3FE2A

Human dead-box rna helicase ddx5 (p68), conserved domain i in complex with adp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
234
structure length
234
Chain Sequence
QEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase DDX5
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 80
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fe2A00
4MRPA 5DLQC 3K70D 1MO6A 1WBBA 1PLKA 4CT5A 2XSZA 3WP0A 1XEWY 4M1OA 3BORA 1NN0A 4AWXA 2AL7A 3NBYC 1GRNA 1XZPA 4FN5A 1EXMA 2RGGA 1ESMA 4TT3D 1LB1B 2AXNA 3N70A 1OSNA 1U0JA 2Z83A 2GWHA 3U7FB 5FTJA 4C0SA 3RVBA 1JPNA 4ZI3A 5FL3A 1RZ3A 4QNMA 5EP3A 3NH9A 4XSHA 5B58C 4BRWA 2D2EA 3ZVLA 5JJKA 1N6IA 4IDHA 2WJHA 3FHCB 1OXSC 5FL7D 1XMJA 2OSBA 2G6BA 4HDQB 3NXSA 5GJCA 1IJFA 1MH1A 3NKVA 1FFHA 1CR4A 1G3QA 3AP2A 2BMDA 4UNNA 1ZCBA 4D4KA 3CZPA 2EYQA 3QVUA 2OG2A 4QNRA 3OEHD 5TVKA 3E70C 1G8PA 1ZNZA 4DLXA 2V3CC 2HJVA 3FGNA 4B6FA 4URZR 3U60B 3HU1A 1Q1EA 3QXCA 3DHWC 3TMKA 1TQ2A 3I8XA 1XNJA 4H9GA 4DUGA 4JLMA 3MWYW 3UPUA 2H7VA 2RGEA 1CF4A 1X8JA 1WXQA 1P7CA 2FPKA 4QHYA 3U5ZB 1MABA 4IVQA 3B5JA 4KFTA 1N25A 1XB2A 3FDIA 1DO0A 2LWIA 5JBQA 3M6AA 4QJ5A 2CE7A 2EFDB 1XPOA 1NSTA 4N1AA 2JLUA 1F6BA 5FBWB 3IQXA 2PEYA 2C9OA 3VR3A 3ZD7A 2FFHA 2O8CA 2R8RA 1LVGA 1G4AE 3QKUA 4QBGB 1ZU4A 3AEZA 3REGA 1KMQA 3RABA 4Z1MA 3VR1A 3GQBA 1E2HA 4YMVA 2ZSDA 2GXQA 4JVSB 4YDHB 2GK7A 1I2MA 2WJVA 3QXSA 4FCWA 3SJBA 1IN8A 1BMFA 3DDCA 4DLYA 3VNVA 3RSLA 1KJZA 2B8WA 4XD7A 2HV8A 2DWPA 1W5SA 1ELOA 5CIQA 3O8BA 3R8CA 1XD8A 2QNRA 5C2JB 4ZIRB 5SZIA 4WXPA 2C9YA 5KU1A 1R0WA 4OI1A 3DOEA 4MKIA 3WNBA 3KQUA 2RAPA 1T3SA 2CK3D 2R44A 2O8FA 4LYJA 2ZRKA 4QOSA 4CEHA 1MO5A 3TH5A 1SZPA 3I32A 3K0AA 4X8LA 2OE2A 2VRWA 3QKSB 5C46F 2R6GA 1YR9A 2I1VB 1G5PA 3ZLJA 1X86B 3LD9A 4DRZA 5KSPA 3CRQA 3PENA 5HE9A 1E9SA 4UNSA 3B6EA 1W4RA 5KPDA 3GPLA 2H8KA 1J99A 4GSYA 4OHVA 1H8EA 2OXRA 4KBGA 1S8FA 1FW6A 4KVAA 3BFXA 3THYB 1JPJA 5FI1B 4EPXA 4CEIB 4LY6A 2GA8A 1I4LD 1MV5A 1TEXA 2O0KA 3B1WA 3LDAA 3DO6A 2HF9A 4JS0A 1KDRA 4NONA 1VIYA 5CJPA 3UANA 4A2PA 3P1JA 4EFLA 2RCNA 3O8CA 1EFCA 4PHGA 3KJHA 4D80A 2EFHB 4Q4HA 1QDEA 3VU9B 1UBEA 3IIMA 4LJ7A 4DLTA 4D4JA 4YMUA 4M9XA 4TQUS 1QHXA 1T5LA 4Q1DA 3BXZA 1NL3A 2P65A 2IYUA 4Q1BA 4A9AA 4D26A 3QNUA 2ZRIA 2XOKD 1D2MA 4CT4B 3MLEA 4DLVA 1W46A 2NO9A 1CRQA 4JLBA 1IONA 3WYFA 1IN4A 1XTKA 2WVJA 4Q1CA 2ZRFA 2AKYA 1H8HD 2QBYA 1N5JA 2J7PA 2JGNA 5DSZA 2IS1A 2VF7A 2QRZA 2V4ZA 1PLLA 2B7CA 2OAQ1 5C18A 4U7DA 4DCUA 1G4UR 4NP6A 4OKSA 1EX6A 5F3WB 3BD9A 1Z08A 1W0JA 4JT4A 1M34E 2GDJA 1OV4A 3LV8A 3ADBA 1Z07A 4WAUA 3RLFA 3SOPA 1UBFA 5FOWA 5L3VA 4TQAA 5JRZA 5BN3A 3EASA 4A6PA 1TNDA 2VTKA 4D81A 5GVSA 2G0TA 1RRGA 3QF4B 4BZPA 5CYPA 3CWQA 2AWOA 1EX7A 5DI3A 2CJWA 1E2FA 2F7SA 4Q19A 1FQJA 2B21A 4A92A 4HAUA 2FFAA 2ZI9A 4S2EA 3NHAA 1MO3A 5J4KA 5DHAA 3EC2A 1K8RA 4GL2A 1ZVQA 5KTYA 1ZAKA 2C96A 1VCIA 5G3YA 4W5HA 3SBDA 4X8HA 3EZ2A 5CDFA 4BZQA 3ASZA 3Q7QA 1A4RA 1S1MA 3VKHA 1E9CA 4GPTA 4L4UA 4LJ8A 3D3QA 3CF0A 3TSOA 4BWYA 4P31A 1FNMA 1MR3F 2ZRGA 3LXRA 3G82C 1OFIA 4TTPA 3WNCA 2OEPA 3W5IA 4V0OA 3I1FA 1G6OA 4B3FX 1T8UA 1FQKA 2DFTA 1JEDA 4PAOA 1U8YA 4QHSA 3T1QA 3RRZA 3OEED 4WW0A 3TR0A 1UKZA 1IN7A 1D5CA 1ZINA 5L3SA 1R5BA 3CRRA 3P4YA 2ZM5A 1KIMA 3DZ8A 4KJZA 4YXWA 1GOTA 4TL7A 4URYR 4D0GA 2OCBA 1Z28A 4W5JA 1YJ5A 2QE7A 3L43A 4GFDA 1KNXA 2OXCA 3GJXC 2W2VA 3ZVRA 2ERYA 1W49A 3B82A 3QQ5A 1N3BA 3V00A 2AWNA 1M8PA 4B74A 3PEVA 1RYHA 3HP1A 1P5ZB 1KJYA 1NNEA 5EP2A 4HUTA 5JEEA 1UKYA 2J0UB 1DAMA 4DWJA 3W3ZB 1SVKA 2FU5C 5JI3E 4C0AC 3LLMA 3TGPA 3BB4A 3TAHA 4MYHA 5KYKA 1LNZA 2YWGA 2ZEJA 3AVVA 2GZAA 3GFOA 4MKGA 4QL3A 2RGNA 1G8GA 4PQRA 1LTQA 3BH0A 1CRPA 5UKDA 3TLXA 3EX7C 1BYIA 3QBTA 4XVQA 2WMOB 5HR5A 4J0QA 1L4YA 2GILA 4CF7A 2VIIA 3CF2A 3EARA 4PC3A 1NLYA 1Q1BA 3MG9A 1A2BA 3N2EA 3LVQE 4V03A 1Z63A 2ZJ5A 5AJXA 1QHIA 3B2EA 3MGCA 3FWYA 2XXAA 3FMOB 1XCPA 2QMOA 4OQFA 1UEIA 4R7ZA 1LV7A 1XEFA 3CR7A 1GZSA 4B2LA 4EPWA 2WMNB 2QN6A 1I2DA 3FOZA 3L0IB 1YZNA 5L8VA 2ODBA 2QL6A 1NN3A 2IYVA 2F9LA 4MDEA 3K0SA 2D2FA 4NCIA 5DIFA 1YVDA 4RJLA 3OAAD 1KSGA 1TX4B 3IIJA 4DT1A 1W36C 2ERXA 1KKLA 2ZE6A 4FCVA 3EIQA 4H1UA 1E9FA 1JR3E 1VCMA 1KK0A 2OBMA 4KVGA 3PIRA 4LUCA 2W2TA 2VHQA 1F2UA 2ZITA 2EYUA 3M0EA 2GEVA 2W6JD 4KFUA 1JNYA 1XX6A 2REBA 3ASYA 3KTAB 1AS3A 1PV4A 1NBMA 4P32A 1Y3AA 1E2GA 1NF3A 2J5XA 4KFSA 3ZH9B 2W2XA 1GG2A 4LJAA 3FMFA 3EZ7A 3U7GA 2GAOA 2AK3A 4M22A 2TMKA 2YOGA 4QC2A 1UADA 3BH7A 4WIAA 5DO9A 2JIZA 1J8MF 3DPUA 1AIPA 4L15A 2MSEB 4Q9LA 4MGYR 2YHSA 2ZSFA 4HI0E 5EXSA 5LPNA 2RGNC 5EE1A 1IQPA 2Q3FA 4DDUA 3U44A 4PPFA 2ZVQX 3MMPA 4BRUA 2VP5A 4MGKR 2XSZD 2FPLA 3KXIA 2JLRA 3GLHE 4F4JA 1VYTA 2ZRMA 4B6EA 3Q8XB 1SQ5A 2W83A 3IBGA 3A1WA 3E2IA 2O8FB 1CKEA 4B76A 2BM1A 5CK5A 3KQLA 1G3MA 2LCFA 3KFVA 2REOA 4M1MA 2ZYVX 3SQXA 5ANRB 2WICA 621PA 4PO8A 1FMJA 1KGDA 4Q1AA 4O0MA 4NKRA 4DCSA 4I1SA 2IX3A 1OKKA 2D4HA 3KUDA 5L3RA 3SHFA 2A2ZA 3GLGE 1UM8A 2WAXA 3U2QA 4EPVA 1XJQA 5FOXA 3CNLA 4D25A 2PT5A 5AJWA 5FUXA 1YZKA 1RRPA 4I1VA 3T1TA 3NTUA 1E2LA 3BGWA 1N6KA 2RMKA 3MAAC 2RHMA 2F3RA 3B8HA 2ASEA 5JWOA 1XCMA 4ZKEA 3O8RA 1N2CE 1G20E 2C9CA 3GD7A 4Q4HB 3AF0A 4KLNA 4DUGD 4BLPA 3PFIA 1E0AA 1NP6A 4DLUA 2OLKA 2ZJOA 3DOFA 4XTCS 2VHTA 1QG4A 4GBMA 5KSYA 1Z5ZA 2Z0MA 1U8AA 1ZD8A 3LW8A 4AI6A 1L8QA 1Q22A 4NYMQ 5CYOA 1YZGA 3HPQA 1F3OA 1M7HA 4TQ9A 2AFIE 2IWHA 4TMKA 1ZD9A 2V9PA 2WKPA 1ZUIA 2QORA 5CM8B 1IY2A 2IYQA 1O87A 1HA3A 4Z1MD 1N6PA 1RW4A 2XNDA 5LD2B 3AKEA 4Q18A 4HZIA 2VH5R 4PC7A 4S35A 1E1QA 5KDLA 5E3HA 4BEBA 5C4MA 3RNLA 3GLIB 4G5RA 4FWIB 1YZQA 1OFTA 1KI3A 1EFUA 3A4NA 2DPXA 2YOFA 4MKHA 1BO6A 3K09A 4G5SA 1IN6A 5J40A 2J3EA 4M1YA 4LGMA 4UQOA 1NMXA 2ORWA 2WWGA 4ZDKA 4BQSA 4ZDJA 2FPMA 3HR8A 1P6XA 5DI3B 1UKEA 4G5QA 3VR4A 2WSSA 4KXFB 5CK4A 2CHQA 1GITA 5DISB 1R0XA 3AKYA 1T91A 4CGZA 4JSTA 4Q7JB 4TLAA 4KAXA 5TB5A 3RWOA 2D62A 1OB5A 1OIVA 4HB3A 3VX4A 1TUEA 3CUEF 4ZIRA 1MT0A 5JLJA 1KNQA 2VF8A 1TU3A 1G41A 2PJRA 2B7BA 3SBEA 4EPYA 2IS4A 4ARZB 1IY0A 1SVWA 4IOLA 4JYBA 4M9ZA 5BW8A 3TNFA 2YYZA 5LB4A 4ZCMA 1SXJB 4XOIA 2FSHA 1X8LA 1NLFA 1ODFA 1W1WA 4NCKA 3NHBA 5IF9A 2OAP1 1E32A 4YDSA 3K9HA 1KTVA 1UF9A 3ND9A 3EPJA 3QI2A 4A15A 4GMXA 4C0KA 1J8YF 1GNRA 2CE2X 3DZDA 1U0LA 3GJ0A 5A0FA 1Z0AA 3LVRE 3LRPA 1E4VA 3P32A 1NIJA 1CLUA 3THYA 3R9IA 3WMEA 4CEIA 1BOFA 2BMFA 2N46A 3SEAA 3L8YA 2ZIAA 2VO1A 3AH8A 2EFCB 1N6OA 2A5FA 4KYUA 2O8DB 1KYIA 4HSEA 3GEIA 2CDNA 2V7QA 3SJCA 3MWLA 2J7PD 1TF5A 3TUJC 3IEUA 3VU9A 1AQYA 1VHTA 2FZLA 4WVFA 1ZBDA 2NO0A 2JEOA 2CLDX 2VQSA 2GEDA 2H16A 4H1VA 4AD8A 4AG6A 4KLZA 4R9UC 1DADA 3LXXA 3ADKA 5FTNA 4BE7B 4LHVA 1Q57A 1E1RA 1ETUA 2VBCA 1R5NA 2VLIA 3OIVA 1S0UA 3U6KA 5J47A 2WWWA 2QP4A 1EFHA 2WZQA 4LJYA 4DDTA 2ZI7A 5FBLB 4V0ME 4MKFA 5HZHA 5HKKD 3I72A 2GEUA 4OK3A 5AUNB 4IDOA 1W0KA 4LX0A 8OHMA 2XXAB 5CIWA 4EAQA 1Z06A 1XRJA 5IDVA 2CHVA 2Q3HA 3B85A 4OYHA 4JIMA 3BS4A 3EWAA 3D8BA 4CEJA 2P6NA 5G41A 1Z47A 2BEKA 2GF0A 2X2EA 3B13B 3QF4A 4X8MA 3AGQA 2EU8A 3OFNA 1HE8B 4HLUC 1Z2CA 4HDOB 4A4DA 1E9AA 2JDIA 3PEUA 4QM7A 2KBFA 2NZ8A 4NMMA 4HB4A 4R2IA 2IYTA 2ZJZA 3U7HB 4QBFA 1KZGB 4EDHA 4AKEA 2HLDD 3I8SA 2MMCA 2Z4SA 4JBWA 4TTQA 2ZRNA 1ZNYA 2UKDA 1OLOA 4C9BA 3A1UA 3RSOA 1TEVA 3PXGA 2XNSA 3A8TA 4ESVA 3PUWA 1MKYA 4F91B 4YXWD 2VP2A 5H8WA 2BOVA 4JT2A 3TBKA 5JWHA 2ZSBA 1V43A 2G9NA 4A0RA 4DSNA 3R8FA 4IVPA 1IBRA 4BFVA 1G7SA 2HF8A 3DEFA 1SVSA 4PPNA 4RZ3A 2H5EA 1Z8FA 1E99A 3AKDA 5FFMA 2OBNA 4YMWA 3TIFA 1C4OA 2EWWA 2BIFA 4MGIR 3QENA 3TSWA 2JAQA 1FL9A 1NKTA 3K9LA 3UMSA 5SZJA 4D4MA 4BZXA 4CW7A 2P0EA 1R6BX 2R6CA 2EFEB 2VHUA 1XPRA 2NIPA 3RS2A 3TQFA 4BLOA 4XJXA 4DXAA 1VMAA 4IJMA 4A82A 5FOVA 4CRWB 3BH6A 2PH1A 1R8QA 5E4FA 4V0LA 1AGRA 3BC1A 1CJUC 3PITA 3ZZUA 1GSIA 1BYUA 4IVRA 1T8TA 2QROA 3QXJA 4JMPA 3KL4A 2J0UA 1U2RA 2PCLA 4I4LA 5FPHA 5DH9A 4MDFA 1TQ4A 2ZJYA 3NEJA 4LHXA 1UJ2A 3VQTA 2CCGA 3P27A 5EZ5A 4AYTA 4MYTA 1Q21A 4NYIR 4US0R 4JKIA 4IHQA 3N5CA 1N5KA 3QIAA 1CJTC 1W2HA 1ZM4A 3NBXX 4F7WA 3I61A 4Q1EA 2OHFA 2KB0A 1SVIA 3KFXA 1NI3A 3O47A 4ZDWA 1LF5A 3MJRA 3Q72A 4GZLA 2ZS7A 5CDFE 1YKSA 3WYGA 1HY3A 1UBCA 2OILA 2XZPA 1XZQA 4PZLA 3SJZA 1AZSC 3KKQA 1RE0A 4U02A 4CYMA 4DLRA 4HAXA 4Q4AB 1NJFA 1CXZA 4MA4A 2F1IA 1GVNB 2ODWA 3QXHA 1TQDA 1MO4A 1PUJA 4UJ3A 1ZM3A 3GJ6A 2ZRCA 5AJZA 2QSZA 2GAAA 1RYFA 4IXMA 1SKYE 5FUVA 5JHGB 2I1QA 1N0VC 2BEJA 1Q3TA 2OT3B 1E79A 1S9HA 3EAQA 3LY5A 3P20A 4FINA 5K8LA 4FD2A 4A6XA 4E22A 4V0NA 4DLSA 1COWA 2BM0A 2CCKA 4TN1A 4IOJA 4UXJA 4B47A 2D7CA 3SR0A 2GBLA 5CLQA 4LYAA 4P3YA 4LCBA 5KDOA 3BWDD 4QFMA 2NOAA 4TMTA 4BGDA 1CTQA 1MOZA 3LX5A 1RIFA 1EG7A 2R62A 5J5CA 4A8JB 2WPDA 421PA 2V6JA 4KV9A 4NYJR 5H1YA 4BASA 2DFLA 3FVQA 2BCGY 4OL0A 4F92B 3KTAA 3SQWA 5B57C 2NMVA 1T6NA 4EQ6B 4C3ZA 3PCRB 4G3XA 2ZYUX 1NVVR 4JVNA 4LDJA 2ZSEA 1VIAA 4LK2A 4V02A 4GNKA 4ZO4A 5KHOC 4IFBA 4AKHA 4Q7MB 3LQQA 3FKSD 4FW9A 3BFVA 2QMEA 3Q5EA 3ICEA 4DSTA 2ZI4A 5FH9A 1ZCAA 1Q1ZA 1DS6A 3FYHA 5AK0A 1PUIA 3AQ4A 5FPYA 1P9RA 2IS2A 4FCTA 3A1VA 3LFUA 3BOSA 1NY5A 1S1CA 3C5HA 4GOXA 2GXAA 1G18A 1CS4C 1WE2A 1KK3A 3GEEA 4M1SA 1YZLA 3FTQA 4V0MA 4KHZA 3BFKA 4GI7A 5TV2A 1GKUB 2V54A 1GKYA 1CR2A 5HCNA 4JBYA 3A1SA 1U81A 2V6IA 3ZDQA 1M2OB 2RGCA 4JJZA 5JI2E 1DAKA 1HT2E 3OIUA 4PHTA 2IYRA 4TL6A 4YMSA 5BYKA 4HB0A 4RZXA 4OI0A 3CKLA 1HQYE 4WOPA 1X6VA 1OB2A 1VKJA 3GFTA 2FEOA 2D06A 1JXOA 4DBLC 2JLZA 5AJYA 4OQLA 3FHTA 2XTZA 1P2VA 3GJ3A 1R0ZA 4B3DA 3ZIAD 1G7CA 4BFWA 2QT0A 2R9VA 1Z3IX 2AN9A 4GRAA 3SHWA 4RD6A 3ICQB 1KO5A 1GKIA 2CNWD 2GBLC 4TYPA 1Z0DA 3H1TA 2DHRA 2Q21A 4KSCA 1NBME 4NBSA 5J4HA 1VG9B 3UMFA 3KXLA 3U3JA 1G5RA 1B0UA 4Y0AA 2ZS8A 2ATVA 2NO6A 4KI0A 3VNUA 3U3MA 1W2GA 4RKEA 1GRRA 1XTIA 3GLFA 4Q00A 3A6PC 2WV9A 1CULC 3MJHA 1E94E 3BE4A 3KXKA 2JLVA 2BKUA 1XF9A 4LZZA 1XD2A 1NKSA 2O0HA 4RD0A 1M74A 3T5GA 4Q9IA 1JJ7A 2O5VA 2UVQA 1GP2A 1E4YA 5CJ2A 4U00A 2OLJA 4Q7KA 2O8EA 1AS2A 4JJKA 4E03A 1NN1A 2OFOA 4G5GA 2ZR0A 3H4MA 3L0SA 4QXAA 4BFXA 2KSQA 1W47A 2DB3A 4LJ9A 4PO9A 3GLIA 1XTRA 4NL4H 3SDZA 3RRMA 1EESA 5F2EA 3BBPA 3CH5A 4POAA 3X1XA 3CLVA 3U61B 5TY0A 1TMKA 4CEJB 5FR2A 2WKQA 1CP2A 1GNPA 3KKMA 4B3GA 2ONKA 2D74A 1AS0A 2OFWA 2JLYA 5F9FA 3SYKA 1W5TA 1X1RA 4L9WA 4TYWA 1NG9A 2KWIA 4NYIQ 3DKVA 3VR2A 3WNDA 2BVNA 1X1SA 2NGRA 4DB2A 4UJ5A 1BH2A 4JBXA 3W3AA 3TR5A 5DYIA 2BWJA 2QPOA 3EZ9A 3U3RA 2J7KA 2OO7A 1FX0B 2JLQA 2DCUA 4B44A 4PX9A 1ZRHA 4A0FA 3OE7D 1VYUA 2ZE8A 4FIDA 4ARZA 1II9A 1AGPA 1JR3D 2C04A 5E95A 1JECA 4UNPA 2ZUCA 3AGPA 1GTVA 4D0LB 1SXJA 2FG5A 5C4GB 1OHHD 1XEWX 3FMIA 5DYGA 1JQLB 5AWFC 5H68A 4NTZA 2V7QD 2WM9B 4TYYA 3QBVA 2ZJ2A 4BECA 1J90A 4D2IA 2WJYA 3AP3A 4A0GA 3VR6A 5CITA 4B3BA 2JJ2A 2P5TB 3QJYA 3R9XA 4M21A 2HXYA 4FWTA 1D9ZA 5E7JA 2XAUA 1RRCA 5EXTA 2O8DA 1XU4A 1L2TA 4HLCA 2XZLA 3TVTA 1DPFA 4W9MC 5LD2C 4LBVA 3KX2A 4NYJQ 2EW1A 1F5NA 1XXHB 4DVGA 2FZ4A 3H0KA 4TTRA 3K0EA 1GL9B 1ZP6A 2DFKB 4FI3C 5D3MB 2N1BA 4OQNA 1NG1A 3QPVA 5EXPA 4BLTA 3KQKA 2YJTD 4GMDA 1XMSA 3JZMA 3HJNA 3RS0A 1J70A 1ZD1A 3SS8A 3RAPR 1NN5A 2DR3A 4HAZA 3K9NA 3RC8A 4XWOA 3RYTC 2J0VA 1QG2A 3IHWA 2A30A 1E9EA 3TUZC 1BIFA 2IYLD 3R7WB 3SFZA 2QQ0A 4EIWA 2JDID 1G8FA 2VSFA 3ZGXA 4DDVA 1L4UA 1KI6B 4OJQA 2BCJQ 3ZZTA 4P0TA 2H17A 1WMSA 3QY0A 3AKCA 2W0SA 2YWEA 2IYZA 4LC1A 1RJ9B 3LNCA 1M7GA 3Q5DA 2C5LA 4IKEA 2BJWA 3ONWA 4NDZA 1IAQA 2VSOA 1KO4A 1WDTA 3VR5A 1AKEA 3PEWA 2ZE7A 2PBRA 2YVUA 3KZ1E 1SXJC 2C98A 3PV0A 2GCNA 2FV8A 1HQCA 3FB4A 2IS6A 1KI1A 2ZTSA 2JJ1D 4K46A 1WCV1 4RFVA 3RRYA 1EFRA 1T5IA 2O8BB 2ZJBA 3B1VA 4NPHA 3UG6A 3UMRA 5BQ5A 5HCIA 4I99A 4D82A 5FPSA 3T35A 1RKBA 4W5WA 1DE0A 1P62B 3HPRA 4MRNA 821PA 2QM7A 5LDDC 1T0JB 4N0EA 1FNNA 5K8TA 1ZW6A 2FE4A 3D31A 4G01B 2ZR9A 4RD1A 3WXMA 4D6PA 3AVUA 3TW8B 5G40A 3ZQ6A 1F2TB 1QHYA 4QGHA 1HTWA 1CR0A 3CPEA 3UXMA 3I92A 4JLKA 3B9PA 4LSGA 5DHFA 2LKCA 2WWIA 2HT6A 3EA5A 4FXPA 4M1KA 4C2UA 4Q21A 2WWHA 4B2PA 1E2IA 3OEHA 3FFAA 5IK2D 3SFVA 2IUTA 3U4QA 3P26A 5FR1A 4M2LA 1SKQA 1RC8A 2KBEA 2GRJA 2IYXA 2XJ4A 2P6UA 2REXB 1VCNA 2FDCA 1ZNWA 1O3YA 2HCJB 5EXXA 2PMDA 2CXXA 1N0WA 4BLQA 5CB8A 4TLCA 3THXB 1Q3HA 4RFSB 3V4FA 2ONJA 4JLDA 4IRUB 2P2LA 3VKWA 2HDNB 1VG8A 2X8AA 3PG5A 3QG5A 4Z8XA 4EJSB 1C1YA 3CRVA 3TVDA 5IRCD 2QA5A 5EP1A 3U7EB 1PZNA 3IILA 4OQMA 1RRFA 3AP1A 3NWJA 4R2HA 2ZJ8A 2V1XA 3PVSA 4L5BA 4L16A 3MD0A 2FMXA 2IF0A 4EKDA 4B35A 3AV0B 1VHLA 4Q4AA 5JCZA 1COWD 2ZAMA 3HDTA 4IFEA 1GWNA 2BMJA 4P4SB 4DSOA 1S4QA 2BDTA 5FBQB 1E2JA 4TMVA 1E2QA 4PTLA 3CH4B 1S3SA 1HE1C 2ZANA 2QGZA 2WPDD 4Q9KA 4ZDIA 1G19A 2W58A 3GLFB 3THOA 2CK3A 2OFXA 3BRWD 3CW2A 4ABYA 1XD2B 3WBJA 1FUUA 2RB4A 3GJ5A 1QHGA 3HYRA 4LHWA 3LO5A 3K1JA 4MGZR 4C30A 4URXR 4EPRA 3OIYA 1G291 1EWQA 3D7MA 3UKDA 3WMGA 4EPTA 1TPZA 2O8EB 5KUTA 1Q44A 3EPKA 4A8JA 3QE0A 2NQ2C 2J59A 3A37A 2FSIA 3IEVA 1AA9A 2VPPA 1QHNA 4EQ6A 4URWR 3K0FB 1XFAA 1UEJA 3V4RA 1W44A 1BMFD 1E9BA 1WQ1R 1NRJB 2B8TA 2F43B 3FHOA 1DVRA 3TJZA 1OW3B 4XD7D 1S3GA 3NIBA 3MRSA 4ZKDA 3LBIA 1OYWA 2FSGA 4C7OB 1DAFA 4BLRA 1GL6A 2LKDA 2ODEA 4GOKA 1CJVC 4XTRA 2DWQA 2JA1A 1HT1E 1L7VC 3V9PA 4RD2A 2BV3A 3PEYA 3SYNA 5A5GA 2A5JA 4AG5A 2ECKA 1P75A 3DMDA 1CJMA 4JLJA 1XDBA 2OBLA 2XOKA 3U6BA 3B78A 3C5CA 4F38A 5G3ZA 2G3YA 4BLSA 4Q4LA 2CEAA 1JXMA 2W00A 1SVOA 1H8HA 2H57A 4Q9JA 3T1OA 4DEYA 3IDQA 1YR7A 2VSXA 4HYYA 5M04A 1H8ED 1Z0FA 4Q4JB 1U0HC 4HZUA 4D4LA 2N42A 1I4TD 2B6HA 3B1YA 1UBGA 2QTHA 3C14C 3WRYC 2WHXA 4A2WA 3RC3A 4B73A 3REFA 4F4CA 3QPWA 1ZM9A 2HCBA 4AK9A 4AY2A 4L9SA 4YLGA 1DO2A 4OQXA 3LQRA 521PA 4OK5A 1OH7A 1IHUA 5FOUA 3UK6A 2QUZA 2ZPTX 2X2FA 2C99A 1R10A 4PAMA 3QKTA 3RS5A 3KKPA 3B1ZA 5CB6A 1US8B 4JVLA 1UDWA 2Q3MA 1ZUHA 4LJ5A 4QRHA 4HAWA 4JVMA 2WIBA 2PLRA 2RGAA 2ZROA 5FUWA 3T61A 5C1BA 4UNQA 5HTKA 2DY1A 2CVFA 4NZYA 2EWVA 2ZYWX 4KODA 4A8JC 4UXIA 3IPYA 1E0KA 5FBRB 3VMFA 5JEDA 1WF3A 2XB4A 1N6RA 3K09C 1W0JD 4DB4A 2QZ4A 1H65A 2XX3A 3RRNA 3T15A 1OE0A 3U3OA 2DWOA 4M1TA 5KOYA 3NC1C 5JFGA 1GIAA 4QBIA 3OEEA 3HWSA 1E2EA 5FTLA 2F3TA 3ADDA 2GXUA 4LI0A 3C4JA 2WIAA 3NDBB 2IT1A 3KJIA 1TUIA 4EFNA 2WWYA 5KNCA 1VCOA 2J9RA 4PO1A 2ZRAA 3CX6A 1Z2AA 4MRSA 2FH5B 3I3SR 2PMKA 3ZS8A 2VP9A 1G7RA 1ZNXA 5B30A 3TRFA 4JKYA 2QSYA 3VX3A 1FUKA 4Q01A 3K0CA 1SHKA 2DYKA 3IKJA 2PLFA 4OI4A 4US1R 1KY2A 4RVCA 3W34A 3EZFA 3KQNA 2IYSA 5GJBA 2W0MA 3T5DA 3EZ6A 2NG1A 1IXRC 2JJ8A 2C78A 1KMHB 2FOLA 5JS8A 1KK1A 4II7A 3RS4A 2CVHA 3KB2A 3F5FA 3KJEA 3K70B 1YHNA 2P67A 3OF5A 4PZZA 1W36D 3VHLB 2J87A 1B23P 4ILEA 5E7MA 1N6LA 3W8NA 4JZKA 2X77A 2FF7A 2DBYA 2IBMA 4IDQA 1OXTA 1P2UA 1DAEA 2GCOA 3EG5A 4NCNA 4F4IA 1V5WA 1JQJC 1E2DA 1FX0A 5DNYB 4KITB 3FE2A 1VDZA 2OUKA 2BJVA 5BXQC 4PQYA 2JJ2D 2QE7D 1TAGA 1U9IA 3OESA 4PPGA 4Q48A 1IN5A 2Q9CA 3DL0A 1DAIA 3GLFE 4OJKA 1J2JA 5KNBA 4PPQA 1G7TA 1OYYA 2OCAA 4DCVA 3CRW1 1KAOA 2YNMA 4BEJA 3LAWA 3TUIC 4PHHA 2JLXA 2ANCA 3B1XA 3U4QB 5G53C 1OT3A 4LV5B 3OAAA 2D7DA 3THWB 2GZHA 3JZAA 1Q20A 5CM9C 3AF1A 3NEYA 3SN6A 3GLIE 1IY1A 2IHBA 1EFTA 4D0NA 1LS1A 4UKDA 1A5TA 1XXHA 1XMVA 2W6JA 4N3NA 3DM5A 2OZEA 1XJCA 2AXPA 5D3MA 2GJAA 2PX0A 2X1VA 4OK6A 4PZYA 4RZUA 2QI9C 2CLCX 4O2LA 2JCSA 2UZIR 2FA9A 1J7KA 3RHFA 1WP9A 1Z6GA 3K0CC 3K53A 5JJIA 1G64A 3BB3A 1P72A 2GVDC 2IUUA 3MFYA 3AUYA 2ZRHA 2G77B 2CHGA 3EWSA 1TF2A 2J1LA 1QHHB 4CIDA 2A9KA 4ASUA 1NMZA 2W6IA 3P4XA 5EE0A 121PA 1HH4A 3R7WA 1XPUA 1D8TA 4Q47A 3K9GA 5EUMA 1DTSA 4XIGS 3W5JA 1IOZA 1GM5A 3EPHA 1KI6A 5EE9A 4RCYA 1EFRD 3ECCA 2QT1A 1IXSB 2OCYC 3QVVA 4M1WA 3MSXA 4V0KA 1RJ9A 1SXJE 4GZMA 1N6HA 4LPSA 5GJVC 1UPTA 2YC4C 5JSZB 4PSKA 1F48A 4Y0VA 3S1AB 4TWZA 4BFZA 1NBMD 1U9IC 2OCPA 4CDGA 1JAHA 4PFSA 3TSZA 1OF1A 2GF9A 4N0DA 1ZIOA 2WJIA 3I62A 3G5UA 4RY2A 4ESHA 4DKXA 3B9QA 2O8BA 2XGJA 2PT7A 2A5DA 1OIXA 1FP7A 2RGBA 1QVRA 3CPJB 2R6DA 4M4SA 1G16A 2JIZD 2IW3A 4PXAA 4RZ2A 3I73A 3UIEA 5JMTA 2FSFA 4R71A 1P3JA 2ZRPA 4BPBA 4URUR 3QKRB 2VL7A 3ZD6A 1II8B 1P60A 4P4UA 1KKMA 2AR7A 1E6CA 3NDPA 1Z83A 4GOJA 3LX8A 1F2TA 1R7RA 3BAFA 4MRRA 1E9DA 2ZI6A 4IOKA 1YE8A 3KDSE 4IEIA 3T1VA 4CVNA 2QU8A 4XVUA 4AKGA 3L0OA 4LRWA 3LLUA 1CR1A 4KBFA 4ERNA 2ATXA 1A7JA 4Z51A 3HYTA 4RD4A 5KSZA 1PVOA 3KB1A 2PL3A 2IYYA 2ZRLA 1GUAA 3K8YA 2KI5A 4US2R 2ZUBA 2OM2A 1TF7A 1G3RA 3Q3JB 2ZJAA 1PLJA 2YINC 1OKKD 1QBKC 2BBSA 3IHLA 4JL5A 2HYIC 2ORVA 4I1UA 1E69A 3H86A 1DOAA 4QJ4A 4HZUB 3PUZA 5J4VA 3WBKA 3CB4A 2A78A 2ZQ5A 4AIIA 1UFQA 4IOMA 1YR8A 1EK0A 1E3MA 3SJAA 4KU4A 3THXA 3KJGA 4RFSA 4DIDA 5JWRA 2I4IA 4FMDB 2IHYA 4BFSA 1N5IA 4ZPXA 1XJ0A 2F1JA 4EJSA 1AZTA 1DAHA 3BERA 4TMZA 2WJJA 4TSFA 4AURA 5JRJA 1WA5A 1K5DA 1XTJA 5FPKA 1F60A 1P73A 1BKDR 4C2TA 2QEQA 4ZV4A 4PHFA 1W48A 2C95A 1OH5A 1QZXA 3NVAA 2IL1A 3Q7PA 4PQFA 1AQUA 2BBTA 1WB9A 3AB3A 3QOFA 3TK1A 5BWMA 1YQTA 2GJKA 4BFUA 1G8YA 2B92A 2ZXUA 1TADA 3QSYA 1DELA 1XEXB 1JR6A 2V8OA 1OIWA 3OIWA 1E2NA 3IGFA 4TL8A 5CLLA 4DLWA 3I5YA 2HXSA 4P4SA 2RH5A 5BN4A 3EIEA 1KO7A 4KO8A 3SU8A 4WXRA 3F0TA 5ELXA 1TQ6A 2ZAOA 1GDDA 3C41J 5DN6A 2XNDD 3AVPA 1E1QD 2E87A 4B75A 4GT1A 4WZBE 3RANA 4WBSA 2BMEA 3DMNA 1Q1QA 4O3MA 2FN4A 1Z6YA 3CX7A 2GXSA 1N5LA 2VHJA 4IEEA 3IBYA 1KSFX 4PC6A 1AK2A 4JLNA 4P33A 1W7AA 3CONA 5AUPB 5EE3A 3C7KA 1CIPA 3IIKA 2FGKA 1Z29A 2WSSD 2ZYTX 3AVWA 1NMYA 4E07A 3TW4A 4HUQB 5AUOB 3ZZ0A 3K0FA 1KI8A 5GVRA 1AJEA 3W6PA 3HR7A 2F43A 1HYQA 4O2RA 1NVXQ 2R65A 1YR6A 4MQBA 4ON9A 1T9HA 2NPFA 4Z54A 4WA7A 1WBDA 2V55B 4R98A 4C7OA 3R20A 3EPLA 1U90A 3CWZA 5JJLA 4NE2A 3VHXA 1LS6A 4GDFA 3FKQA 5BYJA 4YQFA 2YZ2A 3U3KA 1DG3A 4B71A 1VPLA 4DEXA 2RGDA 2MSDB 3PUVA 4NU0A 2QAGB 2P3SA 3IQWA 4PR0A 3PR1A 1Z6XA 3GLHB 4IW3B 4EJSC 5L3QB 4K8OA 4LOAA 3W8RA 1E2MA 4PC2A 1ESNA 2XITA 4TL9A 2IEYA 4X8OA 4UNRA 3FPAA 1KDPA 4UXHA 4WZ6A 1FMLA 2GCOB 4Q02A 2L0XA 4ACBA 2Z5FA 3IUYA 1LW7A 4Q4JA 3NBFA 2QY9A 5KPJA 2A5GA 2IK8A 3GEHA 3GJ7A 3TKLA 1BS1A 3B7GA 5HKKA 1P9WA 2F1HA 5FTMA 5JS7A 2FFQA 4YONB 2C2HA 1U8ZA 3GLGB 1E0SA 1Q0UA 1R4AA 2SHKA 2IUSA 2P5SA 4ITRC 4OBEA 3E1SA 1NLZA 3VKGA 2FX3A 4Z8YA 5FUYA 4TMXA 4Q5IA 1W4BA 3CO5A 1KJWA 1FZQA 1II0A 1VG0B 2QENA 2X19A 2H18A 3EXAA 2ZE5A 1US8A 1ZM7A 2QMHA 2F1RA 2PX3A 4QM6A 4MUBA 4MUAA 2QG6A 5J4YA 4G5OA 3SE0A 1JBKA 2D3WA 2FNAA 3OZXA 2HLDA 1U94A 3MWJA 4KSBA 4NYMR 4ZI2A 1E1RD 4JYCA 2RHDA 1OJLA 4EUNA 2CL6X 4LBWA 3CRMA 1D6JA 2CCJA 2XJ9A 1D2NA 4TLDA 2ANBA 5TXGA 4P4TA 2Q9BA 4JLVA 3AM1A 1GFIA 4Q1FA 5TARA 1NVWQ 2HUPA 4URVR 2J46A 1NVVQ 4O25A 3VTKA 3I5XA 1T3HA 3CBQA 3UWOA 1G5TA 3VFDA 1E2KA 1W0KD 1SGWA 2C77A 4M9SA 6Q21A 1GNQA 1A2KC 2XTNA 3L2OB 1HUQA 5EE5B 3NC0C 4MITA 2O0JA 4C0JA 4RCZA 1R2QA 2CMKA 4A0HA 4B32A 2NPIA 3IO3A 4TYQA 4B48A 2AKAB 3OFND 1UDXA 3HU2A 3M4YA 4TYNA 2IEZA 2WKRA 3QXXA 4TZ6A 4AKIA 5FTKA 4PC1A 3R9WA 2GZDA 1HV8A 3LBNA 2KJQA 2FFBA 721PA 4CZ2A 3W6NA 4B43A 1AM4D 4B33A 2AD1A 3EC1A 1GILA 3ZJYA 2IWRA 1AKYA 2H1LA 3SZRA 2WBLC 4PSAA 3JVVA 3SNHA 1LFDB 1XMIA 4HAYA 4PAQA 2G1KA 1XBTA 1KMHA 1KI2A 1ZYUA 2ZU0C 4XH9B 4LWZA 2F6RA 1KI4A 4Q66C 2VHCA 2IXGA 3WY9A 3LH5A 3AF4A 2ZI5A 4FMBB 3W9YA 2J0SA 1K6MA 2PZFA 1GAJA 1NIPA 3MWKA 3QPUA 4KFRA 2YKGA 4HATA 2IYWA 2G0NA 4IDNA 4A2QA 3IPXA 2MMGA 2Z6VA 4MYUA 3LW7A 4C0HA 3X1YA 4TT3A 4DCTA 5EUQB 3N2IA 2OESA 1W4CA 5SZHB 3LWNA 4E5UA 4C4PA 3OHMA 1X3SA 4FMDF 1X8KA 2AFHE 2IXFA 2NZJA 3CR8A 4FMCB 4JLPA 3L82B 5FL7A 1YRBA 2AK2A 1EGAA 2ZR7A 3X1WA 3UWKA 4XSGA 1QHSA 1KOFA 1JB1A 1OH6A 3ADCA 2QM8A 5KDDA 1MABB 1CU1A 2VEDA 1YU9A 3CNOA 4GP6A 5F9HA 5FI0B 1A1VA 4NH0A 5AJVB 3G0HA 2J41A 1C9KA 1I4DD 5HZKA 3D6TB 3THWA 4NHOA 4DSUA 1OH8A 2F9MA 1KI9A 2O8CB 3MCAA 3WHKA 4IDPA 4C0LA 1CJKC 2G1JA 4DC9A 3X1DA 4LV6A 3C16C 3C8UA 4RKFA 3CIOA 1CBUA 4QBHA 2W6ID 1IXZA 1P9NA 2FGJA 4XWAA 4ASUD 1YZUA 2FWRA 5LBIA 2BBOA 3QG1A 5FBVB 4YMTA 3W6OA 4LHZA 1MRSA 3WRXC 2ZS9A 3DM9B 1DARA 3SYLA 1S9DA 2GK6A 1JJVA 4XVRA 4LBYA 1U98A 5K8IA 3FKSA 2RGXA 1XCGB 5AUQA 3SC3A 1QF9A 1K5GA 4QHTA 2E1RA 1G8HA 2RKOA 1QRAA 5IT5A 2BBWA 3L8ZA 1QHHA 1P2TA 4JLOA 1KZ7B 2YV5A 5TMPA 2BC9A 1E79D 1JEEA 2WOOA 4LBZA 3VAAA 4QGFA 1P61B 2HT1A 4Q9HA 2UZ3A 5LB2A 2GCPA 4CEHB 5F98A 3T12A 3KUCA 3K70C 2Q6TA 3K0AB 1OXVA 5JHHB 4TLBA 1OXUA 1W4AA 4EFMA 1MRNA 4PANA 2Z43A 5JECA 2AHOA 4L8GA 1R0YA 1FTNA 1ONBA 2AD5A 1OPXA 1HEIA 4Q7LA 2PCJA 2WAYA 3T06B 1ZM2A 3SI7A 4DJTA 1T0HB 3T34A 3BK7A 3QEJA 3JVUA 3UATA 4DHEA 5JSZA 1Z6AA 3S1AA 1TL7C 1VTKA 4B3CA 4AYWA 5P21A 1RFLA 2G83A 2AX4A 1RVDA 4WZAE 3WP1B 1ZC3A 3AUXA 2ZI3A 1M7BA 2GKSA 2WJGA 1DG1G 1YRAA 2ZRBA 4ZCLA 1RPZA 2YC2C 1G6HA 1DEKA 2I3BA 1R5OA 2IC5A 3NG1A 4BFTA 2GHIA 2XTMA 2VP0A 3J81k 4OHXA 1T4GA 1AN0A 3ZIAA 2YWFA 1XTSA 2QAJA 4HEJA 2ORIA 1Z22A 1XXHE 2ODNA 3QKRA 2HYDA 1II8A 5EJEA 2CNWA 1NVUQ 1ZIPA 3ZQJA 2HEIA 4HAVA 3EIHA 3PUXA 4I1OA 4W7SA 1P2SA 2XZOA 3KKOA 4BFYA 5KNDA 2QBYB 1ZC4A 5E7IA 2F55A 1EWRA 1KDTA 3LBHA 2QTFA 3H2YA 2BKEA 2IXEA 3BIFA 2DFNA 4QGGA 5FPTA 1G9XA 4B2IA 1YZTA 3GJ4A 1ZJ6A 1SVLA 4M0LA 2QPTA 5EZ6B 4DCNA 3ZVNA 3ZVMA 4E09A 4HLDA 1FPMA 1KO8A 4OI2A 4OHZA 1M1YE 1NY6A 2QQEA 3IO5A 3AF3A 4JSYA 4LV8B 2WSMA 3FFBA 4ZCIA 4A36A 1LY1A 1GL7A 4ACAA 4TSFD 4HDCA 2FJUA 2CL7X 4JLAA 2NTYC 2VP6A 2CBZA 1ANKA 1FP6A 1U99A 2YOHA 1DBSA 5H70A 1TU4A 3ZS9A 4B34A 2CJWB 5GADl 4U5XA 4MH0R 3ZYCA 3X2SA 2GJ8A 2GVZC 2YWHA 1KAGA 2ZSAA 2QP3A 3GJ8A 4DDWA 4GP7A 3BB1A 4LC0A 2IA5A 3NBZC 2ZRDA 3LA6A 3Q85A 2WTUA 3CNNA 4LJ4A 5KSOA 1OFHA 2QPAA 2QTVB 1A82A 3C15C 3AVTA 4LYFA 5FOTA 4NCHA 3CM0A 1VYVA 5B2ZA 4LPKA 3F8TA 3DKPA 4YC7A 2EVWX 5DN6D 1OFUX 1ZMXA 5DI9A 4TLEA 4DZZA 2QRNA 3QF7A 5EQTA 1KK2A 3PJRA 4M8NE 4HLUA 2GNOA 5JCPA 4KCGA 1FTSA 1XEXA 4QG7A 4DIEA 1SKYB 4G1UC 5DE3A 2R2AA 2ZRJA 1KI7A 3QKSA 5FOSA 1W36B 4DLZA 1P4SA 1E9RA 2HJGA 2ZU6A 5IHPA 5HPYB 2QGNA 2A7QA 5L3SB 1GRQA 2IF2A 4OHWA 4A1FA 2R6FA 3RDPA 4G0NA 5AR1A 4M53A 5BN5A 2EFGA 2OV2A 1Z0JA 3OE7A 1KDOA 1SULA 3HU3A 1VG1A 3L0PA 1JR3A 5HE8A 3CPHA 4OHYA 3H84A 3QUSA 3A36A 2J0QA 1KHTA 4Q03A 1OHHA 4RD3A 1ZU5A 1G21E 3BJIC 2C03A 2VYFA 3NH6A 2V1UA 1DAGA 1M6NA 2MSCB 1IJEA 3EA0A 3TE6A 1UAAA 2GTPA 3PUYA 3CX8A 2GETA 3Q9LA 2WWFA 1E2PA 2Y8EA 4HUQA 1NJGA 2GJSA 5KO2A 2NO7A 1VECA 2QMUA 1HURA 3B60A 4K81B 4AYXA 4FMCF 2GJ9A 2Z4RA 1G17A 3KKNA 2CLSA 1Q12A 2JLSA 2XEXA 4HLQB 2KE5A 3F3YA 4M9QA 2K5UA 2ZETA 4RSGA 3GMTA 4QGAA 4PSVA 4IXNA 2EQBA 1JALA 3WHLA 3GP8A 1Z6TA 3M1IA 4LYHA 1KY3A 4LHYA 4LJ6A 2WOJA 3CZQA 1XD9A 3I4LA 2JATA 3RWMB 1KSJA 4HB2A 1FOEB 2QAGA 2PEZA 1D9XA 5L3QA 3GLHA 2CL0X 1SXJD 3A58B 3AVYA 3AVOA 1N0UA 3KQHA 5DGXA 1E0JA 3RS3A 5GJWC 3RS7A 1CEEA 2JASA 2ZUDA 5B64A 3A4MA 3GCGA 4MYCA 3AVQA 3ETLA 3W90A 1KO1A 3AVXA 5J4LA 2BHRA 2VP4A 3WMFA 2P6RA 1UKVY 5A4JA 2Q0HA 1E96A 3QEOA 4DT1B 2FEMA 2Q9AA 2H92A 1G1MA 1NSFA 3GLGA 3ND8A 4AC9A 221PA 3X1ZA 3MUFA 4B3XA 4BUJA 1G3IA 1JAIA 1R8SA 3E5HA 4I81A 5EP4A 2WWXA 5K8UA 1S96A 1SHZA 1Y63A 1F2UB 2QP9X 4QKQA 1S2MA 4KYIB 2ZVPX 3FMPB 3DVLA 3O8DA 5D3QA 1TTTA 1E98A 1ZUNB 1N6NA 4TZ0A 1Z0IA 3A1TA 1OXXK 2JJ1A 4C0QC 5JZVA 2PZGA 2VA8A 2R6AA 1PJRA 3PQCA 1KSHA 2ZREA 2E9SA 5SZKB 4F93B 4NCJA 3A4LA 1D2EA 1QVAA 3UG7A 2C8VA 3TAUA 1XP8A 3U44B 1XTQA 2JLWA 2XB2A 4TMWA 1T3LA 4JL6A 4QJ3A 1LF0A 3TQCA 1Z0KA 2J45A 4XWKA 3GFPA 3EW9A 5TDHA 2PZEA 2A3RA 3WYAA 1G3UA 2GESA 1WRBA 4C0BA 2NO1A 2O52A 3CF6R 2QAGC 1IM2A 4JL8A 3AF2A 1JI0A 2PJZA 1XWIA 5IK2A 2A5YB 1SVMA 2G88A 4MRVA
chains in the Genus database with same CATH superfamily
1VKHA 2JFUA 2R85A 2VVTA 1OI4A 3V55A 2F3PA 1EQUA 1YDGA 3QK7A 4M1OA 5JSUA 1NPDA 1GKKA 2V4UA 4X63A 1NN0A 5F3DA 3VRHA 5HM8A 1WW2A 4X7BA 1M6YA 4MV9A 1PJAA 4CIXA 5B3AA 4CCYA 2IXBA 2ZFUA 3U7FB 2BSQA 3RVBA 3LDUA 1RZ3A 2V3WA 4ZQIA 3HCBA 1PEKE 3JQAD 3QPCA 4L76A 2J6HA 3ZVLA 2CNNA 3TQQA 4XCQA 2G4CA 4E0BA 4QJBA 5JJKA 3UMGA 4J8PA 1OXSC 3IS3A 3GJYA 4FFPA 4JV5B 1HYGA 4XM2A 1P9OA 2EJUA 3N0RA 3NXSA 2IEGA 2XAAA 3AP2A 3R3JA 5GJCA 1ZCBA 5CR9A 2EYQA 3DW1X 1E7SA 5D86A 5HGXA 1QIMA 4NE7A 2VDWA 4QNRA 2BUBA 3OEHD 3E70C 4BLUA 2XW6A 2B5OA 4S24A 5FFFA 2AYYA 4GBJA 1ZNZA 3R44A 1WCXA 1TIKA 1WCWA 2HJVA 3GQVA 1YUBA 4B6FA 2EQ5A 4Y30A 1Q1EA 3QXCA 1I5RA 3TMKA 1QC5A 1DEHA 3CF4A 4UTPA 2JIQA 3LFTA 2BEVB 1RQ7A 3FROA 1RWWA 4I36A 4DUGA 4JLMA 1QDLB 2H7VA 3UPUA 1L7AA 2ACWA 1X8JA 3KLMX 4YQZA 4ZVTA 4QHYA 1V1JA 3GAMA 4IVQA 5T4EA 1XB2A 4INAA 4AKTA 5JVDA 2LWIA 3KBBA 3I6BA 3RW9A 4D3FA 2IUEA 2HPHA 1FFAA 2FW9A 2JI6A 4G8CA 1I24A 5ADWA 1UBNA 3K4PA 2BGTA 4RJKA 5FBWB 2A9OA 4P08A 4EA9A 3ETGA 3IE2A 3VR3A 5LQCA 2O8CA 5HX7A 4R51A 3WL5A 3ZGLA 4GECA 2FMFA 4IHJA 1WVIA 4WK6A 5I7RA 1YHZA 3WKDA 1ABEA 3REGA 1IATA 5NLLA 5LP6A 5IM4A 1SG9A 1XVLA 1OXKB 1JUDA 1V5FA 4F3NA 1NW8A 3L06A 1XHEA 1MOQA 3E58A 3R1IA 4FCWA 5HKBA 4LSZA 3ZNNA 3WYBA 5GOZA 4RJTA 3TLBA 3PU6A 4XD7A 3DAGA 4GAEA 3BQ9A 1ZGJA 3F7TA 1W5SA 4NS1A 4BBZA 4FBGA 5CIQA 4KNYA 4PSCA 2TECE 2DU8A 4AJ9A 3G13A 4X85A 1KERA 1GT91 3EMBA 4EJ0A 5KU1A 1M3SA 3KQUA 4ZCSA 1O0CA 2RAPA 2EBUA 3K20A 3OECA 3OH8A 2NZ2A 3LBFA 3RO7A 1PT7A 1SZPA 1OQAA 3ZY6A 3I32A 2G36A 3FNBA 4Z4FA 3JZIA 3JYQA 4AX8A 4DV3B 1WOMA 2Y1KA 1J24A 3ZLJA 1R64A 1X86B 4B5LA 5TQ2A 2Y2UA 3PENA 4AL4A 3DZCA 2J3LA 1QMPA 1R6DA 2ZTUA 5CT8A 2OGWA 1IUKA 3KOYA 1XA3A 4GSYA 5JD5A 2AOUA 2I80A 5EYPB 3LCUA 4QODA 4X60A 5IVDA 2COUA 2X5KO 3T3DA 2Q4TA 5CRIA 3TXXA 4EYKA 3IAM1 2XB6A 2WIFA 3H19A 4DA7A 2VTDA 2XWJI 4ZVMA 3BHMA 1CNMA 1I4LD 1XYGA 3BQNB 3QOYA 1WB6A 1SEPA 1ORVA 1UJ5A 2RBKA 5E1MA 4A2PA 5KYTA 2WA1A 3O8CA 2D13A 4GM4A 4CM5A 3OETA 4FGKA 5KNDD 2OZLA 2EFHB 4U5QA 5E8RA 5JJCA 1QDEA 4G81A 3IIMA 2WJAA 4LJ7A 4DLTA 2E7ZA 5L40A 3IAUA 4E33A 1T5LA 2Y66A 3BXZA 2VYND 3LC0A 4K6GA 4Q1BA 3SQDA 2XOKD 1D2MA 3MLEA 5JCJA 1DT5A 5TT0A 4JLBA 1U4SA 1M76A 1U8UA 3L4BC 3RFCA 1IONA 4UOQA 2WVJA 1ZMOA 5DSZA 2VK2A 3D8RA 2G72A 3IELA 3W77A 4A8TA 2EOAA 1WDKA 4DQLA 2QRZA 1MB3A 2P7HA 2B7CA 5C7YA 4DCUA 1YMQA 2C59A 1EX6A 2B8NA 1TMYA 2VDMB 3ORSA 3ADBA 3NM4A 1OV4A 3CXRA 3ICPA 1Z07A 2NVOA 3L8DA 3P0HA 4QPCA 4TS1A 3PDUA 4WASA 3SOPA 1WNTA 1WHTA 1O94A 2A67A 2W98A 5BRNA 1RLOA 2WT4A 3VC3A 2C92A 4ODIA 4ZQEA 4ZA2A 2P4QA 1TNDA 5GVSA 1XV5A 2DPMA 1I4EB 3EDRA 4L5JA 5I9LA 4HWOA 2ZAYA 1X14A 4BZPA 3S29A 2AWOA 1EX7A 5DI3A 1FQJA 2VYVD 3GBPA 2ILTA 4J0FA 1NBWB 5KVAA 4R1TA 5L4NA 4JJFA 2IU3A 1J8QA 4OYYA 4HAUA 3TNDA 2EW8A 2ZI9A 3HKCB 4GG1A 4S2EA 2QX4A 3RARA 4K8RB 3EC2A 1Y4ZA 5D51S 1UZAA 5DHAA 3K9BA 3L1UA 1ZVQA 1Q7BA 4G07A 3FUWA 1FSZA 1W75A 1B73A 2C96A 1QB8A 3E9YA 3KJNA 3FI0A 4EJ2A 1UH5A 4W5HA 4RL6A 1QV9A 3LZDA 5E6SB 4BMYA 5BNWA 1LBQA 3FCAA 4X8HA 3AKZA 2L69A 4PIPA 4MPPA 5CDFA 4R1PA 4D02A 3Q7QA 2O19A 3KDAA 1O5IA 5G4KB 3T1YB 4LJ8A 4X45A 1L5YA 4WEOA 1J8VA 4PX3A 5KYUA 5DDIP 5AHKA 1VQ1A 2Z2YA 4CLEA 1EU1A 1G20B 3RJ9A 3NHYA 4MS3A 1ZJ4A 3PHCA 1FQKA 4XJTA 1JEDA 4P35A 1U8YA 2PR7A 2F17A 4OIFA 5EJ8A 1I6MA 1Q1GA 4KR6A 1I01A 3R76A 2GAFA 1ITZA 2AB0A 3EH2A 1UKZA 3L7AA 4ND8A 1ZINA 3TR0A 5GZ1A 1QAOA 1Z2OX 3ZDZB 3KK0A 4DNXA 2ZM5A 1J20A 4KYVA 3DZ8A 4Y2XA 1GFWA 2RHWA 3IR5A 1A8HA 4MCJA 5ED4A 1DKLA 3FJOA 2OCGA 3TOXA 4EW1A 1NYRA 3KUKA 5TVGA 1Z28A 1ZCFA 1EAMA 1YJ5A 2O1WA 4W5JA 3T3HA 2QE7A 3X1KA 1ZN7A 5BQOA 1TYBE 4BNIA 3QVGB 4GFDA 3U0BA 1A50B 2YIMA 3M83A 3SSAA 5K5EA 3VC2A 1SUWA 3H75A 4J7UA 2UAGA 4ALNA 4DS3A 3R3XA 1NNI1 1N3BA 4DY6A 3V00A 4UVGA 4B74A 3PEVA 2AG0A 2AF4C 5KNDA 1T2FA 2CMFA 1RYHA 4L3VA 2I99A 5K7SA 3M4NA 2VXCA 4ZZ3A 1NNEA 1BXGA 4HK4A 2BUAA 4IF6A 3RWBA 3SQMA 2ZUEA 3HDVA 5DLDA 4EHDA 5B6PA 1DAMA 2GTIA 1E1DA 2XZDA 3HM9A 3D2LA 4PYMA 5ERYA 5KYKA 2VNHA 1Y9ZA 1GFSA 3ZG6A 3ED1A 2IE8A 1WL8A 2EARA 3INGA 4ABTA 1E3JA 1BYIA 4MW2A 1BQ4A 3ZOZA 4RORA 1QORA 4LF6B 1D2AA 3IUPA 2XYGA 4ZGWA 3CF2A 5EQDA 1LKZA 3C24A 1GPJA 4RXMA 1NLYA 3C1OA 1HG0A 2W22A 5B2EA 3N2EA 3HG7A 1H94A 1N0IA 4LRQA 5KYGA 5K0LA 3ZQKA 5JO0A 3CA8A 4NZMA 4CNBA 1AXEA 3ZXYA 2NWQA 3AEUB 1VLHA 3AONB 1XCPA 4RVHA 3P2MA 5BOSB 5ESRA 4Q7EA 4WRRA 5E3IA 4OL9A 4HEA1 1SCIA 5CFOA 1QS0A 3O91A 4PZ0A 4FK8A 2QX9A 2C7VA 2P2SA 4W6ZA 2ODBA 2IYVA 5K45A 2F9LA 5DZSA 3HDJA 3K0SA 3C6KA 4XJSA 4KV7A 1H9BA 2HTFA 1N7JA 4NV1A 2H1CA 1JVBA 4OLFA 5ALJA 3UQYS 3PQ2A 2H2HA 4DNQA 2Z4TA 4OXXA 2HZ7A 4CCWA 1Y6ZA 3QVXA 1Y4SA 2ZSHA 3PVZA 4DT1A 4HTFB 1W36C 3AW9A 4FCVA 2H7CA 5KYVA 5CB0A 4KMSA 5B4TA 3BTOA 4LUCA 2VAXA 4WACA 4C4OA 1IJBA 1RWVA 1ONPA 5C5IA 1UBTS 4EELA 5JD3A 3LL4A 1IVNA 3M0EA 2GEVA 4KFUA 5JDCC 4NEQA 3SZMA 3ASYA 5T4BA 2JH9A 4B45A 4BJ3A 3DCYA 2JGDA 2Q1XA 2ZJ6A 3BD8A 1Z0ZA 3DOOA 3N0TA 4GEKA 4P32A 4Q3KA 4KFSA 1GJRA 3VPBA 1WLSA 3ZH9B 4B6RA 2W2XA 1QCDA 5EI5A 5KYNA 3CE6A 2Q2NA 1NDQA 3EZ7A 4ZN6A 1H2FA 1V11B 4M0UA 2YOGA 3G8AA 2JI9A 3ANXA 1K7XB 1GUBA 1OGIA 2NYUA 3M70A 1J8MF 1KZHA 2R6ZA 3G1WA 3Q2OA 3PZBA 1OCEA 1TVKA 1EWKA 3KPYA 2GD0A 3AJ8A 4L15A 1CIJA 1NI4B 1JR2A 1U0EA 4HI0E 5HJ5A 5JJ5A 2VJBA 5LPNA 2RGNC 5EE1A 1IQPA 2ZKLA 4QUIA 3HJCA 2XB9A 1YI0A 2ZVQX 2P91A 4ZICA 3W4IA 4BRUA 2NV2B 2FPLA 2G9QA 3GLHE 3KXIA 1FRNA 2YRFA 4OB7A 1P0IA 4F4JA 2G1PA 1SUBA 5BWCA 3Q8XB 1DUIA 4Q3DA 3V1NA 4BVJA 2CLFB 2W83A 5CDTA 2DHDA 3PFWO 4FFOA 1KBOA 4B76A 5IWCA 3DJYA 3C1TA 4Q37A 3UJBA 1X7XA 4P0QB 2C3MA 4LF9B 1FFYA 2CZQA 2LCFA 2REOA 3SZ3A 3SQXA 1QH1A 1XMQB 2BISA 5EL0A 5EJ4A 1FMJA 4M89A 3ELWA 3LT5A 4O0MA 3B38A 3L8HA 4DCSA 4JA2A 1XCLA 1LV8A 4HGQA 3N7TA 1XNGA 3SHFA 5KBYA 3W7AA 2WAXA 5H9WA 1J0CA 3U2QA 3OKFA 3QI7A 4RA6B 5HK9A 1ZJ5A 2GT1A 3L8MA 3TECE 4D25A 4LFCB 2PT5A 5FUXA 4AJLA 2PRZA 5I7UA 1KR2A 1Q7TA 4X71A 5C7OO 1EMDA 2Z2IA 5IEBA 1RRPA 3OZBA 1ENZA 2DHQA 3NTUA 2VT6A 1JHVA 1L6IA 4ZO6A 3GNQA 3UQZA 1N6KA 3MAAC 1LNSA 1THMA 1ZMTA 5DBFA 4DYVA 1ZCJA 2YS7A 2F3RA 2W2MA 3L4SO 3LLVA 4DXHA 2PL1A 1JG7A 1XCMA 1QG6A 1TYEB 3GEGA 3HDGA 4OM7A 2JFWA 2J9XB 4Y1RA 2ZBVA 3RVKA 3F6BX 3RT7A 4F2HA 1E0AA 4UPEA 5HZGA 2VJMA 1Z17A 3A1FA 3DOFA 3RQSA 4CODB 1PU2A 1SPXA 2UUBB 2P2GA 4ZT4A 1CE8A 4MTLA 4GBMA 3RIMA 5KSYA 1Z5ZA 2Z0MA 1V8OA 4MV1A 3CN7A 2YQZA 3F3KA 2IZ0A 4EG0A 3PXXA 4JYMA 1M7HA 3OLQA 2P4EA 4X54A 4YJKA 5KEIA 1VDMA 1M6HA 4HDMA 1NURA 2I2WA 4P98A 3RSFA 1UMBA 5LA6F 3QUAA 4HGNA 2V9PA 2QORA 3JQ7A 4F4DA 4QPPA 5EKTA 1XQVA 2CL5A 5ES3A 2IIVA 2Q8QA 1O87A 1HA3A 4B3IA 4Z1MD 5T8KC 2XNDA 4D42A 5LD2B 3AKEA 4UAGA 1KRHA 4E32A 5E3HA 1NSYA 2HU2A 2E6KA 3GLIB 3TTSA 1X9IA 4G0UA 1EFUA 4GKJB 1GCIA 4K9QA 4NENA 1JG1A 1YNSA 4H6WA 3GJQA 1U1FA 4FU0A 4QX6A 5DN9A 2ZWMA 5LZ7A 2WTAA 3CVUA 4OQ4A 1RMYA 2FPMA 3HB7A 1P6XA 1XE3A 3K4HA 1P3Y1 2NVUB 4G5QA 1DKPA 3KD2A 4BL5A 1GZ3A 3TZEA 4J1SA 1SCQA 1MXHA 5CK4A 5HJEA 5BSKA 4L3OA 3M4XA 2G4LA 4YREA 3GZTB 2FQWA 1BVUA 5JAIA 1QRRA 1JPUA 1R0XA 1T91A 1NRWA 1Y4UA 2B4AA 4OSEA 3NO4A 4QUGA 1YJXA 4TWAA 1ODCA 4KN5A 3RKRA 4MLDA 5FNZA 4O4LA 3VM6A 1LJUA 4XDHA 3PR2B 3CUEF 4ZIRA 2FETA 5HIAA 5JLJA 1G59A 3FYCA 1BGXT 2I1WA 3UB2A 1XC7A 2FP4B 4ZT7A 4R0NA 2V7TA 4R1LA 4MB2A 2IS4A 2I7XA 1IY0A 4M9ZA 4MWZA 2AOTB 3DLAA 4BPRA 3L7BA 5LB4A 2QVZX 4ROTA 5EOVA 4G8BA 1SY7A 1ODFA 2FSHA 5I4KA 3NHBA 4G0MA 3T99A 3MUOA 2OAP1 3VDRA 4DR1B 3KSZO 1EIWA 2VCEA 2WC1A 4I5DA 1EBFA 2AJ8A 3VUEA 3EPJA 4BEWA 2BELA 2G9VA 4C0KA 4DCMA 4KQ2A 1VGRA 1GNRA 3DZDA 3EQ2A 3RVJA 3WDLA 2HFKA 3M6UA 4H35A 1I7NA 4DJJA 3LRPA 3JWGA 1E4VA 1NIJA 1CLUA 1W5FA 2EIXA 1YMVA 2ZWOA 5GP1A 5JLAA 3DLHA 3WMEA 1PIWA 4CEIA 2YW9A 1BOFA 1DQYA 3NHWA 2VO1A 3A2NA 4NZNA 4ENUA 4ZT3A 2OSVA 3NFYA 4JBLA 2O8DB 4DR6B 4FZ5A 5KYWB 2O7QA 1DRWA 1E7YA 1RYMA 4BMPB 3OC6A 3L46A 1TPYA 1POWA 1UXKA 2J7PD 3HFJA 5H16A 3TI7A 3ICWA 1AQYA 4C6TB 3KSUA 2DSTA 2OORA 4QQFA 4OU4A 1RACA 4WESA 3GPBA 2JCVA 4AG6A 4KLZA 2C2BA 3IA7A 2B5WA 1DADA 3ECAA 4G24A 4JAVC 3TGWA 3GWGA 5FTNA 4AUNA 5F76A 3EWNA 1UMCB 3P9RA 1RQXA 4L8FA 4LHVA 4FHCA 1R5NA 1JEAA 4DQUA 1WWKA 4PLHA 1OFVA 5KI6A 5J47A 2D8MA 3AI3A 4FQ7A 1RJDA 1SWWA 3KSRA 5ILGA 3EHEA 3T0GA 3N2NA 1DIBA 1GHTA 1P5JA 2Q2QA 2ZI7A 5FBLB 1IEQA 4MSUA 5COBA 3STTA 1RXWA 3M4JA 1O0SA 3ON5A 1O7JA 2AH5A 1L5FA 3PE6A 3RK1A 1TZKA 5IEJA 5AUNB 1W0KA 4LX0A 3O21A 3B7WA 1Z06A 1XRJA 2QSJA 3JQCA 1OILA 3KS9A 4JP3A 1BW9A 5DSTA 3FLBA 1KXZA 2A9JA 1C9JA 2P6NA 5G41A 2GUGA 1MZPA 2X2EA 3QF4A 3WL4A 2JHFA 2EU8A 3OFNA 1HE8B 2J4DA 4HDKB 1VRCA 1JIXA 1Z2CA 3MOGA 4P3KA 3RSZA 3SVZA 4BNFA 4DTIA 4KQWA 4E5DA 1XTUA 1E9AA 1BKSB 4QM7A 1GEEA 4NMMA 1MG0A 3BGVA 3IQZA 4HB4A 4RSHA 1C30B 2IJGX 4XOUA 3UTDA 1KZGB 1D5WA 2E37A 2HLDD 3I8SA 2Z4SA 4F86A 2XDYA 3KOWA 5AVZA 2HSZA 5F64A 1R3DA 3D6VA 3L6EA 2ZRNA 2V7VA 2YY6A 4GPD1 1YOVA 4L22A 1ECBA 5LA6A 3A1UA 3WA6A 2IHUA 3MMSA 1SBHA 5CPBA 4B2YA 3OQJA 1TEVA 1FYXA 3EZNA 6AT1A 4J16C 3PXGA 4YDRA 3GA7A 4J76A 4F91B 2D8AA 2Z9DA 1CP3A 2VP2A 1WCIB 3Q4GA 4YXWD 3HY3A 3NJRA 2AS0A 5H8WA 1ULTA 3TBKA 1QKJA 2X0EA 1A9XB 1F9EA 3ESQA 1B4DA 3K9QO 2ZSBA 1KAMA 3G9QA 3U9LA 3R8FA 5HIMA 4B7UA 2AJBA 3LWBA 1PS9A 1ZWKA 3TW6A 3WZLA 5IC6A 2AOXA 3AEQB 5TS2A 3ABQB 4PPNA 2ZDGA 5JAOA 3AKDA 5FFMA 4F9FA 2ZUSA 1G55A 4H60A 4WZBB 4JP2A 4JN6B 4H4DA 4QPNA 1SUEA 2EWWA 4Y2UA 4GR9A 4Q9AA 4OJYA 1OX4B 4N8EA 4MGIR 3QENA 3BIXA 1FL9A 1X1TA 1NKTA 3TCNA 4BO8A 3E8SA 5SZJA 2BM8A 4D4MA 4UM9D 3PDIA 4CW7A 1R6BX 2BKAA 1XPRA 3KR1A 3RS2A 4YRDA 2IOFA 3ETCA 1B2LA 2I2BA 4MROA 4IM7A 4CM4A 2R7LA 1FS4A 4DXAA 2PZLA 1C5KA 2AUMA 4FE4A 4MO9A 4LRUA 4Q9DA 1K86A 1FY2A 2J67A 4TX1A 4X6UA 3HUUA 3QVLA 1CY6A 5EESA 3VPSA 5E4FA 2GFHA 1AGRA 1VB3A 2OK7A 4O4HB 4JLSA 3BA1A 5AKEA 2ZYAA 5EWLB 2YMQA 3PITA 5IH3A 4JMPA 1BYUA 1SCBA 2PCLA 1WJGA 2WUVA 1E5VA 3SLKA 1OBCA 2WV7A 1WBJB 4Q6WA 1TQ4A 1XDSA 1UQTA 3ELBA 1UJ2A 3GEDA 4MV5A 1HORA 3WGOA 5F7JA 2JHAA 1MIHA 3PB3A 3DKIA 5EZ5A 3FPSA 4OQQA 5C8XA 4JKIA 3QIAA 1FJ2A 2VJPA 4XYMA 3R4CA 4GPBA 4ND2A 4PEVA 4QU9A 5AXAA 4QDOA 2KB0A 2WK1A 3KFXA 1JSLA 1Z5NA 2GCGA 2Z1DA 4O2AB 4ZDWA 1PV1A 4I50B 3Q72A 2I87A 3FCUB 4R5MA 3GRYA 5G02A 3VVCA 3S7ZA 2BH9A 4NOKA 2OHOA 5JW6A 1JZTA 1YKSA 1YTUA 3RVMA 2BHTA 2VUSA 2XZPA 1XZQA 1NVKA 3IPCA 4FI3F 3RJ5A 2VAWA 3NTRA 4J6FA 4AUMA 1XAJA 1ZVJA 4DQDA 3PNOA 5ELMA 2GPBA 1KFEB 1SHTX 3TTYA 1MO4A 2GN1A 1J09A 3D02A 5BW4A 1L1QA 2POQX 4RDHA 5DYWA 3DYBA 3VPHA 1SKYE 1RRKA 2I1QA 2HWWA 3V7NA 2BEJA 1Q3TA 2OT3B 2RSLA 4IZOA 2A35A 5ARDA 3KVYA 4D4GA 5A04A 2UXDB 1CNEA 2VNAA 2H07A 2Q46A 4FD2A 4B3JA 1RTKA 1W25A 1SD1A 2V4MA 1E77A 1COWA 4DLSA 5LZ2A 4GBED 1JHQA 4TN1A 3GFRA 2GN2A 5ICFA 5JCOA 4KQGA 4Z9XA 4C6SA 5KDOA 4C4RA 5AK5A 5JNUA 2VZ0A 3L6OO 2JGIA 1BJRE 1QK4A 1CTQA 1N2BA 1SUAA 2CYBA 2GGSA 1MOZA 1BOOA 1TZJA 2VHEA 2R62A 1QYIA 3EODA 3LX5A 3P5BA 3OPYA 2V6JA 4QDTA 4Y7CA 3SIRA 4OHMA 3FVQA 1NFRA 1E5LA 4ZOAA 2NMVA 2XD4A 2M9MA 4DADA 2H52A 5AM3A 2G63A 4C3ZA 1Y8AA 2X9QA 4IIUA 4XGRA 1NVVR 1B8PA 4FDMA 2AC4A 1SMKA 2R97A 3O92A 2CB0A 2G1AA 4IFBA 4B81A 5KNCD 4Q7MB 3LQQA 4Z3OA 4UOZA 4AROA 5TQ0A 4KRFA 4H0NA 1YDHA 1BGVA 1H2AS 1LFAA 3BFVA 1X19A 4W8GA 5ITWA 3ICEA 4IPTA 1DBIA 4CIWA 5JNSA 4UOEA 1XRMA 2Z57A 4R54A 4GMGA 3HV0A 4GR4A 1DS6A 4BMNA 1P9RA 4PV7A 4UCQA 3FLEA 1XAIA 4FCTA 3A1VA 4B3RB 3C5HA 4KXLA 3FYSA 2NYVA 1G18A 2H06A 2QVXX 4XEUA 4UATA 3DBIA 4YP5A 4CMJA 4KHZA 3NUGA 3RVPA 5HRCA 3BFKA 5TV2A 1GKUB 2WF6A 3IRUA 2P9CA 5CFNA 3AXTA 4C07A 2Z8YM 2LZ0A 1XJ5A 3BWVA 3H16A 4L4ZA 4ARCA 1GKYA 4AP6A 1U81A 2HSGA 5E6UB 5EJ2A 4EG6A 3O93A 1XZDA 1JKFA 5D6OA 3TEMA 1M2OB 1DO8A 4IGKA 4JJZA 3W2FA 3LHSA 5I51A 3OIUA 3KE9A 4BIIA 2AUTA 4PHTA 2IYRA 4TL6A 4ZU3A 4B3HA 3IEXA 4WOPA 1OB2A 4BO2A 5DVZA 4DW8A 1SCNE 4UCXA 1X92A 3DE0X 1BFUA 3ES9A 4XE5A 1P2VA 3WS7A 5D87A 3ZIAD 2R9VA 3GUYA 4YJ2B 1ZD3A 1O1YA 4WQMA 4RIIA 4ZOEA 3G3EA 5ABPA 1GKIA 2GBLC 4UZEA 3MW8A 4BNZA 5B7QA 3TRIA 2FZWA 2DHRA 1MOPA 4RE5A 1RHRA 5F4BA 4EGCB 4F3YA 3DBRA 2OWDA 4NBSA 3KAJA 2BGUA 2QZ9A 5J4HA 3RHZA 4R0MA 1VG9B 2YBDA 1LLUA 1J5XA 1JG6A 1PBNA 3P9ZA 5EHQA 3UMFA 2GB4A 3RVSA 3BHJA 1A8IA 2ATVA 2NO6A 3VHQA 3U3MA 2QV7A 3VR6H 4RHUA 4K0RA 4XIJA 4Q00A 4XSVA 3UKOA 3I05A 3ANMA 4MIYA 2JLVA 2BKUA 3IP3A 3KTFA 1NKSA 4ZXFA 2Q9UA 5T3YA 2NLOA 4DV4B 4X91A 1QR6A 2DFPA 1N4AA 4KDCA 3LUHA 3ZE0B 3T4PA 3JATB 4KUHA 3ZDRA 1GP2A 2H1HA 3EEFA 3GBSA 1JFFB 3QTLA 3WQRA 2P11A 4G1EB 5TNXA 1CEQA 1M2VB 4QYIA 2O8EA 4JP1A 3RM3A 3S3TA 1WXWA 4TM8A 4CM8A 5CLFA 3AHIA 2E4AA 1MJ5A 2VK4A 3H4MA 4QXAA 3L0SA 3VR4D 4BNNA 1GXSB 1W47A 3H9UA 3NHJA 1PJBA 4RABA 3AHDA 3AINA 4H7IA 2PO5A 2AYXA 3P9YA 1T5SA 2BFBB 5FNVF 2IIBA 4MYRA 4R2LA 4D8WA 1Q83A 1UOQA 1ZQ9A 2DTDA 2J5KA 3CH5A 5EINA 3X1XA 3CLVA 1RPNA 1CR6A 3IAAA 3ER9A 4JUDX 1JVSA 1O97D 3FPJA 3SHOA 3V4OA 4CEJB 3K96A 2AOVA 1CP2A 3Q7SA 3K1AA 3KKMA 1VBMA 3ZYZA 3Q2KA 4P53A 4U7JA 3JZFA 2VRNA 3EXHB 3M33A 2D74A 2B9VA 4B83A 3M6WA 1Q7RA 2OFWA 1E3SA 4MHOA 4Y9RA 4BB9A 2K2QB 5B3JC 2JLYA 5EKSA 4DA4A 1M6WA 3IEIA 4Z2AA 1XTVA 1A7KA 4Y2PA 5DYYA 3VR2A 2H9AA 2VQ6A 1X1SA 2F1KA 3TNYA 3O83A 1BH2A 5ALTA 2FRVA 3W3AA 4G4GA 1MRZA 5CLIA 5CB4B 1J23A 1JQBA 2QPOA 1PGNA 5AHWA 1XZKA 4HYTA 3WGZA 1RFGE 1DIAA 4YAWA 3WLFA 1FX0B 1KIAA 1J2UA 2KQUA 2JJMA 3R77A 2P8JA 2X9NA 5I4CA 1VYUA 2ZE8A 2CDAA 4G36A 1II9A 1JR3D 2EAUA 4QFCA 4UNPA 3EVZA 4AZ0A 1XNHA 4D0LB 1SXJA 2V3VA 5C4GB 3IT2A 3NIGB 3MIZA 4XCXA 1Z8NA 4B82A 3LSYA 5IZCA 5AWFC 1VE9A 3EN0A 3GVHA 4FYPA 2V7QD 5H68A 1NONA 5ERXA 2XE8A 3T9EA 4TYYA 1NUHA 5CDGA 2ZJ2A 1B3RA 4ZP1A 4JLWA 1UBHS 5T5QA 4D2IA 1GAQA 4L4YA 1MGPA 1M2FA 1QIFA 4RLFA 5A4FS 1RWBA 2JJ2A 5BUCA 5JYDA 6ADHA 5K3FB 2P5TB 4GPEA 2J9GA 4JC5A 4JK3A 2OECA 3ME5A 4IDBA 1J25A 2L82A 4WVLA 3M34A 5EXTA 5T64A 4AKSA 1RRCA 1L2TA 4HLCA 4EMTA 2XZLA 2H8GA 2X0IA 3ELYA 4W9MC 5LD2C 1PX2A 5DX1A 1F5NA 4DVGA 2D4AA 3H0KA 4TTRA 4AKHA 2RKBA 4WOCA 4K87A 4QUAA 3OWHA 4I6EA 3ETJA 3R7FA 4WZZA 2B99A 3QPVA 3WGJA 1EJ2A 1UM9B 3KQKA 3JQ9C 3GGGA 4RSRA 1IM8A 1XMSA 1M2KA 1M6VA 2KM1A 1ZD1A 3SC2A 5AO9A 1X0VA 1EUYA 1IEXA 1BE1A 3CVVA 2OA0A 3WGGA 4HAZA 5AKIA 4UFNA 2IBTA 2Z58A 4IWYA 3RC8A 3EF3A 1TAQA 2A30A 5HKLA 2C82A 3TUZC 1MFPA 5C32A 4FYYA 1BZYA 2EBWA 4L4XA 3LQKA 1H3NA 2ZIUB 3D0KA 4N5MA 2PBFA 3CEAA 4M83A 1A8QA 1TJ3A 4N9QA 5F21A 1I0LA 1L4UA 3IXQA 2PGNA 4Q6BA 4UTNA 1MA3A 1WX1A 1VI6A 3RYHB 5LQMA 1Z15A 3BPSA 1IVYA 3QY0A 2YWEA 2Z56A 1M7GA 3QEMB 4QUHA 2IX9A 3ONWA 4I5IA 3TQRA 2VSOA 4XASA 3F78A 4DARA 4LKRA 5HUJA 2HNKA 3CPSA 3HWX1 1R6AA 4D96A 3KSBC 2GCNA 1X80A 3CJRA 2W70A 3PQFA 4DMUB 2ZTSA 1YCFA 7MDHA 1DJLA 2JJ1D 5HK8A 5DNYB 3P97A 1T5IA 2JFVA 1XVTA 2O8BB 3UMRA 3LUFA 3MAGA 3HEBA 3O4VA 3ZDEA 4IDDA 2K4MA 1K88A 1YS9A 1RKBA 4W5WA 1DE0A 1P62B 1YDEA 1VBKA 3NHSA 4HADA 5ER9A 4CV1A 3X2EA 4AJNA 5JR3A 1T0JB 4HEHA 4LDPA 1EJ6A 2Z3VA 2NT3A 5HDQA 4MPJA 5FNVA 1XZEA 3DB2A 4NMXB 4YRFA 3WXMA 1SZDA 4BMVA 2VZEA 1N92A 3W5BA 3AVUA 3ZQ6A 5B37A 4NS4A 1C7IA 2XBLA 4HQRA 2JJQA 4FDVA 4QGHA 1KQGA 4WXMA 1H6DA 3OPNA 1PJ4A 2HFJA 3K15A 4HDSA 1MLDA 8ATCA 1ZRNA 5C9ZA 1MC8A 2AVDA 4ZVKA 4FHFA 2QBYB 4HBZA 4F4FA 2QMQA 1GYQA 4ETMA 5H5JA 3T38A 2PYZA 4NU5A 3B6ZA 4RIGA 2NXEA 1SXPA 2TS1A 4LXIA 1F4VA 3PGKA 4PN7A 1AHPA 4ZI7F 3O9MA 3D4IA 3JQBC 1V8PA 1KEEA 2GRJA 5HS4A 3IKTA 4MX8A 1Y9DA 2CDCA 3H7IA 3NOOA 1SUIA 2P6UA 4OEHA 3UFBA 1VCNA 3MJCA 3K0KA 3BAZA 1GUDA 1O3YA 1HOTA 1N0WA 3DZJA 2Z2JA 2GYUA 4BLQA 1QTNA 2X58A 4PCAA 4JI2B 3QMPA 1V47A 4X84A 4JLDA 3ASUA 4IRUB 3PLNA 4X1YB 4GOLD 3RBXA 1AGYA 2YQ4A 1VG8A 2FN3A 4OMUA 3VKWA 1E2BA 3BK1A 1AXGA 1C1YA 4PQEA 2ZG6A 2NUAB 3QU2A 5EP1A 1CZRA 3NYQA 1YQEA 2Y1LA 1PZNA 2B2NA 1RRFA 1SQGA 2IPOA 3KQYA 4BXOA 2BH2A 1BEZA 1VJGA 4GKBA 4TT8A 4ALKA 2VZ8A 5AVKA 4L5BA 2BFPA 3ESXA 2AYZA 2W8ZA 4S1TA 1JTVA 4BU0A 4K7JA 4AMYA 1WO8A 2JFPA 3R3SA 3D0QA 1EXWA 4D44A 1C9DB 3MCVA 4HVCA 3HDTA 2HOQA 3A6DA 3PC7A 2QI9F 4EL0A 1JXQA 1BVHA 4NBLA 1LSJA 1U3DA 4PM4A 5I9SA 4UVDA 4XQ0A 1S4QA 2IU0A 3VKFA 4F9GA 1DC6A 3VNVA 1VE3A 3AUKA 3CKMA 4YQEA 4G84A 3EULA 2BFDB 4QXQA 2YYYA 4F45A 3GELA 4BGDA 2PAFA 4KQEA 4N6GA 1ATZA 1T6BY 4Q9KA 4XQ9A 1RQPA 2X4DA 5IYZF 3QLTA 5DM60 3GLFB 2CK3A 3SZUA 1YACA 1GQQA 2OFXA 1P29A 2XMGA 1KJ8A 3AR8A 1NC1A 1FUUA 2RB4A 4HFNA 5A6SB 2GHTA 3GA5A 5BQPA 3I2FA 2FYTA 3HYRA 3D8TA 1VKOA 3LO5A 3VR3D 3K1JA 4REOA 4C30A 3LX6A 4CUZA 4URXR 2BGWA 1G291 2E82A 4P3NA 4FR5A 5EVCA 5CW2A 2OYRA 4LDRA 5FRDA 3UFXA 4CKBA 3CE9A 4RLSA 1JFLA 1V1RB 2RHCA 3TSYA 2J59A 3A37A 1UK7A 3IEVA 4LJRA 3NUZA 3IP6A 4W8HA 4ALJA 4FDUA 2CJXA 2YN0A 1UJMA 3K0FB 1UEJA 4HDNA 1WQ1R 1NRJB 3H5AA 1TAUA 1Z4IA 4JITA 4XD7D 2OQVA 4DV6B 3NIBA 4F71A 3IUJA 1IPFA 1RWPA 4X93A 4E46A 2PS0A 1DXHA 1DAFA 2VPXA 4CTOA 1KZYC 2C54A 2LKDA 2WSIA 3H4IA 3IUSA 3OT4A 4PGFA 2I62A 2JC3A 1L7VC 5EMNA 3V9PA 1XQ1A 1W2WB 3PEYA 1UC5B 2QG9A 2DT5A 3AIKA 1QUEA 3H4VA 4R9RA 1RXIA 4RMHA 5EEGA 4AG5A 5A5GA 4ZYTA 4FNMA 5K0FA 3EYWA 3P0RA 2NQ8A 1TKBA 2VYQA 2Q8PA 4OFWA 2ZAIA 3BD7A 2J0SA 4YRRA 3U6BA 3RFVA 1OT5A 4EF4A 4HVLA 4GZ3A 2P2ZA 3MCWA 4DMKA 1UBUS 3D8HA 1DFGA 1XZIA 3KSMA 3O9VA 4BLSA 3DAHA 4GX1A 2CEAA 3HJHA 3RU3A 5FBZA 2H57A 4YS6A 4ZPJA 1XXLA 3QLUA 2PD4A 2BKLA 4WBNF 2R8XA 3T7IA 3W7VA 2I2FA 4ND7A 1T3TA 1C3JA 3W79A 4Q4JB 4HZUA 3HJTA 2N42A 5B7GA 1UBGA 3KLOA 5E6RA 4A2WA 2GBFA 3WL6A 3HSYA 3CB2A 3REFA 2WINI 1Y8QB 5IXJA 2O2JA 3TD9A 4AK9A 4AY2A 2XMSA 4YLGA 4OQXA 3E22B 3LOPA 5KQSA 1OH7A 1UXGA 2LVBA 2C99A 2QOEA 3SWWA 4MPRA 4WDQA 4DL9A 2M6RA 1RPJA 2EX0A 3I9OA 4NZOA 1AUXA 4LZPA 1AKUA 1T5BA 3KKPA 2FEWB 3B1ZA 1P4RA 2NUTA 3SICE 4CMHA 1A77A 5IARA 2Q3MA 1ZUHA 2WIBA 1RSZA 3IOMA 3UWMA 4D9JA 1CVRA 4Z99A 4E13A 5AVSA 3LGXA 3T61A 3BIWA 4H59A 3AQIA 1PEAA 2I78A 3FPHA 1R00A 2CVFA 2EWVA 1AUOA 3OZSA 3PYLA 5AI4A 3VZDA 4YHBA 4ZI7A 4KODA 4OAOA 4Q24A 4JJIA 1LPMA 4TV8A 3E9DA 3NWBA 4DAEA 4POOA 3HMQA 3M3DA 3GU3A 5FBRB 4FHDA 3GMDA 3VMFA 4RDIA 1MT3A 1PDOA 2R5WA 3E9QA 2AFVA 4ZEWA 2JIOA 1U4OA 3MTJA 2XR1A 4RA9A 1LEHA 1AU9A 3IMGA 4WKNA 4FYMA 2J33A 1M54A 1FVXA 1LA2A 1EFKA 2AFRA 1H05A 4JR1A 4Y6QA 1E60A 3JYPA 3IRVA 3PHHA 3F9IA 1ZN2A 3COJA 3NC1C 4UW9A 3PWSA 1HYHA 4P84A 5FTLA 1LRLA 2WT9A 4NV0A 5K0NA 3ADDA 4HXEB 1J56A 1GZ7A