H7FA 2UZ0A 4IIVA 6LDHA 4YUZA 3P9IA 4B4UA 3M82A 3GJRA 2HSEA 3CGGA 5MGBA 2J1LA 4AMGA 1XZMA 2W2NA 2YHUA 1W19A 4UD6A 3A4IA 2GXAA 1EK5A 2FZ5A 1HORA 1JP7A 4C03A 3QXCA 2Z2XA 1NJ5A 4YP7A 3E35A 3K20A 3ZIUA 5IVDA 1IBSA 4P54A 4H7KA 3GDGA 2E9SA 1UC8A 1MH9A 4JLPA 3TRHA 5JCJA 4KNYA 2ZYVX 2H65A 4GL4A 4GVLA 5DH9A 2DR3A 4L76A 4M0UA 4UAUA 2OXIA 5HK8A 3GFVA 5IK2A 4HYEA 3B2QA 4M0PA 3C8UA 1K27A 3P5SA 3QOFA 1SRQA 1DEKA 5JDIA 2BEVA 3PQ4A 2JFPA 4MKFA 1Z3CA 4XA8A 3UJNA 5DNCA 1JH9A 3SYRA 1I2AA 3T4XA 1ZUIA 4AIIA 4PE5B 5HKKA 2ZIGA 2C07A 3EVNA 4W5JA 2LCIA 1T9AA 1FYDA 2ONYA 2FQWA 4BL5A 5LMNB 1TLLA 2OHHA 3LVQE 2XNCA 1GQOA 2IE0A 2P6OA 2SBTA 2QRHA 3KLPX 2VEOA 3MQ2A 3PQ3A 5A4DA 5AKXA 4YMHA 2JLXA 1L4FA 3F5QA 5KTMA 4ZU3A 1ZIOA 4TQUS 2J6HA 2GZSA 2Q5CA 3SFTA 5AVJA 3BJRA 3I3OA 3ODPA 1NRXA 2FN7A 4YRFA 3T4PA 4BX0A 3CF2A 4QKQA 1JHQA 5ALPA 3ESRA 3MT7A 4AMUA 2HSJA 4KVFA 5EE3A 1USIA 2E5WA 3O95A 5EQJB 1M0EA 3UA4A 2IYAA 1YBVA 1USKA 1C1DA 3EXAA 3VHXA 3R3VA 4HBZA 4BZPA 1MOSA 2ZGVA 2JAUA 2XGSA 3FR7A 5ICCA 2DY0A 4D3ZA 1RAIA 4TV9A 4ZHQF 1FP6A 3FB1A 4W5HA 1E7QA 1GVHA 3G7UA 5F35A 5CW1A 5IM4F 3VTKA 1DC6A 1HFWA 5AVKA 4MDEA 3G0BA 5EQTA 2IHYA 3O8BA 4J4HA 1NVEA 4WFQA 5GY7A 9ATCA 1R3DA 5I9TA 1XLTC 1P7PA 1NXPA 2JGDA 2Y1XA 3Q98A 3QLVA 3RI3A 1WABA 3NIDB 1DJPA 5EHGA 3W6OA 1YR9A 3GH3A 1C3OB 4RVGA 1DDGA 5EXSA 3MAGA 2PPLA 5I9MA 3WIOA 4DA0A 3A6PC 4RCYA 1RI4A 2C5HA 2WF5A 1OV6A 4I4TF 4WNYA 1I14A 1X87A 2O2YA 4G0MA 1CV2A 1JNYA 3ESZA 4H6XA 1XDSA 3KKQA 1US8A 4NBKA 5FNVA 5HMLA 3DWGA 4D2IA 4N48A 1X1AA 2AOUA 3FPKA 3DNPA 4MHOA 3A4YA 1OBHA 5FTWA 1WCXA 4CFZA 4PC1A 3V9AA 4MS3A 1C8LA 1TA9A 1AMOA 5ALMA 3GDFA 5ALOA 3LBFA 5LUBA 1PZHA 1UR5A 2BFBA 3NZEA 3O0TA 4F72A 1KWKA 1H2AS 3QE9Y 2IP2A 2FWJA 4NBSA 1RHQA 4L74A 4TL8A 1SKYB 2H11A 5ALTA 3UHAA 5J4LA 2O0LA 3SQLA 4CG2A 4EARA 1RBQA 4JQYA 4X8HA 1R6DA 5KHAA 3AFOA 1JA9A 1C3JA 1P9RA 1WPQA 2CLDX 2FQ1A 4U9IS 1Z75A 3QE0A 5CAEA 1SBTA 4Z7QB 1YZVA 2G1KA 3T9DA 4ZN6A 2WWYA 2X0EA 3N70A 4W1RA 3E2MA 5K8LA 2WD8A 3W34A 1U28C 4LDQA 5AVTA 1LRKA 2AR7A 2BRUC 4Y1GA 3Q1KA 3EUEA 3CZPA 4N8SA 4F9FA 1U94A 1W93A 2JAQA 3BD6A 1KFJB 3HCFA 3KCNA 1RHUA 2A9JA 3IPXA 1A8UA 2QQ0A 4BP8A 3EEOA 3IA2A 1SKQA 1UCFA 2HT6A 1Y3AA 2FMHA 2YWFA 1GGVA 4Y9UA 2LCQA 3R0QA 4GECA 3GY0A 5CM8B 1KI6A 2WAOA 3PXEA 1U98A 3KT6A 4PLPA 1YI1A 1BQEA 1TM4E 4GKBA 4NMLA 4P84A 3V97A 4IO1A 4TN1A 4KE7A 3OZGA 2QD3A 4JL8A 2QRVB 1MOQA 1QLWA 1QQBA 1OLSA 4D9CA 3GW8A 4P33A 2H1FA 4NQZA 3RUHA 4DA8A 4HNUA 4BLUA 1J23A 1A2OA 3C7KA 4YAUA 3DUFA 3JD1A 3MGKA 4JFAA 2ILTA 1SPBS 2I4MA 4DUGA 4DLSA 4C6RA 1T25A 5HJ2A 4DLAA 2ZM5A 2BPOA 1O1YA 1FLAA 2Q5IA 1SJ9A 1FNSA 1EFHA 3U7HB 4P7BA 3TBHA 5D1HA 4AYWA 4JGGA 1CETA 3UPDA 3GUZA 1KSGA 1QE0A 4ENSA 1Z33A 4JYZA 1O89A 3FVVA 1V48A 3G7NA 5B5SA 4WGFA 4KFCA 2X8BA 4AY6A 3TEFA 3W0LB 2CVQA 3PQ5A 3OLVA 2IS2A 2JHFA 3FYHA 2R2AA 3A1TA 3AO0B 4DSOA 1O03A 2O14A 1RQPA 3VVBA 3AIMA 3OLWA 1KDZA 4IKPA 1O6GA 3UPTA 2IBMA 2EKPA 1CQWA 3JV7A 1YB2A 4A16A 2ZYWX 1XTTA 4RQTA 3ZBUA 2BLLA 1BGXT 2BGNA 2BZ1A 2PXAA 1Y82A 221PA 3N2IA 3OC6A 2ATCA 3LA6A 5AVQA 3L8DA 1QUFA 4X3PA 4CEHA 2C83A 5KSOA 2MYPA 5FADA 3OQJA 3FCOA 2VF7A 2B20A 3IFSA 1NQAO 5JAHA 1Y8AA 2HJWA 3L49A 1Q50A 1ECJA 1VBMA 5CT6A 4WLVA 3V8VA 4GOND 1HRDA 2WEKA 3KQOA 5CCDA 4MA4A 5JNVA 4EUKA 3D1JA 2P9FA 2IPNA 1VXOA 4LY0A 3K9NA 1ISSA 1HC7A 4UAJA 5CU7A 3P9SA 3NJ8A 3IDZA 4U1RA 5KNLA 4P3OA 4ZT2A 3ZHXA 3WL7A 4RTOA 2Q3CA 2I2CA 4PXAA 3KHKA 2XX3A 2JBHA 5CM2Z 4GMFA 1A72A 4E70A 1SU6A 2VPIA 5FUYA 4ZIRB 2WPDD 1M6VB 3ANXA 2OBYA 5F23A 1I3CA 2BFFB 2GWRA 4FOSA 1KHTA 4XASA 1EAYA 5LQSA 2BAGA 5AJWA 1Z8HA 4OHKA 4N3CA 1Q19A 4NEGA 4RHTA 5HRAA 3E9NA 1BFDA 3K0CA 2HB6A 2A1IA 2CUKA 3CJQA 3OIUA 3LIIA 4NE2A 1JDNA 4P4LA 5EZ6B 1DL5A 1SURA 5CLHA 1DTWB 2CK3A 3JVDA 3TDMA 4LWPA 2V9PA 4JUBA 2PJDA 2X1MA 3FPLA 1XUOA 4ZC1A 2ZSKA 5IARA 1YS4A 4HB2A 2VWPA 4H31A 4F3YA 1LUAA 4X92A 3AI7A 3ZV3A 5K9ZA 5E6RA 2UZ3A 1IL0A 5C1IA 4JBYA 1PW7A 5G3YA 2EZUA 3VU9B 5HKLA 2WWRA 3QLTA 4I3FA 3JYPA 1BEEA 1XVAA 3HZZA 1JQAA 2WAXA 2JG3A 5BVGA 3IEXA 3GJ4A 4PO9A 3COVA 4G1FA 1FUKA 1JS1X 1TO6A 2FN4A 2GYVA 1Q7TA 2AW5A 3ZLTA 2GBGA 1KYTA 2AXQA 5K2OA 1IY1A 2CHEA 2QJTA 4YQFA 1PBTA 4QPJC 1SIBE 1C0KA 1YVEI 5TE9A 3TCNA 1MEOA 1CDOA 2W2QA 3UENA 4EHLA 3KB6A 3Q88A 1U8AA 1U9CA 3DE6X 1JIJA 5T41A 3S40A 3PT5A 4MQUA 4C78A 2ZVPX 4KNWA 2WM9B 3AY7A 1Z18A 3LWBA 2E0IA 3DNFA 2WB2A 3R9XA 3LMKA 4TYWA 3FBWA 1TYEB 4RBNA 4U5XA 3AY3A 2FWRA 5LOVB 3LKVA 2PKQO 1G38A 1N32B 4ID3A 4F5YA 2EJWA 3SBOA 3PYXA 5E8RA 4PAOA 4LF5B 2ID9A 1VC2A 1Z0AA 5DTEA 2AFRA 4LTNA 5EE9A 5J2TF 4C4YA 3FHOA 4HH3C 3AXSA 4JLDA 4WMLA 1CEYA 1N5RA 5DI3B 2OZLA 3RFVA 2JARA 2NU6A 4DWWA 4UJ3A 1GG2A 1NVGA 4J29A 4YCNA 1NA5A 2H1WA 2WV9A 3PHIA 1YJXA 3E2IA 5H82A 4MWZA 1WF3A 4UAVA 3RNLA 5BR4A 1NVFA 4L72A 4Z8XA 4YBRA 1AY0A 2AEEA 1DU4A 4G84A 1P8JA 1RRCA 4BC0A 1NBOA 4NMWA 3NW9A 4UOQA 1PRYA 1FVXA 3ESXA 4YJ3B 2FSHA 3L18A 4NEHB 4D4LA 4P80A 3TFWA 1XMVA 4BMYA 3D4BA 3GROA 4PZ9A 4CCAA 2DKNA 5AVXA 2ZCUA 2HRDA 2I7VA 3G79A 4YNBA 5IP5A 1V1MA 4G1EB 1OXBB 2RH4A 3O1HB 3HB1A 1Z38A 3I2FA 3PCXA 3N39C 2F17A 2OV6A 4H3KB 3I1JA 3OZSA 2XSZA 4G97A 3UMMA 2XUGA 4Q3KA 1SA0B 2PZAA 4X1OA 4NFLA 1I4TD 1KYWA 2Q0SA 4US2R 2RDMA 2WPNA 3W5DA 1U80A 2X6RA 1VSQA 2I6GA 5ETJA 1QKJA 1GY8A 2AEJA 3EGCA 4IDAA 5K8JB 5GP1A 1AV6A 1RJDA 5TF0A 2WT8A 4UNQA 2I2BA 1JAZA 1GG5A 4NS1A 1DV2A 4HZUA 5COAA 1LK5A 4H1VA 3WRXC 2X2PA 3G2JA 1TU4A 3MWDB 1GAXA 2QIOA 1JEDA 2J3HA 1KS2A 3LTEA 3R41A 3F2VA 3GP5A 1J0BA 4F4HA 3NEPX 2QW1A 1GKYA 4RL6A 2BP7A 1CP3A 2VI5A 3PENA 1NQUA 2Q50A 2PA0A 1DKLA 4MV7A 1KBZA 2MINB 3BPSA 2SECE 3T3IA 2VQFB 1VA5A 1M2WA 1OFUA 1A50B 1PZGA 1QYDA 1QR6A 2YWXA 3VZDA 3AX6A 1KF0A 4IKOA 5A04A 5AUOB 3OEED 1D4FA 3QGMA 2A2ZA 3U7JA 4AKHA 3IAHA 4K9OA 2JFZA 3FRJA 5L3SA 1GCOA 4FOTA 3IP1A 4BAZA 1MV5A 2P1ZA 3FUTA 2HSZA 3VH1A 1IOWA 1QZZA 5IWAB 3COYA 4N9WA 3GWGA 2CLMB 3EGDB 3COZA 2ZI3A 2B7CA 4CLRA 1O8CA 4C3ZA 2H5EA 1P17A 2HA4A 2L18A 1SHTX 1FK8A 3E9ZA 4OU5A 4V0OA 3VPFA 1TYZA 5IS2A 1RHKA 4YTEA 3R1IA 2EF0A 3UY4A 3R3YA 2R25B 2LKCA 1E3QA 4UNSA 1E4EB 4LYEA 3CV3A 2A4KA 4YDRA 2HJ9A 4TMZA 3MJDA 1C7ZA 3NTQA 3KPYA 1N2EA 3HABA 3SHTA 2ZLBA 3MPOA 4RU1A 3ZWAA 3FWNA 2ORVA 3OZCA 4I9NA 5JZBA 2ICAA 4ABTA 1TJPB 5DDIP 4L0CA 1XRSB 1H2EA 2I0FA 1MJGM 4H9GA 3WNQA 4ISCA 3IR6A 1Y8QA 2PIDA 4AS1A 4OJTA 2F3SA 2CSUA 3G6KA 3PS9A 4J0JA 4YONB 4HEA1 2EJUA 2Q3BA 3E7XA 4HAWA 5SYNA 2Y1KA 4E5VA 3KTFA 2P5SA 2JI6A 3FWHA 4RENA 3L93A 4UVDA 4BPRA 1L7MA 2AZDA 2Y68A 5JYCA 1J5PA 1ORIA 1EFKA 2FZVA 2H2GA 4IRMA 5SZIA 1F2UB 3U3OA 1XCMA 4KQGA 3ZS9A 2P2NA 4EATA 1QS0B 3OH8A 3EZXA 1XPOA 4U7WA 2P9EA 2DUUA 1TRKA 4RV9A 4TTQA 5E2AA 4BZXA 4TZKA 4BQNA 4DS3A 4MH0R 1QGDA 3HA2A 1E4YA 2BFPA 3MGAA 3Q85A 4V02A 5ENDA 3L1KA 4LI0A 2ZUUA 5HQJA 3V8NA 3VPHA 4I1OA 2I1WA 4ND5A 4AUMA 5KTNA 1N78A 3BRCA 2X15A 4IUCS 4QTZA 2OD7A 4XWTA 4CQMA 5BWNA 1Z6AA 4KQMA 1RKBA 5FO1A 2FCAA 3BX1A 3LFHA 1LWNA 5EXDA 3KT0A 3GCDA 1KMQA 5TGDA 3FAKA 1TCBA 2JS7A 3QYFA 4FYJA 3QMMA 2NQ8A 3I3SR 2WYVA 1JNXX 2EARA 3GN1A 1T6XA 1V96A 1KI1A 4N01A 4X1KA 4XCQA 3ZU2A 1FMCA 1GL7A 3CSSA 3MUEA 3I5UA 1ZQ1A 3AONB 4KYUA 1J6UA 1E7SA 3PNQA 4P98A 5LP6B 3O3NB 1L5HB 3OQIB 4CM7A 3A6GA 5LU8A 2X0IA 1EJ6A 1HBJA 4I9FA 5C34B 3S0JA 2W4IA 3GLHB 4GLLA 4JVNA 4EG0A 2WG1A 4HQFA 2V6BA 3AJRA 3M6IA 4QOHA 3W5CA 2J5KA 3IIJA 1QIJA 4LGCA 2ZIFA 1VM6A 3LLVA 4KNVA 3TNFA 4YLEA 4UATA 3OCCA 5CFMA 1Z7WA 1OWMA 1X7WA 4KR2A 1CB7A 4I5GA 4KWTA 1J8FA 3R7AA 4HAIA 2ZR7A 5BSMA 2J7PD 3DLBA 2YMQA 1EFRD 3EXHA 2NYUA 4IDDA 5FBRB 3CSUA 3ICVA 4URHA 3CT6A 4MO2A 3ZVNA 4CMIA 1EVEA 5EC8A 2RG7A 5IG2A 2PX2A 5B7GA 1N4DA 4LZWA 5EIHA 3BK2A 1LC0A 2VJPA 1DWPA 4BNFA 4BIMA 4QO7A 1PV1A 3D8TA 2WILA 3OJFA 3V7YA 3CG0A 1ADGA 5AKKA 1E96A 2BEVB 4M3NA 2NG1A 5IM5A 4A9AA 3EMDA 3KD3A 1R7RA 1DQSA 3PKJA 1D7AA 4JOCA 3RRJA 3MD0A 3TLZA 4IJWA 3KOXA 5BMVB 1FW6A 2XIJA 2G9ZA 1E8MA 5THKA 1EVQA 5AVYA 1JQ3A 1DCTA 1HPLA 1DWOA 4AX4A 4YV7A 1I5EA 1KI4A 1AS0A 4JIGA 2YUTA 5FKJA 5JMWA 4IJQA 1KVTA 1XK6A 1B3RA 3SNHA 1ZGCA 1IEWA 1W4CA 3OZFA 4FGLA 4B6OA 3U09A 2QN3A 3F8TA 4Q24A 4LMRA 5AOBA 5IKOA 3HYCA 4ROSA 4DJAA 1PT8A 1ILEA 4BXOB 5TX7A 2O6HA 1C1DB 2CFRA 3HSKA 3O90A 1AV7A 2ILVA 3LGXA 3VHXB 2QTFA 4TL9A 5LA6A 1A95A 4R7ZA 4JJ8A 2XE8A 3O6VA 2ZE7A 4TV9B 1FNBA 4QIHA 1V95A 3OZUA 5JDCC 3L05A 1P2SA 1KIAA 4AECA 5F5XA 3WIVA 3UK2A 3ENKA 2AUNA 2BVNA 3H9CA 3JATA 3B6ZA 5E1DA 3LGAA 1RI2A 3EC7A 4KOEC 4S2EA 1NI4A 3ADKA 4WY5A 3NDPA 2JGDB 1S1MA 3PFHA 3C3MA 2Q3MA 3DZKA 5E2IA 1OFUX 2VT6A 3OKFA 4EELA 4Z7OB 5CFZA 4L4YA 3GF4A 2XBUA 2J5RA 5KBYA 5F98A 4GPZA 4LE2A 3BZBA 3L43A 4R4JA 3R75A 1P80A 3TQSA 3I2YX 4RD3A 4H08A 2VKQA 1US8B 4D3YA 3HXTA 4OLBA 3I0MA 4Y0VA 5JS8A 3O82A 3AHCA 1YZYA 4LXHA 3OE1A 3DM5A 1SB8A 1D2NA 2W8ZA 4R1UA 4BNVA 2RD2A 3ZI4A 1N3YA 2FGKA 3BKWA 3OT5A 3SN6A 2WJWA 2ZRKA 4MS3B 2YJTD 5KWIA 4CMJA 1ICEA 3G9QA 4IZHA 3EA4A 4U2CA 1HDYA 3WWDA 2O6LA 2YVKA 4MAFA 2ZB7A 3D0RA 4O4JA 1W7AA 2IF0A 4L27A 2XUOA 2ODBA 5AQ1A 2BFBB 3D1LA 4WKPA 3ND9A 3SBEA 1BGVA 1CZKA 4Q9KA 2ZP1A 4JELA 3OZXA 4KIGA 5A0FA 1PDOA 4ZI7F 2G5TA 1IBMB 1QXSA 4N41A 4PGFA 2PUCA 4C0BA 5ALHA 1JR4A 4CLEA 2O8DA 2MSDB 2P2YA 2QD5A 1H6AA 5CAEB 2BCJQ 2Q4OA 1QE5A 1H6CA 1IWOA 4B6GA 4OJQA 2AFHE 5HZMA 5LZ5A 2BL4A 3P4YA 3DZ8A 4AO8A 4B83A 2UZIR 1YASA 2GM5A 1VL2A 4I1SA 2HEGA 4C7KA 2ZBFA 1QGAA 4JJZA 3P9CA 4P7FA 4QGFA 2D2IA 2RCNA 1E7WA 4LI3X 4P35A 3RWBA 2XB9A 1V47A 2BHSA 1CIVA 2XADA 1W2GA 3L9XA 4KQCA 3DT8A 5C80A 5F2NA 4MLPA 2N46A 1EFDN 3DV9A 4I81A 3MLBA 4A8JC 3PNKA 2GZ1A 4B1FA 2M6RA 5AM4A 1H4TA 4DIOA 4FYIA 5IKXA 1ZBQA 1HSZA 1KI6B 1OX4A 1POXA 3H4IA 1BS2A 1T5BA 3SC2A 5IDQA 5LLTA 4TROA 4ESVA 1ZUD1 4KV9A 1JDTA 4CV1A 4I55F 4QT4A 2AT1A 4DR4B 5HTKA 1Y4AE 2H1LA 3E27A 3MYYA 1U7HA 1OSNA 4MPPA 5JQGF 2AQ8A 3BE8A 5K4AA 1OLSB 2ACVA 1GSAA 1Q2UA 5KHLB 3MW8A 5DN6D 1TM2A 4EDHA 1E5XA 3ADBA 3G49A 4C0SA 5I5EA 4JLSA 4DW8A 1K1EA 1U7OA 2VTDA 2XKBA 3DUFB 4HT3B 4WJZA 5BWLA 4Z1MD 1Q0ZA 4PRYA 2HA0A 3LWDA 1L8XA 4YQZA 1U90A 3SQOA 3QKUA 5JNWA 4DILA 1I1NA 1OT5A 3GRZA 2XMRA 3Q7IA 1TK2A 2EGGA 5CDFA 4BLOA 4RY2A 1F06A 3RREA 4DM4A 4YJ2F 3FYCA 4R51A 4P08A 4URZR 3F96A 5CFPA 1LSOA 2PZEA 3N2EA 1E1LA 2ZJ0A 1U99A 1E9RA 1HYQA 1YE5A 3B3JA 3DAGA 1RCUA 4MP3A 4BX8A 4LBZA 4DSNA 4UNRA 3RC2A 2GOYA 3N07A 2P67A 1KYXA 3L01A 4D8WA 4RJTA 1J33A 4RH1A 2EFYA 1MC4A 4HJRA 1YHNA 2QT0A 4AF6A 3FKJA 3H6HA 3OQ6A 1M8KA 4MKGA 4U2FA 2ZIZA 4QT0A 3STYA 1P60A 1JJBA 1NT4A 3BE5A 1ZK1A 2MTBA 1R2QA 2UUPA 2QG4A 3I0ZA 3IQEA 2BGKA 1JJ7A 1QP7A 1WSWA 2R1VA 3CZ9A 3EHDA 3LQRA 4A6PA 4F2HA 4ZI3A 1N5DA 5JTUA 4WSOA 1JWBB 5FYDA 3VYTB 1KI3A 5CJJA 3KELA 4TXMA 3QEKA 3P9QA 3BWCA 5CNJA 4DXDA 3PR1A 4MUYA 2V7XA 3PQ6A 1PL7A 2OZVA 3TFOA 3TSWA 4ENVA 5KNCD 1OWPA 4B2YA 3QVUA 1NLFA 4DIBA 1I6MA 4OGFA 1QOZA 4PCLA 3BWYA 3RSGA 3FTQA 3QKRA 4JVSB 2HW8A 3DE2X 1UKAA 4C89A 3J7AC 3WJ7A 4BO4A 4ZTBA 2O8FA 1NFQA 1VB3A 2IDKA 3HJFA 1M7HA 2ZUCA 5IUKC 2JD0A 1RAHA 3IUMA 5FOQA 2BRUA 2VJCA 2HM7A 2DTDA 3G2LA 4KO8A 4MIYA 4WLFA 1W5EA 2YIMA 4PCVA 4QTUB 1FSFA 5FBWB 2FQXA 3UG6A 3L7JA 3HA7A 4WA7A 2NXWA 5IUJC 1J22A 1MB9A 1EJ0A 1P9OA 3WVNA 3IR5A 1ZXLA 2R8PA 3LNCA 3EXG1 4B9AA 1A8HA 1XO1A 2FF7A 2OFFA 2BEWA 2WDPA 3HKDA 1L4EA 1DJNA 3BGVA 5B58C 1JJIA 2J4CA 1NXSA 2A88A 1C4KA 3LZDA 4I46A 7MDHA 4E2WA 1ZI6A 4DLTA 2XA2A 4XJVA 2DPHA 4WOBA 3QE4A 2OVBA 4MYUA 2YVLA 4XVCA 1APBA 5EKTA 3NBXX 4HNRA 3WGIA 5A3RA 1PP4A 5DOVA 3M8KA 4W4TA 3TRIA 1BJTA 4J4TA 5TEVA 3VH3A 1PDVA 3W8EA 1E1DA 1LRLA 3UQZA 3QW4B 2EHJA 3AG6A 3T9AA 3WKEA 4PO8A 1ZW6A 1GYRA 3A58B 5E6RB 5KYUA 1R6UA 2GZAA 3HU5A 4L8FA 1CR2A 2XB6A 2E1PA 2YWEA 1SIUA 2AXEA 1ZSNA 2C03A 2XNHA 4IEFB 3BRSA 3TB4A 3V5NA 4BLWA 4IPTA 3ZU4A 3VR1A 2OHVA 4TYMA 3K0SA 1I0ZA 4G4SP 2WI8A 1R8SA 2JBAA 4FEAA 1A8IA 2WPDA 1GSHA 2QTRA 3QH4A 2Q4DA 4ENWA 5BVGB 4IDNA 2B82A 3OQBA 3T06B 1AB5A 1YGYA 1IIBA 4HYQA 4FXOA 4LE0A 4ZI2A 1RABA 1YQXA 4D9FA 3ZV7A 3NP7A 3L7KA 1PJAA 3VYUB 2CJXA 3WICA 2C7BA 3RS2A 3GP3A 2QJFA 2D2XA 4J0KA 1C7JA 2HJVA 4GICA 4PINA 2OBLA 4QYSA 4N8DA 1E79A 4Q9LA 2XHZA 3WAJA 3CZ5A 2VDVE 3FH0A 5C46F 1SC4A 4RDIA 5FYQA 1X19A 5DP1A 5F5LA 4OOEA 2A1UA 3AFNA 3AGQA 2DHEA 3AM1A 2C9ZA 4OQEA 3R9XB 4PICA 4EI7A 2FPOA 3H5IA 5IF9A 5L53A 2LW7A 2WR8A 1VG8A 1EGAA 2BCEA 3KPJA 4F9TA 3A3NA 4M2LA 2O8BA 4NG5A 1QO9A 3LHKA 3SIXA 1X7ZA 1V5FA 2OGUA 2XQGA 3OOYA 3SU8A 2V7TA 4TX1A 3Q3GE 1V26A 3BCHA 3GJ5A 1AN9A 3OD5A 3ANNA 2OZLB 2NU6B 3WB0A 5DM60 3BWMA 4XQGA 3RB8A 3OPMA 1N6HA 2DBVO 1EBBA 2HNAA 4FKBA 4BV9A 4K1LA 4KK4A 1YQGA 2ZVDA 3MGCA 4X20A 2GH1A 4E5KA 3DHVA 4QPPA 3LCRA 1J7JA 3HL0A 4J3FA 2GBCA 3AM4A 5DTMA 5AVUA 4TMWA 1JLKA 5FBZA 2WU3A 1EG2A 1NRIA 3PC8C 1V1MB 4HNQA 4WNCA 1PWYE 4X1YA 2GEJA 3CW9A 2J0EA 1PR9A 3PPIA 3AHGA 4XE5A 3K71B 3B38A 4LRSB 2LBPA 4JU9A 4B74A 4BNHA 1HE4A 1WCV1 2HYDA 5TF4A 4JBIA 4QNNA 2C2XA 5CH3A 4UE2A 2WT9A 1XYYA 2MSCB 3S2GA 4JX8A 4NCKA 4IV5A 1XLVA 5A7FA 4AY2A 1MTOA 5CRIA 1FTWA 3A9TA 4IRUB 4XYEA 1YK1A 4HZUB 4Y0AA 1J0AA 3KYIB 3C3DA 4BNMA 1VL5A 4XLLA 5E38A 3RYIB 1JVBA 2AI1A 2Z8ZA 4KUGA 4BV2A 1A7JA 4NXNB 1MOPA 2BP7B 1FIUA 4RW0A 3EXFA 2CBGA 1ULBA 2P0AA 2BM9A 2ACEA 4RM2A 2Z4TA 2P62A 3WBBA 3HO8A 5C2JB 4LJKA 3RUPA 1MXHA 1W9MA 4IOLA 2AI3A 3PUZA 2R6ZA 3H6KA 3ZHZA 4YUXA 2CD9A 3ZU3A 3ZE6A 5F7OA 3UWKA 5CFQA 5L3SB 4YCSA 5ARBA 4WN9A 1A4UA 1YU9A 2UZAA 2XUKA 3T1VA 4EW1A 4MR7A 1M0TA 4KXVA 1OB5A 2O3RA 1Z5GA 2JRCA 3BZUA 2PBLA 3IQGX 3PPVA 4BZZA 1TVMA 4HWSA 3OX4A 4BOYA 2DFPA 3E5RA 3LKBA 4Y2HA 4CLRB 5EAIA 1HGXA 1U3FA 3C6ZA 3CMMA 3ZD7A 2M1XA 1BU5A 4R9UC 1CUXA 2GNOA 2QHXA 1R5BA 3PA8A 3MAJA 3H11A 2YASA 3QUAA 4YRQA 1XDZA 3PVZA 2YCBA 5I45A 3S29A 1K92A 1P8AA 3VU1A 3PX7A 1T6ZA 4V0NA 1FTNA 3DMYA 1ZY2A 2PUHA 2HTEA 3I09A 3FIJA 3E61A 2FRVA 3M49A 4Q3CA 1YOBA 2V5VA 3DBIA 4JENA 1Y7TA 3B20A 3MUOA 4RPIA 4S2UA 5KUTA 2G80A 1SY7A 3JWHA 4IX1A 4OEHA 3GUVA 1TO1E 1HDOA 2QMOA 3OEEA 4RTSA 1FFWA 2II6A 1DFGA 1QOPB 1DMSA 1Y8QB 1TZKA 1Z5UA 1R0BA 4G5QA 3CCBA 4IV8A 2V8BA 5JTTA 1C4XA 1TF2A 3R7DA 3QBJA 5JNTA 1O94C 1RJ9A 1YJ8A 2JGNA 2VUIB 1WXXA 1XVIA 2XWJI 3DTVA 1N5KA 1DEAA 1EX1A 3TQHA 2VBFA 2HF7A 1I3LA 4RZHA 3W2HA 5C32A 1Y33E 3QVGA 1KU6A 5K7SA 1ORTA 2HA7A 3BMNA 3CB2A 4K8RB 4WRRA 3J7TA 1D1QA 3PF8A 3ZGXA 4A1OA 1A88A 1T6NA 4AN0A 1WPXA 1FRQA 2V58A 3CUEF 3JQ7A 4BB5A 4UKDA 1YJAA 2VSOA 1R0KA 1CS4C 3H5NA 3BJEA 3BH0A 5AIBA 1ZR4A 3DBOB 4CQMB 5JPCA 4M37A 1JG4A 1W5TA 4AJ1A 3C5VA 4E46A 5KNCH 4ZO9A 1RZ3A 1U6IA 4ZCTA 5I7AA 3ERCA 1HFKA 3WRXA 4X1KB 3WYCA 1YAJA 1RW4A 3NHLA 4G9BA 1VGRA 4CG0A 1RLMA 4DCVA 3NNNA 2Z09A 2ZJ4A 2ZRJA 3ZXXA 3SK0A 4GXTA 1MHTA 3ABZA 1YS2X 1FZTA 3I01M 5EPEA 5JSQA 1Z5WA 1R12A 3ABQB 4K03A 2JNWA 1ADCA 2CDNA 3NIGB 5G0WA 3E4DA 1LTQA 1V3UA 1EFLA 1FP1D 4OHPA 5GGYA 1EGQA 4OB8A 4YUYA 2O2GA 3TTSA 2IUEA 3MJCA 1BTOA 3Q9LA 4PZUA 1D6JA 4J7AA 4R1MA 4F7DA 1PWXA 5E7QA 2EZTA 5A62A 4JXZA 5GV7A 3THYA 5ILGA 3I1YA 1I7SB 3TVYA 1K5PA 1VIMA 4H7HA 2GEFA 1Q91A 1XTUA 4H1TA 2NN3C 4MHSA 3QITA 4QPZA 5ADWA 1O94D 5A6SA 2JFWA 1JHPA 1X7WB 2PZMA 1SVWA 1V1RB 4YAEA 3AI3A 5FOUA 1B16A 3NO4A 2X23A 1FQWA 1P6UA 3EXHB 1MW9X 3O8DA 4Z86A 1TQHA 1V3QE 2OXRA 5FOTA 5GVSA 3HWSA 3SIRA 4DBZA 1IVSA 1B4DA 1RLIA 3CIOA 4LFCB 1GYQA 2JGEA 4CMIB 4EBBA 1Q7BA 4KWCA 2GHQA 1BAPA 2CL0X 4A0FA 4ZYYA 1AX9A 2VYCA 2JDIA 1FPMA 4UD2A 1J1IA 2C9YA 4Q3DA 1K6MA 1XTQA 4DRZA 1QF6A 3OLQA 1GQYA 3DVRX 3U7EB 1R66A 4TTPA 1CUHA 4CTNA 1KI9A 3W1WA 1TK3A 1ONPA 2IF2A 2QRUA 1A9ZA 2CWDA 3FMVA 3NP9A 5T4EA 4OFXA 2GJAA 5BXYA 1K7YA 2KB0A 2OG1A 4ONEA 3K9LA 1OPRA 1CE8A 1CJMA 1RJWA 1X7GA 4ND1A 5IVPA 1KERA 3I2HA 4QVGA 1S5PA 2VFAA 3QWHA 5KJFA 1FPQA 4PLHA 1WS6A 2HU7A 2V1XA 3B53X 3JAKA 4LIPD 2W6PA 1QR2A 2XV1A 1T91A 1EP1B 2JIOA 4RIFA 4WCFB 1JDSA 2VHXA 4M9XA 1XTRA 121PA 1E9DA 2J7PA 4EIWA 3WB2A 1EFRA 2P5YA 4FC6A 1ETUA 3EUFA 4XD7D 3ACBA 3LKZA 3L1VA 2ZU6A 3DWFA 1VBKA 3L7NA 3DFFA 3PPYA 4YI3A 4Z0NA 4ZO7A 2V9ZA 2HY7A 2VPTA 2AMVA 2Z3WA 4WEOA 1J00A 5LA6B 5HHTA 4CGYA 3OPYI 4OV6B 3EPPA 1U2QA 2QPAA 3PFKA 4GR4A 4DJJA 2WC1A 1T36A 5JC1A 4DV7B 4M8SA 2WZDA 1W1WA 1RXWA 5DGIA 3I8OA 3II6X 1VP3A 3FYDA 3JATB 5DYNA 3CISA 4L8YA 3ZHCA 1QRAA 3WMXA 1PL8A 3LZCA 1GPUA 1NI4B 2ZRDA 3H5VA 2C8LA 2Q9UA 2OAGA 4MV5A 4MWTA 2JIBA 1QHFA 4BN0A 1LTKA 3DV2A 5IYZA 2WMDA 3UXMA 3D3NA 3L4EA 3KAKA 3P32A 4DIUA 1Z4IA 1Q21A 2XYRA 2ZJAA 3DP9A 1INLA 3R7SA 4OK5A 3ZWOA 5B6JA 3N6RA 2IV7A 5DMHA 3TAHA 4EO9A 3I9OA 1Z26A 1FLNA 1YB5A 1TB4A 2XNSA 1W34A 1CKEA 5F51A 1NW5A 1R4AA 1RLOA 1QF9A 2EJCA 1P5FA 4AUEA 1YCFA 2X2EA 5AKZA 2ZJOA 2X2OA 5AW1A 3JQPA 1LY1A 2ZT6A 4GM4A 2AN4A 4P6VF 4DYHA 4CTMA 5D2CA 1SOWA 5L8VA 2EZ9A 4KQKA 1N2CE 1N5MA 3LJKA 5JSZA 4O4JB 5FQOA 2E4ZA 3ZWKA 2W42A 2NP7A 4EZIA 3SAJA 3AWIA 4IZIA 1WLYA 1UBTS 2DFVA 1IJBA 1ORWA 1GU0A 2JCVA 3G82C 3IOCA 3R3ZA 4K87A 1ELOA 1UBJS 1XDBA 2G3YA 1S6YA 3NXKA 4V0LA 3OICA 3WBFA 1Y1SA 5CXUA 3COJA 4E5UA 2WJ6A 1FQJA 3KUKA 5H9VA 5DBHX 3PZBA 4JHXA 2PUEA 4Q4LA 2O8DB 1PT5A 2NXCA 1LV7A 5L4LA 4UEWA 1E3SA 3R23A 5HJEA 5COQA 1RRKA 3DDOA 1L4UA 4KFUA 2ZWOA 4JP8A 2JRLA 4D6PA 2A67A 4P53A 1JYEA 3IAUA 1GKUB 4LHVA 4DUZB 2WWWA 3FTDA 4HGNA 4GM0A 5KX5F 3I2GA 4J9UE 3O3MB 3P2JA 2B21A 1KJ9A 4L5AA 3TIIA 2Y71A 1QYXA 1V3VA 2Q49A 2OXFA 4MJ3A 2HEIA 4FHDA 3OO0A 4N0DA 2EKDA 4WAUA 4M0EA 1QCYA 1Q20A 3K0EA 4R1LA 5CVVA 4ZANA 4YX9A 1IXSB 1BEUB 5A05A 4YUAA 1I4EB 1OX4B 1Z6PA 3DE1X 1XTIA 1DOZA 1BMDA 2OILA 4N5HX 4QARA 3SC2B 4DTCA 3KT3A 2MCFA 4F7WA 2WG2A 1P1IA 2CN1A 3AM3A 4UOZA 1MXFA 1XAHA 2VL7A 3W7BA 4R2WA 1F1BA 2J3LA 1S9DA 4CTJA 1ISGA 1KYZA 3GP8A 3M6AA 4KO4S 1XZLA 3K6JA 1D0IA 3I9FA 4IDBA 4MCHA 4G89A 5AJTA 5E4FA 2CXNA 3V8MA 1IUOA 4NDNE 4EP1A 4ZOLF 5DRTA 5JFOA 2MYTA 3L8MA 3SX4A 4HGPA 1N7JA 1UEXC 2IA5A 2ZREA 3R44A 4GQAA 2LGJA 4HNGA 2HPAA 2J5BA 4L9SA 4WXMA 1Z25A 1WPRA 1SHZA 1YB4A 1GRQA 1NOJA 2Q7XA 1KI2A 2ZK7A 3KLMX 1ARZA 3UJ6A 3T34A 4ZJPA 5TVKA 1C3VA 1FRFS 2ZSAA 4G56A 5FI0B 3CR3C 2OAP1 4OTZA 2DPLA 2SNIE 2AEFA 4EKIA 1KPIA 3A9WA 2XITA 3SLRA 1M34E 3ZTYA 2OCPA 1YR1A 1IZ7A 2C29D 4PZAA 4AMBA 2AV6A 3A9UA 5CK5A 3M6FA 5T67A 1F7UA 4FHZA 3O0DA 1LBEA 2WJGA 3C15C 4Q3AA 1M54A 3RRXA 3HNOA 3I45A 3WNVA 4AB1A 1JE1A 3KU4A 3P2MA 4GGOA 4WLUA 4BASA 2G71A 4TYNA 3KKMA 3ZGYA 1G20E 3FHCB 2WM3A 3HR7A 1TTHA 4GUDA 1ECPA 3GGJA 4HWTA 5EKXA 4M1WA 1LH0A 1Q44A 1OWLA 5DN6A 1HR0B 3K0FB 4NBNA 4KBFA 3BSSA 1ULSA 3GLRA 3O2SB 1U7UA 3KWJA 1QH8A 2HR1A 2R1VB 4KX5A 5CH8A 3HCEA 4MPTA 1R74A 1JYFA 3D5EA 2A1TR 2QTHA 2X5XA 3SJBA 1QTNA 3H97A 5COBA 2HYIC 1T3LA 3W6UA 1RHMA 3RUEA 4DLZA 2AHRA 3Q7TA 4I1YA 1R5NA 1G66A 1RHJA 5EZ5A 5FTNA 4WK4B 4L0MA 5TRTA 4E14A 4E03A 3QKRB 3QXHA 1WW8A 1LQUA 1E5QA 2NACA 3AERA 3BREA 1Y5IA 4BU0A 3MS2A 4GPD1 3W78A 2O8FB 1E0AA 3PPXA 1NNUA 2ZTHA 2HBQA 3G9ZA 4TXLA 4UEQA 5FO0A 5FNVB 3HZOA 5GGXA 5TC4A 2CXSA 2GX6A 2JFGA 1HLPA 2A84A 5JOQA 5JJ5A 2X4LA 2E18A 4OK3A 1WEKA 3JQFC 3VNRA 1FDSA 4R5MA 2EW2A 4TYQA 4P9NA 1LDNA 4OQZA 3A6DA 3QPWA 4A8JA 4RTPA 3X43A 3EAGA 2IYPA 2YIVX 1Y80A 1IN8A 2BEWB 3HKDB 4QOEA 5E3JA 5FIUA 5J9FA 4HVLA 1L7XA 1A9QA 1E0SA 1Y0BA 1CY6A 1WMFA 4IYJA 5JSUA 2X1HA 2DETA 4R40A 3TE6A 5THXA 4JI4B 1ZC4A 3TW0A 4J3JA 3HMKA 1R8YA 2YOGA 1JG3A 5KNCA 4NP6A 1GQSA 5HOEA 1DTEA 2DR2A 2OMEA 4K3VA 3VZQA 1V9CA 5KYUB 3FZEA 2C2KA 5I5GA 4LXTA 1PEAA 4JBHA 1NR1A 4LXUA 3GBVA 1R0RE 3ZBTA 3TUIC 1GIAA 1UDCA 2A0XA 2P2CA 4XJSA 4NCNA 3EYWA 3TXXA 3KYJB 2OO5C 4YWJA 5FX2A 2BGUA 3OZIA 1FRZA 2FQYA 2JBAB 3U0VA 3NATA 4EX6A 5CLIA 1G5TA 1J2RA 1IMJA 1NE2A 1PSWA 1NKVA 4KN8A 4RVCA 3KE8A 4HNHA 3DHWC 3UKDA 2PT9A 2FW8A 5IXYA 2WU0A 3KZCA 4FR2A 2GRUA 4KLAA 4KXYA 2J0QA 5JJKA 1P44A 4PQEA 2PKQP 4EW3A 4QFMA 1QG6A 2FHPA 4E7PA 4CHGA 1GUBA 3TZCA 2ZS7A 2QVZX 1OI7A 3VKFA 2ZUEA 1PTKA 2HQBA 1JH8A 4ZQIA 3UWMA 2N1BA 2V7PA 4MEJA 4D3FA 4PZ0A 2C1ZA 2Q5OA 1GRRA 1BHSA 4GRAA 4QHTA 4F84A 2MYUA 2P5TB 2AG6A 4DUPA 4IR7A 1U63A 2A1UB 2QG6A 3B1XA 4OB7A 4ZV4A 3FA2A 5T4HA 1LBSA 3FIUA 5EJ4A 3B7GA 4BKUA 1FU7A 4CU2A 4E21A 2O8BB 5D51S 1EH5A 1X7ZB 4Y2XA 4DIFA 3AF6A 1UIMA 2AW3A 4KIJA 1L5VA 1KEZA 3ZVMA 1N33B 2PJZA 2OHIA 2Y4NA 2XVXA 3RLIA 4BYGA 1G4AE 2GERA 3ZXYA 3TTWA 1E2JA 2CBZA 4LK3A 1RWMA 4NYMR 4PHCA 1EINA 1RKVA 4XQ0A 1N9KA 3CONA 2VHWA 4OKIA 4RDHA 5G40A 3I9V6 4DLXA 4BY9E 4BFZA 2DQZA 5AJHA 1J4AA 1G5FA 2HF9A 3LU1A 4XVQA 1Q1EA 2QDXA 2LPMA 3H7AA 4R05A 3TQQA 1TZCA 3HFJA 2QM7A 5CDGA 3B60A 2OAEA 5FJJA 3KQKA 3Q7QA 2G82A 2GPBA 2OUKA 4X1YB 1W59A 2OENG 2B1QA 2X9LA 3QX3A 1PE0A 3IAXA 3L0BA 3C0KA 2ZJ6A 3PD7A 2IH5A 2ODWA 1S2MA 3IAFA 3IPYA 5DBIA 3VKHA 1QPGA 1UBHS 4W99A 3MGGA 3PDCA 2TMKA 5EINA 521PA 5MF6A 3WV5A 2Q3JA 2UYHA 1G4HA 5K0TA 2HJGA 3WXMA 5A4AA 2E82A 1VGVA 1E89A 2JATA 2OBFA 1B43A 4ES6A 1E2LA 1F3LA 4XGQA 1KY5A 4JDUA 3EOAI 1DT3A 4K6HA 4X44A 1XP5A 2Z2JA 3COPA 4O5OA 4N5LA 2FR0A 5DHTA 3NM4A 4DANA 1AUPA 2FNAA 1V8BA 1ZGHA 4R8LA 3UK6A 5JHHB 1KBQA 2VF4X 3WP0A 4BVHA 3L0YA 1RQXA 1HF3A 2VTKA 2EYQA 2P8JA 3EXFB 3ENNA 4Y6QA 5DNDA 4ATNA 5TLSA 1LC3A 1AS2A 4LX8A 3WQRA 1AMNA 5F9HA 3E5NA 4J0CA 4JK3A 4CNQA 2IYEA 4OXNA 2ARKA 1U0HC 5E1MA 3JWEA 2J46A 1AKUA 2G1UA 3TRFA 1Q0UA 3BD7A 1DC5A 3A4LA 3IXLA 4W5NA 1KYIA 1O96A 3JQBA 3O1IC 3D6VA 1B26A 2QYOA 4MPRA 1H9CA 3EH2A 2BGLA 1XYGA 2ZRCA 3KJZA 3PGKA 2JF0A 4HPJB 4KK3A 3ZCTA 4HSEA 2OKGA 4WN9B 1QKKA 4ZAVA 2PJRA 4MR7B 4KITB 5JISA 3QVKA 4KDRA 1A5TA 1IM8A 1SUEA 3FW1A 3M6XA 1VIVA 3E1SA 4OYYA 4QG7A 3INGA 4D57A 3AF5A 4EM6A 1N4AA 2O48X 1WBBA 2ZI6A 3FGZA 4D8XA 4HK4A 2PGJA 2XVYA 4PYLA 4BBZA 1DTSA 5ITSA 3MQFA 2YW2A 5AK3A 3H11B 2I62A 5DN9A 3IGFA 5J4VA 3WRYC 3N0TA 4R3NA 3D4PA 3OA0A 4JVMA 2D59A 2WOOA 5DP2A 5FAXA 3OM1A 2ZBEA 4U63A 1EA7A 1M2KA 2WFLA 2XCOA 1E98A 3RS7A 1KJYA 5CB4F 4HX9A 1T9GS 1GGNA 2H1SA 4MW4A 3T8YA 3Q7RA 3ABOB 3CUKA 1U7ZA 5HA5A 4XUCA 2FFJA 3PF9A 4NCAA 1NVTA 3MCAA 4ZDJA 5KOHA 1N36B 4G5GA 5KTPA 2I7TA 3H3FA 1OFHA 3AVYA 4MI9A 1RJ9B 2QN1A 3DTVB 2Z5VA 1VSUA 3TLGA 3UAXA 2QTBA 4AYXA 4HDOB 2C3PA 4ZVQA 3OWOA 2W4QA 1XHFA 3ILSA 5ALSA 1JHZA 5FHRA 3QVGB 5CFOA 5KC9A 3GEIA 3BMNB 3GRCA 2R86A 4RQAA 1I7QB 5CT5A 3MHTA 1YDEA 4DWVA 1N75A 3WLTA 5CEEA 3CF4G 3MOSA 5C0OE 3NEYA 1KY3A 2G09A 4RX1A 1Z29A 3GJQA 4TLCA 4TQ9A 3JQ7B 4M1OA 1AO0A 1QO0D 1ID1A 1RM3A 2FX3A 3AP1A 4JJGA 3R0ZA 1TFUA 1UZUA 4QJ5A 3RK4A 5J5CA 1JXOA 1NV9A 2RKWA 2AC2A 1NQOA 3BWVA 2GD6A 2Y0DA 2AHOA 1EGHA 2CXRA 3IBCA 1DDIA 3TINA 3O47A 4JA0A 3SS8A 4EY7A 5FUMA 3AR2A 4FDVA 2XGMA 3GVHA 2Z6VA 4F12A 1FRNA 1Z7BA 5CTJA 1E0JA 4H60A 4Q9IA 2HHHB 3AL0C 5LWQA 2IZ5A 4W6QA 1AQYA 5DMXA 1OMOA 2A59A 4OHRA 3C70A 3MN1A 3NT4A 4OM7A 4B0OA 4DWJA 2WD7A 4JQOA 1NMZA 2DERA 1Q1NA 2VZLA 3H2ZA 5EHNA 1BD3A 4IHKA 4DN6A 2V4MA 3KXKA 1L7QA 4MXDA 1P72A 4A2PA 2IKSA 2HPHA 1T2EA 1CG6A 2WF8A 3GLUA 1Y1LA 5LM3A 3K1AA 3S27A 4BJ6A 1Y98A 1IN5A 1J2TA 1QZ3A 3FVRA 4IX9A 3THYB 3RBAA 1C30A 3QQPA 3JQ8B 4JJIA 2VJMA 2QLNA 4XIGS 3B6EA 5C8DA 2FPSA 1PR0A 3NVMB 4PLZA 5A6SB 4S1OA 4ALIA 4PWZA 5CDHA 4YPFA 4I4IA 3ZPXA 1IM5A 1NAHA 2AFHA 3AUYA 1Q1GA 1YU6A 2HA3A 3OIWA 4QQKA 2ZB8A 1XBTA 1QRSA 3SVTA 2GZHA 4MW1A 4CM3A 1NJSA 2XYPA 4UMFA 2R6JA 2A33A 1KETA 3DE0X 1T5HX 4MKZA 4CIYA 1A98A 2ERCA 2R2GA 3K96A 4WOKA 4Z6KA 4TVOA 2QX6A 2CNBA 2RFLA 3BG5A 3AVTA 1QM5A 3T3MB 2H0AA 2VHYA 4R8SA 4ER7A 4BWVA 5FQNA 2MSLA 5KMGA 1A1SA 2JD2A 3L79A 3IBFA 1S7CA 4B3JA 4AJKA 1G9TA 1UBCA 5M34A 1ZU4A 3W5AA 3ZJUA 4D81A 3WAKA 3NG1A 1CE8B 3ZIAD 1TCAA 3I61A 2Q41A 5AICA 3RABA 3ABIA 3K2EA 1AUOA 1AM4D 1SUPA 2NAPA 3JAKB 4A6DA 1FLVA 3E3MA 4PFQA 4NZMA 4R1TA 4CETA 1LPNA 3KTAA 3R6GA 1YZHA 3PP8A 4Z0PA 3D6FA 3EH1A 3K8QA 1GWNA 3WHIA 4BUZA 4EWLA 4Q93A 3T99A 3CUTA 3AVVA 2X5NA 3TQIA 3SCZA 2YYZA 3FGOA 4YT5A 5IFKA 1OJ7A 2JFNA 3EUAA 1U3WA 4BFVA 2IW3A 1YGPA 3N05A 2QW0X 1P2UA 3FBTA 1G2QA 1GTZA 3CX7A 2H1RA 1F1JA 1T36B 2R8RA 3G0DA 4RLFA 1JHVA 3V4OA 4B4DA 5I8PA 2PRIA 2WUVA 1YIDA 5K45A 5DI9A 2QMQA 2Z43A 4MW6A 5ALKA 2BDEA 3BCSA 3P52A 3WHPA 1SXGA 3IAEA 4Y2PA 1XRLA 4DOMA 4F4FA 4MA5A 5F5NA 3GNLA 1ODLA 3LW8A 5KAPA 2H5IA 3N0WA 3LQKA 2XHEA 4M76B 5IYZB 1U2GC 3TNYA 4BZQA 5I7WA 2VDNB 4DLYA 1PG2A 3Q2IA 4JBGA 3UB2A 2JFQA 2ECPA 1PAUA 5K0CA 5KKNB 1LPOA 3W1VA 3JD0A 5K4HA 1KJJA 2CJPA 4IY1A 3OFJA 4TTJA 5DW3A 1RYZA 3PDJA 2Q3EA 3OFND 4MQBA 4V0ME 1L3CA 4JCCA 1URPA 4NAUA 3SQDA 4H15A 5F52A 1C2YA 4W8OA 1WUKS 3QEOA 4R2KA 5JSZB 1GNSA 2PWPA 2IXFA 2QSZA 2RBEA 5EJIA 3R8CA 1QCDA 3TL3A 1TJ3A 2Q1SA 4ECEA 1YAHA 2AYZA 2CCKA 4X7RA 3I5YA 1MD9A 4B47A 5H16A 2NSHA 2AF4C 2YQ5A 4CJXA 3L6UA 4L1KA 1E58A 1YDMA 3A11A 1FBNA 5LB4A 5KREA 4Q6BA 2I1LA 3CNLA 2AGVA 2JLBA 5D7NA 3X2SA 4DEXA 2BFEB 5I4KA 3G1TA 2NTEA 3G23A 3I1IA 2OSBA 2IEDA 4RNDB 1OE0A 3ENQA 3ZWDA 4U7GA 3DZFA 4FMCB 2K2QB 3JZMA 4JN6B 1RZUA 1H0KA 2HX1A 1PVVA 4YAGA 1JBQA 1OROA 2QRLA 4B75A 1TJNA 2R96A 3REGA 2FQQA 4EHJA 1E66A 3OE7D 4TL7A 2DU8A 3RODA 3F6CA 4NAVA 3PUJA 1YRAA 4WBNA 3B9RA 2AG1A 4DDHA 3T5BA 5AUNB 5BSGA 1GCIA 2Y1LA 5H8WA 1XTZA 2QRNA 4LQ4A 5JBQA 1T15A 3EQ9A 4QE3A 4EHAA 2B4YA 3VC2A 3HCOA 2QX9A 3LRPA 1UZAA 2VJNA 1IC6A 1Y7PA 1T2NA 2WIFA 3BVPA 1A7UA 3F3SA 1IWPB 2WAAA 5KWJA 1MORA 2WKQA 4BMCA 4YR7A 5FBKA 3KL4A 2GCIA 3E82A 4RANA 3P5BA 3GNQA 4FZVA 1NU6A 2BFCA 2R84A 3BE4A 5HPYB 4P3XA 4Y9TA 4TZ0A 4IIXA 1AC5A 2UVQA 1KSHA 4JP2A 4TT8A 3NHAA 3UW1A 4BVEA 1TC2A 2CFIA 4P4NA 4G81A 4XM0A 2DHRA 2FRXA 1FDVA 3N28A 4FEGA 3OWHA 2WYWA 2IV2X 2M6LA 2SKCA 1COWD 3K8YA 5EUMA 3EPLA 2P75A 2A7QA 2AUTA 4FYWA 1QV7A 4RGVA 4RKYA 3PWZA 4TRMA 1IZ0A 3BCUA 3M33A 5I7UA 1NYLA 4NONA 3ZHBA 1KOFA 3VDMA 2WHQA 3DYIA 3GDWA 3R9IA 4DLWA 3P19A 4RTKA 3OZWA 3AYZB 2IXGA 3EFOA 2YFYA 1LLCA 5CPFA 3SX2A 2FMFA 1L0BA 2XUDA 1E2KA 4A23A 1VYHA 3BDAA 4RMHA 5AHXA 4YAJA 1SBHA 2H63A 2IYRA 2D5AA 3BFJA 3VZCA 1YDFA 4LOLA 1S9HA 5B2ZA 1VPDA 1ISRA 1WOYA 2QU7A 3D4IA 3PT9A 2I4IA 1I4DD 4BQIA 2VCEA 2EGHA 1SUDA 4LBVA 1QH8B 1BX0A 4GI5A 3WG9A 4NYIQ 1M67A 3JW8A 4CL0A 3ES9A 5BQXA 1XNJA 1SVOA 4Y2RA 1KK0A 4I1RA 4IGAA 1NC3A 2BMFA 1Z13A 3R3WA 4HVTA 1GUFA 3WL6A 3RV4A 2Q28A 4PG7A 2H4JA 3N8NA 4IGKA 5D84A 3G17A 5FFNA 2BGWA 2PGNA 2R6GA 1WUHS 1MRNA 3WGLA 2XCSB 5JIBA 2P6NA 3VUFA 4V0RA 1O97C 1L2TA 4KE6A 4BE9A 1E3TA 3KEFA 4BRUA 1NVAA 3AERB 3K8ZA 5LQNA 1HKHA 3W5IA 4MLCA 1XEXA 3GLTA 1P5JA 3ELYA 1Y3FE 2F9LA 2QNIA 4UW9A 2LDXA 2CYCA 3GXBA 2KJQA 4JB0A 4Q7LA 4MEAA 4ZICA 3GLIE 2DT8A 1CF9A 4LOKA 4RCVA 5L3ZA 4Y7DA 4O4JF 1MEEA 3RRMA 3JVEA 4OO3A 1Y5RA 1KEKA 1KHHA 2CV1A 5E1OA 3EF3A 2RGRA 3EIWA 4QM6A 1ZDMA 4MWCA 4QTYA 1R16A 3DBRA 3U6KA 3H2GA 3ZBPA 1Z17A 1DXQA 3K1ZA 3KYDA 4ITRC 2XVZA 4Y2QA 3OCUA 2VDOB 1KR5A 7REQA 1PX0A 2R62A 1WVIA 3AIIA 3ND6A 3FTEA 1RAEA 1I30A 3MMPA 2GQ0A 4PRZA 3GJ7A 3DL7A 2EDCA 4XLTA 1RR6A 4LVNA 4OXYA 3NTVA 4P22A 4WUVA 3EXIA 1C7RA 1ZNYA 1K89A 2CDAA 3T61A 5DCWA 2FDXA 5DCLA 3TK1A 1UBSB 3PRYA 3TI7A 4LXIA 4YBZA 2OXTA 3RARA 1BVUA 3C7DB 5DT2A 2PYIA 3RFFA 1VL0A 4E2FA 3C3BA 1XZCA 1Q7RA 2JL1A 4WVFA 3FSJX 1ODCA 3C4JA 3QWIA 5A0TA 5CURA 2R97A 4KODA 2VP5A 1WTCA 2JZOA 2YC2C 4X64B 5GTDA 1XZEA 3VFDA 3HCWA 2HRBA 2JK1A 4R9RA 4UQOA 1F20A 5HF8A 3TLMA 4D25A 1DBIA 3K1TA 1O97D 3VR3A 1SCBA 4R9VA 5ABPA 4D9JA 3D4LA 1WV1A 1CD5A 3OY2A 5HKAA 5A3QA 3U61B 4HN4B 3PR2B 3SWWA 1WUTA 4IF6A 4LN1A 5JJIA 2WWHA 3C6BA 3D7NA 2NVWA 2VH1A 4MUMA 2CLEB 3KZ1E 5B1IA 3QV2A 1Y5NA 3KCQA 5JZVA 2JIDA 4GD3Q 4RFVA 2EQ5A 1XZ8A 3CTMA 2QM8A 4H7EA 2PGIA 4PYNA 3D0QA 1V4NA 4C4TA 4BX9A 4NE7A 3KFXA 4AJNA 1JHRA 4YO8A 4GBGA 2A92A 4U9UA 4C7MA 4ENUA 2RIPA 1QVRA 5FR1A 4UHDA 2CLCX 4J2TA 4BFCA 1AUVA 4PLWA 1P3DA 2ZJYA 3MB8A 5BNWA 2I3AA 5CDYA 3T7KA 3HVIA 5B4VA 1J7KA 1RYDA 2PWYA 2ZDHA 4FDTA 4F8YA 1K08A 3E0QA 4CM8A 1NDHA 4NENA 4XIFA 1UP6A 1CULC 2GARA 4Z3OA 1L8QA 2OEPA 3K3PA 3W5VA 1GQFA 3ZGNA 1A9YA 3ZC3A 1MV8A 5KYNA 2EIXA 1MFPA 3OQMA 4JMLA 3I6MA 1NSYA 1FLDA 5JNSA 4O8CA 4HJXA 1DLIA 2QVYX 3NWEA 5TQVA 3U3RA 5JI3E 3ZVRA 3GLGA 3FMIA 4FGZA 3ZV6A 2RHDA 1ZJWA 2IJGX 3N7UA 2D6FA 1KMNA 2TMYA 2WUFA 4W1SA 2X1LA 1ZNXA 3ZOZA 5A4IS 3U60B 1ZL2A 2J8ZA 3D8HA 2H85A 4QHYA 4DZZA 1ST2A 2OGTA 3RU3A 4OQLA 5K3FA 3G5LA 4R9NA 3BICA 4BLRA 4Y2SA 1FQKA 4YASA 4C2BA 3U4MA 4H59A 5F3DA 4EF4A 1B41A 1SXIA 2DWUA 3ISVA 2VJYA 3QVWA 1GAWA 4GBJA 4KXLA 2PV0A 2XNJA 3M89A 2W70A 4OBXA 4B33A 1KSFX 5KJ6A 1SZPA 2W71A 1MPTA 4UPDA 5ALDA 3DL0A 2O0MA 2AXPA 4HNVA 3IP5A 4UOEA 1PGPA 1GR1A 3L7MA 2ZT5A 3M6MD 1Y3BE 1XL1A 4XUGB 5ALEA 1YE8A 4BEBA 1TI7A 3L0IB 3F71A 3CKMA 3A7DA 3AILA 3HSYA 4WXHA 3AKZA 4BMXA 4QLBA 1FDIA 1LJLA 3U4AA 1WXIA 2OO5A 4W8HA 2B8JA 1SAYA 2D0IA 2GPYA 1UDRA 3BBLA 3N87A 4KVGA 4U0JA 1M2JA 1K75A 1TF5A 4KLNA 3W2TA 1RMYA 1TZBA 2QMUA 4GGMX 1A5AB 1ZMOA 2V6JA 1O96B 3AY0A 4P0TA 3U4CA 3VDQA 1DKUA 1N2JA 4TKLA 3NKFA 5D85A 2ZCJA 2I8LA 2QAGA 3FTNA 3OF2A 1SELA 2EC5A 2BR4A 2Q62A 4F92B 1X1BA 2JFFA 1VMDA 2Y0CA 3ZVLA 3UBTA 1FXWF 1XKTA 4QUAA 1PFQA 3FSRA 2L2QA 4XSHA 3BD8A 1EBFA 4BNYA 2J9FA 4EL5A 2HRCA 2UZ4A 1GLNA 4B5KA 4MWOA 5F78A 2P78A 4UM8B 3U16A 1DBPA 2AVDA 2ODPA 4ZVSA 3RVRA 1IK4A 1U5AA 1Z4JA 4OQMA 2YTZA 2HQ1A 3UO8B 5LFAA 5DX1A 4KO3S 5BSKA 4KAAA 1UXOA 2A5LA 2B4RO 4DQUA 3K4PA 5IAEA 2F90A 2WFLB 1M3SA 2RH9B 4IJUA 2GCEA 4ESHA 1K0FA 3LYLA 1BXZA 4L6CA 2F3PA 4WY8A 4KCGA 1R0ZA 1J8MF 5BSEA 2Y0BA 5KOHB 2N0SA 5JH7A 3ZQJA 1LLUA 1F6BA 2YV4A 1U81A 4R2JA 3TCKA 3TLGB 2PAAA 2QI9F 3GT0A 2RHJA 2A5JA 2PSDA 2XY4A 4KQWA 3BGWA 1DIHA 1P1BA 4QBKA 3WYFA 4D97A 3AR7A 1N2BA 1UOOA 4FYXA 5FPQA 4B48A 1SG0A 4AAYA 3CUUA 4R8MA 4YRRA 5H3HA 4BCCA 4H1WA 1TEXA 3QX9A 1PGNA 1KZ1A 1YQWA 4PTLA 4A8PA 1KK1A 2QYHA 4RVUA 4V03A 2BH2A 1UAYA 3C1OA 2CCJA 4OLFA 2VP9A 1NUHA 3GLQA 4R16A 1P7VA 2EBFX 2Q5LA 5C8XA 3HDHA 5IN4A 1YVPA 3ITKA 4ZRDA 2OCGA 3LOPA 2P4UA 3VO8A 2DQKA 1Q95A 3EY9A 5DKFA 1LSUA 1S01A 1W5BA 3D8UA 3QOXA 4LZPA 4MUNA 3UMFA 1T0HB 3CN7A 1LFDB 1P2VA 2PKRA 3WIUA 3TL2A 2V0NA 4UFPA 1TADA 4F0JA 5BV7A 3V55A 2H4WA 4IGFA 4RM3A 1SVKA 4KAFA 4QOJA 2COKA 3OETA 1YBFA 5EHQA 4COOA 2O59A 1XTVA 2A0FA 2WD7B 4DC9A 1I0IA 1PX2A 3EIQA 4F71A 2JK0A 3P0JA 2RAUA 4H7DA 5BR1A 1I2CA 3AEUA 3ICWA 4EUFA 1QAQA 2WTUA 3W6NA 1CZNA 4UPVA 1D9ZA 4MUKA 5EUCA 3MINA 3K1AB 5DPMA 1O77A 1JTFA 1FX0B 2GKOA 5CX1A 4Q66C 2G83A 3P0IA 1J0EA 1C30B 1GFZA 1QO0A 4R1SA 2VJMB 2Z9CA 3QEAZ 3TMKA 4J6EA 4O2LA 5CT9A 3UWSA 2H92A 3S1AA 3AI2A 1RPZA 1ISHA 4MV6A 4E30A 1XN4A 2NU9A 1AKEA 2AFHB 2RGYA 1Q11A 3USES 4ZHSA 5HKBA 5LMCA 3VOTA 2PS3A 5A71A 1E3JA 1EHYA 3ON5A 4UPEA 1YQQA 4TGLA 3T0FA 1L5FA 2FPKA 3MTAA 3TD2A 4CCYA 1XCOA 4URVR 2AJBA 2RAPA 4N40A 3N7TA 3ZWCA 1DOAA 2AWOA 4KR9A 5C1OA 5AM5A 3WRYA 3TAUA 2W2OA 1Y8CA 1EZZA 3EFEA 4IUBS 4BGIA 2HWYA 4M7RA 3AHFA 5KMGB 5F4BA 1OBCA 2IGBA 3HDJA 5ARDA 3X2FA 2YFQA 4XXHA 3VJRA 1UEJA 1RKXA 1NNSA 2CE2X 2IPLA 2Z8XA 3I05A 4MINA 3OZBA 4L5CA 1ECGA 2I7DA 1LW7A 2Q6TA 4JC5A 3N0RA 4BFLA 4OBEA 1THGA 5ITVA 4JLWA 1JEOA 1GPJA 3SVLA 3K9CA 4RL4A 5KEIA 3X1WA 3IT2A 1XVVA 1ZONA 3D3WB 4QLOA 4F97A 1UQRA 5DT9A 2Z58A 1X38A 3GZNA 4XQEA 1U04A 3R7WA 1DKMA 1SHKA 1ZUNA 4EB8A 5FULA 2IIBA 1B23P 5KOJA 3KPUA 3H4VA 1VG0B 1CYEA 1IHPA 2ONCA 3DKKA 3KTAB 2BMAA 1A04A 3L6CA 3C87A 4RF4A 4WEQA 1CF4A 5CB6A 1XTBA 4MHTA 5GJBA 4LNUA 1QB8A 2ZAGA 2FRDC 3TW6A 1UP4A 1W5AA 3IP9A 5LYJF 3WLHA 1PJZA 3IEIA 4FFRA 2HK7A 4RY8A 1KDOA 2HF8A 3CKKA 1F2DA 3GGOA 3HKEB 4FE7A 1CW2B 1PGOA 1X1EA 3PE3A 4JR2A 4DV1B 3LY9A 2XRFA 2N75A 1YRYE 1JVSA 4QDUA 3RYTC 1ND6A 5JCZA 2Z2IA 3OU7A 4ZV7A 2ZANA 2O7NA 1DRVA 4OHFA 5EXTA 1NXQA 1ZM2A 1EP3B 1KEWA 1O5OA 4ZA2A 1RKUA 4XPZA 1RI5A 4LWOA 4ALJA 4NCHA 4HMOA 3ZIAA 3TF5A 1EDZA 1LRJA 2QGZA 2ZRPA 1G20A 1MAWA 2VATA 5CYPA 3RFCA 4JI0B 3FWZA 3Q3VA 2KW5A 1U3CA 3H3JA 2UYYA 5ILQA 3LBNA 3KZMA 3S7ZA 1BDHA 1EYZA 1T8YA 3I64A 4HDNA 4C0XA 4MGHA 4D46A 2WTBA 5AVZA 1E1RA 3S55A 4Q3BA 1Z08A 3O2NA 2QROA 2GRJA 3A1NA 4OB6A 1XLUA 3QQ5A 4QUBA 4BTLA 3HYRA 4ZZ0A 2XYGA 2YYAA 3LFUA 3DFMA 3VNUA 1E2QA 1OLUA 2A3RA 4BTEA 3KLOA 3OEWA 1NBAA 2QWXA 2PXHA 4WECA 3ZY3A 1GSIA 4TRRA 2EX0A 2PUGA 4TMXA 2VCYA 4EVRA 4ZZ1A 2GM3A 3MYRA 4RLQA 3ONFA 2IE8A 2C95A 3PTLA 4JLKA 4X5OA 1DBVO 1N8TA 4IW3B 1QG4A 3EQ7A 1A71A 2F4VB 1FDUA 3AF2A 4IIJA 1EVZA 1NBIA 2I6FA 2PSEA 4Q7QA 4KI0A 2D0DA 1U3VA 4X8MA 4YAKA 1ENPA 3DEZA 4LDNA 3MXOA 3AOGA 4HFRA 5ERYA 2KBEA 2I78A 3PRKE 4FSHA 3ZDCA 4P92A 4PR0A 4C5AA 3IOEA 3AB3A 1WR8A 4CFYA 2KI5A 1CNEA 1AKWA 4FFDA 3OFNA 5JO0A 3QTTA 1W47A 3IELA 1HQYE 3W5UA 3F67A 4D1YA 4WBNB 2RC5A 3BJIC 3BXEA 1X14A 1ZJ5A 1EWTA 1SCJA 3KOYA 3NC0C 2GPSA 1QMGA 2J32A 2XDYA 3NYRA 2A14A 1IZYA 5DGCA 3B36A 2PH1A 2ID4A 4IJ6A 1NIPA 4OKNA 1EAMA 5A5VA 4EG4A 4L8VA 1DADA 2SCUB 3P7MA 1U8XX 1ABBA 2P4HX 4LJ8A 4P38A 1EJBA 2DYKA 5IT0A 4IXTA 2X0RA 3BA1A 2BFCB 1DPGA 3QFFA 4LG1A 1G63A 1WSBA 2R1TA 1UT6A 3HCBA 4JC4A 5JC8A 3A26A 2WM8A 4M0DA 4ZPJA 3NCTA 5H1YA 3RS9A 3OTGA 3SSMA 3JR3A 4MCAA 5CX4A 3WK5A 5U4QA 4P83A 2FUCA 3GRKA 4OSOA 1M66A 1D4OA 2ONZA 2FSGA 1X1TA 2Q5QA 3KSBC 5KQRA 3IYLW 1II9A 3OE7A 3MBKA 5KPJA 1C3XA 3TJRA 2YZKA 1B6GA 3GT3A 3A8TA 3Q8WA 1QQ6A 1MVOA 1WO8A 1W48A 2ZAIA 4UEOA 3SR4A 1Z63A 4ENPA 1K4MA 2XWBF 2JC3A 3D8NA 3IVAA 5JALA 1ISFA 4NAHA 3CEAA 3EFOB 1U2GA 1I5OA 4IGEA 2X22A 4TTVA 1E64A 3R5SA 4PCAA 4BWGA 1QVZA 5DNUA 4C1NA 4OHYA 1U8ZA 5JD5A 4C3UA 2IIQA 2JLRA 3ACCA 1T0JB 3DZJA 1NDQA 1RE0A 3H2BA 3S8YA 4MUGA 3SR3A 1GPDG 1WXHA 3SQXA 3EGOA 4KRGA 1G5QA 2E87A 2HWWA 1Z7EA 3E22A 2F64A 3NS7A 4F1KA 1P18A 2HKIA 1QZUA 3KSUA 2CLOB 2FG5A 1YNSA 1P6XA 4ZCQA 5HQ3A 3C5CA 5TSDA 3B5EA 1SKBA 1ZP6A 2GLUA 1Y8RA 5CW2A 4ZAXA 3RT7A 2B25A 1COWA 3ED5A 5SY9A 1Z9BA 3ORRA 3D6JA 4BNUA 5D00A 3TZHA 1KTVA 3IEKA 4PSUA 2R65A 3NQ41 1HG0A 2JJ2D 3CPJB 4Q7KA 4KLCA 1QNFA 1YJQA 2AA3A 3VSBA 3W06A 4BNLA 2GA8A 3NAQA 3N53A 4H17A 2GNPA 2QUBA 2ORWA 1WG8A 3VGJA 2CJYA 4OHBA 1TC1A 2HMAA 3EQ2A 1DX9A 1B8VA 4LWQA 2IL1A 3HVUA 1JKJA 4U2DA 4EENA 3RUDA 2VDQB 3H2SA 2FMIA 4QEZA 1XEXB 3QPUA 4G41A 1XELA 5JXHA 3G68A 2O5CA 2ENUA 3R5JA 4S05A 2XB2A 1E7RA 5KTYA 2I1QA 3ISTA 2NNWB 4JT9A 2IYYA 1A77A 3QUTA 5DOZA 1OA1A 3FG9A 3U3KA 4ZDIA 1S4MA 4FINA 2PMDA 1U7PA 2C1XA 2VQDA 3ESDA 3FCCA 1VBFA 3T7DA 1SG6A 2GKGA 4HMPA 4L08A 3ZKAA 1H1TA 4DTIA 4EJ2A 4G1VA 4AXXA 1JKIA 2HJRA 3K53A 3ICEA 3KYDB 3H5RA 3BTOA 1M76A 4TKVB 3RAJA 2GUWA 1IOVA 3TL6A 7REQB 3MSXA 4J03A 1N6OA 4Q6WA 3M4XA 3FHLA 4W1QA 1YHZA 3OZDA 5FWDA 3ABSB 4PGGA 1DCKA 4HWPA 1B1AA 3EXIB 2ETXA 2P6PA 2O4UX 3LYAA 2NTNA 5DXAA 3QU2A 2PL3A 3PFBA 4Y1EA 1E2BA 1RFLA 3HSSA 1UQTA 1XZFA 5T4FA 1SQ0A 2UUOA 5B3LA 1I10A 1QIMA 4JQCA 3SIPA 1J0DA 2WTEA 5FUQA 2CV0A 3KQSA 5CHYA 3VBCA 1TGYA 4Y7CA 4ZVOA 2JFHA 2QL7A 3AP3A 1P2BA 3I92A 2YS6A 2H29A 3KLNA 4J0FA 3UYKA 3GPLA 1PCXA 4U0KA 3D7RA 4AJ9A 1LJUA 4A6XA 2HA5A 1P0FA 1KVUA 3BAZA 3CJTA 3EZLA 4TSKA 4YAIA 2CFOA 1X7HA 1BZYA 1MVLA 2EHDA 4FFPA 4EGJA 4NBLA 3QLEA 1KWGA 5CFNA 5IHPA 1M1YA 4RE5A 4C7BA 1DO0A 3JRXA 4WXEA 3KEQA 2PU7A 4ZHQA 2XGGA 3GRUA 1L6RA 1XQ1A 5A2GA 2GEUA 1N6RA 4LF4B 1OX5A 4QRHA 1S02A 1WMBA 3SC3A 2X14A 2JLUA 1QKIA 4AJOA 4AM8A 4N39A 5TY0A 2Q46A 4FQ5A 3ZZUA 4UBJA 4CDNA 1RS0A 8ADHA 5GINE 1RPJA 1C9YA 1T3TA 3FETA 5KQGA 4L3WA 3ZJYA 1VE5A 3Q0TA 4GPEA 2VWHA 2GESA 2C5EA 1OI2A 2EZ8A 3B3FA 3WV4A 1N3LA 4EB6A 1NVVR 4TOIA 4ER0A 1DUVG 4RF5A 4FWBA 1MGPA 2OA0A 2FEOA 4DLUA 2POQX 1OX6A 3L41A 3L4JA 4B81A 4IVRA 5KZMB 1GZ7A 1GSOA 1VHDA 2OFXA 3ETHA 3CRZA 1IUKA 3EFBA 1E2DA 5B6IA 4CM8B 1N2HA 1P9NA 1XTKA 2Y4OA 3PHBE 1FFBA 1YB7A 2P90A 2BZGA 3MK31 3IA7A 2N9UA 4E4TA 3HJTA 1AZLA 2GLXA 4YMUA 1P19A 3O93A 4FJ2A 5MHTA 3FB4A 3BWXA 2PYZA 3RSLA 3NRJA 3UJHA 3TPZA 3FPCA 3IVRA 4DCMA 3M4ZA 1R3UA 3NB0A 4X00A 4FSDA 3U26A 3GLGB 2W2TA 3UF0A 1CDDA 2WWGA 2G6TA 3VYRB 4ZYTA 3HKCA 2V6FA 4D41A 2ZRHA 4QUHA 5K3FB 2H59A 3NDJA 1VGQA 2OM6A 3UTDA 2Z3VA 3GH1A 4CYMA 3EX7C 5H4HA 3A2KA 3FFBA 1VFNA 1VKHA 1X74A 4KMMA 4NU8X 3ZI0A 1HT3A 1I0LA 4I36A 3GRYA 2O06A 3SXPA 3ZQKA 2ZAMA 2CXHA 5E8JA 2EYUA 4ARBA 1PIWA 4BDTA 3AQIA 4YXFA 1BS9A 1G291 3NEAA 1VJ0A 4Q9AA 5C31A 2QA5A 1GNRA 3C7TA 1C14A 1O0SA 3THWA 4HP8A 1UKVY 1HNWB 4E32A 5LL6P 4RESA 1NI3A 1JHAA 3UV6A 3PUWA 3T5MA 1AE1A 4W5QA 4HC4A 2O1EA 2CL6X 1L8OA 1O58A 4F9GA 1RACA 2RKOA 5L3RA 3KFVA 3LX4A 2ADMA 1C9NA 3GWZA 1NE7A 1JXAA 4FSXA 3OOSA 2GF9A 3VBEA 5B55A 1MJGA 1KL7A 4WACA 4GW3A 4PFSA 2NM0A 2WJ3A 2WUWE 4BVBA 2OCDA 1WDMA 1XB2A 3H1TA 3NYIA 2J9YB 4TSRA 2ZRBA 4HDMB 2QQEA 1VLQA 2F1RA 2QAGB 2V8OA 2XQVA 4IEEA 4LBYA 4UULA 4E5DA 1OVGA 1P0IA 4FX5A 5CXXA 1TM1E 2XT0A 4LZNA 1E0KA 4Z2YA 5E3HA 1BOOA 3P0FA 1OXMA 1QV6A 2CUTA 3QRWA 2J9FB 4OHVA 4DBLC 3KB8A 1UBFA 5DEIA 3O73A 1FFAA 2ZI7A 1R64A 4HXGA 4GLJA 4PIPA 3W6ZA 4HLDA 4D3DA 1E9CA 2UVPA 3JQCA 2PH5A 4BBPA 1JRLA 4X3OA 3E9DA 3MVEA 1DJOA 3NTUA 1N6LA 2OYCA 7ABPA 3C48A 2H4YA 4JT2A 1VYVA 4KGXA 1P1RA 2X42A 4ND6A 2DB3A 4FBMA 5M5BA 2HCRA 3O3CA 2PUDA 2VDRB 4DHEA 3KQQA 1KP9A 3ZVKA 1OIWA 4BNXA 5L40A 3A1UA 2VSNA 4UBMA 4KTTE 3FVQA 2NXJA 1PZXA 3AETA 5DLYA 3W79A 4ZVPA 1V9SA 1NJ1A 1QFXA 3P9NA 4B4OA 3FF4A 5I7RA 2BGRA 1RLTA 1SEPA 2XQKA 3BYZA 3IXQA 4YGXB 4GOMD 3LLUA 3PDWA 4CKYA 3LWNA 4XSGA 1JMVA 5JH7B 5LNK6 3EZNA 5DO9A 721PA 4O2AA 2VNAA 1WA5A 1YCGA 1HT2E 3EZ9A 2YBEA 3TLEA 2Y9MB 1T0BA 4C0HA 3S6JA 1WUIS 4ZCIA 4GYKA 5K2MA 1PQUA 1UPXA 3PITA 4ZEXA 3SM3A 2VXOA 3CX8A 4XZ3A 3N9IA 4CN9A 1NW4A 3DAOA 3E84A 3I28A 1HFEL 1E92A 2I29A 4FS3A 4G0XA 1B2RA 1TT5B 2FX5A 1DIOB 1MVNA 1ACMA 3BE6A 1JQLB 3K9QO 2TSYB 4GX5A 2BJWA 3OLCX 3AVPA 1DOHA 5CXQA 2E6KA 2XB8A 3QF4A 5HDBB 3T41A 3SXUA 4HX5A 1E6MA 1GA6A 2ROQA 3SHWA 5GZ1A 2FOIA 2YMLA 2GNAA 3HV0A 5DSTA 3BWDD 2CE7A 3DPUA 2A78A 2VBIA 1YS6A 2F9MA 3T7TA 2Q4RA 5IFLA 1HE3A 3VR2D 4V0MA 3FPHA 2ZB2A 1TUBA 3VSEA 2A5FA 4NCIA 5CJ2A 4TWRA 4D9IA 3R0VA 5EHXA 1ZJ6A 3WB1A 5EI5A 5JD4A 2OB2A 3GAAA 4XDZA 3PHLA 3R4VA 1SK8A 3M1IA 3V1TC