1FXSA

Gdp-fucose synthetase from escherichia coli complex with nadp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
317
structure length
317
Chain Sequence
KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PROTEIN (GDP-FUCOSE SYNTHETASE)
publication title GDP-fucose synthetase from Escherichia coli: structure of a unique member of the short-chain dehydrogenase/reductase family that catalyzes two distinct reactions at the same active site.
pubmed doi rcsb
source organism Escherichia coli
total genus 101
structure length 317
sequence length 317
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 1998-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1fxsA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1fxsA02
1ADFA 1LEHA 3JQFA 1H6CA 3HSKA 4XR4A 4JJIA 5I7SA 3WBBA 2VUSA 1QYXA 1E1NA 4FGSA 5EL0A 4NK5A 2CUKA 4RQTA 4N5MA 3ZWAA 1WDMA 3C1TA 5JNLA 2PFGA 5IXYA 4B4OA 4HUJA 3KEQA 5AVOA 4BO5A 2IXBA 2CDCA 4WOKA 3WDSA 1Y1PA 4F46A 1C1DA 4CQMB 3TWOA 4RV9A 3LVFO 1EUZA 1HDGO 4DIOA 1KVUA 1P1IA 1EE9A 3QQPA 3AJRA 3DZIA 1J5PA 4MVJI 4XR9A 2V7PA 4Y9DA 3JD3A 3PLRA 3VPXA 1GZ6A 1ENZA 1E1LA 5CDUA 1B26A 3IUSA 4H15A 1GCUA 5AXBA 1IZ9A 1B15A 2JD2A 4IPTA 1E3SA 4EGFA 2W2LA 4W7HA 1U5AA 1OC4A 4FFOA 4D79A 2C07A 4YR9A 3BMQA 1HE4A 3VH3A 2DPHA 2NU6A 5L4SA 4J1SA 2QW8A 4CMAA 3KSUA 2J5RA 5JE8A 4ALKA 1MC4A 1HLDA 1UXJA 1YGYA 2NADA 4PLGA 1X0XA 5BSHA 2OL4A 1VLLA 4FFPA 3KUXA 1V0JA 1P33A 3ETEA 4RPJA 3BHIA 3VPFA 4EYEA 1XGKA 1R12A 2PZMA 2DBVO 1LLQA 1P9LA 3ZW8A 3E8XA 3ENKA 3O8QB 1YVEI 3WGZA 3LSYA 4AL4A 2VHXA 4J9UE 3A9WA 3W4IA 4FSHA 5IN4A 2AQKA 3GG9A 3G1UA 4UEOA 4I9UA 5JY1A 3UOGA 4J0EA 1HZJA 4LN1A 1ADBA 1EE2A 2HMVA 1Z7BA 1E92A 1WZEA 4WKGA 4IDCA 1EBFA 5JAZA 1DEHA 3PP8A 1A27A 4Z0PA 1QP8A 2JKVA 4YRAA 1ISHA 1E7YA 3KV3O 3PK0A 2Q4BA 3DMTA 4JROA 1A7KA 1E6EA 2V6BA 3OJOA 1C14A 3ROQA 1U7TA 3WGGA 4BO9A 1YB1A 3GEDA 1ZUD1 1H0KA 3WGHA 4D44A 3DL2A 1Y9AA 2NTJA 2GERA 1U2GA 4IQGA 5DNAA 3H65A 1EBUA 4WLVA 4R1TA 3QRWA 4BNUA 1E6WA 2H1SA 3HJAA 1P1HA 4P4NA 4G65A 2YQ5A 2PV7A 3ON5A 4WLNA 1VJ1A 1YL6A 1Z82A 2PGLA 1EUDA 3NAQA 3ONDA 3PGJA 4IQ8A 4JP3A 5H83A 1PWXA 5KVSA 4RVSA 5JXWA 2I66A 4ZQHA 1YDEA 4NJMA 1DIGA 4XYGA 4KQXA 1FJHA 4PN3A 4A26A 2HK7A 1GADO 4FBGA 3D3WA 4D45A 1PJBA 4ZQEA 4OIMA 1QYVA 4QFCA 5H82A 4ALNA 3F1LA 1YO6A 2WD8A 2P5UA 4A2CA 1I5RA 5GZ3A 1T4BA 1UH5A 1NXQA 1TLTA 2ZQYA 2C5AA 5CP8A 4IGFA 3AK4A 3JYOA 2I99A 1F06A 3TFOA 2IRWA 4ND2A 4M55A 1WW8A 4J1TA 3DBHA 3WBFA 3WQQA 3RQSA 3E5MA 3GNQA 2VWHA 4B8ZA 3GUCA 4D3SA 4YT4A 4YJHA 2ZJ0A 1NHWA 1ADGA 4ZICA 1NHGA 4BNNA 2JHGA 4XGKA 3F1KA 5EQFA 1Y8QB 4LMPA 2ZTMA 4W99A 4IQ0A 2V6GA 4BO7A 2E6UX 4YJFA 2YV1A 4Y6RA 1DFIA 2X22A 5I9MA 4DUPA 5KWEA 1MFPA 1U1IA 2C82A 3K92A 3KYDB 3RUFA 3C7CB 1TEHA 3JQEA 2O7SA 4DPMA 1U28A 2GD1O 5FWNA 4NBWA 4OMUA 5JPIA 1NPYA 5A3JA 1R4MA 3UW3A 3G3EA 5DT9A 4J1QA 2PWZA 1JU9A 3M6IA 2E4AA 3KLPX 1PGNA 3SVTA 4U5QA 2YDYA 5GZ6A 5L51A 1E5LA 1N1EA 3PHIA 2JFFA 4MVJP 5BSFA 4L74A 1ADCA 1ZO8A 5L4NA 2DFVA 3NGLA 4M1QA 4JLWA 2AG5A 3U4DA 1DIAA 3EZLA 1U3VA 4E33A 3O03A 5EJ2A 4DBVO 1XU7A 3UICA 1Q7GA 4FB5A 5EESA 3WJ7A 5B4VA 4HX5A 1I8TA 2NU7A 3W8DA 1I2CA 3C1OA 5L7TA 1E7RA 3ABIA 2DBRA 4IBOA 4CMHA 3N74A 3GPIA 4H3VA 4KDEA 1JWBB 1QR6A 2ZYDA 4DLAA 5JBIA 4GAEA 1KC1A 5KTKA 4MIOA 4X54A 2CF6A 1NFRA 3AI2A 4A27A 5JDIA 3Q2KA 3O4RA 1VL6A 1MX3A 4R16A 4OKIA 4OKNA 4OHUA 4E32A 2AQHA 1PZGA 3ZNNA 2OUIA 1KEPA 4B7UA 4D41A 1JA9A 4GLOA 4NU5A 4DTIA 2PZJA 2XXJA 1LA2A 3MWDB 3AOEC 1XR3A 1GZ3A 2AQ8A 4IS3A 9LDBA 3IMFA 3N7UA 3I23A 4Z0HO 1K6XA 3JD0A 3RC1A 4YTEA 1PL7A 4R4JA 5IAAA 5HM8A 1VL0A 4BUCA 1E3WA 3QIVA 3WMWA 4E21A 2C59A 2EHDA 2VYNA 4B7CA 4CMEC 2O50A 3ZV6A 3K6JA 3ICPA 3AI1A 3EW7A 4R3WA 1DRVA 1JW9B 3DDNA 5DCUA 4P38A 4FIZA 4BO0A 4BNGA 1U3TA 2CNBA 2GRAA 4YQYA 2C7GA 4JBIA 4NU6A 3GK3A 5G0UA 1YRLA 3AU8A 3KEOA 3QHAA 3VPSA 3WGOA 4IY1A 2P5YA 2PH3A 2XPCA 3TL3A 1QV6A 3OJEA 5GY7A 1W6UA 1Y8RA 5B1YA 4XQ9A 1PS0A 4ID9A 8LDHA 1ZEMA 3C1AA 3JQGB 1HSZA 3D4PA 3H5RA 2NU9A 4NFSA 4CQLA 3LQFA 2YW9A 5JAMA 3RUEA 4GMFA 4R01A 4YT5A 4B8WA 3EK2A 3LT0A 1R16A 4KUGA 5KVQA 3ZH2A 5ITWA 5JC1A 1SOVA 2I6TA 4ZVVA 2B5WA 3NTQA 1UAYA 4R54A 3H9UA 5L7YA 1BW9A 3GPDG 3A4VA 2CSUA 1W73A 3V2UA 2P4QA 1ONOA 1GPDG 4IJKA 1PGJA 1ZSNA 2ZJ1A 4QQRA 3BHMA 1ML3A 3D5QA 4Y8VA 1M76A 4BV8A 3BMNB 4OQYA 3E9MA 1NX6A 4QEDA 3C7DB 3JQAA 3FR7A 4PLCA 1HTBA 5CDYA 1WLYA 1DIBA 1DSSG 5HA5A 2Q49A 4BB6A 4MOWA 5DOVA 3UCFA 4B79A 5B12A 3VKUA 5TJHA 3RUDA 5L7WA 4A7PA 5JMWA 2H63A 4I8XA 1Y7TA 3D64A 1PS8A 4XDYA 2UDPA 4WUVA 3E6AA 2F1KA 3M1AA 4NJOA 3PYXA 5LCXA 3IOYA 4MVJH 5TJ9A 2J3IA 3KM0A 2Q2VA 4EUHA 4M86A 3U5TA 1T1SA 4R3NA 1HE5A 4FS3A 3FPLA 4LRTB 1ZMTA 5EINA 3F5QA 4EEXA 5G4KB 5DCWA 5JSFA 1G6KA 2WEKA 4O6VA 4RQUA 5KKAA 4YPOA 3UN1A 2J5KA 5JAIA 1OC2A 1BXZA 1VM6A 3PWZA 1YXMA 2P68A 2SCUA 4B3JA 4D46A 3SBOA 2HMUA 3I83A 3PFWO 4LGVA 3DR3A 2EERA 2R2GA 2X9GA 1W8DA 2WYWA 2X5JO 2X5OA 2PY6A 4MO2A 3RWBA 5KVCA 4WEQA 5ER9A 4F45A 3FBGA 5FI3A 3EYWA 4PLYA 3T4XA 2HJRA 2IEBA 4BMNA 1KY5A 4CMIA 3VPGA 1L1FA 3TF5A 2QZZA 1GUYA 1TT7A 4J7CA 1AXEA 2NTVA 4NBRA 1MC5A 1UXIA 1GZ4A 2FZEA 3CMCO 2VTDA 4DYVA 4AJ4A 3SXPA 4BNKA 5T6BA 4NNJA 1T2DA 4QSMA 4GMGA 2XXBA 3L07A 5G0TA 3GDGA 1PL6A 5FF9A 3RCBA 4PZDA 4CR7A 1C1XA 4HFMA 3S2FA 1LU9A 1C0LA 3JYNA 2UV8A 2YFHA 3M1LA 2O2YA 1SCUA 3NTRA 4QX6A 4WCDA 4EI2A 1H6BA 5TNXA 3VDQA 4KP7A 1LXCA 4LK3A 1LTHR 1N7HA 4ZQBA 3GZNA 1F17A 2AE1A 4R1NA 3EMKA 2P9CA 3PHGA 4RO0A 1CYDA 3LF1A 1GEEA 1T2FA 3AOGA 5ES3A 4PG5A 2D5CA 1QKIA 4WCFC 3X2EA 1KC3A 4BV9A 1YOVB 4DYDA 1X14A 3NV9A 5A06A 1PX0A 1OAAA 1WDLA 3PQFA 4TRJA 4BNLA 1PQWA 5I8WA 1QG6A 3KETA 4ZRMA 1DAOA 3JQ7B 4DREA 3NYWA 4TRNA 5AXAA 1Q0HA 2Y05A 4AJOA 1NVGA 2I67A 3QWFA 3TFQA 3P7MA 2J5QA 4GQAA 3ZU3A 3KRTA 4GX1A 4XYLA 1LSSA 1OOEA 3TL2A 1ARZA 3I9OA 3V1TC 3PHHA 4IDFA 3P19A 4U0KA 3DFZA 3ZWPA 4BNFA 2X0RA 1DFGA 3WICA 3TJRA 3AI3A 2DBQA 1BXGB 4N5NA 3RU9A 3FCOA 4BNHA 5T5QA 3TQHA 2NSDA 3QW2A 4TMFA 4GLLA 3ZHYA 1MG5A 5IZCA 2V6MA 1RYDA 4BOYA 1C0IA 1HDOA 2BFPA 4A10A 1E5QA 3Q3CA 2X0JA 3AY6A 4IDDA 4KQWA 1P44A 3H4VA 3GEGA 2NQTA 2O48X 2DBZA 1UXHA 4K6CA 3BMQB 4LSMA 1RM0A 1F14A 1XEAA 1EUCA 2W2KA 4GGPA 3ZDFA 3RAJA 4UAGA 1YJ8A 1KIFA 4RJTA 2QIOA 3FF4A 3AY3A 3CINA 3IAHA 3PJFA 1HWYA 1DRUA 2NV6A 4HFRA 3D0OA 4BNWA 1QRRA 4DQUA 4YXFA 4DWVA 3O38A 3PWKA 1O89A 4XA8A 3HB5X 5AYVA 3KLMX 1X1EA 2Q1SA 4WOJA 3MJVA 1LUAA 2GCGA 3HNPA 2CY0A 1YBVA 1N9GA 4Q9NA 1PSDA 3JQ9C 4CM8A 4IMRA 2VHZA 4M87A 5JO0A 2OXIA 3WXBA 4TVOA 4PLTA 5L4LA 2YZ7A 3NT4A 1FK8A 1DLJA 3ROMA 3P2OA 1XELA 2VUTA 3Q11A 4I5DA 4PZEA 5K0ZA 2BFOA 3WYCA 4RZHA 4W9NA 1B8VA 4YACA 1DHTA 2BFAA 1YL7A 1T2EA 2DPGA 2ZB4A 4BO8A 2IZ1A 2PR2A 1NAHA 5CEJA 3GGOA 1P3DA 3IL2A 3QJ5A 1K6JA 2VWQA 6LDHA 4PG4A 1EMDA 4YT8A 1HDXA 2G76A 4AJHA 4ALIA 4HV4A 5KJFA 2IODA 1ISJA 1W0CA 2HMTA 3KSZO 4M8SA 2GUGA 1SC6A 3BTUA 3AFNA 1IHYA 2BELA 2EW2A 2IZZA 4GWKA 4IDGA 2QG4A 5BNIA 2V6FA 2ZYAA 2X4GA 2NWQA 1DIHA 4NJMB 1ZK1A 2Z1NA 1WMAA 4O1MA 3OQBA 1CF2O 4OXKA 4UEKA 5A4DA 1DHRA 4WEOA 1ZXLA 3D3WB 3OSUA 2DKNA 1FDSA 4GSLA 2YJZA 3GNTA 3CZMA 5B4UA 3PRJA 1Y6JA 2VHVA 4TSKA 3ITKA 5T67A 2X9VA 3AWDA 5U1PA 3JYPA 1VRWA 1YBAA 3DOJA 1HXHA 3W1VA 3S2EA 1V3VA 4DPLA 3A14A 4PRLA 5BR7A 1XLTA 5KNLA 1ZW1A 3DBHB 3ENNA 4J9VA 1JN0A 1NQTA 4Y6PA 3ZI0A 1Z73A 2B4QA 4IXTA 4OOFA 4BNIA 3H7AA 1SNYA 5HTOA 1KEUA 2JD1A 3V8BA 1HDYA 5EMHA 3HDQA 2AQIA 2B5VA 2Y68A 3MJCA 1GYRA 3T4EA 4PVCA 4JK3A 3LT2A 5TGDA 1JAXA 1WXDA 2I3GA 3PFFA 3ZHBA 2FPGA 1GQQA 2UYYA 3WWZA 2EF1A 2R00A 1N5DA 1ZKMA 4ZRNA 1I32A 4DA9A 5T8KA 4XCVA 1DC5A 4JJFA 1X13A 2R00C 1G1AA 1UP6A 3W8FA 1R4MB 3BXXA 3NRCA 3IJPA 3QVSA 2ZYGA 4JN6B 1ZZEA 4NBTA 3EVNA 4LVUA 4DC0A 5AQ1A 2XAAA 4FN4A 2A94A 3GLQA 3VZSA 3L9XA 1XCBA 1WP4A 2Q45A 4WASA 4CLDA 3INTA 4E2ZA 3WFIA 4CLHA 1O6ZA 5JYEA 4UVDA 2FPIA 4CMJA 3FBTA 2HMSA 3TPCA 1K5HA 4AJ1A 3GRKA 4HBGA 4E4YA 4FJ0A 2Q46A 3M2PA 2BI8A 1Q0LA 3JQFC 3QV1A 1D8AA 2J3HA 4BO4A 3IP3A 1ISFA 5DULA 4TZTA 4Z9XA 3B1JA 4DIBA 4II2A 4OOEA 2NLOA 3RC9A 5HWSA 2GZ1A 1HZZA 1T2AA 3WMXA 3HADA 3TRIA 3RBVA 1KYQA 3DTYA 5MGBA 3FNGA 4TVBA 4F6CA 2I65A 3VOSA 4CLOA 1D1SA 3ZNOA 3C85A 3C24A 3G49A 1KVTA 1GL3A 1JKFA 3DBRA 1DRWA 3HDYA 1ORRA 3UVEA 2I9PA 1DC3A 2W8ZA 3NJ8A 3QWBA 3QVTA 1SPXA 2NQ8A 4BNVA 1MXFA 4IJUA 4NBVA 4N7RA 3UCEA 1FF9A 3QVOA 5TT0A 1CQJA 1PJSA 3GQVA 4IJVA 3STHA 5KOIA 4R5HA 4GX5A 4CMKA 1EK5A 3RROA 1I3KA 1PU2A 2C7VA 2Z95A 5IDWA 3GVPA 3V1UA 4ZQFA 1K89A 2P91A 3UUWA 3DBVO 3EGOA 4LW8A 5I9NA 1BDMA 3AY7A 1VKNA 5EPOA 2UUPA 3A28A 5TX7A 1SBYA 4PCVA 2RHCA 4ND1A 1Z7EA 5G2OA 4GSKA 1I30A 1DC6A 3LLSA 2EGGA 2VOJA 2RBEA 4RF3A 5THQA 4NBUA 4E5PA 1Y8RB 5C7OO 1UDBA 3S2GA 1IUKA 5A9SA 5DOZA 2OOSA 2HJSA 4BB5A 1JKIA 1HDCA 1LQUA 4B3IA 3U0BA 2EG9A 4CQLB 4OJNA 4MIEA 3WQRA 1M2WA 4CL8A 1P0CA 4A5OA 2E82A 2BFMA 2CDBA 5COQA 2Q1UA 4K9DA 3GVCA 1Y81A 4J1NA 2VT2A 3ANLA 2EKPA 2PGJA 3DWFA 3GEMA 4GBJA 3WTCA 3WYBA 3OMLA 5AOVA 4BGIA 1BXKA 1GUFA 1BW9B 1FDWA 4KUHA 2X7HA 4PG7A 5IJZA 2AMFA 2DU8A 1ZJZA 3F6YA 3I6IA 1KS9A 3DMTC 4FR5A 4URFA 2PKQP 4FFLA 3DB2A 4BQRA 4CM4B 4XKJA 2XOXA 3FTNA 5T64A 3DHNA 3GT0A 4FOOA 3D7LA 4Z9FA 5G0SA 3OQ1A 2I5PO 5JS6A 3H9JA 3MOIA 3WR5A 2PNFA 2VWGA 3N58A 7ADHA 1UXGA 2BI7A 2C29D 3JQ6A 3GR6A 2PK3A 3DC2A 4D3FA 3MJ4A 1SZJG 1ISIA 2FWMX 2WE8A 3GY0A 3PJEA 1B8PA 2JAHA 4J7UA 4BO2A 4J3FA 3IP1A 4UUMA 4Q39A 4XDZA 3NGXA 3W6ZA 3NDIA 3MJSA 1BTOA 3TZHA 1ZEJA 4XQCA 2WD7A 3BMOA 3OIFA 3RASA 2PD4A 4C4OA 3INGA 2ZB8A 5A04A 4Q3CA 4JNKA 2PD3A 1U2DA 4R68A 2VNSA 4DXHA 2HRBA 4GVXA 3W4KA 3AUTA 4L73A 1HRDA 4BO1A 3H3FA 4DQXA 1F0YA 3H8VA 4TWRA 4H16A 5A1TA 4FC6A 3TOXA 3F4BA 3PDUA 4RPLA 4YB8A 4B4VA 4RDHA 4WLOA 3EC7A 1UAGA 4NDNE 4MPDA 4CLXA 5CFZA 4GKBA 2OP1A 1D7OA 2WJPA 1B14A 4YJGA 2E37A 2FSVA 3R6DA 1ZK0A 2OP0A 1SAYA 5TC4A 3G1TA 3GUYA 3ZNPA 2P2SA 3ROPA 4L8VA 3SJUA 2E49A 4NK4A 3PDJA 4DIFA 5A02A 5ENVA 3W6UA 3U4HA 4AJPA 3DAFA 5AXCA 5IDYA 3PYMA 1IULA 3WWYA 4XX0A 1U4SA 4E31A 3AM4A 5ICSA 1SEVA 1Y9EA 1OI7A 8ADHA 4GVLA 1C1XB 3KSDO 2YQ4A 4UUNA 2GSDA 2Y93A 3RI3A 1B2LA 3GMDA 2A4KA 4Z3DA 5C3MA 4RPHA 3GFGA 4HKTA 2UVDA 4W4TA 2GN6A 1H6DA 1JQBA 2Y1DA 4WCFB 3ZGYA 1GV1A 3PI7A 4RVDA 4BNTA 1V3UA 5I7FA 2H6EA 1PGOA 4MP3A 4RVUA 2EGHA 1DXYA 4ITUA 3KXDA 1UZLA 4NFHA 4A03A 3BMCB 1FDUA 1A4UA 3ETDA 5G0WA 2PH5A 3HFSA 3FRJA 4ZA2A 2WE7A 4IUYA 3OIDA 5JYDA 2D2IA 2Y99A 3K30A 5DN9A 2PKQO 4BNZA 4YAKA 1MFZA 1MV8A 2GZ2A 4RL6A 3PJGA 5L53A 5TLSA 4ILKA 1LX6A 3BHJA 4M89A 2FMUA 1VPDA 3K5PA 5TQVA 4BO3A 1NM5A 4XYEA 4ZN6A 4YWJA 3I9NA 3EAGA 4CV0A 3MEQA 2FR8A 5F5LA 1I24A 3V5NA 4IINA 3JV7A 2J8ZA 3ZHZA 2WWRA 4E5NA 3MCVA 5FFFA 1X15A 4J43A 2B69A 2JHFA 4CR8A 2X58A 4BNYA 2WDZA 5JDIC 1GEGA 2OO5A 2B35A 3VZPA 4R5MA 4EJMA 1WVGA 1B8UA 3WJAA 1C0KA 4IGEA 2Q1TA 4ND3A 4EITA 3HHPA 5C37A 1TI7A 5JFOA 1I01A 1PWZA 2PD6A 1E1KA 4BO6A 2VRCD 1V35A 3HFGA 2IDZA 2VN8A 4HFNA 3RU7A 4WK6A 2BD0A 4IJWA 4FQ8A 4G81A 4I5FA 3OIGA 4P4LA 3RC7A 1FDVA 2W2KB 2QYTA 3K9QO 1P0FA 1FMCA 4YAEA 4WLEA 3L6EA 1R6DA 5A5FA 5C7IO 4CM9D 2B37A 5DZSA 1HDRA 2X9NA 4LVCA 1N92A 5F21A 4OSPA 1NVMB 3AUAA 3NKLA 1IPEA 3HUDA 1SB8A 2IYPA 1HEUA 3Q2IA 1PEDA 3QA9A 1KY4A 2B4TO 4F3YA 3Q9UA 1YKFA 3WTBA 4EUEA 1DB3A 3LDHA 3GVIA 1CQIA 3UFXA 2PTGA 2OFPA 1N9GB 1FXSA 4MVJM 2GZ3A 3IJRA 1K3TA 2Q1WA 3RD5A 5LDHA 4CM8B 3E9QA 1UP7A 4E2WA 3RKRA 1PS9A 3F5SA 3FTPA 4AICA 4R51A 3VAZA 3WLEA 3C7AA 4JCOA 3EVTA 1PJ3A 4RPGA 3GDOA 4GL4A 1S6YA 1YONA 1A71A 1PIWA 2O3SA 2B0JA 4U6QA 1YJQA 2H5LA 3O26A 1BDBA 5DBFA 1AXGA 3FHLA 4XWYA 3OETA 5A05A 1NPTO 2HDHA 1J6UA 3SEFA 3OFSA 3E5RA 1D4FA 1JKJA 5K6AA 3U4CA 3I5MA 2WTBA 4J91A 1R0SA 2YHIA 3E1KA 4IXWA 4FJ1A 3ZZNA 1PR3A 4YBZA 4NG5A 1MB4A 1ZH8A 2GR9A 5IZ4A 5CHEA 4C7JA 5K6AC 4KZPA 3IUPA 3WS7A 1X7GA 1ONNA 3JD2A 1XU9A 3BTOA 4DLLA 1QLJA 2BF7A 3CE6A 4RLSA 3CSDA 3RFVA 4QFDA 4RDIA 2DTDA 3EZYA 1WZIA 2A9FA 1NPDA 2V65A 5CEFA 1ID1A 4RLHA 1A9ZA 1ISGA 4E5MA 4XEHA 1I0ZA 3K31A 1G0NA 4CV1A 3VZRA 1M6HA 2NUAA 4UVHA 1PTJA 5U9CA 3DBLA 1WAMA 3SC4A 1M67A 3G79A 1LDNA 2VNAA 2AHRA 4LISA 4NQZA 4U0JA 4AFNA 1XHLA 2EXXA 1SMKA 4ZU3A 2GF2A 3HWRA 3QLJA 4J4HA 1GFSA 3ZWYA 3RJ9A 1UZNA 1M66A 3K8ZA 3GGGA 4LCJA 1CWUA 4QECA 4NHEA 2OBNA 3FN4A 1O94A 5IDXA 5KJ6A 1HF3A 3LK7A 5BNFA 1P31A 4HY3A 1RM3A 3ZWOA 3S8MA 4TRRA 4RZIA 4Y6SA 4P22A 1EVIA 1YDWA 2D8AA 3ANNA 2HQ1A 5KVVA 1ULUA 4EEZA 1MG0A 4L4SA 4NPCA 1E3JA 3KYDA 4A0SA 3OEWA 3OHSX 1T25A 3DMYA 4HP8A 3V1YA 3LC2O 1T26A 4FOSA 5IFLA 1R4NA 3EY4A 2Y0EA 3RUIA 4GH5A 3GN1A 4FCCA 1XYGA 2O3QA 1I2ZA 2ET6A 4MP6A 3CH6A 1A5ZA 3TDKA 3FWNA 1P1JA 2CVQA 3NTOA 4QO8A 3H5NA 1T1RA 2GLXA 5K9ZA 2W2LD 4DL9A 5I7VA 5HRUA 3JQBA 4OQZA 5G0VA 3RBZA 5KCZA 1J4AA 4FFRA 3CKYA 1O5IA 1F8FA 3QWHA 2FOIA 1X7HA 1LLCA 2PZKA 1JWAB 1C1DB 1K0UA 1B3RA 1UUFA 4PLWA 2D4AA 3GF4A 3I3OA 1WMBA 3I9LA 3KO8A 4MVJF 1EDZA 3TZCA 2PKRA 2JFGA 4KTVE 4YQZA 1ZK2A 1N7GA 4J7XA 4AVYA 4K28A 4WLFA 5LDGA 1KERA 3BIOA 1LDGA 1NR1A 2NTNA 3DEYX 3DZHA 3OQ6A 4CLOB 1EVJA 5FI5A 1BRMA 4CM1A 2O3JA 4OXYA 5L95A 3MTGA 3TOZA 4E5KA 5IZCC 2W98A 2J3JA 4ESOA 2NNLD 3JYLA 4Z0TA 4EZBA 4Z6KA 1E3IA 1M6WA 2YDXA 4O0LA 3PQDA 3WQSB 1NQAO 2BGKA 5GZ1A 1HKUA 4MVJA 4PZCA 4J0FA 1PGPA 1XIVA 5JW6A 2BH9A 1IE3A 5FEUA 1GUZA 4PLVA 2WYVA 3LC7O 2GN4A 1K2WA 3X2FA 3F4LA 2Q2QA 2EWMA 3DFUA 3HN2A 4L9RA 1VSVA 4BKRA 2EV9A 4L76A 3QWIA 3E48A 2QQ5A 3R3SA 4PLPA 4GPD1 3GFBA 4R1UA 4XIJA 2AA3A 3JD1A 3S1LA 4DVJA 4MJLA 3GG2A 3HQ4O 3KBOA 5L45A 2GN9A 3RUAA 3GN2A 5ILOA 2FHSA 3H2SA 4K26A 5A9SB 2ZIZA 5ITVA 4DMLA 4UVGA 5JDCA 2YV2A 4JBHA 3JQ8A 3O9ZA 1GY8A 3D3EA 2C2YA 3VC7A 2RH8A 2VWPA 1KEWA 1QMGA 3ASUA 3D4NA 4Q3DA 2Y1FA 1TT5A 3L4BA 1H93A 3B1FA 3JQGA 3U49A 4YDRA 2YV3A 1O0SA 1Y5MA 3I1JA 1RPNA 4OSOA 1GQYA 1EK6A 2O3UA 5FYDA 1NR7A 2VZ8A 3ZU5A 1UJMA 5KJCA 3ZU2A 5L9AA 2DUWA 1LI4A 4YRBA 2C2XA 4G5HA 2EP7A 4K6FA 2NVUA 2EIHA 1U8XX 4BHTA 1PZFA 4J4TA 4WLUA 4W9NC 2Z5LA 1AN9A 3PPIA 4UREA 3TSCA 1MP0A 4OO3A 3KTDA 4U6SA 4TROA 4RF5A 3G0OA 4G2NA 4XGIA 3RBXA 2J3KA 3BMNA 4INAA 5GMOA 4CM6A 3DZFA 2JCXA 3AM5A 3D4OA 3I52A 4MINA 1XQ1A 4L75A 2D3TA 3IKVA 1KETA 3UHAA 1BWSA 3WOHA 5F1OA 2BHLA 4NZ9A 5A3VA 4CUZA 4KWHA 5TT1A 4LMRA 1GQ2A 4BKOA 3IS3A 4IMPA 3UCXA 1ZMOA 3NDRA 4CPDA 4AJ2A 5F1PA 2HRZA 2B4RO 2DTXA 2FP4A 3LYLA 3BMOB 4E13A 1GR0A 3DQPA 3SC6A 5IF3A 5A03A 2G17A 3B6ZA 4KUEA 1UZMA 4L4RA 3RUCA 4D3DA 4B4UA 4HNGA 3C8MA 5H81A 2J6IA 3FPCA 4Z9YA 4FPXA 3COSA 2RHRA 1X0VA 2OGUA 3ZN2A 1X7DA 3ANMA 1BGVA 3ADOA 3DZKA 4KOAA 1WDKA 3JSAA 4XZ3A 2Q2WA 4YJGB 2EJWA 4AJIA 4YJHB 1HYGA 4M54A 2CDAA 3AUSA 3HN7A 3DHEA 1ENPA 4TKMA 4E0BA 2DT5A 3F9IA 3B20A 1SOWA 4ND4A 5TF4A 3DOOA 2PZLA 4BNMA 3WNVA 4CMGA 4Q3AA 1JLLA 4GX0A 2PA3A 4YJFB 4JIGA 4WNIA 3E82A 1RJWA 2NACA 2Y0CA 3A1NA 4GGOA 2B36A 5TSDA 2Y66A 4FFNA 1P1RA 5T8KC 1OMOA 4ZHSA 1I33A 1MGOA 2Y0DA 3NDJA 4XYBA 1GV0A 5F1KA 5F3RA 1P1FA 1HDZA 4Y67A 1Y5RA 3GVHA 2H9IA 2GYYA 4E2YA 3CTMA 2X5KO 1A9YA 3I4CA 1YE3A 1G0OA 4PRKA 2HK9A 1C0PA 3P5SA 1TVEA 3Q0EA 3WG9A 3CPSA 4OL9A 3ASVA 2VT3A 4WE3A 3RSHA 5I9LA 2GO1A 2NM0A 4W7IA 4CLRA 5ADHA 1T2CA 2HK8A 2RAFA 4BKQA 4E6PA 1OBFO 2VYND 3GNSA 1IHXA 6ADHA 1R66A 3DXFA 1HLPA 3VTFA 1H6AA 2EW8A 2F00A 3VH1A 3INRA 4DBZA 4EJ6A 5C5IA 1B16A 3OA2A 1U7HA 4DGSA 1CDOA 2I3AA 3JQ7A 1XWFA 4D42A 4E30A 1DOHA 2Q99A 4IS2A 4U7WA 3TNLA 1GAEO 2FPPA 3ZWWA 3QY9A 1YQXA 4R69A 3WGYA 4AJJA 4KMSA 5CEEA 3ONFA 1QYWA 1U3WA 1EFKA 1AUPA 4MKZA 3TN7A 5KIAA 1X1TA 3AFMA 4NIMA 4R9RA 5DDIP 2VCYA 5A5EA 1WPQA 1E3WB 2X0IA 1BXGA 4HFJA 2ZATA 3NUGA 3ZWXA 5A9TA 4KTTE 1ENYA 1CIVA 3AM3A 3MTJA 2CZCA 3ZW9A 1NQOA 4UVEA 3WGIA 1Q7CA 2LDBA 4Q3BA 5BSEA 1QSGA 2FR0A 1PJQA 3RIHA 3ZV5A 1EFLA 3RUHA 4UUOA 1ZFNA 2JAPA 4A73A 1KVQA 2P9GA 2ZKLA 5JCJA 2VTEA 3JQCA 3JQAD 4XQEA 2WYUA 5IN5A 3P2YA 4PVDA 3F46A 3UAGA 1ISMA 2Q3EA 4J90A 1JTVA 3I9MA 4YJDA 1KVRA 2ZTUA 3U09A 4O59O 2P4HX 2IZ0A 1YB4A 1RYEA 4UULA 3H6KA 1ZBQA 3WIEA 1W4ZA 1CETA 2CF5A 3DONA 2YHUA 1GDHA 3QVWA 1BHSA 1KBZA 3E9NA 3PLNA 3H3JA 3LZ6A 2O4CA 2I76A 3HZZA 3WGQA 1EQUA 3Q1LA 2QX7A 3U4IA 3KVOA 4J6FA 1VKOA 3FD8A 3HB4X 1IYZA 4UVIA 3BZUA 3ZWBA 3D5TA 4ALLA 1NFQA 1UDAA 4CM7A 4OXNA 5HBRA 5JC8A 3JQAB 4JGBA 5CDTA 5I8ZA 4I5GA 3BAZA 1DJQA 3Q6IA 4TZKA 3GGPA 2PLAA 1PL8A 3ROKA 3DTTA 4RPKA 5THKA 2VZ0A 3IIEA 4QT0A 4K1LA 1ZNQO 2D1YA 1I2BA 2ZCVA 4ZJUA 5TS3A 3R3JA 3R1IA 1FDTA 1OZAA 3WX0A 4NH4A 3W8EA 1N1GA 3WB9A 3EDMA 5CDGA 4CJXA 2YHIB 3A06A 3GMSA 3NEPX 2PGDA 2FSSA 2HLPA 1H2HA 2RH4A 4XRRA 4QO7A 3RFTA 1BG6A 2E48A 3HDJA 5HS4A 3QWAA 4W6ZA 1LRJA 1AHIA 1E7SA 5BQFA 1ENOA 2NU8A 4IZIA 3SJ7A 3I4FA 1F12A 4FW8A 3KYCA 3OECA 3UKOA 4M49A 4JX8A 2WSBA 1PJCA 2EKQA 4IIVA 2ZK7A 4RCVA 3GVXA 4R41A 4AJKA 2NVWA 2Y1OA 1NAIA 4WJZA 1LC0A 2HAEA 3OF2A 1E3LA 5COBA 1L7EA 4JBGA 3UXYA 4CMIB 4BGVA 1H9BA 1B0AA 3ZWNA 4MP8A 1GD1O 5ILGA 4J2OA 2AG8A 3KYBA 3DBLB 2YYYA 2Y1GA 1ZK3A 4LCEA 2VUUA 1E77A 2C5EA 3K2BA 1DBVO 4PFJA 1DPGA 1QV7A 2Y67A 1IPFA 2IXAA 1NWHA 1OFGA 2JCVA 1T24A 5CPBA 3V2GA 1PJTA 3NJ4A 1U4OA 3PIIA 3ZHXA 1LDBA 4MDHA 2C0CA 1JDJA 4YYZA 2X0NA 3GZNB 1ZJYA 4D0SA 2X6TA 2OZPA 3AUUA 5DCYA 2DFDA 4Z3KA 3IKTA 1P77A 3CZRA 4XD2A 3VTZA 5EERA 4B3HA 2A35A 1MA0A 5EN4A 2CVOA 2DM6A 3H9QA 1BMDA 5DBIA 2CD9A 5F5NA 4NI5A 1QYDA 5DP2A 3U3XA 4BIIA 1R4NB 1R37A 4J16A 2W4QA 4CV3A 3I6QA 1XG5A 1WNTA 3LLVA 2Z1MA 4W82A 4QUKA 1I3LA 3ZNQA 4DMMA 4CM5A 4BQPA 4D7AA 3LU1A 3VVBA 2VYVA 1XQ6A 3IDSA 4R9SA 1YBMA 4KDFA 4MVJD 1VJTA 3S55A 3I9JA 3B1KA 1A4IA 3DAPA 3ZU4A 1H5QA 1Z6ZA 3DO5A 3NT2A 4CMCA 4FJ2A 1ZK4A 4WPGA 3L6DA 2QRKA 2ZTLA 1ULSA 4XYMA 3PWSA 2NVBA 4BNJA 3DHYA 4DQVA 1CJCA 1DC4A 4IDBA 3D1LA 4GI2A 2C20A 4L4XA 2EP5A 1PQPA 3ULKA 2DUUA 1P45A 1E7WA 4U8GA 1RM5A 4ZQGA 3PEFA 4CQMA 4I1IA 1IY8A 2DAPA 5IXSA 1XKQA 2O7QA 2TMGA 3HE3A 4NR0A 1DDOA 5CPFA 3ZWVA 2BGLA 3AOEA 1SEPA 3VVCA 4CMBA 1DJNA 1NBOA 3C3XA 2HO5A 1F8GA 1Z75A 2VHWA 1CEQA 1R0LA 3ITDA 4TRMA 4WGGA 4LSWA 1S7CA 4D43A 3CXRA 3VH2A 2WM3A 4CMEA 4PLFA 3HG7A 5KKCA 1IOLA 2HCTA 2QRJA 4P4GA 3FWZA 4R1SA 1R15A 4BS9A 4CM3A 1Q1NA 5I7EA 4BGEA 1MLDA 4HWKA 2X8LA 2OBYA 4RVGA 3G17A 1Q7BA 4I9HA 1RWBA 4PG8A 1V6AA 3OEYA 2D5AA 4II3A 4H7PA 3ZV3A 3CEAA 4BMVA 5MDHA 3K73O 1E3EA 1C3VA 3ADPA 3JQ8B 1NYTA 5ER6A 3MWEB 4XQGA 3R0IA 3SLKA 5C7LO 1MXHA 1QXSA 1YQDA 3H5AA 3O8QA 1TB4A 5BSGA 2GPTA 1TT5B 4JP2A 9LDTA 3RC2A 4IZHA 1J49A 1HETA 4XJSA 1CRWG 1GPJA 1HE2A 3GOHA 3M2TA 3PHJA 4Y98A 1VJ0A 3CUKA 2TMDA 2W90A 1O9BA 2O3RA 1JVSA 3HDHA 4DLBA 4AJLA 4O63O 1NP3A 2GASA 2NVUB 4EUFA 4EW6A 4B7XA 3ONEA 4ALMA 2IE0A 3W4JA 4RVFA 1D3AA 4WNCA 5JY6A 3VKVA 1E7MA 1HE3A 1EDOA 1GCOA 3E18A 3KOUA 2JL1A 5B37A 4WECA 4CM4A 1NWCA 4BGUA 2RIRA 5BT9A 2R6JA 4ZD6A 1BVRA 4J4BA 3H2ZA 4E5YA 4BKPA 3CMMA 3OJ0A 3L4SO 1LRLA 1NVTA 1P74A 2BLLA 2VQ3A 3FNEA 3OM9A 3PXXA 4GKVA 1V8BA 2C54A 1LSUA 1ZCJA 1AGNA 1K6IA 4J49A 3IQDB 2VHYA 5CG2A 2DLDA 3L6OO 1J0XO 1I36A 3EHEA 3QVXA 4YA6A 2X23A 4LRSB 2BKAA 2EKLA 2ZTVA 1AE1A 1GYQA 4AG3A 1Q0QA 1LLDA 4D0RA 1EQ2A 2QRLA 4BVAA 3WFJA 3V2HA 1Q2XA 5ENDA 3E03A 3GAZA 2FZWA 1PJ4A 4TQGA 1A7AA 1GTMA 2X86A 3PHLA 4RF4A 2JJYA 1LDYA 3JTMA 4CR6A 4I9NA 1RM4A 3BYZA 4PLZA 1B7GO 1SO8A 3PQEA 2FY8A 2BRUA 1ZXBA 2LDXA 3FI9A 2O2SA 2QYSA 2Q50A 4FDAA 1O8CA 1I3NA 4HADA 4NFYA 4Q3NA 4ZGWA 1PZHA 4S3MA 4BNXA 1HSOA 5DP1A 2G82A 3RKUA 1Y8QA 1U5CA 1GYPA 2ILTA 4JXKA 3UH1A 4J2HA 1EVYA 4GX2A 2HUNA 2CMDA 1EEHA 4KWIA 1LQTA 4C7KA 1U9JA 3ORFA 2DC1A 2YFQA 2BGMA 1A72A 3BTVA 1CERA 4N18A 3TZ6A 4XJTA 1LBEA 3OP4A 4JJGA 1PQUA 5CDSA 3BA1A 2RCYA 2A92A 4BL5A 4IM7A 3PGXA 1KVSA 2IYOA 2P9EA 1ZSVA 4UEJA 4YAJA 3FNFA 5L40A 4FGWA 3WSWA 4FFMA 4WCFA 2AXQA 4DPKA 3IC5A 1R0KA 5CAEA 2OMEA 3T7EA 2FN7A 3PJDA 3L0DA 4BKUA 1NQ5A 4MIYA 3PIDA 3ZWMA 1JAYA 2O3TA 7MDHA 2AEJA 3L77A 4CLRB 2VRBA 2O23A 5G4LA 3K96A 1NASA 3BMCA 4ND5A 3WYEA 4AJNA 2CVZA 1E1MA 4N5LA 1MUUA 2YY7A 5TIIA 3JCZA 4GWGA 1KEVA 1UDCA 1ONPA 4QTZA 2UAGA 3JQBC 3PVZA 3L9WA 1E0DA 1O95A 2UUOA 2YUTA 3K2EA 4CUJA 1ZSYA 3MJTA 1UXKA 3GH3A 3QSGA 2X1HA 1ZIDA 1TXGA 3TZQA 2D59A 5JCJD 1YB5A 2QZ9A 4XGNA 5LC1A 2DTEA 4OAQA 4RF2A 5BNTA 4PG6A 4DC1A 3DBRB 1H94A 5AXDA 2WMDA 1IL0A 1N8KA 1Z45A 3GHYA 2Y1CA 4YAGA 1EVZA 2HKIA 3S2IA 1EZ4A 2ZQZA 1ZVMA 2ZB7A 3U9LA 1DAPA 1QORA 2JFHA 1DIRA 2O4UX 1KOLA 4E12A 1LDMA 1LSJA 3FR8A 3H9GA 1I3MA 3FSRA 4L0QA 1B3BA 4ROSA 5A9RA 3UF0A 3VH4A 4F6LA 1YL5A 3I9KA 1PR9A 2GNAA 3OJFA 5EIOA 1T4DA 2G5CA 1LSOA 3GZ4A 4MKRA 3F47A 5IDQA 3U62A 3VDRA 3OA0A 3NT5A 3ZV4A 3WGTA 1UP4A 1VE9A 3CIFA 3QE3A 3F3SA 4B4WA 5COAA 4EJ0A 4XB1A 5CG1A 1YQGA 4HNHA 2CFCA 4FD3A 5DF1A 4E2XA 4CL3A 3OH8A 4E3ZA 3RFXA 2ZB3A 3ST7A 1IZ0A 4UUPA 1IB6A 3PZBA 3RVDA 5JDCC 5IG2A 1Z74A 3MOGA 1AHHA 2VZ9A 3QP9A 5TRTA 1SB9A 3L4BC 3LF2A 1JVBA 2VRCA 4S1VA 3JD4A 3VPHA 4ALJA 4RGBA 3JQ9A 4YAIA 1VSUA 1YH3A 3OJLA 2POQX 3DZJA 2QHXA 4OM8A 5EQDA 4MVJE 1QLHA 1U3UA 2BMAA 2DQ4A 2HSDA 5JMPA 2FR1A 3TZKA 2HU2A 4YT2A 4O5OA 3GRPA 3JQDA 2Q4EA 1WWKA 3AW9A 2IEDA 4CM9A 3ETGA 3PYLA 1LJ8A 3AU9A 1TA4A 5J23A 5KJEA 4IDAA 1I10A 4N54A 5ICMA 1PJLA 3RJ5A 2DVMA 3PZRA 3KHUA 1BSVA 4PGFA 3VHRA 3LT1A 1V9LA 1LC3A 1V3TA 5U4QA 2WD7B 2EEZA 4CODB 1HL3A 1H2BA 3OBBA 1UR5A 4PLHA 3DAGA 3SX2A 3T7CA 3EUWA 3ZCXA 2GDZA 3GHHA 1XDWA 4AJEA 2JCYA 2XF8A 3GC6A 1PGQA 4YVFA 4CLEA 4I5EA 3WSVA 1VL8A 1P1KA 1NFFA 3KYCB 2OORA 1PZEA 1LLUA 2G1UA 1VC2A 1XSEA 2AE2A 4EBFA 1DFHA 4RVHA 1E7QA 2G0TA 3MZ0A 4IIUA 3MJEA 5JLAA 3PTZA 5G4KA 4JQCA 3DZGA 3WIDA 4EDFA 1BVUA 4FC7A 1RKXA 1D1TA 5JO9A 1U8FO 3OICA 2GN8A 4XIYA 4YEDA 1HT0A 4DRYA 4BMSA 3KZVA 3GAFA 4ONEA 3WNQA 1PJ2A 1GU7A 1LRKA 4OH1A 1HYHA 1LNQA 3FNHA 1NTOA 3KB6A 1QYCA 5T57A 1M75A 3Q9NA 1YS4A 4P8RA 5JCXA 4CV2A 2VOEA 2JD0A 3JYQA 1HYEA 2Y1EA 1E6UA 5HS6A 3VZQA 5DBGA 5JAQA 2VYVD 4YCAA 1XA0A 1NNUA 5L3ZA 4HXYA 3SLGA 1DLIA 3LC1O 2EJVA 2ZCUA 4Q3EA 4PIVA 5B4TA 4CUKA 5KJ1A 4MKXA 1VI2A 3ZWCA 1LDEA 2D0IA 2AW5A 4XB2A 1H9AA 4NMHA 1L7DA 2AEMA 4I08A 3GA0A 1DO8A 3UGKA 3DZBA 3GDFA 4IDEA 3B70A 4OYRA 4MVJG 1YWGO 3DOCA 4OGWA 4CQMD 1N2SA 2AEFA 3H9EO 4TKLA 4YRDA 1YOVA 3NX4A 3ICCA 2B83A 4XRGA 3LT4A 3BTSA 2HMWA 3WLFA 2FRDA 4QXMA 4RORA 2GGSA 2OHXA
chains in the Genus database with same CATH superfamily
1TYCA 4LXTA 1ADFA 2ODAA 2XKBA 1OYWA 3HSKA 5MN4A 3TUIC 4JJIA 4DLRA 2CSXA 3PX2A 3WBBA 1PNOA 3FCCA 1CFJA 1NV8A 2BMJA 2R79A 3N2YA 4R40A 9ATCA 2VZEA 3TXAA 1PDWA 1SCNE 2V98A 4GC9A 1WDMA 3C1TA 4HUJA 2RI6A 3HRHA 5FPPA 4MO9A 2XVAA 5FO0A 2WA1A 4AWBA 4F46A 1TL7C 2XW6A 2K7FA 3CWZA 2CK3A 5KYNA 3AL3A 4CQMB 3GLIA 1E79A 1VPWA 3CX4A 2QTVB 1A95A 2OAGA 3KCQA 3LVFO 3NYQA 5JBQA 3C45A 1KMHB 2PLRA 4ITVA 1HDGO 2H0AA 4WOBA 4MKFA 1KVUA 3ZCUA 5BPHA 2YRFA 1NT2A 3NWPA 5CLJA 1B74A 3ER9A 5JSUA 4FFBB 3VPXA 1XXHB 2Z1DA 4J03A 5AW8A 2TECE 4G37A 4ARAA 1JKMA 5CDUA 3L49A 1B26A 5C7YA 2DQZA 4H15A 1PWHA 5JJCA 5AXBA 2AJCA 1E1CA 4F5DA 3LBFA 1X1CA 2JD2A 2OHOA 5DX8A 4ESHA 1OBCA 3K6RA 4EA6A 1PDVA 2W2LA 3EXEB 1PNVA 3G6KA 1SK9A 3I1YA 2QVCA 4D79A 2P0EA 2OG1A 4YR9A 5J9FA 1CDZA 2ADMA 2QW8A 1FNCA 3VTKA 2EJCA 2VF4X 3AEUA 1CUCA 4ALKA 2ZKIA 4CDRA 2ZGVA 1VJRA 1UOQA 1AV6A 4KFUA 2PJDA 3VOTA 1UK7A 2JH3A 4UPEA 2EBHX 4F4UA 3KUXA 1D1PA 1PR6A 1VGQA 2B20A 3ETEA 1NYRA 3FYUB 1MQSA 3FYDA 4WNAB 5JSZB 1R12A 5I7UA 1VPEA 1CPYA 1P9LA 1W581 3ZW8A 3IBTA 4FWIB 5K09A 4Y2XA 3LSYA 3S2SA 2YMLA 1WB5A 2AOTB 3C4JA 3A9WA 4FSHA 4N6NA 2PSFA 2BAGA 3G1UA 4NNOA 3A6HA 4PAMA 1W29A 1YS9A 4URYR 4TL8A 1JE0A 1LI5A 2XSZA 4LN1A 3CCCA 4KLRA 5AHWA 5BWBA 1Z7BA 3IALA 4EG8A 1L5RA 2VHQA 3EXIA 5JAZA 5JNWA 1LPPA 1ZKDA 1T13A 1QP8A 1SXJC 2YRWA 1ISHA 3L7NA 4H08A 2W9XA 4CRWB 1P19A 3DMTA 4JJKA 4JVMA 3B8HA 1A7KA 1EM8B 3N6RA 3UPDA 5FLEX 1AD2A 1F4LA 1QX4A 4WZ6A 4BO9A 3ZZUA 1O87A 3CRW1 5CVJA 4BX3A 3UH0A 2CHUA 2GCOB 1A96A 1NTRA 4MYUA 1QPBA 2EKZA 2Z2ZA 3IDOA 4EG3A 4B6FA 2PGIA 1KMMA 3R76A 4O4JB 1JKJB 4DDHA 1SKUA 2MSWA 1JNYA 1OD6A 2AVDA 4UFOA 3UQZA 1G2IA 1CZLA 2B5OA 2FDRA 1FB5A 2J41A 4G8BA 4LJ4A 1MNAA 3TH5A 1E6WA 3N28A 2CJWA 3KFVA 4YNBA 4HDCA 1FNDA 4K9MA 4OIFA 3RVNA 4C4XA 2BONA 4FHGA 1LF5A 2PV7A 2IEYA 3KQOA 2ZRAA 3H05A 1YL6A 4WLNA 4EB3A 4EATA 3FB1A 3RK1A 3LXMA 1MH9A 1ZITA 2A84A 3AG5A 3MINB 3NKVA 2ZYWX 4MUJA 2GPAA 4WJKB 5KVSA 4RVSA 2ID4A 3D02A 2ECKA 1YDEA 3P2IA 1DT3A 1DIGA 3VAYA 2N1MA 4MW1A 4GI5A 2DPLA 1I80A 3ND6A 1GADO 1ZVQA 13PKA 4HAVA 2CWWA 3STVA 2EWWA 4U6NA 4K9NA 2PRZA 5HOEA 2IXFA 1FYEA 5EC8A 1AO3A 3ROZA 3AEKB 4I36A 4QFCA 5H82A 4ALNA 2HT1A 1G21A 4KPEC 1YO6A 2C5SA 2P5UA 1E9DA 1I5RA 2ZJFA 4QUGA 5EE9A 4DWWA 1NXQA 1TKAA 1WR8A 1TLTA 4UFNA 1N2EA 4EO7A 3D7NA 3MUOA 2VP6A 5IT9A 3HL0A 4QQKA 3L6RA 4FR0A 1U3CA 2JGDB 3A6KA 2D1FA 3AK4A 3JYOA 4IRMA 2FG5A 4JVLA 4WY8A 5CM2Z 3P5BA 3HJHA 4M1OA 4NV1A 3DLAA 5D5PA 2G9NA 1JR3E 3V9PA 2AFIB 1Z8DA 3C3JA 3DBHA 3QX7A 5K8JB 2GB4A 3RTDA 1XB2A 2WYOA 3D43A 4RVCA 4CCYB 3PCXA 4GZ5A 2WM2A 4JI7B 5DX0A 4ZTZB 1F2TB 1L4UA 3R41A 1PN3A 1L5HB 2X1VA 5KNCH 2E0IA 2I0FA 3T5DA 3R5JA 2VUHB 4D1YA 1KBOA 4FINA 2VDOB 2XVMA 1RJDA 2V6GA 2H4HA 4IL5A 4YJFA 4Y6RA 4LXXA 1DFIA 2X22A 3MTAA 3C7CB 3BK1A 4UDYX 2O7SA 3UMSA 1BEZA 5DGTA 3JVIA 1YKGA 3LKBA 2GD1O 1G8YA 1CUIA 1UC9A 3IE0A 3K6KA 3L7LA 4Q6BA 2AW3A 3U7QB 4DR5B 1R4MA 2X77A 2O8EA 3AHJA 3DOUA 1OLXB 1VGVA 3IELA 4MKGA 5EVCA 1X2BA 4IXNA 1YHNA 2DH6A 1JU9A 4X00A 1TDJA 2O8NA 3GLFB 4X5OA 2JGRA 1E6KA 5F2KA 2XGGA 2ZRQA 4OXXA 1U0TA 4G4GA 1HDIA 5L51A 2FFBA 4M1EA 1NULA 1TAGA 2JFFA 2NPFA 1MQ8B 1A82A 4F9EA 1ADCA 2O8VA 1ZCZA 4CIDA 4EMBA 2WUFA 4PC6A 2ZZMA 4CEHB 1GILA 4RNDB 2WVJA 3NGLA 1KDVA 4JLWA 2AG5A 3U4DA 1E1YA 3EW9A 2P9JA 3I58A 3O03A 3VJLA 4NS4A 3WB0A 5EJ2A 2JGEA 5K0BA 2VAXA 3DF7A 2RKWA 3UICA 3N6XA 5K8VA 1EE1A 1NQVA 1OYYA 1WHSA 2DUNA 2AOUA 4W5QA 3G82C 5HUJA 1YFJA 5L7TA 3L0ZA 4RXUA 2DBRA 4PY2A 3RVQA 5JWRA 1DV1A 4J0GA 2RGBA 1SR8A 3K1AB 5F52A 4TTAA 3T4PA 4JB0A 4FYHA 1YK1A 2HLDD 4DLAA 2OM6A 3P9XA 4MGKR 4U4AA 4DC9A 5J4LA 1E2HA 5TS2A 3O2QB 2CF6A 3L8FA 4MH0R 4X54A 5C31A 3VR6D 5TY0A 4ZVSA 4Z5XA 3HRKA 4DLNA 1LFAA 2BEKA 1CVRA 1TQDA 1IHOA 2A0UA 2FMFA 3AB3A 3TKLA 3WIUA 2OUIA 3K0FA 3HBJA 1ZD3A 2JCBA 4EK9A 4DG8A 1JA9A 3W9BA 4QA9A 2PZJA 3AGQA 5CLGA 5AJTA 3MWDB 2J4DA 1W88B 4QTYA 4IS3A 1BKSB 2VA8A 2R1UA 3E3MA 9LDBA 1FFYA 5I3ZA 3N7UA 2AX4A 2V7UA 3K53A 1K6XA 3ZUPA 4OJQA 3LBNA 1PL7A 4UATA 3OQNA 3P2KA 4WKCA 3LY9A 5JISA 4TT8A 2VYNA 3V4OA 1QBKC 3ZV6A 4QODA 3NXSA 5FNVB 2RSLA 5HJEA 3BZWA 3M1YA 3JWJA 1SIOA 3AM1A 2EU8A 5CCEA 4FIZA 3PXGA 1YFZA 4FN5A 4MRVA 5K6RA 5FUYA 4JBIA 2AVNA 3GK3A 5G0UA 2W0SA 4BE4A 3KEOA 4NAUA 2XZLA 1J2EA 3MGAA 3WGOA 2WJ4A 3ORYA 1MABA 2PH3A 2XPCA 2I8LA 1KQGA 3LUPA 4LZZA 2ZVQX 1QV6A 1XWWA 3TQTA 4ZTUB 1PLJA 2GEUA 4LDPA 4WY2A 3RFFA 3RF6A 1A9OA 2ISQA 3CF2A 5AM0A 4AKSA 2COUA 2QVXX 3C1AA 4PAGA 1GRQA 1HK7A 1HSZA 3R7DA 2J4FA 4NFSA 3SS9X 3AIKA 1L5MA 1Z2AA 4D56A 5IMSA 2HTEA 3W5CA 3ESXA 4QPNA 3UMVA 4QHYA 2WOOA 4GMFA 2GZRA 3RUEA 2P40A 2HCBA 2M98A 3LT0A 1PYDA 1CY2A 1R16A 4FGZA 2HADA 3TQSA 1NBIA 1RRFA 3RS2A 1VMKA 4CKBA 1I1QB 1QZZA 3MVEA 4UDOA 1TE2A 4MQFA 3NTQA 1AJEA 2VJAA 1F8UA 1YR7A 2HEIA 2J9GA 2WHPB 3G9TA 4G1UC 5KWVA 1KSJA 3GPDG 2XLCA 1KWGA 3HLTA 2CSUA 4Z54A 1ZUNA 3V2UA 4EP1A 1K06A 2P4QA 4ROTA 3TAHA 1FS4A 2ZJ1A 3LC0A 3BHMA 2FWIA 2YN4A 3NWBA 4Y8VA 3OLXA 2W6CX 4BEJA 2WFAA 3ZH9B 4BV8A 3SZ3A 3ZQ6A 1NX6A 4OFBA 4PLCA 3P0RA 3ELYA 1UIRA 3UJBA 1CLEA 3D6HA 5ALHA 1WLYA 2XGOA 2GCEA 4GMHA 2AS0A 3K09C 3MSXA 4BB6A 1QU2A 2Z9BA 3PIRA 3UCFA 4B79A 1PO7A 5TJHA 1DQYA 3U44B 1DDIA 4DS3A 1JF8A 3O8LA 4PZYA 3SWWA 5B1EA 2XMBA 4A7PA 1HT1E 5HRCA 5TQ2A 5JMWA 1Y63A 4Q4DA 1O96B 4XDYA 2IYVA 3B36A 1JG4A 2F1KA 4FHZA 5JTUA 1XVIA 5LCXA 3KAQA 4D99A 1VECA 1KYZA 1HMPA 3CNNA 2ZR8A 1Z4MA 1S3SA 3U60B 2HWWA 3PNPA 2GYWA 4JBXA 1HE5A 3W9UA 1AHNA 2QRGA 4EI7A 5IJWA 1OUMA 4IAOA 2PSDA 1ZMTA 2QTWB 5DXJA 1W5TA 2CHQA 1UWKA 3IMGA 1C81A 3FIUA 5DCWA 2Q0XA 1G66A 3DT8A 2FZKA 2WEKA 4RQUA 3RS8A 3UN1A 2RGXA 3EC2A 4EQZA 2ASVA 2J3EA 4HATA 4J6EA 3W3AA 2P68A 2RC5A 3CNQS 3EOZA 1GVHA 3U17A 1VP3A 4DSOA 2HMUA 3MTEA 3WLQA 3R9XA 1C9DB 1E60A 2R2GA 2ZYSA 1W8DA 3RTEA 2X5OA 4FBLA 2ECFA 4AF7A 5F76A 3FM9A 3CRNA 1VHJA 4R2LA 2HJRA 1GA1A 3T4XA 2IOFK 3VR2A 5GADl 1L1FA 3THWB 3ETHA 1TLFA 3R7AA 5AHOA 4AWXA 3TF5A 4ZTBA 5ALPA 2HHHB 4ZI5A 1ZNXA 2C98A 1TT7A 3DMFA 1IM5A 1CE8A 1MC5A 5JJKA 2AR9A 1VIVA 3B7PA 3CMCO 4Z7OB 3QPVA 3ABZA 4HRXA 1KI6B 3ZDEA 4AZ3B 4BNKA 1F6BA 2AG0A 3SS8A 4QSMA 1KJZA 2F3RA 4HDSB 3C70A 3D6JA 3GDGA 3O3CA 1N5IA 3RCBA 4CR7A 5HIIA 3RRZA 1C1XA 1VHTA 3T5AA 1LU9A 3JYNA 3VUFA 3W7VA 1B1AA 2YFHA 3QXCA 4KPGA 2BW0A 1K5GA 3K0AB 2O2YA 1C8KA 2RBKA 3M1LA 3JYHA 1XF9A 4RK5A 4S1OA 4EI2A 1TKBA 1WD7A 2WTEA 5TNXA 3VDQA 4K9OA 5CURA 2B7LA 1HTWA 4YRRA 2FX5A 4ZQBA 1PL0A 3GJSA 3H9BA 5B53A 2G06A 2IYZA 3PITA 1ZCFA 2B3DA 1ZIOA 2W2OA 4Y6LA 1T2FA 2Q9CA 3DOFA 5A4FS 3M6AA 2EW1A 4MGEA 5KOHB 5ES3A 2D2XA 2D5CA 4KBYA 3A1TA 4Q4AB 1J2JA 1OYOA 1XLVA 1NVVQ 3EMBA 4MUXA 1PX0A 1OAAA 1BE1A 3IA2A 2WUEA 4O0MA 2QRNA 1PQWA 3FZNA 1X3SA 3KETA 4ZRMA 3HKEB 4GQIA 4YBRA 3TR5A 5AXAA 2ZE7A 3FAZA 1JEDA 1KU6A 1Q0HA 5F33A 4YCDA 4ED9A 2A6PA 4C3UA 1FMFA 1C7QA 4R2HA 2I67A 4A9AA 5FX2A 3GP8A 3BCUA 3QWFA 2I33A 3TFQA 3DCYA 1F0KA 3NCTA 1I1OA 1T3GA 2WVHA 3DS8A 3EF1A 4GQAA 4KYTA 2LW7A 4NOKA 1JHRA 4Y9UA 5D7NA 1ND6A 4XYLA 1GLNA 3ANYB 2ZW9A 4P54A 3YASA 4ASUD 5KHLB 4IQFA 1QRUA 5ECYA 1XN1A 4GP7A 1AIPA 3ZWPA 3U7HB 1F2DA 1NLFA 2J0EA 3BORA 3HYRA 3L8EA 3V32A 4B3TB 5FWNA 1G19A 3O92A 2W2NA 2WYIA 4CKEA 3AI3A 2R8BA 3EZXA 5CT9A 1BXGB 4WIAA 1L5VA 4D02A 5C46F 3LHSA 2C8LA 3TLBA 3HP7A 2YVKA 2YFYA 2NSDA 3R6TA 4GLLA 3ZHYA 1CR4A 1MG5A 3K72B 4QTXA 1JB9A 1TD9A 2ZVDA 4FYPA 1MTOA 5KDLA 1Z5OA 3C0KA 3TRFA 4B34A 3MUEA 3AQIA 2O8FA 1C0IA 2BFPA 1GGEA 3Q3CA 4MHSA 5IJ0A 2X0JA 3FWHA 3THOA 3P8ZA 3AQ4A 4J8PA 4DW8A 4QYIB 4KQWA 4N41A 4XIIA 3GEGA 3EFEA 1LPOA 3UYKA 4BTLA 4MWTA 4PYIA 1J99A 1JA0A 3EQZA 2DBZA 3NFYA 1TZ2A 2CL7X 2VJBA 2QDXA 4K6CA 1Q20A 3M7IA 3S28A 2W2KA 4CKXA 3QLUA 2HA6A 4X20B 3C6KA 2P2ZA 3DEZA 4GMXA 5FWXA 1HBJA 3W5IA 3X1YA 3ZGVA 4BN4A 2JBHA 1E3DA 2GXAA 2FZLA 3GLGA 1XEWY 4EGQA 2D13A 5LR6A 3FF4A 1K4YA 2FEAA 3WHLA 4EZIA 5FWDA 1KFCB 4V1CA 5EZ6B 3AR8A 4IJ5A 1DRUA 3QVGB 4BNWA 2G6TA 3SM3A 3NUZA 1O89A 4I6EA 5BWOA 5KYYA 5I45A 3BD8A 3T9DA 4E11A 2BEUA 3HB5X 3N7AA 2WTNA 2NO0A 2Q28A 3KLMX 1RPJA 3H6HA 4PO9A 1Z37A 4FVTA 4MDEA 4CBVA 4GR5A 2CY0A 1Y34E 2MOKA 1JNXX 4JKOA 5F9HA 3SIRA 3AIMA 1H66A 1PSDA 1WTCA 4QYWA 4RGVA 3RT7A 4E1BA 3IB3A 5HGXA 1CUYA 2IUSA 4FMBB 4A23A 4NE7A 4CM8A 4XVCA 4PEVA 2OXIA 2X2OA 1XQ9A 2OK7A 4PLTA 1FK8A 1EA5A 5KNBD 1N7JA 2XVXA 1XELA 1V2HE 4I5DA 1WMEA 4TTPA 3C3MA 1EX9A 5JYCA 3KOMA 1M8GA 3FWKA 4W9NA 1KSFX 1VCNA 3KR1A 5ALKA 1DHTA 4KXWA 3ZGNA 1V47A 4P36A 3VNAA 4P3KA 1XCLA 1TCAA 4DLUA 2BFAA 4RKFA 4WOCA 5JJLA 1N5MA 3T7AA 4ZEVA 2DPGA 2ZB4A 3GU3A 4NYIQ 2XA1A 2OSBA 4KR0A 5AM2A 3FGPA 2IL1A 3GRYA 1A50B 1DO2A 2BDEA 2YWFA 1QNFA 4HV4A 1NC1A 2HHLA 4G1EB 5KMGB 2B8EA 2VSQA 3WL8A 1J8DA 1HT3A 2GUGA 2BELA 1D0SA 2I4MA 4LDNA 2QTCA 5BNIA 1QIMA 4MYDA 5B1DA 2QLTA 2NWQA 3HA3A 5FT9A 2ZP1A 1DIHA 1QP4A 1CEEA 3HBLA 1EFDN 4AZ0A 5A4DA 2RHLA 3OD5A 3OQBA 4UEKA 4UTOA 5CJ2A 3SX0A 2IEGA 3FHJA 2CXHA 5KWSA 2DKNA 3AR3A 1MO5A 2H2AA 3M6LA 4GSLA 4Y18A 5BN4B 4QQ8A 4YRMA 2QPLA 3DL0A 4TM7A 3WI7A 1JQDA 4L5JA 3KDPA 4HC4A 3TJZA 3HUUA 1P17A 1R00A 2DYKA 3DOJA 1HXHA 1B43A 1LPSA 1RAHA 2J6BA 1R7RA 3ZOKA 4PRLA 1VYTA 1GU0A 1ESDA 3QOYA 1RYHA 1II8B 3HV0A 4KL8S 4E51A 1CF4A 3Q8WA 4CG0A 5AICA 2OK8A 5DO9A 3E9DA 1JLKA 3D1JA 2QI9C 4ZO6A 5JT1A 4LBYA 4BTEA 1CIPA 1J0AA 1SXHA 3WIBA 2JA2A 5FTLA 3U7RA 1OXTA 4G0UA 3PXUA 1ZCBA 2YYSA 3HDQA 2V7QD 4DFDA 2POCA 4QZVA 1KE1A 4TYYA 2HPAA 1GYRA 3FI0A 1T43A 1EG7A 1Y3HA 4PVCA 4JK3A 4BDSA 1UFKA 2QR3A 4EL5A 1XA4A 3NORA 4YMVA 2FPGA 1J0CA 3CF6R 3G0BA 4DV5B 1USWA 1GTL1 3ZIAA 4U2GA 3L8GA 2YVQA 2YWXA 1I32A 3ZHVA 2AXPA 3P9PA 3IVCA 3EMVA 3PFHA 4HRYA 1KI7A 4TL9A 4YAOA 5T8KA 4RH1A 1R6TA 3ICEA 1JT9A 4GBGA 1ZH2A 3HVKA 1YZHA 4MDFA 1EG2A 1UP6A 1UJCA 3URKA 1M2OB 3ZWQA 2LRHA 3BH0A 4NE2A 1MDBA 3NRCA 2XQIA 1Q12A 2GM9A 1DQZA 3FCXA 3IJPA 3LWDA 5D86A 2NSLA 4D92A 3KOZA 1V7CA 4LVUA 2GD2A 4ETIA 2XAAA 3TRJA 2ZRHA 4J1JA 5LQAA 4WNYA 5IASA 2A94A 2AH5A 3INNA 3KD2A 2XOKA 3EIQA 2DEUA 3L9XA 3D2AA 1C41A 4V02A 2Q45A 2JKZA 4ZJPA 3PDCA 4X1IA 2IDKA 1YV9A 3WGUA 1IATA 4C07A 1BAPA 4W1SA 2QWXA 5DMHA 3DTVA 1R6BX 1M6NA 2CLEB 4CLHA 3VNRA 3GBSA 2XKJE 4YRIA 4M9UA 5JYEA 1WX1A 4Y2PA 2FPIA 4H0CA 4HAYA 4YLYA 1YVUA 4UXJA 2FRDC 1DTWA 4F0JA 5LOVB 4E4YA 4MWEA 2WG0A 3SBXA 1Q0LA 3JQFC 3PQ6A 2IDMA 5IMBA 3QV1A 1D8AA 3DKPA 2EZ8A 5J2TB 3CR8A 4AKTA 1PR1A 5CYFA 1OU0A 2HFJA 2JIRA 3I2IA 5JS8A 2XEXA 3B1JA 3BERA 4B47A 3KWLA 4M8LA 4DCNA 2OFWA 1AURA 3JWGA 2NLOA 1HNWB 8OHMA 5HWSA 2GZ1A 1T2AA 4PRZA 2OD2A 4HTFA 4AO8A 4HMPA 1KARA 1TIPA 5MGBA 4FILA 2ZJ5A 4MV0A 1NG1A 4F6CA 3ESBA 1ZUHA 4H2DA 2AJBA 2VQ6A 2XBUA 3C85A 1USKA 3KXKA 3BDVA 4TYNA 1DT5A 1DRWA 5HZMA 2IU3A 2I9PA 1DC3A 3AUXA 3AMVA 1I0IA 5K4GA 1JHVA 4RZ2A 5DK4A 3FZQA 1EJ0A 1MXFA 2QX4A 3FYSA 1T4MA 4E2FA 2ODTX 3QVOA 4EY3A 5TT0A 1CQJA 3GQVA 3STHA 1ZRMA 2OBBA 4O2RA 5BVHA 4CMKA 2ES4A 3ZVLA 1Y3AA 2AN1A 2G4VA 2XNDD 2Z95A 3ZI4A 2Q6KA 3B1WA 3GVPA 5IDWA 1GTRA 4MUGA 1F38A 3DXXA 5BSUA 2GDJA 3CA8A 1TQ8A 2OMKA 3VHLB 1BDMA 3ZDDA 1W4RA 2DR3A 1VKNA 5EPOA 5CA1B 1A9SA 4KBFA 1XVTA 4EG5A 1SBYA 4G5QA 1ACJA 1NXSA 4ND1A 1JDUA 3TD6A 2UYCA 3LLSA 2C9YA 1CB0A 5GGYA 5THQA 4NBUA 4C1NA 1Z29A 2Q3HA 1NQUA 3KPYA 5DOZA 1QFXA 4OXIA 2HJSA 4BB5A 2I1WA 1WUHS 4B3IA 2YYAA 2V0NA 2NU9B 4CQLB 2HA4A 1TAQA 1YZVA 4MIEA 1M2WA 2DKFA 3PFIA 4CL8A 4YXWA 4A5OA 3QVUA 2E82A 5CT5A 2CDBA 4C3VA 3SEQA 3GLIE 1AH2A 1BA3A 1W4BA 2WA2A 5FA6A 4KIWA 1Y81A 3L06A 5HCIA 2H48A 1DZIA 4Q4HB 2VT2A 2J45A 3CZ9A 5H0IA 5KYWB 3ANLA 2EKPA 1KI4A 1R0XA 3ZVMA 3DWFA 1JL3A 2BFDB 2QU7A 4NG4A 3K9CA 4NMMA 4B2LA 4BGIA 1L7BA 1P0QA 3F8WA 4TUYF 4PG7A 2C00A 2I80A 4DCSA 4K0KB 4DKJA 2PKQP 1XZMA 3DB2A 1OW3B 3VR4A 4CM4B 4F4JA 1C9MA 1TU0A 2XOXA 1E1QA 5AJWA 4MYHA 3GT0A 1V16B 4GI1A 2GPWA 1PR0A 4FOOA 3UMBA 2WABA 1K4MA 4R0VA 1LPMA 1UBRS 1E9SA 1WQ3A 1TO2E 1U2GC 3BFJA 3ESZA 1GNPA 1U3DA 3H9JA 4I8IA 3LDFA 2VWGA 4YCBA 7ADHA 4B40A 5LM3A 5JNTA 4TUYA 3CCFA 3AG6A 4D57A 4E94A 1M5TA 3FSGD 3JQ6A 4KDRA 2WHYA 2PK3A 1C4WA 1S4MA 3C6QA 4D3FA 1IAVA 1GNRA 1SZJG 5KQPA 2WE8A 3C3CA 1B8PA 1DWPA 3PGMA 3VSEA 3K5IA 4J3FA 3IP1A 2QR5A 3UXEA 1WD5A 2XGSA 3AV3A 2D6FA 3FCSB 1CP2A 2OKGA 3HS3A 4UNNA 4AIIA 1TM1E 1Y33E 2WF8A 2DPMA 4CTMA 1BTOA 4XQCA 1TCCA 2WD7A 3BMOA 1E62A 2ZQ5A 3VPBA 4Q02A 5FUBA 4IIXA 4JWKA 5T3YA 4Q3CA 4JNKA 2C84A 4R68A 4KC0A 1TA0A 2HRBA 4V0SA 3UC5A 4UTNA 5FQOA 1SXJE 4BO1A 2WJAA 1Y3CE 1F0YA 3AH8A 1MC1A 3I0NA 1SKBA 1TJ5A 1RYZA 3NBKA 4FDVA 1DP4A 3H8VA 3ZQJA 2G9QA 2P6NA 5D3ZA 3TD9A 4DIMA 4Y1GA 1YB7A 3BWMA 3D8BA 5TVKA 3IQXA 2SCUB 4N82A 1EGAA 4I4TF 4YB8A 1P4JA 1LJLA 4F9FA 1T91A 4WLOA 2OM2A 3EC7A 1JEYB 1VLJA 1RXSA 2PCLA 4GW3A 2OP1A 2Q5JA 2IZ7A 4DV4B 1MGPA 1B14A 2E37A 2FSVA 2JA1A 4KQJA 4HQOA 1CVIA 3R6DA 4J1TC 2OP0A 1NVAA 2XI4A 2H1LA 4M9ZA 2I62A 4MV4A 5AK6A 1ZH6A 5GJCA 4R3UC 4TQUS 4DUGA 5LMZA 4LYDA 3ZNPA 4RD6A 4UNIA 2UVPA 2WZCA 4OREX 2VPWA 4LHVA 3UG7A 4DIFA 5ENVA 1NE2A 1W87A 3RWMB 4BVJA 2XYPA 3DAFA 4OHXA 3KQLA 4I4TA 4ZU6X 3WWYA 5BRJA 4BRWA 3ZCSA 5ITZB 3KVYA 2Z2KA 3GGSA 5ICSA 1SEVA 1BS1A 1O95D 1OI7A 1H0SA 2BKVA 5IUJC 3KSDO 4UUNA 3E0XA 2ZUBA 2XT9A 3UXMA 4F4HA 5LZ2A 1DWOA 1F1BA 4HEA6 1SCUB 4Z3DA 1UEJA 1P5RA 1SBIA 1TF5A 2P67A 3GI1A 1TTPB 4PZ0A 2RI0A 5EMNA 1H2ZA 3WBJA 5GINE 2UVDA 1U28C 1KIAA 2Y1DA 1NVVR 1GGMA 1GV1A 2VPQA 1G3IA 1V3UA 3R24A 3DP9A 1RRCA 2M9MA 3GRVA 3OCJA 5I7FA 3UEOA 3K6SB 1MAWA 4RVUA 2EYQA 2XYQA 1DXYA 1HY3A 1T5LA 5ALDA 2O1EA 5G1NA 2ALJA 2V0CA 2YNMA 1Y4SA 3KXDA 3T4UA 3CCBA 1MA3A 1ESEA 2G7ZA 4A03A 4D4IA 4ZGBA 1PNTA 2XQVA 4GZMA 5G0WA 2WE7A 4ZOCA 2QUZA 4QYTA 4W6QA 1XWIA 2R62A 1GQOA 1OILA 1Z36A 1Z4QA 2WNHA 2ZPUA 3B2NA 3MJHA 5DXAA 4JVNA 3ZDRA 4BFWA 4BNZA 3CNEA 4PR0A 4RL6A 3OWXA 5L53A 2EBWA 4M89A 3BHJA 3OSZA 1VPDA 3K5PA 3OU7A 3S5JA 4TVSA 3D8HA 1U9IA 4XYEA 1KZ7B 1T0UA 5J2UB 4ZN6A 4FM9A 2QEQA 2QRQA 4ZAFA 4F72A 3MEQA 3UMRA 1W0KD 2C5FA 1GPUA 1ACLA 1YAHA 2LIPA 5DTIA 3UQYS 4M0EA 3NR2A 4IDNA 2PVPA 4GYKA 1RVV1 2HRRA 3R0VA 3IPCA 1BQ4A 1I7NA 2CD7A 4J43A 4KVZA 3TLXA 3R6WA 2X58A 4DEYA 1N34B 3E8SA 4TZ6A 5JDIC 4Q4CA 1IZYA 4EECA 3CVUA 3C8ZA 4ACAA 1LK5A 2IZOA 2PR7A 3FH0A 3IMCA 4TWAA 5C1IA 1VE1A 2DRIA 1XT6A 5IT0A 1CQZA 1RAAA 4F21A 1P1CA 1CY6A 1IJFA 2PBRA 2PDAA 4IGEA 1UODA 3FMGA 3ZTTA 4B44A 5JFOA 1UDWA 1PWZA 2WDPA 3SIPA 1KIMA 1HGXA 1RSZA 2ZIAA 5CX4A 3TEMA 2BKUA 2PD6A 1E1KA 1UFQA 5KREA 3QUQA 4AF8A 2VRCD 3CRMA 2QOEA 1N2BA 3EIUA 3HFGA 5C8ZA 3MPUA 1N9KA 4PO1A 2BD0A 3A6JA 3WYFA 2ZIEA 1CJBA 4IJWA 4MEJA 3ITEA 3OQJA 3H7IA 1SQGA 4ZVLA 4CT5A 3QF4B 1ODIA 1THGA 4II7A 4P4LA 3FPHA 1K7SN 4QTTB 3V8VA 4EHHA 1NF9A 2QYTA 4B6RA 1ZN8A 1OZGA 3VBEA 4E1AA 5KYUA 2VHCA 4CN8A 2ZM6B 5C7IO 2PUWA 4KFTA 4MAAA 4ZVUA 3BXFA 1OXSC 2R96A 2X9NA 3TMKA 1QZ3A 1EVKA 1XJWA 5F21A 3RYFA 3A9TA 5KINB 1K7XB 4K81B 2ZRNA 3GRUA 3W05A 1PFYA 3NKLA 1ZGAA 3JRNA 1YCHA 1YR1A 4RMIA 1A2BA 1L4KA 3SYNA 1CY4A 3RK4A 2I2AA 3L8MA 3F2VA 1KY4A 4ZC8A 5K8LA 3RHZA 5H02A 1AQLA 3LDHA 4XM2A 4EUEA 5CA0B 2IYYA 3GVIA 4ZHQB 4E3WA 4QXQA 2VI5A 3S1SA 1CQIA 3UFXA 5GWXA 1QTQA 2O8DB 2HXSA 3E05A 2HCJB 2OFPA 2ZR0A 1JGTA 5G3YA 1PKXA 3LBIA 2A67A 2FHPA 1XD2B 3IKMB 2QXUA 2VDVE 3RD5A 5KSZA 5LDHA 1DBPA 3NBQA 4DDUA 1EB8A 1GGJA 2EARA 5GOTA 4ZCPA 2Y0PA 3HUEA 3LGSA 1XRJA 4JVSB 3RKRA 5KQSA 4QWMA 1GQRA 3OZ7A 4NYIR 4Z4IA 1PS9A 4AICA 1XXLA 4R51A 5K0SA 4LF7B 3TTXA 3VAZA 3WLEA 2CWDA 3SQDA 4S0XA 5KKNB 2A2ZA 1PIWA 2P6PA 2O3SA 1TECE 5IUNC 2VDWA 3MWLA 4K3VA 2EGUA 4NMXB 2GBGA 4KRGA 5JEEA 2QG9A 1FJXA 4IOMA 3O8DA 2H18A 1IU9A 1ECFA 1IQUA 1XRLA 3MGBA 4WBNA 1ELOA 1O6GA 4Z9AA 1YMVA 3Q8KA 2GYUA 5FJIA 3SEFA 2UZ0A 2X5NA 2VP0A 5EKXA 2XNKA 1WEKA 3JQPA 3I5MA 2X19A 2WTBA 3CGWA 1GGHA 2FUNB 1T9AA 3E1KA 3NH6A 2BPOA 4WERA 3ZZNA 5KC9A 3GZTB 5KZMB 3PDWA 3EAFA 1DMSA 4LF8B 3SKVA 2H1IA 1ULHA 1TM4E 2DERA 1P39A 3NBMA 5H59A 2GCNA 2Z58A 3KQTA 4HN4B 4ETWA 4K9KA 2GPBA 1V1RA 4CIYA 5D3KA 3BKWA 1QGDA 4AJ9A 1NZDA 3CSDA 1U8ZA 1BCSA 3JVVA 1M2VB 4JOCA 4OV6B 4O25A 2PS3A 2Q3DA 2ZRCA 2WUGA 3I1FA 3T3EA 3WRYC 4TV9F 2QM3A 2OCKA 3RS0A 2BCEA 1WZIA 1XEFA 4KXLA 4XH9B 2GT1A 2I29A 2V65A 1J00A 5DN6A 5K20A 4EYSA 3LOQA 1A9ZA 3NHBA 3MTIA 1ISGA 4XEHA 3V4FA 2VEOA 2BTQB 3K31A 3VO2A 1BQ3A 3FUTA 3Q6MA 2R44A 1A8HA 3DEKA 1M6HA 2AWNA 5H68A 2OCLA 4TXHA 3P94A 3V1NA 3VZRA 5SZKB 1PTJA 1M0TA 4JUCA 5K0EA 1GM5A 2BC9A 4JFRA 1WAMA 4LHXA 5A7HA 2O1XA 1L5YA 3HYTA 3CEHA 1XDGA 4TV9A 3QLJA 5DTJA 1G8PA 2WW8A 2ZJAA 1QR2A 3BX1A 5HFNA 1I7DA 2HPVA 3K8ZA 1OLSB 1CWUA 2II6A 4LXHA 3BIWA 2JJ1A 1G17A 3COZA 4QECA 2OBNA 4CW7A 4ZZ3A 2C2GA 3ELDA 5KJ6A 4ENQA 1LPBB 1EK0A 2YH2A 1FFCA 3C3YA 3LK7A 3LRXA 4HY3A 4OHPA 5ALNA 5BNFA 3S8MA 3VR5A 5A5GA 4P7KA 4CKCA 2RK6A 1UJ5A 1EVIA 4DJJA 1YDWA 2E4XA 3ECAA 3LP5A 3IKJA 2WLSA 1EFUA 1L7OA 1V4NA 3AKCA 1WL8A 4O4HB 1SCKA 1XZBA 3EXFB 3W77A 4EEZA 5MN5A 4M2LA 2FPOA 5K3BA 1FVOA 1E3JA 2F6RA 2GJKA 3KYDA 2IBSA 4PC3A 1EAYA 2JARA 1AT1A 3O9VA 4LOLA 3QBEA 2FPKA 1NBMD 1NXVA 4HP8A 3H2KA 3QBDA 1DC7A 4HZUA 2YBEA 1L5NA 1GN8A 3W2TA 5DBHX 1L4FA 4UNRA 2D74A 4NYJQ 5MGNA 3SZGA 4D9GA 3IOCA 3OZCA 1RMTA 4LE1A 3ER8A 5EZYB 4PZAA 2P2YA 4RHUA 4S1WA 3MRVA 3JR3A 3JAMA 1T0IA 3TDKA 3FWNA 4IILA 2CVQA 4AN4A 5KYXB 4QO8A 1BGXT 2J0UA 1CY1A 4RY2A 3JARA 1AKMA 2H7VA 4YONB 3TCNA 1KZHA 3Q7TA 3F6SA 4OQZA 5TQJA 4BV3A 3RNLA 5JH7F 3IPXA 2B1JA 3R7WA 2XZTA 1BN7A 2OHVA 4TKUA 1XZGA 7YASA 2QPTA 1D1QA 1XK6A 1KO7A 1JWAB 1C1DB 1MIOA 2OCAA 2PRSA 1DX4A 2WHQA 3GF4A 3K9NA 1KEZA 4YRPA 3AR9A 1VLHA 3KO8A 4MVJF 4PZZA 2JFOA 4B84A 2FGJA 1VQ1A 5JSHA 3FVRA 1N3BA 2CNLA 1EJ6A 1MEEA 2ZJ3A 4ZCSA 4BATA 4EABA 5FWYA 3T5CA 2JAWA 4WLFA 3T9CA 1D6JA 1KI8A 3LQ1A 3IAS6 2W93A 5JH7A 4JLOA 3DZHA 1WXEA 1A5TA 4CLOB 3WFZA 3STTA 1BRMA 3HBMA 2J3DA 4OXYA 4CFYA 3LT5A 3GLRA 4E03A 4E5KA 5L95A 5IZCC 2X2EA 1EXWA 3CRVA 3U3OA 1QE5A 2FPRA 2YDXA 5GZ1A 2BGKA 3EGEA 2BL4A 3BH7A 4LSZA 3IEPA 4MVJA 2GZSA 3TZBA 5JW6A 4B3FX 2NUBA 4CTJA 4WXMA 2FE4A 1GUZA 2GM3A 4MWSA 2WYVA 2JDIA 2JS7A 4PLVA 2C1EA 1CR1A 1R6XA 3LC7O 2GZAA 1Z2OX 3WC4A 2HHJA 3X2FA 3F4LA 3L46A 5K6TA 1DEAA 2I1LA 1UAAA 4R2JA 3VPCA 4YV7A 3VKHA 1VSVA 2GAIA 5BSKA 3NHPA 4HWOA 3FKSA 2EF0A 3A10A 4L76A 3I8OA 4OYLA 3PPYA 3ZS9A 2I6XA 1SU6A 2WWIA 1F2UA 2P7IA 3TLKA 1T4CA 4P5DA 2BM0A 2C04A 4KO4S 1X77A 4OBWA 3E9YA 3LXRA 4AECA 1G7SA 4JB2A 4MNTA 4TLLB 1FUEA 3I6ZA 3LSTA 4S1PA 5ILOA 3H2SA 5A9SB 1NBEA 2ZIZA 4C76A 2PXXA 4DMLA 5JR3A 4TZ0A 3RIXA 5JDCA 3A1EA 1TF7A 3SR0A 3D3EA 5ALUA 4UBMA 3FY4A 2COKA 1KQOA 1QYRA 1KA9H 1KYXA 4WX2B 2FZVA 2BEWA 4GE3A 3ASUA 1QMGA 2V8BA 3URMA 2A0YA 2I2DA 2Y1FA 3T8YA 4ENVA 3B1FA 1OFUA 3U49A 4YDRA 4AK9A 4QDKA 2PGNA 1KRXA 2GFQA 3I05A 1Y5MA 3Q7EA 4ZZ2A 5D7BA 1RPNA 3GJYA 5JXGA 2DR2A 2JASA 1Z0DA 2AJTA 2O3UA 1RZ3A 3M4JA 1X8KA 4HQRA 2J33A 3O4VA 3ASZA 3Q9LA 4LHWA 4C2BA 3AT1A 2JVKA 3OZFA 1LI4A 4HNAB 5F1YA 3DO6A 3R8CA 2C2XA 3UJAA 4G5HA 5JATA 2VA9A 3QPBA 4B6GA 2CYBA 4ZI7B 1JLHA 3RK0A 3UFBA 1G5PA 1L9XA 2JH8A 4EYKA 1VJGA 4JI6B 5AW3A 1HFKA 4EG7A 3PPIA 1M10A 1FRNA 3I6YA 5GONF 1MP0A 3TSCA 1G8GA 3KTDA 1TFUA 2XUDA 3JS5A 4U6SA 3V55A 4C03A 4PN7A 3BMNA 2W2XA 4INAA 4G24A 1TCUA 1XAGA 4CM6A 1T15A 1G7TA 1AY0A 2Y9MB 3IVRA 4XUEA 3GLGE 1UPXA 2AJDA 3AM5A 3DZFA 3NBXX 3UHAA 1XQ1A 1RXVA 2D3TA 3IKVA 1XV5A 3GD7A 2E1PA 2NX2A 4NZ9A 4F6RA 4KWHA 5KSPA 4MXDA 3OU6A 5JS2A 2NAFA 5JANA 3IS3A 3E7PA 2I9KA 4Z51A 3CE9A 1NU8A 3UCXA 1P60A 3H17A 1KSGA 1TK2A 1Z28A 4Q7EA 4CPDA 2G88A 5F1PA 5GONA 4FZ5A 2ADFA 1R9NA 2FP4A 4P4TA 2WKWA 3QU4A 3U2QA 2ZREA 1EUQA 3GLVA 4KUEA 1ZGBA 4G2TA 3RUCA 2AG1A 4D3DA 2VSYA 3GX1A 4HNGA 4EGJA 4EKGA 5FBLB 1E6CA 5DHAA 2GCIA 3TQQA 2J6IA 2YC2C 3R3HA 3BPSA 3E70C 2XUKA 3V4VB 2JLVA 2RHRA 1X0VA 5H3HA 2ZWPA 3HCRA 3ADOA 3DZKA 1BJTA 1NMZA 4KNYA 1S89A 2GLTA