1TU3A

Crystal structure of rab5 complex with rabaptin5 c-terminal domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
165
structure length
165
Chain Sequence
ICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-5A
publication title Structural basis of Rab5-Rabaptin5 interaction in endocytosis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 53
structure length 165
sequence length 165
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2004-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tu3A00
5CYOA 2ZJAA 3HJNA 2VPPA 3HU1A 1IQPA 2QMOA 2FX3A 3B1WA 1Q1EA 1T8UA 2MSEB 3FYHA 2IBMA 3U7FB 1JI0A 4NYIR 1F60A 1JPJA 1ELOA 4PAOA 1XMSA 1P75A 3A4LA 3CNNA 1ZW6A 3PIRA 2IYUA 4TYPA 2W2TA 4Y0AA 1VG8A 3JZMA 1DO0A 2ZVQX 2V6JA 4MGKR 1D6JA 4RD2A 3KJIA 2HF8A 3UMFA 4FN5A 3A1VA 4JVNA 5JJKA 1QHHB 4GI7A 5FPSA 1OFUX 1R5OA 4MUBA 2ZPTX 4HAUA 2GCOA 2GILA 1KDOA 1ZRHA 4R71A 2HLDA 4PO8A 2VEDA 1KJWA 5GJCA 3EC2A 4E09A 4NP6A 4N0DA 4DUGD 5AUQA 2O8CB 1OHHD 4YDSA 3SDZA 2P0EA 1QHGA 1U81A 2ODNA 4NKRA 1E9BA 4AURA 2KBFA 3BD9A 3O8DA 4MRSA 3PUXA 1R7RA 4HDCA 3RNLA 4PHHA 4PQRA 2BBSA 1FX0B 5EXSA 3KXKA 4W5WA 3DMNA 2QAGC 1TU3A 4LI0A 2HEIA 4LJ6A 3TUZC 3QKUA 1TF5A 1NG1A 1XWIA 1YQTA 2WSSD 3EZ7A 3QXJA 3D31A 2B6HA 1G7RA 1XU4A 4B43A 4C2TA 2QE7D 1QBKC 2WJGA 2R44A 3BB3A 3D8BA 4NU0A 4LK2A 2VA8A 4GP6A 4QBIA 5IDVA 3TKLA 3QY0A 2VP9A 5KSZA 4JIMA 1K5GA 4X8LA 1KSFX 4PZLA 1W36D 2WWXA 2XXAA 1XBTA 1R8SA 4QBGB 4OYHA 3TBKA 4RD6A 1SXJD 3WNBA 3M0EA 3U6KA 2O5VA 3BAFA 4W9MC 1NP6A 1C1YA 1YE8A 3ZVNA 3PXGA 4DWJA 4QFMA 1OXTA 2QBYB 3MGCA 4TZ0A 1N6NA 2EFHB 4IOMA 2AD5A 4FCVA 4ZO4A 1TL7C 3C16C 2CK3A 4JT2A 1XTKA 3WMFA 2ZI6A 1W7AA 2BBTA 3OFND 1E1RD 2W58A 3SJBA 1OF1A 1NMZA 2IYVA 3CNLA 4NDZA 5H68A 1BMFD 3D6TB 2JCSA 5EXXA 3SN6A 3ZZTA 5L8VA 2R2AA 121PA 1XRJA 2CLSA 2ZI3A 3PG5A 4DB4A 4KITB 3TE6A 4DSUA 3E2IA 1YR7A 2W2VA 4E5UA 421PA 4EPTA 4UJ3A 1N6PA 2ZRNA 3X1DA 1OIXA 1T5IA 1Q1ZA 3CLVA 2CLDX 2HJVA 4IHQA 2GJ8A 4RVCA 4WZAE 2CE7A 2ERXA 3B1ZA 3AM1A 4IDQA 3EWAA 2RKOA 2H57A 2F43A 4NHOA 3A6PC 3GLIE 4NPHA 1NNEA 5JLJA 1LFDB 1OE0A 2P6RA 3AF0A 4AG5A 1U98A 1KZ7B 1TQDA 3Q85A 3ZGXA 5DSZA 2IF2A 1DE0A 4ILEA 3ETLA 4WVFA 5FR1A 1KK3A 5IF9A 1G6OA 4Q18A 4YLGA 4D4KA 4G5OA 3UIEA 4D0GA 3CF2A 1AKYA 2VF7A 1CJMA 2FU5C 2QPTA 4NYMQ 4DSTA 4D80A 3NEYA 1GNPA 3A4NA 3SYNA 3FE2A 3S1AA 3P4XA 1N0VC 4JLMA 4BLQA 2GESA 1YZNA 3P20A 1QG4A 2C78A 5TB5A 3C4JA 1KKMA 2QAGA 2QM7A 5LD2C 2JASA 3GLHA 1ZU4A 3RDPA 4RZ3A 2O8FA 2IYQA 5FOTA 3I8XA 2HDNB 5DISB 2P2LA 1UBEA 2D62A 1ZUNB 3PR1A 3DHWC 4FMBB 1DO2A 1GL7A 5ELXA 1IBRA 1T9HA 4M1YA 4JVSB 2R6AA 2V1XA 3AVPA 1ZUHA 1DAGA 2FV8A 2EYQA 1Z83A 2VP2A 4QGAA 3TW4A 4PANA 1DTSA 2JJ2A 1P2VA 4PSKA 4GOJA 4AKHA 5EE3A 2V9PA 4AYWA 5EZ6B 4EPWA 3EASA 2WWWA 2MMCA 1FUKA 3VX4A 5FPHA 1ZCBA 3WMGA 3QE0A 2D74A 3K0AB 3QOFA 1F2TB 5H1YA 3TNFA 1R0XA 2FDCA 3AKYA 1GG2A 4GZMA 1P6XA 2AX4A 3BFVA 3K0FB 4V0OA 4GP7A 2GVDC 3QIAA 4Y0VA 3V9PA 4C4PA 2ZR9A 2EFCB 2O8EA 2QPOA 4I4LA 2DPXA 3X1XA 2ZYTX 5FOWA 2RGNC 4ZI3A 1E2JA 1FTSA 5KYKA 1H8HD 1DPFA 1VHTA 4D4JA 1E0JA 1DADA 2WIAA 4FXPA 4GSYA 3H84A 2BDTA 4JBXA 1IXZA 3GJXC 2AKAB 4URZR 5AR1A 2FFQA 2V55B 4QNMA 3TVDA 3ICQB 3Q9LA 1CKEA 4K81B 3OE7A 2J9RA 4N3NA 2WSMA 4BFUA 1CR0A 1Y63A 3THYB 5CB8A 2JLSA 1SVWA 3GJ0A 2VHUA 4GOXA 5LB4A 3SNHA 5H70A 2YVUA 2GJ9A 3GCGA 4F4CA 2XTMA 4URWR 5GVRA 3WYAA 3OIUA 4ZV4A 4M9ZA 1G16A 3T12A 4EPXA 1SVOA 3O47A 2WJJA 1KK1A 5HZKA 1HEIA 1W2HA 1M8PA 4FI3C 3VU9B 2R6FA 5IRCD 4I99A 3W34A 2J41A 3ZD7A 2NTYC 3M4YA 1ZYUA 3W3AA 2P6UA 5KOYA 4Q9IA 2QRNA 2YOFA 3AGQA 2PMKA 4BFYA 3ADDA 2IHYA 4EFLA 1VDZA 1E2EA 2I3BA 3QENA 1G17A 2CL6X 3FKSA 4BZPA 3N2IA 2HXYA 4B73A 3LW7A 2NOAA 2BOVA 2AFHE 3A1WA 2ONJA 4H1UA 4HSEA 1PLKA 1YZKA 4A6PA 2X2FA 1K5DA 3O8BA 1ZNWA 4K8OA 4A0HA 1QVAA 2FNAA 1JAHA 3FTQA 3QF7A 5CM8B 5J4KA 2J0VA 5JBQA 1D5CA 2GBLC 3CB4A 3VHLB 3HP1A 4MRRA 5FTKA 3B9PA 1Q21A 4MKHA 4JJKA 1KSGA 1KO8A 1S9HA 2ZSEA 3A1UA 2JDID 2YOGA 5BN5A 2GETA 1SHKA 3SBEA 5FPYA 3G82C 4HLCA 4XSHA 1E1QA 2ZU6A 3Q5DA 2ZS7A 4FMDF 3QPVA 2O8DB 1MABB 4D0LB 4QGGA 4YDHB 3W5IA 5J4YA 4Q47A 4BEBA 3GLFB 3NH9A 4I1VA 5G41A 1QHNA 3U3JA 1KJYA 2C9CA 1US8A 3IQWA 5KUTA 3BGWA 5SZKB 2EFEB 4OJQA 1SKQA 2FSFA 2ZREA 3QXXA 2P67A 1Z6TA 2Z4SA 3F5FA 3R9WA 3MLEA 1X86B 4EPRA 4UXIA 5JECA 1Q20A 4A2QA 2ZSDA 2QMUA 4D0NA 1K8RA 3H2YA 4DCVA 1DARA 2ZRIA 2G0TA 4KLZA 2RGNA 3B85A 1R0WA 1G3QA 4P31A 5KNBA 4QL3A 3U3RA 1Z0IA 5DI3A 2IX3A 3WP0A 2BMFA 2WIBA 5FFMA 4BEJA 2KI5A 3QJYA 2F7SA 3U3OA 5KDOA 1Q22A 1E9DA 1U94A 1JQLB 2J59A 1G41A 2Z0MA 3CZQA 4GNKA 5AUNB 3DOEA 4AG6A 2C03A 5LB2A 4GFDA 3A8TA 4TMZA 2JLQA 4HAZA 2GCOB 3FKQA 4F38A 1VPLA 4AYXA 4EQ6A 1C9KA 3RWMB 1KI3A 1NLZA 3KUDA 1NBME 1W0JA 2Q3FA 3AVVA 4BPBA 1KSJA 4KFSA 2ZRLA 4LYFA 1YRAA 2REBA 3AQ4A 2OFOA 4XD7D 3PENA 3QPUA 1OSNA 2IC5A 4OI0A 2W6JA 4Q9HA 3CBQA 1Q3HA 4TMWA 1AJEA 2GCNA 4L9WA 3KKPA 2GZHA 2JLWA 2B21A 4ITRC 3SJCA 5KPDA 3V00A 3IBYA 2ATXA 1CS4C 2ORWA 3BH0A 2F6RA 3CPEA 5FL7D 5JSZA 4TZ6A 4FINA 4ERNA 721PA 4B76A 4C2UA 1S2MA 1U2RA 5KSOA 2RGEA 1Z2CA 3LAWA 1YR6A 3W6PA 2Z4RA 1W1WA 4QG7A 3AB3A 4GPTA 4Q1FA 2Q3HA 3TUJC 5E3HA 2GBLA 1E2NA 1E98A 1JBKA 1TX4B 5EE0A 4QKQA 2XXAB 1L7VC 4C0BA 1KDRA 2QTVB 3DMDA 4H1VA 1T6NA 1G7CA 1DELA 3BRWD 3LX5A 1RPZA 1OH5A 2FF7A 2I1QA 3SYLA 3QG5A 2JGNA 2OHFA 3RRZA 2J0QA 5DE3A 4LJ4A 3UXMA 1W0KA 4JL8A 4KAXA 2Q3MA 3BB1A 4LV8B 4DIEA 5DI9A 1K6MA 1TUIA 2FPLA 2Z5FA 1WE2A 4A2PA 4G5GA 4C0HA 2YZ2A 3IKJA 4Q19A 5M04A 1NG9A 3PEYA 4QJ5A 1UBGA 1UM8A 3KXLA 1Z0JA 3G5UA 1HV8A 1ZNXA 2VF8A 2V7QA 4Z1MD 3IQXA 3L0OA 1TQ6A 2DB3A 1RJ9A 1UFQA 3B9QA 2PX3A 5D3QA 1NIPA 1KDPA 3H4MA 3CR7A 1N5LA 1EGAA 3GJ6A 2CJWB 2A3RA 3OESA 5KSYA 4JLKA 2G83A 1G6HA 1Z0AA 4Q7LA 4OK6A 4PC7A 5HPYB 3B8HA 4OI4A 3A1TA 4TTQA 4QC2A 3OEED 3QKSA 2F43B 3K9HA 2IT1A 2QY9A 4WAUA 3HDTA 4DCSA 2ZRAA 3GJ3A 1AGPA 5FUVA 1KI6A 3NWJA 5AK0A 2ZTSA 4LOAA 2FA9A 1EK0A 1EFHA 4KI0A 1IHUA 1E2PA 2ZEJA 1NN3A 4DLUA 4KV9A 2A7QA 4LUCA 1TNDA 5HR5A 3S1AB 1L8QA 3U7EB 3IPXA 2AD1A 3AVUA 1KTVA 1N6HA 4JZKA 5FI1B 5FUWA 3FHCB 3KB2A 2YNMA 4UJ5A 4BFSA 1S8FA 3IGFA 4BZQA 2QAGB 4E03A 3GLHB 3AP1A 2O8FB 3L0IB 1Q44A 3AVXA 4O2LA 2RGAA 5JZVA 2GCPA 1F6BA 4NBSA 2PCJA 1KK0A 1RRPA 4YMTA 3LLUA 2FFBA 5BYJA 4HEJA 2IA5A 5C18A 1ZM4A 4DVGA 1SGWA 3LQQA 1HQYE 3TSZA 3GEIA 5B57C 4JYCA 4V02A 3IUYA 1FQKA 1GSIA 2GDJA 3LBNA 1H8EA 1WP9A 3MWYW 4Q7KA 2PEYA 3MSXA 2NO1A 1WF3A 3C5HA 2G9NA 1HTWA 4B3BA 3ZD6A 4I1UA 1QG2A 3I1FA 1KAGA 4A92A 1YR9A 4HAYA 1W44A 1GKYA 3SHFA 4A82A 1G3IA 3Q7PA 1ZAKA 4PR0A 4GMXA 2NPIA 3FMIA 2IEZA 1PJRA 1E2HA 1ZJ6A 3MWKA 2RHDA 1YU9A 3LX8A 4HUQA 2BMJA 4ASUD 5KPJA 1H65A 2HCJB 2GTPA 2J7PA 2O0JA 4DDVA 2ZRPA 3T15A 2O8EB 2ZYVX 2WWIA 4JJZA 3ZZ0A 1EWQA 4US1R 1CJVC 1CEEA 4PZZA 4D4LA 3VX3A 2DY1A 2D06A 1JJ7A 1W49A 2DWPA 5AJWA 4DKXA 3EXAA 4XJXA 1WA5A 2VO1A 1T3SA 4TQAA 4OK3A 1PUJA 2X1VA 4GMDA 5IK2D 5EP2A 3ADCA 5G53C 4B3XA 1N0WA 3MFYA 2W0SA 3VFDA 4BLPA 3Q3JB 3NEJA 3K53A 2X77A 1SHZA 1CF4A 2VL7A 3VKWA 3HPRA 4YMWA 4DSOA 4HATA 1CR1A 1WBBA 3KFVA 4PX9A 5C2JB 1IOZA 4GL2A 4CF7A 4MKIA 3GJ4A 1LV7A 1RRGA 2VP4A 4TMTA 4B32A 1GZSA 4IDOA 4EJSC 3TAHA 3K70D 1AA9A 1W36C 2ZS9A 5HCNA 3EX7C 1IN6A 4URYR 1RW4A 5JI3E 2CNWD 4M0LA 3QSYA 3AGPA 1DAKA 3ADBA 3P26A 4D82A 1HT1E 1GFIA 1XNJA 1SXJC 1CULC 3LWNA 4II7A 1A7JA 2QI9C 1KMHA 1XMVA 3BH7A 1JR3D 3UKDA 4F4IA 1N6IA 1JALA 3C7KA 3MCAA 3BFKA 1FNMA 4B75A 3O8CA 2XITA 1UJ2A 4B6FA 2N1BA 1Q1QA 2WWGA 5K8IA 3LLMA 5LD2B 3U3KA 3ZLJA 1F48A 4L15A 1TPZA 3LH5A 4DIDA 3KKOA 4QGHA 2JJ1D 5KNCA 2IXGA 4UNPA 1Z28A 1FL9A 4JBWA 5EE1A 2RGGA 1Z22A 2H92A 1KZGB 3CX8A 2G77B 4HZUA 3TW8B 4G3XA 1NI3A 3FPAA 2RB4A 4JBYA 4KO8A 2OCYC 1E4VA 1UPTA 2A5YB 2QTFA 1L2TA 3BJIC 1DAIA 2BEJA 4LHZA 2V3CC 4LJ8A 2JAQA 4O25A 1S3SA 1S0UA 4IOJA 5HKKD 4C0AC 1PV4A 2IHBA 1TQ2A 1US8B 2ZJOA 2XB2A 4MYTA 1X6VA 1NMYA 1XEXA 2JLXA 3EPKA 2LCFA 1I4DD 2Q6TA 5CITA 3B13B 4TTRA 3SQXA 3FDIA 2YYZA 2D4HA 2ZJBA 5TARA 4M1TA 1ODFA 1MO5A 1UEJA 2J3EA 4DUGA 2WKQA 2QAJA 2VQSA 2DBYA 1VKJA 1OHHA 3LFUA 3U2QA 2G1JA 1VCOA 1E2DA 2A5JA 1OLOA 1CIPA 1E9SA 2B92A 1N25A 3ADKA 4Q9LA 5DI3B 4HUTA 1E2QA 5E4FA 3WHKA 3T5DA 3EPLA 5KSPA 5A0FA 1IM2A 3W6OA 2DFTA 2C8VA 1IXSB 1P9WA 2OBNA 3EARA 2W00A 3AF3A 3TR0A 1KY3A 4IEIA 4P32A 5K8UA 4DZZA 5EP3A 2ZSFA 5ANRB 3NHAA 1RRFA 1XX6A 2WSSA 1V5WA 3ZJYA 4EQ6B 2DYKA 5K8TA 5EP4A 3A58B 1KO5A 1ZIOA 2NGRA 2ZRKA 4LBYA 2QE7A 4MKFA 1FQJA 3A37A 3AUYA 2R6CA 5FTNA 4KODA 1ZNYA 4EJSA 1JEEA 2GJSA 2WICA 4ZDWA 4A1FA 4P4SA 4E07A 2ZQ5A 1T5LA 2C9OA 4PHFA 3DVLA 4G0NA 1MRNA 1SXJA 2XJ4A 2BWJA 4DBLC 4TYYA 1E96A 2W2XA 4IFEA 4R9UC 1UBFA 2SHKA 3HR8A 3PEUA 2GK6A 3CH5A 1KIMA 4JT4A 3EPJA 2CMKA 4B47A 1MV5A 4ESVA 1P62B 2GXSA 5JSZB 2QL6A 1BYIA 4TL9A 5F9FA 4IOLA 1KSHA 1BIFA 3CH4B 2H1LA 2V6IA 1Q12A 5FTMA 3BIFA 1GKIA 2FEOA 4G5RA 2RHMA 3RSLA 2JIZD 1SVKA 4CZ2A 3OFNA 1IXRC 1G18A 1F2UA 1E1RA 5BN3A 1G4AE 3M6AA 2G6BA 2CXXA 3DO6A 1BMFA 2BVNA 2D3WA 1Z47A 5BW8A 1GNQA 2NG1A 1XJ0A 3VR3A 5LDDC 3THYA 1XXHA 2D7DA 4QBHA 2XAUA 3A36A 3R9IA 3FHOA 4B34A 1Q3TA 1XEWX 5TY0A 2REOA 4C30A 2GK7A 1COWD 4IW3B 1S3GA 4C0SA 3CKLA 5BYKA 3AF4A 2VP6A 2YOHA 3IIKA 5JRZA 3T06B 1OW3B 4DDWA 3KQKA 1GNRA 3R20A 3KFXA 4NCNA 3FWYA 3TMKA 621PA 1IN7A 4HLDA 4JVLA 1HA3A 1MT0A 4JSYA 2QNRA 5DGXA 2ASEA 2OCAA 5TMPA 2WWHA 4PO9A 2WWYA 1OIVA 2RCNA 4LPSA 1E9AA 4QRHA 4Z51A 2HF9A 2CJWA 3J81k 3K1JA 5TVKA 2BCJQ 1RJ9B 3KL4A 2QP4A 4W7SA 3REGA 2IS2A 3I5XA 1JAIA 2B8WA 2EU8A 2HT6A 3LXXA 3AKEA 4V0KA 3EA5A 2ZITA 4QNRA 4NTZA 3NVAA 4LWZA 4BE7B 5EJEA 2VP0A 3I72A 5J4LA 1CRQA 2J45A 5FTLA 1GITA 2PT7A 2EFGA 3CPJB 1MO6A 3QKSB 1QRAA 2CHQA 1EWRA 4PO1A 3NH6A 3K8YA 1CR4A 4MYUA 3WYFA 2PT5A 3PCRB 1KI6B 3RS7A 2WOJA 3UATA 3UMRA 1E2GA 1G5TA 2AWNA 3E1SA 4YMVA 3WY9A 2BBWA 4B6EA 1NLFA 4RCYA 1JJVA 4A36A 1PUIA 2IW3A 3CF6R 1GILA 1P73A 4TWZA 1YZGA 5CDFA 3WP1B 5A4JA 3B7GA 1Z07A 3QNUA 5JHHB 4MDEA 5JJLA 3NBFA 4M1KA 4NONA 2AFIE 4BFWA 3IIMA 1GIAA 3TJZA 3GP8A 2C5LA 1A2BA 1S4QA 4HDOB 2RGXA 4BECA 1G3UA 2VBCA 4C0KA 5FBVB 1JR6A 3GLFE 4POAA 4OL0A 1II9A 4LYHA 4D6PA 4TT3D 3OEHD 2KSQA 2RMKA 3HU3A 4NYJQ 1P4SA 1X8JA 2QG6A 1RVDA 4PC2A 3CZPA 3K0SA 2FPMA 4H9GA 4OHVA 4OI1A 4URVR 3KQNA 1TTTA 3U7GA 2D2EA 1N6RA 2G3YA 1DAMA 3DOFA 4PFSA 3G0HA 3T35A 2ZJ2A 4PPNA 1T0HB 2VHJA 4N1AA 5JWHA 1G8PA 1H8HA 2A5DA 2AKYA 2BKUA 2QMEA 3ASYA 1ZM3A 4HYYA 3BERA 4I1OA 1NBMD 3NBYC 1OXUA 1OJLA 1FTNA 2OCBA 5JEEA 2G88A 3QEOA 1UKYA 2DFLA 1NVVQ 1SVSA 4XWOA 1SVLA 1VIAA 2QEQA 3MG9A 2XGJA 1DBSA 2YKGA 5GJWC 5J47A 4ACAA 2XOKD 2V54A 2GNOA 1Z6XA 4RFSA 4PZYA 3ZS8A 1WCV1 2W6ID 1KKLA 1DOAA 1E9RA 4U7DA 4HUQB 3TQCA 5DHAA 1VYVA 1KGDA 2VRWA 3CWZA 3SU8A 1VHLA 1P7CA 5TXGA 1W4AA 1FNNA 1ZINA 2GAAA 4MRVA 1E79D 4LCBA 1W46A 2GA8A 5SZIA 1NRJB 3NKVA 1RYHA 2FFAA 5CK5A 5J40A 1U90A 4D25A 2GWHA 3UWKA 3R7WA 2R8RA 1JB1A 1OXSC 2F1IA 4Q1EA 4OJKA 5FOUA 1I4TD 1KOFA 4S2EA 1ZBDA 4V0MA 4XIGS 5BXQC 3B60A 1TEVA 4XSGA 3FMOB 1WDTA 3VR6A 1NY5A 1MR3F 3RABA 1KO4A 4ON9A 3DZDA 1E9CA 2FSGA 3PUZA 1S9DA 1T3LA 3X2SA 4LHYA 3A4MA 3THXA 1GDDA 4Q5IA 2C77A 4DDUA 1N3BA 4DLYA 4AWXA 1PLLA 2JDIA 1QHYA 2C04A 1LF0A 1KMHB 3CR8A 2JLYA 2RGCA 2WKRA 1P60A 1EFCA 2OESA 2REXB 3KXIA 2AK2A 3IILA 1G8HA 4MGZR 521PA 5JCZA 4IFBA 3PITA 3FMFA 3HYTA 4O2RA 4NCHA 3ECCA 4LV5B 4ZIRA 1SVMA 1IY0A 3THOA 3HWSA 2UZ3A 4BGDA 1KK2A 1ZD9A 1VG1A 2GEUA 5SZJA 3RC3A 3RS5A 5C4MA 4RZ2A 4WW0A 2PJZA 1ZUIA 4HB0A 3GEHA 3VR5A 1IAQA 5CJ2A 5FOXA 4HZUB 4Q1DA 2WJVA 4P33A 2P5TB 5P21A 4NL4H 2ATVA 2YHSA 3P27A 3P4YA 4IDHA 4MQBA 4R7ZA 1TU4A 3H86A 3T1QA 221PA 4KBFA 5FBWB 4FMDB 3VTKA 1Q1BA 1FP7A 1XEXB 2ZJ5A 3PJRA 4LBZA 4DLVA 2NMVA 4RCZA 3BXZA 1S1MA 4P3YA 2AK3A 1YKSA 4OHXA 1G3RA 5KO2A 4LHVA 1YZQA 2PMDA 4QGFA 3RRNA 1JXOA 3L2OB 3GJ5A 2EVWX 2A30A 3QVUA 4NCIA 2XB4A 3Q8XB 3SZRA 1V43A 4U00A 1Z6AA 2NZ8A 4NYIQ 6Q21A 4Q1AA 1O3YA 1P61B 1Q0UA 3QEJA 4M4SA 3DL0A 4GRAA 4TTPA 3AF2A 3I5YA 3OHMA 4LPKA 4XD7A 4DLTA 5CB6A 4DXAA 3BORA 1OH6A 5C1BA 3FGNA 1HUQA 4URUR 2IUTA 4ZCMA 1G5RA 1II0A 3V4RA 1XFAA 1T91A 3U60B 2IWHA 3DM5A 5FL7A 1TF7A 1OFTA 1RIFA 3GLHE 2HV8A 4KU4A 1KI2A 2QTHA 3RS0A 3BOSA 3PUVA 4B3GA 3NC1C 4EJSB 3DM9B 2IYZA 2C2HA 1W36B 1E9FA 3KKQA 3GFTA 3TUIC 1R2QA 2XSZD 1W5SA 1P2SA 4PAMA 2ANCA 3CX7A 4P4SB 1ZMXA 4TLBA 2ZR0A 4KFUA 5E7JA 1SXJB 2J0UA 4HB3A 3RSOA 1G9XA 2P3SA 1OIWA 5EE5B 1B0UA 1LVGA 2H5EA 4KHZA 1JNYA 4BWYA 1KNQA 2PBRA 2XTNA 2ZU0C 2BV3A 1GL9B 2C98A 3LV8A 4IDNA 3MJHA 1R8QA 2B7BA 2BMEA 2G1KA 5F2EA 2BIFA 4TQ9A 4IOKA 5FUYA 4BRWA 1M1YE 3TGPA 3LD9A 2WJIA 2WAYA 2R9VA 3C8UA 2B7CA 1F2UB 2FE4A 4B71A 2OFXA 4TLCA 3UWOA 1G291 2VHTA 2IXFA 1E2KA 5DLQC 1OFIA 4TQUS 4TSFD 4LDJA 1W4RA 2PL3A 5FOVA 1XXHB 4LJ9A 4V0NA 4Z1MA 4DB2A 3BH6A 3L0PA 2A9KA 4LBWA 2QROA 4AD8A 4KYIB 2F3RA 1W4CA 2IUUA 3K9NA 1N5IA 1E2LA 4Q1BA 3VNVA 1DAFA 1F5NA 3JVVA 5L3QA 1P9RA 1YRBA 1KO1A 1KI8A 1PVOA 4JKIA 4Q7MB 5LPNA 3CNOA 4LZZA 3UMSA 1X8LA 2OE2A 2ZI5A 4Q4AA 2QQEA 2UVQA 4M8NE 4OHZA 3OEEA 1S96A 2FG5A 4QHSA 4CIDA 3K70C 2WWFA 3ZS9A 4KLNA 4B74A 5C46F 3QXHA 3RANA 3QXSA 5JMTA 1XTIA 5C4GB 2AR7A 1Z0DA 1P72A 1GVNB 1NVWQ 3VR2A 2ZRMA 2IYTA 2ZE5A 3W6NA 5TDHA 2R65A 1G7SA 1D2MA 1KYIA 1NKTA 2OLKA 2F55A 3ZZUA 3GLGA 2ZE6A 4M1WA 1ZU5A 2CCJA 4MYHA 3TAUA 4XWAA 5DN6D 4KBGA 5CM9C 4FCTA 2ZAOA 1NJGA 3EZ6A 2EW1A 1UKZA 2O8BA 2P5SA 4TYQA 2IYXA 3KJGA 3CPHA 4TYWA 3U7HB 4MDFA 3IO5A 2ZJYA 4GZLA 4Q48A 4U02A 5CLQA 1TF2A 4A0GA 1NN0A 3QKTA 2NPFA 2V4ZA 3B6EA 3BC1A 4P4UA 4QM7A 4IDPA 2JATA 4CEJA 1XD2A 2G0NA 3ZQ6A 3CW2A 4NYMR 3LBIA 4PPQA 3UANA 4BUJA 5J4VA 4DRZA 4TLAA 2BHRA 2CCGA 4YXWD 1MKYA 2VIIA 1IONA 4EFMA 1NY6A 5L3SA 2BKEA 2QT0A 2OFWA 4PPGA 3WBJA 1P3JA 5JS8A 2YWEA 4AC9A 2N42A 4JL6A 3TR5A 2WPDD 3FFAA 3ZQJA 4F7WA 1LB1B 2H16A 2UZIR 5B2ZA 1EFUA 1WMSA 2ZR7A 4FWIB 4A8JC 2CDNA 2FSHA 2OILA 2QZ4A 4D4MA 4OK5A 4AKGA 2A5GA 5GADl 4N0EA 4C7OA 4CW7A 1JXMA 2ZSAA 2CEAA 1J8YF 1N2CE 1KAOA 3PFIA 1G3MA 1GP2A 2AWOA 2ZRCA 4MGIR 4TYNA 2J5XA 4KVAA 4Q4HA 4ASUA 1KI9A 1ZD8A 1Z3IX 3SFVA 1FW6A 5CIQA 1OPXA 1UDXA 4B44A 1X1RA 1OKKD 2CVFA 1XD9A 2QRZA 1X1SA 3JZAA 3I62A 2ZRDA 2JA1A 3E70C 4LHWA 2OXRA 1Z2AA 5HTKA 2WJYA 4KVGA 5JWRA 1J70A 2ZANA 1BYUA 4UXJA 1EFTA 5IK2A 3WNCA 4DSNA 1E9EA 2FJUA 4HZIA 4LY6A 4XH9B 2ECKA 1T4GA 3I3SR 5EUQB 3ZH9B 3ICEA 1NLYA 1LW7A 4ZDIA 1Z29A 2F1RA 2Q21A 1CR2A 4RFSB 3RRYA 5JEDA 4RD3A 3VAAA 3AVYA 3VHXA 4XVQA 1E2FA 2FZLA 2ZJ8A 1YZUA 3CUEF 3WRYC 2OG2A 3BFXA 3NIBA 4HLUC 2A5FA 4WZBE 3QVVA 2DFNA 1D9XA 2GHIA 4A9AA 1Z63A 3VKGA 1U0HC 1E6CA 3TSOA 2ZROA 1II8A 2KE5A 3AVWA 5JCPA 1E99A 2CNWA 3LRPA 4NZYA 2J0SA 2OLJA 5HE9A 3AV0B 1NKSA 3CIOA 1D8TA 2AL7A 2OSBA 2WMOB 4OKSA 4D2IA 3L82B 4DJTA 3RC8A 5DH9A 1JR3A 2GXAA 4IKEA 2D2FA 3R7WB 5H8WA 1Z5ZA 2OCPA 3NBXX 4JSTA 1A4RA 1G8GA 2XNDD 3TLXA 5FBLB 4ZCIA 1ZNZA 3N5CA 1IJFA 2C95A 3AEZA 3EA0A 4B3FX 2GZDA 1OFHA 1Z6YA 2JJ1A 4F91B 1XEFA 2O0HA 2HJGA 3THXB 1AQYA 2H8KA 4FW9A 5JI2E 4OQFA 2RAPA 1OYWA 1VG0B 3GLIA 2ZI4A 3ZYCA 1NSFA 2QU8A 3GEEA 2YV5A 2WBLC 3UG7A 1ZM2A 2F1JA 3KDSE 4A8JA 5HKKA 1XTJA 4ZIRB 4B2PA 5AJXA 5DHFA 2WOOA 2I1VB 5FPTA 3I4LA 3I8SA 3VR4A 3LVRE 2IYLD 4PQFA 1T0JB 2LKDA 4HAXA 3WNDA 2IL1A 2PZEA 1OV4A 1QHSA 3BK7A 3CRRA 3ZIAD 2DWQA 5E7IA 3OIYA 1CLUA 2ZRJA 3F0TA 5A5GA 2BMDA 4KFRA 3AVTA 3L43A 5KHOC 2XX3A 2AN9A 4G1UC 1NVUQ 5G3YA 2E87A 3M1IA 2GRJA 4LGMA 3T34A 3SHWA 5JHGB 2VSXA 5JFGA 1CRPA 1IN5A 1LY1A 2Y8EA 4Q21A 5J4HA 4UNSA 4EAQA 1SKYB 1IN8A 4B2IA 4CEHA 2GKSA 3NC0C 1FMLA 1XD8A 1YVDA 2O52A 3CONA 2GAOA 1UADA 4FMCF 2FSIA 1TUEA 2YWFA 3B5JA 2AXPA 2ZRFA 1EFRD 4KYUA 1UKVY 3KQHA 5F9HA 4MA4A 1AIPA 3PVSA 4HLUA 3DKVA 4A6XA 4KJZA 2GJAA 3QUSA 2YWGA 4Q4JA 3RLFA 2IXEA 5FI0B 3X1ZA 1ZM7A 4B48A 1E94E 4BFXA 5EZ5A 4FMCB 2XZPA 1GAJA 1E0SA 4AIIA 4RD1A 1KNXA 4QJ3A 2YWHA 3Q7QA 5B30A 2ZI9A 3AF1A 2YINC 3LXRA 1XDBA 3MJRA 3TRFA 1R0ZA 3B1XA 3KB1A 5AUOB 4B2LA 3GPLA 1IY2A 2PCLA 4KXFB 1FZQA 3NDPA 4TN1A 4BZXA 3W8RA 3LNCA 4C0JA 1LNZA 2DCUA 2WM9B 2JIZA 3EZFA 4LX0A 5J5CA 1U0LA 1XJCA 3E5HA 2F9LA 2JJ8A 4RSGA 4A0FA 5JRJA 1AN0A 4YC7A 1OXVA 3ASZA 2CCKA 2K5UA 4UNRA 3N70A 5CJPA 2WHXA 3LO5A 5LBIA 3SFZA 4M1MA 3FMPB 1OB5A 2IS4A 4YQFA 4S35A 1NMXA 2NQ2C 2J0UB 3NTUA 4NCJA 4DEYA 1CU1A 4C0QC 2HLDD 5D3MA 2MMGA 5IT5A 5DYIA 5CIWA 4BLSA 3SEAA 1XJQA 3TK1A 1G8YA 1W48A 2BBOA 1COWA 2XEXA 1KJZA 2ZSBA 1U8AA 3NXSA 4QOSA 1UBCA 4A2WA 2F1HA 5AWFC 2CHGA 1NF3A 1XPUA 3SBDA 4AYTA 2X8AA 1YR8A 1CBUA 2Z43A 1NL3A 1T3HA 4D26A 3CRMA 3EIHA 3U4QA 1OH7A 4G01B 4EDHA 3DZ8A 3QKRA 5DIFA 2QORA 1WXQA 3H0KA 3WXMA 4IXNA 2A2ZA 2PLFA 2D7CA 1VIYA 4FCWA 3GFPA 4W5HA 4JLVA 4BLOA 3EIQA 2ZIAA 2Z83A 3IEUA 4EUNA 2ORIA 1LF5A 3IHLA 1XZPA 2VLIA 3VKHA 1QHXA 3LDAA 5L3QB 2P65A 4CRWB 3THWA 1XEWY 1Z06A 4OQNA 5AJYA 2ZRBA 2BJVA 2GEDA 5GJVC 1GL6A 4RKFA 5CK4A 2ANBA 2BC9A 3P32A 4Q4AB 5KDDA 2ODWA 1XPOA 1GRRA 4DCUA 1J99A 1MO3A 4XTRA 2GF0A 1KY2A 2BJWA 1J8MF 2ZVPX 4L16A 1ZIPA 2Q0HA 5BN4A 4DLRA 1JR3E 4A4DA 2QQ0A 2IWRA 4BFTA 3K9LA 3KJEA 3QF4A 4LRWA 1A82A 1CTQA 4DHEA 2IS1A 2CK3D 1YJ5A 1G1MA 3GLGB 3K09C 2WZQA 2OM2A 4KCGA 1I2MA 4TL8A 1D2NA 4X8MA 1SVIA 2F9MA 3EWSA 4ZPXA 4GOKA 4HB4A 3FHTA 3NDBB 4US0R 1M34E 2GF9A 2FOLA 4NCKA 3SC3A 3GMTA 2O8BB 2QUZA 4L4UA 1EG7A 1N0UA 3AVQA 1N6LA 1XCPA 3W9YA 4UXHA 3SQWA 4XTCS 3VMFA 3Q72A 3BBPA 2PZGA 2JLRA 3CRVA 3IBGA 4TT3A 3OEHA 1NJFA 4YONB 2OAQ1 4CEJB 2R62A 3MWLA 1XD2B 1VCNA 2QP3A 1RYFA 2B8TA 2QGNA 4JS0A 5DYGA 3AP3A 2ODEA 2FGJA 3HR7A 5L3SB 3HYRA 1G64A 4US2R 1FPMA 1KDTA 1VCMA 3ZVLA 4F93B 2PX0A 1XCGB 1NBMA 2CL7X 2CL0X 1OB2A 5KTYA 1TMKA 2AHOA 4FIDA 3ZDQA 1HURA 3OF5A 4GT1A 2KBEA 2KWIA 1KHTA 1P2TA 2FFHA 3D3QA 3WYGA 3LA6A 1Q57A 1E3MA 4MUAA 4C7OB 5F98A 1WQ1R 2FMXA 2XOKA 1P9NA 1JECA 2OV2A 3QG1A 3QQ5A 3WRXC 4KSBA 1KMQA 2W6IA 5EXTA 4Q4HB 1CJTC 3OIVA 4CGZA 4JLOA 1R6BX 1X8KA 2R6DA 3MAAC 2J46A 3KZ1E 1CJKC 4DLXA 2OEPA 2FZ4A 2J87A 4J0QA 1ZCAA 5K8LA 4DCNA 1DS6A 2FH5B 2GJKA 3DDCA 2HXSA 1E79A 3F3YA 1XPRA 2LKCA 1JQJC 1XCMA 5DNYB 4NE2A 1AQUA 3MRSA 2DR3A 2ZRGA 4AKEA 4O0MA 4Z8XA 2QGZA 1DVRA 1E0KA 1Z6GA 2FGKA 2IYWA 1ETUA 1AKEA 4MRPA 4EPVA 2JJ2D 3IO3A 4RZUA 4DC9A 3QBTA 1DG1G 3VR1A 3LVQE 3TH5A 2IYSA 4GDFA 1L4YA 4PXAA 1UDWA 3K70B 4ZDJA 1TAGA 1U8ZA 1II8B 5UKDA 3CX6A 3R8CA 1RKBA 3EZ2A 3IHWA 3T1OA 1EX6A 4MGYR 1AZSC 3WBKA 5AJVB 4ESHA 3U44A 2QENA 2Q9AA 5FOSA 3K09A 3FFBA 3L8ZA 4IVRA 1SXJE 2WVJA 4FWTA 1E0AA 4QHYA 3MWJA 4QHTA 1ZD1A 1VYTA 4I81A 4IJMA 3RWOA 4R2IA 1M6NA 1R0YA 3B78A 3VNUA 4M53A 4TL7A 4E22A 3GQBA 1N5KA 1WRBA 4DT1A 2AXNA 1VCIA 4ZCLA 4IEEA 3GJ7A 3OE7D 2QSYA 3PEVA 4MITA 2UKDA 1HYQA 4JLNA 3SOPA 3T5GA 1AGRA 2Q9BA 3C14C 3GFOA 1R4AA 3N2EA 8OHMA 4AY2A 5JWOA 1IJEA 1D2EA 1DG3A 4IVPA 1RE0A 1U9IC 2VYFA 3GLIB 3C5CA 1F3OA 1SULA 1E2MA 2QPAA 4Q7JB 5G40A 4ABYA 1IN4A 4DLWA 1XXHE 1NN1A 2OO7A 3KQLA 3IEVA 4ARZA 4G5QA 1ANKA 3IIJA 4A8JB 1LS6A 4PHTA 2XJ9A 4HB2A 4LC0A 4Q01A 1XF9A 3QBVA 4Q1CA 1FMJA 1J2JA 4TLDA 1YZTA 1GWNA 3LQRA 2FN4A 3RS4A 2KB0A 1W4BA 2PZFA 3KUCA 2JLUA 3W8NA 1BH2A 3WMEA 5FPKA 1CJUC 3FKSD 2W0MA 1A5TA 3RS3A 4ZKDA 2EWWA 2F3TA 2JLVA 4B3CA 2FPKA 3GJ8A 4EKDA 3OIWA 4JLAA 1XTSA 1YHNA 4MRNA 2EFDB 3RRMA 4CVNA 3SJZA 4WBSA 1E69A 3C41J 4DLZA 4XWKA 2HYIC 1FUUA 4M1OA 1T8TA 3B1YA 3KTAA 4CEIA 1XMJA 4LSGA 1P2UA 4W5JA 3O8RA 2EQBA 4IXMA 1GKUB 2H7VA 4DEXA 2ZYUX 5AJZA 4LJ5A 4CEHB 3ZVMA 4WOPA 1GOTA 5HCIA 4A15A 1CXZA 1LS1A 4G5SA 3F8TA 4RJLA 4V03A 1E1QD 3CF0A 2YC4C 3EZ9A 4MH0R 3TVTA 3ZVRA 4TL6A 1G7TA 1M7GA 2NO0A 3K0EA 4PC3A 4TMXA 2ZYWX 1R10A 1AZTA 1EX7A 1M2OB 1MO4A 1WB9A 3NBZC 4HLQB 2QP9X 3PQCA 3UG6A 4B3DA 1ESNA 4Q4JB 4QXAA 1UKEA 2XSZA 1Z0KA 4R2HA 1U99A 3RYTC 4BQSA 4HDQB 4ZI2A 1QHHA 2WAXA 3AKCA 4M9QA 1RRCA 3C15C 5CDFE 1ESMA 3BWDD 2YJTD 3KJHA 4LV6A 3RVBA 5JJIA 2IF0A 5L3VA 4Q66C 4OQLA 2V1UA 3QI2A 2CHVA 2C99A 2NZJA 2O8CA 2ZUCA 4KFTA 3IDQA 4M9XA 4M9SA 4Q4LA 2HT1A 1G21E 4RKEA 2VP5A 2ZUBA 4Q9KA 3W90A 1HE8B 4UNNA 5EP1A 1OXXK 4IVQA 3U3MA 3WHLA 1QF9A 4UKDA 1RFLA 4PPFA 1EXMA 4X8OA 1HQCA 2NO6A 4QJ4A 4XVRA 4XVUA 1FX0A 4M1SA 1Z08A 2OBLA 3CO5A 4TSFA 3SE0A 3FOZA 3LBHA 4M22A 4B35A 1R5NA 1U9IA 2BEKA 1ZC4A 1A2KC 4JKYA 5D3MB 2NIPA 1PLJA 5EUMA 1W0JD 4V0LA 4P0TA 4ZDKA 2ZXUA 1GRNA 1KI4A 4LJYA 3X1WA 2Q9CA 4JLPA 2XZLA 2X19A 1FOEB 1ZVQA 2GVZC 5FBRB 1VMAA 3B82A 3RAPR 5HE8A 4JLJA 1MH1A 1P5ZB 4ACBA 2HYDA 2W6JD 1BS1A 2ZE8A 3U4QB 3CWQA 4TMKA 4AK9A 2ERYA 3QKRB 4KSCA 3D7MA 1PZNA 2VTKA 4WA7A 3KKMA 4M21A 2CVHA 5JS7A 1AS2A 4OQMA 3RS2A 2QBYA 2QN6A 2H17A 2ZE7A 1BO6A 5BWMA 3SS8A 4BFVA 2WTUA 1OYYA 4D81A 4F92B 5FL3A 3HU2A 3PV0A 1ZC3A 4OI2A 5DN6A 5B64A 4RFVA 1GUAA 3THWB 2VH5R 2O0KA 2MSCB 1AS3A 1DAHA 3ND8A 4TLEA 2NO7A 1W2GA 2VHQA 4OHYA 2DWOA 3IPYA 2GXUA 3BS4A 4OBEA 3KQUA 5F3WB 4CT5A 5IHPA 4M2LA 1NSTA 4NH0A 3EG5A 5KDLA 5SZHB 2IUSA 1I2DA 2FWRA 3OAAA 4V0ME 4WIAA 5EXPA 1CP2A 3SJAA 3W3ZB 4AKIA 2CE2X 1D9ZA 4PSAA 1W0KD 2JEOA 3QF4B 1B23P 3U5ZB 1JEDA 3K9GA 2ORVA 3BB4A 4DLSA 2VHCA 4YXWA 4F4JA 2IYRA 4L9SA 3T61A 3H1TA 4K46A 2IS6A 5E95A 1M74A 2WPDA 3EAQA 1I4LD 4BLRA 3EIEA 3OAAD 2OZEA 3SI7A 4YMUA 4WXRA 1UAAA 3ONWA 1E32A 1SZPA 3QXCA 4BFZA 1J7KA 1ZM9A 3JVUA 2L0XA 4BLTA 3T1TA 2V7QD 1U0JA 1UEIA 2RGBA 3TQFA 4HI0E 5GVSA 4DDTA 3KX2A 3MD0A 1XMIA 4XOIA 5KNDA 1C4OA 3QPWA 3U61B 1VYUA 1XP8A 3CM0A 1QZXA 3DEFA 4L5BA 4Z8YA 5KU1A 3L0SA 5E7MA 4LJAA 3OZXA 4PHGA 2JLZA 3I32A 1MRSA 4LBVA 3B2EA 2XNSA 3MUFA 3TIFA 1OKKA 2VSFA 2ZUDA 4RD0A 3ND9A 4P4TA 2KJQA 1NVXQ 4PSVA 821PA 1GTVA 2HCBA 1WBDA 2ZETA 1RZ3A 2GZAA 5EE9A 3B1VA 2IEYA 2QMHA 2BM1A 2OUKA 1O87A 4JLBA 3I73A 4LJ7A 4NYJR 2QT1A 3UPUA 3K0CC 1XTQA 2VSOA 3TSWA 4MKGA 5CLLA 3U6BA 1RC8A 4LYAA 2NO9A 2GEVA 2X2EA 1G8FA 1SKYE 2RH5A 2XTZA 2ODBA 1DAEA 5EQTA 1LTQA 2P6NA 3EC1A 1G4UR 1G5PA 1JPNA 2PLRA 4JVMA 1J90A 4O3MA 4DCTA 5HZHA 1XTRA 4WZ6A 3DKPA 3NHBA 5L3RA 2QSZA 3PUYA 5FH9A 3K0AA 1F2TA 5B58C 3LW8A 4OHWA 1IY1A 3PUWA 1KO7A 2QA5A 2MSDB 3K0FA 3Q5EA 1NVVR 4RD4A 2DHRA 3EW9A 4A0RA 2EWVA 1R5BA 1E2IA 4NMMA 1FP6A 3SR0A 1AM4D 2ZM5A 1VG9B 4URXR 1G19A 3GD7A 1Y3AA 2E1RA 2I4IA 3KKNA 4PAQA 1QDEA 1VECA 4HAVA 4YMSA 4L8GA 4Q9JA 4AI6A 1YZLA 4MYCA 1H8ED 2ZJZA 2XNDA 2ZS8A 2J1LA 2RGDA 2J7KA 3UK6A 1S1CA 2WJHA 2WV9A 3VQTA 3FVQA 2Z6VA 2OBMA 2EYUA 2ZRHA 3AKDA 5DO9A 2CLCX 4EFNA 2PJRA 3T1VA 1FFHA 4BRUA 1G20E 4IRUB 4RY2A 4B33A 4WXPA 4EIWA 3HPQA 1A1VA 4Q02A 1L4UA 3EPHA 1M7HA 4OQXA 3I92A 3U44B 2ONKA 2ZI7A 3PEWA 1SQ5A 2IYYA 2H18A 1MOZA 4PTLA 3RHFA 2BM0A 2FEMA 2W83A 3L8YA 3MMPA 3R9XA 2J7PD 4UQOA 3W5JA 1U8YA 1EESA 2LWIA 2TMKA 4PC6A 4TMVA 3VU9A 5FBQB 4LHXA 2PH1A 1UF9A 2WKPA 1NIJA 4GBMA 4CDGA 4DT1B 4JL5A 4ZKEA 3X1YA 4C9BA 3I61A 4PC1A 4Z54A 2DFKB 4R98A 2CBZA 2OAP1 4JLDA 2R6GA 5TV2A 2ZAMA 1TADA 1TEXA 2V8OA 3ZIAA 4U5XA 4CT4B 3REFA 3AP2A 4LC1A 1N6OA 4CYMA 3CRQA 1W5TA 3AUXA 1AK2A 4HAWA 2OXCA 4JYBA 2C9YA 1W47A 1Z8FA 1VTKA 5AUPB 2HUPA 4EPYA 4ARZB 1GM5A 3DPUA 1HH4A 1M7BA 4BASA 1N5JA 4PQYA 1BOFA 2BCGY 2PEZA 2YC2C 4C0LA 1N6KA 2OT3B 2QM8A 2WMNB 3NG1A 1QVRA 3LY5A 1OT3A 1X3SA 1XB2A 1NN5A 4X8HA 4UNQA 5FR2A 4C3ZA 3A1SA 3K0CA 4Q03A 3R8FA 3AVOA 3P1JA 4QM6A 3AH8A 1HT2E 1OH8A 1HE1C 5CYPA 4JMPA 2C96A 1ZP6A 4RZXA 1EFRA 1XZQA 4FD2A 5FTJA 1MABA 1BKDR 1E4YA 2O8DA 1GRQA 1KI1A 2N46A 1QHIA 3BE4A 3FB4A 4LYJA 2XZOA 3GLFA 2GXQA 4Q00A 4QBFA 5GJBA 2A78A 1HY3A 5BQ5A 1TQ4A 5FUXA 1ONBA 3KTAB 1DEKA 3SYKA 3V4FA 1Z0FA 1KI7A 2E9SA 1AS0A 4CEIB 5G3ZA 3CRW1 3GLGE 2IK8A 4I1SA
chains in the Genus database with same CATH superfamily
1PJTA 4GBED 5CYOA 5GM1A 3W8FA 2JFOA 4Z7NB 4U63A 1E58A 3JS5A 3SX4A 4OF4A 4L51A 1IQPA 3LF2A 4FC7A 2QJTA 1Q1EA 4ARCA 1S01A 3AY7A 2ZYRA 5T7BA 2ZTHA 3RSOA 1JPJA 1ELOA 2VA9A 3SFTA 3CNNA 1ZW6A 3VR4H 5JS2A 2IYUA 1MZVA 3F9RA 1CZRA 3EH1A 1VG8A 3HKEA 4LKOA 5ALOA 4CMGA 5EMLA 3LDFA 3A3OA 3NXKA 2ZVQX 4L6CA 4EENA 2X3UA 2ZDQA 1UFOA 4MGKR 4PICA 4RO0A 2UYOA 5JE8A 2DUUA 1M3SA 3A1VA 1L8OA 1NAIA 3VH2A 2JIPA 5DTRA 2HRZA 5FPSA 1R5OA 4PG7A 2PG3A 3ULKA 2ZPTX 4Q4DA 1UMBA 2V5UA 2FZCA 3ABZA 5K0ZA 4MAAA 1KDOA 2R00C 1UBOS 4PO8A 1V26A 4K6MA 9LDTA 4E09A 4U7FA 5ER6A 5JPDA 4ZWNA 4XCQA 5EIWA 4FW8A 2BR4A 2O8VA 2OP0A 4WKGA 5TNXA 1X1TA 2PUTA 4P53A 3S55A 1VLMA 4KDFA 1E9BA 1LQUA 4NKRA 4RABA 3BD9A 3SDSA 3K16A 3O8DA 3EE6A 5DBFA 3R5KA 1GPLA 2AMFA 3H2IA 2QLMA 3ROGA 2JGDA 4HDCA 1N32B 3RNLA 2IE8A 1FX0B 1WDLA 2C2XA 1DNPA 3ONFA 1GU7A 2Q1UA 3KXKA 4MUFA 1OVGA 2QAGC 5F78A 4LI0A 3I83A 3IR7A 1RJEA 4MVJI 5KI6A 1B1CA 1TF5A 1C30B 3LFTA 4R05A 1G5IA 3EZ7A 3HXTA 2C4UA 2CDCA 1TM2A 3WJ1A 2VXBA 4QSHA 3WICA 1QYRA 2WJGA 5BW6B 1ZI8A 1Y33E 2R44A 1JU4A 1T1EA 1T9CA 2RAUA 3EYAA 4GP6A 4LQDA 4QBIA 5IDVA 3R6WA 5ICCA 5KSZA 1CQPA 3OSZA 1UR5A 1KSFX 4PZLA 1YJ8A 5AXCA 4IIEA 3COZA 3PD0A 4QBGB 4E2YA 3TBKA 1VFNA 2ZB3A 3ED1A 3WLIA 2WD8A 3AERB 4EGFA 3CKMA 1MBZA 1BGVA 2NYUA 4X1KB 1PFKA 2VHEA 1T0PA 1NP6A 3PZRA 1NW8A 4LQCA 1TZBA 3ZVNA 3BSFA 3K0HA 3RSCA 1OWLA 1OXTA 1ZRSA 1V16B 2EP5A 2W43A 2EFHB 3B51X 2FEAA 1BJRE 3OKAA 4J94A 4ZFNA 4TROA 4NICA 2CK3A 3WGUA 2C42A 1EIWA 4JI6B 3QLUA 1MVLA 4UAGA 2AIRA 4UEOA 4MDHA 5LDGA 1JJFA 1EDOA 1M5RA 1NURA 1GZ5A 5IVKA 1E1RD 3SJBA 1OF1A 1E20A 2GN0A 2YCBA 5EJ9A 1V7ZA 2QD1A 3CNLA 2DU8A 2HZBA 1BMFD 4CM1A 1W1UA 2PPLA 3VR3D 4G0UA 1W30A 2JIMA 4PX2A 5C7LO 1GGMA 1OT5A 3KEOA 5SICE 4FFOA 2VHVA 4DB4A 4Z2AA 4JN6B 4KITB 4NOJA 3R75A 3EQ8A 1YR7A 3P52A 4BHTA 4EPTA 2ZRNA 3X1DA 4CM9A 1L4EA 1RAHA 2IEAA 5FI5A 3CKYA 5DDIP 5IX8A 5IYZB 1DJMA 3X2FA 2R6JA 3P9RA 3ZHQA 2HJVA 3EXEB 3F3MA 3B1KA 2DUJA 5JCXA 1A8HA 3B36A 2WFLB 5A9SB 3UY4A 3R3HA 4S1TA 5K8JB 2JZOA 1JNXX 3ASVA 2GD2A 2P6OA 3EWAA 1O95A 4FKMA 2DUWA 1KWGA 1DTEA 1I0ZA 2F43A 4NHOA 3PXCX 1FTWA 1ICIA 2ZYGA 4I9NA 4PINA 4NPHA 2AQ8A 3JQ8A 4RHCA 5HF9A 1NNEA 1FDIA 1SQ0A 1LFDB 2DY0A 4FM9A 3KQSA 3SNKA 1OILA 4BVJA 4OU5A 2G4VA 1YDFA 4AG5A 2P2SA 4OXQA 3S7ZA 4PYRA 4WVFA 1XRLA 5IF9A 1KK3A 1SBCA 4DIMA 2BP7B 1RM3A 2XOEA 2ZAYA 5JIBA 4D4KA 1UJ6A 2V5AA 4TS1A 4YJDA 4GBJA 2VF7A 3FBGA 4BVGA 2HI0A 1CJMA 1THTA 1IM5A 3Q5GA 1CY6A 1Y8QB 3NEYA 1GNPA 1UJCA 2QD4A 3A4NA 3O2QB 3KVRA 1B7GO 3O94A 4F3YA 3P4XA 1N0VC 5BUSA 2Z9BA 2F17A 4YK7A 1T6ZA 5L53A 3JD2A 3C4JA 2JD2A 1KKMA 2X5JO 3IEIA 4OP1A 4KYTA 1ZONA 3ZY4A 1LBHA 4JUAA 2Z5LA 3GLHA 3PXXA 3RDPA 3UHJA 3I8XA 1P17A 2X13A 5D3KA 5H16A 1YL7A 4P3XA 4ANFA 4C0XA 1XRQA 3RARA 5ELMA 1Y42X 4YQEA 4B84A 5AK5A 4FMBB 1RC1A 3PTZA 1L5LA 1CG6A 1GL7A 1IBRA 1QAQA 3HB7A 3OEYA 2R6AA 4JVSB 5TF0A 1N92A 1Z83A 1UAGA 3ZU4A 4QGAA 3S28A 2W93A 1GGKA 1Y3DE 1LW6E 2PAAA 3LK6A 2DOKA 4M6WA 3UNXA 1P2VA 4PSKA 4GOJA 3FTPA 1BU5A 1HOXA 3QEMA 4ODIA 3S3TA 5HKBA 4HQLA 4AYWA 4JOSA 1DJLA 3OCCA 4EPWA 3CO0S 3QHPA 3DAYA 2YIMA 1FUKA 2VDLB 3HA2A 3H9CA 3SKXA 1QIHA 1YCFA 4BNUA 1VL2A 1HDXA 3DC7A 3QOFA 4TX1A 5H1YA 1EZ4A 1R0XA 2ZWOA 3C3YA 5D87A 3QI7A 2XWJI 4GZMA 1P6XA 3BFVA 2YFYA 5ENZA 3ZOKA 4V0OA 1ABEA 2F3PA 3BXFA 2XMGA 4KRFA 3QIAA 1V6AA 3V9PA 2ZR9A 2EFCB 3V5NA 3MAJA 2WJPA 4O33A 2QPOA 3GH3A 4ZK6A 2DPXA 4F3TA 3DAFA 2G28A 3PC7A 2I62A 2ZYTX 2RGNC 4EA7A 3PFHA 4ZI3A 2AOWA 1SCJA 3A6PC 1WLSA 4RTMA 4IG9A 1ECCA 1E0JA 1DADA 1M2JA 1W73A 2IYEA 2WIAA 4HJRA 4QPNA 4YROA 3H84A 1IXZA 5IZ4A 2AJ8A 4URZR 1K6IA 2CLIB 1V7CA 4QNMA 5AR1A 5TQJA 1T1JA 1ZGJA 1TRKA 4RF5A 2Q2WA 1CKEA 5LM3A 4KMRA 1XTTA 1ZHHA 3OE7A 1QQ6A 3MOIA 3MYRA 4J1TC 4N3NA 4EHLA 5DP1A 4RLQA 2Q9UA 3U1BA 5HQJA 1IRIA 2JLSA 1SD2A 4UHJA 1HNNA 1N2IA 3G85A 1TGYA 4AW9A 5I7RA 1M8KA 4N6NA 3OLQA 2WTMA 4M60A 1GG9A 4U7GA 5EJGA 2FCRA 4L78A 2QUBA 2OUIA 3ZZ1A 1T9KA 1TIKA 2G63A 2XTMA 4DMFA 4F4CA 4N8SA 4DE5A 5AIBA 3JQBA 3O2JA 1ZG3A 1GU1A 4FOSA 3GYBA 3O4HA 1G16A 1Z68A 4ZV4A 4B7AA 1HEIA 1M8PA 3N2KA 1BXGB 3VU9B 1ZGZA 2R6FA 5IRCD 3SSNA 2UXBB 3W34A 2L69A 2J41A 2IXDA 4RA6A 4EWLA 4CLDA 3EXG1 3G2IA 2QRNA 2X42A 4DLAA 2TS1A 2AX3A 3I64A 1R66A 4K6OA 1Y4AE 3ADDA 4BZPA 1M0WA 3HVJA 2CL6X 4AMBA 1BE0A 3N2IA 3GQVA 2XMRA 3HG7A 3NX4A 2HXYA 4RMNA 4RSRA 4GOOD 5CA0F 3LW7A 2WJWA 1UOEA 3ZG6A 4DWWA 2BOVA 3A1WA 1ULHA 2BLNA 3CZ9A 3PE6A 4B4VA 5IUJC 4H1UA 4JT9A 4CEIB 4HH0A 5E6SA 2CXPA 1EE9A 1GFWA 3O8BA 4KL8S 3V3TA 1AUVA 1R3DA 1SXGA 1ZNWA 2EF0A 3VR6D 1MT3A 1VLZA 2IYAA 3EDYA 2J0VA 5KOHB 2GBLC 1VPVA 3CB4A 1NASA 3W1EA 5CA0B 3CVXA 4D74A 3HP1A 4JP3A 1E3JA 1MC1A 3HYNA 2HRDA 3B9PA 1QYXA 2KW5A 1KSGA 1EFAA 1KO8A 2EQAA 3A1UA 1PV1A 2YOGA 4MVJD 2AFIB 4DA0A 4I55F 2YIVX 2F8TA 1UT5A 5ESRA 3G82C 4WVLA 5GY7A 1Q16A 2IH5A 2ZU6A 4OXXA 3Q5DA 1LEHA 4K9PA 3UB4A 4FMDF 3QPVA 4OOFA 2Q6OA 3UM9A 1PDVA 3AG5A 4BQIA 3UCEA 5J4YA 4DMCA 4MRAA 2D5LA 2Q1TA 2HQOA 3NH9A 2DMRA 1LPSA 2OHJA 3IQWA 4IWNA 4WECA 1J00A 1VLVA 3I39X 4BMNA 3RSFA 4YCSA 2ZREA 4BV2A 2Q07A 4RPIA 4EI7A 2AZDA 3TECE 3QTTA 4EPRA 3KK0A 2P9ZA 1Q20A 2B2CA 4ZU3A 3N0VA 4D0NA 1K8RA 3H2YA 3GPBA 4LOLA 4NBVA 2IOFK 1DARA 1SXHA 3V8PA 1C8VB 2ZRIA 2QL7A 2Z6UA 1KYTA 2HSDA 1JS1X 5JS1A 1GEGA 5CGZA 1R0WA 1G3QA 2HN9A 3WGIA 3BEOA 2E49A 3VZBA 4UTPA 3VR5H 5ADHA 3L4BA 3AF6A 4DJFC 1FEZA 5F1KA 3HKEB 3E7PA 1QK4A 1P1KA 3GXOA 1TM7E 3MZ0A 5IJ9A 3DV0A 3V4LA 1NXQA 1U94A 2QVBA 4BJ3A 5BWLA 1T2CA 3C8HA 1G41A 3CZQA 2OSVA 1XVLA 1Q91A 1FS6A 2DWUA 4G0YA 2QLBA 4QECA 3DOEA 3D5TA 1L7NA 1X1BA 2DECA 4PWZA 5KVAA 5LCXA 4EBFA 2JLQA 4HAZA 1UMBB 3C3EA 1T4MA 1WIWA 1EAYA 1E7QA 1E89A 5LBUA 1VPLA 1DOZA 4QFBA 4PLGA 5DTQA 4CUKA 1JEAA 3F7OA 3IVRA 4YY3B 1FSPA 5LUAA 4ER7A 3U4GA 7MDHA 1NAHA 5ECGC 1WXDA 3AVVA 4XUCA 2A1IA 4BPBA 4KFSA 4FP9A 3LUKA 3PUHA 4LYFA 4XIIA 5CBPA 5H3HA 1RS0A 1WOMA 4TV9F 4EGQA 1COZA 3FDZA 3PENA 4L72A 3GNLA 4YRCA 1OSNA 2JGDB 2IC5A 3JZDA 4OI0A 2DBRA 4X7PA 2CF5A 1HYBA 5MGBA 1H6AA 3S8EA 1M8FA 1L7RA 4TMWA 1N7GA 1Z4NA 1J0BA 2WWVD 3U13A 4D5GA 2E5LB 1MNQA 1U1FA 1U6KA 4LY9A 2QDKA 3KKPA 5HKLA 3SY8A 3ESQA 2JLWA 4I46A 2RHWA 2M1XA 1BX0A 1DIRA 2B21A 3TRIA 3QZUA 3EWNA 3IBYA 3UOWA 3CPEA 2ORWA 3DWEX 4RANA 4B6JA 1K86A 721PA 2LGJA 3UMCA 3V8QA 2VJDA 3ESDA 3GUUA 3NKLA 3OQBA 3TTTA 1GV0A 3WQHA 3WFZA 4D8VA 1Z7GA 4XRGA 1R8XA 1DZIA 1JBKA 2FXIA 1FC0A 4INOA 4QKQA 2VRCD 3MGAA 5GPBA 1ZCJA 2IITA 1BXKA 4NZMA 2A0XA 1ETHA 2XEDA 4YRBA 4G0QA 1Z4QA 3RADC 1T6NA 3UCFA 1G7CA 4X63A 1P1FA 3LX5A 3TIGA 3K71B 1OC2A 4Y6GB 4AIRA 2HA7A 2FF7A 3FBTA 1UP7A 2GCIA 1R4ZA 5DXJA 2VOJA 2P9EA 1Y81A 1ZJ5A 4ZJUA 1QAMA 4IJKA 4RPJA 2J3LA 3TKYA 3IESA 1JHXA 1TUIA 2FPLA 2J0EA 2Z5FA 2QQGA 2OV4A 4KN9S 5FOQA 5HJEA 1TM3E 3EOZA 4JXKA 1Q6ZA 4Y2UA 2VG8A 4PGAA 4RV5A 3KYDA 9GPBA 4EUSA 5M04A 3FR8A 3AJDA 1E1MA 2O1EA 3EZLA 3FB1A 3MGBA 4KB5A 5HF5A 1CUXA 1UM8A 1D4AA 2Q29A 3MHPA 4KQEA 4K8RB 2AMJA 2OZKA 3OX4A 1F17A 1NW3A 4OMUA 3IQXA 4IS2A 2DB3A 4B9EA 1RXIA 2JI9A 4HQNA 1WY7A 3B9QA 5B3AA 5JDCA 1TTTA 5D3QA 1NIPA 2O6LA 3O7WA 3G8BA 4L0QA 2XODA 2HU7A 1BGXT 4HMPA 4J9VA 1NA5A 3T1YB 2CJWB 2Y67A 4ZV7A 1RKXA 2HMYB 3EZNA 3K9CA 1A5BB 1ISPA 5KSYA 2AC2A 2MSLA 3WKAA 4Q7LA 5EZYA 3B8HA 1X7YA 3R4VA 3G5TA 1AKTA 3EQZA 3DHEA 3CVYA 3F9CA 2F43B 3NV7A 1XAGA 4FYYA 2IT1A 3WWCA 2QN2A 3U37A 1K5HA 2V97A 3JQ8B 5AVTA 3HDTA 4DCSA 1B00A 1OA0A 2CVPA 3A9RA 3GJ3A 3V1TC 4ZRMA 3I04A 3D2LA 5B12A 3FOWA 2HKIA 4KQWA 3E1KA 4NMXB 2RD2A 3C1TA 5AK0A 3BCHA 3H8VA 3M4XA 5B1SA 3OLWA 3ES9A 3L84A 4NVRA 4PLFA 4BGEA 1L5VA 2CJXA 1E2PA 4XW2A 1J5XA 3PIIA 5AT1A 4FC6A 2A7QA 3FNBA 1TNDA 1IXYA 5HR5A 3L02A 5F23A 2QX4A 3IELA 4WUTA 2AD1A 2IZ5A 3IMKA 4G09A 4FHDA 4CMHA 2XQKA 1N6HA 3N8KA 1JAZA 4JZKA 5FI1B 1T2NA 3A3PA 4ZO7A 5IWCA 1S8FA 4YJ3F 3LC7O 3NCHA 5ALEA 4DV7B 2GUWA 3FNGA 5LQMA 3H8WA 3LOQA 2X9GA 3GLHB 4OQ4A 2GYWA 2O2CA 3IX7A 4ZT7A 3OTGA 1SBNE 5CB4F 1JPVA 1FZTA 2NTJA 2BL4A 1Z5VA 4Z0PA 5HFAA 1BE8A 2GBCA 2HU5A 2PCJA 5BNFA 3DBHA 3RQIA 1OI4A 1RT9A 4L9RA 2VJOA 3LLUA 1XROA 4C04A 5AM3A 1X0VA 2Z2JA 3CQ9A 1SGWA 3LQQA 1HQYE 1UZUA 2VFAA 4M6WB 4V02A 2ODPA 1DEAA 3MLBA 1GGFA 4PGMA 1J2RA 3QEMB 2O2ZA 2AQIA 1JLKA 3MWYW 4WGFA 5AVXA 5KWIA 1XZKA 2RSLA 2XMPA 3WB1A 5C8XA 2PSDA 5JYEA 2BM8A 3MT0A 1HTWA 2ZTVA 3ILVA 3W2TA 4EZIA 5F1YA 4ZHQA 2ETVA 1YVPA 3E27A 3T95A 3FG9A 1F1JA 4TRJA 3FLBA 1Z16A 2V6GA 3FYUA 1RHRA 3G2QA 4HAYA 3SHFA 3BGVA 3Q7PA 3RC9A 1MPTA 2H1SA 2NPIA 1ZIYA 1ENPA 1H85A 1WKVA 1DQZA 1GPUA 2IEZA 2ZATA 1VIMA 2L42A 1E2HA 3FVWA 3LX8A 2LW7A 4U7JA 4UHBA 3T52A 1H65A 2O0JA 2J7PA 4HGRA 4DDVA 5BP7A 2LDXA 1O8CA 2ZYVX 5E3IA 4BNJA 2PS3A 2WWIA 1O89A 2IVZA 3E7FA 3AETA 3ZZ0A 3GR6A 1Y8ZA 3ORRA 1Z5WA 2D06A 3M34A 3H83A 4JB8A 4INAA 3O74A 3NZEA 3ZH2A 2ZAIA 1N1EA 3EXAA 2VO1A 1ATIA 1SHTX 1T3SA 2WG2A 3KL2A 3OLXA 5CDHA 2QRLA 3KWFA 2VBGA 5EP2A 4GZ3A 1QNFA 1KJNA 5G53C 2N9UA 4B3XA 4YECA 5CT9A 4DKJA 4NG5A 2OGZA 4L7QA 2R0QC 4Q3CA 4Z4IA 3K53A 1SHZA 5YASA 1CF4A 4BIMA 3H4IA 5MGNA 2LZ0A 1JHAA 1Y3BE 4XWGA 4AZ0B 3VPCA 4YMWA 1AMOA 5AVVA 4MTLA 2C8KA 5LIRA 5HK9A 2VQEB 4HATA 4N5MA 3QU5A 1CR1A 3KFVA 5C2JB 3IAM1 3KSUA 1BXRA 5JADA 4B6QA 4B3IA 4XIFA 1T9BA 3F2IA 4MKIA 4CF7A 1C8BA 3GJ4A 2YMPA 1RRGA 1GZSA 3K70D 4F3NA 3RIHA 1F12A 5LKRA 2ZS9A 1NJSA 3N2KB 3VM6A 3EX7C 1N3IA 1Z3CA 3ZDXB 3WGVA 1DJQA 3QSYA 4RA6B 1YB6A 5DGIA 1DAKA 5ADUS 1QRRA 1R37A 3P26A 8GPBA 3ZW7A 2HBZA 1XNJA 1CULC 3GNTA 1GUZA 1JHMA 3IQHX 4B3RB 4II7A 1ZD3A 4GLLA 2R1TA 3O4VA 1XMVA 2B82A 1IZ9A 3OKPA 3RNOA 1JR3D 4RMJA 4X3PA 3ROMA 3GDWA 1JALA 5DM0A 3BZUA 4INJA 3MCAA 4FB4A 1ORTA 4JJ8A 2HIAA 1ODIA 1K3UB 3KVOA 5DT9A 4E2FA 1EE2A 1KP3A 1T9GS 5E6SB 2R751 3LLMA 3VMMA 3E4DA 3QUQA 1IC6A 4QZVA 4AKHA 1F48A 4K9OA 3ZDFA 4CNBA 3CLTC 3QWFA 3LH5A 5ICMA 2IDMA 4QGHA 4OO3A 2P3OA 4Y6QA 5KNCA 2FX5A 4MWEA 5CEEA 3PEEA 3M4NA 1LBEA 2XRYA 2IPXA 3BHJA 3J7TA 3NOVA 3PC2A 4FGWA 2VDRB 2ID8A 4JBWA 4EHJA 3EK2A 2J09A 5LWHA 2IHNA 1Z22A 2H92A 3MWGA 3QWHA 3ZHZA 1KZGB 3CX8A 3FOBA 1VKZA 1DO8A 2G77B 4OAPA 4UUMA 5CXQA 2LRHA 4G3XA 1JKXA 4P93A 1NI3A 1UXOA 4X20A 5JAMA 1PQ4A 4CL3A 2FZGA 1DAIA 2BEJA 2ZSHA 4LHZA 2RGWA 4NX2A 2V3CC 2JAQA 5D5QA 4O25A 3T5PA 1S0UA 1L4KA 3T3IA 2BTQA 2YVAA 3JASA 4C0AC 3NOQA 1TQ2A 1PR9A 1YB4A 4TKZA 4BQRA 4MW5A 3EPKA 1KQFA 2QZ9A 3B13B 3FZEA 1RBQA 2AMVA 2ZJBA 3GT3A 1R0KA 1LPOA 5DFAA 1JJIA 1TO1E 3UV6A 3ACBA 3QHQA 1MB0A 3S0JA 4CFZA 1XK7A 4JJGA 1DBWA 2IP4A 3ELUA 3OJXA 4ZO8A 1B8NA 1USKA 1ODSA 1LSSA 3QE3A 2OMEA 2G1JA 3BF7A 1NR1A 1VCOA 3HSYA 1E2DA 3IJRA 1OLOA 5IWAB 2B92A 4RH3A 4ZPJA 2WVHA 4HUTA 5E4FA 1ZK4A 3T5DA 3CF4G 3ESYA 5A0FA 5IJ9B 2HJWA 2VTEA 2OQ2A 2G5CA 2SKEA 1EFLA 1OZFA 1YCGA 2C8VA 3DV0B 3HA7A 4HDSA 1P9WA 1GL3A 4G97A 3T5CA 3UMJA 2CB9A 3M5CA 4ZQFA 5IC5A 1SR8A 3EVCA 4I1RA 1TZ2A 5ANRB 3NHAA 1FPQA 4ZU6X 4UDXX 1V5WA 5K8TA 1I3CA 1X7DA 2IYFA 1I4EB 3ONNA 5CPBA 3WRWA 3PI6A 3BT7A 1J4AA 1U9ZA 4B46A 1FQJA 1I7NA 2G40A 2FFRA 2R6CA 3A37A 3OZEA 1GTRA 1I36A 2YN0A 2VK1A 4TMYA 5CLGA 1H5QA 3ZWXA 5CBPB 4RU1A 2GJSA 4GD3Q 1P0MA 1PW7A 2YJ3A 5T3UA 2FVXA 3FDZB 5K99A 3L05A 2R8YA 4OGFA 4P4SA 5DJ5A 5LYYA 4E07A 2QX6A 2ZQ5A 2QLJA 4G0NA 1PT5A 1WCWA 4WN3A 1XMPA 4D3XA 1AC5A 2BWJA 2JVKA 5LLTA 1L7BA 1CUDA 4TYYA 1E96A 4IFEA 2SHKA 3I5UA 2YQ5A 4M8KA 1TO6A 1Z7EA 5L95A 2HLPA 4JT4A 1AUQA 5ENDA 9LDBA 1VFPA 3GZTB 1MV5A 3KPWA 1IE3A 1S3IA 4LZAA 3LPDA 3V1NA 1FF9A 3CH4B 3DUWA 4IF6A 5FTMA 2VYCA 5JNWA 2GR9A 2ICAA 3WAGA 3WLRA 2JIZD 4QXMA 3ZC3A 1SVKA 4HNRA 4EKGA 4GW3A 1ULTA 3SIPA 4CZ2A 1IXRC 3I37X 5BN3A 3GJSA 2ZYDA 3A7DA 2OOKA 3N6XA 3R6TA 1LQTA 2XCOA 2XQVA 4JWTA 1N78A 1YI0A 3AO0B 1V35A 3G8YA 2NG1A 1XJ0A 1YHZA 2BMVA 4D57A 3THYA 1XXHA 4DQKA 1J24A 2XAUA 1O9HA 3A36A 4D4HA 1P7WA 3R9IA 5B4VA 3QH4A 5EJ2A 2H1OA 2HTEA 5HMLA 1ONPA 1Q3TA 2P9QA 5TY0A 5HKAA 3AY3A 1QBGA 3UWMA 2GK7A 1JBEA 3BN3A 1F0PA 2BRUA 1S3GA 2PK3A 5KWVA 2CXOA 2VJPA 3VPHA 2V7BA 3AF4A 4OIFA 2H1CA 5TEWA 1K8XB 1MX1A 1NGSA 2ACEA 2VXOA 1LDEA 3M3DA 1T15A 3ZE2B 2JF0A 1KYQA 1ZIXA 4IDDA 4Q9AA 4JY7A 4HVCA 621PA 1WMDA 3KYDB 4BMPB 4JVLA 4C7JA 1MT0A 3TZCA 2ZUFA 1MEOA 1YTUA 2BCEA 2FTKE 3HO6A 4A2CA 2HF9A 1O5TA 4IXWA 2O7QA 5EIXA 1UZNA 1HL3A 3RPEA 2BCJQ 1OAAA 4W7SA 1YACA 1KU0A 2WDPA 5PGMA 3NM6B 1RQRA 3II6X 3LECA 2REQA 3LCJA 3LXXA 1VJTA 2EKZA 2ZITA 4YAFA 3GCDA 2OC4A 1YRQA 3G17A 3MTDA 4GPEA 1JEYA 4HPJB 4BE7B 1L3BA 4R40A 1SVUA 4XUEA 5EZYB 4EHAA 1L1QA 5J4LA 4Y30A 1X7YB 3WADA 1MO6A 3GVPA 3FVVA 3T3EA 1YOBA 2GN2A 2PX4A 3FTDA 4MYUA 2FPSA 3KUUA 2RDMA 2AN3A 4YRIA 1B6RA 1YQ9A 3RS7A 3U3XA 2DE0X 2YDXA 3QEAZ 1E2GA 3HN6A 1V3UA 4B6EA 2QR5A 4A36A 2IW3A 5F3RA 2PXCA 3VSBA 4RY9A 3WIDA 4CM6A 4AJKA 4MRMA 4GSLA 1GPYA 1Z07A 4N4AA 2FRVA 3H6KA 5JJLA 4XGKA 4M1KA 2ZUSA 4W5RA 2FSVC 3DQZA 3TJZA 3A6JA 5HQTA 3UPDA 2HK7A 1GN9A 3WGYA 2HPHA 3SK0A 4C0KA 5FBVB 1JR6A 3DGEC 1IZ8A 3WYCA 3GLFE 1JIUA 2R8PA 2FEWB 3T94A 4D6PA 3JARA 2WYWA 4OHBA 4TT3D 1YNOA 4UMDA 1BDHA 2FN7A 4RY8A 1ZOSA 2B37A 3DBHB 3MT9A 4S12A 4ZHQF 5BV7A 4IM7A 4PC2A 5IF3A 4OI1A 4IMRA 3FTEA 1MLDA 4HQOA 3KQNA 2X1HA 1W8DA 1X7HA 2D2EA 1CIJA 1LU9A 5M34A 5AH0A 5B3JA 2ATCA 2DUNA 3HV0A 3T35A 2F64A 2ZJ2A 1T0HB 2VHJA 3Q0IA 4PPNA 2ECQA 1G8PA 1H8HA 2A5DA 4LHSA 5JWHA 3WB0A 1MQAA 4C07A 1ZM3A 2B7LA 3INYA 3HBAA 4HYYA 4I1OA 4I4NA 1TCUA 1R9GA 4ZHQB 3AJRA 1NNI1 2NQTA 4R1OA 2OCBA 5C1IA 3B6IA 4LF8B 2RBKA 3FWNA 1YI8A 3FYUB 1NVVQ 4NECA 1YIAA 2EP7A 4IUYA 1SVLA 1VIAA 2DQYA 2QEQA 5LN1A 1Z4KA 3ZVKA 2XGJA 5J47A 1KEZA 3CTPA 4R9VA 2J5BA 1U7HA 2AJDA 3A6LA 2XOKD 2XUIA 4B3SB 1I30A 2V54A 1UBUS 5K20A 1N75A 1PK9A 3REQA 3ZS8A 1DDOA 2W6ID 1X38A 4PG8A 4ZOLA 5WRFA 4IIHA 1NQUA 5KHAA 1MIOA 4NAVA 3TQCA 2W71A 3ITNA 3FTCA 4PFJA 3W5CA 2Q7DA 3AETB 5CVCA 1QO0A 5TXGA 1BQ4A 2Z04A 3JYQA 1JG4A 2GAAA 1ZH6A 1QYDA 4MIOA 3ZHOA 5KMGA 4B79A 2WKSA 4UEWA 1I6KA 1W46A 2W2PA 1KXZA 2YJ5A 2IPMA 2XCTB 2LIVA 2X7HA 3F4KA 1NV9A 1MG0A 3SXUA 1NRJB 4UQLA 1KC3A 4BO5A 1NVFA 1ZI9A 1U90A 3ZU3A 4CU5A 3VV2A 4BGUA 4H35A 4E31A 3BDIA 4C0BA 1ISJA 1OXSC 1NVDA 1LKZA 4OHCA 2C7RA 4G8BA 5ALHA 4BO6A 3GELA 3M83A 3A28A 5H80A 5LJLA 4EY5A 4LF6B 1EGVB 1BXRB 5TF4A 3BMOA 3L06A 1U0GA 4KR0A 4G23A 1NY5A 4X6XA 1PR6A 2Q8NA 5EPUA 1YFZA 3RABA 2P9YA 4JUBA 2C7QA 3UJ9A 3GU3A 1ADFA 1S9DA 1T3LA 2ZULA 2XF8A 4LHYA 3A4MA 5CFMA 2C59A 3VC3A 4RVGA 1GDDA 4Q5IA 3S70A 1N36B 1N3BA 4CGYA 2BI8A 4NNPA 1RHUA 5C35A 3JVIA 4RPCA 1O6CA 4GVPA 4DLYA 2HCFA 1SC3A 2JDIA 3DT9A 1QHYA 4CHTA 1SG6A 1LF0A 2ISQA 2R1TB 4RK6A 5A02A 2UYCA 4ENSA 2R96A 2JLYA 2CVQA 2HNAA 3QELA 1P91A 1WG8A 2REXB 3F5SA 4UZSA 4OREX 3HFJA 3T3HA 1A50B 4MGZR 3ZXUB 5KBYA 3JATA 3I1JA 5C5DA 2EW8A 4CTOA 4DG9A 3ECCA 2OVBA 1V8FA 2WTBA 4FYPA 5CT8A 1U28C 5KINB 4G56A 2I6SA 3HCOA 5C7IO 2O8NA 2WYVA 4JC0A 4YO8A 4EA9A 3HWSA 2UZ3A 1PS8A 4YACA 1V4VA 1XLVA 3V1LA 5SZJA 5C4MA 4HVTA 1BWSA 1PGQA 8LDHA 4WW0A 2PJZA 2ZCVA 1U2PA 3S27A 3TOSA 1IAQA 1IJBA 1W1IA 3LWZA 4LXQA 3ITDA 4P4LA 2DWCA 2YYYA 2M98A 4Y7DA 4MP8A 2JGEA 4P33A 4Q1DA 2CFTA 1QKJA 4X20B 1JQAA 5CCBA 1J39A 4BPRA 3L79A 2YHSA 3GRFA 4MQBA 5J5AA 3C5WP 1JHYA 1WEHA 3ICOA 1DIHA 2BTQB 3AUKA 3ICVA 3G6WA 3JASB 3E2MA 3GMSA 3IJEB 3VTKA 4DSZA 2G25A 5DYYA 4FSXA 4QX6A 3W7BA 3U81A 3PWSA 4LBZA 3PQ3A 2XUZA 1RWXA 4JBHA 5F77A 4H4EA 2NMVA 3BXZA 2NZ2A 2VPTA 1V48A 4GO1A 4P3YA 3SEFA 4EITA 3ABSB 4JI0B 3F4BA 5KO2A 4QGFA 3RRNA 1FBNA 3AX6A 4Z3KA 3CVUA 3GJ5A 2MYTA 2IGTA 4NCIA 3NONA 5J59A 4RGYA 2XVYA 5AHKA 2NZ8A 3A06A 1WDMA 4Q1AA 1ESEA 1TLFA 1PYGA 5CVVA 5F4BA 1E8MA 1Q0UA 2P9GA 3HJUA 3RUHA 1IU9A 5D86A 4HWTA 4L74A 4DS3A 3GZNA 1DC5A 1RM4A 1CC1S 3OHMA 2RH8A 5CB6A 3S29A 2IZ0A 2JAWA 1LA2A 1KOLA 4M46A 3BORA 1DSSG 4B0OA 4HDSB 2GZ3A 1OH6A 2IRWA 3FYSA 5JZMA 4URUR 3VAZA 1II0A 5KZMB 4QARA 5EOVA 2AN1A 1OROA 1XFAA 3JYNA 2VSQA 1BA3A 3U60B 4EJ2A 2IWHA 3UHPA 4YA6A 1CY4A 4JHXA 1PJSA 4EVSA 1A98A 1Z5OA 3O1LA 4PNZA 1EDBA 5GONF 5FL7A 3GDOA 3RIXA 3BWBA 3TLCA 4E5YA 5IASA 1M8GA 1RIFA 3ITKA 1KI2A 2QTHA 4KU4A 3SYMA 5JD5A 1KZYC 4ZVUA 1CIVA 3D0QA 1XJWA 2XMSA 2G6TA 3B7WA 3R9KA 3NC1C 3DM9B 2OCGA 1GA6A 4Q9NA 2C4VA 3GFTA 3KKQA 4KIJA 3TUIC 1P2SA 2C1ZA 1U4OA 4P4SB 4TLBA 4H6VA 3UUGA 3PGKA 4G9EA 2IHTA 4CN9A 5E7JA 2GAFA 4F45A 3BRWA 2O07A 1G9XA 2YZKA 4WDQA 1NW9B 3ODPA 5EE5B 1DRKA 1GZDA 5JT1A 1JNYA 4FZVA 1J9EA 3OM8A 1GAEO 1KNQA 2PWPA 3EGDA 3MSCA 5CRIA 5EEHA 1U0RA 1GL9B 2FOXA 2NO5A 3BZWA 2C98A 3AI7A 1XVAA 3AHCA 3CLSC 3E35A 3OPYI 4W9RA 2IIPA 2WW8A 2BMEA 1YQUA 2G1KA 2X0KA 5F2EA 2BIFA 3WLQA 3KU4A 2DH6A 2ZYAA 4FHFA 4QDXA 1NFRA 4TQ9A 4WCFA 5CVUA 2JFXA 3O4GA 4Q0MA 5K3FA 4S1VA 3NYQA 4L9AA 4JI5B 3LUJA 2WAYA 3C8UA 2OD2A 4X97A 3VPXA 2QXYA 3H0CA 4YRPA 4P6VF 4BBPA 5BN3B 1KOGA 4ENVA 2PANA 4TLCA 3UWOA 1GAQA 2O0LA 2WK1A 1G291 3T7DA 4ZVMA 4DM3A 3E15A 4MHSA 5DLQC 3RSSA 3ZI7A 1OFIA 2AUNA 3NT2A 3IR6A 1W4RA 1XDZA 2PL3A 1XXHB 2FPRA 4KWTA 4Z1MA 4DB2A 4LBWA 5CB0A 1KPHA 2A9KA 2QROA 3ZGZA 4MV7A 4QG3A 3I2GA 3VDMA 3RAGA 5B2FA 5C32A 1EH5A 4N3CA 5IVHA 3G9ZA 1GNVA 4KK3A 1G8SA 3VNVA 1AQNA 1LBIA 1GAWA 3DEAA 3JVVA 4PLZA 1JYFA 4UVEA 1Q1GA 1GYQA 3HB1A 1EM6A 3DA8A 4J0JA 2OE2A 4C7BA 2UVQA 2JCVA 3D4BA 2W9XA 4M8NE 4OHZA 3DULA 2OORA 4NEHB 4YCLA 1M67A 4QXRA 3RG2A 1OVMA 1S89A 3P8ZA 1S96A 3VSCA 3OU2A 4QHSA 5ALWA 2V6MA 4QDKA 4X62B 2WWFA 3TB4A 4KLNA 4B74A 2HMUA 4MQ6A 5JMTA 4QOJA 4KQ2A 2OB1A 4R8KA 1GVNB 4E7OA 2ZRMA 2IYTA 3PNVA 1ZD4A 5EIBC 1MENA 1G7SA 2OLKA 2VZ8A 1NKTA 2D5CA 2P6MA 2REQB 4PGHA 3CLUC 3KC2A 5AOVA 4M1WA 3AU8A 4OQEA 1E6KA 4MYHA 4HGOA 4PG6A 4XWAA 5DN6D 4KBGA 2WHQA 1RQ2A 4C21A 1JEYB 4JJAA 1E1LA 4WK2B 1RLIA 3HM9A 2QDXA 3ZUGA 4RH0A 4BYMA 3A31A 2EW1A 3PDUA 1L5QA 4MQ5A 2O8BA 1HDIA 4RJKA 2PJDA 1KE1A 4QBTA 1UBHS 3G79A 3A7EA 1ISIA 4II3A 3DDOA 4EF6A 5FCDA 1TF2A 1K2VN 2OQRA 5I9BA 3CFYA 2D2VA 2XUQA 3BZBA 3K2BA 3IAXA 1CJSA 2NPFA 4I7EA 1QFZA 1FUYB 2QTTA 3SZLA 3UUWA 1QF6A 1G0OA 5K3CA 3JWGA 3HCEA 4MCHA 4P4GA 5AI6A 1ST3A 1VJ1A 4QOFA 1GQ2A 5TQ0A 3ZQ6A 5DIZA 4NYMR 3LBIA 4PPQA 1JW9B 1K06A 1RJFA 1YR1A 2GK3A 2I67A 1U1EA 2CCGA 2XVAA 3BE8A 3GLRA 3N8IA 3RYHA 4MRMB 5L3SA 2BKEA 3CZRA 3PF9A 2W6NA 4PPGA 4U0KA 1IH8A 2BELA 2EX0A 2N42A 4JL6A 3TR5A 5EXEA 3FFAA 3OJFA 2JGIA 2UZIR 3GUZA 4OAOA 1SCDA 1EFUA 1WMSA 4FWIB 1P0PA 3BHIA 3WS7