1TU3A

Crystal structure of rab5 complex with rabaptin5 c-terminal domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
165
structure length
165
Chain Sequence
b'ICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-5A
publication title Structural basis of Rab5-Rabaptin5 interaction in endocytosis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 53
structure length 165
sequence length 165
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2004-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tu3A00
2ZRHA 1KZ7B 4P4SA 2FE4A 4G5GA 4AKHA 3IO3A 2AN9A 3UWKA 2JCSA 4HLDA 2QBYA 3M0EA 3CNOA 2OFXA 2B7BA 1UJ2A 2ZI7A 5IRCD 1SULA 3BK7A 4UKDA 1E2QA 4EUNA 1KI4A 1TUEA 2NG1A 5AWFC 3OIYA 1XJQA 2V6IA 5KU1A 2G83A 3PIRA 2ZS9A 1GUAA 3LBHA 3D31A 3NTUA 1AZTA 1ZINA 1OLOA 2ZJ8A 4PC6A 4Q7MB 3B7GA 3U4QA 1O3YA 1HV8A 4RKFA 2ORWA 4C0KA 4RJLA 4JLAA 2W83A 1G3QA 1OV4A 2ZS8A 5K8LA 3KUCA 2BMFA 2I3BA 2VTKA 1XJ0A 1YZGA 2HYDA 1GRQA 4DDTA 2XB2A 4PQRA 2KBFA 3ZD7A 4CF7A 5HPYB 2IXEA 3W90A 5E7MA 3X2SA 1Z47A 2ODNA 4QGHA 4ZIRA 1EFHA 4DLSA 1N2CE 2MSEB 3BB3A 4PSKA 1XPRA 4UNQA 2OBMA 2VF8A 4DCVA 1P7CA 4IEEA 3DM5A 1E4YA 1Z29A 3QPUA 4QBIA 1WXQA 1H8HD 1S9HA 2YINC 1IN8A 1ONBA 1Q21A 2ZJBA 1Z3IX 3KTAA 4LV8B 4MKGA 5E95A 5BWMA 1Q44A 1EK0A 2QAGC 1I4DD 1GL7A 1UBGA 4PPNA 4CGZA 5FUXA 3RRZA 1US8A 2IBMA 2CK3D 4KBGA 1E98A 3ZGXA 3LQRA 5LD2B 1W36B 2ZI6A 1XPOA 5FOSA 4I1UA 4DLWA 1OF1A 4I1OA 2QRZA 2ZRNA 3OHMA 4Q66C 3VR3A 1N0VC 3RSOA 3GLFE 2QAJA 1UEJA 1ZMXA 5DI3B 2Z0MA 4NH0A 1Z6AA 4FMBB 4M1TA 4DXAA 1KMQA 1NN3A 1TPZA 4MYTA 1COWA 2C96A 4KYUA 2JJ1A 3CRRA 1NY5A 2ZI3A 2IYYA 1R10A 4RFSB 5D3MB 3QXSA 2AXNA 4A6XA 4AWXA 1AJEA 3U3KA 1V5WA 2PL3A 2QORA 3KFXA 3OZXA 4RSGA 1FTNA 4Q1DA 1G3UA 2QG6A 1P2VA 3BORA 2BDTA 4E5UA 3VKWA 3TNFA 4RZ2A 2ZI5A 1R5BA 1IQPA 2X2EA 4DUGD 2GXAA 1HY3A 5B30A 2EW1A 2R6GA 1CJMA 2AK2A 3BWDD 2R65A 1L2TA 2WIBA 4IXMA 4XWAA 4IDHA 4BEBA 2YWEA 3MMPA 3F8TA 4KLNA 2VPPA 2BM1A 5HE9A 3OFND 1H8ED 3SS8A 4WZAE 5EXSA 4LPSA 4ZDKA 2WSSA 3IIJA 4NCHA 4BFUA 4CEJA 5JEDA 3FHCB 1F60A 4IOMA 2WOOA 3RS5A 1Y3AA 4TLAA 3GLFA 1T5LA 3FMOB 3SYLA 4HUTA 4RZXA 1DAFA 2Q3MA 1OYYA 3I62A 2VF7A 5CJ2A 2R8RA 3QF4A 4OQFA 4QBGB 5AR1A 3A8TA 5FOTA 2W6IA 2XSZD 4KO8A 4B47A 4ZIRB 2ANCA 2WAYA 1N6RA 1ZU4A 3MD0A 2PJRA 4GI7A 3OEEA 3OAAA 1CRQA 2GCPA 3FKQA 4XVRA 1L8QA 1W4BA 4LYAA 1XNJA 1G4UR 3R9IA 4DHEA 3MRSA 1GL6A 3HWSA 1OHHD 4XWKA 1K8RA 3UG7A 2J0VA 5IT5A 4A9AA 1BO6A 2WJVA 3AH8A 3A1VA 4L9SA 3B2EA 2ZAOA 2ZYWX 2D06A 1YU9A 3T61A 2Z6VA 4NE2A 1XBTA 3B60A 1W36D 3BE4A 4Z1MA 2PMDA 2XNDD 1P73A 5AJYA 5AJWA 4PC1A 4R9UC 5J4HA 2J45A 2EFHB 2JLZA 2ANBA 2AD5A 5HCNA 1UBCA 4Q1FA 4FWTA 4NU0A 4P0TA 3IBGA 2YC4C 4EAQA 1N5LA 4RD1A 3BC1A 2FFHA 5KOYA 3AP1A 1Z6YA 3HR7A 2A9KA 3QKUA 4TMVA 3RRNA 1G9XA 5BW8A 2IK8A 5SZIA 3EXAA 2F43A 4POAA 4B33A 2FZLA 4AG6A 1II8A 1SVMA 5BYJA 3L0IB 1N0UA 4S35A 2DPXA 3AVOA 1P75A 4L4UA 2V4ZA 3A4NA 4QRHA 2V9PA 1RJ9A 3AQ4A 5L3SA 2HF9A 1KTVA 2VP6A 2ZR0A 1TADA 3EIQA 4GZMA 5K8UA 3ZLJA 4HDQB 5KNBA 4Q1CA 3H4MA 1RRPA 1ZM2A 3KL4A 4JLOA 2PBRA 2HT1A 2ZJYA 4IRUB 3EPKA 3TVTA 3I5XA 3K0AA 3Q7PA 1IAQA 1T3SA 4GT1A 4M9XA 4MH0R 3K9HA 2J1LA 2QE7D 3G5UA 4KAXA 3Q7QA 1E9SA 2GXSA 1FUUA 2HF8A 3VHXA 4LHWA 4YLGA 1FUKA 3FGNA 3IHWA 3OE7A 3WMEA 2O8CA 5LB4A 4ZDJA 5C18A 2CHVA 2J0UB 1GNPA 1DADA 1QHSA 1M1YE 3GLFB 3AVXA 1G3RA 1GAJA 1OB5A 4G3XA 3KXKA 1VYVA 2RCNA 5FOXA 3ZVMA 2WWHA 3T15A 2NIPA 2FA9A 5FUWA 1CRPA 3B6EA 4FCTA 1RRFA 2Z43A 3K0CC 1F2TA 1G7TA 3QF4B 3SNHA 4DLVA 3ZVLA 3KB2A 2OM2A 2ZQ5A 1KI1A 4YXWD 3SQXA 5KUTA 2ZRCA 5KSPA 3BFKA 4AYTA 2GETA 1Z6GA 4JLNA 1KO4A 1WQ1R 1XU4A 4RD4A 5KO2A 4GPTA 3NVAA 3KKMA 3LVQE 2QY9A 3A1TA 3DL0A 2EWWA 3C14C 2YJTD 4BLOA 3EZFA 2W58A 4EKDA 5FFMA 4CZ2A 2C9OA 2QQ0A 2QM8A 2YYZA 2OAQ1 5A5GA 4PO1A 5JWHA 1CTQA 2WKRA 1D9ZA 1AS3A 2NO7A 1BYUA 1MOZA 2ZSFA 5B2ZA 3K1JA 3EPJA 5JWOA 2ZRMA 3K70C 5KHOC 1MKYA 2J7PD 2O8DB 3L0PA 3T1OA 3CWZA 4LHZA 1KI7A 1M34E 1U8AA 5FPHA 3RS4A 2XTNA 3WY9A 3KUDA 4PSAA 4IKEA 1AK2A 1VCOA 4BLSA 2DB3A 3W34A 3BAFA 4HAVA 1S1MA 4GOJA 1T3LA 5TY0A 1D2NA 1KMHA 5JSZA 1I2MA 1T4GA 2DYKA 4ZV4A 1BIFA 1ANKA 2FU5C 1COWD 1Q12A 4LUCA 1G5TA 3CZQA 4EPXA 2KBEA 2VRWA 4GNKA 4XTCS 4O25A 1QHXA 1E2HA 2IYUA 3AUYA 5FUVA 2E9SA 3U7EB 3W3ZB 4PPQA 5BYKA 3PV0A 2G0TA 1P60A 2CLSA 4AURA 2VIIA 2XXAA 1RJ9B 1GKYA 3ETLA 3QXJA 1BKDR 1FTSA 1KHTA 4ERNA 4QBFA 3MSXA 3BS4A 2O8FB 5B58C 2W2VA 3T5GA 4OHWA 3BH0A 1TUIA 3VX3A 4WAUA 4LHXA 4XWOA 3NG1A 2V55B 3JZAA 2CE2X 3TVDA 2GKSA 2J59A 4RCYA 1KK1A 2DR3A 1TQDA 4TTRA 2H92A 1NG9A 4IFBA 2KWIA 1ZD1A 1Q1ZA 3MLEA 1U81A 4L15A 3AUXA 1R5OA 4QOSA 2QT0A 5J4YA 2O8CB 5J4KA 3OEHA 4D4KA 2JJ2D 3VX4A 4C3ZA 1TEVA 3KKPA 5C46F 4JJZA 1DEKA 4NPHA 1XXHA 4R7ZA 3AF0A 1MT0A 3K09A 4Q9JA 2W6ID 2DBYA 4ZCLA 1VG1A 3LLUA 1E9DA 2VO1A 3NC1C 3OAAD 3FMFA 5FR1A 2PLRA 5JI3E 1E9FA 1U99A 2RMKA 4OBEA 5DISB 8OHMA 1OPXA 4MUBA 5JJIA 1ZCAA 3QKSA 5FBRB 2B8TA 4AKGA 1UKVY 1MO5A 3TBKA 3QEOA 1KJYA 1P72A 2BCGY 2GTPA 2ZTSA 4MA4A 2D7DA 4YMUA 3N2EA 4V0KA 2WPDA 5LPNA 2CVFA 3DOFA 1E2GA 3L82B 1W2HA 3CKLA 4TMXA 1R8QA 3HU1A 2QEQA 4Z1MD 4O2RA 1E0SA 4LYHA 4UJ3A 2JIZA 5J5CA 2WWFA 1VYUA 3WNBA 4B3XA 2X77A 4EPVA 3U3MA 4MRPA 4DEYA 2GCNA 1GOTA 2WIAA 2IT1A 2RKOA 4Q1BA 1N25A 1RW4A 2MMCA 1TNDA 1XTKA 3X1WA 3HJNA 5AUPB 4AC9A 1E4VA 2Z83A 2JLSA 3JZMA 4W5WA 4A2PA 2GJ9A 3GEEA 2ERYA 4MUAA 4Q21A 3PCRB 1N3BA 2WVJA 2JLWA 1DBSA 2O0KA 4X8LA 3QI2A 2DCUA 1G8GA 1X8JA 2JLRA 1P3JA 4YONB 4RZUA 3W5JA 2FPMA 5JWRA 5DHFA 1P62B 1CKEA 5G40A 5A4JA 5P21A 3TLXA 4V0LA 1NG1A 1NBMA 4Q02A 4D0NA 1X8LA 4URWR 1GVNB 3O47A 4FD2A 4LBYA 2X19A 1KYIA 4QGGA 4TLDA 5KSOA 4LJ9A 1AKYA 2QAGA 1II9A 5J4LA 2PH1A 1AIPA 4JLBA 3PEUA 1G64A 3CX7A 4FWIB 2HCJB 3KQLA 3GLGE 2OHFA 4JBWA 1VTKA 2YVUA 2J87A 4JKYA 1PLJA 3AM1A 4XSGA 2OZEA 1NMYA 2REBA 2WBLC 4QJ5A 1T91A 3MJRA 4HEJA 2NTYC 1W0KA 3BOSA 1GITA 2IEYA 4CEHA 2FOLA 4LI0A 1J99A 1G6HA 4IHQA 4M1SA 5CJPA 5FTLA 2CL7X 3QNUA 1CP2A 1EFTA 2RGEA 3QBTA 4BPBA 1E2IA 2VHCA 1L7VC 2W6JA 2XAUA 2ZS7A 3I8SA 4C0QC 4BZQA 3MAAC 5FPSA 1XEXA 3RAPR 2J46A 4QGFA 1TQ6A 3MWJA 4US0R 1SVOA 1J8YF 1IXRC 3N70A 1MABA 2H57A 3ZDQA 1IOZA 4XOIA 4OK5A 2ZRFA 2C2HA 3GLHE 3B1WA 4Z8XA 2BBWA 3QKSB 3GD7A 5JI2E 3B5JA 2EQBA 4NYJR 5DNYB 3SYNA 3W6PA 4D26A 3DPUA 4QJ3A 4HI0E 1DPFA 3QVUA 2GA8A 5EE9A 4PC7A 2GJKA 3C5HA 4TT3A 3AB3A 3D6TB 1SVWA 4IDNA 1GWNA 4Q4JB 1OXSC 5FL3A 4QHTA 3HPRA 4D4JA 5GVRA 2DFLA 2P0EA 1G4AE 2QP4A 1IBRA 4P3YA 5CDFA 4OI2A 4BLPA 3BB4A 3S1AB 4CRWB 5JECA 4OYHA 3WYGA 2D4HA 4TL6A 1VKJA 1YR6A 621PA 2XTZA 4TTPA 4Q4LA 1XCPA 1N6KA 4KODA 4M1YA 5DI9A 3GQBA 4E07A 3TUJC 1YHNA 1ZIPA 5KDLA 2ZE7A 3THYA 2FNAA 4BFZA 1KI6A 2FGJA 4DCTA 2LKCA 3NXSA 4G5RA 3SJZA 1KJWA 2QNRA 2VHUA 4EFLA 2OEPA 5JS8A 4US1R 2R44A 3GLHA 1XEWX 2WOJA 3NIBA 3ZVRA 2D7CA 2A78A 1KI3A 2IEZA 2Z4RA 3GJ8A 2ZRGA 4A0RA 3BJIC 3SOPA 2MMGA 3CX6A 3WBKA 4LSGA 2CNWD 5EE0A 2WWXA 3ND9A 3JVVA 4L9WA 2HDNB 2PZFA 3BIFA 1E3MA 3M6AA 1ZUNB 5CM8B 3B78A 2QMUA 4V0ME 1KK0A 1GTVA 2CBZA 2H1LA 4NKRA 5JRZA 3LW8A 1IY2A 4BFXA 4NYJQ 3U44A 5JZVA 5GJWC 1CJVC 1Z07A 2O0JA 4DZZA 3OEHD 2Q9BA 2OESA 5FBVB 1M6NA 1YZUA 3RANA 4CEHB 3HR8A 2VH5R 2YC2C 1VHTA 1XP8A 3BGWA 4GP7A 1NLZA 4NHOA 3NBYC 2AKAB 3PG5A 1FMJA 3WP0A 2QMOA 3RYTC 2KE5A 1FW6A 2OBNA 1GM5A 4U00A 2IS1A 2FEOA 4DWJA 1TEXA 3EWAA 5DIFA 1QVRA 3AP2A 3SR0A 2EWVA 2F9MA 4LJYA 5DE3A 5J40A 1Z0AA 4IOJA 2IYXA 3SBEA 1M8PA 2AXPA 2VP2A 3B9PA 4YMSA 1KO8A 5G3ZA 2IWHA 3VU9A 4FINA 3SZRA 5EJEA 5IDVA 4PTLA 1LW7A 3E1SA 4HUQB 5CK4A 2IL1A 1FFHA 2WPDD 5EP1A 4CEIA 4D80A 2CLDX 3IUYA 4URVR 1RPZA 1SHZA 5EUQB 4G1UC 3T1VA 3F3YA 3QG1A 4B6EA 1FQJA 1XD2A 1W4CA 1Z28A 4A8JC 2R6AA 1NLYA 2ZRDA 2ZU6A 4B73A 1EGAA 2KJQA 4B3GA 4IOLA 3TUZC 4YMWA 2GJAA 1F2UB 1ZM4A 3L0SA 3IEVA 4PX9A 5ELXA 1YR9A 3SJAA 4UQOA 1HQCA 4L8GA 3ICEA 3PEYA 1F5NA 3IEUA 4C9BA 3R20A 4JVNA 2FGKA 1GL9B 3BD9A 4RD0A 4P33A 3V4FA 3K8YA 4CDGA 1DAKA 2IF0A 1KI6B 3J81k 4RFVA 2IS2A 3EG5A 1HA3A 2J5XA 1VIYA 3D3QA 3VR5A 1M7GA 1Z0DA 4JZKA 3GLHB 1VHLA 3P1JA 4B2LA 4LJ8A 4C0AC 1D8TA 3RSLA 3DKPA 1UFQA 1QHGA 2CJWB 5FI1B 1E2EA 1N6LA 1VG0B 4WIAA 4BLRA 4EQ6A 2VHQA 4AKIA 1NN1A 4EPYA 2R6FA 2B7CA 2PJZA 2ZETA 2A2ZA 1E9CA 3DO6A 2BWJA 3QF7A 4HZIA 4A0GA 1W1WA 4JYBA 2IUSA 2IYWA 4R71A 1H65A 1W0KD 1GNQA 3E2IA 5E7IA 1OW3B 1E96A 1UKEA 2ZUBA 4M9SA 4JKIA 1SXJC 2CE7A 2ASEA 3I3SR 1BYIA 3LA6A 3ZIAA 3B1XA 1G3MA 3WYFA 5EZ6B 2DFNA 3A1UA 3TW8B 2C9CA 2OV2A 2W6JD 3QVVA 1VCMA 1RYFA 2EFDB 1E79A 3QENA 1G5PA 3AVYA 2QROA 2QENA 2V8OA 2IYSA 1J2JA 5EZ5A 4Q03A 1LS1A 1NMZA 3LFUA 4OJQA 1GG2A 3NH6A 1HT2E 4Y0AA 5CYPA 4D4MA 3EX7C 1X6VA 1Z0IA 5KDDA 3QKRA 4JSTA 4TQAA 4QGAA 1TL7C 3UXMA 2ZRIA 4QJ4A 3RWMB 1Z5ZA 5TXGA 3FOZA 1LV7A 1FP6A 4MGIR 1Q20A 2WZQA 5AJVB 2BKUA 3QQ5A 3ASYA 1QDEA 4TT3D 1JXOA 5KPDA 1HYQA 3TQCA 4F4IA 3SFVA 3CR8A 2PX0A 3AKYA 4W9MC 2BJVA 1XD2B 3AVQA 3U3JA 1NJGA 4BRWA 3AF2A 1GRRA 4LOAA 4OHZA 3W6OA 5KTYA 4WVFA 2SHKA 3IPXA 3HPQA 4MKIA 4QC2A 2GAOA 4P32A 2D2FA 1W5SA 3ADKA 3EA5A 3GP8A 2IS4A 1RZ3A 3KQKA 2ZJ5A 3LDAA 2B92A 4AYWA 2CEAA 4LJ7A 2G1KA 4Q1AA 4KFUA 3EPLA 4PZZA 1QHIA 2NO0A 2W0MA 3N2IA 1E1QA 4GOKA 4P4SB 1JNYA 3MWLA 4US2R 3IILA 5B64A 4C0LA 2Q21A 2QBYB 2BIFA 3GMTA 2QTHA 5FL7A 1AQYA 3GPLA 1XDBA 4URXR 5F2EA 4DBLC 1U98A 4IFEA 2P5SA 5HCIA 4B71A 1XZPA 2C03A 5EP2A 1NRJB 2IF2A 2WM9B 5JLJA 4ZDWA 4EFNA 5FTKA 4EQ6B 2UVQA 1E2KA 5G53C 2KI5A 3RVBA 2G0NA 3AKCA 2ORIA 5FPKA 3PUXA 4TMTA 3U4QB 3UMRA 3EA0A 3PQCA 4TWZA 4LYFA 3WXMA 4ESHA 2IYLD 1Z0JA 3K70B 1WDTA 2OO7A 2J7KA 1U9IC 2ZM5A 1GFIA 2Z5FA 1D2MA 4IDPA 2F1IA 4F38A 4DB2A 2Q9AA 1U90A 2GZDA 2VYFA 4BECA 1XRJA 2VQSA 2XZOA 4I4LA 3RLFA 3X1ZA 2O8BA 3VR6A 2DWPA 4HLUC 3I4LA 4DLTA 3H1TA 3WRXC 4GMDA 3MWKA 1W4AA 5IK2A 3VR4A 3GFTA 2GJ8A 2QA5A 3CR7A 2NOAA 3K9GA 4L16A 4DC9A 1G41A 1P4SA 2LCFA 2H18A 2QTFA 2WSMA 3K9LA 4JBYA 4PQYA 1T8UA 3KTAB 2P3SA 2QPOA 4GDFA 1U0HC 4A15A 1FX0A 1YJ5A 4OHYA 2Q9CA 2OCAA 4E09A 2WWGA 3QKRB 1P9NA 4RVCA 1E9AA 1EFRD 1US8B 4U7DA 4JLPA 2HJGA 1XPUA 1G20E 3RS2A 3TSZA 2NO6A 4ZDIA 1EXMA 1D5CA 1YZNA 2DFKB 1W5TA 4GFDA 1HT1E 5AJZA 1NMXA 3OIWA 1N0WA 4QFMA 2ZSEA 1DELA 2W00A 5HKKA 5TMPA 1CLUA 2CHGA 3C4JA 5BQ5A 4PR0A 3TR5A 1ZJ6A 2I4IA 2XOKA 1JR6A 3L43A 1E69A 4F4CA 4DDVA 1Z6XA 2ODWA 3WYAA 4D2IA 1G8YA 3A36A 4JL8A 1XCGB 2HLDA 1Z83A 2BKEA 1CJKC 3B1VA 5EUMA 2RGNC 5C2JB 3U3OA 4B2IA 2WJGA 1JECA 1HE1C 1O87A 3C8UA 4W5JA 1Z0KA 2DFTA 1ZM7A 1CULC 1EWRA 2F7SA 2ZE6A 4XH9B 2GWHA 2GVZC 1KSGA 1WE2A 4P31A 4JLKA 1FZQA 2FFBA 2WV9A 1JR3A 4Q9LA 5H1YA 4QM7A 1E6CA 1I2DA 1KDOA 4NCNA 5ANRB 1E2NA 4F4JA 1ZW6A 4DSNA 3TAUA 3UANA 3NEJA 2O52A 4A2QA 721PA 3AP3A 1W7AA 3NBZC 3ZZTA 1UDXA 3Q9LA 3TGPA 5JJLA 4HSEA 3LD9A 3EIHA 4CEJB 1OXTA 2ZEJA 5LB2A 2OT3B 1HQYE 1YRBA 4EIWA 3FVQA 4LK2A 3K70D 1OH5A 4ZKEA 5TV2A 4DSTA 2H16A 2ZXUA 1SVIA 2EFEB 3C16C 5AUQA 1W36C 3RC3A 4WXRA 2QGNA 3SFZA 2ZSAA 2YV5A 1T6NA 4FCVA 4LBWA 5E3HA 2CLCX 2OLKA 1E79D 5AK0A 4A36A 1N5IA 2R9VA 2O8BB 2XJ9A 2FN4A 3TSOA 3A4LA 4TN1A 3REGA 3VTKA 3LY5A 4PO8A 3KFVA 2EFCB 2GNOA 1HUQA 2C78A 1SVLA 4DRZA 4JT4A 3DVLA 4PC2A 4QG7A 4V0NA 1DS6A 2ZE5A 2IHYA 3UKDA 2GJSA 3U6BA 2ZYTX 4KJZA 1II0A 4BUJA 2R6CA 1XMSA 1ZP6A 3KXIA 2QPTA 4KCGA 2C9YA 4PAMA 1VECA 2NPFA 4NMMA 1YKSA 4QHYA 3SE0A 2PMKA 4CT4B 4AY2A 3VKGA 4OL0A 1G7CA 1S8FA 1LVGA 5EP3A 5L3RA 1OFHA 4C0JA 3NHAA 3LWNA 1A7JA 2GRJA 1BMFA 3CRMA 3ECCA 4ILEA 5EXPA 1R8SA 3MUFA 4UNPA 2WTUA 1ZIOA 2C8VA 1ELOA 1E2MA 1QZXA 2FH5B 3AV0B 3QY0A 3IQWA 4EPTA 1XXHE 2IUUA 4C7OA 3GJ5A 2PCLA 2JJ1D 2P65A 3CO5A 3QIAA 4KVGA 4IVRA 3BERA 3HYRA 4ON9A 1YZQA 2F43B 5JCPA 4TLBA 2ATVA 1II8B 1JXMA 1CXZA 5BN3A 1G21E 2GEVA 1OFIA 4NYMR 1XEFA 2IUTA 1A4RA 4S2EA 3QXXA 2JLYA 5L3SB 5FH9A 5FL7D 1FNMA 4KI0A 3FPAA 3SHFA 5DGXA 2WKQA 1E2PA 2JLQA 4YMTA 1OKKA 1G5RA 4PFSA 3I72A 1EESA 3RHFA 1U2RA 1P5ZB 1X1SA 3GFPA 3K0AB 3GEHA 2WSSD 1N5JA 2D62A 3IIKA 3I73A 2WWYA 1W2GA 1XD8A 3H84A 1KSJA 1CIPA 4HAWA 2RGBA 3L0OA 3KKOA 2ZR7A 2GXUA 1VYTA 2C77A 4ZI2A 421PA 2ZSBA 1Q57A 3K9NA 3KJEA 3MWYW 2W0SA 4OKSA 3LO5A 3QBVA 2ATXA 1QHYA 5J47A 4A8JA 4EFMA 1EFUA 4KU4A 4G5SA 2J9RA 4XD7A 3ZS8A 1Q22A 1VG9B 4LBVA 1F2TB 3K0SA 4PHHA 2EU8A 1UAAA 1KSFX 1YRAA 4X8MA 2P67A 3DZ8A 1CJUC 4JT2A 1PLLA 1QF9A 4ESVA 3CRVA 3ZZUA 3CNNA 2CMKA 3OEED 3WMGA 1NVUQ 3UMFA 4B3BA 1LY1A 3QPWA 3ADCA 1U0JA 3MFYA 2FSHA 2C98A 4KHZA 5IK2D 4IOKA 4I1VA 4M1MA 1NBME 2VLIA 2GCOA 5EXXA 1RC8A 4DCSA 3P4YA 4DJTA 4WOPA 1NP6A 4Q19A 2JLXA 5KDOA 1ZNZA 3ND8A 4IJMA 3BH6A 3QG5A 3CRW1 3UATA 4ASUA 4NYMQ 1R7RA 3ZJYA 3NEYA 2ZROA 4RCZA 1XTJA 1E9EA 2A5YB 3SN6A 2OBLA 1N6NA 1KSHA 3GLIA 4B6FA 4JLJA 1TQ4A 2BMDA 2F55A 4CT5A 2BMJA 2DHRA 2GESA 3I8XA 4I99A 1TF2A 3DMDA 3SI7A 1DOAA 1CEEA 1VIAA 1OH7A 6Q21A 1K5DA 4URZR 5EE3A 1TF5A 1FMLA 1G17A 4QM6A 1G7SA 4KYIB 1UKZA 3SDZA 2XOKD 4LDJA 1E2DA 1KMHB 1ESMA 5BN5A 5JSZB 1SXJA 4NP6A 1JPNA 1DAHA 3CB4A 4GSYA 4JVSB 3QUSA 4ABYA 3K0FA 2EVWX 5JRJA 2HLDD 1ZD8A 1OE0A 4BRUA 5FPYA 4N1AA 1E2LA 2WAXA 1LTQA 5L3QA 1RIFA 2RH5A 3GJ6A 3WHLA 2QTVB 1AS0A 3R7WA 4OK3A 1ZVQA 1K5GA 4BWYA 2JLUA 2XXAB 2NZJA 4Q5IA 2F1RA 1XTSA 1DO0A 1GSIA 2PEZA 3DM9B 4NCKA 4C30A 5HR5A 1TAGA 3EC1A 4DLRA 1ZCBA 3LXXA 1IY0A 2JASA 1DAIA 1JR3D 4MDFA 3THXA 1E2FA 3TH5A 4FXPA 5GJCA 4TTQA 4A82A 3N5CA 4NDZA 4BFWA 3CONA 3GJ0A 4Y0VA 3X1YA 4RD3A 3VNUA 1UBFA 4LJ6A 3A1WA 1HURA 4BGDA 2IC5A 3FWYA 3DZDA 1E99A 3OE7D 2QN6A 4KBFA 5FOUA 1GILA 1LFDB 1NI3A 1CJTC 5CDFE 1N6PA 1YZKA 4UNSA 4A0HA 1GP2A 4EJSC 4PHTA 4KFRA 1DVRA 2YKGA 1WBDA 2BV3A 1W44A 4M1WA 4P4UA 4QXAA 3BFVA 4B48A 2GXQA 4ZKDA 1UEIA 4EPRA 1XXHB 1DAMA 2E87A 1P9WA 1QVAA 2L0XA 4QKQA 3C7KA 4X8OA 1KY3A 4GZLA 1WMSA 4PO9A 3SU8A 1NL3A 1J7KA 1NVVR 4B3DA 3LQQA 5FOWA 3HU2A 3PUVA 4EPWA 4LY6A 1P2SA 2ZPTX 1JB1A 1W4RA 5KSZA 4CYMA 2G3YA 1P2UA 1Q1BA 4OHVA 1WCV1 4R2HA 4QNRA 4DT1A 2HCBA 3B82A 3CWQA 1BS1A 4FMDF 5H68A 1CR0A 4ZPXA 1S1CA 1HEIA 5G41A 1FOEB 5KYKA 4UJ5A 1X1RA 1KK2A 3RRYA 3AEZA 4UXHA 3GLIB 2QGZA 1BMFD 2FF7A 4Q4HA 4MYHA 4V0OA 4XIGS 4PC3A 3UG6A 4GMXA 2GK7A 1M7BA 1JI0A 1KKMA 4X8HA 5CIQA 4XJXA 5TVKA 4HDCA 3ZYCA 4B34A 5F9FA 5CLQA 2ZJ2A 1MRNA 1G291 1U9IA 1VCIA 3LVRE 4LJ4A 2CK3A 3T34A 2BBSA 1SXJB 1R2QA 2VHJA 3VNVA 2PLFA 2ZI4A 1T3HA 3K0FB 4RKEA 2IA5A 2H8KA 2DWOA 4DCUA 2WWIA 1X3SA 4HLUA 1CS4C 1U0LA 1PUIA 3V00A 4BASA 1C9KA 3R7WB 1OFUX 1IY1A 2F6RA 3WNDA 1JAHA 1S3SA 1DTSA 2YOGA 3H0KA 1SHKA 4TL7A 1MH1A 5EE1A 3A58B 3SJCA 4UNRA 1OIVA 1Z2AA 3THXB 1K6MA 1NVVQ 1A2BA 2IW3A 2QAGB 1Z6TA 3HDTA 3LXRA 2VP0A 4HB2A 4LV5B 4YDSA 3M1IA 3NHBA 4BZXA 1PJRA 3B8HA 2WJIA 4TL9A 2FWRA 2G77B 5KSYA 1D6JA 1G8FA 4UXIA 3QKTA 2OFOA 2N42A 1S9DA 4DUGA 3W8RA 5TDHA 2VSFA 2ZUDA 4BFVA 3EC2A 4JS0A 4J0QA 1XZQA 4B43A 1WBBA 1E0AA 2GVDC 2OSBA 4XD7D 3K0EA 1F48A 3D8BA 1OT3A 1XEXB 1A5TA 3EIEA 5A0FA 2ZRKA 4A0FA 1IJFA 2O5VA 2HEIA 2ZVQX 1T9HA 1EFCA 2QPAA 1N5KA 4TSFA 1MABB 1LB1B 2RGNA 4Q9KA 3B85A 4LHVA 4ITRC 3U6KA 3A37A 3LW7A 5FTMA 3C5CA 5DYIA 2AK3A 2VL7A 4OI0A 3VKHA 2CCGA 4A92A 4DT1B 1RRCA 3EASA 3P26A 2BEKA 4B3FX 5DH9A 4BLQA 2XGJA 5HTKA 2JIZD 1IONA 1T0JB 1XB2A 2VSXA 3B1ZA 3RWOA 3AVUA 4OQMA 5EXTA 4DCNA 2IWRA 1M7HA 3M4YA 4LJ5A 4NTZA 4Q00A 4NYIR 3SC3A 4MRVA 1W0JA 1ZNXA 5K8IA 3TQFA 1E9RA 3ZS9A 3FB4A 4Q4HB 4D6PA 1NN0A 3O8CA 1L4YA 3FTQA 1HH4A 1A82A 1JQLB 1JQJC 2ZU0C 3DHWC 3VMFA 2GEDA 2Q3HA 4M9ZA 1SXJD 5HZHA 2GZHA 4JLDA 5SZJA 1AGRA 3VQTA 4D0LB 2W2TA 2QZ4A 3K0CA 1S4QA 2C5LA 2EYUA 3BXZA 4H1VA 1EX7A 4WZ6A 4JLVA 1IN7A 2OLJA 5GVSA 3THYB 4ZI3A 1Q1EA 1R4AA 4HYYA 4EDHA 1R0WA 1T0HB 5CB6A 4Q18A 2A30A 1OXXK 2XJ4A 3TJZA 1NBMD 3L8YA 1XMJA 4FIDA 1PV4A 1KI8A 4AYXA 3DEFA 2HV8A 3P20A 5CK5A 1YE8A 1HE8B 1PZNA 1OSNA 2O0HA 2O8EA 3V4RA 3BH7A 4U02A 4GRAA 1DG1G 1RKBA 2ZR9A 3LH5A 1KDTA 4FMCF 4DLYA 1XMVA 2WKPA 5JS7A 3IO5A 3AKDA 4M21A 2IYTA 3CZPA 3GCGA 3TSWA 4C0BA 3UPUA 5FPTA 2NGRA 3CM0A 1UPTA 1MR3F 1X86B 3ASZA 3NDPA 4QBHA 1AM4D 1R0ZA 2ZJOA 3JVUA 4Q1EA 3U44B 3KJIA 3TKLA 4DIDA 3CX8A 1SGWA 2IHBA 2FJUA 1R0XA 4AKEA 2ONKA 4MGZR 3T12A 2OCBA 4MRRA 2CHQA 1TQ2A 3RC8A 2WMNB 5AUOB 4V02A 4NYIQ 2JAQA 1YVDA 1ZUIA 3FMPB 4LPKA 1XTIA 2QE7A 2NMVA 1EG7A 2PEYA 2RB4A 2ODBA 1UADA 5FOVA 2WHXA 1PUJA 3CH4B 4MDEA 2CCJA 1IM2A 5E7JA 2VBCA 5EQTA 5H8WA 4UNNA 1F3OA 4KXFB 3PEWA 4QL3A 5JCZA 4DLXA 2ZANA 1D9XA 3TE6A 1RFLA 4TMZA 3VU9B 1KO7A 1P2TA 1D2EA 1Q0UA 2VP4A 4D4LA 1S96A 3PVSA 2FPKA 3CPJB 3KX2A 3QEJA 4AD8A 3OESA 4CEIB 2ZJZA 5GADl 2FSFA 3AVVA 2V1XA 4YXWA 1GDDA 4YC7A 3GJ3A 3R9WA 1NKSA 1OIWA 1MO3A 4LCBA 4HAUA 4MKFA 3KB1A 5JBQA 2OCYC 3R8FA 3D7MA 2V3CC 1UKYA 1MO4A 2CXXA 2WJHA 2FG5A 4DB4A 3AKEA 4DVGA 3U7FB 4D82A 1T5IA 5CM9C 3O8BA 4PHFA 1RRGA 2BMEA 4BFYA 4URYR 3DMNA 3WBJA 3CBQA 4JMPA 5TARA 5C4GB 2DY1A 1FNNA 1ZM9A 4M53A 2AFIE 3MJHA 2QMEA 4PSVA 2YWGA 4DDUA 2A5DA 4Q9HA 2AHOA 4IEIA 5FTNA 2J7PA 5L8VA 5KNDA 5LDDC 2FV8A 3W8NA 1ZBDA 5SZHB 2OCPA 3CF6R 3PUYA 3EZ9A 2AX4A 3P32A 4E03A 1GKUB 4MQBA 4TL8A 2GK6A 4HZUA 5HE8A 2R62A 2XZLA 3O8RA 4PPFA 4KVAA 4C0SA 2HXYA 3TUIC 2O8EB 2RGAA 3RS7A 3NDBB 3I61A 2A3RA 1ZC4A 3CLVA 3F5FA 5BN4A 2LWIA 3QJYA 2A7QA 1DAGA 3I5YA 3CIOA 2IYQA 4KSBA 1VG8A 4TLEA 1G18A 4Q01A 1NF3A 121PA 1HTWA 4O2LA 3SYKA 1PVOA 3C15C 1VPLA 4KLZA 2REXB 3GJ4A 1Z06A 3RS3A 3ZH9B 2BBTA 1TTTA 521PA 4BQSA 1G19A 4MRSA 3ZZ0A 2HYIC 2R2AA 4HAZA 4IXNA 5JEEA 2VEDA 2JDIA 3W5IA 1R6BX 2E1RA 1YR8A 3LV8A 3TR0A 1MO6A 1RYHA 1XWIA 3KKQA 4TYNA 4GOXA 4TYYA 2AWNA 4I1SA 4TSFD 2J0UA 1CBUA 1AGPA 4YMVA 1NKTA 4FCWA 1NVWQ 4G5OA 2N1BA 2JJ2A 1A2KC 4M0LA 4CW7A 1QHNA 4K8OA 4DIEA 1JR3E 3B1YA 2OILA 4JJKA 1G8HA 4B2PA 2PZEA 1TX4B 4NZYA 4JLMA 4G5QA 5FBLB 2XEXA 5EP4A 1SQ5A 4RD6A 1NIPA 2YNMA 4F7WA 2QP9X 4M1KA 2Q0HA 4JVLA 4QNMA 1W0JD 4TYQA 3EZ2A 5FUYA 2X8AA 2YWFA 2B6HA 3IQXA 4B35A 1QHHA 2FX3A 3CH5A 3IDQA 3I1FA 2IYZA 4IVQA 3WMFA 4DDWA 4II7A 3E5HA 4EJSA 1OFTA 3CF2A 2GILA 5AUNB 4TZ0A 3UK6A 1KIMA 3CF0A 4B32A 1KDRA 5FBWB 2O8DA 2AR7A 2JEOA 1AN0A 3LX5A 3CUEF 1E94E 2IYRA 1ESNA 2PCJA 3NWJA 3RABA 1Z08A 1ZUHA 1XD9A 3KJGA 2NO1A 3V9PA 4KV9A 3MGCA 1N6IA 1UF9A 1E0JA 3FHTA 1YQTA 3DDCA 4OJKA 2F1HA 4OQXA 3THOA 4ZCIA 1U8YA 4HZUB 4TYWA 4JVMA 4LRWA 3VHLB 3NC0C 1NN5A 2ZI9A 3AF4A 2ZRLA 1U8ZA 1F6BA 1S3GA 3FFAA 4JL5A 4LJAA 3W9YA 3FE2A 2ZJAA 1LF0A 1VMAA 4F93B 1Q3TA 4K46A 3PUWA 3PXGA 3EZ6A 4NL4H 4JSYA 4Z54A 4GBMA 3PEVA 1XMIA 2PZGA 5H70A 1JJ7A 4NONA 2RGGA 2Q3FA 3H86A 2A5GA 4LC1A 1ZC3A 2O8FA 1KDPA 1XCMA 4Q7KA 4IVPA 2VHTA 1Q3HA 3AGQA 3H2YA 4MYCA 4B75A 2IS6A 2ZYVX 1N6HA 1QRAA 3KZ1E 3ZIAD 5LD2C 2WWWA 1VDZA 1GNRA 4MRNA 1WA5A 1KI9A 2YOFA 3TIFA 2IXFA 3UIEA 4CVNA 4A2WA 4FI3C 3THWA 4YDHB 4PANA 2UZIR 1XTRA 4CIDA 3FKSA 1NVXQ 2AKYA 2ORVA 4HB3A 5CYOA 4E22A 1KNQA 1ZRHA 2J3EA 4LX0A 4HAYA 2F3RA 3AGPA 3NH9A 4A4DA 3ONWA 1B0UA 4Q7JB 1J90A 1KK3A 3EPHA 2AFHE 4DKXA 3LRPA 4WZBE 3HYTA 1FX0B 2D3WA 4B74A 4F91B 4LZZA 3UMSA 4L5BA 5JHHB 2GBLC 2I1VB 1UBEA 3EZ7A 1Y63A 3ZQ6A 3P4XA 4TZ6A 2FEMA 1AQUA 1IJEA 2BHRA 2QMHA 3TRFA 2PX3A 1EX6A 2QUZA 4HB4A 4AI6A 2X1VA 2BEJA 2HXSA 4FN5A 1A1VA 4W5HA 4JBXA 4JIMA 3ZVNA 2BC9A 1W48A 4HATA 1SVSA 1BOFA 4D0GA 1ZAKA 4OI1A 2XTMA 3G0HA 2P6UA 1QHHB 2UZ3A 1OH8A 2W2XA 3R9XA 2AWOA 3TK1A 4OI4A 5DO9A 4DSUA 4EJSB 4FW9A 1NY6A 3W3AA 5JHGB 3TW4A 1OJLA 4TQ9A 1ZNYA 3U7HB 3EAQA 3L8ZA 4V03A 4C2UA 1E1QD 5CB8A 1OH6A 1DE0A 2RGXA 1KZGB 1Z8FA 1QG2A 3FDIA 3SJBA 2RGDA 4PHGA 1G3IA 1I4TD 1SKYE 4PAOA 3ZQJA 3AVPA 3T35A 5C4MA 2ZVPX 2ZRBA 4ZCMA 1E2JA 1KAOA 2X2FA 2ZREA 3BB1A 3L2OB 4G0NA 1NLFA 3EARA 3EW9A 2NPIA 4XSHA 5F9HA 4PAQA 2H17A 2ZIAA 2OFWA 2OG2A 3GLIE 5J4VA 5B57C 1YZTA 1M2OB 4A6PA 4YQFA 1GKIA 1Z0FA 2QL6A 5JFGA 4WXPA 1R0YA 2C95A 2QQEA 4LBZA 3RRMA 4Q48A 3WNCA 4NCJA 3IBYA 4RD2A 4FMDB 2EFGA 2IX3A 2F3TA 2EYQA 5KPJA 1SXJE 2ODEA 4MGKR 2CNWA 2CDNA 1FPMA 3U7GA 3AVTA 5DHAA 2JDID 4RZ3A 3PENA 2QI9C 3PITA 4R2IA 4LC0A 3THWB 1NSTA 4IW3B 2CL0X 3GFOA 2V1UA 4P4TA 2F9LA 4XTRA 1XX6A 4TYPA 4PQFA 4IDOA 4URUR 1KOFA 1IHUA 5DYGA 4DLZA 5C1BA 4M9QA 4HDOB 1G6OA 2H5EA 1DO2A 1X8KA 2D74A 2V6JA 5KNCA 2FPLA 5CLLA 2G88A 1WB9A 2FFQA 3I32A 4WW0A 1E9BA 3AF3A 3KQUA 5DSZA 2R6DA 3ADDA 1JEEA 2FMXA 1DG3A 2PT7A 3GEIA 1YZLA 2K5UA 3BFXA 4DLUA 4AIIA 1LNZA 2J41A 3WRYC 1G16A 3E70C 1Z2CA 3CRQA 2JA1A 1PLKA 4LHYA 4PXAA 2QSZA 4XVQA 3U60B 2JATA 2RHDA 3A4MA 3R8CA 2VSOA 3DOEA 4MYUA 3W6NA 1IXSB 3B9QA 3FYHA 1SVKA 3U2QA 3QSYA 3GJ7A 1KY2A 2IYVA 5HKKD 2GZAA 2CVHA 2GDJA 3Q72A 3Q5EA 1CR1A 2A5FA 3KKNA 3Q5DA 2ERXA 5HZKA 2V7QA 2NQ2C 3CNLA 1P61B 1RE0A 1IXZA 4UXJA 5M04A 1W47A 4BFSA 4C7OB 2N46A 1JEDA 2Z4SA 3I92A 3QXHA 2YOHA 5F98A 4Q4JA 2JLVA 2JJ8A 1NSFA 2XITA 4NBSA 1W49A 1KJZA 3IGFA 4R98A 1KNXA 3RDPA 5DN6A 5JMTA 1QG4A 5CIWA 1KAGA 2XB4A 3S1AA 4Q47A 2GF0A 3QOFA 3FFBA 2PT5A 1KKLA 2FZ4A 1M74A 2VP5A 2YZ2A 3B13B 1G1MA 1FL9A 4DEXA 3FMIA 4BFTA 3G82C 2ZUCA 1E1RA 4ZO4A 3HP1A 3O8DA 3EWSA 4BZPA 5F3WB 2XNSA 221PA 2MSCB 3WHKA 3TAHA 2AL7A 4D81A 2BVNA 2ZAMA 1ZM3A 3CW2A 1UM8A 3RS0A 3VFDA 2TMKA 5UKDA 3AF1A 1Z22A 3LNCA 4LGMA 1T8TA 4C2TA 2P5TB 3TMKA 1AZSC 4A1FA 3SEAA 4A8JB 4W7SA 2ZRJA 2BJWA 1NIJA 2YWHA 1Z63A 2QP3A 4Z8YA 2P2LA 1L4UA 4HLQB 2B8WA 1OXUA 4F92B 1C1YA 4OQLA 1YR7A 4GP6A 3LBIA 4M22A 3T1TA 2G1JA 4KFTA 4B76A 1VCNA 3FKSD 4M8NE 1E0KA 1S2MA 1CU1A 1WP9A 3P27A 3SHWA 1KGDA 5SZKB 2G9NA 1ODFA 3PR1A 3OIVA 1JBKA 1XTQA 2WICA 1GRNA 1WRBA 2Q6TA 2CCKA 3KQNA 3LAWA 1N6OA 1AKEA 3VAAA 1SKYB 2B21A 2GCOB 1ZD9A 4G01B 1TMKA 1S0UA 4KFSA 5AJXA 1MV5A 3AVWA 4PPGA 3NBFA 3U3RA 3LX8A 3PUZA 4C0HA 5FI0B 4AG5A 1KI2A 2D2EA 3IKJA 4Q4AA 3FHOA 4RY2A 4U5XA 5EE5B 2ONJA 4AK9A 2MSDB 4TLCA 3C41J 4MKHA 4N0DA 1JAIA 4WBSA 1H8HA 2BOVA 2FFAA 1WF3A 4TMKA 1CR2A 3GJXC 3VR1A 4HUQA 2BM0A 4KSCA 4BEJA 1J70A 4FMCB 1IN6A 2HUPA 1XJCA 3HU3A 4B44A 2OAP1 1R5NA 1CF4A 1GIAA 2A5JA 4JL6A 4OHXA 2KB0A 2AD1A 2FSIA 2OXCA 2QRNA 2Y8EA 3OF5A 4JYCA 1EWQA 2C04A 3GLGA 1XFAA 2KSQA 1TF7A 4IDQA 4ACAA 4ARZA 3U61B 5CITA 1IN4A 5L3QB 5FBQB 3RNLA 5G3YA 2J0SA 1F2UA 2WJJA 3ADBA 1OXVA 3Q85A 1OB2A 2GEUA 4LYJA 3SQWA 2G6BA 1AS2A 1OKKD 3DKVA 3PFIA 5DLQC 4QHSA 3X1XA 1OYWA 3KJHA 1W46A 1DAEA 1TU4A 2V54A 2VA8A 1MRSA 3NBXX 3OIUA 2LKDA 2ZRAA 4TMWA 3KDSE 1LF5A 821PA 1TU3A 1FQKA 5E4FA 1GZSA 1JALA 1KO5A 3IPYA 3QE0A 2JGNA 1OIXA 3NKVA 3T1QA 5BXQC 2HJVA 3Q8XB 4WA7A 2WMOB 2CJWA 2FDCA 2XX3A 2J0QA 2NZ8A 4HLCA 2GF9A 4PZYA 1C4OA 1AA9A 2BBOA 2FSGA 1G8PA 2RGCA 3OFNA 1H8EA 5FTJA 1RVDA 5K8TA 2RHMA 4BE7B 1KO1A 3IHLA 4MITA 1ETUA 1J8MF 4C4PA 1P9RA 3KQHA 4LV6A 3QXCA 1QBKC 1B23P 2UKDA 3MCAA 4OQNA 5IHPA 3REFA 4B3CA 2RAPA 4LWZA 1DARA 1LS6A 1JPJA 3IIMA 1JJVA 3Q3JB 2P6NA 4HAXA 3VR2A 4GL2A 1SKQA 5IF9A 3F0TA 4N0EA 2OXRA 4TQUS 2IXGA 4ASUD 1IN5A 2XSZA 4D25A 1G7RA 2QM7A 3CPHA 5D3QA 2QT1A 1FP7A 2VP9A 2ZE8A 2DWQA 2ZYUX 3A6PC 5GJVC 3CPEA 4H9GA 2F1JA 3UWOA 2ZRPA 2OUKA 2I1QA 4Q4AB 3X1DA 1XEWY 4XVUA 4H1UA 5GJBA 3ZD6A 1OHHA 1P6XA 4K81B 2BCJQ 2HT6A 4OK6A 1I4LD 2ZSDA 3LLMA 2QU8A 2ECKA 2V7QD 3KXLA 5LBIA 2YHSA 5L3VA 3WP1B 4O3MA 2REOA 4Z51A 1CR4A 3MG9A 5FR2A 1EFRA 3K53A 1XF9A 4HB0A 3A1SA 3BRWD 2QSYA 2XNDA 4M1OA 4M4SA 3QPVA 1ZNWA 4O0MA 4V0MA 4M2LA 1ZU5A 1V43A 1UDWA 2WJYA 1SZPA 5DN6D 3GLGB 1NNEA 5JJKA 5DI3A 2ZITA 4ARZB 4KITB 4NCIA 3SBDA 3LBNA 2C99A 4MGYR 3ICQB 2OE2A 3PJRA 4N3NA 1U94A 2GAAA 1E32A 3K09C 5TB5A 4PZLA 4I81A 4BLTA 2P6RA 3T06B 3U5ZB 1ZYUA 2XZPA 3T5DA 4RFSA 5D3MA 2CL6X 2H7VA 1E1RD 2NO9A 4ACBA 4DSOA 1Q1QA 4Q9IA 1BH2A 4Q7LA 2GBLA 2GHIA 3BBPA 1NJFA
chains in the Genus database with same CATH superfamily
4I55F 1PT7A 1YK0A 3GW8A 2B4KA 2IYAA 3CLTD 2OHVA 4MV8A 1A4XA 5AM0A 3M0EA 4OA8A 4YGXB 4XARA 2G80A 2B7BA 3PNVA 4G85A 1Y82A 1KYZA 2I3DA 1ATIA 5IJ0B 1NNI1 1VI6A 4XYGA 4OQPA 4JT8A 4RLSA 2HHJA 2IQIA 3MILA 3PIRA 5KC8A 2ZS9A 1QIIA 2C07A 3LBHA 3IUBA 4NK4A 1YDEA 4XJVA 4DWVA 2Q1SA 2W8BB 1AZTA 2ZPAA 3DQZA 3I83A 4PC6A 4Q7MB 1Y8RA 3B7GA 5K6RA 2DH5A 3IDZA 2JLCA 1U2ZA 4O4LF 4ZZ2A 8ATCA 3NV7A 1UP4A 2R8PA 2ZTMA 4XM0A 4RKFA 1WVMA 2DM6A 4ZAVA 2Z5GA 2W83A 1G3QA 1TM5E 4EG1A 2BMFA 2RG1A 1X7ZA 5JAHA 3CNHA 1ZHOA 3NFYA 2HYDA 2XB2A 2PIAA 5BVGB 2I9KA 1GAEO 4RTQA 3ZD7A 2ZUUA 4BS9A 5IAJA 4KLRA 3W90A 3AV3A 3UFBA 5KQSA 1ZKMA 1YR2A 5E7MA 1ACMA 4JA2A 1EFHA 2QYOA 5F12A 4INPA 4IZ6A 4I9NA 2IV2X 1EVJA 4LJRA 1N2CE 2FW0A 2MSEB 2QRLA 4H0FA 3X3HA 5JBIA 3HBNA 2FPUA 3LYAA 4DARA 3KEMA 1CX9B 6PFKA 1P7CA 3KM0A 4IEEA 4QAQA 5BW6B 1RQPA 2BTQB 2PUGA 2AMJA 3AILA 1YOVA 3B52X 3M4JA 1TMOA 2FMKA 1WXQA 3B7PA 2YINC 4M6WA 4YJKA 4J7AA 3IKMB 3NBAA 3UTDA 1Q44A 2FXIA 4JP8A 4DW8A 5F1PA 2O54A 4OJYA 2XVMA 3WL7A 2I4NA 4CGZA 4NPCA 1GSAA 4HX2A 4RH1A 3PWKA 3RRBA 1TO2E 2OA0A 5JZMA 2XKAA 1E98A 4LQDA 3LQRA 5JNUA 2HLPA 1W36B 3I6IA 5FOSA 1G5IA 1F3LA 1RHRA 1GGVA 3PPYA 4DLWA 1J9ZA 3NB0A 4QQKA 4M83A 3VZDA 1EPUA 2QRVA 4E2ZA 3UUWA 4E5VA 4EVSA 3HXPA 4H1WA 5IJ9B 1DJNA 3OIFA 4EWLA 1ADGA 1BGVA 3GLSA 1B26A 1ODTC 3TL2A 2F00A 1OZFA 1L7OA 1N5DA 1R8JA 1ZMXA 4EA9A 4B3TB 3NYQA 3LT0A 3UF0A 4G5FA 3ESDA 3GUHA 3B1FA 2QD3A 5JLAA 1PI3A 4ONEA 1DKRA 3RBAA 4FSHA 3NX4A 3EXIB 4TT8A 1Y4SA 2AVNA 2C96A 4HAOA 1FUEA 2R8ZA 3CRRA 1XG5A 4LA4A 1IWBB 4ZZ0A 2IYYA 4RFSB 1O0SA 5CNKA 3QXSA 1VJTA 5D3MB 4A6XA 4D9HA 4OPMA 1RCFA 2PL3A 4QDZA 2A9OA 4YNBA 5GTDA 3HUFA 4Q1DA 2BGNA 4NJOA 2O9JA 3WJ7A 1G3UA 1JG3A 1E1DA 3RU2A 2CXOA 5AW8A 5CPFA 3VKWA 1VPWA 3TNFA 3HLKA 3FUCA 1R5BA 4X6LA 1C7JA 2A0FA 2X2EA 1EFDN 3R7DA 5DGTA 4BMDA 1M2NA 1OC4A 4CDRA 3NOQA 2R6GA 2PLAA 1CJMA 1P39A 2C9DA 2HWKA 3CE9A 4WY5A 3U17A 3D6VA 1L2TA 1PJBA 2OCDA 4FT4A 3E05A 4IXMA 4RA6B 4RXMA 4XYEA 4BEBA 3X1KA 3LY8A 3ZHSA 4DMFA 2CBXA 2GPNA 3IDFA 3ZCRA 1HBJA 2BM1A 2G8NA 2FJ0A 3UK0A 4JJAA 3KUUA 5EXSA 4ZDKA 2WSSA 3I6BA 4W82A 2JA2A 4INJA 5DRTA 4NCHA 1PEYA 4AM8A 5A5VA 3FHCB 2VTEA 1LU9A 2WOOA 2XGSA 4G56A 1J49A 2VPQA 4UDOA 5E2AA 3W6ZA 5GPBA 1ECJA 2GPJA 1NJSA 1T5LA 4TLAA 3ZJUA 2HIHA 1UPUA 3GMSA 1DBPA 2GBPA 2CHFA 5C51B 2VOEA 3CO0S 5AQEA 1QF6A 3PGA1 3H2JA 2FSUA 1X7XB 3I62A 2PRIA 2X6RA 1J1ZA 5CJ2A 3F9RA 4OQFA 2I3ZA 3HUUA 1W1IA 2BPOA 2OGTA 1IB6A 2W6IA 2XSZD 3TSYA 5KWIA 1XGKA 2WAYA 3MD0A 5E0OA 1Q15A 1QC5A 5F7ZA 1P31A 4GI7A 5ALIA 1PD1A 3FPKA 1HYBA 3EAFA 3OEEA 3CB2A 1O4WA 3WJ2A 3G6KA 1L8QA 4RGBA 2ACVA 4LYAA 4PFKA 4CKWB 3MRSA 3AR3A 4AP6A 3C8HA 4YJ3A 1UBHS 2PKWA 2G67A 3O8OA 5DYNA 3UG7A 1T1RA 1MJGM 1NNUA 3JZDA 4R51A 4A9AA 2X9VA 2JLBA 3AH8A 1O0CA 2A86A 2M32A 1DC4A 3HXQA 1YGYA 1N1GA 1OPRA 3AQIA 3FPCA 5AKEA 2QJOA 4N9WA 3TVYA 4NE2A 1XBTA 1M67A 5AM2A 1W36D 4Q4CA 1GPH1 1Z68A 4Z1MA 3ANXA 2PMDA 2XNDD 3DBVO 1YDFA 2X4IA 3P2EA 3PFHA 4RGYA 5AJYA 4R9UC 5IBPA 5C34B 2Y68A 2EFHB 3TLCA 3UENA 4D9BA 3R0JA 2ANBA 1ISMA 2AD5A 1GXSB 4EB0A 1TKAA 3MJCA 1QONA 2MYTA 4NU0A 1Z38A 3FLEA 3Q7RA 4Q1FA 2ZDGA 4BQRA 4RVUA 4EAQA 2VDKB 1N0HA 3SP1A 1KXZA 3ZCQA 1MAAA 3KTFA 4MROA 3BC1A 3IT0A 4PXSA 4C01A 5KOYA 1Z6YA 2V7EA 1C1XB 4J0EA 5EIAA 2VXOA 3BMXA 4LGYA 5ALLA 1P80A 2IK8A 5IXJA 1WW3A 3EXAA 2F43A 5JNVA 3PI7A 5IZCC 4N5DA 1H4TA 4AG6A 1I7SB 4PU0A 1IB0A 3GLKA 4W1SA 4RUKA 3S8YA 1DL5A 2ZIUB 3LXMA 4IQFA 3K35A 1QPZA 1MB0A 2EBWA 2FX2A 2KHZA 2OKGA 2YZGA 4G63A 1E3TA 1JPUA 1XKLA 1BROA 4PLCA 5HKAA 4ZREA 3A4NA 2RHWA 3BMNA 4WTOA 2HF9A 5L3SA 4OEHA 5JSFA 3RVSA 1TJ4A 4F85A 3ZLJA 5K8UA 1VZ3A 4HDQB 4XGKA 2R1UA 4FI3F 4YFYA 1P5JA 3DNPA 1DHRA 3IMCA 5JAOA 3K4PA 3BCHA 3B3GA 4OLBA 2ZJYA 2JKVA 3TRIA 2O5RA 3Q11A 3RWBA 3K0AA 4GT1A 2KX7A 4RCVA 2QDXA 4XB2A 3VU0A 1UXJA 3T1YB 2J1LA 7GPBA 3WLHA 3G5UA 3DLCA 2AH5A 2SKEA 4KXUA 2BTOA 2Y67A 3HVHA 4WFJA 4F1WA 1IBSA 3NS7A 4Y7DA 2DLNA 4YLGA 4UBIA 3FGNA 3OE7A 3IE0A 2IYNA 3WMEA 1RJFA 1GLGA 4FK8A 1SU7A 2J0UB 1E2UA 4HHEA 5LB4A 1QHSA 2G7MC 3QX9A 5GGXA 4CBVA 1G3RA 3GLFB 1OB5A 1ZCJA 3QU4A 4FFBA 1EMDA 1U0SY 1VYVA 2HPZA 1BDJA 2RCNA 2Q6OA 3A6DA 4IJQA 4MKGA 3QMMA 4KPFC 1QOPB 1SUIA 2VK2A 1CRPA 4FCTA 4F84A 4BMNA 1ZVJA 3SR3A 3OPMA 3SNHA 3ICOA 3O2QB 3PICA 4ZHSA 5LQCA 2QL7A 2A9JA 2ZQ5A 1KI1A 2QPLA 4UW9A 4YXWD 3KT6A 1C3OB 4KR6A 1NX6A 4FE3A 4JLNA 1E3SA 2OAEA 3Q2OA 4F8YA 1KO4A 1EIWA 1T25A 3GIWA 1WQ1R 4RD4A 1RABA 1PS8A 2VJPA 2D2IA 4KW7A 5J2UB 2VWGA 1SUPA 2C4HA 2FFJA 3DL0A 4GKVA 3EGCA 2Q7XA 4WXEA 3C14C 2YJTD 1Z8DA 3EHEA 4D4LA 2PUJA 4BLOA 5HP4A 5H9WA 4INAA 1V1RA 2DRIA 2W6QA 5CNMA 1A9QA 2O20A 4M8IA 3RYIB 4OLJA 4IFTA 5A5GA 2BGTA 3B1KA 2WKRA 1IHYA 3V8EA 1AF7A 1BYUA 4RKRA 5BV1A 2X41A 4NX2A 4WBXC 4DUPA 3K70C 4FC7A 5KHOC 2O8DB 2D0PB 3I28A 3CWZA 5CW2A 1M34E 4GC5A 5JVDB 4ZAZA 1E62A 2Y92A 2E5FA 1AK2A 1WU8A 4IG4A 3BAFA 3IEPA 4GOJA 3WGZA 5KREA 3W4IA 4ZHQF 2GQ0A 3DCYA 4MYRA 4UCQA 1Q12A 2NSYA 1LQUA 2FOIA 1HF3A 1P19A 4EEKA 3I9MA 3CZQA 3H4VA 2I2AA 4EPXA 4UQLA 3BBLA 4TKUB 1WZEA 4G09A 1KZYC 5BT8A 1KOLA 2PMBA 3W3ZB 1U0GA 3QUBA 4M9RA 1NPTO 1DDIA 1P60A 4PW0A 1JLRA 4OREX 3T9AA 3VR6H 2IPOA 3O82A 5EZQA 3WDKA 4IX9A 4QBFA 3MSXA 4BUZA 5B58C 5BV0A 1JFTA 1XZAA 1TM1E 5JDIC 2W2VA 3G7UA 5JS2A 5IS2A 2XR1A 3JYQA 4WAUA 1KEUA 4XWOA 5CVJA 5H02A 3O8QB 3VKFA 2JAWA 2GKSA 1CQWA 2VF5X 4DR7B 5TPZD 2FPXA 3CSSA 4Z4CA 3OHSX 5F7OA 1VP9A 3BMOB 2AN4A 1XDGA 2DR3A 3LPDA 4TTRA 5CLHA 5KCMA 1NQWA 1MB9A 2KWIA 3E03A 3ZWWA 5D85A 4UVIA 4YMHA 1CUYA 4D9GA 1KMIY 1QWSA 1XIVA 3KOUA 3VM6A 4ARUA 1DQPA 1G66A 1LNQA 2QT0A 3AEKA 5J4KA 4JXKA 3OEHA 1L7EA 1RMTA 3D9QX 4IHKA 4JQYA 2I33A 4EGJA 5C46F 3P9PA 4A8HA 1YI0A 3HYLA 1MT0A 5ERXA 1FFAA 1LW6E 4G4SO 3IEXA 4QASA 2FSVC 3AM3A 1O54A 2XYQA 1VG1A 4YBZA 2QG9A 4MWCA 4MHOA 2ZJ7A 3C3YA 3KEGA 1O5TA 3L7BA 2YNMD 1U28C 2GFHA 3L7IA 4GQAA 4V0SA 1E9FA 1U99A 4OBEA 5AW0A 1BWPA 3NHUA 4R1MA 3IULA 2ACKA 2D1QA 2WYOA 3BHNA 1KS2A 4NZMA 1ZCAA 3LCJA 3PVCA 5FBRB 4C4SA 5KOHB 3VOTA 3OY2A 3Q0EA 2D1SA 3KB8A 3QEOA 1XLWA 4MA4A 1UJNA 2GEKA 3N2EA 1C7ZA 4V0KA 2KLBA 3UUFA 4LF4B 2DVMA 3AFIA 3DFKA 3OC0A 5E8JA 3EXHC 3UT5A 1E2GA 1RI1A 3H13A 3T7IA 4TMXA 1CQJA 1YRHA 4N6GA 3L8GA 3WV5A 3RK4A 2WWFA 1VYUA 1PR1A 3LGSA 1NUUA 3MW8A 3O1LA 4EPVA 3U3MA 3IP9A 2B7LA 1FDIA 4QOIA 3V4ZA 3B12A 3W2FA 2GCNA 3FBWA 4JH0A 1OOEA 2WU0A 1E8MA 1CIVA 1B3RA 1Q6YA 2X5JO 4RM2A 1JQDA 2RKOA 2CF5A 3BJMA 1H85A 1N25A 1GUBA 2Y1GA 3N05A 1TNDA 1GPNA 5LYJF 3QE4A 1HDCA 4FDMA 3UUGA 1GFZA 2GN8A 3DEJA 4OHUA 3OFJA 2GJ9A 1FLNA 5TQVA 2ZBFA 4AXXA 2WUEA 1A9XB 2AJDA 1MC1A 1N3BA 1THTA 2R68A 2WVJA 3AFMA 3U9TA 1KAHA 1CUVA 1DBSA 2O0KA 2POCA 4MZDA 3QI2A 3WOVA 1JEAA 3JATB 4OGWA 2O3RA 4BO7A 3C48A 2HV9A 1I0IA 1RRVA 3ESZA 2CWDA 3V2IA 5LWHA 1P0QA 2XE4A 4RZUA 3MT7A 5JWRA 4V2IA 5BWNA 2X0IA 4I50F 1W0CA 3ITDA 3BIWA 2R1TA 2IU3A 3V8BA 4KC0A 5P21A 5A4JA 2QTBA 4H2DA 2RGRA 4RENA 6REQB 5J2TB 4NS4A 1GVNB 1RXEA 3O47A 2PRKA 1J0BA 2IX9A 4LBYA 1ONSA 4OO3A 3MT9A 4QGGA 4FILA 3L1VA 1C8VB 1PFUA 2AUNA 2OSVA 3GWZA 2QAGA 4UHCA 5KSOA 4YQYA 3SCZA 2HOQA 2J4DA 3WIDA 3QFTA 3WKEA 5I7VA 1AIPA 3I9JA 2Z5LA 3EH2A 1G64A 2BEUA 5EHXA 1SQSA 5JMOA 2ZIWB 1TUGA 1QP4A 1VL1A 2YV2A 2EL9A 2FETA 3AM1A 4XSGA 3VPSA 5HNKA 1AKRA 3BEOA 2WBLC 1P1BA 4LSWA 4QJ5A 1VE9A 2HBYA 1XP5A 1D4AA 2FP4A 2NTYC 1S2GA 3M4XA 2VXYA 4LYGA 3O93A 2FOLA 1U6JA 3PSAA 1G6HA 4IHQA 4JBLA 1QCYA 3DAGA 2H63A 4WKPA 1ILEA 3T7TA 1FFBA 1N2OA 4D8YA 3BWCA 3DGEC 4BPBA 4BZQA 2VHCA 2W6JA 2ZS7A 2X0FA 2LR0A 2FQYA 3M6XA 1Q0ZA 2Z8YA 4WH0A 3RAPR 1XEXA 3TTVA 4WKNA 3ABRB 1PQ4A 2DJIA 1F0NA 2ZTHA 3MWJA 4GLFA 3BTUA 3N74A 3WWCA 3I30X 1G63A 2R4QA 4AMZA 3O21A 4AUEA 1PJSA 2ZRFA 3W3AH 2G7ZA 1OUMA 3WYDA 5LZ2A 4ML3A 4DM3A 3QKSB 4XWGA 2EQBA 2DECA 3LCMA 3MRXA 5IJXA 1B16A 4NZOA 5JYBA 3WB2A 4BWFB 1MG0A 2XCSB 3AETA 1LI7A 2J3DA 4DQDA 4DCJA 2E1PA 3PRKE 4OHPA 2XZDA 4QJ3A 4X93A 1DPFA 4P34A 1JYSA 3IRUA 5K0CA 1T6XA 4EVQA 5AKLA 4LRYA 3GNTA 2H7CA 3HJRA 1LZLA 4IDNA 1V1JA 2FQQA 4N8EA 2DZDA 5ALXA 1BCRB 4QECA 5K8JB 2DFLA 3G2PA 5ALOA 1CF9A 2P11A 1YUMA 4OI2A 1FDWA 4Q7EA 5JAIA 2JGDB 1AKMA 2R8OA 5E2IA 1CUHA 2JRLA 4AQYB 3KPJA 1XVVA 3QYFA 4AY5A 1QFMA 3HWRA 1JT9A 3C24A 2EQAA 3COZA 5FDFA 1QX3A 2XTZA 3GX1A 4TTPA 4DCOA 1V11A 2VAVA 1VJ1A 5DI9A 3Q3GE 3GQBA 4RTPA 3IEMA 1BQ3A 4GLBA 1V8OA 2R8EA 4P5DA 3RK0A 5KDLA 2B25A 2FNAA 2HQSA 2YR0A 2HHCA 3A9VA 3EEQA 1AVTA 1JEQA 1W34A 2BUCA 2H00A 1V2HE 2LKCA 2YMLA 3M2TA 4G1BA 4G5RA 5B1EA 2TYSB 2XCLA 3GLHA 2I6SA 1QYCA 1GG8A 1JX6A 3BX1A 3FVTA 1QOZA 4PVCA 1CUDA 2W6MA 1GLNA 3ZQKA 1PR6A 2CXRA 3K4QA 2J3HA 3RE1A 1AT1A 3G9UA 1EAYA 2KPOA 2YV4A 4F7DA 3K1ZA 3BJIC 5JSYA 1NKVA 4PR3A 3SOPA 4C6HA 1SBQA 3JD4A 3WBKA 2CNWD 2IHKA 5EE0A 4EA8A 3R9KA 4IZIA 3CRNA 4JWKA 4PLHA 4IS2A 5DLPA 2RI1A 3KQTA 4PN7A 1J5PA 3B78A 3GEBA 2FUCA 1KK0A 1GTVA 4NKRA 2WT4A 2EEPA 3V32A 1M8JA 3ZWXA 1UKBA 2G9RA 4YCMA 3DHYA 3FPGA 1WD7A 3RQSA 4MW7A 3P2YA 3L0ZA 5JD6A 5JZVA 3V1LA 5GJWC 4C88A 3SIRA 4KI7A 1XQXA 4DZZA 4BC0A 2Q9BA 5FBVB 4CEHB 3RANA 4IQ0A 3G13A 1H23A 3TW8A 2G5PA 1VHTA 3R3SA 4M86A 1JDSA 1YA4A 2E4VA 3BGWA 1LBEA 3PHIA 4IV8A 3Q7EA 4MKXA 1RACA 4Y1GA 3CVJA 1YZFA 2C4TA 4LWPA 5I9NA 3PG5A 1FMJA 3NHWA 2GH1A 4J6EA 1NQ5A 3A3KA 1O5OA 1X1CA 2YV3A 2UDPA 3X1JA 2P0AA 3HV2A 4OXRA 4E6EA 4W5RA 1XA4A 3M6VA 1QVRA 4HRAA 2B1RA 4RIFA 2JVKA 2XB8A 2VTVA 5J40A 3O3CA 2VATA 4RLQA 4QE3A 3LHSA 2D4AA 1DC6A 1H1DA 2QRGA 4ESOA 3CVYA 2AXPA 2XBUA 1KO8A 2IWHA 1J8QA 5JZBA 2JGFA 2Q6IA 1P2GA 2Z57A 3FI0A 3SZRA 1UDRA 1L7QA 3JU3A 5EJEA 3H5IA 5FLKA 4NU5A 3I01A 2W2KA 1NYTA 4ZXFA 2ZIEA 1QYIA 5I8WA 3FH0A 4URVR 5M7EA 2XQVA 1RPZA 5E38A 3VTZA 2YL2A 1Z8HA 5EUQB 4JI3B 4G1UC 4KX5A 3STXA 1FQJA 1V3TA 4K6CA 2W71A 3QJ5A 5KTMA 3U09A 1W4CA 2Q4TA 3AWDA 1K6XA 4Z4IA 4OLAA 1Z28A 4A8JC 3IOMA 4HT3B 1AN9A 4G4SP 1ZI6A 3LL4A 5MGNA 3I12A 4XWYA 3B3QA 2WYIA 4HV4A 5JCJD 4XYBA 1ZM4A 4HYQA 1S6YA 1GU0A 2W22A 1JEYA 2C3UA 3OLYA 4JCOA 4PX9A 1X8XA 1C3JA 4N0MA 4XX0B 1PHPA 1YVEI 4IIJA 3GGSA 4C9BA 4DR5B 2NXJA 3R20A 2W4IA 3JWEA 2P9HA 4WZZA 1WZIA 1OAOC 1FFXA 3A6FA 4YJDA 3HL4A 5GZ6A 2O57A 3SS9X 3V4FA 2IF0A 3IJRA 1DQSA 4KQXA 3V7YA 4RFVA 3BWXA 1P5FA 3D3QA 3SXUB 3CVOA 3VR5A 4PZPA 1Z0DA 1WUKS 4JZKA 1YACA 3NBKA 1V7ZA 1Y4AE 4LJ8A 4GAEA 2RAFA 1VMEA 4ERXA 2AXEA 1CR6A 3F6PA 5TJHA 3D7RA 3ESRA 1RRKA 4J0JA 3OX1A 2RK6A 1N6LA 2O2ZA 4FEGA 4LG1A 4EQ6A 4G0WA 2VHQA 1XLTA 3DE1X 3T7EA 1NN1A 5EMNA 5LKRA 5JMPA 1IUOA 2R6FA 3RRZA 4C14A 1NVTA 2JC3A 1UFRA 2FW1A 3AB7A 5EFZA 2BKXA 1Z5PA 3LK6A 2JI4A 2P2CA 2A2ZA 1AXEA 1F2VA 4YRNA 4A0GA 2CFOA 1JDVA 1YMQA 2PT6A 3SIXA 4MB0A 4R71A 2O4CA 1W0KD 3Q9SA 4X6XA 2IUYA 4ZRDA 1SG0A 1OW3B 3RSFA 2ASEA 2H0QA 1BYIA 4QRDA 4XRGA 3B1XA 3WYFA 2DFNA 5DK6A 1VCMA 4GKJB 5H3LA 2W2NA 5B3LA 1AK9A 4QXOA 3HA5A 5KI6A 3QFFA 1UZLA 2YWJA 3J7AC 2JK0A 2R7MA 5IKOA 3WJ1A 4JCCA 3UEOA 1YFJA 2QROA 3KV3O 2IYSA 4GMKA 3UICA 4QOHA 3AR8A 5B53A 3KJQA 3AY3A 5EZ5A 4RV5A 5L6MB 1WL8A 4OJQA 4ZGWA 5JROA 3UXHA 4NATA 1HT2E 4BKMA 5CYPA 5D6OA 1X6VA 2R4UA 1MHTA 3FPBA 3UCXA 4CUJA 5KDDA 5KOJA 3INGA 3QKRA 4S1WA 4BVLA 2VSYA 3ORFA 4HYTA 4QGAA 3R0QA 2ZRIA 3B3JA 3E7WA 4QJ4A 5LLSA 1PNQA 3RWMB 3FOZA 1Y9DA 5LP1A 4MGIR 5LDGA 4S1TA 5AJVB 2BKUA 2RHLA 3AJEA 1QDEA 3QU7A 3EIFA 4HWPA 1HYQA 1N2SA 1FP4B 4H60A 5B7NA 2ZCVA 1U1IA 2BJVA 3ORSA 2AN1A 3HY6A 4U6NA 3U3JA 5SICE 2JHPA 2P6OA 3SXPA 2V98A 3NEPX 3JRXA 3KE9A 3W6OA 5KTYA 2PM8A 3V55A 1U3UA 3UV3A 2B37A 2J07A 3DO8A 3SAJA 5I01A 1QB7A 4QC2A 3BGVA 3QW4B 5C4IA 3UVEA 3LF1A 4V1CA 3GAMA 1W5SA 4NRDA 1REQA 1ZSNA 2VBGA 4LYEA 5B36A 5AOAA 3N6VA 5DJ5A 1XUOA 4LJ7A 4Y1RA 3A05A 1CRWG 1TK9A 3D8TA 2PRSA 2JK1A 5BVHA 2NO0A 4LECA 4N5IX 3GNQA 1N5OX 4O2AA 4PRKA 2RG7A 4AS2A 4P4SB 1YRWA 1X19A 1PJ4A 5B64A 1JL3A 3BWYA 4C0LA 5B12A 3AIOA 1GFSA 1TMYA 2QBYB 2CEKA 2Q99A 4O4HB 1AQYA 1TO6A 1LLFA 2YUTA 4OXKA 1G6KA 4N39A 5E1MA 1ZCZA 1YDMA 3CVUA 4HWSA 4YJFB 2HJWA 5CXQA 3LCUA 1HLDA 4UTOA 2WM9B 3H9CA 5JLJA 1AB5A 1VKRA 4WXMA 2Y4OA 5EIOA 3EHDA 3I5UA 1L4NA 1R4NB 4TVSA 5IH7A 2GHQA 3I34X 4H1HA 1E2KA 4R5MA 3VVMA 4E2FA 2I7CA 3ZY3A 3AKCA 5IHXA 5FPKA 1QFXA 5E9QA 4J16A 3CJRA 4UBOA 1QK5A 3VRHA 3WS7A 5IF3A 4ZICA 3PQCA 4TWZA 4LYFA 3WXMA 3Q87B 1Z0JA 3L7NA 1TO1E 2C7RA 1ZGHA 2AYZA 2D54A 4JB8A 1TIKA 4MQEB 4MK4A 4MUGA 3PF8A 2Q9AA 3EFBA 1FYFA 1FDVA 4HPWA 2XE7A 1JNXX 2VQSA 2DHEA 3BILA 2DQ4A 4I4LA 3ZK7A 2XZOA 2NSDA 2RJOA 2HK6A 4F4DA 5SYMA 2CVZA 2D59A 2EZ4A 1NBHA 1R3UA 2NYRA 2PX6A 3FUWA 4ZOLA 1SCKA 4WQMA 3OCUA 4OLHA 2O8BA 8GPBA 4K88A 2HRBA 2WA1A 4PPYA 1GU7A 1QQ6A 3O31A 4DLTA 5C5EA 2QN7A 3K6SA 3DC7A 5CAEB 2C3PA 3OU6A 4RF3A 1W4AA 2O2SA 3UJDA 4DC9A 2QA5A 1LQ2A 1X80A 3CR7A 3CT6A 4KAJA 1G41A 1AUXA 2LCFA 4UFNA 4ZQHA 2OXIA 4JC5A 3LQYA 4L28A 4LIPD 5JJCA 4GDFA 2P3SA 2QPOA 4HXGA 5ADHA 4OHYA 5E6SA 2C9ZA 3KOWA 3QU2A 4QTUB 1Z37A 4J2HA 5AVSA 3CUTA 1O95C 1J0CA 1SCUA 1P9NA 1S2NA 5EGNA 3ROEA 1E9AA 3V5NA 4MW6A 2JBAA 4AJLA 1GSOA 1US8B 1BFDA 3FW1A 4B9EA 4U7DA 2XQIA 3OZSA 4RK7A 3M6WA 3PE3A 5AMXA 3RS2A 3VPHA 4TRNA 2NO6A 1YZNA 1D5CA 4HK4A 1W5TA 3N8IA 4RXUA 5AJZA 1NMXA 3NHRA 5TS3A 2QUAA 1N0WA 2C8JA 1WXXA 2ZSEA 4C4AA 1DELA 1GCGA 3RUHA 1N2JA 3VO1A 5KNLA 5JSKA 5EMMA 3ED1A 5TMPA 2Z4TA 1PHRA 3NHJA 1M73E 3EEBA 3L9XA 3OLVA 4G26A 5EHQA 1CQXA 1ZJ6A 1XCJA 2E5WA 4PS0A 4GVLA 1E69A 1JR6A 4Y6GB 3D4PA 3ZWOA 1KFBB 2G17A 4DDVA 2JJQA 3DXYA 4M7WA 1Z7YA 2ODWA 1TZ2A 5LKAA 4HFNA 3A36A 5A02A 3ENZA 3CH6A 2HLDA 4NHEA 1KY4A 1CJKC 5SY9A 1EB9A 2WSLA 4LF6B 4B2IA 2R48A 3K5HA 1AKQA 2M1ZA 1YE3A 3GN2A 2D1FA 1ZI8A 1QJ4A 4W5JA 3LC7O 2VT6A 5F51A 4AN4A 5KWSA 3T7SA 2YBDA 2E4ZA 5FCDA 4EY3A 5HGXA 5TF4A 5AOCA 4P31A 4R4JA 1OGIA 3TDMA 1NNSA 1FZQA 3H5NA 2RK3A 4IF4A 4RH0A 3WNVA 2FPIB 1KDOA 1UMDA 1A8PA 3SDBA 3IS3A 1A04A 4HTAA 1ZW6A 1QO9A 2GM5A 3TAUA 4UOEA 1L5LA 2XYVA 1O6FA 3G2QA 3NBZC 3WHPA 3T7JA 2Z6QA 4KZPA 4EGCB 1DIGA 3OM9A 2X0RA 3WSTA 5DNEA 5LB2A 4B8WA 2OT3B 4NFLA 2NV0A 1YB7A 2HQRA 5DEIA 3CZ9A 4HGOA 3GHHA 4A1OA 3C3EA 5AUQA 3T7DA 1IC6A 4LJSA 1TK2A 4D5GA 1NDHA 1FS5A 2ZSAA 2H4XA 1T6NA 3W06A 2FPOA 4GU5A 3E9MA 3A4TA 3QVKA 5F52A 2IRWA 5AK0A 5KX5B 4XX1A 4A36A 1E58A 3CLSD 2FN4A 1Z4IA 3TSOA 4TN1A 3REGA 1KL7A 3R77A 3LHFA 4MV9A 5KQGA 1D7AA 2F62A 3MMZA 2G1UA 1CJBA 3L9WA 3TNYA 4DRZA 5LUBA 1M1NB 3WQBA 1NUPA 1N33B 2EGHA 4V0NA 4D42A 1WDLA 4FP9A 4RANA 2Q5OA 2X42A 3L92A 2AR0A 3OOHA 3R7FA 3UKDA 4ARBA 2UZ4A 1II0A 1ZP6A 5DLDA 3KXIA 3E22A 4I6JA 2XOEA 3G8BA 2C9YA 4NFYA 2NPFA 3TIFA 2VPYA 2FN9A 4NMMA 3I0MA 1U8CB 2WTMA 3D4OA 2FSSA 3I8OA 1Z2DA 4IO0A 4P35A 3EOAI 4PBTA 5A0FA 5H5JA 2IBSA 3VKGA 2CJYA 2V6GA 3KQPA 4X84A 3T7KA 2JFUA 1KS9A 5DDIP 3C3MA 1BS2A 1MJFA 3IVXA 1PWZA 3LWNA 4YAGA 1EM8B 2PGDA 3JQ8B 1JUDA 1BMFA 1XZEA 2ECPA 2NZXA 4Q0MA 3ECCA 4ILEA 4OBWA 4RU1A 1R8SA 1L4HA 1XFDA 1ZOIA 3D7KA 3EYWA 3M9WA 4HWTA 3TTUA 2C8VA 2WTUA 4DMLA 2QVGA 2FH5B 3LQFA 3OVMA 1XNGA 1Y1QA 3IQWA 1IQRA 1MD9A 1WHTB 2PCLA 1PG2A 1UXOA 2O2DA 1W73A 3HYRA 3UW1A 2XVXA 3GK3A 1YZQA 2FVXA 2H1IA 3RKSA 3VZBA 3C87A 3WYBA 2NU7B 3FHLA 1KZ1A 3U16A 3GY0A 1JXMA 2CWWA 4UUNA 3KD2A 4ZALA 2ON6A 4NLLA 4Y6QA 2X8JB 3EZXA 4YCBA 1JKFA 3C6ZA 3FPEA 1DWQA 1FNBA 4QUIA 1NXOA 5E4YA 3HADA 4RZSA 5FL7D 4O1IA 3FPAA 3N39C 5TQ0A 1Z5NA 2WKQA 1E2PA 2JLQA 4HG2A 3WGNA 3PGXA 3W8EA 1QG6A 2WABA 3WGTA 4YMTA 2OP0A 3F6YA 2NU8B 3O83A 4RNDB 1G5RA 1MTZA 3O2NA 3RC2A 1QTIA 1EESA 1DWOA 1SOAA 3GFPA 4LF5B 3EVNA 4CLXA 1B43A 2IY9A 3I73A 1W2GA 2BELA 3H84A 4HGQA 3ZHBA 1M8KA 5JO9A 4JXXA 1SVUA 1CIPA 2RGBA 3FWZA 1IBMB 2ZR7A 4UPDA 2W9XA 1Y8AA 3HCFA 1HO3A 4UHFA 3ROTA 3NW9A 3VTAA 1NGSA 4O4IA 3KJEA 2FR1A 1CLEA 3DEAA 3ZV3A 3ETDA 3A9UA 4C29A 4LOJA 1LPMA 1R9MA 3IA7A 4WOBA 5CEFA 2ZSKA 2XF2A 1BAPA 4MJ7A 4XD7A 3ZDYB 3ZHUA 2XKKA 1A8HA 3H3XA 1W87A 2HRCA 3DAFA 5IX8A 4PHHA 2CFCA 5I8PA 5KTSA 3BQMB 1UAAA 1KSFX 3VR6D 4X8MA 3OFKA 1CJUC 3BAZA 5BO5A 3ZE7A 3ZZUA 3GIDA 3LI2A 4B3BA 5LP6F 5KJ6A 1LY1A 2QTWB 3G88A 3KR0A 1SU6A 3QPWA 1G21A 2C98A 4K40A 2EKLA 2QV0A 3CLRC 4KHZA 2NACA 4MWBA 5JOQA 3ZD8A 4J29A 5CA1B 1HFEL 2GJ4A 4KQHA 2LCQA 4E0BA 2VLIA 4OP2A 1CZNA 1ECCA 2IEBA 3S5UA 5B30A 3GT4A 4TXNA 3SSMA 3P4YA 2VK4A 3BWBA 4DCSA 4DNOA 3LUHA 2WY2D 4EL5A 5I6DA 2JLXA 1ZNZA 3CRW1 4P7BA 3WGKA 1RJEA 2W2PA 3HLTA 2ZROA 4C0WA 4RCZA 3R4CA 1Z75A 3RF7A 3EGWA 4FOTA 3ZHVA 1XTJA 2FRDC 4FR0A 4IH9A 3MK31 1FVXA 3CJTA 2OZVA 1JG6A 2H85A 1R6UA 3H5VA 4ENSA 5BY2A 5AVVA 2ZLBA 3A4VA 3E9DA 2BMJA 4J1TC 4CT5A 2GESA 3L8DA 1KZ9A 3PX2A 1AGNA 1DOAA 1T1GA 5TPWB 3SI7A 3ZE1B 4X24A 1VIAA 3H8VA 1YKFA 4R2JA 1K5DA 4XASA 5ICFA 5EERA 4EB6A 1WABA 4RPCA 1L5YA 1LVHA 1A72A 2WF8A 2ZDQA 2HPHA 3GWGA 1KMHB 3G2HA 4I9FA 3CNBA 4NP6A 2H65A 2EIXA 2VAXA 4Y2TA 1GZ3A 4BO8A 5H7XA 2PD6A 5K5EA 2BFNA 2YYYA 3G1WA 3SQDA 1RQ2A 4JR0A 4L0DA 3IE2A 5EWMA 3WKDA 4BRUA 4CV2A 1J0DA 3GLTA 4EUKA 1DX4A 4F11A 1LTQA 5L3QA 3EGOA 4MW4A 3KDAA 1BDMA 1AS0A 5A6SB 2F8SA 2BGRA 4I6GA 4XIYA 4AICA 2XMRA 4X9XA 2V9CA 2F1RA 2WDPA 4BNYA 1E89A 3DM9B 4C30A 1BCSA 3CVVA 1MF7A 4MWZA 4JI7B 2WNIA 3U62A 3PFKA 1DAIA 1RBQA 4GNRA 4EJFA 5DWVA 1GAQA 4COOA 1AO0A 4GM4A 2J3KA 1KJ8A 1R0CA 4L8YA 4RAOA 2GM9A 2AG0A 2HXGA 3PS9A 4TTQA 5GJCA 4A82A 4DNPA 3OOYA 5IJWA 1UDAA 4IVNA 3GJ0A 3LYUA 4KH1A 4WBNB 4WMLA 1WAMA 1Z25A 5JFOA 3E6AA 3HYSA 3OURA 1QCZA 3I9V1 4LJ6A 3A1WA 4DYDA 4BGDA 3FYUB 2Z6AA 5IC5A 1AXRA 4TRJA 4KBFA 4BQEA 2PUTA 1NI3A 5K1ZA 2HZBA 4YRIA 1DC8A 1EX9A 3DMPA 2EARA 4JJFA 4UNSA 2OXFA 4A0HA 1O96A 2PD3A 3ZD9A 4EJSC 4PHTA 5A4MS 3Q7TA 1XTZA 5CYGA 3AY6A 4G8JA 2YKGA 3NTLA 1SH7A 4GZ6A 5KBYA 1DFGA 2B83A 1SBHA 1TLTA 5H3CA 1DCFA 2BV3A 1W44A 2XUFA 2XUGA 3FKJA 3IUNA 2BF4A 4QXAA 5CJJA 4NOMA 5CTJA 3WLMA 4EPRA 4INOA 4CMEC 1XKTA 2UZ1A 4D1YA 1G98A 4ER3A 4QKQA 4MVYA 3HO1A 4I3FA 5FB3A 4GZLA 3K6JA 2IKSA 4TYMA 1W59A 4MP6A 1NI4B 1VIVA 4GYYA 1J7KA 1DU4A 3ANLA 3LLCA 2Z9CA 3LQQA 4LMAA 5WRFA 3UHPA 1EDEA 3PUVA 1RWVA 4E7PA 4O5AA 4RSMA 3GDHA 4QU0A 1KJNA 1Q14A 1PNRA 1L4EA 2G3YA 2QIOA 3W1VA 1Q1BA 4OHVA 1C0EA 4P5PA 4R2HA 4DYVA 2OVBA 4DT1A 2IHJA 3B82A 5G0VA 3QELA 4R8VA 1CR0A 4BY9E 1HSZA 4H4EA 4BJ1A 1S1CA 4IDFA 1SKAA 3SX4A 2GN1A 3LA8A 4ME6A 3TLBA 4IDEA 5K8CA 5KYKA 1PDWA 1X1RA 1BHSA 3I9V6 4UHHA 3A0UA 2J85A 3HFGA 1Y33E 3QJGA