2GKGA

Receiver domain from myxococcus xanthus social motility protein frzs
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
122
structure length
122
Chain Sequence
KKILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVDLSAGQNGYLICGKLKKDDDLKNVPIVIIGNPDGFAQHRKLKAHADEYVAKPVDADQLVERAGALIGFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An atypical receiver domain controls the dynamic polar localization of the Myxococcus xanthus social motility protein FrzS.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Signaling protein
molecule keywords response regulator homolog
total genus 45
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2006-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gkgA00
5IULC 4Z99A 1YIOA 4Z4CA 4F3TA 3CLKA 1DZ3A 2PUBA 4G0PA 3RVKA 4O1IA 1USIA 2P9HA 3TO5A 2PL9A 4NCAA 2ID9A 4G0YA 1DP4A 4UHJA 5CNMA 3CG4A 5KQGA 4NICA 5IEBA 4G0XA 3CZCA 2GWRA 1QP7A 3H6GA 4IMIB 1Z25A 4MLDA 4W5OA 5BRJA 4ZMRA 1CHNA 1UDRA 2L18A 2L17A 5JNUA 2RJOA 2IDMA 3M9WA 3BILA 1HEYA 1K66A 2JB9A 1YMVA 2TMYA 4LZLA 4NQRA 2A9OA 1YK1A 3FFTA 2HSGA 4KZKA 5TQ2A 1KGSA 1EWVA 1E6KA 3TMYA 2W42A 1JYFA 2PUEA 3GA5A 2WY2D 1JDNA 3KCNA 4HNSA 2FN8A 3GV0A 1JH9A 4EYOA 1GUBA 1LJLA 1PEAA 3IP7A 4NV3A 4XFKA 2R4QA 4S05A 2WRZA 3FGZA 3OM1A 3RVNA 4LDZA 1JBEA 3CG0A 1PUXA 5KC9A 1DRKA 2ZWMA 5JNVA 3TB6A 4D74A 3SY8A 4W5NA 3VNBA 4EUKA 3CZ5A 3DLBA 3QX9A 1D4ZA 3HUTA 5IUJC 3HS3A 5BR1A 1F51E 4W5RA 4YO7A 3O2QB 3UKJA 4W5QA 3QLUC 2WJAA 2PLNA 3H75A 2X7XA 2MYUA 1QP0A 4DQDA 2FLKA 3DBIA 1M2EA 1M5UA 4JB0A 5TPWB 3ROFA 3RVOA 4W5TA 4MGEA 3M9XA 3O74A 3OLXA 3RVLA 4MAAA 3MF4A 2E4YA 4G0OA 3O21A 1Z17A 2VUHB 1JL3A 4CBVA 4Y9TA 4G0MA 5IX8A 2FQXA 4WWHA 2WB4A 3KJXA 1SD5A 4RS3A 1ZITA 3QELB 4IMJB 3EAFA 4LE2A 1B00A 5HQJA 1Z26A 3LUHA 3I09A 1E6MA 2GI4A 4IGAA 5DKFA 1TJYA 2CD7A 2PL1A 5BQ3A 1GLGA 3H5WA 2V0NA 2OENG 4MQEA 4EVSA 4IRXA 3JPWA 3GRCA 1AB5A 1JFVA 2L2QA 4H3KB 2LUOA 3A3KA 4KK4A 4L85A 1I3CA 5IUKC 4RU1A 3MIZA 3HM9A 4D6YA 5D2CA 3ILHA 7ABPA 4LE0A 5JNSA 3OQMA 3JS5A 4GNRA 4HYEA 5HKOA 4IF4A 4RY8A 2FTKE 1E6LA 3BREA 4KREA 2JRLA 1DC7A 3KTOA 2RDMA 3RVQA 1NXOA 3GL9A 3HZHA 1RZRA 2PUFA 1JHZA 4RXMA 5DGCA 1U8TA 4FE7A 1QO0A 2LIVA 3T38A 1CYEA 3Q41A 4RK0A 1YK0A 2JVJA 3DLHA 1ZGZA 3GWGA 3Q7SA 5JS1A 4ETNA 1KMIY 3D02A 1NXPA 3JTEA 3HV2A 1T34A 3O2SB 3N8IA 1C0EA 3OO0A 2MSKA 4L4UA 4N0QA 3L49A 3Q15C 1R8JA 3CKMA 3HSYA 3EGCA 4MS1B 4OLBA 4F12A 4KPYA 2FEWB 1JWLA 1JF8A 2PAFA 2CWDA 4KNYA 1NTRA 2B1JA 4XASA 4N41A 4KMRA 3OQNA 1EAYA 5FWYB 2R47A 4B09A 2RGYA 2CHEA 1BAPA 2JBAA 5FBHA 1JLKA 3BRSA 2PE5A 3OQOA 3H5TA 2H3HA 5IC5A 4PE5B 4RKQA 3KHTA 1USKA 1BVHA 5JNWA 1QKKA 1Z12A 3H1FA 3SM9A 4UHKA 4EY3A 4EYKA 1S8NA 2LPMA 3G85A 1FFSA 1FQWA 5E3JA 5FWYA 3LUKA 1YTUA 3MYYA 1Z2DA 1FFGA 3LKVA 3P9YA 3QLUA 4RY0A 3CHYA 4DN6A 3HO1A 2FN9A 2VK2A 1VKRA 1NXSA 3KSMA 2FMHA 2MSLA 4QYMA 5FWXA 3C97A 3TD9A 2PUAA 1PEYA 4RXUA 1JYEA 2RJNA 1QP4A 1ISSA 2R48A 2J48A 3FDFA 4OTZA 3A0UA 4ZPJA 3W9SA 5EWLB 2M98A 3QLVC 4GPAA 1ABFA 4JASB 2WWVD 3A10A 3H6HA 4RK1A 4Z4EA 3QX8A 3R0JA 5ABPA 2FMIA 5TQJA 3LKBA 5KWSA 5KQMA 3EODA 1P6QA 3MM4A 4M88A 4YRZA 4MR8B 1F4VA 4MQFB 4TN5A 1ZAYA 3SNKA 4H60A 1C4WA 4MYRA 4YS6A 3RVMA 4WT7A 1YVUA 5HSGA 4MS4A 4QYWA 4YWHA 3GYBA 3QK7A 1RPJA 3I42A 3QLVA 2R25B 4FE4A 5CHYA 1Z16A 4N03A 5PNTA 3T95A 1Z15A 2XDYA 4PICA 4P98A 1H9CA 5JNTA 4Z0NA 2FSPA 1EFAA 4MQEB 1Z13A 2PMCA 2Q5CA 4LRQA 4MS4B 4TMYA 2FEKA 1XHEA 4G0QA 5DCLA 3MA0A 4OG2A 3JVDA 3I45A 4RSMA 1ZGGA 1URPA 3NBMA 3LMKA 3O1HB 3MQ4A 2JVIA 4QPJC 1D1PA 3UK0A 5C5EA 3QELA 3EJWA 5KQPA 1Y1LA 4XXHA 2QZJA 3C3MA 4Q6WA 3FFWA 3G1WA 1ISRA 3O1IC 3NHZA 3H1GA 4MRMA 4N47A 1WETA 3HEBA 3E3MA 4PEVA 2E4ZA 3LUDA 1Z18A 2JCGA 4MPTA 1D2AA 4EYGA 1TVMA 1YMUA 1EWTA 4ZYLA 4N0PA 4F06A 3C6QA 2FMFA 1RXIA 3OMWA 4MLCA 3FFXA 2PJUA 4KRFA 3KS9A 4EVQA 1IIBA 3K9CA 5TPWA 3N75A 1W9HA 1M2FA 2N9UA 2PUCA 2HQBA 3C3WA 1L5YA 4KVFA 2PUDA 1DC8A 1QQBA 2GKGA 2H0AA 3O1JC 3DZDA 1GUDA 3GBVA 1A2OA 1EHCA 1Z2EA 1ZDMA 4MS3B 1DBQA 1MVOA 2E4XA 3IP6A 4RK6A 4WXMA 1QO0D 4MRMB 2NT3A 3GT7A 1JDPA 2M1ZA 3TX6A 5DLEA 1XHFA 1J56A 6CHYA 1QPZA 3CFYA 2QVCA 4TLLB 5JS2A 4Z4HA 5TPZA 4MR9A 4TLMB 1TLFA 3KLNA 3N53A 5KQLA 1BDJA 3VNAA 2QR3A 4RZSA 5ED4A 2WMYA 1ZH2A 1USGA 5EWMB 5EWJB 4YR7A 3RH0A 1JFTA 3OO1A 1YS7A 2YHAA 4G97A 1A04A 3F6CA 3N6VA 1CEYA 4G86A 1W25A 4ZJPA 3F6PA 5TQ2B 3O2JA 1LK0A 1LJUA 5JNRA 3D8UA 4N76A 2AYXA 1PHRA 1VLZA 3F7NA 3HCWA 3LUFA 2HQRA 2QXYA 5KI6A 4EYQA 4OATA 4ZMSA 4KQ9A 3H5LA 3SG0A 1LBHA 1APBA 2HJ9A 2B4AA 3H5VA 1NXTA 1FFWA 5I4CA 1U2PA 3OMXA 1SRRA 2LP4Y 3HDGA 1YS6A 3HDVA 3KYJB 4MQFA 4MR8A 4Q7EA 4JAVC 3RVSA 3F73A 1BDIA 2MYPA 2FKAA 3H5OA 5BRAA 1VPWA 4Z4GA 2O20A 3E61A 4ETIA 4WXEA 3HUUA 1BDHA 3N0RA 1GCGA 2NUBA 1U04A 2LBPA 4QICA 4HNRA 5EWLA 1BA2A 3HK2A 1DBPA 3C3KA 3LUJA 3DGEC 3NHMA 4JP1A 1PNRA 2P4UA 4RY9A 1ZESA 3IPCA 4ML3A 4RDCA 3Q9SA 1MAVA 3HXMA 3HJFA 4MR7B 2PKXA 4YV7A 2JK1A 4RK7A 2OQRA 3MMNA 1ZN2A 5EWMA 4HNQA 4KFCA 4YGXB 3B2NA 4MR9B 4Z4FA 1EWKA 3H1EA 4YCSA 5TQ0B 4DADA 3SQNA 3URMA 1U2QA 1ZH4A 4JA2A 2HPHA 4YP9A 1KRWA 5CNIA 1JFSA 1P2FA 4ETMA 4OBBA 2JVKA 2IKSA 1RNLA 4MS3A 5FBKA 4Z4IA 4WUTA 3RVRA 1NATA 4PZ0A 1XWWA 4F11A 2KYRA 1ZHHA 1GCAA 1TM2A 1P8AA 3KKEA 1KRXA 2VUIB 1MB3A 3N0XA 2E4UA 3QEMB 4MS1A 4LX8A 3KG2A 1A0OA 4OLAA 3ROTA 4P1ZA 2QVGA 1DCFA 5KC8A 5IBQA 4Z9BA 1SXGA 2A9QA 2NT4A 2PUGA 1DJMA 4S04A 3IPAA 2WJWA 4KV7A 4XAQA 2GX6A 3HVRA 3S99A 3NNDA 1NXWA 2FQYA 4JB2A 4O1HA 4G0ZA 3SAJA 1U0SY 3CS3A 4XARA 5T7BA 3JY6A 3A0RB 3LOPA 3N0WA 3Q7TA 4E7OA 2CHFA 2NZUG 2F8SA 1PNTA 1TMYA 3EULA 4RK5A 3LUGA 2IPLA 5CNJA 5T3YA 2QV0A 2MYTA 3L6UA 3LTEA 2AYZA 2QW1A 3LFTA 3LUAA 1RXEA 1NXXA 5EWJA 4NCBA 5DTEA 2ZAYA 2DRIA 2ID7A 1LBIA 3NNSA 2F8TA 2E4WA 3K4HA 1QMPA 4WZZA 5TPZD 1MB0A 2FXIA 2IPAB 2E4VA 3JVIA 4O5AA 4H3HB 2IPMA 2FMKA 3CTPA 3JPYA 3BRQA 3OLVA 1SXIA 1DRJA 2GBPA 2MSWA 2QU7A 3FMVA 4RK4A 3RQIA 1VRVA 4FB4A 5GOTA 1DCKA 5TE9A 3H5IA 3IDOA 5CNKA 5GQSA 1OXBB 1L5ZA 5B3JC 2NZVG 1OXKB 2QSJA 3QEMA 1DCMA 1K68A 2FW0A 2HQOA 3LUCA 3OLYA 3T8YA 4EVRA 8ABPA 3EQZA 5FWXB 4LE1A 2A9PA 2FVYA 2IYNA 2FQWA 3GBPA 4EGSA 4RV5A 4Q6BA 3RVPA 2YHBA 2FEPA 5C5CA 2VYCA 3BBLA 1NY5A 4KQCA 1AB6A 5HM6A 4PYRA 1P6UA 4IILA 4KK3A 1D1QA 1MIHA 1E2BA 4RWEA 5IEJA 3T6KA 3CU5A 4LDAA 9ABPA 3O75A 1ABEA 1NXVA 2IPNA 3CRNA 2IOYA 4JOQA 3OLWA 5B3JA 3KLOA 4D6XA 3NNNA 4E7PA 3QEKA 5TQ0A 1ZVVA 1SXHA 1ZY2A 1RZRD 2FLWA 5IUNC 1QNLA 3UUGA 1QQAA 3EDCA 2JBAB 1M5TA 1DBWA 1D5WA 3IP5A 3OM0A 3Q7RA 4F8JA 2I6FA 3OLZA 2A9RA 4MR7A 4YLEA 3M6MD 3QLTA 5F64A 3I5AA 3RVJA 2MYNA 3ILYA 3KYIB 4RKRA 1DG9A 1FSPA 6ABPA 3DGFC 2BGGA 2L19A 3EQ2A 3IP9A 1JX6A 4RXTA 4XLTA 4Z9AA 3CNBA
chains in the Genus database with same CATH superfamily
1KZ9A 1JXMA 5BPFA 3IQDB 2OO7A 4R8KA 1ZBDA 3LD9A 1AZSC 1E18A 4DIDA 2O54A 3MZ0A 4LWOA 1P44A 1GL7A 2CXNA 3KZNA 4URZR 2PGIA 2VJKA 4U6SA 4F4UA 4LF7B 3R3UA 5ALWA 3TBHA 1ECFA 2JLVA 2ZRJA 2BHSA 2GCNA 3N2GB 3RF6A 1KU0A 3WNBA 3E22A 4XRRA 4ZYUA 5A4MS 4GL2A 2JCYA 2E21A 1B6TA 2HBZA 1ZRHA 1Z8DA 2DLNA 1EIZA 1ZOLA 3CZCA 3C70A 4PLVA 4PLTA 3WGYA 1DADA 1QHHB 2A9VA 3ZC3A 3ZWAA 4K2AA 4IG9A 2NVWA 3MCVA 4DTIA 3CRZA 2IUSA 4MWTA 1XROA 1ECLA 3PHBE 4RDHA 1SVMA 4ENTA 3ZGNA 2H11A 3P9QA 2Z6QA 4GR4A 1TM3E 3PUYA 1EJBA 1F6BA 1RHMA 4TMVA 5HBGA 3MCZA 3AVYA 5CA0A 1NVUQ 2O2HA 2J46A 4KXVA 4HNAA 1GYRA 1Z47A 1E6KA 2ZBDA 4UVDA 4FILA 5BNFA 3T5CA 3KQHA 2JFVA 3TLJA 3MWEA 1NUQA 1SC1A 4G1EB 2FSHA 1NPDA 3KYCA 4I4LA 1KQGA 3ECCA 2Q99A 4RPJA 1U90A 1ZUIA 4AROA 1FL9A 3N8KA 3T1OA 3SHTA 3AUUA 5G1PA 1EFUA 2VCYA 5KX5B 3PSAA 4A03A 2G1PA 4NE7A 5CMLA 1L7AA 4L9SA 4AJJA 3FLEA 3F3SA 1XNGA 3KJNA 3EGOA 4TXNA 3WQSB 4CT4B 3UKJA 4PSVA 1DAKA 1NNSA 3MCTA 1FMCA 3DQQA 4V1CI 3F5DA 3WLFA 4Q9NA 3GJ7A 4NYMR 4B4WA 2QZSA 3WWDA 4DUPA 4ZI7A 1NSYA 3LYAA 5DNVA 3PITA 1M5UA 3MBIA 4IJWA 1SD1A 4JB0A 5AYVA 2BFBB 5KVQA 2OD9A 1XNJA 4U7DA 4TQAA 1W59A 3V2IA 2C92A 5AFSA 3E84A 1XVTA 5E1OA 1XJ0A 2HMYB 1E96A 1UBUS 4R5HA 3QOYA 4YROA 3SI7A 4NEHB 4BMZA 1YF3A 4H0CA 4UUBA 2IXAA 1ZK1A 2QPTA 3RK1A 3VC3A 1UBNA 4YCBA 4A8PA 4X8LA 3EUFA 2HRBA 4BKRA 2I76A 3VRHA 1E2LA 4B3TB 3MSCA 2IP4A 1MVLA 2FUNB 2NW6A 2ZT7A 3MT0A 3HP4A 4HDKA 2YCLA 1UDBA 4QQNA 2WUFA 4L0QA 2I29A 5CLQA 1PJ8A 1DKMA 1VJ1A 3EXIB 1JAZA 3M6UA 2RGXA 3MWEB 4KIWA 3KOYA 4L5JA 4TS4A 5CVJA 4K28A 4RVOA 3EDMA 1YCHA 2H7CA 3M6LA 4MVJP 2NVUB 4AG6A 4CQLB 1JLHA 4A6PA 4ZVNA 2WMNB 3VR6H 1PN3A 4LVOA 2Q4DA 2EQAA 2VKQA 5ICFA 2F1IA 2AHOA 4BKMA 4JUBA 2FCRA 1U94A 4AZSA 4I36A 2R1VB 2BFOA 3WDSA 3TTWA 2WFLB 4CQLA 5F1YA 1PQWA 5CFRA 4EY6A 5CJJA 1Q12A 3B7GA 2ZWVA 5AUOB 5KNCA 1JT2A 1P3DA 3MQ2A 2VSYA 1DAOA 2W22A 2GILA 4GOLD 4JLWA 5AKLA 1WJGA 5FOVA 3MERA 1CYEA 4DSZA 4MVYA 4WV3A 4XIGS 1L4EA 5NULA 1RCFA 3LECA 3MXTA 4LIPD 1T4CA 3H7IA 5KHLB 1JSZA 2CZCA 2F59A 4EK9A 1SELA 5JR3A 3T7AA 3T3OA 3HYLA 2CXXA 4HFJA 3TLAA 1IJBA 5DP2A 1BWRA 3T5MA 2Z3VA 5SZJA 3WTBA 5IBCA 3OO0A 5TJ9A 3UB4A 1FMLA 2HHJA 2DQKA 3Q15C 4NTZA 3TLGB 2A1IA 4FE3A 2PU7A 2X9QA 5JEDA 3DKVA 3EQ9A 4LQDA 1JQLB 2ZTVA 3WRXA 3ZJ4A 1XDDA 4TSKA 3CEPB 3H4VA 5BN3A 3AL0C 1NTRA 1GQYA 1RM5A 1T9ZA 2ZIGA 1YZTA 2JRCA 3BHJA 4ZCPA 2EZ8A 1UXHA 3N2KB 4BMVA 5IHXA 3EIEA 1U80A 2YKGA 3CISA 2X77A 3FG9A 2OB2A 5H3HA 3C7KA 1VPDA 2XPCA 3KOXA 4D5EA 1TT5B 1XJQA 3H9EO 4HBGA 2GVZC 2OUIA 1XPUA 2ZCUA 2GM3A 2G1JA 1JIXA 2OSVA 4ZXFA 3JSAA 5HKBA 5JNWA 4C30A 4ARAA 1RXSA 1YFJA 5ADUS 2JZNA 2EP7A 2O8CA 1YTUA 3UK6A 1U31A 1XVUA 3MN1A 3WGNA 1PT7A 3MNFA 4QX6A 3HO1A 1G55A 4INJA 5EINA 4DMLA 3QVSA 3PC8A 3CX8A 4FMDF 1NI5A 2R1TA 4PZPA 3A1TA 4UE3S 1MNAA 5JOQA 2I87A 2C2MA 4KYIB 4IZ6A 4OFXA 2GWHA 4YAGA 2BDTA 3QPDA 1OYOA 3AOEC 4M0EA 3K71B 3BL8A 1KYYA 3MRVA 2R48A 1VXRA 3E9DA 1E3LA 1PRYA 1WQ1R 3EDYA 1K89A 2YJ3A 4DAEA 1Q20A 1W5BA 2GXSA 2H9YA 2PRYA 2X6RA 3EQ7A 2BZ0A 1YI0A 2FMIA 3KR9A 3LKBA 3OJFA 2AFIA 4MVJE 4MXDA 3T4PA 2PZMA 1GA6A 3HJGA 1VE5A 3HB0A 1W75A 5HZMA 4FYWA 2ZSFA 5AW1A 1XTQA 4PU0A 1PK9A 5M7EA 2ORWA 2Q3LA 4G5FA 4R9NA 5DV9A 2C7RA 2NU6B 4GHWA 2EZTA 4KLCA 3L2OB 5JC8A 4QGBA 3Q85A 5HK9A 4N0MA 4J1NA 3M6WA 3N2NA 2X2EA 4UHBA 1L4GA 3Q3GE 2R00A 1RQPA 2HLDA 4HAXA 4JA0A 3DMTC 3E15A 3EMDA 4XTRA 4LFCB 4E12A 1IM8A 1FP1D 1PJQA 2X4DA 4Q7JB 1DDOA 1GZDA 4C0WA 5B7GA 1U98A 1M1ZA 4HEQA 1NYLA 5FF9A 2ZT5A 2O3QA 3K1JA 4LRQA 4ZAGA 2Y76A 4UZFA 3W2FA 3W8FA 3IEXA 2SKEA 3TIXB 2OTCA 1K6JA 1X7HA 1P1HA 5K0CA 5J2TB 1KBZA 1ZGGA 5DMHA 4KPEC 3CNNA 4C7OB 1QFZA 3CH5A 4PYLA 4Y2VA 4QPJC 1AN0A 3DULA 3FAKA 3ASUA 3G0OA 1RHUA 3I1JA 3DHVA 3EJWA 1F2UA 1V35A 1Y1LA 3EY4A 3QELA 5E1MA 5M3BA 4NDZA 4Q4AA 2CXTA 3G1WA 5CVDA 2PS9A 5AT1A 1RJWA 1S2IA 1EFVA 3ZU4A 4MARA 1O54A 4ZQBA 3IT1A 3UICA 2FUG6 1A88A 2O7QA 4GWKA 4LBZA 3W9YA 4NAUA 5AXAA 2WJYA 3NWPA 2AR0A 3AVPA 3PTLA 4GSKA 4LUCA 3LWBA 4B32A 4BB5A 3K1ZA 2YN2A 5AOAA 2Z8ZA 5E9AA 2QRNA 1NOKA 2W8ZA 3FHLA 3HU2A 4QD3A 2DEUA 3W6PA 1Z83A 2JFUA 3C3WA 2XI4A 4DSOA 3EFEA 1TRHA 3SDSA 3MOIA 4MP6A 3SJUA 3WFIA 4B9EA 3NO4A 3DZDA 1RBZA 1SUEA 4NCJA 1RC8A 2NAFA 2R6DA 1M66A 3QV1A 1KK1A 4HRVA 2R96A 3U4MA 2Q5OA 2IS1A 1FEZA 3QVOA 1J06A 2LW7A 4BCBA 3HHEA 4MYUA 2WJVA 2CY0A 2RBKA 4RZQA 1DG1G 4FS8A 4BLOA 4H7DA 4DQLA 2DX7A 3CJRA 3O9MA 1YXMA 3DDNA 5J40A 1VHWA 4J6EA 3SF8B 3FPCA 1XAGA 1MB4A 2N46A 5FO1A 3J80A 4ARIA 4RVNA 1SC6A 2XOEA 1X77A 2B6NA 1FRZA 2Q2VA 1P2VA 1P1RA 1Y6QA 3CR3C 2I66A 4DIUA 4CCWA 1Q7CA 3AV0B 1H2WA 1I01A 3PDIB 4KXXA 4JVSB 1ONOA 3CNLA 1CEYA 4Y18A 3WNDA 3BSYA 1YAJA 2ZYVX 2HT1A 3CUWA 2IYPA 2Z8YM 4OATA 1E0JA 3G2HA 4ZMSA 1DFHA 3PD0A 2QLJA 1F3LA 5FAKA 1MO6A 4N48A 2QJTA 1ZYUA 1L8AA 3UUWA 1HUQA 1M6EX 3CWQA 2IYLD 4UTZA 4HNHA 2BTQA 5KJFA 1PFYA 1XKXA 3HDGA 5HF6A 1ATZA 3NHUA 1OC2A 3HJUA 5GJCA 4UW9A 3OPYB 1WSAA 4RUKA 1P81A 4LYHA 2AW3A 4JD5A 2AG1A 2YNMD 4YK7A 4DMRA 3E61A 1UDWA 1AM4D 1ID1A 2OOKA 4BO0A 2X0IA 1DVRA 3MILA 3LC2O 5CR9A 4FR0A 4LGMA 4C2UA 4JI2B 10MHA 3B9RA 3CZ9A 4W6QA 2E89A 1DBPA 3I8OA 2VRNA 4JBIA 3AVQA 1XFAA 4NF2A 4R1NA 2PIAA 1M73E 1ZKDA 3K9HA 5FJIA 3EPJA 3D6VA 4DBLE 5EP1A 2DULA 3BCUA 1LVHA 3H1PA 1B26A 3DD5A 3E8SA 3GFSA 3KPWA 4L4SA 4MYHA 4TT3A 5DFAA 3SBEA 4TTVA 3BD8A 3CLTC 4BWFB 3V55A 2ZRHA 1LTQA 3BWVA 1N3YA 1RM0A 2C00A 2HNBA 4KFCA 1VGQA 3NH9A 1DXHA 1NG1A 1ZC4A 4KO4S 4NNJA 3E05A 3KWLA 4AZ3A 4BBPA 1RP1A 3M3HA 5TQ0B 3GHYA 3I9NA 3KSDO 1ZJJA 3HBFA 3SQNA 3WGMA 1FZTA 1UFKA 4Y98A 2D2IA 4FQ5A 5DN9A 5JPDA 1GHTA 1ONNA 1JFSA 3JRWA 4CF6A 2HWWA 4YJHB 3V9AA 1Y6GA 1MV8A 4CWAA 1P1JA 4FCVA 1ENOA 1LPAB 4BEJA 5IZCC 3R8FA 5LQKA 1KQOA 1QHXA 2VJPA 1DSSG 2ACKA 5C18A 2GF2A 3OTHA 4JLSA 4EUEA 1TM2A 4U2KA 5CFNA 3DAFA 4JYZA 1US8B 2ZLBA 5CTAA 4GXRA 3TR6A 5ERXA 1J5EB 4N40A 2VTDA 1K9SA 4UFPA 1PFWA 3ZTTA 2DBYA 1A0OA 3KG2A 5HOEA 2JDID 3DHNA 2H8GA 1QO9A 5KJ6A 4I6EA 3EVEA 3TQIA 3QWAA 4JEMA 3EBOA 5ITZA 1NW5A 1W5SA 1SXGA 3C3EA 1GPKA 1RC0A 4PPQA 2NZYA 2WJWA 5CW2A 3R8XA 3WLKX 4BE4A 1EFRD 4NESA 5JH7B 4R1OA 3G0HA 1KY2A 4BUCA 3O6VA 4DWOA 4JYPA 1WOYA 4N6NA 1D8AA 2V7GA 5EIOA 2VP9A 3DV0B 1D4OA 2GBLC 2ZI5A 1U2TA 3T7TA 1EFLA 2Q9BA 3GUZA 1OWNA 5C37A 5JQGA 1G2IA 5A4KA 3IPLA 2P6RA 1T1RA 3JQDA 3EVTA 4JJ4A 4FBMA 4KYVA 1HTWA 3HA2A 5CNJA 4MV0A 3F9CA 1KI8A 4H0NA 4I1YA 1JEJA 5F7OA 1Z36A 4X00A 3UJ7A 1W46A 3LFTA 1N2BA 3RAFC 3H7AA 5H02A 3D8NA 3L18A 1BOFA 4KXNA 1YRBA 1K0UA 5DBFA 1FQOA 5H82A 5LXTA 2ODQA 1YAHA 2IK8A 2PZ8A 3MT7A 2AIRA 2TMDA 4XRGA 2YWFA 4OQEA 3VNQA 4CM1A 3W1VA 2E4AA 1X7XA 4RIFA 2G4LA 3AV3A 1C30B 1WY7A 5TGTA 3OLVA 1D6SA 1SXIA 2DFDA 1X1BA 2QM8A 2Z3WA 3VX4A 5J1SB 2ZZNA 2EKQA 1UXKA 4JP8A 1ZCFA 4NHOA 3H9CA 2YCBA 3ONNA 4QRDA 3X1MA 3ZDZB 3K05A 3K2EA 5KAMA 5B3JC 2QSJA 1OKKD 4FGKA 1NP3A 1TJPB 3L5KA 1DCMA 2WA1A 3BN3A 3LUCA 1XZJA 3ADPA 2AB0A 3D6MA 3EQZA 4YCAA 2GAFA 3F71A 4EKGA 2I3GA 3GBPA 1GPYA 2Z3ZA 3OQJA 4NBUA 4URFA 1X1RA 2NTNA 1AGXA 1AS0A 5J4KA 2NSDA 2CF5A 4FCCA 3L0ZA 1PL0A 3GLRA 3D3JA 3QOFA 5HM6A 5CDSA 2GPSA 2M32A 3GJ5A 1FTGA 3MFQA 1JLLA 3VYUB 2V8OA 1H0KA 3WQRA 5KS2A 4O2BA 4UBNA 4WXRA 4Y2QA 2AGVA 3NASA 4QDXA 1X19A 3BHIA 1NSTA 3ABOB 1VA5A 2HO4A 4RKEA 4IX1A 1PZEA 4M6WA 3AHCA 4G4SO 1M5TA 1SIWA 1LF0A 1EP2B 2ZPUA 1JHQA 1SK8A 5ERGB 3GY0A 1T8SA 1M10A 2ZB4A 3QU5A 3DONA 1V1MB 1E9SA 4JSRA 4D3FA 3IA7A 1KRHA 4J8PA 1A2KC 1N8SA 1E89A 4DLUA 1UP6A 1NMYA 3E1GA 4R54A 2FUCA 1MENA 3WL5A 1GUFA 1NJ1A 1NVVQ 1Z07A 4M7PA 1EFRA 2BELA 1G8HA 2XGSA 4Z99A 3W7BA 2Q1XA 2YXLA 5E8JA 3PTAA 3OFKA 3DMTA 2DMRA 4JQZA 3N2IA 3RHSA 2B1IA 5BUSA 1IMJA 4J7XA 2BUAA 4NH0A 2XE6A 5C8ZA 3E0QA 2XUZA 1XUOA 4JGBA 1PTKA 5DHTA 4DLLA 4PN7A 5IPFA 2P35A 2XNKA 1UFQA 3CG4A 3IV6A 3O8QA 2A86A 1XVVA 2OESA 1YZYA 4NICA 4QJBA 4X84A 1W4LA 4JDPA 4ZDKA 3HNPA 4YRKA 1ZJ5A 2XB2A 1CHNA 1RRFA 2H5JA 3DO8A 4D3YA 1L1FA 1CEEA 1MOSA 2GN2A 3M9WA 4CT5A 1TUBB 1SUFA 2ZYWX 3NYWA 1KQNA 5KYYB 2AXQA 2X9VA 1N2CE 1P5JA 3CM0A 1H66A 1S9HA 3TTSA 4D3ZA 1H3FA 1A76A 3AP1A 2ACWA 2JZOA 3DOIA 3C7CB 2A9OA 3HDQA 5TQ2A 4CLEA 2BOVA 1J97A 3H8SA 4FNAA 2PUEA 2EJUA 2OGZA 2OCBA 5AVZA 2OAEA 1IJEA 1IOWA 2HA2A 4DAOA 1ZMBA 2QRJA 2IHUA 1C0LA 1QHNA 4OLJA 1XU9A 3LXRA 2NP6A 1UT5A 3HXPA 3IDZA 4FHZA 1GR0A 4J0DA 1C81A 4OU4A 1EGQA 2EOAA 1QGED 1T6BY 2CUZA 3CG0A 4FMCF 4V0MA 1VRCA 5DNAA 1GTVA 3ZDYB 3S1AB 3HZZA 3IAS1 1Z45A 4D5GA 4WOKA 1U0NA 1SKAA 4HWKA 3DOFA 1D4ZA 3WKCA 3R5JA 1DQPA 4TROA 3ZHSA 4LI3X 3SZUA 3AQIA 3KTAA 5AKXA 3O2QB 4YCCA 3K0EA 2AK2A 1CX9B 4GL4A 3E3AA 3ITNA 4NFSA 2IOFK 4BMCA 4DNFA 2P90A 1OHHD 4FONA 5FV4A 1C7IA 1N3BA 3M1AA 5I7UA 4EGAA 5AUPB 2C5EA 3C41J 1TEHA 1E6UA 1JTVA 5EMMA 1XU4A 2C29D 3DZCA 4KR9A 1RTTA 4KWCA 1IATA 2AI1A 3PWSA 2Y05A 4GOJA 4D41A 3AZPA 5AK5A 5DW0A 1Y8QB 3P2JA 4PG6A 3D3WB 3GW8A 4GZ5A 1MH1A 1W6RA 3UENA 3H11B 5IKXA 4CR7A 3DAPA 4MDYA 3HCDA 4MB2A 4WWHA 2WIKA 4ENSA 1U7ZA 1F8FA 1CBUA 1ZC3A 1AUXA 3MYRA 4ESEA 3IUMA 2BMJA 4J9UE 5AXCA 3N59A 5AW9A 4DDTA 3RTBA 2I8CA 2J9ZB 3UM9A 1SULA 2H1IA 4M83A 1JDSA 3ZQKA 4E5KA 2V4UA 4QDKA 3U3OA 5CCEA 5FOUA 2WJ6A 2ZDGA 4W1QA 1IZZA 1JKJB 3D4PA 2LUOA 3A3KA 1SHTX 1RSZA 1I3CA 4L85A 2XBLA 4E5DA 1QQ6A 1SUBA 4ABTA 4MKXA 2VR1A 3RG2A 3NTVA 4TLEA 3VC2A 4ERNA 4YUWA 5I48A 5CHEA 1H65A 3FOCA 1QB8A 3JS5A 4DLPA 2GNPA 2NSLA 3MS2A 2QUKA 4ZOBA 5BORA 3VYWA 2DWOA 3G68A 4NJOA 1N0IA 3IAEA 3KV3O 1C1XA 3RVQA 5ELMA 2WMOB 3OT5A 1IUNA 3UTCA 1CUIA 2GCOA 3QLEA 4RJJA 1QKIA 6REQA 4LTMA 3O8QB 5T4BA 2XQIA 3G2NA 4CKYA 1MN6A 5JROA 1BROA 1TYDE 2FR1A 3U3KA 2QTVB 3ZIAA 3N8HA 4NE2A 3A11A 4NMXB 5HE8A 4D9NA 2AQKA 4Y2GA 4DG8A 3H17A 3DTVA 4HDRA 4P0TA 1M7HA 2XT0A 3HM2A 2Z8YA 2PWBA 2QE7A 2RGNC 4CMAA 1XKLA 1R18A 4ZRDA 1ZXBA 2IXGA 1MCZA 3IQZA 1XZGA 1D0VA 1TF7A 4GF5A 1IEQA 1YZ3A 4Q39A 4D02A 1CZRA 4UKDA 1EIWA 4RQUA 2WSSD 3GQVA 3H2IA 4MKFA 1Y8CA 2JIBA 1GSOA 3LCJA 1YR6A 2BD0A 3GJ4A 3PGA1 4AS3A 1BQ4A 2JK0A 2XB6A 5C8VA 3ZDDA 3HU1A 4ZEOA 1BMFD 3RYFB 4B09A 2WU3A 5BV0A 1D9ZA 4WZAB 1BAPA 3DVQX 4BP9A 2DSTA 1JLKA 2VNJA 4RVUA 3H5TA 2GH1A 1OGYA 2AS0A 2IU4A 3PVSA 3REOA 3IQHX 4PHHA 1K97A 1RZ3A 4WDQA 4EO4A 3U80A 1MW8X 2ECFA 2IC5A 1WM1A 1BVHA 3PPXA 2YWRA 3T1QA 4IMRA 4FOTA 2N75A 3MTEA 3UYLA 4DA6A 1HC7A 2VEDA 5I01A 1JQKA 1XDSA 4FDVA 1L5QA 3KYCB 1GU7A 3LSYA 3ZY6A 2NO4A 4ZQGA 2RB5A 4DN6A 3C4VA 4N39A 1Q1AA 2XUHA 3EN0A 4J2TA 4QE3A 1U99A 4O2AF 4YP1A 4F2DA 3EIHA 2NXEA 3E5RA 3QMWA 4INAA 4CUKA 3U61B 3VOSA 3JZIA 3UIEA 2XNDD 5CM8B 3N28A 3P27A 3TOXA 1W0KD 2CXPA 3TDNA 2QTVA 3TSAA 2ZR7A 2XKKA 3PNVA 2IYWA 3A10A 4D26A 3J7AC 5E0OA 3TFWA 3UXMA 5BW4A 5KWSA 3TL6A 3ORYA 1ZD4A 3BAZA 3KB2A 2CKDA 1LDMA 1SNYA 3AR4A 3H87A 3I9JA 2VP6A 5LP6F 3CF4A 3AU8A 4IH1A 4P4SA 3S2IA 5GIPE 1CUHA 4I2VA 2A30A 1VHTA 1OVGA 1ZL0A 2AG8A 1I14A 2EWMA 3N2YA 2YTZA 5HSGA 2IOHA 1C5KA 3E7XA 1XMVA 4TTTS 3DTYA 4ZVRA 4GICA 1HORA 2CHGA 5CXUA 1S01A 2VCEA 2ZIXA 3RT9A 2CLLB 1DS6A 5PNTA 3VVMA 3H1BA 1UL1X 1KTVA 3AC0A 2GLTA 2GS9A 1LV7A 1TK2A 3IERA 4CCYA 5KTMA 1VA4A 3DW3X 2Q5CA 2BCGY 3I2JA 2FEKA 2XDQB 1AMUA 1VSVA 1A4UA 2PAAA 1ETUA 1RAHA 3ICWA 3LVFO 3QKIA 4IQ4A 4O8ZA 1J39A 5HEKA 5CU7A 4EG1A 3VYRB 4PLPA 5LYJB 2NNLD 2ZYDA 4XSGA 1N6PA 1RBYA 1SEPA 5FPSA 3C3MA 1H3NA 4Q1CA 5E0KB 1N33B 4G3XA 4JVOA 2EATA 4IXWA 4W7SA 1H2FA 1V1RB 4YFYA 4X9XA 1ZS9A 2OGWA 2ATIA 1XEAA 3A1WA 4HDAA 4KIGA 4U9IS 5JMPA 2H5EA 4J0KA 4AO8A 3TECE 4REQA 4OM8A 1F2DA 3KEMA 1A5TA 4B34A 3O8LA 2YDXA 4S12A 5KYVA 2YY7A 4FEYA 4E5VA 4HTAA 2YJ5A 1LTHR 4G1UC 3A1UA 2GPTA 2J1LA 4KVFA 4TXJA 3WVNA 3D59A 2GKGA 3GVHA 2FFBA 1K8ZB 3PQ6A 4FEGA 4R9SA 2OO3A 1A7JA 4ZT3A 3ZHOA 3GH3A 1SWWA 3DBHB 4BZQA 1LDEA 3C8HA 3H2HA 3MB8A 4MS3B 1D5CA 4TYPA 4RK6A 2VLIA 1J0AA 1N2IA 4MITA 1NAHA 3E9ZA 2O1WA 1SXJB 5DLEA 1JE1A 3B1XA 1HWYA 4GPTA 5LC1A 4BV9A 3TIIA 1ANKA 3L7IA 1N7IA 2JFPA 3BMCA 3E1SA 5CLLA 2M2IA 2YUTA 3VYSB 5FX2A 3VSBA 3CW2A 1ZH2A 4L3VA 2OVBA 3UCXA 4EX7A 4B80A 4JVLA 4CW7A 5B7PA 3K9FC 4DR7B 1WBJB 3NBXX 3GLTA 3PPVA 4HDQB 4MP3A 4UCWA 1DV2A 4GPBA 1CUUA 3PEFA 4KSBA 2ZTSA 5IXSA 1M72A 4FR5A 2QT1A 1AQLA 2XSZA 3PHLA 2B4KA 4JZYA 1R4ZA 4Y67A 1A9XB 4R6XA 5EZ6B 1GGFA 4KJXA 4FFRA 2XA1A 1KSFX 1V3TA 2IH4A 3GPLA 3KXKA 4YV0A 2AYYA 4XM2A 3MUEA 5LP1A 2EGGA 3KPUA 2XBUA 3ADDA 2VP3A 4FX5A 2RHHA 2C78A 4MTLA 4Q4HB 2QQFA 4AQDA 2VBIA 3QKUA 3H19A 3IKLA 3NAQA 2D5BA 5PGMA 5KNBA 3GAAA 3TOZA 3RWBA 4XSVA 2G9UA 1GG8A 5IKEA 2P9TA 2JIPA 1PL7A 2GM9A 2R8PA 5E7JA 4LBVA 2RC5A 1QF6A 2HA6A 3PNLA 5HGJA 3N0RA 4EG8A 4J76A 2V58A 4FZJA 3AR5A 1ZQ9A 9GPBA 2JJ8A 4X90A 1LZLA 3D8BA 1HSOA 4TLCA 4AQYB 4H7PA 4K0RA 4E5SA 4R1LA 1WULS 1E1QD 1K9VF 2B4RO 1CW2B 1CRZA 5J4VA 2WHQA 2XWJI 1MMFB 2GCIA 3ELYA 5J58A 2OZPA 1ZNXA 4F6LA 1T1GA 1MXHA 2EP5A 3L8CA 5LUAA 2HWKA 2I3AA 2GK7A 3CH7A 4DQUA 3EHDA 4A16A 1I7PA 4B3BA 5I7WA 4RK7A 2W93A 3QSGA 3ACBA 1I7QB 3C6YA 3E9NA 2V98A 3GLHE 2VDKB 3WLIA 3B51X 1H2BA 2ADOA 3CO0S 4Z0PA 1K6IA 5A4IS 5LQUA 2HQ1A 5TSDA 3HCNA 2Z2YA 1GCUA 1LQUA 2WSBA 4GZMA 2FRVA 3GCDA 1NKVA 4GP6A 4GMGA 4ZU3A 5TC4A 1QZUA 2H2WA 2WD8A 1MIOA 3E8XA 3TR5A 3NDJA 1HRDA 2B25A 5JXGA 3ESDA 2NTEA 4MO2A 3AHJA 6PFKA 1U2GA 3IIKA 3O93A 2A7QA 5F1OA 1E2DA 1NATA 1U6JA 1G16A 4AIRA 4DJFC 3B60A 4DF3A 1Y4AE 3SFZA 1RJGA 3NIBA 1IQPA 1NMSA 1Q1ZA 1B8PA 2HBYA 4JEUA 1R9MA 3HEMA 5F21A 1VE7A 1AVTA 1O1YA 2CL5A 2CUKA 2VUIB 2PEYA 2J3JA 3QLJA 3GRPA 3QP9A 3CE9A 4Q3KA 4QGAA 4X6YA 5DGHA 2ZM5A 5AJHA 1S2MA 1MR3F 2R4UA 2WJHA 5AXBA 2DU8A 2PK3A 3M82A 2O8NA 2BGKA 2OO5C 2LD4A 1DI0A 3R20A 2NT4A 1QV9A 1QCZA 3QU9A 1V26A 2IXBA 1T4CB 4N9QA 3VR2A 3OLCX 3OOYA 4BKUA 3H13A 1C30A 1W76A 3SYRA 4QJ3A 3AETB 1XCMA 4R01A 1VSTA 2FF7A 2IHKA 2YWXA 2IS2A 1O95D 3LNCA 3KZCA 2VDLB 4KL8S 3A0RB 4RCVA 2COKA 4OX9B 4HRAA 1M7BA 3A2NA 3ODPA 1GUAA 2OV4A 5T3YA 2JJYA 4FC7A 4WKPA 3OX2A 4PYJA 5JBNA 1VP9A 1PNVA 5CIYA 1C7RA 3TTXA 5KTNA 4UVGA 3FNGA 2QGZA 2YYZA 2WD7A 4LY0A 2ISSD 1WCYA 2I62A 2CUTA 2ZAYA 3NUQA 5ECGC 1L5NA 3V4PB 4D56A 5AI8A 2V7XA 3ICVA 3R44A 4MKHA 2QJRA 2JH8A 1MJGA 3TOVA 3KUUA 2YQZA 2FOLA 4ZIRB 3K4HA 4CL3A 1OFTA 4RGVA 2Q5FA 1JDVA 2FXIA 3MTAA 4LXIA 4B4DA 4B74A 2ESRA 2NNWB 2TRSB 2AR7A 5KQRA 1N5IA 2MSWA 1ZVJA 4J0FA 1TW2A 3W9UA 3ROGA 4PS1A 1CQWA 3JZAA 3TM4A 1JJBA 1XN1A 5FA6A 2VRBA 3PNYA 5FYDA 2XD9A 8ATCA 1FYWA 1L5ZA 4R31A 3ZWDA 5G0WA 1G8FA 3HBLA 2DE0X 2C94A 1JBQA 2CDRA 1EVZA 2DTDA 2Q7DA 1Y48E 2FJ0A 2D8AA 5EKSA 2BBWA 4Z9YA 2AFIE 4AMGA 2DF8A 4D3SA 1H9CA 1GV1A 4FPXA 1E4YA 4TWRA 3HP7A 1Z6GA 4IDDA 4P34A 4Z2AA 3HDJA 2K7FA 4XI9A 4BJ3A 4NV0A 5E9WA 1VE6A 1USVA 2BMFA 4HFRA 4MO9A 5IEJA 4Q3NA 2C7VA 3GEDA 3CRNA 5EQJB 2A0KA 1YBAA 1Z08A 3OLWA 1ML3A 1GP2A 3A27A 3HN2A 5DGTA 2AMYA 3DPUA 4US0R 1OXMA 2C5AA 3P20A 1WPXA 2C5BA 3BE5A 5IUNC 1SCAA 3A4IA 2JBAB 2VK4A 4M7RA 5E4TA 3HV0A 1DBWA 2AOVA 2XYRA 3PFFA 1EYZA 4FN4A 1TCVA 4TLAA 1B8UA 4A73A 3OLZA 1TTHA 3NHAA 1OIVA 7MDHA 2O19A 1YR8A 4QU5A 1A7AA 3FPKA 5BWCA 4BFUA 3H65A 3RBXA 1BTOA 1P31A 1J07A 2PVPA 3D54D 3L46A 4RE5A 3P0RA 4ZT4A 5SY4A 6ABPA 1V9CA 2QUJA 5EGNA 3D8HA 4QOJA 4WAUA 3S3TA 5KHOC 2EQ5A 4F5WA 3AR8A 1U3DA 3K16A 3NANA 5FUMA 4BFCA 3GJXC 3PRHA 4O4JF 4MUHA 1CIVA 5FO0A 3FIUA 3CURA 1N1EA 1SURA 4QYTA 4Z1MA 2OMEA 3HCCA 1G8GA 3V8EA 4Q02A 1X14A 3TLMA 4O1IA 4Y6OA 3TO5A 1BS1A 4TL9A 2XUQA 4FIZA 2ZXUA 4KFUA 4KIJA 3HLTA 5B1IA 3PHGA 3I1YA 2PX0A 1NVEA 1PBNA 3AEZA 4GWLA 4MWBA 3R7BA 3A3PA 4DT1B 3UTDA 4KXMA 5DE3A 3QENA 1P33A 2HWUA 3LZCA 1XEXA 3QXXA 2F43B 2R6ZA 4BLVA 1U63A 1OAKA 1JPNA 1JZTA 2A0UA 2QXTA 4UEOA 4BNGA 3FHOA 1ZH6A 2C7OA 3F78A 1ZK4A 1QZXA 4EG4A 4PQFA 3PFKA 4TKZA 5ALVA 5DSTA 4MKIA 3KCQA 4IXMA 4WSOA 5FTJA 1CKEA 3ZCVA 5C8YA 1EFKA 3OQPA 3HCAA 3K30A 4OH1A 1A9QA 3FUVA 2NAPA 1ISMA 2WPNA 1JLRA 2Y1WA 3FF1A 3OX4A 4BE9A 1KAGA 3ZD7A 3ZGZA 4OIMA 3WKBA 1M1NA 1Z0FA 2BGLA 2XV1A 3AXSA 3E4DA 4E0BA 5JNVA 4FNGA 1QVRA 5DB4A 2HBRA 2B8WA 3OJOA 4FSHA 5CVUA 1RI3A 1ZM4A 3ED5A 4TZ6A 1XQVA 4URWR 5BPHA 3HS3A 1VG9B 3EG5A 5L53A 4V03A 2XYPA 1KK3A 1VJTA 1KYIA 4EPVA 1C9EA 1EPUA 1N2CB 3GCZA 5DWVA 3TPCA 2JW5A 3GI1A 2H31A 4PC7A 2OBBA 2VDJA 4HLDA 4JYCA 5IFKA 3MGBA 3QE3A 1DGQA 1B14A 1LNSA 4W6ZA 2BISA 4NCNA 1M2GA 1RJFA 3DWGA 3NBAA 5CYPA 5ESRA 1SUIA 3SHFA 4G0UA 1RWVA 1E1YA 2I22A 3IT2A 1YZHA 3NHLA 1HO3A 1REQA 4OIFA 1RFGE 4UATA 3WLTA 1Z68A 1TUIA 3O21A 1EXMA 1XLTC 4N1AA 3W77A 3EPKA 1IXYA 2BSQA 5DT9A 3WGVA 4ENUA 3O4HA 3HYRA 1NBAA 3N5CA 1MHPA 2JH3A 1TJ4A 5IX8A 2AUMA 3FYUC 1Z5GA 5JYEA 4GFDA 4JWKA 3JR3A 4UUOA 3MMPA 5EXEA 1NASA 1E3JA 2GD1O 2PQ6A 3FJOA 4GZ6A 3OQVA 3REQB 3VKFA 4O1MA 3UK7A 3DUFA 4C2TA 2WG0A 4XZ3A 2VAVA 5A0FA 4EJSB 3WV4A 2BFAA 3RS8A 1LLQA 2BR3A 3DE3X 3VU0A 4CIXA 2CUNA 3GRCA 4MW0A 1MO4A 1ZR4A 2NTYC 4V0SA 4LF5B 1OXXK 1E63A 1VFNA 2FSFA 1AQUA 1FS5A 4EEKA 1A1SA 3MTJA 1KMCA 1GGMA 3C8DA 3NHPA 4HVAA 5I4KA 2I3ZA 1CIJA 1ND6A 2ORYA 4DLYA 3IMFA 1KI6A 5K3SA 3BMQA 5J63A 4WKNA 1TUBA 4LYFA 4YJ3A 3K3PA 5HKOA 4RY8A 2FTKE 1EFPB 3EZFA 4NOJA 2GNAA 1EB8A 2XX3A 3M81A 1E6LA 1R0YA 4U2EA 2Y8EA 4LSWA 3NPMA 3IQEA 3NWEA 3LCRA 3NBKA 4FKMA 3N2GA 4BP8A 2RHLA 4EUNA 3A1EA 3C3BA 3WL4A 3G5TA 1H69A 4RL6A 2HJWA 2YWCA 2VCHA 3DLHA 1FP7A 2IYYA 2YQ5A 3LE8A 3ENVA 3UG6A 1N36B 1IK6A 3CCCA 4NBNA 3G0DA 1WTCA 4N5LA 1RWBA 2DVMA 1HMYA 2CGEA 4GLLA 1Y5RA 3QVTA 3EWNA 3MBOA 5CXXA 1N5OX 2AJTA 3VNUA 3OZDA 1SK9A 3VTKA 2WSYB 2C59A 4NYIQ 4Q5IA 4O02B 3TZLA 2B69A 3PL5A 5FWAA 3TNYA 2PLAA 3I04M 7YASA 1VL6A 3ZU2A 1IUPA 4KHPB 2QWXA 3KLMX 5K0EA 1L1QA 1AIPA 1FP4B 1HDCA 4W8OA 4N41A 2OG1A 3M7IA 4IP0A 3U4DA 1Q77A 1O7JA 3U19A 3G89A 4TLBA 2BHNA 3Q10A 5LB4A 4BMDA 4P86A 3UAVA 5KX5A 1PJ4A 2GVNA 5EJEA 3GUCA 3OQOA 3TW6A 1MB2A 3KHTA 5LZ7A 3WWCA 4DA0A 4HG2A 3ONEA 4URXR 4M1QA 6ADHA 3KKQA 1P2BA 4O29A 4DR5B 5ADWA 2QBYB 4FHDA 3IGFA 4H1HA 2O8VA 5I9IA 2HU5A 3HJBA 4XUDA 3OTGA 4HPJB 1K7SN 3G85A 4JKYA 4IHAA 521PA 4WX2B 2PUJA 2HV8A 5C3UA 1ULSA 1L7QA 5JDCC 4DIOA 4BO7A 5HJ7A 1ZHOA 2QLMA 3TZCA 3VJLA 2XOKD 4D4KA 3T15A 5KKCA 2WYIA 1N0WA 1SBQA 3TNLA 9LDBA 4L6CA 2PT9A 4F1JA 4RTRA 3C45A 2W2LA 1ISSA 3BTUA 3ND7A 1BEZA 5EHIA 2OA0A 4HVLA 5MN6A 2QMYA 2CNKA 1PT9A 3QLVC 5B3LA 1E9RA 3LY9A 3DDOA 5DHFA 3S2YA 2QAJA 4HKTA 1JLSA 3PHJA 4Z4EA 3R0JA 3KJQA 5ABPA 3FYHA 5DTQA 2HI0A 2YRFA 1F4VA 3I9V6 2D0DA 2PMKA 4W9NA 1C3OA 4BUZA 4HQFA 4EHIA 4ES6A 3T3DA 3IBGA 4ND3A 1QE0A 3TEMA 1WXQA 5KUTA 3WHLA 4MQ5A 4H1WA 3KSZO 4W7HA 4DJEC 2QF7A 2OZKA 4KC0A 1ZW1A 1SCUA 4QXRA 6NULA 4QU9A 5JI3E 4Q00A 1SC4A 2CJPA 5ELLA 4AS1A 4BNNA 1E3IA 1CF2O 2OV8A 3I64A 2XDYA 1TEZA 3GFBA 1TKCA 1TCAA 2OM6A 4E46A 2OBMA 1NYQA 1IYZA 3TUZC 2GJ8A 2OHXA 4P4NA 4JI3B 2BH2A 4IF6A 2NPFA 1N1DA 1JIIA 3VPBA 3JAMA 4YTEA 2Z09A 2CDCA 4FDTA 2P27A 4IZIA 1IHOA 2P4QA 2H4XA 3AHDA 3TKLA 3P5SA 1URPA 1WCV1 4HDOB 3RSFA 2XHZA 4ED9A 1Z2PX 3CZRA 1GZ7A 3E9EA 3FRJA 1RFLA 3DC2A 1MC8A 1FUIA 1LS1A 1O8BA 1ZGJA 2C0QA 3NKVA 2QVLA 4EHNA 3BMCB 1RS0A 5BNZA 1PVOA 4MI3A 2X5KO 3BB3A 2QGNA 3I12A 3G6KA 5IAAA 3JD3A 3R0XA 1LK5A 3CLHA 4R84A 4YO8A 4DWVA 1PDWA 3B3AA 3LP8A 1C50A 5ALZA 3BQNB 2C5FA 5DGDA 4BVAA 4CEIB 1DJMA 4ZGGA 1II8B 1B93A 2H29A 3E9MA 4H2DA 2X9LA 5JMTA 3CLVA 1CJBA 2Q5HA 2RHDA 2XKBA 4LRYA 2N9UA 1BYUA 1EDOA 4NS1A 3WK4A 4DHWA 1CB0A 1R0KA 3ELWA 3JV7A 2JA2A 1UXIA 4K3VA 2ZR8A 5FPHA 3UT0A 2QE6A 3CPEA 3VKUA 3UAGA 3O1JC 5TF4A 2Y67A 1ZI6A 1YDGA 2AF4C 4Q21A 4ARBA 4Y9UA 3ZGXA 4NAHA 2F3SA 2DLCX 3IJEB 3O94A 3GAFA 5F5LA 3OD1A 5AHWA 1YL7A 2NT3A 4OGKA 1JDPA 1U1CA 4HL6A 1N6OA 4IKOA 2AX4A 2FGJA 2QM3A 4KR0A 4UTNA 2XVZA 3OKPA 4G5QA 4EHLA 2XYHA 2W2KA 3QMPA 4FFVA 1DAGA 2RHJA 4EIWA 3W5AA 4FDMA 5K8LA 2YIJA 1JEYA 4I5GA 3I52A 2Q7XA 3SJBA 2EARA 2Z95A 1U8ZA 2J9XB 2EDCA 2XTNA 5EWJB 3UAXA 4ZTZB 1I9GA 1XD2A 1JVBA 1L2TA 3OO1A 3GPBA 4IEFB 3DCJA 5B58T 5CFMA 1J42A 3C74A 2DBRA 1ENZA 1PO7A 1SM4A 1SWVA 3B9QA 3EFHA 2C57A 2ID4A 4JOCA 3ZW9A 1MNQA 3QU7A 1QOQB 3KKOA 2MIIA 2WIFA 5HVNA 4I1UA 3H1AA 1UINA 1GU0A 1BE0A 4PXAA 2AYXA 4X7RA 1EM8A 2B78A 5LZ9A 3WB1A 1W87A 5FCDA 5CDHA 1TTTA 5A9RA 1I5EA 1OOEA 3ITDA 2O5CA 3BKXA 2XCSB 4BO2A 2J8ZA 1J1IA 3CNEA 4DBLC 1U2PA 1J70A 1B74A 1ECPA 2Q5LA 1WP4A 4F8EA 1U1IA 1EE2A 2EIHA 5B3KA 1PHPA 4ZN6A 2FKAA 4X41A 1U5CA 1K6MA 1FFHA 1C8LA 1P4HA 4OSEA 1EJ2A 1MAWA 4XLZA 3NDIA 5EMNA 1NJFA 4QQRA 4E14A 1G5TA 4WOCA 2CE7A 4DQXA 1XCBA 3I6ZA 5LCXA 5KOHB 3E58A 1PJRA 3LRPA 2ZBVA 3LBIA 3MWLA 3C85A 4HQLA 3T5TA 3Q1LA 5C46F 3VUFA 3DEFA 2O1XA 3UJAA 5J4LA 1SUPA 4Y6GB 3DGEC 2BHLA 2P41A 3D6HA 5C80A 4BC1A 4MUBA 3HXMA 4YUZA 1Z28A 1EK1A 2JFWA 2QRVA 3KZXA 2COEA 2V6JA 3AFOA 1R66A 3B6KA 4H4CA 5AJZA 1FOEB 3PD7A 1GSHA 3GGOA 3KQYA 4G36A 4IR7A 5FOXA 4FCWA 4CJXA 5JWOA 4UUAA 4P31A 2UXCB 4TXMA 4PCAA 1R3DA 1PSZA 3W8NA 1GNSA 2IQ5A 4GOKA 2WB2A 2ATCA 2AVDA 2CF6A 1U2QA 4REOA 3TNJA 1G2PA 4PZAA 4JT4A 1HXHA 3K4QA 3PD1A 4MUNA 2CCKA 4AF6A 3UQZA 5T64A 5LDDC 1KO7A 4JT2A 3V7UA 3AW8A 3W05A 1ULHA 4UM7A 1PWEA 3R3XA 5ENZA 3FCAA 3GZJA 1BEUB 3IO3A 2EZ9A 3ZZ1A 4YPVA 3WZMA 4DPMA 2IP2A 2FW1A 1KJIA 2QL5A 3IIIA 5FTNA 5IAEA 3S81A 1VMEA 4CU5A 3H0EA 1Y42X 3V7WA 4BNTA 5CP8A 1AA9A 1W36D 1ZA1A 3OA0A 3NHSA 4IDAA 3ZWPA 4EH1A 3QEMB 2W7TA 1T5LA 2WD9A 4KQFA 2FQQA 1YS2X 4GG1A 1WRBA 1P5ZB 3ADKA 3DVLA 3CXRA 4JUAA 4BQFA 4C4TA 3MD9A 4HS9A 5J59A 3CKYA 3D1JA 5LYJA 3NGMA 2AXEA 3IPAA 2NO6A 3K7EA 2OMKA 2IUUA 4FYVA 4I55A 2J3DA 1SBTA 4AJKA 5I5GA 4XARA 2UU9B 4CF5A 3PI7A 3SD7A 1OU4A 1ULZA 4UBOA 4HJRA 1MZPA 2ALJA 2ZJ5A 3C4JA 3H16A 4JJFA 5JFOA 1DFIA 4I4TB 1LVUA 1R2QA 4G1FA 2X0NA 4U02A 5JMOA 3KC2A 3RNLA 1A96A 2ZFUA 4BB0A 1KYVA 5LQMA 1TIKA 4HCJA 2N3ZA 1PYOA 3DBRB 1K75A 2CHVA 3I01A 5ARCA 1W5TA 2MYTA 2NVOA 3EWAA 3LW7A 4HADA 5FORA 3SQMA 2AYZA 3U0VA 4RQBA 4V2UA 2V59A 2WAOA 1V11B 1NXXA 2J87A 5TJHA 4NCBA 5DTEA 4Z3DA 3LQFA 1HFEL 2IQIA 3COYA 1DNPA 1Q16A 2PS0A 3WB2A 4GQBA 1S4MA 2XVYA 4G4GA 4IEEA 2QKYA 2BFPA 3WYAA 2F8TA 1ZL2A 3E9QA 3GRFA 4B71A 4EA8A 1P0IA 1QMPA 3IV7A 4CYMA 2WSMA 2J5RA 5KWJA 4C3OB 2EFYA 3R09A 4HWOA 1GPH1 3JPYA 5AK6A 1GQQA 1HY3A 2P65A 5D6NA 5F9HA 1Y63A 3GFTA 4HGRA 1SOWA 2F3TA 2JIZD 4KW7A 4A0FA 2XMPA 4ENPA 1NGSA 5DEOA 1BN7A 3TQCA 3TLKA 3UJBA 1UK9A 4L57A 2J67A 8ABPA 5AW7A 2CL0X 2DUWA 4I9GA 5HG0A 1XQ9A 5F9FA 1L7VC 1LRJA 2WSIA 3HLYA 3LFUA 2ATEA 2X5OA 3AKCA 2RKWA 1CP2A 3BERA 1G19A 4W99A 4I55F 2JCBA 1NW3A 4WNAA 4Q0MA 5C81A 3DEKA 3Q7EA 1HDYA 4WEQA 3BBLA 4ARZA 2DPLA 3R6LA 1NU8A 1SXJC 2VNIA 3FUTA 3QJGA 4BLWA 5JJKA 1BA3A 1SU6A 4ZO9A 2ZQZA 5EZSA 3SKYA 1PQYA 1V7PC 1SBCA 1Z0JA 3T06B 3ZQ6A 4MCJA 2QN9A 4HH1A 1R8YA 5ECYA 4EMSA 3LTNC 3SQLA 2FX2A 1NY6A 2ZJFA 5AVUA 5TY0A 4M99A 1F2UB 3DP9A 1ENYA 2PV0A 4NMLA 1GGEA 4WN3A 3WIUA 3OETA 4LZAA 1QPZA 1QNLA 4I8IA 3BFKA 1FP6A 3CF4G 2WJPA 4P36A 1CB7A 5FT9A 5IABA 4NXNB 2DWPA 3IP5A 3OJWA 2BKVA 2XYQA 1HE1C 3DYBA 3VDRA 1V5EA 3M6MD 3QLTA 5F64A 3U56A 1E7YA 3AM1A 1USWA 1XMIA 2ZBGA 4NCHA 2IV7A 3W5SA 4HBZA 2GYWA 1C2YA 1JEAA 2IU6A 1N6NA 2RBGA 3F67A 3JQGB 5JQWA 1B23P 5BSVA 4JQCA 1CJCA 3LP5A 3PVCA 1FTNA 2BKEA 3IP9A 2G63A 3TAXA 5C1DA 1WPGA 2QE7D 1DC6A 4FEEA 4R9VA 5I9MA 5CRIA 4EUSA 1M2HA 3ZWQA 2ODEA 4ZJYA 3FDZA 3G88A 3CKLA 3U26A 3P96A 4EJ2A 3CLRC 1DZ3A 4YDQA 4V1CB 3DDZX 3LGSA 1KOJA 3R9XB 4CGYA 1Q74A 4DCMA 4KWHA 2YWHA 2XGJA 4KFTA 4UJ5A 2BUCA 4U9HS 1T5TA 4KE7A 1MJNA 1W0JA 1BCSA 1QGAA 5A4DA 1PE0A 3SXUB 4RTQA 5KYNA 2VAPA 4LJ9A 1L7OA 1KZ4A 4IIVA 3CZAA 2X1LA 4K87A 3DHWC 1CRWG 4ZMRA 1SUCA 1QIFA 3BH7A 2WFLA 4M1YA 2I6UA 4Z7JA 3ZJUA 3ZCRA 2N1MA 4MSUA 3I6IA 2XTZA 1O97C 2XVXA 4IJMA 3UFXA 1LC3A 1GAWA 1KEWA 1QIEA 1ULAA 3GJ3A 4HOYA 5K3FB 3SXPA 5F23A 1E3MA 2EX4A 1K66A 4FB5A 1C4KA 3EGIA 4Q15A 4UPDA 3AJ8A 4GX2A 4YBRA 5DWDA 4QXPA 4JFAA 1KE2A 4DR3B 2X19A 3IQGX 3Q5EA 2FWBA 5E6UA 4CV2A 2ZUEA 4ROTA 1JDBC 1ISGA 1G8SA 2GCPA 2YFHA 3PFBA 3AP3A 3L40A 2EJWA 3F2IA 2AD1A 3KCNA 1RQNA 2Q5IA 3LC1O 3Q4GA 4QHTA 2BR5A 1XDGA 4ZALA 3T5DA 3ND5A 2VOJA 4DIMA 5H8WA 5CVEA 1WXDA 2SCUB 2QRQA 4DM3A 3OM1A 2ZI3A 4B8YA 1RYYA 2Z4SA 3OP4A 5FNVF 8OHMA 2RAVA 4LEIA 4M2LA 3SF8A 1AKQA 4JUDX 2WHYA 5TV2A 1G5FA 5IXJA 1J9ZA 5BVGB 1QORA 2AK3A 1F0KA 1Q22A 5IUJC 4TRRA 2R5NA 4AG3A 1DFGA 4YAJA 4EB6B 4EITA 4I9HA 1TQ4A 1ZD9A 2YV3A 1BCRA 1AKVA 1E61A 1L4FA 1ODSA 3B2EA 4K26A 3H75A 4OBWA 4C20A 2OBYA 5EPOA 1JAIA 1Z3IX 4UE6A 1MG5A 4WNAB 1YRQA 2BCEA 1DMSA 3B1YA 4HNUA 3QEAZ 3RVOA 1W4AA 3RCBA 3U3XA 1G5QA 2Q6VA 3VO8A 1JHDA 1ZLXA 3OLXA 4OLHA 3Q3IA 1ZR2A 1QTNA 2BZGA 3W7AA 3GFFA 3ZNQA 3MJEA 1KDRA 1G64A 3AR2A 4RSHA 1E9DA 5AM2A 4WXPA 4AJHA 2O59A 2RONA 3EZYA 2BN4A 3HUDA 2PL5A 2UUPA 4BV8A 4BXOB 3REGA 1T9HA 3AF0A 3E53A 3WGLA 2P0YA 3WYNA 3VNSA 4C89A 2ZCVA 4EHBA 5DTIA 4G0NA 5BQPA 1QWSA 4EJFA 4Q4CA 4B40A 2G5GX 4UTXA 4U2FA 3ESZA 5BQ3A 3DT6A 3EXHA 2XD4A 4BLTA 2Q5EA 2V0NA 3RU7A 4PZCA 4MIYA 4EVSA 5C4IA 2O8DA 1J7JA 4RMGA 4HYYA 1OROA 3ZLJA 1CR1A 1I3MA 3FOWA 1E2PA 1BU5A 3HB9A 3NCTA 4DPKA 4RIEA 3D7RA 3HDTA 3WNQA 2ZVPX 4HNTA 1ONBA 2ZPAA 1AT1A 3RSSA 5K3EA 1KKUA 4UQPA 4LHXA 4BUJA 4Z49A 4CLOB 4KE9A 3R7AA 4LE0A 4BY9E 4Z8YA 3VPFA 1GSIA 1JEQB 4DMKA 4TS1A 1A27A 1TEXA 1QRRA 4WZBB 4W9RA 5B12A 4L8VA 4RHEA 4BFVA 1JR2A 2HLDD 3AXTA 1DXOA 1KMQA 1UP4A 2VAMA 3GIWA 1MC1A 1FFXB 1ORHA 3GRZA 4UHFA 1NX6A 4L0DA 3HY4A 3HZHA 3DL7A 4MW5A 4UEWA 2OD7A 4ZI3A 2ZP1A 3W0LB 2F1OA 1UCFA 4N6GA 3SXUA 1TPYA 5A5FA 2P6OA 3OEHA 1PLKA 3GWGA 3IT0A 4RW0A 5TMEA 1MTZA 2J41A 3GFRA 3QBEA 4BN5A 1QTIA 1LW7A 2AN5A 4ADSG 2DBQA 4BBZA 4JQYA 4FI3C 4OP2A 5ALQA 5KKNB 2WNSA 4K1LA 3TSOA 4X91A 3U7GA 1R5JA 4L4UA 4GM4A 4RANA 1S96A 3L49A 4KO3S 1KAEA 5CEFA 4TTQA 3VZQA 4COOA 4WK2B 3FZNA 3PC6A 3DYVA 1YS9A 4CQNA 4AY3A 4DCGA 4F12A 4ZK6A 4BZPA 3ONVA 2QR5A 5IVPA 2PZGA 4OQZA 1A8SA 4EEXA 2YVUA 1FFAA 5KMGA 2H63A 1M1UA 3QVGA 1BGWA 3ZY5A 5EJ7A 4CIYA 1UBEA 1KFJB 1M6YA 3BA1A 4XWKA 3E4CA 1JT9A 1K8RA 1OX5A 2FZGA 2RK3A 2ZJ1A 4UHDA 2J09A 4LMRA 1QHIA 5DM4A 5EIWA 5EP4A 2YS6A 1QHYA 1UPXA 3AK4A 5CVVA 1AXEA 2XY4A 4EPYA 1AGNA 4WBNB 3AVWA 1VCHA 1NF3A 2DR0A 1T3HA 2OORC 2HMVA 2IODA 2LGJA 1Y6RA 1Z12A 2QRGA 2QD5A 3TG8A 2H4HA 4OGGA 1S8NA 2OSBA 3LVQE 1P7CA 4WFIA 4F1KA 2CLCX 1HETA 1VIAA 1IUOA 1QZ3A 4HWTA 4D3DA 3MYYA 3N6XA 4W1PA 2PYDA 1IZ0A 1I3OA 5CK4A 2VQDA 1E3DA 5EI5A 3VC1A 1MZVA 1U0JA 3A9UA 3P4YA 4GMKA 4Y2PA 3ZU6A 1VG8A 5BURA 3ZJVA 1C9YA 5F5NA 1MGPA 3AUTA 4CGZA 5ALHA 1Z6PA 1O3YA 2WM9B 3S4YA 4NHEA 5KJEA 1U6IA 1PGNA 4ID3A 2PUAA 4ZJZA 1GRCA 4B75A 5KYYA 2IT1A 3J7TA 3QVWA 5EJ5A 1CHDA 3BORA 1KTIA 4NOLA 4ALIA 5C0OE 3OF3A 2FMUA 2P5SA 2WWFA 3RIMA 4YMTA 1MRZA 4NZMA 1R6XA 1OXSC 1XCOA 2D4HA 2QJWA 3NBZC 3TLYA 3CWZA 5EMHA 1Y7HA 3ZE7A 3KTFA 1ZAYA 1GXSA 1U28A 1WO8A 3PS9A 2IV3A 2G5PA 1LW6E 2ACEA 1E1MA 3U4GA 4OB6A 5BV8A 4YH1A 3DZBA 1C2TA 2O14A 1EP9A 3CH6A 3IRVA 4QOFA 3QJYA 1ISHA 3GCGA 3TRHA 1PR4A 2E55A 1I10A 3AEKA 4JJAA 1ZGAA 4MGIR 3ED1A 5D7BA 2P6PA 3H5RA 4FE4A 2JZCA 4X8MA 5DJ5A 4F86A 5CBPB 5LPNA 1CUVA 1IXRC 2DHCA 5K6AC 1Z4JA 2FWIA 2C58A 1RCTE 4LOIA 1POWA 5EZYF 4QVKA 4Q9LA 4PQEA 3OBBA 4F4FA 4JXJA 2AI2A 3BWXA 3GN1A 4Q1EA 3QUQA 3PXDA 1OYVA 4FZVA 3H9JA 5FV7A 2A67A 3BH0A 4TYWA 4JVNA 4X94A 1P9WA 1U8UA 2JEOA 1RI5A 5B1YA 2WF9A 1RVDA 1ZISA 3D6FA 3O5AA 4TT3D 4ND8B 4F7DA 2GCGA 5JMWA 2EGUA 5LNK6 4YALA 3U4HA 3C48A 4XEUA 4N47A 1QG4A 2BM0A 1U0RA 3NHYA 3K5HA 1Z18A 1P62B 3CLUC 4BVHA 4YMIA 1HT1E 2P2LA 4HGZA 1P7YA 4MHSA 3C6QA 3R3SA 1TKAA 3I9FA 1Q2UA 1EK5A 1KZ7B 2BKLA 3BXGA 3CMMA 3ROMA 3ZQJA 3ZOZA 4GKAA 4YCNA 1ZMRA 4Q9AA 4N0EA 3K35A 4P4GA 2HHHB 3KDPA 3SQXA 2O7VA 3GNSA 3HUFA 5K99A 1H6BA 1V16B 1Z5WA 3KR1A 3PX3A 4YMUA 4R9RA 4B6RA 3QYJA 2H08A 3QU4A 1F3OA 1UJ5A 2BEVA 1SN7A 1M8PA 2XKAA 5EE3A 2QL7A 3EG9B 1JHAA 2OHVA 2J30A 1M54A 2HJSA 4HF7A 1FBTA 4RZIA 3W4KA 4LTDA 3LX8A 1SZJG 4EA9A 4TLLB 1UOEA 2CBZA 2HWYA 4OSOA 2OXEA 2XB9A 5EE9A 3VNAA 1LI4A 4C1NA 4EYEA 5ED4A 2GAAA 3RHTA 5JU6A 1AK1A 1SXJD 2TYSB 2J45A 1USGA 4QTTB 3ENZA 3S6JA 4TYNA 1ML4A 3PEUA 2RK4A 3INNA 5JSQA 2P6MA 1CK4A 4PGHA 4HUTA 1JG4A 2NMVA 1VCIA 2QTZA 3PK0A 1M8KA 2JPDA 3LLCA 2AF3C 3F6PA 4I5IA 1QDEA 3LPMA 4KO1S 5DBOA 2AKYA 2PXXA 3WLJA 1OU0A 5JNRA 1VJDA 4XR9A 1Q0SA 1QKJA 5I8PA 2XUKA 4XQ0A 1QBKC 3KQLA 2QN6A 2QW8A 3SGLA 4IH4A 1WMDA 4JB3A 4WA8A 3W1EA 3DV0A 4YAIA 4DUGD 3F49S 4DRXB 1R37A 5I4CA 4B3MB 1JJVA 2QP9X 3I0ZA 1AXRA 3VR1A 3GP5A 3UV3A 4JAVC 3LPDA 4HMOA 1KP9A 3N7AA 1VL0A 3WY9A 1LKZA 2NSJA 1ARZA 1MO5A 2XHEA 3OIYA 4MWCA 5DCYA 4BZWA 1C7EA 3FSEA 4RZUA 4TYQA 1PJ3A 2CBGA 4TV8A 3W3ZB 1VE3A 5I9SA 3F4BA 1GCGA 4QGSA 1ZICA 2DSNA 2JLBA 5K0JA 4FMCB 4K40A 4IIGA 4ALLA 3BD9A 2W6IA 1U2RA 5DYWA 2NZXA 1VYUA 4ASUD 4BTLA 1FYXA 5ARBA 4C6RA 2JS7A 3IXLA 3EA5A 2YJNA 1T8TA 5KVCA 1X1SA 1Q0LA 5HILA 2GHIA 4G5YA 3FSJX 3FKSA 1P75A 2R65A 4TN1A 2MINB 3UH1A 3X1JA 1Y4DE 2WAAA 3ETCA 1N4AA 3JSXA 4JEIA 3AW9A 4LBWA 3ICQB 1D2MA 1XJ5A 1XZIA 4KTVE 1NOJA 2F4NA 2FPGA 4LV8B 4P84A 2GPNA 4OHZA 3RYHA 3UHOA 3NMUF 2I4MA 3JCZA 2HA4A 3Q0TA 3AG6A 5CX1B 5AM1A 1OC4A 4GIBA 5AW4A 5HQ3A 1P2FA 1MG0A 4NJMB 1R6BX 1TA4A 1Z7EA 2D3WA 1GWNA 1YCDA 4M0CA 4OGLA 1SVNA 4PM4A 2HGZA 3K73O 4IIUA 4ZT5A 1T3SA 2H8KA 1TF5A 2OOSA 1XTRA 4IVQA 4MGZR 5DSZA 4D0NA 3AVXA 2ZUWA 4AJEA 3BL6A 3Q7QA 4QO7A 1TIBA 1XTZA 4QNRA 3T94A 3FJ1A 3DMPA 1QVZA 4B73A 3HCPA 5P8WA 2X1MA 3CRRA 2DKNA 2VSXA 4UBLA 3W4IA 4AJ4A 4AN4A 3RDPA 1OXTA 4DZTA 2QYOA 4BYMA 2HCJB 3MHPA 3CGWA 4Y7DA 5D1HA 4PCUA 1ADFA 2B99A 2NO1A 1XXHA 4RMHA 3IJ5A 4LQCA 5K0ZA 2HMSA 1WV0A 4K5QA 4PYNA 1AGRA 1UKZA 4H7EA 2B0CA 1KDZA 2CC2A 4KV7A 3K92A 4B82A 1RLOA 1T2CA 2C2WA 2Q9CA 3UGKA 2CNWA 2PFGA 1Q3HA 1XRNA 2GFIA 3I28A 4Q03A 5BOSB 3PI6A 4LPKA 1E2NA 4IDCA 5JW6A 2FJPA 3BMOB 4NU0A 3THYA 1HA3A 1L8OA 2I1VB 2V55B 2NZUG 2Y6VA 1SHKA 3C24A 2VXYA 3G2OA 2AL7A 3CLRD 3H4TA 3L7CA 4IIXA 1DC3A 5JDIC 1R0ZA 4RK5A 3QF4B 1RAEA 2JAHA 3CUUA 4GOXA 5BQFA 1T3ZA 4RV9A 1S0UA 2CZGA 2RGNA 3G0IA 4Y2HA 1T6XA 1FJGB 1KAMA 4N5DA 2QSUA 1UFRA 3JQ8A 4MW9A 4EVIA 3K6RA 1MX5A 4I9NA 4HQKA 4WINA 4G1MB 1SC3A 3ORSA 3GGCA 5EGSA 4Q01A 3AY0A 4I4TA 4CL2A 2GD6A 1UEXC 3WYDA 3CVYA 1E7MA 2NO7A 2VOEA 4CM9A 1R74A 2O7SA 1RQGA 5TPZD 4IZHA 4LY6A 4LS3A 2PCLA 1AH2A 3M6IA 5I7AA 2YIMA 1OI4A 1SA0B 4YPOA 4WEOA 4P0QB 1IN1A 4HP8A 4LOHA 1X9GA 1R6AA 3QUCA 3IDOA 4X95A 5AK0A 2RGAA 5CNKA 4D8YA 2MJLA 1UC5B 4A91A 1KDVA 4MWZA 4C4PA 2H06A 1HE8B 4LE1A 2A9PA 3L7BA 4PO8A 5JBQA 1Y4ZA 3VO9A 3DSRA 3JQAA 3PUIA 3GGDA 4P54A 5JD6A 4LXTA 5C5CA 3O3MB 1Z7GA 1WWKA 2GPJA 1T1JA 2QMUA 3KNZA 1NY5A 1RAIA 1T36A 1MLDA 2HQSA 5BSHA 1BKYA 1XALA 4FGWA 5AW8A 4DV6B 1N4DA 2Q3DA 3VO1A 1ICIA 3WAKA 2UUAB 3UA3A 3IUEA 4XW2A 5MDHA 4PIVA 4LDAA 4JOQA 4BMOB 3STXA 3KLOA 3OCWA 1YL6A 3H84A 5CX1A 2XE4A 1UBCA 1J5XA 2FDRA 5FLYA 1ADBA 1BE1A 1QFSA 1AX9A 4DNXA 1RZRD 4PXSA 3UUGA 1UJ6A 4QDZA 1NURA 2IEAA 4R1TA 4UARA 3OX3A 2BONA 2IBMA 5AVQA 3K9BA 1JQDA 3K0BA 2QMEA 3K31A 4AICA 3E5NA 1QVVA 5DNUA 2WWWA 2PG3A 2C95A 2QNBA 4TKMA 3I5AA 5E6RA 4D8TA 4QBHA 4BECA 1J1UA 1Q5PA 1S3GA 2O23A 1QLJA 5G4KB 5CB4B 3WQHA 4N3GA 5U4QA 3RKRA 2R5FA 3NC1C 3FSGD 1R0SA 3AERB 2VP5A 3JQAB 2L19A 1RZUA 1FQKA 3KL4A 5EIBD 3LPNA 4G1BA 5FJJA 4Q3EA 5U4XA 3CNBA 1XF9A 4AMVA 3LHDA 4HGPA 5F76A 1DRVA 2C9ZA 1V96A 5I47A 1AE1A 2QM7A 3F90A 4F3TA 4FWIB 3QXHA 3WRVA 5AVTA 3WGQA 4ZV7A 4BMPB 2PUBA 3DEZA 5AI4A 5D3QA 4BX0A 4CCSA 1RAGA 3F5SA 4MPDA 4XWTA 2NIPA 1FDSA 1XZPA 2QY9A 1RRGA 1ORWA 3F1LA 4IRUB 5KQGA 1FX0B 2GWRA 1IFXA 2H4JA 3GCWA 4KN6A 1ECCA 4BL5A 4EMTA 3TTVA 1HOXA 1FDIA 2EERA 1E77A 4MDFA 1G6HA 2BHRA 5IT5A 1DXYA 4ITVA 1KU6A 5IAGA 4BN0A 1RABA 4QFBA 3RV4A 4E33A 5F35A 1MOPA 4L8YA 3EVCA 4EMBA 4AKIA 3R77A 5F2EA 4OFBA 2X23A 1SJ9A 3E70C 3G7SA 4C4SA 5IYZA 4UM8B 2BH9A 2YN0A 5AP9A 1W36C 1H2XA 1X0VA 1NV8A 3JARA 2PX5A 3LIIA 3MINB 4MWEA 2C1XA 2ZTLA 2BBSA 2C5LA 3PLNA 4Z51A 1Z22A 1NBIA 3IT3A 4Q9IA 4F56A 2PUVA 1P2TA 2D0PB 4LV5B 1WXXA 4S05A 2WRZA 2FPKA 4PRZA 2NG1A 1HE5A 2NU8A 2DR2A 4C0SA 3SX4A 3FOFC 4BRUA 4BXOA 2ZDHA 4S3MA 4O2LA 3PRJA 5KREA 4UOQA 1E0DA 3EFOA 5REQA 2X8LA 3A06A 2Z9DA 1QH1A 4RQTA 4LN1A 4RGBA 5EL0A 5FRDA 4XA8A 1QS0B 3PUHA 4MGKR 5BR1A 1KYZA 2PKYX 3WL7A 2J59A 3A14A 3GAZA 3TL2A 1N78A 5JSHA 4F6RB 4A0HA 5KNDA 3IESA 5KYTA 5K0BA 2OLKA 1YHZA 2FRDA 2MYUA 2I91A 3L3BA 3IVCA 5E4JA 2JIOA 1U0TA 1M2EA 4H15A 4II2A 2FPIA 1LQ2A 3NTRA 4K81B 4M55A 3ISVA 4CM8A 1XZAA 2X0RA 2YN4A 2H1CA 1I36A 5WRFA 1V71A 1T35A 4RHYA 2FW8A 2QVYX 4IDHA 3MJ4A 3GLFA 4EB6A 2VDMB 2BLLA 1DKNA 3OOWA 1H05A 2Z8XA 1JAHA 1F9EA 4LGCA 4TWZA 4UXJA 3A04A 4X60A 2BMEA 1X1DA 3DA8A 4HB4A 1TDJA 4RENA 3VV3A 1OTXA 1NTOA 2QMQA 4R8RA 4RS3A 2V6IA 3HR4A 4LE2A 5AQEA 3FYSA 3NTOA 4JJZA 1X7DA 3UWSA 4V0OA 4XGQA 3TN7A 3NVAA 1RYDA 1E6MA 1HDIA 1G20A 1TAQA 1X1AA 4IGAA 3WR5A 2JGFA 5JZ9A 5KSZA 4K6GA 2D1FA 3PNOA 3OF5A 4JYAB 5D86A 2XA2A 3R7NA 5J2TA 4C7OA 2BFCA 4DV3B 1E5VA 3AL2A 3OKCA 3SHOA 1Z0IA 3QFFA 1UJ2A 3DUWA 2L2QA 3T4EA 4EO7A 2G25A 1UM8A 4F9GA 5EN4A 3W5BA 2AE1A 4HEA6 1OILA 1YZNA 4JIMA 3AR7A 4PSCA 3CSSA 4YEDA 1JIQA 2W6CX 4G63A 2IITA 5D5QA 2C4MA 1E6EA 4GBED 4X7PA 1XPOA 2C9CA 4KLZA 3B53X 1ZXXA 5EKUA 2VBCA 4CMCA 1B15A 4C0BA 2D59A 1KI7A 1XZMA 3NTQA 1OFIA 1RLUA 2ZUUA 2VPZA 1N6RA 3GL9A 4MNTA 3K9QO 1FTWA 3WFJA 1KO8A 4LQLA 1DBIA 5EEGA 4BASA 4B3DA 2GJ4A 1P29A 4G8BA 3RTDA 1RKQA 1TW3A 5K6RA 1OAOC 3GNQA 2W58A 3HRKA 5TARA 4F1WA 3K70D 3PICA 4DJTA 3G6WA 5H83A 5K3AA 3H99A 3RABA 1H23A 4Q3OA 4M1KA 4S1WA 3INTA 2YMLA 2IDKA 5TS2A 3RROA 1F8YA 3GARA 5FUBA 4XVHA 5HZHA 1VI5A 2B21A 3K6KA 1Y9EA 1QE3A 3SYMA 4LYEA 3G2QA 4BGEA 2A3RA 2KW5A 1JAYA 3RUCA 2VF4X 3LIPA 2O06A 4PNPA 3VU9B 3LL4A 4RMNA 5FWYB 2H1WA 2ZQYA 3ESAA 1PR9A 1R6TA 3ZVMA 3I76A 3RAGA 2PE5A 3RSOA 1SUSA 4G67A 2DC1A 3CZPA 4RKQA 4LJYA 4E2YA 3FBWA 2WBLC 4O4JB 2PBFA 2E18A 4AZ3B 1TTQB 2HHAA 2QG6A 1L4LA 3EBPA 4TWBA 4D9FA 3OIWA 1OLXB 3OSZA 3B5EA 3HDYA 3AFHA 3IURA 1NONA 4IIDA 2G70A 5A2GA 4PHCA 5B2ZA 1FMJA 5CEEA 4YRJA 2GM4A 3RSCA 5CA1F 2IH2A 1P4JA 3TUJC 1KFKB 3RS9A 1OYYA 2K4MA 2CDAA 3D8SA 2NOAA 4ND5A 5F4BA 1UMKA 5KSPA 1UFVA 3EEFA 1X7ZA 1N3IA 1PEYA 2RIRA 1K86A 4RXUA 4D96A 1KL7A 2LZ0A 1EFHA 4QO8A 4M1ZA 2JARA 2WQ6A 5CDYA 3UJDA 4QODA 5B1SA 2R6JA 1GZ6A 3KQSA 4G1CA 4U4AA 4JASB 5JANA 1NP6A 2WWVD 4B4UA 3H2SA 2PRIA 2H18A 5D85A 2DFNA 1QOZA 1UMBB 3RREA 4EHAA 1EXDA 3JWEA 1N2EA 1GYQA 1OV6A 1XMOB 3BCHA 3A9CA 2R8RA 3THWA 2XMDA 4RPGA 2NZJA 2H1LA 4PV7A 3V7YA 2CK3D 2KWIA 1T9BA 3A6JA 2I78A 3TMAA 2UZ1B 2ZANA 4YS6A 2GHRA 3OFNA 3RVMA 3EW7A 3O26A 1U3WA 3BD6A 5JAQA 3SR3A 4B47A 5C5IA 5ENVA 2VQEB 5IK2D 3DJFA 1CVRA 1R5BA 2GK6A 5CHYA 2O3SA 2H7VA 1P4SA 2ICAA 3ZUPA 1V8ZA 2LDBA 4PICA 3GRUA 3DOUA 3PYMA 3ZZTA 3R5KA 4K9KA 3ZHZA 3HQ4O 5HZGA 5JNTA 1V37A 5JZOA 3F98A 5K6AA 4NXMB 2MSNA 1XQ6A 4MQEB 4R1QA 2UUBB 3DFUA 5H16A 5BR7A 2H9AA 3LSTA 4PQGA 4UUNA 2B83A 5HM8A 1ODTC 1ZAKA 4QUKA 3AWDA 5E9JA 4KPGA 4PSUA 3TJRA 3LLVA 1PWHA 1CZNA 1ZRSA 2QRHA 4FU0A 1EQ2A 4TL6A 1YDFA 5JLJA 2GAIA 1IU9A 3LBHA 4O2AB 1GPBA 1UPTA 1J6UA 1O6ZA 1XD8A 5DWQA 3LQ1A 3A70A 1XRQA 1FYDA 3DJYA 3H1GA 4IO0A 4MRMA 4BP3A 4CV3A 4E5MA 1BNCA 3IJRA 2BBTA 1Q21A 1SU8A 3K9LA 5H3LA 1DZIA 4YRCA 2QROA 5DHSA 1RXIA 3HABA 2XF2A 4MLCA 2E37A 1WLYA 4PRKA 2XNCA 3DDSA 5AM5A 5K3CA 3T7RA 4C0JA 4GI7A 2ZYAA 1YIDA 2Q29A 1P91A 1E2FA 4WTOA 5LIPA 1OLUB 2W9XA 4WDRA 3I3OA 1GUYA 4V0ME 3LWDA 4NCKA 2EFHB 3PQFA 5A4AA 2I2FA </