1FXSA

Gdp-fucose synthetase from escherichia coli complex with nadp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
317
structure length
317
Chain Sequence
KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GDP-FUCOSE SYNTHETASE)
publication title GDP-fucose synthetase from Escherichia coli: structure of a unique member of the short-chain dehydrogenase/reductase family that catalyzes two distinct reactions at the same active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 101
structure length 317
sequence length 317
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 1998-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1fxsA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1fxsA02
1PWXA 1QP8A 3WFJA 3LF2A 5C7IO 4D43A 4R5MA 4XYEA 3D5TA 1R4MA 2A92A 2D5AA 2JFGA 3ON5A 4FDAA 2WYVA 4RO0A 5FF9A 4UEOA 4BL5A 3CINA 4RV9A 3ULKA 4MVJM 2Y1DA 3W8EA 1DFGA 3RFXA 2PKQP 2EGGA 1O94A 2QYSA 3ZW9A 1UUFA 1IULA 1EUDA 5T8KC 1N7GA 1R37A 2E37A 3IKVA 3KVOA 4KMSA 3FWNA 2OOSA 3I52A 2DKNA 3A28A 5KJFA 2O3UA 4XIYA 5G2OA 5BSHA 4NPCA 5JYDA 2WD7A 4MVJD 4CV3A 1LQUA 2BF7A 4PIVA 3T4XA 3HG7A 3H6KA 4YAKA 2A35A 3U4CA 1GQ2A 4NR0A 3A4VA 4KUEA 3OF2A 1DO8A 4K6FA 2D5CA 2Y0EA 4ILKA 3IUPA 3U49A 2VWPA 4D3DA 3E9MA 3GDOA 3I9LA 1YQDA 1ZKMA 4CV1A 5EINA 1HYGA 4RPJA 3SXPA 3HB5X 4IZIA 4L4SA 1P3DA 4PLTA 4GLOA 4RJTA 3IS3A 1JU9A 5JDCC 4E2XA 2E82A 3KTDA 2I3AA 3EHEA 1D1TA 1EQ2A 2JJYA 2RHCA 2GN4A 2RH4A 4WLUA 1ZXLA 3TWOA 4BNVA 4XGKA 5CEFA 4NFYA 4TSKA 3MOIA 3ZV6A 5JCJA 1DIAA 1PJTA 4P22A 4M89A 4OXKA 1GUZA 1M67A 1PS0A 3L4BC 4YAEA 4P8RA 1PL8A 2CDCA 1IHXA 4ALKA 4DL9A 3ZWCA 1T2FA 2QRJA 2OBNA 1UP7A 3ZV4A 3TL2A 5L3ZA 2ZIZA 4A0SA 5ITVA 4WE3A 1ADFA 2O23A 2HK7A 2IDZA 3ZU5A 2CMDA 1M6WA 4J7CA 4GH5A 1KOLA 2WD8A 5IDWA 3F4LA 1E77A 2HUNA 5A02A 4E0BA 4QFDA 1H94A 3E1KA 3MJVA 4A10A 1ZUD1 1YDEA 1MC5A 4A27A 4BNUA 3KSZO 3VDQA 4FJ2A 3VHRA 3QWIA 1H0KA 3RFTA 1XGKA 4BS9A 4DUPA 2Q45A 4AJHA 1QLJA 2H6EA 4W99A 1LRJA 5FI3A 3E5RA 1P31A 3RUEA 3WIDA 3RC9A 1W6UA 2VYVD 1A9ZA 4MVJG 8LDHA 2VWGA 2Z5LA 3AOEA 4LRSB 2O3TA 2CFCA 1Z73A 5G0VA 4YTEA 2P9GA 2C54A 3DQPA 1EFKA 5AVOA 3WNQA 2WDZA 3EUWA 1N9GB 2IZ0A 4GX0A 4CM9A 4IJKA 4KP7A 3OJFA 2YV2A 1UXGA 2D3TA 5BT9A 4IQ0A 5DN9A 4YQYA 1GZ4A 3PIIA 1OC2A 2WMDA 1IB6A 4F46A 3TZCA 1ULUA 3BTVA 3MZ0A 2NWQA 5EPOA 4M8SA 1WDMA 1NAHA 3MEQA 3QWAA 4O5OA 3KYBA 2CNBA 2X0JA 3GH3A 3S2FA 1QYCA 4NDNE 4WLFA 3RUIA 1FJHA 5B4UA 1VE9A 2DM6A 5JFOA 4I5DA 1M2WA 2Q50A 1P44A 2WEKA 4E6PA 3D7LA 1HYHA 1RM3A 3QIVA 1DFHA 3PQDA 2X5OA 2J5QA 4TZTA 1CYDA 4CQMB 1JAXA 3DMTA 1I36A 2ZB7A 5K0ZA 5I8WA 1D4FA 1H6AA 1PZGA 5C7LO 1HXHA 3PJFA 3PQEA 1UXHA 5MDHA 3EVNA 3BMOA 3JQAB 1EE9A 4GL4A 5TJHA 2AW5A 3IOYA 3UUWA 4DBVO 1LLDA 3PDJA 1HDGO 5L51A 3DHEA 4LSWA 4JJIA 3DHYA 3HDYA 4JIGA 4II2A 2DBQA 3ZN2A 1Y8QB 5HS4A 4LN1A 4JJGA 4BNIA 4XIJA 4NU6A 1S6YA 1HTBA 2H9IA 1LNQA 2GERA 4CM5A 1ZZEA 3KEOA 1Z7BA 3ZNOA 1DHRA 5IG2A 3D64A 1LLCA 4FOOA 5JC1A 4D0SA 4BB6A 4PG4A 3RUAA 4DVJA 3DZBA 4FFOA 2HDHA 3NJ8A 5ENVA 2R00A 3WLEA 2O3QA 1PJCA 3F9IA 1DXYA 4IGEA 1G0NA 5ENDA 4DGSA 2X7HA 4Z3DA 1L7EA 3M2PA 1PEDA 3JYLA 5TQVA 1YKFA 1PJBA 4RZHA 4KUHA 3F6YA 4ID9A 1QR6A 1PGNA 3K30A 2GO1A 2X0NA 3RBZA 4BQRA 2NACA 1U1IA 2WSBA 3OA2A 4GX2A 5KKAA 1GY8A 5TSDA 3KYDA 4EJMA 4WLNA 2ZB8A 3UCXA 3VPXA 1HETA 2W4QA 3HDHA 3CTMA 3M1AA 3H2ZA 1I30A 1HRDA 2VHWA 3HWRA 4IIVA 4Y6RA 5ER9A 2Q2VA 3FI9A 8ADHA 2EG9A 2O4CA 3K2EA 1GZ3A 1RPNA 3W1VA 4NJMB 1IZ0A 2A4KA 3FPCA 4DQUA 2OUIA 4E13A 4OJNA 3UOGA 3HFSA 4OXYA 4E5YA 5I9NA 1HWYA 4NG5A 3WX0A 1P77A 5CPBA 5U4QA 1P9LA 5IAAA 4MP8A 3MCVA 3ST7A 1O6ZA 4ZQEA 1ZSYA 3H5NA 4RVFA 4U8GA 3TJRA 1SEVA 1N1EA 1WMBA 1YBVA 1X0VA 3M2TA 3H9GA 1IUKA 4GI2A 2P9CA 4J91A 4DLBA 3L6EA 2BH9A 3JV7A 4BKUA 2PD4A 2QZ9A 4YAIA 1T2DA 1ONOA 2HMSA 5U9CA 3HJAA 1RM5A 3QP9A 4TRMA 1O8CA 4I5EA 4WCDA 3PWZA 1YH3A 1EEHA 2PWZA 4Z9XA 3TDKA 3W8DA 3BA1A 1P1FA 1BVRA 2HMUA 4BNXA 4DBZA 1WWKA 3DAFA 3E03A 4BNNA 2Q1TA 4D3FA 1PU2A 4IDCA 1GL3A 2GR9A 4B4UA 4UVEA 3ZU2A 3GGPA 1GYRA 5AYVA 1LDMA 1C1XA 1YDWA 4YJHA 4ZN6A 1EMDA 4BO0A 2DTEA 2CVQA 3D4NA 1GQYA 1HF3A 1SCUA 2BGLA 4XYMA 3AY6A 3GVPA 4LSMA 4AICA 4ONEA 1C1DB 1X0XA 1PL6A 2B4RO 1ENOA 1KERA 2ZYGA 3BMCA 1GTMA 1BDMA 5F3RA 3PWKA 1XU9A 5CP8A 5BNTA 1DC6A 5ILOA 1V8BA 4MINA 1ZNQO 5DCWA 4RF3A 1H93A 5L7TA 2GYYA 2VOJA 3IP3A 4W9NA 4BV9A 4S3MA 1H6CA 1AGNA 1EVJA 3DTYA 2J3HA 4RDHA 5IJZA 2B5VA 1DB3A 4RLHA 5HM8A 5EESA 4Z3KA 3TN7A 5K6AA 2X23A 1VKNA 3I6IA 4PLZA 2XF8A 1CQIA 4KDFA 1WNTA 3KXDA 1EVZA 3OETA 3KHUA 4KTTE 1E3JA 2GLXA 3L4SO 1X15A 3MJEA 1B16A 4U5QA 4NU5A 1DAPA 3DMYA 5GY7A 5L7YA 1ENZA 1HDYA 5JMPA 1D8AA 4JCOA 2LDXA 2PZKA 3LC7O 1YJQA 2EHDA 4BKPA 1PJ2A 2CUKA 2GD1O 4MVJE 3H65A 3FNEA 2QRKA 1DRWA 2VUUA 5G0UA 3QQPA 4DIFA 3L9XA 4YB8A 3C7AA 2H63A 2NM0A 3U9LA 2PKRA 4P38A 5IN5A 1DLIA 4RF4A 4WEQA 2IRWA 3W6UA 1PZEA 3CIFA 3I9NA 1PX0A 3OQ6A 3FSRA 1ARZA 1BRMA 1T4BA 2UDPA 4QX6A 2PGJA 3OJ0A 1WDLA 1DDOA 1E7YA 3KM0A 2HJRA 3FD8A 3E6AA 5BNIA 4FS3A 4J0EA 1C0IA 3C3XA 1RWBA 2A9FA 4EUHA 4EUFA 5KJCA 3H3FA 1W8DA 4INAA 1U2DA 3X2FA 1NPYA 4RL6A 5H82A 2JHFA 1LDEA 4YT5A 2F00A 4M54A 2C29D 3I83A 4BGUA 2GZ1A 5CAEA 1LC3A 4IXTA 4B4VA 1JWBB 2EJVA 1J6UA 1V3TA 1XDWA 1LBEA 1KBZA 4GMFA 4J1TA 3GUCA 1LA2A 1Y6JA 4WCFA 2CDAA 4HUJA 4CMIB 1P0CA 4OQZA 5BQFA 2YFHA 3WBFA 5DBGA 4OL9A 1ISJA 4J7XA 1H5QA 4UAGA 1U3TA 4YQZA 3RBXA 3VPGA 1DLJA 1LDBA 1HE4A 4GX1A 1RKXA 4XRGA 1GUFA 1P74A 4FD3A 1F12A 4ITUA 4CM8B 2VTEA 1MC4A 2NTNA 2PR2A 4ZICA 1PWZA 2YV1A 4S1VA 3KETA 1SPXA 3DC2A 1U8FO 3I1JA 4GQAA 4ND3A 1X7HA 4YXFA 4J49A 4N7RA 2IXBA 4M87A 1PJLA 3MJ4A 2NVWA 4N5LA 1E1LA 3K6JA 4LCJA 5JO0A 3ETDA 2VZ0A 4IMRA 4CL8A 1F17A 4YJGB 2VNAA 3VPFA 3JQBC 4L73A 4A2CA 4CQMD 5JAIA 2D1YA 4ZQHA 1FXSA 1ZCJA 5JS6A 1QV6A 9LDTA 1CF2O 1LRLA 4WUVA 4HWKA 3SJUA 3JQAD 4ND2A 1ZK0A 4RPGA 2ZQYA 1LU9A 4I8XA 3P5SA 4UVIA 2AEJA 4AL4A 4J1QA 1R15A 4N54A 4DREA 1VLLA 5IXYA 1BW9A 1JVSA 4J9UE 1L1FA 2JD2A 2B69A 4CUJA 3SLKA 1R6DA 4MKZA 2EJWA 4TRJA 2CD9A 5THQA 4BNZA 1ZSNA 2W98A 4OXNA 5A06A 5A9SA 4D3SA 5KJ6A 1E1KA 1FDWA 3PLNA 4CLEA 1RM0A 4W4TA 3KUXA 1SO8A 3NDJA 3RAJA 1V6AA 2I6TA 3BMQB 4I9NA 4JLWA 5KWEA 3D1LA 1UZLA 5I7VA 5JAMA 2UV8A 4UUOA 3N74A 3W8FA 4CLOB 4XJSA 4YJDA 2IE0A 4QFCA 3PP8A 3PGJA 4CMAA 3R0IA 4ND5A 3OIFA 1XLTA 1PJ4A 1PQPA 2V6BA 3NKLA 2Q99A 2HQ1A 2NQ8A 4NBRA 3RIHA 3O8QA 4GGOA 5JY6A 4XD2A 2BRUA 1MP0A 3CH6A 5DDIP 2VOEA 4PLYA 5AXAA 1R66A 3IIEA 1BTOA 3EK2A 5ICMA 2RBEA 5C37A 3F5SA 4TVBA 1DRUA 2WE7A 2JCVA 4LRTB 3T7CA 3QW2A 1GADO 3L9WA 1U7TA 3ANMA 1VPDA 3VZPA 4H7PA 4HKTA 1XCBA 4UVGA 4BO6A 2JCYA 3SC4A 3QLJA 5DP1A 5IZCC 4DYVA 2YUTA 3KZVA 4Y9DA 2Y0CA 4MP6A 4CLDA 3ZW8A 1KC1A 3PYLA 3GEMA 5K6AC 1JKIA 1J5PA 3GVCA 3ZWVA 4URFA 2HSDA 1SNYA 3W4KA 2X4GA 3FF4A 2AQHA 1Q7GA 1EK6A 5EL0A 3JQ8A 1I8TA 3ZU4A 5A9TA 2EP7A 4L75A 3QVTA 5ITWA 1JA9A 5F1KA 1U3WA 4WASA 1B15A 2CZCA 1KETA 4AJIA 5A05A 4LISA 3RU9A 4TROA 1ADCA 1ADBA 1YXMA 4AJ1A 1Q2XA 1MGOA 2NTVA 3NAQA 3UGKA 2C59A 4NK4A 1LDNA 2FZWA 2WYWA 2V6FA 1IY8A 2C0CA 3GA0A 3H9QA 1GD1O 1F0YA 3GRPA 2R6JA 5T5QA 4FSHA 1BDBA 1YB5A 4Z0PA 3V1YA 1KC3A 4YRAA 5BSEA 4JQCA 4F6LA 4OGWA 3IC5A 4IPTA 4BB5A 4EJ6A 2GGSA 4L76A 4Y98A 2BI8A 1E7MA 2AQKA 5I7EA 5COBA 5F1OA 4CM4A 4MJLA 2B5WA 4MP3A 5JYEA 1MB4A 4GBJA 3DZJA 2EW2A 4RVGA 5IDQA 3GC6A 2IXAA 2Y1GA 1UH5A 1C3VA 4B4OA 3P2OA 1H6DA 1UAGA 4WK6A 3GZNB 3HADA 1HDZA 1BSVA 1D7OA 1TB4A 4BIIA 1LSSA 1ZJZA 1QORA 1NYTA 1GU7A 1PJ3A 1YL6A 3GNTA 4WCFC 5FWNA 3PYXA 4WNIA 4BGVA 3DEYX 3RD5A 1GR0A 1QXSA 2HMWA 4D45A 1CETA 4CMGA 3D4OA 1C0PA 2CDBA 3VZRA 1M6HA 3Q9UA 2Y0DA 1U4OA 2X9VA 4WPGA 3NTOA 1K6JA 3HDJA 1DAOA 1TXGA 2DBVO 3MWEB 3HHPA 3C7DB 3EZYA 5F5NA 5GZ1A 2FRDA 4UVDA 4YCAA 4UREA 4AJJA 3K92A 1NNUA 3RROA 4X54A 4ZA2A 4R41A 3GG9A 4B7UA 4CUZA 4BO8A 2X5KO 1BMDA 3OP4A 1PS9A 2AQ8A 3SLGA 4E5NA 1QYDA 5JNLA 1DJNA 3AM4A 5HTOA 3ANNA 5G4KA 2GN6A 5CG2A 1NQ5A 4AVYA 3IMFA 3LLVA 1J0XO 3DOCA 3OMLA 5T67A 4IQ8A 3X2EA 1VL6A 1IYZA 1KVQA 3JQ7B 4LK3A 2P4QA 3STHA 2FR8A 3HZZA 3LT0A 2C2YA 2ZTUA 3BMNA 3I9JA 1CDOA 2J3JA 2YHIA 3PHIA 3AJRA 1G0OA 1XHLA 3OM9A 3WQRA 3R6DA 5DBFA 1WMAA 3O03A 3SEFA 1N5DA 1YL7A 3OIDA 5EQDA 2Y1OA 3DR3A 1YJ8A 3NRCA 2E4AA 1QYVA 4OMUA 2DFDA 3BMOB 4BKRA 3LT2A 4EUEA 3ITDA 2RAFA 4GX5A 3ZNPA 1NQAO 2QYTA 4HP8A 3UFXA 3V2GA 2XPCA 5B4TA 1E5QA 2CVZA 5L4NA 2P4HX 1EK5A 4YWJA 4LVUA 4YT4A 5LC1A 3U4HA 2B36A 3WSVA 2HKIA 3LDHA 3PFFA 2XOXA 4YR9A 2PZLA 2X58A 3DBLA 2FR0A 4B7XA 2VT2A 3COSA 1E7SA 4B3HA 2YYYA 3BAZA 2AQIA 1NVMB 4RCVA 3SX2A 5IXSA 1GZ6A 1ZSVA 3U62A 3RSHA 1RYDA 2FPGA 2NLOA 2EKQA 5IN4A 1NVGA 1SZJG 4FC7A 1K5HA 3KBOA 4CLXA 3ASUA 2GZ3A 4NZ9A 2JHGA 4OOFA 3KB6A 1NM5A 3UH1A 1TA4A 4PVCA 3GVHA 1ENYA 2OZPA 3ZGYA 4EITA 3M6IA 4BKOA 3KYDB 2FZEA 4QECA 1NR7A 5A5FA 2DTDA 3FR7A 5IDYA 4XZ3A 4XEHA 4RZIA 1CERA 2RHRA 3A06A 3IJRA 3FTPA 4XQ9A 2FHSA 3PRJA 5ER6A 4XR9A 1MFZA 3H3JA 3FCOA 4RVHA 3ADPA 3LT1A 3PJGA 4P4GA 1A7KA 2HRBA 4C7KA 3GAFA 3JQFA 4DIBA 3H4VA 4WGGA 1IHYA 3VZQA 4Z9FA 2R2GA 1ONNA 4XJTA 2PGLA 1K89A 4MO2A 3SC6A 1UP6A 3N7UA 4CM7A 5CHEA 2I76A 1ENPA 3DL2A 4RPKA 4DWVA 3RKUA 3F3SA 3RUDA 1EUZA 2QRLA 1I5RA 1X7DA 5TF4A 2O3RA 2Q49A 4J0FA 3H9EO 4PZCA 4A7PA 4ZQGA 1YOVA 1E3IA 4KDEA 3C24A 2HK9A 1RYEA 2QZZA 3PYMA 4WECA 1H6BA 2VYNA 2IZZA 2P68A 1TVEA 4MKXA 5L95A 3PHGA 3CSDA 2B4QA 3WFIA 2YFQA 1OC4A 1NFRA 2NVUA 4XDYA 4P4LA 4ESOA 2PH3A 3JQDA 2ZJ1A 3NJ4A 3KRTA 1Y9EA 3QWFA 1B8VA 2Z1NA 1P33A 1LXCA 1LJ8A 3VKVA 3P19A 1T2EA 1UXKA 3A14A 1T2CA 1GEEA 2I9PA 1PZHA 4A03A 4BQPA 2BKAA 1AXEA 3O4RA 1T2AA 3JD3A 4O63O 4YJHB 5A1TA 1XA0A 2Z1MA 4PG5A 4U6SA 3TZ6A 5LDGA 4DC1A 4LMRA 5B37A 4YJFA 4KQWA 1D3AA 3ZWAA 3O38A 3AWDA 3DBVO 4KWIA 4PZDA 3E82A 4FOSA 3S8MA 5EIOA 5U1PA 3GMSA 1FF9A 3JQ9A 4U6QA 3JQGA 1E5LA 3OJEA 4BHTA 1VL8A 3R3SA 2J8ZA 2TMDA 4KZPA 3LC2O 1NX6A 4PLCA 5THKA 4AJOA 1A27A 1F8FA 5KVQA 4XKJA 3UXYA 1LQTA 2X0IA 3KYCA 4E3ZA 1BWSA 3JYPA 4I5GA 4I5FA 1HDRA 3DBHB 1E3SA 4RF5A 4YACA 4BGIA 4E33A 2CSUA 3NEPX 1KVSA 2WM3A 5JCJD 2GN9A 4EW6A 1I01A 4CMBA 1MUUA 4ROSA 1H2BA 2PZMA 4BO1A 2EIHA 1I24A 4GAEA 2YDYA 3GF4A 5EMHA 4WOJA 5B12A 1WVGA 3EDMA 1XG5A 1DIRA 1HZZA 4CV0A 4AJNA 4ZGWA 2G1UA 4CV2A 1N92A 1HDXA 1DJQA 3EYWA 2EGHA 1PSDA 4MOWA 1QLHA 3GQVA 1XEAA 2Y1FA 3G3EA 1CQJA 2GPTA 2C7VA 2H5LA 5T6BA 2D59A 1UZNA 3K73O 5CDTA 2FSSA 1WW8A 1A71A 3C1TA 4Q3EA 1XSEA 1LSUA 4R68A 4UVHA 3SBOA 3FWZA 4BVAA 1MFPA 2LDBA 3DBRA 3JYOA 4H3VA 4CMJA 5AXCA 4PCVA 5COAA 4ZD6A 4IDAA 1XR3A 1B2LA 3UKOA 4ALMA 4E5KA 2YV3A 2F1KA 2I67A 4GWGA 1K6IA 3JSAA 4H15A 1PL7A 4DMLA 4GKVA 3AM3A 4QT0A 5DBIA 2OHXA 1JKFA 1QKIA 3QE3A 3D4PA 4IM7A 4O0LA 1KYQA 4RPHA 2X86A 3TZHA 4ZRNA 1ZH8A 3E48A 3KLPX 2OL4A 1AXGA 4ALIA 4Q3BA 5JSFA 3BTSA 4FGWA 5CDUA 3E5MA 1JAYA 1DHTA 2PFGA 4NMHA 3TF5A 4PN3A 3HFGA 4WCFB 3DZIA 2P5UA 4NJOA 3PK0A 1ZO8A 3UN1A 4CM9D 3D3WB 3V5NA 1VSVA 1ZK3A 1KS9A 2W2KA 1B8PA 1SEPA 3I23A 3CZRA 5KJEA 3WMWA 1Q0QA 1DOHA 1MXHA 1ZFNA 2GUGA 2EERA 4AJ4A 3ETEA 3GVIA 5A9RA 1I10A 4CM1A 5LCXA 1N9GA 3PHJA 5FEUA 1KEUA 2UVDA 1SBYA 4FR5A 1TT5B 5TLSA 3F4BA 2VRCD 1HZJA 1UR5A 2FWMX 3AK4A 4BNLA 2O7SA 1SB8A 5GZ3A 5KNLA 1PGQA 5IZ4A 1ORRA 1GCUA 5DF1A 4WNCA 1KVUA 1CIVA 3ONEA 4QTZA 3BHJA 3HE3A 5FYDA 3PTZA 3JQFC 1EZ4A 3D0OA 4CUKA 4R54A 1XWFA 2JFFA 1UXIA 5TT1A 1ZK2A 3AI1A 4FB5A 4K28A 2PKQO 5GMOA 1JLLA 2DBRA 4OKIA 4RPLA 3CMCO 3ROKA 4TVOA 3AOEC 1O0SA 3I9OA 4BGEA 1Y81A 3JYNA 1M76A 2OMEA 4GVXA 1HLDA 3FTNA 3LT4A 2DFVA 3JQAA 2BI7A 3EVTA 4HV4A 3I4CA 1YONA 3CXRA 2VT3A 2VZ9A 4J1SA 4BNWA 2IEDA 4CLRA 1Y8QA 5A9SB 2JCXA 3PXXA 2X1HA 3FNHA 4CR6A 3U3XA 1PS8A 2HO5A 3P7MA 4D44A 1NP3A 1T1SA 1Q7BA 3EC7A 1ISHA 4PGFA 4Q3CA 1LRKA 4Z0TA 1Z45A 4NBUA 4EGFA 2B83A 2NADA 3PZBA 1YE3A 2B4TO 2Y93A 1DIBA 1ZMTA 4Q9NA 4UEJA 3F1LA 4NNJA 4Y6SA 1JWAB 3NX4A 4B8ZA 5CEJA 1E92A 3DMTC 3JTMA 2FY8A 3DO5A 3R1IA 3VC7A 1ZK1A 1ZK4A 3O8QB 3PFWO 2POQX 1NWCA 1V9LA 2G5CA 3GMDA 4GWKA 1YL5A 2QIOA 3I6QA 1ZIDA 2X0RA 4R9RA 5TS3A 2D4AA 3VAZA 4GSLA 1ZEMA 4N5MA 1YGYA 3CEAA 1BVUA 4TRRA 4CMCA 3ICPA 3WGIA 1UDAA 2D2IA 3HQ4O 4IY1A 4JBGA 4XRRA 3RJ5A 1R0LA 3K2BA 3NYWA 3WR5A 3ABIA 3WB9A 4AFNA 4NJMA 3WTCA 4K6CA 3GNSA 4KQXA 5CFZA 4JP2A 1I2ZA 1KEPA 1T24A 2EW8A 2R00C 4WKGA 3JD0A 3UF0A 2ZTLA 3RBVA 4JROA 1EQUA 1K2WA 2HJSA 2DUUA 4RVSA 1V3VA 3DXFA 3QVSA 2Q3EA 1NQTA 2JAHA 5EQFA 4FJ0A 3NT4A 3FBGA 3U5TA 2BLLA 4MVJP 1ZMOA 1E3WA 2BGKA 3GDGA 3FRJA 1EBUA 1LLUA 2OBYA 1E6EA 3TZKA 3JQEA 3PI7A 1I3KA 1RJWA 4WOKA 1E7RA 1I3NA 1IL0A 2NSDA 3AI2A 3CUKA 3Q9NA 1R4NA 3EW7A 5L53A 4NFSA 3ZWMA 3RJ9A 3ZWNA 2W2LA 4BKQA 1LX6A 4PFJA 4DQVA 4C4OA 1NHGA 5F1PA 4DLLA 1HEUA 4J16A 5ADHA 1Z75A 3F5QA 1UDBA 4XB2A 4OM8A 2V6GA 4BO4A 3GHYA 4J3FA 2GCGA 2PK3A 1SAYA 4R1TA 4CM4B 1PQUA 1PJQA 3AI3A 3H9JA 4AG3A 3RC7A 2HU2A 3RC1A 4JX8A 3ZWWA 2Y66A 2O7QA 4IINA 2NU7A 1AE1A 1A4IA 1A5ZA 3OEWA 1UDCA 2IZ1A 1CJCA 4LW8A 1JKJA 4EI2A 5BSGA 2JKVA 4W82A 5L4SA 5J23A 4BNGA 5T64A 4IDDA 4CR7A 4OSOA 1Q0HA 4LGVA 4CMKA 1V35A 3LLSA 2WYUA 2ZTVA 4DC0A 4YT2A 2J3IA 2Q46A 2VRBA 4IDEA 1OFGA 1ZVMA 1UJMA 4E31A 3G79A 2OO5A 3AUAA 4BO3A 3MJSA 1N1GA 1Y7TA 3B1FA 1YVEI 1E3LA 1Z74A 1R4MB 2NNLD 4XGIA 3TZQA 1KVTA 1OBFO 3D3EA 4KUGA 4JN6B 3O26A 4IIUA 2X6TA 3Q6IA 2BFOA 2C07A 4NI5A 3K8ZA 4IJVA 2AMFA 4UEKA 5A4DA 3QA9A 5IDXA 5C5IA 4D79A 3WSWA 4O1MA 1Z6ZA 1I3LA 1LEHA 3MTGA 1GYPA 2PA3A 2YHUA 3MOGA 4AJPA 1PIWA 2YHIB 3UICA 2WD7B 1IPEA 3QJ5A 4M49A 3P2YA 3GRKA 3S1LA 3L4BA 4W9NC 2O50A 3S2GA 4XYLA 2VHXA 1U5CA 2AEMA 5JDIA 3OH8A 2Z95A 3Q2KA 3L6DA 2XAAA 3WLFA 3L07A 1LDYA 2GNAA 1A7AA 1TI7A 3AY7A 4XX0A 4IDFA 4MVJA 2VTDA 3PPIA 2J5RA 4Z6KA 3E9NA 3K9QO 4LMPA 3NDIA 3AU9A 4PLGA 4TQGA 5JAQA 4U0JA 1U3UA 5KVVA 1X1TA 2FPPA 3U4DA 4FPXA 5CDYA 4MVJF 3L0DA 4IBOA 2GZ2A 4J2OA 3TPCA 3ZWPA 3K5PA 4HXYA 5DCYA 2C82A 3AU8A 4U7WA 1GV1A 1NASA 3MWDB 3B1JA 3GEGA 1P1IA 1DC4A 1YRLA 3NUGA 2OP1A 2PV7A 5I7FA 2AEFA 3ZZNA 1YB1A 3RVDA 1ZW1A 2ZCVA 3KEQA 3KO8A 5I9MA 5HS6A 2E6UX 2NTJA 1ONPA 1B7GO 3CKYA 4JBIA 2ZB3A 3RI3A 5L40A 4L9RA 3LSYA 1GYQA 1J4AA 3V8BA 3Q1LA 3RQSA 3UAGA 4CM8A 1LUAA 4KTVE 1Y1PA 3Q2IA 3WXBA 4ND1A 4IDBA 3OSUA 1Z82A 1E1MA 3JCZA 2Y1EA 4A26A 2DPHA 4FCCA 4Q3DA 2YY7A 1YQGA 3ETGA 1W73A 3LQFA 5AXBA 2AE1A 4FFLA 3HUDA 4GLLA 2GASA 2HRZA 3PZRA 4ZHSA 3GN2A 3GG2A 4FFNA 1X7GA 1O95A 2OFPA 2W8ZA 4R51A 3WJAA 5H83A 3NGLA 3FN4A 2RCYA 3GK3A 1DIHA 1BXGA 4CL3A 4JK3A 1DIGA 2CVOA 3B1KA 3B70A 3DFZA 3C7CB 1VRWA 3GGOA 4Q3NA 4G2NA 1P1KA 1N7HA 4RLSA 3S55A 4MDHA 5I7SA 3ZH2A 1A4UA 3PHLA 3T7EA 4AJKA 1DC3A 4Q39A 4TRNA 2YZ7A 1JW9B 3Q3CA 3ZHZA 4B3IA 5C7OO 2QHXA 1PQWA 3EMKA 5TRTA 1VJ0A 4P4NA 2HMTA 3QVXA 1Q0LA 2BFAA 4IUYA 1YS4A 1UZMA 4LCEA 1W0CA 4XB1A 1HLPA 5DP2A 4C7JA 2VYVA 3PDUA 3QRWA 3G1TA 4TWRA 2I99A 1LDGA 1HYEA 3GAZA 3H8VA 5JC8A 3BTUA 3ENNA 1PGOA 4BNJA 3QWHA 1YBMA 1YQXA 3PGXA 5KIAA 2IYPA 1R16A 3U09A 5BNFA 1O9BA 3BMQA 2P9EA 3VVBA 3M1LA 1YBAA 3A1NA 1XQ6A 4R1NA 1ISIA 4NBTA 5A03A 1Y5MA 1NQOA 1HKUA 2OORA 4FQ8A 2NVUB 4IS3A 3V1UA 4MVJH 4BNFA 2Q2WA 4CLOA 2C5AA 1EDZA 4ZQBA 3TRIA 4CR8A 3VVCA 5JAZA 2BD0A 2DTXA 3ADOA 4IQGA 2BFPA 3VPHA 1AN9A 3DFUA 3RWBA 5L45A 4DQXA 1GCOA 3JYQA 1QG6A 3GDFA 4PLVA 2ZYDA 2EP5A 3TL3A 3W4JA 4JJFA 1M66A 3S2EA 4CJXA 4UUMA 3WG9A 4BNKA 3GT0A 4MIYA 4YJFB 5A5EA 4PLWA 3TFQA 5TJ9A 2GN8A 1NPTO 3UCFA 4QO8A 4UUNA 1QYXA 4W7HA 3JQGB 2C5EA 2JD0A 4BNMA 1GFSA 4J2HA 5B1YA 5JBIA 2O48X 1Y8RA 4HBGA 4R3NA 3VTZA 3DOJA 3ZWYA 3WGOA 3TFOA 2D0IA 4IDGA 3G17A 1WDKA 4KWHA 4XDZA 6ADHA 2JL1A 1B8UA 3ANLA 7ADHA 2XXJA 3ROPA 3RUHA 3Q11A 3LF1A 5H81A 3WYCA 4R5HA 2VUTA 3KYCB 4E12A 2NQTA 1IPFA 2BELA 1GPJA 2ZK7A 3ENKA 3JD2A 4R4JA 3ICCA 5KJ1A 3GNQA 4YPOA 1UXJA 2EF1A 2HK8A 4GVLA 3WBBA 2GDZA 2VQ3A 1I2CA 3V2HA 1EVIA 3DONA 4OYRA 3DWFA 1OZAA 3OECA 4GKBA 4JGBA 1EE2A 1Y5RA 5DOZA 2V7PA 2GSDA 1B3BA 4CQLA 2CY0A 2DU8A 4QXMA 1SOWA 2ET6A 4NBVA 2FP4A 4WJZA 1VL0A 2VUSA 1XU7A 1O5IA 3UHAA 4XYBA 1E0DA 2P2SA 4IS2A 3ASVA 4AJ2A 4YT8A 4U0KA 5JDIC 4XQGA 2YW9A 1OOEA 5JMWA 3TOXA 3ZDFA 3E8XA 5EERA 3QVWA 2FPIA 3BIOA 3ZWOA 4J9VA 5KOIA 3QY9A 4BNTA 1NTOA 3DBRB 4IJUA 1NWHA 1U3VA 2E48A 3CPSA 4E30A 1KEWA 3FNGA 1DSSG 4XR4A 3IJPA 1OI7A 3AUSA 5A3VA 5DNAA 4HFNA 3INRA 5KCZA 1U4SA 2O3JA 2DLDA 2VHYA 3ZWBA 2ZTMA 4NQZA 2I3GA 3IAHA 1VI2A 3BZUA 2NUAA 4JNKA 5AXDA 3GZNA 4IZHA 1MXFA 3FNFA 2NVBA 1XYGA 1SB9A 2VWHA 1P1RA 3LK7A 1JTVA 1N2SA 1V0JA 3F46A 5CDGA 1ZXBA 4YDRA 5BR7A 2UYYA 3LC1O 1ML3A 3BHMA 3BTOA 1D1SA 4BO7A 4ALLA 1HE2A 1MLDA 2UUOA 2W2KB 3PIDA 3VOSA 3S2IA 4PG7A 3WGGA 3I3OA 1C0KA 4BO2A 1HDOA 2O2YA 1YB4A 3EAGA 2AA3A 3TNLA 3NV9A 4JP3A 3PEFA 2HLPA 4J1NA 2P5YA 3AOGA 5KKCA 2NV6A 1QRRA 3DZKA 2EEZA 3OJLA 4N18A 4EYEA 5HA5A 1VC2A 2FR1A 4M1QA 1B3RA 3KLMX 1C1XB 1ZJYA 1DEHA 3T4EA 3R3JA 4RDIA 3I9MA 4E5MA 4B3JA 2VRCA 2Q1WA 3WGQA 3JQ7A 3BMCB 1ZEJA 2B0JA 2A94A 2OXIA 1WZEA 1BXKA 1SC6A 2Q4EA 3GN1A 4F6CA 3G0OA 1I0ZA 3QV1A 4G65A 4HX5A 4J6FA 4E32A 1E7WA 4HNHA 3B20A 4NHEA 4CMEA 4MIEA 2VCYA 4IGFA 3EY4A 4D7AA 4FBGA 4N5NA 3WQQA 2X9GA 2QW8A 3GOHA 4R16A 3A9WA 4EBFA 2QQ5A 1BHSA 3H9UA 2GRAA 3GPDG 2PD6A 3OQBA 4FIZA 4CLRB 4E5PA 4EJ0A 1KY4A 3WWYA 1PR9A 1M75A 5A3JA 1GQQA 3AFNA 4RQUA 4BOYA 3KSDO 3HNPA 5JW6A 4LVCA 1GDHA 4NFHA 1H2HA 3JQ6A 1BG6A 1GEGA 2EXXA 2Y1CA 2O3SA 4GMGA 1F14A 1I3MA 5EJ2A 4DPKA 2NU8A 1JN0A 4PVDA 3I5MA 3N58A 1FDVA 1MG0A 1DRVA 3HN2A 5COQA 2G17A 4I9UA 2PTGA 2ZYAA 2EKLA 3V2UA 3E18A 4XCVA 1P0FA 6LDHA 1LSJA 3NT5A 4TMFA 4G81A 3ZV5A 1UAYA 1Y9AA 1R0KA 4K9DA 1EFLA 3H5AA 1VKOA 1KIFA 4F3YA 3GR6A 4NIMA 5G0WA 4NBWA 4Q3AA 3BHIA 4PLHA 3IL2A 4BV8A 1K0UA 1U5AA 3WOHA 4CM6A 4DPMA 3NT2A 4HNGA 3ZNQA 1IOLA 5DZSA 3TOZA 1F8GA 2J6IA 2WE8A 3F1KA 3ONFA 3GVXA 1ID1A 2CF5A 4O6VA 1SMKA 4J43A 1QMGA 2Y99A 3DDNA 1KVRA 4YYZA 4F45A 1S7CA 2OP0A 3JQBA 1XIVA 4M55A 5T57A 3SVTA 4BMVA 5I9LA 2UAGA 4BNHA 2TMGA 4OHUA 1DBVO 1R12A 4RVUA 2E49A 4XA8A 5JLAA 2ZKLA 3UCEA 2AE2A 1FDSA 2CF6A 2X8LA 4IJWA 1H9AA 1HT0A 1YWGO 1WAMA 4M86A 5EN4A 1ADGA 1BXZA 1GV0A 4ZU3A 4FGSA 4HFRA 1C14A 2XXBA 1ISMA 3NTQA 3AM5A 4NK5A 1TEHA 1A9YA 3GUYA 4IMPA 5IF3A 3DZHA 3JD4A 4FN4A 2VYND 1E3WB 4MKRA 4PLFA 3LU1A 3WMXA 4PG8A 2NU6A 4K26A 2Q2QA 3WIEA 1PJSA 4RF2A 4QUKA 5JXWA 3K96A 2BGMA 2C20A 3VH4A 1XQ1A 3ZV3A 1NBOA 2PNFA 1R4NB 3SJ7A 3OA0A 5TC4A 1I2BA 3DTTA 3WDSA 1G1AA 1WLYA 4RORA 3IP1A 3BYZA 1GPDG 3PJEA 1BGVA 2EV9A 2IYOA 4GGPA 5DT9A 5AQ1A 2WJPA 4I9HA 1AUPA 1EDOA 1HE3A 5CEEA 4OSPA 4EDFA 1B14A 3EZLA 3W6ZA 5ICSA 2G82A 5I8ZA 3ZHBA 1PGPA 1CEQA 4OKNA 1HDCA 4CQMA 4ALNA 4BO9A 2HCTA 1BW9B 5KVSA 4BNYA 4Z0HO 3U0BA 1EVYA 4IXWA 3I9KA 1AHHA 4RGBA 4CM3A 2RIRA 1NVTA 1K3TA 4UULA 3FPLA 2X5JO 4QQRA 2B35A 1HSZA 3WGTA 1DC5A 3U4IA 4XQCA 1MV8A 3ZI0A 1U28A 5L9AA 1QV7A 4R1UA 4AJLA 3UVEA 3AY3A 1P45A 3BXXA 2IODA 5DOVA 4EZBA 5HWSA 3WGYA 2AXQA 2ILTA 4B79A 2BMAA 2YQ5A 1NFQA 5TX7A 4XYGA 2OGUA 2DQ4A 3MJCA 1PZFA 2ZQZA 1ZBQA 1WP4A 1LI4A 3EGOA 5IZCA 3CE6A 3RCBA 4OO3A 2IEBA 3DZFA 1ULSA 4ZRMA 4L0QA 3FBTA 4ZVVA 1FMCA 3AUTA 4HADA 4DMMA 5JCXA 2VWQA 1PGJA 4L8VA 4W7IA 2FSVA 4O59O 4D42A 1J49A 1DFIA 2C7GA 4AJEA 1MX3A 3DBHA 3GY0A 2Q4BA 3AW9A 1YO6A 3RC2A 3OQ1A 3DZGA 3MTJA 3PLRA 4EEXA 1VM6A 3HN7A 5FFFA 4MIOA 3INTA 3WYBA 2NU9A 4NH4A 2AG5A 2J5KA 2UUPA 1KEVA 1GUYA 5JY1A 2DAPA 2PGDA 2VHZA 4J90A 3C1OA 3GHHA 5TNXA 3ZHYA 5B4VA 3ZCXA 5CDSA 4J4TA 3JQ9C 4Z9YA 3MJTA 3K31A 4GSKA 3DHNA 4D41A 2HAEA 4OIMA 3TQHA 4CMEC 2W90A 5L7WA 2EWMA 5TGDA 3IUSA 1MG5A 5GZ6A 1QSGA 2Y67A 3KSUA 1LLQA 2DVMA 2H1SA 2G0TA 4WLOA 1U2GA 2PY6A 2VHVA 2HMVA 1LC0A 4W6ZA 3OFSA 3JD1A 1CWUA 3INGA 3JQ8B 2QG4A 1MA0A 1WZIA 3NGXA 3PHHA 1NAIA 3GPIA 2Q1SA 2FOIA 3QHAA 3RUCA 4B7CA 1JVBA 3VZSA 1KY5A 1U9JA 4KOAA 4E4YA 2SCUA 2X9NA 5G0TA 2FN7A 3VKUA 3WYEA 2VZ8A 2J3KA 1FDTA 3TSCA 1I33A 3GFBA 1QYWA 3PVZA 3FHLA 3D3WA 4R69A 1XELA 1Z7EA 4ND4A 2ZCUA 1K6XA 3F47A 1IZ9A 2YDXA 4PRLA 4BMSA 1PTJA 3WWZA 2Y05A 3H5RA 1TLTA 4FFRA 1CRWG 1I32A 4TKMA 4XQEA 3VH1A 3L77A 2PZJA 4JXKA 3I4FA 1TT5A 4YVFA 1EBFA 9LDBA 1L7DA 1T4DA 4GPD1 4ALJA 4HFMA 2FMUA 4Y67A 1B0AA 1ISFA 3PQFA 3KV3O 1T26A 2YJZA 2X22A 4FC6A 3G1UA 3IQDB 2DC1A 5T8KA 1U8XX 1C1DA 1BXGB 1NXQA 5HRUA 3GEDA 3C8MA 1P1JA 5G4LA 4B8WA 3B6ZA 1UP4A 5K9ZA 3LVFO 2VNSA 3E9QA 1LSOA 2BFMA 2RH8A 4II3A 4DA9A 5LDHA 2PD3A 2I66A 1WPQA 4OQYA 4MVJI 2Y68A 1X1EA 3CZMA 3NTRA 5F5LA 5JO9A 3RASA 4YAGA 4QO7A 4R3WA 3DAGA 4R01A 5FI5A 3C85A 1TT7A 1E6WA 5JE8A 3O9ZA 1R0SA 4D0RA 2ZATA 1PR3A 4WLEA 4EEZA 3GGGA 3RKRA 3JQCA 4J4HA 3VH3A 5DULA 3ZNNA 4YRDA 1HL3A 3IDSA 5G4KB 4MPDA 2JFHA 1T1RA 2WTBA 3H7AA 4UUPA 3HDQA 1GAEO 2DPGA 2GF2A 1E6UA 4L4RA 5ES3A 4L4XA 3RUFA 5JDCA 2AG8A 4PLPA 1X14A 1Q7CA 1B26A 1Q1NA 5AOVA 4FFMA 5DCUA 4DTIA 3V1TC 3ZWXA 3QWBA 3BMNB 4RVDA 4Y6PA 1ISGA 3WQSB 2V65A 2Q1UA 4YAJA 3WGHA 1IE3A 3DOOA 4DXHA 3W4IA 3QVOA 4JBHA 3GFGA 1G6KA 4WLVA 3G49A 4FJ1A 4E2WA 5F21A 2I5PO 4CPDA 1NFFA 1NPDA 3VDRA 3VH2A 4DPLA 3FR8A 1NHWA 4TKLA 4DRYA 1C0LA 1VJTA 3H2SA 4Y8VA 5G0SA 3ZU3A 3GLQA 4A5OA 4DIOA 3L6OO 4TZKA 5JPIA 3ZHXA 4FFPA 5CPFA 5KTKA 5MGBA 4PZEA 1HE5A 4L74A 5L4LA 2I65A 4YEDA 1DPGA 4CODB 1Y8RB 2PLAA 2JD1A 3DBLB 1XKQA 1W4ZA 4BMNA 3RU7A 4ZJUA 4B4WA 4E2YA 1F06A 3CMMA 4OAQA 4FW8A 4CMIA 2O2SA 4D46A 1JQBA 1O89A 5A04A 3ROQA 3WICA 3VPSA 1OAAA 3OICA 7MDHA 4E21A 4RQTA 1FDUA 4ZQFA 3WTBA 4R9SA 3ROMA 2YQ4A 3VTFA 1A72A 4A73A 3GZ4A 4QEDA 4PG6A 1VJ1A 1E1NA 4XGNA 4CQLB 2W2LD 3WGZA 1N8KA 4BUCA 3PJDA 1NR1A 2ZJ0A 3IKTA 4OOEA 4HFJA 5TT0A 4WEOA 4DYDA 1E3EA 3OBBA 3ITKA 1WXDA 5BSFA 2VN8A 3NDRA 2P91A 2V6MA 1FK8A 4HY3A 4E2ZA 1VSUA 3OIGA 4YJGA 1V3UA 5HBRA 4J4BA 1RM4A 2ZB4A 2JAPA 3DB2A 3HB4X 4XWYA 4QSMA 3LYLA 2B37A 3UW3A 1T25A 2DBZA 4BO5A 1JDJA 2DUWA 3PWSA 5IFLA 4R1SA 2G76A 2PH5A 5ILGA 4I08A 4I1IA 4PRKA 5TIIA 4K1LA 3DAPA 4G5HA 3OJOA 1HSOA 1SOVA 2DT5A 3KOUA 5CG1A 4CMHA 2BHLA 3HSKA 1H9BA 2O4UX 3C1AA 5KVCA 1EUCA 1AHIA 3WNVA 5C3MA 3QSGA 1LTHR 2EKPA 1P1HA 3AUUA 4CLHA 3WS7A 3D5QA 2QX7A 3AFMA 2D8AA 3OHSX 4YBZA 3OEYA 4OH1A 4YA6A 3Q0EA 3LZ6A 4DLAA 1X13A 1YOVB 3ONDA 2WWRA 3WJ7A 4YRBA 1U7HA 3ORFA 4H16A 1E7QA 3RFVA 1OMOA 2AHRA 2C2XA 4J7UA
chains in the Genus database with same CATH superfamily
4HLDA 1JYFA 1L3IA 3ROFA 2F9LA 3BF7A 3LF2A 4H7FA 1P2FA 1OD6A 4RD0A 1N6KA 3RFCA 5C7IO 3KVYA 4R5MA 4MV9A 1EVQA 1Z0JA 5CDHA 2Q2NA 2A92A 2B1QA 3ON5A 5CGZA 1WIWA 2WYVA 3ZDDA 4UEOA 1WD7A 5C31A 4BBPA 4BL5A 2HNKA 1I1OA 1QPGA 3WK4A 3TFWA 5AM1A 2XEDA 2Y1DA 5AVSA 1O94A 4C7OB 3WB1A 3A1TA 2QYSA 3A6GA 4FCWA 5JJIA 1UUFA 4N7MA 1EUDA 1G5RA 4TSFA 3U39A 4UJ5A 3ZQKA 3R9WA 1R37A 2E37A 1VI5A 4KMSA 3ROZA 4P7GA 1TO6A 3REQA 1PWYE 2IUYA 2NYRA 5EWMB 1JQEA 3QUSA 4MXDA 2O3UA 4BU1A 3OAAA 5EIEA 2J9FB 2WD7A 1UKZA 3SNKA 2BF7A 1ZM2A 3M6LA 4PIVA 1ZD1A 2WLSA 2XKJE 3FOZA 1VP3A 3DGEC 3NHMA 4HQRA 4DCPA 3H6KA 4XM1A 5KQRA 3QEMB 3ISVA 1JHPA 3U4CA 3LQ4A 5JEEA 4N8DA 2HHLA 3NHLA 3WJ2A 2OO5C 3NM4A 3IQEA 4U3JA 2GSWA 2VK8A 2F62A 2QRHA 3H2KA 1V5IA 4PQYA 3QU9A 3NB0A 4EO9A 3QHPA 2Y0EA 4YAOA 3STUA 3T54A 1LX7A 3IUPA 2O8EB 2NPIA 2N3ZA 2VWPA 3U49A 3E9MA 3GDOA 3ESRA 3CLUC 5EINA 5FT9A 5EJ8A 2O1XA 4IZIA 4L4SA 4A15A 2IOHA 4GLOA 1INLA 3IOCA 4RJTA 5KDLA 5HCIA 5I3ZA 4IHAA 4EGQA 1H05A 1JU9A 5CVDA 4Z4EA 4PAWA 4RA9A 2BP7A 3U17A 2N1MA 4E2XA 3KTDA 5JIBA 1KOFA 1A97A 2I3AA 3EHEA 5K3BA 2NU8B 5C8VA 1AMOA 2P5TB 2D7CA 4I4TF 2GN4A 2JAQA 3STWA 4XGKA 2C78A 4MWCA 4TSKA 2OLEA 4JNCA 3ZV6A 1A2OA 1TIKA 3AL3A 1DIAA 1A7UA 1GGNA 4M89A 1GUZA 4PSCA 4R84A 3WYAA 4BMOB 2VNHA 5EJFA 1QLWA 2Q4OA 3EF1A 4I1UA 4O2LA 5SYAA 3UJ7A 1KHHA 3ZWCA 3V8NA 1FFXA 1Y89A 3KAPA 1ULAA 1UP7A 2R25B 3TB6A 2Z4RA 2ZIZA 3DE3X 3FMIA 1O95D 1L6IA 3C4JA 2OXEA 3DLBA 4J7CA 1M6WA 2FQ1A 2XIQA 4GH5A 2GWRA 2HF9A 5CX1B 1GTSA 2BC9A 4IXDA 3B52X 5B6PA 1WW2A 1YUNA 3P0JA 3H99A 3F4LA 1R0YA 1NZDA 1Z4NA 5ES4B 1J56A 4QFDA 1E0AA 1GPAA 2LXNA 1H94A 2O8FB 3D7NA 4QJBA 2G8NA 2RGGA 3CUVA 4H4CA 1YDEA 3GCDA 5ILQA 1VG0B 3ITNA 4U6NA 3EZNA 4HH1A 1EU1A 4P34A 4A27A 4BNUA 1NVUQ 13PKA 3HCRA 4OJQA 1BHQ1 2CLMB 3FVQA 4L0CA 4QQNA 4RTKA 3AP3A 3DF9A 1XGKA 2Q3MA 4BS9A 1DXHA 5LL6P 3H2GA 1NG9A 1D2AA 1JDSA 4W99A 4KGVA 3SHWA 5J5CA 1YBHA 5K5EA 4JB3A 3PFHA 3GCWA 3LO8A 1P31A 2GAIA 2VO1A 1B0PA 3RSFA 2ONCA 2IWHA 3WIDA 5FCDA 2VYVD 4FFWA 4ZCIA 2AYXA 1YV9A 2KPOA 2JW5A 2Z08A 3HU1A 4LRSB 2VJOA 4K8RB 1P5RA 3DMDA 1Z73A 3J81k 4F8EA 1UKEA 3KJNA 1K8QA 1JPVA 4Q48A 1FY2A 4YDHB 5DGCA 5CCXA 4L78A 2QI9F 4CWAA 4GX0A 4LEIA 4ISCA 3H5TA 4P83A 4IJKA 3LPLA 4RJLA 4UTXA 1GOTA 1OBOA 5AHRA 5ELLA 4Q4CA 2QMOA 1YJCA 2IA5A 1ICIA 3IB6A 3CG0A 3ORHA 5GGXA 2FG6C 3U6KA 5DN9A 5H7XA 3C3EA 3UXHA 3KPVA 1IB6A 1ULUA 2PV0A 1L7QA 3PNVA 3UATA 3UMCA 1X7WA 4J0CA 5KYWA 3MEQA 1O03A 3NOXA 3KYBA 5FBHA 2CNBA 2IKQA 4YMVA 4WLFA 1FRFS 2AG6A 1FJHA 2FCAA 2WAOA 1FE8A 4Y0NA 1EGVB 3RBAA 1P7PA 4N82A 1VHLA 2WF5A 3LS2A 4IIDA 4N9WA 4I5DA 4OFXA 1WMFA 5DSTA 5JFOA 5K0CA 4XFKA 3ICVA 1UWVA 2FQYA 3D7LA 1HYHA 4W5HA 3QIVA 3QE2A 4NE7A 5ICGA 1S5PA 4WT7A 1EZZA 1DV2A 1GZSA 2QUJA 5CNIA 3G7SA 4CQMB 3DMTA 5G41A 1QQBA 1GRQA 4C0SA 5K7SA 1TGVA 1YMQA 4DCCA 5I8WA 1D4FA 1H6AA 2A7QA 3RODA 2Z8ZA 1WCWA 5IM4A 3WZMA 3AP2A 1HXHA 1W5SA 3KQSA 4IOLA 2J85A 4HLCA 1NSYA 1PLJA 1U8ZA 2C84A 3BMOA 3GMTA 3JQAB 4JWTA 2PU7A 3IOYA 3IURA 3JATB 2A8YA 3OE1A 2QLTA 4NLLA 4EH1A 4AB1A 3HDYA 2ZTHA 1C3LA 2WHRA 1IN4A 1Y8QB 4OBEA 5HS4A 4LN1A 3V7FA 1QE3A 1RFGE 1RBQA 2I33A 4NU6A 4Q4AA 4UCXA 1S6YA 1VPWA 3A37A 2RGWA 4F72A 1AKMA 5G3ZA 2W6JD 4NCXA 4X8MA 4ZYTA 1Z7BA 3O75A 3ZNOA 1DBIA 2RK3A 5IVDA 5IG2A 4Q3OA 3W7VA 2HFKA 1D2MA 4PG4A 4YPFA 4RFLA 4DVJA 3F49S 5HUJA 3B1VA 5WRFA 4FFOA 2DHCA 1COWD 4DWWA 3JVDA 2V96A 3IAXA 4G5YA 2AHOA 2E1PA 3VSDA 4F84A 4W5QA 5A0TA 2R751 1DXYA 5ALQA 1BS2A 1ECBA 4OFZA 1FJ2A 2DWCA 4V24A 1L7EA 2XWBF 3M2PA 4LHEA 4ZYZA 1HNNA 3E22B 3RRXA 4X97A 3F6YA 5HQ3A 1O0CA 2NACA 1U1IA 5HJEA 4ZOLA 3SSNA 2FUCA 1L7PA 1KDTA 4MJ3A 4PR0A 1E8NA 1BE1A 1CJMA 4HZGA 5AKHA 5DGDA 4ZAXA 3KYDA 1TMYA 4DLXA 2ZT6A 3UKJA 4AMZA 3VPXA 4HAWA 4N6NA 3UT0A 4U8HA 2ZXUA 3ZGNA 5IVKA 2IBTA 1E6LA 1YRYE 3M1AA 4S24A 3TPZA 1A8HA 2VHWA 3HWRA 1Y48E 1HO3A 3L4EA 4U2FA 3UIEA 3FI9A 2JIMA 3LVRE 2X14A 5DO9A 4MHSA 5FOWA 4NJMB 3OO0A 1IZ0A 2XZDA 5FQOA 2A4KA 3FPCA 2G7MC 4BY9E 2QEQA 2OUIA 4E13A 3C74A 4D5GA 2PUCA 1C5KA 1C9NA 1X39A 5E6RB 4DJFC 4NG5A 221PA 2P3SA 1DAFA 3AUYA 1NC1A 3IT3A 4KPUB 1WMEA 1J8VA 1ZSYA 2R8BA 1E2MA 4ARIA 3OMXA 3IBYA 3G2IA 4K87A 3ROEA 2BSAA 3TNJA 1YBVA 1TYEB 1AM4D 4V0SA 3S0JA 2FAXA 1KEEA 4GMXA 4NCHA 2D2EA 2I8CA 2P2YA 1X0VA 2VUIB 1A5AB 1IUKA 1KMQA 4GI2A 4I55A 4OI1A 4HWPA 5DLPA 1WXWA 2OE2A 3ETCA 4J6EA 2PUAA 3FYUC 1ZD5A 1E4EA 2BH9A 2WJGA 3N2KB 3TW8A 3T3HA 4HNQA 3HM2A 4BKUA 1KI1A 4G0ZA 3O1LA 4AROA 2AZXA 4ZOCA 3NZEA 1MJNA 1NRJB 3NV7A 1P6XA 3IEIA 2QSYA 4AJIA 5K3EA 4DR5B 5U9CA 1JT9A 4HQ0A 4WA7A 1Y4DE 4TRMA 3EXG1 1N2CE 3DZ8A 3OLCX 4EDHA 3ONNA 2A9KA 3UAYA 3BD9A 3AC0A 1G66A 3H2IA 5BVHB 4Z9XA 3MTAA 1U0FA 2O52A 1NQXA 3T9FA 2ZITA 3BGDA 3EXFA 3A6FA 3QMMA 1P1FA 4WESA 4CF4A 5DYYA 3EVGA 1Z4PX 4MQEA 1X42A 5CA1B 4ZALA 2QIPA 4BNXA 4DBZA 1WWKA 2WW8A 2R66A 4PQEA 4BNNA 4D3FA 5JZOA 5KX5F 3IMGA 1LW6E 1FJXA 1J5XA 1GL3A 4B4UA 1USGA 1GKKA 3GGPA 1M2OB 4WAUA 2YYZA 4WNAA 1VFPA 1LF5A 2VPXA 3VNSA 4F9TA 3GJ8A 1C1XA 3GT4A 1FTQA 3OCZA 1H2WA 4N3AA 2YRXA 4PZLA 3TR5A 1ZJ5A 1ZOIA 1T2VA 3T41A 1GQYA 2Z6UA 1KQ3A 1W35A 4ZHQF 3AY6A 1X8LA 3NYQA 3THSA 4UM9D 1C1DB 1YHYA 4WERA 5DKFA 3W2HA 2B4RO 4KR6A 1R9GA 1KERA 2ZYGA 3BMCA 1BJKA 1SG9A 3CG4A 1JIUA 3PWKA 3GGCA 3D6AA 5CP8A 1SXQA 1DC6A 2ZJ8A 4GEGA 1VLJA 1OLUB 4MINA 4DW8A 5LQMA 2IYTA 3D6MA 2RK4A 3DTVB 1JFVA 3N3BC 5IKOA 4DMGA 1JEOA 5FXMA 2VOJA 1PR1A 3B2NA 3IP3A 4W9NA 1RSZA 1GXSA 3COJA 4S3MA 1H6CA 2CHVA 2Q21A 2YMLA 3FKQA 4UDNA 4DOMA 5IBCA 4G09A 4KQKA 1OLXA 4RDHA 1QGED 2QQFA 3CT4A 4F5YA 5BWCA 3ZXSA 2CJWA 1EM8A 1VMIA 3R6LA 4RH0A 2BMEA 2VA8A 4F2HA 5HM8A 5AVUA 5KPJA 3CLTD 4K9OA 4ZVLA 5K6AA 3T12A 3I62A 2X23A 1VKNA 2G80A 4PLZA 3U19A 1WNTA 3A4YA 4G9EA 4ENSA 3KHUA 3P5BA 4RBNA 3VHQA 2H31A 4KGXA 2ZXEA 3O4JA 3L4SO 3DO6A 3OE4A 4PWZA 3WZ2A 4D99A 2GLUA 5FI1B 3PRYA 3C3KA 4U5QA 5JBNA 2P4SA 3LIPA 1TTQB 4NU5A 1VCIA 1B8OA 1DQZA 1LBIA 2A7XA 3DMYA 2P9FA 5GY7A 2VCEA 1VBNA 2ZREA 1KE1A 2JJ1D 2EL7A 5JMPA 3VU8A 3ZGZA 3GD5A 1RAGA 2AFHE 1YJQA 3RRMA 2CUKA 4HDOB 4ARCA 1YQQA 3FNEA 4HDNA 2QRKA 4G1VA 4M8IA 4OHCA 4LRXA 4MRVA 3S2SA 1UOOA 3TJZA 2QL6A 4AN0A 1CB7A 4O29A 1NXOA 1ECGA 5GV7A 1GZVA 2GCNA 2TSYB 2A9QA 4NPAA 4YLEA 4F12A 4K9LA 4G8BA 4ZVSA 4PRYA 3W6UA 1NIJA 2CWDA 2Z2XA 3BPSA 3T7TA 1KIMA 4QTYA 5DRTA 3PGVA 2WU0A 1ULZA 3PT9A 4XX0B 2WAAA 3FSRA 2UDPA 2ISCA 1ZICA 2PGJA 1E7YA 1E1QA 1Q1GA 2O7NA 2ZRHA 1LD3A 2VSXA 3D81A 1NJ2A 1DKPA 2PRSA 3E6AA 1C0IA 3C3XA 1RWBA 3JS5A 2YASA 4GNRA 4J0EA 3N9IA 3ZV7A 2QTGA 4EUFA 4FLMA 5LZ9A 1O7JA 4J07A 3PD1A 4N8EA 2R6AA 2GBFA 2X3UA 1XKLA 3SP1A 2FWRA 5KYYB 2GD6A 1A8PA 1R00A 1XEWY 2JHFA 2R8OA 4JQSA 3IUJA 2J5XA 5JTTA 5DWVA 1CR1A 5CAEA 2AOXA 1G16A 1T6BY 5ALMA 2B7LA 2IITA 2AJLI 2R85A 2QRGA 2HSZA 2ZRNA 3AF4A 2RJ3A 4G0QA 3IAUA 1LBEA 4BLRA 1QIIA 1GR1A 1KBZA 3DE7X 1U8YA 4GMFA 3O8DA 1JXMA 4UMVA 4YDSA 3R7NA 3TYXA 2CXHA 3KEGA 4WCFA 5M2QA 1FYXA 4OQDA 2JLUA 2ZU0C 3K5HA 3NHRA 1Y6GA 3SICE 1PFKA 1Z68A 4JBNA 2ZBGA 4U7FA 3FWPA 2YFHA 5C81A 2FPKA 1P8JA 4OL9A 3I0NA 1H5QA 5DBGA 3VPGA 3W2GA 2A1TS 1LDBA 1WF3A 2AN4A 2ECQA 2FRVA 3DKRA 3L01A 3L1VA 4FD3A 3E9EA 1FNCA 4HDMB 4XPIB 4CM8B 1JPNA 4ITUA 2GEKA 2VTEA 1B42A 4WZBB 5HKBA 3KXKA 4FI3C 4LMAA 4ZICA 3E0XA 4MNTA 1XXHB 1RC0A 1U0EA 1IEQA 1XZIA 4QJ5A 4BQFA 2RSLA 2IGBA 3KETA 1RYNA 4C3ZA 3DC2A 4H17A 1HNXB 1C3OB 4GQAA 1X7HA 4AZVA 1B23P 2FSHA 4AM8A 4YRGA 3H5OA 1WQ1R 2R11A 3I1FA 3DCNA 3IEUA 2V6JA 4M87A 1E6MA 4P82A 5FBWB 3T15A 5IT0A 2Y77A 2NVWA 4QJIA 4N5LA 3F6RA 1SHLA 2XVYA 4ZZ2A 3INYA 1R18A 2JARA 2M1ZA 3B1WA 3KR9A 2FG5A 2VNAA 2XITA 3JQBC 4L73A 3KALA 3LQ2A 1WG8A 5CT5A 3SHFA 3VPFA 4ZQHA 1ZCJA 1YQTA 4C7BA 3WRYA 5MF6A 5T4BA 4WUVA 4HWKA 1UPCA 4P92A 1IU9A 1S2MA 2AC7A 2R44A 2QF7A 5C4GB 2AXNA 2QNBA 1ZK0A 4RPGA 4UVIA 4J1QA 2KE5A 1N0IA 3O91A 1RWPA 4PPFA 1L5VA 1VZ2A 2EHJA 2HA4A 3X1WA 1E94E 3CRQA 1IQUA 4LYJA 1KZHA 3NJRA 4UTZA 3S2UA 2CNOA 1L1FA 1GFIA 2JD2A 1OGYA 3DP7A 4BFXA 1CS0A 1MO4A 1O77A 4LG1A 1DZ3A 3K9FC 1J0AA 3LUPA 4TRJA 1BXRA 2JGEA 1F5SA 3VKWA 2XBUA 3O3MB 3OE7D 3U7QA 3DE2X 3PPVA 3WKCA 1QF9A 4ISBA 1AB5A 1IM8A 2Z0MA 4D3SA 5KJ6A 2AIRA 1FDWA 3WRXC 2PZEA 4W4TA 5HJ5A 3KUXA 1I4OA 2AOVA 2IYFA 2V98A 3B7WA 3B9RA 2ORVA 2XOKA 3F6CA 4LV6A 4PPYA 3RAJA 1NATA 5JV5A 4I9NA 2JLYA 4COOA 3GLGE 5KWEA 2NXNA 3D1LA 1UZLA 4TLEA 4QVIA 2VDJA 2R86A 5KREA 2DHQA 5I6DA 1MRSA 1EX6A 4BDSA 2C9OA 4B34A 4UM7A 3U4QB 3V42A 4UHFA 1P7ZA 2CXTA 2LCIA 4YJDA 2COUA 2IE0A 3GT7A 4D9NA 4DAEA 3RTBA 1IN1A 3OIFA 1XLTA 3KEMA 1R0XA 3TR6A 1E1YA 5LDDC 2Q99A 1R8YA 1RYYA 4NP6A 5CVEA 5JADA 3DLCA 4TLBA 3T7KA 1WCV1 2EYQA 4OBBA 2CV0A 2H08A 3CHYA 4DLRA 4HN9A 5ITZB 1JPUA 2IEYA 4BJHB 3K20A 5ICMA 2CKMA 4LWQA 1Z29A 2GKOA 2ZAIA 1SA0B 4Z53A 3NOOA 4UCQA 4TVBA 4EP1A 1BWQA 2WE7A 2AR9A 4ZEVA 4HGZA 3QW2A 2ZJOA 3IUBA 1NNEA 5TB5A 1HK7A 1XZFA 1VPDA 3VU3A 3ED1A 3VZPA 3R5KA 3PTLA 4JJAA 4C6HA 3LDUA 2NZYA 4ZOBA 1U3CA 2YC4C 3KKMA 3SC4A 1MVNA 3O93A 1A2BA 1EWYA 3K1ZA 3M6MD 3S1AB 3H04A 2YUTA 2FDXA 2NUTB 1OASA 3KZVA 5BOSA 3IPXA 2UUBB 1Q1AA 2IWRA 5IYZF 3ZW8A 4CLDA 2FNAA 1KC1A 1KJZA 5B3LA 2FV8A 4OP1A 2RONA 4IO1A 3FFWA 5CMLA 1JKIA 2H7VA 4GFDA 4FZVA 2GFQA 2QTVA 3N05A 1RP7A 2BI4A 5AVZA 1T8SA 3O47A 4JSYA 4P54A 3FF4A 3OUTA 4UNNA 3DUFA 4NENA 4PY2A 1DQPA 2AG0A 3NEYA 1I8TA 1KO4A 1TMOA 1ZITA 2DFLA 4G8DA 5EL0A 3SJBA 3ZU4A 1M9NA 1NBMA 2EP7A 2J3DA 3WLSA 3SHTA 1X70A 4KNYA 1JA9A 1IATA 4XD7A 1U2PA 4WASA 1JSRA 1CY1A 4LISA 3F9CA 3WHIA 2Z8YA 1FJGB 4RD3A 4HH3C 1Q2XA 3DFKA 5GTDA 3MWGA 3EH1A 3RAGA 2W2QA 3UGKA 4H1VA 4LXIA 4NK4A 3PUXA 4PEVA 4EG8A 2FZWA 2WYWA 2V6FA 2V9CA 1FS4A 1GD1O 1GZ5A 4AY3A 2C97A 4FSHA 3H87A 4OHBA 2QLNA 1BDBA 1R4ZA 1S2NA 3LW8A 1KC3A 2E89A 4KODA 1GNQA 4JU9A 4XLZA 1XV5A 4F6LA 5CXQA 4D9MA 3Q3VA 3IC5A 1GGMA 1W47A 3PXBA 4EJ6A 2XB9A 1VBMA 1R0WA 3P9QA 4PAQA 2JZNA 5NLLA 4EG6A 5C8DA 1XB2A 1GL9B 4QKQA 4N3NA 2B98A 4JEUA 3K16A 5H3HA 4CM4A 3MM4A 3OBIA 3PNBA 3I1YA 4MJLA 4M0CA 1AUXA 5E95A 4J0JA 2NZJA 2XA9A 4CBVA 1W5TA 1X19A 2G9NA 4CNBA 4F93B 1Y37A 2EW2A 2Z9DA 1QHSA 2Z5FA 2Y1GA 1UH5A 1TU0A 1N2OA 2WT4A 1C3VA 1NU6A 4HNUA 1L5HB 3EEFA 4A36A 5SYMA 4WK6A 3ZBQA 4IV8A 1BSVA 421PA 3WWPA 1OIWA 3WWDA 4CKCB 4RKFA 1L7VC 1NYTA 2L18A 2Q3FA 2WOOA 4P93A 1HTWA 3OOWA 1VHJA 3MCWA 1JJ7A 3VGJA 1QH9A 3HCDA 5FWNA 3P2KA 2IW1A 1ATIA 1GR0A 1O96B 1PT5A 1QXSA 3GLUA 3JW8A 3VR4A 4CMGA 2JCBA 3G5AA 5JXGA 3K70B 2WQZA 3RVOA 4JQYA 5IH7A 2CDBA 1R2QA 3C5EA 1RRGA 4TOIA 2Y0DA 4E5UA 1U4OA 4DLWA 4QJ3A 2BFBA 4AO7A 3NTUA 5CH5A 4IWYA 2I1QA 2QSJA 3PV0A 2H0RA 2P41A 1T3LA 1Z5GA 3C7DB 1W93A 3NKVA 4IIFA 4RLFA 4QYMA 3TIVA 4ZI7F 1EWQA 3O4HA 4YCAA 4L9WA 2MJLA 1T0HB 5KSWB 3NWPA 7REQB 3QITA 4X54A 2PX4A 4R41A 3HI4A 3U7IA 3PQ4A 4A8JB 3SLGA 4H27A 6GPBA 1TCBA 2AQ8A 2H2HA 3VZCA 3C39A 4EMSA 4BVBA 3QXJA 3S99A 4QAJA 2VF2A 1EP1B 4HTFB 5HIKA 2BONA 4BQNA 2JLZA 4OB6A 4P5EA 4QYIA 5CG2A 2ZJAA 1NQ5A 2WJ4A 1BRTA 2CFTA 4YECA 3J7AC 2X5NA 2YZGA 3OMLA 3L6RA 2GEFA 2HN9A 5T67A 1E1RD 1TX4B 1VL6A 1Z8DA 3NNDA 4RXTA 4I50F 5LP6F 2C2HA 2P4QA 1NF8A 1PN3A 3LT0A 1QHYA 2HDOA 2JHCA 3BMNA 4UU1A 1D0VA 1XVLA 2VDKB 3AO0B 3ZPXA 1DXQA 2G9ZA 3PUHA 1X80A 3WQRA 4K6KA 3G1WA 4MS4B 5REQB 4RY2A 2FEPA 1G7TA 2GEUA 3VHLB 4UM9B 2PUTA 1TQ6A 5B3AA 3RYHB 3H1GA 1REQB 3DR3A 5EJIA 3GLGA 4NKRA 1YJ8A 2FF7A 3NRCA 2Y71A 3ELWA 3QKRA 5EIWA 2A9JA 3E7PA 2M32A 3UWMA 4ZZ1A 1RZ3A 1X74A 4DMCA 4NONA 3NXKA 3ZNPA 5EE3A 4F21A 3NUQA 5FPYA 2QVCA 2L69A 4HP8A 5EVCA 2QE6A 2V0NA 3DMPA 2MSKA 4IDUA 2ZJBA 5LC1A 4OHZA 4C07A 5JD5A 3OTGA 2WUGA 4DCVA 2EAUA 2WUVA 2PNJA 2V7EA 3I1IA 1VECA 2WUFA 3RVRA 2XMBA 4YR9A 4MQUA 2IXGA 1R6BX 2DUNA 3ZHCA 1DGQA 1QCDA 2PZLA 4B7XA 1HNZB 4B3HA 4TYNA 3QPAA 3BAZA 4G4SP 5J43A 4KBFA 3Q0IA 4N6OA 4QTZA 5SZHB 3S7ZA 4F6RA 5IXSA 4BVHA 2W6JA 4NATA 1QNFA 3F6SA 1JL3A 1E9CA 1RYDA 1Q77A 2PGXA 4L9SA 1KORA 1EFHA 1QO7A 1SZJG 4XB6B 6YASA 1PK9A 5AIAA 1QIHA 2I9KA 2TECE 4FC7A 3VDXA 1K5HA 1YNSA 2FUKA 3AEKA 3JX9A 4D6PA 1OXVA 3KB6A 3E05A 3TEMA 3UH1A 2XVMA 4U7JA 1ENYA 4GD3Q 5C4MA 3QKWA 5CFQA 5EE5B 1NR7A 4H1HA 5IDYA 4C7VA 2OCDA 2XD4A 2OCIA 4LJKA 1HYQA 4MKHA 4OHPA 4EENA 2RHRA 3CS3A 3MD9A 4D9GA 1W7AA 4GMKA 1E64A 1XTQA 3VR4H 5DM1A 3EGXB 1CR2A 4QWWA 1RDFA 4XQ9A 4LPSA 2C61A 3PRJA 4XR9A 2YS6A 3FCOA 3H3JA 4LNUB 1XNHA 4C3OB 4C7KA 3H9CA 2RGXA 4Q03A 4CT4B 2TRSB 4QTUB 4DIBA 3RS4A 1UDRA 1WXEA 4WGGA 1XRPA 3VDMA 2O7VA 2GAOA 2FB9A 1C80A 1OR8A 4XJTA 2PGLA 2WJHA 4MO2A 3SC6A 5K0NA 1XTUA 3CISA 3F8SA 1DAKA 1ENPA 1JILA 4Q16A 5KTOA 4FTWA 5JJLA 2N1BA 2V7GA 2YUIA 5D1HA 4KLCA 3HFRA 2A3NA 3F3SA 1PFVA 3COPA 1KO8A 1DE0A 4BBZA 3OJWA 4K46A 2QRLA 5TF4A 1GHTA 2WV9A 3F96A 2R6CA 4RCYA 1XMXA 2FSPA 2QMQA 3PUJA 1A8UA 3M1IA 1RYZA 3H9EO 4GE0A 2GJAA 4N0DA 4UBMA 4A7PA 1BX3A 3BGOS 2IK8A 3O3CA 3B38A 2Z6VA 1JSCA 3DFMA 5JD4A 4WXEA 3PUYA 1ESCA 2Q27A 4BRSA 2LVBA 4J75A 1E3IA 3EXEA 3BCRA 3GFFA 3T95A 1U98A 4IF6A 4JELA 1ZHHA 4WECA 1RYEA 3N8NA 2Z56A 2P68A 3MMPA 4MRMB 4EO4A 2O8CA 3OG9A 4MKXA 3NHAA 1KP3A 1UBCA 2Y1LA 4A4DA 5BSKA 1G3QA 4X65B 4MB2A 3RAEC 2P9YA 1AA9A 5K6RA 1NFRA 4Q00A 5JVDA 2QL5A 4U2EA 4P4LA 2LWIA 1E3MA 1LFAA 4KACA 2PH3A 3T0FA 3KRTA 4C43A 3FHTA 1B8VA 1RYBA 4RZQA 2PWPA 3K4QA 2GZHA 2I03A 1LJ8A 3C8DA 3QELA 4WW0A 1T2EA 3KXPA 3A14A 3VNRA 2VAVA 3R9XA 3NBAA 4XSGA 1OBCA 1PZHA 1NMSA 2C9CA 2QPTA 3C6QA 3DD1A 2EFDB 5D7NA 4A03A 3VX4A 3DR5A 4O63O 1F2UB 4YJHB 2IQIA 4HZUA 1JSZA 5HCNA 4IRXA 3TLGA 5I51A 3OQMA 1MO3A 3NBUA 3NC4A 1H2ZA 2EBHX 3JZAA 4DNXA 1VLVA 2DPLA 4CKZA 5LDGA 3UUGA 4FEYA 3DCJA 5AUNB 4P3KA 1VE7A 3L6CA 4KJZA 4KWIA 3LUCA 4Y30A 3E82A 2BN4A 4BFZA 3O7WA 5U1PA 3GMSA 2IU0A 4RIGA 6NULA 1JDNA 1RQ2A 2HRQA 3Q7EA 4MUJA 2DWPA 3NALA 3UTCA 4HLUA 2XUJA 1JIIA 3KJIA 4EG1A 4ASUA 1GU1A 2I7VA 3FDZA 1ORIA 1A27A 1F8FA 3I8SA 3EPKA 3I28A 1OU0A 2V74B 4FYXA 2YXEA 3VYWA 5KQSA 4OH7A 5F52A 4Y6OA 1H8EA 3GJ6A 2P75A 1ZN2A 2HJHA 4HNRA 2HU5A 4P1ZA 5DCLA 1YCHA 4BGIA 2IYVA 2F1JA 1E3SA 1N0HA 2Z1DA 2ZPTX 4YACA 5MHTA 2HA2A 1L4UA 5DX8A 1KVSA 1VHDA 2WM3A 1TLFA 3DULA 3U3ZA 1CZLA 1DEKA 3LFTA 4ME6A 3W2FA 5JCJD 1GSAA 1W0JA 2O1EA 1H2BA 2PZMA 1H1LB 3PSHA 2EIHA 3UJ6A 1I24A 2YWXA 2EKZA 3GF4A 4G0XA 3KR2A 3SQNA 2CBZA 2IY7A 3EDMA 4UHKA 4BVJA 5B12A 1Q20A 2FR8C 3GLRA 4AJNA 4DMFA 5BW4A 2AJCA 2G1UA 4FZ5A 4UNPA 4O4IF 1AV7A 4J29A 1VMAA 3EISA 4MOWA 2LP4Y 1P19A 1JEYB 2DFTA 2JJ1A 1TM1E 3CIOA 3KBBA 1IXKA 2C7VA 4DJAA 4UXHA 2D59A 1OU4A 5PGMA 1A98A 3GU3A 2Z6QA 4EMBA 1SBNE 3K73O 4WJLA 5LNK1 1KSFX 3C1TA 3D2AA 1AKVA 1NW6A 1S02A 1Y1RA 1V2GA 1ZG3A 3ESXA 3CBGA 4O08A 1CT9A 3I76A 1VHWA 2Z2ZA 4CMJA 2R7AA 3LHKA 4PCVA 2CCJA 4IDAA 1XR3A 2O5VA 4E5KA 2F6RA 4L4UA 5LVAA 1N5JA 4QDOA 1V7QA 2F1KA 3GPCA 1G59A 1PUIA 2G9RA 1K6IA 3W5UA 2C04A 3GGJA 1IZYA 3EBPA 3RYTC 4N3GA 4GKVA 4INOA 5DBIA 2WPDA 3TO5A 3D02A 1LQ2A 1JKFA 3CW9A 3HGQA 4LHWA 2W2VA 4O0LA 1I6KA 1CY0A 1GNRA 1T8YA 4RPHA 4P5PA 3CF2A 4YJ2B 2RKBA 4ZRNA 2YINC 3A6KA 2WG0A 4Q3BA 3DLIA 3VR5A 3O21A 4MCJA 1GCIA 1ZRSA 5AM5A 1JAYA 4NMHA 2IYNA 4MQFB 1FW6A 3MQ4A 1F1BA 1DUSA 1NVVQ 5J5VA 4H1TA 3W3AA 2P5UA 1WB9A 4LXHA 3UN1A 4KI7A 3DB1A 4Q93A 4X44A 4S2UA 4OPMA 1R3UA 1JIQA 4CM9D 4EM6A 3D3WB 3NH6A 4R1MA 1VSVA 1ZK3A 3V5NA 3OQNA 1T35A 2PG3A 2PYDA 2CJFA 2Q62A 2W2KA 1B8PA 3DT8A 1CEEA 1Z4JA 1DOHA 4HSEA 1GPBA 4ERXA 3OX2A 3ETEA 5A9RA 1I10A 1Z6XA 5LCXA 2ZI6A 1F6DA 1RRPA 2AS0A 4Q7KA 3T06B 2VQDA 1JS1X 1WMDA 3FYHA 5TLSA 1G21E 1Y3HA 2VYQA 2JGKA 2VRCD 3F4BA 4R7GA 2DT8A 1JG7A 4E7PA 4BNLA 1V41E 1BWPA 2H4XA 3GL9A 3K9LA 4QDKA 4N5IX 4GR5A 2F67A 2OFOA 5KNLA 1P61B 4OU4A 3L3BA 1PGQA 5IABA 2RAPA 5DF1A 1OH5A 1CIVA 2YIVX 4NU8X 1AURA 2JAOA 3BHJA 1NQUA 2H48A 1NR5A 1RAEA 4N0MA 1ZESA 3KLBA 1FSSA 2I6GA 3OT5A 1ND5A 5EYPA 1E3DA 5L6MB 3EEBA 1ATZA 3G8AA 1ZK2A 3AI1A 3IA2A 3W8RA 3D8UA 4FB5A 3L93A 1MVOA 2H18A 1G21B 2IF2A 2LGJA 3QIAA 4G5SA 1D2HA 1UFQA 4OMFG 2B34A 3BRQA 1PSWA 4HWOA 3ZHQA 1JLLA 3D4IA 2YV5A 2KLBA 2C1XA 3UQZA 2QMUA 4R3UC 4W7SA 3CMCO 3ROKA 1CV2A 1KJQA 2I2DA 1ITZA 1BDJA 4BGEA 5HX7A 2XNCA 1UBFA 1ODFA 3JR3A 5TMPA 4QYWA 3LT4A 4TKUB 1U2ZA 3TDNA 3Q7SA 1QIKA 3EVTA 5HRAA 1YI8A 1UJ5A 3KKQA 1KNXA 3U16A 1YONA 2X4IA 1EAYA 1JR3D 3CXRA 1C1HA 3EULA 3K5WA 5HUQA 1AG9A 2QX8A 3S4YA 2JCXA 3FPGA 3FOAA 3MINA 5G02A 5CK4A 4NMLA 3CNNA 1ZM9A 4JL5A 3U3XA 4E46A 1OWPA 5LD2C 2HO5A 1W4BA 3N6XA 3V80A 3OE7A 4UBKA 3ZQ6A 4DV3B 5DE3A 5IJWA 3SXUB 5HSGA 2EOAA 2PO7A 4PINA 3THYA 2NADA 2DY0A 4IP0A 2IIPA 3EIOA 3GJZA 4OQXA 5EKTA 1YS7A 4Q9NA 4UEJA 2HYIC 2A86A 3SJZA 1T6YA 3A26A 3BXZA 3CEHA 1DBRA 4NNJA 4B0OA 1JWAB 1Z4IA 4C2BA 5E8RA 3U6BA 5KHAA 4WXYB 4K0KB 1M2HA 3DMTC 4GMDA 3R3UA 3UG6A 4Z54A 2FY8A 3R1IA 3KQQA 4LIPD 3P9RA 4WX2B 3S7TA 4UNSA 3UMMA 1USVA 2POQX 4LV8B 2E85A 4O0MA 4XGRA 1E69A 3BJEA 4DSNA 2ID8A 4TVSA 1Y9JA 1QKJA 3HA5A 3NNNA 1V9LA 3NBQA 3C48A 1CZKA 3DHWC 4IIJF 4AQYB 1DAGA 3RSLA 5J2UF 1QWSA 2OGTA 2X0RA 4B87A 2QV7A 2XMDA 4DJEC 3VR5H 2D4AA 3EGDA 5K8IA 4JBLA 3GYGA 1ZEMA 4N5MA 1YGYA 4RKRA 1ZR2A 3CEAA 3LLMA 1AH2A 4HOYA 1BVUA 1J22A 4TRRA 3RE1A 3AF5A 1QRAA 1KARA 1SHKA 1UDAA 2J3EA 3ICPA 3W3AH 5JT1A 4IY1A 1LB1B 1WW3A 4XRRA 5DK4A 3NYWA 1N4AA 1NNSA 4EFLA 4LXTA 4QBGB 1Y3CE 2CVFA 4JZKA 4M1SA 4UD6A 4ETWA 5LIPA 3HYNA 2YHBA 4FWTA 5I7RA 3KXIA 3N8DA 3GUZA 2HD4A 2PSSA 1VGQA 2IHUA 1Q57A 4HH0A 1I2ZA 1T24A 4ZEXA 3T3GA 2PDAA 1KFKB 1ZN8A 1U0HC 2A0UA 3GRFA 4LA4A 2ZTLA 4M0PA 4U39A 4WKPA 1EQUA 3NHBA 1L5LA 2R6FA 5DISB 1SOMA 4YDQA 3Q9LA 2YQZA 5LYJB 2XLCA 1Z2PX 3RREA 2FMXA 1V3VA 3DXFA 3QVSA 4HX9A 3MSXA 1NQTA 2L19A 3NCTA 3E8MA 2R6HA 5GVRA 1JFFB 5DJ5A 2VNIA 4B0PA 1LCIA 2GH1A 2WKQA 3BOSA 5DNWA 5AW5A 3GFPA 3U5TA 1JF8A 2A59A 2BMWA 4GI1A 4OATA 3FHJA 1ZMOA 4YQEA 3ZK8A 1N8TA 2BGKA 1JT2A 2CBGA 3TX6A 4I8DA 3IQGX 2Q07A 5AKLA 4WOKA 1E7RA 1VIMA 4DCTA 3VKHA 2H2WA 1RRFA 2WFLA 1IL0A 3AI2A 3CUKA 2C7PA 1TA9A 4JB2A 3Q9NA 5B1HA 3IALA 5BOVA 2OQIA 3EW7A 3FG9A 5L53A 2ZS8A 3ZWMA 2BW0A 3ZWNA 1TF5A 4IHQA 4IMIB 4GE3A 3BREA 4DLLA 5JSQA 4J16A 3DM5A 5F4BA 1UIMA 5AI4A 5ALTA 1AS3A 1VKJA 2V4UA 2ZSUA 4MW2A 2Q4RA 4J3FA 2FMKA 4YP6A 1RCUA 4FONA 1FNDA 1SAYA 5D2CA 3QYPA 1PJQA 5CBPA 3DDUA 2FOXA 3E1SA 4Y9RA 5EZYF 5IUJC 4RY8A 4BN0A 3RC1A 5I48A 4JX8A 3TZEA 3WLTA 1PNOA 2Y66A 2O7QA 3IH5A 4RMJA 1P5ZB 4ICIA 3IE1A 2RH9B 3T1QA 1MC8A 1ZRMA 2LUOA 1S3IA 1RWMA 2PJUA 4GXNA 4WIAA 2ZSAA 5EXSA 1T0BA 4IIYA 3OLXA 3N2GA 1UPTA 3AJ8A 3M33A 1LW7A 2W93A 3CR8A 4OLFA 1WB6A 1LS1A 4KH0A 3RF7A 3ANYB 3ZEAA 4ZK2A 4O4JA 4EI2A 5KYTA 2JKVA 1WXQA 1CIPA 3GAAA 1Z15A 3EH2A 3I9V1 4KE7A 3G9UA 5G1NA 2OV4A 1E5VA 1YIOA 5B7PA 3E9DA 1P80A 2G0NA 2H1CA 4IDDA 4DTCA 3SKXA 1RBZA 3FMVA 4ZVKA 1QOZA 1Q0HA 3WBJA 2Z58A 4CMKA 2E7ZA 1WU7A 3JXEA 3LLSA 3ZC3A 2ZTVA 1P17A 2BGIA 4Q1AA 4JU8A 2VRBA 4WNYA 5CVTA 1XD2A 1UJMA 2NO7A 1NI4A 3A6LA 3KAQA 4E31A 2FZ4A 3AM1A 4GP7A 5CLLA 4IKPA 3MJSA 3STYA 5D3ZA 1YVEI 1E3LA 3OQHA 4QL3A 1R4MB 4Z4HA 2YN4A 2GTPA 4MW7A 3TW6A 2NNLD 5KYVA 5CA0A 2WDPA 3TZQA 3KYJB 3ZVRA 1JXAA 3IPCA 3D3EA 4LZJA 4JN6B 3O26A 1O3YA 2QVZX 3KPUA 1RLIA 5ADUS 3WL8A 4FZRA 3QFTA 4F2PA 2M6SA 2AUNA 4NAHA 5E9QA 1R64A 4JY7A 4NI5A 2DR3A 5EFOA 3T7IA 5CXUA 4UEKA 5KU7A 5A4DA 3QA9A 1KA9H 4LX0A 4PZ9A 5C5IA 1Y3BE 1RYMA 3KXLA 1HY3A 4RC9A 2PZAA 3WSWA 5K3OA 1V8ZA 4QARA 2IS6A 1GYPA 2C5HA 4S05A 1EH5A 2B4YA 5JRJA 3QNWA 2VYFA 4RTSA 5DW3A 1LPAB 1WULS 1X86B 3Q40A 5HBGA 4YREA 1WCIB 3K09A 2UKDA 3QJ5A 1N2GA 4C5BA 1NI3A 4MGIR 3V34A 3D2CA 2RGCA 1OZ0A 3L4BA 4W9NC 5ALRA 3ZW7A 3S2GA 3UBTA 4XYLA 4RIFA 1CYEA 4IDXA 1MTOA 3GBSA 4KGDA 2AEMA 3OH8A 2XNDD 3R5TA 2XAAA 2RARA 3I42A 4X5OA 4PICA 1TI7A 4MVJA 4DMKA 5TR9A 1NVDA 1RCTE 1SXHA 3KT0A 3PPIA 4QEZA 2DULA 2W11A 1GPUA 3K9QO 4PLGA 4RABA 4TTVA 4XVHA 4ZWNA 4TQGA 3RF6A 1R5JA 1MIOB 2OZVA 5KVVA