1TU3A

Crystal structure of rab5 complex with rabaptin5 c-terminal domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
165
structure length
165
Chain Sequence
b'ICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-5A
molecule tags Protein transport
source organism Homo sapiens
publication title Structural basis of Rab5-Rabaptin5 interaction in endocytosis
pubmed doi rcsb
total genus 53
structure length 165
sequence length 165
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2004-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tu3A00
2D74A 2D4HA 1LFDB 3MMPA 4O0MA 1LF5A 3AVPA 3RDPA 4D81A 1MH1A 3NBXX 3OESA 4V0MA 5CDFA 3B82A 4LC0A 4KITB 4CW7A 2QAGC 1Y63A 2GJKA 3Q8XB 2WHXA 4D4MA 4Z1MD 5L8VA 2PX0A 2VPPA 3WNDA 2V55B 3CF0A 4XSGA 1PZNA 2F7SA 2VH5R 1G8FA 1W5TA 2HJGA 4LJ4A 3W5IA 3CX7A 3QVVA 4A82A 2FEMA 1CR2A 1E0JA 3AGPA 3L0PA 1PUIA 1HE8B 3DM9B 2WZQA 3TR5A 3W6OA 2ATXA 1YE8A 2FV8A 4JLNA 5KNCA 4HDQB 1GUAA 1D2NA 3X1DA 2FSFA 1Q0UA 2A2ZA 1HTWA 2OLKA 4UNSA 3KQNA 3CF6R 4EJSB 1KIMA 2R2AA 3F8TA 5LPNA 1C9KA 1YRAA 3B8HA 3C4JA 2H17A 1OSNA 4ESVA 4G1UC 4FIDA 1MO6A 3GMTA 1I2MA 2KBFA 4FN5A 2QPOA 3OIYA 1G3UA 1CF4A 3AF2A 3U3KA 5FPYA 4MYUA 1RRPA 1NMYA 2ZXUA 2FFQA 5J5CA 4KBGA 4A1FA 4TL7A 3WNBA 3I1FA 2ZSDA 5SZKB 3ZIAD 2O8EA 4GZMA 4YONB 1E9FA 4FCWA 2QM8A 2JAQA 2O0KA 2WMOB 3TNFA 2JLZA 1VDZA 4ZIRA 3K70B 1Z0JA 2CDNA 3P27A 2ORIA 4LCBA 4FD2A 5CIWA 3KQLA 2OHFA 1N6HA 4QOSA 2ZEJA 3GLGE 4GOXA 3WYFA 4OBEA 1NJGA 1OXSC 2BMEA 5EQTA 1S1CA 2BJVA 4CEJB 1W2GA 4GL2A 1TTTA 1G291 4ZCIA 4RCZA 2D62A 1E2PA 5JRZA 1CLUA 3ZLJA 1LB1B 3QY0A 1GL7A 4MH0R 4XSHA 2ODEA 2ZJ5A 4BFXA 1T9HA 1I4TD 1RJ9A 2A78A 1N0VC 1NF3A 3AVYA 4HAZA 3KJGA 4MQBA 4D0NA 1QHHA 1WMSA 2LWIA 3T06B 4Q4LA 1L7VC 2GHIA 1TMKA 2HYDA 4MRVA 3D31A 2GJAA 4PHTA 4IVQA 4X8LA 5L3VA 4OI0A 2W6ID 5AWFC 3H2YA 5G41A 1S9HA 1DO0A 3NWJA 3BRWD 4ON9A 3CH5A 2IYWA 4U7DA 1UBCA 3AF4A 3W6PA 4RD6A 4C7OA 2OFOA 4LV5B 4WOPA 2D2FA 3LBIA 3FKSD 5HKKD 3FE2A 2R6DA 3GFTA 1XD8A 2NZJA 3G5UA 3I62A 3IDQA 2C77A 3B1ZA 2ZI5A 1KJZA 4URXR 1XRJA 3LQRA 3WRXC 4F38A 3B6EA 2PBRA 2PZGA 1JJVA 1Z06A 2WIAA 3LX8A 4JLPA 2GZHA 2RGAA 2PMKA 4HUQB 4QBHA 4S35A 5CDFE 2J9RA 2YWHA 2IUTA 3MLEA 4B3DA 4A36A 1CBUA 5JEDA 4E5UA 1Q44A 2EWVA 2Y8EA 4AIIA 5FPTA 1W4CA 2REOA 1EESA 4DLTA 2FEOA 2R44A 2O8DB 4RSGA 2RHMA 1E0SA 1U2RA 3RNLA 5JSZB 1JEDA 2GRJA 4LYFA 4DJTA 4PC7A 2CLDX 4BFTA 3VKWA 5G3YA 3U4QA 1TF5A 2W2TA 2IXEA 2MSCB 2G6BA 3PV0A 1P62B 1S9DA 1O3YA 4LK2A 3LH5A 5J4VA 3QUSA 3TUZC 3CNLA 5DISB 3W3AA 4PSVA 3U6KA 2ZSAA 2J5XA 1U81A 3C8UA 2QAGA 4TYWA 1TNDA 4HSEA 3D6TB 2NO6A 3JZAA 3O8DA 1NY5A 4TZ0A 4US0R 3NXSA 4AYTA 3PVSA 4C4PA 3P1JA 1W4BA 2H7VA 2VBCA 2Z4RA 4QHYA 3VTKA 4AYWA 4LZZA 1MO4A 3SN6A 3W90A 1G18A 2Z4SA 1XXHE 1KAGA 4P3YA 3WYGA 2JJ1D 5JI3E 4R2IA 1ZIPA 5FBVB 2REBA 3TJZA 1G19A 2PCLA 2W0SA 3OAAA 1ZBDA 2VQSA 3AP3A 3I5YA 4Q9LA 4QFMA 5M04A 3OIUA 1AKYA 1M7BA 2RCNA 1UM8A 4M1KA 1YKSA 3VX4A 4JJZA 3DMNA 4CT4B 1ETUA 3PUYA 5DO9A 821PA 5EE0A 2ZS8A 5FOTA 1OXXK 5KUTA 3UMRA 1HQCA 1UEIA 1XEFA 3CIOA 5DI9A 2NMVA 4CVNA 4D25A 1TX4B 4WAUA 2WOOA 2R6GA 1D8TA 4IFEA 3WHKA 4F4JA 1FX0B 4Y0VA 4DSUA 2O8BA 1G8HA 2PZFA 4M2LA 1QHSA 1SZPA 4UJ3A 1LVGA 3IO3A 1CJUC 3D3QA 4Q5IA 2QP3A 4URUR 1E99A 1S1MA 4AURA 1S4QA 3AQ4A 3IPXA 2V7QD 4CF7A 2ZSFA 1KI6A 1G7CA 3QXJA 1G3MA 4XWOA 4NDZA 1OV4A 4NP6A 4RKEA 3ZH9B 3QSYA 1AZTA 1M6NA 4HLQB 4YMTA 1YR7A 4JL8A 1E9DA 4L9WA 4NYMQ 4ZCLA 2ZITA 3WRYC 1NN3A 3CRW1 4GPTA 2C9YA 2RB4A 1N3BA 4HATA 4V02A 4IW3B 1E2MA 5AJYA 3VR5A 3FPAA 5JCPA 2VSFA 1J2JA 421PA 2GBLA 1WXQA 3TMKA 4KBFA 1XBTA 2FPMA 1IN7A 1YR9A 2V8OA 4PQRA 5FOWA 3EPKA 2AR7A 4R2HA 1R0ZA 4A0RA 4TLEA 1KOFA 2OSBA 3KDSE 3U3MA 3NC1C 1NIJA 3DO6A 1EG7A 2CE2X 3B85A 4LJ7A 3IUYA 4NKRA 2GAAA 2PJRA 1Z8FA 4IDOA 1KI8A 1GVNB 2C98A 2ZR0A 3LRPA 1KI6B 4Q66C 4B32A 4DSTA 2C03A 3QKSB 1ZNZA 1P9RA 3A4NA 1E4YA 4C0SA 2FZLA 3SHFA 5HE8A 2EW1A 1P61B 3B9PA 1MO5A 4V03A 1FX0A 4A2QA 1E9EA 3CPJB 5JRJA 2XGJA 1G5TA 3U2QA 5CB8A 1Z29A 4M21A 4I1OA 3RRMA 2UVQA 2BC9A 3OE7A 2IYLD 4YXWD 2H1LA 5A4JA 2G3YA 2L0XA 4BLSA 5ELXA 4C2TA 5IK2D 2VHCA 1JNYA 4KODA 1X1RA 3SJBA 5JJLA 2MMCA 4H9GA 4IFBA 2XX3A 1AZSC 2ZSBA 1G6HA 5G3ZA 3HPQA 2MSDB 4IRUB 1SVSA 1VYUA 2ZE8A 3MJHA 4Q01A 4JLKA 1W2HA 4P0TA 4NHOA 1DAKA 1UKYA 4D80A 4M1SA 1E69A 3GJ8A 2ZU0C 3HU2A 1Z2AA 3OIVA 1E2QA 1N6OA 3EC1A 2YOFA 1W0KA 1WBBA 2GCPA 4OQMA 5FTLA 2G77B 1N6PA 2XAUA 4CIDA 4RY2A 1NBME 2W6IA 2ZQ5A 4PR0A 3QXSA 3N70A 2ZRMA 3ASYA 4BE7B 2MMGA 3NHAA 1C1YA 1HURA 3SQXA 1I2DA 4BZPA 1H8EA 2W0MA 2AWOA 2YWEA 3CZQA 4FCVA 1L2TA 1S8FA 3BFKA 3LNCA 2IXGA 2VYFA 4BFSA 4ZDIA 4P4TA 2PX3A 4QKQA 2WTUA 4L8GA 1KI9A 3QF7A 3T5DA 3ADCA 4Q7LA 5EZ6B 1AN0A 5G40A 2J0QA 3K0EA 1HUQA 3GLFE 4A8JC 3KB1A 3CR8A 2H8KA 4HZUB 1VMAA 4ZCMA 5B30A 3T1TA 1Z0DA 2QORA 4IJMA 1W48A 3IIMA 1CXZA 4IOLA 5F9FA 1U0JA 1S0UA 1ZAKA 1T6NA 3M4YA 2ZS7A 2OLJA 1G64A 1TL7C 3KFVA 4M1YA 1IXSB 3VR2A 1EGAA 2FZ4A 2X19A 5EP4A 5BQ5A 2R6CA 4DC9A 1A5TA 2YJTD 1ESMA 3MG9A 4B43A 4BFUA 4EPXA 1CJTC 2ATVA 2HXSA 1SQ5A 2CVFA 2XB4A 1K6MA 2WV9A 4KSCA 1T8UA 4W5JA 5AJXA 2OBLA 2O8CB 3SFVA 2CBZA 4C7OB 4PC2A 3WHLA 3SOPA 4PPNA 3B9QA 4QNMA 1GOTA 2CE7A 1J90A 2FPLA 1XTQA 2A3RA 4MKGA 2HF8A 1NSFA 1F60A 2NG1A 4LJYA 4KXFB 2Z6VA 2IEZA 5CLQA 2BCJQ 4RJLA 2ZRIA 2ZVPX 2QTHA 1M2OB 3ZQ6A 4HUTA 1XXHB 1QHHB 4IDNA 5EE1A 2FOLA 1G8PA 3TR0A 4LHYA 4R71A 4LV8B 2OAP1 2V6JA 3ZS9A 4F4IA 2JLSA 3I32A 4Q4HA 1TQ6A 4Q4HB 3U60B 4F7WA 2G1JA 3QPUA 2GXUA 4OKSA 2RGDA 1NBMD 3FFBA 5CB6A 2B6HA 4POAA 3PEUA 1N6KA 1FQJA 5AJWA 4PPFA 5HE9A 3EZFA 4FWTA 1TQDA 1NN5A 1QVAA 1OLOA 4MGKR 2RHDA 4WXPA 1P7CA 5JWHA 1G9XA 3P4XA 1OH6A 1DOAA 4XVUA 3AVTA 2B7CA 1VHLA 2RMKA 3X1YA 2Q6TA 2K5UA 4NCKA 1MV5A 1Z08A 4DDUA 2B92A 3HWSA 1D9XA 5CITA 3PJRA 1UKZA 3IPYA 2NO9A 3AF3A 3T5GA 3TSOA 2CL6X 2ODBA 4ASUA 1SKYE 3RHFA 2IYSA 2BKEA 1DADA 3TW8B 5EUMA 3C7KA 2ZJAA 1W36C 3E5HA 3RRYA 4LBZA 1IJEA 3SU8A 4PPQA 3A4LA 5P21A 2YZ2A 1TF2A 2KB0A 3QE0A 2J87A 1RC8A 5FUYA 4Z54A 4GI7A 1CJMA 4PPGA 5KYKA 4BASA 4C0JA 1QHIA 2DFTA 5KDLA 1BS1A 3THYA 2D7DA 4MGZR 2B8TA 4EPVA 1LNZA 4WZAE 3VKHA 2IK8A 5LD2B 1KYIA 1Q57A 1ZD1A 2HUPA 2Z43A 4PTLA 4Q48A 1H8ED 1RW4A 2NO0A 2YINC 1ZM2A 3UMSA 3R8FA 3THXB 1WDTA 2IHBA 3K0AA 3ZDQA 3BIFA 2ZRLA 4TMVA 1OB5A 1TQ4A 4FI3C 1EFUA 3B5JA 3CRVA 4PZYA 5H68A 4DIDA 3GQBA 1KAOA 4PSKA 4WXRA 3AVXA 3IHWA 4MKFA 5K8UA 5JMTA 4RCYA 4UJ5A 2ZYUX 3RWMB 2ZI6A 2A5YB 1P72A 3DVLA 5GVRA 1TF7A 4XIGS 1D5CA 4TLBA 4EPRA 2ZM5A 3U7FB 3CZPA 3SE0A 3TQFA 5CYPA 5J47A 2WSSA 5AUOB 2OV2A 1QZXA 3CPEA 3VFDA 3A8TA 3TUJC 2QU8A 1R0WA 2OUKA 4DZZA 2F3RA 121PA 2R62A 2WOJA 2A5GA 5GJVC 3MRSA 1D2MA 3FMPB 4UXIA 1ZCAA 5DGXA 3AVQA 3LFUA 1NG1A 4YXWA 3I61A 3OE7D 1R8QA 4LUCA 1CTQA 4K46A 1QG2A 2HCBA 2NO7A 1KZGB 1NKTA 4M9SA 1E2NA 1ZRHA 5TXGA 3K0CC 4WZBE 2BBTA 1XU4A 1E1RD 2PH1A 3B78A 3LX5A 5KDOA 5FTJA 3VU9B 3VHXA 2BDTA 1XNJA 4NYJR 1I4DD 2FF7A 3EG5A 4GP7A 4V0OA 2YV5A 3SYKA 1UKEA 2GWHA 2PEYA 3OF5A 2OCBA 3CKLA 3ND9A 1BKDR 2NPFA 1NL3A 4NCIA 2RKOA 2ZRBA 4OHWA 1PLJA 1KK2A 3SBDA 2O8BB 4NONA 3I8SA 2MSEB 3AKEA 3T12A 2JGNA 3AV0B 1XJ0A 3QF4B 2ASEA 5C1BA 3TVTA 5C4MA 2ZYTX 1P75A 1QF9A 3ZS8A 2ZYWX 3ZD7A 1BO6A 3OFNA 3BXZA 4IDPA 4QBIA 3U3OA 3KQHA 2ZUCA 2IT1A 4Q03A 5FI0B 4B6FA 2AN9A 5JFGA 2JIZD 1ZUIA 1FUUA 1ANKA 2R6FA 2GJSA 3GJ7A 4L4UA 1OHHD 1XPRA 1ZD9A 1N6RA 3A4MA 4H1VA 3IKJA 1KJYA 3Q72A 4DCVA 3H1TA 4P4SB 2GF9A 2PL3A 2JLRA 3IIJA 4C0AC 2PLFA 3CLVA 4B71A 1JAHA 2QEQA 3AVUA 5KSYA 2VP2A 2BWJA 5DIFA 4TZ6A 1DAEA 4B3XA 1VYVA 2A5JA 4HB0A 2ERYA 2FU5C 1RRGA 2KSQA 4I81A 2QAJA 4M4SA 3EIQA 4KVAA 5CJPA 3AM1A 1VCOA 3IILA 2GK7A 1U0LA 3ZZ0A 2CHQA 3HPRA 3CRQA 4FMCB 4G5GA 4TYPA 2QA5A 5FL3A 2Q3FA 2GDJA 3I92A 2BBSA 1CJKC 2VSXA 3VR3A 1OB2A 3F0TA 4MDEA 1OF1A 3DMDA 2IEYA 3BB1A 1K5DA 2WPDD 4PZZA 3SEAA 2YWGA 4JT2A 4MYHA 3UXMA 2QMOA 3KJHA 1IBRA 2D06A 2ZETA 4LJ5A 3DHWC 5FL7D 1DEKA 3V4FA 3GJXC 1ODFA 4NE2A 3WBKA 2I1QA 3FOZA 2IUUA 1UKVY 1JPJA 4PAQA 4G3XA 3TQCA 3SFZA 2GVDC 2XZLA 2WWXA 1KZ7B 3O8RA 2IS2A 2XNSA 3A1VA 2PT7A 1VCMA 4GT1A 4G0NA 2J7PD 4DRZA 2QT0A 1E79D 1J8YF 1XCMA 3ND8A 1P9WA 2XOKD 2WSSD 1GL9B 3K1JA 1GRQA 1AIPA 3OEHD 3PR1A 4R9UC 3E70C 2VL7A 1ZNYA 5FI1B 4Q9IA 2DWQA 3BB3A 3LY5A 4P31A 2EFGA 3KKOA 1FW6A 2H18A 3L8YA 4B6EA 3ECCA 4BLQA 1Q1EA 4URWR 4B35A 4UXJA 4N0EA 1OPXA 1T91A 4LRWA 2NGRA 4P4SA 621PA 1E0AA 3EPLA 1KI4A 3NKVA 1W0JA 3LXXA 4IHQA 1JQLB 5IHPA 3SI7A 4FXPA 3WNCA 5A5GA 2RGXA 2XTNA 4XWAA 3M6AA 2CL0X 3FMIA 1XP8A 4LI0A 5BWMA 3K70C 1FNMA 1HT2E 4W5HA 5JSZA 2FE4A 3LBNA 4L16A 5IDVA 2GCNA 4EPTA 4AKIA 4TWZA 2QRNA 4GP6A 3KKQA 4Q21A 3BH0A 4CRWB 4QM7A 5KSPA 1VHTA 4CEJA 2F43A 2OCAA 4KLZA 4WA7A 1PVOA 3QPWA 2HEIA 1ZW6A 3M1IA 4MITA 3GJ6A 2VA8A 1IN4A 1XEWX 4B3BA 5K8LA 4JBWA 1M1YE 2C2HA 4OQXA 1E98A 4AWXA 4HAYA 1U9IA 1E9SA 2I4IA 1AK2A 4JLOA 2C99A 2JJ1A 1E3MA 1ZC3A 1SVKA 4DT1A 4EIWA 5FUVA 3JVUA 3K0SA 4Q9JA 3N2EA 4GRAA 4UXHA 2HYIC 3EXAA 5AR1A 2JATA 1SVOA 2JIZA 1OYWA 2XEXA 3ZYCA 5KSZA 1EXMA 1ZMXA 1GKYA 2XXAB 2J59A 1PLKA 2XXAA 3GEEA 1YHNA 4JYCA 2V1UA 5JJKA 3T1OA 2H57A 4IVPA 4S2EA 1Z0FA 2ZPTX 4XVRA 1GKUB 1ONBA 2AKYA 4D4JA 4YDSA 4MUBA 2ODNA 2GKSA 3IGFA 2D2EA 4DCTA 1XMSA 2KWIA 3KKMA 2JJ2D 4I1VA 5EE5B 5L3SA 4OI2A 2OE2A 4Q18A 1JEEA 1KMHA 5HCNA 3PEYA 1G8YA 3K9NA 4C30A 2W6JA 3K9LA 4UNPA 4WBSA 2IYYA 1FPMA 4B74A 2WAYA 2HLDA 3VR1A 4JLDA 3H0KA 2CHVA 2NOAA 3VHLB 3GLHE 3LD9A 2J45A 3X1ZA 1MR3F 4RFVA 5GJCA 1FUKA 5HZKA 4UKDA 5JCZA 4D0LB 2BEJA 3THXA 3EZ9A 4N0DA 4FWIB 1L8QA 2GCOA 1IM2A 4US2R 4PC1A 1TUIA 1AA9A 3EAQA 5J4HA 3P20A 4DB4A 3DDCA 1OJLA 2KI5A 1X8KA 1RE0A 4KYUA 2ZI9A 5KNBA 1E6CA 3PG5A 4H1UA 1Z6GA 5EP3A 2BV3A 4AG5A 1BYUA 2ZRJA 5H70A 4E09A 5FOSA 4CT5A 2WJVA 3T61A 3KKPA 3AUXA 4IDQA 1IXRC 4BZXA 3OIWA 3HYRA 1BYIA 1Z28A 4IOMA 5AJZA 5FUXA 2JJ2A 5L3QB 5TDHA 2QGNA 3BOSA 1JPNA 3UG6A 1RZ3A 1J8MF 2VP0A 5AUQA 1RYFA 1LS1A 2CEAA 3KXKA 1OKKD 3GJ0A 3GLIA 4LHZA 2FSGA 2R8RA 1G7SA 1KDTA 2GCOB 4A9AA 2OFWA 1Z83A 5E7IA 1FP6A 1Q3HA 4M53A 1VCIA 3SS8A 2A5DA 2A5FA 2Q0HA 2AD1A 2Q9CA 1KDOA 3BGWA 4OHZA 2PJZA 1DAIA 1YJ5A 1SXJC 1VG0B 4NYIQ 4YDHB 1DAHA 1T0HB 3MSXA 3Q5EA 2GNOA 3EIEA 3G0HA 1LTQA 2AXPA 3PEVA 5FOXA 3ZVMA 4EQ6B 4DLWA 3RVBA 2BOVA 1FTNA 1RVDA 2N46A 1E0KA 1CRQA 1H8HA 1V5WA 2RH5A 3DZDA 2QE7D 1OXVA 2CMKA 2ZRAA 5L3SB 2WVJA 2OBMA 3B13B 2WIBA 4JSTA 4NU0A 2NIPA 3C15C 2C9CA 1GFIA 4KFTA 1FMJA 2B7BA 3FHOA 3DKVA 4MKIA 1JXOA 5DYIA 5KPJA 1RRCA 3SYNA 2GXQA 1CR1A 1BH2A 2XNDD 4XH9B 2ZJOA 1QRAA 4DUGA 2J0SA 5J4YA 3EIHA 2DFLA 4TTRA 4ZI3A 1AKEA 2FH5B 1V43A 2BMFA 5D3QA 2EWWA 3SJZA 4BLOA 2QMEA 3FFAA 2AL7A 3LDAA 4XTCS 2VP6A 1D6JA 1W4RA 4OQLA 5DSZA 1U8AA 1UBFA 1XPOA 4A4DA 3D8BA 4B2LA 3WYAA 2CCGA 1OYYA 2WWFA 2EFHB 3CO5A 2IYXA 4XVQA 3NH9A 1JI0A 2F43B 5E95A 1Z6TA 3IQWA 2V3CC 1E2GA 1II8A 4AYXA 1PJRA 2P67A 2ZUDA 2ZU6A 4JT4A 1W36B 1SHKA 1G7RA 4LX0A 3NH6A 2R6AA 5JZVA 1MKYA 1YZLA 2C8VA 2RGCA 2F1RA 4Q7KA 4KCGA 1U90A 1G41A 2DWPA 2F55A 2J7KA 3EA5A 3IEUA 3Q85A 3QBVA 4GOJA 5ANRB 5FR1A 4ILEA 3ADBA 4QGFA 5DI3A 2EFDB 2C04A 2EFEB 1M7HA 2EFCB 1G4AE 2CLSA 5EXTA 3CF2A 1OXTA 1T5LA 4W9MC 2IS1A 3CWZA 4GOKA 3FMFA 4B73A 1CRPA 4V0KA 3V9PA 1N5LA 3K0AB 5HZHA 1X8LA 1GITA 1IONA 3A6PC 3LO5A 1S3GA 4EKDA 1XZQA 4CGZA 2OAQ1 3MWYW 2IWRA 3RS5A 4XTRA 5BN5A 5JLJA 1LW7A 1IQPA 2GF0A 2IA5A 5DN6A 4V0LA 4W7SA 3THWA 3KL4A 1VCNA 1XB2A 1DELA 4LBVA 3CRRA 3R9WA 4C0KA 2Q9BA 3A36A 3AKDA 5CM9C 1JR3D 1NJFA 2PZEA 4NYMR 4PHGA 3W8NA 4M1WA 2WICA 3BJIC 4OK3A 3T15A 2RGEA 1R10A 4AI6A 1GZSA 1UJ2A 4Q19A 3I5XA 1NN1A 3QKUA 3WBJA 2WMNB 5IF9A 5FOUA 1IN6A 1TEVA 5FTNA 2VHQA 2JJ8A 5GJWC 1W4AA 3QJYA 2H92A 1UPTA 2OXCA 2CVHA 1RPZA 3KFXA 4CEIB 1DO2A 1U8ZA 1Z63A 5FH9A 2F1HA 1W47A 4Z8XA 1WRBA 3K8YA 2FSIA 1MRSA 3NBFA 4RZ3A 2BIFA 4OQFA 5EZ5A 1AGPA 3FDIA 5C2JB 2X8AA 4QJ3A 4WIAA 3CX6A 1KDRA 8OHMA 5JS7A 1GKIA 1ZD8A 3HR8A 4P4UA 4MGYR 2Z0MA 2TMKA 3TAUA 1R6BX 4LJ6A 1CJVC 4V0NA 1E1RA 1RKBA 2I3BA 4M0LA 3BS4A 3LWNA 3LQQA 5DLQC 4IOKA 1KO7A 2G0NA 1US8A 1M74A 4LGMA 2AHOA 2P5TB 4MKHA 1D2EA 4TTPA 5FTKA 3SYLA 3GPLA 4D4KA 2FFBA 2XNDA 4AC9A 4RD3A 1EFRD 4YMVA 3LBHA 5CJ2A 2CNWD 2IXFA 4HB2A 4HB3A 1OH5A 1K5GA 5KSOA 3AVWA 5LB2A 4LOAA 2OG2A 1Y3AA 1ZM4A 2P3SA 5EXSA 1U8YA 2QGZA 1N5IA 4DVGA 4HI0E 3QPVA 4C0BA 2BM1A 2JLUA 1E9BA 1ZINA 1AQUA 2XJ9A 3LLMA 2QPAA 2CK3A 2O0JA 1OIVA 4Q1AA 4ZKDA 3V4RA 2ANCA 2JLYA 3V00A 5EP1A 3QXCA 1Q3TA 1UEJA 3UG7A 3UWKA 2ZSEA 3GLGB 4NH0A 1XCPA 2JDIA 3H86A 5IT5A 5HTKA 2BKUA 1R5NA 2UZIR 1C4OA 1YZTA 1W1WA 4DLYA 1XMIA 1AQYA 2ORVA 3FKSA 5HKKA 1GM5A 1G4UR 2WWGA 4OHVA 1J7KA 4OI4A 4TTQA 1ZM9A 1FZQA 5SZHB 1E9AA 1TAGA 1Z6XA 2W6JD 3T35A 5DN6D 4Z8YA 1OKKA 1ZC4A 3SHWA 1ZNWA 3GLFA 1KK1A 1BMFA 1YRBA 4EUNA 3C41J 1A1VA 4RD4A 2WKPA 4HLCA 2QUZA 4Q4JA 3NC0C 1ZNXA 1YZQA 4I1UA 3RRNA 5UKDA 3K09A 1F2UA 4MRRA 3W8RA 2BMDA 3ZGXA 4PAMA 1QHNA 4DCSA 1KSFX 3ADKA 2BBWA 5L3QA 2QNRA 5H8WA 4QBGB 4OYHA 2NTYC 3AEZA 1GAJA 1YVDA 3CR7A 4HAWA 2GEDA 3RC3A 1T3SA 1SVWA 4QGHA 2QAGB 1II9A 2Q9AA 4HZUA 4URZR 4D4LA 4IOJA 1NG9A 1VG8A 3CPHA 3EX7C 1X6VA 1E4VA 4HDCA 2ZS9A 3PENA 4D0GA 3QNUA 4BLTA 3MCAA 4DB2A 4TMKA 2IF2A 1EFHA 4JBXA 4M1OA 2XITA 4HAUA 2V4ZA 1QDEA 1ZM7A 2RAPA 4Q1FA 5D3MA 4OI1A 1M8PA 4A0FA 3TUIC 2WJYA 4A92A 4PQYA 3BK7A 3BC1A 2OZEA 4PQFA 3MGCA 4HAVA 4C3ZA 4F91B 3TVDA 2A7QA 221PA 3Q9LA 5JWRA 4E07A 2FGJA 4BPBA 1XZPA 3ZVRA 5KHOC 4Q9HA 2IBMA 4GFDA 1KI7A 3RABA 3KKNA 1AS0A 2ZRNA 3WP1B 4KO8A 3ZZTA 1MABB 2QBYB 4MYCA 2O52A 4KAXA 5FPKA 2AX4A 3UKDA 4DHEA 3A1WA 1EK0A 3L0IB 1KSHA 1HY3A 5SZJA 1N0UA 4M1TA 2QQEA 4ACAA 4OHXA 1OT3A 4OJQA 1JBKA 2JCSA 1IXZA 1WB9A 1W0JD 2WWHA 2FDCA 4ZI2A 2RGNC 1P9NA 3RS4A 1GNRA 3ZQJA 4A15A 3GLHA 3RYTC 2Z5FA 3GLFB 1X8JA 1YZGA 3B7GA 1OIWA 2J1LA 2W83A 4JVMA 3LW8A 3ONWA 1OE0A 2ZR7A 1GP2A 1CKEA 1KO5A 1Z22A 3G82C 4DXAA 1S96A 2SHKA 3HP1A 3TAHA 1OFHA 2AXNA 5LB4A 4ZDJA 5KPDA 1G3RA 3Q3JB 4YMSA 2YVUA 4DDWA 4FMDB 4DSNA 2G0TA 4EJSC 5BN3A 2AKAB 3BFXA 3LV8A 2G83A 4LYJA 3U44B 2O8FB 1RJ9B 4OK6A 4PAOA 2BMJA 1JQJC 1OHHA 4IDHA 1P3JA 2VHTA 1U9IC 4KSBA 3UMFA 1E1QD 3QI2A 3CB4A 3BBPA 1XF9A 2HCJB 4LPSA 1LF0A 2RGNA 2FG5A 2QG6A 1NVVQ 3IO5A 3BH7A 4G01B 2QM7A 1AM4D 5J4KA 4GNKA 4RD2A 3WMEA 4BGDA 3EC2A 4NYIR 1NIPA 4HEJA 4OQNA 1VYTA 3RAPR 4MRSA 1R7RA 1SVMA 4ZV4A 5BW8A 1IN5A 2FJUA 1L4YA 1TU4A 2QT1A 3WP0A 3FYHA 3T1VA 3QEOA 2V7QA 4JVNA 2C9OA 4Y0AA 4C0HA 5KDDA 1WCV1 2AK3A 4I1SA 4Q1CA 4M22A 4QJ4A 3SBEA 2OCPA 1N2CE 1U99A 1Z47A 1SXJD 2WPDA 4PSAA 2ONJA 4LHXA 3GEIA 1DS6A 3CNNA 4PZLA 2OBNA 1ZJ6A 1T8TA 1T5IA 1GL6A 4Q1BA 1XTSA 4L15A 3QG1A 3FTQA 3QQ5A 4PXAA 2AK2A 2VLIA 1YZUA 3P32A 2X2FA 4ARZB 2GZAA 3TGPA 3P26A 4A8JA 1NKSA 4B3CA 1CIPA 3OEHA 2QSYA 1XTKA 2ZAOA 4LBYA 4TLDA 3F3YA 1E1QA 2ZI3A 4QJ5A 4AD8A 2RGGA 1RYHA 1R5BA 1VKJA 4ZDWA 2NO1A 2FSHA 1W36D 2CLCX 2LKDA 3H84A 3K9HA 1WP9A 5FPSA 2IL1A 1FMLA 2FNAA 5F9HA 2JLXA 1OW3B 4IEIA 1KGDA 1GDDA 2EU8A 4G5QA 2QTFA 1XEWY 1SVLA 2QSZA 1F5NA 2BCGY 1HA3A 4AKGA 3BE4A 2ECKA 1IJFA 5LD2C 1UAAA 3I4LA 3TBKA 2F3TA 1UFQA 3DEFA 1NLZA 2OESA 4IEEA 4QGAA 1F2TA 1TU3A 1NI3A 4NBSA 2BHRA 4ITRC 3I3SR 1ELOA 4HB4A 1BMFD 3UK6A 1CEEA 1E9CA 1OH8A 2EYUA 2AFIE 1VPLA 4QL3A 3EWAA 5FR2A 3TE6A 3EPJA 4QBFA 2A9KA 5TMPA 2D7CA 3NG1A 1Z0AA 4F92B 5F98A 2ZE7A 2WJIA 2EVWX 3T34A 4DLXA 1AGRA 3RWOA 3AF1A 3ICQB 1KI2A 1G5PA 3O47A 3FHTA 1NLFA 2WKRA 4O25A 4TQUS 1GG2A 5JEEA 2JA1A 5B57C 1KK0A 3DKPA 2AWNA 1JAIA 1FQKA 2VHUA 4FINA 3U7GA 1KNQA 3L0SA 2ZRFA 1G6OA 5AJVB 1EFCA 2X2EA 3Q7PA 3FGNA 1ZCBA 1NRJB 2CCKA 3NTUA 1GRNA 4JLJA 2ZRDA 5GADl 5B2ZA 2HT6A 3ADDA 5KO2A 2QP4A 3X1XA 4N3NA 3KZ1E 2QP9X 3IBYA 1N6NA 3PQCA 4OJKA 3EPHA 2QQ0A 2QROA 4O2LA 1SXJB 1NVUQ 2YYZA 1W7AA 4EDHA 3GJ5A 3GP8A 3T1QA 4EPYA 1JR3A 2WKQA 5TY0A 3K0FA 2YHSA 3UPUA 1A7JA 2IS4A 1E2DA 2WJJA 4FW9A 4JKIA 2IF0A 5DHFA 2ZAMA 1G5RA 2XZPA 2OILA 3MWKA 1FFHA 4TMTA 4YMUA 3CRMA 3FHCB 1NLYA 3AP1A 5KOYA 4LJ9A 1GRRA 2P6UA 3RS0A 2C95A 1UADA 1E79A 5K8TA 2ODWA 3PCRB 2O8FA 1KKMA 3B60A 2IWHA 4BEJA 1WA5A 4HLUA 1Z0KA 1DG3A 1SKQA 3UIEA 1W44A 4YMWA 4LHWA 1QBKC 2IHYA 3GD7A 4CZ2A 1SGWA 2V9PA 3UWOA 1G1MA 3SDZA 1E32A 1TQ2A 5CIQA 4EQ6A 2Q3MA 2OEPA 2N42A 3ZD6A 2B8WA 1Q1BA 3FB4A 2FPKA 1NVXQ 1U0HC 3TIFA 1WF3A 4B76A 1OIXA 2JLVA 2D3WA 2HDNB 2ZANA 4MDFA 3KJIA 4PHHA 5FUWA 1DVRA 2OO7A 3BORA 1JECA 3U44A 2XSZD 4IXNA 1XFAA 3FKQA 4X8HA 3U3RA 4B47A 4O3MA 3THYB 3J81k 2OXRA 2OCYC 4TYNA 2IYVA 2QMHA 1PV4A 3ZVLA 1NVVR 1GWNA 1KO8A 2FFAA 3U6BA 4ZDKA 2QI9C 4L5BA 2VHJA 4TQ9A 3GLHB 5B58C 5E4FA 3NVAA 2CK3D 2GESA 3AH8A 4B44A 3W3ZB 2JLQA 3KX2A 4BLPA 1JALA 2GA8A 2WWIA 4N1AA 5J40A 4ABYA 3SC3A 2IC5A 1G7TA 3CBQA 2ZE5A 4WW0A 2VP9A 3WXMA 2GXAA 4GSYA 4IVRA 3IEVA 1VIYA 4Z51A 1MABA 1Q20A 1XJCA 3WMFA 3MAAC 4BFVA 2G1KA 4PO8A 1DTSA 2IYTA 2REXB 2ONKA 1M7GA 4JBYA 1HYQA 4UQOA 2VRWA 1P2VA 3W6NA 4DLVA 3HYTA 1EWQA 1AS3A 4GMDA 4JIMA 3EZ2A 1P60A 1HH4A 5E7JA 3TSZA 1P2UA 2DWOA 4MUAA 4RZ2A 2ZRHA 3R8CA 2QZ4A 3CM0A 1R8SA 4F93B 2H16A 1E2IA 2VTKA 1HQYE 2P2LA 4X8MA 1MRNA 2GJ8A 5BYKA 4AY2A 1G21E 1Q12A 4ACBA 2QPTA 4PANA 4C0LA 4HUQA 3MD0A 4DCUA 5G53C 2GEVA 4FMDF 4EFMA 1N0WA 3PUVA 4EFLA 4HLDA 5IRCD 3U5ZB 5EXXA 2IS6A 3AKCA 4B2IA 2GILA 3E1SA 2NQ2C 1XXHA 1Z6YA 4JZKA 3UATA 4YLGA 2PT5A 4JSYA 3RRZA 4HZIA 4LJAA 2BBOA 1XMVA 2YWFA 3SQWA 1QHGA 2DHRA 4QXAA 2KE5A 2IYZA 3JVVA 4TL9A 2RGBA 5C4GB 4OHYA 4A2WA 2Q21A 2YNMA 2ZJZA 2VF7A 4BZQA 1P2SA 4Q1EA 4PO9A 4R7ZA 1H8HD 3KQUA 4Q1DA 1UF9A 3HJNA 3ETLA 1N5KA 4TMZA 4TT3D 4URYR 4PC6A 3WMGA 4DT1B 2F9MA 2QENA 4TSFD 5JI2E 2ZRKA 4FMCF 3ICEA 3VQTA 2GTPA 3QKTA 1A82A 1T3LA 3SNHA 1G3QA 4Q7JB 4I4LA 2IYRA 4LY6A 5TV2A 2B21A 4KYIB 3GLGA 1W49A 2ERXA 2FA9A 4NMMA 5TVKA 4P32A 2F1JA 3B1VA 3JZMA 2HXYA 5CYOA 3UANA 1E96A 4PO1A 3SJAA 5AUPB 1S3SA 2XSZA 1KJWA 4V0ME 4QNRA 3REGA 3K0FB 2J41A 3FMOB 1OXUA 3DOEA 1KY3A 2CJWA 4Z1MA 4ZIRB 5EJEA 2WWWA 4AKHA 3OHMA 3O8BA 1SXJA 1F2TB 2CL7X 1MO3A 4RD1A 4JS0A 1YQTA 4A0HA 1IAQA 1J99A 3TK1A 1TEXA 4R98A 2ZTSA 3VKGA 3L8ZA 4BFZA 1UBEA 1Z5ZA 1NY6A 3I8XA 3TRFA 1W0KD 4LWZA 4XWKA 4CEIA 2ZUBA 4US1R 1YU9A 1JJ7A 4B34A 1NP6A 5L3RA 2FFHA 2O8CA 5DNYB 2FN4A 4DWJA 1E2LA 3AVOA 4MYTA 3K53A 5BN4A 2QY9A 1XD2B 721PA 5K8IA 1R0XA 1VECA 4Q00A 3A37A 4QC2A 5FTMA 2J0UA 2YOHA 2GVZC 4KFUA 1E2EA 2FX3A 2HV8A 3QIAA 3QXHA 3CNOA 1IY0A 2J0VA 3NHBA 4TN1A 1F3OA 5KU1A 3OZXA 5CM8B 4LYAA 1NBMA 5LDDC 5J4LA 3L43A 2ZRPA 3DM5A 3LA6A 3KTAA 4NZYA 1XEXB 2C78A 4CYMA 3QENA 5DHAA 4JVLA 1J70A 1X1SA 3HDTA 3QBTA 2GETA 5CK5A 2ZREA 1FP7A 2VSOA 1W46A 3QVUA 2VO1A 3RSLA 1Z3IX 3GLIE 4JL5A 3LVQE 4Q7MB 4F4CA 3R9XA 3U7HB 1UDWA 1KI3A 3NBYC 4B3GA 1F48A 3RS7A 1KHTA 2QTVB 5JBQA 1CU1A 2HF9A 2W2VA 2FGKA 1ESNA 5AK0A 3U61B 5FBQB 4JLAA 3NEYA 4EAQA 4DLZA 3B2EA 1Z07A 2V54A 2JEOA 1JXMA 2QE7A 4HDOB 4P33A 1XCGB 4MRNA 4DEXA 1ZU4A 1DG1G 2ZJBA 1NN0A 1F2UB 1BOFA 3QOFA 2Q3HA 1KK3A 1CULC 4AKEA 4CEHA 1II8B 2VP5A 3TH5A 2J46A 4TLCA 3RLFA 4HAXA 2O0HA 3AF0A 4QHTA 3VNVA 1WQ1R 1ZVQA 4RD0A 4A8JB 4BFYA 1TPZA 3LXRA 3I73A 4RFSA 4ARZA 3DPUA 1Q22A 2HLDD 4GBMA 521PA 5TB5A 4B3FX 1B0UA 2DR3A 4TYYA 2DCUA 1KSGA 2PLRA 5DI3B 4D6PA 4JJKA 1OH7A 3QF4A 3CUEF 5LBIA 4G5RA 4RVCA 3GJ3A 4LDJA 1FOEB 4UNQA 2GBLC 3QG5A 3KJEA 4BWYA 4ESHA 3A1SA 4O2RA 3HU1A 4LYHA 4RZUA 1ZIOA 3VU9A 5FBLB 3RS2A 2BVNA 2XB2A 1NNEA 2QBYA 1NVWQ 4TL6A 3R7WA 4UNNA 1DARA 4YC7A 4JMPA 2F9LA 1CR4A 4DEYA 1JB1A 3GFOA 3AUYA 4GDFA 1G16A 1UDXA 4RFSB 4TL8A 1FL9A 4U00A 2E87A 3A1UA 4D26A 4AK9A 2DBYA 2XOKA 4DKXA 5EE3A 2DPXA 3O8CA 2JLWA 1OFUX 3QKRB 4TSFA 3D7MA 5D3MB 4TT3A 4BQSA 1VIAA 2ZI7A 4NCJA 3BAFA 4M9XA 1DAFA 3RS3A 1GNPA 1EWRA 1KO4A 2JASA 4MRPA 2YC4C 3PIRA 3B1XA 1U98A 3P4YA 2IW3A 3MWJA 1XWIA 1DE0A 3THOA 3X2SA 2FMXA 3AB3A 4BFWA 4G5SA 4B33A 2ZJ8A 2KBEA 2IYQA 4JYBA 1SVIA 5FL7A 3Q5DA 4QGGA 1RRFA 2DFNA 2WAXA 4Q4AA 1FTSA 3GFPA 1R4AA 5HCIA 2I1VB 1F6BA 2WSMA 3K9GA 2QL6A 3ZVNA 4B75A 1ZUNB 3PXGA 4HYYA 1T3HA 3L2OB 2FWRA 5BXQC 1XD2A 2E1RA 3DZ8A 1U94A 4KHZA 4L9SA 1CP2A 1COWD 3E2IA 4M8NE 1MT0A 1XTIA 4FMBB 1E9RA 1AS2A 3GEHA 4RKFA 1N6IA 3CWQA 3KXLA 4M9ZA 1E2HA 2O8DA 2IX3A 4IKEA 3VX3A 2G88A 2DY1A 1GTVA 5DE3A 2GEUA 4BECA 3IIKA 2ZJ2A 3OEED 3AVVA 2DYKA 3VAAA 4A6PA 1A4RA 3HR7A 3N5CA 4ZO4A 3Q7QA 3QEJA 4C0QC 4KFRA 4D82A 4X8OA 3GLIB 5JHGB 1ZM3A 2P0EA 2EQBA 3ASZA 3K70D 2F1IA 1EFTA 2N1BA 1VG1A 3KB2A 3SR0A 3FWYA 2R65A 1E94E 3ZIAA 4MGIR 2J7PA 3BWDD 3THWB 4TMXA 2V6IA 5KTYA 4XD7A 1G20E 2QMUA 3OFND 1T4GA 4Q4AB 3S1AA 4DBLC 4JL6A 1YZKA 1W5SA 1A2KC 2CHGA 1IOZA 1P4SA 4A2PA 2R9VA 2ZIAA 1CS4C 1X86B 3EZ7A 3TKLA 1XTRA 2EYQA 3L0OA 3K09C 5H1YA 4NCNA 1IHUA 1LS6A 3LW7A 1G8GA 4U5XA 5F2EA 1KKLA 2NZ8A 3FVQA 1R5OA 4Q4JB 4GMXA 3U4QB 1N25A 1T0JB 2J3EA 2VIIA 3HU3A 1US8B 4ERNA 2V1XA 4DLUA 5CLLA 4A6XA 5HPYB 2UKDA 5JHHB 4OK5A 2IYUA 1YR8A 1E2FA 3C14C 3LAWA 5FOVA 3CONA 3B1WA 3ZJYA 3AKYA 1Z6AA 4PHFA 3RANA 1NSTA 3NIBA 2LCFA 3EZ6A 4NPHA 1XTJA 4MA4A 2VF8A 1SKYB 2WM9B 3EASA 6Q21A 2JDID 2A30A 4KFSA 4OL0A 3OAAD 1ZYUA 1PLLA 1EX6A 2BJWA 5F3WB 5B64A 3LVRE 1E2KA 2G9NA 1KY2A 3REFA 5FPHA 2O8EB 4BEBA 4KI0A 3WY9A 4M1MA 4ASUD 4JVSB 1AJEA 3OEEA 4E22A 4KVGA 3IBGA 4AG6A 3BH6A 4URVR 4KJZA 5JWOA 3DL0A 1IY2A 3VNUA 1GSIA 3KXIA 1P6XA 3KQKA 2UZ3A 3TSWA 1JR3E 1A2BA 5GJBA 1COWA 2P65A 3A58B 1SHZA 3NEJA 4I99A 1MOZA 5EE9A 1QHXA 2BM0A 1GILA 3CX8A 1TADA 3PUZA 3S1AB 5JECA 3VMFA 2AFHE 3PFIA 2ANBA 2GZDA 4NL4H 2QRZA 4G5OA 4B2PA 1K8RA 1XEXA 4M9QA 2ZVQX 3C16C 1NMZA 2P6NA 1GNQA 3MWLA 5GVSA 2DB3A 2C5LA 1HEIA 4DUGD 2WJGA 5E7MA 1VTKA 4KV9A 3N2IA 1Q1ZA 4DCNA 3EA0A 2QN6A 1PUJA 2ZYVX 4LV6A 4NCHA 4C2UA 3EWSA 5DH9A 3SJCA 4DLRA 2ZJYA 1KMQA 1B23P 1DBSA 1M34E 1VG9B 5EXPA 3BB4A 3PUXA 1KO1A 3A1TA 3TLXA 4BRUA 1Q1QA 1HE1C 1GIAA 1KDPA 1KI1A 4B48A 3R20A 3M0EA 4JLBA 3NDPA 1IN8A 1LV7A 4NTZA 2WJHA 2PMDA 4LSGA 5FFMA 3X1WA 4A0GA 3MUFA 3BERA 5C18A 1YZNA 2VP4A 3W34A 3DOFA 3CW2A 1P5ZB 2OM2A 3KTAB 4TYQA 1R0YA 2WBLC 1XPUA 4LJ8A 1OFTA 2W00A 3QKSA 4KU4A 4XOIA 3SZRA 1QVRA 3U3JA 4U02A 4EJSA 3PEWA 2ZRGA 4JKYA 3RSOA 2CXXA 3IHLA 4TQAA 2P5SA 1WE2A 2HJVA 3NDBB 2E9SA 1H65A 4ZPXA 1HT1E 5A0FA 2J0UB 3PITA 1E2JA 3PUWA 1YR6A 4BUJA 3RC8A 2WWYA 5BYJA 3EW9A 4QG7A 4DDTA 1TUEA 4BLRA 5FBRB 4J0QA 3EARA 3R9IA 4GZLA 3H4MA 4BRWA 1WBDA 2XJ4A 1R2QA 2ZRCA 1JR6A 4LC1A 3VR4A 3KUCA 4KLNA 4PFSA 1Z2CA 3W9YA 1XDBA 3QKRA 2YC2C 4II7A 4PX9A 5FBWB 2X77A 3BFVA 1OFIA 2PEZA 4Q9KA 2ZE6A 4DLSA 4LHVA 1D9ZA 3IQXA 2GK6A 4E03A 2GJ9A 2ORWA 2KJQA 1L4UA 5AUNB 1P73A 1KTVA 2X1VA 3R7WB 1EX7A 1XMJA 3QXXA 4TMWA 1XJQA 3NBZC 3GJ4A 1II0A 4NYJQ 1S2MA 4UNRA 5KNDA 1DAMA 3I72A 2CJWB 5JJIA 5HR5A 2NPIA 3CH4B 1KMHB 2OT3B 1LY1A 4Q02A 2CCJA 4K81B 2W58A 5EP2A 2HT1A 1I4LD 3MJRA 4QM6A 2W2XA 5TARA 4FCTA 4QRHA 1BIFA 2AD5A 3MFYA 1G17A 4WVFA 1XD9A 3VR6A 1QG4A 1RFLA 3LLUA 2ZROA 1Q21A 2CNWA 1ZU5A 1NMXA 2BEKA 1EFRA 1IY1A 2DFKB 4PC3A 4Q47A 5E3HA 2IUSA 4LPKA 4TLAA 4DDVA 2O5VA 1ZUHA 1N6LA 2YOGA 5C46F 4DIEA 1G3IA 3GCGA 4RZXA 1DPFA 1XX6A 3TW4A 4LBWA 1QHYA 4HLUC 4QHSA 3U7EB 2P6RA 1KSJA 1Z0IA 3B1YA 1X3SA 3L82B 4CEHB 4ZKEA 2Z83A 2LKCA 4CDGA 1RIFA 1SXJE 3AGQA 2H5EA 2YKGA 5DYGA 4JLMA 5JS8A 1P2TA 4IXMA 4DSOA 3AP2A 1O87A 1SULA 2GXSA 2PCJA 3KUDA 5CK4A 1HV8A 4D2IA 3C5HA 4YQFA 3ZZUA 2VEDA 4EFNA 1KNXA 2F6RA 4K8OA 1FNNA 4XJXA 2GAOA 1DAGA 2XTZA 1ZP6A 4W5WA 3W5JA 2ZR9A 3C5CA 2XZOA 4XD7D 1N5JA 2XTMA 4JLVA 4C9BA 5SZIA 5EUQB 3K0CA 3F5FA 4WZ6A 1UBGA 2OFXA 2C96A 3BD9A 1CR0A 4EPWA 5IK2A 2ZI4A
chains in the Genus database with same CATH superfamily
4O33A 3UEOA 2D4HA 2WNIA 1VP9A 3R41A 2PO7A 4YUZA 4NSNA 3RIHA 3T9EA 3H8VA 5EPOA 4V0MA 1QTQA 4IGAA 2XCQA 3NEPX 3BN3A 4HNAA 4LC0A 4Y6QA 2VWPA 4CMEC 5B6PA 2I7TA 2VHZA 2QW0X 1BD3A 3DQQA 2PX0A 2CZQA 3ME5A 4XSGA 1PX2A 4JFRA 3C7CB 3CX7A 3IOEA 3QVVA 3U4AA 5DCWA 3DOCA 5AKGA 3DOUA 4EGJA 1PL0A 1N7JA 1ADYA 2G36A 3H1GA 3ITEA 1YE8A 2FV8A 3KPVA 4YT5A 3RC2A 3S29A 4AFNA 5KNCA 1D2NA 4GEGA 4K03A 5DNEA 2FSFA 1Q0UA 4OLFA 4YRBA 1VOTA 3AW8A 3CF6R 1KIMA 2R2AA 5HQ3A 4NCBA 2JK1A 2J48A 5HEKA 5LPNA 3KHSA 2UXCB 1BN6A 2V59A 2Y2VA 4RENA 1WCXA 2ESRA 2WE7A 3AESA 4G1UC 4RK4A 5T64A 4UDNA 4FIDA 1MO6A 1WD7A 4K6FA 2FR1A 4FN5A 3GAMA 5DT2A 4TTVA 4H4DA 2O8VA 2HCFA 3V4VB 3F96A 1WSAA 3LCUA 3PFGA 2VJAA 4ZMBA 1Z2EA 1V16A 1G2QA 3QUAA 3WVNA 1T34A 4D98A 1X8XA 3ZE8A 3NOOA 4A1FA 1I3CA 2BHLA 4HYTA 4QLOA 1IAVA 1PW7A 2QUIA 4TV9F 4W9NA 4F1JA 4M0PA 1U3DA 4ITUA 2OXIA 4YONB 4C4YA 2HA6A 3GEPA 2O0KA 4CCWA 2XGOA 4MUGA 5L51A 3F7MA 2NXNA 3H3JA 3LYHA 3RGWS 4NH4A 4ZIRA 3ZH2A 3P27A 4BMOB 4FD2A 5EG5A 5HXAA 1EBFA 4J9VA 1ESCA 1T10A 3S44A 5GIPE 4YCMA 4QOSA 1U8EA 2ZEJA 1NJ2A 1EWYA 1NJGA 2BMEA 3WBBA 3CUUA 1S1CA 1NC1A 5IPFA 4E2WA 4ZCSA 5D6NA 1KP3A 5L45A 4UAGA 2PWZA 3O93A 1TTTA 3A0UA 1OR8A 2D62A 4HX9A 2VPIA 5A9RA 1V8BA 3VYWA 2DR2A 4JUCA 1LB1B 2NP6A 1G60A 4RL4A 1M1NA 4DOMA 2ZJ5A 4BFXA 3JQBC 3TKAA 2RHHA 4MQBA 1QHHA 1WMSA 2LWIA 2VT3A 2B4AA 2A94A 4Q4LA 1L7VC 2GHIA 4FSXA 2Q1WA 4L78A 4ER0A 1IXYA 4N41A 2EKPA 3D31A 4K28A 4IVQA 3ENWA 4ND2A 4OI0A 1N0IA 4GPBA 5AWFC 1Q2UA 4Q3KA 3GT4A 4M46A 5G41A 5IBRA 4R8RA 5HJ7A 3K4PA 4DLNA 4CL2A 1DBQA 1CUAA 3EQ7A 3EOAI 1QVVA 5HRUA 4DGSA 1GAXA 4MR9A 1UBCA 2I71A 1EWQA 1QQ5A 5HS6A 4LV5B 4WOPA 4BRWA 3G89A 3PD7A 4B3MB 4C7OA 5EUCA 4F12A 3FE2A 2PBLA 2QTLA 3AKZA 3NTOA 4CW7A 4FP9A 2AGVA 4GUAA 4I3HA 4EW1A 1HOXA 2P6PA 3FVTA 2VPXA 8ATCA 2ZI5A 3V34A 4NULA 1GA4A 1HYBA 3T9FA 1FFCA 1XRJA 1VJ5A 1XPJA 3KYBA 3ZCVA 5IJZA 4K6HA 3F1KA 1ZJZA 5EIAA 4HH4A 4E5MA 4I08A 2PZGA 4JLPA 4RO0A 3LX8A 4YI5A 3U3ZA 4A73A 1P9OA 2H4XA 3B5IA 1YKGA 2RGAA 1FRNA 4KGXA 4EI9A 4GVPA 4HUQB 2BFEA 3HL0A 3NVMB 1KAQA 2J9RA 4QBHA 4WJKB 1Q1NA 5IBPA 3HUUA 3DFFA 1XQ6A 5TF4A 1HQKA 1CBUA 3HY4A 5AP9A 4QDOA 1RXIA 2EWVA 3A9UA 4OMCA 1W4CA 2REOA 5I7EA 4Q3EA 2P62A 2C5EA 4CMHA 3EWNA 4F6RA 1VE3A 2R44A 4D96A 1U0SY 3A9RA 5ECDA 1E0SA 2Q2OA 4ZHQA 2IP2A 3RNLA 4EZEA 4D9JA 2B9EA 4BNHA 5JSZB 1R5JA 4LYFA 4M89A 5EFZA 2X3FA 1NHGA 2FWBA 3MQ2A 5GONB 4DJTA 1TM4E 2NUPB 4X64B 5G3YA 3ESYA 3FVRA 3D6HA 4QVKA 5KAMA 2W2TA 4YRGA 2G6BA 2FWJA 2P9EA 3PV0A 1XDUA 2I2CA 2WP8J 1IM5A 1P62B 3OU7A 4NBKA 4AZWA 4EH1A 4Z7NB 3V4PB 3KT6A 1MNQA 2FFJA 3LH5A 4YCAA 3TUZC 3DTYA 2V0CA 5DISB 1EFVB 2GFHA 4GIBA 4EVSA 3VA7A 1HMPA 3QA9A 4FQ5A 4BNLA 2PSFA 1VSUA 4EG7A 2DHEA 1IH8A 4Z4GA 1N3IA 4WI1A 4WKGA 3P1JA 5AVZA 1AT1A 4EYEA 3G88A 1MO4A 3ILYA 2B6NA 4LZZA 4X6UA 1G18A 3SN6A 3TRKA 3LIPA 3W90A 4FNMA 5AOBA 1ORWA 3ZX4A 1VJCA 4FGSA 4GNRA 1NW7A 1SBQA 4QU5A 3WYGA 5KYYA 1QGYA 1Q0TA 3ZGVA 1ZIPA 2CXUA 1G19A 5EHQA 1U0NA 4GE0A 2VQSA 4PVDA 4Q9LA 4QFMA 1OI3A 3OIUA 5M04A 1L9XA 2RCNA 3PXEA 3B53X 2Z2IA 4ZHSA 3KHUA 5C1PA 3MCZA 2X4GA 3VX4A 1QWSA 4JJZA 1AV7A 2K2WA 2LP4Y 4GGMX 5JAUA 2GBPA 3WJ2A 3PUYA 2NACA 3OCJA 4FD3A 4M7RA 5DO9A 5G4KA 2AIRA 821PA 3R77A 1H2BA 2VF2A 5CD9A 1HQCA 3SDSA 4BQEA 2Q8QA 4PYQA 3RTDA 2Q07A 4RXTA 1EZ4A 2IEBA 2MINB 5K0LA 2CFSA 2YCLA 1KRHA 1PTKA 4HGYA 4HHEA 1AKVA 1CQXA 4IFEA 4J76A 3ESZA 3LKVA 4IJ5A 3CZ5A 2CWWA 3WGNA 1CUZA 1G8HA 3AR4A 1JHMA 2X0KA 2JRLA 3WGMA 1SKBA 3F67A 4B84A 4CIVA 5ILOA 3D6MA 1UQUA 2P79A 1ETHA 4NBLA 4X85A 5CT4A 3JW8A 2HMAA 2V3VA 2ZSKA 5IKXA 1TJYA 2OKCA 3L07A 3L4BA 4MV5A 2YMLA 1E99A 1S1MA 1VE1A 1S4QA 4CF7A 2RBKA 1TJ4A 4BAGA 2ZSFA 1KI6A 1G7CA 1VBNA 3AY6A 3CVJA 5T4FA 1G3MA 3PX3A 4RKEA 2NUTA 3LKBA 1C8VB 3DO8A 5KJEA 3RQIA 3IDSA 1HSZA 3QSGA 3SGLA 1BX3A 4O0LA 4MQUA 4YMTA 3KJQA 2VDOB 4IIHA 5IZ4A 4BFCA 1DKUA 1NN3A 1ZSNA 2VK1A 3U16A 2C9BA 2DE0X 4GPTA 1SC9A 1U2SA 2NZXA 4F5DA 4WDRA 1AD2A 4HATA 3TCKA 3TOCA 2NQ8A 4G89A 3GGDA 3KUUA 2FOXA 3INYA 2HLHA 4RMHA 1YUMA 4G8JA 4Z4QA 2G70A 3WL7A 5DK4A 1J2JA 421PA 1D1TA 2GBLA 1WXQA 2YWCA 3TMKA 4KBFA 3MK31 2QTMA 2YASA 2VTVA 1V8PA 2FPMA 1YR9A 3TLAA 3EPKA 1DC6A 5FOWA 3BTSA 4LZWA 1N5DA 1MFPA 1Q74A 2OZLA 4BKUA 3DV0A 1BKSB 4R1UA 1U3CA 3DFZA 1EG7A 2WG1A 2Z1DA 3B85A 4LJ7A 3ZR4B 1U1CA 3PUIA 4AUNA 5B55A 3ZDDA 4IKPA 4LYDA 1GVNB 4PNZA 4ALKA 2RI1A 1KI6B 1TW2A 4D8UA 4L8VA 1J9EA 4DSTA 4HV4A 1ZNZA 1E8NA 2VTDA 3E7PA 4MRMA 4R16A 2EV9A 2LUOA 5CFLA 5TS2A 4JOCA 1L4KA 2GN9A 1Z7EA 3HRKA 4IDFA 4J7XA 3VTAA 3SHFA 4MYDA 5FQOA 5BR1A 2EW1A 5JAOA 3B9PA 1MO5A 4V03A 2WVAA 4LQ4A 2IYNA 3VZSA 3VPCA 4IRXA 5G4LA 3CPJB 4Q3DA 5LU8A 3RUCA 1M1UA 4FFWA 2IZ0A 2P7HA 5EAIA 5CB8A 1Z29A 4HFJA 3ZHCA 4GC5A 2P91A 1JQ5A 1J8QA 5AMXA 1L5GB 2A33A 1JKFA 3HJBA 5ETJA 5TQ2B 3EXFB 3IBSA 2C92A 3LRTA 4DM7A 4YXWD 3V2HA 1DIHA 1MB0A 3HJRA 1IG3A 3RKUA 1K66A 3W5SA 5FOQA 2Y66A 1GLNA 2BFFB 4QT0A 2J30A 2PT9A 2Q7XA 1P3Y1 1EDZA 2VHCA 3C3KA 1EFKA 4WEQA 3UMVA 2APJA 3R3HA 1CRZA 3ETNA 4PE5B 3JSXA 1IN1A 1G6HA 3HPQA 1J6UA 2MSDB 3TN7A 3WXBA 2A3NA 1BW9B 1GN8A 2CMGA 1GZDA 1W2HA 3AIKA 3SVLA 3EUWA 1GPMA 5EA2A 4P0TA 4NHOA 3ABQB 3OOJA 1RQRA 3L4SO 3HU2A 4RTMA 1HF3A 1K89A 3AV3A 1N6OA 3E0QA 1WBBA 2V4MA 2QLBA 1QKKA 2OZVA 3ACBA 5FTLA 4RE6A 4F45A 4GBGA 3MJCA 1UXKA 2ZQ5A 1SN7A 3JPWA 4PR0A 3N70A 4YBZA 1WW2A 2ZRMA 4UD2A 2HQ1A 4F5ZA 3OZSA 3TJRA 3SQXA 1I2DA 4BZPA 2W0MA 3H5IA 1JEYA 4IFTA 4FCVA 4PFJA 3LNCA 1LBTA 2YUIA 4KPGA 4ZDIA 2I7XA 5KTPA 2WTUA 1E1NA 4L8GA 1PFYA 1RJGA 3RIEA 2ZZMA 1P0PA 1KI9A 3QF7A 4KQ2A 2GPAA 3ADCA 1WIWA 2FDXA 2Q2WA 3ELBA 5IAOA 2J0QA 2JGMA 2FPIA 1PJ3A 4YALA 1Q0RA 1PAUA 3CQ9A 3CR8A 2A8YA 4IWXA 1ILEA 1GLVA 4AL4A 4E3ZA 5K9ZA 3IIMA 2NAPA 5CPBA 2BFEB 4KOAA 1S0UA 1ZAKA 3KEFA 3KYJB 4OF4A 4EHLA 3HC7A 3MBOA 3NDRA 1BVYF 3DS8A 1IXSB 1UK9A 3GVCA 2P9BA 3LECA 4G4GA 4D4HA 4DC9A 3NO4A 4DR1B 1P2GA 4B43A 4BJ5A 3HXQA 4M49A 5DSTA 3AT1A 1EX9A 4TWBA 1K6MA 4DW8A 1TPYA 2YMQA 4W5JA 1XTVA 2YH2A 1NVGA 2ZDHA 3COSA 1KZ1A 1AN9A 1SC1A 4TWRA 3FNEA 1XDZA 1DG9A 4PNEA 3WHLA 4WSOA 4G1MB 3M83A 4X20A 3B9QA 1WPRA 2YRWA 2FTKE 1QIFA 3DOJA 4MUFA 3L7JA 1XTQA 2A3RA 3FH0A 4MKGA 4TVKA 4X1KB 3V8QA 1NSFA 5C5CA 2NG1A 4LJYA 5D87A 1L1FA 2IEZA 4RC9A 4NEHB 3ILVA 3LLSA 5CLQA 5THXA 1O97C 2ZVPX 1A27A 4YEDA 1M2OB 1J5XA 4YTEA 1QB7A 1JQBA 1OX5A 1T8SA 2AE2A 1XZCA 2O1WA 1Z2OX 2FOLA 3EW7A 4UTXA 5G0VA 5BSRA 4LHYA 5CB4F 1JFFB 2CJXA 3FZEA 1U9ZA 1AX9A 2V6JA 4PYRA 3OLVA 3ZS9A 3KB8A 4F4IA 2K7ZA 3I32A 1O6GA 2V0GA 4G97A 1C9MA 2BT4A 3IA2A 3CKMA 4M98A 3U60B 2I4MA 1DQSA 3EDRA 2WVHA 4XQ9A 1DAPA 1YO6A 2G1JA 3KRTA 3AUSA 4BVJA 2GXUA 4EA6A 2RGDA 1NBMD 3ZU5A 1O97D 4POAA 3PEUA 2D5IA 4V38A 1LNQA 4EKIA 3GUCA 1JJAA 1TQDA 4BY9E 3L4JA 3PFHA 5AHXA 2R7NA 1NN5A 3VNSA 4LEIA 2QI9F 4PCAA 1OLOA 3AOGA 1U6JA 4FDVA 4D8YA 1A1SA 2DOKA 1B93A 3HKEA 2RHDA 1V3VA 3HGTA 1O57A 4WXPA 3RVMA 3T4UA 3O0DA 5JWHA 1U0RA 3STHA 2B5WA 1DOAA 4Y1EA 4XVUA 4WQMA 4YMIA 5AM1A 5BNZA 4LJLA 4EENA 4I1PA 3DV9A 1JDBB 1Y37A 2PRIA 2Q6TA 4PZUA 4TRMA 5EKUA 4KL8S 1Q7BA 2B92A 1TZJA 4HN2A 1U2DC 2NO9A 3EVBA 3IPYA 3NJ4A 5JBNA 2GX6A 2OD2A 2BKEA 1DADA 3TW8B 2BGKA 5EUMA 1CP3A 3NAZA 5I4BA 3Q7EA 2YQZA 3ER8A 3KZMA 2XCRB 3C6ZA 4F96A 3WHIA 4PZPA 4XCXA 2KM1A 3RC1A 4NNJA 3RRYA 1V48A 1QH0A 5FJJA 1YGPA 1RDFA 2QUHA 3SU8A 4BB5A 3O8NA 1C7FA 4WBNF 1J49A 4A03A 1VYHA 5ED0A 2PV7A 2KB0A 3DGFC 1TIPA 2J87A 4S0ZA 5I6DA 4GI7A 4AJHA 1NPYA 1CJMA 1J0XO 2XCIA 4PPGA 2FPXA 5L7WA 3DB2A 1QHIA 2VYND 3GAFA 2P3OA 2E4XA 2B8TA 3RK1A 3AM3A 3ZV3A 3AI1A 4AF6A 5H3CA 2IK8A 4HQLA 4BNWA 1KYIA 1ZD1A 4Y9TA 3OZDA 4DMFA 4J03A 2HU2A 4BBZA 2DGDA 4V1CI 3VOBA 4L4SA 1RW4A 5EWJA 5JS1A 5JMOA 5ECGC 1Q92A 1WDTA 3M1LA 4IDAA 2HNKA 2VJQA 1I51A 3BIFA 4FI3C 1VFPA 4J1QA 3B5JA 4LDPA 4PZYA 3DBLA 4DIDA 4HWPA 3KPUA 3L6BA 3NBQA 5K8UA 3ORRA 3AL3A 1DTEA 4RGQA 3E0XA 4S0XA 2ZI6A 4ENTA 3GUYA 4L73A 4NV1A 1P72A 3DVLA 1CJCA 4E51A 1TZKA 3HMKA 3MWGA 3PGLA 4DLKA 4JODA 2ZM5A 4R84A 1I3LA 5I9BA 2QVLA 1X15A 2RIRA 4MMXB 1WX1A 3TQFA 3AUJB 5CYPA 2FWIA 4P1ZA 2WSSA 3K6SA 1YR3A 4AULA 3N6RA 3EGWA 4LNUB 4M3NA 1QZXA 3GELA 1FDRA 5AW7A 3KK0A 3TUJC 3ZCRA 1NQVA 3TQSA 1R0WA 4DZZA 2ZUTA 2BEVB 4UVDA 3SQNA 4KDCA 3TFOA 2R62A 3DMHA 4I36A 4KUGA 5GJVC 3PXXA 1YMVA 4GO1A 5HBRA 4UXIA 1ZCAA 2B8NA 1I4OA 4EY4A 3AVQA 3HXTA 3PIDA 1NG1A 4U1RA 2BMWA 2R1VA 5E38A 3R5HA 3W5HA 1S8NA 1YASA 4M9SA 1NKTA 3ZN2A 1YV9A 3IAUA 1ZRHA 3FHJA 2DKNA 5KDOA 1H3EA 1ODLA 1Q1GA 3DBVO 2BDTA 1HLFA 4HMPA 1VBKA 4B80A 1EDOA 1GYRA 2GR9A 3HR4A 3L5OA 1GV1A 4XQCA 3RG2A 3UV3A 3ZWNA 5ED4A 1V0JA 1V95A 3CKLA 4PX5A 1BKDR 1NJ6A 5EGNA 2ZYSA 1UZAA 5IYZB 2WWRA 2ZRBA 3RFUA 3EIUA 1PLJA 1S2LA 2I7CA 4BN4A 2B36A 3SC2B 2MSEB 3AKEA 1YB5A 3DAHA 2JW5A 4P4NA 5E6RB 4C6SA 1E3DA 1GGMA 1Y7LA 1M2WA 2JGLA 1T3GA 3H1BA 1JV2B 4CDMA 4BQNA 4LXUA 3LSYA 3TVTA 4DQLA 1S2GA 1Z7GA 2XYHA 3ZCXA 3ZS8A 5TEWA 3ZD7A 1BO6A 3OFNA 2B0JA 2IUFA 2E3JA 1DCFA 2DKFA 3A4IA 5I4KA 1KH1A 1VA5A 5FI0B 3KQHA 1PFGA 3CVVA 4QTZA 3N0WA 2GJSA 2RKWA 2W6ZA 4MCAA 2HRZA 3R7LA 4Z3KA 1APBA 2HA4A 1OHHD 2R8OA 2BFNA 3HSKA 3TLYA 1N6RA 2F3PA 2QX6A 3PS9A 5D1NA 2UUAB 2HWXA 3UFXB 1LSUA 2O1SA 4H7IA 1ADBA 3H6KA 2P27A 5AOAA 4F60A 3O9VA 1JFVA 1Y6JA 5KSYA 2VP2A 3HKDA 3IV6A 2DPHA 3MT0A 5FYQA 4B3XA 1BMQA 1I6MA 1QAQA 1VYVA 4HB0A 5HTOA 2KSQA 1RRGA 2JH9A 3NM5A 3O26A 5DP2A 2PANA 2QYTA 2XD9A 4JUIA 4MVJE 4Y3UA 3L0BA 4H59A 4ZD6A 1L7BA 4YMGA 1U0LA 1QORA 3I34X 2BW0A 1PJ8A 2QS9A 1ACMA 2OBYA 2Q1XA 5EC8A 2HWUA 5A1JA 4Z2AA 3BBLA 5KOHA 3GRAA 2AFIA 2G8LA 4TZTA 2R4TA 3PA6A 3F0TA 1IC6A 4NCXA 2AQIA 4O5AA 2HNAA 3DMDA 4GX1A 5C8ZA 1K7XB 2AJTA 2YWGA 1H93A 2R87A 3NYIA 4HRVA 2ODAA 4JT2A 2IYPA 3ICPA 1SXGA 3SZ3A 1GJRA 3UXMA 3PQEA 4Y2PA 1UOPA 3FDXA 2GN8A 1TJNA 3EFEA 3HUTA 2MINA 3VU1A 3FTPA 3KYCA 4TS3A 3GROA 1LI4A 1OUMA 3IBCA 1IOLA 3MW8A 4PVCA 3WBKA 3WRVA 1QP7A 2IUUA 2YNMC 1VIMA 4GOOD 3MIZA 3NHLA 5EHXA 4D42A 5IJ9B 4BJ1A 4G3XA 1Z4KA 1M72A 1USKA 3PXCX 1SKAA 3O8RA 2CF6A 3ZE7A 4GR4A 2DT5A 3TRDA 3TXYA 4KUHA 4DCPA 4DABA 1GYPA 2J7PD 2Y67A 4L51A 3VTZA 3OE5A 4X91A 4MA0A 3CBGA 5A6VA 1P1HA 1YA6A 1IB6A 3VGJA 4DS3A 1QS0A 1X80B 1SUEA 1RQ7A 1IB0A 1P9WA 3KYDB 3ND8A 4OXYA 1GPAA 3TTVA 1I4WA 3CG0A 4D45A 5A0TA 1LKZA 4HDKA 2FI1A 1GL9B 5A7FA 5F2OA 1O9HA 3L79A 1IOVA 1GRQA 1AIPA 3GPBA 4EJ6A 3NQ41 2Z2YA 2W2OA 3OEHD 4XRRA 1RACA 3E70C 5ALLA 2VL7A 4CM6A 2PD4A 3BK1A 1T4CB 4QYIA 4Q9IA 1WM1A 2HKIA 4OJYA 3K20A 2YS7A 4P31A 5DMXA 2JBAB 2GOYA 3ECCA 5KWJA 4URWR 4N0EA 1RLMA 4AJIA 1OPXA 4L7QA 4LQCA 4F9EA 1TGVA 1LZLA 2NGRA 3BJZA 3EPLA 2QD4A 3A14A 3E9CA 3U3DA 1JQLB 5IHPA 3SI7A 1QRRA 3SX4A 4FXPA 2XTNA 2A4KA 3NBMA 4RABA 2CL0X 3OOYA 2JKZA 2G0AA 2OL4A 3NTXA 4AWBA 5I47A 1U7DA 3K70C 4W5HA 3O2NA 1UK8A 2P4SA 3L8EA 2DY0A 4B74A 2Y2UA 5JS2A 1QIMA 1AY0A 2A67A 2PR2A 3VR5H 1JR4A 3WDSA 2DJ5A 2NVBA 1BHSA 1GTG1 1PZHA 2PWAA 4Q21A 2PXXA 1KOGA 1SQGA 3C98A 5EZSA 1W35A 1PVOA 4JB8A 3G1TA 2KLBA 3M1IA 4MITA 5IUNC 4B3BA 1XEWX 4KGZA 2YR0A 4JBWA 5K8LA 4PRKA 5J5AA 1CQWA 2C2HA 1U9IA 1ZGZA 4PGFA 3N9IA 1KY4A 3FCUB 3PIIA 1E3MA 2C0CA 3QE9Y 2HQBA 3IUJA 4N8SA 4R1LA 4E1VA 3GA0A 1OV6A 3N2EA 2COUA 5AR1A 2JATA 1FU4A 1QTRA 2JIZA 4RVHA 1OYWA 3EDYA 3MMZA 3FDZB 1R6AA 1T9CA 1G5FA 1G1AA 2VDMB 4MGEA 2AFRA 4OO3A 4DR6B 1ZMXA 2JFYA 4BNIA 4QFBA 3KAPA 4W7HA 1GKYA 3PPWA 2DZDA 4YO8A 1HSOA 1K9SA 5JMWA 1JG1A 1VLVA 3QLVA 3NOQA 4NOLA 3WIBA 4C3VA 1V1MA 5JAMA 2PKEA 4J29A 5FNZA 3IVXA 2H57A 3I2YX 2PZMA 1UK7A 2XIQA 4QWMA 4Y2GA 4ALIA 2ODNA 3IJ5A 3LP8A 1U5CA 3RFFA 1UZMA 2NQTA 1EPUA 4GKBA 3CW8X 5CA1B 2QNBA 1AMNA 2KWIA 3EMVA 4UMVA 2CJPA 2ZT5A 3KKMA 1B8VA 5L3SA 3JQ7B 1A7KA 3ZKAA 5EJFA 4ERXA 3T7RA 3J81A 2NTNA 3PEYA 1PR2A 3E8XA 5I9SA 4C30A 1C50A 1D09A 2W6JA 3UPDA 5BSKA 4UNPA 2AZ4A 5ALJA 3RJTA 1WKCA 2VS1A 3HG7A 4KXLA 3H05A 3R3UA 4XW2A 2J3DA 1M8JA 3U48A 2PA3A 3H0KA 4GE3A 3CUKA 5DM0A 4I5FA 4BNZA 4BX3A 1V7QA 3C70A 5JNVA 5GJCA 3ZCPA 4I9HA 2PAAA 3UT5B 1X80A 4N0DA 5GZ1A 1EM8B 3QW4B 2VNJA 4MQMA 1KJJA 3MT8A 3O3NB 3P9ZA 1FU7A 5SY9A 1KVSA 5HMMA 4US2R 2VP3A 5L4SA 1ICEA 1LJ8A 4DB4A 3LHKA 2Z04A 4EG3A 5LYJA 2KI5A 4TN5A 1X8KA 4WY5A 4UUOA 2ZI9A 2GEFA 2FKNA 4B0PA 5LKAA 1ZZEA 3THRA 3WLJA 1IK6A 1Y4ZA 2X9NA 5EP3A 4ZK6A 4IQ4A 4RPGA 3JQAB 3D43A 5H70A 4E09A 5FOSA 2R84A 2X1MA 3II6X 3JQBA 3E9QA 4BZXA 2CMFA 3IAS1 3QVSA 5AW8A 4QUHA 1BYIA 2EX0A 3DHEA 2NU8A 1J2RA 4Q16A 1T1EA 2YDYA 1SB9A 2C59A 2JJ2A 5FUXA 5TDHA 4B9AA 4BN5A 5A9SB 4DV5B 3S2ZA 5LDHA 2YFYA 1QC5A 1GXSA 1LNSA 1C1XA 2F1OA 2VP0A 3HYNA 2MDTA 2AFIB 3BIOA 4UBIA 1RYFA 1LS1A 3EXHC 3EXEA 4CLOB 4JHXA 3H1FA 2FSGA 3UFBA 3H5NA 4FR0A 3IMFA 1T5OA 4QDJA 5ENDA 3IAM6 1GQOA 2ENWA 1FP6A 3D4BA 3R09A 2A1TS 3O4FA 4BTLA 3ITDA 4IH4A 2L18A 2A5FA 4QATA 3S55A 4QWWA 1SG9A 2V4UA 2PKCA 2PJZA 2OORA 3ORYA 5BOSA 2XY4A 4OIFA 1VG0B 3OLZA 4YDHB 3L77A 2FVXA 2WMYA 3IE2A 3G0HA 5LUBA 1OXKB 1FP4A 3CG4A 2QZSA 5EEGA 2H7CA 2A7XA 1FTNA 1RVDA 2N46A 1E0KA 4JJFA 5I8ZA 1CRQA 1H8HA 1UJCA 2FQQA 2H52A 2RH5A 4YCNA 2HGSA 4FBGA 2Y1XA 4J1SA 3KQTA 2KPOA 4V2UA 2QRQA 5L3SB 1FLDA 1RPTA 1SUWA 5EJ2A 3NYWA 4ENVA 3B13B 1FTYA 4HQNA 4OA5A 3U3XA 4CCYB 2C9CA 4BMSA 1MFZA 1UOOA 4TSRA 3ZJUA 1DDGA 1MC5A 1OASA 1Z5PA 4KFTA 4LN1A 5B3JA 3HA7A 4EI2A 1JAXA 2B7BA 3N87A 3OIGA 1OC2A 1AQ6A 1DUVG 2XV1A 3DKVA 3FHOA 5M29A 1JXOA 2PR7A 4MULA 4Z1OA 3T3NA 2FUEA 3OZUA 1YUBA 1RI4A 1WNFA 4R9VA 4WXHA 4HAOA 2ZJOA 1NXVA 3IAM1 3O4RA 4X20B 1EHIA 3A9TA 1JKJA 4GUDA 4Y2UA 1WB4A 2I33A 4OQEA 5J4YA 3V80A 3UJ8A 1I6WA 4TTRA 3KSZO 2FN9A 2G76A 4KXWA 3AL2A 5D3QA 3OC0A 4WECA 4EARA 5K0SA 3SJZA 2QW1A 3FFAA 3FG9A 4MQ6A 1YJQA 2E6UX 1CHNA 2VP6A 1CVRA 1D6JA 1W4RA 3DYIA 3E3NA 4OQLA 5IJAA 3ZU4A 1UBFA 2LD4A 2VRCA 3S8EA 4TKVA 3Q0EA 1BFKA 1UK6A 2BEUA 3D8BA 4A4DA 4RS4A 4R2JA 4BMPB 2ZR8A 4XVQA 3TQQA 2VT2A 4QOEA 2UYCA 3F8SA 1II8A 2VQ3A 3H5AA 4C7KA 4JT4A 2ZU6A 2LCIA 3NH6A 2HCRA 2R6AA 3N3AC 2FUKA 4XVHA 2J31A 4KO3S 3ND6A 1QFSA 3DCNA 3ZI0A 2G71A 4NG4A 1Y80A 2DWPA 3D6FA 4MLPA 1O4VA 5DM4A 4AIRA 4HDRA 4K0RA 3EA5A 4F85A 4B8WA 3BMXA 4L4YA 1L4FA 4ZQGA 4FFLA 3EGDA 1G4AE 2CLSA 3FX2A 3HB0A 3MOIA 5EXTA 4J07A 1SD5A 3PLNA 3SE7A 1AUVA 1T5LA 1YFZA 3HUDA 4W9MC 1RWBA 1ZCZA 1N9GB 4V0KA 1FBNA 1OWMA 2P75A 1N5LA 1EXVA 3A6FA 3QXGA 1F5SA 3CVOA 2R00A 2FG6C 1Q95A 3NV9A 1SVUA 1CYEA 3LUCA 1PG2A 3QHAA 4C06A 3A6PC 1R66A 1S3GA 2NV2B 1ZL0A 1T4CA 3H8JA 1SCJA 1RKVA 3DE2X 1W5BA 1R0KA 2X5JO 2Z2JA 5DXAA 3RS5A 1E3EA 1N2HA 1SBZA 4AROA 1IQPA 1DQPA 3BZBA 4V0LA 2I2WA 3A06A 4W7SA 5K5EA 3L7CA 3OTIA 3GVIA 1M5TA 1XB2A 3E6AA 3T3DA 4F5EA 1ACLA 4WZAA 1FQWA 3A36A 3AKDA 1ODSA 1P19A 4RYDA 3WHPA 2FMHA 3W8NA 5IWAB 3T15A 4NFYA 2EFJA 1DLIA 1L4LA 1TM3E 3ONFA 5JLAA 1UJ2A 4Q19A 3MXOA 3G9XA 4D0SA 5A3QA 1OOEA 4BO1A 2Y1DA 2GD2A 4OHKA 4MMYB 4BN0A 5IF9A 3G8CA 3FOCA 3BQNB 7MDHA 3PC3A 1UWKA 1FNDA 2ZSHA 1SXIA 2F3UA 2PM8A 2VHQA 2JZOA 4E46A 3R9XB 2JJ8A 2NW6A 3MJ4A 3PWZA 3LZDA 3CVUA 1I6KA 3VPHA 3QJYA 3IXLA 2G6TA 1UPTA 1MMFB 4RK1A 2WQ6A 2HSZA 2V7GA 3HFGA 3RJ5A 4RELA 1RPZA 3AILA 3OM1A 5EIHA 3G5TA 4LSMA 5CLHA 1U8ZA 5JSFA 1UQTA 3M4NA 4KQXA 1YQ9A 5C32A 3IFSA 3BWXA 2Y1OA 1B1AA 3K8YA 5AKLA 3EN0A 3KU4A 4D9HA 4AXXA 3RSSA 2KW5A 4B8ZA 1P7YA 4QPDA 5DM2A 3C4QA 4RZ3A 2BIFA 4OQFA 5EZ5A 4BNMA 4FLFA 1CIJA 3TLCA 2FX5A 3TKYA 5J5VA 3G3EA 5I7SA 2H4FA 2YFHA 2H8GA 3D1VA 3LT5A 1P5FA 5JS7A 1SO8A 3EXFA 1GKIA 1PF7E 1ZD8A 1NF8A 3JR7A 3VYUB 4ZOEA 1GSOA 2BGRA 4YN3A 5AVKA 1BVUA 3E3MA 3RADC 5BSHA 1XHFA 3DE3X 3QOYA 3K31A 3PTAA 4J3FA 2AN4A 1M74A 4PU0A 1XO1A 3W7AA 2I9KA 4KN5A 1Z5UA 1RIIA 4JLSA 2XNDA 1LQ2A 1RLJA 2YHIA 4GECA 4M38A 4RPCA 2GT1A 3GZJA 4RTNA 3HDGA 1L8AA 1I3OA 1J2UA 4YMVA 1XZNA 3DMRA 5JZOA 1F6DA 1GUDA 2IYAA 3CUSA 3F4KA 3LXMA 4LOLA 1K5GA 1DBIA 2HA5A 2XQFA 3DHYA 4CF6A 5KSOA 5EXSA 1Y3AA 4QG3A 3BSSA 3ZDFA 3PXBA 1ZUWA 1N5IA 5F1PA 4ZZ2A 2BRUC 2ZW9A 1V2GA 3QRWA 3RVNA 5KMGA 3V8PA 1JYSA 3GLVA 3BZWA 5CNJA 5AW4A 1K8YB 1O58A 3HKCB 3IPAA 1MBZA 4JKOA 1W96A 1JN0A 4NJEB 1H4QA 4BO2A 1QRUA 2XJ9A 3LLMA 3EDQA 5DGIA 1KZHA 1VI2A 3O7WA 2HO5A 5I9LA 4Q1AA 3VBCA 4ZKDA 3H97A 4JI8B 4AICA 3DC7A 3PXDA 3QXCA 3GEGA 1Y7HA 5DWVA 5KTNA 3MTBA 1MW9X 4ZT3A 3M1YA 1LBEA 4TKLA 2XBMA 2GAFA 1ES9A 1L4MA 2I87A 3KZCA 5JY6A 1KIAA 1YZTA 2J3LA 3K35A 3R3JA 3VC3A 4DLYA 2PKYX 1EINA 3F9IA 3FOEC 1M1XB 2Q3LA 2D1SA 1XELA 2YJ4A 4OHVA 3ZXXA 1TYZA 4TTQA 2OD7A 4C6TB 3PL5A 1SHTX 5SZHB 3T35A 3I23A 4WKNA 4D9CA 3X0DA 3GLFA 4EGFA 1BMFA 4UZEA 1HKUA 1Z3CA 5AO9A 3RTEA 4EUNA 1FCJA 4HLCA 4Q4JA 2QXUA 1FRVA 1NUAA 1SURA 4MVJD 4NWIA 1UZNA 4WFIA 4CE6A 4N48A 3W8RA 3ZGXA 2PXHA 1QHNA 2OYRA 2P4HX 4QBGB 1MIOB 4NZMA 3E61A 3DXFA 2HRDA 4HAWA 1RZUA 2JBWA 3M6UA 4REQA 5E6SB 7YASA 1JZQA 2JAHA 2QYOA 2QAGB 3M4JA 4CG1A 4UM5A 4DV0B 2HV9A 2JCVA 1VG8A 3WLNA 2HX1A 4IIVA 2BP7B 4R68A 2JI8A 4JBXA 4IBOA 1RE1A 1U1FA 2I1LA 3JRWA 3NUGA 4HAUA 4UC0A 5IP5A 4E2ZA 5JDIC 3HXPA 1ZM7A 2RAPA 5D3MA 2Q29A 1DC8A 2NZ2A 5FJIA 4GMHA 2FN7A 1RP7A 3BK7A 2OZEA 4PQFA 4UHJA 3BXFA 4AMUA 2FW6A 1PFWA 2BFFA 1V71A 2EC5A 2BUCA 4XFJA 4DL9A 221PA 1GCUA 2RI6A 2XUOA 3HA3A 4Z4HA 2G28A 1PNQA 1XZPA 1GG5A 3ZVRA 4F6RB 1Z6QA 2IBMA 2P30A 3GLSA 4EM6A 1PQWA 2E4WA 3A4TA 3NZEA 4H1WA 3A9VA 4OKNA 5ALKA 1AS0A 1C0KA 2ZTLA 3JWJA 4PO3X 2OG1A 1J7JA 1WHTB 2X0FA 3WP1B 3ZZTA 1YJCA 1S3IA 2ZKLA 4KMRA 5LOVF 4ZVTA 2AX4A 2I4LA 3BAZA 3L6CA 3F9RA 1KSHA 3IR6A 1C8KA 1N0UA 1RYEA 2QQEA 4G23A 2MSLA 2UXDB 1MG0A 3B8EA 2JKVA 3GAZA 4OJQA 1VHJA 3JWPA 4CM9D 1N5MA 2WT4A 4XE5A 1U7HA 4ZI2A 4OIMA 3SZUA 3RS4A 2J32A 3ZQJA 1NUHA 4DMLA 4EDFA 3RYTC 1UBHS 3FBGA 4Y6SA 3S2GA 2IXDA 3WL4A 4UUNA 3WTCA 4CR7A 4DRYA 1KYQA 2II6A 3DJFA 4EABA 3HB1A 3Q10A 3H0CA 3KO8A 2ZR7A 1GP2A 1WMAA 1PNVA 4H18A 1C7JA 1J2YA 4M8LA 4MR9B 4CHGA 2G08A 3ZK9A 4YP0A 4C20A 1OFHA 2AXNA 3PXUA 4LWOA 4X94A 5LB4A 1GD1O 2HMWA 4WXEA 3INGA 5KPDA 3U56A 1OT5A 3BKWA 1M1ZA 4GICA 3EIOA 4QDKA 1V37A 3T0GA 4FGKA 3IODA 1SJ9A 3LV8A 2O6HA 3ANTA 4NHEA 4C29A 6YASA 3FSJX 4G2TA 1X7XA 3JTEA 3KZOA 3HBJA 2QMZA 4BX2A 4ZAWA 1A71A 4KSBA 1U9IC 4YAUA 2Z6QA 4X1YA 3QI2A 3O91A 4U7WA 4YAKA 1TZMA 4I8XA 3M5WA 2FG5A 2BUBA 4ZZ1A 5I51A 2QM7A 1AM4D 1CB7A 1L7OA 2FY8A 3NBAA 3BHNA 4RD2A 4MP8A 5TGTA 3WMEA 1V6AA 2CNBA 3EC2A 2BYTA 1NIPA 1LDMA 1XC7A 3T7SA