1FXSA

Gdp-fucose synthetase from escherichia coli complex with nadp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
317
structure length
317
Chain Sequence
KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQDRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GDP-fucose synthetase from Escherichia coli: structure of a unique member of the short-chain dehydrogenase/reductase family that catalyzes two distinct reactions at the same active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords PROTEIN (GDP-FUCOSE SYNTHETASE)
total genus 101
structure length 317
sequence length 317
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 1998-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1fxsA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1fxsA02
1DIGA 2OO5A 1LJ8A 3MJSA 3U4IA 3K8ZA 2I65A 2IZ0A 3PHGA 3DZKA 1YS4A 3WYEA 3JYNA 2CDCA 2ZTUA 3CTMA 4MP8A 5A03A 3ETGA 2AQIA 3TWOA 5ENDA 1X7DA 2O3UA 1FXSA 2XOXA 4IQGA 3VOSA 2FSSA 2EKQA 1I3LA 4GX0A 1K5HA 4G5HA 4R4JA 3R6DA 1VL0A 4AJNA 2BH9A 5L95A 4E6PA 4CLHA 3IJRA 4XDZA 5I7FA 1ZSVA 5I9MA 1FDVA 4OSPA 3WYBA 4BO3A 4CM5A 1SBYA 4MVJH 2Y0EA 1NQAO 3E9QA 4NI5A 4UUOA 1GUZA 2YHIA 3QRWA 2BI8A 4BL5A 3ORFA 1PL7A 3T7EA 4BO7A 2ZKLA 3VZSA 4NFSA 3X2EA 8ADHA 5I8WA 1UDCA 1QYWA 2NUAA 3D4OA 3BMNB 2X9VA 3MJ4A 1KBZA 1B2LA 1OC4A 5A3VA 3V5NA 4AL4A 2CMDA 1UUFA 3H9EO 1NM5A 2EW8A 1I30A 5CEEA 2NU8A 4MVJE 1JKFA 1TB4A 3QSGA 2HRBA 3BMQB 4IJUA 4HX5A 1ZSYA 3DBHA 4B79A 2X6TA 1HYHA 2E49A 4IDGA 4L9RA 1YO6A 3PWZA 1GTMA 4J2OA 4B8ZA 2NNLD 1OMOA 2FP4A 3L0DA 2X0NA 3FHLA 4J7UA 4GQAA 3UN1A 1DJNA 1ENYA 3GNTA 4IDCA 3D5TA 4CUJA 4RJTA 3WGHA 1PTJA 1QR6A 1DFGA 2DBVO 3BIOA 4BIIA 1H6DA 5MGBA 1PS9A 3H4VA 3FNGA 1FF9A 4BO2A 3AY3A 4BGVA 2ZK7A 4IMRA 1EE9A 3BTSA 2GZ3A 4BNUA 2QHXA 4GX1A 3F47A 2YJZA 2NU7A 2IZ1A 1E3WB 4MO2A 3ZWWA 4AJ2A 4BQRA 4EJ6A 3GLQA 4HNHA 1LLUA 1PZEA 4D46A 2I3AA 3ZV4A 3NX4A 5AVOA 1PJTA 5CG2A 3VPXA 2OHXA 2VOEA 2EF1A 1EQUA 4ALKA 2Y1CA 2OGUA 3U5TA 1U2GA 4GPD1 1C1DA 1K3TA 1RYDA 5U4QA 1WMBA 4W4TA 4WASA 4L74A 5IDXA 4CQLB 3ZNPA 1NVMB 5LC1A 3QA9A 3WIDA 1IULA 3A4VA 5LCXA 3W8DA 1MG5A 2D59A 3DAFA 4J43A 1EFKA 3BMCB 3M1AA 5CDUA 1MC5A 3IP1A 2B5WA 1N9GA 4PLZA 1MP0A 3GNSA 3L4BA 4CMEA 4BNJA 1V3VA 2VHYA 4KQWA 2GUGA 3DZHA 4U0KA 3LF2A 3GC6A 1UDBA 1YBAA 4RVUA 4QXMA 3DMYA 3SJ7A 3UGKA 2I99A 1GV0A 3ZWXA 5J23A 1LDBA 2QG4A 3AUTA 4NHEA 2OMEA 2GCGA 9LDBA 2VTDA 4RVSA 4OGWA 1Z73A 2WD7A 1MGOA 3VC7A 3EUWA 1NHWA 3OETA 3VTFA 3KSDO 1VJ1A 4XQGA 3H3JA 4BO5A 3NTQA 1ISGA 3H2SA 3L6OO 5IN5A 4ZHSA 4FJ2A 5C5IA 3BHIA 4B7CA 3CZMA 3UAGA 4B3JA 4PCVA 4FB5A 1TLTA 2WYVA 1O8CA 1UXGA 3E82A 2NSDA 1LSUA 2ZYGA 4IUYA 3F4LA 1P3DA 4TRJA 1HDYA 1DPGA 4QFCA 5EN4A 4WCFB 5JCJD 2HK8A 4R41A 4YPOA 3WSVA 3O9ZA 3AI1A 5TQVA 5CDTA 3ASVA 2WEKA 4EUEA 1GPJA 3LC1O 3MCVA 3G0OA 4JXKA 4QUKA 4Z0PA 3RROA 3TFQA 1YRLA 2PTGA 4IS3A 2H63A 2C29D 2X22A 4CPDA 1IB6A 4BNZA 5IJZA 1P1HA 2ZATA 1LSJA 4DREA 3JQAD 3KEQA 3N58A 3W4IA 3F1KA 4E30A 4ESOA 1JW9B 2LDXA 1PJLA 2PD4A 3DZJA 1KVSA 4Z0HO 2W90A 4BO0A 4YJFA 1HF3A 4RPHA 3IDSA 1GZ4A 1HE3A 4RDIA 4HXYA 4N18A 3GRKA 3JQ9A 4P4LA 4R01A 2YHUA 4DQXA 2VYND 2GNAA 2CUKA 2DFDA 3ZW8A 3TNLA 3C24A 4ALJA 3PZBA 4J4HA 3EZYA 4HKTA 2PH5A 3JQBC 3KBOA 4WUVA 1ZH8A 2OUIA 1J5PA 5F5LA 4R69A 1LDYA 4FFMA 1FMCA 2E37A 2PKQP 4LGVA 4L73A 3NEPX 2HLPA 1Z6ZA 4Z3DA 5JYEA 1XQ1A 1H2BA 3RSHA 3GVHA 4DYDA 3UICA 1WWKA 4TWRA 2IRWA 3WR5A 1X15A 1DDOA 2X9NA 4EUHA 3PHJA 1E7YA 3ITKA 2JKVA 4GWGA 1QRRA 3FRJA 4EGFA 1C1DB 1C0IA 4YT4A 2JD1A 1GUFA 3KSUA 4BUCA 4CLEA 5JDIC 3JYPA 3K2EA 1HE4A 3PWSA 3PXXA 2YDYA 2HRZA 4GH5A 5C3MA 1KERA 1HTBA 3OIDA 2VUUA 2FR0A 2DPHA 1XELA 4NU5A 2Q2WA 1PL6A 4PG6A 1NPYA 1N1GA 3EYWA 4BHTA 5T8KC 2C82A 1DRUA 4IINA 1IZ0A 4WCDA 4EW6A 4PVCA 4YQYA 1PJSA 4BV8A 1WMAA 4BKRA 4WGGA 2HUNA 4D44A 4GSKA 1U1IA 3ICCA 2VTEA 3KZVA 1R37A 2PKRA 4GI2A 3GMDA 4EDFA 1VL6A 2ZB8A 3WICA 2OOSA 5GZ3A 3U4CA 3HADA 5HTOA 3GN1A 1XA0A 2PZMA 5FWNA 1OFGA 3A28A 3KXDA 2V6MA 3OJ0A 2Z95A 4CM1A 4IQ0A 4OM8A 1HDGO 4PG7A 4J1SA 4PLHA 5ER6A 1U5CA 1I0ZA 5B4TA 2VRBA 4G65A 1UXJA 4IJWA 4XR9A 1LDGA 1VPDA 1YJQA 3WX0A 1F14A 4YJHB 1I3MA 4S3MA 2FRDA 4CV1A 3OJFA 3TDKA 2ZB3A 3RQSA 4JJGA 3RUIA 1ZNQO 1LDNA 1WDKA 1ZW1A 3PJDA 3IAHA 1L7EA 3OQBA 4TKMA 3D3WB 1T2FA 4W7HA 4F45A 5A5FA 3OA2A 2PGLA 2PWZA 3QE3A 3ZU4A 1NPTO 3CINA 3I5MA 4ZQGA 3L9XA 5KCZA 3GDOA 1Z45A 1N5DA 3BTOA 3MWDB 4M49A 4WEOA 1Z82A 2C20A 3ZWYA 3S2FA 1AXEA 3PQFA 1GADO 1SZJG 3E5MA 3RU9A 4O1MA 3PIDA 2VZ0A 9LDTA 1XR3A 2WSBA 4K28A 1LLQA 3ZWNA 3OM9A 1VKOA 1Z74A 3KV3O 4YTEA 1NWCA 2AMFA 2D3TA 4MIYA 4CV3A 4NQZA 1DLIA 4LRSB 2IEDA 4NR0A 3V1YA 1NX6A 2OP0A 1A4IA 3DOJA 2JHGA 3ZNQA 4L4RA 1N92A 2FHSA 1AHIA 3QWFA 4MKXA 4TMFA 5IF3A 4MVJG 5T6BA 1P9LA 3QWIA 5DF1A 3VTZA 4CV2A 3RKUA 3JQ7B 4M89A 1Z75A 1SPXA 2HO5A 4BB6A 3ADPA 4TRMA 3WGIA 3WGGA 3OJEA 1O89A 4I5GA 4TRNA 3D1LA 4HFJA 4ILKA 2O2SA 1E3SA 4DLLA 2QW8A 4DIBA 1HL3A 4DMLA 4YRDA 3F46A 1DFIA 1HE2A 1TEHA 3F5QA 4N5NA 5K6AA 5JMPA 2VCYA 4CQLA 1SB9A 3K9QO 4WLFA 5L4SA 3AOEA 5IZCC 3FPLA 3W4KA 1P1FA 5AXCA 4OKIA 3GFGA 4ZQFA 4BOYA 2FPGA 2FPPA 2POQX 3GEGA 3PGXA 2C5AA 1OZAA 3BA1A 3WBBA 3RBZA 4B7XA 4NNJA 2Y1OA 3F4BA 3KETA 1RWBA 3HJAA 3I3OA 1YB5A 4P8RA 3A06A 3SBOA 5H83A 5KVSA 3M6IA 1WAMA 5U9CA 1E6UA 1QYXA 5JAMA 2ET6A 4DIFA 3A1NA 1U28A 2PZLA 4ZU3A 2VT3A 3AUAA 1GEEA 1YB4A 1ADBA 1NTOA 2I3GA 3Q11A 2NVWA 4CL8A 1CF2O 4U6QA 3JYLA 1EQ2A 1FDSA 3L07A 4HBGA 1ISHA 4YT2A 3AOEC 4A73A 2I6TA 4ZA2A 2J3HA 5DCWA 3U3XA 5L53A 1IL0A 2P9GA 1KEWA 4R9SA 1YQDA 2AA3A 3S1LA 5K6AC 1PX0A 1E7SA 4J6FA 5JW6A 3I9LA 3WMXA 3PP8A 4QO7A 1QV7A 1UP7A 4AJLA 4CMCA 3BMOA 1WW8A 4R54A 4BNKA 2YFQA 3LT4A 4W6ZA 4D0SA 2VHXA 2Q99A 3GH3A 3PHLA 3TFOA 1VE9A 4R1TA 2FSVA 3FD8A 1EK5A 2EXXA 1I32A 1GYPA 3IIEA 3FTPA 5B4VA 1LUAA 1NR7A 3GAZA 2FPIA 4CODB 4PZDA 5T5QA 1D7OA 4Q9NA 4CQMA 3HDJA 2Z1MA 3I83A 1CEQA 4KTVE 2AG8A 5CG1A 5TS3A 2GDZA 3TZ6A 4BNGA 3QVTA 2YW9A 2G17A 2VHZA 2I9PA 3A9WA 3W8FA 1PGQA 2GN9A 3RC7A 3U49A 4HY3A 4BVAA 4DLAA 3OHSX 3SVTA 1WXDA 4AVYA 3EMKA 5TC4A 1D3AA 4HNGA 1X7GA 3EY4A 2H1SA 3OP4A 2QRJA 1Q7GA 2O50A 3TF5A 4NK4A 4CM3A 1VSVA 3FWZA 4Q3NA 5ADHA 4WNCA 1E77A 3GVXA 1HWYA 3G1UA 4RV9A 4WCFA 4ND5A 5A04A 2G1UA 4AICA 4J1QA 5DNAA 4XDYA 2Y66A 3H65A 3DFZA 4MIEA 1WDMA 1WP4A 5DBIA 3E48A 3PK0A 1YOVB 5EERA 2VNSA 5TGDA 2E82A 4FPXA 5CPBA 1M66A 2XPCA 4DQUA 2HAEA 5DP2A 5EL0A 1O6ZA 4FC7A 4XQCA 4ALIA 4BMVA 3DQPA 3ZWAA 2O3JA 3TPCA 2UV8A 3H5NA 4IXWA 4DRYA 1TA4A 3NJ4A 1PQUA 5JC1A 4R9RA 1Y5MA 3FBTA 2JD0A 4OXYA 5AQ1A 3ST7A 3DEYX 3KO8A 3TZHA 1A5ZA 2PV7A 1I2BA 3I52A 3IP3A 4LW8A 4E3ZA 1CRWG 4E13A 2Y68A 2WE8A 5JDIA 2G82A 3PLRA 3VVCA 3PI7A 4UUMA 2D5CA 2V7PA 5IDWA 2GGSA 3FI9A 4IIUA 1D8AA 1OC2A 4H15A 2BKAA 3NV9A 6ADHA 4IS2A 4GLLA 1WDLA 5F21A 5JPIA 3ZDFA 1KYQA 2Z5LA 3KLPX 3MTJA 5FFFA 1GZ6A 3VZPA 4AFNA 3K30A 4DVJA 3LDHA 2B35A 5ER9A 4F46A 4CMIB 2EWMA 2R6JA 3JQEA 3U4HA 4PLYA 1YWGO 3TOXA 2PFGA 1LEHA 3WLEA 1SEPA 4C7KA 3OFSA 2YDXA 2Y1EA 1VI2A 4E5KA 5CFZA 2RHCA 1Q0HA 2DPGA 1ISIA 3NGXA 3C3XA 4MJLA 5H81A 3W1VA 3OIGA 3WQRA 1X14A 1OI7A 2BMAA 3C1OA 1KC3A 4AJKA 2ZB4A 1B3BA 3GOHA 1F8GA 2VUSA 4XYMA 3H2ZA 2DTDA 4XYEA 4W9NA 2PH3A 3ZV5A 1I8TA 1UP6A 3O03A 4NJMB 2Q49A 1P1JA 3SLKA 3VKVA 2O4CA 3K6JA 4EEZA 4XJTA 5A9SA 3Q2IA 5KJ6A 1D1TA 2OFPA 1MC4A 2RAFA 3HUDA 1H6BA 2VWGA 4JGBA 4YJHA 1Y7TA 2C54A 3BAZA 1PU2A 2RCYA 1U3UA 1MFPA 1YL7A 2CY0A 3GZNB 1NPDA 5CHEA 4D42A 1PJ3A 2YV1A 1YVEI 2VT2A 5A05A 4A26A 1SOWA 2Y05A 4E2YA 1LRKA 3PGJA 3LSYA 3QVWA 1MXHA 4Z9YA 1VL8A 4R16A 1YKFA 3RBVA 2JCXA 4UULA 5A02A 3B1KA 5THKA 1ZEMA 1O5IA 2C7VA 1YL6A 4M54A 3DAPA 3OQ1A 1P1IA 4D3FA 2EGHA 3HDHA 2D5AA 3IS3A 3BMQA 3I1JA 4XIYA 2WYWA 4YB8A 4CMJA 3JQAB 1AUPA 1F0YA 4GLOA 2P5UA 3I23A 1X1EA 1EDOA 3Q0EA 3I4FA 2J3KA 3X2FA 2WM3A 3K31A 4RLSA 3DXFA 2LDBA 1YB1A 3A14A 4E4YA 2VHVA 3MJCA 2AHRA 3RI3A 4LCEA 4GVXA 3AU8A 3WDSA 4OAQA 1DXYA 1QORA 3INRA 3L9WA 4H3VA 4ROSA 5ES3A 4CMIA 4YRAA 1UH5A 4Z9XA 4FS3A 2TMGA 1E7WA 1AE1A 2D2IA 1KY5A 1LA2A 2HJSA 4RPGA 4CLOA 4I5EA 5I7EA 3ZCXA 1IPFA 1ORRA 3MJVA 2UUPA 4R5HA 4NFYA 3GUYA 1E3JA 1RM0A 3RC2A 3INTA 2NU6A 4L4SA 4PN3A 1U4SA 1ADGA 3JSAA 2FR8A 4RVDA 2I76A 3PIIA 1SMKA 3CEAA 1B7GO 1DHTA 1NQTA 2X58A 3Q6IA 5U1PA 4CM4A 4D3DA 2Q45A 1T2AA 1Y6JA 3ROPA 4CQMD 4GX5A 1HDZA 2OBYA 1XU7A 3ONDA 3RBXA 4FFPA 2P68A 1U7TA 2HQ1A 1BMDA 1JTVA 3Q1LA 5JC8A 1YE3A 3PLNA 1EVZA 2RHRA 4HWKA 3EVNA 2GN6A 4WECA 1CDOA 1T25A 1LSSA 5DCYA 4IDBA 3TN7A 4BKPA 3CPSA 3NYWA 4PG8A 1JA9A 1W8DA 3HQ4O 5DDIP 2B0JA 3VPGA 3FF4A 3QVSA 1PJ2A 3EVTA 3ROQA 4OYRA 2Q4BA 3OECA 4J0EA 4HP8A 3PDJA 4JBIA 3NDRA 3GQVA 1JU9A 2B5VA 1R16A 4OIMA 4R1SA 1PGPA 1G0OA 2OL4A 2OBNA 4U8GA 3T7CA 3KYBA 1NWHA 3UKOA 1KVTA 5GZ1A 3EAGA 5JE8A 1ML3A 3GUCA 3GG2A 4KOAA 2FZEA 4Y6RA 3BHJA 1L1FA 1EEHA 2AE2A 1N1EA 1T24A 1LNQA 3WGYA 1UAGA 5ENVA 4QTZA 4GAEA 2QZZA 3STHA 3KOUA 1KEPA 1YXMA 1SNYA 4U0JA 2X86A 1B15A 4BO4A 3DWFA 3UFXA 4F3YA 2WD7B 1WPQA 1UXKA 2BGMA 3ON5A 3HFGA 5L4NA 4M55A 1UJMA 1F8FA 2O3RA 1E3LA 3E1KA 1HZZA 1A71A 5DZSA 3EZLA 2W2LD 3K73O 1WNTA 4I9HA 1C14A 1N9GB 4UVGA 5HWSA 3V2UA 1H0KA 3VDRA 1ZUD1 1OAAA 3OIFA 4CM4B 1CYDA 3PVZA 5EJ2A 3WXBA 3JV7A 1XYGA 2X8LA 5JO0A 3MWEB 2JHFA 4W9NC 5F1OA 1KVRA 3JQ8B 5BSHA 2NM0A 5IZCA 4CR6A 2CF6A 4CR7A 5TIIA 1ZK1A 2RH8A 5EPOA 4BNMA 4E12A 3UCXA 3UF0A 1V3TA 1Y9AA 3P2YA 4KWIA 4NJOA 2AQ8A 1BDBA 1LXCA 2GLXA 1LLCA 1N7GA 1DRWA 4MVJM 2O4UX 2FMUA 1X0XA 2NADA 4FIZA 1ID1A 4M87A 4NFHA 5A06A 1ISFA 4AJHA 4XCVA 4DPMA 1PGJA 5ILOA 1EBUA 4WLOA 1Y9EA 4BNIA 1A27A 4MVJD 4IPTA 3W6UA 5JCXA 2DU8A 3DB2A 2Y93A 3EGOA 1DJQA 2QQ5A 5IXYA 4WNIA 1ISJA 1A7AA 3WTBA 8LDHA 3E8XA 4JQCA 3ANNA 3D4PA 3DBLA 4YJGA 2EIHA 2BFMA 2YV3A 3BMOB 2PZKA 3ZHXA 3SJUA 4J90A 4UUPA 3U0BA 3GG9A 5BSEA 1EK6A 2ZCVA 5JAZA 2IXAA 1DEHA 5JNLA 2VWHA 4UEJA 2VYVA 3ZH2A 3ZU2A 3H9QA 2V6BA 3LLVA 4HFRA 5KJ1A 2BGKA 1GV1A 2WDZA 3JQGA 4ZJUA 3ZI0A 4J91A 4MKRA 4I9NA 3PEFA 3BTVA 1M2WA 3S2IA 3B70A 1S7CA 2IXBA 4OJNA 1GZ3A 4DUPA 3DHNA 2AQHA 1YL5A 4Q3BA 2D1YA 4R1NA 1HSZA 1MV8A 3S55A 4R5MA 4GX2A 3RUEA 3QJ5A 4YAGA 2H9IA 2QIOA 1GQQA 4HUJA 4IQ8A 1H6AA 4I1IA 3TL3A 4FFNA 4KUEA 4JNKA 1XG5A 3WIEA 4LCJA 3R1IA 3COSA 5COQA 3RCBA 2JAPA 1E5LA 4D43A 2AE1A 1GYQA 1IOLA 4FDAA 5JS6A 5FEUA 4ALLA 2NLOA 4B8WA 2X0RA 1H6CA 5K9ZA 1NFFA 5AXBA 4XGIA 5T8KA 4LVCA 4IY1A 3LVFO 2QRLA 3HN7A 2EERA 5G4KA 5BT9A 2HCTA 1DC6A 3UXYA 1NBOA 2PY6A 4YT8A 5JDCA 2BGLA 1LSOA 3GPDG 3AUSA 2A9FA 3GVIA 3DDNA 2VZ8A 3L6EA 1GQ2A 4BGIA 1P0FA 4D3SA 5DOZA 3DZBA 4J16A 3FCOA 3KRTA 3DBRA 3I6QA 1U5AA 3NDJA 4JK3A 1NAIA 2IE0A 4DPLA 1DC5A 1DIBA 3ITDA 3V2HA 1KVUA 5G2OA 3JD3A 3NDIA 1R15A 1NYTA 4KP7A 3P5SA 3ANMA 3TZKA 1U9JA 3EW7A 4J1TA 1X0VA 3GHHA 1KY4A 4YAKA 2X5KO 4LSMA 1K6JA 5EQDA 1R6DA 2X0JA 1I5RA 1BXZA 3AFNA 4I9UA 2CFCA 2XXJA 1BVRA 1P44A 2B36A 2P9EA 4AJEA 4C7JA 2ZB7A 3Q3CA 1P77A 4GKBA 3AM5A 4CR8A 3VZQA 5TRTA 3JQBA 2V6GA 1NQOA 1E1NA 1JVSA 2O7QA 3KUXA 4URFA 2GYYA 4XQ9A 3ADOA 4E5YA 1ONPA 1ZK2A 3GFBA 3C85A 1FJHA 4IDAA 4RVGA 5JDCC 2VQ3A 4NG5A 2YZ7A 1PS8A 3HHPA 1TI7A 2TMDA 2GR9A 3L6DA 3AUUA 1XDWA 4IGEA 4F6CA 2D4AA 3VKUA 1F06A 2HK7A 3F5SA 2ZYDA 3PHIA 4E5NA 2BFPA 1ZJZA 3D64A 5A9TA 1AN9A 3WSWA 3TRIA 3ROMA 2C2XA 1GUYA 3RUCA 4IBOA 5DT9A 2NVBA 4MVJF 5IFLA 1P0CA 2AQKA 2JFFA 4OOEA 1T2EA 3OEWA 4XGNA 4E32A 1E3IA 1X1TA 1ZJYA 1QP8A 4WCFC 1EMDA 4AJ4A 4BO1A 1UZMA 4A27A 1AXGA 2PD6A 1E1LA 1D1SA 2W2LA 3ZWBA 3SXPA 4DC0A 5BQFA 1IY8A 1K6IA 1NFRA 3KM0A 4DC1A 1Q7CA 2O48X 4FW8A 5BNTA 4YJDA 4GBJA 7ADHA 2CDBA 5EQFA 4ND4A 2BI7A 2DBRA 3JD1A 2NQTA 4NBRA 3SEFA 4BMNA 5KKAA 1BTOA 3ZWCA 4RF3A 4NPCA 1YH3A 3NRCA 4CLOB 1YONA 2DTEA 1Q0QA 5JCJA 1NXQA 1Y1PA 4RZHA 4YCAA 1RKXA 1RJWA 2IEBA 2WD8A 4RF4A 3JD4A 3KYDB 2JFHA 2Q1TA 4QX6A 1HETA 3WJ7A 4BO8A 4BNHA 1C0LA 4TKLA 1Z7EA 4CJXA 3ZWPA 4CLDA 5EIOA 3ZWOA 3P2OA 4R68A 4FC6A 1EVIA 1E6EA 3U4DA 4K1LA 1A9YA 4BNFA 2X23A 4J4TA 3WWYA 4DGSA 2J3JA 2VN8A 4YBZA 4A10A 2H6EA 4MIOA 3VH3A 1C1XB 3E9MA 3CIFA 5MDHA 1GR0A 1QLJA 3P19A 4NBUA 3FNEA 2B4TO 4XJSA 3RUFA 1H9AA 1HT0A 2A92A 4YJFB 1GU7A 3LLSA 2AXQA 1PJ4A 1HSOA 1M6WA 1VC2A 4RPLA 3DL2A 4F6LA 4MVJI 4D45A 2IODA 2GN4A 1PL8A 3FNFA 2EKLA 4QO8A 2UVDA 1U2DA 1Y81A 4WLNA 4CL3A 2WTBA 4Z0TA 4J9UE 1EVYA 2ZTLA 5KVCA 4XZ3A 6LDHA 3R0IA 1HYEA 1U3TA 4TVOA 3R3JA 2JAHA 2CD9A 2BF7A 4FOOA 1XEAA 1YDWA 3GVCA 5JAIA 4HV4A 1PWXA 2ILTA 4O0LA 4J49A 3GEMA 4GVLA 4ZN6A 2NU9A 2AEJA 3JQ9C 2PA3A 4GMFA 4G81A 5JLAA 2GO1A 1DC3A 4J1NA 1DIHA 3QIVA 4RL6A 3GAFA 3RUDA 5TF4A 4E21A 4DXHA 4ONEA 3PJGA 1EE2A 3NT2A 1NASA 1X7HA 1ZK0A 4JX8A 2VRCD 2XXBA 2C2YA 2DM6A 2PR2A 3RC1A 4DBVO 4J4BA 3JQ8A 2X7HA 1LQUA 1N8KA 4Y9DA 5KOIA 1GY8A 3WGOA 1NQ5A 2FZWA 3PYMA 1CWUA 2J8ZA 3WBFA 2JCVA 1HDOA 1KETA 3ZZNA 4IZHA 4WKGA 1PGOA 5ICMA 3F6YA 5JO9A 5JFOA 3RUAA 3FWNA 3PRJA 4CQMB 3NGLA 5C37A 4L4XA 2QRKA 1UR5A 4PLVA 5COAA 1HE5A 1QMGA 1ZMOA 3LT2A 3V1UA 3G1TA 4WLVA 4FBGA 3E5RA 4AJIA 1WLYA 4E5PA 3WGTA 1NAHA 2BLLA 4XR4A 1A7KA 1KEVA 1SAYA 2ZJ1A 4IMPA 4K9DA 1E6WA 1SEVA 1Z7BA 3N7UA 4FCCA 4GL4A 4TQGA 3I9OA 1JWBB 1ZVMA 1EBFA 1UDAA 3UCEA 3VAZA 1ZBQA 3MJTA 4M8SA 3UCFA 5ITWA 3BMCA 5KIAA 5KNLA 1HLDA 2YFHA 3B6ZA 3HWRA 3LYLA 1UZNA 4DIOA 3WYCA 4WE3A 5DOVA 1I24A 1V6AA 3TL2A 2FY8A 1O9BA 4Z9FA 1SCUA 4M1QA 2Y1GA 1JAXA 1RPNA 1XWFA 4P4GA 2F1KA 5IDQA 4XGKA 4KDEA 4A03A 1FDWA 3CKYA 4W99A 3G3EA 2ZCUA 4B3IA 5CAEA 1EUDA 5KTKA 1GD1O 4M86A 4A5OA 2FR1A 4OMUA 1GYRA 4N5LA 4E31A 3VVBA 2J5QA 4PFJA 4BQPA 3GY0A 1NFQA 1NVTA 5EINA 4BV9A 1EFLA 1DRVA 1P31A 4E2XA 2UUOA 3ZWVA 5IDYA 1TVEA 1UXIA 1U8XX 5JBIA 1H94A 3H5AA 5I7VA 1B8UA 2PD3A 1B8VA 4MP3A 3TSCA 3ZHBA 1ADFA 2RH4A 3H9GA 1HYGA 2CZCA 1IPEA 1WZIA 3KLMX 2Y67A 4FR5A 2PKQO 1VM6A 3INGA 4UVHA 3JD0A 5G0VA 4Q3CA 2HMSA 1HDCA 1I2CA 4RVHA 3QWBA 3CZRA 2J6IA 2JCYA 1FK8A 5G0UA 3CE6A 2GSDA 3GNQA 5TX7A 2VYNA 2PGJA 3AI2A 3DBHB 2B83A 1GCUA 4IDEA 4XRGA 5HRUA 1HZJA 4JJIA 2NVUB 4JROA 4WOKA 3VPHA 1JVBA 1T1SA 4FQ8A 4OQYA 2NTJA 5KKCA 1DAPA 2G76A 3CMCO 4E33A 1BXGA 1T4DA 3HNPA 1PJQA 3WQSB 1XQ6A 4OQZA 2CSUA 2GASA 2GZ2A 5I7SA 1BWSA 1V3UA 3UHAA 4EITA 1R4MB 2DFVA 4IM7A 4EJMA 4BNXA 5B4UA 1XU9A 3DFUA 4DBZA 3QY9A 3FN4A 1CJCA 5DBFA 3GR6A 4JLWA 4CM8A 4GGOA 2DAPA 1B8PA 4OXKA 3H3FA 4WEQA 5EMHA 2C5EA 1G1AA 1ZIDA 1AGNA 1NVGA 3KYCA 3HN2A 3MJEA 4CM7A 3ONEA 1HDRA 5TNXA 3KVOA 4BS9A 3DBRB 3IUSA 1JN0A 4GKVA 4RPJA 3BHMA 5HBRA 3ULKA 3S8MA 1LU9A 1U3WA 3ENKA 4ZICA 1XKQA 3GA0A 2E48A 1IHXA 3QLJA 5GY7A 4UVEA 2IZZA 4IGFA 4PRLA 3B20A 2GRAA 2Q1SA 4Q3EA 4NMHA 1L7DA 5L7TA 1H2HA 2QYSA 3GZ4A 4J0FA 2I67A 2VWQA 4JBGA 2EJWA 4FSHA 3W6ZA 3LZ6A 4BNTA 3ZV6A 5JYDA 2VUTA 3MEQA 5CPFA 3AY7A 2E4AA 3IKVA 5ILGA 4YWJA 3W8EA 5FYDA 3F9IA 3W4JA 1T1RA 1ZO8A 1KIFA 7MDHA 1I10A 2UYYA 4Z6KA 4QQRA 4A2CA 4QEDA 2A4KA 1E3EA 1PSDA 3ETDA 3FR7A 1EUCA 4Y98A 2I66A 5T64A 3ICPA 3WWZA 1RYEA 5TJHA 3PYXA 2ZYAA 3NAQA 2R00C 3VH1A 4HFNA 3OJLA 3DHYA 3GRPA 4EEXA 1LDMA 1QYDA 1U7HA 2PNFA 3KEOA 1KVQA 2JJYA 2C7GA 5G0WA 1JQBA 1ZXBA 3GMSA 3WFIA 2EV9A 1M76A 4OXNA 4A0SA 3EK2A 2V6FA 2JFGA 3FBGA 3Q2KA 1PZFA 5TT0A 2O3TA 1EZ4A 1MA0A 4LISA 4WLUA 2FWMX 3DBVO 3GK3A 4OO3A 3U62A 2Q3EA 3PYLA 3IJPA 4KMSA 1KOLA 1QLHA 3HG7A 2P2SA 2DT5A 2WWRA 1TXGA 2B4QA 2EEZA 1QYVA 5DBGA 4DTIA 2VWPA 4NU6A 2ZTMA 1QSGA 1VSUA 3GGPA 4CUZA 2P5YA 4KTTE 3C1TA 4N7RA 1JWAB 4WLEA 4DLBA 3BMNA 3JQAA 3DO5A 3QVOA 1BSVA 3D3EA 2NTVA 1QKIA 3L4BC 4GGPA 2O2YA 3FR8A 3Q9NA 3WNQA 2NACA 1ULUA 4I8XA 4XYLA 1G0NA 3H8VA 4IDFA 5ICSA 3DR3A 4ZQBA 2P4QA 4K26A 1EUZA 1ZK3A 3RFTA 1DIRA 2W8ZA 3S2GA 3WG9A 1E1MA 4LMPA 2O3SA 1HKUA 4O59O 1ZK4A 3D0OA 1IUKA 1H9BA 2OORA 4CUKA 4CLRA 2Q2QA 1ZEJA 1C3VA 5A3JA 3RWBA 1E0DA 1BVUA 4LRTB 4XKJA 4MINA 2B69A 3NKLA 4NBWA 5T67A 1X13A 3P7MA 3T4XA 5KVVA 2JD2A 4PLGA 3PTZA 1CQJA 3HZZA 5I9LA 1RM3A 4IXTA 3L77A 4Y6PA 3RKRA 1ISMA 4PG4A 4Z3KA 3JTMA 3B1FA 1U3VA 4EYEA 2DUWA 3GDGA 3QWAA 4I5FA 1MLDA 2Q1WA 3V8BA 1UZLA 4IJVA 4JP2A 4RORA 1B16A 1B0AA 3ZNNA 2UAGA 3OBBA 4BO9A 3CUKA 2RIRA 2YYYA 5C7IO 1LLDA 3K2BA 3JD2A 4ZD6A 4TSKA 1YBMA 1C0PA 4LN1A 1J0XO 3RVDA 5KJFA 1IHYA 3NT4A 2W4QA 1Q1NA 2VHWA 1DOHA 4NH4A 5F1PA 3E18A 5AOVA 3I6IA 1V9LA 3D3WA 4YVFA 3C1AA 4UVDA 4BNVA 1C1XA 3V2GA 1P1RA 1PZHA 1R4NA 1ZMTA 4XD2A 5AXDA 4PLPA 4DL9A 3C7CB 4B7UA 1I3NA 3JCZA 3MOGA 4BKUA 1MUUA 1I33A 4JN6B 5TJ9A 1YDEA 4BO6A 1XHLA 4W7IA 1HEUA 4L75A 3VDQA 1CETA 2W98A 4KQXA 2YY7A 4P22A 3ZN2A 2PK3A 4LMRA 2YUTA 5G4KB 5FF9A 4D79A 1KC1A 2QX7A 1Y8RB 3KYDA 4XX0A 4YDRA 5DULA 1HDXA 1DIAA 1M6HA 4TVBA 4XB1A 3PZRA 3FSRA 3WQQA 4BKQA 4PLTA 1DFHA 3LT1A 4RQUA 1ZXLA 5LDHA 2Y0CA 1K89A 2WJPA 1JAYA 4QECA 4C4OA 2Y0DA 1BDMA 1BGVA 3VPFA 3G79A 3DOOA 2CF5A 3KTDA 3QVXA 4BKOA 4MPDA 3JQFC 3HFSA 1T26A 4HADA 1P33A 4O6VA 3OMLA 3RC9A 3G17A 4FFOA 4ND3A 4MDHA 2SCUA 3DZIA 4N54A 3OICA 2H5LA 3U9LA 1V35A 4JBHA 3ETEA 1EDZA 1NHGA 4MVJP 2AG5A 3MOIA 3OH8A 3QW2A 4XYGA 3AWDA 3HE3A 1GFSA 3PHHA 3TZCA 3UH1A 4RF2A 5BNIA 4TRRA 4ND1A 2GZ1A 1ZKMA 1W0CA 1YJ8A 5L7YA 4IIVA 3ROKA 1XGKA 1PR9A 3GT0A 2Y99A 1BRMA 4I08A 4L8VA 5KVQA 1T2DA 1MX3A 5CDGA 4GSLA 4RF5A 3ANLA 2J5RA 2O7SA 1GQYA 2CVQA 2EKPA 5GMOA 1LC3A 3KB6A 4FGSA 5FI3A 3VHRA 1NP3A 5B37A 4II3A 2DBQA 2X4GA 1M75A 2FN7A 2HMWA 4FJ0A 3WTCA 3JQCA 1M67A 3DBLB 4YJGB 2A94A 4BGEA 1XLTA 2O23A 3FTNA 3WB9A 4MP6A 3AW9A 4YQZA 1HXHA 1Y5RA 5AXAA 4AJPA 1N7HA 1R4NB 5KJCA 2W2KB 3AY6A 5BNFA 3LU1A 4ZQHA 3I9NA 4JJFA 3RUHA 5JY6A 2DLDA 5BR7A 5L4LA 4NZ9A 1GPDG 1R12A 3FNHA 3K96A 3KYCB 4H16A 1R0SA 4PRKA 1ZFNA 2Q1UA 3PDUA 1UAYA 2D0IA 1ZCJA 1KEUA 4Y6SA 3TZQA 4BB5A 4IDDA 2NWQA 3UOGA 5BSGA 5CDYA 4DYVA 4J3FA 3RFVA 3RJ9A 4LSWA 4XIJA 4B3HA 1GAEO 3DMTA 1LRLA 4YACA 3U09A 3ZV3A 4YR9A 1YQGA 1TT5A 5G0SA 4YYZA 1PIWA 1ULSA 4FFRA 3I4CA 4L0QA 4PLCA 3GZNA 4AJOA 3IQDB 3NTRA 1VRWA 4U5QA 1F12A 2HMVA 2GF2A 3FPCA 4NIMA 1LDEA 5F1KA 4QFDA 5B1YA 2YQ5A 4RDHA 2DQ4A 2BD0A 4RGBA 1J6UA 4Q3DA 1C0KA 3WLFA 4FGWA 4PLFA 4L76A 4OSOA 4NJMA 4R1UA 2EP5A 2FOIA 4CMHA 5A9SB 1QG6A 1I2ZA 3ASUA 3LK7A 5THQA 3NUGA 3GEDA 2Y1FA 1DSSG 3JQ6A 4OHUA 3AK4A 4J7XA 2HSDA 2X9GA 4CV0A 1U8FO 2B37A 3ZU5A 3M1LA 4XQEA 3VH4A 1K0UA 4AJJA 3AM4A 3LT0A 3OA0A 3DMTC 4NDNE 5IXSA 4KUHA 2OXIA 3AU9A 3OF2A 1HRDA 3MTGA 1E1KA 1DB3A 2OP1A 5HS4A 4DMMA 1Y8RA 2ZJ0A 5DCUA 4G2NA 1PZGA 3SX2A 2V65A 1H93A 3GHYA 4PZEA 1A4UA 4ZRNA 4GMGA 1T2CA 5B12A 2UDPA 2PZJA 5HM8A 3C7AA 4TROA 5DP1A 4YAJA 4ZQEA 2ZQZA 1QYCA 3D5QA 1ONOA 2NQ8A 1SB8A 1PQWA 5TLSA 4EZBA 3I9MA 4RVFA 5CDSA 1XIVA 2O3QA 5LDGA 3DTTA 3ZHYA 3Q9UA 4FFLA 4FOSA 2NV6A 3T4EA 4B4VA 5BSFA 3AJRA 4RZIA 4WOJA 3QHAA 1R0LA 1W6UA 3VZRA 5C7LO 5KJEA 3H9UA 4JP3A 4NBVA 2DC1A 2DKNA 4A7PA 2HK9A 5K0ZA 3C8MA 3CMMA 5AYVA 3H6KA 1G6KA 3VH2A 2R00A 1RM4A 5TT1A 3VPSA 2VYVD 4S1VA 5L9AA 4R3WA 3GPIA 4UVIA 4PG5A 4WPGA 4CM9A 1DBVO 4HFMA 1LTHR 4AG3A 1OBFO 2DVMA 2PLAA 3WFJA 3ENNA 1R66A 2OZPA 3K5PA 1B3RA 1PGNA 1YGYA 5A5EA 1B14A 3H9JA 2HDHA 4NK5A 4YA6A 1ENOA 3TJRA 1GCOA 4PVDA 1VJ0A 5L45A 3LC2O 4Q39A 5C7OO 5I8ZA 1ADCA 4KZPA 3ZHZA 2C59A 1NR1A 1E7QA 4J2HA 4D0RA 4ZGWA 1MG0A 4ALNA 4N5MA 5FI5A 2BELA 4ALMA 1PQPA 2IDZA 4BNLA 1UXHA 3E9NA 4UAGA 2VRCA 2Z1NA 5H82A 5IN4A 2Q50A 1ENZA 1D4FA 2GERA 2ZQYA 4ZVVA 1R4MA 3S2EA 1I3KA 3ZGYA 3IL2A 2VOJA 2WYUA 4DQVA 1H5QA 1P74A 1WZEA 2X1HA 4YAEA 4CMEC 4E5MA 2C07A 4PLWA 1R0KA 4XB2A 1O0SA 5DN9A 4KWHA 3O8QA 1U4OA 1XSEA 4RPKA 3RASA 2R2GA 2E6UX 4KDFA 3RJ5A 3F1LA 4YAIA 2ZTVA 4K6FA 1K6XA 3G49A 3V1TC 5IAAA 3UW3A 4JCOA 1SOVA 4CMGA 3WGQA 3M2TA 1AHHA 1IE3A 2X5JO 3HSKA 3IUPA 3PFFA 4IZIA 4CMAA 1GDHA 3OJOA 2HU2A 2Q4EA 2HMUA 3D7LA 1PWZA 1V0JA 1Y8QB 4PIVA 3RFXA 5L40A 4BGUA 3DC2A 4FN4A 5A1TA 5JXWA 3IC5A 3RIHA 4R3NA 4CMKA 5ITVA 1Q2XA 2BRUA 1DC4A 1MXFA 3EDMA 1E3WA 3IKTA 2NVUA 5L3ZA 2EP7A 3BXXA 3KSZO 3O4RA 1GL3A 4KUGA 4CM6A 4UUNA 4E2ZA 5A9RA 4BMSA 1BW9A 5L51A 3BZUA 1NNUA 1LC0A 1VLLA 3I9KA 1K2WA 5T57A 3DZGA 4Y8VA 2CVZA 5EESA 3UVEA 3DONA 3WMWA 3DZFA 1MB4A 1P45A 4BNWA 4K6CA 1SO8A 1LRJA 4II2A 4W82A 4UREA 2Y1DA 5CEFA 3BYZA 1IYZA 1T4BA 3LC7O 4U7WA 1PR3A 4BNYA 2AEMA 4XRRA 4ZRMA 5JAQA 1FDUA 1ONNA 1DLJA 4CMBA 5JMWA 4D41A 1ZSNA 1Q0LA 2DUUA 2Q2VA 3PJEA 4PGFA 2GN8A 1DO8A 3ZWMA 1RM5A 2Q46A 5IG2A 5IZ4A 2C0CA 2YV2A 3JQFA 4LVUA 3HB4X 1ARZA 4ND2A 3GGOA 3PJFA 1PJCA 3OEYA 4MVJA 1DAOA 3UUWA 4O63O 5HA5A 1A9ZA 1JLLA 3PFWO 3R3SA 3K92A 2XF8A 1DHRA 3AFMA 5CEJA 4CLRB 1E92A 4O5OA 3WOHA 3OQ6A 3DOCA 2B4RO 1S6YA 2J3IA 4R51A 4FJ1A 4INAA 3WNVA 3QWHA 3O8QB 1FDTA 5G0TA 4OOFA 3L4SO 3EC7A 4B4UA 5GZ6A 3H5RA 4FD3A 5JSFA 4NBTA 4QSMA 2X5OA 4Y67A 2EW2A 4CM8B 3AOGA 4UEKA 4TZTA 4UEOA 1O95A 3RD5A 5HS6A 3DHEA 1LQTA 2W2KA 3GF4A 3WJAA 3WGZA 3ZNOA 4DWVA 3ONFA 5L7WA 4RQTA 2BHLA 4TZKA 1I36A 1BXKA 2AW5A 1LI4A 5KWEA 2EGGA 3RAJA 5CP8A 2RBEA 1EVJA 1J4AA 1OOEA 4E0BA 2DTXA 2QZ9A 3MZ0A 1CQIA 3ZU3A 1JKIA 3AM3A 3D4NA 3CH6A 4LK3A 1KS9A 1QV6A 1TT5B 3I9JA 3QV1A 4JIGA 3HDYA 1TT7A 1JDJA 1ZZEA 1VKNA 3PWKA 4P38A 3RU7A 1J49A 3HB5X 3O38A 2GPTA 2F00A 2CDAA 4XWYA 4I5DA 3DTYA 2P4HX 3OSUA 1LX6A 2HMTA 1BW9B 4OL9A 3SC6A 1Q7BA 4ITUA 1B26A 1A72A 3KHUA 3IOYA 4QT0A 4EBFA 3LQFA 2BFAA 3CSDA 3GDFA 1QXSA 3NJ8A 3E6AA 4PZCA 3PPIA 2HKIA 1V8BA 1UP4A 3E03A 3M2PA 3ZW9A 1PS0A 4YRBA 2QYTA 2GD1O 3IMFA 1E5QA 5G4LA 1F17A 4CM9D 1MFZA 1O94A 2JL1A 1W73A 2WMDA 3BTUA 4RLHA 3TQHA 1I01A 5F3RA 4XYBA 4GWKA 3TOZA 4B4OA 4CLXA 4H7PA 3B1JA 2IYPA 2A35A 5F5NA 3C7DB 4ID9A 1LBEA 2VZ9A 1P1KA 4OKNA 2EG9A 3WS7A 4J9VA 2X0IA 5I9NA 2P9CA 3SC4A 3JYQA 1WVGA 3JYOA 3GN2A 4RCVA 1E7RA 4MOWA 3GGGA 3H7AA 4EJ0A 1YQXA 4DPKA 2J5KA 3HDQA 1JKJA 4EUFA 1BG6A 1ENPA 2EJVA 1GEGA 1Y8QA 3NTOA 3QQPA 2HJRA 4U6SA 3CXRA 3AI3A 1YBVA 2CNBA 4WJZA 2YHIB 1CIVA 1E7MA 4P4NA 2G5CA 3PQDA 4AJ1A 4YXFA 2PGDA 5COBA 3ABIA 1CERA 2P91A 3N74A 4BNNA 4J7CA 4MKZA 3NT5A 4X54A 3JQGB 2CVOA 1IZ9A 1W4ZA 2XAAA 3LF1A 3DAGA 4E2WA 4XEHA 2VNAA 3QP9A 1N2SA 2EHDA 3JQDA 2DBZA 4OH1A 4YEDA 1SC6A 4DA9A 2I5PO 4IJKA 2YQ4A 2ZIZA 2D8AA 3EHEA 2NTNA 4RO0A 5A4DA 4B4WA 5TSDA 2AEFA 1PEDA 4Q3AA 1BXGB 5JY1A 4XA8A 1VJTA 1YOVA 1PJBA 3PQEA 2WE7A 2IYOA 3O26A 1XCBA 4D7AA 3F3SA 3GVPA 1HLPA 4YT5A 1BHSA 2BFOA 2G0TA 3SLGA 4WK6A 3JQ7A 4EI2A
chains in the Genus database with same CATH superfamily
4HWGA 1Y9JA 1HNZB 1BMFD 2JGDB 4C7OA 3I2YX 3MJSA 4N3NA 2IZ0A 2K4MA 6REQA 3QKIA 5CT9A 1L5HB 1KMHB 3JYNA 4XWKA 2B7BA 4IF6A 3F7TA 2XE6A 1Q14A 4PFKA 4RELA 4FFDA 2HH9A 3AHGA 5B53A 1ECPA 3DVSX 1M2OA 1Z2PX 3WHPA 4OAOA 1XTKA 5FPYA 2X5XA 4TL7A 4AJNA 2EKQA 5JWOA 4GX0A 3DPSA 4G5HA 1VL0A 1E4VA 1ZOOA 2D13A 4LX0A 4GZ5A 4E6PA 5E6UA 3IJRA 2B21A 3SJAA 5I9MA 4GZ6A 4BZQA 3V9PA 1J0CA 1MX5A 5K0LA 3RG2A 4G2TA 3AW8A 2B4KA 3V4VB 4X64B 1GUZA 2X5NA 2YHIA 1Y6QA 4TV9F 4N41A 2HD4A 1PK9A 3ORFA 5F7OA 4PQRA 1J9ZA 3CKLA 1PL7A 3T7EA 8ADHA 4NFSA 4KJZA 2HPAA 2W6ZA 4GMKA 3WV4A 1WU7A 3HP7A 2YTZA 4DILA 1QYRA 1YC2A 2ORYA 2X9VA 3E81A 3V1LA 1I14A 2F48A 5JWHA 5BN5A 2PMEA 4AL4A 1P4AA 5KQLA 2EW8A 3Q8MA 2HEGA 3D3JA 4FIDA 1TB4A 2A58A 3A6HA 1JZQA 3LO5A 4IJUA 1Q1GA 4MUEA 2MSLA 4I55A 3M4XA 3OX4A 1YO6A 4L9RA 3TCNA 5DWDA 1DJMA 2E89A 3K1YA 2BT4A 3DCJA 3MYYA 1GTMA 2BZ1A 4B8ZA 3L0DA 3P20A 3LC0A 3SX0A 3BIFA 1ENYA 3GNTA 4CUJA 4MITA 4PTYA 3WGJA 2I29A 4LJLA 1QR6A 1DFGA 3MK31 3UJ9A 1PS9A 3H4VA 4EYGA 4XGRA 1FF9A 4RETA 1E9DA 3AY3A 1AM4D 1NRJB 4IMRA 5AW9A 5CIWA 1DCKA 2X7XA 5DEOA 3PFIA 5EMKA 5C5CA 2QHXA 2YXPX 1CZUA 4GX1A 4OHCA 1UMDA 3RYHB 1PR0A 2YJZA 4NCHA 2ZUTA 2BH2A 2NU7A 3JXEA 2WSLA 4MO2A 3AVXA 4BX9A 4HGZA 4AYXA 2PWBA 2OR3A 3UMSA 3ZQ6A 4IDUA 3DUFA 3VPXA 2AOUA 2FLWA 2EF1A 3R6GA 4KRYA 4Q9KA 3ZWKA 2AFIE 3C1UA 3U3DA 2I1VB 3AEUB 2OGUA 1FPMA 1WJGA 3BRQA 3V32A 5JBNA 5ARCA 4HCJA 5JNTA 2JF0A 3AP2A 4W8HA 3A9RA 2XSZD 1RXCA 3UQZA 3UJ7A 2MYUA 2D3WA 3WJ2A 4CQLB 3ZNPA 5FI1B 4DVGA 1ZUHA 1BN6A 2CVPA 4X1KB 4BN0A 3WIDA 3V7WA 4HEA6 4MK4A 5E2IA 3IP9A 1N33B 1T4GA 2WVJA 1RCTE 3KWLA 3A4VA 5LCXA 3T7SA 3L7AA 3W8DA 1TO1E 3DAFA 3KEMA 3QX7A 3T95A 3DM5A 3BMCB 3V1KA 5A4AA 3UWPA 2VHUA 3FDZB 1N9GA 3X1XA 3JR3A 4WZBA 4CF6A 4CMEA 3LG2A 4MS1A 5C8YF 3M9XA 1N0WA 1GNTA 2ZEJA 2HTFA 4YPVA 5HOQA 1RWVA 3LF2A 3GC6A 4RVUA 4B74A 4C4AA 3SJ7A 3DMYA 4EQ6A 2I99A 4JL5A 4UDOA 2WV7A 1GCGA 1D9XA 2PX3A 4N12A 5E1DA 1WS6A 3G9UA 4FFSA 5E2BA 2QG4A 3W77A 5J23A 4W5TA 9LDBA 2GCGA 1EPUA 1S2OA 2Q2NA 3GFSA 1BEZA 5IJ9A 3A1EA 1OXVA 3R3WA 4MMXB 3OPNA 4HVTA 2Y6UA 3JY6A 3MUFA 1XVLA 3RS2A 2A9PA 3CISA 1I80A 2W6QA 3HCDA 4PBTA 3VC7A 5J58A 4BFTA 2PIDA 5BPFA 1VJ1A 2WNSA 4O4HB 5ALEA 3NTQA 3OIWA 3TH5A 3A1TA 1ISGA 2KM1A 3L6OO 3OAAD 4ZHQF 2D1SA 5EUMA 5T4BA 4KQCA 3CZMA 2ZUBA 4PCVA 3WWPA 3AF3A 5EXTA 1TLTA 5AM0A 2WNHA 3ZHSA 1ZH2A 3ZHUA 4GC5A 3WA7A 1HDYA 1TO2E 1JG7A 5EN4A 3I9FA 3QKWA 4U7TB 5JCJD 1GCAA 1GO2A 4YPOA 1T9BA 4Y7DA 1T9GR 4GOJA 2DERA 3PDWA 4O8CA 1AD2A 5TQVA 3D3QA 1WD5A 2AN1A 3ASVA 2WEKA 3R40A 2NZYA 1TU4A 2KYRA 5KREA 1OYVA 3DMNA 3M83A 1E4YA 3CV3A 3NI2A 4N5HX 4IS3A 4M1WA 4ZFNA 1E2UA 2P9BA 4ZP1A 5F23A 4RABA 4ZAVA 5KHAA 2ZATA 4CCAA 2D7DA 2AVDA 3A9UA 4DREA 4MYCA 1O03A 3N58A 4S1PA 1FRFS 3F1KA 4KC0A 3HB9A 1JW9B 4OFWA 4PXAA 4OGFA 4ESOA 2VFAA 3TLCA 3NHZA 1FRNA 1KVSA 4Y2JA 3UPDA 1DL5A 4QZVA 1XRQA 3NH9A 2YFYA 4RPHA 2VJNA 4RDIA 5PNTA 4DRZA 3EF0A 1EXNA 4M9XA 2H7XA 4N18A 2GYVA 4QQNA 3JQ9A 4HDNB 4J0JA 4NMLA 3SSAA 4R01A 4LUCA 1Q57A 2VYND 1TM3E 5C4GB 5DX0A 2CUKA 3ZW8A 1O6CA 2XVYA 1EHCA 3H19A 2JIPA 4ALJA 2RAVA 4J4HA 1F4PA 3IB3A 2YV5A 1NVVQ 3L7MA 3PNOA 4JEIA 1DAIA 3RT7A 2KLHA 4ZO7A 3V3KA 4WUVA 3KS9A 4AUMA 5K09A 1XRLA 4WESB 2F9LA 4K87A 1VLQA 1C80A 2Z6VA 5DW0A 3HKBB 5F5LA 3GLFA 4R31A 1I7PA 3F0TA 4MLPA 2E37A 3IEVA 2FQQA 3BWYA 1QHHA 1Z56C 3OTQA 3H87A 3EPPA 4ME6A 1GRRA 3VJRA 4UBOA 1XQ1A 1QAMA 4BU0A 1PK8A 1RW4A 3GVHA 4DYDA 1I1NA 4HAOA 2IRWA 1X15A 2X9NA 1W44A 2QSYA 2C2BA 3UG7A 1U7WA 3GLFB 4J8PA 1C9JA 3SHTA 3HCAA 2JKVA 3DD1A 5B58C 2O05A 2H0QA 4LNHA 3KQHA 5BSWA 1X7ZB 1C0IA 4YT4A 5CA0F 7AT1A 2H0AA 4KN8A 4ZOQI 4UHEA 5TQ2B 4D4KA 5ULLA 3FYHA 4PNPA 3MWJA 3LUFA 3JYPA 1M1YE 1FNDA 4KL8S 4ZWNA 4CCYA 3RKSA 1RKVA 2CNLA 3UMMA 2CHQA 2FPKA 2ZSEA 1JXAA 3KFVA 4M22A 4MV5A 1XE3A 1N4AA 4YV2A 3O74A 4KB5A 2VPZA 3COZA 5C3MA 5JASA 3ZE7A 4X20B 2P8JA 2E2WA 3OZEA 1I51A 1N2CA 2Q2WA 1PUJA 1N1GA 2L42A 4BHTA 5C5EA 2DQKA 3EZ9A 4DRXA 4QWWA 4AK9A 5JISA 4MQEA 4PVCA 9ATCA 3R6LA 3H1AA 1WOMA 4BKRA 4WGGA 1OX6A 1N2ZA 1F2TA 1PF7E 4GSKA 1E2DA 4DLRA 4HNUA 3KZVA 3ZD6A 3EZNA 3GMDA 1CJTC 3WICA 3G1WA 4GYKA 4EMTA 3QU5A 1AKEA 4O2LA 1XZJA 2UZ0A 3KXKA 3HADA 3O3MB 2P9JA 1KZ1A 4PFQA 3U4CA 2V5AA 3GN1A 3WDKA 5FV7A 2MJLA 1EZZA 1CR1A 1YZHA 2PZMA 3KXDA 3OJ0A 4V0ME 4WOPA 1LBQA 1NRWA 1NUTA 1PV2A 1MQAA 3N7AA 4IQ0A 4J1SA 4LXQA 4OM8A 1GGFA 2VPTA 2YOFA 5ER6A 1M3SA 3D54D 4IJWA 4XR9A 3NBXX 5REQA 4MR8B 5TY0A 3S5JA 4HBZA 5FUYA 3NHJA 4M9SA 3L7LA 4POOA 4XD7A 1VPLA 1C9MA 1I3MA 2B78A 5JANA 1DTEA 2I54A 1OPRA 4NY1A 1AS3A 2HCBA 4DLVA 1KYZA 5E4JA 1T5SA 3L1HA 5FUXA 3V55A 2OE2A 1SD2A 1P29A 3D7RA 4HT3B 2E0IA 1LDNA 1B0UA 2Q3MA 2VF7A 2FSHA 1GRCA 1L7EA 4I55F 5C8XA 5A5FA 3E9CA 3VHXB 1N57A 1NT4A 3QE0A 3QKRA 2VRWA 3Q87B 1NPTO 4H27A 4HLDA 3HYNA 3SPXA 5KWSA 3KQQA 3AIMA 1COWA 1ML4A 1LB1B 1DQYA 4O1IA 4QWMA 1BA2A 3D81A 3L9XA 5A3RA 3DEIA 4M49A 3S7TA 4WEOA 2LNDA 1Z82A 4M8IA 4ZQIA 5FIUA 4LJRA 3ZWYA 2OWEA 5FCDA 4DWJA 4YUWA 1P7WA 2NPFA 5AR1A 4BVHA 3UQYS 4E5UA 1W93A 3FBWA 5D8DA 5KDLA 5AKEA 3PIDA 1BS2A 3HVIA 3TMYA 1KAGA 2WSBA 4K28A 3V97A 1L5FA 1LLQA 1DQZA 1VKOA 1ESDA 4G86A 4MIYA 3KBBA 1YQQA 3B48A 4XM0A 2PNJA 3V2IA 2PT7A 3DXZA 4IFTA 5BQPA 1A4IA 3DOJA 1XDSA 1UMKA 4DCUA 1X1RA 1B42A 2PZGA 2ZUDA 3GOQA 4KR6A 4L4RA 3M4ZA 1AQIA 1AHIA 2FHSA 4IHKA 3R5TA 3DT8A 3Q3VA 4LWOA 4TMFA 1PWYE 1JLLB 5D3MA 3QWIA 1BWPA 4KAJA 4QQKA 4RAQA 5DF1A 4B45A 2C57A 2KPOA 4XSVA 3RKUA 1RFLA 5KNCH 4A3SA 3DPUA 1BS1A 4TRMA 4YR7A 2Z2XA 1H8ED 3SGLA 2PL5A 4TRNA 3NXSA 4HFJA 4RS3A 1E3SA 1QANA 1TZMA 1Z47A 1HO3A 1HL3A 2A5JA 3HWSA 1VHDA 3UJNA 2F8LA 1HE1C 3ZEIA 2PXXA 1G64A 4Z53A 4N5NA 3D0QA 4R8LA 1YR6A 2PUTA 5B55A 3F78A 3OFNA 3BSYA 4WLFA 1FSSA 1P7ZA 3AOEA 1JMKC 3FPLA 3LXUX 1RE0A 3OWOA 2WQ6A 5AXCA 3CX4A 3GFGA 1CUSA 2Y2VA 2POQX 4WBSA 1A9SA 4W5HA 5EC8A 3RIXA 3W0LB 5LOVF 1OZAA 1K6EA 1EJBA 3MRSA 4JJ6A 3QMMA 2NU7B 5BW4A 4MWOA 1QHNA 3I3OA 3OO0A 3TLKA 4EPVA 1YB5A 4P8RA 1D4OA 2WIFA 4PPFA 1HKHA 3ZY2A 5BNZA 1L3IA 3M6IA 1WAMA 5KVSA 3SJZA 5JAMA 1P5HA 4DIFA 2JZNA 3A1NA 1GDTA 4GC9A 1G2PA 1YAJA 2J9YB 3KZKA 1YD7A 1XAJA 1JQ5A 2FETA 2NVWA 3UJHA 1E2BA 2BMWA 4N0DA 3JYLA 5MHTA 5I9BA 4HBGA 1ONBA 1ISHA 4MGEA 5ELLA 2JC3A 4ZIRB 5B5SA 3KUUA 5DCWA 2WLSA 1M73E 2P9GA 3BQMB 3UK1A 4R9SA 3S1LA 3GEEA 4DCGA 2FEWB 4ARIA 3BZBA 1R3UA 3M4NA 4JXJA 5CFPA 4J6FA 5JW6A 2Y4OA 1GGMA 1SVWA 3PP8A 4QO7A 1QV7A 2B7LA 5H02A 1UP7A 3BMOA 1WW8A 1J70A 2GJ9A 3L46A 2ZWVA 3O6VA 2YFQA 1QZTA 2IOFA 3GH3A 1MW8X 4MZXA 4R1TA 3G68A 4J1GA 2P3OA 4NARA 5FOQA 4J3NA 2C7BA 1NW7A 1JAHA 4HXFB 5G02A 3RNOA 4BNWA 5C8ZA 3IIEA 3AVPA 4LVNA 4LZPA 2XRZA 1FSZA 1NR7A 3NBQA 4J7AA 1W9MA 1J8FA 1KF0A 3PL5A 2F3UA 1YMUA 5T5QA 1NKVA 4L3OA 1QWSA 2GXAA 5E6UB 3HDJA 1V9CA 2Z1MA 3HYTA 4NYJR 2XKBA 2HRCA 2WD9A 2Y9MB 2AG8A 3A3PA 1NBME 2E1PA 1MB3A 3I4LA 3RVBA 1SU6A 5CG1A 2GDZA 2CW5A 2GBLA 3TZ6A 4BNGA 5LMUB 3QVTA 1ZCAA 2DUMA 1D9ZA 2AJLI 3MLBA 4ZOLB 3AEXA 1JXOA 4Z0NA 2GN9A 3U49A 4BLUA 3H11A 3B7PA 4FEEA 3AF6A 5D5HA 3CW9A 1E1RA 2QRGA 4PC3A 1I4OA 1OF1A 3HZRA 1G20A 1VXOA 3J7TA 1DQNA 4K3UA 2AN3A 4N6OA 3Q7EA 4AVYA 2OV4A 1EFUA 1SOAA 1FVXA 2QRJA 4M2LA 4RGVA 3PXAA 4XVHA 4DR6B 2O50A 5KNCD 4XXHA 4Q5IA 3ITEA 4EMSA 2WJ3A 1OY1A 5CB4B 1FFHA 5FWXB 1G38A 3D4IA 2I8AA 5AI4A 1BE8A 4F5WA 4H17A 4WNCA 2BZ0A 2XGGA 3GUHA 3QEMB 5DLPA 2ZR8A 3OY2A 1P2FA 4RV9A 2ZUFA 4ND5A 4QYXA 5A04A 4AICA 2AFIA 4O4IB 5DNAA 4G9EA 3KTFA 2Q3CA 2HADA 5G3YA 3DFZA 3VMMA 2EL7A 2QL6A 5CW2A 1SKMA 1Q20A 3LDGA 1WEHA 3C4VA 1W85B 1UPXA 1WP4A 3PK0A 1YOVB 1K8ZB 2VNSA 1T6XA 5EZ6B 3DTVD 3TW4A 2R7AA 5IPFA 1NRXA 1WXHA 1V48A 1RTTA 2FMKA 1Y34E 1ZI9A 2HAEA 3NTUA 3OLYA 3U7QA 4DQUA 1U1GA 1Q17A 4GE0A 1ZJ6A 5DHSA 3QPAA 1OE0A 3DZDA 3TPCA 1TCBA 2BM9A 2P6MA 2GPJA 2WWGA 4I99A 4BWYA 1QTQA 5JC1A 1VG9B 1IXYA 2HA5A 3FBTA 3WAJA 4MW1A 1WVIA 1C30B 1ZUWA 3H13A 4MIKA 4NESA 1SVNA 3O95A 1ZICA 4II7A 1ES9A 3KB2A 2I22A 2IHZA 4LG1A 2PV7A 3CJTA 4KR9A 4LW8A 1VDMA 1XAIA 3IT3A 2JCGA 4EIWA 2ZS7A 1L8XA 4CCWA 2V97A 1OX5A 3PLRA 5BT8A 3PI7A 2D5CA 1ZIPA 2BE9A 2V7PA 4J6EA 1KAHA 4UD2A 3FI9A 1Y82A 1TQ4A 2IPLA 5EFOA 2BKAA 3NV9A 3OPYI 4EW3A 1SQ6A 4G23A 3MTBA 5H1YA 1C30A 5JPIA 3KDPA 1WTAA 3M49A 4RKQA 4YRQA 4DYHA 1P2UA 4N4AA 3QELA 2Z5LA 3KLPX 3MTJA 4EATA 2TECE 2ATVA 2XUGA 4EF5A 1HM5A 4HWOA 4HDRB 2RHBA 4H6WA 2PPLA 1Z18A 4M1TA 4F0JA 1TK2A 2FCRA 4DM3A 2M6KA 3ZE0B 5EWMB 1A0OA 2IKSA 5JZBA 1COWD 4MMYB 4H59A 2Y1EA 1VI2A 3DWIA 2H8GA 4FP9A 4B81A 2ZRQA 3B78A 2EATA 5LLDA 3CEMA 3K4QA 3W1VA 3WQRA 4V1CI 4OLFA 2BMAA 3TG8A 1Y4AE 1KC3A 1WSWA 1X8JA 3W1EA 1XHEA 3NIGB 2R2AA 3L8MA 1RI5A 3H2ZA 4M36A 3H8JA 3KD3A 4Z8YA 3IVXA 3VKVA 3BXPA 5BXYA 4C4XA 4R8SA 2YCBA 4EEZA 4XCXA 5A9SA 4YLYA 5D3QA 4WXHA 1MABB 2DFNA 1MC4A 2XXAA 1H6BA 4CXMA 2MSNA 2WSSA 3FYTA 1EJ2A 1P7VA 4KV7A 1Y7TA 4UC0A 3ZQ4A 2HGSA 1U3UA 2EIXA 2PN1A 5FNZA 5B1DA 5EKTA 4LXXA 4WINA 3GZNB 1NPDA 2J9GA 4EPXA 4IF4A 2A4MA 1MC1A 3U9TA 4R9NA 1QQTA 5ALSA 2UXDB 1CR6A 1WUJS 2ZUCA 3G13A 2I2DA 1E9RA 1H85A 2NUTB 2Y05A 5ILQA 5I6DA 3LQ1A 1USUA 1TJ4A 1IG3A 2WTNA 3OUUA 3CR3C 3GIDA 4XUEA 5HIJA 4EGQA 4CKCB 3RYCA 3R9XB 3DCYA 3T3OA 1VL8A 4R16A 2XMRA 2CLIB 3P4UA 5DTQA 1Z7WA 4WY5A 4GWLA 1E58A 4K9LA 5CX4A 1HX7A 1P1IA 3JZFA 2ZSDA 2H1WA 1E4OA 4KIWA 4GRAA 1FRVA 2IV2X 2NZUG 2GF0A 3DL0A 3PUJA 5AH0A 4D97A 2B5OA 4RMJA 4TMVA 4R71A 3S68A 1UBEA 5H9VA 1FSPA 4GLOA 4GLJA 1R9GA 1SELA 1E9CA 4N1AA 1D6SA 3GRRA 1XTQA 5DNUA 3X2FA 1YQEA 2WM3A 3K31A 2O14A 4RLSA 1KE1A 3U44A 3HJTA 4P6VF 4R3UC 3M8KA 3ENQA 2NPIA 2I8LA 2V6IA 4QGBA 3F6EX 3L1UA 1YB1A 1P4JA 4DCCA 3J81k 3SZRA 1GGEA 2VHVA 3MJCA 3GGDA 3A9VA 2AHRA 2HHAA 5IKOA 1YTLA 4LCEA 2XNDA 4XFJA 1DZIA 4KREA 1QGAA 3LQRA 2AWOA 4KGXA 4Z4HA 1IZYA 1NJ8A 2Z4RA 1PP4A 1DXYA 1RYFA 1VJDA 1F6WA 1ZITA 3RAPR 2C99A 1YIDA 2P77A 2G70A 4CMIA 3FE2A 4YRAA 1DXQA 5LZ4A 3FMFA 1N2OA 1YS6A 3FB4A 1E7WA 3GXBA 2QZPA 3LPAA 3QNWA 2D2IA 2RHHA 2HJSA 2QT0A 4BTLA 1JWLA 5I7EA 3ZCXA 3MMXA 1ORRA 4R5HA 4NFYA 1AUXA 2DCUA 1K8RA 4MJXA 3OQIA 2F62A 4B3MB 3D0KA 3ILHA 3ES9A 1VECA 2F9MA 4P7FA 3ZX5A 4PN3A 1ADGA 1QHIA 3KCQA 1P0IA 2FR8A 2A0FA 4MYTA 4P98A 5H4HA 3FOFC 1KJ8A 1W4BA 2PUGA 3CEAA 3K15A 1MNQA 4OHVA 1DHTA 1NQTA 4Z2AA 1XZ8A 2VDKB 4CM4A 4F5EA 2Q45A 3RGGA 1THZA 3UWKA 3OOHA 3MWLA 2BP7B 3BXHA 3CW2A 2FSGA 4GBED 1P19A 3RBXA 2QN7A 3T9AA 4IZ6A 3K1AB 2PU7A 1UPUA 1ELOA 1QCDA 1BMDA 1D1PA 1ZM9A 4L7QA 1OLSB 2V3VA 4TKUB 4RHEA 4ZOLF 4TKVA 1QHFA 3TVTA 3EVNA 2JRCA 3PHBE 4G0NA 4JI3B 5AW4A 4LQLA 5DYGA 1LSSA 5HZGA 1SC9A 1XV5A 1SKYE 1CJUC 1U8UA 4MRRA 4IDBA 4Q1AA 2FJPA 3UW1A 2GK7A 1U0BB 5FADA 2DXIA 3H18A 3EUAA 4YCLA 1W8DA 2VH1A 3IBGA 2IGBA 3KOZA 4MDYA 1GVNB 4OQLA 4UDNA 3VPGA 1FXWF 1WMEA 2ZT7A 1AJEA 3ROQA 3T52A 3E8MA 4GOMD 4OYRA 4J0EA 1FU8A 4ZTUB 3PDJA 4YP1A 4JBIA 2FLVA 4DXDA 5CCBA 1OGYA 3A9SA 1XCOA 1HZZC 3P26A 1R16A 1W0JA 4FYPA 4C6RA 3BRWA 4R1SA 2AHOA 3KQVA 4QOHA 1G0OA 4IJMA 1T3ZA 2OL4A 1ZGZA 1KZ7B 2E85A 2FSFA 2IE8A 2NX2A 3NATA 5F64A 1JDBC 3KQPA 3KVVA 1RTKA 2ZBGA 4TN1A 1Q3KA 3O2QB 2CSXA 2UXCB 4H7DA 4Y6RA 2JZOA 1EEHA 2XOKA 3MMNA 1P72A 1MIOB 1T24A 1LNQA 1T8TA 3KOWA 4CIBA 1J2YA 5ENVA 4GAEA 3K4HA 1J0EA 1JALA 5A4IS 2FHPA 3LBFA 1N2HA 5HCNA 3DTVB 1RJEA 2X86A 2OLEA 4NLLA 3WA6A 4BO4A 1KU0A 1IUPA 1XEXA 1VI6A 2Y0BA 2D8MA 4QPZA 4YREA 2G71A 3U7QB 3MF4A 4FDTA 3E7WA 4K05A 2RKWA 4M55A 3S29A 4OK3A 2JFOA 5FI0B 1KRXA 5C8VA 4HSEA 1UT5A 4D80A 4LJ8A 1MV5A 1V6CA 2O3RA 3NP7A 1MEEA 3VUFA 1B0ZA 4X7RA 3HN6A 4RZ3A 4KIGA 1K6MA 1OH5A 3K73O 1W0KD 1WQ3A 5HOEA 1WBJB 2NZVG 2XNKA 1Z4OA 3SBEA 1N9GB 3U4GA 5EZYF 2MINB 3NHBA 4WNYA 5ES4B 5HWSA 1T9HA 4I50A 4IXNA 1ZUD1 2WG1A 4NSNA 5K7SA 4C7XA 4N76A 1ZGGA 1A50B 4TXLA 4Y9RA 2H2DA 5ECDA 4CEHB 3JV7A 1CLUA 4NATA 4K2AA 5JI3E 5HP4A 3JVDA 1XZHA 1MEOA 5FFNA 3A1CA 4H1WA 2ID4A 4OFBA 4AW9A 1PNTA 2EZ4A 1IBCA 2NT4A 2V03A 3JQ8B 2ANBA 3PX7A 1Z5UA 3RVPA 3IBYA 1UPBA 2ZJ3A 1N1DA 1J8VA 3FVVA 3TIFA 4CR6A 4FCTA 5AJHA 3BSFA 1E98A 2XYQA 2RH8A 3CUYA 3DS8A 4KQFA 4TTVA 4E12A 1QG4A 5TIIA 1N5IA 3CVVA 3UF0A 1Y9AA 4KDRA 1J2RA 1XMPA 4M3NA 3KUCA 4ZT6A 2AQ8A 1YMQA 1LXCA 3JWIA 4BFCA 1DRWA 1X70A 2FMUA 1X0XA 2G06A 2O4UX 5A6SB 1Z0FA 5BWLA 2VYFA 4ZI3A 1FBTA 4W1PA 4XCVA 1XL1A 2XRFA 1JBEA 4H7KA 4AJHA 5ILOA 3BE6A 1G5HA 1QB7A 4MVJD 2DU8A 4CKEA 2ZYWX 2WJZB 3OU6A 2WZQA 4M1MA 4AJ9A 2GDJA 3UK2A 3MB8A 2FPGB 4LEIA 4KLCA 2CKMA 2ZBPA 4EFDA 1A7AA 1S9DA 2KBFA 3ACDA 8LDHA 1Z88A 3E8XA 3HXTA 4WXPA 1TQHA 2A30A 3D4PA 7GPBA 5BN3B 1Q95A 5IMSA 4I3HA 1K63A 2BFMA 2HNBA 2PZKA 2NZXA 1WSBA 2P2GA 4QXPA 2GTIA 2Q28A 4Q12A 1XZQA 2WFLB 3U0BA 3ZHXA 2RKBA 4ZI2A 3Q7RA 1COZA 2IPOA 1SBQA 4OMCA 4Q9IA 4QKQA 1WIWA 2XCOA 5JNLA 3BXOA 5EZYA 4B3GA 3FVRA 1YJ5A 3UFXB 3ZU2A 3H9QA 2QENA 4DV3B 5M34A 1JFFA 3LLVA 1FP1D 1Z8NA 4MWEA 5E4TA 2QZ4A 1GV1A 3KJIA 5GWXA 3EFEA 3WMEA 4MKRA 3Q7TA 4I9NA 4NJEA 3ZGOA 3I37X 1NKTA 4NAUA 4MRNA 1OFIA 2REQA 2I2BA 2I6SA 5A4KA 1E5DA 2AJ8A 1S7CA 2H11A 3EOZA 3A1DA 3LUDA 4UMDA 5GJWC 1Z4LA 5EIHA 4UDYX 3V9AA 1HSZA 1SHTX 1MV8A 2ID9A 3I6ZA 3OF3A 4GKJB 4GX2A 4G5OA 2IDKA 3HV2A 4RM2A 4FFBA 1QOPB 1SOUA 1RWQA 2UZ3A 3GO4A 3B9BA 4C0QC 3MXOA 5FAXA 2Z6AA 5EYPB 4LCJA 3CLSC 3R1IA 4RSMA 2A9KA 4GNRA 2ZXFA 4BRZA 3ZK7A 2C3UA 3UT6A 4S2EA 4PANA 2OSVA 5FX2A 4WN9B 4QU9A 1AV7A 5JS6A 2ZJ4A 3DLBA 5JFTA 3FHTA 3AUJB 4CVNA 4D3YA 1UJ6A 5E3IA 5IUKC 1U3CA 2WA2A 5I51A 3PEEA 4I8DA 5B30A 2XCUA 5MGNA 2X0RA 3JAKB 3LOQA 3H1PA 2GN2A 5J2UB 3I73A 3MM4A 4WUTA 4F4JA 1EFAA 1NFFA 5AXBA 4XGIA 3UV7A 2ZETA 3B9RA 1CCWA 1JSLA 3P1JA 2QRLA 4YRKA 1CG6A 5BW8A 3K9FC 4BUJA 4HGRA 4GR9A 3ZWDA 2XMGA 1KP2A 1G8HA 5JDCA 4YT8A 2KLBA 4B76A 3KR1A 3AHCA 2DFPA 4PZUA 4GOXA 5HIIA 2A9FA 2ORVA 3LPLA 4MQ5A 3WLFA 3GT7A 3OOYA 4PYNA 5DOZA 1ZLYA 3EQ2A 4RH1A 4I14A 3DBRA 1XVUA 2F3QA 2PH7A 3QXCA 1G66A 5LBIA 3O1JC 1W8IA 5CNKA 1DC5A 2VAVA 3V2HA 4YYEA 1KVUA 4F12A 4YCSA 1FW6A 5TDHA 5CLGA 3VPBA 1UT6A 3QVMA 2GHRA 2ENUA 4QJ4A 4IJSA 1CUEA 1HEYA 2OAQ1 1Z28A 2YXEA 4KP7A 4GOND 1FFDA 3O9VA 3ZQKA 2WZDA 3GHHA 3MBKA 3DUWA 2JGAA 4BCDA 5EIXA 1JQDA 2Z8YM 5EQDA 5LYJA 2ZVQX 4GEGA 2X0JA 5LKRA 4FKMA 1BDJA 4ZOEA 1I5RA 2XGOA 4QASA 3KL4A 1CUCA 1ZGHA 3BRSA 4PYIA 4KSCA 5BSMA 3UAXA 2IXTA 3TD2A 4P3KA 3NWJA 4CR8A 2BYTA 3PJRA 3KTAA 4KFUA 5IVDA 2R4UA 3H0KA 1M6YA 3JTEA 4DJDC 1QRDA 3C2QA 3LCJA 1NQOA 4C3OB 3A2NA 2LCIA 2WIAA 3KUXA 3MC1A 5BSRA 2QRVB 4Y2SA 1CDDA 2VDPB 2XTZA 4TMWA 5AVTA 3KQMA 3TG2A 4IDAA 4RVGA 1NVUQ 2ONKA 4IRMA 5JDCC 2ZJOA 1JIJA 2YXDA 4NG5A 5KPDA 2A9QA 2EFDB 2Z8ZA 3GUVA 4EB8A 1TW3A 3VNUA 2ZFUA 1MOPA 3QXXA 4HF7A 5CNJA 2TMDA 1ACLA 5FOUA 3AP1A 3L6DA 1FP2A 1XDWA 3UXMA 4BLOA 3PNQA 3I5YA 2I3BA 4F6CA 4CGYA 2VSNA 3LHIA 4CZ2A 1U6JA 4LDNA 1WABA 1WULS 1SCKA 1WXIA 3QVJA 4KEAA 4MJ7A 4TUYA 1BCSB 5EKUA 2JFBA 5A9TA 1TCVA 2POCA 1JJFA 3BILA 2Q7OE 3X1JA 1S2NA 4FMPA 3WL3A 3ZDRA 1GUYA 1VGQA 4IBOA 4MVJF 3OCWA 1P0CA 2AQKA 2JFFA 2NNWB 4OHWA 4KYIB 1T2EA 4OOEA 2M1XA 4X95A 4R6XA 3VNQA 2C4MA 4XGNA 3A4MA 4AO8A 5KOYA 1FZQA 1X1TA 2NXWA 1FYWA 2NTEA 4AJ4A 4BO1A 4EVIA 1RPJA 2G8LA 2WAAA 5K3CA 3S1AA 2JA1A 1D1SA 2W2LA 3BD6A 3JU3A 4IILA 3SXPA 4DC0A 3LUAA 1IY8A 1NFRA 3KM0A 2R11A 1QE3A 1FQKA 3GRZA 5IAKA 1Q7CA 2EP8A 2O48X 5IEBA 2E1RA 2G1AA 3R3YA 4PPGA 2C0QA 5LZ8A 1WMSA 1Q91A 3MWGA 4UHFA 5LSAA 3JD1A 4C1BA 4IIFA 3SEFA 2WUGA 1T0IA 1MRSA 1BTOA 2OK7A 2ZZNA 5E1MA 2HQSA 3CCBA 1YH3A 3DXYA 3R2JA 4NPCA 5JCJA 1H23A 2J3LA 1PYOA 4AQYB 1OZGA 3UAVA 2QRVA 2IEBA 3CC8A 2NZ8A 4JP5A 1G8YA 5GJCA 2VJLA 5T4HA 5JZOA 5K8JB 1BHO1 2I1LA 2JFHA 3TW0A 2Q1TA 2FEKA 3K0KA 2ZI5A 4JX9A 2PYZA 1HETA 3WJ7A 3ED5A 5CM2Z 3TSYA 1C0LA 4TKLA 1GL7A 3VOBA 2OD7A 1LS1A 5FTKA 3RYFB 2PU5A 1OZHA 2QX9A 5TMPA 2PBZA 5J5VA 2QRNA 1E6EA 3QKSB 5ALHA 3H17A 2Z83A 1XXHB 2R5WA 4G4SP 4LHZA 1YCHA 5KQSA 1MC8A 3H2GA 5EVJA 4DGSA 2W2TA 4YBZA 1UANA 5JJIA 5BUQA 4FILA 3P9KA 2EBHX 3BJZA 2GAJA 2VP2A 5EAIA 3H99A 1SN7A 4Y2HA 1KE2A 2PVSA 2G25A 4L8FA 4CIYA 5MDHA 1QLJA 5KSYA 3P19A 1NJGA 3FNEA 4D2IA 2FKAA 4HDNA 4XJSA 4B71A 1GU7A 3W2FA 4DW8A 4IYRA 1QONA 3D02A 1E6CA 3DL2A 4F6LA 4D45A 2PWYA 3VR6A 1NNLA 1OWOA 1DT5A 2O2ZA 5SZKB 1WMDA 1KEZA 2PLNA 1U2DA 4H60A 4PHHA 1XLWA 4QO8A 4Q4HB 3C87A 4R1PA 5K6RA 4Z0TA 2NMVA 3VR4D 4FZ3A 4J9UE 3SF8A 1XJ0A 2QG9A 2V6JA 3TLGB 1S9HA 6LDHA 3R0IA 2AUNA 4LA4A 1U90A 5LWQA 1M5TA 1UBOS 1Q0ZA 1E0JA 4TTQA 3IUYA 2ZJ5A 5H3CA 2XWBF 2V58A 1YDWA 5JS1A 3MUOA 3QX9A 1RBQA 1QP7A 4C2UA 2MOKA 2X8JA 3RANA 1CQJB 1C8VB 3FOCA 2KE5A 1F4VA 4B48A 1RQNA 2AEJA 2NU9A 2PA3A 3BN3A 3IVCA 3QX8A 4GMFA 3HKEB 4KN6A 4KQKA 4PZLA 4RL6A 5JLAA 1XI2A 2VJCA 3GAFA 5TF4A 3I2FA 4BLRA 4TSFD 1HTWA 1C81A 3MLAA 5FAKA 3PEVA 3PPWA 2UUCB 5EWJB 1R6TA 2PR2A 3CT4A 3EXFB 2L17A 1XTJA 3JX9A 3RC1A 4DBVO 2D1FA 3CE9A 4PC2A 1JS1X 4I50F 5JATA 1WUHS 1LQUA 1N8KA 4IP0A 1I7DA 4I1RA 2QMUA 2OGZA 3WGOA 3B7WA 3OZFA 4LOLA 2FZWA 3ZZNA 4HNAB 5B2EA 3CM0A 4QTYA 4JMLA 5ICMA 4LC0A 5JO9A 2PJUA 3NGLA 1UR5A 2YWCA 4PLVA 4QFBA 1CS0B 2CC2A 3T3HA 1D09A 4WLVA 1QBKC 5FORA 4FBGA 3E5RA 4AJIA 4DCNA 2YHSA 2CXXA 4D9KA 5C4MA 3RF7A 1YBHA 2EJUA 4XR4A 4Q4DA 1KEVA 3SC2B 1SAYA 3ERCA 2QF7A 2VATA 1LPPA 1MDFA 2XKJE 5GADl 5D7NA 4EHIA 1Z7BA 4FCCA 4GL4A 3VO9A 3EWIA 1JWBB 3I9OA 4IVNA 4DUYB 3NP9A 3VAZA 2QX8A 5CA0B 2XCRB 1ZBQA 2GK3A 1QIKA 1ZINA 2H5EA 4M8SA 1HURA 3UCFA 2O5EA 1EWKA 1CJSA 1H2YA 5KNLA 4MUIA 4IDXA 2ZREA 5KTPA 2ZRBA 2JLCA 1UMBB 2WFLA 3A32A 1JHAA 1UZNA 2IEZA 3HJGA 3FLEA 3LYLA 5LNK1 3K53A 2B1IA 1H4SA 3EVZA 1I24A 1V6AA 5HMMA 3H42B 2Y1GA 3FTFA 3NJRA 2JFUA 2LKDA 1QK4A 2F1KA 5CT6A 3ZVNA 3TDNA 2ZIFA 4YLEA 3UJCA 1JE0A 4FXPA 2G28A 5E0OA 2I4LA 2BEWA 3RSZA 5J4YA 3K2QA 2ZBVA 3FG9A 3NYIA 3RTGA 1UBMS 1ZVJA 1A1VA 1OIVA 4A5OA 3ZVKA 2FR1A 3K1AA 4OMUA 4E31A 4C9BA 1PT5A 3IO3A 2WF9A 1XN1A 4BQPA 2ZYUX 2JIZA 1QQ5A 5EINA 3NBKA 1C8KA 4QRDA 4UHHA 3VBCA 4XUGB 2IL1A 3DGEC 2GSWA 2JJ8A 1L8LA 2UUOA 3N2KB 4NL4H 3TLBA 3ZWVA 3ZVRA 4CDGA 1UXIA 4F9GA 4I4TF 5IBCA 1KI2A 3HMKA 3G82C 2IWHA 2UYOA 3IXQA 4JV5B 2EQ5A 3IA7A 1L4YA 1Q0RA 1T4CA 3H5AA 3ZHTA 4RE5A 3IOMA 3D4BA 1Y1RA 1ADFA 2RH4A 1IRXA 3VC3A 1HYGA 1V41E 1PFVA 2A3NA 2I4RA 5EP1A 3N5KA 1X9GA 1ZG3A 2RHLA 4LYYA 2GM9A 4LWQA 1GZSA 4N0PA 4JI0B 4F2WA 3LKBA 2PKQO 4FR5A 5G0VA 3JD0A 5BQOA 3T99A 4C04A 1QF6A 1SIBE 5DGCA 3NANA 2QB5A 2O2DA 5EWMA 1MN6A 1Y5LA 1ZAKA 2QTCA 3V46A 3A4LA 3F71A 1YR1A 2CXTA 3CZRA 2ZI9A 2C03A 4FCWA 4I50B 4OYLA 5BYBA 4HN2A 1TVMA 4KPGA 2VYNA 5IH7A 3TIIA 1KPGA 2B83A 5K6TA 1TYCA 3RNLA 4IDEA 1MCZA 5BVGB 1CIPA 3MSXA 1U0OC 2XUKA 4GFDA 4JJIA 4RYDA 4EJSC 3R6TA 6GPBA 5DNYB 4QGFA 1IN8A 1JVBA 1T1SA 2HDWA 4OQYA 4E1AA 1IQ0A 5EJ9A 4OXIA 2G76A 4WFJA 3CMCO 2K7FA 1BXGA 1IJBA 1PJQA 3O3OB 4UMVA 2NU6B 1XQ6A 4ZQCB 2DP4E 4KXYA 2GASA 1T29A 1P9NA 1V11A 4I4IA 5C5DA 1BWSA 1OD6A 2D54A 1XVAA 3IUQA 4XIFA 2JAUA 2BBTA 1LPMA 2JGJA 5B4UA 1RXUA 3CPJB 3SEAA 5K01A 5FBLB 2JGRA 2R3SA 2R87A 1KQ3A 3NM6B 3VXKA 2HT1A 3OQNA 1D2HA 4MQLA 3GR6A 3I04M 1MO3A 3IOEA 1M34A 4DZRA 1B8PA 3DEZA 2HN9A 4OXKA 4WEQA 3QXJA 2R1VA 1P6QA 2AF4C 3UWMA 3EA0A 2Q5FA 4CM7A 1S3FA 3SIPA 2QJRA 1MO4A 1CQWA 4LDPA 4RPJA 2C8VA 4PZ0A 3RC8A 2NO4A 1EP2B 5ARDA 1XVTA 4XSGA 1XKQA 2OXTA 2E48A 2ZR9A 3PCTA 2FCAA 1ZKDA 4EY6A 3KKPA 4UVEA 2UUAB 1PG2A 3K9CA 4X3CA 1D6JA 3K0AA 4GUDA 4Q3EA 1V95A 4TM7A 4MS1B 3ASZA 1YB2A 3Q8WA 4IIGA 4OGKA 5C8YB 2I67A 3NUQA 1IEVA 1CK4A 1I2MA 1JDUA 2IDMA 2UZIR 1H5UA 4FGLA 3E1SA 4JBGA 4KGDA 1WXXA 5JYDA 4PICA 3TIGA 1TPYA 1NBAA 2PAAA 1RAHA 4R1OA 5EXEA 3ZV7A 1NUQA 5L3SB 1NF3A 3MEQA 1NI5A 1YCFA 3IKVA 4CKBB 2I8CA 2O54A 2CL5A 5FYDA 1I4DD 3HYRA 3W4JA 1CBUA 1VP9A 2O5RA 3OCVA 7MDHA 5EHZA 4YP9A 2HRRA 4Z6KA 1GQFA 1L5YA 5CD9A 1T9AA 2O8DA 1YE8A 4KU4A 2B4AA 1WSAA 1BRTA 2WM8A 4MB6A 3ZC3A 3ZXUB 4A2CA