1TU3A

Crystal structure of rab5 complex with rabaptin5 c-terminal domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
165
structure length
165
Chain Sequence
ICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Ras-related protein Rab-5A
publication title Structural basis of Rab5-Rabaptin5 interaction in endocytosis
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 165
sequence length 165
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2004-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tu3A00
3EIHA 3SI7A 3VR3A 3D31A 4ZIRB 1X3SA 4MA4A 5FOSA 2ZJ8A 2C98A 5BYJA 1Z07A 3QPVA 3K53A 4QHTA 5BXQC 1OXTA 3EIQA 2CVFA 4LC0A 5G41A 1TQDA 2C9CA 2X77A 2ORIA 3QE0A 1AN0A 1TTTA 3AVXA 2H8KA 2ONKA 4RFVA 3Q7PA 3O8RA 3WHLA 1EFUA 1Q3TA 4D80A 1KYIA 4GZLA 5K8TA 2ZRLA 3DDCA 2G6BA 2J9RA 4BFTA 3X2SA 4OL0A 3RS4A 4NCKA 1QHNA 5GJVC 1WE2A 3HYTA 4Q4HB 4D0GA 3I61A 4TLBA 1UBEA 5J47A 1NBME 3NH9A 2DWPA 3TW8B 1YZTA 3U60B 3PEWA 2F1JA 4UKDA 1N6IA 5AJYA 2WJGA 2A7QA 4M1YA 4DZZA 3E2IA 1M7GA 4L9SA 3V4RA 3CRQA 4G5QA 1ZM7A 3F3YA 4C0AC 1AK2A 1U9IA 2OCAA 1MO4A 4P4SB 1P60A 4DEXA 1ZU5A 4EPRA 1UBFA 1G19A 1IONA 1NLFA 3A6PC 4DUGD 1D6JA 2VQSA 3SZRA 2VH5R 3SHFA 2ZROA 3PUYA 4D4MA 1GRNA 5DYIA 3SFVA 3T12A 4D0NA 3R9IA 2PX3A 4DDTA 1GAJA 4ZIRA 2ZAMA 3K0FB 2RGXA 2PT5A 2OCBA 3BORA 3EZ6A 3T5GA 1XTJA 2ZRKA 4RKEA 4U7DA 4EDHA 2C99A 4CEJB 1NN5A 3R20A 1XMVA 3NIBA 2R62A 1JR3E 1Z5ZA 3AQ4A 2WIAA 3SJBA 5IK2D 3ZVLA 1AGPA 3ZIAD 5FTLA 2CCKA 2IYLD 2IEYA 3WHKA 4B73A 4DIEA 3UANA 2QMHA 4TL7A 1QBKC 1BYUA 1E79A 2OBMA 4Q4HA 3NEJA 1BOFA 1TEVA 4TL6A 2KBFA 1WRBA 1UAAA 4Q1CA 1XEXB 1HV8A 3L0SA 4FWTA 4UNRA 4I1OA 4JLJA 5FOWA 4C0HA 3B1VA 1LF5A 1X86B 3EX7C 4OI0A 3B8HA 1M7HA 3QKTA 4P4SA 1N6KA 2GTPA 2ZRHA 1ODFA 1ZIPA 3P20A 2WVJA 2QORA 3FTQA 2IBMA 3K8YA 3TQFA 4XVRA 3FHCB 1QG2A 4TMVA 4V0NA 3K0FA 4HLQB 1GUAA 2D74A 2I1VB 1RW4A 4KVGA 2P0EA 1Z2CA 1KZGB 4IHQA 4AYXA 2BJWA 4CZ2A 1NL3A 2WAYA 4B3XA 3K1JA 1IXRC 4CEJA 3ZS9A 3K0EA 1KI7A 2OFOA 1FTSA 2RMKA 3IIJA 4BFZA 2ZM5A 4ZI3A 2YV5A 2IF2A 5J4YA 3AF3A 3BE4A 4US1R 2FSIA 2ZQ5A 4JL8A 3MMPA 4Q4AB 5FOXA 2R8RA 3VR5A 3D6TB 1J99A 3IILA 3BWDD 4MYCA 4DB4A 2GXQA 2IL1A 2ZJBA 1Z6XA 5E3HA 2CE2X 2WJVA 3MG9A 2BEJA 4KFRA 4AK9A 1G5RA 4OQXA 1XF9A 4C9BA 4JLMA 1XEXA 2F55A 2WWIA 3AGQA 2QA5A 1XPOA 5CM8B 1ZIOA 2AL7A 5KPDA 1JXMA 3EPHA 2QP9X 1GSIA 4JIMA 3LQQA 4LWZA 4RSGA 1KGDA 3NDBB 4HB3A 3QXXA 2QQ0A 2FV8A 4FMDB 1BO6A 2ORWA 4NYJQ 4D2IA 1XTKA 2LCFA 3C41J 1P2VA 2VHQA 4RZXA 4QM7A 5KNDA 2ODWA 1KY3A 2IXEA 2NIPA 3P4XA 1L2TA 4B44A 1II8B 2FF7A 1D2NA 3AUYA 4OQNA 2ZSEA 3C16C 4L15A 3LAWA 3OAAD 4IVQA 1T5LA 4QKQA 1NG1A 2GCOB 4Q4AA 2A5DA 3RRZA 3X1ZA 3CW2A 1XPRA 1VMAA 2WWWA 1X6VA 3R8CA 1OIWA 3PEVA 3RS5A 1N5JA 3H2YA 4HB2A 4IVPA 2ZRPA 1E9FA 4LHWA 4NPHA 3RYTC 3FVQA 1XTIA 3QXHA 1KTVA 4AC9A 2CVHA 1JNYA 1NKSA 4LJ7A 3IBYA 2I3BA 3B9PA 2FG5A 4GNKA 3H4MA 4J0QA 4TLDA 3RLFA 3TE6A 4IFBA 4YLGA 721PA 4KJZA 1S3GA 2VP9A 1Z0IA 4Q9JA 2RGCA 1KK2A 4F4IA 1W2HA 3AP3A 1DPFA 3EPJA 1JJ7A 1QRAA 4LDJA 4CVNA 4PC2A 3MD0A 2Q9CA 2V7QD 4AYTA 4C7OB 4MGYR 1G3UA 1QHGA 3BK7A 4A9AA 3A4NA 4MKFA 3N2EA 2OT3B 4PZZA 3GJ6A 1TADA 4Q4LA 4DLYA 3GLGB 1IOZA 1XB2A 3HP1A 1II8A 2QAGA 2ZRBA 3BFXA 1X8JA 2QTVB 3A4MA 4OQFA 3NTUA 1RRCA 3AM1A 4XWAA 1RIFA 2QBYB 4M21A 5J4HA 2OSBA 2GCOA 2V55B 3UMSA 3VHXA 2XXAB 2WJIA 2ZRAA 2C2HA 1CR4A 2JEOA 1ETUA 2CL7X 2G77B 4NCIA 2VP6A 2GZAA 4RZ2A 2J0UB 3IHLA 1W1WA 1G6OA 2Z83A 3BC1A 1Z47A 3TUJC 4HAZA 2ZUDA 1C9KA 4JT2A 1VCIA 4Y0AA 2F9LA 5CIWA 1YZNA 2IS1A 1W46A 4IJMA 1U98A 1UKYA 5CK4A 3FKSA 1CJKC 1N6PA 2B6HA 1KO5A 2EFHB 1P2UA 3T35A 4DCNA 1XNJA 4YMUA 4C7OA 1T8TA 4D81A 4QHYA 3ND8A 2YC4C 2ZI7A 4QNMA 1FMLA 2WWFA 1Z6TA 1VDZA 2PBRA 3B60A 3CB4A 3NBFA 3V9PA 4QG7A 4PC6A 2RGGA 3FKSD 3GLGA 3F5FA 2ZJAA 2FZ4A 4LOAA 2GEVA 3JZAA 4IEIA 3VMFA 4EFLA 4Q21A 4G5SA 3RDPA 5DGXA 2QBYA 3DEFA 1GWNA 3AH8A 1U8ZA 4TYYA 3FFAA 2O8EB 2XXAA 1JEDA 3M4YA 3NWJA 2QNRA 2GZHA 1YRBA 4NCJA 4DSTA 5JWRA 1TNDA 1ZP6A 1TUEA 2J0UA 2ZRNA 4BFWA 1B23P 1E0AA 1N6RA 4RD2A 4BZXA 1W4RA 521PA 2OO7A 4Y0VA 2NPIA 2NO1A 3CM0A 1HT2E 1IN7A 1Q3HA 1MOZA 1FX0B 1PV4A 2AFHE 4ABYA 1OFHA 2IXFA 1DAFA 2XNDA 3AF0A 2VF7A 1N0WA 4TTPA 3FB4A 3ADBA 3THOA 5SZIA 4LYJA 4MGIR 3B6EA 4TMTA 1I4DD 2QRNA 2FMXA 4LHZA 1M7BA 3BH0A 1ELOA 1COWA 3KKPA 3OIUA 3WBJA 1A5TA 5DLQC 4QM6A 3EARA 2GNOA 2GF0A 2XNDD 4B6EA 3I1FA 3CRW1 4ZDJA 1NSTA 1E99A 4PSKA 5L8VA 5FL7A 3SDZA 1AQUA 1NVVR 2K5UA 3EZ7A 3V4FA 3RS7A 2IC5A 5CB6A 3K0CA 4Q1BA 5L3QB 1XP8A 3SS8A 2O8EA 1COWD 1E6CA 5K8UA 4EPVA 4QGHA 4B71A 3VAAA 4UXHA 3OE7D 3TVTA 3A1UA 5JEDA 4I1SA 1G4AE 2G88A 3M0EA 5AR1A 3KXKA 3KKNA 2ZI6A 3PEUA 4NYMQ 4RY2A 2PZGA 2ZU6A 2CCGA 5FL7D 2V3CC 2XZLA 5F3WB 2ORVA 3VKWA 2CHVA 1F2TB 2EYUA 4M53A 4WIAA 4A0GA 3W8NA 1BMFD 1IJEA 1YZGA 4LSGA 3P26A 2R44A 1E9AA 3V00A 2R6CA 1GG2A 4ZPXA 3FDIA 4LX0A 3PEYA 1G3IA 1G7RA 3CONA 1FX0A 3LW8A 4QXAA 4ZI2A 1T3SA 3QKSB 5TV2A 2KI5A 1EG7A 5DE3A 1C1YA 3A8TA 3W6NA 3TVDA 5K8IA 4HB4A 3ZD7A 5BN3A 4ZV4A 3ADCA 1F48A 3O8CA 2NTYC 2L0XA 5CYPA 5FOVA 1YQTA 2J0VA 3GLGE 4MQBA 2DHRA 1Z0FA 3L8YA 4Q47A 5CJ2A 3AF2A 4RD6A 1A2KC 3IDQA 2LKCA 1DE0A 4IOLA 4PZLA 3GCGA 1QVAA 1CEEA 5L3QA 5TDHA 3QXSA 2OCPA 5AJZA 2VBCA 2C77A 1Z8FA 1Z06A 1DAMA 2D2EA 2JLRA 2GXUA 1GRRA 1WDTA 3KDSE 4S2EA 3W90A 1R10A 5JJLA 1F2TA 2GA8A 2V6IA 2ZVPX 4ARZB 5CK5A 5AUPB 1HYQA 2IEZA 2VIIA 5JRZA 4W7SA 2E9SA 1YRAA 1KNXA 3P1JA 1EX7A 3NBYC 1E32A 2QN6A 3PJRA 1IN8A 1L4UA 5DN6A 1Z29A 3Q72A 3QKSA 4MKHA 4B74A 1Z08A 4G0NA 4HDOB 2X8AA 4NKRA 1K8RA 1XX6A 4L5BA 1W36B 5K8LA 1FUUA 3KFVA 3OF5A 1OYWA 4I4LA 3ZH9B 1HT1E 1P5ZB 2RAPA 4OBEA 4UQOA 1WQ1R 2O0KA 4KSCA 3K70B 5JS8A 5DHAA 4BPBA 1Y63A 3DOFA 4DLUA 5DN6D 4WZAE 3U7EB 4OQMA 2J59A 4IXMA 1US8B 3QJYA 3CPEA 2PEYA 1E96A 4FMDF 4IKEA 2I4IA 2VEDA 3RHFA 2ASEA 5JFGA 1OIXA 2R6FA 3H84A 4FCVA 2BCGY 4K81B 1PLJA 1XJQA 3BXZA 3HDTA 1ZNWA 2CHQA 4MUAA 3P27A 1XU4A 2ZYVX 1E2GA 3CNLA 2IYRA 3MLEA 4ON9A 3GJ8A 5L3SB 5A0FA 1YR7A 5JMTA 2A5JA 2ZRMA 1AKYA 4CEIB 3Q5EA 3ZYCA 1SHKA 2YOFA 3QY0A 4RJLA 1U8AA 2VP4A 1FZQA 5DI9A 5H68A 1P72A 1SGWA 4JLKA 5IF9A 4AI6A 4ZKDA 3AV0B 2Q9AA 3KUDA 4Q19A 4PHTA 5FBLB 3TRFA 3TJZA 2YOHA 2CCJA 4ERNA 2NMVA 3IBGA 4LV6A 3A1SA 2F6RA 1W5SA 1OXXK 2DB3A 2BV3A 4XD7D 1US8A 4FXPA 3Q85A 2FFAA 1E69A 1FP7A 1G7CA 4XWKA 2LWIA 1P2TA 2GXSA 3CLVA 1FL9A 3SYNA 4G5RA 5CJPA 5IDVA 3K70D 4NH0A 4LI0A 1RRGA 1KOFA 2YINC 3FHOA 1W2GA 4DXAA 2Y8EA 2DFNA 5L3SA 1CBUA 4OHYA 1JAHA 4R2IA 2AN9A 4DLTA 1LS1A 1XMIA 821PA 4CEIA 5A4JA 2CE7A 3N2IA 4M9ZA 3T06B 4RZ3A 1GKYA 4L16A 4WZBE 3AF4A 4X8MA 3QKUA 4PQFA 3TMKA 2MSDB 3C5HA 2CLSA 3G5UA 4DLRA 4CRWB 1AJEA 3ZDQA 4UJ5A 2JLQA 1P73A 4TSFD 2J45A 2QTHA 1P61B 2VHUA 1V5WA 4PO9A 2VLIA 4DB2A 1OB2A 2LKDA 2FDCA 3U3KA 1E9SA 1DVRA 1JAIA 2OUKA 1DELA 3NDPA 2EFCB 1MO5A 5FBQB 2PT7A 4B3FX 1NG9A 3RC8A 3AVVA 4PO8A 3U61B 2R6AA 3W34A 3KXLA 2P2LA 1N3BA 1E9BA 1Z63A 1SXJC 5AUQA 4TLEA 1E0JA 3MWKA 2IS2A 3MAAC 3QUSA 4V02A 2ZXUA 2PJRA 2MSEB 4A0FA 2DPXA 2YHSA 2HT1A 1CRPA 5LPNA 2PZFA 4XVUA 1LW7A 1OKKD 1CTQA 3CRVA 3F8TA 2ZUCA 2IHBA 2WKPA 1P3JA 2IWRA 1S8FA 1AGRA 2DFKB 1R0ZA 2HJVA 4LBZA 4RKFA 1ZD9A 4CT4B 2CMKA 2ZI9A 3QPUA 3PFIA 2W6ID 3HR8A 3LY5A 4B75A 2QUZA 4E22A 1IN5A 2D3WA 3WRXC 1H8EA 4KU4A 3OEEA 1R5OA 2C78A 2H57A 3GJ7A 5FUXA 4IOKA 4BFSA 5B64A 1NIJA 3MJHA 4M1OA 2BVNA 2GVDC 4R7ZA 3LVRE 3X1DA 3H1TA 4B32A 1OH5A 1T4GA 1VIAA 3LV8A 3BRWD 5FBWB 4ZDIA 1H8ED 3OEED 2VHCA 2Q0HA 4Q4JB 4Q9IA 3B13B 2IWHA 4GOKA 4V0MA 3AB3A 2WWHA 5DO9A 5EQTA 5P21A 5M04A 3SC3A 3B1XA 1D2MA 2ZJOA 2H7VA 2ZJZA 4H1VA 1JI0A 2BKEA 3UMFA 3PITA 2F3TA 3EPKA 1NNEA 3PUWA 3M1IA 3WRYC 2CK3D 3FKQA 4GDFA 4P33A 2ZANA 4EUNA 4DLWA 3SYKA 3QI2A 5EP4A 2C95A 1N0VC 3QF4B 4QFMA 4BLRA 4BLTA 2IYTA 3PENA 2QAGC 3RRNA 2JJ1D 4U5XA 1WP9A 4M9QA 1DOAA 1G17A 1M1YE 1TMKA 2EU8A 1RZ3A 2IUTA 2W0SA 1E0KA 2FPKA 4JLBA 3RWMB 5HKKD 3O8BA 4M1WA 1ZCBA 2XZOA 1XCPA 3U7FB 4LJYA 3EC1A 2C04A 1JPNA 2YWFA 2XTZA 1OSNA 4UNSA 3CH4B 1ZU4A 2ZR0A 4Q1DA 3DKVA 2UVQA 1A7JA 3IIKA 4MGKR 1KIMA 2W00A 1CR2A 4D25A 3B5JA 2NO6A 5CLLA 2Z43A 4FCTA 5KUTA 4RFSB 2RGBA 4WVFA 3U6KA 4AD8A 5TARA 5DYGA 4WW0A 3VQTA 4LJ8A 4D4KA 3CZQA 3B7GA 3K9GA 3PQCA 4DKXA 1ZM2A 1WB9A 3CKLA 2O8CA 4US0R 1FFHA 1KI6B 1V43A 4JL5A 2ZI3A 2Q21A 1QHIA 4DDWA 1N6HA 3X1WA 3CF0A 4QGAA 2J5XA 2ZJ5A 3ZJYA 2ERXA 2JA1A 3P32A 4YMVA 4EFNA 4TYWA 3PG5A 3QIAA 4DDUA 5EE9A 4DUGA 3FOZA 1NVUQ 1U0JA 1N6NA 2B8WA 2ZYUX 3L0OA 1YVDA 4TT3D 2WIBA 1UADA 3T1TA 2N46A 5JHGB 2HV8A 4DWJA 3NEYA 2QMUA 2ZS7A 3QNUA 2G1JA 3VKGA 5DSZA 3AGPA 1G3RA 4ZCLA 3VNUA 1ZD8A 3I4LA 2RGNA 4B2LA 1ONBA 1S1CA 1J70A 5IK2A 3ZIAA 3EZ2A 2RGDA 4MRNA 2A3RA 1SQ5A 5HR5A 2MMCA 4RFSA 4KODA 1XMJA 1AS2A 4OKSA 4TQ9A 2OZEA 4V0ME 1CRQA 2WSMA 1G9XA 1B0UA 2HYIC 2ZSBA 5IRCD 2CEAA 4MRSA 1NMYA 1Z2AA 4Q7KA 1KK1A 4URXR 2KBEA 1KI6A 4BEJA 1Q57A 2G1KA 3T1VA 1KAGA 3S1AB 3WP1B 5AUNB 3CPJB 1KMQA 4M1MA 2JLXA 4KSBA 2BOVA 4C0QC 5H8WA 3KQKA 4I99A 3WP0A 1Z6AA 3BIFA 1R2QA 2EVWX 1RFLA 2ZIAA 4HAXA 4II7A 2O8FB 1Z6YA 4A15A 1WMSA 1SVLA 1XD8A 2IK8A 2R6GA 1A2BA 1O87A 1YZQA 5EUMA 2NO7A 4RD0A 1DS6A 5EJEA 2CL0X 4Q7MB 4URZR 1VECA 1XEWY 2FSHA 2P6UA 3U3OA 2QMEA 3MGCA 4FMCF 4LGMA 3TAUA 5GJCA 1JBKA 3BAFA 3RC3A 1ZJ6A 4B3BA 4XH9B 4H9GA 4HDQB 1G1MA 1AKEA 3VFDA 4GOXA 1TQ4A 2ZRFA 5FPHA 1II9A 3CRRA 2QPTA 2ZSFA 2GBLC 2BMFA 5LBIA 5J4LA 3O47A 2XZPA 1VPLA 4M2LA 1HH4A 4LRWA 2C5LA 2AD5A 1AZSC 1AS3A 2H1LA 5TXGA 3A58B 2QZ4A 1OB5A 2NQ2C 2GILA 3RABA 1FPMA 1P2SA 4OJKA 2WWGA 4Q9KA 3ETLA 3LVQE 3S1AA 4QGGA 3AVOA 1K6MA 2RGAA 2IYQA 2IYWA 2H16A 4A82A 4KFTA 4MH0R 4W9MC 1G64A 3AKCA 1OXSC 2JCSA 2XTMA 5FPKA 1E9DA 2GJAA 3UPUA 3C15C 2F3RA 1ZC4A 1PJRA 2FPLA 1EGAA 4Z54A 2GWHA 5G3YA 1OF1A 1FP6A 4HYYA 5BYKA 2GJKA 4P32A 2C9YA 4A6XA 1F60A 4KXFB 3GJ5A 4JLVA 3NHAA 3GLHB 4JVLA 1E2LA 2JLZA 1NN0A 4HUTA 4EPYA 1FTNA 4NYIQ 2F1RA 3OAAA 4ASUA 3RS3A 4DT1B 2GEUA 2QSZA 1NN3A 3CX7A 4AURA 5F9HA 1N6OA 1GNQA 2OBNA 2OFWA 4H1UA 1KMHB 4KI0A 1IY2A 5TB5A 1CR1A 4M9SA 2PH1A 4C4PA 4ASUD 2B92A 3UWOA 5D3MB 1RC8A 3DVLA 1K5DA 1TU3A 2WTUA 2SHKA 2X1VA 2MSCB 2QG6A 3LBHA 3QG5A 2ZJYA 5HE8A 3QKRB 1AZTA 1SXJD 4TYPA 1C4OA 2PZEA 1SKQA 3SNHA 3MCAA 4MITA 3WNBA 5EP2A 3H86A 4A36A 1RKBA 1ZVQA 2O8DB 2V7QA 2VP2A 5JECA 4TMZA 5H70A 1FW6A 3IO3A 2NG1A 2V1XA 2ZE5A 3DM9B 1ZM3A 1RYFA 2QQEA 3K09A 5EE3A 4EJSC 1G4UR 2VF8A 4TYNA 4F92B 3I72A 4GRAA 1OXVA 3W6PA 3BERA 3RAPR 1OXUA 2ZSDA 1H8HD 3GLHA 4UNPA 5H1YA 3SQXA 1ZM9A 1DO0A 2HEIA 1U99A 1EFHA 1Z22A 4OYHA 4LBVA 3ICEA 1MRSA 4DT1A 4TTQA 4Z51A 1P62B 1I4TD 1TF7A 2GZDA 2NZJA 5C4MA 1UBCA 1W4BA 4OJQA 3VR6A 1KMHA 4XSGA 5JBQA 3I73A 2FGKA 5FBVB 4A8JC 3THXB 5HE9A 2ATXA 2HLDD 5BW8A 1HTWA 4TLAA 1OHHA 1QHYA 1VHLA 2WPDA 1QHXA 3A37A 3U4QB 1HUQA 1XMSA 2FEMA 4LBYA 4LJ6A 5D3MA 3QF7A 3SR0A 3FHTA 1NVXQ 4JT4A 1HY3A 1KSGA 3EPLA 1N2CE 1QVRA 1UKZA 3CWZA 3U44B 1GDDA 4BZPA 4DJTA 3EW9A 3DOEA 3QKRA 2XOKD 4OK5A 2QROA 1OHHD 2V6JA 2WPDD 3IQXA 1L8QA 4HAVA 4PAMA 1OFUX 2O8DA 2KJQA 4QNRA 2EWVA 4Q1EA 4QBFA 2B21A 2W6JA 4JLPA 1Z6GA 5EZ5A 3AVPA 2VSFA 4NZYA 4MRRA 4R9UC 4KVAA 4P3YA 1CR0A 1EWQA 1ZUIA 4US2R 1TF5A 2FOLA 3GJ3A 4OQLA 3FMOB 4DCVA 5BQ5A 3FYHA 3MWLA 4FN5A 1RJ9B 1OJLA 3A1TA 3A1VA 4BLSA 2W6JD 2IS6A 3Q9LA 2VL7A 3KQLA 2JASA 2UZIR 1ZBDA 1Y3AA 2ZI5A 5FR2A 4ACBA 4KITB 1VYVA 5KDDA 1XTQA 3AP1A 1DG3A 1N6LA 1ZNYA 2OEPA 4B33A 5BWMA 3THXA 5JRJA 4DLXA 1E2IA 2HCBA 2BIFA 5JCZA 3FMIA 4BRWA 4Z1MD 3U4QA 3Q8XB 2WSSD 4BASA 1NMZA 2XITA 3KKOA 4V0KA 1U2RA 3DPUA 1O3YA 1UDXA 4JBXA 3ECCA 4AG6A 3U44A 4CIDA 3SQWA 4BZQA 2WKQA 3QBTA 3AVYA 1E1RA 2V54A 1NMXA 1IXSB 2OLKA 4QRHA 2D7CA 1II0A 2DCUA 3NVAA 2Q3MA 4DLVA 2HJGA 4KBGA 1A82A 4JSTA 4QJ5A 3RSLA 3OIWA 4L4UA 3GFTA 1E1RD 1Q1ZA 3I62A 2MMGA 2GKSA 3L43A 3GLHE 2GEDA 2R65A 4NE2A 4OI1A 1RJ9A 1HE8B 1TPZA 1GILA 2C96A 4RD4A 4ZDWA 4ZCIA 4C0BA 3AEZA 2W58A 4A2QA 4Q18A 4JJKA 5IT5A 5JJIA 1HQCA 2G83A 4JYBA 3OE7A 4LPSA 4BGDA 4ZO4A 4IW3B 4JKYA 4Q7JB 5FPSA 4M9XA 2OV2A 4W5WA 2FFHA 5LD2C 4O0MA 4N1AA 1R8SA 4GI7A 5JS7A 3KJGA 1LNZA 3VR4A 3OIVA 1BMFA 1AIPA 1MH1A 4GL2A 3PIRA 2W0MA 3LXXA 1Q1EA 5CITA 1G20E 1NJFA 3T1QA 3B1ZA 2RHMA 3TSWA 5SZHB 2HF9A 1JQLB 2IS4A 2IX3A 4KAXA 1E2EA 4P0TA 3MRSA 3CNNA 4OK6A 1EK0A 1GNPA 3UXMA 3U6BA 2OG2A 1E1QD 1GL7A 2QMOA 5KSOA 3ZLJA 1QHHB 4DEYA 5E7MA 2RB4A 4PXAA 5ELXA 2J41A 2R2AA 1W0KA 4GBMA 1UEIA 3ZVMA 2QRZA 4BFYA 2G9NA 4AKEA 1XCGB 4LJ5A 3ASZA 3VU9B 1VG9B 3HU1A 1HURA 5HTKA 5SZKB 4M0LA 1W0KD 2DFTA 5F98A 4HZIA 1JQJC 2FNAA 3KZ1E 1DADA 1ZNXA 2DBYA 4TYQA 5KDLA 3ICQB 2G0NA 3PCRB 1W49A 3GLIB 1GZSA 5F9FA 1VIYA 1SVKA 3I5YA 2AFIE 3NH6A 4L8GA 3GJ4A 4LK2A 1OV4A 4CGZA 3TKLA 1EFCA 4FINA 3TSZA 2H18A 2UZ3A 2A9KA 3FPAA 1KSFX 4DC9A 1KK3A 4DHEA 1HEIA 3MUFA 2J7PD 2FJUA 4GP7A 5JCPA 2O8BB 2YVUA 1YHNA 1TQ6A 4AYWA 3PVSA 4B3CA 1OH8A 2QE7A 3NKVA 3KB2A 4MYUA 4QL3A 1QHHA 3DKPA 1E3MA 4DRZA 1BKDR 1XCMA 3VKHA 1TF2A 2Q3HA 4OHZA 5JJKA 2FPMA 2OFXA 2GDJA 3NBXX 4G3XA 3VX3A 3VU9A 1KSHA 2QE7D 5EE0A 4F91B 1U9IC 1I2DA 3SBEA 2RHDA 1E2QA 3RRYA 1A1VA 4ACAA 2JIZD 4KYUA 4Q1AA 4TN1A 3T61A 3BFKA 2H17A 2XNSA 2ZYTX 1N25A 1RYHA 4F93B 3WNDA 4EIWA 3RS0A 4NYJR 3GLIA 3PUXA 1PVOA 2R6DA 4NYIR 1F5NA 2DWQA 5FTJA 2XX3A 1E2DA 4A1FA 5LB4A 2VRWA 6Q21A 4LYFA 2OESA 3CRMA 3AUXA 5FBRB 3CF2A 4NONA 4ARZA 5JLJA 2W2VA 2FFBA 3OESA 4P4UA 2ZS8A 3QVVA 4B6FA 4ZCMA 2CHGA 3LFUA 2KE5A 1DARA 4A4DA 4MDFA 1UJ2A 3A36A 2O8BA 4XOIA 2BWJA 3NG1A 2O0HA 3SU8A 1TU4A 1EFTA 4Q48A 4XD7A 4IFEA 2EFDB 3AKYA 4P4TA 2GK7A 1G3QA 2V1UA 5GJBA 2YOGA 2EQBA 1FMJA 4NU0A 2WBLC 4PTLA 3KQUA 1I4LD 4G1UC 1JXOA 1Q20A 4X8LA 3JVVA 1E9EA 4NCHA 1J2JA 1T3LA 5G3ZA 2BHRA 2VP5A 4A6PA 1MRNA 4F4CA 3SJCA 4CW7A 4QC2A 3B82A 4D4LA 4RCZA 5C4GB 2PEZA 1EESA 1DAKA 2BC9A 3WYAA 5TVKA 3P4YA 4BUJA 1OPXA 2A5GA 2A78A 3EZ9A 3TUZC 1SULA 2ZVQX 3O8DA 4KLZA 1ESNA 5BN5A 4MUBA 1KK0A 2WWXA 4BLOA 4TSFA 1VG8A 3N5CA 4U00A 3RWOA 3ZVNA 3FMFA 3SFZA 2G0TA 2GCNA 4IDHA 1BS1A 1Q22A 3ADKA 1LY1A 1VG0B 4QGFA 4C0KA 4C2UA 2ANCA 5B30A 1A4RA 1YR9A 1G5PA 1DAHA 4JVNA 4AKGA 4DLZA 3KQHA 1GL6A 4RZUA 3L8ZA 5CB8A 2FGJA 2QGZA 4LUCA 4B43A 2OCYC 4BLPA 1XPUA 3AF1A 1T3HA 3EWSA 1U81A 3LX5A 1IXZA 4RVCA 3SYLA 4LYHA 2AD1A 2F1IA 1XWIA 5JI3E 4MDEA 1MO3A 3I32A 1ZM4A 3Q7QA 1FOEB 4JBWA 1OKKA 3SN6A 1G7TA 1QHSA 3UKDA 1DG1G 3K9HA 4V03A 3ZQJA 2ZRDA 4B48A 2H92A 3BD9A 4HUQB 4BFVA 2AWOA 3F0TA 4JS0A 5KHOC 1VCNA 4JL6A 3AVWA 2W6IA 3QEJA 3U7HB 4KHZA 4GFDA 4IDNA 2VYFA 3LBIA 4UNNA 3GLIE 1IM2A 1ZRHA 1NKTA 1CJUC 2OE2A 4GPTA 3UG7A 3TGPA 1RPZA 1DAEA 2Z4RA 1IBRA 421PA 1ZW6A 1M8PA 2VO1A 1E4VA 1ZUNB 2PMDA 3C14C 4BE7B 2O0JA 4NP6A 1NY5A 3MWYW 1NF3A 4PC3A 4Q00A 1DAGA 2ZE7A 4K46A 4LJ4A 4JVSB 4O2LA 3QSYA 4GP6A 1YR8A 1KI9A 2HXSA 5FFMA 1XRJA 4Q01A 3WMGA 1S3SA 4BFUA 4LHXA 1XJ0A 4YMTA 2CJWB 3W9YA 2ECKA 2BM1A 3AP2A 2DY1A 3B2EA 5FI0B 3OFND 4TTRA 1KO8A 4EPWA 4C0LA 4NTZA 4OI4A 2GAOA 3KJEA 1P6XA 1W0JD 2CLCX 2CK3A 4HDCA 5L3RA 2P6NA 4Z8XA 4PC1A 2XB4A 121PA 1NBMD 2B7BA 2DR3A 4P31A 3KKQA 3OZXA 3IKJA 4JVMA 2JJ1A 2OHFA 2IUSA 2QSYA 3QVUA 2YYZA 2JLUA 5HKKA 3WY9A 1QZXA 4LJAA 4C2TA 3ZQ6A 4MGZR 1FQJA 2FSGA 2EWWA 2GCPA 3CH5A 4GT1A 5AJWA 3B78A 4EFMA 4EPXA 1MABB 2REBA 2WM9B 3R7WA 4MRPA 2CNWD 3H0KA 1E2KA 4WOPA 1OFIA 1R5NA 1R0WA 2GK6A 3C5CA 3KJIA 4KLNA 1FNMA 1PUJA 2A5FA 3DHWC 4CT5A 4ZDKA 3TR0A 3FGNA 3KQNA 4DCSA 3QG1A 5KSPA 1M6NA 4NYMR 2QP4A 4B2PA 1GTVA 3OIYA 2BBOA 2AR7A 2JJ2A 4HB0A 2QY9A 4HEJA 5ANRB 4NL4H 1JR3D 3U3MA 4Q4JA 2EW1A 1NY6A 3W5JA 3EASA 3LD9A 3AVQA 1E2HA 3QEOA 4XIGS 4OK3A 4YXWA 5HCNA 4V0OA 2JJ2D 3ZZUA 4B2IA 4FIDA 3R9XA 2VHJA 5FTMA 4TT3A 5KOYA 3NBZC 4G5OA 1ESMA 1XFAA 2IYSA 4A92A 4HLUA 1D5CA 2V9PA 1ZC3A 4FI3C 2QM7A 3PXGA 5CM9C 5FTKA 3QF4A 4W5JA 5JSZB 2XJ4A 4YXWD 3GP8A 1Q0UA 1NIPA 2B8TA 2FSFA 3DMNA 4E5UA 4BEBA 2GJSA 2W2XA 3A1WA 4YDHB 2J87A 1MABA 4PPGA 3LO5A 4IDOA 3Q5DA 1SKYB 3KL4A 1Z0DA 2FE4A 2HF8A 1CULC 2WJHA 3I3SR 4C0JA 2WMNB 2REOA 4BWYA 5FH9A 2DYKA 4WXRA 3QQ5A 4KYIB 3K0AB 5BN4A 3LQRA 4WBSA 4EKDA 2JLWA 2PLFA 1FUKA 1G5TA 1KI3A 1IN6A 3RSOA 5KNCA 3LLMA 1TEXA 3ONWA 4LV5B 1RE0A 1HE1C 2O5VA 5L3VA 3TAHA 3MFYA 2D7DA 4OHVA 4BECA 1T0JB 2ZREA 1VKJA 5GVRA 5KDOA 2XB2A 1E9CA 2Z0MA 4B76A 1KNQA 1NVVQ 1IHUA 2ZUBA 1XZQA 1OFTA 1VTKA 2IYZA 3PV0A 4HZUB 4QJ4A 3RNLA 5KPJA 1QF9A 1W44A 2VHTA 3E5HA 3LWNA 4IDQA 4O25A 2REXB 3KTAB 4QBIA 4XTCS 5EUQB 3KKMA 3JVUA 4POAA 4YMSA 4W5HA 4Q66C 1JB1A 5JSZA 2C03A 2J0QA 4GMDA 1NLYA 3CPHA 4CDGA 4ESHA 3ZS8A 2EFEB 1OLOA 4TMWA 1CJTC 4JJZA 2IYUA 3PR1A 2NO0A 1ANKA 5JHHB 4FWIB 3K0CC 4UXJA 1JEEA 4U02A 1GITA 3TR5A 2WHXA 4F7WA 2NGRA 2OILA 1G8PA 3U5ZB 1Q1QA 3Q3JB 3K0AA 5CYOA 3B85A 1GNRA 2CLDX 4DSOA 1W7AA 2GJ9A 2OAP1 1F6BA 4K8OA 4TZ6A 1W5TA 4Q1FA 1P9NA 3W5IA 3QXJA 4Q9HA 1ZAKA 4PANA 3DM5A 1R0YA 1OH6A 1KAOA 1KI4A 4NDZA 1CU1A 1GKIA 4JSYA 1F3OA 4XJXA 3BFVA 4DBLC 1SXJB 1E79D 1YR6A 5F2EA 5FOUA 4HZUA 5G40A 1P9RA 2WKRA 1X1SA 2ZAOA 3GEEA 2Q6TA 5AUOB 5KNBA 1T8UA 3CUEF 3HYRA 3KTAA 5HCIA 2QM8A 2QGNA 1Z0AA 5HZHA 1GP2A 3TK1A 2ZE6A 2BDTA 1DBSA 5GADl 5B58C 2O8FA 2AXPA 5J40A 4AKHA 4GZMA 4LY6A 1G7SA 3CWQA 2EYQA 3K9NA 2ATVA 1SVOA 2IYVA 2P65A 1T5IA 2A5YB 4EAQA 1G16A 4BQSA 4CF7A 2P5TB 1YZLA 3IHWA 3KXIA 3ND9A 1S0UA 4RCYA 4X8HA 4JKIA 4BLQA 3DMDA 3SHWA 5DHFA 2XJ9A 1CJMA 4PAOA 4A0RA 1CKEA 3W3AA 2FN4A 3BB1A 4FMBB 3U3JA 1ZMXA 2QENA 3KFXA 1EWRA 3BGWA 4URWR 4UJ3A 4IDPA 4G5GA 4DSUA 1MV5A 4YONB 1U0HC 4IXNA 1KKMA 1QG4A 2JLSA 3W8RA 2BMEA 621PA 3CF6R 1SVSA 1SXJA 5E7IA 2J46A 4PAQA 4PR0A 4YMWA 2QT1A 1AM4D 1W47A 3EA5A 3B1WA 1U8YA 4PSVA 5EE5B 1EX6A 2WOOA 2GF9A 3DL0A 1XXHB 3MSXA 4DSNA 1PLLA 3WXMA 1JPJA 1H65A 3KB1A 2A2ZA 2XEXA 1H8HA 2BEKA 3EXAA 4CEHB 1Q12A 3LNCA 5JEEA 1UBGA 1YU9A 3D8BA 1P9WA 4M1TA 2QAGB 2PMKA 4D0LB 1SKYE 2ZRIA 4B3DA 2KWIA 3TLXA 1R7RA 1X1RA 5B2ZA 4DCTA 1D9XA 1KHTA 5IHPA 1K5GA 3BH6A 1KJYA 1IAQA 1KO1A 1D2EA 1NJGA 5FL3A 1CXZA 1UPTA 2AHOA 3RANA 1KI2A 3T34A 2HLDA 3I92A 2D4HA 2J0SA 2HUPA 1LS6A 1R8QA 2UKDA 1I2MA 1SVWA 5KTYA 2EFGA 4A2PA 4N0EA 3VTKA 3E70C 5G53C 2ZEJA 1F2UB 3UK6A 1LF0A 2XOKA 3A4LA 1X8LA 4Q02A 4E09A 4F4JA 5AJXA 1XD9A 2WICA 2W83A 2AKYA 1W36C 3QPWA 4QBGB 4A0HA 4TL9A 1XXHA 3G0HA 3IEVA 1MR3F 3K70C 4JLDA 2ODNA 1DEKA 1J8YF 1OIVA 1Z3IX 4QHSA 4CEHA 1NSFA 2F1HA 4RD1A 4L9WA 4LHVA 4HATA 4RD3A 1GIAA 3CZPA 4TWZA 2B7CA 3UG6A 2Q3FA 4JLOA 3ZD6A 3G82C 2GXAA 1UFQA 2P3SA 3NC1C 3QOFA 2GJ8A 2P67A 3SBDA 1IQPA 3I8SA 1CS4C 4Z1MA 4Q5IA 4PHGA 5C1BA 2KSQA 2WSSA 4MRVA 4BRUA 2YWEA 1W48A 3BB3A 5JWHA 4AWXA 1JR6A 1F2UA 1KDRA 3LXRA 5EXPA 1OYYA 2NO9A 3EC2A 5DNYB 5CIQA 3GLFB 3CO5A 2OXCA 3OEHA 4WZ6A 4MYTA 1SXJE 1E4YA 3LRPA 1KO4A 1XEWX 5B57C 4E03A 5LB2A 5KU1A 1OW3B 1SVMA 4TQUS 2QPOA 3BS4A 1G8FA 3GFPA 4KCGA 5EE1A 3QXCA 1DTSA 1YKSA 5FR1A 1R4AA 1KDTA 1IY1A 3OEHD 4B3GA 2AX4A 1CF4A 4KBFA 4OHWA 4LCBA 2D06A 1LVGA 1M34E 3PUVA 2AK3A 1G291 5KSZA 5EZ6B 3IO5A 2C8VA 2AXNA 3K9LA 2GRJA 2DFLA 3GD7A 3ZGXA 4JMPA 1S4QA 1YZUA 1OH7A 3AVTA 1S2MA 4NHOA 5DH9A 3EG5A 1ZYUA 1XD2B 1WCV1 4G01B 1KO7A 5DI3B 4ZKEA 4BFXA 2BMDA 2FX3A 1OE0A 3I5XA 2WZQA 1CLUA 1FQKA 1N5LA 2YNMA 2ZPTX 3HWSA 4AIIA 5JWOA 3THYB 4A2WA 4I1VA 1J8MF 1XDBA 3W3ZB 1MO6A 3IUYA 4TZ0A 4V0LA 4TL8A 2BCJQ 4MKIA 5FI1B 2ZYWX 3THWB 4HLCA 3CX6A 4FD2A 1L7VC 3HU3A 2CDNA 3GLFA 2PL3A 5FOTA 4DLSA 5JI2E 3C4JA 4PFSA 3WYGA 2G3YA 2E1RA 3D7MA 1Z28A 1JALA 4YDSA 2IT1A 2Z4SA 4ILEA 4B47A 4CYMA 2X2EA 4MKGA 5EP3A 2X19A 1EXMA 1XXHE 2HT6A 2WMOB 4QOSA 1XTRA 1E1QA 1G8HA 2KB0A 4D82A 3LA6A 4WXPA 1PLKA 1M74A 3NHBA 3C8UA 3BBPA 4IOJA 1HQYE 2VTKA 1KKLA 3IPXA 1GVNB 4M22A 2V8OA 1VCOA 1RRFA 2A30A 3FE2A 3AVUA 2FA9A 2NPFA 2HYDA 2ZTSA 2QAJA 2WAXA 2FU5C 4LPKA 1R5BA 2JDIA 2D2FA 1XD2A 5DI3A 3D3QA 3X1XA 1TQ2A 4WAUA 2ZE8A 4AY2A 3VX4A 3THYA 5SZJA 4DVGA 1VCMA 1SZPA 1ZCAA 4WA7A 5E7JA 2JDID 2GBLA 1VHTA 5EXSA 1BIFA 1NRJB 3THWA 4LC1A 2OM2A 4LHYA 3HU2A 4PQRA 3K0SA 4O3MA 3E1SA 4LYAA 2Z6VA 2ERYA 1WA5A 2VSXA 1KSJA 1R0XA 2C9OA 4KFUA 2J7PA 3GEIA 2ZJ2A 4PX9A 5FUVA 3TBKA 2NZ8A 1AQYA 2AWNA 3IIMA 3L2OB 4GSYA 4ITRC 2YKGA 1UM8A 2Z5FA 1G6HA 5HPYB 2QPAA 4DDVA 4MYHA 4O2RA 5AK0A 1S96A 2BKUA 2ZS9A 4PPFA 1CIPA 1E98A 2BBSA 5LDDC 4EPTA 5KYKA 2AKAB 2FFQA 4D4JA 2RKOA 1LFDB 2IHYA 2ONJA 4PPQA 1XTSA 4Q7LA 4EJSB 4YQFA 2GETA 1Z0KA 8OHMA 1GFIA 4HLUC 2OAQ1 3TW4A 3VR2A 2JATA 2CXXA 1KI8A 1S9DA 3QBVA 4JZKA 4N3NA 4XTRA 3EAQA 1T6NA 2BJVA 5EXTA 2JIZA 4PHHA 5GVSA 4QJ3A 1TUIA 2OBLA 2I1QA 1IN4A 1HA3A 1XZPA 3GJXC 4R2HA 4HAYA 4UNQA 4KO8A 2HCJB 4I1UA 2NOAA 4AKIA 1U94A 2F7SA 4HI0E 4IRUB 2IUUA 3REFA 3GLFE 1IY0A 1KZ7B 1CP2A 1RRPA 4LJ9A 1L4YA 4A8JB 3BOSA 3TIFA 1E9RA 1G8YA 1G18A 1VYTA 3EIEA 3BB4A 2ZSAA 2RGNC 3GEHA 4XVQA 4DIDA 2QI9C 1Z0JA 1LB1B 5J4KA 5EXXA 2J7KA 3VHLB 3IGFA 2IW3A 1E94E 3BH7A 2VA8A 3U3RA 4B35A 5EP1A 2JLVA 4IOMA 4DCUA 4PQYA 2VPPA 2PLRA 1Q1BA 4LZZA 1VYUA 1JJVA 3RRMA 3UWKA 2YC2C 3UATA 4KV9A 4EJSA 2QEQA 1G21E 1M2OB 1DAIA 1KY2A 1PZNA 2GESA 2WOJA 1KDOA 4URUR 2ZETA 3U2QA 2RCNA 1CJVC 1R6BX 1ZUHA 221PA 3BJIC 3T5DA 5D3QA 2BBTA 2JJ8A 4I81A 4JLAA 1WXQA 5CLQA 3TQCA 3GPLA 3GJ0A 3CBQA 2QP3A 2ANBA 3DO6A 3PUZA 3EWAA 4TLCA 4FMCB 2JLYA 2TMKA 3CIOA 2FWRA 4M1KA 1G3MA 1YJ5A 1ZD1A 5AWFC 1WBDA 3DZ8A 2CBZA 3L82B 3R8FA 3ADDA 1U90A 4HAUA 2VSOA 2W2TA 1ZNZA 2PCLA 5KSYA 4A8JA 5CDFA 1JECA 4TMXA 1ZINA 2FZLA 3AKEA 3UIEA 2Q9BA 3IEUA 2GAAA 3W6OA 1D8TA 1P7CA 4R98A 3M6AA 1D9ZA 1P75A 2QU8A 1N5IA 3ZZ0A 1YZKA 2IYYA 1KJWA 1Q44A 2IF0A 4URVR 1GM5A 2WJYA 4D26A 5FPYA 3GFOA 5GJWC 3CR7A 1FNNA 3SOPA 3IQWA 1J90A 1GOTA 3CX8A 1W36D 2CL6X 4QBHA 3UMRA 2BBWA 4HLDA 2IYXA 1E2NA 2ZU0C 3TNFA 1EFRA 5FTNA 4OI2A 1MKYA 2QTFA 2F9MA 2X2FA 3SJZA 5KO2A 1LV7A 5A5GA 5DISB 2YZ2A 3EA0A 2AK2A 3J81k 3L0IB 3T1OA 4PPNA 1W4CA 2J1LA 4LBWA 3OHMA 2WJJA 2ZRJA 3B9QA 4C30A 1EFRD 4GMXA 4URYR 3LDAA 3EZFA 1XEFA 2P5SA 3WMFA 4S35A 2F43B 3QENA 1WF3A 3SE0A 2RGEA 3LBNA 3C7KA 1E2FA 4PSAA 4AG5A 3ZVRA 3WYFA 1P4SA 1UEJA 1XJCA 2GHIA 3KUCA 4XSHA 1TAGA 2N1BA 1NLZA 5LD2B 2BMJA 3WBKA 1RVDA 2HDNB 1VG1A 1U0LA 3FWYA 2WV9A 2DWOA 3JZMA 1XBTA 4FCWA 4PO1A 2ODBA 2VP0A 2YWHA 5DIFA 1WBBA 4UXIA 3U7GA 3VR1A 2JGNA 4LV8B 4FW9A 1QDEA 3LH5A 5FUWA 3HPQA 2E87A 3OFNA 3IPYA 2PCJA 3WMEA 1W4AA 1IJFA 1UF9A 2ZI4A 1AA9A 1NP6A 4X8OA 1J7KA 3B1YA 2HXYA 5J5CA 2FEOA 5FUYA 2GVZC 2ZR7A 4ESVA 1W0JA 1X8KA 3HR7A 3ZZTA 4HAWA 4Z8YA 4OHXA 1Z83A 4PZYA 2ZITA 4C0SA 3VNVA 4JBYA 4IEEA 4EQ6B 1SHZA 5E95A 1NBMA 1MT0A 2BM0A 1G8GA 2D62A 2P6RA 4M8NE 3SJAA 4R71A 3GMTA 1AS0A 2O52A 2OLJA 4NMMA 1DO2A 5FPTA 3K09C 4Q9LA 3T15A 2F43A 1SVIA 1NI3A 3LX8A 4PHFA 4YC7A 3R9WA 1S9HA 4XWOA 3TH5A 3DZDA 4HSEA 4NBSA 1UKVY 3SEAA 2ZRCA 4HUQA 1T0HB 3WNCA 1PUIA 1UDWA 3FMPB 4GOJA 4M4SA 5CDFE 5HZKA 5J4VA 2FH5B 4Q03A 1UKEA 3R7WB 2CNWA 1BYIA 3KJHA 2PJZA 2XAUA 4N0DA 3GQBA 4D6PA 5TY0A 1T91A 2N42A 2RH5A 2V4ZA 5C18A 3FFBA 1TL7C 4B34A 2YJTD 2JAQA 2YWGA 1Q21A 5JZVA 3REGA 1GKUB 3CNOA 2OXRA 4C3ZA 5UKDA 1JR3A 2XGJA 1GRQA 2WWYA 3LW7A 2O8CB 2J3EA 1GL9B 4PC7A 2PX0A 1YE8A 1KI1A 1KJZA 5C2JB 5TMPA 1E2JA 3HPRA 4NCNA 4F38A 2QL6A 2CJWA 3AKDA 3X1YA 2XTNA 1TX4B 4EQ6A 2ZRGA 1KDPA 3CR8A 3NXSA 3TUIC 1S1MA 1BH2A 3ASYA 3KX2A 3N70A 3I8XA 2XSZA 1NVWQ 1N5KA 4TMKA 5C46F 5E4FA 4E07A 3LLUA 4IVRA 5AJVB 2IXGA 1E2MA 3NC0C 3RVBA 1OT3A 1N0UA 4JLNA 1LTQA 4KFSA 1E2PA 4JYCA 3HJNA 4TQAA 1E0SA 2H5EA 2ODEA 2QT0A 3MWJA 4M1SA 3TSOA 3L0PA 3RS2A 3MJRA 1NN1A 1G41A 2XSZD 2IA5A 2ZR9A 2R9VA 1T9HA
chains in the Genus database with same CATH superfamily
1WMAA 4GU5A 1GFZA 4ZI5A 3HXKA 1MA0A 2UYYA 3D8NA 4MA4A 3NYRA 4B5KA 3H9GA 2FPSA 2ZJ8A 3ZTTA 5BYJA 4J7CA 1A9YA 1H23A 1W87A 2XW6A 4WBXC 1W75A 1OXTA 7MHTA 3R24A 3L7BA 3EIQA 2CVFA 4LZAA 4P98A 1WP4A 3QE0A 1AN0A 4G85A 4HC4A 4TTIA 1TTTA 3A26A 4ZZIA 2ONKA 3AVXA 4JLUA 1I0IA 3Q7PA 1ULHA 3TOVA 2CZCA 2JFYA 4MCIA 4WT7A 1IH8A 1FDWA 4B6GA 4OX9B 1K8ZB 2BPOA 2ZRLA 4RY0A 1P9OA 2J9RA 3FUVA 1QH8B 4OL0A 3UUEA 3RS4A 5ED4A 4L7QA 5GJVC 3U4IA 1WE2A 4BC1A 1YDHA 3HYTA 3MGKA 5H3LA 2FX2A 3LXMA 5B7NA 1YZTA 3K6KA 2PBFA 3WZ2A 1N6IA 3H4IA 5AJYA 3M33A 4MVXA 2A7QA 2FPRA 4QTYA 3BXXA 5CTJA 4FNOA 2NZXA 3BK1A 3R3ZA 4L9SA 4NFHA 3IQIX 3DZBA 4G5QA 3JALB 5BRJA 1D03A 5TLSA 2BYTA 2V97A 2BFWA 2OCAA 4B76A 1EM8B 3HZRA 4EEXA 5CD1A 1P60A 3O3NB 1QV6A 3ZWOA 2VZEA 4UHJA 3UAVA 1NT2A 1G19A 1Q7EA 3R5TA 4DEXA 4EPRA 1WHSA 3MPUA 5FUBA 3A6PC 2EV9A 2VQSA 5IVPA 4JFAA 4MHOA 3PUYA 4D4MA 2VTDA 4YIKA 4R31A 1GRNA 4NXNB 2X5OA 1BFUA 1NP7A 2PX3A 3AR7A 3CISA 1JMYA 2ZAMA 3C1AA 1M8KA 3K0FB 1CZLA 4MUNA 5DHRA 2RGXA 2C8KA 2E4AA 2LUOA 2OCBA 2YWXA 3PA8A 5IJAA 1W19A 2VAVA 3BYZA 3EZ6A 5EFZA 3T5GA 4AICA 1YL6A 4ER3A 3ZVKA 2GASA 3TRHA 4DZRA 4CEJB 5BSWA 2I6QA 1CDZA 2Q9UA 1LX7A 3DOIA 1GTG1 3GVCA 2R62A 3R20A 3G9TA 1XAGA 1Z5ZA 5CLGA 5AKHA 3UHAA 1V71A 2BLNA 2VP3A 5EA2A 2NV6A 1CVIA 3GHHA 4I19A 5F5NA 2HQBA 2Q2OA 3KOUA 1X92A 3IURA 3LUAA 2B8NA 2IYLD 3NHZA 4LHEA 4NZOA 2B5VA 5IFKA 2B4TO 1KXJA 3UANA 2QMHA 2V98A 5AI4A 3I2KA 2WHRA 1P8AA 3PC8A 1QBKC 2WF5A 3BA6A 2OBMA 3LPDA 1QH9A 2JIOA 1BOFA 1T6YA 4TL6A 1WRBA 3F6EX 4FFPA 1SMKA 4Q1CA 3LSTA 3TBHA 1HV8A 5FEUA 3L0SA 1HF3A 3DMTA 1TVMA 3FVRA 4C0HA 3L7OA 4S12A 5MGBA 1ZISA 3AYZB 4OI0A 3B8HA 1M7HA 2GBGA 2W2QA 3LECA 4NI5A 2L19A 3DG9A 1CERA 2HA6A 1QLJA 5BV0A 5BPHA 4Q3AA 4HF7A 3P20A 3CV3A 1VJRA 2WVJA 3IRUA 2QTRA 5HW0A 3VTFA 2Z56A 1WXFA 4ED9A 2Q3BA 4XVRA 5DGCA 3DDHA 4M7OA 5BSRA 3FW1A 4HLQB 1SRRA 1GUAA 4Q82A 3O21A 1WDWB 4KVGA 3L0DA 4QUIA 4RWZA 1Z2CA 3ROEA 4Q39A 1QQTA 2BJWA 2CSUA 3E0XA 2CNKA 1U04A 2PRKA 1KC1A 2P9FA 3LUFA 4NESA 1BCRA 1GY8A 2OHIA 1AZWA 3Q12A 4G0UA 2Z04A 3HCCA 3AERB 3K0EA 1NYQA 4R8SA 1PKXA 1PWXA 4DV5B 4RDXA 4BBJA 5HM8A 2O2YA 4CKBB 5J4YA 3BE4A 4G4SP 5AM3A 1FDUA 2FSIA 3OZCA 2EZ4A 5DP2A 5IDQA 1Q14A 4ZI7B 1R4NA 3BWVA 2VJKA 4DRXA 2CNLA 1XVLA 5C53B 2O1EA 3FUWA 3DOUA 1QANA 1PQUA 3RVJA 1I1HA 3OJCA 4IRXA 2Y9PB 3T9BA 1O9GA 4F7DA 5E3HA 5K6AC 3LYUA 4RZSA 4KFRA 1EBFA 3AFHA 2IX9A 4IQ4A 3RBZA 3H65A 3AGQA 3LQ4A 1ZVVA 1SG6A 5EJIA 5INTA 1P4GA 3EBOA 4DM7A 3UWMA 1VLLA 2HU2A 4WCVA 3UXHA 1JQ3A 1YDFA 4DQLA 2I2FA 2QP9X 1I33A 4BQRA 1YQGA 4JIMA 2CY0A 2PUWA 3LQQA 3FUTA 3PNSA 4P84A 1JFRA 3TLJA 5GZ3A 2A0WA 1D6NA 3V8MA 1R9JA 2BKXA 1BO6A 3JD0A 2XAAA 4NYJQ 4O2BF 1XNGA 4X3PA 2PZMA 1N3IA 2Q5OA 2LCFA 2RB5A 3FR8A 4NQRA 1YCFA 3TXAA 1GKLA 2IDMA 5DX8A 4MW2A 1LPAB 3CW8X 5TQJA 2J4CA 2VLBA 2X42A 4MS3A 4O1IA 2O7RA 3UK1A 1M1NA 4IIFA 3KQOA 5TNXA 4AJKA 5CJJA 2ADMA 2ROQA 3AUYA 3COPA 3IMKA 4ND3A 4L15A 3MCZA 2ID7A 2SICE 2CDRA 2WHPB 3K6JA 1L5YA 3OAAD 4RS3A 1T5LA 5BSTA 1YS4A 2LPMA 4MIOA 3H3JA 2AXEA 4GKKB 1FTQA 5FUMA 2XMRA 3D4IA 3I09A 1XPRA 3TI9A 3CEAA 1VMAA 2DUWA 2WWWA 3A6JA 1M66A 4FJ1A 3NIWA 1HFJA 1Z33A 2C5GA 4JEHA 1T6ZA 1XZMA 4NPHA 5AK5A 3I04M 5BV1A 1DAPA 1XTIA 3QXHA 3FPLA 3DP7A 4NDAA 3USZA 3IBYA 2Q0SA 3D4PA 2O2ZA 3B9PA 1Y1LA 4GNKA 4TLDA 2BHTA 3B12A 2ZUTA 2HHLA 2PU7A 4J49A 1L3CA 4YLGA 4DR5B 2AFHA 2VP9A 1Z0IA 2RGCA 1R88A 1KK2A 4P54A 4RNCA 3EPJA 1JJ7A 2C0PA 2CVQA 3D3NA 4BO7A 5CGQB 2X6QA 3TECE 3MD0A 4GPAA 1TI7A 5HS4A 3ZNNA 3SHOA 1IBMB 3FPKA 2OYSA 4EHBA 3DEKA 4GUDA 5HRUA 3NWOA 5GONB 2YFHA 4K86A 5I9TA 3D8TA 4B4UA 2PFKA 3GJ6A 1TADA 4INJA 2I2DA 4GSKA 2PKEA 4Q4LA 1D2CA 1PR3A 1IOZA 2COEA 1U63A 3UM9A 2N9UA 2QAGA 2VZLA 3BFXA 1X8JA 2YJNA 4PYJA 5EZQA 2XMQA 4EHLA 5HNKA 2W4IA 3JAWA 5K7SA 1VPWA 2QW8A 4ILKA 2DQ4A 1YS7A 4FNAA 1WXWA 4LMRA 4M21A 4BAGA 5L95A 3KHUA 2R79A 5AYVA 3UMSA 4ALIA 5A6VA 2ZRAA 3NHRA 5JAOA 1CR4A 1WXEA 2JHFA 4DMRA 2JEOA 5DXJA 4H4DA 3DUFA 2VP6A 4FHEA 4RZ2A 1M3SA 4CM9A 3FVWA 3F6RA 4AJ9A 1SHJA 1V8DA 4INZA 2DOKA 1L7NA 2ZUDA 3ROMA 2VNSA 1VCIA 4YXFA 5L7TA 2IYAA 3ROKA 3X2EA 2IS1A 1ZOSA 1W46A 3BX1A 2PWYA 3GDHA 1KJQA 1J07A 1V5EA 1T1EA 1U98A 4RTNA 4LCJA 3P9NA 1GLNA 2C8JA 2XBUA 2B6HA 3JYHA 4LJKA 4G89A 3R5SA 1P2UA 2BGMA 4UASA 4HFRA 4CNBA 1XNJA 3MMSA 4Q3NA 4RDIA 4HGNA 1R0BA 1F8UA 2FSUA 2J4DA 2NU9B 2ZI7A 4CKYA 3TNJA 4WESA 1VDZA 2PBRA 2YHIA 4N5MA 1VBFA 5DX1A 5HKOA 1DHTA 1JWAB 2K7ZA 3TOXA 2C8LA 3FNQA 1M6VA 1CS0B 3FKSD 4OYRA 5LYJB 2J8ZA 2C2MA 1RP7A 4WZAB 3RQIA 1J23A 1JNXX 2B7LA 3S81A 4IEIA 1Y6ZA 3ESCA 2GJ4A 3PLRA 3VMFA 3ZCRA 2EX1A 4NICA 2HU7A 4IUYA 1R64A 1VFPA 2JD1A 3RDPA 3UAGA 1C2YA 1XNHA 2QBYA 3K72B 1GWNA 1P77A 5FWAA 3JPYA 4DYHA 3L8FA 2O8EB 2UYOA 1JWBB 1K7CA 1PFUA 3I01M 1JEDA 3OE4A 4OA5A 2OGTA 4H7DA 3JXEA 4R54A 4CLOB 2H52A 4DSTA 5JWRA 3BTUA 1CQZA 1JHRA 1IHYA 1TNDA 3C7DB 4UDYX 4BFWA 3ANLA 1JYSA 1ZNQO 1SOUA 4RD2A 1WDKA 4D45A 1W4RA 2KHZA 3WL3A 4PZDA 2A94A 3STVA 2OO7A 4DYDA 1IN1A 4Y0VA 3PA6A 2NPIA 3CM0A 5C5DA 2ASVA 4PLHA 3TXYA 1QIFA 1YR2A 4DPLA 3I9OA 3HA2A 1V2HE 3OTQA 4WJZA 1H0KA 1RBMA 4YWJA 3LLSA 1FX0B 1P8JA 4FT2A 3PNBA 2AFHE 3HXLA 1BE1A 1QE0A 1OFHA 4NJEA 4INOA 4TSRA 1A7UA 1PQ4A 2OHXA 1UXOA 4LSMA 2FMXA 1TJ5A 3V1KA 4NWIA 3BH0A 1ELOA 1QTRA 3ROPA 4YR7A 1RHUA 3EVNA 3KKPA 4JR2A 3T3DA 3QU9A 1HXHA 2BJHA 4HEQA 3JYLA 3DOCA 5DLQC 5JMOA 4QM6A 2DH5A 3R0JA 5CR9A 2GF0A 3QU7A 4B6EA 5CB4F 1CUYA 2YASA 3D59A 1E99A 3ELWA 1C2TA 3QVKA 4I4TB 4P1ZA 1NVVR 4O4LB 1JEYB 4MICA 3EZ7A 3M4ZA 4QQNA 2LZ0A 3AUJB 3N7UA 3F9RA 1ZN8A 5EQFA 2V6FA 3L6BA 1CUIA 1COWD 1E6CA 2ONCA 1QIMA 3AETB 3CPSA 3FYDA 3G5MA 3MS7A 3PXEA 3QUQA 1GNTA 4QGHA 3TVTA 2WA2A 1JHMA 5JEDA 5JW6A 2H1CA 1G4AE 3GB9A 3KXKA 1TJYA 3DDUA 1Z62A 4GXRA 4UARA 3SR4A 4MR8A 1YVRA 2WVGA 2CCGA 3N6XA 1HZZC 2V3CC 4A23A 5EFOA 3Q9NA 2HQ1A 2F48A 1E1LA 2FP4A 4WIAA 1QO0A 2AF4C 3WSTA 3GK3A 1SBCA 3KOOA 3OEYA 1BVHA 2VQDA 1NX6A 3HZHA 1FBNA 4LSGA 4MUJA 1E9AA 1KAHA 1UBUS 1EU1A 2R6CA 3V00A 1X15A 1DQSA 2JI4A 3H9BA 5CNIA 3E9NA 2XMDA 3NETA 1G3IA 4M8KA 2I4RA 4WCFC 3VOBA 4N49A 5B1DA 4D8TA 3Q4GA 4Y2RA 1NNLA 1MMFB 2KI5A 4WK0B 5HIMA 5TV2A 1EG7A 4XASA 5DE3A 2A35A 4YFVA 1I51A 5AK3A 2A9PA 2JIQA 4ROTA 1I6LA 3FSRA 4ZV4A 2ZYDA 3ITEA 1F48A 3O8CA 2NTYC 4F60A 2L0XA 2HZ7A 4WKGA 1K7YA 5CYPA 2HIMA 4MQBA 2DHRA 3C45A 4MVJP 3WDKA 3RYHB 1RI1A 1GR1A 1RZRA 1X19A 3G9XA 5CJ2A 3GNSA 2VPTA 3DT9A 1A95A 1PU2A 2JJYA 2OO5C 3G79A 4OFBA 4PZLA 1AUVA 5REQB 3C24A 2HADA 2CLKB 1Q1AA 2P2NA 3GCGA 4J7UA 1C1HA 2RC5A 3DE1X 4EHDA 3ED5A 5L3QA 3LPNA 1CEEA 3EJ6A 1TYAE 1SO8A 4I2VA 4N40A 1GKKA 1H5NA 4U9UA 4NLLA 4EDFA 1MAUA 4HNUA 4F86A 2VDQB 4W8OA 2NT3A 4WJLA 2F8SA 3L6UA 1DXHA 4TV9B 2NYVA 2PH3A 1NUAA 4MGEA 4TRNA 4KP7A 3ZN2A 2JVJA 3W90A 1R10A 3HCAA 3GW8A 4MI9A 1R1DA 1O9BA 4B6QA 1FU7A 3G0BA 1HYQA 3Q9UA 3QOWA 4ZI7F 3ZDAA 5LUBA 1O97D 3BVPA 2OBBA 4DMFA 1AZLA 3EVEA 1MQ9A 4G1MB 5AHWA 2HPZA 3W05A 4CQLA 2AMFA 2PXCA 4LVNA 1L4UA 1Z29A 4KGDA 3Q72A 1X7WA 1NXOA 2QRKA 2VKQA 1Z08A 1RZVA 1K8RA 3SKYA 1DIRA 3F73A 1W36B 5K8LA 1FUUA 1X9IA 1GQFA 4FOPA 1UK6A 3BF8A 4FHCA 1SHLA 4OBEA 2VK8A 4ZO6A 1WQ1R 3ESYA 4BP9A 4HX2A 4KSCA 5JS8A 5DHAA 3AJ9A 4BPBA 3NFYA 1XPUA 1MQAA 4HQNA 4KQ6A 3H6GA 4KH1A 1HG1A 3JQDA 2XCUA 2MJLA 4IKEA 1X7YA 1ICIA 2I4IA 3T5TA 3SVLA 2B37A 1WCIB 3A1EA 3RHFA 3WGTA 4ZARA 5JFGA 4KHPB 2II6A 4FCVA 5B3LA 4K81B 5IJ0A 1T8PA 1QFSA 3T7TA 3HDTA 3ICOA 1YRWA 4FK8A 3VI4B 2GN6A 2WQ7A 3MXOA 5ECDA 3ZUGA 4D57A 5KTTA 2ZYVX 1W30A 3DFKA 3R3SA 5KWSA 4MUIA 5IAKA 4HRXA 1JKMA 2ZTMA 3ASUA 1N32B 1Q77A 4NSNA 1H42A 2XI4A 1M2GA 1PEDA 5JFOA 1Y1PA 3Q5EA 1IG3A 3K5PA 4CEIB 1SHKA 1T2UA 1X7GA 2GYYA 1UZLA 5DIZA 3S2GA 2IQ5A 3TI7A 4P38A 2PTHA 1YJAA 5CLIA 1APBA 2HA3A 4RJLA 1U8AA 1N8SA 2VUSA 1FZQA 4M0FA 1DIOB 5DI9A 3NHKA 4C1BA 5H68A 1RHMA 3FYUA 1DBQA 2CXRA 4Z7JA 3ZOKA 2AZ4A 3L7MA 3E05A 2WJZB 5I7UA 3JQFC 3AV0B 3V2IA 2WG0A 2Q9AA 3WGLA 3OI7A 3UJ3X 5EGSA 3T4UA 1K0UA 1VRCA 4OF4A 1LPSA 4BBZA 1KQGA 2F4VB 4NY1A 1WPQA 1RKQA 4N9WA 7REQA 1N2IA 5G2OA 3N05A 3MIZA 4OL9A 4PSCA 4PS1A 1MB2A 4LV6A 1XRMA 3I4CA 4TWRA 5FBZA 5LDGA 3RC2A 4HWRA 4L08A 4K26A 3W5AA 1OXXK 4XFDA 5AM5A 4CKWB 5TC4A 3TLAA 4XD7D 4PGAA 3W2EA 2OAEA 3ZW9A 2GNAA 4QOIA 2ISQA 3LF1A 4W5OA 1W2WB 5JNSA 4WGGA 4QOGA 4XWYA 2IHNA 1FL9A 1G6KA 1L5LA 1C4WA 3TIIA 5IDVA 3WAKA 3K70D 4NH0A 4LI0A 1L5ZA 5BW5A 3UW3A 3I9JA 5BUSA 2R8BA 1VLZA 2AB0A 4ZYWA 1CBUA 1YJCA 3ZHUA 2QN7A 1U2QA 3DLIA 2JI6A 3NMUF 1K3FA 2AN9A 4PIMA 4JP3A 4G0VA 3CXUA 2OZLB 2X6TA 1XMIA 4YRBA 4K1XA 1A1SA 2XEDA 3PIIA 1N9GA 3N2IA 5DBHX 4D98A 2VJMB 2LW7A 2HSZA 2MT9A 1CFJA 2I03A 3K5IA 3HFGA 4HAOA 4HGOA 4ND7A 1ACJA 3MJTA 1A88A 4X8MA 5EC8A 3TMKA 2AZXA 2AOWA 1X7XA 4CN8A 3Q88A 1XZKA 3IVAA 5F12A 4OKIA 1KMIY 1KTIA 4EUSA 5DN9A 4TSFD 2J45A 1ZSVA 2BM8A 4GZ5A 3PU6A 4PO9A 2VLIA 1WUJS 4YUXA 3LL4A 4P7BA 2MSNA 4H6PA 1DVRA 5B1SA 3HGTA 3KBBA 4BMYA 3NDPA 2EFCB 3PUHA 4PAGA 2NTJA 5BT9A 1ISGA 3EVTA 3B51X 1WCYA 3R8XA 3U61B 1IZ8A 2R6AA 2YWJA 1N3BA 1E9BA 1CY8A 2P30A 3HJCA 3JARA 3MWKA 4BX9A 2HNBA 3MAAC 1KH1A 3OJ0A 2IYFA 1I36A 3DE0X 3QUSA 4U7GA 4C89A 4EGSA 1JWLA 2I66A 3NGXA 1LW7A 4GGMX 1DSSG 1MORA 2ID9A 4NECA 5DW3A 3NEPX 2Q5JA 3D1JA 1RHJA 1WKVA 4D9IA 3G2LA 5KOHA 1T4CB 1R0ZA 1E1MA 4XUDA 4RKFA 4CT4B 3HBFA 4WY2A 3RVDA 3H6HA 3QY9A 3FSEA 1GCOA 1PNOA 3GNLA 4QDTA 4RE6A 1V45E 3ZE8A 1O94D 4PG4A 5TQ2A 5CFMA 4CCAA 1IN5A 2P9CA 2D3WA 5C37A 2H57A 4IMRA 5AH0A 3F8SA 3HMKA 2Q4TA 4O4JF 3SMVA 1E3EA 4DABA 4GG1A 3NTOA 5G4LA 1UR5A 1CJSA 1VRVA 3NPAA 1R0CA 1AQLA 1ARZA 3H83A 1KJ9A 4A1OA 5DBIA 1L4BA 4UEKA 5FBWB 4J0EA 4KMMA 3OEED 4Q4JB 2ODAA 4Q9IA 2E1PA 3ZW8A 4DCGA 1ZS9A 3IR5A 3JAKB 4CNQA 4GOKA 3STUA 5DTIA 4YV7A 1L4EA 4K05A 2WWHA 4LOLA 5DO9A 3PRHA 2P9TA 5M04A 2SBTA 4EA9A 4W1PA 1H2ZA 1D2MA 3QOYA 4DL9A 4MEBA 5E1BA 1LLCA 1PJLA 2ZJZA 4BX3A 1U2GA 2Q5QA 2O1SA 1XA4A 2BKEA 3UMFA 2ODPA 2R1VA 4OB7A 1B6TA 1DOZA 1SA0A 2IEGA 3FKQA 3OIDA 4V3CA 5ILQA 3T9EA 3DWEX 3W78A 2CBGA 3WWCA 3FWNA 4O4LF 5EP4A 4BVGA 1PGNA 1KH3A 1JDVA 1W96A 2E2WA 2GKOA 2RARA 3L46A 3PENA 4PBTA 1YCDA 4ZEWA 4HQ6A 3RRNA 3T5CA 1K5HA 1PW7A 2OHVA 3BHJA 3OZTA 2DJ5A 4JAVC 4GQBA 1TMKA 5F7OA 1PWZA 2W0SA 3RWMB 1Q0PA 2FPKA 3C4VA 4K6HA 3VJMA 5BORA 3O8BA 2IIBA 3GYGA 1ZCBA 2GX6A 4GYWA 3B9RA 2M32A 5A9TA 1XCPA 2XZOA 3KCNA 1JPNA 2G67A 4GLBA 2XTZA 4MR9A 5K4AA 4KW7A 2Y66A 3STYA 3UUFA 1ZU4A 4Q1DA 3V48A 3DKVA 2UVQA 2BGUA 3FOCA 4Q93A 3DFUA 2X4DA 2YIJA 3K73O 2XE7A 4MGKR 1KIMA 4NOJA 2VTBA 4F5WA 1YBMA 1D1TA 4LF7B 3JYPA 2M1XA 3HJBA 4KXMA 3UFBA 1AA6A 4D25A 1Q6ZA 4Q9NA 5EZYF 2CLIB 2Z43A 3QU4A 4FCTA 4GSLA 3RHSA 4ZICA 3EXHA 1H3FA 2RGBA 2NUPB 1I0ZA 2JA2A 4WVFA 3MJCA 3OETA 5D3KA 3REQA 1P5HA 5DYGA 5ES3A 3DV0A 4RA9A 5FO1A 1JZQA 4ND4A 3VQTA 5GP1A 8ADHA 3CZQA 1VL6A 2M9MA 3B7GA 1SELA 1WPXA 3DZFA 4K9QA 4BLWA 2O8CA 3WLLA 5JDIC 2C5BA 1KI6B 4LNHA 1Y4DE 1DIAA 3GJQA 2VF4X 2ZI3A 2Q21A 3O73A 4JL5A 4W1SA 4GRDA 1N6HA 1M10A 3NBMA 3BFJA 4MCJA 1L7EA 2Z5GA 3GEGA 4ZVKA 3X1WA 4CR6A 3IJPA 4JLWA 5EYPB 1RYBA 2WV7A 3HBNA 5ICFA 1X0XA 6NULA 3QIAA 3M6LA 4IDDA 3FYCA 3GG9A 5HILA 4DUGA 4EO7A 3FOZA 2NQ8A 5F1PA 1U0JA 3E58A 4KQMA 3TG8A 1QIKA 2ZYUX 3C6QA 3L0OA 4TT3D 4X24A 1WM1A 2WIBA 1UADA 1G2PA 1HNWB 4ME6A 5JHGB 2GBIA 3S2SA 4UDXX 4CF3A 1ZN7A 4TV9F 5BSKA 2G1JA 3A06A 1QAMA 4Q3EA 3VKGA 2CLHB 4LY0A 4DIFA 1KZHA 2P2YA 3DVAA 3NHSA 3PL5A 1G3RA 3SDBA 5JVDA 1DQRA 3W6ZA 5FLYA 4U2DA 1LRLA 3VGPA 1QLWA 3KLBA 5IK2A 5I5EA 3ZIAA 1ZA2A 2VYCA 2WKSA 4MRNA 1HDGO 1YS1X 5F64A 1SQ5A 5HR5A 5LKRA 1AH2A 4P35A 2B1JA 4ND6A 4Y7DA 3ZW7A 2FPIB 1CRQA 3ME5A 4A26A 2WG1A 1HDEA 1B0UA 4X97A 4GXTA 3QEAZ 1MX3A 3T99A 1IXKA 4Q7KA 5D1HA 4GLLA 1E4OA 1I2CA 4KOEC 2KBEA 3N3BC 4N3CA 1TU0A 3T1VA 1DMRA 4Q15A 3RTEA 4FB4A 3OCZA 5JC1A 3QELA 1ZJ5A 1BW9A 2FRXA 1Z6PA 2XA1A 4KTVE 1UJ5A 4ZHQA 2ZBFA 2JLXA 4MOWA 4MB0A 5LP6B 3CLUD 3R6DA 1NUPA 3O0DA 1R2QA 2EVWX 1AKQA 1C30A 4HAXA 1A2QA 2H48A 3K2QA 1OI3A 4II7A 1VI6A 1WMSA 3L1VA 3QTLA 1Y3DE 1RPTA 3I9KA 2JH9A 3N7AA 1EBUA 3WK6A 3WDSA 4RESA 2DG2A 3CKKA 1FU4A 2XVZA 4FUQA 2CL0X 1P2DA 3EIWA 3FNFA 4I66A 4J76A 4J0HA 4Q7MB 1VBKA 3QLEA 5SYMA 2FSHA 2DR2A 3X43A 1YS2X 4I7EA 4MSUA 2WD7B 4WNYA 1CUVA 4B3BA 4EHKA 4H9GA 2BZGA 3WFZA 2FUEA 2JB9A 4EMTA 4GOXA 1IRIA 1TQ4A 2ZRFA 3DV2A 2O8VA 4MP6A 5IKEA 1UXGA 3EVBA 1ZRMA 1Q0RA 1ZKMA 1CZKA 1BX1A 1LK5A 1RHKA 4IHJB 2E55A 3ORHA 1K2VN 4MWOA 1L3IA 4PU0A 4M2LA 3EEBA 1XZDA 4BDTA 3ZGYA 1AZSC 4I5EA 4EI2A 2DP4E 4FYVA 1JG6A 2QLTA 2QMQA 2W8BA 2R00A 4K40A 4M88A 3SYMA 1K75A 1Q6YA 2NQ2C 4ANFA 4FJ2A 4W8GA 4DG8A 4M7PA 1SCBA 4HXGA 1FPMA 1SAYA 4IQ8A 1TZ2A 1N1GA 1DEXA 2WWGA 2XWPA 4ISCA 3PF8A 4Q9KA 3ETLA 2QD2A 1Z35A 1UBOS 1YBFA 1YL7A 4MW0A 3AVOA 4MCAA 1K6MA 2PE5A 4ALLA 2WQZA 5CX1A 3BCSA 3T9FA 3FMGA 4TXMA 1Q7CA 4JK3A 2XD4A 1PK9A 1E9DA 2GJAA 3UPUA 1T0IA 1YDEA 1ZC4A 3PXDA 4UHDA 3RBAA 3ZHVA 4Z54A 4MAAA 1FP6A 3UJ8A 2XA9A 3URMA 3PDUA 4MJXA 4A6XA 3QTBA 1F60A 1P44A 5IBCA 3M3HA 1OI7A 5A1JA 2V7UA 4MLDA 4OTZA 3U7QA 3OQIA 4FZ3A 3U4AA 4NENB 3O5AA 4JCCA 3DDZX 5DVZA 2GEUA 3PDIA 3P0JA 1U0SY 2QSZA 4DT1B 4W99A 1PNRA 4P22A 5TS3A 4RJ2A 3RVMA 3ZQ4A 2NXCA 3CNHA 3OLQA 4LYYA 1RRVA 1GADO 1S3IA 2I2CA 3SDSA 4PLVA 1SPBS 5KQLA 3AERA 1DKMA 1YUNA 4C4PA 4ASUD 1H2BA 2B92A 2YVKA 4TV8B 5HYVA 2VYVD 3A0RB 3TW0A 3DVLA 5GV8A 4F5YA 1KDVA 1KFKB 5CH8A 1K5DA 2JFBA 1UBRS 1HQKA 5HDBB 5AD1A 1ADCA 1EVJA 1O54A 2R60A 3E3LA 1GGFA 2BR3A 2ATCA 2IPMA 2EATA 2VUIB 3G1WA 4LHSA 3UOAB 2AG8A 3EUFA 1AZTA 1SXJD 1RFGE 1V8ZA 2PZEA 4YP6A 3SNHA 1T0PA 1VM6A 3MCAA 2Z2XA 1E1KA 5EP2A 4BMNA 1RKBA 3MAJA 4A36A 1PX2A 3OX2A 4TMZA 2K4MA 1FW6A 2V1XA 4XJVA 3K09A 3I9NA 1G4UR 1DIHA 3WL6A 4EY6A 3ZK8A 4ZT5A 3LCCA 2H63A 2PLNA 3I72A 3BERA 3RAPR 4PG6A 3GLHA 4U0KA 3OZGA 2F1KA 4UNPA 3SQXA 4OHYA 1MJGM 3SZGA 3G23A 1IY9A 1U99A 2G0AA 2QTNA 5CP8A 3LFTA 3QVJA 4JC4A 4LBVA 2PQMA 3RNOA 1GSAA 3GT3A 4Z51A 3GUHA 1WL8A 1VSBA 3BPSA 1QIEA 2AQKA 2OL4A 2Q8QA 2QTGA 2Y1CA 1YU6A 3KLNA 2FUCA 5FWNA 4QT4A 2JLAA 1N7IA 4HX9A 2FPWA 4RVSA 3TDKA 4CG2A 1ONNA 2HLDD 5BW8A 4G2TA 1QHYA 2OXEA 2QTMA 4CG0A 1QHXA 3A37A 3R5HA 3U4QB 2P8SA 1I3MA 5HF9A 5D3MA 2XNJA 2HD4A 1Z16A 3QF7A 4I6JA 3F71A 3SR0A 3TQTA 2CHUA 4KR9A 1EEHA 2HM7A 1EI9A 2I6FA 1G20A 1HY3A 2AFIB 2JANA 5F73A 3U0BA 1UKZA 3CWZA 3V7YA 1GDDA 2EW8A 1GGMA 3EW9A 1DFIA 2Q3DA 3DOEA 2HLHA 4JI3B 2XQIA 4OK5A 1M67A 2QROA 5FI3A 2WPDD 1EMDA 1JJIA 4HAVA 4RPHA 4UZFA 2JD2A 1LSUA 1O08A 4G0OA 1KR2A 4IUCS 3E9CA 4QAQA 3K35A 5EZ5A 3SF8A 1Z6GA 4JEMA 3WKCA 4CM3A 2Q6IA 3WGNA 4BO5A 1A0OA 4R01A 2J3HA 2H3HA 1ZUIA 3DWFA 3MFQA 3W06A 1TF5A 1CQJB 1GFSA 2YMLA 3I83A 3UCXA 4C7BA 5AVYA 4R2MA 2H7CA 3OM9A 3IDZA 2VYQA 3MWDA 5BO5A 2O7QA 2RI0A 3FYHA 4O2AB 5ARCA 4U0JA 5JADA 3L7AA 1RJ9B 3GWZA 2XIQA 4LXUA 3FDJA 5FRDA 3GEPA 3KQLA 4I1RA 1XZCA 1USWA 1MIHA 4EHFA 1Y1SA 2RHHA 4U39A 3ZY2A 3IHKA 3DMGA 1Y33E 3AP1A 3TL3A 1QFMA 2CMDA 2C31A 4RJTA 5BWMA 3THXA 5JRJA 3OX1A 4DLXA 1ISRA 2QI9F 1CRLA 2D5AA 3BWBA 5EXEA 2FR8A 1OLUB 3JTMA 4H15A 3W2IA 4ECEA 1M6WA 3IDFA 3B6IA 1T3TA 2Q6OA 2B1RA 3RFCA 3ECCA 4AG6A 4IS3A 4N0MA 2CFRA 4CIDA 2OLEA 3TLKA 4ZT6A 4BZQA 3ITNA 3FZQA 4X1KA 3L4BC 4FGZA 3GRUA 1BX3A 4G0ZA 1TMGE 3B1JA 3F2VA 3IP8A 1PGOA 4E46A 4BWVA 2DCUA 2GN0A 3ZI4A 2Z3VA 1KQFA 2HDOA 5JSHA 3NVAA 3ETNA 3HCDA 5FO0A 1S7GA 5EPOA 2CC2A 4GKBA 3GFTA 4L07A 2ZJ7A 3E48A 1HDYA 4U2EA 1Q1ZA 3OMXA 4ER0A 3L43A 2GKSA 2XGSA 1NZDA 3GLHE 2AR0A 3LYHA 4OI1A 5EI5A 2CXUA 4CIBA 2C96A 4ZDWA 4BJ1A 1P0CA 1JSXA 4N18A 1LBHA 3LWZA 4E30A 4XEHA 4Q18A 2V7WA 1DBPA 2D1FA 4JJKA 4U3JB 5LYJA 3LGAA 5JJIA 4WLUA 1HQCA 2OCDA 1PV2A 1G63A 3CMCO 2EDCA 4LPSA 2GN8A 4BGDA 1UOOA 4A7PA 3ZWKA 4S1PA 2QTBA 3AO0B 3DGFC 4ZOLB 1YHZA 2LBPA 2UZ0A 3RE1A 2FFHA 5SYNA 4QREA 1J6UA 3Q11A 4KIJA 1R8SA 4O0MA 5LD2C 4KXUA 5JPIA 3JD4A 1V4BA 2FKAA 3OIVA 4KXWA 4BO2A 4B3IA 1E8DA 1DQZA 2BGJA 4B7CA 3PIRA 4GWKA 2W0MA 4RH0A 3ROFA 3U9SA 1N34B 1G20E 1JG1A 1NJFA 3B1ZA 4LAFA 5F78A 3T1QA 3TD6A 4BPRA 4ZC8A 3DBRB 1KA9H 2HF9A 1XHFA 3PQDA 1IOVA 1JQLB 4MS4B 4KAXA 4WFJA 1E2EA 3ZGNA 2IS4A 1XCBA 3JQ8A 3CNNA 3LQFA 5CFQA 3LZCA 4AJPA 3T3IA 3K6SB 1DPGA 3KM0A 4K03A 2BEWA 3FRJA 1D6MA 1ZICA 2C1ZA 1SBTA 2C84A 3P45A 1QGDA 3NS7A 4IGKA 5LP6F 3CH7A 3HYCA 3CA8A 1E1QD 5BSVA 2P4QA 1GQ2A 3CJRA 1MVNA 2GN1A 1LQTA 5KSOA 3K9CA 2QTCA 4UBOA 1QHHB 2VAXA 3PI7A 4HVLA 3ZLJA 1QK3A 5E7MA 4PXAA 4KG7A 1SUEA 1BXRB 2R2AA 4FHZA 5ELXA 4M0UA 2OV3A 2VWGA 1S8OA 3EZLA 3IT0A 1CCWA 2QRZA 4O5OA 1T9KA 3FZEA 4WFKA 3UH0A 1NU8A 3MBKA 3ENWA 4MP8A 3U1VA 3UVEA 1C29B 5CYFA 1U8EA 3VU9B 1QQAA 1DT3A 2WUFA 3LSYA 1P2FA 4EYSA 5B4UA 2IZZA 3GZNB 5HGXA 3EIOA 4F9EA 1W0KD 1PFVA 2DFTA 2VUTA 3BULA 1TUBA 2FNAA 4TMYA 5I47A 2DBYA 2IVFA 2AH5A 2BFBA 4RHXA 3V33A 5HZGA 5F9FA 3GLIB 1VIYA 5ICCA 3ZHRA 2POCA 1BWPA 2NU6B 3GJ4A 4PG7A 1OV4A 2LP4Y 4CGZA 4OJMX 4FINA 3L41A 2H18A 2HUNA 2UZ3A 4RV4A 3FPAA 2GCEA 3Q15C 5E38A 4R3NA 5ELLA 1QG6A 4DC9A 5IJZA 4A5SA 3MUFA 3NT5A 2PBLA 4B3MB 1YA8A 4QU5A 1RS0A 2YVUA 1TQ6A 4WOKA 1QX3A 1CZNA 3T4PA 4HDNB 5JAQA 5FAKA 1JL3A 3UKOA 2EJVA 3NKVA 4TKMA 3H1EA 3TTXA 1T8YA 3DKPA 2XDQA 5LJIA 2Z30A 4DRZA 1BKDR 2IOQA 3QEMA 3ANSA 2Q45A 5FXMA 1KDZA 1TF2A 2Q3HA 2YV2A 4DJ5X 4PLCA 1FS5A 5JJKA 5LLSA 4BUCA 1ABBA 2PD6A 3E3MA 2Z57A 4GD3Q 4NZZA 5EE0A 4B0OA 1QFJA 3IBTA 5F35A 1P1FA 5FV4A 1I2DA 1O58A 3I0MA 5J3JA 2EEZA 6AT1A 1SVNA 4ND1A 2HJHA 3L6DA 3T61A 4UHFA 4WY8A 2Y4OA 2H17A 1U11A 3VDXA 3HO8A 3BGDA 3RS8A 4JOCA 3THRA 3WNDA 3RS0A 2P1ZA 3I0ZA 4YAUA 5JOQA 4NYIR 1E8NA 4LVCA 4X44A 4FQ5A 2D1RA 3MJ4A 1R4MB 1SUBA 3CMMA 3MZ0A 1E2DA 5LB4A 3DDWA 3VJLA 5BN5B 4E1AA 3AEXA 1ACLA 1JT9A 4GQAA 3GRAA 3IKVA 3SYTA 3CF2A 3TRIA 1YMUA 1CY2A 2XD9A 3E5NA 5CBPA 4B6FA 3QVVA 5CFPA 4ZCMA 3LFUA 3RSSA 4MDFA 3RVQA 4TOIA 3K30A 1AV7A 1P0MA 2SKDA 3EGDB 4UHKA 4EF4A 4XOIA 5FADA 5J58A 1KF0A 5D87A 3NG1A 2BUAA 5GZ6A 1K1EA 3UEOA 1YI0A 4Q48A 4K5QA 3FOWA 4DBLE 3PC8C 1N2ZA 1V7QA 4FFNA 4AJNA 1GEGA 2NU8A 1H2WA 2YOGA 7ABPA 2EQBA 3AV3A 3ABQB 3KLOA 5KVCA 1I7SB 1I4LD 4G1UC 2CZQA 4LA4A 2BFOA 1GT91 1Q20A 2TRSB 1A8QA 2CWDA 3DMTC 4NCHA 1J2JA 4R2WA 2BHRA 3KB8A 2IYOA 1MRNA 4F4CA 2ZIZA 3BFPA 4QC2A 2BEVA 1TIPA 1IBKB 3FWZA 2ZIVB 2PEZA 2ZUSA 2AW3A 1ENPA 4CU2A 1DAKA