2GKGA

Receiver domain from myxococcus xanthus social motility protein frzs
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
122
structure length
122
Chain Sequence
KKILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVDLSAGQNGYLICGKLKKDDDLKNVPIVIIGNPDGFAQHRKLKAHADEYVAKPVDADQLVERAGALIGFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An atypical receiver domain controls the dynamic polar localization of the Myxococcus xanthus social motility protein FrzS.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Signaling protein
molecule keywords response regulator homolog
total genus 45
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2006-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gkgA00
4Z4FA 2YHAA 4MGEA 1YTUA 4TLLB 5D2CA 4Z9AA 1JWLA 4XLTA 3KCNA 4MR8B 1F4VA 4RK7A 2L18A 4MR9A 1P6UA 2FXIA 1FFGA 3F7NA 2ID9A 3H1EA 3JVIA 1D5WA 4RZSA 3F6PA 4B09A 2RGYA 4FB4A 3SQNA 5CNKA 5BRAA 4LZLA 1RZRA 1KGSA 1QKKA 1RXEA 3EAFA 3F6CA 3OLWA 5BR1A 4JB0A 1NXPA 2CD7A 1JFSA 3IPAA 1JFTA 4ETMA 5JNWA 3C3MA 5KQLA 3H5IA 3QEKA 5C5CA 3HCWA 2PUFA 1YMUA 4YGXB 4JB2A 3HK2A 3HDVA 2B4AA 2RDMA 1Z15A 3EJWA 3CFYA 5KI6A 5KQGA 1ABEA 2R25B 4OG2A 5IX8A 1P8AA 4W5RA 5KC9A 5EWLB 5FWYB 5HSGA 1ZHHA 4P1ZA 1BA2A 3BREA 4H3HB 3FFXA 1EWVA 4DADA 5JNRA 1YMVA 5IUKC 1MAVA 3K4HA 1QP4A 1FFSA 3DZDA 3N75A 4NV3A 3MA0A 4MS1A 1HEYA 3QLTA 2I6FA 2JK1A 5TQ0B 2HQRA 4IGAA 2GI4A 2FQWA 3M6MD 1A04A 4RU1A 4G0YA 5IULC 1KRXA 4WWHA 4Z4IA 5C5EA 3NHZA 4RXUA 3OM1A 2TMYA 4DN6A 2JB9A 6ABPA 2E4UA 3LFTA 1D1QA 2FQXA 1DBPA 1DRJA 3ROFA 5KQMA 3H5WA 2PUDA 4OATA 2KYRA 1PHRA 4KK4A 2FN9A 2FMKA 4DQDA 1YK0A 4WXEA 4Z4CA 1K66A 1DJMA 3HVRA 4NQRA 4RV5A 3RVPA 2Q5CA 2W42A 3CKMA 3DLHA 2IOYA 2FTKE 4ZPJA 3OM0A 1J56A 1PNTA 4W5TA 2GX6A 1U2PA 3Q7RA 4RKRA 3D8UA 4IILA 3GL9A 3BBLA 3RVLA 3RVKA 1NXXA 4Q7EA 3D02A 2MSKA 4OTZA 3NBMA 2PUAA 4N76A 1P6QA 2E4XA 2OQRA 1LBHA 2FLKA 2FSPA 3QLVC 3KG2A 4JP1A 4N03A 5DTEA 4KV7A 4YP9A 1GCGA 2R47A 2PKXA 2LP4Y 2IPLA 4RS3A 4W5NA 7ABPA 2IYNA 2MSWA 3O75A 3HS3A 3O74A 4IRXA 3GA5A 4HNSA 4RY8A 1ZH4A 1PEYA 1ZGGA 4MQEA 3I42A 3QELB 4L4UA 3SY8A 3VNBA 3OQMA 3QELA 1YIOA 1ZAYA 3G85A 4JAVC 4MRMB 4XFKA 5IC5A 5ED4A 4PZ0A 4ZMRA 3NNDA 3LUDA 5CNJA 5FWXB 3QX8A 1DBWA 4QYWA 2PLNA 2WJAA 1LJLA 1ZH2A 1RNLA 1USIA 2JVIA 2V0NA 3GRCA 4RSMA 1FQWA 3SM9A 3VNAA 4XARA 3HUTA 4KRFA 1XHFA 3B2NA 3N8IA 3TD9A 1LBIA 3LUAA 3N0XA 1DG9A 2N9UA 4G0MA 5GOTA 3N53A 2LUOA 2VK2A 4KZKA 4IF4A 1M2EA 3TB6A 1OXKB 1D4ZA 4PYRA 2QSJA 4YO7A 5IEJA 5EWMA 1CEYA 4MAAA 4E7OA 2WRZA 5TPWA 1D2AA 1NXSA 5CNIA 1USGA 4G0XA 4KPYA 1JYFA 3O2QB 3MIZA 5TE9A 2PL9A 3QEMA 1PNRA 1DCFA 4Z4EA 3KLNA 3HDGA 2OENG 3O1IC 4MQFA 2CHFA 1BDJA 1QO0D 2VYCA 5FBHA 3A10A 4D6XA 4E7PA 4IMJB 4NCAA 4ZJPA 4Z99A 8ABPA 4MS4B 1A0OA 3CNBA 5EWJA 3OO1A 1ZDMA 4MQEB 3H5TA 2A9OA 1E6LA 3Q9SA 3RVJA 4ZMSA 4UHJA 3LUHA 2J48A 1Z12A 2MYUA 1FSPA 1GUBA 3S99A 2M1ZA 1CYEA 5TQ0A 1EWTA 4NICA 1ZY2A 1DP4A 1MB3A 3O2SB 4PE5B 4F12A 3FFWA 1M2FA 3TO5A 1C0EA 3QK7A 4RDCA 1B00A 2FEWB 3OMXA 5TQ2A 2NZUG 3FGZA 3IDOA 3OLYA 1Z2DA 4L85A 4TLMB 1JYEA 4EYGA 3LUGA 5BQ3A 1GLGA 5HM6A 3H6GA 1VPWA 4N0QA 4OLAA 1EHCA 1RPJA 1YS7A 3ROTA 1JHZA 2FMFA 2QW1A 5DKFA 5JNVA 3CZ5A 4D74A 1JLKA 1ABFA 3UUGA 2QVGA 2JCGA 3I45A 1U2QA 1RXIA 4MS3B 3N6VA 5JS2A 4G0QA 3RVOA 4KFCA 1E6MA 2GKGA 1E2BA 3ILHA 1M5UA 3HO1A 1NTRA 1SD5A 3O1HB 4QYMA 3HSYA 3JPWA 3Q7SA 4EYKA 3HJFA 2AYZA 1L5ZA 3TX6A 1FFWA 3O2JA 4TN5A 2HSGA 1DC7A 5FWYA 3C6QA 2A9RA 3DBIA 2A9QA 1U04A 2FQYA 4MR7B 5IUJC 4F06A 3OQNA 4MS1B 2PJUA 1JX6A 2JBAA 2E4VA 3EULA 5EWJB 3JTEA 2JBAB 2MSLA 4P98A 1ZESA 5JNSA 1RZRD 5FWXA 4RY0A 1H9CA 4G0PA 3KTOA 4PEVA 1Z25A 3JY6A 4LE2A 1EAYA 2X7XA 5T3YA 4EVRA 4HNQA 4KQ9A 2BGGA 3DGEC 2JRLA 4O5AA 3JVDA 3G1WA 3CLKA 1K68A 3H75A 2QZJA 2PUCA 1JFVA 1YS6A 1D1PA 2HQBA 4QICA 4XAQA 2L19A 2JVKA 2FVYA 5E3JA 4EYQA 3T95A 4NCBA 3MQ4A 2M98A 3UK0A 1Z17A 2IDMA 1Y1LA 2RJOA 3OO0A 4G86A 4OBBA 3CS3A 5EWMB 4ETNA 2PUEA 3M9XA 3LMKA 3H1GA 2HQOA 3QLUA 2WY2D 4RK6A 1Z13A 1QPZA 1NXWA 1NXOA 1VKRA 3CG4A 5KWSA 5HQJA 2NZVG 2JVJA 1BVHA 2HPHA 3LUCA 4F3TA 1VRVA 2QXYA 1ZGZA 1XWWA 3FFTA 3C97A 1U0SY 4EGSA 3QX9A 3F73A 2FMHA 5JS1A 2E4WA 1QNLA 4MLCA 2XDYA 5B3JA 2QVCA 4MQFB 4N47A 2PAFA 3MMNA 2PUBA 5DLEA 5TQJA 3RVNA 1MIHA 4H3KB 1KMIY 5BRJA 1SRRA 3HM9A 3JPYA 2FEKA 4MR7A 3NNNA 4PICA 1JBEA 1JH9A 1BAPA 3C3KA 4W5OA 3NNSA 2A9PA 1W9HA 2AYXA 3T6KA 2LBPA 2GWRA 2VUHB 3DLBA 3N0RA 1QP7A 3LKVA 4W5QA 3QLVA 4EVQA 1GCAA 1XHEA 1F51E 4MR8A 4JOQA 4KQCA 1NXTA 3URMA 4RK1A 3Q41A 2FEPA 1DCKA 2WMYA 1W25A 2H0AA 4CBVA 2LIVA 3CZCA 1QQBA 2ZWMA 1ISSA 3KHTA 2PL1A 2FN8A 3NHMA 2IPNA 3M9WA 3A0UA 4RK5A 1CHNA 4Z4GA 1SXHA 4G0OA 3HV2A 3RQIA 3LTEA 4JASB 4LE1A 3RVSA 1NATA 3BRQA 3CG0A 3OLVA 4MS3A 5IUNC 3EQ2A 1PEAA 4KK3A 4YR7A 3T8YA 4YLEA 2FW0A 2MYTA 3LUJA 2F8SA 5T7BA 3BILA 1WETA 4YRZA 1DC8A 2PE5A 2NT4A 2VUIB 5EWLA 2IPAB 1NXVA 1UDRA 4HYEA 4LX8A 3IP6A 3OLXA 2HJ9A 4KMRA 5HKOA 1LK0A 1VLZA 1YK1A 2ID7A 1BDIA 3KS9A 4MS4A 5I4CA 1C4WA 2E4ZA 3R0JA 1ZVVA 4YCSA 1L5YA 2P4UA 1Z16A 5DCLA 3L6UA 4MYRA 1TLFA 3KKEA 1Z2EA 4N41A 4MLDA 2GBPA 4EY3A 4ETIA 4H60A 3GBPA 4GPAA 1PUXA 2CWDA 3DGFC 2WB4A 5KC8A 4FE4A 4QPJC 5KQPA 4Q6BA 1JDPA 5TQ2B 1USKA 6CHYA 3EDCA 3MF4A 3GBVA 3SNKA 4LE0A 3H6HA 1TM2A 4YS6A 4WT7A 1TMYA 1I3CA 4RWEA 1DCMA 2FMIA 1E6KA 4RXTA 5ABPA 4HNRA 3A3KA 4KREA 1JDNA 3RH0A 1IIBA 3HEBA 2H3HA 2L2QA 2B1JA 4Y9TA 3HZHA 5TPWB 4F8JA 1APBA 1DZ3A 3RVMA 1AB5A 1M5TA 1KRWA 1YVUA 2QR3A 3O21A 4LDAA 2E4YA 3CRNA 4EVSA 3GT7A 3Q7TA 3A0RB 4RKQA 1GUDA 2FLWA 4O1IA 1MVOA 3EQZA 1EWKA 3H5OA 3GV0A 1OXBB 3MYYA 3OLZA 5TPZA 4S05A 1URPA 3CTPA 4Z0NA 3K9CA 3LKBA 4M88A 5F64A 1QP0A 1DRKA 3P9YA 3KYIB 4EYOA 3EGCA 1ZN2A 5GQSA 1SXGA 3LUKA 4XASA 4MPTA 3IP7A 2R48A 3IP9A 4O1HA 4RY9A 3FDFA 2MYPA 2CHEA 1Z18A 4ML3A 5PNTA 2WWVD 1ZITA 1NY5A 5DGCA 3E3MA 4ZYLA 4MRMA 1U8TA 3QLUC 4WZZA 3FMVA 4YV7A 2IPMA 3LUFA 5JNTA 2IKSA 1R8JA 1EFAA 2L17A 3OQOA 1DBQA 4GNRA 3CHYA 4TMYA 4G97A 3O1JC 3H5LA 3KJXA 4LRQA 4Z9BA 3E61A 3SG0A 1ISRA 3ILYA 4RXMA 4KNYA 1AB6A 3JS5A 2NUBA 4MR9B 3SAJA 2RJNA 3H5VA 3MM4A 5CHYA 1JF8A 3BRSA 3H1FA 2R4QA 3TMYA 1T34A 4XXHA 1S8NA 3N0WA 3C3WA 4YWHA 4LDZA 4G0ZA 4FE7A 4D6YA 3OMWA 2NT3A 3EODA 4WUTA 4JA2A 3KYJB 1JL3A 4UHKA 4RK4A 3RVRA 4Z4HA 3UKJA 2PUGA 5IBQA 2YHBA 4OLBA 5CNMA 4EUKA 3KLOA 2ZAYA 2O20A 1SXIA 4N0PA 1LJUA 3HXMA 2P9HA 2QV0A 3QEMB 1BDHA 3Q15C 3IPCA 2QU7A 3HUUA 5B3JC 1A2OA 3LOPA 4S04A 2LPMA 4IMIB 3W9SA 9ABPA 3T38A 2DRIA 2F8TA 1TJYA 3I09A 3GWGA 4Q6WA 2PMCA 1QQAA 1QO0A 3KSMA 1MB0A 5TPZD 3GYBA 4F11A 3L49A 1P2FA 1Z26A 3I5AA 2FKAA 2WJWA 4WXMA 3IP5A 4RK0A 1TVMA 1QMPA 4KVFA 2MYNA 3CU5A 5IEBA 3RVQA 5JNUA 5FBKA
chains in the Genus database with same CATH superfamily
1H2RS 2DY0A 2VHEA 1JYSA 1HTBA 4HDNA 5M2QA 4N4AA 1YTUA 4HTFB 2VH5R 1G8FA 3HU1A 4OREX 2YY7A 2YJNA 4EW6A 4MR9A 2W00A 2NSDA 4PWZA 4RVDA 2V98A 2Q3BA 2JAUA 3E27A 4M54A 1XP8A 3NYWA 4V39A 1Q19A 4D8UA 4AECA 2RGYA 1U3VA 1FF9A 3HFSA 4G56A 3DO6A 4OFZA 1RRMA 4P83A 4D1YA 1JECA 1H1DA 4GPD1 4PHGA 1YCFA 3QY0A 4EECA 4CQMB 4MP3A 1W88A 4QG7A 2YVQA 5KQLA 4ZXPA 1XMXA 4BVBA 4LOAA 3TUJC 4BNKA 2DECA 4QQKA 3OQIB 3E0QA 4FFMA 4K0RA 2BGUA 5DO9A 3WGMA 1PI3A 3PFIA 3RRBA 5C1DA 3DM5A 5LYJF 4CFSA 2QX4A 4CEIB 2V6MA 5ETJA 1IWBB 4JUCA 1T8PA 4X6XA 1YB7A 4V0RA 1AV6A 4K88A 1Z6AA 1Q6YA 3L7MA 2XMBA 5ESXA 5CBKA 3U09A 3M6VA 1Z2CA 3BD6A 4BO5A 5LZ8A 4WBSA 4F3NA 3MCUA 3HFRA 5F76A 3BXXA 3R5FA 5CT4A 3PRJA 4DFDA 1QP4A 3GJ0A 2GDJA 3SIWA 2PBRA 1XDBA 3IQIX 5J5VA 4LF4B 4LXHA 1EK0A 5B7QA 1CSEE 1I7LA 5GJWC 1PL6A 3ZHZA 3F4KA 2DQ4A 4URZR 2A4MA 1E3DA 3DWGA 3URKA 3C5HA 1U3CA 2EARA 3ZZ1A 2P1DA 5BMVB 2I2WA 4YCJA 3VU9B 1C29B 1JLHA 4GE0A 4UBNA 3T0GA 3TTTA 2WOOA 4C6TA 1FFCA 4YMSA 1Z0ZA 5T41A 2ORIA 3A1VA 3C1OA 1JFFB 1FP6A 1OV6A 1DBPA 2BGJA 3G2KA 2IE8A 3OKCA 2O2CA 3VDNB 4OATA 2IS1A 4HMOA 4CLXA 1N5MA 3QJYA 4HFRA 1AURA 2C3OA 4XGNA 1P9NA 1DJMA 5EY5B 4MDFA 4F2PA 3JAMA 3FPKA 2IOYA 1BH6A 2GTPA 2Q7DA 2VA8A 4DV7B 1PK7A 4PYOA 5LDGA 1EFVA 4IILA 4EFKA 2P1RA 2POCA 4RMJA 1P1IA 2B4YA 4XWGA 1R12A 1ZLXA 4RA9B 3ZBPA 5TLSA 3SIXA 4BXOA 1PCXA 4BKQA 3TLYA 2ZYSA 4UTNA 4DA6A 3WWYA 1R27A 3OURA 3FOZA 4DV3B 1P9LA 4DXAA 1PJZA 1KC1A 4MDHA 4I4TF 3DMNA 3KYBA 1A72A 5JXHA 2BGWA 4XR4A 2D8AA 3H84A 2IDKA 3DCYA 2XYQA 2YJTD 3NC1C 3LWBA 1D9XA 4F3YA 3S1SA 3TNLA 4FFRA 3QUTA 2WD8A 2H51A 2ODAA 3LF1A 5HIMA 5E7QA 1LBEA 2CXRA 5ALFA 4FP9A 2X86A 5IN4A 1GPKA 2EJBA 2WPDA 2P5TB 5ALIA 3OMLA 3LNCA 4MA0A 3LY5A 3DTNA 2RGRA 2Q9UA 4ZK2A 1THGA 4EF5A 1AK2A 1EFTA 3LLCA 4HEA1 3FCCA 4ZMRA 2NTYC 3EDMA 5CNJA 2VBFA 4BO8A 5IABA 5AVRA 1RWPA 1VJRA 2F43B 1M7HA 2EKPA 3QVTA 5DBGA 3RYTC 4DLXA 3VKVA 4O4JA 4RGVA 3GRCA 2V0NA 1FRQA 3MOSA 1WXGA 1TECE 1VFPA 1DX9A 1TVKA 2PV0A 3KIPA 3PZBA 4LRSB 1Z82A 4QU8A 1CEXA 2DFNA 4UFNA 3N8IA 1QZUA 2BFEB 1IMJA 1ZA1A 3GFBA 5DFAA 3K0BA 3E5RA 3H2IA 5BWMA 2BFCB 3P4UA 4JS0A 2QE6A 1XEAA 2DQZA 1CQXA 4M3NA 3FSJX 1FXUA 1K9VF 4OIMA 4U5QA 5LMNB 3UOGA 4AO8A 1XLWA 3ZHSA 1KO7A 1AMUA 4I4CA 1HG1A 1OXKB 2PH1A 1CEQA 2QSJA 4R3UC 2DC1A 3DUFA 2XCTB 1HE5A 3V9PA 1Q74A 1ENYA 2A35A 3CUVA 3KQVA 3HJAA 3ETEA 1L8OA 1WD7A 1KY4A 4I50A 4RPKA 1KAGA 1R9NA 5DLDA 3M3DA 3W1WA 3LJKA 4DUGA 3UXEA 2B61A 1J24A 3DKKA 3EVZA 3WGHA 4EGAA 1C9KA 1N0UA 3FR8A 3ETDA 5JSZA 2PUDA 2BHNA 4DZZA 1CZNA 1KEWA 2VYQA 4M98A 4E7PA 5KVSA 1Y48E 4BX9A 5JRJA 4REQB 5A05A 3OQBA 4ZPXA 2HOQA 4O2RA 3BXPA 2ZZKA 4MMZB 1MEOA 2P6RA 1Z83A 5AJYA 3VTAA 2JI8A 5SICE 5CBPB 4Z2YA 3SSNA 4N3GA 1L6RA 5BW8A 1Z12A 3QRWA 2Z08A 2V7PA 4F8YA 1FTWA 1XZNA 1GFSA 4NICA 4EEXA 5LNK1 1DP4A 1IHOA 2P3SA 5A3VA 4R1PA 1ESZA 2OMKA 3MW8A 5CYGA 4CEJA 4Y6OA 1SKUA 4PCAA 2NZUG 3IDOA 4WLVA 1DBIA 1NRIA 1YNOA 2IHUA 3EMKA 4UOQA 2X4DA 2ODTX 1QIEA 1NWHA 4TLEA 4EYGA 2XUGA 4BP1A 2GOYA 1XMVA 4KWHA 1U3GA 3WO1A 2JFBA 1JKMA 1FPMA 1X87A 3X0DA 2YN4A 3QVWA 1WVIA 1E1KA 1LF0A 2GLUA 4L74A 4ZT6A 5JMOA 2C00A 4ROSA 2QW1A 2OHXA 4G5FA 1PR1A 3HP1A 3MQ2A 4NSNA 5IT4A 5J2UA 3WDMA 1AQ6A 3SEAA 1IH8A 3PWSA 5DBFA 2N47A 2WKQA 3I45A 2IW1A 2ZJ7A 3Q11A 2JNWA 4ZU3A 3REOA 4HVLA 4KTTE 3ZZ0A 1V45E 4EH1A 4X65B 1V11B 1F14A 1G3QA 4HNTA 3OI7A 4RADA 2GZDA 1CC1S 3O1HB 5KEIA 3HJNA 3C5WP 2GRAA 2XMRA 4YGYA 1FFWA 1G2QA 2MSNA 2WWHA 3OAAA 4TN5A 4V0KA 1OR8A 5HEKA 1E59A 4JQZA 5IH3A 1QCDA 2V8BA 3DBRA 4B6SA 2FA9A 4GXNA 4IJ5A 2GJ9A 2XMQA 3WGZA 5IKOA 4BEWA 3OIVA 2RC5A 3OFND 5IUJC 5CYFA 1V7CA 4NECA 5J43A 4BTEA 1D0SA 1QTIA 1P0QA 2ATXA 3IB6A 3R5TA 1YDEA 4NZOA 2CLKB 2QW8A 5FL7A 2F1OA 1X7WB 5IVDA 1H93A 2WZCA 2QY6A 3ASUA 3CCFA 2RGXA 1OUMA 4HS9A 4P98A 1YOVB 3C5CA 2VTDA 4FIDA 5DVZA 3DZ8A 3A31A 2PVPA 1AHPA 4BEJA 4CMBA 4OXKA 3S1AA 4GX0A 2QTTA 1U4NA 1ECPA 3A3NA 3AZPA 3DGEC 3QE4A 4HTFA 4KQ9A 1C7RA 1V35A 3B9BA 3IXLA 3QPDA 4LQLA 5FYQA 3RUHA 4ZTBA 4DCOA 4TZ0A 2Y9MB 2DULA 2OD2A 3RLIA 5A62A 1RYBA 1I3MA 2B37A 4MQ4A 2PYZA 3OF3A 4XAQA 4S1NA 4OY3A 4NMHA 3V8NA 1WD5A 1TKAA 3P0IA 3THWA 2ZIFA 3BE6A 4FUQA 2G0TA 4N0MA 1X38A 3QI2A 4UHEA 5FI1B 2IDMA 4D9BA 5LPNA 4IQGA 3FPEA 3NVDA 3M9XA 3A6PC 1O89A 1WHTB 1R8SA 5HCUA 2CT8A 4LPKA 3H1GA 1EQUA 3A8TA 1BJTA 3VV2A 1TQ2A 3U5ZB 2CY0A 3G3EA 4ZDWA 2W2TA 1L5WA 3NH9A 3CG4A 4EYSA 4CEIA 1OBVA 4XWWA 3GGOA 2X0IA 3C87A 3JAKB 4FFBB 3ZXSA 5AO9A 2I4LA 2O5RA 3JD4A 4BEBA 5CB8A 4ESVA 5AR1A 2FUNB 2C5BA 2CJWA 3F67A 1ONOA 3H9EO 5LQNA 1S3FA 1BROA 1SRRA 1ZLYA 3CZAA 4RFSA 5IM4F 4OHCA 2AMYA 2R6ZA 5CX1B 3UFBA 3USCS 1E4EA 2JAWA 3ZWMA 3QTBA 4B75A 3BQ9A 3BWBA 4RMIA 2IEGA 1CUYA 5JH7F 1DAGA 4ZU1X 3N0RA 3TQRA 5JD3A 5A2GA 2X42A 4UNQA 1OWNA 4KPFC 2Q0SA 1G5HA 5CB4F 2H5IA 3O7WA 3PHGA 4H77A 4TVOA 5KDDA 3DMGA 3B6JA 1YBFA 1NAHA 2R9VA 2GCOA 3E6AA 5JZBA 4P54A 3UB2A 1XNGA 4C89A 2GN9A 5HZMA 2BBOA 4A0SA 5DHQA 2DP4E 2JJQA 4XX1A 2XOEA 3HVHA 3D8BA 4L08A 2C9MA 4ROTA 5DX8A 5B1HA 5ALEA 2B6HA 1GL9B 1GPDG 1RWMA 2FN8A 2PMWB 3R77A 3WK6A 2Q9AA 4MW1A 2ZRLA 3X1MA 3TRFA 4BWFB 4ARAA 5KU1A 4I8DA 4Q9AA 5JCOA 4C3VA 3CG0A 4OEHA 5C1PA 4HB2A 4K5QA 5GADl 4HDMA 1QE5A 2AZMA 3C7CB 5BNTA 4Y18A 3F6SA 1OPXA 1RTKA 1UIRA 2AW5A 3E05A 4G01B 1P2SA 1PZFA 2EJTA 1GKUB 3S6JA 3MJEA 5C5DA 4IHJA 4OJYA 1EP3B 3R5JA 5FUQA 4QLOA 5JU6A 2DBZA 5EQTA 2F8SA 1OKKA 5CVEA 1BX3A 1H9AA 1KZ9A 3NV9A 3R3WA 1JMVA 1WQ1R 3E7PA 2IITA 4DSUA 4EHIA 2OLKA 1EFRD 1U4SA 1CUZA 4IHQA 4G09A 2IPXA 2IPAB 3P2IA 3WMEA 2Y0PA 3HWWA 4EY6A 2WQZA 4R51A 3FUVA 4BMSA 1JIIA 4LCBA 5HKOA 1DDGA 3ONVA 1D6MA 1OXVA 2BE9A 2FI1A 4BO3A 1W7AA 1JJ7A 3I05A 1GSOA 3BGIA 2ATVA 4MS4A 4O02B 3BE5A 1FFBA 3ZK8A 2BTQB 2WIBA 2O1WA 1XDUA 1U7DA 3IRUA 4G0VA 1NFQA 4JVLA 3L7KA 2HA3A 2JHFA 2WZDA 3CCBA 4HZUB 4Q7QA 4UARA 1KYQA 4OJTA 2ZRJA 2GBPA 4JCOA 1YFKA 3UH0A 3LDGA 2ZI6A 4M83A 3VU0A 1T0UA 4JD5A 1LC3A 1VTKA 3DMHA 1UWCA 3HGQA 3GAZA 5JHGB 1YZHA 1ZD8A 1IAQA 4QYIA 4D99A 4Z3OA 1JXAA 4FEYA 4BL5A 4BQIA 5A2QA 5EIOA 3LYHA 4US0R 1USKA 3BFXA 1M7GA 2OFXA 4G25A 1X7DA 3GJ3A 2IU3A 3R3ZA 4YS6A 2V7QA 1RKQA 3R9XB 1TCUA 1YTLA 4ENQA 3MQFA 2IYZA 3QVLA 1OBOA 2PGXA 2OO5C 3IHWA 4OH1A 2XEXA 3BMNB 4AZ3A 2B35A 4C43A 2HRZA 4J9UE 3IE1A 3THXB 3DEAA 1VGVA 5LP6A 1TEHA 2FRXA 4LMRA 1KGDA 2FUCA 1SNYA 1A71A 2WF7A 1TLLA 4YI3A 2GEKA 2VJNA 4J2OA 4AF6A 2CNOA 4OHVA 1AB5A 4DXHA 1KRWA 1H0HA 2W8ZA 5F23A 3TD6A 4HZIA 3L0YA 1ATIA 3A14A 4PAOA 4YJ2A 3AF6A 1YQGA 3GEDA 2BCGY 1GUDA 5EG5A 4V0MA 1DQPA 1EWKA 2FF7A 2LKCA 4ZYWA 3GLFE 2CXNA 1F20A 3M89A 2OV3A 2N0SA 2RI6A 4H1VA 1U8EA 2AB0A 2P75A 2VYND 4MXDA 3U61B 5CH8A 4ZJZA 2YUIA 5AUQA 4ICIA 5HOEA 2CFSA 1FMCA 2VKTA 1ZRHA 5KTMA 3ICEA 3G5MA 3O8LA 4A16A 2FPXA 2QUHA 1PJBA 1QZ3A 1RQPA 2QX9A 4LG1A 4DA8A 1FFXA 5E9AA 5HKLA 3SLRA 4BLPA 1NV8A 2QN6A 3ZY5A 1V96A 3CRW1 3A6FA 3LUFA 1QX3A 5BN3B 2HQSA 2J0SA 1S3GA 2BVNA 1EUDB 5EC8A 3KQQA 3A1SA 4CE6A 4DE5A 4CKCB 5K8LA 4P3NA 4S1TA 1KEEA 4X95A 3OQOA 2PKQP 2REXB 5DTQA 1ZR4A 3AL3A 1PQ4A 2D1RA 2CL6X 3JS5A 1VE5A 2WAMA 5KNCH 3RF7A 4CF5A 5KCMA 4P0TA 4CMJA 3DE1X 2XW6A 4LWOA 4OHOA 1KJQA 1T34A 2BMFA 3QVXA 3W3AH 5B58C 2C5SA 5FLXA 3FE2A 4PN3A 4EUSA 1H6AA 3SQMA 2IHZA 1D3AA 1M2OA 4L57A 1IY2A 4GOMD 4I36A 4QELA 3R8FA 3F5DA 2ZTVA 4HWSA 2JBWA 3O2NA 3DT8A 1OX5A 3T0FA 3GA0A 3ZYCA 4ILEA 3GIWA 2Z2XA 1R6DA 3RVRA 3VJMA 3VSCA 1RJ9B 2B8WA 3EPLA 3G0HA 2AMJA 3KYCB 2PANA 4OOEA 4QRHA 1BXKA 4ES6A 3QEMB 3DYBA 4K2HA 3PXGA 2I8CA 3GZNB 3UHFA 4DNPA 1ORVA 2ZSUA 2KW5A 3NWPA 3LOPA 1LCIA 3EXHB 2DR2A 1LTQA 1XE3A 2H2FA 4L27A 4GEKA 9ABPA 1D2HA 1DJPA 2VCEA 3OC6A 1DC5A 2ZBVA 2V1UA 2F8TA 1AKNA 2OQIA 4HWPA 3OZIA 4F96A 1XN4A 4YACA 5CD1A 5A3JA 4I6EA 2OILA 4Q4DA 4N12A 2VRWA 4Y2PA 4MIYA 5D85A 4ZCRA 4ZFNA 5KB3A 5GJVC 2Y27A 4NMXB 4A6PA 4RZ2A 4CUKA 2D00A 3L1UA 3HCNA 1QKIA 3ORQA 4QOSA 2QTVA 1YJQA 2XQVA 4KKVA 4BVGA 5BVGA 4JI4B 1PHPA 1W94A 1DL5A 2X9QA 2RHHA 4RK7A 4OUDB 4XCVA 1Y7HA 4ZEOA 4DIBA 4ZI3A 1ZU4A 2XLBA 1HNWB 1Z62A 2ZRIA 4HDOB 1OXTA 3HYRA 4H6XA 2P4EA 1RDFA 2VPXA 3HCEA 4K3VA 2VWQA 3TVTA 1GGHA 3N8GA 3WK9A 3YASA 3DBLA 2XCRB 1XPUA 2FSSA 3DV0A 5D00A 2G40A 4RTOA 1EBFA 3HI4A 2I1QA 3A7EA 2H29A 3LCCA 3IYLW 1JFTA 4PYQA 3T3DA 1NLZA 1V9LA 4JHLA 3O9ZA 1Q0UA 4M2LA 5FX2A 1T0HB 1E60A 2DHDA 4BPBA 4IVQA 1U0RA 3N58A 1Y4UA 4NBUA 2H5LA 2YS6A 1T36B 5K0FA 1NFRA 3CFYA 5AWFC 8ADHA 5KJ1A 4UVIA 2PX6A 4G85A 1ABEA 5KNBA 3ILVA 4OG2A 4MV8A 1K5PA 1E5QA 2IUSA 4FGZA 5JY1A 4Y8VA 1CUEA 4JZYA 3A6EA 1PR3A 1FBNA 1Q0QA 4UM7A 4JY7A 1IVNA 2DWQA 4HADA 4JLBA 2IXTA 1PDWA 5HZKA 2CNWD 3IIKA 1AUPA 5BV8A 3BXGA 4D3YA 1QYDA 3ZJTA 4YJGA 1RKBA 3SNHA 1E61A 1H94A 1NBWB 2JFNA 2O2HA 4A6EA 5FH9A 1KKUA 2I2AA 5JYDA 1SUAA 1JB1A 1SU7A 3CT6A 3TG2A 2FX3A 4U39A 1UBTS 1G21A 2QUKA 4ZJYA 1A04A 4GP9A 5IH7A 2Z4SA 1F2TA 3AG5A 3EZ7A 1V6SA 4W9NC 5AW5A 1SHJA 2G5GX 3PNSA 3PNQA 1SUEA 5AM4A 1J8DA 3CA8A 3JU3A 4GKVA 2ZBDA 4H2DA 4QBGB 3VHQA 2QLFA 2GUWA 3L7OA 4DQDA 2EJVA 3TBKA 2OAP1 3B7WA 5FOSA 3RC3A 1GTJ1 3DO8A 2UYHA 4YRJA 3FPJA 2W42A 3DLHA 1XU4A 1YSCA 2R2AA 4L78A 3U4MA 2OB2A 3IKJA 3ZWVA 4W5TA 4MI9A 1TVEA 4X3OA 3TLZA 2RHRA 4MB2A 1N92A 1RYZA 4JJGA 3H5RA 1GPUA 4DIMA 1JSRA 1QE0A 3P0FA 5B58T 5KNBH 3HJHA 1HM5A 3L43A 4PIPA 1V5EA 1CZKA 4HEJA 3UYKA 1KJ8A 4R9RA 3WIEA 2GAOA 5FPYA 3VC7A 4DHEA 3FJ1A 3KR9A 3PPIA 1N5LA 1GNLA 2GBCA 5CAEB 3ZD7A 4N76A 1EE2A 3PL5A 3WIBA 4FE3A 4DDHA 5DTEA 4G4SP 4X8OA 3RT9A 2OFOA 1NUQA 1TO2E 2BUAA 3DG9A 3LBAA 4DG5A 1Z56C 4J7UA 5H80A 2ONYA 3BRWA 3UAYA 5BPHA 1EVZA 1PZGA 2B2XA 1TCVA 2H0RA 3I2KA 2HF8A 2PZEA 2VK1A 2X15A 3GVCA 3LHFA 4BNLA 3DWIA 4EKNB 5LQKA 2NP7A 4KGVA 1KSJA 2ENWA 1Q6ZA 3FI9A 3U1TA 4EJ2A 3OFKA 4G23A 3AM4A 1HG0A 4IIUA 2I71A 3MS7A 4PZYA 3WX0A 3L6OO 1M2VB 4X54A 1FFYA 3SSAA 2JG3A 1F6BA 2PZKA 2WU1A 3V4OA 5K09A 4KE9A 5BOVA 3EH1A 4BMDA 3OTOB 1DBWA 1TUIA 5EE1A 4TWRA 1S3IA 3FZEA 2AG5A 5LP6C 1BVYF 3FTCA 4C78A 4O4JB 1Y6RA 5ER9A 4MUJA 4XARA 5C4IA 4FINA 2AHOA 2X3FA 1TF7A 4IRUB 3BJIC 1U8XX 3B12A 1E79D 3G0DA 3PQ4A 3RWMB 3WP0A 4F3RA 2X23A 1Y9JA 3EQ7A 2F1KA 4AJ2A 1ILEA 1T6BY 1LF5A 3ZV5A 4JELA 3TJRA 5K20A 4KIUA 1J6UA 1VL1A 4ID9A 5D51S 3FRHA 2C03A 2H1VA 5ALHA 1RZUA 3RU3A 3S1LA 1QDUA 1EUYA 1IY0A 2O5CA 4R69A 2X8JB 5IYZF 2WRZA 3OIWA 2PSFA 3PQFA 1DLIA 5LZ4A 4MYSA 1E9AA 1D5CA 5CDGA 5ENDA 3V6MA 1QQ6A 4MIOA 1JJBA 2X41A 1DJLA 2Q5JA 3RIXA 1HYEA 3ZU2A 3HYCA 2G4LA 3RODA 3DLPX 3JQAD 1R5NA 5JI3E 3TDKA 4LDRA 4B8ZA 1KAEA 3F6YA 1AY0A 1IAVA 2FGKA 2JLWA 2YWCA 1G8MA 1CRQA 1S2NA 1YQXA 3TKLA 2JA1A 1ZDMA 4HUJA 4MVCA 1KH2A 1JEDA 4AX8A 1EYZA 4ZMSA 1WW2A 2BFDB 2I54A 4J3FA 2JK0A 4IOJA 3I3SR 5TNXA 2Y0DA 4MJXA 4C6RA 5M04A 5K3OA 3T34A 2JI9A 1MABB 3VR3A 3O95A 1MO6A 1B00A 3OMXA 5GWXA 3OLYA 4L85A 4WNAB 2O05A 3NEAA 5AXCA 5TMEA 4QPNA 1N6OA 4FBMA 4YRSA 3ELWA 2B34A 2AOXA 1A2BA 3UQYS 1MX3A 2SCUA 1H22A 1IG0A 3DR3A 4MWGA 3ZX4A 4HAWA 2YQ5A 3CO0S 4HLUA 2DU8A 3JAWA 1DC4A 4ANFA 4OOFA 1HE4A 3KUXA 4TS3A 4C4AA 2B83A 2FJPA 3PQEA 4UDOA 2W2OA 6GPBA 1JU3A 5H3CA 4F7WA 4IGEA 2F59A 3CE6A 3FETA 1Z88A 2BMVA 3CX3A 2XNSA 4H1TA 4RTRA 3DEKA 2G4CA 1JKJB 3R5HA 3MOIA 4YLGA 4V02A 3IBSA 4KUHA 3WWDA 1GRCA 3K5PA 3HO1A 2GPNA 3K0AA 1XZQA 1SD5A 1QCCA 1AQYA 2LVBA 4KIGA 4YDHB 3JPWA 4B71A 4U2BA 2PFGA 3QKWA 5K3DA 3HJFA 3PFHA 1QTNA 2ODPA 1AGRA 4QBKA 3EW9A 4MO9A 721PA 2YC2C 1RJEA 4DRXB 5T3UA 2ZR9A 2PGLA 1XDDA 4F4CA 4P2GA 1HA3A 3MLBA 2JL1A 1CZUA 1Z07A 2E4VA 2WR8A 2OCDA 3EULA 3MYRA 1W59A 1E64A 1R0WA 4GS5A 4QFDA 3DFUA 3KSAC 1VC2A 1DXOA 1NMQA 3CCCA 4LCEA 4FMDF 4YMWA 5KVQA 3VR6A 4Z5XA 3M6UA 3OZGA 2H06A 3I0MA 2XEDA 4TS9A 5H68A 3HZRA 1P2VA 3LOUA 3H2JA 1OX4A 1YGPA 2EKDA 1WEKA 4RY0A 1KDZA 2BP7A 4LE2A 3USZA 4PGGA 1SCUB 5ED0A 2HK6A 3F8SA 1P1KA 1DJQA 1IBSA 1NBOA 1R5JA 2IDZA 3IMKA 2ZB2A 1XEFA 2Q0XA 3OY2A 4PYKA 3JQ7B 3EUEA 5F7ZA 4IIGA 4A10A 3NFYA 5EA2A 1TOAA 3ZLJA 2YNMD 4IDEA 3BIJA 1RHUA 3P9CA 1JVNA 3AVOA 3KR1A 3W5UA 1X42A 1UK8A 1D7OA 1NRWA 1V47A 1W52X 3EC7A 3I5MA 2XODA 4LYAA 1OH8A 2VUTA 4ZT2A 3LY7A 3IELA 2ATIA 1KJWA 4Y2VA 3UA3A 2ZIGA 1EK1A 1KQ3A 1US8A 4ENRA 5JFTA 5DHUA 5CJJA 1H8EA 2PZGA 1FMJA 4IUYA 3TKAA 2YVLA 1KEVA 2PZMA 3U39A 4M99A 4YXFA 3PR3A 3ND7A 4RQAA 1ZGZA 3S55A 3KD3A 4HFMA 3V1LA 1C8KA 4MLCA 3DV2A 3PFWO 4QOJA 5J2UF 1O7JA 2PAFA 1O1YA 3NHUA 5HJ5A 1XRRA 1P1JA 1MIHA 1MU0A 3X1YA 4B3IA 3FDZA 4D9EA 2X0NA 1RAHA 2AI2A 5MFPA 4O08A 2G1PA 4FHZA 1ISHA 4W6QA 2UUPA 1G1MA 1N5OX 3EWSA 1BAPA 4JYBA 2IHTA 2Q5HA 3RS3A 3G79A 1QBGA 2EW2A 1F2TB 1GAXA 1Z5VA 1VE6A 4IO1A 4ZCPA 4HGOA 1A2KC 2AJDA 1Z7WA 3AEZA 3G5UA 4R83A 2ZRFA 4RKWA 4UHCA 1JNXX 3PJEA 3H87A 1SC1A 4MW0A 5FEUA 1XHEA 1L8QA 2IGBA 2JJ8A 2W5UA 3U7EB 3DHEA 3ZU4A 4DQVA 4X61A 5BUSA 4JROA 3PI7A 1KJNA 2JANA 1Q21A 5C8YB 5JWOA 3PEFA 1YD7A 2C04A 3S2SA 3A9WA 3RC1A 1RHMA 2QY9A 2NGRA 1TUEA 1GU7A 4AJ9A 3ONFA 2J0UA 1E3JA 2ORWA 4GZ3A 7REQA 1XTRA 4KW7A 1YBHA 3LTEA 4MUAA 3HXOA 2NV2B 3DXZA 1KP2A 1DO0A 3BRQA 2VYVD 3M1IA 4HG2A 3SEQA 1NNSA 3N2GB 4K6CA 4NVRA 5HMMA 3V1TC 2HN9A 1MT3A 3EQ2A 3TFQA 4BDTA 2G7ZA 2EFYA 4BNHA 5B2EA 5H4GA 1A27A 1RACA 2GCNA 4H7PA 3T8YA 4ISCA 4D45A 2XUPA 3EDOA 4Y2TA 3BK2A 5T7BA 4IWYA 4ZC8A 4IHJB 1CUUA 1UBMS 4DUYB 5EKUA 4M9CA 5HUHA 5AW0A 1E2DA 4E5SA 2HRQA 2Q1SA 4WHMA 3D3KA 1IEXA 2JI6A 2YZKA 3ANSA 4L15A 2OAGA 3D8HA 2CL7X 3ROQA 5K0EA 1C4WA 1KQOA 4X6YA 1G55A 3H5NA 3OEED 1PD1A 4Q3BA 1M2VA 1OZGA 2C9DA 2P8JA 2XMDA 1A7AA 4NMLA 2F55A 3BD7A 1J33A 1TCCA 1PX2A 1ZNYA 4Q21A 2VXOA 4R1UA 5CHEA 4QOEA 5K7SA 2ZIUB 3ODPA 1RP7A 1SOMA 2C77A 5E4JA 2QMZA 1X7GA 2VSXA 3B5EA 4QD3A 5EXPA 2JLQA 5EZYF 1IUPA 3RYHB 4B3BA 4EITA 3T5AA 1ZMTA 2WHPA 3QKSA 5IJWA 1IMOA 2R79A 3E58A 5BP7A 3K35A 1GQ2A 1F7UA 2Y0EA 4QDKA 5DF1A 1ZCAA 1WF3A 1DC3A 2C8JA 4I8IA 4MP6A 4BN4A 1LV7A 3M6LA 1IPHA 4XZ3A 3QENA 2XB9A 4FDMA 1I3CA 3ZK7A 3QU2A 1E6KA 4OFWA 3EX7C 4XGRA 3GGCA 3KTAB 3OOWA 4X3PA 3QGMA 3L79A 1YL7A 3A6DA 1JDNA 2K6GA 3A26A 3OCWA 1EIWA 2CXQA 1Z35A 4PTZA 1IIBA 3FVQA 4ND5A 2P65A 4XSHA 2DM6A 521PA 1W35A 4DM3A 4XW2A 4L73A 1XPJA 4M21A 4CIYA 4YJFB 1DAPA 1ZM2A 2HHAA 3NUGA 1VA5A 4MWSA 2FN4A 4ARBA 5JLJA 2JIRA 2CBXA 5JDCC 4CV2A 2BTEA 4QIHA 1R8XA 1ZGJA 2QX7A 1TD1A 1Y3BE 3PFCA 4H18A 1DFGA 1VG9B 2X8AA 3GFOA 2XWQA 2XX3A 3TLKA 4HX5A 4QGBA 2HNAA 4QTXA 4F21A 1L7NA 1URPA 1LPOA 5BQXA 3UPTA 4AO6A 3PTAA 4B7ZA 4NDZA 4IDOA 4CM8B 1ANKA 3PYXA 1GFIA 4BNMA 3DKPA 2OD7A 1V0JA 3PHIA 2QUAA 2BWJA 2HO5A 2DPMA 2G80A 3ZQJA 2XECA 1L4UA 2PKCA 3HNOA 4B6EA 3KKPA 5PNTA 2ZYWX 3MINA 4E94A 2WSSD 3BT7A 4D2IA 1T0JB 4DYDA 1PBTA 5E6SA 4F4UA 1EVJA 4ALMA 3I12A 4MO2A 1JHOA 1YASA 2D54A 1EE9A 4UVEA 4BKMA 2OCXA 4FHDA 2RAPA 2B5OA 1GDHA 1GN9A 4P4GA 4WCVA 3H5LA 3NQ41 3QNMA 2FG6C 2VT3A 4NULA 2YW9A 4OXRA 3SAJA 1Z37A 2BKAA 4UXJA 4XDGA 5E1DA 3Q6IA 1MO4A 1LS1A 2SECE 3FLEA 1MF7A 2IW3A 2XYGA 1SKYB 3VYRB 2IPOA 3R9IA 2YZGA 1HMYA 4EO7A 1ZUWA 2JHCA 3TQOA 3EZLA 3MERA 3WGOA 1DZIA 1GTVA 3GLGE 2NXNA 5MN6A 4OGFA 4IXWA 1GKLA 4ETWA 3DT9A 1U94A 1Z7EA 5P21A 1K97A 3IUSA 3DE3X 4JA2A 3PUZA 1DTSA 1E79A 3ZWDA 2FPMA 4E0BA 1CR6A 1EAMA 4D4MA 1VFNA 1P4GA 4CLRA 1M6HA 1WCIA 3GLFA 1UKAA 4AQDA 2YWHA 4JSYA 5JBIA 4GYWA 1T1EA 3IBYA 1FX0A 2QDXA 3DJYA 3PQCA 1O4WA 4M1YA 4MIKA 3K15A 3HUUA 5HE9A 1LDNA 4CJXA 4DDUA 5FOVA 2GGSA 3RJ5A 1F12A 2LPMA 1RYHA 1GVNB 2BEUA 2Z5GA 3W9SA 1DKRA 1USWA 5FTJA 1PWYE 1M6YA 2HXGA 1VCOA 2PMCA 3OZRA 1DIAA 1NVUQ 3AHJA 3Q5EA 4B6PA 2Q6VA 3OKPA 2GJKA 5EXXA 5K51A 5WRFA 4BWVA 3EC2A 5C34B 2XWBF 1JAZA 1HRDA 1N0HA 3IUEA 3TR6A 3C3DA 3NZEA 5DT2A 3ISJA 2DCUA 5ENVA 3SZLA 4IIBA 4KLZA 1SCUA 2E48A 4BMCA 2H2HA 4CIDA 4BQEA 1F7VA 5A03A 1X1QA 3PLNA 1B74A 2PL3A 3EEQA 3B6MA 3O3NB 4KV9A 4OQEA 3AZOA 5JHHB 5IWAB 2L82A 4P8RA 1JWLA 4ERXA 3DCNA 5BW5A 4BJ6A 3L9XA 3WHLA 2C9ZA 1TQHA 2ZDQA 3BMCA 3FMIA 3FNFA 4GXRA 4J9VA 3ZWKA 2HMUA 2QRNA 1ZJYA 5CXSA 3W6PA 4BJ5A 1NF3A 5AW2A 4MOWA 4ILKA 3QU4A 3EAFA 4RGBA 2WINI 2CMKA 4NE9A 3SXUA 2C7RA 1PW5A 1OTHA 2O0LA 3TIGA 1Y34E 1JZSA 3GLRA 3IV9A 3NONA 4LJSA 2CHGA 5DCWA 3QEKA 5IJXA 3W34A 4EI9A 1RMQA 4YJHA 4D9HA 2ZI5A 4B3MB 3K92A 1Z7YA 2WEKA 3RIMA 4EF6A 4BLRA 1ZI9A 2VYNA 1G3MA 3N74A 3CB4A 4B4OA 3WHPA 1LBTA 3GCXA 4AKIA 3DH0A 3I04M 1J25A 2F8MA 1SBZA 2CBZA 3EXG2 1LK5A 1R5OA 3AVUA 3EXEA 2B0CA 1ZHHA 2LRHA 3UHOA 3VSBA 1BA2A 3RSGA 2QL6A 3OETA 1EWVA 2HJHA 1XAHA 2ZIWB 2E82A 2EBWA 4DADA 4F38A 5IAAA 3C4VA 1DELA 1CR2A 1FSZA 2WMNB 2GRUA 4YP1A 5D84A 4MS1A 5CGQB 1IRXA 3UANA 3F5MA 2W2QA 2NYVA 4RJJA 3I0ZA 4BX8A 1VJ0A 3E9RA 5K4HA 3ZD6A 1N1MA 2Q5QA 1VZ2A 4QYXA 1BXGA 4YALA 3LHDA 4FD3A 1W85A 3I4LA 1FU7A 3HVJA 3OUZA 4D42A 3IEIA 4REMA 4HEHA 1T0BA 5SYMA 1MZPA 4JJAA 4B8YA 2TMYA 2C20A 4W1RA 4C4TA 1R6VA 1X8LA 2JIZD 1NMXA 3LC7O 1N0IA 4QUEA 1DRJA 3WB1A 1RCTE 3ELDA 2E37A 1U5CA 2W22A 4FDTA 4L6CA 1PHRA 4OGGA 1Z63A 1T9DA 1OB2A 2WYUA 4HKTA 1JRLA 2Z3WA 3FMOB 4X44A 3ZG6A 4E22A 3SBDA 1Z2PX 2B4QA 5EIXA 5KTPA 2NG1A 3EYWA 4O4IA 3IIJA 2YJ3A 1FOEB 3OPXA 4R01A 3LX4A 5BWBA 3DTVB 1W49A 3DW3X 4Z0PA 1TDJA 4UW9A 3TLJA 3GARA 2F8LA 1V1JA 5EGSA 2HA5A 5HQ3A 1E5TA 1MA0A 2R11A 1N6PA 4HLNA 1TC2A 2HAEA 2VRBA 5L51A 4GYJA 2IEDA 2PUAA 1P6QA 3BSFA 3HCFA 3KSUA 3D9QX 4RZIA 5EXDA 3A2KA 2O19A 1NN3A 3SJUA 1Z2NX 1B8VA 1U2TA 3L0CA 2VJDA 4YJKA 1UFVA 3KQOA 1D0VA 4TS4A 4HQOA 4OU5A 4U7TB 1EB9A 1U1EA 1JEOA 3RSCA 5TQVA 4IKEA 1W9MA 1Q1QA 4E4TA 3C7KA 3QU5A 2ZB8A 1CE8A 3MTEA 4Z3DA 1WKCA 1E94E 4F4JA 2TECE 3PNKA 2P9BA 3OZFA 1XV5A 3T5CA 2DZDA 3C39A 3VOAA 3LRTA 4MLPA 2V0CA 3EJ6A 5FUVA 1AN9A 4GUDA 5ED4A 3EEBA 3PICA 4NI5A 5K3AA 3ZD8A 4YRAA 3IE0A 1CKEA 1E7QA 4HB4A 4QYWA 4RJ2A 4KMSA 5BT9A 5FUMA 2H4JA 4DV0B 2UKDA 1T15A 1U0TA 1CLUA 3RKRA 5AVZA 1T91A 3HUTA 1GGMA 1QDLB 4IMPA 2F00A 1RRPA 3GROA 2RI1A 5EE3A 5H1YA 1J9GA 2P5SA 3UXHA 1VIYA 4GMXA 1BCSB 1KFBB 4IDDA 1MB4A 2REBA 4ESOA 2C88A 4BMNA 1XQVA 3QUBA 4NL4H 2SKEA 3N53A 4X66B 4KBFA 5E3IA 1P1FA 4LXUA 1H3NA 4F2WA 4G4IA 3EVNA 1JQ3A 5JZSA 1W36B 3HWX1 1R0CA 2XGOA 3LUPA 1AMOA 2H85A 2O57A 3WLHA 4K87A 4XA8A 2EATA 4L02A 2O6LA 3A1DA 1NXSA 1M1UA 5CVTA 3HN7A 2I55A 2M6RA 3ZX5A 1USGA 5AOAA 4RPGA 2O54A 2IXEA 3O2QB 5KTSA 1TLTA 3ZDAA 5FOTA 4LV8B 4JP8A 2X2FA 3EEYA 3U60B 5ICEA 4UTZA 2HADA 2PL5A 3ZE8A 1MX9A 4S1PA 4L5JA 4YUYA 1SB9A 1OKKD 3CLVA 4BTVA 5JARA 2D2XA 2W6PA 5C52B 2X8LA 3Q9SA 3RVJA 3ZV7A 1U63A 2FN3A 1VSBA 3CGWA 3NBFA 2WM2A 3M8KA 4NZMA 4S3MA 1QWOA 2IP4A 2P4HX 5FL3A 4JP2A 3KM0A 3CF0A 1U9IA 3OUTA 1AXRA 2VHYA 3P26A 3PUJA 3TI7A 5KTNA 1ZUNA 2J0VA 1NYRA 1QF9A 2AD5A 4AP5A 5K01A 3D7MA 1SULA 4JI0B 1GFWA 1VLQA 2AZXA 1Z2DA 3C8HA 2F67A 1HX7A 3N87A 4KAJA 3NU1A 5E7IA 4V1CI 3BMXA 1A98A 5FP0A 2PZBA 5EJIA 1WY7A 1H0RA 3W8DA 5B37A 1DQSA 4MZXA 1EHCA 5KDLA 4MUXA 1Y42X 2NXWA 2BBWA 2P7IA 2C5GA 3RYCA 2M2IA 1YT5A 3PEUA 4JJ7A 4N8EA 5CLIA 5I5GA 1F0YA 1D07A 4H1UA 4Y6SA 2W2XA 2ZYHA 4MVYA 4A8JC 2ACVA 2VSQA 1N0VC 2P7HA 2CNWA 2HLPA 3UUGA 4KACA 3V7WA 4LF8B 2PSJA 4TLDA 3VTKA 1U0HC 2JW5A 2QHXA 3TBFA 2HLDA 3BDVA 4NAUA 4CDMA 5D1NA 4U7PB 4ZO8A 3EMBA 3LC1O 5BVHA 3K0AB 5EMNA 1DC7A 2ZAGA 3GOQA 3COYA 4FGWA 4WBXC 5FTWA 3SM3A 4YT8A 3UNXA 2FP3A 4IFBA 4LTDA 4NLLA 1PWEA 1HR0B 3P8ZA 1ULBA 3CW8X 3ET4A 1A7KA 1MG5A 4F46A 2INGX 1OW3B 4DWVA 5AKGA 2ZXUA 4M9QA 2HSEA 2ZBUA 3OQHA 3K5WA 2Z4TA 1X2EA 4DMLA 3VKHA 1ZOLA 2E1PA 3I2IA 3IT2A 3ONDA 4YAGA 3ZLUA 1LPNA 1K08A 1ULSA 2Y1CA 2GF0A 1Z25A 4XJXA 3VUEA 4EJ6A 2O3RA 5HXAA 3MWEB 1NDHA 4BHTA 1O96B 4TVSA 3FVTA 4AQ7A 4LPSA 2QZZA 1EA7A 1Y6JA 3V2IA 2RJ3A 1D4OA 1FK8A 2F3RA 4KMMA 5AKKA 4PLVA 2Q1YA 3EF1A 4WNYA 1EVKA 5ERGB 5L7YA 3VZQA 2GN0A 3GXOA 1LU9A 4QICA 1JDTA 1IN4A 1LFDB 3KEGA 3V1NA 4QJ3A 2VNIA 4BNWA 4MVJE 2H1HA 1DT5A 3O31A 4K6MA 4UBJA 3T95A 1SPBS 1FDSA 1JP7A 2GILA 2RJOA 4IUCS 3AVPA 2XE4A 2C5HA 4G86A 3HU2A 1KY3A 1A77A 2WFMA 3NH6A 4L8WB 1U9YA 4NU6A 4Q82A 4BFVA 4C9BA 5KHAA 4E4RA 5JTUA 4WAUA 2CDBA 1V3UA 4K1LA 4IEIA 3ZGXA 1FFEA 4DV2B 1JQKA 5LD2B 1C8LA 2I4OA 5I7EA 2CGEA 1O9GA 2WM8A 2YNMA 3SJCA 3T7CA 2VAMA 5JRZA 2XZPA 2AF4C 1YBMA 5DRTA 5KNCD 1ZVKA 1ESEA 5JS1A 1E7WA 3HR7A 1FP4A 3D4PA 4KITB 1JSLA 5CPFA 4J49A 2VNJA 3Q3JB 1QTQA 1XTBA 3NRJA 3G2IA 4OD0A 1E0SA 2EJCA 2IEZA 2JLZA 2JD2A 4PZEA 1QHXA 1CULC 5IKMA 1UOQA 3B2EA 2J6BA 2XBUA 1UBUS 2ZYGA 4Q19A 3M2TA 1K6JA 1JJFA 1K92A 2F6RA 3L02A 3B89A 1YRWA 4L22A 3LH5A 2V96A 4Q66C 1VE3A 4JYMA 1JEJA 1XTQA 3KZCA 2P2CA 4JJFA 4Y6GB 4HATA 4Y67A 4LZOA 3H9BA 3QFHA 4PR0A 2YNMC 1N5IA 3GVHA 3ENNA 4ZARA 2IHVA 5CB0A 1WNFA 2H0AA 3A4MA 3ML1A 3ZCTA 4ZVOA 2M6SA 3CN9A 1J2YA 1L4KA 1MX1A 4ONEA 2OGZA 4DL9A 3FXAA 1MBZA 4R1MA 2O0HA 1HYBA 1C1HA 2AOVA 3I73A 3M3HA 5ALJA 3E03A 5EZYB 4DLVA 2FFRA 2GM9A 1OBFO 1XQ6A 4D4HA 3IIIA 4PXAA 4MWEA 3RU2A 3NFRA 3VR2D 3AR7A 1PO7A 4UZSA 1KVUA 1M0SA 2JKZA 2EKBA 4TMXA 5B4VA 3I9MA 4W82A 1UP6A 1WXIA 3A2LA 1HY3A 1GQQA 1U3UA 4GKJB 4YRDA 3EE6A 2VHVA 2FW0A 1LBSA 2O0JA 1B6GA 1ST2A 4GKAA 4ZWNA 4K05A 5LXTA 3U81A 2R1TB 5D6NA 3NGMA 2NN3C 2NT4A 5AVKA 1FDOA 1E32A 1Y1QA 4HDRB 3ZVKA 1AOXA 2PIDA 4FYXA 4BN0A 1NLMA 2X14A 4ZOLF 2JGKA 3B6EA 4Y1FA 5I9BA 4EOGA 3G2OA 2GPBA 3Q9NA 1BDIA 5AOVA 3FPBA 2H4YA 4JQSA 5REQB 1Q16A 3VO9A 4PINA 1NP6A 4BNGA 3KUKA 4NNOA 4XFDA 1KS2A 3VZBA 4JVNA 5DI3B 3WISA 4HAZA 3DPSA 5EMMA 3UFXA 3WOVA 4N41A 3IHTA 3Q7EA 3D6VA 2V7UA 4G37A 2O2EA 4Z1MD 1PTJA 3FGPA 3L7LA 3L8FA 4H60A 2HF9A 5EKDA 2VDWB 1ZD1A 1C4XA 1E5XA 2D3WA 3JZFA 4JKOA 1M9NA 1ONNA 1OFTA 3UTCA 1P7VA 4FNAA 1PYGA 2W2MA 4MVJG 5H0IA 5LDHA 2FSVC 2XTZA 3TE7A 4UC0A 2X6RA 1KY2A 1GR1A 1YRAA 5FOUA 4RD4A 1FDIA 5DGHA 2Y8EA 5G0VA 4B6FA 3OP4A 3CX4A 1TM7E 5LMCA 1CF9A 1WNTA 4OBEA 4LXQA 1L5HA 1Z9BA 1A9PA 1R7RA 1Y6ZA 3PXAA 1XZCA 2GHTA 3L1HA 4I1UA 3WMWA 1GSIA 2B4TO 2CYBA 2V97A 3BK7A 5E8RA 1T4BA 1Y3AA 4HP8A 2EP5A 1QRAA 4AUNA 4EA9A 4RULA 4Y9TA 4F6LA 4W7IA 2ZGVA 3QHAA 1EESA 5C53B 4N5IX 5BN5B 1AO3A 2QN8A 3EIQA 1GZVA 1LSOA 2OCAA 1U7ZA 1EDZA 1U2SA 1C7FA 4IM7A 4JUAA 3Q7TA 4LF5B 3VNSA 5DBEX 5L3SB 2BDTA 5KYYA 2QAGC 1U02A 2R7MA 4O4LB 2P0AA 3A7DA 3EQZA 3H3XA 1V3TA 3JATB 4PLWA 1TYBE 3I01A 4XRRA 4ZZ3A 2X4GA 1Z5OA 4MYHA 3JRNA 4TUYB 3K9CA 3ZY2A 4S05A 3LKBA 1Q84A 3O90A 1T3TA 1J2RA 3VUFA 1RXUA 3QPUA 3RHZA 1DKOA 1T10A 1BN7A 1RRVA 4MPTA 5LCXA 1XCMA 4O1HA 2Q49A 2CHEA 3GLHB 1NNEA 2MHCA 3U26A 1N2CB 4KGZA 1W8IA 2WKRA 1FYDA 5L3VA 3SN6A 3OE5A 3QLUC 4F2GA 3MINB 3V32A 2AL7A 4PYNA 1T3HA 1D9ZA 3G2QA 4QU9A 1W76A 2HA6A 5HS6A 3BCHA 3TLEA 4GLJA 5G1OA 3E61A 3O9MA 3TXAA 2O07A 1AB6A 1SHKA 2IUTA 2IZ6A 1OT5A 4OSOA 1Y3IA 4PFSA 4UEWA 3UB3A 4BAGA 2IYSA 4YP7A 7MHTA 4BBPA 1JF8A 1NUAA 2IZ7A 5THXA 3V8PA 2ZUUA 4ZCSA 4K8OA 4PR3A 1C4KA 1WZIA 5K8VA 1TYZA 4N6GA 2B7BA 4QASA 1U1FA 2WU0A 2O2DA 4BO9A 3L0DA 3OMWA 1S2IA 4URYR 5CM9C 1IIRA 2Y6VA 2HMYB 3DYVA 1FX1A 4PBTA 1Q0TA 4G5YA 4HD8A 1TA0A 4HDKB 1NUUA 4QUKA 3IMCA 1ZM3A 4M9ZA 3VU1A 4Z4HA 2B30A 3L8DA 2GLTA 3KLOA 3QPBA 4FYWA 1YVDA 4C2BA 5LDDC 2A6PA 4BE4A 3ELUA 3EGDA 4JFRA 3RW9A 2FW9A 3ZNOA 1NYTA 2ZM5A 2EZ8A 2W4QA 5IAJA 1BRTA 2BRUC 4LFCB 3ISVA 3RDPA 4XD7A 2ZVQX 1SHUX 4ZCIA 4DNOA 4PYLA 4IX9A 3ADCA 4NFYA 2BONA 4PQRA 4GL4A 4U00A 5JQGA 3O4GA 1OA0A 2ZUTA 5JAPA 1V7ZA 3DSRA 2P8SA 4JX9A 4C0QC 1IBMB 3K94A 3IP5A 5THKA 2C54A 4W1PA 3C4QA 3G23A 5CW1A 1Q7RA 2XZLA 1OF1A 1CY7A 1O96A 4DCCA 4LVUA 1SVIA 5G1PA 4EMUA 5C2JB 3ITKA 4JIGA 2QUIA 3L4BC 3QPVA 4NZYA 3G2LA 4CQLB 1IWOA 2YHAA 4Y7DA 1L4EA 2XGSA 4XLTA 621PA 1KAOA 3RTGA 1F4VA 1IDOA 5BV1A 4LJKA 1ADGA 5LQSA 3TZEA 1F6WA 2H1IA 3MCTA 1QKJA 3MTIA 1JG3A 4BO0A 1SVKA 1ZK4A 4B3TB 3KB2A 3GZ4A 5U4XA 4PZCA 5BRAA 5A0TA 2OD9A 4GYYA 3R23A 4PHTA 2FJUA 1M34A 4YUWA 1OXSC 1Y6GA 1PFUA 3O8OA 1POWA 1E1NA 2FPIB 2ASVA 3U40A 5HKAA 3OOHA 1TQ6A 2BY4A 3C3MA 5EJ5A 4DMHA 4G41A 2A0YA 1IHUA 4DLYA 5HJ7A 3HDVA 5JJIA 4NENA 2NP6A 2OWEA 4G3XA 1P9RA 2JAOA 2ZAOA 3U7JA 1JPNA 2CSXA 1U3TA 3AUSA 4F56A 3HGTA 4Q48A 2FFHA 2CZQA 5E2AA 1J99A 2R8BA 1QONA 3C0KA 5JW6A 4AKGA 3RRNA 3K0CC 2WWTA 3AWIA 2YH2A 3WTBA 4TM8A 4LYDA 1NULA 3AP1A 2HHJA 3LS2A 4RKEA 1KXJA 5EGNA 2XLCA 4B9AA 1BHO1 4LRYA 5ELXA 2I66A 3QLTA 4EB0A 3RVDA 2I6FA 4DLWA 1ZC3A 1RS0A 2W6NA 1D0IA 2R4UA 3CUTA 4LHEA 3VNRA 2GI4A 4DC0A 3T3OA 4WN9B 3M6MD 4GW3A 3K8QA 3ZEIA 4YRTA 1CY8A 1Y33E 4AZ0B 2I87A 1YE5A 4NCNA 3WKBA 2L69A 1SOWA 2H16A 1OLSA 2VJYA 1H9BA 3FLAA 4HLUC 4DN6A 2A5DA 4P5EA 4DPKA 3ZD9A 2VL7A 1D1QA 4GSYA 1WXFA 4ZREA 2KSQA 2VXCA 4RF5A 3H5WA 3PFBA 1XZIA 3NI2A 4R71A 3L7AA 1LDEA 1KIFA 3KZKA 4DJEC 1A76A 4Z4CA 5CT5A 1TAQA 4R54A 3O4RA 3JQRA 2TYSB 4QBFA 2QN2A 2FTKE 4ZPJA 1Z0FA 2PPVA 1M75A 3C7AA 1F60A 2ZJAA 1WV1A 3BGVA 3R6LA 4OQDA 4XKJA 5K0NA 3MBOA 3SX0A 4CUZA 1A8SA 3E35A 5KTTA 4MV1A 3ZOZA 9ATCA 3KBBA 1D8AA 4GDMA 3PJFA 5DLQC 3V4PB 1G5IA 5EL0A 5JOQA 1YV9A 2DTDA 1UXIA 1M6VB 1Q91A 1R9MA 2HIHA 3N8NA 3Q0TA 3SX2A 1V4BA 2IJGX 1FQJA 2JAPA 2O3UA 2XYRA 3CRQA 3QLVC 4I3FA 4PG4A 4Q39A 2I2DA 1SAYA 2Q4TA 2VHCA 1NBAA 3ANYB 2AE1A 2BGMA 3QMMA 4C1BA 1R0BA 3F5FA 3N28A 4RS3A 1YNSA 2GXQA 1RQRA 2DPGA 5JZVA 3LD9A 4PVCA 1T3SA 2GN2A 4ND8B 3SHVA 5CLFA 1NN0A 1WTAA 4P4TA 1SR8A 1BTOA 3F90A 3HCCA 2VSOA 1HK7A 1YJCA 3PUWA 4FW8A 5KBYA 4K03A 3UFXB 1EP1B 1V71A 2LR0A 3AI3A 4F9GA 1A8IA 4MWCA 5IK2A 4LYGA 5DPMA 4AN0A 1G3RA 2H7YA 2I4NA 2P2NA 3IPYA 4Q3DA 2D13A 3IAAA 3NYRA 4XWOA 5BMVA 4H35A 3QX8A 4AYWA 2BCEA 1ULTA 2FWIA 2NPIA 1SBYA 1XXHB 2YL2A 4TT8A 3V4ZA 2XTNA 2X0EA 1GITA 3DXYA 4E5NA 4AZWA 1E9VA 4ZAFA 3R8CA 1EVEA 3G0IA 1Z73A 2IYVA 1CVLA 2AC7A 2IYLD 3OQPA 2OXRA 4WECA 3T9AA 1WPRA 2A0UA 4ER6A 1YZKA 5BV0A 2ID8A 4EWLA 1VKZA 2EYUA 4I1YA 4RPIA 3DKVA 4DMMA 3FVWA 1ZEJA 1W6RA 4P4SA 5EZQA 2EC5A 3EZNA 1HDXA 3TB6A 3TFWA 1NYQA 5IVIA 4EFNA 1CJCA 2RHGB 3MWDB 2B98A 4LYEA 1ACMA 2R6JA 4QO7A 3ADPA 1UPTA 2D2VA 2X4IA 5IM4A 1OJ7A 5DRYA 4OHWA 1R0KA 4YVFA 1ZAKA 2V58A 2VPZA 5BRNA 4EA6A 4KPYA 5CMLA 5C51B 4L8VA 4UVDA 1AGXA 4BFLA 2J09A 2KPOA 1ZCBA 4CKEA 3VTFA 4D7AA 3VKWA 1OYOA 5A3RA 1XELA 4BGVA 1F4LA 1C3OA 1A0OA 4PRZA 4TTTS 3SC2B 3L4JA 1XLUA 2D1TA 3EVFA 1MNQA 2ERCA 4AJEA 4ABYA 3PUHA 5IT5A 4BTLA 4CMAA 1SK9A 4F85A 4JLMA 3TEJA 5LFAA 1TVCA 4ZVSA 5CDTA 3IEMA 3M2PA 4Z4QA 2I8AA 1WQ4A 3OTHA 4KUGA 5TV2A 4MUKA 1Z0AA 1BYIA 2BGIA 4Z7QB 2FF5A 2GK7A 4WUVA 1SA0A 4C7KA 3RLFA 4AY2A 1PU2A 3O2SB 4HYQA 1MJFA 5FWDA 5TVKA 3SICE 2IH2A 1DIBA 4IO0A 1B93A 1MLDA 3ESRA 5AVOA 3UMSA 1ST3A 4R9NA 1SVMA 4POAA 3CRRA 1BKDR 4FPXA 5I7UA 1Y1RA 2ZUVA 5B3LA 1NDUA 3P9NA 3LUGA 4D8VA 1QH9A 1NI3A 3OJOA 3U80A 3CLSD 3VSAA 2BFEA 2I33A 1L4MA 4NMWA 1M66A 4QREA 5ARBA 3AESB 4JKIA 3COPA 4HAXA 5A5VA 5CA0B 4W9NA 5IAOA 4M9SA 4P93A 3TSOA 1CY0A 2BH2A 1ZIYA 2VTVA 5K1ZA 1GDDA 5BSVA 3T61A 3H1TA 3I83A 1GTSA 3JZMA 4GAEA 3GJZA 3TPZA 4L6IA 4F3CA 3KUUA 5E38A 2ZQYA 1U2QA 1KK0A 4EUEA 2YR0A 3RVOA 4HBGA 2AA3A 3NVAA 5EE9A 4QO8A 5LYJA 3B85A 2WTXA 1CJSA 3HXKA 4FJ1A 4I50B 1AX9A 2QW0X 2ZJ4A 4CMIA 2G63A 2A5YB 3MAGA 1VXRA 3NORA 4ALJA 2H6EA 3NPAA 4KO2S 3OECA 3FZGA 1SIWA 2FWPA 4OP1A 1E1QA 3TM4A 1IHXA 4KEAA 3H4IA 4F4HA 2X0FA 2VPPA 3CEJA 1EG2A 2J3DA 1RFLA 3GEHA 5CBPA 4Q7JB 1WSAA 1HBJA 1RIFA 2WMOB 4IH9A 4N54A 4ZOEA 5F2NA 4Q9KA 5KYWA 4QUBA 2PD3A 3OVMA 4QG3A 3OCXA 3ZUPA 3TRHA 3AIKA 1DV2A 2O5VA 1A9ZA 2FN7A 1W581 2QVLA 3VAAA 1CRLA 2QZJA 1UP4A 3IVXA 5IJZA 2Q6LA 3WK8A 2ZUEA 3ILSA 2NQ8A 3IL2A 3H19A 4BQRA 4Q9NA 2ZJ0A 1SOVA 1YL5A 1LFAA 2RGBA 3D7LA 3WS7A 4CMHA 1RC1A 1WMSA 3JVEA 3L0BA 3L77A 2XTJA 3MBIA 3BFKA 1SXJB 1T6YA 4F0JA 4F4IA 5BV2P 1IG3A 1P7YA 1SC9A 1VBFA 2EFEB 1BEUB 1E1YA 2VHUA 3LU1A 4PSCA 1T8WA 1C9MA 4WVLA 5AJVB 5A9TA 1B1CA 1L8LA 3A1WA 3TLCA 1Z74A 1P80A 2GZ3A 4Q3AA 2I6SA 3HZOA 4Q00A 3LUCA 1TI7A 2A94A 1NVFA 2H59A 2G9QA 1E9RA 3IQZA 1CUHA 5E6UA 2C1EA 1WKVA 3EZFA 3IEXA 1U5BB 1V2GA 3MEQA 3A9RA 4LWPA 3CWCA 5CURA 2V3WA 3ITDA 3M6FA 2YMPA 3MB8A 3MWJA 3NBQA 2EGUA 5DNAA 1EM8B 4N47A 4F4DA 3J80A 3DL2A 3PFFA 2IYFA 2Q9CA 4NATA 4U7WA 4YCBA 2PK3A 4CL0A 4UCWA 2Q62A 5U9CA 4DR2B 4HNUA 2IUYA 1HGXA 5FJIA 2QXUA 1D03A 1QG2A 3LYLA 2W2LD 2J5BA 2CK3D 2HSJA 2AYXA 2OZEA 2QLBA 1V1MA 1PWZA 2GWRA 1OOEA 2H1WA 3CPHA 2IZ0A 3BCSA 3FG9A 4JI3B 3UG7A 3NKLA 3QI7A 4RBNA 1MHTA 4TWZA 2QYOA 1J9ZA 1OLSB 4GOND 4JLPA 2VF4X 4NNPA 3BSWA 1MEEA 4DY6A 2H3EA 1PBNA 3KPVA 1GCAA 1UEJA 1P4SA 4ZO9A 1Y7LA 3AXSA 1E3EA 4L75A 3VSEA 3RYIB 5IF3A 5ITZA 1VJDA 4IS2A 4L8FA 3U7QB 1NN1A 1C81A 4RS4A 2YXEA 5FPHA 1NM5A 3SXPA 2RCNA 5SV2A 3L0ZA 1ZSNA 2HMTA 2P4SA 2VF8A 3FZYA 4PLHA 2P2SA 5AIAA 2H65A 2VHJA 4FLFA 3TD2A 4Z4GA 4LGVA 1GUZA 1BOFA 2IT1A 1NJFA 2OP0A 2QRHA 3MGBA 3QOXA 3R4CA 4JASB 4LE1A 1GV0A 4M7WA 2PS0A 1E2LA 1XRNA 1A95A 1II8A 2G9RA 4JU9A 2QTZA 4OFXA 4HCJA 2R5NA 4R8RA 1OZ0A 5IJ9B 3E0XA 5H4HA 1LPPA 3HBJA 3G7NA 2G72A 3EIUA 5CR9A 5DNDA 4Z1OA 2HA4A 4F91B 1IUNA 2JD0A 2C7BA 4MTCA 4QBIA 4OLJA 1D6JA 4JWTA 3RS4A 1RM4A 2B82A 1Q44A 3K05A 3PNMA 4WCFA 3N86A 4DKXA 4D3FA 1UDRA 1Z28A 1QIHA 3ZOKA 1OC2A 4HWTA 3SFTA 5KJCA 3ESYA 5FHQA 3JVUA 5GTDA 4TTJA 4UMEA 2B21A 1WXWA 4M1ZA 1DKQA 2LD4A 4KBYA 5IXSA 1ZD5A 3D4OA 3FYTA 1ND6A 3IURA 4BQNA 2WMDA 1QDEA 2I80A 4KH1A 1NMSA 2RK3A 3PUVA 2ZU6A 3MT7A 3WB9A 4EB6A 2EJUA 4A03A 1ESDA 1L4YA 2EX4A 5FL7D 5KC8A 3N3AC 2GKSA 1YA8A 2GZ2A 1SC4A 2XE8A 3LPMA 3U0VA 4C29A 3O91A 4FHFA 2O0KA 2YN2A 3A4TA 2GPWA 4KRGA 1EPUA 1OI3A 2C3YA 1YE8A 1DKPA 2OCBA 3HDQA 1B8NA 4OBWA 2WWWA 3HA7A 3PK0A 1S89A 3BMQB 2IV2X 3V48A 3ZW9A 4KREA 2XTAA 1XVIA 1J2JA 1WS6A 3HEBA 3KCQA 2OESA 4D8XA 5E8JA 2H4FA 5LXTF 1JJAA 2RH5A 4L8LA 2RBGA 4S0XA 3SQOA 4I1RA 2QR3A 4O4HB 1D2CA 1MRSA 4YBZA 3QMWA 1AKQA 3L93A 4P82A 1N36B 4Z51A 1DHTA 4I2NA 4IMRA 2X9NA 5GINE 1X1BA 2ZCJA 1HSZA 3P2MA 1GXSA 1O95A 4OXYA 4DBZA 5AVQA 5KPDA 3DOEA 1DXYA 2QAGA 3GK3A 1AIPA 1KHTA 3L7YA 3ROZA 3CSSA 4CMEA 4QATA 1QP0A 3MUNA 3STWA 3LF2A 5TMBA 4J07A 3L6RA 3U3KA 2QN1A 4D4IA 3WRXA 4UTVA 2OCGA 3IKLA 2VLIA 2QD5A 2I34A 1PUJA 3PQ3A 1UPAA 1VMKA 2IXFA 4GSLA 4IJVA 5JQGF 1EXVA 4DR6B 2VPWA 1AMNA 1V6CA 2DUMA 2YWRA 3ZJYA 3UJDA 1ODIA 4F5ZA 4A6DA 3NHLA 5HOQA 4GKKB 3DWFA 3NHKA 2A33A 1XRLA 3SG0A 1ORTA 4NBWA 4CETA 1LDBA 1NI4A 4HLCA 1GNPA 4F8EA 1P9WA 3HMKA 1AQIA 1SVWA 4MW4A 3MM4A 4LSWA 4C5AA 1U65A 3B48A 3BAZA 4YMLA 4CMGA 4Z8YA 1QH1B 3OPMA 1K8ZB 1XA0A 1QH8B 4FI3F 1K3UB 4ADSG 4YV2A 3BMNA 4IIDA 3N6RA 3THXA 4IDPA 4LBYA 2FZCA 2W6JA 4A8TA 3LL7A 3QUCA 1JSCA 1CIJA 4QEDA 4W7HA 3RC8A 3IDSA 3RUIA 4OU4A 5HE8A 2FSVA 1U7XA 2GR9A 2QX8A 5DEIA 3LQFA 4Q9JA 5D87A 4BJHB 4QU0A 4E12A 5CCBA 3BZUA 1RM3A 4AMVA 4BGEA 4TTIA 4B6RA 1AKVA 4P33A 4U6QA 1J1IA 4H0NA 2HTFA 3KTFA 3LV8A 3S3TA 3OTWA 3VH4A 1BGXT 1UBRS 1VE1A 4LHSA 2Y77A 4HJXA 4OAOA 5JWHA 1E1LA 3ZCVA 3BMOA 4MARA 2B1RA 5AM1A 5ALOA 1EX7A 3IDFA 5I45A 4DM7A 2A78A 2EG9A 1U0JA 4EG7A 1WHSA 3ICCA 3FYUC 3ZTWA 4J43A 1RM0A 3NTUA 2B2CA 1K6XA 1ZNZA 2PRJA 2WFLB 5C18A 1KK3A 2F62A 2P90A 3I5AA 3ZCXA 5KCZA 1QVAA 3CBQA 4ZOLB 5K3SA 4BMXA 2QBYA 1WPXA 1XP5A 1NOIA 4NV1A 4NX2A 4NFHA 1VPLA 5K8CA 2P9GA 2QD2A 4KDRA 4UNPA 3V4VB 4A23A 4CFYA 5JXIA 2PVCA 1OASA 2XMPA 5ITVA 4ENVA 2O9JA 1NU8A 1YUMA 2R0QC 2CEAA 4YMIA 1QB7A 3U4IA 2DBRA 2D4AA 3KCNA 4MR8B 3WWPA 2XGMA 3D8SA 3PC8A 3IEUA 2QTWB 3ROXA 4IHKA 2CDCA 4FKBA 4ND4A 5BSHA 2WJJA 3FY4A 1UMCB 3HDHA 3MTGA 2ZB4A 3UMRA 1T9AA 4JYAB 2UAGA 1I3LA 1M34B 1IZZA 3BWMA 5EZ5A 2CD7A 3BXEA 1XZPA 5BT8A 2X1HA 3H9UA 2FPIA 3ECAA 1YS4A 3KXKA 4QT0A 1U2DC 4BO4A 2JH3A 1C1DA 1QGOA 3B6IA 3HFJA 3CXUA 1WBBA 2H4HA 2RDMA 1AK1A 2XCLA 3CUUA 4D9GA 2HIGA 2OORC 4GRDA 4MV3A 3SF0A 5A4IS 2YWFA 1V4NA 4TZTA 3JD3A 4LN1A 3BWXA 5KIAA 3MJHA 1FP1D 4FSXA 3ZJVA 3R3YA 3DULA 4G8BA 5EWLB 2WJYA 2EBHX 3L7BA 1ZPDA 2ZPUA 4N39A 3JRXA 2QL9A 3U4QB 3CNEA 1T2AA 1YMVA 3RB8A 5DNCA 1AV7A 1ZK3A 3K4HA 3TMKA 1SXPA 1XTTA 1FFSA 2W90A 4E07A 4QPCA 5K0JA 1U8UA 5F4ZA 1WM1A 2ZIXB 3L5KA 3EOZA 4LJ9A 3HVIA 3OIGA 4B45A 5AD1A 2WV7A 1AQLA 3KKKA 1JIQA 3HJGA 1WO8A 4RU1A 5DYGA 3DQZA 3E5HA 1SXJC 2Z6VA 3TQTA 1KRXA 1CU1A 1W5BA 1ZOIA 1J5EB 4GDFA 1E2GA 3KQNA 5LLTA 3MCZA 4IOMA 3QQ5A 4V1CB 3FHJA 3IJEB 2F9LA 1E96A 2WAAA 3L6BA 4YREA 3SYKA 4ID3A 4NOMA 4L7VA 4UEQA 1GQOA 2DQYA 1N2GA 2Q8QA 5FTNA 4ZCQA 5JALA 3LG2A 1Q20A 2QJTA 3DE0X 4QDZA 1II9A 2HHLA 5K8TA 2DYKA 1ZBQA 1JQBA 2J3KA 2RE8A 1VCMA 2YZ7A 3FPCA 4M53A 1J56A 1EB8A 1PNTA 2DMRA 1DAOA 5CVUA 3AM3A 3ZHUA 1TTHA 4LY0A 1ZXLA 3OZBA 4GBMA 3PDWA 4EELA 3KTDA 5BPFA 3PC2A 3D8UA 3UJCA 1UQRA 1U4OA 1QYXA 4Q7MB 2V9PA 2DPYA 4K9LA 3CR8A 4LAFA 5LA6A 1NHGA 1I4LD 2O8VA 4TMFA 3UWSA 1NW6A 1JG1A 1T36A 3E70C 1DWPA 2RFLA 4LHVA 4WOCA 1M6VA 5IXJA 2FFAA 1I9GA 1KZ6A 5DGXA 5BY2A 1RYFA 2DSTA 2ZB7A 4GR4A 4UU8A 2OYRA 4HVAA 1NVWQ 3WQBA 3AHFA 1H6CA 2I6UA 3DJFA 5AI9A 3R5XA 3HTXA 4AZTA 2FSFA 3ENWA 2F90A 1AKMA 4NABA 1ZJ6A 4EHAA 4GP7A 1PEYA 1Y3DE 2WIFA 4KX3A 3TOCA 4C4YA 3PIRA 4JENA 1AZTA 3VNBA 1SBHA 1IRIA 1J2UA 3OHPA 1GSHA 2DF8A 3UWDA 4A8JA 3WJ7A 1ZYUA 2J41A 4DA9A 3ZY3A 1SCAA 1ZH6A 4QGSA 3O47A 2BGRA 1RMTA 1YZGA 3NNDA 4RL4A 2P79A 4XD7D 1Z0IA 5EMHA 4P31A 3ED5A 5J2TF 2HD4A 3CVUA 1TAGA 3Q98A 3Q5GA 1X2BA 5T4HA 1JFFA 5B3AA 2GUGA 2WJAA 4GOJA 5DW3A 4XD2A 3SKVA 1RBZA 1G8JA 3GLGB 3NOXA 5LZ7A 1JI0A 1XHFA 1X92A 1I30A 2J7PA 2XWJI 3F9IA 1DO2A 1J5XA 1SIBE 2QLLA 4BZZA 4MNTA 1V4VA 2QP4A 2C2XA 5HKBA 3CY6A 3BMQA 3ZZNA 3AU8A 4WDQA 1KYZA 1U9IC 2VHTA 1K6MA 2OKCA 1U2EA 3HJTA 5HW0A 4YI5A 4O2BA 5E4FA 1HMPA 1PNVA 2PQ0A 2V45A 3VR1A 5DN6D 1ZRNA 1RBQA 1V8BA 2DLDA 3GT4A 3K0EA 3P94A 1UZAA 4EFLA 3DOHA 1C7JA 5DM0A 1G66A 3L8ZA 2ACKA 5I47A 1NW4A 3INNA 2NVUB 4WZAE 3ZJ5A 4I6GA 4HNHA 1W93A 2HJSA 2IELA 3ADOA 3E7XA 4J0IA 4QGHA 3T9EA 5F2EA 3U7IA 4D97A 1PZEA 4ZN6A 1B0AA 5HJEA 3TBHA 1FTNA 5AHKA 4KOEC 1MXFA 2VWHA 2JARA 4JT8A 4PAGA 2G8NA 4AAYA 1RQGA 1KVRA 3LCRA 3CXRA 4G84A 3ADKA 4IMJB 3UO8B 2H48A 3P4YA 1NQVA 5HDQA 3HKDB 3HO6A 3R5KA 4K1XA 1ND5A 3G9ZA 1E20A 2N1BA 3PNYA 3DAYA 4K9PA 4FK8A 2Q4BA 2Y1WA 3U3ZA 2NO5A 1X86B 4JT2A 3U19A 3LXXA 1I4WA 3I23A 1IJBA 3IAFA 3E15A 1IVYA 1UQUA 4UTOA 3SMQA 3FGOA 3W5VA 4FWTA 4ECAA 1O57A 2C5FA 5BURA 5CA1A 4MVJM 5LQJA 2WNHA 1V25A 5K0ZA 1MB3A 3TIXB 3G9XA 1EZ1A 4CGYA 3RVBA 5TQ2A 2PU5A 1I1HA 2PWBA 2VJBA 1JVSA 4H7JA 4MDEA 3RC7A 1E9BA 2Y9PB 2QM8A 2YINC 5F73A 1MRZA 1JAXA 4FCWA 1ZH0A 4OLAA 2YJZA 1KQPA 1EDOA 2QVBA 1MPTA 1OGYA 3AHEA 3B1YA 3NV7A 4FOSA 5K6TA 1PVVA 1WLYA 4IW3B 5DNVA 5ALXA 2COUA 1C0KA 1LS6A 1CUCA 5DBIA 3T0IA 3TRDA 5A71A 3K9GA 4FFOA 4AJJA 3ZE1B 2ZUWA 3TZBA 4WESA 5IKEA 5DLPA 4HT3B 4MULA 3JQFA 1EJ6A 4B7XA 1F1BA 3FM9A 4MKFA 4TKMA 2W6OA 3C98A 2RC6A 1G291 5FHRA 1CUFA 2WIGA 3PD7A 1NTRA 2CXUA 4JP5A 4BRWA 4HNGA 4V2UA 3F6RA 2XUZA 3STTA 1L5ZA 1RWWA 3PDJA 1LPMA 2XE7A 3DZHA 3HZZA 2FZ4A 3TTYA 1JB9A 5C3MA 2A9RA 4P6VF 2JH9A 3FI0A 4BNFA 4ZKEA 1SU8A 5CLQA 2CCJA 3BQNB 3GPDG 1N2CE 3IQXA 1G63A 4X24A 4LJ8A 4B87A 4A1OA 2YRWA 4ZOQI 5AM3A 5JQWA 5JSHA 1G42A 4NIMA 3W4JA 5L4LA 4FD2A 2Y4OA 1VB3A 1GTL1 3GP3A 1C3JA 4QQFA 1E1RA 4ZOLA 3OQVA 2OCLA 4G5HA 4A91A 1G38A 4TT3A 2NXCA 1M0WA 1LI7A 4R1TA 3UB4A 3BPSA 3TE6A 4ZXFA 2GM3A 1PLKA 1JDVA 1FUYB 3DFKA 3HJUA 2ZQ5A 4JYCA 1WDTA 4O5AA 5CP8A 4C08A 1I0ZA 4F5WA 2LKDA 2R1ZA 2YICA 1RQ2A 3PTLA 4URHA 3JYNA 5A9SA 1JBQA 1JQAA 1U1CA 2YOHA 4WKCA 1T4GA 2FPGB 1KO1A 4JU8A 3STXA 3EPHA 1G8GA 3OE1A 5LQAA 4QEKA 3WL5A 3FYCA 1C8VB 3UK2A 3P9PA 4M1QA 1COZA 5IT9A 2IEAA 1Y1LA 2JLRA 1AS2A 3MRXA 4XQGA 2FK8A 3T7EA 3LPAA 3CKLA 4MW6A 2Y1EA 2WY2D 3KHSA </