1FXSA

Gdp-fucose synthetase from escherichia coli complex with nadp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
317
structure length
317
Chain Sequence
KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GDP-FUCOSE SYNTHETASE)
publication title GDP-fucose synthetase from Escherichia coli: structure of a unique member of the short-chain dehydrogenase/reductase family that catalyzes two distinct reactions at the same active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 101
structure length 317
sequence length 317
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 1998-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1fxsA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1fxsA02
3FR7A 4UVEA 5CDGA 4Q3CA 1HZZA 4YT8A 1L1FA 3RUCA 1BWSA 1XKQA 4TKMA 4QUKA 2TMDA 3I83A 2C7GA 2WWRA 1UUFA 4R5MA 3QVTA 3WJ7A 1NX6A 2IEBA 4MIOA 4AJLA 3GY0A 4AG3A 4U7WA 4WEOA 4E5KA 4ROSA 2O2SA 3DAPA 3AW9A 1NP3A 2X4GA 3VHRA 5LDGA 1DOHA 1MUUA 1SEPA 1T2DA 1I2ZA 1R0LA 3W6ZA 1RM5A 3JQAB 1JKIA 5L53A 4NI5A 3FSRA 4BNXA 5L4LA 3I5MA 3GDFA 3VH2A 4MIEA 1JWAB 2DAPA 1NVGA 2HKIA 4OHUA 3U5TA 2J6IA 2O3RA 4I9NA 3K5PA 3TZQA 4YJDA 5EL0A 1E6EA 1BTOA 1BSVA 2JCXA 4ESOA 1P74A 1PGNA 2D5CA 3EC7A 3WGTA 1BXZA 5DBIA 4MP8A 2C54A 4J2OA 1W73A 5JYDA 4RJTA 1WPQA 4ALLA 4DGSA 4NMHA 2RHCA 4E2YA 4BO7A 4BGIA 4HADA 3I9MA 2EJWA 4UVIA 3CKYA 4D46A 1E92A 3KOUA 7ADHA 4OMUA 4IDEA 4R68A 2R2GA 2SCUA 4P22A 3IMFA 4YDRA 3OA0A 1HWYA 1RJWA 4O0LA 2NACA 2JFGA 1PX0A 3ZV6A 2FR1A 1PL7A 4DC0A 2IEDA 4WCFC 5IXSA 5J23A 4RF3A 4XWYA 4MOWA 3IL2A 1MG0A 2O23A 2Q49A 5H83A 1VSVA 3MJ4A 5JYEA 4A10A 1GL3A 3CINA 2WD8A 1MLDA 4B79A 2AXQA 1E3SA 1FK8A 1TEHA 2WEKA 4KUGA 5CPFA 2HU2A 2QQ5A 2X86A 3OJOA 4RF4A 3H3JA 2NQ8A 3EGOA 3VDQA 4CQMB 1Y9EA 1X14A 4OO3A 3LC7O 3ZU5A 2PLAA 3LT0A 4TROA 1PQPA 1X15A 3GK3A 1YL7A 3I52A 5DOZA 4E31A 1W6UA 3PHJA 2XXBA 3QSGA 5AXCA 5CEJA 2IRWA 4AJNA 4CMCA 4OYRA 1ZMOA 2FOIA 2X9VA 4UUMA 3U9LA 4BNGA 1I3KA 2Y1OA 5TLSA 5MDHA 3WGYA 2E49A 4NBRA 3BMNA 5L40A 3R3SA 1UZLA 4IIVA 3ZU3A 1M75A 2DC1A 9LDBA 3LYLA 4UVGA 5DP1A 2NVUA 1C0IA 3DZKA 3BIOA 3IKTA 4IGFA 2D59A 2JFHA 2D1YA 2JFFA 4WNIA 3ZDFA 3A28A 4BMVA 4EJ6A 2YFHA 5IN4A 5DZSA 2P9EA 1LSOA 2AQHA 1EK5A 1D7OA 1KVSA 4UEJA 1I3MA 3NT2A 4P38A 4CUJA 5CDSA 2VCYA 1EFLA 4IY1A 1OOEA 2FY8A 3KHUA 5IN5A 5I7SA 4JBGA 3LC2O 4GMGA 2EWMA 2GZ2A 3OM9A 3E9QA 3Q0EA 4EYEA 3I9KA 3E03A 2OBYA 1Z45A 1HZJA 1ISHA 1E5LA 2O4UX 3C85A 1U5CA 4YAGA 4J1TA 5KTKA 2NU9A 2HMTA 4HP8A 2PD6A 4O6VA 5IDYA 4D42A 3DZGA 4R41A 2Y0DA 4M89A 4XIJA 3WYEA 5CEEA 1ISIA 1E1KA 2Q4BA 1E7MA 3H5NA 1NQ5A 1P1JA 2X7HA 4M1QA 5TGDA 3FNFA 3C3XA 1IL0A 4NQZA 2YZ7A 1QG6A 3JQ7A 3NDJA 5A5EA 2OL4A 1OC4A 1CEQA 4DIFA 5JAQA 1I8TA 4D43A 3R6DA 1Y81A 3MCVA 5T67A 2ZTUA 3WDSA 3LDHA 3GRPA 3DZBA 3GG2A 4WGGA 4E5MA 1LLDA 3W4KA 3KV3O 5IG2A 4GAEA 3UGKA 4Z9FA 3IUSA 1LQUA 3KUXA 4BKOA 1UXHA 4D41A 4PLZA 2FPIA 3NT4A 5U4QA 3L4BC 3ZWWA 4LMPA 4RVDA 4AJOA 4BO1A 3HWRA 4D3SA 1CQJA 4K26A 5TT0A 1V3TA 4O5OA 3CZMA 4R1NA 2VWPA 3D1LA 1JW9B 4BQPA 3WGOA 1T26A 1QYDA 4B7XA 3KSDO 1SBYA 4WLEA 1T1SA 4YT5A 4GX1A 1E3WA 4IQ8A 3VVCA 2CSUA 5COBA 4S1VA 2PA3A 5KOIA 3AUSA 1B8PA 2O3UA 4EEZA 2CF5A 2AQKA 2EW2A 4J4HA 3GEGA 2X5OA 1VKNA 1V3VA 4IDCA 1UAYA 1PJSA 3NTQA 4PLWA 3WSWA 2DTXA 1TXGA 5F1OA 4CL8A 3AU8A 2BD0A 4BNTA 4MP6A 2PK3A 2WD7B 3QV1A 3WFJA 1EZ4A 1SEVA 2H63A 3BMNB 4LCJA 4PG6A 4IJWA 3FR8A 3D64A 4RLSA 1NVMB 1KIFA 3JQFA 4GPD1 3B1JA 1IUKA 2NVUB 1QLHA 3GH3A 4ID9A 3FPLA 3ZV4A 2CNBA 4CM1A 5BR7A 3KSZO 2UDPA 4HFRA 4ONEA 2GN8A 1M6HA 4OOFA 1YOVA 5KCZA 3DFZA 4R1SA 4IDDA 3UCFA 5DDIP 4NG5A 3GGPA 2Q1SA 1V8BA 1VI2A 3GR6A 5JLAA 2JHFA 1MGOA 1HE4A 1M66A 1K3TA 4YJHA 4O59O 1I30A 1J4AA 4HKTA 3IC5A 3OQ1A 3DMTA 5FI5A 1UXIA 2C5EA 3NAQA 3VPXA 3VOSA 4ITUA 1IHYA 1U9JA 2R00C 1H2BA 3AUTA 4OSPA 5EQFA 1DAPA 3GOHA 1P33A 3Q9UA 4FC7A 4IDBA 1UP6A 1DSSG 2RHRA 4N7RA 4AFNA 4E3ZA 1ONNA 3FNHA 4XKJA 2HLPA 1Q0LA 4PLPA 5L51A 3JQ8B 1QP8A 4CM3A 5C7IO 4LK3A 2YJZA 3I9LA 2JL1A 3C1TA 3NJ4A 1FMCA 1M2WA 1IOLA 1K6JA 4IS3A 2CFCA 4FQ8A 2V6BA 3JQ7B 4KDEA 3F9IA 1P77A 3PJFA 3TFOA 4UULA 2GPTA 3U4DA 4D3DA 2BMAA 1TLTA 1H2HA 3S2FA 1B0AA 1ZIDA 2E37A 1V9LA 4OXYA 4RVHA 1NQTA 1UJMA 3G0OA 4JROA 4QFDA 1W8DA 2RIRA 2EGGA 4CV2A 1LC3A 1ULSA 2RCYA 1L7EA 1UXGA 3P19A 3O38A 2W90A 3PYMA 5EINA 1HT0A 3U62A 2DVMA 4CMIA 1G0OA 4FFOA 3R3JA 2AQ8A 1EQ2A 2P9GA 4L0QA 3FTNA 2OXIA 4C7JA 2PY6A 3Q6IA 2GO1A 1W0CA 4JBIA 4CM4A 1C0PA 4IDGA 1LUAA 3A9WA 1XYGA 2H6EA 1H6AA 4W7HA 1T2FA 1GY8A 3L9XA 3U4CA 1H0KA 1AGNA 3JYQA 3H3FA 3SC4A 3PHIA 4B7UA 3I9NA 4GLLA 2Q4EA 3JV7A 4GX0A 5I8WA 1PSDA 3TWOA 4IMPA 4J7UA 1E3WB 4LISA 2ZK7A 1E3LA 3I9JA 4N54A 3ST7A 4IDAA 3KRTA 3CPSA 3GGOA 1O6ZA 2GRAA 4Q3EA 3UCEA 3WMWA 2ZJ1A 1SMKA 4PLGA 4B3JA 2AE2A 3FNEA 1X0VA 4I5GA 1VPDA 3RKRA 2HO5A 1NHWA 5TF4A 2AA3A 1UDBA 4P4LA 1RM0A 1B2LA 2GNAA 4E5NA 3GN2A 2EP5A 4AJIA 3OEWA 2J8ZA 5L95A 1ZH8A 2PZKA 4FIZA 3O4RA 4R54A 5T5QA 5TNXA 3W1VA 5A1TA 4Q3NA 3JYOA 4BIIA 3W8FA 4B4UA 3FCOA 3PFWO 1YOVB 4GMFA 3GPDG 4R01A 1PL8A 2BH9A 4CLDA 3E48A 3E5MA 1Z6ZA 2J5QA 4F45A 2B69A 4KP7A 3OMLA 4YJHB 3VPSA 1DBVO 3HDYA 2I9PA 5JAMA 3DEYX 3QWAA 5JMPA 1P9LA 2P91A 5B12A 2QZ9A 3NYWA 3RIHA 3H65A 1T2EA 4OKIA 2A35A 3ZV5A 3P7MA 4XGIA 1PJTA 2FR8A 4BO9A 3U09A 1K6XA 2NV6A 2G1UA 5ICMA 2FZEA 2VZ0A 3PYLA 3DZIA 2PNFA 4BKQA 4RV9A 3DQPA 5DCWA 3H6KA 3HE3A 1YWGO 3OECA 5T8KC 3KYCA 3WNQA 4L9RA 1XCBA 5U1PA 1QYCA 3AOEC 4RVGA 1ZCJA 3NGXA 3QLJA 2FSVA 3E9MA 1HYGA 2WE7A 3G49A 3ZWOA 1A27A 4YJFA 4A27A 2WJPA 3RFVA 3ZNOA 1U2GA 1UXKA 4DLAA 2B0JA 2RBEA 4BS9A 4W9NA 1RM3A 4CM8A 3BMCA 1DJNA 1ZVMA 4RPKA 3NX4A 1P0CA 5CHEA 2PKQO 4WOJA 4PVCA 2I6TA 3Q9NA 5LCXA 5JDIC 3HZZA 2DQ4A 1KEUA 4CL3A 4CMIB 2AG5A 3N74A 1NR1A 3OEYA 3TOZA 3A4VA 4J49A 3WYCA 1DIAA 2VWQA 3HUDA 2ZCVA 4E2WA 4QTZA 3UH1A 4CM4B 4MVJM 1DXYA 2PKRA 4A03A 4XYGA 5IZ4A 4FSHA 3KB6A 3DB2A 4KWIA 1TT7A 2Q3EA 4E13A 4QEDA 1XDWA 2HK7A 4XX0A 5EMHA 5BSGA 3I1JA 3QWIA 4HFNA 1V6AA 1F14A 5T64A 1IZ0A 1GZ4A 2JHGA 3PYXA 3RASA 1FDTA 4Z6KA 3PJDA 3QY9A 1EVIA 1E7SA 2YV2A 2HSDA 4IXTA 4RZHA 4CLEA 3MJSA 3AI3A 4DIOA 5C3MA 1ZSVA 1CRWG 3GDGA 3JCZA 4EJ0A 4G81A 2VTDA 5I9NA 4CMAA 2GZ1A 1DAOA 2IZ1A 1X7DA 4EEXA 3GZNA 4A2CA 2GD1O 2JAHA 2YQ5A 3RI3A 3RUIA 4XCVA 4BNJA 1H9AA 3GC6A 1T25A 2FP4A 3QVSA 1I36A 1YDWA 3GFGA 1WZIA 5MGBA 5A05A 3OA2A 1A9ZA 3SLGA 4CMBA 2AQIA 4CMHA 4CLXA 1ZK0A 4AJEA 3JQ6A 2D5AA 4N18A 1ZBQA 4XR9A 2OFPA 2CDAA 5DULA 3JYNA 1F06A 1KVQA 2AW5A 2EIHA 3EW7A 2OBNA 2YY7A 3C1OA 4D7AA 3V5NA 1PS9A 3DBRA 4ZQGA 2VYND 4EUHA 2E6UX 1LEHA 4FFMA 2GERA 2BI8A 3GA0A 1A4IA 3KBOA 1D4FA 3M6IA 3KYCB 3D4OA 3PGJA 4JXKA 1KY5A 2HQ1A 1LSJA 1EK6A 3CMMA 4U8GA 5I8ZA 1U1IA 4G5HA 2B5WA 4YJFB 3CMCO 1E7QA 3MEQA 2YV3A 2NVBA 1SB8A 1EBUA 1QYVA 1VKOA 1EVYA 5AOVA 4OJNA 2QRLA 3MZ0A 3FTPA 2HAEA 3BMCB 3E1KA 4CM8B 2ZQYA 3GN1A 1R6DA 4HY3A 3GVCA 1B16A 3K73O 5H81A 1LLUA 3RVDA 4GKBA 1E3JA 5B37A 3MTGA 3Q1LA 5G0VA 2Q1WA 4OQZA 3OETA 4BO3A 2DKNA 3K2EA 4Z0HO 3RU9A 4R4JA 3OP4A 1HRDA 1EUCA 3IP3A 4MIYA 3EVNA 4OGWA 5LDHA 3RUAA 2AEFA 5DNAA 2HJSA 2I5PO 4MVJG 1GFSA 1N1EA 1R4NA 4AVYA 1U5AA 4RF2A 3ZI0A 2GN9A 3I6IA 5JC8A 4NBUA 5THKA 2NLOA 2GGSA 4FFNA 1HE5A 4QECA 4UUPA 2JD1A 4BNFA 1J0XO 5DF1A 1GADO 3VZQA 4CMGA 1OBFO 3OJEA 4TQGA 3GHYA 4RVSA 2DTDA 1NYTA 2UYYA 9LDTA 2D0IA 1NR7A 1BG6A 1I0ZA 1MC4A 3V1UA 1F17A 4ZHSA 5JDCC 1ONOA 1DLJA 1SOWA 3K96A 2H9IA 4FBGA 2BLLA 2DTEA 2NNLD 5B1YA 1QYWA 4H16A 3GZNB 4MO2A 5JCJD 2ZTVA 3TNLA 2Q2WA 2ZTLA 3UCXA 1HDGO 4DYDA 2CMDA 2Q1UA 5ILOA 3BTVA 2JCVA 1IULA 1QKIA 4Z0PA 1PQUA 3C1AA 1U28A 3JQBC 2VWGA 3BA1A 2VN8A 1HEUA 2EHDA 2GSDA 2H5LA 4GH5A 4B4VA 1PJBA 3E18A 4OQYA 4WASA 4O1MA 4FR5A 2PTGA 1HLPA 1HLDA 3EK2A 1ZK2A 1ONPA 5F1PA 2CF6A 2O3QA 3PHLA 4BO6A 4JJGA 1ORRA 5CDTA 4E2XA 1A72A 2I66A 3OF2A 3W8EA 5TC4A 5G2OA 1R37A 2NTJA 3WQSB 4DLLA 4WLNA 5T6BA 2UUOA 3DBRB 1YBVA 2LDXA 4K28A 5B4UA 4MVJH 1P1KA 5BNIA 4YR9A 1BGVA 1KBZA 4YAKA 3WBFA 4NJMA 1KYQA 1DIRA 4ND5A 4RPHA 3TJRA 1EVJA 2OORA 5TJ9A 2H1SA 4GKVA 1JVSA 4R1UA 1VL6A 3DBLA 3B20A 2BRUA 4K1LA 1E0DA 1K5HA 3BHMA 4YT2A 2HK8A 2D3TA 5U9CA 2D8AA 5ADHA 3SBOA 1XEAA 3DAGA 1JLLA 3LC1O 5HA5A 4II2A 5IFLA 4E21A 2Q99A 5CDYA 4BNYA 1JQBA 5HS6A 3S55A 1BW9A 1YJ8A 1FF9A 3RC7A 3WIEA 3D0OA 3DHYA 3JQGA 4FW8A 1UXJA 1PJQA 1B26A 1PU2A 1ZW1A 2VT3A 3RUDA 3VKUA 2ZB3A 1XU9A 2I76A 2Y0EA 1WMAA 3I23A 2Y93A 3QHAA 1D8AA 3L77A 2XAAA 1R12A 1WXDA 4XRRA 1FXSA 3D3EA 4JQCA 2WMDA 3PHGA 3L4BA 3UHAA 2VNSA 4XYEA 4XDYA 2G17A 1I3NA 4MVJP 1Y5RA 3DBHA 1EFKA 3KLMX 4PG4A 1R4NB 4ALJA 3U49A 3F6YA 3HN7A 2I99A 5JCJA 3DBVO 4CM6A 1A71A 1BHSA 4BHTA 4M54A 4WPGA 2FPPA 3B70A 3ULKA 2OOSA 7MDHA 1WNTA 5JNLA 5FFFA 4ZU3A 3PK0A 2CDCA 3RBZA 3VPFA 3N7UA 4J3FA 2DBZA 2B83A 3RC1A 1DRVA 3KYDB 1XA0A 4JJFA 4XGKA 2Q46A 4CLHA 5IXYA 2F00A 4MINA 2VHYA 3NRCA 4NFYA 4Q3BA 3D4NA 4IZIA 1O5IA 1A5ZA 5IZCC 1P3DA 4S3MA 3WFIA 3WGIA 2C2XA 1H9BA 3INTA 4JJIA 1B8UA 4AJJA 1WZEA 4YACA 4J16A 1MG5A 4MP3A 3I4FA 1ISMA 4EJMA 3QWBA 4W7IA 1WLYA 4H15A 1Z7EA 3RCBA 3VZRA 1DFIA 1E6WA 1GU7A 1N5DA 4R3NA 4GI2A 2FPGA 3GVIA 2QYTA 4FJ1A 3ZHZA 3SLKA 1NWHA 2EW8A 4GBJA 4NK5A 5AYVA 4EITA 2QW8A 3GPIA 1PZFA 4UUOA 2XOXA 3WX0A 1HDCA 2DPGA 3DZJA 1JAYA 3QWHA 2NTNA 3ASVA 2C82A 4CMKA 4BV9A 3GEMA 4OAQA 4PN3A 5HBRA 4ZRNA 4RQTA 3OHSX 4YA6A 1B3RA 4IQ0A 4XYMA 4IGEA 3ZH2A 2R00A 1EE9A 1JN0A 4NJMB 3VTFA 3H9EO 4BNMA 3GDOA 3DMYA 4URFA 3RQSA 2GF2A 1DB3A 4FN4A 1F0YA 3ZU4A 3L0DA 5I7VA 3OJLA 4J9VA 5KKCA 3DBLB 3AJRA 3QVWA 1HSZA 5JE8A 4QX6A 1HTBA 2VWHA 1EQUA 2O48X 3ZGYA 1G0NA 3B1KA 3NTRA 3IAHA 3L6EA 4IMRA 1LX6A 5JAIA 3TSCA 1A7AA 4GSLA 4JP3A 4YAJA 5JW6A 4PZCA 1U7HA 1BW9B 1R66A 5L9AA 3ZWVA 1QMGA 5C5IA 3KEOA 2NVWA 3WTBA 2OP0A 1T1RA 3U4HA 3GQVA 4FOSA 2P9CA 1P44A 1CETA 4WKGA 1XR3A 1YXMA 1PQWA 4DREA 1PGQA 5BNFA 4YTEA 1W4ZA 1FDWA 1P31A 5HS4A 5GY7A 2D2IA 2ZYDA 5EERA 2I3GA 2VHZA 4Y67A 3H5RA 4UVDA 3NJ8A 3P2OA 4RL6A 3RBVA 3K2BA 1ZJZA 3DBHB 2PD4A 3GHHA 1J6UA 1C14A 1MP0A 4D0RA 4N5LA 5CG2A 4TSKA 3ZHBA 3IDSA 4BNLA 5BSHA 3AOGA 4X54A 1OI7A 4L76A 3P2YA 5BT9A 5JCXA 5DBFA 2DBVO 3EUWA 3H8VA 1EDZA 4FFRA 3F5QA 3QQPA 4ZA2A 1VRWA 2X5KO 3K8ZA 2CZCA 2I3AA 1X7HA 3I9OA 4RDHA 4CODB 1F8GA 2J5KA 4LRSB 1Z74A 3FBGA 3E82A 1ENZA 4RLHA 5TQVA 4FS3A 5AVOA 5BQFA 3FWZA 3TDKA 3EAGA 5THQA 3PGXA 3CH6A 4OH1A 3RC2A 2NADA 4Y6SA 3LT4A 5CP8A 3ZWMA 2A94A 4WUVA 1PJ4A 1EE2A 2ZYGA 2BGLA 3JQDA 3ETDA 1BXGA 1YONA 2A92A 2ZB4A 4BL5A 5KIAA 4DMMA 4BKRA 2UUPA 3Q2IA 3EMKA 5G4LA 5TSDA 1PGOA 4B3HA 4DVJA 5H82A 4W4TA 2AMFA 1WDMA 4J7CA 3ZV3A 2HCTA 4ALNA 3ICCA 4IDFA 4KTTE 4XQCA 3I6QA 4WEQA 3P5SA 2NTVA 1Y5MA 2W8ZA 2BELA 4FOOA 3ZNPA 1I24A 5ER9A 4DBVO 4DIBA 3MJEA 1DO8A 3MOGA 4ZQBA 3JD3A 4DA9A 2YDYA 3LF1A 1Y9AA 5JMWA 1MFPA 3JQ9C 3O03A 5DCUA 3B1FA 4D3FA 5JBIA 5TIIA 1E3IA 4TKLA 4R69A 1CIVA 3MWDB 2Y99A 2C59A 1QLJA 4D45A 3GVPA 4ZQEA 3QWFA 3TF5A 4I5FA 1YQDA 5T8KA 3ETEA 2VUSA 3QRWA 3DO5A 4E2ZA 3RFTA 4WE3A 1ZK1A 5L7TA 1KC1A 4BMSA 4D0SA 2YV1A 3X2FA 5I9MA 2AEMA 1B7GO 1OAAA 4R9SA 2BFMA 4HFJA 1SNYA 4MKRA 3NT5A 5A03A 1ISFA 3KZVA 5ER6A 1CF2O 4FJ2A 3AM3A 3UW3A 1MB4A 1AXEA 1D1TA 4BV8A 3F4LA 3FPCA 4LVCA 1YE3A 2W2LD 1C1DA 3AY3A 3AY6A 3PHHA 4ALMA 1TVEA 1ZSNA 3GAZA 1PEDA 1C0LA 3PEFA 4IJKA 4RVUA 1JA9A 3QE3A 4FD3A 4TZTA 2B37A 4OL9A 1DHTA 3DHNA 2WSBA 3OQ6A 2OP1A 2IZZA 3VAZA 3FF4A 1RPNA 4XD2A 5GZ6A 5ENVA 1BVUA 1VSUA 2O3JA 1YBMA 3LF2A 3INRA 2FWMX 2FRDA 4XQEA 3COSA 5EESA 1LBEA 2PR2A 4WLVA 1AN9A 5DBGA 4JNKA 3HB5X 1NASA 1NAIA 3IIEA 3TN7A 3NGLA 1LC0A 1OFGA 2IDZA 5A9TA 4CM5A 1MV8A 2BFPA 2EG9A 1SCUA 3W6UA 4AJ1A 1DRWA 4RDIA 3CTMA 2HJRA 1EDOA 4RORA 1E5QA 1E77A 2AEJA 1EUZA 4J1NA 4ND2A 1K89A 3RUEA 2BGMA 1H6BA 1S6YA 1UP4A 4QQRA 1YBAA 2IYOA 2HMWA 2OHXA 4YVFA 1ID1A 3W8DA 3WXBA 4AICA 1GYQA 1GV1A 1P1IA 2C0CA 2X58A 3JTMA 1BXGB 3AI1A 3EDMA 2Q50A 3HDJA 4GGPA 4K9DA 4Q3AA 3TL2A 4BNNA 3QVOA 4NIMA 4ALKA 1ZK4A 4PG5A 1Q7GA 2IZ0A 1LLCA 3PDUA 3DOCA 2YUTA 3R0IA 1YJQA 3DONA 4JIGA 5CAEA 5K6AC 3E6AA 4K6CA 2FHSA 3PQEA 5HM8A 1GQQA 3GRKA 3G3EA 4JX8A 2E4AA 4A26A 4CMEA 3T4EA 2DUUA 3H9JA 4XJSA 3I4CA 1JWBB 3OIFA 4QSMA 5IDWA 4GQAA 3RJ5A 1O8CA 1M76A 2Z1MA 3GLQA 1ENPA 3LT2A 3PZRA 1VJ1A 4NJOA 4XQGA 4ZGWA 1F12A 3NKLA 4D44A 2NUAA 1JVBA 3RBXA 3DOJA 3U4IA 5FWNA 1ENYA 1R16A 2IXAA 3OH8A 4Y6PA 4IQGA 1Y7TA 2EKPA 2VRCD 1PR3A 2W2LA 4YRDA 1NVTA 3QIVA 1NWCA 3ZW9A 4YT4A 4G65A 5JFOA 2CVZA 4EDFA 3GUYA 3G79A 2P68A 2XF8A 3BYZA 3GAFA 4KZPA 4H7PA 3EYWA 5C7LO 4PZDA 1NQAO 4FDAA 4M49A 1GR0A 1T4DA 2Y1GA 5A06A 2IE0A 3SC6A 2FSSA 3ITKA 2F1KA 3VH1A 3KSUA 1C1DB 1GCUA 3ASUA 3VC7A 4YRBA 2YQ4A 2DU8A 3LVFO 1Y8RA 5KJCA 3GMDA 2EP7A 3L07A 1GEGA 4AJ2A 2E82A 3PTZA 4Q9NA 5CDUA 3IJRA 2Y05A 1QORA 1CYDA 2ZYAA 1E3EA 1AUPA 2JD2A 5AQ1A 1PIWA 5L4NA 1LNQA 1SAYA 3KO8A 3SJUA 1HE3A 1B14A 1PWZA 4PLHA 1O95A 3ZWPA 1AHIA 4NFSA 5DT9A 1IYZA 3F3SA 1GYPA 1HXHA 3F1KA 4UEOA 4UEKA 4A0SA 3BTSA 5G0WA 2FMUA 3STHA 4TMFA 3QVXA 4CV0A 2A9FA 1WAMA 4DTIA 2RH4A 3A1NA 3PWZA 1FDVA 4J2HA 4KUHA 1QXSA 3SEFA 4BNVA 4MVJD 3PXXA 2GASA 1VJ0A 1DLIA 3F1LA 2NU7A 3JQAD 4CV3A 1U3TA 5KJEA 5B4VA 4RVFA 4P4GA 1BVRA 1YL6A 1NXQA 5IAAA 3WGHA 3H9QA 3VPGA 3WWYA 3GG9A 3V1TC 4NBWA 3DC2A 1ENOA 3RAJA 2Y67A 1J5PA 1E7YA 2DBRA 3HG7A 3AY7A 3VPHA 1HYEA 4L73A 4RCVA 4EBFA 1JAXA 4XRGA 2V6GA 1WVGA 4XA8A 1D1SA 5AXDA 4BGEA 1HKUA 2NSDA 2P4HX 3G1UA 4DC1A 4YAIA 5JSFA 2VRCA 4LVUA 4CUZA 2BFOA 4BGUA 2X9NA 3JQCA 4J0FA 2AE1A 2J3KA 4L75A 4NBTA 4ZVVA 3C8MA 4M86A 4QXMA 4U0KA 1ZSYA 3E5RA 3U0BA 3G17A 1U3UA 1DFHA 2DLDA 4J4BA 2GN6A 4GVXA 5I9LA 4E5YA 5A02A 3PP8A 4CQLA 3K6JA 4U6SA 5F5NA 5FF9A 5GMOA 2PGJA 4ZD6A 5HWSA 5IJZA 2ILTA 1YB5A 3WGGA 3D4PA 1TI7A 4J6FA 3RD5A 1R0KA 2P5YA 1BDMA 4ZQFA 3ZW8A 5JO0A 1ZEJA 3HN2A 3ONDA 2O50A 4E30A 4PGFA 3V8BA 4FB5A 2DUWA 1P0FA 1QR6A 3UVEA 2C20A 4MVJE 2VQ3A 4I9UA 5LC1A 1ADGA 1ZMTA 3PPIA 4R9RA 5JC1A 1IHXA 4J0EA 2VUTA 3GMSA 4P8RA 2J5RA 4J90A 4J91A 1FJHA 3AM5A 3DTYA 3EZLA 4W6ZA 2WYWA 1DC6A 3HDHA 4LSWA 5JS6A 3GF4A 4N5MA 1S7CA 4BGVA 2BI7A 4Z3KA 1LXCA 3CXRA 2ZKLA 2JCYA 3ABIA 4NHEA 5FI3A 3WLEA 4M55A 3UFXA 1LRLA 3DZHA 1N92A 1Z7BA 1X1EA 3AUUA 3PDJA 2C7VA 2O7QA 4CR8A 2V6FA 2R6JA 4LSMA 5FEUA 1V3UA 4NU5A 4DPKA 3EY4A 3WQQA 4AJPA 4W82A 4WCFA 1ADBA 4F46A 3ZWCA 3L6DA 4B4WA 5BSFA 1V0JA 3BTOA 3GVHA 1ADFA 1LQTA 4L74A 3RFXA 4WCDA 4DWVA 4BO8A 4YAEA 3EHEA 4JBHA 3H5AA 1XG5A 3ZWYA 1ZXLA 3ZNQA 3F5SA 4ILKA 3DOOA 5IZCA 5A04A 4WLFA 4C7KA 5EN4A 4CLOA 4A73A 4B4OA 1PZGA 4J1SA 3M2PA 3DL2A 1P1FA 3INGA 2Y66A 3WWZA 4AJ4A 1LDMA 4KMSA 3JD1A 2PZLA 3NEPX 5KVSA 4HWKA 3ROPA 1E1NA 4DUPA 4IPTA 5KVQA 3ZHYA 3TZKA 3JYPA 4IZHA 1AHHA 1SPXA 5C37A 2DBQA 5BNTA 4GX5A 2VYNA 1DPGA 1LSUA 3HQ4O 1LDEA 4E6PA 3UICA 3ICPA 3M2TA 4M87A 1JKJA 4FGWA 1HDOA 2FR0A 1ZJYA 3TRIA 1Z82A 4W99A 5GZ3A 1DDOA 1PS8A 4UREA 4O63O 1X13A 2W98A 3SX2A 5TS3A 3C7AA 6LDHA 2ZATA 4K6FA 3NDIA 1SZJG 4QT0A 4E32A 4CQLB 2XPCA 1LDYA 3E9NA 3TZHA 1NFRA 4KUEA 1BMDA 2O3TA 1UR5A 1XHLA 4IINA 2IXBA 3AWDA 3LLSA 2X9GA 4NDNE 4BNHA 4L8VA 2JD0A 1MC5A 3WG9A 4C4OA 2FN7A 5L45A 3T7CA 3JD0A 4XYBA 1Y1PA 1U2DA 1I32A 3AFMA 5DCYA 3Q2KA 3BAZA 5G0TA 1K2WA 5KNLA 3UAGA 3WR5A 2PV7A 4BNUA 1X7GA 1XU7A 4RQUA 5CEFA 4QO7A 3PQFA 3U3XA 3T4XA 1WWKA 4Q39A 4TWRA 2V6MA 1NQOA 3HNPA 3ROQA 4RPGA 2C5AA 4FFPA 2YW9A 3OIGA 4B8WA 2G5CA 4HFMA 1I5RA 3TZ6A 1XLTA 4G2NA 2G76A 3WYBA 2P2SA 2Q2VA 2WTBA 4R16A 4QFCA 1KOLA 4Y6RA 4KQWA 2DT5A 2EKQA 3DHEA 5L7YA 3V2HA 3MOIA 3PVZA 3EZYA 3RSHA 5A4DA 1JU9A 4TRRA 5ITVA 3DXFA 3CE6A 1YB1A 3WTCA 4WCFB 1PZEA 1T2CA 3ZWBA 3A06A 5A5FA 3HADA 4PG8A 5DOVA 3VDRA 2Z95A 1LRJA 2OGUA 2PD3A 3DDNA 4YXFA 1KVRA 2CVOA 3DAFA 4P4NA 3PWSA 2OZPA 4IS2A 4U6QA 5COQA 2HDHA 2Z5LA 3MJCA 1HDYA 3KXDA 4HBGA 3ZU2A 4DMLA 4B7CA 3O8QA 3QA9A 5I7FA 4CLOB 1NPYA 1KVUA 4XGNA 4YEDA 2OMEA 5DN9A 4INAA 1ISGA 4KTVE 1I10A 2EEZA 4NNJA 1NHGA 2QHXA 2NU6A 3BXXA 3RUFA 3WSVA 1HL3A 4YCAA 3VTZA 4XR4A 2X6TA 3AFNA 4LN1A 4XQ9A 3CIFA 5HTOA 3TOXA 4YYZA 2UAGA 3BMQA 3FRJA 3KM0A 3GNSA 1LA2A 4IXWA 3GGGA 1U3VA 2CDBA 1A7KA 1VC2A 3VVBA 1C0KA 4ND3A 4PCVA 1GCOA 1U3WA 2JJYA 1NPDA 4OKNA 2ZIZA 4NR0A 4UUNA 1DC5A 4L4XA 1DC3A 2BF7A 4ZQHA 4NU6A 1GD1O 1KEWA 4GSKA 1HSOA 4N5NA 1Q0HA 1VLLA 4WNCA 3JQ9A 5C7OO 5KJ1A 1YO6A 4Y8VA 4FFLA 2Y0CA 1DJQA 1DC4A 2EKLA 3DTTA 1X1TA 1IE3A 4CV1A 2QZZA 2NQTA 2O7SA 3FWNA 2JAPA 4NH4A 4WK6A 6ADHA 3VZPA 3ONEA 3UN1A 2CUKA 1L7DA 1E6UA 2CD9A 4IJUA 2WD7A 1GAEO 1VL0A 3ZNNA 3K9QO 4JGBA 1GUZA 3FD8A 3SVTA 1Y8QA 1KS9A 2ET6A 5A3JA 3OJFA 8ADHA 2B36A 3QP9A 1LDGA 4XB1A 4TZKA 3NV9A 3W4IA 4OIMA 1ZO8A 2UVDA 4DQXA 3BHJA 3GZ4A 1SB9A 3ZHXA 1A9YA 4EUEA 3DZFA 2GYYA 4WOKA 2C07A 2J3HA 4FJ0A 3JQGB 1HDRA 3TL3A 1DHRA 4BNWA 3F4BA 3QJ5A 3ANNA 4MKZA 1DIBA 3IP1A 4ZRMA 4RPJA 1PGJA 2A4KA 4Z9YA 3WOHA 2WYUA 4TRNA 4B3IA 1Q2XA 4DYVA 1IPFA 3IUPA 1EEHA 3C7CB 5G4KA 4E4YA 2RH8A 1TA4A 4JLWA 3JYLA 4PRKA 2BGKA 3JQ8A 4J43A 5EQDA 1UH5A 4HXYA 3JD4A 3WLFA 5IF3A 1DIGA 2GUGA 1P45A 4R5HA 3D7LA 2Y1DA 1I01A 4NBVA 1XGKA 1CWUA 3M1LA 3QW2A 3EVTA 4Z3DA 4MJLA 4WLUA 3FNGA 3K30A 3O8QB 3PI7A 3JQEA 5KVCA 1LU9A 5AXAA 3BMOA 3PIDA 2EERA 1YL5A 5TT1A 3PJGA 2WE8A 4BVAA 3OICA 2IYPA 3MJTA 1Y6JA 1ZEMA 1E1LA 4BNIA 5ILGA 5JXWA 3LQFA 5CPBA 1NPTO 1PJ2A 4CMJA 1RM4A 3WGQA 3E8XA 4EGFA 3MWEB 5ES3A 4PFJA 2EV9A 3KYBA 1WW8A 2FZWA 3BMQB 5A9RA 1KETA 5K6AA 1MXFA 1IZ9A 1XWFA 3TFQA 4DBZA 4BNKA 4AJHA 4CLRA 4HNHA 2ZJ0A 3PWKA 4PLTA 3RKUA 2X23A 1QYXA 5G0UA 3R1IA 1KEPA 2QRKA 5IDQA 1A4UA 1ZXBA 4I1IA 1RWBA 1JTVA 1YRLA 2C29D 2VTEA 4B8ZA 3RJ9A 4BQRA 3AU9A 3K92A 3KEQA 3OBBA 5F5LA 3ZCXA 3HSKA 4J1QA 3ANLA 3AUAA 1PJCA 1NNUA 1O89A 2PGDA 1ZNQO 1HDZA 3LLVA 3LZ6A 5L4SA 4FC6A 2J3JA 1QV6A 4NPCA 4J4TA 2JKVA 3CEAA 1GUYA 2YHIA 1KERA 2DFVA 3H2ZA 2HRZA 2QYSA 4XB2A 3W4JA 3D5QA 4Y98A 3OIDA 4HNGA 1PWXA 1H6CA 1Y8QB 4EI2A 1YDEA 3L4SO 4L4RA 3CUKA 2B4TO 3ANMA 4M8SA 4OSOA 4QO8A 2POQX 4BMNA 3AOEA 2O4CA 1CERA 2AG8A 2OUIA 3IKVA 3ITDA 4NZ9A 5K9ZA 2OO5A 4RO0A 1RKXA 4Z0TA 2VNAA 5ICSA 4FGSA 4ALIA 5JAZA 1HDXA 3LT1A 5JPIA 1PGPA 4KOAA 5ITWA 4GWKA 1VL8A 3GNTA 3ETGA 1T2AA 1UDCA 4U0JA 4PLVA 1CQIA 1LLQA 3SJ7A 1EBFA 1X0XA 4MVJI 3MJVA 1E7WA 2VHVA 1TB4A 4DPLA 3D3WA 1U4OA 5JDIA 1HYHA 2QRJA 1E7RA 3ZWAA 1XQ1A 4WLOA 2DM6A 5G4KB 1ARZA 1WMBA 2PWZA 3VH4A 5FYDA 2VHXA 1V35A 4CM9D 4ND4A 3KETA 1N7HA 3WBBA 2PZMA 3WMXA 4LRTB 3FHLA 3L9WA 1EMDA 5KKAA 2YHUA 3WIDA 5A9SA 4XIYA 3PLRA 1N7GA 4BO5A 2X0JA 3HB4X 4PIVA 3H9UA 3RU7A 5JY6A 4BKUA 4DL9A 1C3VA 5IDXA 2TMGA 4PLYA 1PJ3A 2EJVA 3ORFA 1LJ8A 3BMOB 3AK4A 5L3ZA 4D79A 4UVHA 3GT0A 2VOJA 4I5DA 1G6KA 4BB5A 5KWEA 3HHPA 2BKAA 3OJ0A 2VZ8A 1YKFA 1VM6A 3FI9A 1DRUA 1ISJA 1H94A 4AJKA 3S1LA 3PLNA 5HRUA 1N1GA 3N58A 2Y1CA 1OMOA 1SO8A 1B3BA 3MTJA 1XIVA 5TRTA 2HMSA 5TJHA 1WP4A 1XELA 4YB8A 3CZRA 3ROMA 3VH3A 3ENKA 4RPLA 2O2YA 1PL6A 1I2BA 5KVVA 4F6LA 4KDFA 3GUCA 1M6WA 3UXYA 3PRJA 4DRYA 4CLRB 2VUUA 1DFGA 1PZHA 3V1YA 3S8MA 1MFZA 4BKPA 4OOEA 4GWGA 3AM4A 4BO4A 4E5PA 2I67A 4OM8A 1ZKMA 3H4VA 4MPDA 4BNZA 1K0UA 2ZTMA 2BFAA 4GVLA 2QIOA 4IJVA 4OXNA 2PFGA 4II3A 3PZBA 4YPOA 1GQYA 1U7TA 2V65A 4LMRA 4LCEA 3VZSA 4CUKA 4KQXA 1DEHA 1LTHR 1NTOA 2HMUA 4R1TA 1VE9A 8LDHA 2X0NA 2B4QA 5I7EA 4CM7A 3V2UA 3HFGA 3JD2A 1B15A 3UUWA 2EF1A 2YHIB 3HJAA 1N2SA 1H93A 3BHIA 2P5UA 1LDBA 1NAHA 4U5QA 1B8VA 3F47A 4TRJA 3HFSA 4EUFA 1AXGA 2LDBA 3WNVA 4BB6A 1IY8A 3ENNA 3S2IA 1GYRA 2QG4A 3IOYA 1AE1A 3H2SA 1P1HA 2ZB8A 2PZJA 3KVOA 4CM9A 4TVBA 4DQVA 2NM0A 3JQFC 4NFHA 1ZZEA 2X0RA 1IPEA 1Z75A 1SC6A 4LW8A 4YQYA 5K0ZA 4HV4A 3ZN2A 3C7DB 2YDXA 3Q3CA 2E48A 1NBOA 4YJGA 3D3WB 1YS4A 4E12A 2GDZA 1Z73A 2WYVA 4A7PA 4PRLA 3RC9A 1Q0QA 4JP2A 4F6CA 1YH3A 3A14A 3OQBA 4YQZA 3DMTC 3KLPX 4OXKA 3WICA 1Q7BA 3ADPA 3NTOA 2EXXA 4DQUA 5L7WA 1N9GA 4I08A 5JY1A 4MVJF 1GTMA 2RAFA 3L6OO 2GR9A 3GFBA 4A5OA 5F1KA 5A9SB 1LDNA 1D3AA 1YQGA 1BRMA 1ML3A 1KEVA 4PLFA 3LU1A 1T24A 2B35A 4Y9DA 2GZ3A 3Q11A 1YQXA 2VT2A 1N8KA 1C1XA 4I5EA 1ZUD1 2VZ9A 4RGBA 1JKFA 2X0IA 3WJAA 3WQRA 3DWFA 3F46A 4IBOA 4RF5A 4Z9XA 2I65A 5JDCA 4HUJA 3V2GA 1LSSA 3PFFA 1J49A 2Q1TA 1MA0A 2X5JO 1KVTA 5CG1A 2AHRA 1QSGA 1RYEA 4GLOA 1ZK3A 4EW6A 1GZ3A 1RYDA 1UP7A 5DP2A 2NU8A 4XYLA 4CR6A 2CVQA 1FDSA 2PH5A 2PKQP 4XDZA 1GPJA 3JQBA 1TT5A 1HE2A 2HUNA 1I33A 5JO9A 2VRBA 2VOEA 1JDJA 3BZUA 2B4RO 4YBZA 4Q3DA 3FN4A 4E33A 2NWQA 3CSDA 3M1AA 4J7XA 2Q45A 4MKXA 4ZICA 1U8XX 1PTJA 3S2EA 3O26A 1CJCA 4DLBA 4XEHA 1PR9A 2YYYA 3LSYA 3WS7A 4CJXA 2V7PA 1U8FO 4XZ3A 4YRAA 3S2GA 4TVOA 3FBTA 1U4SA 5CFZA 4YWJA 1PJLA 2Q2QA 1SOVA 2Y68A 3LK7A 3IS3A 5F3RA 2Y1EA 2DFDA 3UOGA 5ENDA 1R4MA 4H3VA 3IQDB 3ONFA 2Z1NA 2W2KA 3GVXA 4JK3A 2VYVD 3SXPA 1QV7A 4BO2A 1BDBA 1NM5A 3PQDA 1XQ6A 2O3SA 4R51A 3UF0A 3GNQA 4KWHA 4IIUA 4CPDA 1UZNA 1QRRA 1UZMA 3D5TA 3NUGA 4GL4A 3TZCA 1GPDG 1K6IA 3BTUA 4XJTA 4CMEC 4CQMD 2ZQZA 4I8XA 4ZJUA 3AI2A 1EVZA 5AXBA 2UV8A 2DPHA 4J9UE 4JCOA 1OC2A 3PIIA 1KC3A 1Q7CA 3ZZNA 4YJGB 3T7EA 1CDOA 2YFQA 3DFUA 3JSAA 2WDZA 1O9BA 1H6DA 4MDHA 1LI4A 1ADCA 1Y8RB 3GEDA 1I2CA 5KJ6A 1HF3A 3HDQA 1LRKA 1N9GB 4BO0A 1O0SA 4MVJA 1G1AA 1F8FA 4FCCA 3JQAA 2W4QA 2HRBA 4WECA 1KY4A 5A3VA 4CR7A 3C24A 1GV0A 3B6ZA 4TRMA 4EZBA 1PS0A 1NFQA 1ZFNA 5COAA 2GLXA 5EPOA 4R3WA 2VHWA 2WM3A 5TX7A 4ND1A 4GGOA 1BXKA 3H9GA 1C1XB 3G1TA 5KJFA 1WDLA 4ZN6A 4DXHA 4NK4A 2Y1FA 1ULUA 1Q1NA 4W9NC 4IM7A 2HK9A 4PLCA 4PZEA 3TQHA 4HX5A 4E0BA 3I3OA 1YB4A 2CY0A 5EIOA 4BUCA 1UDAA 3ZWXA 2B5VA 2J3IA 3OSUA 1E1MA 2ZCUA 1P1RA 3ROKA 3NDRA 2QX7A 2X22A 1GDHA 4JN6B 2EGHA 4L4SA 1TT5B 2PH3A 4RZIA 3K31A 4FPXA 5B4TA 2IODA 5BSEA 2G0TA 2X8LA 3UKOA 3ADOA 1GZ6A 3WB9A 5T57A 1OZAA 3ZWNA 2VYVA 3O9ZA 3IJPA 1IB6A 3ON5A 1GUFA 1DIHA 1HETA 1R15A 1GQ2A 3DR3A 2HMVA 3KYDA 1O94A 3RWBA 1NFFA 4UAGA 4LGVA 1I3LA 2BHLA 3VKVA 1XSEA 5G0SA 2XXJA 1T4BA 5EJ2A 4PVDA 1R0SA 3KTDA 4CQMA 5F21A 1EUDA 2PGLA 4WJZA 1R4MB 2X1HA 4IUYA 3RUHA 4BOYA 1WDKA 1YVEI 2GCGA 2D4AA 2W2KB 4I9HA 2G82A 3PJEA 3X2EA 1FDUA 4GX2A 1UAGA 1YGYA 3WGZA 2ZB7A 2C2YA 3OFSA 4PG7A 4DPMA 4AL4A 3RROA 4F3YA 1M67A 3H7AA 1GEEA 2GN4A 1MXHA 1H5QA 5GZ1A 2P4QA 1MX3A 1VJTA 3TPCA
chains in the Genus database with same CATH superfamily
2PMEA 2Q6TA 1FBTA 3PD7A 4P4SB 1YHNA 3GU3A 1SCJA 2FPOA 3B60A 3L7BA 3Q87B 4Q3CA 3ZE9A 1T29A 1R0ZA 1QNLA 1Z37A 4K9QA 5CLGA 3EDCA 1XKQA 4WFKA 4QUKA 2TMDA 2BTQA 1V8FA 4U00A 3I83A 3TMKA 4KLCA 3ZQKA 1N3BA 4C6TB 4NYIR 1L0BA 2OK8A 2XZLA 1WXXA 3GL9A 5ED0A 1TKRA 1YTUA 4QARA 1FEZA 4AJLA 3GY0A 4O2AF 3NIFB 3K0KA 4U7WA 3NASA 3SFZA 3FM9A 1SA0B 3DAPA 4IIJB 3ZD9A 2DOKA 2ZU0C 1XZKA 3Q3EA 3FPFA 3TZBA 4A0QA 4A2PA 5B3JC 1AV6A 2OWDA 2X4GA 3FJYA 3BD8A 5FBRB 5LDGA 2PUJA 1MUUA 5DTRA 1SEPA 1T2DA 3AWIA 3O95A 5IULC 1I2ZA 1R0LA 1OFHA 1ZQ1A 2P11A 5KWJA 3AVQA 3MWKA 1EWVA 2XA2A 5B1IA 1B00A 1RYNA 3I5MA 1IEXA 4HN9A 4TWBA 3VH2A 4EW1A 1NVGA 1WXGA 4NZOA 1KJJA 5E4YA 2J6IA 2O3RA 1REQB 3ZHOA 3TSOA 1WBBA 2QL9A 3LIIA 4YJDA 2KSQA 3T7TA 3HKBB 3GXOA 2RGWA 1V5EA 4QRHA 3EC7A 4GF5A 1UBCA 4JA0A 5JBNA 5DBIA 1QGAA 4ESHA 1SHUX 3ZUGA 4PO9A 4FBMA 2VPYA 4PZAA 3N0WA 1E59A 4C2AA 2YBEA 3D3NA 4ZHQA 4EHNA 1SHZA 1M9NA 2RHCA 1KJ8A 3WLKX 4BO7A 4E2YA 2CLOB 3KEFA 1B4DA 3T06B 2Q6LA 1EFDN 2QPAA 5IEBA 3R6WA 1RKVA 4AKSA 1KFCB 2BEUA 1N5RA 7ADHA 3MC1A 1L1QA 5KC8A 3ZDBA 1RRMA 4YDRA 3OE1A 1W4AA 3MLEA 1RJWA 3OA0A 5LXTF 4HVLA 5KNBH 4CDRA 1VPEA 3MAGA 4HNUA 2I2AA 2FZLA 3UB4A 4C88A 1Y1KE 1PL7A 4KVFA 1II8A 2IEDA 4I55F 2DRIA 4WCFC 2VL7A 5HOEA 1JQ3A 2J3DA 2PO5A 3DEFA 2FMTA 1QZZA 2GAOA 4MOWA 2PSSA 3PNYA 4Q1AA 2O23A 3FYCA 4L8GA 2GK3A 4PYLA 5DXAA 2OCAA 2FSPA 4L6CA 1VSVA 1V8OA 1XEWX 4ZZ1A 2UUBB 4J2TA 4UTPA 3I62A 3QKTA 3CINA 1MLDA 4INOA 4RIIA 4UNIA 4YR7A 5AKLA 2GO7A 4OHWA 3QEBZ 2I6QA 2E5WA 1NT2A 4L2IA 5DIZA 2HU2A 3E61A 4AUKA 3SSAA 4QT4A 2Q3JA 2C3UA 4OA5A 3BXGA 4IOJA 2CHEA 1U80A 3RTDA 5AP9A 1LVHA 3H3JA 2PM8A 2D1SA 2Q07A 5CH8A 1ZD9A 2B21A 1V5GA 2QLLA 4ZC8A 3VDQA 4DIDA 1YDMA 2H7XA 3Q8XB 4UBLA 3PA8A 1O57A 3GP5A 1KBOA 4O4LB 2X0DA 3KDAA 3T6KA 3PHCA 2NAPA 3GK3A 1YL7A 2N47A 5LVAA 4FUQA 1QTQA 2IK8A 2WAYA 5CB4A 1IJEA 1P9WA 1DVRA 4PF1A 4M60A 5E3HA 2IRWA 2B7LA 3NPAA 1UDXA 1IWPB 1ZMOA 4CMCA 1TMGE 4YECA 1KP2A 2C96A 2O07A 1F2UB 2QMZA 2XLCA 4RS3A 4AX8A 3NHAA 5LQRA 2CL6X 5MDHA 4TM7A 1E64A 1M1ZA 2P0YA 2E49A 3RREA 4WERA 4IIVA 2JKZA 3LDFA 4BQIA 1GSOA 2BY4A 4NYJQ 5JCPA 1IBMB 5KX5F 1BFDA 3H5LA 3M4JA 1Q7TA 1LF5A 4IGFA 4KXFB 4OFWA 2G28A 3GRRA 4HWTA 2D1YA 2JFFA 1THZA 1ZJJA 3B9PA 3ZDFA 2IWRA 1OCEA 2AQHA 4FU0A 3OURA 4RMJA 5DGCA 2AZMA 4C4PA 4AMBA 4J1JA 3LKVA 4ARSA 4CUJA 4NMLA 2PUTA 1D4OA 4TLAA 3TLXA 4IY1A 5H68A 1QRSA 1OOEA 2FY8A 1J97A 2E7ZA 2J9RA 2J33A 3N59A 4MQUA 4YCNA 3O3CA 4GIBA 1TJPB 4XDGA 2YL2A 3P32A 2EWMA 4B3DA 3OM9A 3P45A 4DADA 1T36A 2NSLA 1YE5A 4EYEA 3C8HA 3E03A 3W5CA 3PEVA 3IIMA 1ISHA 2FW1A 4BVEA 3TTSA 2XD9A 1N0IA 2V6IA 3HU5A 4MI9A 1R27A 4O6VA 4U2CA 4A0GA 4R41A 1XD8A 4M89A 5SY6A 3FDIA 4D9KA 2XGSA 3H5NA 2ODAA 1NQ5A 1P1JA 2X7HA 1ZP6A 2AFHA 4HH1A 4M1QA 4N01A 4ZC1A 4AWAA 5D3MA 1IY1A 2X42A 5A5EA 8GPBA 3THXA 1OC4A 1E1RD 2JDIA 5FBVB 2PKXA 1Z07A 1XLTC 1D2CA 1E94E 1JRLA 1Y81A 3MCVA 3WL4A 5HK9A 2JIOA 1P4JA 1PD1A 1OYVA 2OCIA 3IAUA 3KT3A 4FTWA 1DKOA 1JMKC 1HA3A 2Z4SA 2OMKA 3FTCA 5C8ZA 3W4KA 2G5TA 2BSAA 4MARA 3TG8A 3K09C 4CT4B 3KWFA 1W9MA 4DWOA 2B8NA 1E9FA 2YIJA 3WA6A 4BUJA 2I3DA 4QDZA 4Z9FA 5TPWB 4BKOA 4RVOA 1W29A 2XZTA 3ROTA 4BB9A 5AOAA 1Z7YA 4DCPA 3UY4A 3NHJA 4Z1MA 3L4BC 3K6KA 1A8UA 3BH0A 4LS3A 2ZR9A 4B09A 4AJOA 3ZWYA 2ZT8A 5CYPA 1X2EA 3LX6A 1QUFA 4RY2A 2RIPA 3B8HA 1K06A 3SR4A 1N8TA 4H4EA 4JENA 1JW9B 1RWWA 1NMEA 2AJLI 3R76A 1L7AA 1CVRA 1QYDA 1ZNXA 2W6IA 2BSQA 2H7VA 1C50A 2C8KA 4MQ4A 3O8RA 3ZS8A 1IJFA 2IITA 4JZYA 1T8PA 2CSUA 2VP4A 3D7NA 3IO5A 1BMFA 1DMSA 2J1LA 2WINI 1C7ZA 4M83A 3RS7A 1NURA 3BBLA 1ZQ9A 2K87A 2UVPB 2X5OA 1UADA 1W44A 1U5BB 5FFNA 4OMCA 2NSYA 4UASA 2HU5A 4PLWA 4WBSA 4D81A 4FOPA 3V8RA 2H06A 4OHKA 2AXEA 5BNZA 1C9YA 2IL1A 4J16C 1TC1A 4U7JA 3K3PA 1LTKA 1W76A 3QELA 1CUSA 2BKVA 3AU8A 4L0CA 1JHPA 2XIQA 3IKJA 4JBWA 1EZ4A 3FETA 1L6RA 2H63A 4HMPA 4YROA 4P2BA 1NZJA 3OOSA 3OLQA 1KIFA 4RLSA 4KHPB 3NBYC 4TPKA 3DDZX 3E3AA 5LZ8A 3QEAZ 3ZV4A 2V03A 1RHJA 4CM1A 1JG7A 2MYPA 1GDDA 1N78A 4YUXA 4HFRA 5K0JA 1TFUA 1KH2A 1GGEA 1SQ6A 1NNI1 2UYCA 4RKQA 1UOOA 3FTDA 1T5DX 3DFZA 1T0HB 1TF5A 3BWEA 3ZBPA 2J9FA 2NV2B 3UAWA 1Q11A 1QHIA 3DOEA 5HUJA 2GEBA 3KSBC 1V8BA 1VI2A 3WP0A 4FEGA 4G9GA 1JQKA 2JHFA 1FBNA 4X1IA 1HE4A 1M66A 1WULS 3NZEA 1K3TA 1T9HA 3ELUA 4YJHA 5ALTA 1ULAA 2ZDHA 5EP3A 3SC2B 3W9YA 4DMHA 3ZKWA 3TO5A 4MV4A 3UW1A 2X8WA 3AUTA 1H2BA 2WAOA 2DULA 4FHZA 1P91A 5EQFA 3JATA 2I55A 5IMBA 4KV9A 5M29A 3LVRE 1DSSG 2RHRA 2NUPB 2Q1XA 1BAPA 4N7RA 5HCIA 4ND8A 3U4QA 3K15A 3ANTA 4Q1VA 5L3VA 4RESA 4NESA 3O8BA 1QP8A 3M6UA 4AURA 5C7IO 3EXHB 4LK3A 1EE1A 1TYCA 4JB0A 2JL1A 2I2BA 1E1YA 1ZUNB 4LRQA 4O4HA 4EKIA 1IOLA 1GXSB 1K6JA 2JRLA 4JR1A 4KFUA 4FLMA 4P31A 2ZRMA 1GGNA 2QJRA 2WT8A 3CO0S 2IXFA 2V6BA 3IDFA 4G5SA 5DSXA 4NBLA 5CA0F 1LB1B 3PJFA 1EDDA 5FWYA 4UULA 5E2AA 3Q5EA 3EFOA 2CEKA 3LP8A 4Q12A 2YFKA 1GPUA 2H9AA 4D3DA 1TLTA 3QOYA 5A4KA 1ZIDA 3G0CA 3HO6A 3M6WA 4RWEA 1P62B 1VXRA 1WZCA 3NKFA 4RW0A 3SSNA 3AEYA 1MOSA 2JIZD 1F20A 4QFDA 3T3IA 1W8DA 3QKRB 4CV2A 2AC7A 1JR3A 2W90A 3EXIB 1G3UA 1T4CB 2DVMA 2G4CA 1XWWA 2K2QB 4CIDA 2FPMA 2IW3A 2NPIA 1KY3A 5CUQA 2WJAA 1L5MA 2C99A 2CWDA 2P9GA 2PA0A 2NO5A 3FTNA 3LUFA 1H1TA 3DMNA 4EELA 3F7TA 4HL6A 1UMBA 4D9EA 1W0CA 2DLCX 2WJVA 3E81A 4MHSA 1LUAA 1HFWA 3QG5A 3A9WA 4NF2A 1PJAA 4ZAGA 1II9A 1H6AA 4MW7A 4W7HA 1TAUA 3KR2A 2RSLA 4J6EA 5FADA 5BRAA 1GY8A 4G86A 4ZT2A 1H0KA 1QAQA 2A5FA 1ODJA 4RKEA 3KTAB 5AKXA 1UEJA 3G02A 3QSYA 4F5EA 1EWQA 1USVA 4W5HA 1PQYA 1YJCA 3RSZA 4OB7A 5A4MS 1W6RA 2ZK7A 1Z0UA 4WBXC 3I9JA 4N54A 4LY0A 5FTNA 3VR4H 3HKCA 1H2AS 1FTSA 2JAOA 4ETWA 1TQDA 2XUAA 3GBSA 4MYDA 4OI4A 2ZBDA 4LJKA 2AE2A 2CHUA 1RLMA 1X0VA 2C9BA 5J5AA 5LP6F 4I5GA 1FLNA 4LJ6A 2Z6VA 2HO5A 1NHWA 3KPJA 4EHDA 5TF4A 4Q4HA 2OXCA 4I8IA 3LUPA 4JI4B 1Z3CA 1UDBA 2AA3A 3CF2A 4E5NA 5IS2A 3VV3A 3LBNA 4EAAA 5D00A 3VHXA 5CLIA 1T1GA 4AS2A 2PZKA 4FIZA 1TLFA 3HJBA 4OFZA 3GCZA 5T5QA 2QRZA 5AHKA 3W34A 1J21A 4ZOLF 1ZHFA 1WUKS 2X0KA 3RSQA 3JYOA 4PAGA 4RZXA 5JH7A 1P2BA 2R1VB 1L5VA 3FCOA 1YNSA 4JLMA 4LXIA 4PYMA 1G8HA 4RZ3A 3VR6A 2GESA 3O6VA 4R01A 2REQB 2V7UA 2Y8EA 3E9CA 2C4HA 4ERXA 2J5QA 2YJ4A 1QAOA 4G89A 1E6KA 1YDHA 1CUJA 4QU9A 1P2GA 3ZD8A 4HGYA 1VB3A 1CY2A 1TPYA 5JMPA 3WRWA 1V39A 4TN5A 2EL7A 2JLRA 4OKIA 4NZYA 3T35A 1PJTA 4I0WB 4PS1A 4BO9A 2NV6A 3ZZUA 2G1UA 3KL2A 4IKOA 5ICMA 4JLSA 2PNFA 3BIWA 1RWQA 4IIJF 4PYQA 3SIXA 5BMVB 3H6KA 2JFOA 2XT6A 1ZYUA 3DMGA 1C29B 3KYCA 3OECA 1C8LA 3R3XA 4GC9A 3ZHVA 4EVQA 3STUA 1ZGGA 1UQTA 1ODTC 1RNLA 4JP1A 4ARAA 2RGNC 2AL7A 3NGXA 2X77A 4ZO9A 3DVLA 3W2TA 3CX6A 2FSVA 2OO5C 3X1DA 4F9FA 3QA3E 3ZWOA 4DR2B 2QZSA 1A27A 1N6RA 2OKCA 4HQKA 4HQLA 3DYVA 3TLAA 2QTTA 3G2KA 3ADKA 1UXKA 4I6JA 2WBLC 2H0QA 3G5TA 2B0JA 2GCEA 2RBEA 2NO4A 5J1TB 2ZZNA 4WOCA 2MMGA 3PD0A 3NX4A 3U16A 2D5LA 1P0CA 3MGAA 2PKQO 5SV2A 3UG6A 5LCXA 5F35A 3PC8C 1XZBA 1VIVA 1E3TA 3HVKA 3HZZA 4YV0A 2X3UA 4M4SA 4UNNA 4EG7A 1P7ZA 1SKUA 2QTGA 3DMPA 2CV2A 1UM9B 3KKPA 1W0JD 5JNUA 1OTHA 1ZKDA 3AF4A 3OBIA 4GP7A 3ZH9B 3HRHA 2VA9A 3EGWA 1AZWA 1DIAA 1OW3B 2GM5A 2VWQA 2ZKIA 4S0XA 4WZAA 1RC8A 2C98A 2HA3A 2J32A 2QTAA 3ECCA 3IVMA 3P9QA 4K03A 2IUSA 4QJ4A 4MVJM 4XVRA 3S4YA 3UH1A 4C06A 4CM4B 4BFSA 5KINB 1Z6XA 2QVBA 4XYGA 2VJQA 3TOSA 2HHCA 2QUJA 3KB6A 4DUYB 5EIEA 3RTBA 2NZ8A 2FZ4A 2JH9A 3IVAA 4EMTA 5B7NA 1B0ZA 1WB5A 1TT7A 2O7RA 2Q3EA 3TLEA 3TQSA 5JQGB 1WB6A 2PWBA 5EMHA 4EI8A 4RJJA 1EFPB 1KZ7B 1AF7A 5AKJA 3TMYA 2D1RA 4ZT7A 3O3OB 5T64A 1GZ4A 4Z6KA 1N1MA 3ABQB 2BFEA 3OCWA 4MLZA 2YZ2A 2C5FA 1E7SA 4IXTA 3MBKA 3EIOA 1AY0A 3JCZA 5FV7A 4EJ0A 4G81A 1T6XA 2VTDA 3L0ZA 5F33A 4DLXA 4C4YA 4ZMSA 3TE7A 3R44A 1D2HA 1O87A 1Z4NA 2MSKA 2PS3A 2GZ1A 1NVAA 5I7AA 4CMAA 1DAOA 1QHHA 5BYJA 4ZV7A 4KH0A 4EEXA 4J0KA 1W87A 2VG8A 2FEXA 3GZNA 2FK7A 5CYOA 3TW4A 2ZE8A 2QZJA 4A2CA 1E98A 4O4LF 4G0QA 1M2EA 2J85A 4HNQA 1VYUA 4UFOA 3KK0A 3QVSA 1PW5A 1YRWA 1S7GA 1YDWA 3H18A 4UC0A 2E9SA 5GONA 5AUPB 4CBVA 5A05A 1TEZA 4O33A 3GLFB 2IZ6A 1A9ZA 5TVGA 1BOOA 4EYOA 4GW3A 1V8DA 1XNGA 2ZSKA 4CMHA 1ZGCA 5EP2A 1BEEA 3A11A 3P9YA 4JLVA 1RKBA 3BH7A 3KJZA 4I9GA 3A3PA 4AS1A 2VTBB 1XZMA 3OT1B 5A5FA 3JYNA 3FPEA 5EZ5A 4R0NA 2IU0A 2AW5A 2MMCA 1MAVA 4MAMA 4FZVA 3RTGA 1PS9A 1M2OA 5KNBD 1IXYA 4DIMA 1UJ2A 1SUCA 2WJ4A 2DPYA 1HFKA 1KEZA 2VYND 3KQVA 3QX8A 2HBZA 1XMPA 1U9CA 4EUHA 5EKXA 4F3TA 3IHTA 5PNTA 5K0TA 5DYIA 2GBPA 4CW7A 2HIGA 1OILA 2OPBA 4JLJA 3IA7A 1D4FA 4G25A 2XY4A 4S1OA 4FSDA 3PGJA 1XO1A 3E5NA 2HQSA 3E1SA 1LSJA 2O2CA 1XTVA 1EK6A 1RHRA 3VA7A 2IUUA 3CMMA 3FNQA 2ODQA 3OM8A 1G6HA 4C7MA 1MC8A 3QPAA 3MEQA 2NVBA 3PT9A 3WDKA 4IL5A 1TTPB 2P8SA 1EBUA 1VKOA 3NBFA 1EVYA 1NW8A 3PL1A 3OQMA 1JE1A 2QRLA 1IZZA 3W8NA 4W5NA 3E35A 2I6XA 1R6DA 1BU5A 2PN1A 3PNMA 3KQTA 3P9PA 4UBNA 3K73O 1P7CA 4DEVA 1FFEA 2XXAB 5B37A 1SELA 2NXNA 3CNNA 4IV5A 3Q1LA 5G0VA 4OQZA 2Q5HA 1Z5PA 1Y1LA 1H66A 2P3OA 1RWVA 1UFVA 2PMKA 3C5WP 4IXDA 4ZCMA 3B6MA 3KQLA 1P5ZB 4MWSA 2A14A 1RI5A 2VH5R 4KIWA 3WQHA 3MSXA 4ARBA 4EHJA 5JRJA 4R4JA 2JLAA 3OP4A 4B6EA 1HRDA 2P9TA 3HCWA 1EUCA 4DA4A 3LP6A 2P2GA 2ZUDA 3EGDA 4KR3A 2IGTA 4HQNA 3C8ZA 3VRHA 2FMIA 1A96A 2M2IA 1XJCA 1ITZA 4IRMA 3HVRA 1LGYA 3T1YB 4QC2A 4AVYA 2X5NA 1Z2PX 1PEYA 1LCIA 2OT3B 3RTCA 5JC8A 1KI8A 5THKA 1PUXA 2DGDA 2P4EA 3LXRA 4XX0B 1FNMA 3IB6A 3ZE0B 4BQOA 2Q0QA 1P6XA 2OHHA 1A5TA 2BUBA 4OBEA 3A6ZA 4RADA 2CLDX 4YC7A 4Z54A 2O2HA 3FVRA 1V7CA 1GADO 4CMGA 3OJEA 4TQGA 1KTIA 3LA8A 5KVVA 1NYTA 2UYYA 5I9TA 1RQGA 4FX2A 1NR7A 1T9ZA 1BG6A 2FCAA 1I0ZA 3QX9A 3F2IA 5JDCC 2YZGA 4N82A 1R18A 1WCYA 1DLJA 2H85A 2WQ6A 4OQMA 4FBGA 2BLLA 4OXQA 1LBQA 2NNLD 4QXAA 1O5TA 2UZ1B 2ZSUA 3TNLA 1PG2A 4FYWA 5IAOA 2Q1UA 4OJYA 3RJTA 1CU1A 1IULA 3UPDA 1QKIA 1R9MA 2X14A 1Z8DA 3DJYA 3GD7A 4WK0B 3C1AA 3JQBC 5KYXB 4I1YA 3C3MA 1Z47A 3WK8A 3HBLA 1HEUA 4DLNA 4IG4A 2YV4A 1MAWA 2WMOB 5TDHA 5B64A 1KORA 3H97A 6REQA 3QZUA 1PJBA 3EQ2A 2OAEA 4EKGA 1ZU5A 1X7XB 4FR5A 5JECA 2OHGA 4S1PA 3WHPA 5FUMA 2G08A 2PVCA 3V1NA 1HLPA 2AG1A 1UJ6A 3EYAA 3M34A 4HXFB 1PTJC 1ONPA 2O3QA 4BVHA 3DWGA 3SKVA 5HP4A 4HI0E 3OF2A 3DVAB 3W8EA 4U9HS 5TC4A 1JDPA 2Q5QA 1JECA 3DXZA 3ZLVA 1OB5A 4M2LA 3TUZC 3AQIA 5EG5A 5T6BA 5KYUB 3KSAC 4DB2A 1F2TA 2ANBA 5B4UA 2I91A 1PHRA 3KQMA 2GPJA 1DBSA 1KBZA 4DT1B 1TQHA 4NJMA 3ER8A 4MGZR 3BSYA 4FE3A 5E6SA 4LZOA 5DLYA 3GJ3A 1ILWA 3SHTA 3T3GA 1OGIA 3HP4A 5CBKA 5K6RA 4JSRA 4GU5A 4R1UA 2ZYTX 2AN4A 2OHJA 3BHMA 1K5HA 2XDYA 3K8YA 5AICA 4YRLA 5GVRA 4C0SA 1XJQA 4OUKX 3IE0A 5U9CA 2AUTA 1LVUA 3I9FA 2VAWA 1K7FB 4HDMA 3W8RA 3R8CA 4AMYA 2WFZA 2XUDA 3EFBA 4KIFA 2V4MA 1QCDA 2H17A 3B53X 1JQBA 3CLRC 1NKVA 1N36B 3B13B 3RC7A 3I42A 2J7KA 3WIEA 3QENA 2QD1A 3GRFA 5EHZA 5IU6A 4ALLA 1J42A 4B3TB 1PJQA 4F3NA 1JIVA 1Z08A 1ZW1A 3IILA 3VKUA 1XU9A 2I76A 2Y0EA 4H1HA 2O8CA 1F5SA 2V97A 2Y93A 4PICA 2OGTA 1DEAA 5CFNA 5HX7A 3BK1A 4NH0A 4XSVA 4QBIA 1JTEA 1OLOA 3L77A 1YFZA 3K0SA 4ZXFA 3UMSA 2HBRA 3O4HA 1FYVA 3PPVA 2VPPA 5AI5A 2F8MA 3KQUA 5H3LA 221PA 4JQCA 3VSBA 3UWOA 1P8JA 3KPUA 2P2ZA 2WKQA 3TCNA 1X7YA 5JCZA 3L4BA 4KXVA 4BFCA 4XDYA 1WEKA 5F73A 3C98A 5JZSA 2RJ3A 4N49A 4MVJP 1Y5RA 1CUGA 1EFKA 2G80A 2DMRA 2QW1A 1R4NB 3A3YA 3U49A 3JY6A 1WMEA 1ZWLA 2RCNA 3D6JA 1FX1A 3DBVO 3JAKA 5FHQA 4CM6A 4M54A 3SFTA 1WF6A 1YKSA 2H2IA 3EVDA 3WGVA 3H1PA 3B70A 4JYZA 4PFKA 2D1TA 5JNLA 4LQLA 4KR6A 4XI9A 1VGRA 2ZYIA 3GRAA 1OFVA 1ODSA 2ID9A 1U0LA 3L2OB 3RBZA 1W96A 2QAGC 2HA6A 2DBZA 2RHJA 4LJ5A 4M0PA 5DGHA 2ZUUA 4Z0NA 3ZCTA 2EFYA 1Q14A 1XEFA 1DRVA 4JJFA 3CKKA 1XAGA 3ILHA 4CLHA 1A9PA 2DCMA 3DDUA 1DZ3A 1GG9A 1ZGZA 4Q3BA 3THSA 2BGRA 4IZIA 3TLZA 3AP2A 2OFWA 5JOQA 4UOQA 3WFIA 1N3IA 1ORDA 1T5OA 1WOYA 3BGSA 3WGIA 3INTA 4PQYA 4Y9TA 4AJJA 3AR8A 1L4BA 3L01A 4YACA 4J16A 4FW9A 1BH6A 3QWBA 2ZBUA 4COOA 1JEYA 1ZNZA 4JJ4A 3MGGA 1VKJA 1RFLA 2PU7A 4Z8YA 1WP9A 3E53A 3Q9LA 3VZRA 5DV9A 1D9XA 4JLOA 3ESYA 1E6WA 2VP3A 3BJEA 1J2EA 1Z4LA 4G8JA 4DRXA 1RWOA 3L0CA 3ZHZA 1D6NA 2ZYUX 1ORWA 4GBJA 5BW6B 3UJBA 5AYVA 4AM8A 3GPIA 2XWBF 3EEIA 4BBAA 2X41A 5JEDA 5DCLA 3D8SA 5JRDS 2XOXA 3L04A 1C1YA 1HDCA 2DPGA 2IY9A 1KO1A 3QI2A 2NYRA 1ESCA 1NJSA 2NTNA 3PXCX 5FPYA 3V3KA 1VRCA 4FR2A 2C82A 2CD7A 3G8BA 3GEMA 3FKSA 4OAQA 5HBRA 3SZOA 4PN3A 4ZRNA 1HFJA 2QMUA 3GFSA 1KK0A 1XKXA 2B1IA 2EFJA 4OXIA 4RQTA 4YA6A 5CIQA 4IGEA 4J0HA 4A2QA 3ZH2A 1KDTA 5TMEA 3K6SA 3C3AA 4AT1A 5AW7A 2UU9B 2VSOA 3QE0A 3TIXB 3V4OA 4RTRA 3H9EO 3FHJA 2IS2A 2YTZA 3DEAA 4PGGA 3R0QA 5DW0A 3ZG6A 1KGSA 1DB3A 1PT5A 2C4TA 121PA 4FN4A 3L0DA 3OJLA 3X1YA 4PCUA 4D9CA 1MAUA 2PBFA 4UHCA 5ALGA 2VPIA 5BMOA 5HM6A 3QVWA 4IDNA 3VNVA 5GP1A 1N5OX 2VWHA 2GKOA 5TMPA 2O48X 4P4UA 1HKHA 1G0NA 2Q4TA 3NTRA 4QL3A 3TVTA 1G5QA 5L3QB 4IMRA 3QXXA 2GH1A 4PIMA 4M99A 1H5UA 1XXHB 2X8JA 4ZODA 3TSCA 2JRCA 3LG2A 3E70C 2HJHA 3REFA 3IQGX 3W6OA 3FNRA 2PCLA 1QS0B 1U7HA 1BW9B 3RB8A 5L9AA 2QL7A 1Z17A 2RKOA 5A0FA 3VR4D 3ZWVA 3AQ4A 2NTEA 4NULA 5JMTA 2XMSA 3BSWA 2XNKA 3D6UA 3GQVA 1KA9H 4KKVA 4BRZA 2ZZKA 2A59A 1PQWA 1BCSB 3H8WA 1PGQA 5BNFA 4ZGGA 1O97C 2DBYA 1W4ZA 1JMVA 3WWPA 5LQMA 2BM8A 4LJAA 4F56A 2ZYDA 4OUDA 2NXCA 2SNIE 1QH1A 3IAXA 3W5VA 2XBLA 3U4AA 3P2OA 3FDZB 3T4UA 3I9V6 3CX8A 3BIJA 1L4EA 5CH5A 3RBVA 5JXJA 5CM9C 1FFBA 3NKVA 1P5RA 1YVUA 2PD4A 4M9QA 4O2BB 3WSTA 4D0RA 4N5LA 2X9QA 2H4WA 1HPLA 1SXJD 1ZL2A 2VDLB 3ICWA 4P6VF 2F17A 4BNLA 5BSHA 3BE8A 2G9VA 3DGFC 1CP3A 1EFHA 1OREA 3ZCQA 4OX9B 2Q3MA 2DBVO 1YQWA 2OKGA 4H0NA 3W2EA 4BMCA 1DKLA 1HMYA 3ELYA 4FFRA 4XUDA 3OZCA 3FTFA 4ZA2A 1L4KA 3OG9A 4AO6A 4DV6B 1HRKA 4LXTA 2YC2C 1EGHA 4C3ZA 4US1R 3K8ZA 5DPMA 5HF5A 4LBVA 1WCXA 3MUEA 1F8GA 3GMIA 4BN4A 3KVRA 4I8DA 4BE7B 1Z74A 3Q85A 1OPRA 3E82A 3N07A 2IY8A 5TQVA 3CKMA 3VDXA 5KDDA 5ETJA 4XGRA 3TDKA 4JQYA 4HEQA 2WW8A 4N40A 3GLHE 3DLTA 1LI7A 3KKOA 3QPCA 4P5PA 1C41A 3AF1A 2NADA 3FF1A 3LT4A 4M0FA 1W59A 2CL7X 3ESQA 4HJRA 1EE2A 3S2UA 3O3NB 3VR0A 3NR2A 1DO0A 4WV3A 5KYWA 1OYOA 2XTZA 2KBFA 2WQZA 2P90A 1F38A 1RZUA 4JEHA 5LQCA 1Q77A 4XB2A 4HDSB 5DTEA 5K3SA 2YHAA 5KOJB 1WZUA 1TU3A 2IXEA 4F21A 4B2YA 4B3HA 4IOLA 3ZV3A 1WDMA 5T41A 1BIFA 1YS2X 2JBHA 4Z49A 1D07A 1QDUA 4IDFA 2L17A 4KTTE 4UBJA 4DN6A 1NN0A 2ETVA 2W2XA 3WRVA 1L4LA 1IC6A 1N5JA 3CQ9A 3IBTA 2H52A 2Q3FA 4DIBA 3MJEA 3P0EA 3WB2A 3MOGA 2JGFA 2VHEA 5EE5B 3TZEA 1J20A 3UXHA 4IF6A 1H8HA 2BP7B 1S5PA 3VYSB 1B76A 3B1FA 1M83A 4FSXA 5BPHA 3L1UA 2IW1A 1JHMA 2AWOA 3MWDB 3P9ZA 4NCIA 4OU5A 2UZ3A 3WYEA 1T8UA 1DAHA 3BJIC 4D45A 1D7AA 2N1MA 4JSTA 1AGPA 3GZJA 4Y9SA 2BHNA 5KYGA 1OHHD 4LHYA 3AI7A 2JJQA 4JU8A 2G8LA 1H9CA 3KIPA 3QBTA 1J0AA 3RFTA 3UMVA 1UL1X 5KU1A 5HKOA 5TGZA 3A1TA 3F8WA 3HCBA 1G3MA 3WV4A 3H04A 1MDFA 4HHEA 4QDUA 4EG1A 5I9MA 5DX1A 1VJRA 1XLUA 1G20E 4GPTA 4IFTA 4WL0A 5EWMB 2BZGA 1RRCA 1EWKA 1QIIA 2QL5A 2G9UA 1U7PA 2HU8A 3KZVA 5ER6A 4AZ3A 4YQFA 5A03A 2EU8A 3K9LA 1BX1A 1CF2O 1XF1A 2H00A 3AM3A 4NEHB 1FS5A 1M1YE 1X92A 4RD0A 4UTOA 2KE5A 1EDBA 4RA6B 1XCPA 3NWPA 1OLXA 2HA2A 2QDXA 3CLSC 4BV8A 3O8DA 1GPMA 3PC8A 4LVCA 1CC1S 2HJWA 2W2LD 3T5MA 1EPUA 1AIPA 1TW3A 1IHOA 2D2VA 1G8PA 3MCUA 1KDPA 1ZGHA 2FZVA 4RFSB 4COKA 1GKIA 1T9GS 3ESXA 3PEFA 4KMRA 1U8TA 2AOUA 4UAVA 3QE3A 4EY5A 4CEJB 3H5IA 2R6CA 1E69A 2WSIA 1RT9A 2G0NA 2HDOA 1DHTA 1G20A 2I1LA 2VT6A 3DHNA 3U5ZB 2VF5X 4U7FA 2AOWA 2IZZA 1Y9JA 3FF4A 2NGRA 3PX3A 1BVUA 4HAIA 1AO0A 2O3JA 5BR8B 1NONA 2ONZA 3DFKA 5EESA 4XQEA 2FW0A 1OF1A 2WPDA 3GEIA 4QM6A 2JHCA 4R98A 2IPMA 2XQIA 3COPA 3G2JA 5DBGA 3THWB 4C07A 1PVVA 3EXHC 3IIEA 1NAIA 4LYJA 4O1HA 3MMZA 3QKUA 5A9TA 4CM5A 5ERXA 3QFFA 5E95A 4AJ1A 3ELBA 1MO4A 2JFXA 1YIAA 2HJRA 3IAAA 3I37X 2WU1A 3T7AA 1IUNA 3GBPA 4FILA 1E5QA 1UANA 4E88A 2IIVA 1P2FA 1EUZA 4MRVA 2FW7A 3NYQA 4J1NA 2RBGA 2COKA 3FYUC 1K89A 3H8SA 4L8WB 2GKGA 3KPWA 2AOXA 2B1GA 2BEKA 5HZMA 5LLTA 4KFSA 5JU6A 3LZCA 1ZC3A 1YBAA 1USIA 4P7JA 1K7XB 2IYOA 2HMWA 4QREA 1QG4A 1Z7WA 4YVFA 3UJ3X 1N7IA 4UBOA 2QLNA 3K1JA 3N7TA 4EJSB 4PN7A 1Y4AE 3JALA 4AXBA 5I7HA 1M7GA 1TRKA 2QE7D 1B41A 4XXHA 1GYQA 1GV1A 4P08A 3Q10A 5IBPA 4KPEC 2AI1A 4GGPA 1FPMA 3LCUA 2QBYA 3FLBA 3QVOA 4X93A 5GIOE 1ZOIA 3ESAA 4ALKA 4ZZ0A 4EEKA 3OPXA 1KFKB 3VSAA 4M1KA 3MIIA 3QUSA 4MW0A 4JIGA 3EQZA 4YP5A 3G0HA 5HM8A 1VSTA 4OM7A 2H0AA 2PL1A 1GGFA 3WWCA 4BE9A 1J1IA 2GBIA 1SOMA 5A5GA 1KO7A 1AZLA 3G3EA 1IXSB 2ZGVA 2ZUCA 3UQYS 3KT0A 4TV8B 3L92A 2ZUWA 3ZTWA 1YQ9A 3L1VA 4WT7A 2IYYA 3I4CA 1JWBB 3OIFA 4F8EA 4P82A 5JASA 4M46A 2Z3VA 4JODA 4WY5A 5GJWC 2FFQA 5LYJB 1HG0A 2FF7A 1M76A 3HKDB 4F9TA 3KV1A 3Q7SA 4ZGWA 5EXEA 5SYAA 1F12A 5M04A 3F6CA 1RWPA 1T35A 2VK8A 3FMFA 4S12A 5AKGA 3WBKA 4D44A 3ECSA 4DKJA 3H9CA 3FHTA 5BV7A 3EUEA 3OH8A 4GQBA 4OYHA 3AXSA 4LX8A 4BMDA 2H5IA 3LT5A 3ONVA 5BV2P 3QMVA 1I14A 2AG6A 2TMYA 3R7DA 4A0RA 1ZI8A 3BFKA 3U44A 2C31A 3GRVA 3GUYA 3G2QA 4R3UC 2QRVB 5JTUA 3H17A 4YLGA 2LBPA 3NYRA 1T9GR 2XF8A 1ZIXA 2FW8A 3LGSA 2Z9CA 2A1IA 1DOAA 1C9DB 1OAKA 2HNAA 3LTEA 4PZLA 2AV6A 3QI7A 3EYWA 4DJJA 4EI9A 3CFYA 4FDAA 4R8KA 3MS4A 1NRXA 1GR0A 1TAGA 2Z5GA 3QVGB 3TB4A 1SXJB 4IJSA 4MQEB 4LQDA 4RJLA 4F6RB 1BX0A 2OCPA 3F71A 1XTQA 1Q7EA 1S8FA 2FRVA 1U7DA 1C1DB 2GKSA 4HDNB 5SY4A 1IAVA 1KQ3A 1EFVA 3VC7A 4DANA 4YRBA 2YWBA 3BSSA 4I50B 2GAIA 1XL1A 4HRAA 1Y8RA 4H60A 2R751 4H17A 1YR7A 1DNPA 2B6NA 2APJA 3AF5A 4LWOA 1AUOA 5K3FB 2ATEA 2OAQ1 4B6QA 3NWBA 4B9EA 5CDUA 3BT7A 3IJRA 1QF6A 1ZVKA 2VP6A 3L7MA 4EENA 2JD2A 1AUPA 1SQGA 1QB7A 4DSAA 3A6PC 4G1BA 2MSWA 3FPJA 3QEJA 1CBUA 3I8OA 4G0PA 5DNEA 4CKWB 4DJDC 1Q2UA 2IUYA 3H6GA 4QLAA 4EW3A 3H8JA 3ZDEA 1SVWA 1FJXA 4NFSA 4EY8A 4UEOA 3UJPA 3UK0A 4UEKA 1D09A 2ODPA 4A0SA 2XZPA 1YR9A 3A2KA 1U9YA 5I7WA 4NU8X 1E58A 5JXIA 2AR7A 2A9FA 4Q05A 3NP7A 1PSWA 1XMJA 3HNOA 2OV8A 2O19A 1QXSA 4ER6A 2VNKA 3FFBA 4D8TA 2JC3A 3PXXA 1DLIA 2JCSA 2HA4A 4QBKA 3EXFA 4XVUA 3EC2A 4P4GA 2OYCA 1CEYA 1YL6A 2JGRA 3JX9A 5IAAA 3WGHA 3FFAA 2OO7A 3C8DA 3H9QA 3QEMA 3VPGA 1A7UA 4NBWA 4PR3A 3DC2A 3CM0A 3K0FB 1F9EA 1XTJA 2IPOA 4IRXA 4UDXX 1HM5A 4OY3A 4DR7B 4PGHA 3DDHA 1M8JA 3U81A 1W9HA 1JFLA 1EX6A 1V1MB 4L73A 3TQFA 2DWQA 1U7OA 1BS2A 1E9BA 4EB3A 4EBFA 4ZYYA 2RI6A 4IJ5A 4OQ4A 3TDMA 3ZGVA 2QV0A 4XRGA 3FYDA 1HNZB 3G2OA 5E6UB 5BURA 1GGMA 1UOEA 2C4UA 2KLBA 1H8ED 5CAEB 3BCRA 4P0TA 1AB6A 1G42A 1RQLA 2ZAMA 4HEA1 2BGWA 1VSQA 4EQ6A 2BFOA 2D2EA 1TO2E 5EHXA 5EIXA 4DXDA 2QRGA 2PRIA 2MINB 3DE5X 3FCUB 4QJ3A 3ZIDA 1PL0A 4IVQA 1RXSA 2C9MA 3P9KA 3A36A 3MPOA 2QYOA 3TEJA 4IEIA 4EBBA 3JWPA 4QYMA 2MSDB 3WHLA 3RLIA 3SP1A 1DFHA 4BEVA 2GN6A 13PKA 3CPJB 1BXRB 3R2JA 4QBHA 2NUAB 3U3OA 3ZJYA 3UMRA 1GPLA 2BL4A 1E3DA 1C7FA 4TKZA 2P2CA 3PP8A 4E5YA 3K9HA 3R7BA 2PGIA 1DTSA 4X71A 1MAHA 5IJZA 5J4VA 1V2GA 5C1BA 5CK5A 4OYYA 3D4PA 4ZAXA 4J6FA 3AERB 4LMAA 1R0KA 2P5YA 3DLPX 4RELA 5BV1A 1KZ1A 5LA6A 3HN2A 1O2DA 2DUJA 4FYYA 5JO0A 1IBCA 2X19A 4W1SA 5CX1A 2O50A 3VBCA 4PGFA 4QYSA 3V8BA 1W7AA 3OZTA 4D3ZA 3AUXA 5EKTA 2QOEA 1UMDA 4OB6A 2FGJA 4I9UA 1K75A 5K3OA 1XOIA 2OHFA 4NEQA 4NXMB 3PPIA 2BSXA 1E2PA 4H7DA 1FYEA 3VU0A 1ZC4A 2VSYA 1A82A 4ZZIA 4AI6A 1TKCA 2ZDQA 3P0FA 4PWZA 2R62A 2VUTA 4HB3A 2PZGA 4M1WA 4NMWA 4UAJA 1CR0A 1OX4A 4LX0A 4P8RA 1UKCA 3AKYA 5IJAA 2A5JA 4RNDB 3EBPA 1JSZA 3ABSB 4LHWA 2BEVB 1PWHA 2X8AA 4P92A 1SA0A 3ROFA 5JS6A 1KMCA 3GF4A 4AP5A 2WU4A 4N5MA 5FR1A 4B7ZA 1O96B 1LXCA 3NHRA 2ZKLA 2JCYA 3TH5A 3KWMA 2WIJA 2HGZA 2IC5A 4TQUS 5HF6A 4ZI7F 3DZHA 4I81A 2FPXA 1S2GA 1RPJA 3O4FA 1L7RA 4Q3KA 4W8HA 2O7QA 4CR8A 2R6JA 4JUCA 2RHWA 3AFIA 1DAMA 1V3UA 4LSMA 1GGVA 3FWYA 4NECA 1LLFA 2G04A 2PWYA 1OGJA 2BCEA 3EY4A 2G9ZA 1CJKC 1II0A 1QQ6A 1US8A 2D0PB 3B1ZA 4R8SA 4AKEA 4H3SA 4AJPA 4W82A 1SRRA 3TPFA 4OU4A 2QTNA 1RLIA 5DWDA 1T9KA 5EWLB 4ZEWA 5JWRA 4O2BF 3AFOA 3KOXA 5AK6A 1J2YA 4MPJA 5CT8A