3FE2A

Human dead-box rna helicase ddx5 (p68), conserved domain i in complex with adp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
234
structure length
234
Chain Sequence
QEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Probable ATP-dependent RNA helicase DDX5
total genus 80
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fe2A00
2HUPA 4NONA 5GVSA 3KXKA 1TF5A 2OCYC 1NBMD 5FTJA 2GJ9A 1JECA 2CNWA 2ZJOA 4DUGD 3ZIAA 4C0KA 4IVPA 2JLVA 4FW9A 2ZE7A 4ACAA 4YDSA 3UANA 1CU1A 3IQXA 1GAJA 3FKSD 4KLZA 4Q1BA 2ZJBA 3G82C 4D4MA 2R2AA 4M1TA 3RABA 1SKYB 3RS0A 2VF7A 2AFIE 1QRAA 3VNVA 2WSSD 2CXXA 1UEJA 4HDCA 1KOFA 4JVSB 3B9QA 2A5DA 2XNSA 4KU4A 1II8A 1R8SA 5K8IA 1F60A 1RVDA 2XOKD 3FKQA 4MRNA 3U5ZB 2VTKA 4NMMA 2NTYC 3EPJA 4RKEA 4M9XA 4MITA 1NBMA 4PC2A 4ZCIA 2JIZD 3AUXA 1IXRC 5IHPA 4UNQA 3ZVLA 1AJEA 4IVRA 2J9RA 1DELA 3AF4A 5FR1A 1S4QA 3A1UA 1VKJA 1UBEA 2VP0A 5JJKA 4PHGA 2G6BA 3CRRA 2AXPA 1G4AE 1KIMA 3QKSB 1M1YE 4NCHA 1JR3A 2IYLD 4YXWD 2WJYA 3EW9A 4PZYA 2XTNA 3BIFA 2JDIA 2NG1A 4HB4A 1II9A 1TF7A 1ZVQA 2O8FB 2G77B 3AVXA 2FSIA 4N1AA 3RS7A 4QOSA 4LJ8A 1Q44A 3FFBA 2FPLA 4PC3A 1G8FA 2ZE8A 1I4TD 5IDVA 1ZW6A 1W44A 4RFSB 2OCBA 2Z4SA 3AQ4A 1LS1A 3IIMA 5EP4A 2ZI5A 3TW8B 2I1VB 3SQWA 4MQBA 4WW0A 3RS5A 1G19A 3FMFA 1GP2A 1OKKD 3CPEA 4KJZA 1FMLA 3GJXC 2OFXA 2YOGA 1XTJA 1CBUA 2KBEA 2IWRA 1ZM7A 4LHVA 2IYSA 4GZLA 2F1IA 4TL9A 1NN0A 1FQJA 1OIWA 1Z47A 1VG0B 4MRSA 4OQLA 2IYYA 2OV2A 4URZR 5JHHB 3W6OA 1TF2A 4GMXA 3FKSA 3ZS8A 3DVLA 3ASYA 1U9IC 3BH0A 4LJ6A 4Q1FA 3G5UA 1U98A 5JCZA 1R6BX 1JAHA 1XPRA 5TXGA 4O2LA 3TAHA 2ZI6A 3QXXA 1E2QA 4M1SA 1SULA 2QP9X 5LBIA 1DPFA 1P2TA 4DJTA 4Q47A 4ESVA 2NZ8A 2P65A 4BRWA 3Q5EA 2B21A 4IOMA 2PBRA 2WZQA 2KI5A 1ZC4A 2FEMA 1XTKA 4B71A 2IF0A 1JR3E 2BKEA 4B73A 5CDFE 1Z63A 2IHBA 2P3SA 5F3WB 3QPUA 2EVWX 1CKEA 1Q1EA 1JQJC 1M7HA 2ZAMA 3K70C 2FX3A 5A0FA 4DLSA 1KK2A 3L8YA 2XNDA 4H1VA 2QTHA 1KO8A 1B0UA 5FL3A 3AVYA 2FF7A 3O8CA 2IS2A 4FMCB 1KDOA 1FUKA 4B33A 2J7PA 3RNLA 5KHOC 2GVDC 1TQDA 4AIIA 4QM7A 2V1UA 4B76A 3AGQA 5FTMA 2GDJA 4RVCA 3BORA 3V00A 3FMIA 3MSXA 2HYIC 4TL8A 4TMWA 2EWWA 3WY9A 4DIDA 3RVBA 1EX6A 4KVAA 4RD1A 4LX0A 3FGNA 2IT1A 4AY2A 5F9HA 4Q66C 1WBDA 4P4UA 1Q20A 4JJKA 1XWIA 4Q00A 4LRWA 3ZJYA 3VR5A 3KQUA 2H17A 1US8A 4MRVA 2DB3A 3L0OA 2QAGB 3MJRA 1SXJD 4KHZA 5CB6A 1KJZA 1EFRA 2VLIA 2ZYUX 121PA 3QUSA 1UKZA 4B44A 4Q7MB 2D74A 2BCGY 4LHWA 5UKDA 3QEJA 1P62B 2D62A 1VCMA 4FCTA 4QKQA 5JMTA 2BCJQ 1LV7A 2HXYA 221PA 3PR1A 1ZIPA 2DWQA 4BFUA 1DBSA 2Q0HA 2CMKA 1N2CE 3SOPA 1US8B 2C78A 4C7OB 1XX6A 3GJ8A 2VPPA 3FFAA 3QKRB 4NBSA 4B35A 3M0EA 3GP8A 2O8EA 4UNNA 5EUMA 2QROA 1F2UB 1OYWA 1E9BA 1KK0A 1K8RA 4M1WA 4GOJA 2DHRA 1Z0FA 4MA4A 421PA 1EWRA 2XXAB 4DLTA 4PZLA 1UBGA 1XRJA 1G8PA 1Z0IA 1QHNA 3AM1A 3PEUA 2O0JA 3NG1A 4L9WA 5KNDA 2RGCA 2V4ZA 3OIVA 5DI9A 5C4MA 1N5JA 5EE9A 2BWJA 3IUYA 4K46A 4YC7A 3SI7A 1KMQA 1GKYA 1ZMXA 3SEAA 1P2UA 1E2NA 2FH5B 4HB2A 1BH2A 3IILA 5H70A 3FB4A 4AD8A 1HUQA 5DYGA 2HLDD 2OAP1 2XZPA 3GPLA 2XZLA 5BYJA 4RD2A 1NMXA 4F4IA 4JLPA 3AF0A 1GIAA 3ZQ6A 2ZR7A 1KI9A 3NKVA 4Q1DA 4B48A 4EQ6A 2ZI9A 2GXUA 2KE5A 4DRZA 2BBSA 1E69A 5FBLB 2G1KA 1X1SA 3F0TA 2ZR0A 2O8FA 4G0NA 5HTKA 2JLYA 3CX8A 5BN4A 2VQSA 4TQ9A 4BLQA 2J0VA 2PEZA 4NCKA 4BEBA 4CEHB 2RKOA 4LHXA 1S3SA 1JR6A 1BS1A 4R2HA 4A0GA 3T5DA 1E0JA 4Q9LA 1FQKA 2I3BA 1W0JA 4BUJA 1TAGA 1NI3A 4NYJQ 1WE2A 4LDJA 1EK0A 2ERXA 1E2DA 4IJMA 3SQXA 4KFTA 3DKVA 1DAKA 1W46A 5FOSA 3KKMA 1C4OA 1TTTA 5KSOA 2BMDA 3LFUA 1YR6A 4D4KA 1UDXA 2RGGA 4W5JA 2ZRMA 1Z0KA 4EJSB 4IEIA 4N0EA 2O8BB 2O8BA 4ZI2A 1OLOA 3SDZA 4FN5A 3VU9B 4RFSA 4UJ5A 4CYMA 2UZ3A 3WHKA 2VIIA 2RHMA 4LC1A 4HYYA 5JECA 1S3GA 4A9AA 1N25A 1CR2A 5DSZA 1KSJA 1V5WA 4NYMQ 2OT3B 2R44A 4RZ2A 1YZNA 1W0JD 2Q9AA 2UKDA 3U3JA 2CCGA 2IYQA 4FWIB 4UKDA 2WMOB 3ADCA 2ODBA 3A36A 3B78A 4Q4LA 5AJVB 1ZP6A 2AR7A 3CF2A 4Z8YA 4BFTA 5GJBA 2Q3MA 3ZZTA 3EXAA 4B3BA 1KI7A 1KGDA 2F1JA 3VX3A 1CR0A 3CNLA 1SVKA 1P75A 3B13B 3D8BA 1XDBA 4C7OA 5DGXA 3KB2A 4D81A 3B1XA 2XB2A 1NRJB 1ESMA 4Z54A 1H8HA 1W0KD 3CIOA 3Q9LA 4GZMA 4UXIA 5L3QA 4QHYA 2REBA 4JSTA 4BLSA 1KSHA 3F5FA 2ZITA 2MSEB 3E70C 3K09C 1NN1A 4PX9A 2IS4A 5HE9A 2OCAA 2IS6A 1LF0A 3BFKA 3N70A 4M9SA 2GXAA 2Q3HA 3C14C 2R65A 4LYJA 3U4QB 1PV4A 1NVWQ 1XCPA 2B8TA 3RSOA 1IONA 4XVUA 1SXJB 2ZJ2A 2ZANA 2ZRNA 3KKQA 3NEJA 1LS6A 1TNDA 2PCLA 5E7IA 3UWKA 2IYXA 3CF0A 4M1MA 4D80A 1RC8A 4DZZA 2QUZA 2BOVA 3N2IA 3QKTA 1F3OA 1MR3F 1M7BA 2YYZA 5CDFA 4EPRA 1LTQA 1L4UA 1X8LA 5KPDA 2HDNB 4HAZA 3BK7A 3SNHA 1AA9A 4CEJA 3K0CC 5EXSA 4JZKA 2YOFA 4TMZA 3A1TA 3AP2A 5FTKA 1JBKA 1KKLA 5CITA 2CK3A 1AN0A 3A4LA 4B3DA 4DCNA 2IS1A 3B82A 2J87A 2KJQA 4OBEA 4LI0A 2GEUA 2WICA 1II0A 2QPAA 1RYFA 4B74A 4P4SA 4DLUA 2ZTSA 4OK5A 3T06B 4JL5A 2ZJ5A 5G3YA 2VP6A 1E2JA 1IJFA 1Q21A 4UJ3A 4Q02A 1FTSA 3QKUA 4PQYA 3TBKA 2RGNC 1W4AA 4PFSA 3EARA 3HDTA 1Q0UA 1E0KA 4PSKA 4TTQA 5G3ZA 2G83A 2ORWA 1FUUA 5J5CA 2AK2A 3VMFA 4DCSA 1S1MA 1FPMA 2Q6TA 3MLEA 2Z4RA 2WWIA 5KDOA 4C0AC 2QQEA 1JI0A 1SKQA 2CVFA 3DM9B 4DSOA 1MH1A 4QGHA 2GZAA 1R0WA 2WJJA 4IOJA 3DPUA 3S1AB 1WBBA 3DZ8A 2D06A 5JWRA 3SYNA 4DB4A 1QHHA 2AFHE 2YZ2A 3I62A 3AF2A 4OL0A 1Z6TA 3LBHA 2I1QA 1OIVA 2W6JA 5JBQA 2QSYA 4A2PA 1LB1B 1V43A 2XEXA 2JJ1D 3RSLA 4DXAA 1YVDA 3A58B 3BH6A 1SQ5A 4TYWA 1RFLA 2B6HA 4V0MA 3GLFE 1G3MA 4F4JA 1GOTA 1U0JA 1W47A 4HZUA 4A2QA 3SHWA 3CRMA 3UK6A 5AJZA 1Y63A 3LW8A 4IFBA 3VHXA 2F1HA 2JDID 5EP1A 4NCJA 4ARZB 1W7AA 4FCWA 5DO9A 1DEKA 5JCPA 2WIAA 1NJFA 4WXPA 2OSBA 1OH8A 4I1UA 1CJMA 1MRSA 5ELXA 4Q21A 1OW3B 1YR8A 1Z0JA 4HDQB 2BHRA 4MH0R 1Z83A 2NZJA 2OFOA 3LH5A 3EA5A 2YC4C 5SZIA 5KUTA 5LB2A 2WHXA 4RJLA 4DLVA 4TT3D 4DCUA 1G21E 1YU9A 5CK4A 3P4XA 1XD8A 1R0YA 1NKTA 1R8QA 4NCIA 3THOA 3K70B 1ZU5A 4OKSA 2QL6A 3KB1A 4ZCLA 2OCPA 4IXNA 2BC9A 4Q7LA 4YMWA 4W5HA 1MO6A 5EP3A 2FFQA 1XD2A 4Q1AA 2H57A 5TMPA 4ZKEA 2XSZA 1KNQA 4KBGA 3N2EA 3CNOA 4YLGA 4DCTA 1XFAA 4XOIA 2UZIR 3MAAC 1AGRA 3LBIA 3WMFA 3ZGXA 4G3XA 5HPYB 1JALA 2BM0A 4MYUA 3KJIA 5FOUA 2F9MA 2NO1A 5FBVB 2V1XA 2W0SA 4R7ZA 4NDZA 4Q5IA 1T91A 5E7JA 3VR3A 4DLWA 3W6NA 1HEIA 4XD7D 4LV6A 1QVAA 3U44A 4JLVA 2VEDA 1BOFA 1M2OB 2QN6A 5DLQC 2XTMA 2YHSA 4A92A 4A0HA 1ZU4A 2ZRGA 4G01B 4B2IA 1YRAA 3W34A 1IBRA 3T1QA 3X1XA 3HU3A 5B58C 3LNCA 4WAUA 4XVRA 1GILA 2QORA 2ZI3A 2VA8A 2R6GA 1NSTA 5KDLA 4P33A 3JZMA 2YWFA 4EPWA 3GQBA 2DFLA 1XJ0A 3PIRA 1D6JA 1E4VA 2VYFA 2QRNA 2X2FA 3PUWA 3E2IA 2BEJA 2P67A 4IDOA 4M1YA 4E07A 2IXEA 5JI3E 1J70A 1FP6A 2HV8A 2DWPA 4LC0A 1W36C 3N5CA 4X8LA 1OXVA 1OXXK 4XTCS 4BGDA 2MSDB 4HAYA 5EZ5A 2IYWA 3QG5A 4HZIA 1JXMA 1VTKA 4DEYA 2DFTA 3EASA 3I1FA 1XEFA 4RFVA 3GLIB 1CR1A 2CE2X 1XTIA 4BFZA 1D2EA 4LYFA 2OHFA 1IXSB 4OHXA 4GFDA 1M34E 3LQQA 3BGWA 1WXQA 1ZM2A 4F38A 1NNEA 2WIBA 1XTRA 3B8HA 4XD7A 3OIYA 1OV4A 4EPTA 1TADA 3IEVA 2C95A 1G4UR 2ZRJA 1DADA 2IF2A 4C9BA 4B3CA 1D5CA 4LZZA 2IC5A 3SU8A 2FPMA 2ZJZA 2A2ZA 1TEXA 5C1BA 1ZIOA 3IPXA 5JSZA 1IY1A 1XEXA 4NKRA 1IN5A 5CLQA 1F2TA 4B75A 3A4MA 3NHBA 4B6EA 4I99A 4PC6A 1G64A 2VO1A 1CJTC 2ZYTX 3HPQA 3TVDA 2ZM5A 4TN1A 2ZQ5A 3OESA 1COWA 3L0SA 4HAXA 1IY2A 2ATVA 2RGBA 2IL1A 4RD3A 2RGDA 3B7GA 4G1UC 3RC3A 2CDNA 3REFA 4V0OA 2XXAA 3UG7A 4A1FA 1T4GA 5FUWA 3EIHA 2REXB 3WP0A 5SZHB 3K0FA 3FOZA 1JB1A 1G3UA 3CZQA 2IHYA 3B5JA 2ZETA 1NG9A 3QKRA 2H18A 1UKEA 1IXZA 2ZS9A 4B2LA 5H68A 3V4FA 5KU1A 5AJXA 3ADKA 3WMEA 1D2NA 1N6PA 5EUQB 3L82B 2QQ0A 2ORVA 1N6LA 4E5UA 4HLCA 3LWNA 5CYOA 1QHYA 3X1DA 4PTLA 4QBIA 3OE7D 3U60B 4OQFA 3MGCA 2CNWD 3TUIC 2PMKA 5J47A 2WJIA 5DISB 2ZS8A 1DOAA 1VG8A 2GHIA 1FZQA 2W6JD 3I73A 3VTKA 1LNZA 4Z51A 1VYTA 4LBVA 2IUTA 2N42A 3KKNA 4AKHA 4URVR 2X1VA 2FU5C 2C99A 4LYHA 2XX3A 1ELOA 1G5PA 5F2EA 3PXGA 3FWYA 1NY5A 1E1QA 4GPTA 3TR0A 3X1WA 4B43A 1NMYA 3R8CA 2RMKA 3LVQE 3VR1A 1CS4C 3B6EA 3UMRA 1HT2E 1D9ZA 1L2TA 1UPTA 4NHOA 1OH5A 1E2KA 2JA1A 2BVNA 1YZUA 2WMNB 1TEVA 3HR7A 5BN5A 5JRJA 4JLOA 1YR7A 4RCYA 3SE0A 4KSCA 4DT1B 2WVJA 2IX3A 1T0HB 3QIAA 4QGGA 1G7CA 1AQYA 2A30A 1FNMA 3IHLA 2Z83A 2C2HA 3K0CA 4QBGB 2WBLC 5FOTA 3LO5A 2J0UA 4TT3A 2IBMA 3Q72A 4KBFA 5AWFC 3QF4A 2PX0A 1Q57A 3AVUA 3K1JA 1E0AA 2BM1A 1P72A 3CRVA 5KSZA 3FHCB 1G9XA 3I4LA 3W8RA 4BZQA 4D25A 2F55A 1E2FA 1P60A 3UIEA 1TQ2A 4Q48A 1S0UA 3A1WA 3SJAA 1A5TA 3THXA 4LJYA 2WJGA 5EJEA 1N6KA 4RKFA 4KITB 1P7CA 2G9NA 3T15A 2GK6A 2VSOA 1QZXA 2IYVA 1OT3A 2J0UB 3CUEF 2IWHA 4DDTA 4DLZA 3K09A 4P31A 2FGJA 3H86A 2GXSA 2BEKA 1NVUQ 1RW4A 2AWOA 2V7QD 2VHUA 5B2ZA 1P2VA 1TUEA 2A5JA 3KJHA 4ILEA 4PAOA 4C30A 4ESHA 4ZV4A 5KPJA 5CK5A 1GZSA 2BMEA 1II8B 4DSUA 4AK9A 1QG2A 2VP5A 3BOSA 3GJ5A 1TX4B 4Q1EA 2FE4A 2CLCX 4JLDA 4ZDIA 1ZCAA 4HLUC 2DBYA 2CLDX 1Z6AA 4M8NE 4B6FA 2XITA 3A4NA 4TZ6A 1OPXA 4L15A 1HYQA 2JATA 4WZAE 4M53A 2A3RA 1VCNA 2ZJ8A 4CIDA 5J4YA 3VR2A 2ZSEA 1GRQA 3C16C 4JKYA 2IEZA 4CEHA 4Y0VA 3ZYCA 4ACBA 3ZDQA 1Q1QA 3TGPA 3VKWA 3TSOA 2BV3A 4DHEA 4V02A 3CR8A 4POAA 3K9LA 4JLBA 4DIEA 2OEPA 4M21A 3NWJA 1RE0A 3K0FB 3L2OB 1P5ZB 1U81A 1G3IA 1LY1A 4OI4A 4P0TA 2VRWA 2X19A 3PFIA 3U3RA 4Y0AA 2ZSBA 1UKYA 1YZQA 1G20E 2XAUA 4WBSA 1YQTA 4LV5B 2GRJA 2GF9A 3HPRA 4CW7A 4DLRA 4DC9A 2HCBA 3WBJA 3ZH9B 4BPBA 4BLPA 1GTVA 2F6RA 3W9YA 1E32A 2AXNA 3S1AA 4AI6A 1XEWY 1D2MA 5DI3B 4KYUA 1GKUB 2Z0MA 4L8GA 4TLBA 1JXOA 3TJZA 2E1RA 2ATXA 2ONJA 2REOA 4LHYA 4LV8B 1F2UA 1G6HA 1I4DD 1W2GA 2X8AA 3BJIC 4HB3A 4D0NA 2XJ4A 2A7QA 2QPOA 2RH5A 5DHFA 1T3LA 1F2TB 4FMDB 4JL8A 4A0FA 3M1IA 1XZQA 4HB0A 4DDVA 1UKVY 3O8BA 3ZZUA 4LOAA 3U7HB 2O0KA 4DKXA 4GP6A 4PC7A 1DAGA 5TVKA 4V0NA 2Z43A 3F3YA 4PQFA 4YMVA 2J41A 2DCUA 5JZVA 3NC0C 1VECA 5JS8A 2JIZA 2ZRFA 4DLYA 3C41J 5FUYA 3X2SA 2WOOA 3FE2A 4IEEA 3OAAA 5SZJA 1KNXA 4EJSC 5CYPA 2QNRA 2V54A 2P2LA 3R7WA 1GL6A 3OE7A 3QOFA 2GCNA 2BBWA 3PVSA 4HUTA 3PG5A 2OXCA 5FBWB 3CNNA 2FFHA 3QY0A 2FMXA 2ZI7A 4NZYA 5CM8B 2QU8A 4M1KA 4P3YA 5EE5B 1N5IA 1TL7C 1VMAA 4GBMA 2OAQ1 3GLHE 3LDAA 3ZVNA 4Q7JB 4GRAA 1CRQA 1MKYA 5HKKD 2PEYA 1VG1A 1Z28A 1R4AA 2X77A 4CF7A 5L3QB 1GM5A 1ODFA 4TZ0A 1HY3A 4MGIR 2DR3A 2H7VA 2TMKA 3QF4B 4EPYA 2EQBA 1W4BA 4QXAA 2LCFA 4B34A 3NH6A 1NMZA 4RD0A 4C0LA 3B1YA 1BMFA 1DG1G 1QG4A 5FI0B 1KI6A 3MWJA 3ETLA 3EZ7A 1R5BA 2AK3A 3SC3A 4R71A 5K8LA 4UXHA 3F8TA 5JJLA 2W6ID 4Z1MA 3AV0B 2ZVPX 1M74A 1YZTA 2EFCB 3KJEA 1XP8A 1X6VA 1KSGA 3R9WA 3LW7A 1WCV1 1ZINA 2BBTA 4TMTA 2J45A 2YV5A 5FOVA 1ONBA 2WAXA 4NTZA 4I1VA 2C5LA 2K5UA 4XVQA 1E94E 1Z2CA 2AHOA 1IM2A 1KDTA 5FPSA 4ON9A 1JEDA 5IT5A 5KYKA 1HH4A 2GXQA 1E2MA 1G16A 1HA3A 3K53A 4MDEA 1XJCA 1GUAA 4ZIRB 3P4YA 5KTYA 4BFXA 4DDWA 2IA5A 2A78A 3GCGA 1W4CA 2DY1A 1RIFA 2FZLA 4B47A 2DYKA 3EIEA 1E79D 3B85A 1DAMA 3ZZ0A 2BMFA 4TSFA 2WWYA 1EFUA 3DDCA 1A1VA 5E95A 1E2HA 4QJ3A 821PA 4Q1CA 2C77A 1DS6A 4OHVA 4G5GA 1NN5A 1NY6A 3BAFA 5BN3A 3P32A 3T12A 2PLFA 3OEHA 2CJWB 1W5TA 3DEFA 4JVMA 2OM2A 1IN4A 4Q9IA 4TTRA 2O8DA 2CK3D 1T8UA 4MRRA 2JGNA 1E2GA 5KOYA 2LKDA 2IW3A 1NG1A 1KMHB 2FSFA 2O5VA 2ODWA 2B7CA 4A2WA 2ZUDA 3IDQA 1LF5A 4Q9JA 4Z8XA 4IOLA 5FH9A 4J0QA 3IIKA 4XWKA 2V55B 1Z2AA 3GLGE 4PSAA 4AC9A 2BBOA 1E9EA 1JPJA 5JWOA 3KQHA 1HE8B 4HLQB 5LDDC 3MCAA 2FOLA 2ZROA 2FA9A 1ZUIA 4HDOB 2PLRA 3BC1A 4TQUS 3WNDA 3EPHA 2O8CA 2MMGA 1UF9A 1GNPA 2J7KA 3KXIA 3Q8XB 4H9GA 4LHZA 1E1RA 4DSTA 2C9CA 2A9KA 2QP3A 4ABYA 3GEEA 1G7TA 5DHAA 1F6BA 1OB5A 2H92A 3B1WA 2VP9A 2RGNA 2DFKB 3LY5A 3PEVA 4PHHA 2RHDA 4AYTA 1SVWA 3SS8A 3QPWA 4MYTA 2FPKA 2CBZA 1DG3A 1MO5A 2CE7A 4CEJB 1E99A 1ZUNB 2BKUA 3CBQA 4L5BA 2VP4A 5CJPA 3FYHA 4BRUA 1JQLB 4LY6A 1FW6A 4JVNA 3ADBA 1KDPA 3W90A 1AIPA 2CCKA 3AVWA 2GCPA 2ODNA 2JLSA 2KWIA 3UXMA 4D0LB 3CO5A 3QJYA 1GRRA 1NVVQ 1QBKC 4RSGA 4AYWA 2F43B 2ZJAA 4A6PA 4R2IA 1SXJA 3Q5DA 1KI1A 1G18A 3NC1C 3THWB 2QMHA 2WWGA 5FL7D 1DO2A 4LBWA 5B64A 5J4VA 4PSVA 3AVTA 3FMOB 1FL9A 3AB3A 4ERNA 3AP3A 4NE2A 1TPZA 4OHWA 4ZIRA 1UBFA 4NYMR 2QTFA 4KFUA 2N46A 1MV5A 1QVRA 3BH7A 1E1QD 4UQOA 2OUKA 3IQWA 1FNNA 1B23P 4LYAA 4CEIB 3TH5A 4WZBE 2J0SA 3KTAB 3I5XA 2RB4A 3B2EA 3DOEA 1Q3TA 4HI0E 4QHTA 3TNFA 2G1JA 4B3XA 4B3GA 1ANKA 3OEEA 1UBCA 4TLEA 3MWKA 1W1WA 4A82A 1ZM4A 1AKEA 1XD9A 2CHQA 3RRNA 2CEAA 4C2TA 1A82A 1AM4D 1N6OA 1L4YA 1R10A 1S1CA 1IAQA 1SHZA 2C96A 3I8XA 3OFND 3U44B 3AKCA 3K0AA 4NYJR 4W9MC 2J0QA 1I4LD 1SHKA 2JJ2D 4TMVA 1E2LA 3LLUA 3E5HA 4JIMA 3U6BA 1GFIA 1YZKA 5TY0A 4V0LA 1ZNYA 521PA 2F9LA 2GAOA 5JLJA 4F93B 4DUGA 3D7MA 1XPUA 2ZRAA 1VYVA 2GKSA 1JAIA 1J7KA 3L43A 2JLRA 1ZYUA 4RY2A 2W2TA 4IOKA 3VU9A 4O3MA 1PVOA 1XF9A 3EA0A 5G41A 4EJSA 4MDFA 4BFYA 5FTNA 1OHHA 4ASUA 1KYIA 3AKDA 3U7GA 2VBCA 1O3YA 2VHQA 3RHFA 2HXSA 4KO8A 4QFMA 2B7BA 4PR0A 1RRPA 2E9SA 4ZCMA 3QXCA 4LWZA 2OXRA 3R7WB 3VQTA 1T3SA 3IHWA 2G0NA 4AG6A 1WB9A 3QEOA 3AGPA 4C0QC 2XNDD 3DO6A 4JL6A 1A2KC 2IYUA 3EWAA 4XIGS 1BYUA 2HJGA 3C15C 4PANA 2J3EA 4TWZA 2FNAA 2OZEA 3ZQJA 1KHTA 1R0ZA 4OQXA 3K9HA 3UATA 4O25A 2WKRA 3JZAA 1DAIA 1L8QA 1C9KA 2G3YA 3NH9A 2ZRLA 3WNBA 4ARZA 2QAGC 5DE3A 2JLQA 2DPXA 4OK6A 4HZUB 4DWJA 1Z6GA 2AL7A 1PUJA 2O52A 3P20A 1N3BA 4DDUA 721PA 3UMFA 1XXHA 2CCJA 1X8KA 1N0WA 4PAMA 2FGKA 1HQYE 3SZRA 4TL7A 2YOHA 1KI2A 1XTSA 1U0LA 1NKSA 1J8YF 3OEHD 3U7FB 1EFHA 2D7CA 4GSYA 4GOKA 4N3NA 4FWTA 1CRPA 2YINC 2AKYA 1RKBA 2R6FA 4FMCF 1ZNZA 2BIFA 1WRBA 5J40A 3OFNA 3AH8A 4ASUD 5GVRA 5AJWA 2QMUA 3LX8A 2ERYA 1GG2A 3CKLA 3TUJC 1E2PA 1X1RA 3ND9A 5AK0A 3BRWD 1LFDB 4C4PA 2OO7A 3CONA 5J4HA 1U8ZA 4QBFA 2Q9CA 2EWVA 1SZPA 4XJXA 2IYTA 5AUQA 1CJKC 3M6AA 1E0SA 3THWA 1W4RA 2ZE6A 3LXXA 4C3ZA 1L7VC 2PMDA 5D3MB 1CXZA 3RDPA 1DTSA 2ZREA 4M1OA 4QG7A 4LJ5A 1XCMA 4BFSA 4JLMA 4L9SA 4ZPXA 2SHKA 5LD2B 2YVUA 3L8ZA 4M0LA 1E6CA 1GRNA 2AD5A 1XMSA 2P6UA 2QE7D 2V3CC 1SVSA 1HQCA 4IDNA 4KXFB 1K5DA 4QNRA 3VR4A 2WAYA 1BYIA 1GDDA 4A4DA 3QVUA 4NYIR 1OFIA 2DWOA 2D2FA 1OJLA 3QVVA 2GCOA 2OBNA 4XSGA 1RYHA 1CIPA 4QRHA 1A2BA 1KSFX 5DI3A 1SGWA 1T3HA 2R8RA 1G7SA 2NO0A 1ZD1A 3MFYA 3EIQA 3P26A 3EC1A 4C0SA 4EDHA 2V8OA 3CM0A 3TR5A 1MO3A 4JKIA 1E1RD 5EZ6B 1OFUX 3UPUA 4TLDA 3TIFA 3ICQB 3AVOA 1VG9B 1ESNA 1U2RA 1HURA 1N0UA 4CGZA 2V6JA 4D2IA 3FHTA 4OI1A 3QSYA 2QI9C 2WM9B 4EQ6B 1P3JA 2Z6VA 3LLMA 3CLVA 3JVUA 4Q4HA 3O8DA 5TARA 4M4SA 3OHMA 5L8VA 4A36A 1ZD9A 1KAGA 3SYLA 3WRYC 3AEZA 2PJRA 4ZDWA 4D82A 3WP1B 3HJNA 1SVOA 2R9VA 1NVVR 1W48A 4PPFA 5JEEA 5D3MA 2FWRA 3BWDD 4ZKDA 5P21A 1MRNA 4A0RA 4BECA 5FI1B 2NGRA 3FHOA 5C46F 4GL2A 2EFHB 3WYFA 1D8TA 3I72A 4TSFD 4URWR 1E2EA 3K0SA 2NO9A 3H84A 4JLNA 5EE1A 3THYA 5H1YA 3WHLA 1S9DA 3SHFA 1F5NA 2D2EA 3PUXA 2OILA 3DL0A 2V7QA 2C03A 2R62A 2VSFA 2ZRHA 3LD9A 2AWNA 3WMGA 4JLAA 4URYR 2PCJA 4JYBA 2VHJA 4TQAA 3Q85A 1IN8A 1QHIA 4ITRC 5KDDA 3IBGA 5FTLA 2GZDA 3CRQA 4AKIA 1XNJA 1P9NA 4JYCA 2IUUA 1PUIA 1JEEA 2P5TB 4EFNA 1TU4A 5CIWA 2R6AA 3PENA 5AJYA 4C0JA 2EYUA 3KQKA 4AURA 4M9ZA 3I61A 3BB3A 3W8NA 2NO6A 2D7DA 4LBYA 4PQRA 4RZXA 1P9WA 5HR5A 5GADl 1KZGB 3BE4A 4US1R 4R98A 1S2MA 2EYQA 2JJ2A 4I1SA 4PHTA 1QHSA 2ZRPA 3LBNA 2ORIA 5CM9C 1G8HA 1SKYE 3LXRA 4AWXA 1GNQA 1XPOA 1U0HC 2ZJYA 5CIQA 2FFBA 3K0AB 4HUQA 2C8VA 3C5CA 4EUNA 5AUNB 1ZM9A 2GILA 1KDRA 3KKPA 1KI4A 1KTVA 4Q03A 1OE0A 2QEQA 3I5YA 4RZ3A 3U6KA 4Q01A 3Q7PA 5JI2E 3B60A 5A4JA 3AVPA 3IPYA 3V4RA 3U7EB 4PO1A 1J8MF 1XMIA 2P6NA 3QPVA 3K9NA 1J2JA 2AN9A 1CULC 4KODA 3T61A 1XMJA 2FDCA 1G7RA 1AS2A 1W2HA 4H1UA 4PO8A 2QM8A 4U02A 3RRMA 2HLDA 4TMXA 2GETA 3GLHB 3U3KA 4II7A 2FN4A 3EPKA 4IDPA 4NYIQ 2QBYB 2XGJA 1U8YA 3C5HA 1H8EA 3GJ4A 1TQ6A 4TYQA 3C4JA 2WKPA 1OXSC 1W36D 2ZSDA 2HEIA 1JNYA 1IOZA 1GWNA 2ZYVX 4P4SB 3VFDA 4A8JA 1O87A 1Z5ZA 5JSZB 2GZHA 1RRGA 5FPYA 4Q4AA 1NN3A 2J1LA 1KAOA 3LQRA 2GCOB 1M6NA 2WJVA 3EZ9A 3MWYW 3DOFA 3I92A 4DBLC 2QAGA 4N0DA 2W83A 2PZEA 2NO7A 1RZ3A 3A8TA 4IXMA 4NP6A 5J4KA 3RLFA 3CB4A 3KDSE 3RYTC 3CH4B 3KQNA 3Q3JB 2J5XA 1BKDR 2QZ4A 4G5QA 4W5WA 2QTVB 4IDQA 3ZD7A 2ZRIA 4FD2A 4AKEA 2WPDD 2RAPA 2AD1A 4RZUA 1KI8A 5LPNA 4D4LA 3LRPA 5HCIA 1VPLA 4MRPA 3UMSA 2JLXA 3W5JA 1A4RA 1OSNA 5KSYA 2QE7A 1G17A 2ZS7A 4C0HA 2HT6A 1EGAA 4JLJA 1Q22A 4MKHA 3ZD6A 4BASA 3AVVA 1MABB 5HCNA 3GLIE 1E3MA 5B57C 1T8TA 4S2EA 4RCZA 1DARA 2HF9A 4G5RA 1T5IA 1TUIA 3NXSA 1XEWX 5DN6A 3PUVA 4IKEA 3W6PA 3TE6A 2GF0A 4ZI3A 4EPVA 2XOKA 3T5GA 4XWOA 4LJ9A 1WMSA 2W2XA 3I8SA 1Z6YA 4LJ4A 2LWIA 3GLGB 4Q4AB 3H4MA 3CRW1 1W5SA 2O8DB 4HAVA 3U3OA 3GLIA 2QGNA 4A8JB 1N6RA 1S8FA 1QDEA 3KUCA 1D9XA 1Z6XA 5TV2A 3AF3A 1AS0A 4ZO4A 3V9PA 4F7WA 2CL7X 3JVVA 3NVAA 4KI0A 2O8CB 1OB2A 2PT7A 1ZAKA 3LV8A 5E3HA 2GJAA 3NBYC 3PQCA 4GOXA 1R5OA 4NPHA 3A37A 5SZKB 3AP1A 1SVIA 4DCVA 3GEIA 4FINA 4PXAA 4PO9A 4TL6A 3IO3A 3U61B 4UNPA 2EFDB 1EESA 4F91B 2D3WA 1OYYA 1VCOA 3GD7A 5FBQB 3K70D 5KSPA 1CR4A 1FX0B 3FTQA 1OF1A 4PC1A 5C4GB 1QF9A 3EG5A 1KO1A 3UKDA 1ZM3A 1DAFA 4CRWB 3CF6R 3AKEA 5M04A 2A5FA 2ANCA 5FOWA 4OYHA 1EXMA 4Q9HA 4R9UC 3SFZA 1P61B 1XZPA 4YXWA 2QAJA 4HUQB 1CF4A 3B1ZA 1X86B 1G5RA 3TMKA 2ZEJA 1HV8A 1DE0A 1KI6B 4U7DA 1DAHA 2G88A 1SXJE 4WZ6A 4LJAA 4ZDJA 1CEEA 1AGPA 3MRSA 3GFPA 4QJ5A 1Z8FA 2QENA 3CWZA 3GJ0A 3QXSA 2LKCA 3DZDA 1AS3A 1Z0DA 2QBYA 2W6IA 1U99A 1I2MA 1KZ7B 2CHVA 4U5XA 3ZVMA 1ZNWA 3ONWA 5L3VA 2HYDA 1UJ2A 1KKMA 3FVQA 4OQMA 4LPKA 2B8WA 5EXTA 4YMTA 2NPIA 1PLLA 1G3QA 1UFQA 1VHTA 4FIDA 1G8YA 1KK3A 4W7SA 4I1OA 4X8MA 1YZLA 2DFNA 4JVLA 5JRZA 1S96A 2ZU0C 5C2JB 1Q1BA 1SVLA 4P32A 3BFXA 3TVTA 2JLWA 2ZYWX 1AQUA 2A5YB 4FXPA 3H1TA 2QG6A 4D6PA 2ONKA 1XU4A 2XSZD 3RANA 3T35A 5HKKA 5K8TA 1OH7A 3QBVA 3KZ1E 1IHUA 1P9RA 3BS4A 4KFRA 3TRFA 3TUZC 2P6RA 1UAAA 3OEED 2AKAB 1TMKA 1YHNA 4E09A 1YRBA 1MT0A 4B32A 5G40A 4HATA 2RGEA 1U90A 4HAUA 1SVMA 2UVQA 3IEUA 1K5GA 2NOAA 5TB5A 5BWMA 5EQTA 1KK1A 1N6IA 4D26A 1GL9B 2F7SA 3TAUA 1GKIA 1TU3A 2AX4A 1IN6A 3OIUA 3SR0A 1EX7A 2GJSA 3T1OA 1H8ED 1E4YA 4V03A 2G0TA 2C98A 2QGZA 1GSIA 3BBPA 3NDPA 5J4LA 2WWWA 2HT1A 1U94A 1GITA 1G41A 1T0JB 3KFVA 2Z5FA 4IRUB 3K8YA 3SFVA 3AUYA 4XH9B 5BYKA 1XXHE 1FX0A 5IF9A 3NBXX 4BFVA 4CEIA 3QENA 3HU1A 5H8WA 3NDBB 2GA8A 3GLFB 2H8KA 2GJ8A 4BE7B 1GVNB 4DSNA 3W5IA 2Q21A 3EZFA 4C0BA 3GJ3A 4GP7A 4Q9KA 4OJKA 2QM7A 3TQFA 4A15A 3OF5A 4AKGA 2GNOA 2ZAOA 1UADA 1VIYA 2IEYA 3GEHA 4NH0A 5FPHA 4A8JC 3U4QA 1P2SA 3BB4A 2F1RA 4KYIB 3QBTA 3NHAA 2OESA 4JSYA 2QPTA 2C9YA 2W00A 4F4CA 3SJCA 4FI3C 3D3QA 3R20A 1EWQA 2PJZA 4V0KA 2FEOA 2FV8A 2F43A 1YR9A 1NSFA 3SN6A 4DB2A 1OXTA 2IYZA 1E9FA 1NIJA 5DH9A 1OHHD 3EZ2A 4BLRA 4EIWA 3GLGA 1Z3IX 3QE0A 4PZZA 2ZRBA 3BXZA 3OZXA 5JEDA 4HSEA 2CL6X 1G291 3CPJB 1AZTA 4K81B 4CVNA 2FZ4A 3SJZA 4QM6A 2N1BA 2P0EA 1AK2A 4BFWA 3K9GA 4EPXA 4WVFA 4Q4HB 5CJ2A 3PITA 5JHGB 1KMHA 5KO2A 3P27A 3WNCA 4MUAA 4LBZA 2HF8A 2ZUCA 5LB4A 1WDTA 3RRYA 3EZ6A 4PPQA 2OLJA 2V9PA 4URXR 1AKYA 1U9IA 4LJ7A 2ASEA 2JJ1A 4CT4B 4D0GA 3IBYA 3EC2A 3TSZA 2ZSAA 3K0EA 1OFHA 1Q1ZA 1T5LA 1XEXB 5L3RA 3TW4A 1G8GA 2ZXUA 4LGMA 2VHCA 1R0XA 5FL7A 3W3ZB 4V0ME 4YMUA 4BLOA 1UEIA 3GLFA 4MKGA 2L0XA 3HYTA 2WKQA 1GNRA 3OAAD 3GFOA 4Q4JA 3QG1A 5E7MA 4YDHB 1EFRD 3KJGA 1IY0A 1XXHB 3PUYA 3CH5A 2OBMA 4A6XA 5CLLA 3C7KA 2PT5A 2ODEA 1X3SA 4YONB 4KCGA 1XB2A 1VCIA 4S35A 5EE3A 4GT1A 4MUBA 3WBKA 1XTQA 2WWHA 2IK8A 1VDZA 5JFGA 1ZRHA 2W58A 2YKGA 1QHXA 2OE2A 3ASZA 2ZSFA 3DMDA 1HT1E 3PCRB 3U3MA 3ZS9A 3WYGA 1YZGA 3NBFA 2OLKA 4IFEA 1RJ9B 4IVQA 2EU8A 2WV9A 4QL3A 2JAQA 4LCBA 1WP9A 3GLHA 3NBZC 2YNMA 3O8RA 4MKFA 1CJUC 1J90A 4DLXA 1NP6A 2W2VA 5GJCA 2QA5A 4EFLA 3AF1A 4URUR 3CZPA 4EKDA 1SXJC 4KLNA 1A7JA 1DVRA 4QBHA 1IQPA 4KV9A 3OIWA 1IN7A 3GMTA 4CDGA 2JLUA 3QXHA 1KJWA 2FJUA 2GBLA 1VHLA 4F92B 4TLAA 1BIFA 621PA 1FP7A 1XBTA 1C1YA 1U8AA 3MMPA 2ANBA 5AR1A 2RGAA 1E98A 5JS7A 1H65A 1E96A 3GJ6A 3LAWA 3DM5A 2NQ2C 1JR3D 1UDWA 2ZPTX 4LPSA 1NBME 2WPDA 4MGKR 2WSSA 1DAEA 4JBYA 2EFGA 3MG9A 3B1VA 1Z06A 4G5SA 4AG5A 4JJZA 5AUPB 3HWSA 5KNBA 1HE1C 4Q4JB 2GJKA 3T34A 2PH1A 3D6TB 4US0R 3R9XA 2WOJA 3NTUA 2QMOA 4RD6A 4UNSA 1OFTA 5DIFA 5DYIA 2KSQA 5F98A 5EXPA 4BWYA 1VYUA 2RCNA 2JJ8A 3FPAA 4BEJA 5IRCD 2EFEB 1XD2B 2QP4A 5IK2A 3O47A 2NPFA 2GVZC 1WA5A 3UG6A 3KX2A 3BFVA 1G3RA 2WWXA 1WQ1R 5FFMA 2GEVA 1KI3A 2PZGA 4UXJA 4BLTA 2WJHA 3TSWA 1OKKA 1KY3A 4HAWA 3AVQA 1E2IA 3B9PA 2XTZA 4OI0A 4X8OA 1KO4A 4PAQA 2KBFA 3QNUA 2FSGA 1RRFA 1NF3A 2JEOA 4QNMA 2Q9BA 2WSMA 4GI7A 3RS2A 4Q19A 2QMEA 3RWMB 3NIBA 3DMNA 4PHFA 3KFXA 5TDHA 1R7RA 3H0KA 3E1SA 1N5KA 1T6NA 3RAPR 2QT0A 4DEXA 3EX7C 4OHYA 1CLUA 2GAAA 2YWEA 1NIPA 5JJIA 2P5SA 2PL3A 1Z22A 2VL7A 3WXMA 4X8HA 2OBLA 3KXLA 1QHGA 5K8UA 1XMVA 5DN6D 2QRZA 2R6DA 4OQNA 2MMCA 4I81A 1YKSA 3CPHA 1E9RA 4JLKA 4UNRA 3TLXA 1P6XA 2XJ9A 1NLFA 2O0HA 1COWD 2VF8A 3L0PA 3BD9A 3L0IB 3QXJA 1ZNXA 2BDTA 2C04A 3VHLB 2NIPA 1T9HA 3X1ZA 1N5LA 4EAQA 4TTPA 4HLDA 2R6CA 1FMJA 2W0MA 2IXFA 4TYPA 1OIXA 5BQ5A 1NLYA 3X1YA 3U2QA 3SYKA 4I4LA 5FUVA 3TK1A 2CL0X 1MABA 5C18A 2GESA 3HU2A 3QF7A 1RRCA 4IHQA 1KJYA 4FMDF 1RPZA 2BMJA 2FSHA 6Q21A 3VR6A 4WOPA 5FPKA 1JJ7A 1FTNA 1M8PA 4JBXA 3LX5A 5EP2A 4YMSA 2ZU6A 4GDFA 1ZCBA 4WA7A 4M9QA 2CHGA 3R9IA 4JT2A 2C9OA 1OXUA 2BJVA 3I32A 1Q3HA 3MWLA 4PPGA 3TQCA 4TYYA 4OK3A 4L16A 4QGFA 3IIJA 2E87A 1M7GA 2JLZA 3HR8A 5FBRB 2QY9A 1CTQA 4QJ4A 2YWGA 4M2LA 1NJGA 3MJHA 5GJVC 5FOXA 2OFWA 3HP1A 3UWOA 2J7PD 1ZBDA 2V6IA 5FUXA 4MKIA 5E4FA 1PJRA 4DVGA 4KSBA 2H16A 4CZ2A 3CWQA 1ETUA 3THXB 1X8JA 3SBEA 1BMFD 1N6NA 4JMPA 3W3AA 3RC8A 1PLKA 1CP2A 2OG2A 3EWSA 3M4YA 2QT1A 3DHWC 2KB0A 1WF3A 2GK7A 3IO5A 4XTRA 1N6HA 4BZPA 2NMVA 3T1TA 5G53C 3PJRA 1VIAA 1UM8A 1EG7A 3ZLJA 1S9HA 2JASA 2MSCB 3QI2A 1ZC3A 1Z0AA 3R8FA 2EW1A 3ND8A 1E9SA 5GJWC 2ZRCA 5A5GA 2ECKA 4WIAA 3BB1A 3IGFA 4U00A 1P4SA 3T1VA 2H5EA 2YWHA 4DT1A 2ZE5A 2IXGA 4FCVA 3AKYA 2JCSA 1LW7A 4EFMA 1F48A 4PPNA 3ADDA 1RJ9A 5BW8A 2H1LA 4NL4H 5F9FA 3LA6A 4O0MA 4OHZA 3MUFA 2VP2A 1H8HD 1W0KA 1YE8A 4HEJA 3CW2A 4QGAA 1JPNA 4GNKA 3NEYA 4GMDA 1FOEB 3CX6A 3SBDA 2J46A 2VSXA 1R2QA 4C2UA 4L4UA 3DKPA 1G6OA 3C8UA 2BJWA 3QKSA 4OJQA 2ZUBA 1N0VC 2CJWA 5CB8A 3MD0A 4YQFA 1Z08A 3P1JA 1J99A 1NLZA 1MO4A 4Q7KA 5HE8A 1JJVA 3I3SR 3H2YA 4Q18A 5EE0A 4TMKA 4LSGA 1EFCA 4JT4A 5FR2A 1NVXQ 3PEWA 1GL7A 3KQLA 1CJVC 2Y8EA 2YJTD 3GFTA 4E03A 4E22A 1ZUHA 4FMBB 4US2R 1DO0A 3RS3A 4O2RA 3RS4A 3D31A 2IYRA 4CT5A 3WYAA 1ZJ6A 1ZD8A 3EAQA 2ZRKA 5BXQC 1OH6A 1AZSC 2ZIAA 4MYHA 1EFTA 2I4IA 2XZOA 3VNUA 1W49A 1NL3A 2RGXA 2ZR9A 4KFSA 2D4HA 4MYCA 1KO5A 3BERA 5L3SA 2GWHA 4IDHA 3EPLA 2VH5R 3ZVRA 3FMPB 3ZIAD 3PV0A 5HZHA 4P4TA 2F3RA 2ZVQX 3KKOA 4XSHA 2F3TA 5DNYB 1G5TA 3WRXC 5IK2D 3LVRE 3THYB 1XJQA 2PZFA 1IJEA 3HYRA 1HTWA 1YJ5A 4B2PA 4HLUA 1K6MA 5D3QA 1FFHA 2J59A 4QHSA 1Q12A 1PLJA 4MGZR 4BQSA 5HZKA 5ANRB 2HCJB 2WWFA 2XB4A 2VHTA 2ZRDA 1BO6A 4IW3B 4LUCA 2FFAA 4QC2A 2FG5A 3PUZA 3CR7A 1MOZA 8OHMA 2Q3FA 3GJ7A 4KAXA 3VKHA 2ZI4A 1Y3AA 1Z07A 4B3FX 1E79A 4OI2A 4M22A 2GEDA 1QHHB 3PEYA 3KTAA 4NU0A 2A5GA 3QQ5A 5JWHA 4LK2A 3VX4A 1PZNA 5B30A 4JS0A 3VKGA 2GBLC 3G0HA 3ECCA 4NCNA 3A6PC 5KNCA 4AYXA 2B92A 2YC2C 4TYNA 4WXRA 1KY2A 1I2DA 3KUDA 1G1MA 3RWOA 3CX7A 5L3SB 2PX3A 3Q7QA 5AUOB 4D4JA 3A1SA 2IUSA 1R5NA 1E9AA 2O8EB 4KVGA 3REGA 3RRZA 4ZDKA 5EXXA 4Z1MD 1KO7A 2WTUA 5LD2C 1XCGB 1P73A 2HJVA 3VAAA 2X2EA 2GTPA 4G5OA 1LVGA 5FPTA 4K8OA 2CLSA 4TLCA 3J81k 1W36B 3ICEA 3SJBA 3TKLA 1TQ4A 4XWAA 1Z29A 2CVHA 2QSZA 1E9CA 4RD4A 1E9DA 3IKJA 3FDIA 4MGYR 3A1VA 4BZXA 3KL4A 4JBWA
chains in the Genus database with same CATH superfamily
4AUKA 3HKCB 2OGSA 2P1DA 2H2FA 1NRWA 1VMIA 1U8EA 2XOXA 3EGEA 3I6IA 4F4HA 4X7RA 4G81A 1MORA 1T34A 1N2XA 4F5YA 1HDOA 3BXOA 1E2BA 5CGQB 3SICE 4Q3KA 4C0KA 4IVPA 2N3ZA 2VJNA 1RAHA 1Y3DE 1TO6A 2VYND 2C8JA 2I1LA 4MWZA 4RHUA 4RJIA 4L9RA 1T8SA 1GUYA 4ND6A 1O57A 2C88A 2K2WA 4L0CA 3UANA 4IBOA 3H5VA 1PTKA 5K51A 4G63A 4RLSA 2ZJBA 1ZK3A 1CNMA 2EZ9A 4D4MA 4BP1A 1V11A 4MQ4A 1OILA 4ZZ1A 5DKFA 2X6QA 4MQUA 2AFIE 1QRAA 1SU4A 3UCFA 5IJZA 1U0TA 3USZA 2WE7A 3RBXA 3GJSA 2NLOA 1XSEA 3AESA 2AXQA 1KOFA 2FN3A 3VPXA 5BSFA 2XNSA 3NNDA 4KU4A 2NV0A 5AICA 1VI6A 3BM5A 3ONFA 3QSGA 1R8SA 2JI7A 3IIIA 1F60A 3FHLA 3KV3O 1USKA 2XOKD 5FV7A 5FWYB 2JD2A 4QATA 2HRBA 2W70A 4DZTA 4RKEA 1C7JA 4M9XA 1NBMA 2HV9A 1XTZA 2Z08A 3DPIA 4W9NC 3KAQA 4QTXA 1GCIA 1DI0A 4KG7A 3GLVA 5TQJA 4E7PA 2YV3A 3HWX1 3ACBA 1C50A 4OUDA 1BQ4A 4UNQA 3OZTA 5CG2A 1AJEA 4ZEWA 2J9RA 5FR1A 1S4QA 4FNOA 3ON5A 2WM3A 2P5YA 5KVAA 1YZFA 3ZE6A 1C8KA 3HLKA 1RYMA 3JZDA 3RG8A 3WC4A 1G4AE 1VIMA 3QVKA 5JDIA 5D5PA 3ZWVA 4KQWA 2WJYA 3EW9A 2DXIA 4MPJA 2FSVC 2Y6VA 2HLPA 1U2GA 1K66A 1ISGA 2JDIA 3EBOA 4HB4A 4AS1A 1FUEA 1NJ5A 1OAOA 2G77B 2NT3A 2PBZA 3LCJA 4BKUA 2C0PA 3DYVA 4QOSA 4XEHA 3H05A 2GPNA 1YVPA 1Q44A 4FE4A 2I4NA 1LU9A 3THSA 4DMHA 2HLNA 3AV3A 3H7AA 1FYVA 2IZ5A 4M46A 1W44A 1XE3A 2OCBA 5DWVA 1LS1A 1VJTA 1HZJA 2ZI5A 5EP4A 5EIBC 1YMQA 2YQ4A 4KH1A 4FZ5A 1W73A 1NVFA 1OKKD 2X13A 3UGJA 4KJZA 1FCJA 1FMLA 3ZQKA 1YJXA 2OFXA 5DVZA 1IDN1 2J9XB 3DR5A 1UWKA 1TUGA 3I9FA 3OCYA 1T36B 2KBEA 4MVWA 3NWOA 1M6YA 4WUTA 3QXGA 1J7JA 2IYSA 3GDHA 4HFRA 4ZAXA 4GZLA 4TL9A 1Z47A 1NX6A 3IDFA 1VG0B 4URZR 2IYYA 2OV2A 1G55A 3HEBA 1ADBA 5IUJC 5JHHB 2G36A 4Z4IA 5T7BA 3EY9A 3FKSA 2WTAA 3DVLA 4UPDA 1U9IC 2F8SA 1FU8A 4Q1FA 3VYUB 1U98A 2NYRA 2QJWA 4OJNA 2DLCX 2UV8A 1WZ2A 5TIIA 2R7MA 3DW1X 4O2LA 4LMRA 5AVKA 2ZUEA 1TM7E 1X0VA 2UDPA 3QXXA 1E2QA 4M1SA 1SULA 4AJHA 3AY7A 1FNSA 3UYKA 4Y6QA 4BRWA 3Q5EA 3LYHA 2B21A 3LQ1A 2X3FA 2WZQA 1XAHA 1DTWA 1NDHA 1PGOA 1ZC4A 3SQDA 3UC9A 1YCHA 2IF0A 2ZZKA 5ADVA 3FWKA 3VC1A 1GGEA 1UK9A 3FRJA 3HVKA 3NWBA 4KQ6A 4L3WA 4B73A 1EK6A 1UIMA 2JAOA 3NJ8A 4E0BA 1Z63A 1FBTA 1IE3A 2HK7A 1JQJC 1LH0A 1M7HA 2BFEA 1RMTA 2CZGA 1D7OA 3BKXA 3E8MA 1KK2A 1CP3A 2XUZA 2XNDA 4DTCA 1KJ9A 1GHTA 1WD5A 1B0UA 1KAHA 5FL3A 4UDXX 2IS2A 3WL8A 2LP4Y 5AKGA 3RSHA 1STOA 2QUBA 1VL6A 4B33A 1MMFB 4BBPA 1YS6A 1NPTO 2GVDC 1TQDA 3GRKA 4A0QA 4B76A 3U4AA 4JYPA 4QQFA 3WTCA 3KYCB 5JROA 3BORA 5SYAA 2ZUVA 4PTYA 1A1SA 3STHA 4YAUA 3I23A 1WMFA 2UZ1A 4TL8A 4OF4A 4TMWA 4Z0PA 5K3AA 4XQ9A 4TMFA 3AI3A 5DHQA 3RVBA 4RJTA 4GMKA 3FUVA 3FGNA 2IT1A 4MQMA 5F9HA 5IM4A 5D3KA 3B89A 3VI3B 2X14A 1KVSA 2AG6A 3HJAA 2DQYA 3K15A 4M83A 1GNSA 1XWIA 1A9ZA 1GU1A 1YQEA 2P40A 4JJKA 4MQ6A 2DTEA 3MRVA 4N18A 4ZD6A 1K5HA 2C97A 4P3XA 2PE5A 2H17A 2PGDA 2VK2A 3PI7A 5DMXA 2P2YA 3L0OA 1IXYA 1FFEA 1BU8A 1YQ9A 3VSBA 2ZYUX 4BB6A 2HRQA 4NFHA 4BQRA 1MLDA 2P8SA 3R3JA 1VC2A 5KMGB 4KXQA 1ZIXA 3AO0B 4Q7MB 4TM8A 4CIYA 4YRQA 3EF1A 4KQEA 4GI2A 3AB7A 2XCLA 1YOBA 4FCTA 2HU5A 3CUKA 4RPHA 4BE4A 4BFUA 4PIVA 4FFLA 2IODA 1DBSA 2Q0HA 4QDZA 4MUIA 4M0FA 4L5AA 2W8BB 3ELBA 3W3AH 4JYMA 4M86A 4TVBA 1V8OA 1PJBA 2C78A 2RB5A 3GJ8A 3GZNA 5DCWA 3FCEA 1D09A 1USUA 4KGZA 3M0EA 4NBSA 3VSEA 4UU7A 3H1AA 4A73A 1OYWA 3F1LA 4PE5B 3ILSA 5T57A 3FIUA 4G23A 3HGTA 4GOJA 1DEHA 4I5EA 2NXJA 4P34A 1Z0FA 1CETA 2RHCA 1EWRA 3FOWA 3P2YA 4JQSA 4MA4A 1LDNA 1XRJA 1I33A 2JFBA 3G89A 4PZLA 4U7FA 2Q5CA 5JJ5A 4YCAA 4KXVA 1QDLB 3BMQB 3NFYA 4P4NA 4X1IB 5DFAA 5BV7A 2YXPX 4H6WA 4CKZA 5IAEA 3OIVA 3DAYA 1Y37A 1BDMA 1DT5A 2R3SA 5EKSA 4G25A 4JR1A 5EE9A 1YK0A 4QUHA 5C4MA 1OLSB 1CQPA 2HMYB 2QG9A 2V5UA 2XGGA 3BKWA 4KQGA 4PO3X 1D04A 4ZQIA 2PUGA 2CC2A 1DEXA 3UAGA 5LQAA 3TOCA 3A0RB 4NOJA 4AD8A 3MTDA 3KZKA 5DYGA 4HS4A 4MR9A 2OAP1 5DLYA 1YAJA 1EFDN 2P2NA 3AUTA 3IOYA 1EHCA 4GDMA 4PSDA 2FX5A 5BYJA 4C21A 3B53X 3CMCO 4TX1A 3QW2A 1K3TA 2ZR7A 4HQFA 4YCCA 1KI9A 2J6BA 4MOWA 4RQBA 4WJLA 2VF4X 1QRSA 2ZI9A 2KE5A 1SHLA 4MEJA 4K26A 4DRZA 3CLKA 5DM4A 3ORFA 4JC4A 2G1KA 4QRIA 1NZFA 4ZZ3A 5HW0A 1X1SA 3OM9A 3KVRA 1UZAA 5KQLA 2O8FA 4G0NA 4WADA 4IX1A 2VDNB 5KQSA 3NUZA 2P11A 4RTJA 2VQSA 2PEZA 5LLDA 4NCKA 1JMKC 2N0SA 5DTIA 4HPXB 3WYBA 1MIHA 3IVCA 3T5DA 5JRDS 2NXWA 3LG2A 1J2RA 1YUMA 1W0JA 1UBUS 3AZOA 1NI3A 5DM2A 4Q9DA 5CVUA 2DETA 2ERXA 3NOXA 3SQXA 3B9RA 4CV1A 3EWIA 3ROFA 2BE7A 3OURA 3WJ2A 1W46A 1YBHA 3INGA 1DV2A 2Q3DA 2KS6A 4FDTA 4DG8A 1Z0KA 2DX7A 4MRAA 2O8BB 2O8BA 2CHUA 1D8AA 2DBVO 2JIQA 1U6KA 2FWIA 3VU9B 5HWSA 5DULA 2F8TA 3BIXA 1UFKA 1ZN8A 2G6TA 4RFSA 4Q12A 4Y30A 4LC1A 5JECA 1S5PA 1R0BA 5KC9A 3IULA 3GMSA 3P0IA 4P8RA 5DSZA 3LT0A 3BMOA 1BDHA 1V5WA 2ASVA 2PZAA 3B2NA 4C4OA 3U1BA 2R44A 3E8XA 3ILHA 4K0RA 3WLAA 1E6UA 1MOQA 4QSMA 1N2CB 1YJ8A 5H4GA 4UKDA 3ADCA 3B78A 1K97A 1OTHA 4ZI5A 1EHIA 1DO8A 1JQBA 2QE6A 2P2ZA 1EQUA 3CF2A 3AW9A 3CJTA 2A84A 4Z8YA 2HMWA 4G07A 4BFTA 2J3KA 4K8RB 5JCOC 1CY8A 4B3BA 5M3BA 1E4EA 5IAJA 5JO0A 1CEXA 2PSFA 3CNLA 4YCBA 3NCTA 3TLAA 3MJVA 1P75A 3B13B 1QH9A 2WA2A 4JC0A 1ZGHA 3OIFA 3NBUA 2PWYA 2YZMA 1ZH2A 1FS4A 3GO4A 4P4UA 1EUCB 1CZHA 3NHPA 4D81A 2BFFB 4YBRA 4DPLA 1T5TA 4Z54A 2Q0QA 2X9QA 2HA5A 5JYEA 3CXRA 3PNBA 1T4DA 1BEZA 1LZKA 4BO5A 4QVIA 4C5AA 1KAEA 3F5FA 2WY2D 5LBUA 1QCZA 2MSEB 2ZITA 2FW7A 3L7NA 4CCAA 1JVNA 4OMDA 1QRUA 1G8SA 1JSLA 2OCAA 4HWRA 4XARA 2GLXA 1LF0A 1UAYA 3D8UA 5JMPA 1K89A 2OL4A 1EBUA 1JPVA 5BV8A 3R0XA 1TYBE 3I2JA 4GYKA 3SCZA 4GZ6A 3U3DA 2R65A 4LYJA 3U17A 1XUOA 3CKMA 1NVWQ 1PR9A 2B8TA 3OD5A 1RZRD 4XVUA 5ERGB 4JZYA 4B87A 1Y5MA 2ZJ2A 2AOVA 2ZANA 3WYEA 2ZRNA 6AT1A 1LS6A 1TNDA 3IAS6 3OCXA 3ZZMA 1NU8A 3WDSA 5CB4B 1V25A 3TL3A 1JYSA 1ONOA 1Q74A 3I2FA 4COKA 3QKTA 3R5KA 1WXHA 1BD4A 1F3OA 3A06A 5JD3A 3E3NA 8MHTA 4CMIA 1X8LA 5KPDA 4HRAA 1C7FA 3BK7A 3SNHA 3DMTA 3AFOA 1E66A 1Y1SA 5EXSA 3DKIA 5D2CA 5IANA 3DUFA 4CF4A 4TMZA 1GAEO 4R8RA 3AP2A 1E5XA 4BO2A 1EJBA 2Q50A 3MGKA 4NDAA 3A4LA 5BWLA 4UZEA 5AM5A 3R3YA 1PZXA 3B82A 2IS1A 3Q3GE 1XU9A 1I6LA 4LI0A 1YL6A 4GVPA 4FGZA 2GEUA 5EI5A 3A31A 2JLAA 4B74A 4GGMX 3ZC3A 5KVVA 2ZTSA 2JPDA 2XTAA 4JL5A 2ZJ5A 2MSWA 3SY8A 1JA9A 2HFJA 2QQ5A 3JZIA 3QWFA 1IJFA 4UJ3A 3N2GA 2WSYB 1FTSA 3P71T 1CC1S 4PFSA 4PSKA 3OCZA 4ZALA 3TB6A 2WYWA 1E0KA 1SY7A 4TTQA 3R7DA 1FUUA 2ORWA 1BXKA 4E5MA 4ETNA 4EYGA 3VR3D 1CUXA 2Z4RA 3IALA 1R8YA 1YUBA 4P7JA 5KDOA 2CUKA 3EMKA 1SKQA 2EBHX 3NTOA 3DM9B 3W5DA 5ES3A 1YO6A 4QGHA 1Z4QA 4QXPA 3ZI0A 4NATA 3DPUA 4J07A 2I76A 1IOVA 1PTJA 3QLVA 1NX9A 5JWRA 3SYNA 1JH8A 2YZ2A 4B3IA 2QHXA 3BTOA 3TDMA 3I62A 3GBPA 1QGED 3RT9A 3LO8A 2ON6A 5ALIA 1ICEA 1E20A 1NMEA 1OI4A 4RVGA 4UHBA 4XM1A 4AS3A 2VPXA 4A6EA 1CCWA 1YVDA 3FLAA 5KAMA 1UWVA 2EATA 2G0AA 3AYXB 3NHUA 4EG3A 5CFNA 3OJFA 3MQ2A 4R6XA 3S8EA 3GLFE 5DHUA 1G3MA 2AI1A 2BHTA 3PNMA 4G5FA 1U0JA 1W47A 4A3SA 4KKXB 3O3MB 3AM3A 2JIMA 2VTBB 4OP1A 4LRSB 2ZJFA 3O4IA 3KRTA 9GPBA 4B7AA 3LW8A 4IFBA 1W7AA 5CT9A 1VSTA 2B94A 1TMOA 2J09A 4B0PA 5DO9A 1U1IA 5FWXB 5JCPA 1C9EA 2FMTA 2H9AA 1E7MA 1NJFA 3LC7O 1ODLA 3TECE 1KVRA 2PLWA 5L40A 5GGXA 1A9XB 1I51A 2C4MA 1RKQA 2HO5A 1MRSA 4X7PA 5ELXA 2IEBA 4Q21A 2E7ZA 1Z0JA 4HDQB 3WL4A 1Z83A 4E7OA 2FEPA 4ARIA 3WK6A 5KUTA 2I62A 1IBLB 2PUEA 2WHXA 4GE0A 4NENA 4TT3D 4AZVA 4DCUA 4ZI7B 2FW1A 1FRQA 1KQPA 2QVXX 1R0YA 1YSCA 5EHGA 1R8QA 2H4XA 1BVHA 4PINA 1RVV1 4QREA 3K70B 5LDHA 4B4OA 1TIPA 4ZCLA 5FA8A 4P5DA 2GARA 4W7IA 4C04A 1CYEA 1JDVA 1K3UB 1DAOA 4DLNA 5EP3A 5IVHA 2YVAA 2CMHA 2FFQA 3P52A 4R9SA 5AW0A 3BQ9A 2XSZA 2VK4A 2XVYA 3KOMA 4KBGA 4D9NA 1N78A 5D7BA 5CBKA 1ZH8A 3IUQA 5EUCA 4F84A 3CNOA 3HCWA 3EPPA 2WAMA 3T3NA 4ZJPA 1AGRA 1K0FA 4GGPA 1U6IA 2BM0A 2QW1A 1H6DA 4QSHA 5FOUA 4OIFA 4N7RA 1TCVA 5L4SA 3CX4A 1T91A 2O2CA 5E7JA 3VR3A 4DLWA 3W6NA 1WKBA 3SDBA 4YROA 1CJCA 4XD7D 4LV6A 1QVAA 4MRMA 3QVSA 4JLVA 3B36A 1M2OB 3KO8A 5EPOA 2YHSA 2IV2X 5AVSA 3W8DA 2OC9A 4UBNA 3ZK9A 5BRAA 1Z35A 5AESA 3M3DA 3GCWA 3Q9SA 4MLCA 3X1XA 2VFAA 2VJKA 1GILA 2EHJA 3SZUA 4CM1A 1AH2A 2P4UA 1WMBA 1Z7GA 1J0XO 1Y98A 5KDLA 4DL9A 2XWJI 4JBLA 3C3EA 3S2EA 4V3BA 2YWFA 4R2JA 1PFYA 4EPWA 2B8NA 3HJRA 5MGNA 1MNQA 1QBGA 2QRNA 3RJZA 1H4QA 2W2OA 2FZVA 5KTTA 2P67A 4IDOA 4TS1A 4M1YA 1J70A 3AUFA 1H1TA 3MW8A 4LC0A 4G1VA 3T0GA 3VZSA 4CNQA 1W36C 3E53A 3ZU2A 4BN5A 5I4IA 1M6HA 1HDRA 4FKBA 2MSDB 1XQWA 1CJSA 3TOSA 4BGDA 4J0KA 3O91A 2IYWA 3DLIA 3A6EA 3UMGA 3ROEA 1ZS9A 3EASA 2GZ3A 3D6JA 1JF8A 2I99A 3F1KA 4RFVA 2BDEA 1WIWA 1CR1A 4X95A 4EHHA 3DL2A 3QU7A 4G8CA 4BFZA 1W1UA 4ROSA 2OHFA 4F56A 1QM5A 5HOQA 5ALDA 4ER0A 2XMZA 1L7MA 3LQQA 1KYWA 1WXQA 1ZM2A 2C1EA 4F38A 3OIGA 4RSHA 3MBKA 5CDUA 4IUDS 3RFFA 3WGMA 2PO7A 2WIBA 1XTRA 4QTTB 4AWAA 3OIYA 5KINB 3ROMA 3Q8KA 3QKWA 2IHKA 1TADA 1T5SA 4ZCQA 1M1XB 4LK3A 1X1TA 3L8CA 2IF2A 4NK5A 2Y0EA 4CV2A 4B3CA 4HPJB 1ACLA 2BGKA 4N7BA 5JFOA 2IC5A 2FXIA 5BSWA 1M1ZA 2VCYA 2ZJZA 3TIVA 3WZLA 5C1BA 2GBFA 2QUJA 1RYBA 3EDCA 1Y1QA 2ID4A 3WKEA 1P5JA 1WXFA 3M4ZA 2WFLA 5CDHA 1ODKA 4YP9A 2QIPA 2FZ5A 1F2TA 2ZKLA 3A4MA 3F5SA 1W5AA 2GYVA 2NZXA 4EL0A 4I99A 3SAJA 3EFOB 1YDGA 4XRRA 3H99A 1CJTC 1P5FA 2WHYA 3EE6A 3HPQA 1H85A 2QTAA 3TQTA 4HAXA 4QPDA 2ATVA 1BSVA 3BMQA 4RD3A 2RGDA 3K2QA 3B7GA 1MU0A 1U1DA 4G1UC 4E5KA 2OHOA 3REFA 3LC0A 3JZFA 2ZTMA 1Q7GA 3NHWA 1T4GA 2E5FA 3D2BA 2ZJ7A 1JV2B 3EIHA 3OFVA 1COZA 4J7XA 1TGYA 4NRDA 5SZHB 3K0FA 1Z5UA 1MDFA 4LNHA 2X9GA 1JB1A 1PFVA 4IWYA 1ECLA 4PG5A 1DKOA 2HW8A 4BC1A 1W76A 3DW3X 3QKRA 3G9UA 5K9ZA 1QTIA 7MHTA 5E9WA 2M32A 4DBLE 3ER8A 4H1HA 4C22A 5H68A 4NARA 4PPYA 2H65A 5KU1A 4YRZA 3WMEA 1D2NA 4XM2A 3TINA 1UOEA 4ESEA 4KB5A 5IJ9B 2I8LA 2R4UA 2ZYDA 2QQ0A 5G0VA 2B1JA 2YXNA 5KMGA 2WDZA 4WHMA 3ORQA 3IP7A 3O83A 3WICA 1K6JA 1NQ5A 1E3QA 3OE7D 4R05A 2CMDA 3BVPA 1ZFNA 1ODCA 3AW8A 1GNVA 1I2AA 1WKVA 3P2OA 3V42A 1TVKA 3WV4A 1Z7YA 2XEDA 3RQIA 3L0DA 4AMZA 4K2HA 5J47A 3B38A 3GRAA 4TRRA 3K1AB 2RGYA 2Q2WA 5K0FA 2GHIA 2W6JD 3BXXA 3MJEA 4LSMA 3OICA 3H7IA 4UE2A 3L84A 1HO3A 2NP7A 4ZQGA 4XWYA 5KTNA 5IT4A 4XE5A 1NW9B 3T7EA 2Q4RA 2ZJ6A 2BMVA 3QTBA 1YS1X 4KQKA 1ZOIA 4YR9A 2H08A 2AGVA 2PPVA 4GX0A 5GTDA 4YJ3A 1U0FA 5F2EA 3AJDA 3PXGA 4D9IA 2AUTA 4GPTA 3DWIA 3TZHA 3X1WA 4CUZA 5IS2A 1NMYA 3O1LA 2XBMA 4L5JA 2RMKA 3VR1A 4IIVA 1SCJA 3IOEA 1HT2E 4LXGA 4UM5A 4HHEA 3GFGA 1M6EX 1FFBA 1UPTA 4P38A 2CSXA 1OH5A 5DX0A 1TYZA 5BN5A 2IXBA 2X5XA 5KYXB 2E5WA 1VBNA 2HO4A 2KPOA 3MJCA 5DSTA 1OV6A 2YV4A 4Q3LA 5REQA 1L5KA 3HK2A 3SZOA 3ETDA 4A03A 4RY9A 4PNZA 1FY2A 1DTWB 3K0CA 3VNRA 4M9RA 3WYNA 1Y82A 1OJ7A 1P2GA 3C3MA 3EDOA 3EXHC 3LO5A 4OUKX 5JCOA 2BISA 3HDHA 3U49A 4MARA 4HFMA 4KBFA 1HLDA 1FYXA 1H3FA 5GIOE 2XMQA 3HJGA 3W7BA 3TIXB 4MGHA 3A6FA 2BM1A 1P72A 3D3EA 3FHCB 3I4LA 3OM1A 2JS7A 3LGSA 3MT9A 4D0RA 1P60A 2ZR8A 3UIEA 1DCFA 1XKTA 1TQ2A 2AI2A 4CODB 1YNSA 3A1WA 5ILQA 1QLWA 2WJGA 2NO5A 3FVVA 1XHEA 4IY1A 4OQQA 2NUPB 1QZXA 2B36A 1VPDA 3BDAA 1IG0A 3CW9A 2J0UB 3LCCA 4XGQA 3RF6A 1FYDA 3UXYA 1IVYA 4DIFA 1IMJA 3RI3A 4S05A 4GBGA 3J80A 1SKMA 5K6TA 4FX2A 4P31A 4AO8A 5EY5B 4CCSA 4DR1B 1FS5A 1A7KA 3JV7A 2ONYA 1QX3A 3R77A 4EQ6A 2V7QD 1RW4A 1L7OA 1EVEA 1WZNA 1P2VA 1E1YA 1TUEA 1ZISA 1UXKA 2A5JA 2CXRA 2F1KA 2E4UA 2X0RA 3KJHA 4UVHA 5H83A 3AT1A 4AZ3B 3DLTA 2DERA 3DAGA 4HWPA 1KL7A 1JU4A 1WXXA 2HBZA 1PJQA 4DR2B 2I87A 1RXWA 3GI1A 3IR7A 2Q6LA 5BUSA 1DXHA 1F4LA 4Q1EA 3KEMA 1R9NA 2H51A 2CLCX 3ROPA 4YMHA 8AT1A 3IAFA 2CLDX 1H0SA 1CUFA 1Z6AA 2A67A 4E94A 5FUQA 1A8IA 5MHTA 3BN3A 4TZ6A 1HYQA 4MP3A 5LSAA 3NGXA 4WZAE 3H1PA 4QGBA 5FPPA 2PUVA 2A3RA 4H16A 3DZKA 3M9XA 5A05A 4CG1A 4CIDA 4CM5A 1U3TA 4Z3KA 3VR2A 1G21B 1UODA 1GRQA 3CTPA 4RK1A 3CEMA 3RSGA 3ZUGA 4EY8A 1E3SA 4GM1A 2IEZA 4QIHA 1OU0A 1XRQA 4CEHA 3ZYCA 3KU4A 1JFRA 1OX4B 2PSDA 2AQ8A 3UAOA 3TGPA 3HJFA 2BV3A 4FYWA 4DHEA 4B79A 2R6HA 5F7OA 4YFYA 5K09A 3CR8A 4LIPD 3NKLA 3K9LA 3KPJA 3L0BA 4LRUA 1RACA 2GTIA 4POAA 2PK3A 3IESA 3VH4A 1GPKA 5EESA 1B8VA 2PGOA 4QU9A 1Q11A 1VI2A 1P29A 2K87A 4PCLA 3VZDA 5C8ZA 1P5ZB 2P1RA 3I09A 4OUDB 3R23A 1G3IA 4XKJA 5ALXA 4F3CA 2VRWA 3ENWA 3FRIA 1O94C 1ADJA 4LDZA 1MB3A 5ER9A 4Q3OA 2ZSBA 3DBRB 2BMAA 2AW5A 1Y3CE 9MHTA 2DJIA 1SELA 2Q3EA 3GV0A 1WU8A 4FYXA 2WUDA 3NANA 3QEMA 3W78A 1YQTA 2GF9A 1XTUA 1WSBA 3QELB 3EUAA 3RVMA 1XO1A 1VKRA 1PV2A 2HCBA 4LWOA 1XZHA 2Z57A 2DPYA 1GTVA 3PZRA 5HF9A 2F6RA 5C0OE 4BPBA 1JHDA 1SQSA 3W9YA 1E32A 2AXNA 3PFBA 1RXYA 5IEBA 5C9ZA 3B5EA 1XEWY 1D2MA 5DI3B 2Z0MA 4RMGA 4L8GA 2B34A 4TLBA 3E2MA 4FS3A 3PQ3A 3TJZA 4NIMA 2E1RA 3CQ9A 1SEVA 2ATXA 4NPCA 4B17A 4BJ5A 4PBTA 3DE5X 4A91A 3I83A 4ID3A 1G6HA 2X8AA 1AC5A 3F8SA 4DJEC 1AMOA 5CRIA 2HK8A 1PWZA 3SQOA 3S81A 1FTYA 2DH5A 1SR8A 1FW8A 1Q77A 1T3LA 1Z0SA 1WCXA 1YASA 2RH5A 3IT0A 4FMDB 4O5AA 3TRJA 2NAFA 4Q7EA 4XQCA 3SEFA 5KAPA 1XZQA 4A0FA 3IR6A 4HB0A 1Z2EA 3I2GA 1UKVY 3ESZA 3NPMA 4XYMA 4LOAA 1RBMA 2WM8A 5AH0A 5LQJA 3EBLA 4N3GA 5ITWA 3QPCA 3DOIA 3QMVA 3EVDA 1XZNA 4PC7A 1H6AA 4I5DA 5TVKA 4MWSA 4V0NA 3F3YA 4YMVA 2Z4TA 2J41A 2HADA 3AR2A 5JZVA 3LL7A 4MWTA 5E6RB 1ZZGA 4KNYA 1E1DA 5JS8A 4KP7A 1J8FA 1ISIA 2ZRFA 4MIEA 1T5BA 3C41J 3PXDA 2WOOA 2RSLA 5JBNA 5AK5A 3ZHQA 3KT6A 5EWMB 4S04A 4KPEC 4FJ1A 4KGDA 3FYDA 2QNRA 2AVDA 3MCWA 1OMOA 2P2LA 5AKYA 3OE7A 3URMA 4AXBA 2OTCA 4O8ZA 4MV0A 4NZMA 3ODGA 1WF6A 4OQ4A 4RQTA 4KSYA 3EQ8A 2OXCA 1ESCA 5FBWB 2V9CA 3N2KA 1O97C 4QPPA 3CNNA 5B53A 3QY0A 4UEKA 4XFDA 4B8YA 5CM8B 1XP5A 2NW6A 3ZLTA 1TUBA 1V4BA 2VI5A 4Q39A 1AKVA 1TL7C 1A2OA 3JY6A 1NVEA 4HH4A 3K73O 3GLHE 5E3JA 4Q7JB 5JC1A 1CRQA 1Z34A 4N0QA 4MQFB 1X19A 5EGSA 1TJ5A 3RS9A 3M5DA 3MOSA 5L3QB 1ODFA 2AR0A 4IFTA 1LDYA 1UIRA 2BM8A 5L51A 4TZ0A 4JJIA 2HA6A 3R0IA 5ABPA 3FM9A 2YHBA 4KE6A 5EJ2A 3FZNA 3MM4A 1E1LA 4O02B 3SX4A 1GADO 1JU9A 1ZH6A 3SMQA 1NMZA 2DHDA 4R1QA 5GMOA 5I8PA 5FI0B 3FZYA 4IDGA 3EY4A 3UICA 5J58A 5ALLA 1WDWB 3MWJA 2JKZA 3EZ7A 4PGMA 3SC3A 5JJLA 4R71A 4X6UA 5I7VA 2WUVA 1QGUB 4YRIA 2PQ0A 1RDFA 1QTNA 3U9LA 2OBYA 1XP8A 1X6VA 1KSGA 4EHKA 1M2EA 4Q3CA 1ZINA 2V0CA 4K40A 2YV5A 4WK6A 4L2IB 3CVYA 2Z6UA 4KEAA 1E94E 5JAZA 1CUYA 3F3MA 1UOPA 4MROA 2QRLA 4L5YA 4UVIA 2C07A 2ZB8A 2IFTA 1E3DA 4C4RA 4DARA 1HA3A 1UZNA 1ZG3A 1GUAA 4WZAB 4RC9A 2HA0A 1TYEB 3P4YA 3ROKA 2ROQA 2PVCA 5KTYA 2DPMA 1NU6A 1RIFA 1DRKA 1IC6A 1BMQA 3FAKA 4FYYA 5AXCA 3ZZ0A 2H59A 1EFUA 3QZUA 3WSVA 2BP7B 2CFCA 5LYYA 3W05A 3GDWA 3CC8A 3W2HA 2H07A 5E6RA 3FN4A 4Q1CA 1YGYA 5T3UA 1NATA 4OHVA 3IV9A 4G5GA 1NY6A 4WACA 2JFNA 3T12A 2PLFA 3HSKA 3ZHZA 4JVMA 4B6QA 4C78A 2AZ4A 5HJ5A 1J49A 2NUTB 1GFZA 2O8DA 2CK3D 2ALJA 3O9VA 5IX8A 4MRRA 1UPFA 3DCJA 3HSYA 4EHBA 2IW3A 3HG7A 1M3SA 2PWPA 5EXEA 1KMHB 2O5VA 3L7KA 5T4HA 1L7QA 2ZUDA 2ZBDA 4ARBA 5A5FA 4EB6B 5EIEA 1THTA 3U7QA 2LRHA 2PXCA 3KG2A 3M6LA 4IOLA 4Q9JA 4J0QA 5EMJA 4F71A 5FH9A 3RU2A 5FX2A 2WD7A 4IJUA 5FV4A 4K9OA 3GLGE 3G2PA 2X1HA 1KYTA 1JPJA 3STUA 5C53B 3GEDA 4R6WA 3KQHA 2WF8A 3KT0A 3N58A 2B4KA 3EGWA 4X3OA 5LDDC 2Z2KA 5CVCA 3ECSA 4U7PB 3CX3A 2QD4A 2FOLA 2HSGA 2V45A 2A57A 4C3VA 3WDMA 2FA9A 3ETEA 3SVZA 4HAOA 3HY4A 2QRKA 4TQUS 4ZVSA 3SZMA 2JJQA 4Z53A 3WNDA 2IUFA 2MMGA 1GNPA 4LHZA 3G17A 1E1RA 2FG7C 4G4GA 1VFPA 1GA1A 2BUAA 2O1WA 3P0JA 4I7EA 2RKBA 3VISA 2H92A 1HYHA 2ZIUB 4IVNA 4R16A 3UHOA 2VYQA 2EKQA 2I0FA 2I03A 3DMRA 3SS8A 2E48A 3QU9A 1L5OA 1UJMA 5CNKA 4B4WA 4EG7A 4HYQA 5JXWA 1MO5A 1VPTA 1F12A 2FQQA 1L1QA 1ZUNB 1FTGA 4TWIA 2DG2A 1AGNA 5CJPA 3U7IA 3D02A 3W8EA 1JQLB 5SY9A 3ADBA 4WXHA 1KDPA 2PZLA 2ST1A 3L6OO 4CE6A 1P1HA 2FCRA 2J67A 3CUYA 3ESCA 3L8MA 1NT4A 2KWIA 2FJPA 3LCVB 4W1QA 1Z38A 4I3GA 1QGDA 3R3WA 1K8QA 4RSGA 3IC5A 2F43B 4WKOA 4AYWA 2YWJA 1JG2A 1JS1X 3THWB 2J08A 3E18A 5C31A 3RHZA 1QIKA 1VL8A 4N3AA 3FXAA 3MINB 4EKIA 5LNK6 1X0XA 4YAIA 4ERNA 2H00A 3ES9A 3AIOA 5CNJA 1EE9A 4NE2A 1XZFA 3C8HA 3JPYA 1HQKA 2HRCA 1X2EA 4QDJA 1PR2A 4YGXB 2Q46A 5A3VA 2N46A 1MV5A 3BH7A 2Q62A 1E8NA 2FZGA 3K9FC 2WIDA 2QUKA 2FUCA 3KLOA 3FVWA 1UUFA 1RABA 4J29A 3F67A 1W94A 3DKKA 3QX9A 3TH5A 3STTA 5HKAA 4CEIB 2J0SA 3UUEA 3B2EA 3DOEA 3INNA 5AK4A 5KNLA 1JJIA 1BOOA 2CF5A 3AEYA 2BD0A 3W2IA 2ZTLA 5C8DA 5KTMA 1ZOLA 4Q3NA 4EB6A 1K92A 1CDDA 3A11A 4HWSA 4TLEA 3LC2O 3IPCA 4K7JA 4K03A 4LZJA 1RZUA 4NU6A 4P81A 1ZM4A 4CM8B 2GBPA 1ND6A 2CEAA 4BEVA 4ZCSA 5CLGA 1AM4D 5BSMA 1L4YA 4JSRA 1D2RA 2JZCA 2C96A 2D2IA 3I8XA 5E6UB 3AKCA 1F51E 3WKAA 2QX4A 2P2SA 1AF4A 1FXSA 1JTEA 1DDIA 3T8YA 2WTXA 2PS1A 1SHKA 4FTWA 2V7VA 5DM0A 1Q0PA 2OZPA 4JIMA 4HNHA 3CU5A 3LM8A 4OATA 5TNXA 4F1JA 4ZGGA 1ZNYA 3G68A 3UQZA 3WGIA 1VYVA 1JLHA 2FPUA 2GKSA 2Q2QA 3AEUB 1J7KA 1U0EA 4FJ2A 4D92A 2JLRA 5A0VA 1L4BA 1JAZA 3Q4GA 2R8EA 3P9IA 2XGOA 5LMZA 1LQ2A 3DE2X 2VWQA 2BTQA 4D6YA 4ZREA 1KZYC 2MWMA 2X8BA 3E3OA 4N49A 5KTKA 4N5LA 1KYIA 1UANA 2R0QC 2JFOA 1QH8A 3SBOA 1DWPA 4RMIA 2HXSA 2XDQA 4RKWA 1CQJB 5B1EA 4QFMA 1BJTA 2B7BA 2Z2XA 1H5QA 4BV3A 2GEFA 1XDDA 3QEOA 4A26A 2Z04A 1HZZC 1KORA 2XNDD 2IYUA 3C15C 1T3GA 4PWYA 2FNAA 3GLRA 3ZQJA 3U16A 3TD6A 4AZ0A 1WLYA 3K9HA 1DIAA 1JBQA 4D5GA 1V1RB 4F60A 4QLOA 1TD9A 1FFXB 1RWBA 5CDSA 2ZSJA 1XHFA 4X7BA 3DVAB 2DQZA 2QI9F 1YDWA 1GTJ1 2DPXA 2XHZA 4GI5A 4UAGA 4CLXA 1HE4A 3IBCA 1T6YA 1Z6GA 3I5UA 4DWJA 2AOWA 3H9EO 2XH8A 2ZUUA 2NVWA 3OETA 4MDYA 3P20A 4QYIB 1OU4A 4BATA 4QDOA 2QQGA 4DDUA 1EI9A 3PLAE 3CJRA 2DE0X 3UMFA 1I80A 4REQB 1GPUA 2C1ZA 5BSTA 2DFVA 3KD3A 4PAMA 2AA3A 1YI1A 3PNPA 4PX3A 4INAA 2WNIA 3PU6A 2ZDHA 4R2MA 3TLEA 1PF7E 4RS4A 9LDBA 3N2YA 1CQJA 1FNDA 1NKSA 1J8YF 3H2BA 4R8VA 1NVBA 2Y1OA 3UW3A 4CETA 3FB1A 4GOKA 1NQWA 4N3NA 4FWTA 2C7RA 3R0ZA 2G8NA 2R6FA 1GSHA 4YRTA 1ZNZA 2XADA 2H85A 2HHAA 3AH8A 4H6XA 1U0RA 4X00A 5JSKA 5GVRA 4M8IA 4YCDA 3ZR4B 3KWFA 2QL7A 3B70A 3ZW7A 2EG9A 4ETIA 1WSAA 5HBRA 4D8WA 3N0XA 1X1RA 2CVPA 4KQ2A 4LA4A 4C4PA 5K05A 5ERXA 3L93A 2XWPA 2Q5FA 3CONA 3RYHA 4QT4A 1U8ZA 2DR0A 1MX3A 4HDSB 1U5BA 4JC8A 1J2EA 3JQ9C 1Y9JA 5FP0A 3M6AA 1I2BA 3LXXA 1YGPA 3F4KA 1YA4A 3QU2A 4FYVA 1O89A 4JKOA 5C5IA 3RDPA 2PJDA 2ZREA 4M1OA 4QUBA 4UHDA 4TZTA 1CUAA 4LJ5A 3TO5A 5CJJA 4XPIB 4JBIA 4UUBA 3PWZA 1NC1A 1ZW1A 4WZZA 1EWYA 3KTDA 3MK31 4OO3A 3L8ZA 3ZDFA 4IRXA 2AD5A 5KC8A 5FAXA 5HIAA 4HGQA 1ABEA 4CFYA 2CWWA 4F0JA 1K9VF 4IDNA 3LQ4A 4BO1A 3KSMA 1K5DA 1X2BA 3VR4A 1QG6A 4UNIA 2DZDA 4JA0A 2B2CA 4XLZA 4NG5A 5ERYA 3ZE9A