3FE2A

Human dead-box rna helicase ddx5 (p68), conserved domain i in complex with adp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
234
structure length
234
Chain Sequence
QEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Probable ATP-dependent RNA helicase DDX5
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fe2A00
2PZFA 1K6MA 1UJ2A 1Z0JA 2PT7A 1WDTA 2JJ2D 1XXHE 5CK4A 3CR8A 5F3WB 3GLFA 1E98A 4EFLA 5CYOA 5JSZB 1R8QA 2F1RA 3LX5A 5K8UA 3V00A 3ZDQA 3WMFA 3TJZA 2XZOA 2ZI6A 3K0AB 2WWFA 2VF8A 2VQSA 1N6KA 3CWZA 1P4SA 4LRWA 2GNOA 1WBBA 3AUXA 4LJ6A 1D2NA 2CEAA 1G3MA 3VMFA 1SZPA 5IRCD 5EP3A 3GLIE 2DFLA 2YC2C 4XSHA 1R0YA 2QRNA 1GL7A 4IVPA 1LY1A 2WSMA 4B3CA 1J8YF 3LW7A 1D9XA 2FFQA 4PPGA 1CBUA 1S8FA 3FKSA 4DIDA 1PJRA 1T6NA 1ZUIA 2ODWA 2A5GA 4B48A 3RS0A 4CVNA 2FZLA 3RLFA 5L3VA 4XVRA 3ADCA 4Q5IA 2FF7A 3QXHA 2ZYUX 4GOXA 4RD6A 1W5SA 4Q1CA 1OHHA 2DWQA 4A15A 1G8HA 1AIPA 5C2JB 4A1FA 1FX0B 1R0XA 1BIFA 3SS8A 2LWIA 3EX7C 1E4YA 2QTVB 4OQLA 2HXYA 4L15A 2VL7A 4MUAA 3RS5A 1II9A 1ZUNB 4TT3A 2QPTA 5JWHA 3VU9B 4OJKA 4OL0A 2Z6VA 3ZVNA 3MGCA 1L2TA 2GCOA 3AF0A 4AKEA 2IEZA 4Q9HA 2PZGA 1NP6A 4L9WA 2J1LA 5C4GB 1OFIA 1PUJA 3RSLA 3IHLA 1OB5A 5FR2A 1CR1A 1XCGB 2E87A 2IYWA 3LXXA 4P33A 4JSTA 2DYKA 1AK2A 1X8LA 1KO8A 3SBDA 1XCMA 1E2FA 2Q21A 3BC1A 1OXTA 1DARA 1Z8FA 2KI5A 2IYVA 2CBZA 2DBYA 5DHFA 3CONA 2WSSA 1TF7A 3MAAC 1IN4A 4IOMA 2AK2A 2P0EA 4RD2A 2GCPA 2Q6TA 2ZUDA 4EPXA 3K0EA 3QKRA 5DI3B 3TE6A 3W34A 1ZNWA 5FI0B 1ZM3A 1GWNA 1JEDA 3K0CA 3L8ZA 3TIFA 3U2QA 1G7CA 1Y3AA 4FWTA 1YZUA 1YR9A 1E79A 1EWRA 2ZSDA 3DEFA 1JR6A 1Z3IX 1S4QA 1MOZA 4PSVA 1UM8A 5IK2D 5HE8A 4M1WA 1LS1A 2QP4A 4JYBA 1DELA 3FE2A 3GD7A 4JBXA 2QTHA 5CITA 1TPZA 2BBWA 1MO6A 3R9WA 4QGAA 3W8RA 2OHFA 3FHCB 3ONWA 2OO7A 2HEIA 3SR0A 1BMFA 2GZAA 3A4NA 1U0JA 3AP2A 4KHZA 4GMXA 1ZBDA 2O5VA 3CRW1 4DRZA 3K70B 3THXA 3FOZA 2IYUA 2J7KA 4V0LA 1IY2A 3PUYA 3WRYC 4G5SA 2GJAA 1JALA 4JL5A 1W4BA 2PEZA 2RKOA 2ZJZA 1CJTC 3FPAA 5TDHA 4QJ5A 2W0MA 3BIFA 2HCJB 3IKJA 3K0FB 3M1IA 4IRUB 4JT2A 3ZD7A 1DEKA 1SXJC 3B8HA 3EA5A 3ETLA 2CNWA 4C2UA 3V9PA 5FH9A 1MT0A 2ZE8A 1N6NA 2XNDA 3RAPR 4B3GA 3ASZA 4HAWA 4LJ8A 2OCAA 1KI3A 4XD7D 1V43A 1T5LA 3V4FA 4AK9A 3ZZ0A 3CX8A 2FSFA 2KSQA 3ZVLA 3T1QA 4GNKA 1PV4A 3TUIC 1KMHA 2ZRLA 2NO0A 1EFCA 3NHAA 2WKRA 3B82A 4IEIA 4XVUA 1QHIA 1Z0IA 1K5DA 2ZREA 2OSBA 3KFXA 2ZRNA 4AY2A 2BC9A 1OXVA 2ZYVX 3KDSE 2JLXA 4RFSA 3KKPA 2PCJA 4YMWA 5AUQA 1JBKA 3MG9A 4RD0A 5DN6A 5SZKB 4NTZA 3B60A 4BZXA 1RJ9B 2J7PD 1NIJA 3TUJC 5IF9A 5EXPA 2J0QA 2P6UA 4AURA 1R5OA 3KKMA 4TYWA 1DBSA 3R7WA 4MDFA 1G7RA 2OESA 5HR5A 3UKDA 4A6XA 3AF4A 3O8RA 4LI0A 1MO5A 1WB9A 2RB4A 3LQQA 1QG4A 1OJLA 1SXJD 4DC9A 2MMGA 3QVVA 2JDIA 1AKYA 1CIPA 3CNNA 3ND9A 2BHRA 3OIWA 3MRSA 4ARZA 4F93B 3R9XA 2F1HA 2J3EA 2W2XA 3ADDA 5CJPA 1NN3A 3C4JA 4LBWA 4TLCA 5KPJA 4I1VA 3U3OA 5CDFE 4BEBA 1RRGA 4Q1AA 3EPHA 5L3SB 4GL2A 3ZZTA 4A4DA 1XCPA 1M8PA 3AVTA 2A78A 5FTJA 5FPSA 2ZJ8A 3CX6A 4LV5B 1CR4A 1KI7A 4HUTA 1Z2CA 2RH5A 1E1RA 2A3RA 5E7JA 2F43B 3K8YA 2WIAA 1JR3D 3LBNA 3T06B 3FFBA 4LJ5A 2GXUA 5CLLA 2GXAA 4PSKA 2VH5R 2ZU6A 1S9HA 3OF5A 3R20A 3UANA 3WRXC 2ZR0A 4A0HA 5J4HA 3U5ZB 1KDRA 3NDBB 3SI7A 2NOAA 2O0HA 2V55B 4EPWA 4JLJA 3B9QA 1NBME 4V03A 2JIZA 2IC5A 1W36B 3PUVA 1R2QA 1KJYA 3BORA 1UBFA 1XFAA 1G17A 4KYUA 1U98A 2GJ8A 4BZQA 4O2LA 3Q72A 4GRAA 5K8IA 5D3MB 5BN5A 2CL7X 3FDIA 2QM7A 4C0JA 4V0ME 2C2HA 3H4MA 3LVQE 4QBGB 3GJ5A 3GEEA 4AG5A 1PUIA 1XD9A 3QF4B 2B6HA 5P21A 1FTSA 3ZVMA 5GJBA 2CDNA 3HYRA 5HZHA 3CPHA 1NLFA 2ZRKA 4DCNA 5B58C 1HE1C 1AN0A 2CCKA 1E3MA 4IKEA 1L7VC 4AKHA 3VHLB 2GCNA 3OFND 5FUWA 1YZTA 1QG2A 2BBSA 2WOOA 3RC3A 4FMCB 3SE0A 4MRSA 4IHQA 3C14C 1O87A 3MWJA 5EP2A 3PXGA 1W46A 3U60B 3DOEA 1G6HA 3W8NA 4B43A 1NN1A 1QVAA 4JKYA 2IS2A 3B1ZA 1OT3A 2IYZA 2VHCA 3NIBA 4TSFA 2J0VA 4FWIB 1KO7A 2HYDA 2V6IA 2VIIA 1WQ1R 3MCAA 2NMVA 3TGPA 1S1CA 2QROA 3BAFA 2FJUA 3PIRA 2RHMA 3AQ4A 2EQBA 2ZPTX 1G8YA 3QJYA 4NU0A 2HF9A 3AKEA 4AYXA 1NN5A 1KDOA 1Z63A 3NBFA 2BM0A 3DM9B 3RDPA 5BQ5A 4C3ZA 4ZCLA 3UIEA 4KFSA 5H68A 3AV0B 4BPBA 1Q57A 2BKEA 3TRFA 1US8A 4A92A 1EWQA 2IHBA 2IEYA 4Q21A 3PCRB 4FMDB 3BD9A 5EE3A 3MJHA 3X1ZA 4DSTA 4Q4HB 5KHOC 1HTWA 3BH7A 1DTSA 3GEIA 5GVSA 3S1AB 4D25A 3NTUA 4I4LA 2J0UB 5CDFA 2Q3FA 3TSWA 4Q9LA 3Q9LA 3VR3A 1F2UA 4N0DA 3VR4A 3U61B 3DDCA 1ZC4A 4NYMQ 3C15C 4DLYA 1G5TA 2DHRA 4KJZA 2O0JA 3C8UA 5DI9A 1M2OB 3L43A 1XD8A 2RCNA 1Z6XA 3VNVA 2ZVPX 4LWZA 2PBRA 4PAQA 2WPDD 4PTLA 1UBEA 1GKUB 1H8EA 3DZ8A 1TADA 4PSAA 2YJTD 4DUGD 4F4IA 2IYLD 1IQPA 1D9ZA 1R4AA 1VMAA 1XEFA 1EFRD 4TYYA 3WHLA 1IY1A 1SVKA 2CCGA 4TTQA 4URXR 1PLJA 1ETUA 1NBMA 4LYFA 3VU9A 2C77A 3P4YA 3K70C 1W49A 4HAYA 3SN6A 4YDHB 5TMPA 2GESA 4I1UA 3UWKA 3GMTA 1RPZA 3EIEA 4BQSA 1U0HC 1E2GA 5TVKA 1M1YE 2J41A 3NVAA 4TLDA 4JLNA 1KO1A 2WKQA 3BBPA 1VYTA 1KI4A 2H18A 3KQNA 3Q5EA 4G01B 4TMWA 5JJKA 2ZRMA 4HDQB 2QAGA 3FTQA 1YZGA 2WWGA 2HLDD 2V3CC 3RS3A 2QORA 2UVQA 2CK3D 1T3HA 1RYFA 1U8YA 3I92A 4TMXA 1EFHA 3VHXA 2OFOA 3BK7A 4YC7A 3RS7A 1S96A 1TMKA 3QE0A 2WJIA 1W1WA 4JJKA 5FOUA 5GJVC 721PA 2AL7A 4V02A 3RC8A 3MWYW 1SHKA 4KAXA 3SBEA 3EAQA 1P60A 2ZR9A 1MABB 1OSNA 3GCGA 5C18A 4P4SB 1FUUA 3UMRA 2WWWA 1D2MA 2EFEB 3TK1A 1YR6A 3TR0A 1WMSA 1ZC3A 4J0QA 5AJZA 4JLKA 5DO9A 5JLJA 1ZCBA 4ON9A 3Q3JB 4LHYA 3NG1A 3R8FA 1F2TB 3AVOA 3W6PA 5CB8A 2ZSFA 3FHOA 2RGBA 2FSIA 2RGCA 1WXQA 1VYVA 4LC1A 3A1TA 4QBHA 4EPRA 2ZI7A 1NVUQ 1JAHA 1SVWA 3OZXA 1AJEA 4RFVA 3R9IA 3EG5A 3W3AA 2J59A 2FN4A 3AGPA 4KVAA 4QL3A 1SVIA 1DADA 5ELXA 1P72A 3K0FA 2YWGA 4QG7A 2W6IA 1KY2A 4B71A 2CE7A 1E0AA 3LRPA 1ANKA 4V0KA 2HV8A 2YWEA 3JVVA 5FOWA 4PFSA 3EC1A 3D6TB 2AKAB 1GL6A 1FNMA 3NKVA 3QOFA 2BCGY 4PQYA 4BGDA 2VP5A 1YE8A 4M8NE 2GKSA 1DAFA 2QPOA 2C99A 4OQMA 4GSYA 5TXGA 1G4AE 2PL3A 3R8CA 3T15A 1Q3HA 1CKEA 3VR1A 5F98A 2X8AA 4PC2A 1SGWA 4KV9A 3SJAA 1XJQA 1G21E 5AR1A 1G3QA 1TU3A 1KDTA 3WNCA 1W36C 1AZSC 2GJSA 4PAOA 5G41A 3KKNA 5KUTA 3IPXA 4DLZA 1NLYA 5G3YA 1IXRC 3QI2A 4MQBA 1RJ9A 3DMNA 4WVFA 3P20A 4FI3C 4GOKA 1SVOA 1GUAA 3K09C 1KK2A 1KIMA 2QG6A 3IQXA 4CT5A 3MWLA 2H92A 2OCBA 1NKSA 3RRMA 4D81A 5L8VA 4CW7A 1XZPA 4HI0E 4MA4A 2ZE7A 4LK2A 3Q5DA 4D0NA 3ZLJA 1QHHA 1Z5ZA 2VEDA 2ZRDA 3IQWA 4UJ5A 1TUIA 4K46A 4U02A 4D80A 4DLSA 1G4UR 3RANA 1COWA 1Q21A 5EXXA 1X8JA 4KODA 5EUMA 4P4UA 2CHGA 3Q8XB 5KDOA 2CLSA 2QEQA 4OHVA 4EPVA 4M9QA 4OQXA 1UKEA 5JHHB 4RZUA 2R44A 4H1VA 4MYCA 2HJGA 1JNYA 1N0WA 4D4MA 5CB6A 3IEUA 4WBSA 2FX3A 2NTYC 5A5GA 1RW4A 5JS8A 2VTKA 4TLEA 1J8MF 4L4UA 4Q48A 1YZLA 4B3XA 1Z0DA 2R8RA 4ZV4A 3C16C 4DB2A 1HQCA 1K8RA 5D3QA 3ZQJA 4JIMA 4O2RA 5HZKA 4V0OA 1FP7A 4URYR 2CHVA 3CNLA 2QSZA 3ZH9B 1GILA 2F1JA 1CJVC 5BW8A 1CP2A 4HB0A 3VR6A 1M6NA 3PUWA 4LOAA 3I32A 4A0GA 4XWOA 3CWQA 5FPTA 4F92B 1ZP6A 4F91B 2NPFA 1E2QA 1KNXA 3UG6A 1RE0A 1ESNA 1KAOA 2F7SA 1XD2B 5D3MA 3AM1A 5JRJA 4KSBA 1SXJB 2P3SA 4NONA 4UNNA 2NG1A 1W2GA 2GRJA 4B3BA 4EPYA 2DWPA 1JB1A 1RIFA 4UXHA 2ZE6A 5HKKD 2OFXA 1U9IC 2QE7A 4TN1A 1I2MA 4LYAA 4MKGA 1J70A 4DSUA 1FW6A 2OBMA 1M34E 1TF5A 1P73A 2HUPA 1P61B 3UMFA 3KXIA 2B7BA 2CCJA 2P2LA 2V1XA 4MGKR 2GWHA 2BEJA 2ZVQX 1Q3TA 2KBFA 2G9NA 2IF0A 2N1BA 4W9MC 3A36A 1MO3A 2GAAA 4Z1MA 1IOZA 1S2MA 5E3HA 2XTNA 2GVZC 3W90A 4KLNA 1JQLB 3HJNA 3FMOB 4OKSA 1CJUC 4Q18A 2ZJYA 2FE4A 3EZ6A 3QKSB 2QBYA 2G1JA 2FNAA 2QP3A 2QY9A 4QGHA 3EC2A 3WYAA 821PA 4PR0A 1YZKA 3TUZC 5LBIA 1QHYA 4IXNA 4JVNA 2CLDX 1AA9A 2ZS8A 2CL0X 3ZIAA 4LJ7A 1E0KA 3AVWA 5FOSA 3KZ1E 2KBEA 1KZ7B 5C46F 4ESVA 2W6JD 3T1OA 1G3IA 4BASA 4Q4HA 1IBRA 2AD5A 2ZJ5A 3CX7A 4C2TA 4HAVA 1NG1A 1N5LA 2OCYC 2BMEA 4KBFA 1QHNA 2C04A 3Q85A 3IIMA 2Z4RA 2Z5FA 2ZETA 2QNRA 3EPKA 4DLTA 1KO4A 5FL3A 5FTLA 1G5PA 1DAHA 1TX4B 3O8CA 2I4IA 4AKGA 1MKYA 1B0UA 3I5YA 1VCIA 1JEEA 3OE7D 4EJSC 1KI2A 2CJWB 3TMKA 1XNJA 1TQ4A 1LFDB 4OI4A 2A7QA 4DLVA 2ZI4A 2WMOB 2DPXA 3C5CA 1V5WA 1XEWY 2VA8A 3B5JA 4RD3A 1Q44A 2K5UA 4P3YA 3BGWA 4ZCIA 3AEZA 1A7JA 1Z83A 5IT5A 3NH6A 4WXRA 1K5GA 1VDZA 2VHUA 5HCIA 1CR2A 3KB1A 4WIAA 2AR7A 3ADKA 1OW3B 2H5EA 4LV8B 5J4VA 4D0LB 2JJ1A 4DLWA 1II8B 1RVDA 1D8TA 1Z29A 1ZUHA 1NNEA 1W4CA 4P31A 4ILEA 5EJEA 4EDHA 1R6BX 2QQ0A 3GFOA 3DVLA 3LBIA 1SKQA 1CU1A 4HZUA 2P65A 1R0ZA 5EXTA 2FDCA 3OEEA 2YOHA 3EPJA 1FFHA 1G9XA 3OIVA 2SHKA 1HH4A 4DWJA 5M04A 4JJZA 2V4ZA 3CM0A 4CEJA 1A5TA 4QM6A 3FKSD 1XX6A 5AJWA 4TYNA 5KNBA 1P2SA 3M0EA 4Q4AB 4HLQB 4A8JA 3FGNA 4G0NA 1MABA 1UEJA 1XEXB 2VHJA 1UBCA 3FKQA 3NWJA 2O0KA 3QEOA 4LX0A 3RYTC 1Z2AA 4P4SA 3CRMA 2IYYA 1EFTA 1KGDA 1OHHD 4OJQA 2V1UA 1KK1A 1ZNYA 1U8AA 1T3SA 2R2AA 4UXJA 3WMEA 3SQXA 2FWRA 4MDEA 2XB2A 3HU1A 4HUQA 3U44A 4C7OB 121PA 4E09A 4HATA 4PO9A 1E9FA 2W00A 4L5BA 2IWRA 2ZAMA 2JLWA 5EE0A 1R7RA 1W0JD 4UQOA 2OILA 1IN6A 5BWMA 1KSGA 4B2IA 4IOLA 1ZD9A 1SXJE 3ZYCA 2F9LA 3KJEA 3VFDA 1OXSC 5LD2B 4HDOB 4NYIQ 3SJCA 4P0TA 4II7A 2EWVA 1WE2A 4HLUC 1ZNXA 4X8HA 1MH1A 1HE8B 1NN0A 1Q1ZA 4AC9A 1FNNA 2WSSD 1W2HA 4M1MA 3AGQA 3GLHA 4AWXA 2PCLA 4CGZA 4TQUS 2OV2A 4GOJA 2D62A 2XXAB 1Q0UA 4GP7A 2FPMA 1TNDA 2R62A 2OXCA 4CEIB 2FFHA 4JMPA 1JR3E 4NMMA 2WZQA 2GZDA 2RGDA 4HB3A 5KSZA 3HDTA 3THYA 4TMVA 1ONBA 4OQFA 4BLOA 2GJKA 3PV0A 4BFZA 1AS0A 4DLXA 3Q7QA 1CULC 1YU9A 2Z43A 2L0XA 2ZTSA 3N5CA 5JWOA 1XXHA 2ZRAA 2C03A 2IHYA 3P4XA 4A2PA 1FP6A 1UAAA 3L0PA 4Q7LA 1XZQA 2ORVA 4QBFA 5IDVA 1G1MA 2IS6A 4QNRA 3WXMA 3DKPA 1BMFD 1XBTA 2RGNC 3CB4A 3U4QB 3CRRA 2I1VB 5AUNB 5DE3A 3WNBA 2YOFA 4IJMA 4QOSA 3SU8A 3X1DA 3UATA 2VYFA 5CYPA 1N6LA 4R2IA 4MH0R 3PUZA 4IDHA 3H84A 1DOAA 3GLIA 1H8HA 2MSEB 4GBMA 4MKHA 5DLQC 3RWMB 2PLRA 5FFMA 2IL1A 1CTQA 3EZ2A 1Z0FA 2BVNA 2I1QA 1G3UA 2VP0A 2ZIAA 3O8BA 4GDFA 1BS1A 1XTIA 1TEVA 1G16A 2CNWD 4LJAA 5F2EA 2V7QA 3UK6A 4ASUD 4OYHA 4MRRA 2XNDD 2REOA 3LY5A 1T8TA 5IHPA 4LJ9A 4KFTA 4DDTA 5HPYB 3AVVA 3AF2A 1XMJA 1NMZA 2OXRA 3OEHA 3ZQ6A 2XTMA 3HYTA 3K53A 3BJIC 4OHZA 1DO2A 2N42A 4RVCA 4ZO4A 3SFZA 5DNYB 1ZM7A 1Z08A 4GFDA 3X1YA 3FMFA 2DR3A 4M4SA 5B2ZA 3IEVA 1EK0A 4S35A 2MSCB 4OI1A 2FSHA 3UWOA 5KO2A 3DOFA 2H8KA 2QRZA 1KI6A 4W7SA 4MKFA 2D3WA 4H1UA 4C0HA 3A8TA 2VP4A 1DAIA 1N0VC 3OIUA 2IBMA 1BO6A 1NVXQ 2JA1A 4LYJA 4Q4LA 2WHXA 2C98A 3TR5A 1DVRA 1F6BA 2V6JA 5BYJA 2ZITA 4FW9A 4O3MA 1N6IA 1AGPA 4FINA 3WNDA 4Q7JB 1EX7A 1N5JA 4QBIA 1E9RA 1F5NA 2EFDB 5J47A 1OF1A 1XB2A 4C0LA 4KITB 1CS4C 3QQ5A 1R5NA 1SXJA 621PA 4YXWA 5H70A 5C4MA 1N6RA 4M53A 4UNRA 1QRAA 3KTAA 1CEEA 3L0IB 2C96A 2VO1A 2GK7A 2FZ4A 1M7BA 2AFHE 1TEXA 4PX9A 1SVMA 1Q1BA 4ESHA 1NY5A 4E5UA 4DXAA 1OPXA 5AWFC 3ZS8A 4W5JA 1XTJA 2EU8A 3DKVA 3A37A 2R6GA 4O25A 4MGYR 5K8LA 1GKIA 2UKDA 4CEHA 4A9AA 1GRRA 1X3SA 4QHYA 4A0FA 1IXZA 1I4LD 3CPJB 2QMHA 5G53C 1E1RD 1TUEA 1GM5A 3LLMA 1WCV1 1J7KA 4KCGA 3FVQA 4OK5A 1BOFA 4IDPA 4TWZA 5HTKA 1RRPA 2ZAOA 3PFIA 4C0KA 4B33A 1LB1B 2BBOA 3OESA 1W0KA 2RGGA 3QKSA 1G7SA 1QHXA 2JIZD 2ZXUA 2HT1A 2D2FA 1NLZA 2G88A 1W4AA 4JLBA 3MJRA 2WJHA 3GFPA 1DG1G 3I62A 4JBYA 1E1QA 1IHUA 2P6RA 4OHYA 2ZRHA 4B6EA 5JWRA 3QEJA 1PVOA 1L4YA 1YRBA 4DCUA 2A30A 2HJVA 3KFVA 5TV2A 1LF5A 1GVNB 3EZ9A 5H8WA 2O8FB 2O8EB 4D2IA 5E7MA 2O8BA 3KKQA 2DWOA 3IHWA 4TL9A 2Z4SA 1YJ5A 4PHHA 1FPMA 1LNZA 1M74A 2ANBA 2RGAA 2BOVA 4M1SA 2ZJBA 5A0FA 1FQKA 3SHWA 4D0GA 1QDEA 1S0UA 4IEEA 4LBYA 1QF9A 4B75A 2FSGA 4KYIB 1BYUA 4E03A 1RYHA 2NIPA 2ZI9A 4PHFA 5KSOA 3REFA 3RRZA 4ACBA 5DISB 1KOFA 2O8CA 3P1JA 4MUBA 4HAUA 1BH2A 4DCVA 2CJWA 2LKDA 2XEXA 1FZQA 3HU2A 1PLLA 1U81A 4EFNA 1ZM2A 3VTKA 2W58A 4M1TA 1P75A 2QTFA 4RSGA 5JSZA 2GBLC 4M9SA 1ESMA 5L3QB 2TMKA 3AF1A 2CE2X 2X1VA 4AIIA 1AQUA 4Q01A 3ZVRA 3K0AA 2FFAA 1F3OA 1E2KA 5E95A 3GJ7A 4TZ0A 1VHLA 3CF6R 2C9CA 4M2LA 4G5QA 4DT1B 3K9GA 5LD2C 1CJMA 3HR7A 4LY6A 2Y8EA 1BYIA 2ZROA 2JGNA 1J99A 4Q7MB 1FMJA 1OFTA 5CIWA 2PZEA 2P5TB 4YMVA 1WP9A 3QXJA 3VR2A 1W5TA 4DVGA 4TMTA 5JCZA 4ZIRB 5DIFA 3I61A 3AP3A 4NCHA 1ZNZA 1G6OA 2OZEA 4YLGA 4BFYA 4DCTA 1ZIOA 5TY0A 2C8VA 2ZANA 4BECA 2Q9CA 2IWHA 1FX0A 3NBYC 3PEVA 3CH4B 4FN5A 2HDNB 4G5OA 3QPUA 1N2CE 3T12A 3PQCA 2FU5C 2JAQA 1ZM4A 4IVRA 4D6PA 4MYTA 3T1TA 4BFVA 2A2ZA 2WV9A 3FMPB 5GVRA 4US2R 4LBVA 2BJVA 2YINC 1R5BA 5KNCA 4LHWA 1JJ7A 4JL8A 1KI9A 1ZAKA 2JJ8A 2C5LA 2QI9C 4C7OA 1S3SA 2IYTA 2ZRFA 1JXOA 2QQEA 1G8FA 5AJXA 2Q3HA 3IIKA 4V0MA 4KBGA 4BRUA 3GLFB 2WM9B 1QZXA 1UEIA 2IXGA 2XZPA 4TMKA 5DH9A 4KFRA 4C0AC 3IUYA 1NF3A 4DLUA 4IXMA 2NQ2C 4HAZA 5UKDA 5J4LA 3KL4A 2H17A 1GKYA 4RY2A 5EUQB 1HYQA 3I73A 4LHXA 4L9SA 2PEYA 4V0NA 4EQ6B 2XITA 4G3XA 4NCKA 4GI7A 5DI3A 3IBGA 5A4JA 2CVHA 1U2RA 1EESA 1W44A 4C30A 1TF2A 1ZM9A 1ZU4A 2BBTA 1Z47A 2GAOA 2FFBA 2REBA 2YWFA 1AZTA 3DPUA 3AB3A 1FOEB 3EASA 4Q19A 4Q7KA 3DL0A 5HE9A 4EPTA 5KPDA 4BFSA 1ZIPA 4QC2A 1VYUA 2R6CA 1U8ZA 3NXSA 3TQFA 4X8LA 1FQJA 1XF9A 5JJIA 4EJSB 3QG1A 3PEYA 4RKEA 2LCFA 1VG0B 1DPFA 4BLPA 2DFTA 2CL6X 1NY6A 4D4KA 1KHTA 2ZRGA 2BIFA 1VCMA 3X1XA 3LD9A 3MFYA 2YOGA 3SEAA 3BE4A 2OT3B 4CF7A 1RC8A 3IIJA 4R7ZA 2VP6A 4B6FA 3TSZA 3LXRA 2GTPA 2GCOB 3TW8B 3IBYA 1KJWA 4NYJQ 4I99A 4NYIR 4P4TA 4HB4A 2WWIA 1U90A 1XTSA 2MSDB 5FPYA 2ZRIA 5B30A 4DB4A 3MMPA 3B1WA 4M9ZA 3BB1A 1ZYUA 2O8DB 1XPRA 2XGJA 4WOPA 1AM4D 4KVGA 3PVSA 3ZGXA 4N1AA 1TQDA 3SYNA 5CM9C 2DY1A 2GF0A 3PG5A 1N0UA 3NDPA 4IFBA 1KI8A 4NZYA 3FYHA 5KDLA 1IONA 1P9NA 4BLSA 3BRWD 4YMTA 3QKRB 3GQBA 3AF3A 2YKGA 5EZ6B 4G5RA 2RHDA 3NEYA 1GSIA 4ABYA 1EGAA 1LVGA 2QMOA 4XJXA 2QGZA 1KMQA 1R8SA 3LVRE 4KU4A 2AXPA 2FEOA 4A2WA 3QG5A 2DFNA 2GHIA 3ASYA 2BDTA 2FV8A 5FPKA 3I8XA 5KDDA 4R9UC 2WAYA 2H57A 1E2EA 3EXAA 2ZR7A 2ZRCA 4YDSA 4QJ4A 2GDJA 1P2TA 3NHBA 3WP0A 1KKMA 3VR5A 2QMUA 1E2DA 4KO8A 5J4YA 3F0TA 2YC4C 2AK3A 3TAUA 1EFUA 1OH6A 1GP2A 4JYCA 4RKFA 2IA5A 4M1YA 3THXB 1OB2A 4EAQA 5JI2E 1T91A 4XTCS 2OCPA 2C95A 1VCOA 4L16A 1SVSA 1E9EA 4B34A 4C0BA 3THWB 4DIEA 1E2JA 4AYTA 5L3SA 1T0JB 2P6NA 4EUNA 2J87A 3W3ZB 3CIOA 1M7HA 1XRJA 4A36A 1E9DA 1COWD 1KTVA 1OLOA 2CMKA 3CZPA 1S1MA 3CNOA 3NBZC 2ZRJA 4QJ3A 4PPNA 3TLXA 2F43A 1ZMXA 1NJGA 2ODBA 3U6BA 1KNQA 4HAXA 1KMHB 3OAAA 2IF2A 3GJ8A 2H16A 5GADl 2G0NA 2ORIA 5CM8B 3AP1A 4TTPA 1OKKD 4XVQA 4TL7A 2FGJA 2XAUA 5EXSA 5SZIA 3B13B 1E96A 1RRFA 2CLCX 3I8SA 3BB4A 3U7GA 3I4LA 2IS1A 1N6PA 2ZQ5A 1X6VA 3WYGA 3L82B 2GEVA 1YR8A 4Z51A 4OQNA 5FTNA 1VHTA 2LKCA 4MGZR 4WXPA 2PLFA 1X86B 2BV3A 3K09A 4JKIA 4CT4B 4CRWB 1Z6TA 4I81A 1HA3A 3AKYA 2YZ2A 3GLFE 1ZU5A 1SKYB 5FBVB 4B44A 1GNRA 5J40A 5JI3E 2X77A 3R7WB 3HR8A 3WYFA 3QF4A 5JCPA 3QKTA 1E0SA 4N0EA 1UADA 1E2IA 2Q3MA 2XB4A 2XSZA 1E94E 5JFGA 1Z6YA 3BWDD 4F7WA 5J4KA 2VP2A 2XOKA 2Z83A 3QKUA 5HKKA 4ARZB 4KSCA 1KZGB 2DFKB 2G3YA 1CR0A 2ATVA 2BM1A 3D7MA 4IFEA 4DJTA 4G1UC 2FGKA 2V8OA 4R71A 3B78A 4NKRA 2NZ8A 3SYLA 3HWSA 4A2QA 4Q1DA 3GPLA 3E70C 3E1SA 3FB4A 1BKDR 3GJ0A 2WMNB 1KSFX 4M9XA 1E2LA 2IW3A 2ZS9A 4ZI3A 1GNPA 1WBDA 4LC0A 1N3BA 1D5CA 4B3FX 2AN9A 4DEXA 3B7GA 5CK5A 1OIVA 3WHKA 2Z0MA 2GILA 4HEJA 1IXSB 4L8GA 4TLAA 4DKXA 1II0A 2B8WA 3VKWA 5FBLB 3MSXA 2B7CA 1T4GA 2F3TA 4Z1MD 4BUJA 1X8KA 1Z0AA 2FPLA 1VIYA 2OEPA 1OE0A 1Z0KA 2ZEJA 1UBGA 2ECKA 5G3ZA 2A9KA 5JRZA 4M1OA 4Q03A 4JS0A 4LJ4A 3VKGA 4NPHA 4FIDA 5SZHB 4G5GA 5FBQB 4KLZA 3K1JA 2A5YB 1GRNA 3B1XA 2PJZA 5K8TA 4ZDWA 1NI3A 2PMKA 3OHMA 4DT1A 4E22A 2AWOA 4HSEA 1Q1QA 1Z07A 1Y63A 2EYQA 4ZDKA 3F8TA 3S1AA 5CLQA 4C0SA 3KB2A 521PA 3ZIAD 5BN4A 2J0UA 2FEMA 2W6JA 2ZRBA 1U9IA 2ZI3A 3X1WA 5FL7D 3T61A 1HV8A 1G291 2UZ3A 5KSPA 1E6CA 2AKYA 3TH5A 5AUPB 1YHNA 1NMYA 1WRBA 2ORWA 3H86A 2GVDC 2C78A 2F55A 1RRCA 1LS6A 2QMEA 2NPIA 4XH9B 4MYHA 3LBHA 2ZSEA 1Q22A 3QSYA 2JLUA 4BE7B 4C4PA 3AVXA 5EZ5A 2C9OA 2BCJQ 1ZD1A 3B2EA 1DG3A 1XMIA 3OE7A 2YYZA 2NO9A 3RNLA 3I1FA 2IXFA 2JJ2A 1JQJC 2BJWA 1UF9A 2MMCA 1T3LA 2GEDA 1A2KC 4X8OA 4JSYA 1G18A 3HP1A 5AJYA 2WJYA 1GAJA 2WAXA 3EARA 3MD0A 4GP6A 4JLPA 3TNFA 3AVYA 3QXXA 5JEDA 3GEHA 3LFUA 2JLVA 4NL4H 4FMBB 4LGMA 1I4TD 4Y0AA 1CF4A 5LB2A 4GZMA 3FMIA 3M4YA 2PX3A 3NC0C 4BFXA 1N5IA 2VP9A 3U7EB 1KDPA 1TTTA 1LTQA 3SOPA 3QIAA 4EKDA 2JJ1D 4QFMA 3P26A 2ZYTX 1JAIA 2JATA 3UMSA 1US8B 2EW1A 4IVQA 3RS4A 3RRNA 4FCVA 4ZKDA 3IILA 1NG9A 4NYMR 4EQ6A 4JVLA 1YZQA 1MO4A 3C7KA 1IY0A 3LO5A 4CZ2A 1B23P 2OM2A 3CF2A 2AWNA 3K0CC 4TL6A 3OEED 3L8YA 3NH9A 3QBVA 5FPHA 1HT2E 3IO3A 5BN3A 4Q9JA 8OHMA 3BB3A 4US0R 4CIDA 5BXQC 4BWYA 2WJVA 1AGRA 1HURA 4OI2A 1F2UB 3C5HA 4PZZA 1KYIA 2KB0A 4HB2A 4XTRA 4JVMA 3QPVA 4LBZA 4B73A 1A82A 4EJSA 2Q0HA 3T1VA 1F2TA 1GITA 3EZ7A 4TT3D 1A2BA 3CF0A 2NO7A 4Q9IA 4NHOA 3RABA 2EFGA 1TL7C 1VTKA 3DM5A 4KI0A 3LV8A 2R6AA 1E9AA 1UPTA 5E4FA 1TU4A 1OH8A 3FHTA 1E69A 5EE1A 1XPOA 2ATXA 1ZD8A 5AJVB 3CRVA 1XJ0A 1G3RA 4LPSA 1SKYE 1W0JA 2REXB 4XOIA 2FOLA 4WW0A 5FBRB 1T0HB 2GJ9A 3KQLA 5FUXA 3L0OA 4NCIA 3GP8A 3KQUA 3SDZA 1P6XA 4PQFA 4F38A 4URUR 2O8DA 4BRWA 5KYKA 4DZZA 2ZSBA 1Z6AA 4WZAE 5G40A 2WWYA 2QAGB 3L0SA 3RS2A 4DSNA 2VHTA 4HZIA 3FWYA 2VLIA 3CW2A 3PEWA 2CVFA 2EYUA 4PZLA 2ASEA 3GLGB 5C1BA 2EWWA 1D6JA 1YVDA 3ECCA 5IK2A 1E79D 3LLUA 4B32A 2J46A 5FOTA 4I1SA 2WJGA 1QHSA 4AD8A 3X2SA 1S3GA 2X19A 3LW8A 3KUCA 1I2DA 1ZJ6A 3CLVA 3GJ4A 3ADBA 1VECA 2D06A 3TSOA 2IUTA 1HT1E 4ZI2A 1MV5A 1ODFA 4LDJA 1XTQA 4NYJR 1WA5A 2NZJA 4URWR 5J5CA 3EIQA 2V54A 4TTRA 4U00A 3PJRA 3KXLA 3EWAA 1OXXK 3KX2A 5JZVA 3WBKA 4B47A 3ICEA 3H1TA 1YZNA 4NDZA 4Q4JB 4RCZA 4RZXA 3TW4A 3J81k 5AK0A 2W83A 3U6KA 5E7IA 1EX6A 1GZSA 3GJ6A 3VAAA 4EFMA 4HLUA 3EIHA 4UNPA 4XD7A 3THWA 3UG7A 4WA7A 1H8HD 1NSFA 4HYYA 3JVUA 1DAEA 3ZS9A 4ASUA 5GJCA 4QHTA 4NH0A 3I72A 1IJEA 4PO8A 5DYIA 1J90A 1P9WA 2ZE5A 2V7QD 3AKCA 4EIWA 4OHWA 3ZZUA 4MYUA 5FTKA 3N2EA 3G0HA 3EWSA 4ZDIA 2IS4A 5DGXA 2JLQA 1UKZA 4LUCA 2ZU0C 2HCBA 2R65A 2J0SA 1H65A 1U94A 1A4RA 3OEHD 5DN6D 2J7PA 2IT1A 4AYWA 2I3BA 1TQ2A 3LDAA 4YMSA 1Q20A 3AUYA 3FFAA 2R6FA 2XTZA 2OFWA 1KY3A 1DAGA 1UKYA 4M1KA 1KSHA 3I3SR 2AHOA 1DAKA 1NVVQ 4GMDA 4Q1EA 4ERNA 2IYRA 1XDBA 2RGNA 2G83A 2WVJA 5TB5A 5JHGB 1XD2A 3SJBA 1E0JA 421PA 2GXQA 2JCSA 3A4LA 2F3RA 1OH7A 5TARA 3RRYA 4XSGA 1EG7A 2HF8A 2JDID 2B92A 3LA6A 3T34A 1TAGA 1RFLA 2ZUBA 4JL6A 1QHHB 1FL9A 3D8BA 3KQKA 3BFKA 1GTVA 2ZYWX 4RZ2A 3VNUA 5FUYA 1P2UA 4YXWD 2VBCA 3H0KA 2ERXA 2PX0A 3DZDA 5GJWC 1ZINA 4KXFB 4PHTA 2FH5B 3A1UA 4BLQA 1JPNA 3W5IA 1W48A 2JASA 1RKBA 1D2EA 4AKIA 1JR3A 1OFHA 3MWKA 3QXSA 4N3NA 2QL6A 1OYYA 1MR3F 2VRWA 2P67A 3SNHA 3W6NA 1Z22A 1P7CA 1Z28A 2PT5A 4LYHA 1MRNA 5BYKA 4QGGA 3RWOA 3IDQA 3AVPA 2IUSA 1YRAA 1KK3A 4NBSA 1PLKA 1W7AA 4IDNA 4HLDA 2IYXA 1CRPA 3GJ3A 5CJ2A 1N25A 5FR1A 2J45A 2P5SA 3ZJYA 3W6OA 4DEYA 1C1YA 2QENA 1NIPA 2RAPA 4PC7A 3SFVA 4UJ3A 1KJZA 3RSOA 1W0KD 1NVWQ 3C41J 1VG1A 1Z06A 2J9RA 4WZ6A 4DBLC 4LZZA 3KQHA 4M0LA 2XJ4A 1U99A 2NO6A 1GOTA 2IYQA 4IOJA 4XIGS 4Z8YA 4PC6A 3G82C 1E1QD 3OFNA 3A4MA 3BS4A 1X1SA 4PAMA 3BH6A 3AVQA 4HLCA 3U3RA 3U3KA 3L2OB 3Q7PA 3WBJA 1OH5A 1KO5A 3GLGE 2E9SA 2Q9BA 2G6BA 4MGIR 4PPQA 4R98A 2WWXA 5DYGA 4FXPA 4IDQA 1FTNA 3SJZA 2IUUA 3TBKA 4TSFD 2C9YA 1XTRA 2H1LA 2WICA 4BZPA 3P27A 4PZYA 2VSFA 2RMKA 2D7DA 3JZAA 3LNCA 2VHQA 1XJCA 3LQRA 5FI1B 1E32A 2GK6A 1OV4A 4TZ6A 3F3YA 3ICQB 3VKHA 1X1RA 1G41A 3ND8A 5EE5B 4ZKEA 1ZW6A 1T8UA 3QBTA 2ONKA 4AG6A 2ZM5A 2QBYB 1II8A 2WTUA 4JLDA 1AQYA 2GETA 3QUSA 1W4RA 2ERYA 4R2HA 2BKUA 4PHGA 1C4OA 1OYWA 2FPKA 2RGXA 4DDVA 2VSXA 2QGNA 5DSZA 4LCBA 4GPTA 4RD4A 2A5JA 4DCSA 4MITA 1E4VA 4Z8XA 2QT1A 3UPUA 5KU1A 1I4DD 2GXSA 2QAGC 1G19A 4ACAA 2ANCA 2FA9A 4E07A 1NJFA 4PANA 4B2LA 3TVTA 1JI0A 1R0WA 5LPNA 1ELOA 1AS2A 1MRSA 2D4HA 2OLJA 4RCYA 5B57C 3LAWA 4NCJA 5KNDA 4QM7A 1G8PA 4H9GA 5JJLA 4Q4AA 4O0MA 1GDDA 2WJJA 1LW7A 1XEXA 3SZRA 3PITA 2IYSA 2UZIR 2WKPA 2ODEA 1CLUA 2NGRA 4M21A 1XWIA 2EVWX 2WPDA 1UKVY 4LSGA 4DUGA 4ZDJA 3WP1B 3E5HA 1U0LA 2G77B 4K8OA 3KKOA 2Q9AA 1EFRA 4CYMA 1H8ED 4UNSA 4A82A 3QPWA 5SZJA 3IPYA 4LHVA 1NBMD 4LHZA 3OIYA 3BOSA 4US1R 3DMDA 2GBLA 2JLSA 1OIXA 3REGA 1P62B 3VX4A 1OXUA 3N2IA 4TL8A 4YONB 1GL9B 3M6AA 5FOXA 3DHWC 4FMCF 1LV7A 4TQ9A 221PA 3P32A 4PQRA 5H1YA 1VKJA 3A1SA 4ITRC 2ONJA 5JS7A 3CPEA 4TLBA 2BWJA 2ZS7A 4FD2A 2QN6A 1NMXA 2VSOA 1SVLA 3EA0A 1KSJA 2YV5A 3RVBA 2DB3A 4IOKA 2HLDA 3U3JA 3NBXX 1JECA 2CK3A 2ZUCA 4FCTA 1P5ZB 2JLRA 6Q21A 2F1IA 5CIQA 4QGFA 3PENA 5FUVA 3LH5A 4HZUB 5AUOB 4F4JA 1HY3A 4U7DA 2XXAA 1ZVQA 4JBWA 2YHSA 3VX3A 1XU4A 4C0QC 3T5DA 4CEIA 3GLGA 4A6PA 4CEJB 2YVUA 1N6HA 2JEOA 5FBWB 4A8JB 2R9VA 2HYIC 5FTMA 3UXMA 1YKSA 4BLTA 4PC1A 3SYKA 4FMDF 2W2TA 1CJKC 1T5IA 4URVR 2B21A 1FMLA 2JLYA 2QPAA 4W5HA 2YNMA 5JMTA 1E2HA 3MLEA 3U4QA 2NO1A 4HUQB 3U44B 4QRHA 2OAQ1 2QUZA 3K70D 3NEJA 4Q9KA 1J2JA 2WBLC 5F9FA 3B85A 2BEKA 4B35A 1YQTA 1DAMA 1SQ5A 4Q4JA 4XWAA 1DS6A 1M7GA 3O47A 2QSYA 3QXCA 1IAQA 4JLAA 2W0SA 2W6ID 1N5KA 1FUKA 1E9CA 1G5RA 4ZPXA 3T35A 4OK6A 1EXMA 4QXAA 1VG8A 2PH1A 5LB4A 2YWHA 3QY0A 3WMGA 1JPJA 4JLVA 2WWHA 2BMFA 2G0TA 4RZ3A 2QM8A 4UNQA 2IX3A 4PO1A 2OLKA 3GLHB 2DCUA 1WF3A 2QA5A 3N70A 2B8TA 2WOJA 3F5FA 4NE2A 2A5FA 1CRQA 2ZRPA 4C9BA 5F9HA 2ZJ2A 3TVDA 1VG9B 5EP1A 4LPKA 4M22A 3IO5A 2OAP1 3AH8A 3QENA 1L4UA 4OI0A 3BFXA 4B74A 1QBKC 2OBNA 1E9SA 2EFHB 2D7CA 3TAHA 2PMDA 1GFIA 1JJVA 1IN8A 4PC3A 5FOVA 3THYB 3SHFA 1SULA 4UKDA 2D74A 4I1OA 2ZI5A 4ZCMA 4IDOA 4D26A 4GT1A 4CDGA 4QKQA 1XXHB 2GF9A 3DO6A 4TMZA 3K0SA 1KKLA 3A6PC 2V9PA 1NKTA 4BLRA 3VQTA 2J5XA 4PXAA 5LDDC 2AD1A 3GFTA 2KWIA 4NP6A 2XZLA 5JECA 4JVSB 1HEIA 3CO5A 3PUXA 5ANRB 4DHEA 5KTYA 4A0RA 4BFWA 4POAA 2QT0A 4RD1A 1AKEA 1L8QA 3GLIB 2HXSA 1P3JA 3CR7A 1IN5A 3EW9A 4BFTA 2BMJA 4Q00A 3TKLA 4PPFA 2KE5A 2WIBA 4F4CA 4B76A 3A1WA 3CRQA 4KFUA 3A58B 4QNMA 4YMUA 1CXZA 1VIAA 2E1RA 2D2EA 2OG2A 4YQFA 1T9HA 3CUEF 4D4LA 1NL3A 4DLRA 1NRJB 3ZD6A 5HCNA 3BERA 2PJRA 4RFSB 3TQCA 5L3RA 3PR1A 1AS3A 1E9BA 3E2IA 1XEWX 5B64A 2ZSAA 1G7TA 1OKKA 3OAAD 4JT4A 2GA8A 1NVVR 1N6OA 3W9YA 2OE2A 2X2FA 3THOA 1IJFA 4D4JA 1E2MA 1Z6GA 1ZCAA 4TYPA 1QVRA 1W36D 2AXNA 1IM2A 1KI6B 4W5WA 3W5JA 2G1KA 4OHXA 3SC3A 1F48A 2FMXA 3NC1C 2CXXA 1O3YA 4JZKA 1OFUX 5EE9A 3KXKA 3AKDA 1LF0A 1XP8A 2QZ4A 5EP4A 3A1VA 4TQAA 1F60A 4S2EA 1OIWA 1GG2A 4U5XA 1TQ6A 4DDUA 2GZHA 4JLOA 3U7HB 4BEJA 1UDXA 4IW3B 1JXMA 5KSYA 1E2PA 1G8GA 1R10A 2O8FA 2O8EA 1DE0A 4JLMA 3HPRA 1P2VA 2XSZD 1RZ3A 2QE7D 5EQTA 3MUFA 2R6DA 1VCNA 1IN7A 3KTAB 4Q66C 4DSOA 3B1YA 3T5GA 1XTKA 2XOKD 1YR7A 2BMDA 2HT6A 2XX3A 3QVUA 3QNUA 2A5DA 1XMVA 3KJIA 1SHZA 2AX4A 3D3QA 3AVUA 2X2EA 1GIAA 3K9HA 2VPPA 2VF7A 3D31A 1HQYE 1KK0A 4Q47A 1Q1EA 2AFIE 3O8DA 3PEUA 1DO0A 4CEHB 4LV6A 4RJLA 3CH5A 4UXIA 3SQWA 4B2PA 4Q1BA 1GRQA 2O52A 3B9PA 3HPQA 4WAUA 4BFUA 1KAGA 1G20E 4K81B 1W47A 5JEEA 5L3QA 2FG5A 2IXEA 3LWNA 3IGFA 4HDCA 1GNQA 1NSTA 2QP9X 1G64A 3JZMA 3U7FB 3RHFA 2CHQA 1P9RA 3B6EA 4Q1FA 2OUKA 3KUDA 2IK8A 4LJYA 2W2VA 4MRNA 2QU8A 4FCWA 2H7VA 3EPLA 4AI6A 2KJQA 3K9NA 2N46A 1ZRHA 4D82A 1UDWA 2RGEA 4NCNA 1KI1A 2QAJA 3BXZA 5JBQA 1Q12A 1E99A 3KJGA 4QHSA 3CBQA 4WZBE 1PZNA 3U3MA 4ZIRA 2OBLA 3BFVA 3QF7A 4OBEA 3I5XA 1XPUA 1XMSA 1C9KA 1E2NA 3LX8A 1UFQA 4DDWA 1HUQA 2ZJOA 5KOYA 5FL7A 2O8BB 4OK3A 3K9LA 3CKLA 2EFCB 4MKIA 3GLHE 2F6RA 4URZR 4A8JC 1S9DA 3HU3A 4TYQA 4Y0VA 4MRVA 2F9MA 2GEUA 2ZJAA 4X8MA 2ODNA 3CZQA 4MRPA 4XWKA 3EZFA 5DHAA 4Z54A 1QHGA 2XJ9A 3BH0A 3WY9A 4B3DA 2JLZA 3GJXC 4GZLA 3G5UA 2O8CB 4P32A 3H2YA 1VPLA 3KJHA 2XNSA 3V4RA 4Q02A 1A1VA 3B1VA
chains in the Genus database with same CATH superfamily
2DKFA 3HA5A 4WGFA 1M2VA 2PT7A 1D1TA 1ENYA 2VYVD 5EMMA 3UC5A 2PKQP 3HV0A 1XA0A 2FSPA 4X9XA 5CK4A 1B43A 2Q46A 1GCOA 2RH8A 3HBLA 4QVIA 1PWHA 4GE3A 3TXXA 2F1RA 4I66A 4CE6A 3ITDA 3TLAA 2Q0SA 1RXUA 1U0OC 3TLJA 5K8UA 2Q6OA 4GVPA 4NU5A 3TJZA 3WMFA 4B6RA 1H2BA 5A7FA 3GROA 2VF8A 3GG9A 1TYEB 1YJXA 3ER6A 3QWFA 4OM7A 1WBBA 1P4SA 4E33A 3CTMA 1VJDA 1W76A 3D8SA 2CEAA 3VMFA 3CXRA 1FA9A 4IIHA 8ATCA 3RU3A 1NE7A 2II6A 1IDOA 4XSHA 3VVCA 2ICAA 4F6RB 1GL7A 1PSZA 1IN1A 1K2VN 1K8XB 1CDEA 2QLFA 2FFQA 3LW7A 3SDSA 5IEJA 2F8TA 2RG1A 1T6NA 3DXYA 1U0FA 4FZ5A 4JK3A 4KXWA 2NPOA 1BCSB 3ACBA 4DA8A 1ETHA 2QQGA 1YQQA 3UBMA 5PGMA 2Q4RA 4H7FA 4YJ3B 4KPFC 3M5PA 4NFLA 4LXHA 4L76A 4M0MA 3SZLA 2DWQA 1Q0TA 1MW9X 1AIPA 4QPCA 3NV7A 3T4UA 3JWHA 5C2JB 3VNSA 3C3XA 4D79A 3BUSA 4QEDA 1BIFA 2GFIA 2LWIA 5AHXA 3SS8A 4YRZA 3L0BA 1K4MA 4F6RA 4MUFA 3UJAA 3DMTA 5REQB 3AHFA 1AG9A 1II9A 3RS5A 4HT3B 3T3OA 3I2HA 2NSJA 5JWHA 4OJKA 4EBBA 3ZVNA 2BEWA 1R9GA 5E8JA 3TW8A 3DLBA 1XTBA 4O2AB 1RQGA 4AKEA 4I0WB 2H52A 3T6KA 1L7MA 2V45A 1C9JA 2QKYA 4ITVA 1PUJA 4O0LA 5BSWA 5BSHA 5FR2A 1Z88A 1CR1A 3IBFA 3RYFA 2IYWA 5AIAA 1J33A 4NVRA 5AW2A 1P4JA 5HNKA 2DYKA 1AK2A 1XYYA 2P6MA 3OEYA 3Q9NA 4Q3DA 4UMDA 3DNFA 4WLVA 4ZHSA 2Q21A 2VEOA 1ITZA 3EXHC 1Y5IA 3C7AA 3PQEA 1DARA 4WERA 4G0VA 2KI5A 1OBFO 2IYVA 3EULA 3IAS6 2DBYA 3CONA 3KJFA 3HQ4O 2WSSA 2GI4A 2N9UA 4KJXA 4KXNA 4HK4A 4IV5A 5JS2A 4IOMA 4NICA 3V3TA 4YT8A 5D00A 2ZUDA 4IZHA 3NFYA 3HEBA 3K2QA 5DBGA 2K7ZA 4GWKA 5FI0B 3G13A 1QSGA 3BWVA 2ROQA 4XX1A 2EKDA 3BZUA 4BP1A 4XUGB 4TROA 1YR9A 4HRXA 3OPQA 1GPBA 1PEDA 3DEFA 3PDWA 2QLJA 1JFVA 1I4EB 3CLRC 3RU7A 2X6TA 3QYFA 3Q6IA 1UM8A 5IK2D 1USKA 2QP4A 3DO8A 4JYBA 5T4HA 3IDFA 3P9KA 1DELA 3A4IA 2H1OA 1HDZA 2P9GA 4PGGA 3WLKX 1TPZA 2BBWA 1E5QA 1I5OA 1MX1A 5HFJA 1JYSA 2WABA 3N0RA 4EY8A 1N1GA 4IPTA 3FHCB 1P7WA 2CJXA 2OO7A 3CUWA 3OZ7A 2XMQA 4HFRA 2HEIA 3ESZA 4Y9SA 5EGSA 1C50A 2GZAA 2VJMB 1JSRA 2YHUA 4YRPA 3RJ9A 4RZHA 1U0JA 1VI5A 4D8UA 4GMXA 1J0CA 1ZBDA 2ZZMA 3VC3A 1RXWA 3CRW1 4XDYA 4AF7A 4AKSA 3THXA 1TM3E 1FFGA 3PSAA 2IIQA 4P7JA 5HJ2A 3K70B 4AP6A 1Q0HA 3PUYA 3GT7A 4QOGA 1ZONA 4GRIA 1XWWA 3RVOA 2ZJZA 1CJTC 1H0SA 1TLTA 2AF4C 2VBGA 4NZ9A 4Q6BA 1XKLA 3H0CA 3I53A 3L18A 1QRUA 4NCBA 2ZATA 2HXGA 4CODB 1DEKA 1JHAA 4MB0A 4XQCA 1PU2A 2X8JB 5BSMA 2A1TR 5FH9A 2CHFA 5AHRA 3TO5A 3D4NA 1EBBA 3RAPR 4RHUA 3C4QA 3LQKA 3DHVA 1NV8A 2RHCA 1T5LA 1OD6A 2GPSA 8MHTA 4HYEA 2P2CA 2KSQA 9GPBA 3RIGA 2PWBA 1QWOA 2HMVA 3CWCA 2NO0A 5HIKA 1J24A 2WKRA 5E2IA 1QHIA 1T6YA 3I39X 4BQQA 2QQFA 2TRSB 2OSBA 3J81A 1GR0A 2XUAA 3IAEA 5HBGA 2BC9A 4NOKA 4MEBA 4D3YA 1KJJA 3PNVA 5IJAA 2AS0A 4PINA 4YMWA 2GO1A 4MRMA 3KV1A 3Q6MA 4U0JA 4W8OA 1SHJA 4NNOA 2J4CA 4NTZA 4DLRA 1Z7EA 1NIJA 5MGBA 3KQTA 4RC9A 3ZWPA 3NAGA 2FEXA 4FDUA 4AURA 1UPUA 5ECYA 1AUXA 2NWQA 1AD2A 5JXIA 3PQ7A 4RXMA 1QWSA 1GRCA 3ZNQA 4S05A 1CT9A 1DLJA 2CBGA 3RVKA 1I1QB 2OESA 4A6XA 1RI4A 1U3GA 3EDQA 1M33A 3EZLA 4LI0A 1MO5A 5K8CA 3RHSA 3DPIA 3O8RA 3LQQA 4ZT3A 4H3SA 1ZH6A 5ALLA 4M6WA 4UZSA 3ZE2B 1Z2OX 3LT2A 2L19A 3AI2A 3D8HA 2O7RA 3CNNA 4F93B 1JDBB 3ILXA 1IXYA 3MRSA 3PT5A 4OLJA 4NXNB 1VB5A 2J3EA 4CN9A 1V7PC 2PD6A 2JCYA 3CEJA 5CJPA 2OGTA 3R75A 3KOYA 3N0WA 3HGQA 4CTKA 5KPJA 4I1VA 4E15A 1H22A 5CDFE 2OO3A 5I6DA 2E2WA 3EPHA 1JE1A 1FDTA 3EZYA 3OZSA 1M75A 3D4IA 3ENZA 3M1LA 3OFSA 1W19A 4PXSA 3VH2A 3PSHA 1DU4A 4FSXA 3A9VA 1X8XA 2D1QA 4HAOA 5IDYA 1CCWA 2C92A 2C8KA 3OZUA 1ISIA 2QD3A 4HDRB 4EJ2A 1D03A 1Z62A 3GP5A 4OP1A 4EARA 4MP8A 5AW0A 2JJMA 4AS3A 4I50F 3J80A 3BWMA 4RPIA 4X24A 1JR3D 4BTVA 3HKDA 3DUFB 5KYVA 1J5XA 4KNVA 5CLLA 3LYLA 5AP9A 2AIRA 1TPYA 4TUYB 1JHYA 1S3FA 1S9HA 4KTVE 4YP6A 3OF5A 3UANA 1Y48E 4I3HA 2ZR0A 1SD1A 4U7GA 3I04A 3W77A 1JHZA 1TTQB 1J0DA 1SPBS 3EC7A 2O2SA 2OC9A 4Z5XA 4XAQA 1E3EA 4MI6A 3X2EA 3GCDA 3ZGOA 4P6VF 4BKRA 2GPWA 2Q8QA 2AI3A 4PIMA 1OLXB 3E6AA 4XRRA 4CDMA 4C4XA 2R00C 1U98A 2GJ8A 3N07A 4TV8F 3OQBA 4O2LA 3Q72A 1U6KA 2PUBA 4F4FA 5CDGA 2H5IA 5A4MS 1EEXB 2CL7X 4MR9B 4N5IX 4KSYA 3DLHA 2QM7A 4C0JA 3NP9A 4ZQCB 1WV1A 2JGJA 2X5JO 4MS4A 4QBGB 5DWQA 2NU7A 3AXTA 5B3JC 5BR8B 2WVAA 1XD9A 2VWGA 3D3WB 2QY6A 2CNOA 4QQRA 5P21A 5GJBA 1WKVA 2HCFA 4EKGA 1SH7A 5HZHA 4DCNA 4LEIA 2WAMA 4IKEA 2F59A 3AHHA 1ULBA 2H0QA 2V96A 4O08A 2GCNA 2BP7B 3IUNA 1QE5A 4L73A 1G2OA 2W6PA 3QE4A 3PC4A 2WP8J 3BDIA 1HTBA 4BU0A 1QP7A 4P36A 4EH1A 3AMVA 5EP2A 4Q3AA 5JFTA 2JIOA 2LPMA 1Z82A 1M1NB 1NM5A 1E58A 3B1ZA 4RFLA 1X7XA 2WHPA 2BE9A 2EDAA 1WD7A 2A6PA 3TOCA 1L6IA 2ZBUA 1JLMA 5DNVA 1KO7A 4ZOQI 1G21B 2A5LA 1WQ1R 2OV4A 3G8AA 1EE2A 3TGPA 4IICA 1GJRA 4II2A 4YMGA 5COQA 1Y1TA 1AUVA 4H4CA 5TQ2A 3ESXA 4MJLA 1GAXA 3B6IA 2H2GA 5AJUA 4O5OA 3RFCA 2QSJA 2HF9A 5BV1A 3NZEA 4UFPA 5IUJC 3IAM1 4DQKA 4D56A 5JALA 3W5DA 1EYZA 3TIIA 2GLTA 3RDPA 3UMMA 1H2RS 1CY2A 1C7ZA 4PRZA 1MOSA 5I7AA 4Z4CA 4KFSA 3ESCA 2YY7A 3CKYA 4DWOA 1XRPA 1R16A 4DPKA 3RBAA 3R0QA 1E4EB 3TRFA 1OBHA 1NR1A 4RE5A 3GRZA 3OKFA 1WUKS 1W75A 2IEYA 1ISJA 3JAMA 5DT2A 4F2DA 2XYGA 2P62A 3FLAA 1Y5MA 1OXKB 2OVBA 3L7BA 4K9SA 3WOHA 5IF3A 4D6YA 3PBKA 3YASA 5KHOC 4C5AA 1XVTA 2G25A 2ADMA 4WASA 4DWVA 3AI3A 3S1AB 3RUDA 3FNFA 4RTSA 5E6UB 4BE9A 2NP6A 2X7HA 3C3WA 3TW6A 3H11B 4TTSA 4BZWA 1DC6A 2WD7A 5KNDD 1ZL2A 1F2UA 2B98A 2BFNA 4K9KA 5IH3A 5AI8A 4KMMA 2PNFA 4A6EA 5I7OA 2TS1A 2W6NA 3GRYA 3C15C 2HJWA 1G5TA 3NYIA 4LQLA 5JATA 1BS9A 2CXOA 2IW1A 2O0JA 3L43A 2IZ1A 1U5CA 1PK9A 4G9BA 1EUDA 4KLRA 4EATA 3L1VA 4PAQA 4EA9A 1ZKMA 4PTLA 4BLWA 1KEUA 4PSAA 1SY7A 1TADA 1T6BY 4LE2A 4F4IA 5K4HA 2IYLD 1D9ZA 4DQLA 2X13A 1YL7A 1LI4A 1XROA 2H65A 3NHPA 1IY1A 2CCGA 4KXQA 4TTQA 5TT0A 4DS3A 5BY2A 4RANA 3SF8A 3VU9A 3VNBA 5JH7F 3IP8A 1PNQA 3D7NA 4GOLD 4TQGA 3HN6A 2CN1A 1A5ZA 2GESA 4DV5B 3W5SA 1J9ZA 1UPAA 1E5TA 1ZCFA 2QZ9A 3GMTA 3MAJA 4IQFA 1FP4B 5GM1A 4BQSA 1L5ZA 1QTIA 2IQ5A 4PZCA 3QWBA 4MUIA 4YP7A 4PN3A 1JWLA 2EWMA 2NXJA 4G9GA 1A4UA 3OQPA 4YS6A 1XGKA 1IE3A 1QC5A 2QTAA 2HIGA 2IZOA 1B6TA 1TRKA 3ANSA 1PZMA 4YLEA 3LPDA 2C4UA 4HNAB 4WKGA 3AL2A 5IP5A 4HDQB 3O92A 2R1ZA 3FTQA 3MQ2A 4LKOA 5K3FA 3VISA 1FDSA 3QVSA 5I4IA 1FJGB 2UVQA 3A3OA 2XMSA 4NABA 1OPRA 3MQ4A 2OFOA 3GG2A 1UWKA 1S96A 1TMKA 1C81A 4JJKA 4JH0A 5GJVC 5B4VA 4U7WA 4V02A 1T1SA 3TD9A 1P3Y1 3MWYW 4IAOA 3ZD9A 5CA1B 3R0ZA 1MABB 1KEEB 4UCXA 3UOGA 3CE9A 1EI9A 2BE7A 1O7JA 1YFKA 1FUUA 2GD6A 2RGUA 3DLCA 1QZ3A 5EJ9A 3BE5A 1GFWA 2WUVA 2WWWA 1D2MA 1DBRA 4RQAA 1QUEA 1XHEA 5JBNA 1M8JA 3TR0A 4DNPA 3MJ4A 1OBOA 3CCFA 4HS9A 4J0QA 1JAYA 5AJZA 4BQOA 3SMVA 3WGHA 5JLJA 1ODTC 1VJCA 4XRGA 3U19A 4ON9A 2ZTMA 1KYZA 2A67A 3NG1A 4U9HS 3R8FA 5F51A 5F2NA 1ZEMA 2EAUA 2ZSFA 4LNAA 3JXEA 3PQDA 1NW9B 3BULA 3DMGA 2O3QA 2FOIA 2H2IA 4DCMA 1I6WA 1JWAB 1Y3IA 2J48A 3L7AA 4WKCA 4XIFA 3WWZA 2RCYA 3KOWA 1NVUQ 1Y6ZA 1SVWA 1XLTA 4RFVA 3K8QA 5CXQA 2VH2A 2RJNA 3EG5A 5H16A 5TF0A 3RTAA 5IANA 2J59A 3U09A 1XQ1A 4LYDA 5KAMA 3FRJA 3OQIB 2CD7A 5EL0A 3AGPA 4G41A 3SX4A 5ILOA 3QU4A 3O38A 2F4NA 3OCVA 5DTRA 3TR6A 2MCFA 1EU1A 1HFKA 2W6IA 3FWPA 1JMVA 4PLVA 5SV2A 2POQX 2QXUA 4MV6A 4V0KA 1DEOA 5ETJA 3QWAA 2IHNA 4F8EA 1NP3A 5KHLB 4J6FA 5FOWA 5K0JA 5KVCA 2P5YA 2R11A 1PDOA 4DQUA 2PMFA 5KYUB 5F2KA 3NKVA 2O3UA 1WHSA 1HT0A 4F2PA 2VPIA 5TXGA 2FWBA 1HORA 4OQMA 1K68A 1G8SA 2PL3A 3A26A 4QASA 4OX9B 3DPSA 1TCAA 2GYUA 4D4GA 1NONA 4MMXB 5JDCC 4WI1A 3VR1A 3T7KA 4ZVOA 4PC2A 4BJ6A 1SGWA 1VMDA 5FFFA 1JSZA 1XJQA 3PQ4A 1G21E 1L9XA 5AR1A 3DMRA 3GXBA 4PRYA 4RYDA 5DTQA 5G4KB 3WNCA 1W36C 2UZAA 2ETXA 3KKNA 1P1FA 1NLYA 1YUMA 3WKAA 3ENNA 4DLZA 3QI2A 3O7WA 1RJ9A 4ZTUB 1JFTA 4WVFA 4LECA 2GSDA 1SC6A 4UEQA 4AJ1A 2GVNA 3I52A 2UYCA 2IDKA 1HE5A 2FVXA 3TTYA 2F48A 3WLFA 1BW9A 2OCBA 1NNSA 3KEFA 4S1WA 5L8VA 2C5HA 5F2OA 4FE4A 4ZOAA 4CW7A 3A7EA 3ONDA 1LDYA 1MZVA 4FT4A 4JLSA 5LBTA 1C3OB 2OGUA 4U8HA 1JA9A 1LLUA 1L5HB 1MVNA 2OG1A 3H87A 1M1YA 2VEDA 3IQWA 2IGTA 5LSAA 4KWCA 1V4NA 2NADA 3OU6A 5HTOA 2PHZA 1ORVA 4XWYA 4XIYA 3O1IC 3Q3IA 1CQXA 1E3JA 3RANA 3VPCA 1COWA 1Q21A 3C6BA 3EHDA 3WHIA 1DKMA 5A5VA 1S2DA 2PZ8A 2QEQA 3TYXA 3RVMA 1ICEA 1RYEA 4V1CB 4JJ4A 2O3TA 4RZUA 1CDDA 1FXUA 5FNZA 3T5MA 2DG2A 5B3AA 4C3OB 4I8IA 1N0WA 1H66A 3IEUA 4FDTA 5BR1A 1P7VA 3D6AA 4JI8B 2FX3A 1AUOA 2Q1WA 1PN3A 1WUHS 2ZT6A 1RW4A 2QX7A 2JFFA 2ZIXB 4GG1A 3ZY5A 2VTKA 3HXPA 4P4GA 4E5YA 4CIAA 2WAOA 4L4UA 3HYSA 1W1UA 4EM6A 2R68A 4B3XA 2HU8A 2ZM6B 4JX8A 3P9CA 4AQYB 1HQCA 4EY3A 3GXOA 3ZQJA 4JIMA 4O2RA 1TUBB 1LDMA 5MN6A 5HZKA 1EM8A 4KXMA 3L4SO 4S1OA 4GLJA 3C85A 2FMIA 1V41E 4QXQA 5BVGA 4DR4B 1CP2A 3VR6A 3ZHBA 1M8FA 5CT9A 1EIZA 3H8WA 4B6OA 2I99A 3CWQA 4CHTA 1GUDA 1ZP6A 5AI5A 1QFMA 4LY0A 3K9WA 4DQXA 3PHCA 1KAMA 4ONEA 3UG6A 1RE0A 1WEKA 4QUIA 3V1UA 4NMXB 4YV2A 4F5ZA 2D1RA 2XEDA 5A4DA 5D3MA 3I5UA 5AH0A 2P3SA 2HJRA 4NONA 5LBUA 4ENQA 1UM9A 1W581 4MVJF 1L4MA 2SICE 4ICIA 1MG5A 1KU0A 1RIFA 2ZE6A 5HKKD 4MX8A 3OPYB 1UWLA 1T0UA 3BHNA 3IDZA 2PD4A 1NAIA 1M72A 1QX4A 1U6IA 1U9IC 2FETA 2QE7A 3M33A 1U2TA 2BUBA 4E3WA 13PKA 4DRXA 5LU9A 5CEFA 1TO6A 4GLOA 2JAWA 4R1UA 4DSUA 4UD6A 2QUIA 2JC3A 2OBMA 1USVA 3JQCA 1TF5A 2VDJA 4D0SA 16PKA 1I13A 2HUPA 3ZDDA 1UJBA 4W5QA 3UMFA 3L7YA 3U7QA 3L77A 1W6RA 1X7WB 2P2LA 3BXHA 3KR0A 1DQYA 4RLQA 2AVNA 5BWBA 5JD5A 4JB0A 5GGXA 3N8NA 2Z3WA 2C1EA 2IF0A 4W9MC 1SCNE 3DSRA 1JIKA 3S3TA 1IEVA 1MO3A 1E8NA 2YASA 3PZBA 4A3SA 5K3EA 4DNFA 5ILQA 1XA3A 2P8JA 3AI7A 2I29A 2IODA 1STOA 3TL2A 5E3HA 3IEKA 4I9NA 2ZT8A 2MU1A 1E7MA 4YB8A 1JQLB 4DNOA 3KZCA 4OKSA 4MYRA 2BFOA 4KNWA 4RVSA 2G1JA 2QY9A 3VNQA 2Q7OE 5HIJA 3C98A 2CFOA 3EC2A 1ZRMA 821PA 5JQGF 2HSDA 3CZMA 4DV3B 3TUZC 2BH2A 1UJCA 3NFRA 5GOTA 1GQFA 1I6LA 2D5BA 1HQKA 3ROEA 5GINE 2Z6AA 5ALNA 1AGNA 2QV7A 2XYHA 1RRVA 2GKOA 4B6JA 1KIAA 1ZCZA 1XNQB 1TO2E 2Y9MB 3MAGA 1AA9A 3OSUA 2ZS8A 4UMFA 4QREA 1O89A 1Y8AA 3AJ9A 3AHIA 5EKSA 4YT4A 1E0KA 2JFZA 2KYRA 4E1VA 2AGVA 2SKDA 3CC8A 4MKRA 2QD2A 2WE8A 2XLBA 3I0MA 3K72B 3KZ1E 1KZ7B 3H9CA 4TS4A 5TRTA 3SIWA 5C46F 1ZISA 5DEOA 5DV9A 4IP0A 2HA0A 4O4JF 4Q4HA 2Q4BA 1NGSA 3CX7A 2GH1A 3RCBA 2W48A 1J7JA 1VKOA 1N5LA 4QE3A 2H4ZA 1QHNA 2QTGA 2HPAA 3QBJA 1QH8A 3H3JA 2F62A 2Z4RA 2ZETA 4GGPA 2PZMA 1NXVA 1UINA 2L82A 4NARA 4DLTA 5BYJA 4FYPA 1C41A 2GQ0A 3COYA 4UQPA 3CVWA 3UB2A 3O8CA 2I4IA 1U0BB 1AHHA 3EXIB 1N1DA 1KI2A 3MT8A 1TCBA 2IX9A 4KUGA 1XNJA 3DTVA 1LFDB 2LVBA 2QRJA 4L2IA 1UCFA 2D54A 2ISQA 3IJ5A 5A1JA 3CVJA 3QOXA 1G63A 1JHUA 2ZI4A 5CJJA 3QYAA 2HHHB 3EK2A 1JDVA 1XEWY 4RD3A 3B5JA 4ZCIA 3WB1A 3BGWA 3AEZA 3LP8A 2PK3A 5CEJA 3NH6A 1R37A 2C4HA 4IX9A 4WXRA 4DANA 5IT5A 1JP7A 4M83A 1JL3A 4OMUA 1UDRA 2VHUA 4ZHQA 4L3WA 1XRMA 1JN0A 2SKCA 5HCIA 3K9QO 4R9RA 3W8FA 2H5EA 2PV0A 5J4VA 2IFTA 1L7QA 1VLQA 1XKQA 4MQ6A 4R83A 4JEIA 4RTMA 2CD9A 1LRKA 1ZUHA 1NNEA 1W4CA 1W59A 1Q50A 3KUUA 5LU8A 2FWMX 1ZJJA 3N2NA 5F1YA 3K16A 3BE6A 5EJEA 3L4BA 1R6BX 2QQ0A 3GFOA 3NM4A 3D8UA 1SKQA 2H1FA 4FYHA 1R0ZA 2BKXA 5E0KB 4IUCS 4RJTA 5JSHA 3AKZA 3LJKA 2G36A 1HH4A 4DWJA 5DGIA 2K2WA 4JJZA 4BO4A 3DDUA 1OLSA 1A5TA 4HMQA 4MS3A 4QFCA 5CFPA 5AJWA 1P2SA 2H0RA 4K2HA 2PS0A 3FKQA 1GQQA 3BILA 1W4LA 4KUEA 3ML1A 2O0KA 5CBPB 4FYJA 3G8BA 4P4SA 1NVMB 1XXLA 2BGKA 5IN4A 2HPHA 2UVPB 4Z7OB 3FUXA 4JASB 3DZJA 3RYIB 1B26A 2PX2A 1K7CA 3PHBE 4L51A 3HN7A 1GN8A 5T6MA 5CX1A 4EGFA 2VT7A 1IUOA 1XHLA 4BVGA 3U44A 1W96A 1EWYA 1DFIA 1YS6A 1UWCA 1DHTA 4PHCA 4U8GA 2DT8A 2F8MA 1YOVB 5LIPA 2IWRA 4E7OA 4GKBA 1K9VF 3GELA 5G0VA 1MJ5A 2C82A 4KRGA 2EBUA 5H82A 2VH1A 3AIIA 4UBMA 2GLUA 4UQOA 5BWCA 1FVXA 1IN6A 1Z33A 3E2PA 3PU6A 2HFKA 1GPJA 4X1OA 1KSGA 4IH1A 1GD1O 2FPSA 2LNDA 1ZD9A 3BMCA 2C07A 4RZIA 1RTTA 4MR7A 4RENA 2F9LA 3VC7A 3KJEA 1L5OA 3VFDA 5FOQA 2W98A 4QFBA 5K0NA 1X14A 2IXBA 4NYIQ 5J2TB 3D2CA 4HLUC 1ZNXA 5AMXA 4CFZA 2WNIA 1ND5A 5LQDA 3I9KA 4JC4A 1HE8B 1NN0A 1ADBA 1O9BA 2C2GA 4UDNA 4ZOCA 4CQMA 2JW5A 4ENUA 1V1MB 4AC9A 1NI4A 2OXTA 4XWWA 3HUDA 1H6CA 1Y7TA 4C07A 1C3XA 1CY8A 4AWXA 1NR7A 4CGZA 2OV2A 2E3JA 5DCLA 4IR7A 4GOJA 3GGDA 2D62A 3RIXA 4CMHA 1XQWA 2X0FA 3KVVA 4CMAA 1BD4A 5E3IA 2FPMA 3DDWA 1WCIB 4XD2A 4AQ7A 1LUAA 3FCXA 1FY2A 1N33B 3A05A 3LUFA 4URWR 1JR3E 1EHYA 1VA4A 4RMIA 2JFWA 4OOFA 5C1IA 3QUBA 4WD3A 3UK2A 5DLEA 3HDTA 3IOBA 4TMVA 3TPCA 2UUCB 1T5TA 1I3MA 5D6NA 1AS0A 1D3AA 4QYXA 2Z43A 4C14A 4FEAA 4NZOA 3WAJA 3DKIA 3QVXA 2C03A 4OJMX 3NLLA 3AU8A 1FTQA 4UE6A 1BDHA 1BMQA 1QIJA 2FQQA 2HZBA 3LIIA 3OLZA 3A9TA 4ZYLA 4WFIA 4LC9A 5LXTB 3BIJA 5DE3A 3WNBA 3B6KA 4QOSA 5DTIA 9ABPA 5IULC 1N6LA 2AF3C 3HH8A 3ICCA 4FR2A 2P9ZA 3EXHA 1Y6FA 2WK1A 5IS2A 1RBQA 3ZHTA 3WB9A 1T43A 3RUFA 2I4RA 1ZK3A 3BWEA 3RWMB 2PLRA 2IL1A 2ZIAA 1HE3A 3QFRA 3O8BA 3AZPA 1KYXA 4YJFA 2D00A 3H5NA 2W22A 1MVOA 4J94A 4KN5A 1ZRSA 4PYIA 2GGSA 2O2HA 4IEFB 1PSWA 3EOZA 4MRRA 2XNDD 5ENVA 1FDUA 3LY5A 1T8TA 2Q2NA 3DA8A 3PA8A 4E5KA 4DDTA 5CMLA 3N3BC 1DEHA 3WYCA 4A8PA 1RCFA 1ORTA 1XZFA 2P3LA 2I2DA 3K53A 3HYCA 1IY8A 1YMUA 1DO2A 3IJPA 2X8BA 1YDEA 4D41A 1RZUA 4JQYA 1O96A 3ROMA 4EABA 4M4SA 3A0UA 1EK0A 1FB5A 2X1MA 2M1ZA 1WZCA 4TRMA 5AKJA 3FPHA 2ODPA 3INRA 5FLEX 3WIUA 5KO2A 2PUFA 4V0QA 1YQEA 4DLBA 3I3OA 2QL5A 5KCZA 1GFZA 2G8NA 3A6FA 3A8TA 2VP4A 5FYQA 3QEMA 4IIUA 5TGZA 3VC1A 4EY5A 1OTYA 1DAIA 2HMUA 3X1KA 1DQZA 1BO6A 1R9MA 4R54A 2E5FA 1BE6A 1JH9A 4K05A 3D1JA 1FPQA 2VPYA 4G8JA 2ZITA 3UMCA 2PL5A 1N6IA 3RREA 3MELA 4O5AA 3WNDA 2QF7A 1FMTA 4ILKA 2AE2A 3I12A 2IYNA 1CS4C 4E2FA 1R5NA 621PA 2X9LA 1R6DA 3AUKA 3IBSA 2YR0A 5LQNA 1EFPA 1A72A 2J30A 3HKCB 3OETA 5K4AA 1QRAA 3MS4A 2GN6A 1SNYA 1W87A 2XE6A 3DT8A 3IUSA 3L0IB 1UH5A 3LSTA 4LQ4A 1H4SA 2PUGA 1TEXA 3BM5A 3AILA 4G0PA 4EAAA 2CLOB 3OKAA 4D97A 2Y2VA 2XNJA 4JI6B 1UMBB 1J8QA 4AN4A 2EEZA 1INLA 4DXAA 5IFKA 1DC3A 3IT3A 1YJQA 3ZS8A 4JQSA 4W5JA 2I87A 4GDMA 1XTJA 4ZYWA 1E77A 3JQ8B 3HFRA 3A37A 3NOVA 2R6GA 4ZO7A 4O25A 3TEFA 4PFJA 1NNI1 5DK6A 4A9AA 1GRRA 3F2IA 2OV1A 1UC4B 4QHYA 4LF9B 4YCJA 1IXZA 2XWQA 4A0FA 1OASA 1Z34A 2E5WA 1I4LD 3MMZA 4JBIA 4KPUB 4NEGA 3TLGA 1E1RD 2JA2A 3NWEA 1MBZA 5FUQA 1GM5A 5DSXA 1NVKA 3LLMA 3IV6A 1UJ4A 1QE0A 3FAZA 4Z9YA 3UJ7A 2G4CA 5DF1A 1CUWA 2W9XA 3IMCA 1WD5A 4OK5A 4IQ8A 3WA6A 4FGJA 1SIBE 2SCUB 4RLSA 1RRPA 2VRNA 2GFQA 4C0KA 2I62A 1CZNA 2G1AA 1W0KA 2RGGA 1GU7A 3FPCA 3OCWA 3OIDA 3QKSA 1KE2A 2HT1A 1V35A 1H1LA 1VIVA 1E3QA 1MMFB 2QM0A 5IMSA 2QN9A 1O1YA 2H4XA 4FW8A 3E5NA 4JLBA 4K3VA 3OU2A 4Q24A 3SZ3A 4JUIA 4EG5A 1XAJA 1PL6A 3O94A 1DG1G 3DDZX 3I62A 4WINA 3B7WA 4AS2A 1IHUA 4RETA 1CQJA 1THZA 2X23A 3D7SA 3R5TA 2V65A 4OMCA 5AW6A 2P6RA 3IQEA 3IX7A 3QEJA 4UEJA 4HNVA 1YRBA 4H4DA 3ZDZB 3UM9A 1LF5A 4RHCA 1GVNB 3BDVA 3EEQA 5ER9A 5HOQA 5H8WA 3URKA 5E7MA 2AKEA 5HYVA 3IHWA 1RWOA 5G0UA 4C6SA 2C8JA 3HBJA 4TL9A 1CQIA 1FPMA 1P1RA 1TA0A 2IUFA 1M74A 4M1SA 2ZJBA 5F23A 1S0UA 1BNCA 2YJNA 1QIEA 3TBFA 2XKJE 3NEAA 3UN1A 4E03A 3KCNA 3PQ6A 4YREA 3Q9UA 4YQEA 2NIPA 4YUAA 4ACBA 2O8CA 3P1JA 4QYMA 3V4ZA 1BHO1 2CJWA 4A10A 3O75A 2LKDA 2XEXA 4QECA 5AVZA 3HU2A 1PLLA 1ZM2A 2CXUA 1P75A 5JAQA 2AQKA 3K6SA 1X1QA 2QTFA 4XQ9A 1XN4A 3ROPA 2REQB 3V1KA 1VL5A 2XIJA 4BC1A 1XVAA 3UMVA 4J0GA 2CE2X 3ISJA 4PE5B 5FNVF 5HF5A 2R00A 3ZVRA 3K0AA 5AFSA 3NRBA 3UOWA 1GTSA 5E95A 5BWOA 4TZ0A 2WM3A 3O3NB 3G7NA 1SIUA 2YQZA 2D5CA 3M6WA 1YB7A 2COKA 4G5QA 3BVPA 1K75A 3K9GA 3R3XA 3WNVA 3RAGA 2A9PA 5B3JA 2JIRA 1UP6A 3TSCA 5KKCA 4LISA 4RBNA 5BN4B 1XCJA 2JGNA 4YRLA 2G7MC 5E9JA 4RVHA 4AJEA 3OOJA 5FB3A 10MHA 4RQTA 1TW2A 1V8FA 1PQWA 3C6XA 3TINA 1D7OA 2XPCA 4IIJB 1IPEA 5IJ0A 3O8QA 4RTRA 1OTHA 5THQA 5EG5A 4DVGA 4RULA 4ZIRB 3FETA 3G9UA 4JA2A 1ZNZA 3MTIA 1ACLA 2OZEA 1D6MA 2VUTA 2IQIA 4OATA 4BNLA 4RY0A 1Z5PA 2ZANA 4Z7JA 5JR3A 3VHRA 4M37A 2IPOA 5SY6A 2JGIA 3PEVA 3SSNA 2HDNB 3FDXA 1TLFA 1MPTA 2QVCA 3PQCA 3L7DA 3PR3A 4ZT5A 3UENA 1I94B 3UJ3X 4D6PA 3GBPA 4J0DA 2G9VA 1Z4LA 2C4TA 3UJHA 3W9UA 3FMPB 3WIVA 5GVRA 4KQXA 1BXKA 1Q3KA 4ETWA 4NAUA 2R8YA 4LHWA 4WOKA 1KI9A 2YNMC 3QUAA 1PI3A 2C5LA 2JJ8A 3FPLA 3NHSA 3QSGA 1S3SA 3FOBA 4JP5A 3T9DA 2G9RA 5CG1A 1NWCA 1K7XB 5AJXA 3M9XA 3VU0A 4L9AA 2Q3HA 3IIKA 4BRUA 2FK8A 1XDGA 1B14A 1KH2A 3NWOA 4OOEA 3X1MA 2IXGA 2XZPA 4TMKA 5DH9A 3BXGA 2YXLA 5I5EA 4C0AC 4RAQA 4DLUA 1NF3A 3MTBA 2FSVC 4IUDS 5IARA 4KXYA 5UKDA 1YB6A 3KL4A 2C0QA 2H17A 1GKYA 3ETGA 1ULZA 1X87A 1ST2A 4HGZA 5DWVA 1ZN2A 1ZH0A 4EQ6B 1U7ZA 2VDWA 4ZEWA 2PBFA 2FW8A 2M6SA 1MEOA 2CVHA 3Q7EA 1BMTA 3CVVA 2HMTA 4C30A 2QLNA 3F71A 1JSLA 4RIGA 5CIYA 2IDMA 4UHDA 1VSBA 4P58A 1ZU4A 3W06A 1N36B 1OOEA 3DPUA 1S2OA 2DUUA 3OZRA 4Q7KA 4EPTA 4EEXA 4BMOB 1ZIPA 4C0XA 1VYUA 2IUYA 3D6HA 4J49A 4U6QA 2I9KA 1XF9A 3SS7X 1TVMA 2Q29A 4EJSB 2ST1A 4L4XA 1T3GA 1VG0B 4YRJA 4NAHA 1TCCA 3EZNA 2GRUA 2P79A 2CL6X 2ONCA 4DIFA 2QVYX 1JSCA 1B3RA 1PBNA 1VCMA 2R79A 3LD9A 2C7PA 3IXQA 2YOGA 1R6VA 4AUMA 2FZGA 4N7MA 3TQTA 1UMCB 5IWCA 5HCUA 3AY6A 4KDCA 3R9XA 4B6FA 9LDTA 2P30A 4WESA 4X6YA 3S1SA 3LXRA 2GCOB 2CHEA 1WQ3A 2VF2A 4QTYA 3AR3A 3FRIA 2NZ2A 1MV8A 4NYJQ 3GLTA 1LTKA 4HB4A 4P4TA 3GWZA 3F1LA 1XTSA 3QWHA 1YMVA 1SJ9A 3ELWA 1YZYA 3KYBA 3O83A 2DC1A 3GVCA 3PWTA 3Q2KA 3TECE 3GCZA 5KWVA 4M9ZA 3EQ7A 4C88A 5LOVF 2M6LA 1HDEA 1XPRA 4B81A 1L5RA 3RFFA 2AEFA 3DNPA 3TQQA 5FDFA 3GP3A 3NUQA 2BHTA 2R8ZA 2RB5A 3O90A 1TQDA 3QE2A 1U1IA 1V7CA 4O4IB 3BHIA 5KYNA 2UV8A 4REMA 4IFBA 4NZYA 1KI8A 3KB6A 2P4HX 3FYHA 1PL0A 3GT0A 3ZGYA 1IONA 1J20A 4BLSA 1TE2A 3GB9A 4N54A 4YMTA 3QKRB 2O19A 2ECFA 3UHPA 3VPAA 3GQBA 2XMDA 1LWNA 1W88A 1RLJA 2RHDA 2AMJA 2FVYA 1CRZA 3GMSA 3MT7A 2CBXA 4P86A 1R8SA 1OZHA 1AU9A 4KN8A 1JG4A 3G5TA 4LTNA 4LRYA 3QTBA 4OXKA 3WLNA 1L5SA 2AYYA 3QG5A 3ILHA 4PS1A 4UTNA 5CFMA 1PJ3A 2FWIA 2XDWA 2RC6A 3A1EA 4BNFA 2FQXA 2I9PA 4U2KA 3IBTA 1RJDA 4Y1EA 3OM9A 4UPEA 4PLPA 2WAYA 1JG1A 3GJZA 5GAJA 3RO7A 4N41A 3W5HA 3I9FA 1HO3A 1TGVA 5BO5A 1PO7A 1Z7BA 4QEKA 4HTFA 4DARA 2VQEB 4D9NA 3A1CA 1A8SA 2QRLA 4ZOLB 3L1UA 3BHJA 3VR5A 1XDUA 1GXSA 2DUMA 2H08A 4KO8A 1HDGO 1KZ1A 2A86A 3DBLA 1YR1A 4MV0A 4Y2GA 4DCOA 1EFUA 3GRUA 2WT8A 4GUAA 2QDKA 1C9EA 4JYCA 4RKFA 4M1YA 4S12A 4S04A 1DCKA 4YRMA 2C7QA 1RHRA 2XWSA 2HEGA 1PK7A 1T91A 4PX5A 1FJHA 3GHYA 3IPCA 3PGA1 2C95A 2HRDA 4P22A 1PF7E 4UBLA 2LE0A 1JRLA 1QZTA 2HQOA 3H9GA 6CHYA 3REQA 1J5EB 4RA6B 2BFAA 5DTEA 3GO4A 3F8SA 3N6VA 4KE6A 4F71A 1NXTA 3H5OA 1IOLA