2KM1A

Solution structure of the n-terminal domain of the yeast protein dre2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
117
structure length
117
Chain Sequence
YKTGLLLIHPAVTTTPELVENTKAQAASKKVKFVDQFLINKLNDGSITLENAKYETVHYLTPEAQTDIKFPKKLISVLADSLKPNGSLIGLSDIYKVDALINGFEIINEPDYCWIKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A S-adenosylmethionine methyltransferase-like domain within the essential, Fe-S containing yeast protein Dre2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Protein DRE2
total genus 21
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2009-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2km1A00
2KM1A
chains in the Genus database with same CATH superfamily
2WTAA 3WGGA 4E09A 1GQFA 1QB7A 2JA1A 2EP5A 1MNAA 2AE1A 4FMBB 1ZJ4A 4MP8A 3DL4A 1SXHA 5A05A 2OXEA 2YY5A 1WOYA 4I1IA 4V0KA 2PMWB 5CGZA 4AO7A 4HCJA 4CM3A 1SG9A 1TVKB 3WRYC 4PYKA 5AVUA 5EJ7A 1UPUA 3A3OA 3D6TB 3IQHX 4RVUA 4EW6A 2IUEA 2IHJA 4TYNA 4B3SB 1G7SA 2W6ZA 3A2NA 3ET5A 3I92A 5ESDA 1B0ZA 2ZB8A 4QAQA 3E7XA 5CUQA 5AM3A 3NGLA 5A5GA 4F3TA 3B9BA 2EG5A 1YASA 3NYRA 4ND5A 1DINA 4AN1A 1JFLA 1LEHA 2FSFA 1QV7A 3T1OA 4J7AA 1SJ9A 2GEFA 4DUGD 1PZEA 2PD4A 1J8DA 3DKKA 3TPCA 5AXAA 2LTAA 4LYEA 1XMIA 4MMXB 3KSMA 5AW1A 4FDLA 5I4CA 3AHFA 3NHAA 1KEWA 1V11B 3OUZA 1AKUA 4IIUA 4JIGA 3RS8A 3LDHA 2XYHA 1T2DA 3V4LA 5TE9A 3FX2A 3EFEA 4LVNA 5JD3A 1F38A 3IJ5A 4CM4A 4DLBA 4KOEC 4ITVA 4AZ3A 2ACKA 1DAFA 2JJMA 3AF5A 1NVVR 2V5AA 2ZRNA 1O58A 4BQRA 3U49A 3V4FA 2QORA 5J58A 1LH0A 1JKXA 1PTJA 2GN4A 4MQ5A 4C03A 2KX7A 3PQ8A 1YAJA 3KVRA 5TR9A 1XO1A 4XD7D 1FJXA 2XBMA 2P0AA 1HC7A 5IKOA 3EK2A 1XVVA 4L9AA 2VRCD 4L4RA 5C1PA 5JYEA 5A02A 1CUFA 3GJ3A 3H2KA 5GAJA 1JRLA 4E31A 4IF4A 4IDNA 5DU2A 4G4IA 1CZKA 1NQ5A 4MUXA 3D8TA 3FPLA 3FZGA 2QUKA 2ZKLA 4Q9HA 4CU2A 4CEJB 2IS1A 4ICIA 1D4FA 3IKTA 2NXCA 3PHJA 4NBUA 2I1QA 1N6PA 3SS7X 2V97A 1ATIA 2YJTD 2XCTB 5JNLA 3FCCA 5E2AA 1DIBA 3AY3A 3I8SA 1SKAA 4IDGA 3B9QA 4UUPA 2OCAA 4D80A 1WCV1 3S1SA 3DQQA 1KDPA 1LSJA 2JASA 4O1IA 3T9DA 2PO7A 5AJXA 1NBOA 1Q2UA 5JVDF 3QELB 1NFFA 5H70A 2HMYB 1RXYA 4UATA 2VUTA 1VHLA 1QV9A 4PSKA 4XVHA 3AUYA 3H19A 4M7PA 3NBZC 1GNSA 4LQLA 5T6MA 1UKCA 2QQ5A 1ZH8A 3AJ9A 4DGQA 3EX7C 1N78A 2JBHA 4D7AA 2FPGA 2HJSA 1FY2A 3A1WA 3K0EA 5I9LA 4RCZA 4JI4B 3GRFA 2OCIA 5CB4B 1XKQA 4P38A 4EUEA 3KPVA 2BGKA 4I19A 5LOVA 1OXKB 1IONA 3DQZA 3ET4A 2QU7A 1J33A 1IY0A 2N75A 5K03A 2VZLA 4I6EA 3DPUA 4QUBA 2JI6A 3OFJA 3KQKA 1E4YA 3LW8A 4HN2A 5I7VA 5JZBA 3S8YA 3ESYA 4CQMD 3A9TA 3KJIA 3L7LA 2GETA 3K16A 3B52X 3BJEA 3DPIA 3KYCA 4IQGA 2MOKA 4H7PA 2XNKA 5CHEA 4OHVA 2MR6A 5BYBA 2VTKA 1MCZA 4RLFA 4EUKA 1HYEA 2J1LA 3DBHB 4PNEA 4G0VA 3K9BA 4GMHA 1SD5A 1VPLA 3HFSA 4R0NA 5CP8A 1Q14A 4OHBA 4GZ3A 4KN5A 2C7GA 2JGIA 1LQTA 3GRPA 4YRZA 5CG1A 1ABFA 4QOGA 1RHMA 5F51A 4FEAA 4DJTA 4BVEA 1YI1A 1SU4A 1GSIA 2V6GA 3I53A 3WLOA 4HLQB 5LZ5A 1RKUA 3OTWA 4RANA 4UM9B 1B16A 3EZXA 3M6FA 5EQFA 3TBHA 3DF9A 1V6CA 4D5GA 1FW8A 3ADPA 7REQB 4UARA 2A9VA 4D9BA 4ZU1X 3T7IA 1I6KA 2VK1A 3A10A 4OFWA 2VF2A 2V1XA 4R7GA 4RPIA 5CA0A 3RJZA 4DTIA 4DCNA 2VPZA 1TF7A 3E3LA 3V4SA 4CQMA 4NCHA 3SC2A 3GDGA 4PM4A 1J5EB 1CQJA 1J1UA 4CEHA 1JLLA 1RE0A 1ADBA 1ZYUA 5PNTA 2LDBA 3A2KA 5EE9A 4B76A 4BO9A 2J9RA 1M7GA 1AXGA 4Z2YA 1PW5A 3OM9A 1Z4JA 3IIKA 3QP9A 1G6KA 4PPQA 4GXNA 4TQUS 3T3MB 1WXFA 2VPQA 3PFNA 3UKJA 3V8VA 3J80A 1K97A 3GJSA 4OV6B 2AOVA 4GGOA 4XOUA 3ZE6A 3PEFA 4JA0A 5AVSA 1SKQA 2EP8A 1HFJA 1W4ZA 3PGVA 1FX0A 5JS1A 2HUNA 4H4CA 5C8YB 1SBNE 3P5SA 4BQPA 1XOIA 4FR2A 1ESDA 1S3GA 1SVIA 3WV4A 4MVJD 1QFYA 2PZMA 1NM5C 4NYMR 4UM9D 2TECE 4YNBA 5T57A 1CVRA 1KKLA 3HMQA 4KO4S 1U9IA 4QNNA 2IZ5A 2XT6A 3ZDCA 4R3UC 4WMLA 3KPUA 4H15A 4XPIA 1XEWX 3TL3A 1OWNA 4KFUA 2B78A 1Z33A 1J20A 1Y8QA 1JG4A 2W4QA 2Z58A 4F5ZA 1XRMA 1A2KC 2XWPA 4PLPA 4TL7A 5LNK6 3LXMA 3IV9A 4FM9A 2ZJ6A 3IURA 4EH1A 1RM3A 2O2CA 2LNDA 3AF3A 3H9GA 3NVAA 1RKXA 5A6SB 5JCOC 1Y7TA 3H4MA 3CB4A 4ONEA 4WKGA 4ZZ0A 2BF7A 3NC0C 3AW9A 3C3BA 2AR7A 4PQFA 3TLGB 1I6LA 2OQRA 3VC3A 2AC7A 2FVYA 5L51A 1NVWQ 1I7LA 4JBXA 2GZRA 2ZQYA 3CJQA 3LDUA 3A9RA 2IDMA 1C2TA 2H59A 2WUEA 1HT1E 4HYYA 3EPKA 4GZLA 1X74A 3H9CA 4UFPA 4K3UA 2R1TA 4KREA 1GCAA 4OL0A 1THGA 1KAHA 3ADKA 2C07A 3MUFA 5U4XA 2YOHA 3VNBA 2CL7X 4DIMA 2B1JA 5C4IA 4DB4A 2G8LA 2NO4A 4UU1A 2KYRA 1IPFA 1IBRA 5BW4A 5CB4F 2AQIA 2LP4Y 2OG2A 2W6OA 4PG4A 5D85A 2JPDA 3DO6A 3MSCA 2WQ7A 5K2MA 3KYCB 1DDIA 1YU9A 2GZ3A 4R7ZA 2D0PB 3PVCA 1CUCA 1C1XA 2I4TA 2P9JA 2XB6A 2ZT7A 3QVTA 4NYJR 1VBFA 4P53A 4PC2A 4XIJA 4NWIA 5FX2A 5HOEA 1J4AA 2GWRA 4ZZ1A 3KOMA 3VX4A 1JIVA 2GBGA 1U0HC 1I0ZA 2P9CA 3E2MA 4IJVA 4TYQA 1TKCA 1LDBA 1X92A 4MPTA 3QYJA 4JOSA 1NBWB 6Q21A 4IMIB 4OXKA 3T9EA 4ID3A 4P32A 4BO1A 1COZA 4IDHA 4FBMA 3L9WA 3L4KA 1ECFA 3GO4A 4ZOLF 5FLEX 1A9SA 1XB2A 4D9NA 5HBRA 4PAGA 3KZ1E 3GUYA 3K0CA 3OURA 1ACLA 3HVJA 4LRXA 4O5AA 1Y7IA 2BUAA 4JV5B 2XKJE 4C4AA 1VG1A 1ZCAA 2XYVA 1F0YA 3EFOB 4XEUA 4OJMX 4EI2A 4XVUA 1HY3A 3NTVA 1YCGA 4L4XA 2GZAA 1TM1E 1LLFA 4LFCB 4MJ3A 3CVOA 1E94E 1G64A 3L84A 5E6RA 1R10A 2Y2VA 1W44A 2GEVA 3AX6A 3TSOA 3EEQA 3BTOA 1DBSA 3VDQA 5HR5A 4YCMA 3TB6A 1WUIS 2I9KA 4X97A 1CRPA 3DLTA 1ACMA 1L6RA 2PGLA 2WFAA 3TD9A 1CUSA 2NO6A 4LJ6A 4LZZA 2PU7A 4MPJA 2ONYA 3OOSA 1GTL1 2GD2A 1PYDA 4OO3A 2I29A 2YJ5A 4FFDA 4M46A 4P3YA 2I33A 4PX3A 3NYWA 3CNQS 3PWSA 2WUFA 5FULA 1K63A 4LKRA 4DGSA 1P6UA 5EZSA 4IZ6A 4EOGA 3BD6A 2DXIA 1VA5A 3KD2A 4KYUA 2BEKA 1T1GA 1UMBB 2QM8A 3WSVA 5JIBA 4IVRA 3WNQA 4WCDA 3SMVA 2RCNA 4IZHA 3K9FC 1KEPA 1R9GA 1Z4OA 5LPNA 3LQFA 1K7CA 3FF1A 4KQ6A 4M53A 1KOLA 4ZOCA 4DQVA 5KAPA 4RVDA 1AQJA 5IJWA 3OTHA 2YRFA 2XUAA 2BC9A 2B1QA 2OBFA 4M0CA 4EUHA 4AF6A 3KKEA 1R8XA 1VP3A 3EXHA 4PY2A 1QU3A 2XADA 3WHLA 1AS2A 4CR7A 4EKEA 2WMOB 3VDMA 2ZRDA 1E2FA 5KWSA 4D02A 4JQSA 2JGEA 2FR8C 1TEXA 2ES4A 2GPAA 1YRHA 2WF8A 3RUCA 4P3PA 3WXBA 1X7XA 2XUGA 1NXPA 2I67A 3BX1A 3NRCA 4AJEA 4ARZB 4CMIA 5IZCA 5K4GA 3OAAD 3T3HA 2XQFA 4R2MA 4KN6A 4E88A 2IZZA 3QOWA 4DHEA 4JEUA 3FN4A 3OZBA 1ZCJA 2ILVA 2NN3C 1JQKA 1H2EA 1PJTA 1GPDG 4G0XA 4B2LA 3ZD7A 3JV7A 3C3WA 4EP1A 3NASA 3CPEA 1ITZA 1G5FA 1NQOA 4WCVA 2H3EA 2Q3DA 2NTVA 3G2MA 4Q3LA 3VR6D 3CT4A 4B35A 3ZCVA 1UOEA 2CNOA 2OC9A 4KIJA 3HCDA 3QNWA 4MIEA 4EW1A 3O4FA 3CVJA 1QRSA 2I3GA 1EB8A 4KQWA 3P0EA 3FYDA 4EG8A 4PAQA 3PFHA 1QHXA 4GGMX 4JS0A 3MT8A 4MW9A 4B6PA 4EFKA 2QMEA 2BFDA 5HM6A 2O0KA 2ERCA 1K6EA 3EZ2A 4LVCA 2WU1A 4RDHA 4D4KA 5BNZA 5K8TA 1KQGA 4ALMA 5SYAA 2WM2A 2Q1SA 5LFAA 1E60A 2BHRA 3VR2A 3KSZO 5BSFA 2NO0A 1EK0A 3N75A 5KVSA 1J70A 3OX1A 4DNPA 4X64B 1Z0AA 3LSYA 4A2CA 2CV0A 3J7AC 2MDTA 1WVIA 2YZ2A 2OWDA 6ADHA 1SZPA 4YA6A 2AK2A 3UATA 4IKPA 1A7KA 1NJFA 1Y63A 3I42A 4YCLA 1D6JA 3OCCA 3WKAA 3UEOA 4Z9BA 4RENA 2RGCA 3C3DA 4FGKA 2QTVB 4A16A 2BGNA 3E35A 4RNDB 1GNTA 4JLOA 4KXFB 1KSFX 3V8NA 2R0QC 3OJ0A 2HH9A 2O0JA 4H7IA 4KW7A 3OUTA 3LPDA 4C76A 5DYGA 2VSFA 3AFIA 3BGWA 2BFCB 1RCTE 2JLQA 4CDNA 3LD9A 1F8XA 2MT9A 3LCCA 1X0VA 3OX4A 4HP8A 4YS6A 3NHWA 1POWA 4FHGA 2H48A 1NN3A 2EWMA 3OT5A 3O8QB 2AW5A 4OHPA 4YJGB 3N6XA 3SXUB 3VU9B 3QY9A 2CLEB 1V8FA 3MWEA 5D3MA 3I23A 3RU3A 3RVKA 4GYJA 3WQRA 2OBXA 2NUPA 1UJ4A 4RQUA 2Q2QA 2QTAA 3CH6A 3C1UA 4ER7A 5CVCA 4DANA 4PZZA 2IPAB 4REQA 2VC2B 3PUIA 3DKIA 4GPAA 4K9LA 4JLDA 4FE3A 2N47A 4EF4A 1V2GA 2QI9C 1ADGA 1TX4B 3WNZA 1TT5A 1L7AA 1X1SA 2YCLA 1JQ3A 1NVBA 1PDWA 1ZVJA 4I4TB 5JC1A 2EYQA 3DXZA 5F2NA 2DBVO 3ZE0B 2QX6A 3PC8C 4QL3A 2OBLA 5BSKA 2CDBA 4RVHA 5KJEA 1S7CA 3JAKA 1H2WA 4HQ6A 4N54A 1NR5A 1KO4A 4FFMA 3WGVA 3ACDA 2XZPA 4BLTA 5J2UB 4DR2B 1VJCA 2A59A 3GJXC 1MGPA 4M1QA 5HE9A 3RANA 1QNLA 4JB8A 1GA6A 2BEUA 4W8HA 2RD2A 3CVYA 3MD0A 2PS9A 4BLUA 4ZDWA 2EERA 2VWQA 5JDIC 3JQ6A 3U5TA 3FHCB 1VFNA 1R64A 2MJLA 4Y2VA 5FFMA 4BNLA 1BG6A 4E5UA 5FBVB 2R7LA 1QGUA 3HVHA 3RFXA 3T5DA 1HWYA 1ZD9A 2H65A 1EMDA 4AKHA 3CIOA 3KB8A 1D7AA 3M9LA 2IZ6A 1K4YA 1LBEA 4C14A 4CT0A 4UMVA 1NE2A 3EHEA 4EB3A 3MJCA 4BJ1A 1MJHA 5FI1B 1W5SA 1UAYA 1E0KA 3GW8A 3OHSX 1X2EA 5KINB 1SOVA 3NC4A 4HGQA 3FYTA 4QULA 4F5DA 4F1WA 2IX9A 4X8MA 1OBOA 1VLQA 3T9AA 2J5RA 1J5XA 4OI1A 4B81A 3EQZA 2QAGC 1L7DA 1ETHA 3ZLVA 4AWXA 5EQTA 4B87A 3PX7A 5B1EA 1KFBB 3CX3A 1B73A 1HQCA 1UBUS 2J5XA 4OQDA 1ZY2A 5TARA 1YQWA 2H31A 5I7RA 1MP0A 1UZUA 4ERXA 4US1R 1V6AA 4WZBA 1MABA 1RKBA 3U61B 1RJFA 3IT1A 3WFJA 4V3BA 4D43A 1JI3A 3EQ8A 4ZVQA 3ILXA 1Y4UA 2YJ4A 5ADUS 4B3DA 3VISA 4ZYLA 1JE1A 4IJ5A 4HD8A 4W8GA 3QMPA 4Q1VA 5AHKA 1CVLA 2TMGA 1XDDA 3SZMA 3LHKA 1HA3A 2JLXA 2RGYA 1RABA 3EBPA 4DJEC 1V25A 1G3UA 2Q50A 1D6NA 1YDEA 2RGNA 2R62A 3I9MA 4KBYA 2B3TA 4AZ0B 1E9BA 4DT1B 3ILYA 5TT0A 2WU4A 2ZRJA 4P4GA 4DLTA 3JTMA 4NESA 5LBUA 5JAMA 1SKYB 4L76A 5LKAA 4GX1A 2BP7B 3HI6A 2DCUA 1E9DA 1WS6A 4CODB 4TLDA 2HGSA 1G4AE 3GFOA 3GDFA 3KL2A 4NI5A 4NV3A 4PTLA 4G5OA 1AMOA 5IRCD 3K71B 3ZGZA 4RXUA 3RK1A 1QAOA 3FFBA 3VR5H 2YZMA 5K0TA 8ATCA 2JZOA 1F2TB 1XDUA 2AG8A 2REQB 2EXXA 2WRZA 1MX1A 3G0DA 1KRWA 1A8PA 4OHRA 6REQB 1ZPDA 3OE5A 4L73A 3F90A 5KSOA 3KEFA 5ER6A 3H5WA 4FOSA 1E4VA 1XV5A 3NVDA 5AKZA 4G84A 1IBMB 4XEHA 1DLJA 1R5JA 2ATEA 2WZQA 1M9NA 4OH1A 4OK3A 4G2NA 4R1OA 1ULTA 4C21A 2G1PA 1S2DA 1SEPA 2Z30A 3OJEA 3IXQA 1A69A 2VDQB 3P5BA 4B7ZA 1DOHA 1PNQA 3QKSA 1T10A 1T3GA 2AFHB 3Q1KA 1WEHA 4IFIA 4CBVA 1FJGB 1IIRA 1BC5A 2NTEA 2QIPA 1MAAA 4IOMA 3UB2A 1EDZA 4YBZA 5ES4B 1FU7A 5CA0F 4LBYA 2NVOA 4QUHA 5AI5A 3TZLA 3F67A 1Q57A 1UC4B 1RYNA 3LWDA 4RJ2A 5C7YA 1ZLYA 3G6WA 4I0WB 2IV3A 2IXGA 1ZVVA 1RM4A 2C4WA 1SUDA 4E5DA 4O08A 4XUDA 3LUPA 4BFCA 3GD5A 2A0UA 4DL9A 4Y30A 1YE8A 1C9DB 1H42A 2J0UB 2C4KA 2H8KA 4G9GA 4URHA 4DABA 1H3FA 1QM5A 1ZIDA 5TV2A 1ZUNB 2QENA 1WUJS 5HQ3A 3KKKA 2R79A 2VFAA 3DEIA 1MO6A 5BSRA 5IKXA 5AD1A 2QW8A 3V32A 2WAAA 2ZUSA 3AEQA 4OL9A 2TRSB 2OOSA 1JHDA 4BASA 1E7SA 3IKJA 1Y1PA 1YZVA 2F7SA 1ZNXA 3JYLA 2R86A 1W5AA 3EARA 2DFPA 2ZSJA 3CF0A 4WASA 2XXJA 1T4GA 3CF2A 3QPAA 5B3LA 3IR5A 1C8BA 2VUSA 3OJOA 1Y48E 4OAOA 1R6TA 2PRZA 2G1KA 1HE4A 3PJFA 5FBWB 3VJLA 3WMFA 4ZI7A 1EH5A 3BXPA 2QUAA 3MPUA 4D98A 3OCZA 3ER8A 4D9MA 3QVGA 1EX6A 1R3DA 3PYMA 1M34A 4KDCA 4W7HA 1SURA 3VKVA 2IE0A 2G63A 5EI5A 3PEWA 3F6BX 2RH5A 3IVAA 1CZLA 1A96A 3QWBA 4FW9A 4PU0A 1OYVA 1CK4A 2B4TO 3GB9A 4PBTA 3CUEF 5KDOA 2NNLD 3UW1A 3NANA 4F45A 3WLKX 2VATA 2ZYWX 1DX6A 4L5CA 1ZD8A 3AVTA 2G0AA 3BRWA 1B7GO 4X3CA 2DECA 3QTTA 2QUBA 4OLJA 2ZPTX 3Q11A 1TAQA 3B20A 3OC0A 1C8VB 3M6IA 1LSSA 1OLUA 2B8WA 3EGVA 2W71A 3ZD9A 5JSUA 1R3UA 3EUWA 2OZLA 4OHFA 4OFZA 2BELA 5K6RA 3UJNA 4LF7B 5SZJA 4AICA 1E3QA 4JYCA 2D7JA 4LJ4A 5D5QA 1DEHA 2JGFA 3CH5A 5BOVA 2RHMA 4JX8A 2HRRA 4JBYA 1C3LA 5LP6A 3BJIC 3F4KA 1L7OA 1O5IA 3GMSA 1N5KA 4I5GA 4Z4EA 1QU2A 1Z25A 3E0QA 2GEBA 2X41A 4CWAA 1V8ZA 1I94B 3R0ZA 4DJAA 2ZOSA 3BFKA 2JFWA 3DAYA 3TFQA 1QH1A 1D2EA 1JTVA 4AYTA 5FOWA 2YH2A 3GLUA 1U7TA 3BRWD 4WINA 4KQJA 4OXRA 3FPSA 4DV0B 1E5QA 2JVJA 1LDMA 2UUOA 3OZAA 2PH1A 1NHWA 1Q7TA 5FPYA 2GA8A 4EEKA 1WMSA 3OG9A 3EFOA 5HBGA 2X5JO 4O4JA 4U7GA 1JR6A 4M37A 2MIIA 3AU8A 4ES6A 2IBTA 2CVOA 2X0NA 3MFYA 4C3VA 3O7MA 4K1LA 3T1VA 4UVGA 3T5BA 4C6TA 1J1ZA 2O8VA 3IHWA 4ZDKA 2CW5A 3AP2A 1WDLA 4Z9AA 1T6YA 2H54A 4KPFC 2O2EA 3ENZA 4ARUA 1O9GA 1UP7A 1LI5A 2P9ZA 1BTOA 3HUFA 3R3VA 4H6VA 4MCAA 3ER6A 1GGKA 3TW6A 3ZDYB 3NIBA 4HDOB 5BURA 1QF7A 2CEAA 3ANNA 3IMFA 4TS9A 4W9NC 4G8BA 1PI3A 2IEYA 3IT0A 1RWBA 1XA3A 4HDRA 4PG6A 4WI1A 1KZ7B 1WSWA 1ZUHA 2Y1WA 4LKOA 1Y7LA 3KSRA 2FWAA 2FZEA 2WAXA 5JPIA 5CDGA 2RHOA 1O94C 4OXNA 4URVR 3RSZA 5B6JA 2XWSA 3FVVA 4KR0A 4ZGWA 4LJ7A 1C3OB 2PMDA 1C1YA 3MC1A 2Z9DA 1G2QA 3HVIA 4YMTA 5FFNA 1MO4A 1YJQA 3X1YA 2FPPB 1HSZA 2TMDA 5EWLA 5EYPB 3TIFA 4B0OA 1S2IA 5TMPA 1P2DA 2D1YA 4QQRA 4YREA 3SSNA 3BJZA 3GLVA 4HQFA 2FN9A 5LP6C 4MYDA 3T6KA 1GPBA 4CU5A 1FUEA 1XZAA 1YUNA 3DW3X 4RTMA 2YW2A 4G1CA 4FYXA 1QOQB 1R00A 1VL6A 5CW2A 3KL4A 3LBHA 1Z7BA 4PZ9A 3IJRA 2HBQA 2WWFA 4II7A 4NCIA 3REQB 5ALFA 1NNI1 2EZUA 2OQIA 3EQ7A 3ABOB 3VPHA 3IE0A 2ADMA 5IDYA 1I24A 1L4BA 4S24A 1ZJ6A 3BMXA 3S2YA 2VRBA 4XM2A 5D51S 3T7RA 4MKGA 4NPCA 5CJPA 5T3UA 4BUJA 4BCBA 1NTOA 3F9IA 1ULHA 5K7SA 5DBEX 1X7ZB 3D6MA 2FZGA 3UHAA 2JC3A 4MZXA 4GHWA 3S2EA 2CVPA 1OAOA 1VPWA 1CERA 1GKUB 1UFQA 2IZOA 3HEAA 3DD5A 5H4GA 1HT0A 3RS0A 4UNNA 5JSHA 3TVTA 4F8EA 5MN6A 2XUPA 3ADBA 1GTMA 2OV6A 2IYZA 4HLUA 3UT6A 4ALNA 1NQWA 5K0GA 3TIGA 4S0XA 4DC0A 2ALJA 4YFYA 4MICA 4CTJA 1KC3A 4MHTA 4EPWA 5DK6A 2H1CA 1RHQA 3KVOA 4CEIA 1KDTA 2ZW9A 3AM1A 5AKHA 1ADCA 4BQNA 3LO8A 1L4LA 2WIAA 3GNSA 1NZJA 1Y98A 1WETA 5C8YA 1CY8A 1H5UA 1NT4A 3RC1A 1H2XA 2Q46A 1ZW1A 4H7HA 4KIGA 4DEXA 5AKLA 2FVXA 4DBLE 1RBQA 2I54A 3AUJB 4DLKA 1SB8A 2Z2JA 3IVCA 1F2DA 3ADOA 3C39A 3KC2A 4N0DA 2JL1A 3PX3A 1NSYA 1DIHA 1LVHA 1QK3A 3KWLA 3WWOA 1SHLA 3IAFA 3IV7A 5BPHA 4L50A 3LRTA 2J6CA 1A76A 2C82A 3I9LA 1B4DA 2IU4A 4JWKA 3WLPA 4COKA 2HYIC 5AK6A 5A9SB 2CXQA 1JNXX 2EYUA 5IG2A 1CNEA 1WQ3A 3M1YA 3TRJA 2GHIA 1UBNA 5KUTA 3GRKA 1H8HD 4UASA 4R6XA 2CJPA 5JO9A 4JP1A 4GOND 4QDKA 3CWQA 3CEAA 4ZVTA 2DT5A 1JDNA 2V7XA 3AR2A 2A3NA 3Q5EA 3R0QA 4C2TA 1ULZA 3IODA 1LRJA 2V7GA 5BN4A 2AUTA 2I87A 5FV4A 1EFKA 1RYYA 2POCA 3TAHA 4O2AF 4DR1B 3OJLA 1H93A 1XD9A 3T38A 2F1OA 1NV9A 3ZR4B 3ZY4A 3KPJA 2VO1A 3DDSA 3ZHRA 1AKVA 3CVWA 3F5FA 4W1PA 2JJQA 5E9JA 5EKUA 1JU4A 1I7NA 3BWYA 3RHFA 4RD6A 1YJCA 2FZLA 4ROSA 1FA9A 4WA7A 4XSVA 4GOKA 3WK4A 1IRIA 4F97A 2NT3A 4ABTA 1SIBE 1U0EA 5IJZA 1A9ZA 1Q15A 1JT9A 3QVSA 3P9CA 4HXGA 1KVRA 3M3HA 4CNBA 3OU6A 1NT2A 1TI7A 5FA6A 3UICA 3K70B 1QFZA 3EZLA 2X8JB 4L8LA 2RG7A 2GM4A 3CNNA 3H42B 3HZZA 1RZUA 1RNLA 3MWYW 5EUBA 4ZU6X 4HLNA 5ALSA 3AHGA 4PS1A 1V6SA 2C0PA 5CYOA 5KS2A 5IM4A 4PSUA 4EBBA 3DXYA 5CB4A 1QS0A 1GEEA 2NM0A 1XXLA 1NBHA 3GFTA 4IDAA 3K70C 3C7CB 1I2CA 2I78A 2P5SA 3FNHA 4YCNA 1SR8A 1OA0A 1CF4A 1WW3A 1AS3A 4M8SA 3HXMA 2VCEA 1GAWA 4ANFA 2OEPA 1N2OA 1XU9A 3JWIA 5ENVA 1Z6XA 5EUQB 3W5DA 1A1VA 1L5OA 3NIFB 2EQAA 1H9AA 2PUHA 2WUDA 3RS9A 3ZDEA 2EATA 1U1FA 3E4CA 1U7WA 1CUGA 5EWMA 1AV6A 5L3SA 4D0GA 4BO4A 4F85A 1F8FA 4DQKA 5E3IA 5REQA 2IKQA 3F5SA 2C3PA 4CLOB 4A0SA 2RIRA 1B8NA 3GJ6A 4RY0A 4DM3A 1GILA 3MLEA 2NU8A 5MN5A 2AZ4A 1HNWB 1EGQA 4LW8A 3ZDZB 1QLJA 2JBAA 4L4UA 3RUEA 5F52A 4DV2B 3WFZA 2GS9A 4FB5A 4JJFA 4RZUA 4C22A 4D5EA 3KXLA 1Q0SA 4XIIA 3UHOA 6GPBA 1CJUC 3PRHA 1Q95A 1Z0KA 4UXIA 5D1HA 3ZDQA 3CH4B 4UBKA 1QONA 3AF1A 3D8HA 5B1SA 2FSVC 4XM0A 5ALLA 5M5BA 2E2WA 1J09A 5EEGA 4EJ6A 2JD0A 4OQQA 3AWDA 3QX7A 4H7JA 1AH2A 1IQRA 3MTBA 2VQ3A 3TYXA 3KWFA 4UAJA 4AZ3B 1U90A 3LPNA 3K15A 3MAJA 4CTKA 1SCBA 2J3DA 4QVIA 3MS2A 5TQ0B 2FRDA 1D1PA 3ENVA 1RQLA 2ZIFA 4OP3A 2JHFA 1OQAA 4M0DA 4D57A 2YYSA 4M54A 1QQTA 2FKNA 5AW7A 4HXEB 1XE3A 1XZNA 2EBUA 4DDHA 3U1VA 1B23P 3Q7QA 4WNCA 1T9DA 2JW5A 1XTIA 3CNLA 3Q5DA 5JXJA 1FDOA 2GXSA 4TWJA 2WD7A 2FW9A 1YZ3A 4MWGA 1VTKA 3PHBE 1FNBA 1GLVA 1NR7A 3NALA 1J90A 1X1CA 3H87A 3CEPB 4PLZA 4YT5A 5K8VA 2C61A 1E1QD 3ND5A 3UWOA 5HZKA 1LDGA 1KHTA 2Q3MA 1J7JA 3DWFA 2GAJA 3D6JA 4WDQA 3T7SA 5JFGA 4UCFA 1OIXA 1HYQA 4MW7A 4BN5A 1K8YB 2R6ZA 4NCBA 3DNFA 3VR4A 2FUEA 3BMCB 3NETA 4GVXA 3IALA 4L2IB 5A5FA 5ITZB 5TQVA 4A5SA 4QGSA 2P9BA 3H8VA 2DFVA 2WZDA 2GYVA 3BCSA 3LMKA 4NZ9A 4ZCLA 4UNRA 5KTYA 3KJGA 3H3XA 2P2DA 1DKUA 4TV8A 1OTXA 3QHPA 2NV2B 2A9RA 4LWQA 4UTOA 5GWXA 4DSOA 4AJJA 5JS8A 5LD2B 1YA6A 5HIKA 4U63A 3IMKA 4XX0B 3NEPX 3FXAA 4TKZA 2VTVA 3AVUA 2BMAA 5IKEA 1ND5A 5HTKA 5EGNA 3VOAA 3BXXA 3EEBA 4OPMA 4XYMA 1N34B 3AIMA 4FGLA 2PGDA 3FNGA 3WB2A 3ZWKA 1M1ZA 1DCMA 3GLQA 3IQFA 3CLUC 3TSWA 2M9MA 3SBXA 4OLFA 3PNLA 3NM5A 1ZNQO 1HFWA 2J67A 1ESNA 4FK8A 2ATCA 2AOUB 4NU5A 3NX4A 3G02A 3TLJA 2ZBQA 2ZU0C 3VUFA 4KQ9A 4AG3A 5T6BA 4AL4A 1NONA 1AHNA 2VNJA 4UZSA 4QE3A 3K53A 1YI8A 1OHHD 3LYAA 3FBTA 2WMDA 1C9MA 1MEJA 1SK9A 5G40A 1Q1NA 3VHQA 3O94A 4YV0A 5IULC 1VKOA 2ZJ4A 3DVLA 3PHIA 5LCXA 3N9IA 4YAEA 3K0AB 3AKCA 2H6EA 4LTMA 2OK7A 3GEMA 1MB4A 1J0BA 4CIAA 5IUNC 4KEAA 1SIUA 3P32A 5DI3A 3VOSA 5K3FB 1K4MA 2NV6A 1DTWA 4MUGA 4Q18A 16PKA 2Q6OA 4E3ZA 1H6AA 2PCJA 2M6LA 3FI9A 3K1JA 3LOPA 3OPVA 3LP8A 1ZSVA 2H4FA 1T6XA 1EYZA 1K5GA 3NHUA 3PD7A 5C2JB 3FMIA 2OBNA 3N6RA 5ALQA 1ZOPA 2FKAA 2BWJA 2IS2A 1QV6A 1JKJB 2X58A 2O20A 2GQ0A 1BU5A 4BGVA 1FXWA 1H1LB 3IPRA 2EW8A 5KVAA 1J0XO 1FDIA 4FU0A 4NS4A 4Q5IA 2QTHA 4K6CA 2A5JA 1TNDA 3M6LA 3D02A 2P7HA 5F9HA 3KLMX 4WBNA 3E9NA 1M34E 3A3YA 1I3LA 3FAKA 2F8MA 3T3EA 1FFYA 4R5HA 3L7IA 2JCGA 3P2KA 4K9OA 2LW7A 3CNEA 2O54A 1R0XA 4DILA 5JZVA 2Y1DA 4LAFA 2GJ4A 3RI3A 4PSCA 1IVSA 1W36C 1IZ0A 1US8A 2HN9A 1GU1A 2P6PA 4M98A 4KYTA 4RAQA 1ONSA 2VSNA 3GLTA 3N28A 5EERA 4B40A 1VHTA 3ABRB 1R6UA 3DUWA 2G77B 1L5MA 4EYGA 1HORA 4MQ6A 2PQ0A 1FYFA 3AI2A 1GNQA 3G9QA 1YBVA 2UXBB 4J2OA 3MINB 3O47A 4LHVA 4Q6BA 4FOPA 3A0RB 1C30B 1EVLA 3ZWYA 2W43A 3GFFA 4KXVA 1GEGA 4IEIA 1SIOA 4G1EB 4X54A 2Q5HA 1FFGA 4R1UA 4MPPA 2VQEB 2AI2A 3SXJA 3Q7PA 5GMOA 2JJ2A 1BX0A 1JSLA 3H9EO 3K9NA 3Q15C 1PUIA 3E9QA 1UXIA 4GG1A 4PFSA 4S1PA 4XIFA 1X1TA 4TMKA 5EIAA 2F9MA 3TECE 4OQMA 3FDFA 4QDUA 1Z2PX 4IQ4A 3HLTA 3E8SA 3PIIA 1N3BA 1CQZA 2WNHA 3BGOS 5CDTA 4WEQA 4D74A 3JALB 5E7QA 1GZ5A 1EJ0A 1GTG1 1XQWA 3BMOB 5FKJA 5IABA 1KO5A 4BRSA 4G3XA 1JZQA 4YRBA 4N7RA 2I2DA 3EGDB 3CUTA 5LYYA 2E1PA 2BPOA 3W6PA 2HADA 5G41A 1HR0B 3NHLA 1N5LA 4EJSB 3BEOA 5ALWA 3S29A 3HH8A 1TAGA 4YRFA 4MI6A 3WYEA 1QP4A 5KO2A 4JB3A 5JFOA 1A5ZA 2Z1MA 2WILA 4F6LA 4CTNA 2QM3A 5A5DA 5JS2A 4XVCA 1E3JA 2PLFA 1M2HA 3WLSA 2O0HA 4MQLA 2XCIA 4BN4A 2QYSA 3HU3A 2WVAA 4Q6WA 4DW8A 1SBYA 1ZRSA 2DJIA 1HQDA 1HT3A 2I80A 2JJ2D 1HOTA 2NQTA 2O2IA 1Y8RA 3DEHA 3E3AA 4OTZA 1SUAA 3ZWPA 1BOOA 4U2GA 1XTRA 1KJIA 2WHPB 3SR3A 1YU6A 4EPTA 2IHZA 1K7EB 1S7GA 2ZXEA 3NLLA 4TLCA 1FFXB 1C3VA 3M70A 5LP6B 4JI2B 4TTIA 1M76A 1NI4B 4MLDA 1EXDA 4Q47A 2GCEA 4RSGA 4RM2A 5E1DA 1PF7E 1NJ2A 4W82A 2O59A 2J5QA 3AUAA 1GTRA 4HTFA 1HMPA 4MZDA 5FWDA 4EEXA 1PYOA 4WESB 3TQHA 1SHUX 3EZ7A 1KO1A 3JQ8B 4KR9A 4KMRA 3A9VA 1VDZA 5F2OA 3LL7A 3OTGA 3S81A 1YR3A 4QEKA 1FRNA 4OREX 3BCRA 1U98A 2XRYA 3DEAA 4Q4AB 1XFDA 3CCCA 2QRUA 3DAHA 3GVXA 3OKCA 2CLLB 4RC9A 3RAJA 1T2NA 3BMQB 4FNOA 4KXXA 2XLCA 5AKGA 3IIIA 2ANCA 2VHYA 2OECA 1DO8A 4HT3B 3D3WA 3GARA 4NCNA 3UAVA 3UK1A 1IOWA 3IUPA 2AZDA 2JGMA 3WK7A 4ZTZB 4L5IA 5FPHA 2BSQA 3OCUA 3MFQA 1FPQA 1NUHA 3NGXA 3HZHA 4S35A 2F1KA 2GVDC 3WKEA 3H7IA 4C4ZA 4BX3A 2GK3A 3WZ2A 4ZT4A 4R69A 4OB7A 3E2PA 2R85A 2XXBA 2NXJA 1YXMA 2XQJA 2IXDA 3BRSA 2ROQA 4A8PA 3LX8A 3NS7A 4EY4A 4DBVO 2FPKA 5A4MS 3ZHOA 1W4RA 2OKGA 1A72A 1Z74A 2BF4A 2HF8A 1DFGA 3I28A 3MN1A 4I3FA 4IJWA 3LUKA 3RC8A 4B0PA 2PYIA 4AD8A 1WSBA 3PXAA 1XTBA 3DCYA 3IB3A 3UA3A 1I4LD 4MWZA 1J2RA 4WQMA 1QQAA 3SSOA 1XPRA 5FTKA 2GGSA 3C5VA 5KYWB 4V1CA 1SVOA 1TZMA 3P96A 5ENZA 4LY6A 9LDBA 5ICGA 3DKRA 3EC1A 2JLVA 4CLRA 2EG9A 1WXXA 4UTXA 4Y8VA 3EXIA 3T8YA 4TRRA 1KI9A 1P9OA 3U3RA 3RWBA 3VMMA 3W8FA 1T5SA 2BJWA 3IP9A 3WHIA 1WBBA 3R6DA 2DBYA 3PIDA 4FI3C 4NCXA 4QTUB 2WJVA 2POQX 4RYLA 5CITA 1JYSA 1QGZA 4IIHA 1EVQA 4EG0A 3K3PA 4FMPA 4RMIA 4U02A 3U4DA 3N53A 4IOJA 2XZLA 4TTPA 2J4DA 4U7HA 1BXRB 4N5MA 1QH8A 5DHFA 4HNGA 1W88A 2IV7A 3ROFA 2CNBA 1W1IA 4EB6A 4QUGA 3O2QB 1HI9A 3KVVA 2PWBA 1GUZA 3RFCA 1OT5A 4CCYB 4EI9A 2EEZA 1DU4A 4FCCA 4YAIA 3EAQA 4D4JA 1OFTA 3QLUA 1VB3A 3NT4A 4J0JA 5CCDA 3V4PB 5B2EA 1KZ4A 3T3OA 5I9NA 4D9KA 3PT9A 3K4HA 2H7YA 2P8SA 2ZGVA 1YZFA 4TXJA 4GUAA 1DEKA 2VNSA 1KDVA 2X8AA 4HF7A 2CLMB 3SHVA 2F3RA 3WK8A 2JFYA 2P2LA 2Z2XA 1G8HA 2E4XA 1UKYA 4M89A 2D7DA 1OFGA 3D7KA 4Z7QB 1E2KA 3WWZA 4ZPXA 1H6CA 1E1DA 4Q4HB 4MQMA 4RMHA 2JAUA 1NUSA 2HNKA 4WW0A 1EP9A 4AYXA 1MU0A 3R5XA 4A7PA 1B0PA 1LU9A 3K1AB 3ZGXA 2J9YB 4XCVA 3QW4B 5DLYA 1OBHA 4J2TA 1M5RA 1JMYA 2YV4A 3R7WA 1T9KA 1JH8A 1OFUA 5FP0A 3E9DA 1LTHR 1OW3B 3IE1A 3EUEA 2IELA 2L69A 3A3KA 4CLDA 1TF5A 2C59A 4LX8A 1N3YA 2YUTA 4MYTA 1CZHA 2WJWA 2B5WA 3KWJA 1WB6A 3RK0A 3OMWA 1SRQA 2B4YA 3E8XA 5HILA 3EH1A 3TZQA 4MUNA 5E38A 4KQFA 3D3WB 3R0XA 1ZUD1 5FUVA 3MEQA 3SYTA 5E8JA 4IDFA 4DAEA 5KWVA 4BYMA 1TO6A 1DAPA 3E48A 3MERA 3AM5A 3DLCA 1J2EA 1GPMA 3AV0B 2CL5A 3BHJA 2D2EA 3GUCA 5DOVA 3MMXA 3CX6A 1JEYA 4XD7A 3R0IA 1VL1A 1NP7A 2CVQA 3EMKA 2P5TB 5EFOA 4PWZA 2VRCA 1X9HA 3DE4X 1IBCA 4WESA 1G2PA 5KIAA 2IYTA 1XRQA 3LLUA 4MW5A 4GFDA 4G4SO 2JIMA 3GJ7A 1GZ6A 1BCRB 2C9CA 2B5VA 3AO0B 3CEMA 1P7YA 3FFTA 4JVLA 2K5UA 3KKLA 4GS5A 4MKHA 1PN3A 4BNHA 4OUKX 5ILQA 3M89A 4YR9A 3HDJA 3HJBA 4B46A 1VLJA 3WL3A 1AA9A 2PT9A 2X5OA 3W34A 2V58A 2I9PA 3BJRA 3O6VA 3U60B 1Q1QA 1KO7A 3BBLA 4DDVA 3EJ6A 2YINC 4FBGA 5IDVA 3D4OA 5DM1A 3UNXA 2GXAA 5F7ZA 2PKWA 2QN7A 2BKEA 1SPBS 3HWRA 4HRVA 3GL9A 3ISTA 2X2PA 4M1MA 3TRHA 4W9RA 4F9EA 4DA8A 1NJ6A 1SBHA 2OWEA 4RKFA 4I46A 5JXGA 2VP4A 2C31A 2ZI3A 1V7ZA 4O02B 1VKHA 4J0QA 2P78A 3EGDA 1OKKD 1G9SA 1OYWA 3GMIA 1QG4A 2AMFA 3BJMA 1P1CA 4AFNA 4D99A 3LVBA 5DZSA 4ZDIA 5JV5A 1T36A 2FX5A 2QAIA 2YVUA 3JALA 4E1AA 1NW5A 3DCNA 4I9NA 5DGDA 1QPZA 2BFBB 4AJ9A 3VTFA 4IXMA 3RFTA 5KEIA 2UVQA 5ITWA 4RLHA 2IEIA 5AW0A 2AFVA 4BQFA 2ODBA 3TLKA 4F71A 5BV1A 4Y6PA 1F8UA 3AR6A 3U1BA 3U6KA 1KGDA 2C88A 3WOVA 2BE7A 3DDUA 4IRMA 3ZXUB 1QCCA 4BVGA 5K6AA 1XZQA 1J8YF 1Z4KA 3IPAA 5EJEA 3COJA 4YJ3F 4DE5A 3ANYB 1N8KA 2ZJBA 1C30A 2QEQA 2PPLA 2QTLA 4ASUD 4B43A 2EEPA 1N9KA 2WKWA 4AJIA 4C5AA 1L5QA 1GYPA 2H4JA 3DVRX 1IL0A 1A27A 3GLSA 3SVTA 1OKKA 3GMTA 2AN3A 3MM4A 3ESRA 3NJ4A 3O9ZA 2E4AA 4H7DA 4IDQA 1X70A 1GXSB 4JI0B 1MB3A 2OHIA 4PANA 3DJFA 3L2OB 4XVRA 1H1DA 4EHFA 1ODCA 2J3MA 4MS1A 4DWJA 3THXB 5BW8A 2B8TA 1O6GA 3KFVA 3WGTA 5M2QA 3EGCA 4PAMA 5DNWA 5A3SA 1WW8A 4PYLA 1A4RA 1LSUA 5FBRB 4ZEXA 4BCDA 2I6XA 4FT4A 3UHJA 1PR4A 4LTNA 1ECBA 4YMGA 4EW3A 1QFMA 4HWTA 3L0SA 3SWWA 3C1OA 4Y7DA 5IDQA 1RJEA 2WSMA 1YBFA 2G5GX 2DF8A 2LIPA 5DOZA 5JH7F 1L5VA 1TK2A 1XQ9A 5DXJA 3IIMA 4Z49A 2FH5B 4PIPA 3VPGA 2BMEA 4OF4A 3R2JA 4W6QA 5FUYA 3RHSA 2IH5A 3UAGA 4TM8A 3SEQA 3ESCA 3Q9SA 4OYHA 4I50A 4MVJA 5HJ7A 5IYZA 4RIHA 3EZGA 3HY4A 1QX3A 3L0IB 1Z5NA 3CMMA 1TF2A 4OQLA 2DR2A 1HURA 3I61A 1TOAA 3AVVA 4GSLA 2XE6A 3HA2A 3UXYA 2JAQA 1OXTA 5EJ8A 4WNAA 1ODSA 4O1MA 1HMYA 1HZJA 1UZNA 1JZTA 3DLIA 4QXAA 1PGOA 4PZ0A 1ZU5A 5L7YA 3WHPA 3WAKA 1Z6TA 2DJ5A 1EA7A 2XNDA 3NTLA 2EJWA 2R7MA 1PJ2A 2G06A 4D92A 4JK3A 1WD7A 1X1DA 3KKMA 5AI0A 5F7OA 3R0VA 3PEYA 3I1IA 5FPQA 1UF9A 3D43A 4DMRA 4Y2UA 3SZUA 2ZYGA 2RGAA 1BWQA 2XA9A 3WLFA 2ZWOA 1A3CA 3HM9A 1XCGB 1TYZA 1T9CA 2PTHA 4O3FA 2WJ6A 2ZPUA 1EFPB 3LM8A 1FXWF 4FDVA 4A6XA 4N41A 5B1IA 3VR4H 2GF2A 2DM6A 3ZIUA 1WHTB 1JPVA 1OC4A 2PZKA 2R5FA 1CPYA 2RK4A 2WWXA 3BD7A 3CZQA 3G23A 3U4IA 4PG7A 1O89A 1WZCA 3CF4G 3N1UA 1E3MA 2PUFA 4TM7A 4TLMB 3ZUPA 2WZBA 1ZM3A 2NTJA 3KLBA 5AW8A 3DFZA 3ORHA 4ZRDA 3GAAA 4DLZA 2PGJA 3JX9A 2ZUCA 3OA0A 5J5CA 4D8UA 4RTLA 1NPTO 3FB1A 4ZD6A 3GRYA 2PX0A 3QUSA 1ISHA 2XNDD 1LI7A 2O3SA 4E2WA 2V9CA 1BFUA 1YHZA 3HY6A 5G3ZA 4TZKA 1B3BA 5F7XA 1ENOA 4Z9YA 1JW9B 1IZZA 3WWCA 3ZHVA 4ZVSA 3IQGX 3TLZA 2Z5FA 3BMCA 1V3QE 1ZKMA 3NHPA 4GM4A 2WB4A 3PQ3A 1V1RA 2B8EA 1JR2A 3REGA 3W4IA 1O0CA 4DY4A 1P61B 2BFNA 2ZSHA 3UTDA 3WICA 3HCAA 3L06A 4UUMA 1K4KA 4NMLA 1WQ1R 4LOHA 5LKRA 1JMVA 1AV7A 1EBBA 2O3QA 2R00A 4QU0A 5K3EA 5D7BA 1JHQA 2ZANA 3X1ZA 3MRSA 4GOJA 5FR2A 2KBFA 3T3PB 2A2ZA 3BQ9A 3BK2A 2C2HA 3H1PA 3OE1A 1Y4DE 3WJAA 4Z3DA 3TI7A 4DV1B 2EVWX 3Q7RA 4MITA 4B7CA 1SKUA 1UEIA 4OQXA 2EHJA 4MYHA 1P0CA 5IT5A 3AL2A 5J4LA 2X5NA 3O8BA 5A7HA 3AUSA 4IGFA 4Y6GB 4GX5A 1JALA 4N5DA 3TKAA 2WJGA 4YIHA 3C8DA 5TQ0A 2HB6A 5B1DA 3TOVA 3HGMA 2ZBPA 1HYHA 1KVQA 4PVDA 4W6ZA 3GVPA 2ZVPX 4H1VA 3EUFA 1N2CA 4LN1A 2R47A 1PJQA 2BONA 4FIDA 4OA8A 4E12A 4AMUA 1Y6QA 3B5IA 2BMWA 2RI6A 1NNUA 2VHXA 4L0DA 4FQ7A 3SBEA 2QUJA 1Z4QA 2F64A 3R4VA 4N0QA 2VWPA 2JATA 3AQIA 3QU4A 3D4PA 3KRTA 2M32A 3IRVA 3OQ6A 1CIVA 1MF7A 3TXYA 5HGJA 2OP1A 3EZNA 4KLZA 4TN1A 2JBAB 3PNMA 1BFDA 1P5HA 3E82A 2FQWA 3NEJA 1PQWA 3U7EB 2C7PA 4HGOA 3W6ZA 3QXXA 4NEQA 4QELA 3WRWA 4AJPA 1YRBA 3ORQA 4OMFG 1U8YA 1C7JA 4Z8XA 5REQB 3O3OB 4LWZA 1EWYA 2A5LA 3KLNA 4IVPA 4TX1A 2X3FA 3LH5A 2ZTHA 3F1LA 2EFGA 5EWMB 3TQFA 3ZW9A 5CIYA 1QC5B 3BSFA 3BA1A 3B12A 3F49S 3IJPA 4R1TA 1X7WB 2VDWB 5DHUA 1ICIA 1VL2A 1XP8A 1XNGA 3FLAA 4D2IA 3ZE1B 3QU5A 5LIPA 4BXOB 4X6UA 3GGCA 1RWNA 2AXEA 2E5FA 4RPGA 1ZUIA 4KVAA 1NC1A 3LLMA 1YGYA 4JSTA 4EA8A 1OZFA 2GTHA 2ZJ0A 3F97A 4HHEA 4BZQA 1BKSB 1TCCA 3DD1A 1KQNA 1TRKA 2AA3A 4H60A 1HFKA 4L8FA 5IHPA 4WA8A 4QPNA 2Y66A 4F9GA 1BE1A 1YR2A 3RVQA 1P77A 3LHSA 3UMRA 3EDMA 3KT3A 2VXOA 2PS0A 4QC2A 3QKUA 4IH4A 3U80A 2HA0A 2D2XA 4KO1S 4UHJA 3EGEA 2JKYA 2JJ1A 1O6FA 1QHIA 1Z8FA 3BF7A 1Q6YA 2X6QA 3HZRA 3NHSA 2OCLA 3HY3A 3P9XA 4M1YA 4TXLA 5AI4A 5C8ZA 1SMKA 2SCUA 2VPIA 5C5EA 1S1MA 1AG9A 4GBJA 4Z99A 1SUSA 1WXWA 3BMNB 3BQNB 5CX4A 3LYUA 4ZQEA 4TS1A 3IDSA 2PMEA 3FR7A 4K03A 4WNAB 3WB9A 5DM0A 4HB3A 1V48A 5J1TB 1MAVA 1GP2A 3SQWA 1DQZA 3VR2D 1CU1A 2X0IA 4CV1A 4MWDA 4KR7A 4YDSA 4XDHA 3TOSA 3LL4A 5A03A 1K88A 1SUIA 4LOAA 4BMSA 2VHWA 3K0KA 5BN4B 3HC7A 3LOQA 1OV4A 4LRQA 1FMFA 5GZ6A 4HX9A 2PRYA 3HP4A 4KNWA 4ZVRA 3FZYA 3OC6A 1DJMA 2JIDA 1D2MA 2FSGA 1C0PA 2KE5A 3FGOA 4O4IB 4P1ZA 1XNRB 2G40A 2ACVA 5DNCA 1KBZA 3T61A 3FMVA 4HYQA 2I99A 2W6QA 2JIRA 5LZ8A 3L1VA 4CGYA 1XTSA 1KAOA 1RI1A 5AH0A 2DQ4A 2I8AA 3IEIA 3JWGA 4DIDA 1EGVB 3SJAA 5C1DA 3KVNA 4OG2A 4QU5A 2IHYA 4DMLA 1FS5A 3DBVO 4B4OA 3AINA 5L9AA 3MCTA 1XVTA 1O9BA 1C9EA 1FB5A 1RWMA 2JFNA 1Y3CE 3KUKA 4R1SA 3JD3A 4KLCA 4BTLA 1ODFA 3QG5A 4C3UA 4IHJA 2D8AA 2RGWA 3I12A 4CLXA 4PIVA 2VPWA 4EFDA 4J1SA 1JFSA 3VZDA 1L7BA 1VPDA 1VE9A 5H4HA 1BYIA 3UENA 1ZO8A 3CSDA 1VMEA 4HBZA 1EP1B 2GBCA 3DOEA 4RTNA 4JQCA 3PJDA 5KTNA 3Q8XB 5I45A 3NYIA 3CEJA 3OFVA 3SBOA 3UUGA 1HZZA 3L4BC 2UUPA 5F12A 2I65A 1GZDA 1L5KA 2J8ZA 2JS7A 2XWJI 3KBOA 3ZLJA 2D4AA 3OZSA 1DQSA 5JD5A 1RXVA 1NJ1A 2VSOA 4NU6A 2F1IA 1IZ7A 1FMLA 1JF8A 1W5BA 4GDFA 2FW8A 2O19A 2ZBDA 3FTFA 1TUGA 1JDSA 4D8YA 5DRTA 5H3HA 2Z4SA 1M0EA 4WLVA 2J5BA 3PS9A 1M2VA 4F6CA 4L4YA 1C41A 3STXA 4YP9A 5LYJB 3DQPA 1XG5A 2ZAMA 1XVUA 4V0LA 2PGNA 1R0ZA 5DP2A 2X0RA 4R3WA 3AVQA 4ZC1A 1QLWA 5HEKA 3EXEB 2C5HA 5A2QA 3I5UA 1WV0A 2FWIA 3CO5A 3FPHA 3WYAA 2C20A 3DXXA 1EZ1A 5A0FA 1CJVC 3I04A 5E7IA 3R9KA 2H29A 4QWWA 1FL9A 4FW8A 1BXGA 3ANTA 1YDWA 1GJRA 1KHHA 2O3UA 4DQUA 4WD3A 4PBSA 4R9NA 4DEVA 1N6KA 1PAUA 3TL6A 2QZ9A 5CR9A 5EWLB 1LSOA 1KZ1A 2HRBA 2XMDA 1KSHA 2PV0A 1LNQA 4FSDA 1JH9A 5KPJA 1FLDA 4B71A 4S05A 1K89A 3RQSA 2YWCA 1FNSA 1MX5A 1GDDA 1IH8A 2FN7A 3D64A 4IXWA 4BL5A 4DCCA 4RKRA 4F2HA 2UU9B 1QUEA 2H1OA 2KS6A 1P9WA 1XK6A 3FRIA 4ACBA 2G9QA 2B37A 1SXJB 1UP6A 1E64A 3Q85A 1VHJA 4JLMA 5SY6A 4JR1A 4LI3X 5DO9A 1JJIA 1UMCA 2XUZA 1XPJA 3PKJA 1BCRA 1VHQA 4CFSA 3RNLA 5KHLB 3AF6A 4US2R 1UT8A 4I5FA 5ECGC 3WGQA 4IWNA 2DUNA 3DDZX 4FD3A 2HF7A 4YUXA 3FLEA 2XCUA 3LXXA 2ZG6A 2C3YA 1UPTA 3J7TA 3VNSA 2ACWA 1FPMA 2R00C 3CTPA 3K1TA 3X1KA 1ORWA 3C5WP 3OO0A 5F2KA 2C04A 3D1LA 2VHQA 2Z3WA 4ECAA 1CSEE 3HSYA 3ZE8A 5JY1A 5AFSA 2A58A 3JCZA 4JU9A 1PQUA 2ZE7A 2A30A 3HJAA 4BEBA 1Q84A 4E0BA 4TGLA 4QGHA 1KORA 1GSHA 1AVTA 4Z9FA 3H2ZA 4P93A 2FN4A 3PQ5A 1F17A 4FE7A 3CZCA 2E4WA 3BRCA 3U4QB 2VHEA 4U2EA 3TOZA 1Q0QA 4GMGA 4P98A 3E3OA 1K3FA 5IM5A 3X43A 4C1NA 1ECCA 3IP1A 3OF5A 4UUNA 4J4BA 4QJ4A 4GR4A 4ZQIA 3OE7D 1MIOB 3HO6A 4PBRA 1RKVA 3NU1A 5HPYB 2ZAGA 3P26A 1GZSA 1UEJA 4BO3A 1TCVA 1NVVQ 1ICEA 4TUYF 1SBIA 1VMIA 4ZCSA 3ZDXB 1DAHA 3FPBA 2GPYA 3DO8A 4LXYA 3MRXA 3ZW7A 4RPHA 1GD1O 4NYJQ 1PYGA 1DOZA 1I14A 1IQ0A 1JHUA 2JRCA 3A36A 1Y3DE 1X7GA 2OAGA 4NBLA 1ZU4A 5EP1A 4NX2A 3K6JA 1QTIA 2P9HA 4N40A 1ZN8A 2RH9B 4JKOA 3LQKA 4QDXA 1IG3A 3ZVNA 2VZ8A 4GBMA 4HQ0A 1XL0A 1J5PA 3WYGA 4BU1A 2V6IA 4Z4IA 3BIJA 4I55A 4UVIA 5HKLA 1O03A 2WWHA 5BNTA 5B3AA 1DPFA 1UPXA 3O1JC 2RAUA 1E5LA 1EG7A 3OE7A 3QPUA 5AIAA 5JDCC 4CCYA 4I1PA 2PX6A 2VK2A 4ZT3A 3FUWA 4GR9A 3D2BA 1W88B 1CF9A 1Z0ZA 4PTYA 4V0SA 3O90A 1QH8B 3S5JA 4C07A 2HA6A 1JKMA 3RT1A 4RF2A 3QIAA 3QVGB 4BFSA 4LFAB 2DT8A 1KEZA 3KTOA 4KKXB 1DP4A 2RG1A 5TY0A 4DRXB 3L01A 4YUWA 1CEYA 4C88A 2NV0A 2PUVA 1GQYA 3VI4B 2Z5VA 3N2LA 4XFJA 4Y2TA 4YCBA 4P3NA 3C0KA 1GOTA 2XMGA 5I4KA 3KT8A 4NMMA 2FJ0A 1NVUQ 2GTIA 1Z4NA 3K0SA 1XKTA 3FVWA 4IQ8A 1EWRA 4LYHA 1CETA 1HRKA 1PFUA 4LMRA 4V3CA 2QA5A 2VL7A 2XW6A 3KEOA 5AJWA 2BGLA 1CFZA 2CHEA 3TCKA 2JANA 2P27A 4S1WA 3A6GA 5B6IA 2FW1A 3EVFA 4IIYA 4LV5B 4CRWB 1QE5A 4GEKA 4MGHA 1YFKA 4Z9XA 4UC0A 1SVMA 2ODAA 3DWEX 4L5JA 1ZUNA 3TTUA 1CUHA 4B9AA 4OA5A 5FIUA 2FEAA 4QRIA 1U8UA 4LRWA 2IOFA 3V7FA 4JWTA 4J90A 3A1NA 5EE3A 5E2IA 3ZQJA 1YCDA 1HBJA 1NN1A 1KS9A 4FFPA 2VXYA 3QPDA 3SX4A 1PGQA 3NEAA 2I22A 3LUCA 4PQEA 5DI9A 4AROA 4LJKA 5DXFA 3AGQA 5FNVB 5B1HA 4RTQA 4XR4A 1UFKA 2E9SA 1JG6A 1X2BA 3MNFA 5T64A 4HFNA 5C51B 1K3TA 1RPAA 2YWHA 1YRWA 2V7PA 1FLVA 3MB5A 4KMMA 2QLLA 4MB6A 4OMCA 1ZAYA 4CM8B 3LQQA 3KK0A 1DX9A 1LLDA 1PEDA 3M9WA 4IJ6A 4KXYA 5H80A 1UDBA 1J25A 4BZZA 5K2OA 4G1VA 4NK5A 1GRVA 1VECA 5ADWA 1HTTA 4ZQFA 2FV8A 4KH1A 2G9ZA 2YWFA 3CX7A 5LNK1 2PUTA 3L0ZA 2I7XA 2OA0A 4V0MA 5L45A 2VNKA 3I52A 3NRBA 4QJBA 1CUEA 3D3EA 5CURA 5ETJA 5KNCD 2GI4A 1ZIPA 4FFBB 2J32A 2WIBA 3BAFA 2PA3A 3DHEA 1FC0A 1ZM2A 4L85A 1OV6A 1HT2E 2FR1A 2JAPA 2NXNA 4DMUB 4P0PB 5A4FS 2C0QA 2P69A 5D6NA 1CZNA 2QLMA 1K7YA 2Y92A 3HB4X 5J4HA 3EDCA 3DR5A 1OMOA 4A4DA 4BBJA 5LIRA 2Q1UA 3CZPA 1ZS9A 2DQSA 3N58A 1UOPA 3PFGA 4L28A 4OAQA 4OKSA 4AN0A 2F1HA 2FTKE 2QDXA 4F3KA 2YUIA 3MWLA 9GPBA 1KPGA 2DBRA 5ADVA 1BJTA 1M5TA 1RAGA 4HR7A 4JX9A 4F86A 1L7XA 3V7UA 2V59A 1NA5A 1ZITA 3MJTA 4ZOLA 2I6TA 4LXIA 2FMKA 1W36B 2RHCA 2CYCA 2BMVA 1HLDA 1X80A 3G82C 3STHA 5BRAA 3E1SA 3NH6A 4UZEA 1ID1A 2E6KA 3QEAZ 1L9XA 4GM1A 1V45E 2DX7A 1OR8A 4MR7A 4EAAA 4DR6B 4MUJA 2IQIA 1ZFNA 2OCPA 4E5MA 2X7XA 4TL9A 2BKAA 1IAQA 3VKHA 1XQXA 1ZXLA 4QU9A 3HRKA 3ROXA 5DMXA 2EX1A 1AQUA 2JIBA 2WLSA 4N3GA 3WGYA 1Q50A 1E6LA 1Q7RA 2ZVQX 3KD3A 4TL8A 2IHUA 4WV3A 3T3GA 5J4VA 1CT9A 4FZ5A 1I9CA 5C18A 8AT1A 1BE6A 1PNVA 1N2CE 4Q9AA 3W9UA 5DFAA 1ZNZA 2PEYA 2VH5R 5JYDA 3LOUA 5LA6F 2CJWA 2ZYDA 4ZOLB 3TXXA 3FSGA 4AF8A 2OC4A 3ELBA 4URFA 5B4UA 2YR0A 1LDYA 1UPBA 3MJVA 5CDFA 3H84A 1BOFA 2PM8A 3ZXXA 1ORDA 8ABPA 1JBEA 2H17A 1B1AA 1E79A 3F3YA 4X5OA 1Z73A 2EJTA 3QBVA 4PRKA 2Y1CA 4YJHA 1AKRA 2I2FA 2Y4OA 4EY8A 3VSBA 4RCVA 4JGGA 4Q9IA 1OZ0A 5HDQA 1B0UA 4MCIA 5DDIP 5J2UF 4TLAA 1NG1A 2FETA 4L9SA 3GDHA 1CS0A 2IY7A 2PX4A 5DBOA 2I3AA 3BB3A 4EW2A 3ETNA 4Z51A 3DCJA 3EVTA 4JP5A 2OZEA 5TF0A 4JFAA 4LI0A 5B53A 4B6JA 4WJLA 1EWVA 1QGDA 5CT6A 5HF9A 4A6DA 5A3JA 4YMIA 1GCIA 2LDXA 5DGXA 1CZUA 1TPZA 4B34A 5A4AA 2COEA 3KQTA 4KLAA 4ZAYA 3NCTA 3RV4A 3RYIA 3TNJA 1W49A 1L7MA 3UCXA 2GBPA 2JAWA 1W29A 4JL8A 2AXNA 4ND2A 4HY3A 4HH3C 2ID4A 1IN4A 3B6ZA 4NP6A 2ZRQA 4BMNA 3W79A 4ZCQA 1E79D 1Z18A 1EEXB 4IH9A 2CNNA 2VKTA 1L9KA 2OHOA 1NN0A 3LC1O 4BFZA 3MTGA 4Z7JA 5AVJA 4RJIA 4C0JA 3VOBA 2G7ZA 5EJ4A 5IBRA 4PTZA 3GA0A 3M4YA 5FEMA 3L77A 5E1BA 3E84A 1ZIXA 5D5PA 3V00A 5JZMA 4UU0A 5LD2C 5IJ9A 4TYWA 5JC8A 1WE2A 1U4NA 1ZK4A 5LQCA 3D6NB 3JR3A 3QXHA 5K4AA 1IWPB 4ZEMA 1YV9A 3JQGA 5DVZA 1BAPA 3DDHA 5L3VA 2UKDA 3FCEA 4BKOA 3HSSA 3D4LA 1SB9A 1YI0A 3LW7A 4IQ0A 1NJGA 2YDYA 2O7NA 2ZI7A 4WFKA 5EIBC 4GUDA 2IOHA 3F46A 3O8QA 5DLEA 1GL9B 1LK5A 1JECA 3L7NA 4J76A 2H5LA 2OFOA 4AJOA 2HD4A 5I7EA 5DBGA 4RJTA 2WOOA 3PL5A 4QFBA 1E5TA 4G07A 4B83A 4ZK2A 3S6JA 5K9ZA 1L7PA 4LQCA 4Q1CA 2IOFK 4XWTA 1Q0PA 1CJBA 3VO9A 5GOZA 4TXNA 1QGED 4LGMA 1YS1X 2PVPA 3I04M 4FMCB 1KMHB 3ND7A 1I2BA 2B25A 3PE4A 2FFBA 2L17A 1GR1A 5JH7B 2VOJA 5AM2A 5JMTA 1VHDA 1P1RA 3TGLA 2AOUA 3E22A 4HH1A 2YIJA 2H4ZA 3TQCA 3V34A 1OH8A 1Z2EA 3P4UA 4PZDA 2F4VB 2EX0A 2A1UA 1KIFA 3B48A 4HXFB 4B47A 4C7JA 1Z5VA 2JH8A 1XZHA 4C0SA 2VVTA 1NMSA 1TB4A 2FSHA 4L0CA 4TV9A 4I55B 1A5BB 1PDOA 2VDKB 1TZJA 1G7RA 2Y0CA 3FNEA 3FM9A 4B3XA 3PPIA 4LDPA 2I55A 4QREA 2I91A 3IKMB 4YP0A 1W8IA 1Z16A 2IP2A 1KNXA 4EHIA 1MXFA 5GINE 1I80A 3ISJA 5H9WA 1M6EX 2MYPA 1UWKA 1E2EA 3I34X 3FNQA 2A8YA 1IPHA 4MJLA 1SM4A 1V47A 2A67A 1JSRA 3L7DA 4YJ3B 4P82A 3IP8A 1NQVA 3FOFC 2RI1A 1BVHA 5CXXA 3UMMA 2NYVA 3UFBA 4RMJA 4Y1RB 4P92A 5G0WA 5GJWC 1D3AA 3RTEA 1SZJG 2FZWA 4A27A 1DKQA 3C2QA 2ZEJA 5CDSA 4FT2A 4PGGA 1FDWA 1NW6A 2PUDA 4DADA 2P4QA 1M6NA 1X7XB 1YJ8A 2VYFA 3OIYA 2WG0A 3TTWA 3VPBA 4ARZA 5LU9A 2WYVA 2CWDA 2NVUA 2WD7B 4OJYA 4XWAA 4RACA 1JWBB 3K70D 4UDOA 3IBYA 2Z9BA 4MEJA 1PJCA 4RDCA 4WJZA 1NVDA 5SICE 3WJ2A 1SXJD 3CKMA 3URMA 4XQCA 1MX3A 3JQBA 1BN7A 4BV9A 1UC5B 1UOQA 2HMTA 2JRLA 4QT0A 1N1GA 4W5WA 3UTCA 2PLRA 4RF4A 3WO0A 1H2HA 2GPTA 3CN9A 4ZTBA 2OPHA 1WVMA 3FJ1A 3H05A 3TBKA 1AMNA 1PU2A 3OOYA 4OX9Y 1JNYA 2Q8QA 1L5HA 2CL6X 2REBA 3CLTD 1UQTA 1N4AA 5CA1B 2PUWA 3ESDA 4ZO7A 1CUVA 1E20A 2DU8A 4MB0A 5ALTA 2ABWA 1DRKA 2OZPA 3A2LA 3KJEA 5FAXA 2XCRB 3D2LA 1N7IA 3U7HB 1CY0A 3OQOA 1OPXA 2Q3CA 3TDNA 1RE1A 4U2CA 4ZI5A 3SVLA 1EU1A 4CYMA 1IJEA 2Z2YA 2QRJA 1V26A 2QXTA 2FMTA 4CM9D 3RBXA 1TZCA 1UMCB 1Y6JA 2PMCA 3H4IA 3I45A 1XCLA 1JZSA 4OM8A 3NG1A 1SXJA 2GLTA 1XTPA 2I8LA 4EG4A 2AH5A 3SHFA 4RE6A 3Q0IA 1P1KA 2PQMA 1JR3D 5E3JA 1DZ3A 1QRUA 2XNCA 3Q8MA 4GI1A 1V5IA 2I6FA 3QQPA 1PQPA 4RLQA 2OHHA 4EWLA 1HRDA 5DNDA 3WLJA 5KJ6A 4Z2AA 2XZDA 5KX5F 4R81A 3V8EA 4KFCA 3JQ9A 2ZXUA 5FD8A 2HK9A 3MIZA 4HQOA 3Q2OA 3R44A 5AT1A 5G53C 3H1BA 3IVMA 3QITA 4A6PA 1UM9B 1CW2B 1BKDR 2NYAA 1HNZB 1GTZA 2Q4TA 4JXJA 4KK4A 3ZDBA 1N5OX 2Y1XA 5BRNA 4J75A 3RSQA 4CLHA 3AR9A 2J3HA 1MW9X 3GGOA 1GQRA 2L19A 3NTRA 3TQIA 3W6NA 4F6RB 2GO1A 4CM9A 3DHYA 2L42A 1GUBA 2PEZA 1L5GB 3KQYA 3AJ8A 3ZKWA 1Y5RA 3GYGA 5BMOA 5JYCA 4GWGA 1ODKA 5FOSA 3A37A 3I72A 4JXKA 3UC5A 2R6R1 2CXNA 1PJZA 4X6XA 3Q3HA 1QTQA 4KAJA 1PHPA 1Q7CA 3BWEA 1T3HA 3GEIA 4BUCA 2QD1A 1HLFA 3L92A 3MILA 4R05A 1V1MB 3AEZA 2AWNA 2QNBA 1MMFB 3RC2A 2FQ1A 5KYXB 3D3KA 1LCIA 2P0EA 4MOWA 4RTOA 3F73A 3GROA 4JN6B 5HQJA 3GH1A 4PO8A 3VTAA 3MJRA 5BSEA 1U3VA 3TZEA 3JVDA 1C0EA 3QLJA 3R4CA 4FC7A 4LOJA 3V3TA 1AXEA 5D00A 1ZGHA 3OWXA 2QG9A 3MWDB 3ONEA 2O8DA 3DMFA 2A9PA 1TQ8A 2PX2A 5HS4A 1Y6RA 2B5OA 3OIFA 1QPGA 2GJSA 1MD9A 1GRQA 2OM2A 3TSYA 4OIMA 5A0VA 3HL4A 2RI0A 4PHTA 2W6JD 2R8ZA 3SJCA 3O1LA 4XFDA 4KAAA 5CLJA 3AQ4A 2H4XA 3OLQA 4YCDA 4A8JC 1LBIA 3AJDA 4HYTA 1NBMD 2DY0A 1ZINA 3EBOA 3MWKA 4RZIA 4DNQA 2OR3A 4Y2QA 2I71A 1OHHA 1PJRA 5AXDA 2ZREA 4P35A 3GLFE 2UUBB 1SBCA 4LZOA 2A9QA 1DBQA 2YCBA 4DCGA 1DRWA 2XT9A 2JI8A 5D84A 2J6IA 2IUSA 2CHVA 3RM3A 5K6AC 4DKJA 4Z86A 1N6IA 1LS6A 5DN6A 3CX4A 3L6CA 4HVAA 1H4TA 4R2IA 1Y5MA 2D2VA 1IU9A 3G2IA 4R1NA 3RG2A 3R5TA 4U5QA 3O03A 3RLIA 1NUQA 1GAJA 3WQBA 1V9LA 4M0FA 4XPIB 2O8BB 3OJWA 3BAZA 1YB5A 3Q3EA 1VMAA 4IIJB 1C0KA 2C7VA 4N9QA 3S1LA 3VYTB 4BBPA 3SF8A 2FXVA 4BY9E 1LW6E 3PJRA 3MXOA 3RTAA 1GZ4A 4L51A 2VZ9A 3L6EA 1M2OB 4FHFA 4QTXA 3A9CA 2I7CA 3DAFA 5KX5A 2HAEA 3REFA 1HL7A 1NBMA 5K0JA 4OP1A 3RT9A 4CG3A 2O4UX 2YOGA 3ZCUA 4EATA 3BTSA 2H2DA 1WX1A 4RBNA 1GITA 1OWMA 2GKOA 4BJ5A 3UAOA 1Q0RA 2BM9A 4YX9A 3BMNA 3GXOA 3HEBA 5CLGA 4HRXA 4FKZA 1WOMA 1LX6A 2SCUB 2VQ6A 3BZBA 1P62B 2CNKA 4JB2A 1JLLB 4C9BA 1CY1A 3DR3A 3IUBA 4LC9A 3V8QA 5LQMA 3JW8A 1VBMA 4JA2A 3KJFA 1DE0A 2CUTA 3QENA 1QDEA 4GECA 4HAYA 4M9ZA 2C3UA 3BFJA 4Q3DA 4K2HA 1IYZA 1HE5A 1CTQA 5JROA 1Y9AA 2D3TA 4LDAA 5FOQA 5AVVA 2WK1A 4RADA 3MJ4A 3AHEA 3QNMA 4KQHA 4Z4CA 4BB5A 3NBFA 3L1UA 5IARA 1WXEA 2P41A 4OOFA 5JWHA 5SYMA 4B4KA 4F4IA 2YVKA 4D8WA 3GCGA 1ISSA 4GQAA 2X9NA 2BMJA 3WP1B 1U7HA 1BSVA 3NKLA 3QG1A 4EHKA 1FW6A 1JLKA 1HLPA 5CT4A 1VPEA 5F64A 4HYEA 4N12A 1C8LA 3IDFA 2Z6UA 2P75A 1E8DA 1ZMOA 3EFBA 5IDWA 5GIPE 2LCIA 3SIPA 5HS6A 4ZVUA 4PYOA 3VX3A 3BH7A 3N8GA 3ECSA 3TZCA 1NJ8A 1U9YA 3UF0A 4TTAA 1QYDA 1U2SA 2XVXA 3ZHXA 5GONB 4QM7A 1ZBDA 5G2OA 1TVMA 1Z47A 2HRZA 2W2VA 1ZD1A 2WTXA 3KV3O 4Z0NA 2CJYA 1NWCA 3ELDA 3VA7A 1OU4A 5IJ9B 4H6WA 3BTVA 3UMBA 1O7JA 3OZ7A 1O6ZA 1KC1A 5HCUA 4ZGGA 5C8DA 2WU3A 5AVKA 4DZTA 5JNVA 2FMUA 4O29A 2IUUA 4U9UA 5AUOB 3D6HA 3QSYA 1QF6A 2F9FA 2QN6A 3P2MA 3LWZA 1BVUA 1X94A 2ONKA 2QZZA 4R1MA 5KNBH 4NBRA 1QO7A 1XLVA 2W4IA 1YL5A 1UK9A 2YVQA 1QIJA 1R0BA 2JGNA 2YHAA 3ETLA 2FK7A 3BYZA 3F96A 3ST7A 2JLWA 1NUAA 4QOHA 2PUEA 3WB1A 4ENPA 3GZNB 4RFVA 4FTWA 5J2TF 2RB5A 1YUMA 5D3ZA 1QVWA 1CUWA 3RS4A 3QTLA 3FDJA 5DE3A 2IIVA 4TRJA 1EGMB 1P1IA 3UN1A 3ZHCA 2I4MA 2PJZA 1N5DA 3AFOA 5F21A 1Z15A 2JCYA 2PUBA 2Q4BA 3ODPA 3PKIA 3ZBPA 1QGOA 1W7AA 2GN8A 2AFHE 3WIBA 1VJ0A 2WJZB 4Y6LA 1MQAA 1Z83A 3DUFA 4MB2A 2LGJA 2EZ4A 2NZ2A 2W9XA 1B6GA 2X8LA 3EZYA 2JF0A 2CD7A 4JITA 1GPH1 2VTBB 1RADA 1C4KA 1T5IA 4I8XA 1MZVA 2JGLA 1IN7A 5FPTA 3CRVA 1FMTA 4LOLA 4F06A 5EXDA 1NSFA 2F67A 3LCVB 4A1FA 2YRWA 4EI7A 1CKEA 1R12A 2PO5A 3ONDA 4MPDA 4RY2A 3U16A 3CF4A 1NKVA 3M5CA 3EVDA 3KE8A 2OO5C 3OP1A 1A98A 1GRNA 1MB0A 2P9YA 2PIDA 3NTOA 5CPFA 3RD5A 3U44A 3HA7A 2VYND 1L8XA 2Q9AA 1AJEA 3DM5A 1XEXB 2C4MA 2ZKIA 4IV0A 1KTVA 2PHZA 4TV9B 2FPMA 2WZCA 1QBGA 3I2YX 3HTXA 2Q41A 1HQYE 1P75A 4GDMA 1RBMA 2A0FA 3UXMA 4KWEA 4GZ5A 1PS0A 3WV5A 4GLJA 4M36A 4YGYA 1OU0A 2QG4A 2YMQA 4A10A 3QPBA 2AOTB 1YC2A 1GFSA 4A5OA 3Q72A 2O1EA 1Z0FA 3EYWA 1H3NA 1MAHA 1P80A 1U3TA 1WHTA 3QHQA 4WAUA 2P8JA 3COZA 2C7RA 1WG8A 3FFXA 3WYNA 4GAEA 1VLLA 2XEXA 1Z38A 3CXUA 1TVKA 3OPQA 4O4IF 3KBBA 2Y0DA 4V0NA 1DWPA 4XYGA 3EHDA 2Y9MB 2GNAA 1KMHA 2ZTUA 3R7LA 2OESA 3HNOA 3KXKA 3SM9A 4YJKA 3WL5A 3M4XA 1MHTA 3C5CA 3TK1A 1YFZA 4KRXA 1BQEA 4MKFA 4U39A 1RDFA 2P91A 2BGJA 3UB4A 4C0AC 2QUZA 1MV8A 4UUOA 5AJTA 4BMDA 3R3ZA 1DT5A 2OHVA 4JJ7A 5HK9A 3AB8A 3CONA 4ISCA 3FHTA 4GL2A 2FW7A 4O2BA 4R2LA 3SLRA 4ZI2A 1O8CA 5JQGA 1E18A 2W6MA 3PLNA 3L4EA 5JS6A 3VO1A 1PX2A 2FZVA 4FYJA 4HGRA 1O95C 1L5LA 13PKA 5KPDA 3IAAA 2BBTA 2F55A 1YKSA 3G2JA 4Y2XA 3KOYA 3Q3IA 1WR8A 4LRSB 1L4NA 3SJUA 3TQSA 3L5KA 1TAHA 1Z62A 5FEUA 4FOLA 4LC0A 3VVBA 5KYUB 2I6UA 3RB8A 3FPCA 3KE9A 2AYZA 3A4IA 1SU7A 2ODEA 3EOZA 3MB8A 4MNTA 3DZFA 3IAHA 2BBOA 4JT4A 1E69A 2Q9CA 3B3FA 1PWYE 4UKDA 5DB4A 4DLWA 1EEHA 2BCJQ 4POOA 1XWFA 2OV3A 3ELYA 3HJUA 3TD6A 4U7DA 1J99A 2R11A 3LYLA 4M1SA 1LS1A 1G60A 4QXRA 1T8TA 3A3NA 3X44A 3RYIB 4ER5A 5INTA 1H69A 4HN4B 4G5QA 2Z3ZA 4KCGA 3HR4A 1YIAA 3FGNA 3B5JA 3AHIA 5FO1A 2IZ0A 4C30A 5IAKA 1M6VB 1FYEA 2ENUA 3VJKA 2GKSA 3ZJVA 1OH5A 4Y18A 3DE3X 2V7UA 3KR9A 4LZLA 2OLJA 2QZJA 1Z4PX 2QE7A 3EXG2 4ZQBA 3MYRA 1WB5A 3DHVA 2V7VA 4C6HA 2O50A 4XIYA 1U80A 1FVHA 3WLAA 2QTBA 1NIPA 4ITUA 3KTDA 2Q3LA 4Q3EA 3AV3A 4E5NA 4N6NA 4EZBA 4ZTUB 4BVLA 3K9GA 4RJKA 3RU7A 1BRMA 3EGXB 4J3FA 3RV3A 3OLCX 1RJDA 1SCAA 1XQ1A 3P20A 1OGYA 2ADOA 4D42A 1MQSA 2AGVA 3WSTA 2Z1DA 3GZ4A 2F3SA 1I1NA 1TCBA 2CJWB 3NHBA 4BLQA 2IY9A 1JG1A 5C4MA 4KDEA 4MI1A 3AUUA 4YRMA 3BWXA 4BLPA 3KETA 3HU1A 1YWGO 2P2GA 2XYGA 3DOHA 5L7WA 3LK7A 2CDCA 2EJBA 2BGUA 4G4GA 1A04A 2VT2A 1RQNA 2XVZA 4RM3A 1DC8A 1Z36A 3DMTC 1DKPA 1D4ZA 1L4YA 2C8KA 3EE6A 5EMJA 2VJCA 3AGPA 5FL7A 4ESEA 3ND8A 1TO2E 1XVAA 1F6DA 3PC7A 1H4QA 2ZUFA 4M7OA 3G0IA 5AVRA 2IZ7A 4JASB 3RRJA 4RORA 3AY7A 3DMPA 2ZXFA 4V2IA 3T1YB 1T9BA 3D0OA 1AO0A 3LCUA 5GZ3A 2ORVA 5J9FA 2O8FB 1U2RA 2Y6UA 5EUCA 2H1WA 4OHZA 1PD0A 2G5CA 1KMCA 1K8QA 1NF8A 2BZ0A 4R71A 1WXIA 1II8A 5A2GA 4MGIR 3LHIA 1IWBB 5SV2A 3MD9A 1THZA 5GIOE 5THQA 4PNHA 3PA6A 4AQ7A 3GFRA 4G2TA 1IMOA 4PVCA 3QFRA 2QVBA 3PXCX 4IGEA 1A5SB 1GQ2A 2A9JA 5K3DA 4RH0A 4HQNA 1OILA 4IBOA 3DTTA 4XB6B 4KE7A 4YPFA 2FSVA 4OB6A 2IWHA 3WLHA 3WYFA 1C7EA 4QQNA 1X7YB 1WCIA 4MX8A 3MYYA 2P35A 3RRXA 4C0HA 5IKMA 4OX9B 2HC9A 1I2ZA 4B31A 4KYIB 5AI9A 4NVRA 3WTCA 3JWHA 1EK1A 1DCTA 1C9KA 2XA2A 4F04A 4IXNA 2BKVA 2CJXA 2HU5A 3E6AA 3I2KA 2GAFA 3BIWA 1A77A 3B6IA 5JQWA 2NLOA 4X6LA 1GUFA 2V03A 4JUBA 1T5TA 2VQDA 3KU1A 1JDJA 1GG5A 2R1UA 2QM7A 3KZKA 4G0QA 1XEAA 3VR1A 3PSHA 2WT9A 2WA1A 2ZAYA 4OK6A 1CRZA 2OBMA 4ENRA 3SE7A 3ZCSA 1RLJA 2BCEA 4F93B 5KTMA 5CXSA 1A9RA 3W2EA 4XUGB 3CE9A 3BDIA 4AZWA 5D2CA 1Y6ZA 2IDZA 4I4TA 2D0OB 4DLPA 2V7EA 4ASUA 5K5EA 1TT5B 1VE6A 1RQGA 2O52A 2QROA 2XDWA 4FBLA 2RBEA 1JFTA 1P2BA 1XDGA 1ZJJA 3NKFA 1D1QA 4REQB 2IU0A 4UTPA 3F6YA 3R7WB 5FQNA 4ALKA 4HL6A 1ZZGA 4KSCA 5H81A 2CHFA 2EQBA 4MA5A 2Z09A 3W5JA 3Q3VA 5D3MB 2Y6VA 1SU6A 2QTMA 3TMAA 1SXPA 1OBCA 1UT5A 1HE2A 5DJ5A 1N5MA 2Z04A 4NCJA 2MCFA 3B2EA 3V1TC 4LF4B 1LDEA 2UZ3A 3I83A 3GRVA 3M7IA 4KVGA 1IEVA 1L4UA 3FYUA 4TOIA 5IBPA 4KRGA 2YOFA 5J4KA 2JGDB 4LDJA 2QTVA 1VIYA 4EGCB 1NZFA 4J03A 5K0FA 1L0BA 1VYUA 4K6FA 1LK0A 4LQDA 4I8DA 4L75A 3MCWA 4JDUA 5CDHA 4KAFA 2OYCA 5LXTF 1PBTA 4KFRA 4BAUA 2FW6A 4FMCF 5AW5A 2LD4A 4R9UC 4ISBA 2PXXA 5JW6A 1ZK1A 2DKFA 4EB6B 4UNQA 4ZEVA 3PWTA 3NNSA 3FCOA 4J4TA 3UPTA 3I6QA 2CB9A 3GOQA 2B6NA 4IV5A 5BW6B 4AY2A 2PGAA 2RHGB 1YZHA 3SI7A 3PVZA 2P1RA 4U1RA 3N7TA 1G8GA 3LT1A 1E6CA 3UJDA 2DHDA 3TH5A 4C04A 1URPA 2I3ZA 5C80A 1ZH6A 3S8EA 2H7CA 4GPBA 4ZAXA 4ZVVA 4LBVA 4M6WA 1MA3A 2H0QA 2PZAA 2W11A 4N7BA 5HJ5A 1WPGA 3PNPA 4AULA 1G2IA 3GC6A 4MO2A 2BSXA 2QNRA 2Y8EA 3RVSA 4RK0A 4RK6A 1N2EA 4HQRA 1SPXA 2IITA 4BLSA 2QJFA 2PX3A 3W3AD 1W47A 2ZTMA 1JWLA 1KYQA 3GIWA 1KKMA 3VSAA 4V1CB 5KQLA 4NTZA 5ICMA 3O4IA 2Q0HA 4MP6A 5J3JA 1Z26A 4LBZA 4QODA 3C1AA 4RGVA 4WSOA 1Z8DA 3OT1B 1N6RA 1E3EA 1NMQA 1L5ZA 2QRPA 2HIMA 4IDCA 1AN9A 1FS4A 4QUAA 3TL2A 5I8PA 3T5AA 1QO9A 5HW0A 1WNFA 1CUZA 3KX2A 3VQTA 3MG9A 2VHCA 3HRHA 1ZMRA 3E9MA 1LD3A 4ALJA 2J33A 4BNVA 2BHSA 4NV0A 1Z35A 3DBLA 5E3HA 1EWKA 4N39A 4QO8A 4JJEA 3SZGA 3PK0A 4ZMSA 3KQUA 2ICAA 2HHCA 5KCMA 5KC9A 4PCAA 2UXDB 3KIPA 1RQ7A 2XTZA 1MO3A 2R97A 1YAHA 1V1JA 4GX0A 1P3DA 3CCBA 1YRAA 2GRJA 1XLTC 5KAMA 3JD4A 3LIIA 1C1DB 3PWKA 3ONNA 4HNRA 1BWPA 1TA4A 4I08A 4L3WA 5CX1B 4EJMA 1BEZA 2VAVA 2I2CA 2DULA 4TUYA 5U4QA 2RHRA 3NNNA 3W3AA 2VI5A 3WIVA 3QXJA 2VEOA 1XN1A 2PZEA 4BE9A 3ZC3A 2YN2A 3CRZA 2IA5A 1UOOA 4OHYA 2OXCA 4I14A 4JUIA 3BMQA 3D1JA 4NDNE 1TMYA 3RTBA 4ZRMA 3PC4A 4DHWA 5I7HA 1UMBA 1ENZA 1IM5A 1OZHA 4LMBA 1R9JA 4XDYA 1R4NB 5DT9A 4H31A 3U4AA 4FWBA 1WHSB 3OCVA 4NMXB 3LQ4A 2E87A 3JQ8A 3OQPA 1LI4A 1KEKA 3QVXA 1V16A 3F2VA 3PNYA 2FJPA 3S28A