1FXSA

Gdp-fucose synthetase from escherichia coli complex with nadp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
317
structure length
317
Chain Sequence
b'KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQDRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GDP-FUCOSE SYNTHETASE)
publication title GDP-fucose synthetase from Escherichia coli: structure of a unique member of the short-chain dehydrogenase/reductase family that catalyzes two distinct reactions at the same active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 101
structure length 317
sequence length 317
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 1998-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1fxsA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1fxsA02
1WDMA 1RYDA 3RUAA 3RC9A 1B2LA 1D8AA 3JQFC 4EYEA 3D3WB 1DHTA 1U8XX 3HJAA 4B4UA 2OZPA 1C0PA 4BNGA 1T4BA 1NVMB 1NNUA 2HMVA 1PGPA 3DONA 3PXXA 4PIVA 2YDXA 1FXSA 3TZ6A 2O23A 4MKZA 1Y9EA 1JLLA 2BI8A 5JC1A 1Q0LA 2OL4A 3QHAA 4HKTA 1B15A 2D5CA 4YAIA 2IODA 3PDUA 2FZEA 3ANMA 3JD4A 3MTJA 4XGNA 4BNMA 3RI3A 3ZV4A 2O4CA 3U49A 1DIHA 3H2ZA 2VZ9A 3TJRA 5HRUA 5TS3A 5CDYA 2NVWA 4CM4A 5COBA 1IHYA 4LSWA 4AJLA 4NBVA 4B7CA 1EUCA 2HQ1A 3EZLA 1R4NB 4FJ0A 3ZHYA 4E13A 1B3BA 1WMBA 3B1FA 2AG5A 1QORA 3GY0A 4QFCA 3VC7A 4CMCA 4O6VA 4FC7A 1GUZA 1C3VA 2HMTA 1UJMA 3VH4A 3GVXA 4IDFA 3UFXA 2O4UX 4IS3A 2NU6A 1GTMA 1UAGA 3DZHA 3GVPA 1QKIA 2ZB8A 1E7YA 4D46A 4DWVA 1G0NA 4PLPA 4FOSA 3OEYA 3ZWCA 2J8ZA 2GZ3A 1XR3A 3HNPA 4CL3A 5EQDA 4JQCA 5A03A 3JV7A 3KSUA 5JDCC 4OH1A 3NDIA 3TZQA 4H16A 1WMAA 4UUPA 1K5HA 4KWIA 1OBFO 4ONEA 1E3WA 2NWQA 1Z74A 3GVIA 3I9MA 4CR6A 4P8RA 4MIEA 3O26A 4YT4A 3JQAD 4P4LA 1XA0A 3ZU5A 1ZKMA 2YY7A 4BKPA 2AEJA 1A4IA 3OA0A 3BTVA 3FWZA 2I67A 3VVCA 1I24A 4WEQA 3F47A 2B5VA 5AOVA 3BMCA 4CMHA 5DCWA 5T6BA 4RPLA 4J1NA 1YB5A 2FN7A 1KVRA 4MINA 2W8ZA 2YFQA 2V6BA 4L4XA 1EEHA 4LVCA 4HUJA 3A28A 4Y98A 5COAA 4ZQBA 3RSHA 1TA4A 3MWEB 5TNXA 3V8BA 4A10A 2V7PA 4RDHA 2VYND 2W2KB 1E7QA 2H1SA 3A4VA 1E3JA 1ZMTA 5T5QA 3T4EA 3RKRA 4FSHA 1DFGA 2DQ4A 5JMWA 2NQTA 1MV8A 3E9MA 3IUPA 4R41A 3GUCA 1CETA 4F6LA 3M2TA 1J6UA 2C7GA 4BNJA 1A7AA 2VUSA 5DP1A 1PR3A 2VRCD 2QZ9A 3BHIA 1XEAA 3BMQA 2Y05A 4BNVA 5BNIA 3ORFA 4GH5A 4OXYA 5C3MA 1IUKA 1ENPA 3IOYA 3JQFA 1EBUA 1PGJA 3K96A 3QIVA 5IJZA 1OAAA 3NUGA 1H2HA 5B4UA 2AEMA 2VWQA 3AOGA 5A3VA 3AM3A 1KY4A 2J5RA 1HE3A 1B8VA 2D4AA 3FF4A 3OQ1A 4QT0A 4B8WA 1UXHA 3FPCA 3HDYA 2FPGA 4Y6SA 2W4QA 3IKVA 3MJEA 1HYHA 3E48A 3M1LA 5KNLA 2Y67A 2ZYAA 3WX0A 4BO9A 1NVGA 2EGGA 2JD1A 4PRLA 4CM4B 3PIDA 5G0WA 4L9RA 4Z9XA 4WLFA 4AJHA 2P4HX 3RUHA 2EIHA 5HA5A 1P9LA 3QVWA 4CL8A 4XB1A 1VSVA 2FPIA 5JXWA 3WICA 7ADHA 2RHCA 4D0SA 4DTIA 5ER9A 3ZCXA 4XYBA 4AJ4A 3W8DA 4BKQA 1E7SA 3V1YA 2VHYA 1X7HA 5F1PA 1YXMA 4WJZA 4QECA 1E3IA 4BUCA 3LC7O 2B83A 3PQDA 2OP1A 1DRUA 4GPD1 1I3NA 4I9UA 1P3DA 3C3XA 1CIVA 3BTOA 1BXKA 1C1XA 1YKFA 3B70A 1KIFA 4CPDA 2C29D 1P77A 1EK6A 1HDXA 2AE1A 1QLHA 4A2CA 3WG9A 2VNSA 3CMMA 2PGJA 5JDCA 1DJQA 1TT5A 3PHIA 3CKYA 1HSOA 2OO5A 1GYQA 4BB6A 4KDEA 7MDHA 1LDGA 2HMUA 4D42A 4Y6RA 5EESA 1YO6A 1PIWA 3D3EA 4FQ8A 5GY7A 4CR7A 4E3ZA 4RORA 5JCXA 5K9ZA 5MDHA 3D1LA 4L4RA 1J49A 3D7LA 3A06A 2WSBA 4DL9A 1AGNA 4HBGA 2DUUA 4WLNA 3KYDA 3BMCB 3I9LA 4XEHA 2B5WA 4NH4A 3PZRA 4XJTA 3RBZA 2PKQO 4CMIA 5BT9A 3G17A 2EERA 3Q1LA 2HSDA 4QO7A 1NPTO 2FHSA 3NJ8A 4F46A 3I6QA 2DPGA 1R0KA 2BKAA 5ITWA 3KXDA 3JQAA 2PD4A 2C59A 1ONPA 3SEFA 1HDGO 2CUKA 4DYDA 4MVJA 4J2OA 2BLLA 3V2GA 5DF1A 4B3JA 1X14A 2PGLA 1U1IA 5JFOA 1ISHA 1LSJA 2NVBA 2Y99A 1IPFA 1Q2XA 2ZB4A 1NBOA 3I3OA 4CM9D 5BNFA 1QR6A 4PG5A 4XYMA 4AJKA 3NTOA 4WE3A 3L9XA 3W6ZA 4ALNA 2Z5LA 3FR8A 1PS9A 1ISFA 2J3JA 4WPGA 4II2A 4WLVA 3WGHA 4FFLA 1EFKA 4R5MA 4FB5A 3BMQB 3IJPA 1GU7A 3GRPA 1NHGA 2WDZA 3M6IA 3O38A 3Q6IA 4HY3A 3GDOA 1H9AA 3GNSA 1DAPA 3AUAA 3NT4A 4A0SA 3A14A 2A9FA 2PA3A 4DMMA 1Z82A 2C82A 4MKRA 3TFOA 4IINA 4D41A 3IP1A 4XB2A 5G0VA 2VYNA 4I5FA 1ZJZA 1KVUA 5CDTA 1LDNA 2YHIA 3COSA 4TSKA 5T57A 1JVBA 4PLHA 1RJWA 3LT2A 5EN4A 4M8SA 1VL8A 1JAYA 3OECA 5AXDA 4QTZA 3WLFA 4R51A 1HTBA 4RL6A 3SBOA 1YL5A 3DWFA 3QW2A 4XJSA 3PLNA 3QWIA 2WJPA 4YRDA 1N2SA 5ER6A 4IJKA 3U9LA 4DPKA 3AI3A 3IQDB 2O3RA 2B69A 2NVUB 3R3JA 2E82A 4IDEA 3D5TA 4GKBA 1ARZA 3RU9A 3ZV6A 4F3YA 1NFRA 3T7EA 1HLPA 1ZSVA 3MTGA 4TROA 5I7FA 3H8VA 3INRA 3FI9A 4ILKA 5A1TA 4IDCA 2NSDA 4PG7A 3GEMA 2P2SA 3CUKA 3VKVA 2QRKA 2VHZA 1VC2A 3DFZA 1PS8A 1NX6A 5AXAA 2IXAA 3INGA 3ETGA 1LLUA 1R16A 3K5PA 2AEFA 3QV1A 2DLDA 1NM5A 2R2GA 1F06A 3T4XA 3VVBA 1U4SA 4XQEA 1N7GA 4IMRA 1G6KA 1YDWA 3QWHA 1TT5B 1ZH8A 2AW5A 1F8GA 4QXMA 4LSMA 5ITVA 2PKQP 1NWHA 3BMOA 4EGFA 4M1QA 1UP7A 2QRJA 4CV2A 3UAGA 3K2EA 2IZ1A 4KP7A 4NNJA 3GMSA 3RKUA 4ZQEA 4OIMA 4A03A 3BAZA 1MG0A 1QXSA 3JD2A 4GMGA 2YFHA 1I32A 3OIFA 5ENVA 3Q2IA 1E3EA 3O03A 3H2SA 1H6DA 2LDXA 4RPGA 3AU8A 4NU5A 4CMIB 3H65A 5T67A 2GCGA 5KKCA 3I23A 2X7HA 1PJQA 4CV1A 3JSAA 1EDZA 1WZEA 3IP3A 4C7JA 3AU9A 2HK7A 4RZHA 2PFGA 3WJ7A 1YONA 4FGSA 1CQIA 1H94A 2HUNA 3H9UA 1I33A 1EVYA 3HFGA 4P22A 5L7WA 1LLQA 1KC3A 4KUHA 2FPPA 3QRWA 1V3TA 1GL3A 1O8CA 3BTUA 4IJVA 3DBHB 1UXGA 4IY1A 5JLAA 1SZJG 4IIUA 5IDQA 4EEZA 2GPTA 4PCVA 4ND5A 1P1JA 3TL3A 2WWRA 1V0JA 1N1GA 3KSZO 4Q9NA 3T7CA 2WE8A 3VH2A 3U4HA 1TEHA 4WNCA 3LSYA 4IPTA 3I83A 1ZVMA 1X1EA 2Y1CA 4DIFA 5TJ9A 4D3DA 1YBVA 1PGQA 1I8TA 3V1UA 4IDAA 4CMGA 3LC2O 1X7GA 1N92A 4GGOA 4IMPA 2YHIB 2XAAA 3ROPA 1GDHA 3EDMA 3KOUA 4IJWA 5I9NA 2BD0A 5DP2A 4QQRA 4HFJA 3UKOA 3PHGA 2PZKA 5THQA 1PL7A 4XYEA 4KZPA 1K89A 4J1SA 2UVDA 3WQRA 5JAMA 3U4IA 4R5HA 3UOGA 5FFFA 4OM8A 3HB5X 3ADPA 2X9GA 3ROQA 4ZRNA 2BMAA 2I6TA 3KV3O 3RIHA 2ZYGA 1B16A 3ANNA 2Q1WA 3WYBA 1K6JA 4KMSA 3ZWWA 1VE9A 1D7OA 4U6SA 3ZZNA 5BSGA 2V6MA 4YA6A 4E5MA 3L6OO 3NEPX 4KUGA 4BB5A 1GV0A 3DO5A 4RF5A 1F14A 4RF2A 4S1VA 1U4OA 1XHLA 1RM5A 3TSCA 1SB9A 4WECA 3SVTA 2H63A 2Y1FA 4FOOA 3SLKA 4J0FA 2HRZA 2AQKA 3G0OA 4A7PA 5KIAA 1E1KA 1LX6A 5CG1A 5IG2A 1OC2A 3K30A 4IDGA 2RHRA 3AI2A 3CINA 3VZRA 5IDWA 3GZNA 3RJ5A 1BXZA 3BMOB 1JAXA 4UVIA 4FBGA 1RWBA 3HWRA 2VUTA 2LDBA 1E1NA 2BH9A 3AM5A 2J3KA 3D3WA 4WLOA 1OOEA 4RO0A 1YS4A 2NTNA 1OMOA 4G2NA 4O63O 2TMGA 5TX7A 4I5GA 1BSVA 1OI7A 3GDGA 3DZBA 4P4NA 4BNLA 2G76A 3ZU4A 4UUNA 4GLLA 3IL2A 1P1HA 4LVUA 5C7IO 2X23A 2ZQYA 4CLDA 2GN8A 4NJMB 5JYDA 3H3FA 1SAYA 4OQYA 1N1EA 4CM5A 1E6WA 4ZICA 3DMYA 4XRRA 1BXGA 1X13A 4TRJA 3MJTA 1I10A 3PHHA 3NTRA 3PYLA 5K0ZA 3BIOA 4RVHA 4H7PA 1MC4A 4CLRA 4BGIA 4CM6A 1MXFA 1PJ2A 4YWJA 4AICA 3HQ4O 1EUDA 2HAEA 3LQFA 2P5UA 1JQBA 4BO7A 1R4NA 1HYEA 5DDIP 5JAZA 4N54A 1ENYA 2PH5A 2I9PA 1QMGA 4WUVA 5EPOA 2WD8A 1BDBA 1ORRA 3S2EA 4BGEA 3AY3A 4R9SA 4DGSA 5C7LO 1XLTA 3L77A 4YACA 3HADA 4I8XA 4NBRA 1O0SA 4TVBA 2W90A 5KVSA 2HK9A 1Y7TA 3JYOA 1ISJA 2C20A 1UZNA 4PGFA 1L7DA 3WBFA 5FI3A 5DBFA 3LC1O 4YTEA 5ILOA 3GNQA 1M76A 4QEDA 3S2IA 1T4DA 1EE9A 1VM6A 5DBGA 2VCYA 1DC5A 1Y8QA 4J9UE 3I9KA 1DRVA 1YB1A 3GVCA 3K2BA 3JD1A 4WCDA 2CMDA 2GLXA 1PGNA 3E5MA 3ITDA 3O8QB 4E33A 4Q3DA 2IZZA 1HRDA 1ISMA 3P7MA 5CEFA 1MXHA 3VDRA 5FYDA 3E5RA 1BMDA 3C7CB 2HDHA 1CJCA 2H9IA 2JFGA 2Q1UA 1UDAA 3MJ4A 3PYMA 2ZIZA 1I3LA 2QG4A 4ALIA 4GAEA 5DOVA 2E37A 4J1TA 1E3LA 1F0YA 2I99A 3IMFA 1LRLA 4CM3A 5HM8A 3DBRB 1ZEMA 4RF4A 2VTDA 4AJJA 4PG8A 2ZK7A 3PGJA 4YYZA 1HEUA 4NJOA 1EVIA 1GYPA 3LU1A 4FD3A 4PLYA 3MOIA 2VT3A 4IDDA 3U09A 1P0FA 2JCVA 1R4MA 3BYZA 2HMSA 1A71A 5KCZA 2CFCA 2ZCVA 5C5IA 3UGKA 4JCOA 4CMBA 3UF0A 2AXQA 4O59O 3RC1A 4DPMA 4IQ8A 1U5AA 4E2WA 1TVEA 2AMFA 1JKIA 5L4SA 3GK3A 2DBZA 3D4PA 4GX1A 5CDGA 3ETEA 3OA2A 1HYGA 3G3EA 2XPCA 4AG3A 1AHHA 4IXWA 4NI5A 1R6DA 2O3TA 2DTEA 3H5NA 3E82A 4CR8A 5L7TA 3FBTA 3I9NA 1CERA 2EKLA 2VQ3A 1LBEA 5F21A 5L51A 4YVFA 4Q39A 3GZNB 3BMNB 3CE6A 4E5YA 4EITA 4ZRMA 3KLPX 4OOFA 3GEGA 3C1TA 5IDXA 1I2BA 1GEGA 2O2YA 1E3SA 3U4CA 4YBZA 4KTTE 1YBMA 3H4VA 3FPLA 2FR0A 3JQ6A 3ZWMA 4DMLA 3DDNA 3DBLB 3RFTA 3ASVA 1WLYA 1IOLA 1P33A 3HHPA 4K6FA 4CMAA 4FFNA 4U0JA 4LMRA 5AQ1A 2EGHA 3F5SA 3BA1A 2RCYA 1VJ0A 5HS6A 3TL2A 2BF7A 1EVJA 1LRJA 4E30A 1PL6A 3O4RA 1BXGB 3WXBA 3TRIA 1HE5A 2B0JA 4YAKA 4TKMA 3HUDA 2PZMA 4EW6A 4CLRB 1YQDA 1GD1O 1JWBB 1Y5MA 1ZJYA 2GZ2A 3MOGA 4CLOA 2QIOA 1ZBQA 5I7SA 3JQ7A 1QYCA 4P4GA 4J7CA 1PR9A 5A9TA 5JMPA 4XA8A 1GZ4A 1HT0A 3DBVO 2IYPA 3OICA 2HU2A 4ALKA 3K31A 3PGXA 3ZV3A 2Q2VA 2NQ8A 3JYLA 3K9QO 3FRJA 3LZ6A 4ND4A 3SC4A 3DZJA 4E5KA 3W8EA 2FZWA 4UVGA 4UEJA 3GN2A 3RUFA 2VT2A 5JO9A 4RPKA 5AXCA 3RVDA 1Z45A 4G5HA 4IGEA 4YRBA 4GWGA 3RU7A 4XQCA 1R12A 3KTDA 3JTMA 1Y8QB 5AYVA 4CLEA 1V35A 4UVDA 5L9AA 3P5SA 3KYCA 4CUZA 1VKOA 3QWAA 1E1MA 3WYEA 4YJGA 2VWPA 2ZB3A 1E7RA 3DHYA 1IZ0A 1NAHA 3ROMA 2CF6A 1RM3A 2C5EA 3EY4A 1LA2A 2X5KO 3GN1A 1MG5A 2CVZA 2R6JA 2A94A 3OBBA 1ULSA 4LW8A 3WMXA 1C0IA 4XZ3A 4MVJD 2D5AA 5JY6A 3I9OA 1IHXA 1ENOA 1SMKA 4OOEA 1I0ZA 3AI1A 1F8FA 1LC3A 2RH8A 1DXYA 1VRWA 1XU9A 2IE0A 1HE2A 1UZLA 3KZVA 1U3TA 2JKVA 3VDQA 3ZHBA 1UDCA 2FY8A 4JROA 1RYEA 3AW9A 5LDHA 4RPJA 1Y5RA 4JIGA 1LDEA 1YGYA 2Z1MA 4BV9A 2DUWA 3SX2A 3ANLA 1ML3A 4IGFA 3GOHA 4Z9FA 3WGOA 1AHIA 1R4MB 1W0CA 2EKPA 2E48A 2ZJ0A 5I7VA 2O50A 4MVJP 4A73A 3NRCA 2JFFA 1E6UA 2ZKLA 3SC6A 4BO5A 1Z75A 4ZD6A 4JLWA 1OFGA 3QLJA 4J7UA 3EHEA 1RKXA 1D1SA 4YQYA 1ADCA 1CRWG 2YV3A 3W8FA 5IF3A 5KJCA 1XYGA 5L45A 4NFSA 5A4DA 3HN7A 3GH3A 2GN6A 1DIRA 3GR6A 5EINA 2YZ7A 1JVSA 1KVTA 2Q3EA 2D2IA 4DLAA 1JN0A 1NFQA 3ADOA 5U1PA 3H5RA 3QVOA 4II3A 1WDKA 1MGOA 3CZRA 4FN4A 4RPHA 4DREA 4AVYA 1D1TA 4I1IA 1CF2O 5BQFA 4OQZA 1Q7CA 2O3QA 5HWSA 4G81A 2G82A 1DPGA 4BNUA 3OFSA 1U2GA 4RVFA 2VUUA 1TXGA 3M1AA 3Q11A 2F1KA 2FR8A 3WWZA 1N5DA 3ZDFA 4QFDA 4NU6A 3RROA 3JD3A 5F1OA 3S2FA 2X0RA 3G1TA 5JE8A 3W4KA 3WWYA 2YHUA 2RH4A 1ZSYA 2WYVA 4BGVA 1V3VA 5DNAA 4Y6PA 3S8MA 4TZKA 3JYNA 5B12A 1Y8RA 1O95A 3U3XA 4HFRA 4J90A 4O5OA 3QY9A 1GR0A 5JO0A 1R0LA 4RV9A 1UZMA 3PWSA 4JK3A 4GKVA 4DQVA 2FSSA 4BIIA 4JBGA 3QVXA 5I7EA 3EVTA 5I9LA 4K28A 4NBTA 3VH3A 1I2ZA 4XX0A 4CLOB 4FFRA 3R1IA 4BMSA 1C0KA 2EXXA 1DFIA 1LJ8A 2NVUA 2VYVA 3EUWA 2JHGA 3JQ7B 4B4VA 2OORA 3D4NA 1FF9A 2UV8A 3UCFA 4EDFA 4MVJE 3WTCA 4YAJA 1NQOA 1UUFA 3AJRA 5TGDA 3S2GA 4P38A 3IJRA 4PLTA 1M66A 4HWKA 3F3SA 1PJ4A 2CF5A 4JN6B 2O7QA 5K6AC 1ADGA 2ZTVA 4B7UA 1U3VA 1E92A 1ZK2A 1QYXA 4DBZA 5KJ6A 2IEDA 5F5LA 4UUMA 5DULA 1HE4A 4OMUA 4EJ6A 5IN4A 1L7EA 3R0IA 4O0LA 4NQZA 3GZ4A 3GAZA 3V1TC 1XQ1A 5ENDA 4E2ZA 3KYCB 3DOOA 2QRLA 3PQEA 4YJGB 3C1OA 1DIBA 2OP0A 4DRYA 5DBIA 4LCEA 1Q0QA 2VRBA 3P2OA 2PTGA 5EL0A 1PU2A 3B1KA 4RCVA 4I9NA 5KJ1A 3DZKA 3NT2A 3HDQA 3DZFA 3CXRA 3ZWVA 4R9RA 4I5DA 5IAAA 4WEOA 3RC2A 2PGDA 3U4DA 1SO8A 2AQHA 4LK3A 2VHVA 4EEXA 1B7GO 2EEZA 4GL4A 2OOSA 3U5TA 1DC6A 1J0XO 1X7DA 3ZWBA 3WJAA 3AM4A 4ROSA 4BQPA 1DRWA 1EDOA 1P44A 2X5JO 2GO1A 4B79A 1DLIA 5G2OA 2AQIA 1GFSA 1PJ3A 2ET6A 4MKXA 3H9GA 5CPBA 1NXQA 5B37A 3H9JA 3OHSX 4QX6A 2Y0DA 4L75A 1T2FA 4OJNA 1PQWA 1VL6A 3AOEC 2NV6A 3SJUA 3GA0A 5JAIA 1M67A 1IULA 1PQUA 4E21A 1NFFA 2P9GA 1Z6ZA 3DBHA 4GX2A 4M54A 3JD0A 3UXYA 4I08A 4KQWA 3UH1A 4F6CA 1C14A 3ASUA 1SB8A 4UREA 5L7YA 2EWMA 3OJFA 4AJ1A 4CQLA 2OFPA 2E49A 3RD5A 4OKNA 5A04A 3L6EA 2X8LA 4DLBA 1B3RA 2Q45A 3L4SO 4R3WA 2NADA 5G0UA 3OF2A 1DB3A 1HSZA 2Y0CA 5ADHA 1EUZA 3HSKA 2ZATA 1H6BA 1PX0A 4MVJG 4ZQHA 4JBIA 5BR7A 1BVUA 1MP0A 1Y8RB 2P4QA 4D3SA 2BGMA 3F6YA 5KKAA 4GLOA 2VOJA 5JAQA 1QLJA 5TRTA 3RUCA 4HADA 2ZTMA 1H93A 4HV4A 1ZIDA 1Z7BA 4FDAA 4LISA 1KC1A 3KLMX 3GPDG 4A26A 1A72A 3NDRA 3UICA 4E32A 4M49A 4E31A 5B4VA 5KWEA 1WPQA 4YCAA 4ND2A 2AE2A 1W8DA 3WGZA 3WYCA 5TC4A 1FDWA 1LDYA 2E6UX 4ZQGA 3IAHA 4TVOA 4E2YA 4NIMA 3W4JA 1PTJA 4W9NC 2G0TA 3AUSA 1UH5A 2Y1DA 5IDYA 1LNQA 3WSVA 2DTDA 3E18A 2XXBA 3JQ9C 1ZW1A 3L6DA 4MJLA 4YAGA 4DYVA 2DBVO 3NT5A 4IZHA 1TI7A 4BNTA 2GERA 5TT1A 3ZHZA 1M6HA 2QW8A 4JP3A 5K6AA 1GQYA 4OAQA 2DVMA 4TKLA 3RUEA 2TMDA 2ZJ1A 1Q1NA 3ZWOA 3FNHA 1LSOA 1MFZA 5CEEA 3C8MA 3V5NA 4J4BA 4XIYA 1NPYA 1O5IA 2JFHA 5IN5A 3O9ZA 4Q3BA 4RJTA 2VTEA 1IB6A 1YB4A 1N7HA 4NDNE 3QVTA 3BHJA 4LN1A 4EUFA 2JCXA 4MVJM 4YT8A 2OUIA 1NVTA 1CEQA 1U9JA 2A4KA 1LEHA 2ZYDA 3TPCA 4E0BA 3EMKA 4J3FA 3LF2A 2JL1A 1LRKA 5G4KA 3DQPA 1YDEA 4HXYA 2UAGA 3CMCO 5L95A 5EMHA 1PZEA 2VHWA 3EYWA 4BNNA 1R37A 4XD2A 1YL6A 4KQXA 1WWKA 5EIOA 3GAFA 4YRAA 4XGIA 4MVJI 2J5QA 3KHUA 4NJMA 5GZ6A 4RVSA 1UDBA 3FTNA 5HS4A 4M87A 1FDUA 2C07A 3FR7A 1ZK1A 1E5LA 3ULKA 2F00A 1M2WA 4E4YA 3C1AA 4M86A 3STHA 4WASA 3AOEA 3TNLA 1BTOA 3GC6A 4BKUA 3FNEA 4KUEA 3I52A 4I5EA 5F1KA 3VZPA 1HDRA 3WNQA 4L4SA 1ZEJA 5CAEA 4CQLB 2GR9A 1P1RA 2B4QA 2DM6A 4BKRA 1K6IA 1EMDA 1GAEO 4ND1A 1DIAA 1FDSA 5G0SA 1V8BA 1ZMOA 4GWKA 4JXKA 3ENKA 4R1SA 1Y9AA 2J5KA 1AE1A 3B20A 5ES3A 2VZ8A 1RM4A 2BI7A 3LT1A 3ZU2A 5JNLA 4AJNA 3E9NA 2YYYA 9LDBA 2UUPA 4FIZA 3PJDA 5GMOA 2X0JA 3P19A 3SXPA 2EW2A 2DTXA 3O8QA 3DHNA 3X2EA 3CSDA 4YT2A 4Z9YA 2CZCA 4MP8A 1SNYA 3JQ8A 3VPGA 1HKUA 3ETDA 3CZMA 1U28A 2NUAA 9LDTA 3LK7A 2O7SA 3UVEA 3HDHA 2Y1EA 4Y67A 4GSKA 4XIJA 3DBRA 2ZTLA 5FF9A 2OHXA 1U8FO 1DO8A 2EP7A 3WQQA 3IUSA 3F4BA 1ONNA 1UXJA 1XG5A 8ADHA 2NU9A 3RUDA 2JJYA 1ZNQO 1NPDA 3IS3A 1Q0HA 4UVHA 2CD9A 4I9HA 1PJBA 4U5QA 3HB4X 3JQ9A 3F4LA 4GVLA 4D7AA 4PFJA 1GQQA 2B35A 4JNKA 3ZWYA 4Y9DA 4FCCA 3PPIA 1F17A 3BZUA 1D4FA 4TZTA 2EJWA 1EK5A 1SEVA 5B4TA 1BDMA 3EGOA 5F3RA 4DC1A 1GV1A 1GZ3A 4IQGA 4NFHA 4K9DA 4S3MA 4MPDA 4PVDA 2AQ8A 3PLRA 2VHXA 4BNYA 4YJDA 1QYVA 4BHTA 4JJFA 4NG5A 5J23A 1ISGA 3TOZA 3WGQA 4URFA 2HKIA 3BMNA 3UUWA 4XDZA 3ZHXA 2EG9A 3AY7A 3OQBA 2CVQA 3CIFA 3GGPA 3SJ7A 3LLVA 4OSOA 4BMNA 1RM0A 2IXBA 4NHEA 3OMLA 2WEKA 5TF4A 5JCJD 5JDIC 3L9WA 4WCFB 1AXGA 2YV2A 3DBLA 3RASA 2D1YA 5G4KB 1LDBA 3TWOA 4OKIA 1ID1A 3PTZA 4B8ZA 2UYYA 3LT0A 1E1LA 5TLSA 1CYDA 2Y1GA 2FR1A 2X1HA 3ZWNA 4Z0HO 3RBVA 3NDJA 1NTOA 4TWRA 1U3UA 3AUTA 4DQXA 3A9WA 1ONOA 2O48X 3D0OA 4XKJA 3PWZA 3KO8A 4HP8A 4L76A 1IY8A 2B36A 5GZ3A 2FWMX 5TQVA 2DFDA 3ZWAA 2RAFA 3G79A 1T26A 4QUKA 1JW9B 4ZJUA 2X0IA 2EW8A 1IE3A 1EBFA 4XR9A 3PP8A 4GGPA 1EVZA 4IZIA 4IS2A 2WE7A 2V6FA 2OBYA 3EVNA 5AXBA 1P1IA 2OBNA 2VWGA 3JYPA 4FR5A 4RDIA 1U7TA 3GLQA 4H3VA 4CM7A 4R1NA 5MGBA 2BGLA 1P1KA 2GUGA 2CVOA 4R3NA 2I5PO 3QQPA 1Y1PA 3LYLA 3RFXA 1PJLA 4CQMD 4LGVA 3ST7A 2O3JA 1AN9A 3QVSA 5IZCC 5L3ZA 4Y8VA 4O1MA 3ZGYA 1BGVA 1EQUA 1SOWA 3CH6A 1BW9B 1P31A 1YE3A 4J4TA 4RLSA 4LRTB 2IDZA 3BHMA 4FW8A 3QSGA 4J1QA 2R00C 4D3FA 4ALJA 1A4UA 4QO8A 1LI4A 1ZXLA 2PD3A 4OL9A 4RVDA 4Q3EA 3VTFA 4CV3A 3F5QA 3JQ8B 4ZHSA 1KEVA 2X86A 2WD7B 3ZNQA 1O89A 2AHRA 3OIDA 2NU8A 2QX7A 4B3IA 4CMJA 4L0QA 3WLEA 3NX4A 1NP3A 1X1TA 1PJCA 4RVGA 3RFVA 3JQBC 4RQUA 3DTTA 4R1UA 4L8VA 3H6KA 2C7VA 1KS9A 4NMHA 3VZSA 2IYOA 2BRUA 5CHEA 1YVEI 1YRLA 5DZSA 3V2UA 2HCTA 4MVJF 1KEWA 1LC0A 1RPNA 1JTVA 1HL3A 3NTQA 3UHAA 4D43A 4NK5A 3H9QA 1B8PA 5A9RA 5L4NA 1KVQA 4YR9A 2NACA 2D8AA 1HDYA 5A5FA 5U9CA 8LDHA 1C0LA 2WTBA 1JKJA 3TQHA 4IQ0A 1PEDA 3SLGA 1E0DA 3WGGA 3D64A 4BO2A 5JPIA 3D5QA 4TRMA 2ZB7A 1GEEA 4MP6A 4PLZA 3UCEA 4CLHA 2WYWA 2GGSA 4PLVA 2P9EA 5FWNA 1UP6A 3FSRA 4J4HA 4DUPA 1BVRA 4KWHA 2VYVD 1VJ1A 3U62A 5JDIA 1IYZA 2P91A 2Q49A 3C85A 4WKGA 3WDSA 5L40A 3KEOA 5EQFA 4J0EA 1NQTA 2X22A 2ZCUA 1KY5A 4J2HA 4BV8A 1NAIA 1WZIA 3MJCA 3DTYA 3G49A 3WIEA 4BO1A 2FSVA 1Z73A 2YUTA 4DXHA 3QP9A 4B3HA 3OJLA 3ONDA 3ZW9A 4ITUA 1PL8A 5AVOA 1H6CA 5LC1A 3VPFA 3OSUA 4PLWA 4JGBA 1PGOA 4H15A 1V6AA 5JCJA 1A9YA 3JQEA 4ALLA 4IBOA 2NTJA 1JA9A 4NBWA 5TIIA 2GNAA 3DMTC 5HBRA 3VPSA 4N7RA 3DZGA 4RZIA 3PEFA 2X0NA 4DC0A 3DFUA 2XF8A 3AY6A 3AK4A 3CPSA 4JJGA 3JYQA 2GN9A 1LDMA 2YJZA 4WOKA 5DT9A 2RBEA 4DIBA 4EUHA 5LCXA 2D3TA 2I3AA 1I3MA 1VKNA 3MEQA 3MCVA 1ZCJA 3ZNNA 5G4LA 3I9JA 4BO0A 4EBFA 2NNLD 4UULA 2JAPA 4E6PA 2I65A 5IZCA 4J16A 3UCXA 3ZU3A 3DAFA 2WM3A 1R66A 3GFGA 4RF3A 2X4GA 3PFFA 2R00A 3GEDA 2PKRA 1DC3A 3WQSB 3WGIA 1YWGO 2YV1A 3FBGA 5CDUA 1LLCA 4UEOA 3ZH2A 3M2PA 4M89A 4TQGA 2Z95A 4XQ9A 5DCYA 4R54A 3JCZA 4D79A 2XXJA 3OM9A 4MO2A 1QSGA 4RVUA 4CQMA 1U5CA 2HLPA 2O3SA 3QJ5A 1SBYA 3H7AA 1HLDA 4UVEA 4XGKA 1IZ9A 3JQBA 4A27A 1GCUA 3S55A 4OSPA 1DAOA 2X58A 1ADFA 1GPJA 1XGKA 2BFMA 2GRAA 5U4QA 3K8ZA 1T1RA 3X2FA 4YPOA 1LU9A 2CSUA 3UW3A 3FCOA 5A5EA 5COQA 1DLJA 5ICSA 4W82A 3RAJA 4ZA2A 3K92A 2J3HA 3ON5A 1CQJA 1WXDA 1WVGA 2NM0A 4C4OA 3HFSA 4UAGA 4BQRA 4Z3KA 1GPDG 3PQFA 3ZWXA 4G65A 1XELA 5H83A 4R16A 3ZW8A 2DBQA 2GASA 2POQX 2QYTA 4EJMA 3GG2A 4OHUA 3VTZA 4RGBA 4D0RA 2Y66A 3MZ0A 1D3AA 4JJIA 1KERA 1VJTA 4CM8A 3NGLA 1E6EA 4CUJA 2FP4A 4HNGA 2QYSA 1SC6A 5KJEA 2EP5A 4TMFA 2YDYA 1WP4A 3HN2A 3WGYA 3PVZA 2H6EA 4BS9A 3OEWA 3C7DB 4XYLA 5JYEA 4AJPA 3OH8A 4FJ1A 3IC5A 4OXNA 2I3GA 4Q3AA 1QRRA 3K73O 3AUUA 1YH3A 4ZVVA 4E2XA 1V9LA 2O2SA 1HDCA 3G1UA 2G17A 5T8KC 3W1VA 2BFOA 4HNHA 3GG9A 1S7CA 3ITKA 2PV7A 5I8WA 3KEQA 3PZBA 1C1DA 4YT5A 3NJ4A 4A5OA 5I9MA 4AL4A 1W4ZA 3FNGA 1DIGA 2C54A 2NTVA 4WGGA 3JQDA 2NU7A 4DBVO 4DIOA 2JD2A 3DMTA 2A92A 1S6YA 1Y81A 4W7HA 4JBHA 3R6DA 1E5QA 1YL7A 4DVJA 5KOIA 3H3JA 2E4AA 2EHDA 4Z0PA 2V6GA 2JHFA 3WSWA 3KETA 1YQXA 3L4BC 5CG2A 2PNFA 2HJSA 4AJ2A 3KUXA 5CFZA 3WBBA 1QG6A 5F5NA 1A27A 1UXIA 2DFVA 4HFMA 1XKQA 3GNTA 1M75A 4DPLA 1ENZA 3E1KA 2EF1A 2BHLA 3ZN2A 1W6UA 1L1FA 3I1JA 1DHRA 3LF1A 4PG4A 3U0BA 1PZHA 1DJNA 1MB4A 4EJ0A 3LLSA 2C5AA 1X15A 4YAEA 3TOXA 3N58A 4PN3A 3UN1A 1GUFA 2D59A 3OETA 1LUAA 4BO8A 1WAMA 1LQTA 3HG7A 1XQ6A 5I8ZA 1B14A 1G1AA 4WCFC 2GD1O 1GQ2A 4CUKA 5A02A 1EFLA 1GY8A 1YBAA 4KDFA 1UAYA 2AA3A 1IL0A 4CQMB 2CDCA 3IKTA 5BSHA 2Q2QA 1VI2A 3E8XA 2PY6A 4NK4A 4W7IA 2AG8A 3PHLA 5EERA 1DC4A 4PZCA 3TFQA 3WB9A 3PWKA 4Q3NA 4B4WA 2DKNA 2PK3A 1E3WB 3GF4A 2FRDA 3FWNA 1YJ8A 1P45A 4K6CA 5KVVA 4PRKA 1HF3A 1K6XA 4F45A 3DAGA 4ZN6A 3WOHA 3GPIA 3DHEA 2HMWA 2GYYA 3GT0A 1UP4A 4ND3A 1ZK3A 4FJ2A 5A9SA 3EAGA 5H82A 1VLLA 4GX0A 3RC7A 4AJIA 2VN8A 4IUYA 4J6FA 4PVCA 1F12A 1LQUA 4R01A 5TT0A 1HDOA 3PJGA 3Q9UA 4XDYA 3VKUA 4NZ9A 4GX5A 4ZQFA 3L07A 4GSLA 1H9BA 1NYTA 3FNFA 4FFOA 1X0VA 3DAPA 1P0CA 3NYWA 3WMWA 3KBOA 2EKQA 1FMCA 1VSUA 2CNBA 3F1LA 4TRRA 2PZLA 3JQGA 4CM8B 2J3IA 3E03A 4YDRA 3GDFA 3RQSA 1O6ZA 5HTOA 4KTVE 1WW8A 3MWDB 1TT7A 1Y6JA 5A06A 1CWUA 3VOSA 3GFBA 3GGOA 1E7WA 2YW9A 4BVAA 3DC2A 1T2AA 1U7HA 3OIGA 4OGWA 1TB4A 4CV0A 2C2XA 3DZIA 4BNHA 3I5MA 1UR5A 4N5MA 5T8KA 3NAQA 4N5NA 4BKOA 3AFMA 3ONFA 1NWCA 4EUEA 4Z3DA 2P9CA 1H0KA 1PQPA 3WS7A 5JBIA 1PSDA 4CJXA 1C1DB 2PWZA 1NQAO 2Q50A 3ONEA 2Q1TA 1ZFNA 1ZK0A 2VZ0A 3EC7A 1G0OA 4IJUA 3QWBA 3WIDA 2IZ0A 3BTSA 1XCBA 1YJQA 3GUYA 3PK0A 5L4LA 4J43A 3F9IA 3GVHA 3ICCA 1MA0A 2FMUA 4NR0A 3S1LA 3GRKA 2GN4A 2QQ5A 3WFJA 5FEUA 2JD0A 3TZKA 2C2YA 4BNKA 1ZUD1 3ROKA 5CP8A 2VRCA 4YEDA 1YOVA 4R69A 3DR3A 3EZYA 2A35A 1Q7GA 2X6TA 3DOJA 3FN4A 3OJOA 3TZHA 3L4BA 4PLFA 5JC8A 1K2WA 3VHRA 3RCBA 2BFAA 5IXYA 4YJFA 1NQ5A 4K1LA 2OGUA 4PZDA 1A9ZA 4XYGA 4ALMA 5BNTA 3PJFA 2WMDA 4FFMA 2CDBA 1HZJA 2IRWA 4CMKA 1DSSG 2PH3A 4MIOA 1XWFA 2VNAA 3EW7A 4BL5A 1FK8A 4XR4A 5DN9A 3B1JA 3I6IA 4GMFA 1I2CA 3VPXA 4E5PA 4YXFA 2CDAA 1BRMA 2PZJA 4HFNA 1DDOA 2VWHA 1C1XB 4WCFA 3PI7A 3GHHA 2DBRA 1BWSA 2ZTUA 4C7KA 4EI2A 3RBXA 3CTMA 3KSDO 4FFPA 2I66A 4DA9A 1T24A 4BNZA 5KJFA 1GYRA 4BMVA 4FC6A 5G0TA 4AJEA 2BELA 4BOYA 5GZ1A 4B7XA 1XDWA 3KRTA 1PJSA 2EV9A 2GDZA 1J5PA 3V2HA 5H81A 2YQ5A 4K26A 5ICMA 5A9SB 3FD8A 1GCOA 4XCVA 1ZK4A 2Z1NA 3NGXA 4MOWA 4PLCA 4BNXA 1PJTA 4RLHA 1PWZA 2W2LD 1HWYA 1E7MA 1QV7A 1X0XA 4N18A 5FI5A 4IDBA 3WTBA 3VZQA 3KYDB 2PLAA 2Q2WA 3B6ZA 5KTKA 2P68A 1FDVA 3LDHA 5A05A 4BGUA 3FTPA 3DEYX 2Q4BA 3CEAA 4JX8A 3VAZA 2PD6A 1EQ2A 1NHWA 4W4TA 2V65A 2B37A 1MLDA 3DB2A 3OP4A 2D0IA 4CMEC 2DAPA 3JQAB 4Q3CA 4WLUA 3W6UA 3WFIA 1WDLA 1KBZA 1HETA 4HX5A 3OJ0A 3JQGB 4KOAA 4MVJH 3IDSA 2WYUA 3GQVA 1GUYA 1KVSA 4ESOA 5DOZA 1JU9A 2X5OA 3HDJA 4FGWA 4FPXA 1YQGA 1EZ4A 1BW9A 1EE2A 2H5LA 2Q4EA 2VOEA 3R3SA 4IXTA 1K3TA 1KOLA 4WNIA 3Q2KA 3RJ9A 1A7KA 2EJVA 3MJVA 1HZZA 3KYBA 2Y68A 5JW6A 4CM1A 2BGKA 4NFYA 1WNTA 3D4OA 1PS0A 3I4FA 3QA9A 2WD7A 1I3KA 5TJHA 1V3UA 1FJHA 2UUOA 1MFPA 2XOXA 2Q1SA 4GVXA 1LSSA 4RQTA 2HJRA 2B4TO 3L0DA 5TSDA 3H5AA 3E6AA 1PZGA 4BO3A 4J49A 4D44A 6ADHA 4NPCA 4N5LA 5BSFA 1N9GA 4W9NA 3ZNOA 5IFLA 1W73A 4BNWA 2B4RO 4CM9A 3NKLA 1QV6A 1R15A 3ZNPA 1XIVA 1LLDA 1HDZA 4J91A 1MC5A 1T25A 2JAHA 1YOVB 3PHJA 3VH1A 1ADBA 3INTA 3KM0A 3HE3A 4DLLA 1DOHA 4X54A 3F46A 3GGGA 4BO6A 2Q46A 4XRGA 1T2DA 2Y93A 3Q9NA 4ID9A 4MP3A 4YJFB 4Z0TA 1OZAA 1PWXA 5C37A 1SPXA 4M55A 3TF5A 3JQCA 1DEHA 3WNVA 3PYXA 1H5QA 4L74A 1ISIA 3Q3CA 5LDGA 4Z6KA 5DCUA 1I5RA 3PDJA 2GSDA 4CODB 2SCUA 6LDHA 4WOJA 1T2CA 1XU7A 2DPHA 5CPFA 1FDTA 4U6QA 3DOCA 5KVQA 2Y1OA 1UXKA 4YJHA 4L73A 3TDKA 4LCJA 4YB8A 1JKFA 3LVFO 4INAA 1M6WA 1NR7A 5JSFA 3QE3A 3BXXA 5BSEA 2OMEA 1B0AA 3E9QA 1P74A 1JDJA 2GZ1A 3C7AA 4IIVA 2JCYA 1AUPA 3LT4A 4NBUA 1KETA 5B1YA 4QSMA 1O9BA 4W6ZA 2BFPA 1VPDA 4LRSB 3N74A 3PIIA 4GI2A 2C0CA 4WK6A 3OJEA 1H2BA 2J6IA 1KEPA 4JP2A 1HXHA 4EZBA 3C24A 4AFNA 5ILGA 3VPHA 1GZ6A 2GF2A 5CEJA 4J7XA 2ILTA 4U8GA 5KVCA 1J4AA 1XSEA 1P1FA 3TN7A 4TRNA 2OXIA 1T1SA 1I30A 3H9EO 2IEBA 5C7OO 3OQ6A 4FS3A 3F1KA 4YQZA 3P2YA 1N8KA 1BHSA 4CMEA 1B8UA 3QWFA 4XQGA 3DL2A 2HO5A 4PZEA 4U7WA 3HZZA 4J9VA 3KVOA 1VL0A 4UEKA 4GBJA 3ZI0A 1LTHR 2NLOA 2W2LA 3AFNA 2DT5A 5L53A 1ZSNA 3ENNA 4E12A 1Z7EA 3ABIA 5JS6A 1SOVA 1LXCA 2G1UA 4AJOA 3NV9A 3EK2A 4MDHA 3WR5A 4BO4A 1I01A 3GHYA 2G5CA 3FHLA 1QYWA 2I76A 3ICPA 3PJEA 2FOIA 1ZZEA 4PG6A 1KYQA 2DU8A 1QP8A 3WGTA 4XWYA 3K6JA 1OC4A 4D45A 2DC1A 1IPEA 1K0UA 1N9GB 2PR2A 4OYRA 4UUOA 1NR1A 2X9NA 1QYDA 2Q99A 1ZO8A 5IZ4A 5IXSA 3A1NA 4ZGWA 2ZQZA 2X9VA 4E5NA 2RIRA 3RUIA 1MUUA 4LMPA 3AWDA 3TZCA 1KEUA 3Q0EA 4B4OA 5CDSA 1PZFA 2QHXA 2HK8A 3I4CA 4BNIA 3ZWPA 4IM7A 4R4JA 1MX3A 3GMDA 1Q7BA 1H6AA 4R68A 4U0KA 1TLTA 4BNFA 3MJSA 1DBVO 4WLEA 1BG6A 1DFHA 3DXFA 1LSUA 3PRJA 1SEPA 3IIEA 1NASA 1I36A 4OXKA 1GADO 2YQ4A 2QZZA 2O3UA 3ZV5A 5THKA 4ZU3A 1E77A 1U2DA 1SCUA 4PLGA 2HRBA 4GQAA 3PFWO 2CY0A 4YJHB 3W4IA 2W2KA 2W98A 5A3JA 1R0SA 5JY1A 4CLXA 4OO3A 4W99A 5EJ2A 1ZXBA 4DQUA 1CDOA 1JWAB 1A5ZA 1U3WA 1ULUA 1T2EA 4R1TA 4MIYA 5T64A 1B26A 1AXEA 2Y0EA 3KB6A 1O94A 3RWBA 2P5YA 2UDPA 3N7UA
chains in the Genus database with same CATH superfamily
3C6BA 5KHLB 1MVOA 3ZW7A 2BTOA 3RC9A 1XCPA 2NZ8A 1IEWA 5EXEA 2H92A 2AYZA 2P3SA 5FLKA 3OTHA 4UFNA 1TF5A 3D3WB 1U8XX 3HJAA 3HBJA 3INNA 1N2HA 4I50A 3VXKA 1C0PA 1Q14A 3GCXA 5F77A 4BNGA 2XNHA 4ZOEA 2GS9A 4UPVA 3OF5A 3DONA 4YY3B 2BT4A 3IVRA 3IPRA 1Z34A 2YDXA 2EQAA 2JJ2A 4MKZA 2LKCA 3MFYA 3KQSA 2KLHA 2F1HA 4LMBA 2EGUA 3K0CA 1IXZA 1L7RA 4RZXA 2P0EA 4RFSA 2H16A 4CG1A 2IH5A 2PX5A 3B3FA 1KJYA 3BXGA 4HYEA 4UD6A 4UM9B 3OOWA 2X13A 3MTJA 2CXQA 1PK9A 3G1WA 3FDZB 3RI3A 2O4CA 3U49A 4EGJA 3H2ZA 2ZAIA 3L02A 2VZ9A 4QDKA 3DOUA 3TJRA 4DCSA 5CDYA 4CM4A 5B6PA 3EBOA 4QGAA 2PJZA 3RSZA 4AJLA 2PYZA 3J7TA 4JYPA 5DXFA 4F3TA 1YVPA 4JEUA 2HQ1A 2D13A 2XLBA 2XCTB 3K9CA 2NO6A 3NHUA 1W5SA 3R4CA 4PX9A 3QBEA 5DGXA 4YV0A 3B1FA 5AW7A 3BBPA 2HUPA 2WOJA 3A6FA 4DQ0A 4OFBA 2BZ0A 4QFCA 5AI9A 3F3MA 2DQKA 4CMCA 4TTQA 3SHTA 1XDZA 3JPWA 3LX8A 4YNBA 4CCYB 1R0WA 5I4BA 1YR1A 3G2LA 1UJMA 1ILEA 4MGIR 1IQRA 4IDFA 3AERB 3CZCA 4INOA 3LKDA 2CDRA 5T3YA 1QH8A 1NR5A 1TFUA 1Z5ZA 4RJKA 3UWDA 2NU6A 2AFVA 5AOCA 2FQYA 1I6MA 5DYYA 3KUDA 4XVUA 1QKIA 3FFWA 4D46A 4UDOA 3TQRA 3WIUA 1M2FA 1RQPA 1FP4B 3PQ2A 4DWVA 3SWWA 3U6BA 3CVVA 1MAAA 2O5CA 4L7VA 2J8ZA 4KFUA 4Q16A 4Q0MA 4L02A 1XR3A 1M72A 4KZKA 5EQDA 4GL2A 4J7AA 3H04A 4QU0A 1QC5A 3EPRA 3NDIA 4H16A 1X38A 1V2HE 4XSGA 4ONEA 3DP7A 1E3WA 2F4NA 1VFNA 1Z74A 2VYCA 5FNVF 4CR6A 1NMSA 1Z6XA 2AKEA 1TK9A 2P69A 3SJZA 2MINA 2ZJ7A 4KYVA 5LUAA 5ULLA 4YT4A 3CNNA 3BWDD 3MRSA 5TQ2B 2AXPA 4M36A 1UZUA 3SX0A 4Q4HB 4P4LA 1AHPA 1SN7A 1XVTA 1PO7A 5ADWA 3PNBA 2H2GA 3JWJA 1ISSA 2W0SA 5E4FA 3M3HA 1U9IA 4YAWA 4D8UA 2FPSA 3RPEA 3V8NA 4A2QA 4B3XA 3GRYA 1ZRSA 5FWXA 3MIZA 3SS8A 3AF6A 3FPEA 2QMOA 3F47A 2B5VA 4D9IA 1X7WB 4HXFB 2QP9X 2R47A 5T6BA 2CWWA 4W8HA 1YB5A 4DUGD 2FN7A 1K7EB 5DNVA 1P5RA 3OUUA 2W8ZA 2YFQA 4Z9AA 3WK5A 2V6BA 1C5KA 1O2DA 1EEHA 3KZOA 4QSHA 1FSPA 3ICEA 1K4MA 3OTQA 3A28A 5COAA 1DRKA 4PSVA 1TJYA 4KX5A 2VYQA 4Q6BA 1TA9A 4RXMA 3DJFA 4Z7NB 4L85A 2G72A 3VNRA 1GPBA 2H08A 3RSHA 1SCUB 2DUJA 3IVAA 4NBNA 5TNXA 1SK8A 2IHVA 2PS9A 5F2KA 2V7PA 3F6EX 4RDHA 2VYND 3HP1A 3A4VA 2HSWA 1ZMTA 5T5QA 4FYPA 3SCZA 2OM6A 1ONSA 3NATA 1GGEA 1NIPA 5BV7A 3B12A 3QOWA 1JDSA 4HQKA 2IHZA 3L8HA 1MV8A 3KUCA 3W06A 3GUCA 4MV0A 1R88A 1KMNA 1JU4A 1SCJA 2DSNA 3PNOA 4I46A 1F2DA 4IH1A 4ZVTA 3GJQA 5HZKA 3B3AA 1FFBA 4F04A 2ID8A 2WU1A 4GBGA 1DQNA 1ABEA 1POWA 5DP1A 1PR3A 2VRCD 3NGMA 1NUPA 4KO4S 1IZZA 2QZ9A 3FMGA 4BNVA 4R7TA 1G18A 4XJXA 1OZGA 2QUHA 2PGXA 2G8NA 2I6GA 3K96A 3QIVA 4X44A 3EEIA 4IIFA 3Q88A 1WHTB 3HO8A 1X7YB 2CLEB 4Y30A 3JZFA 3FMOB 4ETIA 4ADSG 3HCPA 2HPAA 5K5EA 1TVKA 1PAUA 1F5SA 2J5RA 3WA7A 4Q9KA 1QHGA 1B8VA 5LYJB 1CK4A 1B8OA 3MTEA 1NF2A 3FDXA 2YCBA 3HDYA 5JFTA 2QXUA 4PYMA 4HNTA 4FXPA 1TFRA 5GTDA 1NKSA 2I2AA 4JI1B 5B7GA 2ZYAA 2QE7A 4EECA 3IAM1 3NKFA 2HQOA 3KLNA 4QT4A 3T4UA 5BW4A 1JIQA 1YHZA 3PIDA 2JGKA 3EEQA 1UAAA 4P58A 1XLWA 5IJ0A 3W6NA 2BEWA 5KKNB 3O1LA 1QE3A 3O9VA 1R10A 1EUCB 1P9LA 4NPHA 4ZAFA 3E23A 4LGCA 4XB1A 5FAXA 2JEZA 3DH0A 3H1AA 3KAQA 4JQYA 1PEKE 4FHDA 2PZAA 1P2BA 1YR2A 2RHCA 5ER9A 3ZCXA 2IEAA 4MITA 3PKZA 4X61A 1MCZA 4BKQA 2OCAA 1A77A 2W6CX 4JODA 2RGEA 4WJZA 3H9CA 2YHSA 4OEHA 2FQWA 1E3IA 4RE6A 2VO1A 2HLDA 1R0BA 1QKKA 5EP2A 1Z5UA 3GT3A 4YCMA 1KO7A 2EF0A 4FM9A 4W5HA 3M9XA 2OFXA 4G8CA 1YFKA 3M6XA 3ZVRA 4EHJA 4I9UA 5JSZA 4N7BA 1GKLA 1R8SA 3CZ5A 4YMHA 3LT5A 3NBMA 5EXTA 1KIFA 5BQPA 4F4HA 3WK7A 2VSOA 2ZUDA 3ITEA 3WAGA 4B6GA 2AE1A 1KP3A 2VA9A 4UMEA 1W96A 2HJVA 1YHNA 3WG9A 5AD1A 2VNSA 1KJIA 3MF4A 5JDCA 4ABYA 5CFQA 2BHNA 1P2VA 1P91A 2EC5A 2DR0A 3LZCA 1E1CA 3PIRA 2E89A 4U5XA 4BLTA 5LKAA 4XDGA 1VB3A 3J81k 2HMUA 1X8JA 2PRKA 4KHZA 3VHQA 3RBAA 3WO1A 2FP3A 1ML4A 3OC0A 5HMMA 1JI3A 5CA0F 1PIWA 2V03A 4F9FA 5GY7A 3PEYA 5D6NA 5JCXA 3FCEA 3D1LA 1LBQA 4PICA 3KOXA 2PLFA 3A06A 4DL9A 2SICE 4MMZB 3NUQA 4BFCA 1J1ZA 1TMYA 3R20A 1JBQA 1L5HB 1TPZA 2OE2A 4MYHA 1JB9A 1U0SY 4WLNA 1RWWA 2IYAA 3BMCB 1YS7A 2B5WA 2QU8A 3KYDA 3PZRA 4NH4A 3RVBA 4CMIA 2CV0A 1CTQA 4D8YA 1AKRA 1T5LA 4FX2A 4L0MA 4RFLA 1XE3A 721PA 3NJ8A 3I6QA 4RETA 1MEEA 4OHPA 3RYHA 1PFKA 5ALZA 3QMPA 3TQFA 4MI9A 5FWDA 1Q1AA 1F8YA 1RZVA 1HDIA 2EVWX 5AP9A 1CRZA 3OO0A 5FXMA 3MINB 3P8ZA 4MIKA 1HDGO 3SEFA 3B51X 3IOBA 5KQMA 3PI6A 4J2OA 4B6SA 1YAJA 4EA9A 1TUGA 2IKSA 3V2GA 4ZV4A 1X14A 3BSWA 1IAVA 3CVUA 1WCYA 2FPRA 4DSUA 3C6MA 2ZB4A 3DWIA 3FLMA 1GITA 5FX2A 3VSEA 2VQSA 4GOMD 4I1UA 1R74A 2AKAB 1XQVA 3DV0A 4UM5A 4CM9D 4RK1A 1W34A 2O05A 5KPDA 1W5EA 4LRUA 3DE0X 4WE3A 2WVJA 4CKEB 2IY7A 4KMOA 2ZIFA 3HCDA 3HJGA 4EPYA 4M7WA 2Z5LA 5K0EA 3FR8A 3UJ8A 1ISFA 4AUMA 5SY6A 4MUNA 2V59A 1GU7A 4KH0A 2ZSHA 4K87A 4Y2HA 4G86A 3GDOA 2NVOA 3DXZA 2PA3A 3AFHA 1X92A 3LE8A 4DMMA 3UGJA 5KTRA 5EQJB 3TFOA 4IINA 1NGSA 3IP1A 4ERNA 2XYVA 5EMJA 4DV4B 4HQNA 1P4SA 1FFYA 1CQZA 1KYYA 3SBDA 3ZBTA 2F4VB 1LDNA 4H1WA 2LZ0A 1A5TA 1RJWA 3LT2A 1RXWA 5EN4A 1ZG3A 1ZD9A 3Q41A 1OREA 5DNDA 3VC2A 1VL8A 3PQCA 2ZRPA 3K6KA 3UGQA 4X65B 4R51A 1HTBA 2JHCA 2WVAA 2Y8EA 3SBOA 5MFPA 4XJSA 4B1FA 3EVAA 4RSGA 3QWIA 4YRDA 4EJSC 2NIPA 1ATZA 1ULTA 4C4YA 1M2NA 4NYJQ 3RDPA 1UFQA 2AX3A 3H11B 4G89A 4H0FA 3IQZA 3U80A 2P9YA 1QZUA 5L3QA 3IQDB 1M8JA 3UG6A 2IU4A 1I4EB 2FPIB 3DDZX 4FHCA 4ZT7A 5FOUA 2ZSAA 4IDEA 1UC5B 4F3YA 5FD8A 2DBYA 4DY6A 1QK4A 1RMYA 4YI3A 1CUFA 1KJNA 3TQCA 4C7BA 5FA5A 3T7EA 1ZSVA 3VR4A 5I7FA 2LNDA 4ILKA 2J0QA 2ZUTA 4IDCA 2D0DA 4JI6B 2PUBA 2PUCA 4PG7A 4RW0A 1Y1TA 2CJYA 3CUKA 3VKVA 2QRKA 4G0NA 2IZ5A 3O8NA 4QYSA 4NPAA 2E1RA 5E8RA 2GYUA 5FEMA 3CWCA 5LA6A 5A7HA 1QTIA 5AXAA 5AVSA 2IXAA 3OQIB 4YDHB 2OHIA 2YIDA 3OP1A 3KAKA 1BEEA 4B3DA 4ZHQA 2FPWA 1O5OA 3BDAA 1ZNXA 2OV6A 4IVQA 1WD7A 1Y4UA 2DLDA 1GDTA 2YWEA 4YMWA 1Q74A 1VYHA 2H8GA 1FA9A 3OE7A 4EY7A 1SY7A 1FNBA 4X93A 4EPXA 4PS1A 4F0JA 2QRVB 4XQEA 3F7MA 1VPLA 4BV8A 3O74A 4QD3A 1BE8A 1SU4A 2P78A 4Q4LA 1MOZA 4B2LA 1NVUQ 4AM8A 2XSZD 1I7SB 2PZGA 2CYCA 3HLYA 4EGFA 2EOAA 4FP9A 4OQPA 5CCEA 2NP7A 4M1QA 4CZ2A 1U2ZA 2RGNA 1KEKA 3AI7A 4Q93A 3RKUA 1BGXT 3GMSA 4ZQEA 4OIMA 3S7TA 4BECA 3LUCA 2YFHA 1QGUB 3QX8A 4GMGA 4FU0A 4X20A 4XOUA 3PX3A 4W1RA 1E3EA 2ZKIA 2ZSKA 2J9FA 4LYEA 3D8RA 4M9UA 3S5JA 5I45A 2F1IA 4NS4A 1JUDA 4NU5A 2F67A 2PNJA 3TEFA 4K6GA 2GCGA 3SZRA 3WHKA 5KKCA 1M2JA 4TM8A 2O1XA 5K8IA 4MPJA 5GONF 3JSAA 4CTOA 4OF4A 1EDZA 1WZEA 1G7RA 3JQQA 4YR7A 3SBEA 3AT1A 4I14A 3AU9A 2J3DA 4RMJA 1OFHA 1SUFA 1RE0A 4RZHA 5H7XA 5B3AA 5J40A 4B46A 3EODA 3O8CA 1Z5VA 2QUKA 3QPVA 3SYKA 1YONA 4FGSA 4YH1A 1H94A 2WU0A 1XYYA 5CBPA 2P6NA 1DDGA 1AZTA 1EVYA 1OR8A 1SZCA 9MHTA 2PXCA 2IZ6A 1NSFA 2CEAA 2YFKA 1Z5OA 3NXSA 3PCTA 4H3SA 1JG7A 4LVOA 5JZ9A 3BTUA 5HEKA 2ZJ5A 3DBHB 1UXGA 4MUGA 5IJWA 3MLAA 4IY1A 5FOXA 3V55A 4L0CA 4IHJA 4ZCRA 2HCRA 4YECA 2F3RA 1UMDB 1Q57A 3U7JA 4QDZA 2BGWA 4O4HB 2GPTA 4ND5A 1P1JA 1YQEA 5CT5A 1NRIA 1TMGE 2IUEA 2WWRA 2Z43A 3BWMA 4M0EA 4Q9NA 5IP5A 3SF8B 2R87A 3B3GA 2C4UA 4LVNA 3F73A 2WE8A 3VH2A 3THXB 1QS0A 4QUIA 3PDIA 1FXWA 1MH1A 5D84A 5D3ZA 4IPTA 4N39A 1IHPA 3VR5A 2AC2A 3OZVA 4OQXA 2V6IA 3HB9A 4GC5A 4V24A 2GOYA 1PGQA 3G2QA 5ALRA 4IDAA 4CMGA 2C1EA 1X7GA 3KVRA 4F2WA 1RPTA 2V5AA 4GGOA 2YHIB 2DYKA 1E62A 3ROPA 3KOUA 3F9CA 2G9ZA 4NMWA 3ZY3A 3KYJB 1FFSA 2FZVA 1XMIA 5DXAA 3T3IA 3K4QA 5THQA 2XLCA 4IDUA 1OXXK 1PL7A 2Q0XA 3NTXA 4FLFA 3RK1A 5AW6A 4N6NA 4J1SA 1WSWA 1L3CA 4U7FA 4R5HA 1Q16A 3UOGA 3Q2OA 5FFFA 4ZDIA 1USWA 4J1TC 1N0HA 4CNQA 1COWA 1AA6A 1S3FA 1FEZA 2IA5A 2BZGA 2X9GA 4YMUA 3AL3A 4JSRA 2JGEA 2P7HA 5B3JC 3RIHA 4ENRA 2C2KA 3P0EA 4Q1VA 3I09A 1B16A 1TTHA 3QU4A 2P65A 1XB2A 1S1MA 5DNCA 5JS8A 2R0QC 1ESMA 1KAQA 1S9HA 1L8XA 2Q1WA 1B00A 2M2IA 4ZK6A 1PWHA 4PPNA 1E2KA 3TVTA 1QQ6A 4OUDA 1L5GB 2DUMA 1DG1G 1XO1A 3EYAA 4QXAA 4UASA 5E38A 4YA6A 3UHJA 1MAVA 4E5MA 4N3AA 4X66B 3NEPX 3FW1A 1C0EA 3A3NA 5F76A 4RF5A 4XWKA 3PS9A 4Q48A 2YCLA 1NONA 1N2BA 4JFRA 2DFTA 1D2GA 3OPXA 4Z4IA 2XW6A 4J0GA 3GJSA 3JZDA 4HLUA 4H31A 5FBKA 1RM5A 2DHEA 3OZTA 4ZVLA 4FEGA 1VECA 3BXFA 3GI1A 3IODA 4FWIB 4FOOA 3JXEA 1UPCA 2IU3A 2HT6A 1GPH1 3FTEA 2O2GA 4KIWA 4OREX 2O6LA 4DV7B 3RRZA 3G0OA 4A7PA 3IKLA 5KIAA 2QRUA 1LX6A 1OC2A 1CLEA 4QUHA 2HR1A 1RU3A 2BEUA 3BMOB 5AW8A 1JAXA 2HCBA 4PV7A 1NDHA 2XCQA 1RWBA 2OK8A 1NJ1A 1R0CA 2VUTA 4HAZA 2JAUA 1E1NA 1S9DA 4MJ7A 5AI5A 3CJQA 3V1NA 4PZ0A 1R5BA 1KMQA 2O2EA 4ENVA 1DCFA 1YS4A 3L06A 4YV1A 4M9SA 2NTNA 5DT2A 1GL9B 3Q6NA 3SZMA 3E5HA 2OXEA 1SHUX 2WFLA 5AI8A 4I5GA 3VSDA 3C43A 1UOOA 1YQTA 2A57A 2OLJA 2VSYA 4KE6A 5DVZA 5AJWA 1P1HA 1QHEA 1O6FA 3LJKA 1SD1A 4DCCA 1Z8DA 2IDKA 4ZOCA 3CF4G 2H29A 1SAYA 4OD0A 1N1EA 1AIPA 4OQYA 3THOA 4ZICA 3REOA 3ENVA 1CJMA 1NT4A 1LV7A 2P79A 3NEJA 3PYLA 4LZPA 4TRJA 5CH8A 2CFTA 5P21A 4XLLA 4MGEA 3W5IA 3N2KA 2PBZA 3NOVA 3I1FA 3Q7EA 2DF8A 3T5PA 2G63A 4WXRA 1PJ2A 3NLLA 1CQIB 1RYZA 1XDUA 3HQ4O 4GR4A 4JJEA 4YREA 2BI4A 4P3XA 1X80A 5CXXA 1QGED 4PZUA 5DDIP 2DY0A 1V16A 1OXBB 2P11A 4JVOA 1TRHA 4PQRA 2QG9A 2I9PA 4C0QC 1H4VB 1PLJA 2W4IA 3OQNA 2JDID 4N0PA 1M6NA 1I1HA 1MABB 1D8TA 4GRDA 3AY3A 3VI3B 1XLTA 3FYTA 1UBTS 3GPBA 2GBLA 3AVOA 3LDGA 2XUHA 3W7BA 3ABZA 5CH3A 3PUYA 4QPJC 4TLEA 3G2PA 3PHCA 1NF3A 4TVBA 5AOAA 3K7EA 4HLNA 4ML3A 3QSYA 2NO4A 4QOHA 5IBRA 3Q8KA 2BFEB 1WVIA 5LMCA 3K94A 3GA5A 2RHOA 4R1PA 5LU9A 2APJA 2Z4SA 2XKBA 3RT9A 2D1QA 5ISMA 4OB8A 4QNMA 2GD6A 3FGOA 1AV6A 2PX0A 1S4MA 3ADBA 2ZBFA 3TD9A 1DRVA 4QKQA 1LCIA 1YB1A 4FQ7A 3WJ1A 4MYSA 4DB2A 2G83A 2BJHA 2DR3A 2GLXA 4ESHA 2V3WA 5FYQA 2CXRA 3O8QB 3B6JA 1NZJA 2YTZA 2NUPA 1FX0B 1OWOA 3AVYA 3OE4A 4FYMA 1J0EA 4B31A 2FI1A 3VDRA 5FYDA 4I66A 4X0EA 1BMDA 2Q1UA 3COPA 3E1SA 3SPXA 3BH6A 4LQLA 4MW0A 1E69A 3FPAA 1PDVA 3V1MA 5IPFA 4ALIA 3O3CA 2VEDA 1X7XB 2OBXA 1DARA 3HJNA 1E3LA 3IGFA 5GP1A 4B32A 1K97A 3ISTA 2UKDA 2GPNA 1LRLA 2MTBA 3IMFA 5H70A 1ZEMA 1JTFA 3UT6A 4V0ME 4AZ3A 4TXHA 3TOVA 4QJ4A 3O0TA 4PG8A 4YYZA 5K0GA 5F7XA 4NJOA 3EQZA 2VP5A 3CT4A 2J07A 4HUQB 1G8MA 5EKXA 3T1YB 2HW8A 1I9GA 4ZU6X 4L51A 5BN4B 3U09A 4B3MB 3Q8LA 3ZE9A 4PYLA 4BMXA 1NZFA 2CFCA 4C0WA 5JHGB 3UGKA 3RC1A 5EZSA 3RF6A 1U5AA 2QTAA 5EZ6B 2GB4A 2QN7A 3HL0A 4MW6A 1FFEA 1TVEA 4FK8A 2WAAA 4Y1RA 2D54A 1Z0FA 1C9YA 2DBZA 3GK3A 3NWOA 3UJ9A 4MQFA 5CDGA 2OFOA 1HYGA 1G8YA 1AUQA 2XPCA 4NXMB 2RC6A 2PFKA 3A6ZA 5B30A 4IXWA 3VRHA 1FC0A 1GOTA 3LRXA 5LXTF 4CG0A 2DTEA 3E82A 3KQYA 4CR8A 3ZTWA 4ACAA 2WA1A 3HCOA 2XYPA 1E2JA 1HQYE 2GBGA 3I9NA 4IIBA 2AWNA 2EKLA 3H5IA 1P5FA 4G0YA 3DVRX 3KZ1E 3IAS6 3OLVA 1LBEA 3PPXA 4X8MA 1C8VB 2GXSA 3MTAA 4Q39A 4N8EA 3LP6A 2FXIA 3GZNB 2VLBA 4XEUA 3LHSA 3KLPX 4OOFA 3SM9A 3UMYA 2QXYA 4R2HA 4ANFA 5KU1A 3GRFA 3KG2A 1BX3A 3CB2A 4KTTE 3VTKA 4F2DA 3H4VA 1Z22A 2FR0A 3FPLA 4LHXA 4DMLA 2CLKB 3C74A 2DPYA 3UYLA 3I8SA 3RFTA 3ASVA 3OVMA 2VK1A 1PFYA 4FYWA 1IVYA 1Y3HA 3WL5A 5KYXB 4NATA 5EE0A 4D5GA 1S01A 3AUKA 3DEAA 4K6FA 3RRXA 4HPWA 2OV1A 2EATA 3ESRA 3F5SA 3A3PA 3MJDA 1VJ0A 5ECDA 4RQAA 5HS6A 3GAMA 3L1HA 4ESEA 4GR9A 5JH7F 3KJZA 4E14A 1BYUA 3O4RA 2B4AA 5HE8A 3TRIA 1T10A 2C5FA 2QAJA 4JT8A 5E9AA 2Q1YA 2HC9A 1Y5MA 2QP4A 3F3YA 5GV8A 4KAFA 4YO7A 1ZBQA 2YXDA 4TXNA 1RWOA 1Y0BA 1DELA 1PWYE 2XE6A 1QYCA 3PGLA 2XXAA 1QIHA 1DAMA 4J7CA 4K6KA 4RKRA 2VP9A 2V7VA 4U7HA 5A9TA 3V6LA 3DBVO 2XHEA 4EZIA 3VKHA 3RNOA 5I6DA 1JFLA 2WV7A 5LLSA 4UHEA 1CZLA 3K31A 4G4SO 4BE7B 1ZGGA 2W2VA 4RUKA 1QIDA 2NQ8A 4WJKB 4N48A 3K9QO 1E5XA 3KUKA 4ZHQF 3FRJA 3ZHOA 5CXUA 1K7FB 3LZ6A 2XMBA 1SUIA 3FB4A 1QAQA 3W8EA 5LZ4A 3HJCA 3IHWA 2F9MA 3JWPA 2J9YB 3K8QA 4J0JA 4F21A 1RMTA 3AWIA 3DHWC 1TE2A 4YUAA 1E4VA 3QYFA 3DE1X 2MYTA 3IQEA 5HX7A 2P1RA 3WLAA 2ZRNA 3REGA 3RU7A 4YRBA 3KTDA 4DR6B 2Y71A 2IEIA 3IOEA 1V6CA 1WF3A 3K9NA 3EFOB 3Q7TA 4Q1DA 5AYVA 1MW8X 3BFJA 5CNJA 4RYLA 3P5SA 4KU4A 1V7CA 2O8DB 1E1MA 2NPFA 3DCIA 3N1UA 4YJGA 3ELYA 2F9FA 2HJHA 2DWQA 3QBTA 3UXEA 2BR3A 1E7RA 2QAGA 3DHYA 1L8AA 4XAQA 1PFGA 3EY4A 3ETJA 4MA4A 2YYSA 1ZUIA 2HSZA 3A0RB 4UXIA 3EDQA 3WMXA 5JY6A 3C7TA 1J24A 4MVJD 5FWAA 3I9OA 1ULZA 3P26A 3LUDA 3J7AC 1F3LA 1TEVA 2ATIA 2XQIA 1SBTA 5GIOE 5EWLB 2UU9B 3GOQA 4A8JB 1RC1A 2GZMA 5KWVA 1HE2A 5EIBD 1U3TA 1VB5A 3R4VA 1Z6YA 1EGMB 3DM9B 1K27A 1RYEA 5CVJA 2AVNA 4JIGA 1IQ0A 1P39A 3ROZA 3KQUA 3C16C 3ANLA 4AY5A 1ML3A 1Z38A 1QUEA 3L4KA 2RONA 1YR6A 3GQBA 4JGIA 4C6SA 1NOJA 1AHIA 2EKPA 3OAAA 5TQ0B 1E2IA 2XEXA 4RDCA 2JFFA 2EU8A 2DFPA 2JKYA 1Z75A 2PDAA 3O4HA 3OPYA 2WP0A 4HAIA 4BO5A 3QLJA 1M1XB 2CL7X 4EARA 5IKMA 3ZJVA 1B73A 5EMLA 2YV3A 1X8XA 3ZY6A 3KVYA 3M3DA 1MZPA 4IHJF 2IS6A 2ZJBA 3ZJUA 4KGDA 2Y6VA 5DASA 3VDXA 1HT3A 2HA0A 3BFXA 1R27A 3DSRA 2D2IA 1K1EA 4FE7A 1JN0A 4I2NA 5EIBC 3M4JA 4CKZA 3NAMA 3EEOA 2CXUA 1EEXB 1DAHA 2CXSA 3AFGA 3CZRA 3O3NB 4REQA 2G7ZA 2GI4A 4WH0A 4XLTA 4EQZA 1J7JA 2GBFA 3GL9A 5BQFA 4OQZA 3BREA 3D1JA 1USUA 4K6MA 4BNUA 2G82A 4OAPA 4RVFA 1SQ5A 4O33A 3ZDFA 5FLYA 2AG6A 1TLFA 3G2MA 5F1OA 3LX4A 1QU3A 2PT9A 2ST1A 3C4VA 3GJ7A 3W4KA 3WWYA 5ED0A 2GUWA 1ZIPA 4ZVMA 2IX9A 2RH4A 3M4YA 2WYVA 3OZXA 5E9JA 5HOQA 5JROA 2BE9A 5CNIA 4L5IA 4Y6PA 1DI0A 2L82A 2VJQA 3B53X 3JYNA 5B53A 5FBHA 3S8MA 3U3XA 1NJSA 1SCQA 4LDNA 3R8CA 3QY9A 1YB6A 1VDZA 4BQIA 3I2FA 4M0LA 2WABA 2J45A 4PPQA 5I8PA 3O94A 2Z3WA 3I05A 4GF5A 2WDPA 1UKCA 1GKUB 2LVBA 2FSSA 4DQVA 1J20A 1TZMA 5DM60 3ADKA 2I3BA 1B0ZA 3F8WA 3OT1B 1I2ZA 4LI0A 4XX0A 1U2RA 1JEYB 1OXMA 4JXZA 1XMOB 1ADJA 3R1IA 2LRHA 1AD2A 1C0KA 4OJKA 4WXEA 2X0DA 4B4VA 2NVUA 2VYVA 3EUWA 1DNPA 1XP8A 3JQ7B 1AHNA 2VDWA 3ZLVA 3ORRA 1FF9A 2UV8A 5HJ2A 2O0LA 4EDFA 3BK7A 2H9AA 3I8XA 1L7NA 5HQ3B 5F73A 4YAJA 1JHDA 4QYTA 1UUFA 4GKAA 4KAXA 1JHOA 4ZT5A 1PKXA 4Q9AA 1EZZA 1G7TA 4IFBA 5TGDA 4AQ7A 3GFOA 3MGAA 3H97A 5ICGA 1A5AB 5GV7A 1M66A 4PZPA 5DX8A 1Y1KE 3OEED 2OKCA 4LY9A 3QVLA 4JB2A 3NVDA 5FTNA 4HZUA 4RSMA 5REQB 3IELA 4B7UA 4W8OA 2VKQA 1QYXA 4JU8A 4BNTA 1C9NA 5E9WA 5DLEA 4G1CA 5DULA 5IHXA 1OZHA 4ZV9A 1HE4A 4KR9A 2UZ1B 4O0LA 3LP5A 2CNWD 2ZJFA 4M1SA 3GAZA 4TZ6A 2JNWA 4KC0A 4YCNA 3I01M 4K9OA 2QSUA 2FWPA 4X1KA 4TKVB 5CFLA 2WSYB 2CYBA 3RJTA 4CQNA 4QL3A 1ETUA 1Y4SA 3GD7A 4NLLA 4LC9A 1Q0QA 2QUAA 4N76A 4HDOB 3P2OA 2ETVA 4UDXX 1A2OA 4DA4A 1QO7A 2B8TA 3CUUA 2QTRA 2O2ZA 2W22A 3NT2A 3RSSA 2IZOA 5LMZA 2R62A 1ZNYA 3AR7A 5IBPA 2VPXA 1T5HX 1D0SA 1R6VA 3HLTA 1MQ9A 4TT8A 4D2IA 4YRIA 2PGDA 4H7HA 4HPJB 1CNEA 2PZBA 3CW9A 4LJ9A 4JITA 4S2EA 5M3BA 3TXYA 1JFRA 1JDZA 1M0WA 1T5TA 4G1FA 4RA6B 5AKXA 5A6SB 2RK6A 3B1ZA 5F2OA 4BE4A 1X7DA 4PXYA 2ZAGA 3ZLBA 3K9WA 3WJAA 1W5AA 1Y5IA 1JR3D 4UM8B 1CDEA 4W5RA 4TS1A 5FPPA 2Z2KA 3ONVA 1P44A 2FPOA 2IVFA 5C32A 2RJNA 1X7ZB 2WT4A 2AQIA 1GFSA 3VKFA 4WJLA 1UT8A 1PJ3A 2ET6A 1F0NA 4HGYA 1NV8A 1Y48E 5FTKA 1J9EA 5B37A 3B60A 1SXIA 3LOPA 1FP6A 2QRZA 1ABBA 4A8HA 1X77A 2DHCA 5GVRA 1JFFA 2JFOA 3GA0A 4JR2A 1PQUA 3RKSA 4PZLA 4RCZA 2P9GA 1Z6ZA 1JZSA 4GX2A 4M54A 4PWZA 2H4WA 4DJAA 3K0AA 2YJ6A 3ZQUA 4CI0B 4BPBA 1CZUA 1SVWA 4XPIA 4K0KB 2Q4TA 3B82A 1ILWA 1MF7A 4KQWA 4F6CA 1SB8A 4UREA 4QXPA 5L3SB 1E9FA 2OFPA 2E49A 4MH0R 2R1VB 1Q3TA 1OYOA 4GUDA 5A04A 1JQDA 2NMVA 4AP9A 1B3RA 1V8PA 2Q45A 3NTLA 4QUBA 4EFLA 2I4NA 3L4SO 1YD7A 4R3WA 3E3AA 4UHDA 1QF6A 1U8ZA 1A4RA 1XD8A 1HSZA 3OF2A 5CLFA 5ADHA 1BU8A 1V25A 1OZ0A 3UBMA 3ZIDA 2QK4A 3JATB 4UUBA 3ER8A 1H6BA 2PA0A 2IX3A 4MVJG 2W8BB 3HRKA 4LDPA 3T54A 3I39X 2Q2NA 3H7IA 1KO8A 2RI1A 5JOQA 3DKPA 1MX5A 1MP0A 1Y8RB 2WPDD 2QZJA 3LIPA 2F1OA 4D3SA 2AEEA 2Q5EA 4ZOAA 1K8XB 1QLJA 1MIOA 3E9RA 3RUCA 1EFCA 1URPA 2H7XA 1WKCA 2R6HA 3R76A 3PQ5A 4HWSA 4AY4A 1Z4QA 1ZIDA 4HV4A 4TTSA 5D5PA 2ZXFA 4LISA 4V0QA 4F72A 5J1SB 4PAGA 3TDNA 3NDRA 3SHFA 3UICA 4M49A 4E31A 4C6TA 1VPEA 4JBYA 1WPQA 1EX7A 4YCAA 2AE2A 5E3JA 5J5AA 3UMMA 3WYCA 5TC4A 3LW8A 1LDYA 1G6HA 1BA3A 1VG9B 4WGFA 4P6VF 2DT8A 4KO8A 3IAHA 3BICA 1JNXX 3FMFA 2RGCA 3PC6A 3VR3A 3HR8A 2A0KA 4GI1A 3OZBA 1KEZA 2Y1DA 4TV8A 1SUCA 4Q7MB 4A91A 4ZVPA 4CIXA 5JSKA 1IJKA 1UKYA 3CCBA 1SVLA 3L01A 1FRVA 4YAGA 3DLCA 1A9XB 4P3OA 4R1QA 4YQEA 5H59A 2QQEA 3SEQA 3RFUA 3R5TA 4XWTA 4N82A 4R8MA 4LXXA 1DJLA 4EFMA 5IJ9A 4IXNA 5K6AA 4YP5A 4KYUA 4L5BA 4Q02A 3D0KA 1KI2A 3MGGA 1OWLA 3JQPA 4OMCA 3DE3X 1NA5A 2QVZX 5CEEA 4GS5A 1OH6A 4ZJZA 2JEYA 3TW8B 4B43A 4D99A 1Y4ZA 3ZPXA 3EGIA 3O9ZA 1RCTE 2WHPA 1E9BA 3P2JA 1ZIYA 4G8DA 1JEQB 3HMQA 1YB4A 3JWHA 1A50B 1G8FA 1P8AA 2PUHA 3AVQA 4R2IA 2Z6AA 1A8HA 1PT5A 2WT8A 3AETB 1E58A 4B33A 2JCXA 3GEEA 3NHPA 2OUIA 3DMPA 1J00A 1M2KA 3L1KA 1E8MA 5CX4A 4RWZA 2A4KA 4DS3A 3K1AA 8MHTA 3OIUA 4E0BA 5KC8A 4B81A 1DV2A 1HQKA 2V3VA 2C83A 3ELWA 4EL0A 3DQPA 2EKDA 4F96A 2UAGA 5L95A 5EMHA 1PZEA 1W4RA 3L8EA 4LZNA 1ZMRA 4BNNA 2PUDA 2QJRA 2I1WA 5EIOA 3GAFA 2FFBA 4P1ZA 3V8PA 4YRAA 1KYTA 3REQB 3OZSA 5CFOA 2V4ZA 2J5QA 3KHUA 4NJMA 2XQGA 5EIFA 4RVSA 4NSNA 1OF1A 1E1RD 5GZ6A 5JZBA 4LBWA 4EENA 3F78A 5HS4A 1XTBA 1W93A 3EASA 4RZ2A 3EQ6A 1PRYA 2C07A 4JUDX 1K98A 4D3XA 4G0MA 4RLFA 3OUTA 4F4JA 4B3CA 2YMQA 3MXOA 2YWFA 1DBPA 3HJRA 1VLMA 2F00A 5C35A 3G9UA 1T8SA 3FUVA 1GA1A 3MILA 1OLUB 4QPPA 1U0LA 3TE6A 2H4HA 4P82A 4M86A 5HIAA 1E2LA 4NICA 3AOEA 1SQFA 1ZW6A 2XKJE 1ZRHA 3GC6A 4M8IA 3FNEA 2QD5A 3KSRA 4DR3B 2GK6A 1JLRA 3I52A 5F1KA 2C8JA 5A71A 1XTSA 2C4TA 1VIDA 3DC7A 2YY5A 4L4SA 1LW6E 1ZEJA 3AVTA 4WBNF 5SV2A 2WG1A 3JW8A 4CQLB 1P1RA 2AV6A 4Z53A 1EMDA 1B42A 1AZSC 1E6MA 4OXIA 1ZMOA 3PC4A 1FSZA 2C58A 4KFRA 4D4GA 4BAUA 5KYWA 2X0FA 5ALSA 2J5KA 2PX8A 1ZVVA 1BFUA 5AKYA 4H77A 3RJZA 1GUBA 3GBPA 4MX8A 1NVKA 1JJVA 1GG5A 2HWYA 4FUTA 1LVUA 3UKDA 4IUBS 4M46A 2B94A 2F43A 1Q0ZA 4AJNA 3H2HA 3BKWA 2YJ3A 5CJJA 1W25A 1JFSA 1L5QA 3L8DA 4FIZA 3GA7A 3Q4GA 1W85B 1C9DB 4V2IA 5FL3A 4JA0A 3PR1A 1N2OA 1YRBA 4QOSA 4PQEA 3ROGA 4LNUB 5A7FA 4CE6A 1OVMA 4L27A 1FZQA 1T36A 4YT2A 2XRZA 2EWVA 3ME5A 4DUYB 4ZOLA 4AI6A 5CB6A 3CLKA 2CXOA 3ROFA 2XB2A 5CA1B 3HKCB 3C8HA 3HDHA 3AHJA 1OA0A 3E8MA 4NOJA 4GSKA 4X8LA 2K87A 2QV7A 5ARCA 3MSCA 3T9DA 2OHXA 4MKHA 3OZIA 1ONNA 3OZRA 1XG5A 4N9WA 1AZWA 1AXRA 4FB5A 2JJYA 1ORVA 4B09A 1QQBA 1ZNQO 3UJDA 3BK2A 2Q5JA 4D8TA 2CLFB 3IS3A 1CJBA 1Q0HA 1ZISA 2P3QA 3AKYA 1BFKA 4A0QA 4DSZA 5G53C 5K0BA 2WIDA 2Z6QA 4BMOB 1PJBA 3PNKA 1ODKA 4GVLA 3AHDA 2B35A 4JQSA 4YGYA 1XXLA 1Q0RA 1IB0A 4FCCA 1F17A 4MXDA 1D4FA 3KQOA 1EK5A 3MWGA 4C7XA 1BDMA 1BH6A 2MCFA 3SQOA 2Z5VA 5F3RA 3IBTA 3VDMA 5C2JB 1DOAA 4P3PA 3LUBA 3THYB 2IBMA 1M5RA 2COKA 4WESA 1SIWA 2PU5A 4S3MA 2AQ8A 1T1GA 1U99A 2VHXA 3EXHC 2LTAA 4S2UA 1KZGB 3CSSA 1LBTA 1NUTA 4HN2A 3CIOA 4LDQA 4Y2QA 3UK7A 3UB4A 3U61B 1ISGA 1TIBA 3Q5EA 1N7JA 4DMRA 3KKQA 5DIZA 1M34A 1U0OC 3BMNA 4GOOD 5IBQA 3UUWA 4NARA 3BGOS 3GGPA 2YMMA 4O2AA 5CH5A 2HXGA 1NYRA 1G60A 1UBCA 2G8LA 1PT6A 2IXBA 4NHEA 3RTDA 2WEKA 4F3CA 1PSWA 1DL5A 3IIIA 1AXGA 1YI0A 3CG4A 1KI9A 3IJEB 1VCIA 4RZQA 3DBLA 2EBFX 1NN0A 1RAEA 1ITZA 3UJCA 2UYYA 4C0SA 3LT0A 2GN1A 2TRSB 1GNVA 4KIJA 5ES4B 1CYDA 2WPNA 2Y1GA 4H7EA 2O8EB 3RRYA 2O9JA 2HIAA 2GZSA 3GJTA 2LUOA 3KQMA 1SQ6A 3NDJA 3NR2A 4TWRA 4WZBA 3AUTA 1H4QA 2WYHA 3U4MA 2FRXA 2QVCA 4HP8A 4A6XA 4HWOA 1N5MA 3L7DA 1VFPA 1OH5A 3UV6A 5LQJA 3ZWAA 5IULC 3MQ4A 3BS4A 4KW7A 4DA0A 2WIAA 4X63A 1TPYA 1T26A 1JW9B 3B13B 4D8VA 2ZSDA 3PD7A 4G1VA 4K88A 1G17A 5G1NA 4FT2A 2JA1A 3ZHTA 5K20A 3D4LA 2ZBRA 3SE0A 1PR2A 3PP8A 3OFVA 4GGPA 1EVZA 1W0JA 2B1JA 4C4RA 1OLSB 1H69A 1T5IA 3WO0A 1O6CA 1MOPA 1Z17A 5GWXA 1HMPA 2O59A 2WOOA 1H1DA 2XYHA 2YWGA 3HBNA 1H9CA 1YA4A 2H4YA 5HDQA 1NMYA 2E0IA 2ZVPX 4B3FX 1P1KA 5CD9A 4IG9A 2PUFA 3V00A 4FYXA 2ZSFA 3TX2A 4R3NA 5DM4A 3VR2A 1A98A 3G9XA 3DFFA 5CGQB 3THWB 4H2DA 1PJLA 5KYYA 4Z1MD 1QTNA 3OCZA 4N01A 2RH9B 3FJ1A 4I4TA 1NRJB 1XZNA 2QIPA 4EOGA 5J59A 4MUYA 2A88A 2IY8A 1TM7E 5KNCA 2FUG6 2UXDB 1RC0A 2I2FA 2QMQA 1B1AA 3BHMA 4J1QA 1B0UA 3QSGA 4BMDA 1JMKC 5F9HA 1M7BA 2IEZA 5IKOA 5HMLA 4QO8A 1T3LA 1ZXLA 2EKBA 4OL9A 1KZHA 4G4IA 2BH2A 4Q3EA 4MQBA