1TU3A

Crystal structure of rab5 complex with rabaptin5 c-terminal domain
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
165
structure length
165
Chain Sequence
ICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of Rab5-Rabaptin5 interaction in endocytosis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-5A
total genus 53
structure length 165
sequence length 165
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2004-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tu3A00
1E2PA 3LVQE 1ZD9A 4WW0A 4RFSB 1KI9A 2LCFA 5J4HA 3C41J 1A5TA 1LF0A 1G20E 2CDNA 3SBDA 2QL6A 4P4TA 2OLJA 1KI7A 1AS0A 4M9XA 5HPYB 3GD7A 1OB5A 1I2DA 3WP1B 2WKPA 2CLCX 1KSHA 4BFUA 5GJBA 3EWSA 4YXWD 2WSSD 5BN4A 3PVSA 1ZUNB 2EYUA 4G5RA 2IWRA 4TT3D 2OESA 4PO9A 5DI3A 5HKKD 5KOYA 3LWNA 5FR1A 3AVVA 4EFNA 3LLUA 1OF1A 1Q3HA 4B3GA 3IEVA 1Z0AA 2LKCA 5C2JB 1UBEA 3CWQA 4C7OB 3EZ2A 5B30A 3ZDQA 2QENA 4MGYR 3GLGA 1NMZA 1SXJB 2BJWA 2C77A 3BORA 1MR3F 3B7GA 2YZ2A 3K0EA 4CEIA 1GDDA 4CEJB 1OH5A 1ZM7A 3QENA 2V1UA 2CLSA 1YHNA 3EA0A 4IOLA 4JSYA 2XTMA 3NDBB 2W58A 4H1VA 4B3FX 5LD2C 4MYHA 3RSLA 3UMSA 5FTLA 1IBRA 5B2ZA 1MRNA 5TVKA 4X8HA 3K9HA 5FOSA 3PFIA 5HE9A 3TH5A 3GJ7A 4IKEA 1Q1ZA 2AN9A 1VCOA 1XTJA 2EVWX 4UXIA 5EXTA 4CEHA 2QAJA 4KHZA 2OFXA 1N5IA 1G7RA 1Z0KA 3E2IA 5JJIA 221PA 3WP0A 2FFQA 2VSOA 2GEUA 1YZGA 4HAWA 1OHHA 3ECCA 1TF5A 4TMXA 4D25A 2JJ2A 1QRAA 2KBEA 4NH0A 2GCPA 3W6OA 5L3SB 3I4LA 3IIKA 4D81A 2IXFA 2QRZA 3SN6A 3WYFA 2G3YA 3SJCA 1ZM2A 2GVZC 2IEZA 1H8HD 1FX0A 3L0OA 4MGZR 2R44A 5H8WA 1FZQA 2XAUA 1SXJD 4N3NA 1QBKC 2OO7A 4JL5A 3LDAA 4BLOA 4ITRC 2X2EA 5EP3A 3RWOA 3FFBA 2VP4A 1ZNYA 4DLTA 1GAJA 1JJVA 2OM2A 4IXNA 4LZZA 2BMJA 2G88A 4EQ6B 4NE2A 2GCNA 5TMPA 1FNMA 3REGA 3EC2A 4B3CA 4JLVA 1KAOA 1T5IA 4OQXA 4U5XA 5C1BA 2O8FB 1Z06A 3K53A 5DGXA 3KTAA 1LFDB 2BEKA 3E5HA 2GXAA 5KNBA 1EGAA 1LW7A 1VKJA 3PEUA 1WCV1 5F2EA 4LJYA 1E69A 4JLAA 4TYQA 3VX3A 1XWIA 2JDID 4US1R 3SEAA 1N6NA 4URXR 5G40A 4GMDA 1Z07A 4C0SA 2VEDA 2C99A 3BGWA 2Q0HA 2GBLC 2V7QA 2WJVA 5K8IA 3FHOA 3IQXA 2QI9C 1II0A 1TQDA 3T1OA 4GOXA 3UG6A 2UZIR 4HAYA 2CL7X 3RYTC 5FUWA 1SVMA 1U8ZA 3CX7A 1Z6TA 1IJFA 3J81k 1KK2A 1JPJA 1Z28A 2UVQA 3UMFA 2XTNA 2VLIA 1XDBA 3X1XA 5HE8A 4MKFA 4ZDWA 3A8TA 4AWXA 3U61B 1NMYA 4QFMA 5BXQC 2REOA 1DAHA 3RS0A 4CEIB 1XPOA 5AJZA 3ZS8A 1WP9A 2P65A 4JVLA 3QPWA 2WWXA 2AFHE 2WSSA 5CDFA 1AJEA 1NJGA 2IYVA 2NOAA 4KU4A 4PHTA 4AIIA 4E07A 3UG7A 1KNQA 5JRJA 4YDSA 1J2JA 2FX3A 4GPTA 4TLDA 1W0JD 1XJQA 3BB4A 1RYHA 3BIFA 3IO5A 1S1CA 3A4LA 4L8GA 3LA6A 4ZIRA 4LJAA 4EPYA 2GXSA 3AF0A 2DWOA 3ETLA 1JXOA 5CB8A 1OXXK 3LNCA 3TE6A 1BOFA 1QHYA 2F43B 3CRQA 1DG1G 4YC7A 2JAQA 4LBYA 2ZYWX 4A6XA 5EE3A 2ONKA 5AJWA 5FBQB 4B71A 1QG2A 2P6RA 2OAQ1 3IPXA 1IONA 5E3HA 3WNCA 3PEYA 3EZ7A 1XD8A 4Q1EA 2KSQA 4EKDA 1Z6XA 1MRSA 1GP2A 2D4HA 2XJ4A 3H86A 2GZHA 3HWSA 2BMDA 2WMOB 2XB4A 3JZAA 3LXXA 4QM6A 1LY1A 3D6TB 4Q47A 3RRYA 1VIYA 3G0HA 2HXYA 4XTCS 4UJ5A 2JASA 2FEOA 2CBZA 5G3ZA 3T34A 3CF0A 4PO1A 4ARZA 1GVNB 3THXA 4PO8A 4URWR 2ZR7A 1AS3A 2RGCA 2GCOB 5FL3A 1HUQA 4NCIA 4NU0A 4JKIA 3SR0A 1Q21A 1GILA 1II9A 2ATVA 1VMAA 4TTQA 1OIXA 1KGDA 1B0UA 2F9MA 4OK5A 1OFHA 1FTSA 1ZBDA 2G1KA 4I1VA 3RLFA 2XSZA 4O25A 5FTKA 2YOFA 3K9GA 5JECA 1G9XA 1ZD8A 2FSIA 1KI6A 2KJQA 5FOVA 4URUR 2QAGB 3K0FA 1QVAA 1R0WA 1CLUA 2WJYA 3Q8XB 4DRZA 1JAHA 4EPWA 1G3QA 4TSFA 3C5HA 5JRZA 3BFXA 3QIAA 1RRFA 3H0KA 1II8B 2RHMA 3DL0A 4LI0A 4CZ2A 4LPKA 1GNQA 2EYQA 3T5GA 3NEYA 3GJ4A 2JLQA 1LTQA 4DEYA 4HDCA 1C1YA 2F43A 3TUZC 2GAAA 3IBGA 4Q1CA 1IXZA 1J90A 1RRGA 4XJXA 3QG1A 1KO7A 3B9QA 3FDIA 3I8XA 4NHOA 2CJWB 2QORA 4V0NA 3TLXA 4G3XA 1T3SA 4EUNA 3K09A 3TR0A 1NIJA 3TBKA 2QMHA 1F48A 2E1RA 1E99A 4EAQA 1E96A 1E9CA 4DLYA 4ERNA 1JNYA 4I81A 3B82A 1QHHA 2YV5A 4DLVA 4LHXA 3Q3JB 1PVOA 1CR4A 4M22A 4M53A 1E98A 3UWKA 1E9SA 3QUSA 3O8DA 1KIMA 5GVSA 1H8EA 3QEJA 2N42A 2H57A 1NVWQ 1T8UA 4BFWA 2REXB 5JZVA 5TB5A 3UK6A 1RJ9A 3PXGA 1DEKA 4B3XA 1NJFA 1G3IA 1R6BX 4BFYA 2BMFA 1Z6YA 3U3JA 4RD3A 1S9DA 3DMDA 3PENA 2G9NA 4NYMQ 2R8RA 1E2HA 1M2OB 5G3YA 3NH9A 1ONBA 1HA3A 3B8HA 1VYUA 1G7TA 1RZ3A 3IKJA 3MLEA 4OK3A 3GPLA 2JLVA 4B47A 1S96A 1Z2CA 2AFIE 4II7A 4PC1A 2PZEA 1Z0FA 2P6UA 5KO2A 1Y3AA 3N70A 1E1QA 1TF7A 4BLTA 3GJ3A 1OH8A 2QSYA 1HE8B 4Q01A 1T3HA 1XF9A 3W3AA 4GOKA 1T5LA 1DELA 3EIEA 2J7PA 4AYWA 3R9WA 3CO5A 2QY9A 4IXMA 4RVCA 4UNPA 3I72A 1KY2A 4V03A 2WBLC 3BBPA 3L0IB 4EJSB 4DDTA 3HU1A 2JCSA 4EQ6A 1CF4A 1KDRA 5FOUA 1OSNA 5KYKA 4LYHA 3QBTA 4MKGA 1KI2A 1P73A 2GJ8A 4TYPA 4ZO4A 3FHCB 2GVDC 5CK4A 3TSZA 1Q12A 4B35A 4AURA 2D7CA 2J9RA 2AWOA 2B92A 4PC3A 1RE0A 3AKCA 5K8TA 2A5GA 2YVUA 4C0KA 1CU1A 4ZKDA 5ANRB 2RB4A 3AP1A 1W36B 2Q9BA 2RGDA 3AKDA 3PUVA 4LBZA 4B48A 4AK9A 3K8YA 5JSZB 1GL7A 3WXMA 1P7CA 3QKSB 4GP7A 4PQRA 5DYIA 2R6GA 2FA9A 3VAAA 1GL9B 3RC3A 2BM0A 4Z8YA 2GEDA 1XZPA 3MG9A 3S1AA 2PLRA 1T91A 4PPQA 1ZMXA 3PQCA 2QG6A 1SKYB 2OBLA 3EW9A 4JKYA 4PZZA 1Z6AA 5F98A 2VSXA 1W4AA 4MGIR 2J7KA 2IT1A 3GEEA 1GG2A 3FFAA 5SZJA 1NRJB 2ZJAA 4BLPA 1AQUA 4FMDF 2H92A 2A7QA 5FOWA 3HYRA 3U6BA 3LV8A 4HLUA 4CVNA 1NVUQ 1OYWA 1ZAKA 2BCGY 4DB4A 1YQTA 1WBBA 1QDEA 2PT5A 2YOGA 1BYUA 4IDOA 1KSJA 2A5YB 2QZ4A 4IOMA 3U3KA 2X2FA 3AM1A 2JJ1A 3IO3A 3KFVA 4GL2A 4QGFA 1KJWA 2ECKA 2WWIA 3RWMB 1V5WA 4TLBA 1G4UR 1NF3A 2R6CA 4JMPA 5DLQC 4R71A 2J0QA 3ONWA 4D4JA 1OFTA 5ELXA 4B3DA 3KB1A 2JLSA 2IS2A 1YR8A 1KOFA 3PJRA 3SJAA 4A82A 2ANBA 3NVAA 4F38A 3K1JA 1RPZA 2A30A 4V02A 4D0GA 2PCJA 4A36A 3OZXA 1E9RA 3B1VA 5CDFE 1JB1A 1KZGB 4W5JA 1DAFA 3T5DA 3VR4A 4E09A 3T61A 5DNYB 1CP2A 2GESA 4RD0A 4A2PA 3CNNA 4EJSC 2ZSFA 1CEEA 1E0JA 3RS7A 2AWNA 5FBVB 2GF9A 4JLBA 1VCMA 5BYKA 1W36C 1U99A 1IJEA 1KSFX 3BFVA 3VU9B 5C4MA 2CL0X 1NY6A 5JFGA 5DO9A 3U3MA 2GZDA 1W5SA 3K70C 1UBGA 3SQWA 2VA8A 1US8A 5DN6A 5F3WB 4NMMA 4QGAA 4KI0A 3SZRA 5EJEA 4QC2A 4HYYA 2YWGA 1DE0A 1N3BA 1OLOA 2VP6A 5B64A 1W0KA 5EZ6B 1BS1A 1U9IA 4IEIA 4DKXA 1FPMA 4TL9A 4HUTA 2AHOA 4KV9A 4AG5A 2WJIA 3K0AA 4LJ9A 4RZ3A 5FUYA 1R0YA 3DVLA 4P4UA 4DSNA 4GMXA 4JLOA 2FV8A 3B2EA 3CR7A 3IHLA 3PCRB 4BQSA 3W6NA 3B5JA 1DG3A 3GLHA 3I5XA 1XXHE 5JS7A 5AWFC 2ODWA 4XWOA 3VU9A 1PLJA 2VP9A 4Q21A 1GKUB 4RY2A 5FBRB 1SULA 4L9WA 4B6FA 1LS1A 1X86B 5EE9A 1FFHA 1E0SA 4GZLA 4UXJA 5EE5B 3SE0A 5KSYA 1Q1EA 4V0MA 3LY5A 3QKRB 4JLNA 4S2EA 5D3MA 3U60B 2ZI7A 4EPXA 2O5VA 4BFVA 2PBRA 4DT1B 2FMXA 4Q4JA 5IDVA 4URZR 5HZKA 2QROA 3GLHE 2IYQA 4Q7JB 1JBKA 1NSTA 3QY0A 3NG1A 2ZE8A 1IXSB 1XTRA 2OLKA 2QTHA 1BMFA 1US8B 5EUMA 2MSDB 2G83A 2A3RA 4TQAA 4A2WA 3OFND 2C96A 3AUYA 1P3JA 1XD2A 2IF2A 3NHBA 1AQYA 4K8OA 2GCOA 2IYSA 4Q9IA 4BPBA 2VO1A 2J3EA 2RAPA 1L4YA 2PT7A 3MUFA 2FN4A 4LHZA 4UNRA 4D2IA 4JJZA 3DDCA 3M4YA 4A4DA 1U9IC 5FBWB 3KJEA 3D3QA 3QSYA 2HXSA 3LO5A 2NO7A 1YZQA 3A1SA 4LY6A 3EAQA 1Z0DA 4US0R 5IK2A 1N6KA 4OHYA 1CJKC 4BE7B 1Z08A 1OIWA 2YJTD 4A8JC 4KAXA 2QTFA 3NC0C 1EFRA 4Q9JA 2I3BA 1Z29A 3U5ZB 3VKHA 1ZNZA 1UADA 1KY3A 3KXLA 2P5SA 4FCVA 2ZJZA 5EUQB 5LD2B 1J8MF 1ZC4A 2E87A 1QF9A 3W90A 5KNCA 2ZVPX 2FSGA 2QP9X 4LV6A 4NYIQ 1XEWY 2WAXA 1F2TA 2W6ID 4JSTA 1ZM4A 4AY2A 2ZPTX 1NN1A 4P0TA 2AXPA 2H7VA 3IPYA 3BC1A 4EFLA 2O8FA 4Q5IA 3HP1A 3AVYA 4D4LA 2WJJA 3DOFA 4Q4AB 3OIUA 3QKRA 4Q19A 3OIYA 4Q7LA 1TQ6A 3U3OA 4Z1MD 4TTPA 3SI7A 1OW3B 4WIAA 4Q9LA 5GJWC 2ERYA 2TMKA 5L3RA 1NLZA 2ZR9A 4B34A 1E2DA 1E2JA 3GJ6A 1F60A 2FU5C 3GLGB 2NPFA 3FMFA 2XNDD 1CXZA 2CCKA 4AKIA 2IL1A 3GFOA 5AK0A 1U8YA 1R4AA 1E2IA 1FTNA 5IRCD 2C9CA 1XCMA 3BE4A 4ILEA 3FKSA 3NIBA 1Z6GA 5EE0A 1G3MA 1N6LA 1PZNA 4ZIRB 1UAAA 3QBVA 1VG0B 1TTTA 1LS6A 2ZANA 3HYTA 1KTVA 1NBMA 1U0JA 2N46A 2ZUCA 3QXJA 3RRMA 1OB2A 3K70D 2QMEA 1QVRA 1NP6A 4NTZA 3TW8B 4HEJA 2JJ8A 2G0TA 2OXRA 4R2HA 4L15A 4ASUD 1XRJA 2DHRA 4NBSA 2O8BB 4RKEA 3L82B 1JQJC 2IS4A 2Z4RA 2ZJ5A 1VG8A 5E4FA 2BHRA 4KFSA 1M34E 1YRAA 1WQ1R 1VCNA 2OILA 2ZRMA 2ZJ8A 1Z5ZA 2F9LA 1NNEA 4BEJA 2WOJA 4BRWA 3SJZA 4DCTA 2XEXA 4WVFA 4JYCA 3U2QA 1F3OA 2ZYVX 3OHMA 4TLCA 3BB3A 2W0MA 2B7BA 4W5HA 3HPRA 4LC1A 3B13B 1ZIOA 5JJKA 2CVFA 1QHHB 1DARA 3W9YA 2FSHA 2ZTSA 1W49A 2L0XA 4BUJA 1YZUA 3W8NA 4JBXA 3DPUA 4KFRA 5EP1A 2FPLA 4IDPA 4YMWA 2WV9A 3PITA 1KI1A 1XJ0A 4ESHA 3AVUA 2NTYC 4QHSA 1AGPA 4MH0R 4MYTA 4O3MA 1TU4A 1MKYA 2FEMA 4TT3A 4FMBB 2FNAA 4A0HA 1G41A 2R6AA 4KLNA 4D4KA 2Z4SA 1DAGA 1EFCA 4TL6A 3U44B 1SVSA 1YR9A 2RGNA 1G5TA 1JXMA 2CEAA 3I8SA 4I99A 4XWKA 2GRJA 2FOLA 4IHQA 1KJZA 3VKWA 2ZUBA 4QL3A 4URYR 4Y0AA 4LSGA 5TV2A 4C0JA 1Z0IA 3C16C 4OQMA 1YKSA 1W1WA 2VSFA 4ZPXA 1N0UA 3EZ9A 1Z3IX 3K09C 1HEIA 3HDTA 4C4PA 3AVWA 1ZNWA 2VPPA 3DM5A 4GP6A 1NIPA 4IEEA 2VIIA 2W6JA 2Y8EA 3MJRA 5JWRA 1QHGA 4LYJA 4WA7A 5J5CA 4JVMA 3C4JA 4LJ5A 4YQFA 3OAAA 2W00A 3GMTA 2YWEA 1XBTA 3S1AB 1UBFA 3TVDA 3THXB 4C7OA 3THWA 4KXFB 4DLRA 2P6NA 4WZ6A 4ZKEA 3HR8A 3I1FA 3LVRE 2Z5FA 5HCIA 2JJ2D 3GP8A 1MABB 3P27A 3WNBA 1XMSA 1JALA 1BYIA 1G1MA 4AI6A 2I1QA 3GFTA 3RS3A 4AKHA 3RABA 5DH9A 1N2CE 3UKDA 3OEHA 1Q0UA 2ERXA 2J59A 4LGMA 1AS2A 1SKQA 5CYOA 1K5GA 3A1TA 3KKPA 3Q9LA 1AA9A 3VKGA 1HE1C 3U7GA 2WZQA 3IEUA 4XSHA 2XOKD 4NYMR 4EFMA 2DYKA 2IW3A 5AUQA 4RFSA 3SFVA 3OESA 3P4XA 1ETUA 4LBWA 4Q03A 4F91B 2ZRGA 1TEVA 2XNDA 1A4RA 4LDJA 2R6DA 3T1TA 4O2LA 2GNOA 1ZCBA 3IDQA 4F4JA 5FR2A 3KB2A 1GRNA 2FZLA 2WWHA 2ZVQX 4NYIR 3GEIA 3R9XA 4JJKA 3RHFA 2IXEA 4WXRA 1DS6A 2OCBA 2OFOA 5P21A 1XB2A 3CRRA 5FPKA 5D3MB 4J0QA 4WZAE 5AUPB 5JJLA 5HKKA 3EA5A 4PQFA 1N6IA 4RD2A 2FWRA 3RDPA 1OXTA 2ZI9A 4U00A 2VP0A 1W36D 4CEHB 2GDJA 2J5XA 2ODNA 4KFUA 3F8TA 4DUGA 1HH4A 2V6JA 4IVPA 3SU8A 4TYNA 1KDOA 4LOAA 5J40A 4DCVA 1CKEA 1RJ9B 1G8YA 4RSGA 3WNDA 1G5PA 3EASA 3M0EA 3EPKA 2OEPA 1OHHD 2MSCB 4B44A 5LDDC 4G1UC 1OXVA 3C14C 3BERA 1E1RD 3CZPA 4NDZA 4B32A 3GLIE 2OCYC 1CR2A 4X8OA 2FFBA 3W6PA 3R8FA 1KMQA 2G6BA 3KZ1E 4GNKA 4V0OA 2YKGA 1OYYA 3THYB 5JI3E 1U81A 2VP5A 3B1YA 3A1WA 4LHWA 4HAZA 3MWYW 1YJ5A 3PIRA 3T06B 1YZNA 1JI0A 4ZDIA 3U7EB 2X19A 3LX5A 2ZU6A 3KL4A 3GQBA 2LWIA 1IN5A 1D8TA 1MOZA 3DZ8A 1Z8FA 1P9NA 4C3ZA 3V4FA 2WWYA 1VHLA 2ZRCA 3ADDA 2VHQA 2FPKA 1E9EA 5DE3A 4IOKA 4XD7A 4YDHB 3LW7A 1E3MA 2JDIA 4ZI2A 1T9HA 2ZROA 4FD2A 3X1ZA 1UDWA 1Z0JA 4A1FA 3A1UA 2R65A 1UEIA 1WXQA 3EWAA 1L4UA 3GLFA 2IYRA 1VDZA 3BFKA 4TL8A 2KI5A 1ZUHA 3Q7PA 1X8LA 3KDSE 2E9SA 2D62A 2A9KA 2NQ2C 2BBTA 3KXKA 2PCLA 2B6HA 1IN7A 1RRPA 3LH5A 2GJAA 2XNSA 5LB4A 1RVDA 2Z43A 3VR3A 3BRWD 1IY1A 1ESNA 2IYXA 5EE1A 4KODA 4ON9A 5TARA 4LJ8A 2DPXA 5KDDA 3ZVRA 1Q1QA 3BAFA 3HU2A 3TQFA 3EZFA 4FCWA 4AYXA 3DO6A 2JATA 3B1XA 3A36A 3QNUA 2XSZD 2BBSA 1FOEB 4IVRA 4G5QA 1NN0A 2H5EA 2B7CA 3L2OB 2MMGA 3DZDA 3VNVA 1D2EA 1GIAA 2GKSA 3C8UA 3UXMA 1I4TD 1L7VC 2EU8A 2HYDA 1DO2A 2QEQA 4NKRA 4ZDJA 2YINC 4S35A 1XX6A 1CS4C 1J70A 2G1JA 3FMPB 1U94A 1UEJA 5GVRA 5J4YA 121PA 1CULC 2R6FA 4QBGB 1KI6B 4A9AA 3CF2A 3QKSA 3SQXA 4RKFA 1FP6A 1FUUA 2OG2A 3VMFA 2ZITA 5AJXA 2VRWA 3DOEA 4TLAA 4DEXA 3N2IA 5B58C 2D2FA 4C0HA 5IF9A 4M9SA 1S9HA 4G5SA 5CIQA 1XMJA 5FTNA 1XMIA 2VL7A 4HDOB 4NPHA 3RS2A 3LAWA 2V1XA 1Q3TA 3Q85A 1QZXA 2BCJQ 3EZ6A 3BWDD 1G7CA 4M1TA 3LRPA 1Q57A 1GUAA 2DBYA 4WAUA 1XFAA 2WIAA 1SVWA 4A0GA 1F2UB 4JLMA 1T0JB 1Z47A 1KZ7B 2XITA 1W0JA 1HY3A 2G0NA 2QA5A 3KKQA 4BFSA 1AK2A 4TN1A 1M6NA 4FMCF 4RZ2A 1N6PA 1G6HA 4DUGD 1HYQA 4JYBA 3NHAA 3ZGXA 3AQ4A 3IIJA 4NCKA 1S2MA 5D3QA 1COWD 1NG9A 4G01B 4TZ6A 4U02A 1C9KA 2REBA 3BH0A 1TEXA 1W44A 1E2LA 4JVSB 5EP2A 4HSEA 5DI9A 2NG1A 1PLKA 1KI4A 4HLCA 4I4LA 1HQYE 1EX6A 4Q4LA 5TY0A 2O8BA 2DCUA 4L4UA 5IT5A 2HUPA 2D2EA 1L2TA 2VF8A 4O2RA 2O52A 5UKDA 4DLUA 1RFLA 2O0KA 2ODBA 3CM0A 5JS8A 1KI3A 2B8TA 3MJHA 4PAQA 2IYLD 2VF7A 2AKYA 4HZIA 3QVVA 4IDNA 1E1QD 2GEVA 2QPAA 2W2VA 1JR3D 4TSFD 4QM7A 2PMKA 2VH5R 3JZMA 2Q9AA 3EG5A 2QMUA 3ZS9A 1UBCA 4KBFA 4HDQB 1AM4D 1OKKD 2NO6A 2O8DA 2EFDB 5L3VA 2QP3A 2J1LA 2RGXA 4Q9KA 5FTJA 4ZCIA 5FPTA 1D2MA 4OHVA 2BMEA 4GRAA 4F93B 3CPHA 2WJHA 2XXAB 3BH6A 3FTQA 3KJHA 5CIWA 2HCJB 2ZRAA 4XD7D 2OE2A 4X8MA 2C9OA 1EG7A 2GJKA 1I2MA 1TNDA 1W48A 4W5WA 5JMTA 3V4RA 4NCNA 5EXSA 3ADBA 1NKSA 2WMNB 2QSZA 3FYHA 3GJ0A 3SDZA 3CNOA 4DVGA 1E9FA 3MD0A 1EWRA 3NBYC 1LB1B 4IVQA 1U98A 5FPHA 4BLSA 2QAGC 2J45A 3QPVA 4ZCMA 4LK2A 3V00A 2IYTA 3KQNA 1XTKA 4KSBA 1N5KA 4AD8A 3ZVNA 4B74A 1VG1A 1TQ2A 3UATA 1ZD1A 2WKRA 4A0FA 4P4SA 1RYFA 2IHBA 3FHTA 4C0LA 4DSTA 4F92B 1AN0A 2I4IA 2BBWA 1SKYE 3AGPA 2R2AA 4F4IA 3AKYA 2GETA 1TUIA 4QRHA 4PX9A 1MT0A 2RGEA 3F3YA 1UKZA 4XIGS 4PC7A 3NBXX 3CX6A 2R9VA 4D0LB 5BYJA 1KK1A 4BFZA 3QF7A 3BH7A 5E7IA 2YNMA 4FW9A 5FL7A 2FSFA 4NL4H 5SZIA 2ZXUA 4KBGA 4R9UC 3VFDA 1W5TA 5KPJA 2X1VA 2ZJYA 3NXSA 1ZP6A 3ZD6A 1VYVA 3T1QA 4H9GA 5DHFA 2IWHA 4BLRA 1PUIA 2J7PD 2QE7D 2W2TA 4HAXA 2ZQ5A 4JS0A 2P0EA 3ADKA 2Q6TA 4XH9B 1A7JA 3CLVA 2CHVA 1SVKA 4KLZA 1P72A 2OBMA 2EWVA 1J7KA 2CCGA 4KVGA 821PA 4HLUC 3SJBA 4DLSA 3VR6A 2F3TA 2ZRJA 4ARZB 2DFLA 1UFQA 4KYUA 2RGAA 3NDPA 4JBYA 3QI2A 2XB2A 1KYIA 2ZSDA 3LQQA 3KX2A 1CJTC 2QRNA 3A4NA 3QVUA 3REFA 1YZTA 3EXAA 1NY5A 5KTYA 3DM9B 4GOJA 4TMKA 5J47A 1HV8A 3M6AA 2HLDD 3RAPR 4GZMA 2IC5A 4C0QC 2ZSEA 3QE0A 5DISB 1HT2E 4Q4HA 1XD9A 4Z8XA 1FMLA 2QAGA 2RGNC 3AVXA 1E94E 3TMKA 1SVOA 1TX4B 3H1TA 1XMVA 2LKDA 4FMDB 2NMVA 4QGHA 1GNRA 3A58B 4OHZA 3IILA 2A5DA 2ORWA 1COWA 3CR8A 4OKSA 5G53C 2P67A 4FWTA 3QPUA 2OV2A 1KKMA 2XZPA 1VECA 2WHXA 3GCGA 1KO8A 3FB4A 1VG9B 5AJVB 4DLWA 3I62A 2PZFA 3DEFA 3X1WA 4MA4A 1R5NA 1GSIA 4A92A 1CRQA 3QJYA 4HB2A 2ZRLA 5CLLA 3ZLJA 2W83A 2C03A 1AKYA 1WMSA 3WHKA 4NCJA 3GEHA 5KDLA 1JEEA 4MKHA 4PXAA 4B43A 3QEOA 1YU9A 4DWJA 2BBOA 2X77A 3C7KA 2V9PA 4F7WA 721PA 1W4RA 3OE7A 3DHWC 1KO4A 4L9SA 2CMKA 2DY1A 3I92A 2JJ1D 3W5IA 3SBEA 2EWWA 4PPFA 4BECA 1P5ZB 2PX3A 4OI4A 4HZUA 3MMPA 5KPDA 3QKUA 2BEJA 3B6EA 3QXHA 5GJVC 5JBQA 1P61B 3D31A 3EX7C 1BO6A 2RCNA 1FW6A 4EPTA 2F55A 3NWJA 2WVJA 4ABYA 1Q1BA 3KQHA 2CXXA 2QT0A 1VYTA 4NCHA 4R7ZA 3HU3A 4P4SB 2RMKA 5A0FA 4TMWA 4AYTA 3WYAA 5BQ5A 1M8PA 2J46A 3GLHB 3T15A 4X8LA 2ZI6A 1N6HA 1Q22A 3B60A 3ZIAA 3AP3A 1PLLA 3R8CA 1R8SA 3NC1C 4OQFA 5KUTA 1BMFD 3KQKA 3QF4B 5G41A 5JEEA 2HDNB 2ZRIA 1UKEA 2B21A 2ZETA 1XTQA 4OL0A 3RRZA 4Q4JB 2ZYUX 2RGGA 1FMJA 1ZYUA 2G77B 2PH1A 2CNWA 3KFXA 3PUZA 3QG5A 4DDUA 5IHPA 2HT1A 2C78A 4TWZA 1J8YF 1G19A 2CLDX 3C5CA 3CF6R 3EC1A 4O0MA 2DWQA 2F6RA 2VHCA 3SOPA 1G4AE 3B9PA 3V9PA 2CK3A 2ZE5A 4JL6A 4Q7MB 1T3LA 4ESVA 3U7FB 4LJ6A 2PL3A 4FCTA 5FOXA 3B1ZA 4RCZA 5K8LA 4Q9HA 1GKYA 4CDGA 1UKYA 1N0VC 4HI0E 4RZUA 1FX0B 1P6XA 1ZINA 1GRQA 1RIFA 3BD9A 1NVVR 1K6MA 2GZAA 3DKPA 2HYIC 2FH5B 1N6OA 4B2LA 1IHUA 1JR6A 4GSYA 1AGRA 1YR6A 1M74A 1XJCA 3P32A 1KDTA 1KO5A 1WA5A 2ZR0A 1GM5A 4L16A 4IDHA 5KSOA 3B85A 1B23P 1P9WA 2QE7A 1E0AA 4KSCA 4B2PA 4AG6A 4HATA 4HLDA 2IHYA 3K70B 2FZ4A 4MYCA 3IHWA 3FGNA 3VQTA 1OH7A 1P2UA 3AGQA 1DVRA 1ZRHA 4N0EA 3OEEA 1N25A 3E70C 3NBFA 1T4GA 2AK3A 3BJIC 2XZOA 5F9FA 1UJ2A 4OHWA 5CJPA 1KMHB 3WBJA 4DCUA 3TAHA 1YR7A 5H70A 4W7SA 4DLZA 2PJZA 1LV7A 3KTAB 3G82C 3QOFA 4XWAA 2WJGA 1FQJA 4PHFA 4US2R 4LX0A 1E79D 4A8JB 4A15A 3CIOA 2GILA 5FUVA 4BLQA 2XXAA 1G17A 2FG5A 4JLJA 3GLGE 3WY9A 1ELOA 1GOTA 2ZEJA 1E0KA 1S3SA 2NZ8A 4Q4AA 1F2UA 4XSGA 3VHLB 2FFHA 3WRXC 3R7WA 3K0CC 4JLDA 3LLMA 3CW2A 2IYZA 1N0WA 2W2XA 2OCPA 2JLRA 4Q1BA 1OE0A 2QGZA 4K81B 1KK0A 2BIFA 1ZC3A 1QHXA 2JA1A 2H18A 3RSOA 1XNJA 4IFBA 4V0ME 5LBIA 1EFTA 2OUKA 4YXWA 3A4MA 3ZD7A 2CHQA 3THWB 4B76A 4QJ5A 4MKIA 1CTQA 2JLXA 1TAGA 5TDHA 2AKAB 2Z83A 1DADA 2ZRHA 3O47A 1TMKA 5JSZA 1QHIA 4N1AA 2NO9A 3BXZA 5JWOA 1CBUA 3MGCA 4B33A 1E2MA 4QXAA 2D06A 1Z63A 3CUEF 1N5LA 4P31A 1F6BA 3F0TA 1SHKA 3ZQJA 1CJVC 1M7GA 4TL7A 4G0NA 2UZ3A 1M1YE 2PEYA 6Q21A 3U4QA 3L0SA 2OHFA 1F2TB 3PUWA 3ZVLA 4MITA 5BWMA 1ZM3A 3W3ZB 3ZZTA 2W6IA 1NVVQ 3CRW1 4OJKA 3IBYA 5HTKA 1IQPA 2P3SA 2NIPA 3CX8A 4MDFA 2XGJA 1SXJA 4A0RA 1G64A 5K8UA 3VTKA 4QG7A 2BDTA 1ZJ6A 5C4GB 1VTKA 3QF4A 1PV4A 2A2ZA 3PEVA 5DSZA 2C98A 2IA5A 2CHGA 2Q21A 1CJUC 4YMUA 3GLFB 2C2HA 2WOOA 1VHTA 1CJMA 3CPEA 4AC9A 3VHXA 3UPUA 2VBCA 2EFCB 2IK8A 4JL8A 3R20A 3ICEA 5FTMA 2AR7A 2Z6VA 3KJGA 1H65A 1G8HA 2C04A 2Q3FA 4OQLA 4UQOA 3DKVA 4MRPA 4ZCLA 3A1VA 1GFIA 4BFXA 521PA 1RKBA 4M21A 1X8KA 1MO6A 1G8FA 1KDPA 2DFKB 1OXUA 2BV3A 1W47A 3SYLA 1WDTA 1XD2B 1BKDR 2QU8A 5JHHB 4Z1MA 4RFVA 5DYGA 4NZYA 4Z51A 5CB6A 5KSPA 4GI7A 2ZU0C 5LB2A 1UM8A 4UXHA 4K46A 2ZJ2A 8OHMA 1R8QA 4QJ4A 2QTVB 3BS4A 4C0AC 5JEDA 1TU3A 1R5BA 2J0UB 2GTPA 1GTVA 2AD1A 2QM7A 1ZU4A 3HPQA 4HUQB 4BZXA 4CF7A 4OI0A 1YRBA 1BIFA 1EFHA 4GDFA 1IY0A 2V4ZA 3AF1A 4PSVA 4DLXA 1BH2A 4KVAA 4BZPA 4TMTA 1E2QA 4KFTA 1ZU5A 3CBQA 1LF5A 4PR0A 3D7MA 1RC8A 2OZEA 5H1YA 2FPMA 1ZW6A 4JT4A 2RH5A 4LV5B 2DB3A 2GXQA 3X1DA 4DSOA 4M1YA 2O8EA 4OJQA 3EPLA 2JIZA 2BC9A 1NN5A 4ASUA 2WAYA 3PV0A 4OYHA 4ZI3A 5BN5A 5L3SA 3CNLA 2ZI4A 1U8AA 3TGPA 5CK5A 1KK3A 2MMCA 4YMVA 1XTIA 3ASYA 3K9LA 3MRSA 4FIDA 1JEDA 1GWNA 4C2UA 3FPAA 5BW8A 2QMOA 2PJRA 3P1JA 2OT3B 4DBLC 4TMVA 1EXMA 5E7JA 5L3QB 1A2KC 3EIHA 1OJLA 1GKIA 4TQ9A 5FFMA 3AKEA 1ANKA 4PAOA 3RC8A 2NO1A 4LHVA 1FQKA 1E9BA 1X1RA 1W2GA 3TAUA 1U0LA 1AZTA 2Q9CA 2PEZA 2ZI3A 3NKVA 4PPNA 1TQ4A 2F1HA 4WOPA 2OFWA 2V55B 5KSZA 1OFIA 4PSAA 4IW3B 1FP7A 1WF3A 1Z83A 1IAQA 4L5BA 1R10A 1XEFA 2FF7A 2GJ9A 3BK7A 2HJVA 2IS1A 3VR2A 2GAOA 3L8ZA 3KKOA 3RANA 3LBIA 1ZNXA 1KKLA 2FGJA 1QG4A 4DDWA 5J4KA 2GBLA 2KE5A 3VR1A 2O8EB 3L8YA 4OBEA 1VIAA 1KO1A 4XVRA 4CGZA 4C0BA 2ZIAA 1EK0A 1HURA 2VTKA 3FE2A 1DAIA 1W4CA 1FNNA 2RKOA 1ZM9A 1E1RA 3GLIB 4UKDA 2ZS7A 4NP6A 2WICA 5EQTA 3ZJYA 2EW1A 2V7QD 2ZE7A 2WPDD 1C4OA 3LXRA 3U3RA 1E32A 5A4JA 2ZRBA 3N5CA 3AUXA 2ZS8A 3CB4A 1Z22A 3LD9A 3LBNA 4C2TA 1I4DD 3OAAD 4MGKR 4UNSA 2QQEA 1NI3A 4LBVA 2IYUA 4QBHA 3UMRA 1D5CA 2DR3A 3K0SA 1E9AA 3AH8A 2H17A 3TKLA 1IY2A 4KO8A 4P33A 4R98A 4M1MA 4F4CA 4Q00A 4KCGA 1ZVQA 5GADl 3O8RA 1XEXA 4CW7A 4JZKA 3UANA 1W46A 5C46F 3U7HB 2HF8A 5KDOA 1EX7A 4M8NE 3SFZA 1G6OA 3OEHD 4DSUA 3KJIA 3Q5EA 2YOHA 1ZIPA 2HJGA 2QT1A 4A2QA 1YZKA 3SHFA 4LJ7A 1ESMA 5AUOB 4PHHA 5BN3A 3H4MA 4PZYA 3WHLA 2XJ9A 1WBDA 4CIDA 1P2SA 1XCPA 2ATXA 3PUXA 1H8ED 2ZSBA 4HAUA 3LQRA 4IRUB 2NGRA 3IIMA 2GXUA 1DOAA 3KKMA 3MWKA 2IUUA 5DIFA 1HT1E 4EDHA 1UDXA 4QKQA 3X2SA 2A5JA 4OI2A 3GFPA 3K0FB 5CITA 1PJRA 1MV5A 3G5UA 1NLFA 3O8BA 4JVNA 2RGBA 1P62B 2C95A 1CR1A 5C18A 2VQSA 2OBNA 2ORVA 1R0ZA 5CLQA 2JIZD 621PA 2QBYB 2GWHA 1HQCA 2QPTA 3A6PC 1KAGA 2HT6A 2KBFA 2ZSAA 3Q72A 1IN4A 4C9BA 3KUCA 3CWZA 4XTRA 2O0HA 3L43A 2ODEA 3ZH9B 1AZSC 2YC2C 1PUJA 1R7RA 3VR5A 2B8WA 4IDQA 3LFUA 4DCNA 2K5UA 2ZRPA 2CL6X 2IUSA 2HV8A 3OIWA 3ZQ6A 4BWYA 1OXSC 3PG5A 2PLFA 3DMNA 1U2RA 1O3YA 4MYUA 3RS4A 2YC4C 4NONA 5FPYA 1DAMA 3GJXC 4LPSA 5DI3B 1P60A 3AVOA 1NVXQ 3WYGA 1ODFA 1R5OA 4RJLA 1DPFA 3K0CA 1CR0A 1EFUA 2WM9B 3NBZC 5HR5A 1TF2A 1XEXB 1CIPA 5A5GA 4TYYA 4PZLA 1RW4A 1JECA 4DDVA 2VYFA 3W5JA 1A1VA 4MRNA 5FH9A 5J4LA 1G7SA 1WRBA 4I1OA 3PEWA 1SGWA 3MFYA 3VX4A 1DAKA 4EJSA 3B1WA 4IJMA 2YWHA 5JLJA 3IGFA 1CRPA 1KMHA 5AUNB 2CJWA 4QOSA 4Q66C 3TRFA 4EPVA 5SZKB 3PR1A 2ZAMA 3FKQA 4DZZA 2ZM5A 1S0UA 4DT1A 2X8AA 1N6RA 1L8QA 2J87A 1RRCA 5CM8B 3NTUA 4BRUA 1XPRA 2QP4A 5JCZA 5L8VA 1MH1A 3ZYCA 2WPDA 2W0SA 4PC2A 2FFAA 1OFUX 4OQNA 3I61A 3N2EA 4UJ3A 4QBIA 5CYPA 4JLPA 2QGNA 3GLIA 3NH6A 2ZRDA 2GK7A 3CZQA 1E6CA 3AP2A 4JT2A 2IX3A 1TL7C 4ZDKA 2FJUA 4HZUB 2VHTA 3P26A 4OHXA 4DIDA 4EIWA 2QM8A 3KQLA 4UNNA 2HCBA 3TK1A 2F1IA 1E2FA 3QXXA 4I1UA 2IUTA 4D80A 2BOVA 2AL7A 4MRVA 3IQWA 2D7DA 2WKQA 4Q1AA 4Q1DA 1NLYA 2ZJBA 3T1VA 2IF0A 4U7DA 3F5FA 2AD5A 3LX8A 1YE8A 4E22A 4FN5A 3JVVA 2GF0A 2GJSA 2DFTA 1MO3A 4V0LA 1GZSA 1D2NA 3B78A 2N1BA 4RCYA 5KHOC 1JAIA 3TUJC 4IOJA 3SHWA 4LC0A 3I3SR 1NSFA 4PFSA 2V3CC 2GHIA 2H1LA 2OSBA 2EFGA 3OIVA 4PAMA 3FMIA 2WWWA 3GLFE 4LUCA 1KSGA 4RD4A 1IXRC 2CE7A 4PANA 5EP4A 4QJ3A 3Q7QA 3TSWA 3U6KA 1SVLA 5M04A 3WRYC 3CKLA 4M1KA 2AXNA 3L0PA 1SXJE 3KUDA 4DB2A 1QHSA 2D74A 2EFEB 1KNXA 3FVQA 1A82A 1K8RA 4Q7KA 1A2BA 4HLQB 4M2LA 1QHNA 4MUAA 4P32A 2BM1A 2ZJOA 4CYMA 1XU4A 2O8DB 4G5GA 3GJ5A 4D6PA 2OXCA 1XXHA 2Q3MA 1P4SA 4CT4B 5H68A 1S3GA 1YZLA 3WMGA 3ZZUA 3EARA 2VP2A 3RNLA 3ASZA 5DHAA 1EWQA 4WBSA 1X1SA 1X3SA 4LYAA 3P4YA 3O8CA 2V8OA 1G16A 3QQ5A 3I5YA 2KB0A 2F7SA 5EXXA 3R7WB 1TPZA 1XP8A 2QUZA 2WIBA 4HUQA 3MWLA 3ZZ0A 1JPNA 3IUYA 3M1IA 2NZJA 1GL6A 4B75A 2IBMA 1OKKA 4CRWB 5DN6D 4PHGA 3QKTA 421PA 1DBSA 2BJVA 2QQ0A 5F9HA 1Q44A 3NEJA 4HB4A 1FUKA 4A8JA 4PC6A 4H1UA 1GRRA 1P2TA 4TZ0A 1G5RA 3LBHA 3W34A 2MSEB 1E2KA 2ZUDA 1T6NA 1SXJC 2QNRA 5JHGB 3BB1A 1T0HB 1MO5A 3C15C 3GJ8A 2FDCA 2J0SA 1F5NA 4QHTA 3FOZA 3KXIA 1E9DA 4LJ4A 4Q18A 4FINA 2YHSA 2KWIA 1R2QA 2WWFA 2CE2X 5LPNA 1JR3A 5KU1A 1II8A 1G3UA 1M7HA 2FGKA 2OAP1 1N5JA 5CM9C 5SZHB 1JR3E 3RS5A 3EPHA 1P2VA 3TR5A 4NYJQ 3TQCA 1M7BA 4HAVA 2WSMA 3OF5A 5AJYA 1U90A 3AF4A 5JWHA 4FXPA 1S8FA 1JJ7A 3HJNA 3I73A 1EESA 4HB0A 4N0DA 4JLKA 2VHUA 2CCJA 4LV8B 1GNPA 3PUYA 1AIPA 2ZREA 3AVTA 3CRVA 1MABA 4M1OA 1D9XA 3SYKA 4DIEA 4ZV4A 1OIVA 4BGDA 2ZE6A 3K0AB 2BVNA 4IFEA 1R0XA 4B73A 4GFDA 5E7MA 2GK6A 2H8KA 1IOZA 5FL7D 1K5DA 3JVUA 3MAAC 1P9RA 4WXPA 2ZAOA 3LW8A 3U4QB 3FMOB 2NO0A 4XOIA 2QBYA 1O87A 2ZRKA 3T12A 1Y63A 3SYNA 1XZQA 5AR1A 3QXSA 3VNUA 4QGGA 1JQLB 3BOSA 1D6JA 4OK6A 1HTWA 1W0KD 2Z0MA 2ZYTX 3I32A 5FI0B 4RZXA 2PMDA 2V6IA 1DTSA 1AKEA 2BWJA 2J0VA 1E4YA 1DO0A 2V54A 4M4SA 4BASA 5TXGA 3QXCA 4UNQA 1G3RA 5IK2D 3R9IA 2HLDA 1NBME 4FI3C 4D82A 3MWJA 5JI2E 2J41A 2ANCA 1EFRD 4TTRA 2A5FA 3H84A 1KJYA 3TVTA 1G18A 3CPJB 4TYWA 2AX4A 4R2IA 4OI1A 1I4LD 2H16A 1XXHB 1W7AA 1X8JA 1SZPA 3KKNA 1W2HA 4FWIB 4JBWA 2GA8A 4MRSA 1IN8A 2ASEA 5EZ5A 3TW4A 4B6EA 2OCAA 3AEZA 2FE4A 1TADA 3THOA 4Q4HB 2VHJA 5GJCA 5JCPA 3ND8A 4YLGA 4TLEA 4TMZA 2CK3D 2ZI5A 4I1SA 1IN6A 4HB3A 3T35A 4YMSA 1Z2AA 2DWPA 4MQBA 2AK2A 1G291 1V43A 2SHKA 4D0NA 4B3BA 2JLYA 2JLUA 4EPRA 3X1YA 3AF3A 2F1JA 4C30A 4E03A 5L3QA 2P5TB 4M1SA 4LYFA 4LHYA 5FPSA 4DJTA 2BKUA 2C8VA 2R62A 3OE7D 1VCIA 2RHDA 1LNZA 1J99A 2HEIA 3TSOA 3WMFA 3OFNA 4TQUS 2F1RA 3EPJA 3THYA 1SVIA 2QN6A 4BEBA 2O8CA 3TNFA 4JIMA 2IXGA 4MRRA 4DXAA 4P3YA 2XX3A 4B2IA 3E1SA 1KHTA 4KITB 3FKSD 1S4QA 1VPLA 2YWFA 3OEED 4QHYA 1OPXA 3Q5DA 4E5UA 1ZCAA 2IYWA 2ORIA 4PQYA 4AKEA 1NBMD 1NKTA 5CJ2A 4CT5A 1OT3A 5FBLB 5HZHA 4QBFA 2PZGA 2ZS9A 4V0KA 4XVUA 1WB9A 4BZQA 4KYIB 4WZBE 1XPUA 4M9QA 1OH6A 1E2NA 3WBKA 3KQUA 1NL3A 2HF9A 1U0HC 3RVBA 4RD1A 3ZIAD 4MUBA 1W4BA 1T8TA 3CRMA 1UKVY 2BKEA 4RD6A 1WE2A 4QNRA 2PX0A 4Q1FA 2C9YA 4D4MA 1X6VA 1G21E 2P2LA 3TJZA 4GT1A 1XCGB 1NMXA 2J0UA 2WWGA 1XEWX 3W8RA 1G8GA 1NN3A 2JLWA 4M1WA 3AB3A 4BFTA 4ACBA 3P20A 4A6PA 1H8HA 1G8PA 1OV4A 4DHEA 1GITA 5EXPA 4Y0VA 4LWZA 2XZLA 4KJZA 2Q3HA 3K9NA 4LRWA 5J4VA 1P75A 4POAA 1SHZA 1E4VA 3AV0B 4W9MC 2QPOA 3TIFA 1NG1A 5B57C 3EIQA 2I1VB 2IEYA 2NPIA 1S1MA 4MDEA 1E2EA 5KNDA 2A78A 2ONJA 4M0LA 3AF2A 3SC3A 2YYZA 3SS8A 2CVHA 4PSKA 3SNHA 3UIEA 3HR7A 3MCAA 1YVDA 4DC9A 2IYYA 3UWOA 4Q02A 3ICQB 4PTLA 1SQ5A 5FUXA 3WMEA 1DAEA 4NYJR 3D8BA 2CNWD 4D26A 2IS6A 3CONA 3H2YA 4DCSA 1D9ZA 4M9ZA 3CH4B 4GBMA 1Q20A 4Z54A 3MSXA 5E95A 2F3RA 3U44A 3AVQA 1UF9A 4ACAA 5FI1B 2JGNA 4CEJA 1IM2A 4LCBA 4URVR 4QNMA 1UPTA 3ND9A 2ZRFA 3RRNA 5HCNA 3ADCA 2UKDA 2O8CB 4YONB 3AVPA 1ZUIA 1MO4A 2XTZA 2ZRNA 1E2GA 2O0JA 3A37A 2W6JD 1LVGA 4FMCB 2DFNA 1TUEA 3TUIC 2JLZA 3ZVMA 2JEOA 2EFHB 2WTUA 1XTSA 2C5LA 1E79A 4PPGA 3FWYA 5FOTA 1FL9A 4G5OA 2XOKA 4YMTA 4XVQA 4Q48A 4AKGA 3CH5A 2D3WA 2EQBA 1KI8A
chains in the Genus database with same CATH superfamily
4IZHA 2OG1A 1K7EB 4UHHA 1DXHA 2OPBA 4RDHA 3LVQE 1ZLYA 4V0RA 5ITWA 2AOTA 2Z57A 3JQ7A 5J4HA 2E4XA 1G20E 4P4TA 4AS3A 2O9JA 4KHPB 2X5JO 4NIMA 1R4NA 4MOWA 3K5IA 2H51A 1RQNA 1AS0A 1CDDA 1QGYA 2W22A 3GD7A 1OB5A 3EN0A 3WJ7A 2EIXA 4EUHA 2V6BA 1K2VN 1VKHA 3NYIA 4DQUA 4E1BA 5K7SA 2CLCX 1PTJA 1CQXA 1NRXA 3MT9A 1ODIA 1W34A 1ZUNB 4HNSA 5ECDA 5BN4A 4M1EA 4P98A 4BV9A 1RFGE 5ES3A 5KOYA 2XA1A 4GICA 2ECQA 1WCYA 4F8JA 1J5EB 2RDMA 5FR1A 4K86A 2RAUA 4EFNA 3I9FA 2QYTA 5TPZA 3L4SO 1A1SA 1OF1A 4L4YA 4MV4A 3QUQA 3PJGA 3FYSA 1A27A 1UQTA 4AT1A 5IABA 2LKCA 2JLCA 4UD6A 3HCCA 2IV7A 4HLNA 3EZ2A 3ZDQA 1VKZA 4B4UA 2EKQA 2BJWA 2C77A 3IAS1 2Q3JA 3ZE9A 4DC0A 5A4IS 3B7GA 1K4KA 1X1QA 1TO6A 3K0EA 2H31A 3RVPA 1GDDA 4CEJB 5K6AC 1S02A 1WMEA 1Y3DE 4IOLA 4MVJD 2P90A 4MCHA 5ALGA 1T2FA 3JYOA 1X19A 2XYPA 5I51A 4A0SA 3RSZA 1YDEA 1GPH1 1J20A 1MAHA 3VO1A 4ALNA 2CXQA 4YP5A 2X5KO 4PLPA 2WQ7A 2PTHA 1PTKA 3K9HA 3PFIA 1ACLA 2HJ9A 4P4NA 4Z4CA 5EXTA 2EVWX 2VNSA 5AM1A 1ESEA 1SUBA 4C7JA 3DFFA 1N5IA 5D84A 3E2IA 1VKRA 3NYQA 1YIOA 4ZQGA 4ZU3A 3L1UA 4NEHB 3S2ZA 4DARA 3NHJA 3ORFA 4HAWA 1KEVA 2I8CA 4WXYB 4FGSA 1Q14A 4D25A 1QRAA 4MQFB 4NH0A 4TMFA 5E1OA 4RPGA 2C4HA 2IXFA 2EC5A 3WYFA 3C3WA 4MQ4A 4CV2A 2VSQA 3FNFA 3K05A 1QYIA 2GI4A 1HDXA 1H8HD 4FZ3A 4HFMA 1UBMS 1V5EA 5E2IA 2HF7A 4BNHA 3UBTA 2VZLA 2D2IA 3RSSA 3AIOA 4BLOA 1CUWA 4WLFA 1E61A 1JS1X 4ZO9A 4YRCA 1H85A 2ZGVA 2X8WA 3HL0A 4R1TA 4YR7A 1E5XA 1JJVA 2DUWA 1ZK4A 3H6HA 4LZZA 4Q6WA 4KWHA 2WB2A 2G88A 3TGWA 2GCNA 3A6HA 5B3JA 3S1LA 3REGA 4R81A 1T26A 2H5LA 2VQ6A 4L4RA 4DL9A 1TD1A 4U5XA 1ML4A 4O3FA 4ENQA 5LUAA 5TF4A 2O8FB 1Z06A 2OWEA 1WVGA 3LQYA 4D9BA 3E5HA 5A3RA 3ULKA 3G2OA 1C50A 1DXQA 3GHHA 3IP5A 4UHCA 5KNBA 5L6MB 2GXAA 1KH2A 4FCCA 2VXCA 4GZ5A 2UDPA 4LQ4A 2EJWA 1ATZA 2P8JA 1M2JA 4H08A 1N6NA 4ARAA 4URXR 2CFTA 4GMDA 4PU0A 4ETWA 1T36B 4IHAA 2O3JA 3UMCA 2HCTA 3KOWA 2V7QA 4WY5A 2DQ4A 4BVEA 2DY0A 4BO7A 3HDQA 3ESDA 3UG6A 1VB5A 2I9KA 2GZ3A 2IYOA 5HDQA 1E3TA 4J91A 4QQ8A 3RARA 4F9EA 1W9HA 1YI1A 4HH0A 2GO1A 1Z6TA 1M2NA 2E18A 3GEMA 1U31A 4PYMA 1GQOA 2RI0A 3OOWA 5BOSB 1Y8QA 1WY5A 3UY4A 5LLSA 3MTIA 3VPHA 3KNZA 3ZDCA 1KK2A 4LSMA 5GIOE 3MGKA 4RVFA 5H0IA 2GCIA 4PG4A 2WE7A 2H11A 1Q2XA 4YRQA 3F2VA 2VATA 3X1XA 4ZDWA 3EQ8A 1KJJA 3A8TA 4HQKA 4AWXA 3K4HA 4YUZA 5IUJC 3U61B 3FNQA 5CHYA 4A0QA 1VKNA 1SAYA 4EF6A 1XPOA 5AJZA 3SCZA 3ZS8A 4TS3A 1WUHS 3ZI7A 1WP9A 2P65A 3O91A 3PF8A 4JVLA 3UFXA 5HKOA 1KVSA 3I12A 3MCZA 4MW5A 2C61A 1RHJA 4MJLA 3VSAA 2WWXA 4Y6LA 5M5BA 3GCDA 2FZKA 5JY6A 1AJEA 1TYCA 5CHEA 3FWZA 4HX2A 4E07A 3CHYA 5JRJA 4YAFA 2FX3A 4CMCA 4TLDA 3UF0A 3JVIA 3BB4A 2Q5FA 4HQ6A 1T5SA 3AHFA 4L8GA 3A4LA 3LA6A 1V6CA 1AGNA 2CVZA 5COBA 1KQNA 2GXSA 1VMDA 3AF0A 4EPYA 5E2BA 3WGLA 4RH0A 5DLPA 1IC6A 2VNAA 1OXXK 1A9QA 4OP1A 4H3KB 1BOFA 1R9JA 1J22A 1FUEA 1QONA 3U31A 1CPYA 1KTIA 1GDTA 2RE8A 1O1YA 1XNQB 3GAMA 1AXGA 5AJWA 1MVLA 4AIRA 4B8ZA 2P6RA 4KW7A 3BMNB 3QVGB 3PXDA 1UBTS 3FDZB 3OQHA 1G5IA 4UNIA 4ZCQA 4C7KA 3WNCA 3PEYA 3GUUA 2V3WA 3RW9A 4BC1A 2JIMA 4I3GA 4Q1EA 4XX1A 2W4QA 1L7DA 2D4HA 1GP2A 4ZO6A 3PRKE 5LBUA 3L6BA 5P21A 2WMOB 2XB4A 3SSOA 4EX7A 1YVUA 5F12A 3HY6A 1LY1A 2POQX 5DBFA 3TE7A 3UT5A 3NGMA 3SX0A 1NXTA 1EQ2A 5CH8A 2DFDA 3RRYA 5CDTA 2HAEA 3DV2A 4ZOQI 1GYPA 2HXYA 4OLBA 4XTCS 5JOQA 1QH8B 2C3YA 1DNPA 1L4HA 1LDNA 3V2IA 2JASA 4AF6A 5G3ZA 4XE5A 4C88A 3BTVA 1Q7RA 1WIWA 2H07A 3H2IA 3TOSA 3ZZNA 1YR2A 3ZHXA 1OTYA 2RGCA 1NFRA 2V7WA 2R1UA 3LC0A 3M3HA 1RI5A 2NX2A 1HUQA 3KVYA 5HZMA 1E92A 2HDHA 4O2AA 1I7QB 3M9LA 1RM5A 1NVDA 3R6GA 2AXQA 2KS6A 4XGQA 1QVZA 3MD9A 4YASA 3RVKA 2Y2UA 4E21A 5B2EA 2F9MA 1B0UA 3UXEA 3OQMA 3IDAA 4M98A 4DG9A 1ZBDA 1IWOA 1LRJA 2BSXA 3C3YA 3I04A 3QMWA 3G5TA 3RLFA 4KO4S 2VDVE 2V6MA 1GAXA 2ZAGA 1AKWA 5IAKA 1OYOA 2WUFA 2YOFA 4ZQCB 3D1VA 2D7JA 3R7FA 3H7AA 3GFRA 1G9XA 1U0TA 2X0RA 4NOKA 2EGUA 1ZD8A 4EL0A 1BGXT 1JE1A 1QVAA 1R0WA 1CLUA 2HK9A 3CMCO 2AFRA 3S2FA 3VTZA 3Q8XB 4GLBA 3RK4A 3ZUGA 4DRZA 4E14A 4EPWA 4PYJA 1J2EA 2R7LA 1T3ZA 1QO0A 3D0KA 4IFIA 5HYVA 5EIXA 3DBRA 4IDGA 1P7YA 1GV1A 3V1TC 3U09A 3DL0A 2VTBB 4TKMA 2R00A 3NEYA 4ID3A 4HNVA 2QSJA 2ZIZA 3QW2A 4HDCA 2A0XA 2AOUB 4DJ5X 1C1YA 3DG9A 4V1CB 5KQSA 3TUZC 1A4UA 1KEZA 3CRZA 4W1RA 2X1LA 1E1MA 3FVRA 4FHCA 1U2DC 2WYVA 1KO7A 3B9QA 3G2LA 3QG1A 5IJ9A 1VGQA 2XMCA 3FDIA 4NHOA 1OI3A 3K09A 3KZMA 4CTMA 3IVXA 1XRSB 4LE2A 2JCGA 1SA0A 1U2EA 2MYUA 2ZSUA 4Q3KA 1E99A 4KQ6A 1E9CA 1BFDA 1ONOA 2EIHA 2XIJA 5KTMA 1XJ5A 1B8OA 1K98A 2H1WA 1L9XA 1T6YA 2HSWA 3FTNA 4EUSA 4JBIA 1AD2A 3HXQA 2QRHA 3FSEA 1CR4A 2G7ZA 3UUGA 4XFJA 3WZLA 1E98A 4QAQA 4KPUB 4ECAA 4XXHA 4CFZA 2H2AA 3IUPA 4ROSA 1FP4A 3OZDA 1UJCA 2N42A 2OB2A 2H57A 1T8UA 1BA2A 4KG7A 4BNGA 1VRCA 4W7IA 3SYTA 2OV6A 4QFBA 3P52A 4INAA 4AJ4A 4YJGA 2WFMA 4QXPA 3PXGA 1DRUA 4B3XA 1R6BX 1UBUS 5G1PA 1HXHA 1Z62A 4ROTA 3ESYA 1Z15A 3U3JA 4RD3A 3DMDA 3PQ3A 1XVAA 4FJ2A 4MP6A 4NYMQ 1A95A 1XYYA 1GRVA 1ZQ9A 1GQQA 4EOGA 3NM5A 3NH9A 2PBFA 1M1XB 1ONBA 2GPWA 4LXTA 5F2OA 4KO3S 1VYUA 1G7TA 4OK3A 1OU0A 3MLEA 4TWBA 5K51A 3DAYA 3AIKA 1KA9H 4P82A 3BRCA 4S2UA 3FPEA 3FSJX 3QIVA 4P86A 1SOUA 1XRNA 1Z2CA 1NXPA 1GCIA 2P9BA 2HZ7A 1PO7A 2YRWA 3HNRA 4II7A 4PC1A 1FSFA 5IBQA 4KC0A 2EBFX 1TF7A 2OHIA 5DEIA 4EZIA 2DTDA 3OBBA 4MV7A 1HE8B 1QYCA 4I9HA 4Q01A 4WFKA 1TCBA 1XF9A 5B2FA 3W3AA 1NR7A 4GOKA 1FUIA 3NOVA 5C81A 3Q3HA 1IUKA 2DPYA 2VEOA 2YW9A 4AYWA 1GAEO 2QY9A 2CUKA 2OAGA 4RVCA 5EJ7A 4H4EA 4UNPA 2NAPA 4EJSB 3BBPA 4YJDA 3A7EA 4DDTA 2NU7A 2LGJA 3MUNA 2Q3DA 3EH2A 1OSNA 2GEKA 3N39C 2QVLA 3KR0A 3QBTA 3ZCXA 4D6XA 5CA0B 4KR7A 1T8SA 2AQIA 1UXKA 2N75A 4K9PA 1AQIA 1I8TA 1N7JA 1XOIA 4ZZ2A 4D6YA 3IXMA 2ZB2A 2W70A 2XMBA 1MRZA 5L7YA 3ANSA 1U9JA 3DWIA 1Q12A 4EG1A 2J9RA 2AWOA 4EO4A 1TIPA 1M8JA 1U3GA 4A5OA 1GZ5A 4DOMA 4PC3A 1KKUA 2OD9A 5K8TA 1U2QA 3O3MB 2N9UA 2P69A 4C0KA 3OQ6A 1G6Q1 5EESA 4TMYA 4I46A 2RB4A 3LUDA 1HEUA 1LV8A 1G8MA 4E2XA 2RGDA 5LP6F 1W1IA 1EXDA 2C0CA 3BIJA 5AXCA 4B48A 3K8YA 3MTDA 1GL7A 3N86A 2FPPB 2E5LB 5LQJA 4F2PA 2H54A 5DYIA 1NGSA 3ZWOA 7ADHA 3VAAA 1GL9B 1XAIA 3Q15C 5JXHA 5DM70 2DHCA 1VE1A 2BM0A 2UUOA 2DQYA 5ESWA 3HJRA 2ZYGA 3WADA 4UTNA 4MDYA 3HZZA 3KHTA 2QTRA 4MCIA 5F51A 4F3RA 3HR4A 4AECA 1SKYB 3WLLA 3U7IA 3EW9A 5B37A 2QQFA 4BBZA 4PZZA 5CB0A 2NZ2A 2ID4A 4C43A 3UMMA 1W4AA 2XBUA 1YZYA 2GZSA 1F38A 3D02A 4K2HA 4QODA 1XRRA 2IT1A 3PFHA 4PO3X 3FFAA 5LBTA 2QQGA 1JLLB 3S4YA 3V46A 1XDGA 2ZPAA 3KOXA 2VHEA 2WTNA 1UWCA 1BU8A 2BJHA 2Z2JA 3KOYA 3HCNA 1BA3A 2NSDA 3FHJA 2IOFA 4YT5A 1KVUA 5FWXB 1MV8A 1XYGA 4HLUA 1RTTA 4RA9A 1OYWA 4CVNA 2BMWA 4AS1A 3GGSA 1QDEA 2PT5A 1JVNA 2ZT7A 3KP1A 2ESRA 1IPFA 1HFEL 3DSRA 4I1RA 5C34B 4YIKA 3TMAA 1DBQA 2JJ1A 1FS4A 3QH4A 3AM3A 4FXOA 4WZAA 4I4TB 4QGFA 4DLBA 4LC9A 3KZOA 3K9CA 4BKUA 3AR9A 4TLBA 5IAAA 2R6CA 3AT1A 1KFBB 4WQMA 5LXTF 3Q98A 4GXTA 1S5PA 5JMPA 1VC2A 3NTOA 1RQ7A 4V24A 4OB7A 3PJRA 1YUNA 2H3HA 5LZ7A 1EZ1A 3MELA 2JFOA 4P2BA 3VR6H 3VJKA 4F38A 4V02A 1SG0A 4GSKA 1NHGA 1E9RA 3MWEA 5GIPE 3OQJA 3T7RA 4WESB 3OJLA 4FOSA 2GESA 4D96A 3A26A 4UEJA 2CHUA 2FK8A 4TVKA 3U7QA 1JLSA 1Y37A 1R0SA 2R7NA 2O3QA 1NTRA 1TECE 3PGMA 4FHDA 4GVLA 4MDHA 1N2JA 4MVJM 4IG9A 4C01A 1J25A 1M2OA 2OGZA 4G5HA 2HB6A 4L08A 4O4IA 5DYYA 5IASA 1KSFX 2XYHA 3FWHA 3J7TA 3NASA 3VR5H 2ZWIA 4F4UA 1L8OA 3LK7A 1N4DA 1UDAA 4DMHA 1GN9A 5JFGA 3B36A 4YMIA 2GZDA 5DO9A 3GT0A 5IX8A 4ZT7A 1T25A 1UBGA 3HSKA 5F77A 4U0KA 3EQ7A 1GUBA 5F3WB 1XQ1A 4TM8A 2RFLA 4QGAA 2DMRA 5CDHA 2I7XA 1NP3A 4UUQA 2XCQA 5B64A 3JYHA 3MK31 3M4JA 3SIWA 3QY9A 3ILXA 3UHPA 2AFHA 5CCEA 1DP4A 4TL9A 4I1YA 3GPCA 2ERCA 4KV9A 4QG3A 2WJ6A 4LTDA 1ZH8A 3M4NA 1LJLA 2WJIA 3MBKA 1LSUA 4H4CA 5IM5A 1SBHA 5DB4A 1R0YA 1NQTA 1JG3A 3DVLA 4B40A 1BMDA 2MCFA 1K89A 5KYYB 1ILWA 1CHNA 4JR0A 1RKVA 2WFZA 2RHRA 4BVFA 5J2UA 2HWUA 4LMPA 3H11A 4D9GA 2YV2A 3C6BA 3C45A 3EWNA 4BJHB 1SPBS 1V11B 1RWMA 2QG9A 4MS3B 1SKBA 3C8ZA 4TTSA 4BQSA 4LGVA 1EMDA 2WNHA 4EW3A 5K0ZA 3EEBA 1UZAA 2NNLD 3LTEA 5CA1A 3LUJA 1XXHE 1BXKA 2ODWA 5THKA 3WLRA 5ITVA 4D8UA 3QWIA 1PLJA 1I7DA 1USWA 4CM8B 1E5QA 2BI4A 2VP9A 3N1UA 4FD3A 4Q21A 3LHDA 2DECA 1BXGB 2FRDC 3BVPA 4EG6A 3LY9A 4DMRA 5C51B 3VMMA 2LD4A 1SULA 3D4LA 3TQQA 1RJGA 1X86B 3B51X 3S8MA 3SE0A 4TKLA 4D56A 5GONF 4MVCA 5HQJA 3UMYA 1X0VA 4S2EA 4C4TA 2AC7A 5D3MA 3HHPA 5IEJA 2OM6A 1Z45A 3L6EA 3AX6A 2PBRA 2FMXA 3UENA 4GKBA 4A8PA 4URZR 5HZKA 2QROA 4JEMA 3R9XB 4Q7JB 3EVBA 1NSTA 4B6QA 2NV0A 3O1IC 4BFLA 1DXOA 1IXSB 1XTRA 1KBOA 2OLKA 1IHDA 2Y9MB 3FNBA 4F2HA 5CFRA 2MSDB 2GM3A 4CUKA 2A3RA 4ZOCA 1YB6A 3OFND 2C96A 1XK6A 4IDDA 3P5SA 4QICA 2VPIA 1AQYA 5CB4F 5BUZA 4HMQA 3M5PA 3L41A 5CBPB 3ITDA 3O3OB 4R2WA 3RBAA 3H16A 1BRMA 1TKBA 4IHKA 3IP9A 5LZ5A 2P4QA 5L7WA 1QF7A 1L4YA 2PT7A 4FE3A 3MWGA 3LJKA 1KOGA 1IPEA 1NBHA 4ZZ0A 4E11A 1FMTA 1QK4A 1QOPB 2NYUA 4MVYA 5KYWB 3WG9A 3DQPA 4A4DA 1XZDA 3DZFA 4P0PB 2OV3A 5FBWB 3T3OA 1FVOA 5ECGC 3MWEB 2PS1A 4M87A 3LO5A 2NO7A 4KE6A 5IK2A 4FQ8A 3Q4GA 4J0CA 4OHYA 3TOZA 1CJKC 1MT3A 2CXOA 1L5VA 1RPNA 2IUEA 5ALDA 2YJTD 4A8JC 4KAXA 1HOXA 2QTFA 3NC0C 2OWDA 1EFRA 1X7ZA 2WHPA 3AHHA 3MQFA 3GGJA 2I76A 1N7IA 3RADC 1YUBA 3OZCA 1CUCA 3HCOA 5I9SA 4B4DA 1KZYC 2ZJZA 1CEYA 3PIIA 1J8MF 1QORA 3GP5A 4C06A 4ZMBA 2JBAA 1JBQA 2ZAIA 1CUVA 3W90A 2SNIE 3ON5A 4HRYA 1BDIA 1GUYA 3ENWA 3L7IA 2FW6A 1UOEA 5F1KA 2WAXA 2RH9B 2M2IA 2PA0A 1ZM4A 3ITKA 4I0WB 3TLGA 3TO5A 4AY2A 1KXZA 2QLBA 1NN1A 4P0TA 2AXPA 2H7VA 3F9IA 5LOVF 1MHPA 5A2GA 4LFAB 1DPGA 1YZVA 4KVZA 3K2EA 3D1JA 5LQDA 3RAEC 2D0DA 4JI8B 4P38A 4RNDB 3ASVA 4RYLA 4EVSA 4EGFA 5TR9A 5KWEA 4Z1MD 1OW3B 3PTAA 3K92A 1X2BA 1AQLA 1VIMA 2B5WA 2YHBA 3BCUA 3IT3A 4HDSA 1NLZA 2BEVA 1MB3A 1WXDA 3GJ6A 4OLJA 4O08A 3OQBA 2JJQA 3RRJA 4QSHA 1QIHA 1FVFA 2ODTX 3OBIA 4BP9A 5IXJA 1FLAA 4M8SA 2BGMA 1E7YA 1TVKB 2EERA 4KIWA 5LKAA 1JT2A 1ULTA 1CXZA 5FIUA 3ILVA 3HEMA 5U4QA 4HNHA 2ZJ3A 1FTNA 1W5EA 1XP5A 1SCKA 1P1RA 1XCMA 3ZY4A 4ILEA 2O05A 1EFVB 3U7RA 3TLAA 3I9MA 1Y6ZA 4RH1A 5EE0A 5LA6F 3AY0A 4KLRA 5K0BA 2JFYA 3MXOA 4OLAA 4NV1A 4ZAXA 4AY3A 3JWJA 1TTTA 1V3VA 3HYTA 2H1RA 1G21A 3CVYA 2H3EA 5FWNA 4ZN6A 3KTOA 2RK3A 3NX4A 4Q9NA 3S0JA 3OP1A 4P36A 1BFKA 4NTZA 1BX1A 4HEJA 4AP6A 4EHIA 3AWIA 1J0CA 4UCXA 4RTQA 1RTKA 2BF4A 2NWQA 3FVWA 5I45A 5I4IA 1X3LA 4ASUD 2OXTA 5HP4A 4NBSA 1IHXA 1X70A 2IS4A 3OTGA 1PT5A 1JG6A 2ZJ5A 1NMSA 1PSZA 1VG8A 3DZBA 3OZRA 3ORYA 3DQZA 4O4JB 5E4FA 1M34E 4JGGA 1H1LA 2GGSA 2OILA 3U7JA 3RM3A 5KYNA 2YWJA 4JWKA 4EVRA 3HXOA 4BRWA 5HRCA 3AI3A 2XEXA 1AKQA 4UE3S 2ZYVX 2PUJA 3O83A 4YHHB 2G4CA 3BB3A 2EBHX 4YAOA 2I33A 2B7BA 2EGGA 3I42A 3U16A 2P3OA 4A6DA 1L8AA 3CN7A 1SZCA 4YBZA 4G0WA 4M7RA 5T7BA 4CT0A 2CVFA 5IJAA 4IIJA 3ZWCA 2FSHA 4R8KA 5EGNA 1W49A 4RV4A 1YZUA 1W59A 3PD7A 4BUCA 3T7EA 3LYHA 4G4SO 4KFRA 3E9CA 3H13A 4H17A 2FPLA 2I6FA 2G28A 1VPTA 2WV9A 3VRHA 5CH3A 2QL7A 3LC2O 1U2TA 2QY6A 1KJ9A 3OJWA 3P2IA 3EJ6A 4WCFC 1WKBA 2Z9BA 4A0HA 2R6AA 2Q0SA 2ACVA 3KQYA 1MQAA 3EGWA 3LCCA 4KLNA 4G97A 4MW7A 5AW4A 1Z2PX 4X94A 5HUQA 3PKIA 1EFCA 4HN2A 4NICA 2KYRA 3U44B 5FTWA 3HO1A 2R00C 4ATNA 1WZNA 2HRCA 4ZHQA 3OLXA 2YASA 2IX9A 1XLUA 3ZWDA 4XWKA 4CIAA 4DR5B 1KJZA 4CV0A 1XXLA 3H19A 2R6R1 4QL3A 2XE6A 1L3CA 1TVKA 2A0WA 4P6VF 2HRZA 1PV2A 3RPEA 4XGNA 4YRSA 4B3MB 4QIHA 3C16C 1DXYA 4PVDA 2PFKA 4BNXA 1J1IA 1QYDA 1F1BA 4P7JA 4YJ3B 2VSFA 2Q2NA 1GN8A 1TVMA 1YA4A 3QVXA 4JQSA 1N0UA 3EZ9A 5HF8A 5DF1A 3K09C 4LNHA 3RSQA 1RAGA 5T41A 1VHWA 5BVGB 1ZNWA 4RUKA 4PRYA 4GP6A 4HJXA 4BMOB 5CNMA 1XZKA 1DTEA 5FBKA 1M1YA 5JCJD 2JD0A 2WRZA 1Y3HA 2B20A 3PHGA 5IG2A 5EFZA 2XIQA 2VYCA 1DCTA 4W1PA 2O06A 4BDSA 3OQPA 2C3UA 5JD6A 3I6QA 4DBVO 5JU6A 3CBGA 5EJIA 3UWSA 2NU6B 1PCXA 3AJDA 1E3SA 3IUJA 4V1CA 1C1DA 3I6MA 4FS8A 1AK9A 1QTIA 2A86A 3QK7A 4HYEA 1LVUA 5DP1A 3SR3A 4AY5A 4C7OA 5HEKA 1W9MA 4R7GA 1AHIA 3HR8A 4ZKEA 2ODPA 2DSNA 3GB9A 4UZSA 3QX3A 2W2QA 2Z5FA 5HCIA 2JJ2D 3GP8A 2D5LA 1SB8A 3MTBA 3BWMA 4UW9A 3IAXA 3AEQA 3WNBA 3PPXA 2II6A 1RLOA 1MG5A 2QUBA 4S1NA 4ZEXA 1I6KA 1OA1A 2QIOA 3RS3A 1K9SA 3MMXA 1J4AA 5JR3A 1N2CE 3Q10A 4OHFA 4ANFA 3H9JA 2ETXA 4EW1A 1Q0UA 2ERXA 5FD8A 1OI4A 5CYOA 3HM9A 1TQHA 3A1TA 2JIPA 1RI2A 1PR9A 3GVHA 4G6ZA 1U3TA 3VPFA 3E23A 1J42A 4FSHA 4I08A 2VOEA 4B09A 3PYMA 3IEUA 4H7DA 4HEQA 4NYMR 5KHAA 1EIWA 3OC6A 1SCUA 4RFSA 3OESA 5E7QA 1SC1A 4CQJA 1JIVA 2PT9A 2ZRGA 4DUPA 3ZQUA 2XNDA 1A4IA 2GJ4A 4YK7A 4BMYA 3RIMA 3KEFA 3HCWA 1KQPA 4RIFA 5ALTA 2R6DA 3V4OA 5JBNA 5AOAA 4Q9DA 2XGOA 2ATEA 5CYGA 2YHIB 4F4JA 3ZGZA 2QZPA 3KB2A 4GYJA 2WWHA 3RYCB 1FVHA 2GPYA 1ZICA 4JJKA 4J07A 4M76B 3HO6A 4CL0A 2RGUA 1DKOA 2PU5A 1DS6A 2OFOA 2QKYA 4YCNA 2VT6A 2Q7DA 4KR0A 5CT9A 3WZMA 3ZV7A 2EHJA 3CRRA 3BMQA 5LXTA 1E18A 2BL4A 4INJA 5D3MB 4UVDA 1NPDA 5HKKA 2Q41A 4JV5B 3A4VA 4PQFA 3LUHA 2D59A 2FWRA 4FYMA 3UXYA 3PX7A 1RPAA 1R18A 4MXDA 3DUFA 2J5XA 3BCSA 3P9CA 4CMHA 5GQSA 1RM4A 4DUGA 2A7XA 4GLJA 1Y8AA 4G0XA 1K7CA 4IVPA 1H2WA 3DCJA 4TXJA 1CNEA 3IAS6 3RHSA 1CKEA 3HV0A 1G8YA 4RHTA 3VR5D 3DVRX 1C80A 3KDAA 2TECE 3ZHBA 3ZIUA 1FP4B 1WOMA 4CLOB 5LDDC 3I9JA 1DO8A 1EQAA 4UUOA 2C5GA 1BN7A 1DKPA 2OBYA 4UMFA 2WA2A 3LDHA 4B32A 3GLIE 2OCYC 3DTVD 4Y7CA 4Y2SA 2AA3A 2ISSD 3OKAA 1GPDG 3KU4A 5L9AA 3I01A 1MA3A 3G8BA 1E4EB 3KZ1E 2RKBA 4O6VA 5FWDA 5K3BA 1CIJA 1JIQA 1XCBA 3JS5A 3NDRA 2VP5A 1B2LA 3GUZA 3A1WA 4KDFA 5DNWA 5HZGA 3RG2A 2X1HA 1RYZA 4HO1X 1MNQA 1U5BB 3T06B 3U4DA 1YZNA 3QBEA 1DV2A 3DMRA 3K6SB 10MHA 2O1WA 2IPNA 2ZU6A 3EPRA 3GYBA 1Y6GA 1KS2A 1D8TA 4E2ZA 5FV4A 3HBLA 4XQGA 2P9GA 1EUCB 1OAOC 2BI8A 2V6FA 4C3ZA 2X15A 3V4FA 3G0BA 1K8ZB 3FWPA 1VHLA 1KEEB 2ZRCA 3BXFA 3N2GB 3PFWO 4WKOA 4BQOA 3IBFA 9GPBA 3ADDA 1VP9A 3LWBA 2R7AA 2VHQA 2FPKA 1E9EA 5DE3A 3ASUA 5IUNC 3KOZA 1YJAA 5KZMB 4XD7A 3O1LA 4YDHB 3FETA 4YACA 5IMSA 2HI0A 3Q0EA 3GLUA 4ZI2A 2ZROA 4QVGA 1CDEA 1UDWA 4QT4A 3ROXA 3T5AA 3AEYA 4KQXA 3IJPA 1UEIA 1N9KA 3KSZO 3RKSA 1A9SA 3F5MA 2CW5A 4N8SA 4JP2A 4WI1A 3I0ZA 1PWEA 3NM4A 2C2OA 1XLVA 4TL8A 2KI5A 1ZUHA 3Q7PA 4CKZA 1X8LA 3HKEB 2E9SA 1UZLA 2IVFA 2BTQB 3HKCA 1PGJA 2H0RA 1DMSA 3AUSA 1NF9A 4J1NA 3LBAA 4ADSG 1REQB 2GJAA 4L9AA 4LHEA 5JYDA 4BJ3A 4MUYA 1RVDA 2Z43A 4QULA 5KOHB 2EJUA 2PRSA 3GEDA 4KODA 5EE1A 5KNBD 1QS0B 2P9QA 1YK1A 4MUMA 1Q77A 3FZNA 2WM8A 1L9KA 4PW0A 4QYIB 1NUHA 4GRIA 2BY4A 4YWJA 3ZVRA 4QQNA 4RVSA 2CKDA 5KX5A 4L8YA 4EYSA 1I1OA 3IOEA 5DCWA 4ZVSA 2I2CA 1LH0A 2ZCVA 4IDEA 2YHIA 5DM0A 2IIVA 2FPUA 2QMZA 3LDUA 3EUEA 2B7CA 1ULBA 5ECYA 1Y8ZA 3QYFA 3JAKB 4UCFA 2GKSA 3GGGA 2J4FA 3QU2A 5AHWA 3UXMA 3ZNQA 3WAJA 1I4TD 2HYDA 3L8MA 1DO2A 2QEQA 4NKRA 4ZDJA 5EVJA 2LZ0A 2XCSB 4S35A 5E4YA 3PHHA 3ZGLA 4AY6A 1H9CA 2G1JA 2AMFA 4FLFA 4LAFA 4YH1A 4H7PA 2ZBVA 5CU7A 2LIPA 2OB1A 2VUSA 3JARB 2IKQA 4H18A 4L22A 3TW8A 4JITA 121PA 4EHNA 3G2QA 4NHEA 2NSLA 2XUIA 3CF2A 4RWEA 2SKCA 3QKSA 1C29B 1ZLXA 5DTEA 5JTTA 1FUUA 1ZO8A 1LEHA 2OG2A 3HWWA 3VMFA 5U9CA 1V41E 4N4AA 2GBPA 3ZCQA 4K3VA 3QVLA 5K2MA 2D2FA 2ZVJA 3DHEA 4G5SA 2OOKA 3QQPA 1H69A 3CZ4A 2AHRA 4R40A 4RGYA 4WJKB 4HDOB 2Q5HA 3EOBI 3I8OA 3SOZA 3JQ9C 5JZ9A 2FMHA 1LX7A 3LAWA 2V1XA 4HGRA 4L57A 1QZXA 1BE1A 3EZ6A 1SBNE 2VPTA 4KYTA 4OAPA 5E6SB 4FLEA 5EEHA 2VDJA 4M1TA 2YQZA 3LRPA 1NQVA 4BVKA 1SOWA 2YUTA 1YJBA 5CEEA 4FILA 1Z47A 2XITA 1O58A 1W0JA 3W5BA 1Y48E 4BFSA 5JQGF 1RAHA 1L5HA 2O20A 2G76A 4RZ2A 3FCOA 3RFVA 5LMUB 5DULA 5TMEA 4PIMA 3NBAA 1T2AA 1UJ6A 4NAVA 4DUGD 3EZYA 1OXMA 1SHLA 2JVKA 1IVSA 1ZAYA 1PL0A 4YO8A 3ZGXA 1LSSA 3IIJA 4IKOA 5D3QA 3HC7A 4KNWA 4NNJA 4QTUB 2C1XA 1TEXA 1W44A 1Y8QB 4UU8A 1Y4ZA 4MZXA 3U4CA 2NG1A 1DKUA 4HLCA 4I4LA 3MQ2A 1I4EB 4HZGA 4DKJA 3DTVA 1MEEA 3EULA 3R3UA 4ALIA 5K45A 2A9RA 5BN4B 1JN0A 7ABPA 4O2RA 7MDHA 5IP5A 2ADMA 2J9GA 1RHQA 2HHJA 4Q24A 3W6ZA 2OBFA 2Y1DA 3QLUC 3W8EA 3WB1A 4KQKA 3ZHUA 3CLUD 5JASA 4HCJA 1KI3A 4EEZA 5JS8A 2ILVA 3OSUA 2IKSA 2MWMA 3VU0A 5DT2A 2AKYA 1GCOA 3QVVA 4RS4A 5DSTA 4YPOA 5CEJA 1E1QD 3FVVA 4BB0A 3GO4A 1BC5A 1JDVA 4OHKA 3T3EA 4ZVOA 5I4KA 1DDOA 1R8XA 2PMKA 1W19A 4G0MA 3NHUA 4X90A 1UJMA 4DNXA 1UPAA 5DHRA 4M9RA 2X76A 3R9KA 1JQKA 2G67A 1DG9A 2QMUA 2R25B 3KJNA 3R5HA 5A3VA 1FDRA 3ZJ5A 3LPMA 4HDQB 1ZRSA 5L3VA 2QP3A 3N3BC 3DE0X 4IYRA 2H2HA 4ZCIA 2I7TA 4JBGA 2PQ0A 5KYWA 4GRAA 5AKZA 4MRMA 4RV9A 1THGA 2XKAA 1L3IA 2WJHA 2IXAA 3FVTA 1VQ1A 4XCQA 2XXAB 4XR4A 3HO8A 1UJ5A 4XD7D 4W8GA 2OFPA 4ITUA 2VQDA 2PJDA 3AG5A 3FJYA 3GZ4A 4KIUA 5DN9A 5JMTA 2FR8C 3QFSA 4GYKA 2BFEB 5LU8A 4NCXA 3VJMA 2FUKA 4OGGA 2QSZA 4OFZA 3SDZA 3UYKA 1QE3A 3AERB 4RO0A 5AYVA 4EUEA 3MD0A 4X1YA 1HLDA 4HWKA 1RVV1 3RGGA 3SC2B 3U9LA 3RE1A 1IUNA 1LB1B 1QO0D 3TW0A 3ZDDA 4O2BF 5FPHA 1Z12A 3IJRA 4ZCMA 2R0QC 2X5OA 4QTXA 1P45A 5E6RA 2NUTA 3ZWXA 1GY8A 1GYRA 4KSBA 5CVJA 3ANLA 4CMAA 3TZKA 5E6RB 5BQXA 1ZD1A 1UIMA 1RYFA 4KIJA 3TZ6A 3FHTA 4QU0A 2PUTA 2VDLB 1I32A 4G5FA 1F8FA 1AHNA 5CFMA 1N2IA 5LP6C 4MQ5A 2CFCA 4J76A 3WGYA 3ZCPA 3DFMA 4JD5A 4F92B 3NFYA 1PWXA 1JEQA 2QG4A 2BFCA 4OJYA 1D2GA 4L28A 3EDQA 4WCFB 2XUQA 5HJ2A 5BSTA 3WZ2A 1RCFA 4CIVA 1T4DA 4AU1A 3CX6A 5JQGB 2R9VA 5BYJA 1XO1A 3GJTA 3ZWAA 5MGBA 3QF7A 7GPBA 1L7EA 3BH7A 2REQA 3ONVA 3ZY5A 2P7HA 3ER9A 3TLEA 2FSFA 3VO8A 5CEFA 2GPSA 1Y9JA 4LTMA 5EJFA 2ZXUA 1P7ZA 5JPIA 3M81A 4LWOA 3NV7A 4LI3X 1JJBA 3RHZA 2X1VA 2ZJYA 1Q7CA 1VB3A 2I54A 3MJSA 3R0QA 4L1KA 4L5IA 4PFJA 1FZTA 4B2IA 3RR2A 4H9GA 5DHFA 3PE6A 4DIBA 2YVAA 1PUIA 4BLRA 2IBTA 1JIJA 2ZQ5A 1L1RA 2AEMA 3LKZA 4J7AA 3ZWPA 1A7JA 5A4MS 2CHVA 1V5IA 1G2IA 1DC6A 1VJ5A 4TSKA 3VZRA 1EB8A 5IS2A 1L5FA 4OTZA 5JISA 1Y5RA 5JZOA 2DR2A 1U1FA 2J31A 2K2WA 2Z2IA 4JC4A 3LGAA 1BX0A 1V1RB 4KYVA 5BV0A 4KYUA 1UFQA 5AHXA 5F21A 3VYTB 1DBRA 3UKOA 1ZW1A 3LQQA 2ZSDA 3RTGA 1FJXA 2XB2A 4QFDA 3A4NA 4ZOBA 3TM5A 1NY5A 1C8KA 4LF4B 3DM9B 3LX4A 1C30A 3NJ4A 4FQ5A 2J3DA 3WGNA 5J47A 1T0IA 3RAPR 4IIEA 2IC5A 4J2HA 2ZSEA 3KAJA 1OZHA 4ZYUA 4CF5A 3QE0A 1QIMA 2VA9A 3W9UA 4KWIA 4LXIA 1QIGA 4DJAA 2QHXA 1V9CA 2P62A 1ES9A 2J48A 2OD2A 3AVXA 4DR6B 2D1QA 2P6OA 1TX4B 2A1UB 3PJEA 4WESA 2LKDA 4ZOLA 4U7TB 3ZCUA 2WDPA 5T67A 2EX4A 1P0PA 1GNRA 3A58B 1DAOA 2XUOA 5JLAA 1N7GA 4EM6A 1PL6A 1COWA 1AURA 3CR8A 3ABSB 3FLMA 4U2FA 4YUXA 4GUDA 3RJ5A 4HX5A 3QPUA 2OV2A 1YQQA 1KKMA 2GBCA 4B7ZA 1YONA 1RM0A 1ZUD1 3D54D 2WHXA 3GCGA 3GROA 1VG9B