2GKGA

Receiver domain from myxococcus xanthus social motility protein frzs
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
122
structure length
122
Chain Sequence
KKILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVDLSAGQNGYLICGKLKKDDDLKNVPIVIIGNPDGFAQHRKLKAHADEYVAKPVDADQLVERAGALIGFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords response regulator homolog
publication title An atypical receiver domain controls the dynamic polar localization of the Myxococcus xanthus social motility protein FrzS.
pubmed doi rcsb
source organism Myxococcus xanthus
total genus 45
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2006-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gkgA00
1ABEA 1NXXA 2JBAB 3CHYA 3OLXA 1KMIY 4G0OA 5DKFA 3VNAA 1RZRA 2VK2A 3G1WA 3LUHA 3O74A 2MYNA 4LE1A 4RK1A 4E7OA 1VLZA 2ZAYA 3HK2A 2OENG 1KGSA 1U8TA 2N9UA 3HEBA 3JY6A 2X7XA 2PL9A 3N6VA 1JHZA 4OTZA 5BQ3A 4KFCA 3C3KA 3N8IA 3LUCA 3K9CA 4JOQA 2CD7A 2MYTA 4YWHA 1GUDA 2TMYA 2FW0A 3IP9A 3L6UA 3IPAA 3M6MD 3ROFA 3RVRA 4RK0A 1JYEA 2QXYA 4MR9A 4JAVC 3BILA 5CHYA 1I3CA 3RVPA 1ZY2A 1TJYA 3MF4A 2M98A 4WWHA 5KQPA 4YS6A 2RJOA 3HV2A 4MGEA 1JBEA 2MSWA 6ABPA 4Z4GA 4O5AA 1PEAA 1Y1LA 3CLKA 5IBQA 2E4WA 2WRZA 3CTPA 2P4UA 1QO0A 2NT4A 5F64A 5FWYB 3KTOA 2JK1A 3MQ4A 3QEMB 2WY2D 1YIOA 4CBVA 1VRVA 2F8SA 2PLNA 1USIA 2MSKA 1Z18A 3A3KA 2FTKE 3T8YA 1JDNA 3H5OA 4DN6A 5JNRA 4RXTA 2H0AA 1Z2EA 1RZRD 4PICA 3Q41A 3RH0A 4RS3A 3GWGA 1JH9A 1B00A 3URMA 5JNWA 1MB3A 3SG0A 1YK0A 2E4XA 4ETIA 2IKSA 3QLUA 1PEYA 4RY0A 1MVOA 1PNRA 3QLTA 2A9QA 2E4YA 5TE9A 3L49A 4MRMA 5EWJA 1QKKA 1D1PA 4YRZA 4F8JA 4MR9B 1P6UA 3LUFA 2QR3A 4RU1A 3LUKA 2O20A 3F6CA 3Q7SA 4O1HA 2M1ZA 2FXIA 3CFYA 3P9YA 3OMWA 4L4UA 3OO1A 2J48A 1LBIA 3GYBA 4YCSA 1FFGA 1DBWA 1F4VA 1YK1A 1M5UA 2QVGA 3GT7A 3HSYA 1BA2A 3QEKA 3D8UA 5DGCA 5IUNC 1QP4A 4Z4HA 3H6GA 1FSPA 3KYIB 4EUKA 3JTEA 4H3KB 1RPJA 5EWMA 4MS4A 5FBHA 3N53A 1QO0D 3H5WA 5KC8A 3DBIA 1OXKB 4EYGA 5IC5A 3QX8A 3OM1A 3OQOA 4H60A 1GCGA 4Z4FA 3HZHA 1DC8A 2HQRA 1A04A 1P2FA 1K68A 1M5TA 1XHFA 4WXEA 1EHCA 1S8NA 4W5TA 2MYPA 4LRQA 4EY3A 5BR1A 3A0RB 4H3HB 4MS1A 4MPTA 4TN5A 3OLVA 3O1JC 3TMYA 4Z4CA 3D02A 1Z26A 3R0JA 2RDMA 3RVQA 1BDJA 4FE4A 2WWVD 1LJUA 4MRMB 5EWJB 3FMVA 2NZVG 3KLNA 1ZGZA 4LDAA 5TQ2A 3N0WA 4MQEA 1AB5A 3O2QB 2ZWMA 5CNKA 5IEBA 1A0OA 5BRAA 3RVOA 1DBQA 4RXUA 1SD5A 4PYRA 4YV7A 2PJUA 2FQXA 8ABPA 1JL3A 3HXMA 3VNBA 4NCAA 2NZUG 3FDFA 1JWLA 4FB4A 2FSPA 2CHFA 3O75A 3EODA 4F11A 3IPCA 5TPWA 4NICA 3CZ5A 3DLBA 3M9WA 4MS4B 4OG2A 1URPA 3I45A 5BRJA 2FVYA 4ML3A 4RWEA 5GQSA 3T6KA 3RVMA 1NXOA 4EYQA 4S04A 1F51E 2WJAA 5GOTA 5DCLA 5B3JA 3H5IA 2QSJA 3KJXA 2ID9A 2MSLA 4DQDA 3JS5A 4LZLA 3UK0A 4N03A 5B3JC 3MIZA 7ABPA 4MS1B 2HQOA 2FQYA 2FMHA 3KLOA 2R47A 3NHZA 4GNRA 4IF4A 4EGSA 4HNRA 3RVNA 3A10A 3N0XA 3O2JA 1GLGA 1W25A 5HQJA 1YVUA 4P1ZA 1Z16A 2R48A 2IPNA 3LUAA 5TQ2B 4MQEB 4JASB 5FWXA 5DTEA 1USKA 3H5TA 4WXMA 5HM6A 4F12A 1J56A 1W9HA 4OATA 4RDCA 1M2EA 4OBBA 1D2AA 2JVKA 3LTEA 4LE0A 4QYWA 5I4CA 2L18A 4YO7A 1ZESA 1D4ZA 2JVIA 1TVMA 2ID7A 2GWRA 2HQBA 1YMUA 4MAAA 1JX6A 4JB2A 3CRNA 3A0UA 3GV0A 1RXIA 4N0PA 1DG9A 5TPWB 5KQLA 4NV3A 3H75A 3RVKA 4KNYA 2DRIA 2VYCA 2LBPA 1AB6A 3CZCA 3EAFA 3FGZA 1NTRA 4L85A 2YHBA 3RVSA 4MLDA 3F6PA 4YR7A 3OQNA 3N0RA 1LBHA 2XDYA 4IMIB 4RY8A 2PUFA 5IULC 2VUHB 2GKGA 5CNMA 4Q7EA 1UDRA 3LUGA 3N75A 1XHEA 2FN8A 3O1HB 2GX6A 3ROTA 4ETNA 1OXBB 2AYZA 5FWXB 3W9SA 1D1QA 4W5RA 4IMJB 1LJLA 1QNLA 4LDZA 5HSGA 4XAQA 1Z25A 2FEPA 3O21A 3T95A 1MB0A 4W5QA 1CYEA 2I6FA 3Q15C 1E6KA 3EGCA 1LK0A 4KZKA 3TB6A 3I5AA 1QQAA 4KPYA 2L19A 1ISSA 2PUCA 5EWLA 1BDIA 3MM4A 3LFTA 3OLZA 2CHEA 2A9OA 4F06A 1PUXA 1APBA 1Z2DA 5JS1A 3GBVA 3G85A 2FMKA 4YP9A 4M88A 1XWWA 2V0NA 4Q6BA 1GUBA 3OO0A 5KWSA 4IGAA 1CHNA 4RV5A 3LKVA 3NHMA 4Z9AA 4DADA 1TMYA 3SM9A 4EVRA 5JNSA 4EVSA 3LUJA 3C6QA 3RVJA 3HM9A 2R4QA 2WMYA 1VPWA 5DLEA 2AYXA 3HUTA 3QELA 3OM0A 1EAYA 4NQRA 3EDCA 4EYKA 2LIVA 4XASA 4OLBA 4Z4EA 3NBMA 1ZVVA 2FEKA 3DGFC 5JNUA 3EQZA 1NXWA 3F7NA 5IEJA 4F3TA 1P6QA 1DRJA 4KMRA 2B4AA 1FFSA 3OLYA 1ZDMA 2GBPA 3E3MA 4ZYLA 2FEWB 3I42A 3CG0A 2R25B 4KQCA 2IDMA 1L5YA 4QICA 4WUTA 4G97A 2H3HA 3SQNA 1U04A 4G86A 1EWTA 4Z4IA 3KSMA 1D5WA 3BRSA 3I09A 3BRQA 5C5EA 4TLLB 3UUGA 4G0PA 3NNDA 2HJ9A 5EWLB 2FQWA 4G0XA 3O1IC 3IDOA 3MYYA 4RY9A 4RK7A 5CNJA 4TLMB 2OQRA 5T3YA 1ZITA 4WT7A 1TLFA 5EWMB 2PAFA 2IPMA 5IX8A 4KK4A 5ED4A 2PUAA 1JDPA 2QV0A 4NCBA 2PUBA 1U2PA 1JFVA 4YGXB 5PNTA 1KRXA 3SNKA 4RKRA 2E4ZA 3BBLA 4D74A 1Z15A 5TQJA 2A9RA 2GI4A 3HDGA 4JP1A 4JA2A 4RKQA 5T7BA 5IUJC 3KG2A 4UHJA 5CNIA 1MIHA 1NY5A 3BREA 3IP5A 4EVQA 2FLWA 4MQFA 1DCKA 1PHRA 5FBKA 1IIBA 3SAJA 1ZGGA 3ILHA 2A9PA 3HUUA 3FFXA 3GRCA 4N47A 3HJFA 1DP4A 2Q5CA 3OLWA 3QEMA 4E7PA 1YS6A 1QMPA 3EQ2A 1U2QA 3CS3A 1NATA 3O2SB 4G0YA 3EULA 3KKEA 4B09A 3H1GA 2JCGA 2NUBA 4S05A 1E6MA 4N0QA 1WETA 3KS9A 5KC9A 4XARA 2PE5A 3H6HA 4D6XA 4HNQA 3HS3A 3K4HA 5JNVA 4IILA 5JNTA 4Z9BA 3GL9A 2LP4Y 4G0QA 4ZPJA 1H9CA 4RZSA 4Z99A 3RVLA 1DZ3A 2W42A 1EWVA 1ZH2A 2PKXA 2WB4A 4KV7A 1KRWA 3Q7RA 4G0ZA 1EFAA 3HDVA 2FMIA 4HYEA 2NT3A 3KHTA 5TQ0A 2L17A 3F73A 3GBPA 3NNNA 4EYOA 3NNSA 4JB0A 5E3JA 3C97A 4Q6WA 4KREA 3CG4A 2WJWA 4MLCA 2RGYA 1NXSA 4MQFB 1BVHA 1MAVA 2VUIB 3IP7A 1A2OA 3CU5A 2PUGA 4RK5A 1P8AA 1DCMA 4P98A 3C3WA 3JVDA 1QP7A 4PZ0A 2FN9A 2L2QA 3TX6A 3H5VA 4UHKA 1QP0A 1QPZA 1SXHA 1R8JA 3C3MA 3HCWA 4ZJPA 2F8TA 1T34A 3KYJB 5ABPA 1C0EA 1RXEA 4FE7A 3TD9A 1JFSA 4IRXA 2IOYA 5HKOA 4YLEA 3HVRA 4RK6A 4MR8A 4N76A 1NXPA 3JPWA 3QLUC 4RSMA 2QVCA 2FMFA 5TPZA 2YHAA 3E61A 3DLHA 3CNBA 1JLKA 1PNTA 1JFTA 3HO1A 4MR7A 2QZJA 4Z0NA 5TQ0B 4Y9TA 5D2CA 3MMNA 2IYNA 3SY8A 2PUDA 3DGEC 2CWDA 3LKBA 4RXMA 1HEYA 5JS2A 4D6YA 4W5OA 1YTUA 1DC7A 9ABPA 1GCAA 2FLKA 3JPYA 3H5LA 1ZH4A 3JVIA 1ABFA 4G0MA 2BGGA 3FFTA 3OMXA 1U0SY 3H1FA 1ZHHA 1JF8A 1DRKA 3M9XA 4QYMA 1QQBA 3GA5A 2LPMA 2IPAB 3QX9A 1E2BA 4N41A 3QLVA 2JB9A 1DJMA 2IPLA 3B2NA 3Q9SA 2JVJA 4MS3A 3LOPA 1EWKA 2HPHA 4GPAA 3QLVC 4LX8A 5C5CA 2KYRA 2JBAA 3T38A 1E6LA 3Q7TA 4W5NA 3TO5A 1K66A 4XLTA 1DBPA 1Z13A 3KCNA 4MYRA 1JYFA 3RQIA 3H1EA 3IP6A 4XXHA 4ZMSA 2PMCA 2JRLA 4MR8B 1YS7A 3MA0A 1ZAYA 4TMYA 1SXIA 4LE2A 4QPJC 1C4WA 2FKAA 3FFWA 3LMKA 1SXGA 4WZZA 5TPZD 4ETMA 2QW1A 1ISRA 1RNLA 4MR7B 4ZMRA 1Z12A 2E4UA 4PE5B 1ZN2A 4O1IA 4PEVA 4RK4A 1SRRA 2P9HA 3CKMA 3QELB 1BDHA 5KQGA 1DCFA 3LUDA 1USGA 2HSGA 1FFWA 2PL1A 2RJNA 1M2FA 6CHYA 2E4VA 4KK3A 1Z17A 5KI6A 1NXTA 2LUOA 3QK7A 3S99A 5KQMA 1CEYA 1L5ZA 3DZDA 1TM2A 4KQ9A 4HNSA 4XFKA 3EJWA 3OQMA 4OLAA 4KRFA 1NXVA 4MS3B 2B1JA 3ILYA 2MYUA 5IUKC 5FWYA 1VKRA 4KVFA 3UKJA 1FQWA 1YMVA 2QU7A 1BAPA 2PUEA
chains in the Genus database with same CATH superfamily
4J0DA 4DDVA 1YOVB 5JNLA 1YRHA 2EP5A 4ZOEA 1EINA 4A03A 2FI1A 4Z0PA 4B2PA 1LDYA 1T8PA 4A8JB 4TYNA 5CA0F 4MVJM 2PJZA 4ZCLA 4CR8A 3AZOA 1NQ5A 3HJBA 1W19A 1U8EA 1UZUA 1UPUA 2W2VA 1EVIA 4RIHA 5K8UA 4C20A 3P9CA 4JI2B 1QHFA 5IM5A 3FDZA 2NO5A 2Q50A 2VAPA 4JR0A 3ROFA 3RVRA 3ECCA 5K0NA 2FQQA 3OQJA 3RRZA 2I71A 5I4KA 1YGYA 4QEZA 4GSLA 3DQQA 4XFJA 1KSJA 2YCLA 4W1SA 4H16A 4NEGA 4AWXA 5DM1A 3MF4A 3AESA 2CF6A 1IXKA 1TVCA 2B5VA 2GN2A 2YIMA 4FGLA 5DBGA 2OD9A 3PJRA 4KKXB 2BFFA 2HA5A 1DBSA 1FXUA 1JBEA 2GN8A 1QHIA 3P0EA 4ZXFA 2IP2A 3SR3A 4CMIA 2F2TA 1COWA 4AJEA 3K2QA 1NP6A 2WA2A 3QKWA 1W76A 1L4LA 3OZWA 4JT2A 3ICEA 5FBRB 1OWPA 2H2HA 5I7SA 1K0UA 1GQQA 2RGDA 2ODQA 3PENA 2DYKA 5EJIA 1A98A 2WU1A 1O8CA 6PFKA 3W34A 2RG7A 4D4IA 4WKOA 1WBDA 3F4LA 3B9BA 4AN0A 5REQB 1OWLA 3EPLA 3NVKI 2Y66A 3CUWA 3DD1A 3KOZA 1RMTA 3G6KA 4PF1A 3URMA 4HNAB 5BN5A 5JTTA 4EL5A 3ZHXA 1Q57A 1CPYA 1E2NA 1Q15A 4J3FA 3KAQA 1V45E 4NJMA 2Z83A 1Y1KE 2E4YA 3KV3O 3M1LA 3MWEA 1R6DA 5TE9A 2Y4NA 3WNZA 3TYXA 3E22B 2HPAA 3PFNA 3P9SA 4J1QA 4REOA 1O54A 2TYSB 5IJAA 2YYSA 4YP6A 3F5MA 3I1JA 3AR4A 3PGMA 4HX5A 3M4NA 1XTPA 4YV0A 3M1YA 5AM5A 2QVZX 4I9UA 3CFYA 1MO4A 1PF7E 3ZXSA 1HKUA 3S2UA 1JV2B 1G8YA 2IXBA 2WJ4A 5D3KA 1C81A 2BKVA 3NCTA 4PQGA 1EA7A 1JKIA 3EVEA 2IKQA 4WCDA 4YCSA 2HSWA 2I7CA 2CV2A 5CJJA 2V7UA 3QEKA 5E0KB 1P74A 3E82A 4IOLA 1FS5A 4LC0A 5AVYA 1AO3A 4O2BA 2H4WA 4CI9A 1JHOA 3PLRA 2WQZA 1KZYC 3WDLA 1GZ4A 5J43A 5FPHA 3WBJA 2HA3A 3NH6A 3O3MB 1NRJB 1RLTA 2ZRJA 4FMPA 4N3CA 1UMBA 3KYDB 4HYQA 4BZQA 4D9FA 5FF9A 1LC0A 4PO8A 1NMQA 3IFSA 5JT1A 3TLZA 2LDXA 1QYXA 3VR5A 3UXHA 1ZXBA 3KQHA 5DLQC 1GGMA 2QR2A 2RG1A 1TJPB 3VYUB 1Y3CE 3RYIA 1SOUA 4WKGA 5J4YA 1XJ5A 2R8BA 3T06B 3MUNA 5ALKA 3RUIA 4W5TA 4DDWA 3UK2A 3FAKA 4CM9D 4EB6A 1GT6A 1YVEI 4YMGA 4MPTA 3O1JC 4V0NA 3IAUA 2ZANA 4YRGA 2C4VA 3PR2B 4YJGB 4GI5A 1E3WA 4R8LA 2V58A 3LA6A 3JYPA 1D04A 4XB2A 2LIPA 3C8UA 4L3WA 2E21A 2YJ4A 5I3CA 1ZGZA 5J2TB 3JAMA 4WV3A 1XTJA 1GTVA 4DR1B 2CY0A 3ZDYB 3KQPA 5JRJA 4GMDA 4RESA 4IZ6A 3AINA 3P0IA 2XYPA 1PJQA 4GP7A 4EIWA 1OH8A 4EGJA 4MYCA 3B9QA 3QI7A 2R6R1 3A14A 2GRJA 3A6FA 2FJUA 1DB3A 3L4KA 1T2NA 1JHQA 3I0NA 3C87A 1IN6A 2H7YA 4IUYA 3IPLA 3FMIA 4C6SA 3HYCA 1O87A 1YQXA 4NICA 4TWAA 2X3UA 2XUJA 3GRFA 4P54A 5FJJA 3WSWA 4OG2A 1PT6A 2H29A 1HDRA 2WJZB 2AKYA 4X1KA 5FV4A 2P6PA 4G84A 2VP9A 3U60B 4XWWA 1KS2A 3HBFA 3VDMA 3RVMA 4MRSA 5IYZA 3R8FA 1T29A 5HQ3A 3ETNA 4S04A 4RFSB 3LQKA 2WVJA 3H9GA 3FN4A 2YZGA 1J39A 2HXGA 1NUQA 3K7EA 3AYXB 1PW5A 4FHEA 2Y1GA 4EKIA 1QLJA 2OBFA 4Y9UA 4KMSA 1P4HA 4A3SA 4CKXA 5DNYB 3I5XA 2RBEA 1ODLA 3ZTYA 1MXHA 3NHZA 2NGRA 4Y67A 5IF3A 3UANA 1SK9A 5CG2A 3CLUD 5K09A 2P65A 1O97C 2Q3JA 3J7TA 4F2DA 3T7RA 4IX1A 3TQFA 3TAXA 2GEVA 4KXNA 2IYFA 4Y6RA 4F56A 5JFTA 1QV9A 1U8XX 2DERA 3DTYA 2AVDA 2HF7A 2PMWB 2GZSA 4JDPA 5HF9A 1PSZA 3SEAA 4OL0A 1AQYA 2ZJ4A 3HV0A 2ES4A 4RDCA 5A5GA 1N2CA 3HKBA 5B1SA 4F9FA 5GJBA 1A9QA 1D4ZA 2BI7A 2XTNA 3LY8A 4M38A 1G9XA 4P4SB 2AOTB 2ID7A 3NH9A 1EUCB 1ZGJA 3F90A 2OYRA 2NX2A 3FWNA 4XCVA 4AJ2A 2OLEA 2MSDB 4J8PA 4FGKA 4C4RA 5IABA 1DMSA 5DT2A 3NYQA 5FBQB 4KNYA 3H75A 4LHZA 1FFAA 1IBCA 2R85A 1T9GR 1KKUA 1QB7A 2C0PA 1JI0A 1LNZA 2C77A 2YFYA 4HRAA 1FFEA 1TKAA 4WSOA 4D3FA 4MLDA 4CHTA 3O4RA 1SURA 1CIVA 2B98A 3AC0A 3M33A 1N9GB 1G1MA 1P2SA 2I65A 3O73A 3QA9A 3S29A 3CB4A 3WOVA 4BVBA 5A5VA 3G02A 3BXEA 4CLOA 4ND7A 4Z53A 5JSUA 3PDUA 4NH4A 4J0JA 4YQFA 2XEXA 1E92A 1MUUA 3M7IA 3PUIA 4AJOA 3ZDCA 1VCIA 3AGPA 2IBMA 4MAFA 3B6MA 4NBLA 3IKMB 3HVUA 3V8QA 4XIGS 3THXA 4Q16A 1DIGA 2DR0A 4FQ5A 4XSVA 3L6DA 1U9IA 2DG2A 4QHYA 4DC1A 2UZ4A 2AS0A 1MO5A 3LUPA 4MV6A 3SYRA 2BT4A 1E1CA 3FYUB 2J4CA 3K0EA 2OPHA 2VG8A 1LJLA 5ITVA 4ZI7A 1P1IA 1JFFA 4ASUA 4TSFA 5ILQA 4JKOA 1FMLA 2IW3A 1I4OA 5FTLA 4G5OA 3ZH9B 5HUJA 4W5QA 5CVUA 1OJ7A 3G0DA 1H85A 2WHEA 2ZBDA 2LW7A 3JYNA 3R0IA 1N1MA 3OU6A 4LZPA 1JEAA 2OXTA 1J9GA 3MEQA 3GCGA 2PS1A 4JJIA 4GYWA 4XQGA 1R0WA 5CLJA 3RYHB 1XZFA 1BVRA 1GT91 2Q0SA 3WAGA 3INGA 4GI7A 2FG7C 4V3CA 4MGYR 3H5AA 3AP1A 1BE8A 1Z4NA 1DWUA 2OAP1 1VFNA 5DT9A 4B4WA 1RPAA 3OHSX 3I2YX 4YY3B 3C4VA 2V55B 4RV5A 2IQIA 3P0JA 5KWJA 2VNIA 2J3QA 3HUFA 3DZBA 4Q12A 1FDRA 5DB4A 2R7AA 5FYQA 3NORA 3LUJA 2AZ4A 1B4DA 3HM9A 2OV4A 2VZ0A 2ZE6A 4RETA 4GMKA 3IQDB 3LLUA 2WHYA 4PBTA 2V8BA 3PNSA 1A9RA 1QIGA 1TU0A 3W3AA 3SP1A 1G5FA 3ADCA 2J6IA 4F2WA 3LNCA 1KQOA 1U0RA 2ZXEA 3WMXA 3Q6MA 4JBHA 5IF9A 3SEZA 4J7XA 2A86A 2Q07A 3ORYA 4B81A 3WGUA 2FV8A 1YCFA 1Q0UA 4B40A 1VOTA 4O4IF 1WNFA 1YCGA 1ZHOA 1CJUC 2J0UA 4QXOA 1I1HA 3V46A 3FPCA 4H59A 1GQOA 1CETA 1ZBDA 5EXTA 4PG5A 3A1DA 1DQNA 2WSBA 2NU7B 3AP3A 2VDMB 3GJ6A 5BXQC 5EWLB 3L1HA 4PS1A 1WCXA 3PTLA 4W5WA 2XBMA 1Z0FA 1NMSA 3REQA 3K6JA 1F38A 5JZOA 3DBVO 2JBWA 1OD6A 3VDQA 3W9YA 1Q16A 1KI8A 1B0PA 5KINB 4H0NA 4XJVA 4BO0A 1BOFA 3QPUA 2WILA 2WTUA 2E48A 1ZJZA 3F2VA 3NBYC 3UPDA 3TG2A 1MCZA 5JYCA 2V4UA 3UPUA 4DNQA 5BW5A 4ZU1X 1GPUA 2UZ0A 4GOXA 3BMNB 5A3JA 5LJLA 1OI2A 1Y5NA 3LECA 1Y4DE 4P80A 5ED0A 5KYTA 2NO9A 4Y2YA 3R6TA 4IRMA 1SGWA 4TKLA 4Y2GA 3VR6A 1KAMA 3PJFA 3G8AA 1QVZA 2AFHE 4H7PA 4OV6B 3EIQA 5IAAA 2DWUA 1RYFA 2JZNA 2OMEA 3HDGA 4KPFC 3NM5A 4Q7QA 2BHSA 3K30A 4CG0A 3H9QA 4O08A 4U7TB 4BU0A 3EXHB 4D9EA 1BCRB 2EG5A 3QBEA 2DF8A 4GXTA 4P5DA 1ZGGA 4WW0A 1E62A 5T57A 3WV5A 5A5DA 5I7RA 1FUIA 4F8YA 2NP7A 1N7HA 3ZHQA 1MB9A 2IPXA 4EJMA 2YJ6A 2NQ2C 4IDBA 1FP6A 1EWRA 5I5EA 2IUUA 3EWSA 2G80A 3R20A 3V48A 3CLTD 2DCMA 2O8EA 1W5SA 4ZQIA 3QZUA 2QTZA 4RLHA 3WHKA 1UODA 4S05A 3SQWA 5FNVB 4QASA 5K8VA 4BLVA 2JGMA 2RHJA 2P27A 2XEDA 1Z5VA 1DIAA 4IDQA 1B73A 5EQFA 1NFRA 3TNFA 3V33A 3VVMA 1IWBB 5ECGC 2G17A 3K4HA 3GMTA 5EUCA 1KFKB 1MB2A 3GB9A 3RS5A 1KAGA 2WMDA 4OHFA 5JNVA 3U6BA 2VTBB 4P4TA 1LFAA 5ITSA 2H7CA 4MCIA 2DQSA 4IV5A 4ZHQB 2HWXA 4ADSG 4DZTA 2WB4A 5B2FA 4QOGA 1ULZA 2BFCB 4R6WA 1FTWA 1VYVA 4IVNA 2OFXA 5C52B 3S4YA 2GAJA 1V95A 4NY1A 1LBQA 2JC3A 3E1KA 2M1XA 1Y1QA 1USUA 1QX4A 3QVLA 1MEJA 3GFQA 4HWKA 1GRCA 3LVBA 3ET5A 3IXLA 4K9NA 3O38A 2ZPTX 4YASA 4K6CA 3CG4A 5DOZA 2JJQA 3PHGA 1ZJWA 1IOVA 3EA5A 3G5UA 3W8RA 1MG0A 2F1HA 3D8TA 1S96A 5HF6A 3SF0A 2P3OA 3H2GA 2VUIB 2DFVA 4L4ZA 1P7WA 3STUA 4RK5A 1R6VA 3NI2A 1AV6A 4S35A 3TB4A 3UB4A 2V5UA 3F4BA 3JVDA 4KGXA 2ODTX 2O1XA 1D03A 5DW3A 5F33A 1L5HA 3T9BA 5C51B 3WISA 4CODB 1QP0A 4QPDA 5LP1A 1ZI9A 3FCEA 2C98A 1SXHA 5IVIA 3WG9A 4B34A 5FOSA 1FXSA 1MRSA 3MCAA 4XA8A 5KSWB 3V8RA 4ZCTA 4DV5B 1ZN8A 5MFPA 3R4VA 1ANKA 4L16A 1P5HA 5CYPA 3DVSX 3GJ8A 5AJUA 2PRJA 3PC4A 3B82A 5JHHB 1D7OA 4YAKA 4MR8A 1P0QA 1KFJB 2W2TA 1S4MA 4OJNA 1IPHA 2QENA 2YHIA 1E1RD 4KDRA 5HZMA 2WWXA 4OD0A 4MEJA 1AXEA 2YHAA 2AN5A 1R8XA 3HKEB 5DXFA 3CNEA 3AP2A 3JQAA 3UHOA 2HHJA 1JVSA 5TQ0B 3IMCA 4U39A 1JHVA 4D9HA 4U2KA 1M1NA 4D9IA 1YHZA 2CWDA 1G4AE 1GNTA 3GO4A 2WJJA 3D3JA 1LLQA 4G24A 5EUBA 1H2HA 1ULBA 4CG2A 3PNVA 3JPYA 3H5LA 3ICPA 4N3BA 1AS0A 4EABA 1Z22A 1U0SY 1Q7GA 3GLGE 1J0XO 1P7CA 4JQSA 1M2GA 1UR5A 4EKNB 1CNFA 2YFQA 1JEQB 5FNVF 4DOMA 4PO3X 2R4TA 4E13A 1K4YA 4MKHA 3LSTA 2YWBA 1JLLB 3QLVA 2QTAA 5HIAA 4FHFA 4NH0A 4BJ5A 4EKYA 1K5HA 3A4YA 3R24A 1EDEA 4COOA 1I13A 2PZMA 3N8GA 4GPAA 2QQEA 3AB8A 3DBOB 3VVLA 4KXQA 2PX3A 1X1SA 3G0CA 4V0MA 4BVKA 4OKIA 4B7CA 1TEZA 3EC1A 3O4IA 4BPBA 2JAWA 3KE9A 1GRNA 1TT5A 2JAQA 3BH6A 1Z13A 3FUWA 5T4HA 2YV4A 3BH7A 2GRAA 2QLLA 3SZLA 2AX4A 5CGZA 3W9BA 3FKJA 1EJBA 1Q77A 5BQOA 4BGVA 1YS7A 3UJ6A 2D7CA 4CMJA 1UPBA 4YCJA 1XDWA 3Q8KA 2BFPA 4MYTA 4TM7A 5T6BA 2XMQA 3FFWA 1HT0A 4M54A 4A10A 4B82A 4CV0A 1RCFA 5DVZA 4CF4A 3FVQA 3EXIA 2QN2A 4IEEA 2CB0A 1O94C 5WRFA 3CSUA 2XB4A 4W5JA 4UKDA 4Y7CA 3UT0A 4A0GA 2BTEA 2H2IA 5JDIA 5KQGA 2FW1A 3LJKA 3BMQA 1USGA 1NBIA 2I62A 2GPWA 3ZNPA 1LK7A 4GLBA 5KKCA 4EW1A 2Z2KA 1VL8A 3IJEB 4NQZA 3RTEA 3QLEA 2HJHA 1YRLA 4BRSA 1CEYA 3IRVA 1ID8A 5HZKA 1Z74A 1Q2UA 1W2WB 4F4UA 4MWZA 3DTNA 4YA6A 1J42A 3HLKA 4QG3A 4OLAA 3M81A 1FUYB 4HX2A 6REQB 2B1JA 1PTKA 3LWDA 2MYUA 4N54A 5FWYA 1VKRA 3LPDA 1R6BX 2NV0A 3UKJA 2O8EB 1P29A 1NR5A 3R74A 5JBNA 4JLSA 3MMSA 5FWAA 2GHTA 3EFBA 4FCTA 4FB5A 4BVLA 3DPSA 3F96A 5D3MB 4P4NA 3EGXB 2UZAA 3RU7A 4PZDA 2YBEA 4DW8A 3IVAA 2V59A 3C3JA 3HR8A 5H7XA 1O6GA 4MV9A 3AY7A 4YRLA 2WG2A 2GNAA 1YL7A 4YK7A 4HFMA 3N8IA 4Z7QB 2OMKA 2O9JA 3K9CA 4UNSA 5EMHA 1UL1X 3VI4B 1G7CA 4OHBA 3QKTA 4PPGA 3OFJA 4FHGA 4YP1A 1S9HA 4ARUA 1EU1A 4HTFA 4KL8S 5DDIP 3OPYB 1COZA 4IIJA 3QFCA 1X9IA 4I3FA 3V2GA 2Q9AA 2DR2A 3HI6A 1ZGHA 4MV3A 4AICA 1C9MA 1FMCA 2IYVA 5F5XA 1B2RA 1JN0A 5KVQA 2C94A 3HBNA 3I2JA 2OGTA 2ZSHA 4ZO7A 3DE2X 1CUFA 4F86A 5B12A 2RONA 1N9ZA 5DF1A 5LZ8A 3TOVA 1E94E 4TKVB 3RTAA 4FYMA 4LV5B 3VNUA 3MIIA 1NQUA 2V7WA 1T9KA 4K5QA 4WOBA 3UJNA 2YKGA 1DINA 1FYXA 1O5TA 3SFVA 4AYTA 4DN6A 4H1WA 4LGYA 1E61A 1YBVA 1T9GS 1V5IA 1XCGB 1Z2EA 1ZMBA 5FKJA 5J5CA 1VA4A 4ER0A 1ZRSA 1KSHA 4PGHA 1I10A 2AOXA 1KJYA 1AZLA 4U2DA 3SG0A 1U0BB 3SSAA 2W6PA 3IEVA 2CSUA 3M3DA 4DR3B 5F9FA 1FU4A 3RSCA 4QGGA 5DTIA 1ZEMA 3O8RA 3B9RA 1W75A 3B7GA 5H83A 1E79A 3AI7A 4D02A 1RAIA 4DV7B 5T3UA 1QFMA 1NF2A 2KMLA 4O2BF 1MTZA 2QTLA 4ZC1A 3AKYA 1ZR2A 3NWBA 3QKRA 4LDQA 1XQ6A 2JFUA 1PEDA 2W37A 3PXCX 3HUEA 5J63A 3T94A 4MPDA 4L4UA 3UJ3X 4AW9A 4DF3A 4IG4A 1KOGA 5BV0A 2IUEA 2ORVA 2IHNA 1ZCAA 4BAUA 5K3BA 3UHJA 1W87A 4AKIA 2NZXA 4HF7A 3OEEA 3GH1A 4L5IA 1BA2A 2WM9B 1TMOA 4MDFA 4YMWA 3W2TA 2Q5JA 2OZLA 5LQRA 4DXHA 3BVPA 2X0FA 1V0JA 4LGCA 1OT3A 1M67A 1EZ4A 1HM5A 1Y7HA 3D6NB 4NYMQ 1QO0D 5EWMA 2IP1A 1CIPA 4J16C 2MU1A 5C46F 3GRYA 3HKCB 3P2KA 2ZSUA 1AQ6A 4I7EA 2R68A 3EA0A 4G1EB 3TK1A 3FTFA 4JL5A 3IOBA 4C6TB 1AU9A 1D6JA 2V6MA 5AVWA 1JKJB 3IHWA 4LRQA 3Q3GE 4BO9A 3SX2A 2OCKA 4TV9B 3V8MA 4DTCA 3J7AC 5IU6A 3T7TA 3QW4B 2EHJA 1I4EB 2NM0A 5EMJA 1JILA 1HTBA 2Q1TA 2OHIA 2IHUA 5L3QA 4FYPA 3CX7A 4J29A 3IALA 2PUJA 2XBLA 4FW9A 1TJ5A 4HMOA 4RZQA 1KHHA 1C9EA 4PIMA 3ZS9A 1X9HA 1WF6A 1CEEA 4DUPA 2GEDA 3BRCA 1A0OA 2GEFA 2JFOA 2JDID 4N5HX 4AJ1A 3D6HA 3V5NA 2EERA 3BTOA 4B35A 3F46A 3PUXA 4YV7A 2HSZA 3DA8A 5CLLA 5T5QA 1CEQA 1K92A 2ZB3A 3IKTA 1BD4A 1WQ3A 3RHFA 3A1NA 1E9RA 3W4KA 2R7NA 6LDHA 3W79A 4CI0B 1OF1A 2VEOA 2VJOA 3EODA 5K3CA 4OO3A 3RUCA 2DEUA 5TPWA 3L0SA 4OB7A 3IUMA 2C4MA 2JEZA 3RWBA 3EXG2 1NHWA 4D9GA 3EZ7A 2G9RA 4Z3OA 1IWPB 4Y2UA 2QJTA 7ADHA 4PCUA 2D2VA 3QEOA 5LYJA 2CLSA 1MBZA 1TIKA 3KOOA 4JLNA 4RPLA 3WIVA 2XA1A 1CF4A 1NBME 1PJZA 1QIDA 2Z5LA 4MW1A 1EJ6A 1VMDA 4QOIA 5G0UA 2P4EA 4OI1A 4OK3A 3S55A 4Z9XA 1OW3B 2I2DA 4EGSA 2WTEA 4L15A 4DCSA 2ZIVB 3IE1A 3TPZA 4U02A 2RGCA 3O2JA 5ICEA 2Q3BA 2V7BA 1O95C 1PAUA 3AHIA 2WUVA 1PT8A 4B0OA 2QUBA 4P1ZA 1Z16A 1X80B 4E14A 4MWCA 5DTEA 3RU2A 1P1BA 1RJDA 4EGQA 1Q19A 1Z5PA 3NP7A 2IZ6A 3HWRA 4UJ5A 4B4VA 2XXBA 4K6GA 3TI9A 5LJIA 4OQ4A 5M5BA 1VC2A 4JBLA 1CE8A 5G0SA 1JQDA 3GRKA 4MW0A 1L8OA 2JVIA 4B75A 2EGUA 2RB4A 5DM2A 1T5LA 1XMIA 2J5QA 1JX6A 2Z09A 4MWTA 1J8DA 4XIIA 3KQKA 2YV1A 2UUPA 3M49A 4D9NA 1AGRA 1Q11A 5TY0A 4BS9A 3CZRA 4N40A 4QUBA 3RC9A 1BS9A 4K8OA 2CLOB 4BV3A 3HLYA 3Q5GA 2WP8J 2K7ZA 3RVKA 1R12A 2VYCA 1Y6RA 4QM6A 1HMYA 1N6LA 3I2IA 3NO4A 3VU1A 4QVKA 2OWEA 2FZEA 2O54A 2XOKA 1JEDA 2H5EA 3PVCA 2RCNA 4BP3A 1TZ2A 2Q9UA 3IAS1 4MUXA 4GW3A 1MVNA 1P61B 1U5BB 4DTIA 4CN8A 4ZI7F 4KEAA 1LLDA 4WEOA 2NU8A 1SU8A 1QCYA 3PRHA 2EG9A 3WLIA 3TQOA 1L4KA 4JBNA 4EA7A 3IB3A 5A03A 5IJ0B 1MRZA 1DC5A 3DULA 3FMPB 2QD1A 1XCLA 4OP1A 1XD8A 4JI1B 1EGHA 4JWTA 1IHPA 2PR2A 1FX0A 2QX9A 4IMJB 4QBFA 3K1JA 4HDCA 3FCXA 3M0EA 2V96A 1UUFA 3VPXA 2G8NA 4PZLA 4QXQA 2P9FA 2PA0A 5FL7D 3KTAB 3DLCA 3ZI0A 4CCSA 3BTVA 1YV9A 1T2AA 4GYKA 2QRNA 3ZV4A 3E2PA 2PN1A 5EXXA 4UHFA 2YVKA 1APBA 4R8KA 4GM1A 2FMKA 3ZW7A 1W34A 4M88A 3I2KA 3I92A 1N6NA 2V9CA 3UHAA 4BFTA 1WZNA 2BZGA 2VVTA 1IOWA 5JWHA 4UD6A 1MX3A 5DHUA 2PDAA 4ZYVA 4LMRA 4ZREA 3ZX4A 3H17A 3KQOA 2XD4A 2QN9A 3E81A 3EXFA 1R0RE 3KYBA 5CVDA 3RVJA 4DQUA 4EDFA 3FBWA 3RKSA 2CV1A 4NQRA 1L4GA 3L92A 4LZOA 2OYSA 4J90A 2VHZA 1KARA 1PJ8A 3KKKA 1KZGB 2WD7B 3K6SB 3VPDA 5CAEB 3HSKA 3IEXA 4B3IA 4MX8A 4PG6A 3VHXB 1DAEA 1KMHA 1U94A 2IX9A 1ZUWA 4RAOA 4RSHA 4LDRA 2G25A 1QGZA 4FFBA 4H15A 1T0IA 3U13A 2F00A 4Q9LA 3G23A 4RYDA 2WM8A 1KJWA 2QRJA 4JVSB 4UVIA 2R4UA 4A9AA 2RH8A 4NYIR 1A3CA 2P30A 3NM6B 3DMPA 1QVWA 3N07A 4W7HA 1V1RB 3UWDA 4NMMA 2FMTA 1L4EA 2I7XA 3MGKA 2QQ0A 5AJHA 2HH9A 2YXNA 4QUAA 3VBEA 5L4SA 2HCTA 3M1AA 3KUKA 2PU5A 2VFAA 4JEIA 1L7VC 3H4IA 2CXHA 2PUAA 4LX0A 1FSGA 1MMFB 4AQDA 2F1IA 2XMPA 1B3RA 2NW6A 4I4NA 4YEDA 3WYGA 3ZWDA 1JDZA 1JQJC 3ROXA 1Z0KA 5AW0A 4UOZA 3I04A 1QFYA 1ZXXA 1ICIA 3ZXIA 3GZNB 1TRKA 3OPXA 1FDVA 1Y0BA 2OUIA 3NHRA 4N7JA 4DFDA 1NU6A 2HMSA 3ETGA 4WAUA 4OYHA 5THKA 4NYIQ 4RTOA 4UHDA 3SIRA 5K7SA 3GMDA 1Z0SA 2H5LA 3W3AH 3TR5A 2EFJA 1DUSA 5IDYA 1Q83A 1A77A 1BVUA 2W11A 3KIPA 3CKKA 4TS1A 5LQAA 2MINA 1B8UA 2CHQA 1M8FA 1IIBA 2H0RA 5FBKA 9LDBA 3ER8A 2O0MA 3DEHA 4N8DA 4ZRMA 3LL4A 1YHYA 1OYWA 1R0ZA 3G6WA 3HJFA 3MVEA 1YS6A 3OC6A 4JOBA 4RMNA 4BRUA 4NE9A 3FVWA 3T7CA 3TCNA 1V5GA 2HKIA 5EQJB 1B8VA 1N2JA 3JAKA 4M0FA 1EB9A 1XAGA 1E6MA 3OA2A 4N0QA 1BRTA 3PYLA 2XYGA 3F6SA 3Q6IA 3T0FA 2J87A 4X61A 1LB1B 2O5VA 4XARA 5KC9A 4YJHB 5ILOA 2G82A 1U90A 5HOQA 2OO7A 1I0ZA 4WN9B 1K7FB 1QHEA 4PZEA 4LHXA 4X7BA 2UZ1B 2QPAA 5HMMA 2Y6UA 1ZM9A 2BUAA 4S1PA 3W77A 2LP4Y 5AW6A 1VHWA 3ZWVA 4ARZB 2ZU6A 1YMQA 1YQDA 1I2CA 5JPIA 4B5KA 2EBFX 2VAXA 3DWIA 3S1AB 2WFMA 3EEQA 3B38A 5BOVA 2NT3A 2BFBB 2Q0HA 4QYIA 5FWNA 1D2GA 3F8WA 2UYYA 1E5LA 4OPMA 4EYOA 2BM8A 3IAM6 4GR4A 1OFTA 3VR6H 1E2JA 3FNBA 1L7MA 1IXSB 2QUAA 3CCCA 1FL9A 4KFRA 3ZLJA 4KREA 2WJWA 5JSZA 4XQ9A 3SN6A 4O0LA 2JW5A 3NEPX 2RGYA 2OT3B 4LDJA 4Q4AA 1EFVA 5F7JA 3W2FA 1BIFA 4I8DA 3ZZ0A 5DM60 4R1LA 4X3PA 4R8SA 1VKNA 4RA6B 2YNMD 4DY4A 5HFJA 2PUGA 1DDIA 1XPOA 3GEBA 1WB9A 1R5OA 3FZNA 2HU2A 3PX7A 3BFKA 3LC0A 4K46A 1H0SA 1PO7A 1L4FA 3FPAA 1EDZA 4Q7MB 1M6NA 5A6VA 3LYAA 1NNLA 3O82A 2C07A 3ZYZA 1N1DA 3AVYA 2BR3A 3WGZA 1WB4A 1M1XB 3GEGA 3KDSE 2X8LA 3EBOA 3ZIDA 4D82A 1S2NA 5KOJB 3TD9A 3EEYA 4M9XA 4IRXA 4RTNA 1U7UA 2IOYA 2V9ZA 1II0A 1I5OA 3F9IA 4N8EA 3U4IA 4DMKA 2AOWA 5EJGA 4O2LA 3MAGA 3TNJA 1BDMA 3ZHVA 4TTPA 3RUPA 1L4HA 1H1TA 1Z2CA 2DY1A 4KQJA 5GP1A 4YMLA 2PX2A 3VMFA 1DQZA 4JYAB 1T1IA 3B52X 3TE7A 1DS6A 2EKZA 1ELOA 1Y3AA 3FYTA 3DGEC 3HMKA 2BSAA 5AQEA 4D6YA 5A5FA 3A6LA 5KOHA 1B23P 3K53A 3ZS8A 2FLKA 1MGPA 2IITA 3ZBQA 3RAFC 2X22A 4OAPA 3QPBA 3RFFA 5ECDA 4EEKA 4L51A 3ZDXB 4PN3A 4B7AA 3FD8A 3HBAA 1RTKA 1NLYA 1YDGA 1AKRA 1BS1A 4I50B 5AJXA 2B34A 2P78A 4FYHA 4LWOA 4J7AA 2IPLA 2ZDGA 2JVJA 3TL2A 3R40A 4EJSA 3NV7A 5H0IA 2B4RO 3ZYCA 2NMVA 5B6IA 5C5CA 3JASA 1P5ZB 1NN5A 3O5AA 3T7KA 4B31A 4BKUA 3Q8LA 2WD9A 3RFXA 2Y9PB 5TMDA 2ZZNA 2ENUA 2GUGA 2QD4A 4ZDKA 3IP6A 3TJMA 4R7TA 1MH9A 5GONB 2PMCA 3GPCA 2JRLA 5I48A 5KTPA 1GJRA 1EDOA 3K4PA 3M6VA 5BWCA 4MVJG 4C0XA 3TGLA 1ZAYA 2Q3DA 3NOVA 3Q3CA 3TZLA 3BD6A 2YQZA 3ENQA 1SXGA 3V8VA 3TD2A 3NHJA 5JPDA 5CFRA 3LIIA 1NP3A 1PDVA 2JK0A 1KL7A 1T9ZA 3OWXA 4OB6A 3WGHA 4PC3A 1VBKA 3TRDA 1M6WA 2GZAA 3F1KA 1TUGA 4PEVA 4AK9A 2ZWVA 3TX2A 3SJCA 4DLSA 1TLTA 1P72A 2X5KO 5KTSA 1STOA 2JJ2D 2PL1A 3OF5A 1M2FA 2O59A 5IJ9A 1ZVKA 4LJ6A 1JEJA 2CNKA 1MJHA 1KI9A 1Y89A 2I2XB 4RH3A 4TWJA 1LRKA 4WBNB 2IVFA 5DTJA 4NDAA 1EAMA 1YB1A 3D7MA 3F97A 1U2GC 4J0FA 1YL5A 4XKJA 3ASUA 3H4MA 4QBGB 3RIEA 2VHQA 3Q4GA 4XFKA 1LKZA 1YRWA 1LEHA 2WOOA 4ZI5A 5BT8A 1XTSA 4MQLA 4GXQA 3BWVA 2ATEA 3WYFA 1JHMA 1NDQA 2PUEA 2YZKA 3KLBA 1TUBA 1WHSB 3DKKA 2QTHA 3AIKA 4QE3A 1WUYA 3ZE0B 5HCUA 1Z4OA 1VGRA 3CLRD 3DWFA 4RORA 4S24A 4ZO4A 1F12A 4H08A 5FBHA 3ZKAA 2X7XA 1MW8X 3U9TA 4BFVA 1LDNA 3K2BA 3KB8A 4LI0A 1LX7A 2FW0A 3PC7A 3IPAA 3L77A 3R3VA 3V2HA 4YJ3A 1NF8A 3L82B 4RK0A 3WJ2A 1HDEA 3WRVA 3HZOA 2QZPA 4BQNA 2Q3MA 3AL3A 1Y9ZA 4LTDA 4X6LA 2VHUA 5CHYA 1EX6A 4FOTA 2QS9A 1M3SA 3SNHA 3VPBA 5KQPA 4TWRA 3GCDA 4TN1A 4Y9SA 3N2GA 4MUHA 5CX1B 3VXKA 6ABPA 1ZZGA 3KBBA 3SLGA 3V1NA 4X97A 1IN1A 5TGZA 2BGMA 5CBKA 5HKKA 3U5ZB 1J09A 5CIQA 2FWBA 2IGBA 4K87A 2AFRA 1TU3A 3AVTA 4HLDA 3W1WA 4LPSA 3OLCX 4R05A 3B85A 3EUAA 3L02A 3STHA 4A6PA 1KEEA 2WTMA 5T6MA 3K73O 4RMGA 1NNEA 3A3KA 2P91A 4CDRA 2V1XA 1HQYE 1ISFA 4PYMA 1K63A 1G9TA 1FSZA 2R66A 3NYWA 4MW5A 2P9ZA 4GR9A 2AOVA 4RKYA 3TR6A 4CEHB 2R1ZA 5EKXA 4YQEA 5KYNA 5ISMA 3KR0A 3R8XA 1E1MA 1ZICA 2HDHA 4RF4A 4XUGB 1EFUA 1A8IA 4GWKA 3U81A 1T91A 3T7EA 3O7MA 1JECA 1FYDA 3OIVA 1B14A 1QWSA 5L8VA 1XZ8A 5ALYA 4UM7A 2IU3A 3SI7A 3W6OA 1W88A 2Q6IA 1ID1A 3A1VA 5CW1A 1PR4A 2Q5HA 2DSNA 2G7MC 5ALPA 4RHFA 3AF0A 1P6UA 2GZDA 3P4XA 4RU1A 4O1HA 3P9QA 1M8JA 1T3HA 4RKFA 3P20A 4C7BA 4V0LA 1SQ5A 3OMWA 3M2PA 1RYBA 1LBIA 1A7AA 1Y6QA 1WDTA 4JJEA 2BL4A 3T4EA 3T9CA 3T3GA 3IRUA 1B1AA 1QF9A 2BUBA 3NAQA 2QVGA 2I9PA 1PUJA 4FSDA 4C4TA 1G2OA 1I1QB 4HDSB 4EY6A 4PQRA 5K5EA 4KWCA 3H6GA 1KI7A 3SS7X 1FB5A 1LPOA 2I8LA 4B3CA 1G20A 4B44A 1L4UA 1KMQA 3CJQA 1Z5OA 2AOUB 1Z75A 4HN9A 3H5WA 4WBXC 1J33A 2NWQA 4HQ6A 4LNUA 5JVDF 1JG2A 1VFPA 4WY8A 2O2IA 1YQEA 4PW0A 3HZHA 2C03A 1LQUA 1N92A 4Z9FA 3T4UA 3TCKA 1A04A 1WSDA 3SMQA 1S02A 1Y3FE 3NBZC 2RH5A 4DYVA 5HX7A 4TXMA 3U7EB 3DBRA 4G65A 1UFVA 2AXQA 5A4IS 4EY3A 3THYA 4R98A 2DWQA 4MS1A 5T8KC 4BNVA 2MMCA 4CKEB 2RMKA 4EQZA 1H8ED 1TVEA 2O5RA 1Z26A 3FA2A 4IH1A 5ALWA 2RDMA 1WZIA 3A1WA 3SKXA 4CJXA 3NT2A 2EW8A 1Z28A 1U65A 3MWKA 3W0LB 1A1VA 1OLUB 3SS8A 4HH3C 2CLFB 3UAVA 4DWOA 3GXBA 2VQ3A 2JCXA 1PZHA 4CHGA 2FPWA 4WQMA 1SZPA 1ZL0A 2GILA 2QAGC 5KNCA 5I4BA 4YXWA 2ZI5A 2QY9A 4MWEA 1J70A 4X63A 4WZBE 3HADA 3BHNA 5LYJF 4EEZA 1JL3A 3HXMA 5KVSA 1XROA 1BOOA 4X6XA 1VLLA 1BCSA 1JG7A 1QR6A 3QX7A 5DI3B 3BB4A 4V0SA 1DEXA 2EWWA 2LV8A 1EVYA 3WWPA 1HK7A 1IN5A 1PK8A 2FW7A 3EDRA 4DC0A 1IE3A 4ENSA 4O33A 4BP8A 3QF7A 4BEJA 3GA7A 2AEMA 1L7RA 1QE5A 4JELA 4LHSA 2V45A 4UVEA 5DM0A 5CDGA 1KEVA 4REQA 1G18A 3AR6A 1VGVA 2Q6OA 4DCTA 1L6RA 3I34X 4PN7A 3ORSA 2F62A 1T2DA 4LYDA 4F06A 1W1WA 1RKBA 1EVQA 3NM4A 2JS7A 1NMXA 5D85A 2B1QA 3WGQA 3ZJUA 5CH3A 1ILWA 1YQUA 4F04A 2HK9A 2JFPA 1V7PC 1BWQA 2OHVA 3HMQA 4IF4A 3R9WA 5KYXB 2BHRA 2AJDA 1DG1G 1ZN9A 2D3TA 1JZSA 2CWWA 4F92B 2Z9DA 2W00A 5C8XA 1MQSA 1DKUA 1FTQA 4DNPA 2X8JA 4YJKA 2HUPA 3U4QA 2C82A 1BYUA 3MGBA 3BWCA 1FP4A 3A1CA 5HIIA 3TUJC 1F2DA 2C2YA 4R9UC 4D79A 1JU4A 1JDBC 1UM8A 3LTEA 2XVZA 3PDHA 4OA5A 4Q1EA 5I4CA 2PBRA 3FUXA 1E4OA 1V8BA 1XLUA 5TGDA 2WU8A 3VV3A 1YUMA 2DQYA 3I4FA 4JITA 1VYHA 1ZOIA 3V4OA 3ZWKA 4NU6A 4S2EA 4OHPA 3TDNA 1RBMA 1KKLA 4OQLA 4DCPA 4HGZA 4XQ0A 4MUIA 2VJMB 1SPBS 2QRMA 3R76A 3UQZA 5L4NA 4DDKA 4IHJF 3OUZA 1DIHA 2EP8A 3HXTA 2JIPA 3L4SO 3PQ3A 4G41A 4TLAA 5CR9A 3ZY5A 2W2LA 4R41A 4B3RB 2FH5B 2C4HA 4KNWA 2R00A 3WA6A 3ZKWA 1P62B 7REQA 3OEHA 3NDPA 3F5SA 3CRW1 3WMRA 2AV6A 3LRPA 4I14A 1LGYA 3JQFA 4J4BA 3L9XA 2D0IA 2IUSA 1Z5GA 3LUGA 2IY8A 2ZQZA 4RHXA 3BAFA 4TM8A 1G1AA 2NV6A 3ZHUA 4DWWA 4KFUA 2FN8A 4ETNA 2WSIA 4UCWA 4GP9A 1T9DA 1JSLA 2ODWA 1NONA 4PR0A 5BR8B 3A7DA 4FDLA 3B70A 5ALFA 3BT7A 1ATIA 1RYMA 2CJWA 3DF7A 4GUDA 4HY3A 4OGFA 4PZYA 3BORA 3UMSA 1XA0A 3AY6A 3T95A 3DDUA 1PSWA 3L4EA 5CDSA 1N5LA 1E6KA 3KRTA 1AX9A 2AA3A 1SKQA 2GPAA 2OAQ1 2XCLA 4XQCA 4EHNA 3GT4A 4F5YA 3I5AA 1P1RA 1ZJ5A 1ZM7A 2C2XA 2OV1A 3JVUA 4GOLD 2H1SA 3TXYA 4BWGA 2NV2B 4S12A 4WKBA 1QIHA 2CHEA 3NEYA 3GBVA 1RHJA 1SELA 3D0OA 3TZEA 2I1VB 3H3FA 1UP7A 4NZZA 2B92A 5DWDA 4QBIA 1GUBA 4AKTA 1NN3A 4HUQA 3TTWA 2KE5A 4C1NA 4RQTA 3TGPA 1G5PA 1VMAA 4B32A 4XUEA 1N2SA 1QH1B 2NVBA 2IUFA 3GT3A 4DLXA 3SQXA 4BKPA 2MR5A 2FPIB 1VG8A 2ZSIA 4FINA 2QY6A 2X0RA 2VBIA 2WMYA 3FCAA 3N1UA 2AYXA 4G25A 1WJGA 1P2BA 5G3ZA 1KPGA 3A36A 4XASA 3QVSA 4D43A 4EYKA 5IK2A 4L6CA 4LJ5A 1DAMA 2OG2A 4JBGA 3IQZA 5IEJA 2O07A 1VJTA 2B61A 2MJLA 3LDAA 4P3XA 5J4LA 4WK0B 5EJ5A 1T5HX 1C0KA 1NUSA 4GSKA 2WU4A 4JYCA 2WD8A 3KYCB 3PNMA 4MUEA 1XKXA 3WL6A 1HE2A 2IYXA 4BNNA 3QTBA 3QWBA 1HMPA 2XNCA 4UTVA 4P3NA 1XZCA 2R25B 2YRFA 3Q8MA 1Y3DE 2YV5A 1NOJA 1SVMA 2RHTA 3P9NA 1V37A 3UJHA 1EWTA 1DX6A 5TRTA 2XUAA 4IJ5A 4DIFA 3AFGA 3SHOA 2D1YA 3T12A 1GR0A 2YDYA 2OO5C 3MT7A 1NJ2A 1R37A 3F3MA 4YMTA 1YIDA 3EQ9A 4JH0A 4A82A 1DKOA 2BH2A 1T0UA 1V1MB 1RZ3A 4BJ3A 3CX3A 2WKQA 2AQHA 1I7SB 4ZCSA 4KN9S 3V1YA 2FZWA 4NESA 3ZJVA 1XYYA 4POAA 1XEAA 3FOAA 2LZ0A 2REBA 4MPPA 4ZVSA 3U4DA 4CL0A 1AJEA 2G40A 2CE2X 4YGXB 4ER6A 1QF7A 1NF3A 3WLSA 1GZ6A 2P9JA 1GSOA 3ITNA 3FGOA 3I9LA 3CNLA 3CZ9A 4DMFA 4XD7D 2CB9A 5CVCA 2Z0MA 4M37A 2ZRQA 3P2YA 1N8NA 3X2FA 2GI4A 1D2EA 1QBGA 4RKQA 3EXEA 1RLUA 4ZVPA 1A76A 1UAAA 3JSXA 1OI4A 4NFHA 4G09A 4Z6KA 5EMNA 3BREA 3NANA 5ALTA 5LBIA 3ZLBA 2OD2A 2CVHA 4ZQGA 4EVQA 2GD0A 4COKA 4UNRA 3H0KA 3OKPA 1PHRA 4AP9A 5MGBA 2YL2A 2VXBA 5H3CA 3GLIA 3GRCA 4PHCA 1MX9A 1Y1PA 1ZLXA 1J8YF 1RWMA 1TL7C 1ZD5A 5EIWA 3DL0A 3ZUPA 4BVGA 3B5IA 4CRWB 4XTRA 2AFIB 4RGVA 4XSGA 2VC2B 5KB3A 2JGFA 1XPJA 4DC9A 2JCGA 4OLJA 4RPHA 2C2MA 10MHA 4JEMA 3VC3A 4O4LB 1WETA 2DJIA 3GD7A 2PWPA 1ONPA 1TO6A 2LCFA 2CN1A 3JAWB 1TNDA 3DDSA 3FRJA 2I7VA 5EN4A 4O3MA 2JZOA 1KIMA 3M6IA 3PC2A 1S2DA 3QMWA 4E1AA 4ZDIA 4JNKA 3P5SA 4MXDA 4A23A 4RZSA 5DMXA 3E23A 3BIWA 2XGGA 4L0DA 5CTAA 4PVCA 16PKA 4DIDA 3BDIA 4DB2A 3PWTA 4G01B 5CH5A 3UGJA 3HDVA 3MGCA 3VPHA 1SU6A 4Q4JB 5FFNA 3KHTA 4CTKA 3NUGA 1LNSA 3OTQA 5EZSA 2KHZA 3H8SA 4ABYA 4DJTA 4DG8A 4JB0A 5JAIA 2GR9A 3K09A 1KERA 3N3AC 4XWGA 4YDSA 3WHIA 4UAJA 2XE7A 3KT0A 3ZG6A 4LI3X 1OWMA 2DJ5A 5C4IA 1SJ9A 1N0IA 3L1IA 3R7BA 4Q3KA 1U8AA 4KQHA 3AU9A 4WIAA 4C03A 1FMJA 2QMUA 1WR8A 3ROGA 1BJRE 2P67A 1T5DX 3I9MA 2ID4A 1JDBB 3AUTA 2PD6A 2V6BA 4K86A 2FN9A 5CG1A 2OE2A 1XMOB 3VR0A 1JFRA 1B8PA 1N5RA 1P7VA 2QSZA 1KFCB 5AKIA 4YYEA 1FP1D 721PA 3HJCA 1KOFA 4JBXA 5CA1B 1QG2A 1L5MA 1C0EA 2AMJA 2C4NA 4FE7A 1CX9B 2BWJA 4YRBA 1EQUA 2G4LA 4JI0B 2VJAA 4B7UA 3DOUA 1J8MF 1SD1A 5JJBA 1KSFX 2DH6A 1J2YA 2VP5A 3FKQA 3GCZA 3K0FB 5JZVA 5IWAB 2W70A 2H59A 5BRNA 2OY0A 3SZUA 4KN5A 1OPRA 5ES3A 2PEZA 2JLXA 1WD5A 5HDBB 3RWOA 3WL5A 4BCCA 4PIVA 3DAHA 3E61A 1XCPA 2V6IA 4PRYA 1NGSA 4QJ4A 2VF5X 4OYLA 1TYZA 4E4TA 4UBIA 3OEYA 3WHLA 4NMHA 4Q3EA 4NHOA 2IIBA 2YTZA 2PUDA 3MMNA 5HJ7A 4HVTA 4BMSA 2PPLA 3T3OA 4ITVA 3IQWA 1ZWKA 4AQ7A 1HOXA 1Q0TA 4FDUA 4URUR 4IJQA 2CT8A 4QRDA 2HF8A 1ZCJA 4DCOA 1ZU4A 2OKGA 4WJLA 2X1MA 4HN4B 1ISJA 4ZOCA 5F7XA 1JQEA 1X7ZA 3I3OA 4RGBA 3MILA 1QAMA 3C15C 2Z9BA 3DDHA 4JR2A 5EGNA 1E7WA 1QG4A 1UAYA 2J41A 2VH2A 4IOMA 2VF7A 4J2TA 3BX1A 4URVR 3PEEA 3KUXA 3EFEA 4RGQA 3WXBA 3ZJ4A 2PYDA 5IDWA 2JBAA 5L3RA 2GEBA 3KL4A 4GLOA 3QRWA 5IG2A 1PJTA 3MOGA 4J7CA 1WO8A 2HQ1A 4E12A 3EDQA 3NBKA 4ZCMA 4BLOA 4ZMSA 3L46A 1SBCA 2ZBGA 5HGXA 1ORDA 2Y0DA 4DR5B 5HFNA 3GJQA 1JTVA 3I9V1 1YBMA 3L18A 3MGGA 3ANMA 3ZU3A 1KC1A 1K6EA 5E6RB 5SV2A 3QA3E 5DYIA 3SVTA 4OX9Y 1ISRA 1KAQA 4CDGA 3H9JA 1LCIA 1M0SA 3QVGA 4AIIA 3PSHA 3F74A 1IUOA 3QWFA 2BH9A 3LHFA 3ND5A 1IU9A 2P9HA 1VL0A 3CSDA 4YMIA 2H18A 1ADCA 4D42A 2EWVA 2UDPA 4DQXA 5DX8A 1JKXA 5D3QA 3OPQA 4Z2YA 1U99A 4PPNA 6CHYA 3ZGNA 4LJYA 4C21A 3PXXA 5LNK6 1HR0B 1YVRA 4UUOA 1TDJA 1EFDN 1XKLA 2PZFA 2Y2VA 3GQBB 3IT1A 4TRJA 1IHYA 5LYYA 5CA1F 4GC9A 4D0NA 4RJJA 5F1OA 2REOA 2B9EA 4FJ0A 5L6LB 4TVOA 2PLWA 1QH8B 4ACBA 3QWHA 2NU9B 4R71A 1DRVA 1WXHA 4LC9A 3GEMA 5DBIA 5E2BA 2QW0X 3ZWWA 4OAQA 5AKGA 3VZPA 5EZYA 5JZBA 2RIPA 4YJ3F 4GPZA 3RC1A 1KYIA 3CRZA 2GD6A 3F49S 3GEHA 1I3OA 4QDTA 5LXTF 1GFIA 3LM8A 1LH0A 1C3JA 2PO7A 5AJZA 2IEGA 1E77A 4OY3A 1MDBA 2OBXA 4P4GA 2YYAA 3HB1A 1K3UB 2AKAB 1GCIA 3L40A 4PINA 1DJQA 4BGIA 4ZPJA 5D86A 5BQ3A 4X00A 4NATA 2R6GA 3C3KA 2VDLB 3CMCO 4GI2A 4YWHA 1SH7A 3D5EA 5BNFA 5IWCA 3ZVMA 3N8NA 3LSYA 3VPFA 1UXKA 4F85A 4MUKA 1DNPA 4QQ8A 1MC8A 3N28A 3W7BA 3FZGA 1JYEA 1U1EA 4YBZA 4MR9A 4X45A 4DSAA 3E9CA 1DRWA 1MPXA 4ENQA 1FFHA 4Z7OB 1U5CA 2IWHA 4E5VA 1GTJ1 4IPTA 1A4RA 2FPGB 4MYUA 2AEFA 4BTEA 2AMYA 4XVQA 2AD5A 3R5KA 1X7DA 4EUHA 3MCZA 4UOEA 2Z6VA 4UHBA 2XMCA 3ZQ4A 3M9LA 2I7TA 4H4EA 3QQ5A 4WK6A 1E58A 4Q9DA 4RAQA 1ZXLA 5FP0A 4L4YA 4C7OA 1YR3A 5EIBC 2E4WA 1YB6A 3PGXA 1CUSA 5DK6A 4D41A 4FJ1A 3BRWA 3A9WA 3RTBA 1ZX1A 4LJ8A 5DTRA 5B1EA 5KPJA 2ZR7A 3MW8A 3O84A 4GGPA 4PWYA 1QRUA 4X5OA 4RKWA 5FT9A 3CUYA 1REQB 4S1WA 3RH0A 4WPGA 3H97A 4G5FA 5I9SA 4NR0A 5A0FA 1NVGA 3NGXA 4NS4A 1QKJA 3DKPA 3SM3A 2GRUA 4E94A 5JLAA 2JBHA 4GQAA 5FTWA 1YRQA 2DFDA 4UXHA 2NUAB 3NBUA 1LSOA 3T1QA 2B3TA 2A9QA 2FUG6 3U19A 1A82A 5GJVC 5HS4A 4RZUA 2GK6A 3BICA 3P2MA 1KYZA 3RS0A 2R8OA 3HGMA 2LRHA 5G0TA 1C30A 3NGMA 1K7SN 1TQDA 2QMEA 3QOFA 1XU4A 3PT5A 4KXFB 1ZK2A 2AQKA 3Q5EA 2AUNA 1E4EB 2ZJ1A 2OL4A 4BLWA 3WP1B 5ETJA 3IDSA 4IQ0A 3TSZA 3PGLA 3RUDA 2P5TB 2FK7A 2IRWA 1SFRA 2VXYA 2QIOA 3SHVA 1J5EB 3DO6A 3HQ4O 4RQUA 4EY7A 3ENNA 3QXCA 4OMCA 2MSEB 1BE0A 1RAAA 2BFDB 5BSHA 1VZ3A 2NTVA 1E8NA 3RR2A 1DUVG 4EPYA 4RVNA 4RD6A 1PWEA 3QHQA 4TLBA 1LSSA 2A1IA 2OOSA 3L7JA 1U0OC 5BR4A 1RHUA 5JAPA 3JZAA 1C4XA 3BMCB 5C4GB 4EHJA 4MVJE 1M5TA 3BMOA 1XFDA 1FS4A 3AHGA 2JGEA 5KNDA 3IE2A 4JN6B 5CVTA 4MGZR 1P1CA 3JQ8B 1MG5A 2D5AA 3OCCA 3SDSA 1G59A 1Z08A 3X3HA 4OHXA 3RHSA 2WSSA 3ETCA 4INJA 3NU1A 5A3VA 3I8SA 1IVNA 2AJLI 3GC6A 1LJUA 5EKUA 1NN0A 3LO5A 4PG8A 4TSRA 3QIAA 5I9TA 5L3ZA 1EK1A 1A7UA 2VUTA 3CUSA 3QE4A 2PSJA 1XTVA 3MCWA 2X0IA 5FXMA 3S44A 1P77A 3FPGA 4LJAA 8MHTA 3PR1A 3UV6A 5BRAA 1WXGA 5B53A 3KL2A 5AVUA 3S0JA 5J1SB 1J20A 1M2JA 1PNOA 2D6FA 2F3UA 2OUKA 1IZ8A 4YRMA 4IEIA 4CDMA 4BBZA 5I9NA 2WAAA 1AGNA 3L6CA 2FOLA 2PKYX 3CH4B 2QL7A 2HIHA 4AMYA 3IPCA 3UT6A 3BE5A 3E27A 3PEWA 2GF2A 2XNDA 3CZ5A 1BU8A 2NG1A 3RGGA 2BLNA 1IZZA 2FWRA 1JR3E 5KCMA 1BA3A 3FTDA 2WYUA 4RVGA 2C5BA 1FA9A 1M74A 3VH4A 4GPIB 1XCOA 4LOJA 121PA 1T36A 2IV7A 2PSSA 3AFHA 4FQ7A 4LF9B 2GEUA 2B83A 4CCAA 1MORA 2NSHA 2NZWA 1KO5A 1QSGA 2WDZA 3IGFA 1EHIA 1QAQA 2GJAA 2V54A 1PYGA 1XDGA 4GNRA 3KSAC 5JUWA 4HNRA 1E5QA 1UM9B 3ESCA 1NW5A 2QTFA 5DM70 4YCLA 3GBSA 5CK4A 3CE6A 2B35A 3CGWA 3I4CA 3ELYA 2IYLD 2YIVX 3GFBA 2GLXA 3BAZA 3KVYA 4OYYA 3BPSA 4LJKA 1K4KA 3L7KA 2H4FA 4F9GA 5CDFE 2Q1UA 5ALVA 4M0CA 5IKXA 5HCNA 4ENWA 1C9KA 3F3YA 3EZNA 4DLUA 4M0MA 4RE5A 4YECA 2CXRA 2CL5A 5FQNA 3TTYA 5KNCH 5BMVA 1J2EA 2XI4A 4LBWA 4Q1AA 2P2DA 4UUAA 2YW9A 4G0WA 2IS2A 4MYSA 1EEHA 1Q95A 3TZKA 2PUWA 2CZGA 3BEOA 3QVUA 4LJSA 2W4MA 4XX0B 3RIMA 2W43A 3E0QA 1MVLA 1SHUX 2FEOA 1WLSA 4OKNA 1CF2O 1NTRA 3BGSA 2YHBA 5ALHA 2ON6A 3RHTA 4X84A 5DHRA 4JNCA 3ENZA 3FCSB 1NW6A 3WYBA 3FNEA 4NS1A 4JP8A 3RBXA 5J3JA 3LPMA 2CDBA 2PT6A 1Q92A 4EFKA 2PUFA 3ZV5A 3SC6A 1RXCA 1N6IA 4L4SA 4UC0A 1EP9A 1O6BA 2BFMA 3LCUA 4MVXA 2W5UA 5EXDA 3WQRA 5TVKA 2REQB 4YP7A 3RF6A 2GJSA 2QPLA 3BIJA 1OX4A 4US0R 3CPHA 3D0KA 1PGNA 1MT3A 2QQFA 3PFGA 4YBRA 1K8RA 3WY9A 3KJEA 2E37A 4NENB 1OKKA 1W5EA 3U5TA 3E05A 4G07A 4KBFA 5I7AA 4REMA 1BVYF 1VCHA 2A9JA 2AFHA 1XE3A 1U9IC 4NE2A 3N6RA 4EUEA 1JNXX 4IS3A 2DT8A 5KX5A 1XRJA 4G0VA 1Z25A 2FF7A 4FYVA 2FEPA 3WYCA 2BP7A 3AESB 5BURA 2I6FA 1NW8A 3EGCA 5K4HA 2H08A 3K5IA 4S2UA 2IXDA 1JJBA 1F0NA 2I1QA 4HXYA 2NPFA 5B30A 4PSVA 3BCHA 4D74A 3TL6A 3FIUA 4C43A 4RTMA 4N5NA 3KD2A 3T3DA 1RYDA 3B2QA 2A33A 5B1DA 5TVGA 3I9JA 3LFTA 2XJ4A 5CM2Z 1N2GA 1P3Y1 3DW3X 3VGPA 4Z8YA 5C32A 1DTWA 5GADl 2FSVA 4FFWA 3HXPA 3OSUA 1P4JA 1LA2A 5J1TB 3CKLA 1XWWA 3QM1A 1K75A 2Q6VA 4J4TA 3HA7A 4O1MA 3VR4D 5CFPA 1JJAA 4PCAA 2GEKA 3OKAA 1YCHA 5IH3A 3CINA 3RV4A 3LAWA 2PHZA 3TWOA 2XDQA 2Q2QA 4U2FA 3THXB 1J5PA 1SUWA 1E8DA 1BC5A 2XCUA 1KJZA 2J31A 2VNHA 3GJ3A 3GWZA 4OFBA 2O8BB 2LIVA 4ED9A 5CDYA 1N2BA 4JFAA 2EU8A 5B3KA 1XZEA 1W59A 3F7NA 1A5AB 3KFXA 1CJSA 4YP5A 4MRNA 3WGLA 1I32A 3WWCA 1YC2A 3OETA 2ERCA 5CU7A 3DP7A 1RPZA 5LUBA 4C0KA 3N8KA 3R3JA 4MV7A 4LUCA 4NJEB 4HUTA 3KXPA 2GBPA 5FOQA 1T6BY 1T2EA 2IDMA 1MFZA 5LVAA 2H3HA 1RQXA 2QMOA 4D26A 3DUFA 3OCWA 5LWHA 3TZHA 3EC7A 2FZ4A 5HXAA 1V9SA 4Q9HA 2OPBA 2NVUB 3KPUA 3T9FA 4EZEA 4F4CA 3EW7A 5K3OA 1FXWA 4DUZB 3AG6A 3OCXA 3ZGLA 1HYEA 3NW9A 1ZEJA 1TTHA 2GB4A 2J45A 3LP5A 3ONFA 2XUQA 4RVCA 4D96A 3W5AA 3IOEA 2WSLA 2JKVA 3EVBA 2OD7A 2QTNA 1Y7LA 3LQ1A 3LOQA 5KO2A 3IT3A 2IPMA 4KK4A 5D5QA 4DXAA 2H4ZA 2Q21A 2ORED 4W8OA 4I1PA 2BSXA 2R6JA 3FDXA 5FX2A 1JHDA 4YCNA 1M76A 5ITZA 4HDKA 1A9OA 3K9BA 5JD6A 1V25A 5KPDA 5AVZA 4KUEA 3RYIB 3HEAA 4G3XA 1FQKA 1LLCA 3OZCA 4HL6A 4HKTA 2C4UA 3TE6A 5E3IA 1MJGA 4AP5A 1Z15A 3BCRA 4E15A 4EB6B 3ASZA 3WE7A 4X41A 3IEIA 4CM6A 1YFKA 5C1PA 3KG2A 2XX3A 3TG8A 1QGDA 3GDOA 2VP0A 1QDUA 2O48X 3HB4X 3K31A 3TRIA 3OHPA 1MW9X 4P4LA 2YMLA 2BBOA 4HJRA 4TMVA 3GN2A 3T3PB 2Y67A 5E0OA 1G3MA 3COJA 4N0EA 3JD0A 1Y4ZA 1AMNA 4O02B 2ZYWX 1UADA 3M5DA 3TUIC 4TS3A 4V24A 2L0XA 4ZALA 3GLGA 1CD5A 3FPBA 2GZRA 5I5GA 3QEAZ 2D0DA 2LKCA 4RJ2A 1XEFA 4M9UA 2A2ZA 1T9AA 3BDVA 1PZNA 3OEWA 4LVOA 4W63A 2KSQA 1H2AS 4MDEA 5BPFA 4URXR 4AS2A 3GNQA 4KXXA 3N8DA 1IATA 1R15A 3GL9A 3A9RA 3DTVB 3OAAD 5KU7A 5IYZB 2WABA 3IIJA 2JCBA 5FNZA 1SIWA 2C58A 3UY4A 3NYRA 4KV7A 3FHJA 4NPHA 2GK4A 5B1HA 3VKHA 2EKQA 1IEXA 1IN7A 3DE0X 2JAOA 4RWZA 5T41A 2CNLA 4BNHA 1X86B 3FMFA 1F3OA 4FOPA 1R7RA 3LXRA 4TUYA 3JCZA 1VL6A 3B36A 3ONNA 3TL3A 2P1RA 2WYWA 1V16A 5DX0A 5JXJA 3O7WA 5U4QA 4FGWA 1BHO1 2BZ1A 1RWVA 1OASA 1PE0A 4IQ8A 4Q7JB 3V1MA 4ZQBA 5EE3A 4MW4A 1BW9A 2PX5A 3RJMA 4CUJA 2F55A 4K26A 2HNBA 3UUEA 1FZQA 3BGIA 4IXWA 3CVYA 4K9QA 4O4HA 3LF2A 4X65B 1ETUA 3C3WA 2IXAA 3FM9A 3WO0A 4DBLC 5A4FS 1P0CA 3S2EA 2HU5A 1G4UR 4YHBA 3PL1A 4CF3A 3Q7QA 4L1KA 3GMSA 4R5HA 1KY4A 5EJMA 4B87A 2IWRA 3OMLA 2ATXA 5E1OA 2SICE 3KLMX 3MINA 3G2IA 4MQ6A 3TW8B 1W1IA 1JTEA 1MQ8B 2P90A 4MQ4A 1ZUD1 2XNHA 2WZQA 5EQDA 5EMKA 2GCGA 4PLYA 2B9VA 5JAQA 1I36A 1WPGA 3SXUA 1G17A 2PBLA 4EJ6A 5KQRA 3ADBA 2EJWA 4U3JA 5C3UA 5JY1A 5H82A 1P17A 1N6OA 3OOHA 3WWYA 2WK1A 3D7RA 2J5KA 2ATCA 4OFXA 4NCXA 4NEHB 2JLWA 3BWYA 2WLSA 4CLOB 3HGTA 1RYZA 2GJ9A 1XX6A 1MTOA 3ZHTA 1YTUA 4ND5A 2JGRA 5ALGA 3UMYA 4PLTA 4E5PA 1EPUA 1ZBQA 9ABPA 3L4BC 3FRHA 4I36A 2BGGA 2C96A 2B8WA 3AQIA 4LXHA 2FDRA 3MT8A 5BNZA 1ND5A 5HKKD 2WICA 1JAZA 1E9AA 2FY8A 5K3FA 5I47A 3AW9A 1E1CB 2C5EA 1WXDA 3F0TA 3B6ZA 2ZBEA 5EPOA 4ZU3A 1Z7YA 2XCQA 1RRKA 2BTQB 2ZEJA 3DL2A 3O03A 4R9SA 5F52A 5I4IA 4WY2A 4V39A 3LHKA 1EWQA 4G89A 1QBKC 1D9XA 2FFHA 2ZCVA 3QLVC 1JGTA 2F9FA 3ZGYA 5JZ9A 4CEIA 1GILA 1S9DA 1WZCA 4YAOA 1KDYA 3U40A 1EGAA 3BK1A 5JJKA 3O8BA 1VMIA 1XMVA 1NVBA 3BK2A 3Q1LA 1RC1A 1Z45A 4TL6A 2QJWA 1MF7A 1H0HA 2PRZA 4LRWA 1V8ZA 4ZZ2A 3ZE6A 3UFXB 3EG9A 3ESZA 4U7PB 3A2NA 2OEPA 2DUWA 4KZPA 2VRNA 4QUIA 2OILA 3A6HA 3BWMA 3QJGA 4DLWA 1RZUA 2ZSAA 3CZ4A 3RIXA 3WIBA 5DRYA 1DEKA 1GO2A 1NI4A 3PUKA 3RU9A 4A91A 4ENTA 3V3KA 5B4VA 2J6BA 5FEUA 3EF3A 1Z37A 4X60A 3TW4A 4PC6A 2JCSA 2VAWA 1G5IA 4URYR 4KH1A 3PL5A 2J33A 1B8OA 3Q7IA 1PFYA 1I33A 3EAQA 2IIVA 4HTAA 4KP7A 5EZYF 2EJTA 4WN3A 1NXTA 2Y92A 3RTDA 1PFWA 3H3JA 4H17A 1RPTA 4K9KA 2GAOA 1BWSA 3EEOA 3DCNA 3D1JA 1XMPA 3D43A 2X9GA 3K15A 3LX6A 1Y6GA 2OECA 2WNIA 1AY0A 2ZATA 4D9BA 4LS3A 2ZUUA 4ZV7A 3ILYA 3B6EA 5IUKC 1FDIA 4FONA 4L6IA 1QHGA 1XMJA 1G7TA 1XCJA 2IEYA 1NXXA 2VDJA 4JP2A 3IULA 4DYHA 1KJNA 1YVPA 1HLDA 2BV3A 4KRYA 2D5IA 1SMKA 2CCJA 2MYNA 3IHKA 1JIKA 4D3XA 2APJA 3X1DA 2Q3EA 4RF2A 5J2UA 3AH8A 4Y8VA 4XGIA 4OTZA 1KZ6A 1XZPA 1Z5ZA 2QBYB 4OIFA 3VKGA 1T4DA 2AR9A 2CD7A 4IL5A 3KBOA 2GPJA 1E96A 3VO8A 4F1KA 2RGNA 1E3MA 2BN4A 3LT0A 1HURA 2UVQA 3GJZA 3LYLA 2HEIA 5B4UA 1N33B 3JYLA 1UP4A 1ZJYA 2QXYA 1VYUA 3RC2A 3OTHA 3QBJA 1HDIA 1JXAA 4OMFG 1MHTA 2B0CA 4PPFA 2D06A 2B3DA 3T7JA 3AEKA 3AKEA 1DBRA 1GZDA 2QORA 3I2FA 2F64A 1KI6A 4R9VA 3QUTA 1FVHA 3O8QB 5JMTA 2FP3A 5M34A 5EPEA 1O96A 5ECYA 4CQMD 4YJ2A 1MAUA 1QTIA 3VHRA 1NYQA 2ZJ8A 1DEOA 1KTVA 1ABBA 2H31A 5DGXA 3SF8A 3U7RA 1X0VA 1E3SA 1JQAA 1O58A 4MQUA 1W96A 4E5UA 3H5OA 1F2TA 2VK8A 1TA9A 4LBZA 4US1R 2O3JA 2H0AA 1Q2XA 4RXTA 1PWHA 3IUQA 2J4FA 4ENPA 2WHPA 3Q41A 1SZDA 3FIJA 1T5IA 5C9ZA 2ICAA 1ZIXA 3OLQA 3QLUA 4M0EA 1V8OA 1PEYA 3OX4A 1MVOA 2ZR8A 1W0KA 3QLTA 1Q0SA 4NCHA 1L5GB 1PYOA 1NBMA 4I9FA 3O1LA 1T8WA 5ALRA 4AJ4A 2QYSA 1X94A 3AFNA 1V11A 5D8DA 2WKWA 4DRXA 1H3FA 3O4VA 2O5CA 4DV2B 5DBOA 5KTOA 2XUPA 2IDJA 4DRYA 3UMCA 2MT9A 2Q5EA 3P9YA 1VMEA 1SKBA 3GUZA 1EQAA 1T8SA 4I55B 4Q5IA 1GN8A 3LPNA 3T61A 3OO1A 2XCSB 5EIXA 2V6JA 1W0JD 4C0AC 4M7OA 4YFYA 3HKDA 2EFEB 4BO2A 3KEMA 4NMLA 4Z4HA 1T9CA 5DM4A 4GZ5A 4B8YA 4F2HA 1JH8A 1W4ZA 4AULA 1JQ3A 3FHLA 5KAPA 1DPFA 3T99A 1LUAA 4ROSA 3WGKA 4F2PA 2AEJA 5JJ5A 2W2LD 2YS6A 3PHLA 4RVOA 4XFDA 5HDQA 5AVVA 1L5HB 2J8ZA 2HLPA 4TZ0A 3M83A 4KX3A 4YRFA 2PEYA 4Z4FA 2UXCB 3V6MA 2YWHA 5GMOA 1QFZA 2I34A 1RZVA 3OEHD 4UASA 4XOUA 4DR2B 2PKWA 1I4TD 1XR3A 2VBCA 4I4TA 2WF8A 2WC1A 1S8NA 1U0LA 3BSYA 1QQTA 3IO5A 3Q1KA 5ESXA 1J99A 3RF7A 3L7BA 3UWSA 1Y8CA 3KT8A 3GJSA 5JISA 1U5AA 5L53A 3KQLA 3ZHRA 3CEHA 3BWXA 4S3MA 2GN1A 3HRHA 1ZH6A 4FE4A 1B93A 1K8ZB 1W36C 1XD9A 2WMOB 4BXOB 5EHQA 1NJ8A 1X0XA 3O3NB 3D8RA 4RFVA 3QU9A 4LDAA 1DGQA 3V4RA 1ENOA 5ADHA 4P8RA 3R09A 1D6SA 3JQAB 3OPMA 2KLBA 1M8GA 1XZBA 2BGUA 4PLCA 3SC2A 4IS2A 2O8FB 2I6QA 3E9MA 1M1NB 3OZUA 5IKEA 1GV0A 1U3VA 2J3LA 4UE2A 4JJ6A 3AHCA 2Y99A 2YBDA 3GRUA 3HZZA 1UKAA 1ULUA 4RABA 3ZBPA 4BVAA 1PR1A 2VCHA 3LXXA 5HE9A 1DOHA 1WQ4A 2VYND 1SC1A 3QI2A 3QLJA 4Q48A 4GKAA 1GDDA 1TGYA 1ODKA 3GHYA 3MMZA 3LC7O 4GKKB 2HV8A 2QT9A 1EIWA 3IC5A 5CLFA 2HK6A 1JSXA 2XVMA 4C4ZA 3EIFA 2BDEA 4JOCA 2C20A 5MN5A 3BC1A 4O4JB 1GGFA 1AN0A 4EYQA 3UYLA 3D54D 1FYEA 3HDHA 1TYEB 1D8TA 2PZEA 3PTZA 4EZBA 3ANTA 2LCQA 1K86A 3HDYA 1JEOA 3U56A 2ESRA 3OA0A 3C1UA 5A4DA 5KNDH 2ZPAA 4MINA 3W5JA 4TMZA 2CK3D 4N3AA 3U3JA 3TLMA 1H1DA 2DPLA 1J21A 4I55F 5BMVF 2ZSKA 1G8JA 4A6DA 1ZOSA 1SQGA 4HD8A 4FZJA 1RLMA 1TM7E 2G4VA 4X3OA 3RS3A 4O8CA 2ZIXA 1YR9A 5DNAA 1GADO 4MQEB 4L28A 5FWXA 3ZU5A 4GDFA 4CNBA 1USKA 3EXIB 1L7NA 3FX2A 4O6VA 4Z51A 4HB4A 1T1GA 4RULA 3BGDA 3VHQA 4XE5A 5CBPA 1Y80A 3S7TA 2ZLBA 2B1GA 1C7RA 3AV0B 4URZR 4BEVA 4YO7A 4F3NA 1ZESA 2FCRA 4Z1OA 3OQBA 3FGPA 3Q3HA 3JQ7A 3SYNA 2J9FA 1E99A 2WJHA 6YASA 1YULA 1YWGO 3TQSA 3EUEA 4XPZA 4TVBA 1P9OA 2IA5A 1QONA 1PN3A 3ZIAA 2HWUA 1MAAA 1NAIA 2Z58A 3K0CA 1LPBB 3K9LA 4CLEA 4UJ3A 1AB6A 3SR4A 3CZCA 4X3CA 5KWIA 1RM4A 2H92A 5HRAA 3OECA 2B7CA 3IESA 1I0IA 3PUHA 3KCQA 1Q44A 3DEKA 3SX0A 4BMOB 1L1RA 3IDAA 5CDHA 2MSNA 2DHCA 1A8PA 1AOXA 3HUDA 2C7GA 3SQMA 1V8PA 4RZHA 3ON5A 2D7JA 2EFHB 3X1KA 4TKUA 1Y1TA 3MELA 3EY4A 3V1LA 4YLYA 5KX5F 5TT0A 4MP8A 2Q4BA 3B7WA 2H3EA 4PSCA 2ISCA 1XTRA 5C7YA 5LFAA 1FLDA 3BB1A 1BDIA 1XN1A 2OLJA 1HT3A 2ANCA 4H6VA 3EA4A 4W1PA 5AW4A 1GG9A 1WNTA 1PW7A 3ND8A 4EB8A 5C1DA 4BRZA 3R3UA 4EY4A 4UBOA 1D1QA 2X5OA 4DIUA 2L69A 3O9VA 1QV7A 3GAAA 3H2BA 2VNJA 2GSDA 2CJFA 4IFBA 4KLCA 4YRPA 3S8MA 2XTMA 4EG8A 3C0KA 4BNUA 4EPTA 5AIAA 3V7FA 3ER6A 4GRDA 2NUPB 1H6AA 2BFNA 2Q7XA 3B51X 1C8KA 4EBBA 5A9RA 1IM2A 3RTGA 1ZJ6A 3PCTA 4QU9A 4JI7B 4M1QA 4U8HA 1DAIA 3HCPA 3MJTA 4YXFA 3MM4A 4D0RA 1K2WA 1QJ4A 1LNQA 4P4UA 1RKUA 4CV1A 2Y4OA 5JS1A 2MSCB 2WIGA 4KQ2A 1V3UA 1U28A 2C1XA 4R69A 3U44A 5EFOA 2ZW9A 5DP2A 2CD9A 4FFPA 4KWEA 2CHGA 3V7NA 4IDDA 3I64A 5E9WA 2XCRB 2EARA 3S2SA 1TCCA 4DLKA 4DPMA 3AERA 1W8DA 2CCGA 3FNRA 3J80A 3OHMA 2QRKA 4Z9AA 3MTQA 4CZ2A 4PSUA 2WG0A 5EUMA 1DBVO 2BELA 2PH5A 4FUQA 3SJUA 4CKWA 5MDHA 1H8HA 3DFZA 3GFVA 4E5YA 1NVXQ 1OU4A 2VJYA 2D3WA 4LZZA 2LTAA 1SPXA 2HRZA 4TPKA