3FE2A

Human dead-box rna helicase ddx5 (p68), conserved domain i in complex with adp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
234
structure length
234
Chain Sequence
b'QEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ATP-dependent RNA helicase DDX5
molecule tags Hydrolase
source organism Homo sapiens
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases
pubmed doi rcsb
total genus 80
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fe2A00
4DB4A 2RHDA 1NIPA 1K8RA 1HH4A 4TMZA 3OFNA 1PLJA 3E70C 4LK2A 1MOZA 2HF9A 5AJWA 2HEIA 5JCPA 1WF3A 3U3RA 2VA8A 3BB3A 1KSFX 4CVNA 3K0CC 1FMJA 1YRAA 2C95A 4EPVA 4PAOA 3HWSA 5DLQC 3OEED 5EXTA 3QY0A 4JL8A 4DSNA 3GLFA 1P5ZB 3IILA 1LB1B 1UEIA 1EWQA 4PZLA 3CRRA 1GUAA 4FI3C 4MRRA 1S8FA 2VP6A 4NHOA 1IN6A 3MSXA 3QG5A 5FTMA 1OH8A 1GRRA 5EP1A 3IHLA 1P73A 1FW6A 2QMOA 2P6RA 3VX3A 3BWDD 3THXB 4BASA 1R6BX 2TMKA 4ESHA 2P0EA 3BFXA 2HF8A 1SXJA 3UWOA 3GFOA 1KK2A 4GMXA 1T5LA 3TGPA 4HB0A 4CF7A 3DKVA 1WRBA 4RFSB 4TL8A 4BLRA 4IVPA 1NMZA 1UF9A 3CNLA 4NTZA 2H57A 4XIGS 2Z5FA 4A92A 2QZ4A 1N6KA 4HLCA 2ZRDA 2WICA 3N2EA 4MGKR 4MQBA 4B6FA 2PJRA 3BH0A 2OBMA 4OKSA 2FFHA 4BQSA 5TMPA 3EZ6A 1OJLA 1KSJA 2VTKA 5CIWA 5JRJA 3ZVMA 3EAQA 4DLRA 5CDFA 1E1QA 4OQMA 2W6JA 4A0GA 3U7FB 3X1WA 4KSBA 1QRAA 3KQKA 2GEDA 3SN6A 4JLPA 4D25A 3FHTA 1T3HA 4ZDKA 4AD8A 3L43A 1EX7A 4IOJA 3R8CA 4HDQB 1G6HA 4ERNA 4I1UA 3THXA 1Z6XA 1T6NA 4FN5A 4WIAA 3GLGA 3CM0A 3MWYW 3FMFA 2JIZA 4M0LA 3SBEA 1G21E 3WYFA 2LKCA 5H8WA 4CEJB 4Q7JB 3RABA 3LA6A 3LX8A 1LNZA 3MCAA 3U2QA 4JT4A 4TYQA 1W36C 2ERXA 3A6PC 2A9KA 1TF7A 3K0AB 3BXZA 1N25A 1R10A 4GMDA 2JJ2A 2EVWX 4DT1A 2ZVPX 3AEZA 3LBHA 4PQRA 5LPNA 3BFKA 4B34A 3C15C 4ZPXA 1II0A 1E2EA 2ZRAA 2X2FA 3HPRA 3MWKA 4ZDWA 2Q0HA 2GK7A 1CEEA 1TU4A 1YR8A 2GCNA 1ZCAA 3TLXA 4TMXA 4DCNA 2F43B 4DLVA 1U0HC 4X8MA 4Q1EA 2CL6X 2P6UA 1U8YA 3ND9A 2MSEB 3AP2A 3KZ1E 1XXHE 2DR3A 4M1MA 5HE9A 3P32A 2H5EA 1SVSA 3TBKA 3X2SA 4DIEA 5HZKA 5JEDA 1TQ4A 1RRPA 4OK6A 1Q57A 3A4NA 4PANA 2FGJA 1ZM7A 1YZNA 4R2HA 2DFTA 3LDAA 3BORA 2YWEA 4KODA 4TL7A 4CYMA 3DZ8A 3R8FA 4GL2A 2ZJ5A 4DSTA 1HT2E 4AKEA 2F1IA 4Q18A 1HV8A 4AYWA 4M1OA 1W4CA 3CBQA 3QEOA 1N2CE 1QF9A 1SVMA 2G83A 4DSUA 1DARA 4D26A 3QEJA 1X1RA 1XZQA 2ZE8A 4I1VA 1E0AA 1QHNA 1GKIA 2V7QD 3CNNA 1GNRA 2Z4SA 2BV3A 1DS6A 1XB2A 1S0UA 4YDHB 1TQ6A 1KI2A 4FD2A 4JMPA 2ZANA 4LYJA 3FMPB 3M6AA 2QPTA 2SHKA 1R7RA 2HLDA 5SZIA 4Q9LA 2DY1A 1SKYE 2REOA 2VBCA 3IQXA 1KI1A 2PZGA 3AV0B 4TQAA 5F9FA 5DI9A 1VG9B 2ONKA 4ITRC 1RJ9A 3KQLA 3PUVA 4B74A 4QGAA 2IL1A 3FHCB 2Y8EA 2MMGA 4UJ3A 3ECCA 3KB1A 4M53A 1IBRA 1YR6A 2BIFA 1ZP6A 4TTRA 4D4KA 4GP6A 4M1SA 1BIFA 4BLQA 1YZGA 2OXCA 3W6NA 1UFQA 4JIMA 2AFHE 4RFVA 2KSQA 1QHXA 1XMJA 5FOVA 1S3SA 5BQ5A 4LJ8A 3AF3A 2O8EA 2QU8A 2VP2A 2UZ3A 5IDVA 4P31A 1Q0UA 1E32A 1F48A 3K70B 1ZMXA 1P3JA 4DLTA 2O8DB 4ARZA 1CIPA 3AVTA 3SDZA 1N6IA 2GF9A 4KFSA 2FEMA 1UADA 3FMIA 3WNCA 1OB5A 2PH1A 2IYSA 3A4LA 1UKYA 2RGDA 4LJAA 5LD2C 1H8ED 1G3IA 1W5SA 4B44A 2YKGA 3KKNA 1F2TB 4WAUA 1R8SA 4W5HA 3BE4A 3U44B 3ASZA 2FX3A 2EQBA 4ZDIA 1NVVR 3OZXA 4GPTA 4M1YA 4W5JA 4QC2A 1KI8A 2ANBA 4O0MA 1ZU4A 4JVLA 5GVRA 3W34A 4F4IA 4KITB 1NSFA 4M2LA 2C9OA 1EFRD 1MABA 4J0QA 1P62B 4NONA 1R5OA 1D9XA 1IXZA 1L4UA 3L0OA 3ADDA 2J7PD 3LQRA 1AIPA 2CK3D 3VR6A 2H8KA 1OXSC 2W2TA 2ZSDA 2CL7X 3SEAA 3DKPA 1US8A 2ZJAA 1I2MA 2ZUBA 4OI4A 5BN3A 1S1CA 3EPJA 3R9WA 4V0NA 4XTRA 4CW7A 4RKFA 2CVHA 5DHAA 3UKDA 1ZNWA 3Q7PA 2WPDA 4ZI3A 2CLCX 2O0JA 3IIMA 1J8MF 3EIEA 2RB4A 1CS4C 4PHTA 3OE7A 2GXSA 3ZLJA 4C0LA 4XWOA 1FX0B 3K09C 5IK2D 3U7EB 3RRYA 1J70A 2QMHA 2W0MA 3BBPA 2R8RA 2D4HA 3T12A 5GJCA 2ECKA 4WZ6A 2BC9A 2QAGC 5JSZA 3EG5A 1WBBA 3QPVA 4QHYA 2AKYA 2W83A 3L8YA 3CRQA 5C46F 1XTQA 2PX3A 3T1QA 2R6DA 3R7WA 3K0FB 1HQCA 1EFUA 2F1JA 1M74A 2OXRA 4V0KA 1WB9A 4RD4A 2ZUDA 2V3CC 3VNVA 2GA8A 2ZJOA 3CRVA 5LB2A 4BFUA 1ZIPA 2O8BA 3SFZA 5CIQA 4POAA 3T35A 2GEVA 2J59A 5JCZA 2KJQA 3O8BA 1QHYA 4G0NA 3C14C 1QDEA 4D0GA 3U7HB 1WDTA 4PFSA 3AKDA 2C78A 2WOJA 1NRJB 2Z6VA 3IQWA 3UMSA 1WQ1R 2FE4A 4EIWA 4GI7A 4HLDA 5DIFA 3TW8B 3WNDA 4PSAA 3VR4A 2R65A 4IXNA 2J41A 2ODWA 3PEWA 1PLKA 5JS8A 1XEWY 1NVUQ 2R62A 4QNRA 2QAGB 4GZMA 3NTUA 1UKEA 5EP4A 4DLXA 2Q6TA 2QMUA 4QBGB 4BFWA 2GJKA 4TQUS 3BS4A 5J4LA 2HLDD 5D3MA 2DHRA 2QM8A 2O0KA 4TZ6A 2IYVA 1AK2A 3K70C 1PVOA 1AQYA 1VG8A 3GJ7A 1XXHB 1GIAA 1W4BA 4M21A 4O25A 2ZYTX 1EXMA 1IOZA 2WJYA 2V9PA 4YMUA 1RYHA 2ZAMA 3TNFA 3THYA 3PQCA 1COWA 2W2VA 2ZJ8A 1G20E 3NC0C 3Q3JB 5CK5A 4HAYA 4OI2A 4B3GA 5FPHA 3AUYA 2GXQA 1LVGA 3LVQE 4B2IA 2J0UA 2ZRKA 2PCJA 1ZAKA 2VLIA 4OHYA 1M7GA 5IK2A 5C2JB 2ZAOA 1E2GA 2VQSA 3W8RA 1KMHB 4PO1A 1RYFA 2J0VA 3AUXA 1U8ZA 2ZRNA 1Z2CA 2ZS7A 2IEYA 4NH0A 4YMTA 5TXGA 3VU9A 1TL7C 2JJ8A 5B2ZA 1ZNYA 4FWTA 4MGIR 4QNMA 4BUJA 5KSZA 4PSKA 1SVWA 4LV5B 1L2TA 1VTKA 2JATA 3SU8A 3ZZUA 4L5BA 4NKRA 3T15A 3RC8A 1XMSA 2D2EA 1R0WA 4XTCS 5AK0A 2WWWA 4C2TA 1XU4A 1IY1A 2P5SA 1KK0A 1W1WA 2WIAA 5FL3A 2IA5A 1G5RA 1IJEA 1UDXA 2OSBA 2JJ2D 3K09A 1E2KA 2AR7A 1E9DA 2G3YA 4RKEA 4YDSA 4IOLA 1MRSA 2O5VA 2ERYA 3B5JA 3THWA 4DXAA 2B8WA 1W0JD 4RSGA 2IXGA 5F9HA 4ZIRA 2CE2X 3BIFA 1IXRC 3WHKA 2ZR7A 3TIFA 3EWSA 4GT1A 1T4GA 4IDQA 2BBOA 3QKTA 3WMFA 4ZKDA 3DOFA 1EFRA 5HKKD 4BLPA 2D62A 3KFXA 4UNQA 1FZQA 1E9FA 1N6NA 1Z06A 4G1UC 4K81B 1DG3A 2RGBA 2JJ1A 4D2IA 1TEVA 2BOVA 5E7MA 121PA 3KXIA 3X1DA 1G4UR 1E1QD 2ORWA 2P6NA 3QKSA 2VF7A 4XVQA 5AJXA 4LC0A 3CUEF 3TKLA 1L8QA 3CNOA 2UVQA 2IUTA 1AGRA 2BBWA 5KUTA 1OV4A 5FTNA 3RHFA 2F7SA 2NMVA 4DCVA 3U4QB 1W36B 4DIDA 4JJKA 5FBVB 3Q8XB 1NMXA 4N0DA 1RJ9B 1W2HA 1JQLB 3OIWA 1CF4A 3EASA 4JYBA 3HYRA 2ZRBA 1I2DA 2Z83A 1Z0KA 2W00A 3IUYA 2QY9A 3UXMA 2KB0A 5CJ2A 2NPFA 1OW3B 2KE5A 3SBDA 1N6PA 2IX3A 3MD0A 1W49A 4KBFA 3V00A 4DCTA 1RE0A 4PPFA 3UPUA 3N70A 1VYVA 3T1VA 4HZUB 4Z51A 1HUQA 4LZZA 4LC1A 1MO6A 3E2IA 3LFUA 4HZIA 5FBLB 2YV5A 421PA 4DLUA 2DWPA 4Q19A 3M1IA 2B7BA 2GAOA 1GOTA 3W5IA 4DLSA 4DDUA 1IM2A 2OESA 3RNLA 1ODFA 1U2RA 4F38A 4QKQA 3VKGA 2AX4A 3DOEA 3GFTA 2QG6A 3KJEA 4NYJQ 4UJ5A 5KNDA 3HR7A 3EX7C 2DCUA 3VR2A 3X1ZA 2GBLA 4HDCA 2JLWA 2GCOA 1P2TA 4PX9A 1JR3E 1ZIOA 221PA 3AKYA 2ZRLA 1QZXA 1Z08A 3CIOA 2IUUA 2LCFA 3QF4A 3VHXA 3KQNA 3LW8A 3NVAA 1SVLA 1ONBA 1KTVA 1KMHA 2ZS8A 1DELA 2IK8A 4G5OA 1ZUNB 2QA5A 3MUFA 2GTPA 1Y3AA 3NG1A 2HDNB 1JEDA 3CRMA 3WY9A 5L3RA 1GZSA 3A58B 4A2PA 1CJKC 1ZD8A 1W36D 2EWVA 2IYWA 5G3YA 2XX3A 1XD8A 2ZRHA 4PPGA 2H17A 3L0IB 1Z63A 1C1YA 3JZMA 1OIWA 1Y63A 4U02A 1CXZA 3P4XA 2H7VA 3KTAA 4OI1A 4US0R 3KJIA 4RD0A 3B60A 4EPYA 4LX0A 2AL7A 5CYPA 3MFYA 3AF4A 4CRWB 3KKPA 4AKGA 3D6TB 1W47A 2YOGA 3QBVA 1U0JA 1ZW6A 5FBWB 1XCPA 3TUIC 3UK6A 2FFAA 2XOKA 2JLUA 1UDWA 2WJIA 2QTFA 3TVDA 3RRMA 5AUPB 5JJKA 3E5HA 2RMKA 1OXUA 4NYMQ 4RZUA 4NYIR 4LYAA 3MAAC 2A78A 2A5DA 3TSZA 1WA5A 5FOXA 3T1OA 4HAXA 3A37A 1MR3F 5UKDA 4HUQA 1Z29A 2R44A 1E9EA 1U94A 3IGFA 4AG5A 4QL3A 1KSGA 4TMTA 1E9RA 1AN0A 3NBFA 1VCIA 3LLUA 5JLJA 3P27A 1DOAA 4QBFA 3OAAD 4UKDA 4MYCA 1KYIA 4ZCIA 4IFEA 4E03A 1II8B 4PHFA 2PCLA 1H8EA 2QGNA 2IXEA 5JZVA 4ILEA 4HAWA 2YWHA 2BHRA 4DUGD 3R7WB 1A2KC 5BXQC 1VKJA 4MGYR 4BECA 3MMPA 1JXOA 4JVSB 3F5FA 3P26A 4KVAA 4M9XA 4S35A 3PVSA 4L9WA 1GAJA 1NG9A 4MITA 3PENA 3PXGA 2X77A 1CTQA 1MO5A 1R5NA 2FFBA 2JLQA 1IONA 3S1AB 1Q1ZA 3SNHA 1FTNA 2G0NA 5JECA 1BYIA 4PZZA 1Z3IX 2F3RA 2VSXA 2CNWD 4EPTA 3BD9A 2ODNA 3TR0A 2QP4A 1E2MA 3RS4A 3U5ZB 1KO7A 3I5XA 1ZNZA 4WA7A 4LYFA 4TLCA 5HPYB 4TLEA 1FNNA 4Q4AB 2XSZA 2B8TA 2NQ2C 2WV9A 2CVFA 1T5IA 2ANCA 1G3MA 2KI5A 1RRFA 2G6BA 1EWRA 3ZD6A 4KV9A 4B71A 1UBEA 4M9SA 1QG4A 1GL9B 2GXUA 4FMDB 1DAIA 4NDZA 4HDOB 4PTLA 5JHHB 2WKRA 4M1TA 5CITA 1X8LA 4FW9A 4PR0A 5EE1A 1E0JA 1UM8A 3B6EA 1AS2A 5AUQA 5FTKA 5FFMA 3TAUA 1OXXK 5EZ6B 3KJGA 3T06B 2A2ZA 4YMWA 1JAHA 4PQFA 4DZZA 5JI2E 1XD9A 1L7VC 2PZEA 1U98A 2IS6A 2OFOA 3FKSA 3F3YA 3I92A 3PUYA 3SJZA 5KHOC 3E1SA 1XPOA 2W58A 1YHNA 4LJ4A 5KPJA 5GVSA 1XTSA 3KL4A 4WZBE 4YMSA 3RLFA 4BFXA 3QE0A 4CGZA 3CLVA 4Q9KA 1Z47A 3B1XA 3M4YA 1XRJA 3QXJA 4Q5IA 1I4DD 1G291 3ADBA 4H9GA 1ZM4A 3ZJYA 5J4VA 4DEYA 1OH7A 2PT5A 2ZI4A 3U60B 1A82A 1RVDA 3EWAA 3CWZA 2O8EB 3OAAA 5IHPA 2CHGA 5KPDA 2HCJB 2V6IA 1R0ZA 4Q4LA 1OFHA 2VHQA 5CK4A 5FUWA 5KYKA 2QL6A 2QI9C 3LXXA 3UATA 1WP9A 1NNEA 3U6BA 2MSCB 3AF0A 2CXXA 5BYJA 3Q9LA 3B78A 4B35A 2LWIA 2C77A 2QORA 1CJTC 3I8SA 2NGRA 3KKQA 1P75A 3NDBB 3WBKA 2AN9A 4KVGA 3ZVLA 2VP9A 4FCVA 2OBNA 2AD1A 1ZRHA 3BJIC 3NBXX 4EFMA 4MH0R 2J3EA 2ZROA 3AKEA 2CCJA 3VQTA 1OT3A 5EXSA 1CLUA 4BFTA 1FP6A 3RYTC 1KKLA 2F1RA 1NN1A 2XTNA 3K9NA 5FL7A 2N46A 5JWRA 1XPUA 3LW7A 2VH5R 1X1SA 4JLKA 2V6JA 4TMWA 2O8DA 3EXAA 4XSHA 2GJ8A 4DC9A 1NN0A 1W2GA 1JECA 3VHLB 4BWYA 1VHLA 3IEUA 4B6EA 3RRZA 1JNYA 4NCHA 1DPFA 1B0UA 2CLSA 4NCJA 2J0QA 2ZQ5A 2J46A 1SGWA 2IYXA 4AURA 1A1VA 1KI7A 1G3QA 4G5SA 3AVXA 4IDHA 1HURA 3IO5A 1E79A 4HZUA 4IVRA 3G82C 4DEXA 1VDZA 3DMNA 5BN4A 3SFVA 2FZLA 1OFIA 4C0QC 4A2QA 1W7AA 3NIBA 1N3BA 1OHHA 2OILA 4JL5A 5BW8A 2F3TA 5P21A 1E9CA 5KSYA 4D4MA 2WWGA 3NC1C 1FUKA 4Q48A 3MJHA 5EE0A 4NYMR 4JT2A 2RGCA 3R9IA 1SXJD 4EJSA 4QBIA 1E2HA 3K70D 5AUOB 3O8RA 4D4JA 4PHHA 3VR5A 1FFHA 1OH5A 3K0FA 2F9LA 3SC3A 1C9KA 1WXQA 3H1TA 4HEJA 4ACAA 5FTLA 1V5WA 2H1LA 5LB4A 1BYUA 1GRNA 3OE7D 2QP9X 4ZDJA 4FXPA 2CJWA 5JWOA 3AGPA 4DB2A 1JALA 2OCYC 2QE7A 1ESMA 1OYYA 2DFLA 3PUWA 1PUJA 5K8IA 2ZR9A 2JLVA 2FNAA 1N5KA 4WZAE 1FUUA 4DSOA 3TW4A 1D2EA 1NIJA 3EPKA 3KDSE 2HJGA 4QRHA 1Q21A 2GETA 3RANA 2ZPTX 2VHJA 3FDIA 2CDNA 1P4SA 1JBKA 4WOPA 2XXAA 3IPXA 3TVTA 2RCNA 1G5PA 4ASUD 1II9A 3WXMA 1NLFA 1R2QA 1FQKA 3DM9B 3EW9A 4MRPA 4TYYA 4V02A 3NHBA 1BOFA 5BN5A 3ZIAD 1N6HA 4BLTA 4IEEA 1OSNA 1NL3A 1CBUA 1DTSA 1GSIA 2BMJA 2GCOB 1US8B 1K5DA 1YE8A 4Q1AA 3EZFA 3GQBA 2HYDA 3EA0A 1VCOA 4YC7A 5L3SB 2O8BB 1XJQA 2GESA 3W3AA 5FR2A 3SHWA 1GM5A 2X8AA 2QUZA 3CO5A 3QXHA 2AK2A 1R8QA 2NO9A 1DG1G 3D8BA 3ETLA 1OXTA 1DAKA 2VP4A 4FMBB 2PEZA 3NH6A 4K8OA 2GZDA 1KI4A 4I1SA 4QXAA 3K53A 4BRUA 2IF2A 1VG1A 4MUAA 4NU0A 3VMFA 1HT1E 3A1SA 4HLUA 5F98A 2ORVA 4PC3A 4OL0A 2R6FA 5EXXA 3QIAA 1ZC4A 2WSSA 1HEIA 3JZAA 1OHHD 5CJPA 2GCPA 4OQFA 4MYTA 3W6OA 2P3SA 5G41A 2EU8A 3SOPA 5HKKA 3C7KA 1N0VC 3OEHD 1M34E 2QT0A 1KDOA 2XXAB 2BCGY 4KAXA 3GJ8A 5DN6A 2GF0A 5DI3A 821PA 5JRZA 1GVNB 3TSWA 3UIEA 4TSFA 1KK1A 2ZJ2A 4AYXA 1ZINA 1F6BA 4LHYA 1G41A 2CBZA 2FMXA 2OLJA 4MKFA 4Q47A 5C1BA 2G1KA 4HUQB 3Q5DA 3TSOA 4JKIA 5HZHA 4B3DA 1NJFA 3ZGXA 1YJ5A 2A7QA 2QN6A 5TDHA 5KNCA 4N0EA 1AKEA 1P2VA 2RGNC 2YOFA 4TL9A 1YZUA 4II7A 4QJ4A 5DNYB 2FG5A 4EDHA 2GJSA 2QGZA 3EARA 1MO4A 1CULC 2YYZA 2V55B 5J4YA 4I81A 1GP2A 3BB1A 4UXIA 4Q21A 1GDDA 2IBMA 4KFUA 2YJTD 4DLYA 4B76A 1Q1BA 2V7QA 4E07A 3FB4A 5SZHB 1EFCA 1Q44A 1Q12A 2C9YA 2EFDB 5CM9C 1VCNA 3EA5A 4LJ6A 3FKSD 1S96A 3BH7A 4QM7A 3P20A 4Q4AA 1SQ5A 3QKRB 5AWFC 4C0JA 1SVOA 2QNRA 2C9CA 4PPNA 3GLIB 1MH1A 2XJ9A 1P2SA 2PX0A 4P32A 5FUYA 5KNBA 3S1AA 4URWR 3LY5A 1E9BA 1UJ2A 4URZR 1MT0A 4EFLA 4DDWA 2HCBA 4F92B 3PEVA 3THWB 1N5JA 3AQ4A 2HYIC 1E96A 3DHWC 5EJEA 1U90A 4R98A 2BJVA 4PAQA 5AUNB 1E94E 2OO7A 1ANKA 4A6PA 1E98A 4UXHA 1GL7A 2HUPA 4MGZR 4AKHA 2ZRJA 2PLFA 1QBKC 2V1UA 4EUNA 2V8OA 4HAUA 2EW1A 1K5GA 2EYQA 3CZQA 3VTKA 1TQDA 4LRWA 1NSTA 1NI3A 1E9AA 2JAQA 4TL6A 4A9AA 4A8JA 4UNPA 3GJ5A 2O52A 4P4SA 4X8HA 4XD7D 1N5IA 4JBXA 3LAWA 4US2R 4ON9A 4PC1A 5EE5B 2GBLC 3RC3A 1YRBA 3WYGA 4JSYA 4F4CA 4Q4JB 3GJ6A 1DAHA 3UMFA 4DRZA 3U3JA 2DBYA 8OHMA 3QKSB 1OE0A 2OT3B 3FHOA 1T3SA 2PLRA 3HU2A 2WJJA 1UBCA 1ETUA 3F8TA 4N1AA 2ZE7A 2QSZA 3LV8A 2NO0A 4RCYA 4DLWA 621PA 4M1WA 2F1HA 4URUR 3AKCA 4Z8YA 3VX4A 1SHKA 4LJYA 4G5RA 3LXRA 1SXJE 4YONB 5F3WB 2AKAB 2VYFA 3EC2A 1G7TA 3Q85A 4R2IA 4G5GA 1XEWX 3IDQA 5FI0B 1XEXA 3RWMB 4HLUC 1G7RA 2BMEA 2AWOA 2R6GA 3KXKA 3TRFA 3VAAA 4EPWA 1XPRA 1M2OB 1S2MA 4JLBA 3ZQ6A 4CT4B 5GJVC 1Z5ZA 3BGWA 3SJAA 4E22A 4F93B 3AVOA 2IUSA 4LHZA 3CKLA 1F60A 4RY2A 1CRPA 1DAFA 3EZ7A 3GLIA 3BOSA 4HAVA 4PSVA 1FNMA 5TB5A 1W46A 5TV2A 721PA 2X19A 4WXPA 2ZETA 1NG1A 4DCSA 4OBEA 5JJLA 1KKMA 2EFCB 2JEOA 2ZSAA 1LF5A 3EIQA 1GRQA 3REFA 2RGAA 1LW7A 2A5YB 1ZCBA 3KUCA 2QRZA 4RZ3A 4JLAA 1Z0AA 2HT1A 2V4ZA 2IYUA 4B3FX 2A30A 1A2BA 4Q1FA 5KSPA 5FPKA 1IY0A 2ZI3A 1IY2A 1YVDA 4GOXA 4QJ5A 4A8JB 1BS1A 2AK3A 4KCGA 1Q1EA 1N5LA 2QENA 3LO5A 5JEEA 4JBWA 3PV0A 4C9BA 4ZCMA 3AGQA 1KDTA 4OHWA 1KI9A 2C98A 5KDOA 3QQ5A 1I4LD 2R2AA 4XD7A 4ACBA 4DDTA 3Q5EA 1R0YA 1TQ2A 5JHGB 1TMKA 4U5XA 3W9YA 1LTQA 4FMCF 5SZKB 1T9HA 5A0FA 3D31A 4XOIA 2G1JA 5J4HA 2HJVA 1NY6A 5HCIA 2JLSA 5AR1A 2QPOA 4JYCA 4ARZB 2XZPA 3QI2A 3BH6A 5HR5A 1YZQA 3B1VA 1KGDA 3SYLA 3SHFA 2O8CB 2LKDA 1JEEA 1VYUA 1A7JA 4OQXA 2QMEA 3VU9B 2ZS9A 2I1QA 2NZ8A 3LRPA 3RAPR 2RH5A 3OESA 1JAIA 1F2UB 1M7BA 3Q7QA 1KI6B 1D9ZA 1XCGB 1XDBA 4ABYA 1EFTA 1ZC3A 1FP7A 3W6PA 1XEFA 2IHBA 4Q9JA 1JR6A 2C96A 1KSHA 2DFKB 2ASEA 1E2LA 4Y0AA 4Q03A 2EFEB 1Z0DA 3C5CA 1KNQA 4MKGA 4BLOA 1U8AA 3RWOA 5J4KA 1E2JA 2ZTSA 3TUZC 2F55A 2IHYA 3K0CA 5KTYA 3T1TA 3K9GA 2XOKD 4ZI2A 1NVVQ 4NCNA 4D80A 1AJEA 4PC6A 5TVKA 3ADCA 4HI0E 2JLYA 1AA9A 1T8TA 2BMFA 3GLFE 1W48A 1MV5A 3ASYA 1E9SA 1FPMA 1GITA 4IHQA 5FTJA 3GEIA 4ZV4A 1XNJA 2FZ4A 4LY6A 1Z83A 4KBGA 1XBTA 2BM1A 4NPHA 5K8UA 4EAQA 3I62A 4YXWA 3ICQB 1DADA 2ZE5A 3MGCA 2EYUA 4LJ5A 3CPJB 2F9MA 3QBTA 2V1XA 3QF7A 1NBMD 3B1WA 3AP1A 5CYOA 3BB4A 3FOZA 3RS0A 3KX2A 2FU5C 4TSFD 1E2FA 3OIVA 3D3QA 1HE1C 4FWIB 5TY0A 1KY3A 1SXJB 2IWRA 4AI6A 2JCSA 3TJZA 2PEYA 5L3QB 2VHUA 2XITA 4HYYA 2IS1A 2BKUA 4L16A 5EE3A 1AZSC 3RVBA 1ZM9A 1KZGB 3AVUA 4C0SA 2CLDX 3L0SA 1U81A 1T0HB 4MKIA 1Q20A 1LS6A 5ANRB 2OBLA 3TH5A 3CWQA 3SYKA 2OCBA 1K6MA 1MRNA 4DJTA 1E2QA 3NXSA 1QG2A 3UWKA 1G18A 1Z22A 4JS0A 3L82B 1KK3A 1IN5A 1A4RA 1YQTA 3CR8A 3WMEA 3NBYC 4HB4A 3NDPA 4DWJA 2Z43A 2JDID 1H8HA 2NO7A 5JMTA 1VMAA 1G5TA 2FN4A 3A36A 4OQLA 2E87A 2C5LA 3K0AA 2WJGA 2OV2A 1PUIA 4KLNA 4V0OA 4MYHA 4WW0A 1QHHA 2ZITA 3GLHA 2GZHA 4MYUA 2WVJA 2ZYWX 3GLGB 4C0BA 2I4IA 3B1ZA 4V0MA 3ZZ0A 2OM2A 3CH4B 2CL0X 4GDFA 1DO0A 3I73A 1WMSA 4P0TA 3RS2A 5H68A 4B75A 3CRW1 3QXCA 2WZQA 4XVUA 2FPLA 4C7OB 3LVRE 1OIVA 3N2IA 3FPAA 1ZYUA 2QT1A 4CZ2A 1ZUHA 1YR7A 4MKHA 3X1YA 3RDPA 1IJFA 4MDFA 1NKSA 1OPXA 2JASA 4JVMA 2OG2A 4QFMA 1XJCA 3AVPA 4LHWA 5C4MA 4YXWD 3G0HA 4BFYA 2AXPA 2J0UB 1D2NA 1FL9A 3NBZC 3PIRA 4ZO4A 2KBEA 3WMGA 2NO1A 4B2PA 1OKKD 4C3ZA 2VF8A 2BVNA 1HY3A 2NOAA 1UBGA 4MA4A 3CPEA 1NVXQ 1XD2A 2N42A 1JPNA 3OHMA 3TAHA 2O8FB 1G8FA 4C0HA 5JFGA 4TTQA 1XTKA 2V54A 1OB2A 2WWHA 2I3BA 1IQPA 2GAAA 4IOMA 2NPIA 1KO4A 4HSEA 3GFPA 2IS2A 4UQOA 1N6LA 5FOTA 4A15A 3DEFA 2FEOA 4YLGA 1TX4B 3SQXA 2ZRFA 3H0KA 5JSZB 2XTMA 5D3MB 1KMQA 4A0HA 3IPYA 4MUBA 4YQFA 4W9MC 1D6JA 5G53C 3QPWA 5DYIA 1PZNA 1II8A 1COWD 5IF9A 4Z54A 4Q4HB 3T5DA 4UNSA 3QKRA 4AIIA 1G9XA 2DFNA 5EP3A 2FSIA 2DWQA 2JDIA 3LH5A 1OYWA 2IYYA 3NH9A 2HT6A 1XWIA 2FOLA 1FQJA 2XEXA 2BJWA 4PQYA 2GK6A 2WMOB 1KHTA 4Q7KA 1DAGA 3B9QA 2O8FA 4Q4JA 1YZKA 4JKYA 2QBYA 1TEXA 3PEUA 4C30A 2GNOA 4F4JA 3KUDA 5DGXA 2D7CA 4XVRA 4NCKA 5CLQA 2B21A 2DB3A 4KJZA 3LBIA 4C7OA 2Z0MA 1ZUIA 2BCJQ 3LD9A 5FL7D 3WP0A 4IEIA 1G4AE 4RZXA 2PL3A 4CEHB 2ZR0A 2XNDA 3QOFA 1XZPA 3H86A 2FPKA 3BFVA 5EQTA 5FUVA 3VKWA 4RD6A 1N0UA 5IRCD 5L8VA 3GEEA 1ZU5A 4EPRA 4KSCA 2XNSA 3AF1A 4DDVA 2GRJA 1G64A 2R9VA 3FE2A 1EGAA 4ZKEA 3OIYA 1P61B 2WMNB 1Z6TA 3THOA 4U7DA 2JLZA 1DVRA 1QHSA 2X2EA 2ZRIA 1KO1A 4IJMA 5CLLA 4XWKA 4LWZA 3QSYA 2DYKA 4I99A 1KO8A 3SI7A 1C4OA 4ZIRB 4DLZA 2ZVQX 1OH6A 4D81A 2CHVA 2ZI5A 1JR3A 2GJ9A 4PHGA 1NP6A 5FI1B 5KDDA 1E69A 5J40A 1E1RA 4JBYA 1GILA 2JJ1D 4LPSA 1P7CA 1QVRA 1XJ0A 1I4TD 1RW4A 2RGNA 2BWJA 3QJYA 4DUGA 4DHEA 2ZI6A 3P1JA 2NTYC 4Q9IA 1MO3A 1L4YA 2XJ4A 3T5GA 5JI3E 1Z6GA 5CM8B 2HV8A 3SJCA 1NN5A 2QEQA 3SZRA 4LV8B 1MABB 4V0LA 2YC2C 3LQQA 4X8LA 4TT3A 4TYWA 4GOKA 4JZKA 2NG1A 4US1R 1KI6A 2W6JD 3ZS9A 2C8VA 5KO2A 2WKPA 2CK3A 3DM5A 4GRAA 4HLQB 3O8CA 5L3SA 2WOOA 2EFHB 4AK9A 2Z4RA 4OYHA 2YHSA 2YINC 1JQJC 2GILA 3V4RA 1P6XA 1G7SA 2GDJA 3NKVA 5H1YA 3IBGA 3GPLA 1M7HA 2GWHA 4IOKA 2ZRMA 1EFHA 2VO1A 2P5TB 1DBSA 5LBIA 1HA3A 4JLDA 5H70A 4ASUA 4GFDA 2NO6A 4V0ME 4TZ0A 4L8GA 1W4RA 3G5UA 3ZS8A 2BM0A 4M9QA 4PC7A 3KXLA 2RGGA 4Z8XA 1SULA 3H4MA 4Q7MB 3C8UA 2QAGA 4QGGA 2IYLD 3HPQA 1VECA 4G01B 1CR2A 4IRUB 2G9NA 3VR1A 3A1VA 4ESVA 4EPXA 1W0KA 4C4PA 4CEJA 2A5GA 2RGXA 3DDCA 1F2UA 3CX6A 2IEZA 2FPMA 1VIAA 3TE6A 2JLRA 3KKMA 4B48A 5ELXA 3J81k 1GNQA 1TNDA 3CF6R 1B23P 4OHXA 3PEYA 2GVZC 3KB2A 1X8JA 5AJVB 1LV7A 2A5JA 1ZM3A 2PMKA 1SXJC 4PC2A 5DSZA 4NL4H 1JR3D 4Q02A 1G8PA 1AM4D 1E79D 5EUQB 5HCNA 1VYTA 4LYHA 2IT1A 5JBQA 3VR3A 1HE8B 3FGNA 1Z6YA 5HE8A 3GLGE 4FMDF 3U3KA 1J7KA 4L4UA 3IKJA 1BMFD 1OLOA 2OHFA 3I1FA 1FMLA 5G40A 2IWHA 4Z1MA 4G3XA 4L9SA 3LX5A 2QRNA 3NWJA 2JLXA 1VPLA 5EP2A 2OAP1 3PUXA 1G8HA 3ADKA 2VEDA 4HUTA 1IN7A 3RS5A 1D8TA 2XAUA 4B43A 1Q3TA 3B2EA 3EPHA 3GD7A 1Z0JA 1IN8A 1CR1A 1J2JA 2GHIA 2XB4A 4KI0A 3IHWA 3GCGA 4NYIQ 2IYRA 3TR5A 4URXR 1UBFA 3KKOA 1F5NA 3CB4A 4BE7B 1P2UA 5IT5A 3BK7A 2XGJA 2YOHA 2RGEA 4IDNA 2J0SA 4EJSB 1XP8A 1R0XA 1J8YF 2QAJA 1Z07A 2GEUA 5CDFE 1RRCA 3DZDA 4TLAA 5FR1A 4DCUA 1H8HD 3QF4B 3GJ4A 2NIPA 4LJ7A 4PAMA 5DO9A 2AFIE 2CMKA 2IC5A 2R6CA 3I4LA 3ZVNA 3R9XA 1S3GA 2YZ2A 2REBA 3DPUA 4FCWA 3K0EA 5L3VA 2F6RA 1RZ3A 2W6IA 3B13B 3GJXC 4A2WA 2OEPA 4UXJA 4RFSA 2W2XA 1LY1A 2ZIAA 3FVQA 1NMYA 3D7MA 1FOEB 1E99A 4IXMA 4B47A 3ZVRA 4CEIB 5B64A 2FSHA 2FJUA 3AH8A 4XSGA 2P65A 1LF0A 1ZD1A 3UMRA 4Q00A 2FDCA 4JL6A 3OEHA 4TQ9A 5JWHA 3W3ZB 3EIHA 1W0JA 1D2MA 1H65A 3GLFB 2J7KA 1E1RD 1G19A 1KJZA 5CB8A 4L15A 4BZXA 4NP6A 1TADA 2J7PA 3QNUA 2VIIA 2Q3MA 1S1MA 2IYTA 3HR8A 2PBRA 1S4QA 1YZLA 3B82A 3LWNA 4BEJA 3X1XA 5EE9A 3JVUA 3TMKA 5C18A 3K8YA 5KOYA 1GFIA 4XH9B 2ZJBA 4AWXA 4Z1MD 1CRQA 3GLHE 3U61B 1M1YE 2BBSA 4JLVA 1VIYA 4P4SB 1ZJ6A 3SE0A 1HQYE 1DO2A 4QJ3A 1YZTA 1DAEA 3U4QA 2ZI9A 5AJYA 3MRSA 3RSOA 2ZI7A 4OQNA 4Q1DA 1SVIA 4ZCLA 2ATXA 3TUJC 3ZIAA 2ORIA 2BDTA 2Q9BA 1SHZA 1XTJA 3AP3A 3QENA 3I72A 4DKXA 4NZYA 3QVVA 4QGHA 2QQ0A 5FH9A 1UAAA 2H16A 4O3MA 2ZSEA 2IS4A 6Q21A 3OFND 2ZXUA 2XSZD 1P9WA 4Q66C 4IW3B 1G8YA 1CP2A 2UKDA 3A1WA 1V43A 4A6XA 3U44A 3V9PA 1WBDA 3GJ3A 3K9LA 1KDRA 3CF2A 4GBMA 4JJZA 5D3QA 3BC1A 4D6PA 2QPAA 2DWOA 3HU1A 3SR0A 2ZYVX 3B7GA 3ND8A 3B85A 1N6RA 5E4FA 3BRWD 4OJQA 5F2EA 3SQWA 3QVUA 1OFUX 2KBFA 3EPLA 2C04A 2J9RA 4K46A 1RC8A 2QP3A 1UKVY 2RHMA 1PLLA 2WJHA 1OIXA 5GADl 1E6CA 4G5QA 4LUCA 2OFXA 3I8XA 5TARA 4A8JC 1NN3A 4BRWA 4Q9HA 2QTHA 2WWYA 1DAMA 2VSOA 3M0EA 3WNBA 2WIBA 2BKEA 2E9SA 4BFVA 4MRVA 1EX6A 4PO8A 1VCMA 4QHSA 1E0KA 1JB1A 1KAGA 2I1VB 1AQUA 3C5HA 4R7ZA 1CJVC 3LLMA 3IIKA 2VRWA 4B3BA 2FA9A 4JLNA 4C2UA 4HAZA 1NKTA 1CKEA 3ZYCA 1T3LA 3ZH9B 5LDDC 4M4SA 4TN1A 3UG7A 4FMCB 1E2IA 4JLMA 4KYUA 1NBMA 3FFAA 2CHQA 5KSOA 2O0HA 2J1LA 1CJMA 4RD3A 3SS8A 4AKIA 1Q1QA 4TYNA 3VNUA 1KO5A 2BMDA 1TAGA 4TLBA 1Q22A 4W7SA 1VG0B 4F91B 2YC4C 3IBYA 5FOUA 1TUIA 3WRXC 4B73A 2CE7A 1BKDR 1ESNA 2ZM5A 1GL6A 1XCMA 3HDTA 5EXPA 4O2RA 1NVWQ 4LGMA 5GJWC 4URVR 4JLJA 2B7CA 3A1UA 3EC1A 4NBSA 1GG2A 2J45A 2QROA 2WBLC 1G3UA 1XXHA 3DMDA 3EZ2A 4KO8A 3WHLA 4B3CA 2OCAA 3TQFA 4MRNA 4LPKA 2A5FA 4BPBA 2ZRPA 3O8DA 2PJZA 1IAQA 4TYPA 2A3RA 5FUXA 4M8NE 1KIMA 4HB2A 4LDJA 4B32A 1IXSB 4LOAA 1J90A 1RFLA 4Y0VA 2YVUA 2IW3A 3FMOB 2G77B 3U3OA 1KZ7B 4I1OA 3ZZTA 5M04A 2PZFA 4URYR 3HJNA 3OEEA 5E7JA 4OI0A 3GJ0A 3OIUA 1Q3HA 2D2FA 3ICEA 5JJIA 3AM1A 521PA 4M1KA 5CB6A 1HTWA 3N5CA 4IFBA 2WM9B 1GKUB 3KJHA 2H18A 3DO6A 4LI0A 3TQCA 2WAYA 4DT1B 4UNNA 2Q9CA 4LV6A 2G0TA 4TMKA 3O47A 2OUKA 3KQUA 2ZJZA 4D0LB 2YNMA 4QOSA 1E0SA 4KHZA 3KQHA 3WBJA 1RPZA 4NE2A 3KTAB 1O87A 3AF2A 4P4UA 2PT7A 1W0KD 2IYQA 3CONA 4LJ9A 2WTUA 4KFTA 1AGPA 2BEJA 2QE7D 3B9PA 4KYIB 4D82A 4AYTA 4MDEA 2ZYUX 4LBWA 3V4FA 4DVGA 2FSFA 3LNCA 1AS3A 1YU9A 4X8OA 1FX0A 4P4TA 1ZNXA 4WBSA 3CZPA 3F0TA 1UPTA 2HXSA 2XB2A 1WE2A 1S9HA 2J87A 3T61A 2OAQ1 3FYHA 4P33A 4BEBA 1G1MA 3K0SA 1KI3A 5B57C 5KU1A 1A5TA 2X1VA 4RD1A 2CNWA 3U3MA 1CR0A 4RVCA 2ZRCA 1IN4A 2EWWA 1P9RA 1ELOA 1XF9A 2QQEA 3HYTA 2J5XA 1NF3A 4KXFB 1UKZA 3DVLA 1JPJA 1G7CA 3RRNA 3AVWA 2P2LA 1SKQA 1E4YA 1TU3A 4LBZA 4RJLA 1JJVA 5KDLA 4E5UA 1YR9A 3K9HA 1AZTA 2Q3FA 3AB3A 4Q4HA 5DHFA 2XZOA 1TF2A 1LFDB 1T0JB 2D3WA 2Q21A 4BFZA 4A36A 3RS7A 2WHXA 4M9ZA 5FPSA 1E3MA 3HP1A 4AG6A 2QM7A 3DL0A 2JA1A 2YWFA 5HTKA 3VFDA 2AXNA 3HU3A 4NMMA 4P3YA 4H1VA 2FH5B 5EUMA 4PXAA 3FWYA 3WP1B 5K8LA 4JSTA 3UANA 2GKSA 3I3SR 4TLDA 1O3YA 2OCPA 1XMIA 2P67A 4EQ6B 2C99A 4FIDA 4H1UA 5E3HA 2OE2A 3CH5A 1DE0A 1AS0A 3ONWA 4EKDA 3QXSA 1RRGA 4RD2A 1PV4A 3MWJA 2AD5A 1G8GA 2XNDD 3NEJA 3PFIA 3BERA 1AKYA 5BYKA 5FOWA 2WJVA 4CIDA 1D5CA 1FTSA 5J47A 4BZPA 1KJWA 2DPXA 5EZ5A 1QHIA 4GOJA 4QHTA 4WXRA 3RSLA 1MKYA 4EFNA 3I32A 2G88A 5J5CA 4W5WA 3OF5A 1R4AA 2XTZA 3K1JA 2WSMA 2Q9AA 4TT3D 1BMFA 3B1YA 3QKUA 3U7GA 2N1BA 4Q1BA 1NBME 2WWFA 5A5GA 2GJAA 5L3QA 3P4YA 3MLEA 4LHXA 2OZEA 5FBQB 2D7DA 1YKSA 2KWIA 4HATA 4R9UC 1P60A 2F43A 1Z8FA 1G17A 4LBYA 3W5JA 2QBYB 4KFRA 3NHAA 3CF0A 2ZREA 5FOSA 1OF1A 4CEHA 1SKYB 2FV8A 4KU4A 3REGA 3CX8A 2Q3HA 3KFVA 2PMDA 5DI3B 4EJSC 2B92A 2AHOA 1XTIA 2UZIR 1P72A 2VHTA 2VL7A 2FSGA 1EG7A 4Q01A 4EQ6A 4A4DA 1JI0A 5DH9A 1X6VA 3GLIE 2B6HA 3WYAA 4OHVA 5B58C 1SVKA 1W44A 3A4MA 3W90A 4B33A 3MJRA 2IYZA 1SZPA 4Q1CA 3SJBA 4B2LA 5LD2B 3QXXA 1J99A 3VKHA 2K5UA 4OJKA 3FFBA 5SZJA 5A4JA 2CCKA 4RCZA 2MSDB 1E2DA 4IVQA 1RIFA 4BLSA 1E2NA 4PZYA 4YMVA 1BO6A 4S2EA 1U9IA 1XTRA 1KY2A 4BZQA 1PJRA 5C4GB 3W8NA 4CDGA 3ZD7A 4OHZA 1NJGA 1F3OA 2D06A 1GWNA 2QSYA 3IIJA 4KLZA 1OXVA 4QGFA 3PITA 2VSFA 3T34A 1X3SA 2ODEA 1QVAA 2ODBA 1R5BA 4I4LA 5JS7A 3LBNA 2JGNA 3WRYC 3R20A 4OK3A 1KOFA 2FGKA 1XFAA 2RAPA 4QBHA 2VPPA 3C16C 3SYNA 3I5YA 3GP8A 2WAXA 3I61A 4GNKA 4U00A 3AVYA 1EESA 3C4JA 1G16A 3IO3A 4LBVA 4HB3A 4RZ2A 2ZJYA 4IDOA 3FTQA 5AJZA 5K8TA 3QPUA 3PCRB 4GSYA 4LSGA 4C0AC 1Z6AA 4V03A 1DEKA 3QG1A 4TTPA 4AC9A 1S9DA 2ZEJA 3U6KA 5FPYA 2GVDC 4QM6A 1N6OA 5FPTA 3THYB 3MWLA 3UG6A 1TPZA 4PPQA 1LS1A 2RKOA 2NZJA 2YWGA 3RS3A 4M22A 3A1TA 1XEXB 1T91A 1N0WA 2FWRA 2VP5A 1IHUA 1QHHB 2ZU0C 3Q72A 1GNPA 3QUSA 4A82A 3PR1A 1F2TA 5G3ZA 3CPHA 1RKBA 2MMCA 2VP0A 2W0SA 4FCTA 1U0LA 3AVQA 4TWZA 1VHTA 3GLHB 1UEJA 4NYJR 3JVVA 3H2YA 2GZAA 2OLKA 3B8HA 1NY5A 3NEYA 4WVFA 1GKYA 4AY2A 4D4LA 3AVVA 3EZ9A 5DISB 5E95A 1TTTA 2W6ID 2JIZD 2ZRGA 4OK5A 1XD2B 3TK1A 4F7WA 1KJYA 1E4VA 2ONJA 2WKQA 1E2PA 1OKKA 1U99A 1QHGA 3H84A 1P9NA 3L0PA 1WCV1 4LCBA 3CW2A 2ZUCA 4NCIA 2O8CA 5GJBA 3ZQJA 2C2HA 3C41J 2OFWA 4JLOA 4R71A 2H92A 3GEHA 1GTVA 2ZU6A 4XJXA 4QG7A 2L0XA 2IF0A 1G6OA 2CJWB 2BEKA 2CEAA 1JXMA 2FFQA 2WWXA 4C0KA 1ZVQA 4BGDA 2BBTA 4JVNA 2WWIA 5FBRB 1CR4A 2AWNA 2ATVA 5BWMA 3CX7A 4E09A 2GXAA 4MRSA 1ZBDA 1ZM2A 1W4AA 4GP7A 3L8ZA 4BFSA 4UNRA 3FKQA 2ZSBA 2HXYA 1KDPA 4Q7LA 1W5TA 3BAFA 5E7IA 3IEVA 4CEIA 1XMVA 4D0NA 1KAOA 3L2OB 2WSSD 2ZE6A 2CCGA 4A0FA 1X86B 4PO9A 1JJ7A 4FINA 4A0RA 1CJUC 2EFGA 2REXB 4DBLC 5DN6D 4CT5A 1CU1A 2WPDD 2XZLA 2FF7A 2ZSFA 1XX6A 1Z2AA 1ZD9A 2QTVB 3A8TA 3MG9A 5DE3A 4A1FA 2D74A 2VHCA 1KNXA 4B3XA 4IKEA 1TF5A 1HYQA 4IDPA 1T8UA 5DYGA 1M8PA 2E1RA 1X8KA 1U9IC 1Z0IA 3CR7A 4TMVA 3PG5A 2R6AA 1Z0FA 3GMTA 1NLYA 2C03A 1G3RA 1OFTA 3ZDQA 4O2LA 1NLZA 1TUEA 1M6NA 1BH2A 4LHVA 5B30A 3PJRA 4N3NA 4XWAA 1EK0A 4GZLA 2IXFA 3PUZA 1Z28A
chains in the Genus database with same CATH superfamily
4RQUA 5ELMA 5FIUA 4DB4A 4DUYB 3BD6A 3MTDA 1NIPA 2PXXA 4TRNA 4HUJA 5FJJA 1HH4A 1Q0SA 3FDZB 3OFNA 1KQGA 1KZ4A 2IH5A 1WHSA 1WCYA 3ZG6A 1THTA 5FWXB 3ASUA 4W9NA 2OVFA 2XWSA 5CX4A 1WF3A 3U3RA 5JCPA 1MLDA 2JFHA 4JUCA 5AH0A 1FMJA 5DLDA 2OP0A 4D3SA 5JSFA 4HGOA 3OCVA 1DEXA 4HGPA 4KTVE 3DCNA 3IE0A 4A8PA 1XZKA 3AB8A 3BSWA 2QVBA 5FULA 4MRMB 3I2JA 2Y71A 4OUDA 3MINA 2GMWA 3CRRA 4EG8A 2EIHA 1ZAYA 5DXJA 1JKJA 1KH1A 2O50A 3E22B 1T8PA 3OQHA 1O5IA 2CJFA 2R48A 2R1TA 3BXXA 3W2FA 3U9LA 1GRRA 2QTWB 3IHLA 3NAGA 5EP1A 1KE1A 3CLTC 3W06A 5J23A 4WEQA 2J6CA 1HG1A 1KU0A 4RL6A 2WUDA 3VX3A 2L69A 5JR3A 5BR7A 5CG2A 3PI7A 5EJ4A 2P0EA 1SXJA 2ZYRA 5AVJA 1RT9A 4EKYA 4GMXA 1KK2A 3O2JA 2UXCB 1T5LA 4HDNA 3PS9A 4HB0A 3QLVC 3DT6A 4CF7A 5B2EA 3TX6A 3OECA 4JK3A 5LQCA 1WRBA 4RFSB 1UOPA 4IVPA 2IYFA 1ONSA 2OMKA 4PTZA 3EZNA 1ENPA 4U4AA 1U1GA 1YR2A 1CZNA 2A33A 1TVKB 2B8NA 4MGKR 5EJMA 4BX2A 3CY6A 2WMDA 4BQSA 2O5CA 3RC9A 3WLJA 5KYYA 1NWCA 2PR7A 4RULA 4YJKA 5CIWA 2JK0A 4FLFA 1JVSA 3ZVMA 2O54A 4WUTA 7REQB 4L02A 4L9AA 2W6JA 4J0HA 3I0NA 4CLXA 3KQKA 3U81A 1JFLA 3E0XA 1TD9A 2X5JO 1JB9A 3WICA 5CB4B 1UMDB 2IRWA 3L4EA 4O4IA 4ZAVA 2XQKA 1FXSA 2EQAA 4AD8A 2Y1KA 2GRAA 3N28A 4IOJA 2I3ZA 1KRWA 2FRDC 3CUTA 4ERNA 2G4LA 3DP9A 4N8SA 5CNIA 1Z6XA 3EF1A 3GLGA 3P71T 5H8WA 2BFPA 4M0LA 5C7LO 4FR5A 2AOXA 1WCXA 1OGIA 2J6BA 4Q7JB 1CQZA 4MCIA 1RLJA 4UE3S 2VDMB 3LX8A 4MICA 1RJWA 4J0IA 2ERXA 3OU7A 3UYKA 4FB5A 3A6PC 4G0PA 3HEBA 2OAEA 3ZLTA 3HRHA 1JTVA 1EFLA 4RW0A 3LBHA 3AEZA 4B34A 4BNXA 1N8TA 3C15C 4TXMA 4UULA 4D8YA 4EB8A 2I6TA 4RDHA 3MWKA 3UC5A 4OSPA 1APBA 3R0XA 1Q0QA 3Q6MA 4ZVRA 2GK7A 5G4KB 1H5QA 1IUOA 4EZBA 1YR8A 4DA0A 4WNCA 3DZBA 1GPMA 4YV1A 3W2IA 1XDZA 2XIQA 1YZ3A 1U0HC 5D5PA 2CL6X 2P6UA 4N3CA 1Y4UA 2QTAA 1J8VA 3AK4A 4EITA 4M1MA 1WB6A 3P32A 2O7SA 4QARA 1PW7A 2CXTA 3I8OA 5EUCA 1TQ4A 1RRPA 4DLNA 1EK2A 3A4NA 1BTOA 2FGJA 1XDGA 1YZNA 2BKVA 1TJ5A 1SRQA 2R8OA 2BMAA 3LYLA 3PF8A 3PJEA 5LA6B 5FBHA 3ERCA 3A10A 3DZ8A 3U1TA 4QU5A 4GL2A 4XEUA 5DM0A 4YJ3F 2PRSA 3CEMA 3GAMA 1FP4B 3VOBA 4BX3A 3L84A 2IJGX 3MJCA 2HNKA 4KC0A 4KZPA 4M1OA 3IT3A 1V5IA 4X95A 4JQYA 4LDNA 1SVMA 2Z57A 2QN8A 1YDFA 3GVHA 1DARA 2BHNA 5JH7F 4D26A 1SR8A 1JL3A 2ZE8A 3K1TA 3OCWA 4HXFB 3IVAA 1RAGA 4J1TC 1E0AA 1GKIA 1N7JA 2V7QD 4A10A 1X38A 2YWRA 1CUEA 3ZWMA 4FD2A 4P22A 4PW0A 2PYZA 3PLRA 4YAFA 1NHGA 2SHKA 1UQTA 3DEYX 3ENZA 3O90A 2WE8A 4G85A 3AR4A 1THZA 1YQ9A 1VG9B 3ZE7A 4RJIA 3CVXA 4ITRC 1VLQA 2FW1A 3PHJA 3ME5A 2QZJA 1EYZA 3EN0A 1WV1A 4K03A 16PKA 2ZXFA 2ZWPA 3KB1A 4CU2A 2AC4A 4B4WA 3LQKA 5TX7A 2FW8A 1K6XA 4OHUA 2CD7A 9LDBA 4MMXB 4COKA 4N5IX 2OCLA 3L8EA 4BLQA 2Q6KA 1HGXA 1RLUA 1UFQA 4JIMA 3PD7A 4ZAYA 3ZK7A 4DCJA 4F4FA 2B4QA 3KOXA 1IDOA 1QHXA 2KSQA 1XMJA 1JFFB 4BC0A 5C1DA 1IBLB 2QW1A 3QVOA 1HX7A 4RABA 4RSHA 3VDQA 2R8YA 3AF3A 3FKJA 5LFAA 1N8NA 3A28A 5IDVA 2OCGA 4QU0A 3VV2A 4Z4IA 4AY3A 3BSFA 1FFYA 4BO6A 4O4IF 3C4VA 3GPIA 3VH2A 4FYKA 4BKPA 4AUEA 3E7FA 1MH9A 1VI5A 3BHNA 4W5RA 3DW3X 4LRSB 4EHIA 3A04A 2XGMA 4KUHA 1H0KA 3SDZA 1ZCJA 1TJNA 2D5LA 3GFBA 1B8UA 3ANXA 2FEMA 4ZOCA 3LO8A 4NFHA 3LC1O 3LT0A 4FDTA 2PH1A 3HEAA 1M54A 5K9ZA 4ZEWA 4P08A 1OBHA 3UXYA 4C4RA 2H4FA 1ECFA 1RKXA 3D8NA 1QZUA 2P68A 4OIFA 4U2GA 1G3IA 5JNTA 2H85A 2AOTB 2IGBA 3HXQA 1ZMBA 5ALSA 3KKNA 3ZXYA 2YQ5A 1N3YA 2VTDA 2HKIA 2P78A 3BE4A 3TDKA 3FJYA 4HQNA 4FK8A 4ZDIA 5JNSA 1KORA 3B3GA 3TDNA 3ETJA 1N2SA 4BRZA 1KI8A 4CM7A 1FF9A 1RRMA 3W34A 3QEAZ 3SK0A 2QM0A 4JC5A 3TW0A 2V0GA 4J0QA 4NONA 1P62B 4OY3A 3KP1A 5DMXA 1KJIA 1L4UA 3L0OA 4DXHA 3ADDA 3E0QA 5B6JA 1AIPA 2WIKA 1SQFA 3T9AA 8ATCA 3A2MA 1HDZA 3PXAA 3VR6A 4GR9A 1OVGA 2ZKLA 3JZIA 2VT7A 2W2QA 2FX5A 4O2AF 1JAXA 2JEZA 3EIUA 4HXEB 3DKPA 1US8A 3ECSA 1R18A 5DNVA 3SEAA 5BN3A 2DP4E 4XGKA 4V0NA 5AVKA 2WVAA 5IF3A 1KOJA 2CMDA 4BCCA 2C0QA 3EOAI 1QR6A 2GFIA 5EY5B 4FC6A 1F17A 3IV7A 4P35A 3ZGYA 4RQBA 1J8MF 1KXZA 2W4QA 3EIEA 3MIZA 4P86A 1NKVA 3W5SA 3M1AA 4BVLA 1C0IA 2XNHA 2G4CA 5DHRA 5CFLA 5K0TA 1NTRA 4C0LA 1YVEI 3FWHA 1FX0B 2PY6A 5IK2D 3DH0A 2JI4A 1ZEJA 1DIRA 4UHKA 1XZEA 1J70A 1FTQA 4LTNA 2CDRA 4WE3A 3VKUA 2SECE 2NU9A 3I6YA 1JSZA 4CM4A 3ESQA 2IVFA 4K6OA 2FUG1 5GONB 1QOZA 2XCQA 1HE4A 1C1DA 2HWUA 3F4LA 1PDOA 5HEKA 5I5GA 1X7DA 1WBBA 2J9YB 1A8QA 4CMCA 1X7WA 1HOXA 2AKYA 2X8WA 2HSWA 4HYQA 3GVPA 4ZQBA 1P39A 2R6DA 3BKXA 2HPZA 4B84A 1HQCA 3TTTA 3RVRA 5BV2P 5IBCA 2F1JA 5MN4A 2CMHA 4G6ZA 4MCHA 4V0KA 4L0QA 2EF1A 3ITDA 1XJ5A 3U4DA 3CRVA 2O8BA 2JFWA 1R8JA 2OPHA 3WFJA 4PYLA 3BZWA 4IJQA 2Q6OA 4POAA 1W6RA 4L74A 5JCZA 3O8BA 4BTLA 4G0NA 3VXKA 1M0SA 1QDEA 2C7VA 2QLNA 4D0GA 5ECDA 1WDTA 4K87A 4PFSA 4F7DA 3LLVA 5EGSA 2Z6VA 1WQ1R 2FPGA 2ISQA 3WLHA 4HLDA 4PRZA 1RXEA 4JI2B 1QQ5A 2PGJA 3OQJA 5AJTA 1RWQA 5GZ6A 1NUQA 3VR4A 5K3OA 3OJFA 2ODWA 2CV2A 4OH7A 4QNNA 1GLGA 4I6EA 4QNRA 1CEXA 2FUNB 2QAGB 1QLJA 3NTUA 3IULA 1TJPB 3PFBA 1C9YA 2QMUA 1E4OA 4GYKA 4BFWA 3BF7A 3CTPA 1IPHA 3DE5X 2EHDA 5A9RA 1ADGA 2HLDD 5A71A 2E3JA 2AJLI 5E9QA 3RRXA 1AK9A 5A5DA 1XQ9A 3LP8A 3WGGA 1I1OA 5JEEA 1AK2A 5CURA 2AOWA 1XXHB 3A9RA 1GIAA 1W4BA 2WUEA 3GJ7A 4GDMA 1EXMA 1IOZA 3PRJA 4G67A 2XDWA 2FQQA 3TNFA 1JMKC 1GNTA 1COWA 1XEAA 2V6FA 4Q39A 4FGUA 4P6VF 4DM7A 5ALVA 5CK5A 1M2WA 2X0KA 4B3GA 1K63A 1T2CA 4JR1A 4K9KA 2PSHA 3W2TA 4B2IA 5JDCC 2C5FA 4O5OA 2WT9A 2N3ZA 2P9TA 2VLIA 3DSRA 1CDZA 4PU0A 4DHWA 4IEFB 2ZAOA 3HGTA 4GP9A 3E9YA 4BN0A 1TLTA 4EL0A 4TVSA 3B48A 5D85A 4CQMA 1E6WA 3ASVA 2W37A 4QYXA 4YYZA 3EBPA 4N18A 4RTOA 3GBSA 2QSUA 2ZRNA 3A1EA 4JI7B 2ZS7A 1L4MA 4MPTA 1SBNE 4MO2A 5TXGA 2XODA 1TL7C 4FWTA 3HJCA 3KS9A 4FOTA 4GOOD 4BNLA 4DA9A 2JGAA 4BUJA 1UFKA 3O3MB 3CXRA 3FIJA 2JATA 3IKTA 1WTCA 4NKRA 1DX9A 1GSOA 1XMSA 1R0WA 3JATB 4O3FA 3HBFA 1RAHA 4F3CA 3B36A 5AK0A 1YMVA 1XU4A 1SVNA 1IY1A 2MR5A 1KK0A 1W1WA 3QOYA 5HA5A 5TF4A 4QELA 4QX6A 3TIXB 2PT6A 1GQFA 1NJ2A 2OSBA 4HT3B 3BCSA 4MV5A 1IPEA 4HYEA 1E2KA 1Y5RA 3CEHA 1E9DA 3LT5A 2G3YA 3OWOA 4GGPA 4RKEA 3HVHA 4UARA 1O94D 5FPPA 1MX3A 1N5RA 2ZOSA 3B5JA 3R3ZA 3RIGA 3THWA 3VR2D 4DXAA 1OV6A 3M5PA 2IXGA 1S2GA 3KE9A 2Y0DA 3ROXA 4G1VA 4D6YA 1BXGB 4J4BA 3QE9Y 3TIFA 1XAGA 3WMRA 1T4GA 4IDQA 2BBOA 4FGKA 3CUYA 5A3SA 2X13A 3N76A 4NBLA 2MSLA 1R1DA 1E3WA 3B1JA 3LVBA 3TB6A 4BLPA 2O2IA 1FZQA 1E9FA 3AC0A 9ABPA 4G1UC 4B3SB 3SJ7A 3NHUA 4G8CA 2FJPA 1ZUNA 1PQWA 4R9NA 3FGZA 5E7MA 2Y66A 121PA 3X1DA 2M98A 1ZH8A 1E1QD 2ORWA 2M1ZA 5A6VA 3OQ1A 1VI2A 4LC0A 3ANMA 4XB2A 3S55A 3C4QA 3NHZA 1VKRA 4RUKA 3ELYA 1LXCA 2BBWA 3BL5A 4FHZA 1OV4A 5KUTA 2RKWA 2OUIA 4FKZA 3LT4A 4C6SA 3W5CA 1C4KA 2YNMC 2ZSJA 3C7DB 3QPAA 2LCIA 4DCVA 2A1UA 1A97A 2FLVA 5CD1A 2Q6VA 4DIDA 4JJKA 1U28A 1Z18A 3Q8XB 5EC8A 4YT4A 3AONB 3D6VA 1B1AA 3BIWA 2I76A 5ISMA 1Z4PX 2BH9A 2NT4A 3KTOA 3TD2A 3B5IA 4H7KA 2XXBA 3VPAA 1CF4A 2IBTA 2GN0A 3NHPA 1R8YA 1Z0KA 3AEUA 3IUYA 4X7BA 2KB0A 1HNXB 1VPVA 2WDZA 5CJ2A 1GGFA 5BQ3A 3H0CA 4C87A 1XQWA 3ABQB 3MD0A 1OZ0A 2IX3A 1EGQA 4AMBA 5DLYA 1RE0A 5MN5A 4MV3A 1VYVA 3T1VA 4NC9A 1I6WA 1HUQA 4AJ4A 5I7WA 3GROA 5KOHB 5JYBA 3LGXA 5JPCA 3CA8A 3ZHRA 3SM9A 1UXIA 3IURA 4JI4B 3H8SA 1BU5A 3ZGLA 3W5IA 1NI4A 4CLOB 4DDUA 1NVAA 1IM2A 2OESA 4LHEA 2UZ1A 2OQRA 3AZOA 3IDSA 3GFTA 4CHTA 5E1BA 1TECE 4HP8A 4DQDA 4NV3A 1PRYA 5ALOA 3KJEA 4UJ5A 4M1QA 4NVRA 2FEXA 5KNDA 3HR7A 1N3IA 4KXQA 1ETHA 2ZBDA 1HL7A 2VDKB 5GMOA 2DTDA 2ZB3A 1VQ1A 4R2MA 2HNBA 4IH4A 4YIKA 1P2TA 1ZIOA 1B15A 2WW8A 1QZXA 1Z08A 3OJXA 4Q0MA 1H0RA 2I91A 4L0CA 4PICA 5E9JA 1L7AA 1PQPA 4AVYA 3EOBI 1Q3KA 4BNGA 4XVCA 4KMRA 1DELA 1D2CA 2C2YA 4BB9A 1Z2DA 1GGVA 1ZH0A 2QA5A 1FYWA 2OMEA 3CLSD 1SCQA 1UXHA 3KALA 3M4ZA 1ACMA 3MUFA 3MCUA 1DZ3A 3Q7IA 3E15A 1MU0A 1Y3AA 2BFMA 1UK8A 1FY2A 2XTAA 3JD4A 1E3WB 3F3MA 3I30X 3NG1A 1JEDA 3CRMA 4I9GA 3E35A 4EVQA 4FNOA 3WY9A 3KT3A 1YFKA 4WNIA 4MEJA 1CJKC 3W4JA 3H1AA 3HVKA 4CCYB 5HRUA 3JRNA 2XX3A 3TFOA 2PVCA 3LHDA 4MHSA 4ND6A 3DXFA 5JNUA 3ZJ4A 1GG8A 1K4KA 2ETVA 4YROA 4US0R 3KJIA 3HV2A 3B60A 1DRUA 2UV8A 3SCZA 3KETA 4KQIA 1AY0A 2FR8C 2W7TA 1J0BA 3VYSB 4PY2A 1GTJ1 3A4IA 4DQVA 1A5ZA 1PWYE 3AHDA 1U0JA 4XLLA 6ABPA 1GTG1 3GZTB 2HR1A 1MNQA 2I7VA 3PC2A 2JLUA 4RLHA 1WCIB 1JJFA 1FK8A 1XVIA 2WJIA 5GINE 3O91A 3PKJA 3MBOA 3KU1A 4RYDA 4UC0A 5JJKA 4G0MA 1U5BA 3E5HA 1KQFA 3ZTYA 3C3EA 1OXUA 2HM7A 2V7XA 4TXJA 5CEFA 2JGMA 3EEQA 2A5DA 1CY0A 1M1NA 3O31A 2FZKA 1IZZA 2I8AA 1SKUA 3E9EA 3MJ4A 1DC6A 4H08A 5ABPA 2X8JA 1FSGA 1U94A 2J08A 2ZB8A 3IT1A 4X24A 5REQB 4EJFA 2IV2X 2PUHA 3HUTA 3DE4X 3NGLA 1M8KA 3ZBPA 4QBFA 1EA5A 4UKDA 1W0CA 3NU1A 3N9IA 5CH5A 5T5QA 4HGRA 4KPUB 3RK1A 5FDFA 4UDOA 1FTGA 1KYIA 4ZCIA 4BCDA 1II8B 2J48A 4L2IB 2PCLA 4DTCA 2W11A 3NHWA 3BDAA 2BGKA 2OV3A 1KYYA 1C2YA 1A2KC 1DBPA 1F6WA 2OV4A 2JFXA 1N2EA 3FI0A 3IVMA 3L7DA 2F1OA 3MMPA 3R0ZA 1JXOA 4GPIB 4I1PA 1HEYA 2NACA 2NU7B 4GXRA 4MVJG 2WE7A 3I9FA 4M9XA 4RVNA 5AYVA 5LBUA 3TMYA 4G07A 3MW8A 1QVZA 2J5BA 2ZFUA 1VHWA 3BMQB 4NMHA 3N3BC 2P35A 2X77A 3ZLUA 1CNFA 1C3EA 1R5NA 1V96A 1ZA2A 1U2SA 1IONA 3L5KA 4IJVA 3SSAA 4BLVA 4FLMA 2G0NA 2BLNA 3O2NA 3PSAA 4E5KA 5JECA 5BUCA 4W4TA 1Z3IX 2H2IA 3TLZA 4UQPA 2NXWA 2ODNA 1IFXA 4TWAA 3SG0A 3UF0A 1KO7A 5IWAB 4MS3B 4WA7A 4B1FA 3T7TA 1Q16A 1OX6A 3ZCSA 4BUCA 1FNNA 1XKTA 4CLRB 3EVAA 4E5NA 5LU9A 2NQ2C 3DE3X 4JUFA 2BEWA 4DDHA 1L1QA 4E08A 1BE1A 2DZDA 2FUKA 2G6BA 4QYMA 1U0OC 2G76A 5CD9A 4FHDA 4MWTA 4I9FA 4RZQA 4D3XA 1O0SA 4LXTA 4GBJA 4CM6A 1NVBA 2ZIXA 4HDOB 2WKRA 1XELA 4L8YA 3RREA 4FW9A 4RK7A 3BIXA 1HR0B 1E0JA 1YQWA 2QN1A 1RI3A 3B6EA 3FWPA 3OETA 5AUQA 1KH3A 4F3KA 5BV8A 2NWQA 1IUKA 5HBRA 5EZ6B 1MBZA 3D9QX 1PTJC 1IWBB 1X80B 4OQDA 4K8RB 4XQGA 1XKXA 3RIYA 1BW9B 1JAHA 2ZPAA 4DZZA 3DB1A 1XHFA 3F6BX 2JIBA 4JB8A 1DEAA 3SC2B 4WLEA 4XX1A 2C3YA 5IC5A 3GJSA 2Q3BA 4MWBA 2OHOA 1SU8A 3E1SA 3B6JA 3PQ8A 4DSAA 4ZA2A 2F3SA 2OZVA 4WZZA 5GVSA 1YR3A 3T5MA 1RWKA 3HKDA 4LC9A 5GQSA 1L5HA 4UQLA 4LQ4A 3FLMA 5JD4A 3C8MA 5LQMA 3HK2A 3JQBC 1N1EA 4F3NA 5KWEA 3B1XA 5E8RA 3ZK9A 3UQYS 2A9PA 1H69A 2J3JA 3T7KA 4EMTA 4XEHA 4C29A 1DTEA 4ZJPA 4H9GA 2HBRA 4NX2A 4CETA 1SBIA 5EJ5A 1L5QA 5TEVA 2VBFA 3IA2A 4XIYA 4ZTUB 4QSMA 1DXQA 1A82A 1RVDA 4V38A 5CT4A 1X0XA 3W3AH 2V5UA 1P3Y1 4CDMA 2Q1XA 4UBLA 4PQGA 3ONNA 4WMLA 2GM4A 4RY8A 2DGDA 5ECGC 3H0EA 1LPOA 1Y7HA 3U31A 1K7SN 1KVTA 1RHRA 2CYCA 3HZOA 4FQ7A 5E8JA 4XGNA 3SXUB 5A5VA 3PI6A 1WEHA 4KPUA 5FUWA 4DUPA 3FNHA 1GVHA 2QL6A 3PQ4A 4R7TA 5DBEX 3LXXA 2DF8A 5DEOA 3SLKA 3OEYA 3W4IA 1ZLYA 1ULAA 3CTMA 3HJAA 4GICA 2BE9A 5M2QA 4RVUA 1J20A 1U4SA 2DPMA 2JGLA 3AF0A 3EQ8A 5JPIA 4BAUA 4WKBA 1L7NA 3BCUA 3MQ4A 2P27A 4RMHA 4AO6A 2YV1A 4B4DA 1GLNA 1ST3A 4EB6A 3I05A 3IQHX 3HM2A 3IUEA 3M2PA 3KKQA 4HQKA 1P75A 3ZK8A 1ZJ4A 3WBKA 2IY9A 3H1FA 3NDBB 2H52A 4K9DA 2OCDA 2Z1DA 1EUQA 2VP9A 4E14A 3I76A 2PKCA 2G07A 1GUDA 3OCXA 4RTLA 3RH0A 4DV3B 4R4JA 4R0VA 3V8QA 2I6UA 1REQB 1F9AA 2RBEA 4MA5A 5EXSA 5C0OE 1Z45A 5YASA 3V8BA 1ADCA 2VOEA 4KXWA 4UU7A 2PKQP 3SX4A 3ZQUA 1FUYB 2CXUA 3HYCA 3ZWQA 4BFTA 4UD6A 1KKLA 1EB8A 2F1RA 3CGGA 4DV0B 1UFRA 1XPUA 4KKVA 3LW7A 4QUAA 1HQDA 1X1SA 2AE1A 4RJ2A 3GB9A 3RSQA 2Z3ZA 4H6VA 3ZWOA 1ESZA 4DPMA 3EXAA 1WSDA 1ZVKA 3OLCX 4XSHA 4DC9A 1NZDA 3ABOB 1JECA 3FPGA 3KEOA 4MUFA 4QBKA 4BWYA 5JISA 3OPYI 2QE6A 3A3OA 5HDQA 1B0UA 3GJYA 1XU9A 1YH3A 3MWFA 3P9QA 2J3KA 5DSXA 3T3OA 1AB6A 1SGWA 2FJ0A 1S2LA 3RG8A 4G1FA 3IAUA 3U4MA 3V3TA 1RQLA 4RPGA 3T7SA 4IDHA 4F6RA 3DEJA 3GL9A 1HURA 5IANA 3IO5A 1FTYA 4HZUA 3DLBA 3QH4A 2FZLA 3QW2A 2PZ8A 4A2QA 4H3SA 4U9IS 1P80A 3PNKA 4II3A 2HGZA 3AHCA 4PCAA 3S2FA 1SXHA 1JA0A 2BHLA 5AI9A 4BIIA 1CDDA 5CDHA 2D6FA 1ZDMA 1VJ5A 1JXAA 1GGJA 2OILA 3JARB 4DJFC 2F3TA 1ZLXA 5JNWA 1E9CA 2QMZA 2OAGA 2JW5A 2BMVA 3M6MD 1D2RA 1FUKA 3NC1C 3L1IA 4M87A 1A9TA 2D1QA 2V7GA 4NYMR 1ZXLA 4F2GA 3LC2O 5G1NA 4YALA 3ZV3A 5J4HA 4EJSA 3RM3A 4BDTA 2GYWA 3MMSA 4AW9A 3HP4A 3O8RA 1H93A 4PHHA 2ZYIA 2PGLA 2BI4A 2GZSA 3DHNA 1FFHA 4CTOA 3V55A 3LT2A 4UMEA 4KVFA 1ZA1A 3SC3A 3HO8A 3VZCA 1X92A 4BNDB 1KAHA 5A02A 5FTLA 4JR0A 1BYUA 1JJAA 4Z4QA 3ZGNA 2P40A 2HHHB 4HX2A 3R3HA 2CUTA 4K0KB 4PLVA 3RBAA 2A7XA 1T6BY 5E2AA 4YFYA 1V11A 1PT5A 3WIDA 1J33A 4KQ1A 4CCAA 4JITA 1PF7E 3R7DA 3WGJA 4ZXPA 4K86A 4PCLA 3V32A 3WLIA 1YDWA 2QE7A 1ESMA 4K7JA 1OYYA 1X0VA 1I30A 2DFLA 2XQJA 3PUWA 1PUJA 4HS9A 3AOEA 4RF5A 3TEJA 1SG0A 1WW2A 2JLVA 1A9ZA 2XBMA 1M5UA 2P9EA 4M0UA 1FUUA 2B5VA 3FFTA 1ZJJA 3EPKA 1ZI6A 2GD1O 3O4RA 2ICAA 3GMIA 1PNRA 5F64A 2XE6A 3ACCA 4MVCA 3IMKA 4KDEA 3LGSA 1P4SA 4UDYX 2XXAA 1UC9A 1G5PA 2RCNA 1II9A 3SAJA 4C7XA 4RV4A 5KJCA 5C31A 1YNOA 1GYQA 3GFVA 4MRPA 1Q7BA 5CMLA 1REQA 5FORA 4Z0TA 1L5KA 3TPCA 3UK7A 1LPMA 4A6EA 1DTWA 3O38A 3K9WA 3X0DA 4ZRNA 2AOUB 2JCXA 5EL0A 2OVBA 4J3FA 3S3TA 3ZHCA 3FCYA 4HAOA 5G4LA 3ZEIA 1C8VB 4BV3A 1DTSA 4TLLB 4WA8A 4ILKA 1K5DA 4Z4CA 3EZFA 3EA0A 4YC7A 1VCOA 3NPAA 1PR5A 3NM4A 3I62A 3L1UA 1JE0A 4MEBA 3GAZA 5FR2A 4R1PA 2RJ3A 3SHWA 2ZUWA 2ZRQA 3WV4A 1I6LA 1LJUA 3JQFC 1R8QA 2NO9A 3ETLA 4XGIA 2R7MA 4BP8A 2QY6A 4I1SA 2JAPA 1CY4A 3KUUA 4KUGA 2IF2A 4ZV9A 3ZE8A 1X74A 3WLSA 1QAMA 4NU0A 1HT1E 3A1SA 3ZJUA 3FZGA 1O95C 3LLCA 1I8TA 2V4MA 4N39A 5EJ9A 5F98A 4D56A 4PC3A 1J21A 1WG8A 3H9BA 3MEQA 2PXHA 3TJMA 4F6RB 3U39A 1HORA 3NM5A 2G5CA 1ZC4A 2PK3A 1P17A 2VEOA 4MR8A 2GEFA 1T26A 2J30A 3LBAA 4H3KB 4PZ0A 2J3HA 3WLEA 1TJYA 4NEQA 2Y1XA 3DE0X 3EEYA 1ODLA 5G41A 3TQQA 3WGUA 5BMVF 3OOSA 4TROA 5HKKA 3GRAA 4E94A 2CVQA 2X4IA 1BQ3A 3WAKA 4BO1A 5KNLA 1G20A 3ZXIA 3HCFA 4KAXA 5IBQA 1OWNA 2V3VA 4BMPB 5IHXA 1YHYA 821PA 1I1HA 2PUTA 2FUG6 4TSFA 1RXSA 3EVZA 1ZINA 1NW8A 2IDMA 4FQ5A 4KO2S 4QOJA 3CNEA 2CBZA 2XVAA 1PYDA 3RT1A 5ITSA 4EY4A 4BYGA 1G8SA 3FFXA 3WLFA 2DUWA 2B25A 2PA3A 4JKIA 5E4YA 4EATA 1BDJA 4RBNA 4R1UA 1NJFA 1GT91 1SXIA 3ZGXA 2A7QA 1H2XA 3OQBA 2POQX 5TDHA 3WQQA 1ULZA 5BVHB 5LP1A 4MWDA 4TL9A 4II7A 4HWOA 4KQKA 1YDHA 2RK4A 2QGZA 3S2ZA 3SQMA 3QPDA 3VUFA 1ENOA 5AMXA 4LGVA 5J4YA 2Y3IA 4I81A 4BX0A 2R84A 3C5EA 4UXIA 1GDDA 3DBHA 1KMNA 4UAVA 1IHYA 4GPD1 1SPXA 2Q46A 2YJTD 3FR8A 4FEEA 2Z1NA 4EARA 4E07A 3MMZA 5SZHB 1EFCA 1Q44A 2XDQB 3GQBB 1Q12A 4FDUA 4F72A 1B6TA 2JVJA 1BS2A 3Q87B 1S96A 4D44A 2OENG 2WG2A 4Q4AA 3FOAA 4GU5A 4F5WA 4C0JA 3DDOA 5EHGA 1H2ZA 3O9MA 6CHYA 5ADWA 4J43A 1D6NA 2O4CA 2Y1WA 1K89A 2DHDA 3OCZA 4Y98A 3PWTA 4F85A 2PX0A 3SYMA 3L7IA 3NIDB 2QQGA 5FUYA 3WGTA 1SC9A 4IH9A 4JLWA 3U17A 3BQ9A 1UJ2A 4COOA 4URZR 1PNQA 1L5RA 1UOEA 3RE1A 1U5CA 4ETNA 3NAQA 2UUBB 4IH1A 3HJBA 3BWCA 3AQ4A 3G59A 4OFBA 4R98A 3H2SA 2H2HA 4UTRA 1J22A 3O8QA 1HEUA 1M3SA 1YZVA 3AFMA 2FMIA 4G37A 3VH4A 2XUZA 3M70A 1SHLA 3P96A 5A7HA 4O02B 2HIHA 3QTTA 2RHJA 4MX8A 4RTMA 2V8OA 5I47A 5FD8A 2VJYA 1WVGA 3RJZA 4AAYA 1FQWA 2EYQA 3E9NA 3WL3A 4NNJA 2JAQA 1E9AA 4XQEA 3N59A 3KNZA 1X15A 3ICCA 3RFCA 1M8GA 1W1UA 4A8JA 4A9AA 2G28A 2X4DA 2ZULA 3GJ5A 3QYAA 1FXUA 1KBZA 3EGXB 4J7CA 4QOEA 2B3TA 3W5UA 4Z1OA 2Y2UA 3PJFA 4ON9A 4PC1A 4G56A 4Y67A 3WYGA 3VJRA 1W19A 3QTLA 2G63A 3PL5A 4LNAA 1NT4A 3UMFA 4DRZA 4HNQA 1TZBA 5IG2A 1P31A 3QKSB 2OT3B 4G84A 1NBHA 1J0EA 4FDMA 3KUXA 4X91A 2EIXA 3OJOA 4OHRA 1ETUA 4RCYA 2PKRA 2H4HA 2BFFB 3GLIA 4XARA 2F1HA 4URUR 1SHKA 3L1VA 3A6FA 4G5RA 1SXJE 2XWPA 4ROSA 1VJCA 2AKAB 3SNKA 1FRNA 4FB4A 1Y8RB 4MP8A 2JHFA 1XEWX 4ODIA 3IDQA 1RP7A 5JANA 3F73A 2RHGB 3G8BA 4TZTA 1G7RA 2R6GA 2AWOA 3GDHA 2JPDA 3L7JA 4F1JA 4OU5A 3ZIUA 4A5OA 3H16A 2CF6A 4CT4B 1XTZA 5JC8A 2AVNA 1V0JA 5JVDB 4MYSA 4E22A 1GAEO 3GRFA 4EYKA 1UMDA 1FP4A 6ADHA 4LF4B 1BMTA 1CRPA 3TECE 1T1RA 1UXKA 1GUZA 3L4BC 1PEYA 3FGPA 3T8YA 1PJSA 3WSTA 1W46A 2VQDA 4YRTA 2E5LB 1E3SA 3A05A 4LMRA 3B8EA 5TV2A 3I2FA 3VC2A 2ZETA 1L9KA 4ENSA 4RWEA 4OBEA 5HX7A 5JJLA 3AL2A 1S2OA 3LPNA 1JFVA 1T6YA 4HPJB 3REFA 3T99A 2OHHA 3RRBA 4LZLA 3R75A 2VDVE 5KC9A 4IBOA 4UOQA 5BO5A 3UGTA 4QWMA 1T4CB 4D9BA 5C8ZA 2CLIB 4JLAA 4RHXA 1RHUA 2WPNA 1S8OA 3IDFA 3IBSA 2G9RA 4C7VA 3W2GA 3H9UA 3O1LA 2O3QA 3H2JA 5FPKA 2FVYA 5K0SA 5J1TB 2ZI3A 3CV3A 4GO1A 3G2OA 4FZRA 2RI6A 1IY2A 1SHJA 3H4VA 1P77A 4Y2JA 1M6VB 1I5OA 1YVDA 4QJ5A 3NHRA 3MZ0A 1ECPA 5EIHA 4Z9YA 4WERA 1JN0A 1K08A 5C32A 4YMLA 4TS4A 4TSKA 2OQVA 1N2GA 4U7JA 1XZ8A 1Y1LA 4UCXA 1JF8A 1O77A 2WC1A 3HHEA 4I9UA 5KDOA 2ZLBA 3NGMA 6NULA 1R0YA 4HEHA 5LUBA 4R8VA 1U2QA 1TMKA 1ODCA 1GPBA 3RSHA 1A1SA 4LNUB 1F8UA 4Q9AA 4FMCF 3BL8A 2G1JA 1TAUA 1I2BA 3USES 1PQYA 2BPOA 4RDXA 2PZKA 2QPOA 4ISBA 1PFKA 1FSSA 2D0PB 1PJ3A 3BH6A 3KSRA 5FA5A 3GN2A 3D0KA 3TRDA 4EDFA 2X3YA 3PHCA 2O8CB 2LKDA 1VYUA 2C5HA 1A7JA 1KPHA 2EW2A 3IV6A 3NP9A 2ZS9A 2BUAA 2I65A 1N75A 1RHJA 4FJ2A 1S5PA 1MQ8B 3RIXA 1PDWA 1F0NA 5JQGB 4EKIA 1EXWA 2QJRA 3RAPR 2OHJA 1JAIA 1F2UB 4MVJF 1XZBA 4PAGA 3Q7QA 4CFYA 3ZDEA 5CIYA 3I5UA 5B55A 1QC5B 4ABYA 1EFTA 2QLBA 3W6PA 2OV8A 4C07A 3C5WP 1ZUD1 1JR6A 2FETA 4N5MA 3P2KA 4RM2A 1WABA 4EL5A 4XJVA 3JQ6A 1WXFA 3PICA 3LOQA 2FOXA 3C5CA 1RM0A 1IG0A 5J4KA 2ZTSA 1QYIA 4NESA 2Q5OA 4N7MA 4A6DA 2IHYA 1T3ZA 1YBAA 5KNBD 5ALFA 2X3FA 4D4HA 4D80A 4MRAA 5AVSA 1BDHA 3WMXA 3C5VA 3W1VA 4PC6A 1JVNA 2QTZA 3OQVA 4TTIA 4WESB 4HI0E 4IGEA 1AA9A 5TVKA 3HYNA 3KB8A 3KAJA 4IRXA 4YRBA 4BATA 1U2PA 2R85A 4I2VA 4IHKA 1GITA 5AKXA 5IH3A 4NXMB 1EG2A 3AESB 1FJHA 3OT5A 4JJAA 1XNJA 2IDZA 4B9EA 3ZKAA 4EGSA 3E9DA 1XBTA 3E82A 2H0QA 4ZGGA 2YIDA 4MAFA 4EAQA 5AI4A 2QVGA 5KIAA 1EUYA 4ZCRA 5JUWA 2Q2NA 4UEOA 4LCJA 2WQ6A 5BWBA 1QV6A 3B2QA 3O1JC 1NBMD 3QF7A 4S1OA 5A5FA 3HY3A 1UJ6A 3C3JA 3KX2A 2RH8A 4K6CA 2F62A 3L01A 1R9NA 4NBNA 1NF8A 4WZAA 5TY0A 3COJA 2C8JA 1MOQA 1SXJB 5JMWA 2JCSA 3TJZA 4M55A 3WWYA 3U5TA 3IUNA 4GH5A 5ELLA 1HMPA 5KJ6A 3RVBA 1IBCA 3T7AA 5TPWA 3AVUA 2XMSA 4C0SA 4LY3A 5IDWA 1Q0TA 3GFGA 3BQNB 4U7FA 1QR2A 2OBLA 3DMYA 1G21A 4PXSA 1YDGA 2JCGA 2NADA 4V0QA 3SYKA 2X0FA 3N07A 3VR6D 3FCCA 3UHFA 4TWJA 1WF6A 1MRNA 2FRVA 1E2QA 1EZ1A 2Z8YM 1XU7A 3KEQA 3NAZA 5B4VA 1HF3A 5CFNA 4GECA 4JS0A 4OYRA 4S12A 2ZCJA 1OX5A 5EKXA 3G5LA 5H16A 4MW2A 3CEJA 3LLSA 3ROKA 3WMEA 4DWJA 1XNRB 4FE3A 4JEMA 4D57A 1A04A 1VMAA 2FN4A 2ZVDA 2I2DA 5IMBA 3X1MA 2OYCA 4AECA 1K6JA 4CKZA 4JB2A 2E37A 3VR6H 2F4VB 4JOQA 4Z3DA 3CCFA 3KOOA 2WP0A 1TAQA 3H2IA 1DX6A 4NNPA 4V0OA 4UU1A 1TEHA 2LIPA 5SY9A 1DG9A 2ZITA 5ALPA 3GLHA 4RA9A 4Z7QB 2X8BA 3PC7A 5BSGA 5HQJA 2Y92A 1FBTA 5CPFA 2YASA 4OOFA 4FPXA