3FE2A

Human dead-box rna helicase ddx5 (p68), conserved domain i in complex with adp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
234
structure length
234
Chain Sequence
QEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Probable ATP-dependent RNA helicase DDX5
total genus 80
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fe2A00
1Q1BA 4YMTA 4LHVA 2BEKA 4DKXA 1KJYA 4LC0A 4MGZR 4QBHA 4Y0AA 3DZDA 5TY0A 4ZV4A 3FHOA 4QHTA 8OHMA 2VHUA 1Z0KA 3NBZC 1E2JA 3FPAA 1JR3D 3R9XA 1E2DA 2B6HA 1N5KA 1J99A 2Q21A 5EXTA 2CNWA 1KNXA 3B1VA 5GJVC 3K70C 1LF0A 2ZAOA 5HCNA 2ORWA 2JJ2D 4LZZA 4PTLA 1ESMA 2YVUA 1E98A 1P6XA 3R20A 1D9ZA 2J3EA 4B3CA 1Z83A 4ZPXA 1OB5A 1P3JA 4AYXA 3QNUA 3VNUA 3SJAA 2UZIR 1KSJA 2ZRHA 1ZD9A 2F6RA 3THYB 3GCGA 4URWR 5TVKA 2RB4A 4HUQB 4KO8A 5KHOC 4PR0A 3PEWA 1YR7A 4ESHA 3RRZA 2W58A 3C4JA 2AL7A 2I1QA 2JIZA 2ZSEA 4JKIA 4NYIQ 5IF9A 2H92A 4LRWA 4DLSA 3QXSA 3QPVA 2YYZA 2ZVPX 4LCBA 2BWJA 3EZ6A 4OQLA 4KBFA 4BLSA 3FHCB 1TQ6A 4JLKA 4DLRA 1HUQA 3U6BA 1TADA 3WXMA 1FL9A 5AJWA 4BFYA 3RRMA 2X77A 2F7SA 2C03A 4JKYA 3U60B 2V55B 1HQCA 4AKHA 2A3RA 3CR8A 3THYA 2CCJA 2NO9A 1KZ7B 4OHVA 1SQ5A 3EPKA 3BWDD 3W5JA 2QM8A 5JWHA 2OXCA 2R9VA 3IIKA 4LJ6A 5CLQA 2MMCA 5LB2A 2Z83A 4A92A 1EG7A 1L7VC 2AKAB 5JLJA 5TMPA 4HSEA 5F98A 2F1JA 4LJYA 2F1IA 2JLWA 3AVPA 4B73A 2IA5A 4DIEA 1UBEA 1E96A 3VR2A 1M8PA 3UG7A 5AUPB 5BYJA 2O5VA 4WXRA 2BEJA 2J0SA 1XD2A 3BBPA 1US8A 4FINA 3LWNA 3AF0A 4CW7A 1CR0A 1XPOA 1LW7A 2QP9X 4M53A 3VTKA 1G7SA 4BGDA 4Q7LA 1Z6YA 3GLIB 2OBNA 1F3OA 2DYKA 3AVWA 4LHXA 2ODWA 4Y0VA 4YQFA 2OG2A 3VAAA 1CR1A 1H8HA 4TYNA 2QSZA 3PUWA 3RDPA 2ZUCA 4CEJA 2IS4A 4YMSA 4KLZA 1KNQA 2C2HA 1XEFA 4URYR 3T5GA 4CRWB 4G5SA 2FA9A 4LY6A 3CX7A 1Z6GA 2FEOA 5JHHB 3Q5DA 2VHCA 3ADCA 5DIFA 1L4UA 2GA8A 2WSSA 1N6LA 4C4PA 4Q18A 3BH6A 1XCGB 2C5LA 1GTVA 3IEUA 2A2ZA 4FMDB 4A1FA 1VIAA 2HCBA 3SYNA 1BOFA 4AYTA 3QF7A 2QPTA 3OIYA 4KFRA 3VNVA 1DEKA 3NIBA 4PPFA 3GP8A 4Q66C 4JLPA 1U81A 2GCOB 4LJ9A 1X8JA 4D4JA 1VECA 3AGQA 2JLUA 4OK5A 4B33A 2MMGA 3PEYA 4LDJA 4IW3B 4R71A 1PVOA 3LO5A 4ASUA 2OEPA 4GBMA 4HZUA 1XMVA 1OIVA 3QXXA 5K8IA 4O3MA 1VCIA 3CM0A 4Q02A 4HAYA 4JLNA 3BFKA 5EZ6B 1KIMA 4A8JA 4URVR 1LY1A 1XB2A 3LAWA 5EP4A 3MCAA 1R6BX 2CDNA 2QN6A 5E4FA 2EYQA 1TNDA 3VR6A 1WDTA 1S0UA 1A7JA 2W6ID 1SHKA 1KSHA 2GCOA 2VSXA 1PLKA 3RS5A 2XTZA 3B9PA 1XD8A 5FBLB 3HR7A 4RSGA 2W6JD 3QEJA 1T8TA 4US2R 2BHRA 3MJHA 1OXSC 1JR6A 2CVHA 2MSDB 3BRWD 1Z07A 4P4TA 1AQUA 2VP0A 1L8QA 3CRQA 1ETUA 5LBIA 1F2TA 2OFWA 2Q0HA 3CPHA 2C77A 3PVSA 1G3RA 4GOKA 4HDCA 3WNBA 3K70D 4QG7A 4DHEA 1CR4A 4M1WA 4PXAA 2D4HA 3C15C 4HLDA 2OSBA 4EPVA 2C96A 5DYGA 3LQQA 4QBGB 1SVKA 1U9IA 1A2KC 4ACAA 4B35A 3QF4A 4FMCF 3H4MA 1TPZA 2ZRFA 4Q03A 4KVGA 2NZJA 5FBVB 3ZD6A 3G0HA 5FI1B 3TQFA 3LW7A 4LYJA 1O87A 4DSNA 2VSFA 2AK2A 2ZITA 3IBGA 1XTKA 3GJ8A 5BN5A 3R8FA 4Q7KA 3T35A 3I5XA 4HAUA 4US0R 3X2SA 3KDSE 1XMIA 4JLAA 1SHZA 2G1KA 4GP6A 2REOA 2ZR9A 3K0CA 2ZYWX 5FOXA 1SXJD 3UG6A 2FJUA 3AP2A 5DI9A 3TR5A 4L5BA 4QHSA 4NONA 4RKEA 1ONBA 3UIEA 2ERXA 3IILA 4NYJQ 3WRXC 1M6NA 4YC7A 2IXGA 2FZ4A 1EESA 3SFZA 2IYWA 2KSQA 4GMXA 4MITA 3QQ5A 2CK3A 3QVUA 4A8JB 4BASA 2J7KA 4LV5B 5AK0A 3IIMA 2ANBA 2ZANA 3CB4A 4RD4A 1RC8A 1I2DA 5E7MA 2IC5A 5FTJA 2ODBA 1W2HA 3QXHA 4A0RA 3DMDA 2FH5B 2QE7D 3N70A 3GLFB 1P9WA 1NVVR 1DADA 5EUQB 1BYIA 1XD9A 1ZIOA 5D3QA 5JMTA 1G8YA 4NE2A 2JDID 1W0KA 3GLFA 2VP2A 3DKPA 2BMJA 5JCPA 1A82A 1KI9A 2AWOA 3KTAA 4Q00A 1OYYA 3QKRA 5HKKD 1ZBDA 2OCPA 1E1RA 1XJQA 2DCUA 3ND9A 1W4AA 3SBDA 1CR2A 3R9WA 4QBIA 3Q3JB 4ZKDA 2H1LA 2P67A 2CBZA 2YINC 4AIIA 3V4FA 2O8EA 4IEEA 2V3CC 3GLIA 1GILA 1FOEB 2QMOA 2QTHA 1JR3A 3I72A 4U00A 3RS0A 2F43A 2PBRA 4NYMR 1VG9B 3GMTA 5KU1A 3AB3A 3AV0B 1ZM9A 3AQ4A 2EFGA 4BZQA 2XZLA 2ODEA 2QQ0A 4FCTA 1T5LA 4XOIA 1E2EA 1DG3A 4KFSA 4LJ4A 4QXAA 4TL9A 4Z1MD 1D8TA 3BFXA 4KITB 2G83A 4OI0A 5K8UA 3BFVA 4L15A 5C2JB 4NZYA 1KMHA 3C8UA 3R9IA 4BE7B 2IWHA 4ZKEA 2ZETA 2PCJA 1E79A 1OYWA 1U94A 4LC1A 3V4RA 2Q9BA 1S4QA 1VCNA 3IGFA 4IFBA 3PFIA 3TJZA 3GLFE 2D74A 3OHMA 1ZCBA 5FOUA 1DARA 2XOKA 3NH9A 2WKQA 3LBHA 1NVXQ 1Z0JA 2LWIA 3W3AA 1MABB 5E7JA 4F4JA 1G3QA 3HU2A 2WPDD 1IM2A 1FTSA 3QOFA 4F92B 2LKCA 1MABA 1XFAA 1GUAA 2BBWA 5KUTA 4LYFA 1P9RA 3IQWA 3Q72A 4DB2A 1Q12A 2B92A 2QRNA 3FMPB 4CDGA 1E2QA 3DHWC 4OHWA 4JS0A 3TW8B 3X1YA 4U02A 4V0OA 5EXXA 4DBLC 5HKKA 1PUIA 1HV8A 1FQJA 1KO7A 3BORA 3OAAD 4A4DA 1MT0A 3MMPA 1G6HA 3CLVA 4MYUA 1XMSA 1IXZA 1G9XA 2J45A 2IS2A 2Z4SA 5HE9A 2GBLC 1ZM4A 1FP7A 1KY3A 2PCLA 3EIEA 1TQ2A 3X1XA 1MKYA 2QT1A 3B9QA 3EA5A 4R7ZA 3MD0A 2X19A 4EFLA 4MUBA 3SYKA 1JQJC 4JLJA 4URXR 2ZRCA 5FPYA 2HT1A 1G4AE 1KAGA 1WF3A 2X2EA 3F8TA 2WAYA 3LH5A 2QZ4A 2R6FA 1X6VA 3B5JA 2L0XA 4MH0R 1XP8A 3DOFA 4RCYA 3B82A 3ZZUA 1GRQA 2IYUA 3SEAA 1T9HA 2BCGY 3ZZ0A 2GEDA 5E3HA 3KQHA 2FPLA 3AKEA 1G17A 3M0EA 4HB0A 4M2LA 4CT5A 2V6IA 4BPBA 1G1MA 2ZSFA 1F6BA 4KLNA 4MGYR 4NCKA 1ZIPA 2GJ8A 3DOEA 1VDZA 2HDNB 1E69A 3QG1A 2BBOA 5EXSA 4KYUA 1E2NA 1WP9A 1FMJA 2RGNC 2IYRA 4FMBB 4Q48A 1E9CA 5HZKA 5IT5A 5AUNB 2GKSA 3KJHA 1Q3HA 5JI2E 3AVYA 1CULC 2PMKA 1RKBA 1QF9A 3MWJA 1H8ED 1S3SA 1GFIA 1II8A 2JCSA 2RGNA 3HP1A 4MA4A 1DAGA 3ICQB 3FFAA 1W4CA 4OHZA 3L0PA 2WMNB 4I1SA 1ZUIA 1LB1B 1U0LA 1YR6A 1E0AA 2Z6VA 2NZ8A 4V02A 2AHOA 4AK9A 2OAP1 4C0LA 1Z08A 3EC2A 2CHVA 1VG8A 3Q8XB 1TF2A 2WWHA 1E32A 4PAOA 5JS8A 4JMPA 3ETLA 2P3SA 2RGEA 4URUR 2ZJ2A 5L8VA 5F9FA 3LRPA 1CXZA 2EFEB 3IIJA 3RS4A 3TMKA 4TSFA 5LD2B 2WJHA 1SKYE 1XBTA 2GJ9A 3BIFA 1GAJA 5IDVA 2EVWX 5KSYA 4JLVA 1RPZA 4E03A 4IEIA 1NN0A 1V5WA 4XSGA 2V7QD 3AF2A 2JA1A 4NP6A 1LF5A 2IW3A 3U2QA 2ZSAA 4ZCIA 2Q3HA 4Q9JA 3T06B 2Q9CA 4LJ7A 3A1SA 2D2FA 2DFLA 1NLZA 2D2EA 4NU0A 4Q7MB 3K0SA 1F5NA 2V4ZA 1J90A 3LNCA 4G1UC 2CHGA 3EW9A 4NCHA 4UJ3A 3K09A 3G5UA 5LPNA 4TLEA 3N2IA 4BZXA 4BFZA 4AD8A 4FWTA 3T5DA 5KYKA 3VU9A 2OXRA 3EX7C 1BMFA 4G5QA 2OAQ1 4PPGA 1JQLB 4IVPA 4R98A 4Z51A 3A36A 1RE0A 4OI4A 5L3RA 3KFVA 4ZCMA 1FNMA 1P7CA 2NQ2C 4DLWA 3THXA 1AN0A 1SKQA 2IUSA 5L3SA 2DHRA 1IXSB 1ZU4A 2GEUA 1FZQA 1ZC4A 2OBMA 4TLAA 2RMKA 3B1XA 1IONA 3K9NA 5CM9C 3DO6A 2D3WA 2QA5A 3CRMA 3E5HA 1IY1A 1E2HA 1CJTC 3ZDQA 4GOJA 4G01B 4QL3A 1RJ9B 2I4IA 2IYZA 5EP1A 4A82A 3VFDA 4D0LB 2GRJA 2IYVA 3W8RA 4JL8A 2WOOA 2VHTA 3KXKA 4HB4A 1GSIA 1SVLA 4HAZA 1U8ZA 3OAAA 4Q9KA 4NL4H 3O47A 1VYTA 2J41A 3AUYA 3H0KA 5BQ5A 2C78A 4EFMA 1XCMA 4C2UA 621PA 5M04A 4GZLA 3BB3A 3C7KA 1OJLA 2B8WA 1YZGA 5CLLA 1E1QA 2CLSA 3AEZA 3W90A 1RIFA 3R7WA 1YR9A 1RFLA 3JVUA 2YKGA 2O8CB 1ZCAA 1AGRA 1M74A 2V54A 1WCV1 2A78A 4EJSC 4QNRA 3NC0C 2SHKA 1KOFA 4LJ8A 1P2VA 4WIAA 2P0EA 1JXMA 1L4YA 3PUVA 2V6JA 4B44A 2CLDX 2RGBA 3ASYA 5F3WB 2O8DA 5FH9A 1N25A 4MUAA 4RZ2A 1E0JA 1TUEA 3H1TA 2VP4A 4W5WA 4DLUA 3DKVA 1E2MA 2K5UA 3CBQA 4TQ9A 2QBYB 4LYAA 2W0SA 1N6OA 2H17A 3UXMA 4B34A 3GEEA 4L9SA 2ZRGA 4E5UA 1OFIA 2R44A 3OEHD 3UWOA 2JLYA 2JJ2A 2ZI3A 4Q1CA 3QUSA 2FG5A 3GEIA 1RRGA 1N6KA 1Z6AA 2FGKA 2JJ1A 2YWHA 4RKFA 1KKLA 1Z6XA 3NBYC 2CEAA 3TR0A 5JRZA 5BN4A 2B21A 2XGJA 1X1RA 1IN7A 4QM6A 1T5IA 1OXVA 4RY2A 2WJJA 2G1JA 4Z8YA 4FWIB 2HLDA 2ZJOA 5DYIA 3RS3A 1RJ9A 3WP0A 1P5ZB 2QL6A 1MO5A 2OCAA 2WKPA 4IOKA 2HYDA 3NKVA 3OIVA 3QKSB 1CF4A 5P21A 5CDFA 5GJWC 5H68A 5K8LA 4URZR 1HURA 3IUYA 4BRUA 1KK1A 4LHZA 4MKFA 1G41A 4MRPA 1UKZA 3B7GA 2DFNA 3KFXA 1COWD 4I81A 4BZPA 3U3KA 4MRSA 3TGPA 2E87A 4C0QC 2IYQA 1Z06A 2EWVA 1T91A 4DLVA 4N3NA 1E2KA 1M34E 4HLCA 5FOWA 2QAGC 1OE0A 3JZMA 4GI7A 3EPJA 5L3VA 4PQRA 2N1BA 3P20A 1KI6A 1MO4A 2VEDA 3TNFA 3WNCA 4Q9HA 5FPHA 1YZTA 3DVLA 1T0HB 3CNLA 4LK2A 2CNWD 1SVOA 3NC1C 4Q4JA 3BAFA 3VR4A 5EP2A 1CJVC 4TMKA 4Q1AA 1OXUA 4PQFA 4RD1A 4D0GA 3KL4A 2FSIA 4C3ZA 3SYLA 3VKWA 2V1XA 2YC2C 2AKYA 4GFDA 5TV2A 2XSZD 4PC6A 4DC9A 4F38A 1PLJA 2ZI7A 1TX4B 4QNMA 2ZJ8A 2C9CA 4AKEA 1U90A 2KWIA 2DB3A 1NY6A 2J7PA 1XTIA 1OSNA 3CONA 3EG5A 4DCUA 1ZYUA 4ASUD 2O8FA 3FE2A 1HY3A 1Q20A 3LQRA 1BKDR 3TVTA 1NBME 2GZHA 4OQMA 4AWXA 1ZVQA 2JLXA 3IO5A 3LDAA 4JVMA 5EZ5A 1MO3A 3FYHA 5FR2A 3KQNA 4TQUS 4EQ6B 2N46A 1A5TA 4IVQA 4KSBA 3KJEA 5JBQA 2ZE6A 5G53C 3REFA 4M8NE 2W00A 2DWOA 1XWIA 4C2TA 3KXLA 1DAEA 2RGDA 2CL7X 5JSZB 1XDBA 3GFOA 1R0YA 2XTMA 3K9LA 4IDHA 1CRPA 4E09A 3IEVA 1XMJA 2UVQA 4GDFA 2RHMA 3GJ5A 1N0UA 2NO0A 4WBSA 3NBFA 1T4GA 4D2IA 1IOZA 2E9SA 4JVSB 1YZNA 4TSFD 2Z5FA 4A2QA 4EFNA 4RFVA 3H86A 3U7GA 2I3BA 4DUGD 3AVUA 1KK2A 4PX9A 4BLQA 4DSUA 4M1SA 4MRRA 3M4YA 3VMFA 1AA9A 2XB4A 1AKYA 1IBRA 2QEQA 1UFQA 3ASZA 4ABYA 2QU8A 4RJLA 3RLFA 1ZNXA 4DCSA 1UEIA 4POAA 5L3SB 3H2YA 1IN8A 1M2OB 4PC3A 3TH5A 1GM5A 4IKEA 4BLRA 4X8MA 4F93B 4LGMA 4LV6A 4QRHA 4ZIRB 2YJTD 1OFHA 2XJ9A 2AWNA 4IDOA 4HAWA 4H1UA 3CW2A 3MRSA 2ZIAA 2RHDA 3SJBA 5LD2C 1NY5A 4B71A 1A2BA 5JHGB 2WICA 4JBWA 4GNKA 4ZI2A 4XWKA 2GF9A 5F9HA 4Q19A 5FR1A 3Q9LA 4KSCA 3W6NA 4EPWA 1NLYA 2OFXA 2BMDA 4AC9A 4NYMQ 4NYIR 3EWAA 5JECA 1CS4C 1Q1QA 2BM0A 5FUVA 5CIQA 521PA 2A30A 5GVRA 1EX7A 1ZRHA 2IS1A 3D7MA 2GK6A 1EK0A 2QAJA 1E9AA 2BM1A 4FMDF 5KDDA 1M1YE 3SHFA 1D6JA 1LS1A 1N6IA 1ZUHA 3T1TA 4M1MA 2GXQA 1QHSA 1U0HC 2GVZC 2ECKA 2PX0A 1ODFA 3IQXA 3Q5EA 4TYWA 2OLJA 1NLFA 1RYFA 3NEYA 5DI3A 2OLKA 5FOSA 1WMSA 1JPJA 4L8GA 2GJSA 2WIBA 3KQLA 1D5CA 2GDJA 4JJZA 2RGXA 1T0JB 1YRBA 4Q9LA 5DH9A 4QGHA 1NMYA 1ZD1A 2D06A 2J7PD 3IKJA 4XTRA 4CIDA 3VR3A 1YR8A 1IN4A 2FPKA 4MGIR 2IF0A 2GJAA 3FMOB 2ZE8A 2ZSBA 1Z0FA 1XXHA 3MWLA 4K81B 2XXAB 1IJEA 3LFUA 2G3YA 1BO6A 3QKSA 4L4UA 3TSOA 1XXHB 3B1ZA 3AVTA 2DFTA 3QBVA 3LLMA 5CK4A 2X8AA 3I4LA 2AR7A 2WJIA 4JL5A 5BN3A 1SGWA 2P6UA 1FX0A 4D26A 3CRVA 3KTAB 1S1MA 1GG2A 1I4DD 4TL8A 3WNDA 1R2QA 4WVFA 3KUDA 1GZSA 3WYGA 5KNCA 1CBUA 1YHNA 1II0A 4C0HA 1CRQA 3BE4A 1E2LA 2JLQA 1TU4A 3FMIA 1R5OA 4M1KA 4Q1FA 1OH7A 4M9QA 2ZU6A 3P27A 3GLHA 1AS3A 4QFMA 1QRAA 3A58B 3G82C 4FI3C 2AN9A 1OH5A 4Q4JB 3T1VA 2G0NA 2WWXA 1MRNA 2QPOA 2ZI4A 3K9HA 5DNYB 3TRFA 4KFUA 3CIOA 4I4LA 2GESA 3D6TB 4HLUA 2UZ3A 4B3BA 2Q3MA 4A8JC 1E9RA 2BDTA 2HV8A 3P4YA 1HT2E 3QKTA 1MR3F 3V00A 4BEJA 4AI6A 3EARA 3UATA 1E6CA 4DT1A 1JBKA 1ZUNB 4EUNA 1RRFA 3ICEA 1KSFX 4J0QA 2XTNA 1KTVA 3GLHB 3B1YA 3CNNA 1QZXA 1MO6A 1GNPA 1E9DA 1GITA 1NF3A 1FPMA 4KI0A 1JR3E 1I4TD 1KI2A 1MH1A 4F4IA 3UANA 1NN1A 3PG5A 1JAHA 1K8RA 2F55A 3CWQA 1JJ7A 1Q3TA 2CHQA 1UKEA 2OM2A 2J0VA 2ZJAA 1GKYA 4UNNA 1TF7A 1UBGA 2IBMA 1RRPA 1W44A 3A8TA 4G3XA 5JWRA 4HB3A 1QG4A 5B2ZA 1N5IA 1GL7A 1Q22A 3M1IA 3ZVLA 1X86B 3EZ7A 2QE7A 3U5ZB 2VTKA 1DE0A 2FGJA 2GXSA 3TIFA 1VMAA 4BQSA 4M0LA 1EX6A 3W5IA 5FPSA 1QHNA 2GZAA 3RS2A 2G6BA 2VYFA 4CEJB 1R4AA 4O25A 2J46A 3QSYA 4B3DA 2QRZA 4B2LA 3GJ7A 4GZMA 4US1R 2J0QA 3K1JA 2ZRKA 2YOFA 1HH4A 1ANKA 1G7RA 1SXJC 2X2FA 2IYSA 1S8FA 5HTKA 3A1TA 3QY0A 1HYQA 1N0WA 5BWMA 3K0CC 4AYWA 3DZ8A 3TLXA 3TK1A 2O8DB 1XF9A 1SXJA 4X8HA 2PMDA 1ELOA 1UDWA 1KGDA 3IO3A 4ACBA 4CT4B 2R6GA 1GRRA 1D9XA 4Q1EA 2ZYTX 2XZPA 4Q1DA 1YZUA 2ZS7A 5DN6A 2D7DA 3HJNA 3QPWA 5JZVA 3FKSA 1VYUA 1KYIA 4DEXA 5JWOA 4HI0E 2FN4A 4O0MA 3J81k 4KFTA 3IDQA 4DT1B 1ZP6A 4NPHA 2BKEA 1U0JA 1CIPA 4GOXA 3C16C 3F0TA 1KJWA 2ZE5A 2EWWA 1CP2A 3GJ0A 5FPTA 1YKSA 1K5DA 5ANRB 1CJMA 1JXOA 3FHTA 4W7SA 4Z8XA 1H8EA 1UM8A 1YQTA 2BIFA 2C9YA 3BB1A 4PZYA 3NHBA 3L8ZA 2NO1A 2Q3FA 4BFXA 1WXQA 3FTQA 2G0TA 2ZSDA 2OFOA 2H8KA 2ZR7A 2D7CA 3LX5A 2AK3A 4KXFB 2QTVB 1T8UA 5CJ2A 2DFKB 2PJZA 2GF0A 1KI6B 1NKTA 1RYHA 3K53A 4MKGA 3OESA 1P9NA 1AS2A 1SVWA 1EGAA 3HYTA 3QF4B 2QP3A 1TL7C 1V43A 2N42A 4B74A 2RGAA 3TSWA 4HEJA 3SFVA 3ADDA 3E70C 1KO1A 1AGPA 2JAQA 3QXCA 5JCZA 4KBGA 2QMUA 4Q47A 3N5CA 2ZREA 5KDLA 4XD7A 5L3QB 4CEIB 2HJVA 3ZQJA 2WSSD 1HQYE 2FWRA 5A0FA 1J7KA 3ZZTA 1XEXB 4E22A 3ZGXA 2R62A 4DUGA 3WMEA 2ZTSA 2PZFA 4TYYA 1R10A 1XZPA 3A6PC 2NO7A 5AUQA 5BYKA 1UKYA 4NTZA 5FUYA 1QVAA 4TMXA 4TT3D 1NMXA 4TMVA 2QGZA 3DM9B 3Q7QA 1ZMXA 3LBIA 1AKEA 3HPRA 3B78A 2GK7A 4RFSA 1JNYA 5FI0B 1XTRA 3PUYA 4TT3A 5DN6D 5AJZA 1OT3A 4LUCA 2EW1A 4CEIA 4QKQA 1YRAA 1E0KA 2JASA 1DS6A 1D2NA 3WRYC 4IHQA 1Z0IA 4F4CA 2O8CA 2O8FB 3CF2A 2ZM5A 1NVUQ 5AWFC 4BFWA 5KSPA 1YZLA 1NJFA 2ZRBA 2VP5A 4QJ5A 2JJ8A 1QHGA 2CMKA 3FGNA 3SNHA 3C5CA 4CEHB 4V0MA 4QC2A 3QIAA 5IHPA 3Q85A 3K09C 1ZNWA 3W34A 4A2WA 3TKLA 2QUZA 3ZYCA 1LV7A 2IT1A 2DPXA 2PZGA 4XVQA 3MWKA 4DJTA 4IFEA 1UADA 4D0NA 1NNEA 4BLPA 3OEED 2OCBA 4NKRA 2J0UB 3LBNA 4B2PA 5DISB 3AF4A 2F1RA 4XVRA 3LW8A 3A1UA 2DWQA 3NVAA 3WHKA 4IVRA 4EPXA 1D2MA 4B48A 3LA6A 3GLIE 2VSOA 4DVGA 1P2TA 4HB2A 2GXUA 4RD3A 2YWGA 4ESVA 1W4RA 1KMHB 4XIGS 4OYHA 2EYUA 5G3YA 3GLGA 4LYHA 1QBKC 1RW4A 3RSLA 4LHWA 2ZRJA 1EFRA 3F3YA 4M22A 1RVDA 1IN5A 2R6AA 2EFCB 1KDOA 2ATVA 4II7A 5L3QA 2HEIA 3CH5A 4M1TA 3ADBA 4CVNA 3AKYA 3FMFA 3UKDA 2WWGA 3KB1A 3CX8A 4LJAA 1KZGB 1M7HA 4RFSB 4AURA 2FDCA 3ZVMA 3L0OA 2PT7A 1WBDA 5EE1A 5SZKB 1MV5A 5H70A 4PSKA 1I2MA 2PZEA 2YNMA 4JZKA 1S96A 2C9OA 3LVRE 3LV8A 4OQNA 5FTNA 4TL7A 5FPKA 2NGRA 3BD9A 2O8BB 1ZM3A 4WA7A 1YJ5A 1R5NA 2FZLA 3R8CA 2AX4A 3JZAA 1CJUC 2XITA 3K8YA 5HCIA 2A9KA 4AG5A 1W36B 3SQXA 1E9FA 1LTQA 2LCFA 2QAGA 1TMKA 2ZRPA 4HLQB 4LOAA 4DRZA 4WZBE 2QP4A 3QEOA 1W48A 4DXAA 2VIIA 2R65A 4TQAA 4XSHA 2OCYC 4XTCS 2QBYA 1CJKC 3EPHA 1Y3AA 3SU8A 1R8SA 2BMFA 2IYXA 4CEHA 2PLFA 2JJ1D 2UKDA 1G20E 2ZI6A 3SC3A 2C8VA 2WOJA 1TU3A 4A36A 2QNRA 4PO9A 5DI3B 2ZJZA 3UPUA 3CZPA 1EFRD 2BBSA 4N0EA 3CNOA 1S2MA 1GNQA 5J4LA 4AKGA 2PT5A 2GNOA 1A1VA 4DDWA 3QENA 4BLOA 2XNDA 4R9UC 2ZS9A 1X3SA 1GVNB 1HT1E 1KMQA 1KDRA 5D3MB 1G8FA 1NI3A 3ZQ6A 4B6EA 1KSGA 1Z0AA 1G5PA 1FUUA 1XU4A 3DL0A 1FFHA 3CRW1 4A0HA 3BK7A 3B60A 2HT6A 4FW9A 3UMRA 4L16A 4LV8B 3U7FB 2OO7A 1KO5A 1P73A 3IHWA 5JEEA 2NTYC 2J9RA 1TAGA 2PH1A 3DM5A 5E7IA 3KB2A 5TARA 3SHWA 1KY2A 2AD1A 1NRJB 4ZO4A 5A4JA 2IXEA 2KB0A 3HU1A 1DPFA 2HJGA 1KHTA 3L8YA 1HE1C 2ASEA 4ILEA 1AM4D 3K70B 2IX3A 3RNLA 1FX0B 1E79D 2V8OA 1N6RA 2AD5A 3PQCA 4KV9A 5UKDA 5EQTA 3RABA 2HUPA 3WY9A 1BYUA 2OESA 4U5XA 4BUJA 3GJXC 1E1QD 4HYYA 1EWQA 5FBRB 2QY9A 1W0JD 1BIFA 2ZRLA 1XZQA 4Z1MA 4P0TA 2DWPA 1S9DA 1P4SA 1R5BA 3EZ2A 4C0BA 3L82B 4PSVA 4PFSA 3KZ1E 4PC2A 4UXJA 2CE7A 3BC1A 4BFSA 1FQKA 3NH6A 5CJPA 4PPNA 3FOZA 1W47A 3KUCA 2RGCA 2IHYA 4RCZA 5IRCD 1OIWA 1W49A 3A1WA 4FXPA 3THWB 2QSYA 5B30A 3AH8A 1VHTA 4LPSA 3TQCA 1F2UA 2ZVQX 2O8EB 1HE8B 2MSCB 1GDDA 1R8QA 2Q6TA 5KNBA 5IK2D 3QKUA 4B6FA 2FPMA 1BMFD 3I1FA 4P33A 1UBFA 2QENA 3TUIC 3GJ6A 3QE0A 1JEDA 4H1VA 1ZU5A 2F9LA 2X1VA 4XD7D 2BBTA 2CK3D 2GCPA 3PEVA 421PA 3BGWA 1ZNZA 3IHLA 2WJVA 4OL0A 1G64A 1Q21A 3C5HA 3OE7A 1WBBA 4KVAA 1IQPA 3OIWA 3PEUA 2ZJBA 5C18A 1EFCA 1VCOA 4PC7A 1DAIA 2IS6A 3K0AB 1NL3A 3CUEF 2VHJA 5CIWA 4HUTA 1CTQA 1G8HA 4LSGA 4TTPA 4V03A 3VX3A 2QT0A 3BH7A 1UKVY 5K8TA 4N0DA 3LXRA 4NDZA 4NHOA 3FDIA 1DG1G 1ZAKA 4JT4A 4B43A 1QDEA 4WW0A 4NMMA 4W5JA 1E2FA 1LNZA 2ONJA 3N2EA 3AVVA 1P60A 1XPRA 4UNRA 1KKMA 1UJ2A 2V9PA 4M9XA 1AZTA 3CKLA 4KJZA 4ARZA 2PX3A 4MRNA 1ZC3A 4Q4LA 4QJ3A 2FFAA 5FTLA 4M21A 4A0GA 2G77B 4ZI3A 4JSYA 2Q9AA 3KX2A 1OXTA 3T1QA 1VTKA 2IF2A 4NCNA 4IXMA 1T3LA 4JBYA 3EPLA 3EASA 5EXPA 2FNAA 1IJFA 3DDCA 1TF5A 1C4OA 1FUKA 1RZ3A 2E1RA 2VPPA 3HR8A 1N6HA 2FX3A 2ZEJA 3H84A 2NO6A 3OZXA 5HZHA 2RGGA 2I1VB 1H65A 4PSAA 4FN5A 3BJIC 2FV8A 3SBEA 3NWJA 5B64A 1OH6A 3PUZA 4OKSA 5KTYA 4XVUA 2PLRA 1T6NA 1VIYA 2QG6A 4UNQA 4D82A 4JYBA 1F48A 4Q9IA 3Q7PA 4I1VA 2FE4A 4FIDA 4FCWA 3SR0A 5JRJA 2NIPA 3QI2A 2H57A 2JATA 3PV0A 3CF0A 1E2IA 3I3SR 3ZIAD 2P2LA 3KKOA 1HA3A 1HTWA 3MUFA 4JLBA 2Z43A 2JLRA 3ECCA 4A6PA 1XPUA 5EE0A 5G3ZA 5FTMA 5ELXA 2DBYA 6Q21A 4HAVA 4EQ6A 4I1UA 2ORVA 3EWSA 3ONWA 4Q1BA 3ZJYA 1XD2B 1TEXA 4M9ZA 4UJ5A 4WZ6A 4D25A 2ZRAA 1AQYA 1VPLA 3W8NA 3CO5A 4D4MA 2OILA 1SULA 1E99A 3TSZA 4XWAA 3LLUA 4DCVA 4CGZA 1GL6A 2R6CA 1J8YF 3CRRA 4ZDJA 4LPKA 3U44B 1NIPA 4G5RA 4EIWA 4L9WA 4HLUC 5EE5B 5J4HA 1FTNA 4YXWA 4S35A 5C1BA 4TMTA 1PZNA 2VF8A 4DWJA 3B13B 2JEOA 3MWYW 5JEDA 2VP6A 4DEYA 3TUJC 2KI5A 1AIPA 1P61B 2C95A 2ZYVX 4HDOB 1Q57A 3QVVA 1NIJA 4R2HA 3ZVRA 1TUIA 2BJWA 4TTRA 5EE3A 4C9BA 3GD7A 5KDOA 1KI7A 2FEMA 2ANCA 1LFDB 4V0ME 3SZRA 4QHYA 1Z29A 4V0LA 5TB5A 5J4YA 2VL7A 4HZUB 1AK2A 1C1YA 2G88A 2P65A 5JJIA 5AR1A 5KNDA 5EE9A 1NN3A 2CL6X 4WZAE 4PANA 3TVDA 3E1SA 3PXGA 2OT3B 1FNNA 1U99A 2WWWA 3IPXA 3W3ZB 1PUJA 4W9MC 2ODNA 4RVCA 3ADKA 3RVBA 1OFUX 3HDTA 4M1OA 5CM8B 2YV5A 2VA8A 3MLEA 2Y8EA 5H1YA 1G7CA 1NJGA 3T34A 4LBZA 2YC4C 4A0FA 2ZR0A 1N0VC 1BH2A 4OK3A 2G9NA 3RS7A 3S1AA 3A37A 4DLTA 1Q1ZA 3A1VA 1G8PA 4OHYA 1KI8A 2ZE7A 1Z5ZA 3QKRB 4OQXA 1ZM7A 3L0IB 1H8HD 2WZQA 4QM7A 3NBXX 2OV2A 4DSTA 4DDVA 4JT2A 4QJ4A 4DLZA 4PZLA 2D62A 2KBFA 3WMGA 1OHHA 4PO1A 4RZXA 3HWSA 4JLOA 4YMWA 1KDPA 4PPQA 4QOSA 3CF6R 1W0JA 4UNSA 3SE0A 2R8RA 4BFUA 3WHLA 1K6MA 3KKQA 2HXSA 4IOMA 3TAHA 1NN5A 4JLDA 2ZRNA 3RC3A 4S2EA 4LBVA 2GAAA 3IBYA 1SVIA 2GBLA 4QGGA 5FFMA 4NCJA 2FSFA 2QM7A 1QHIA 3QBTA 2HLDD 1TQDA 2WWIA 4MDFA 3MG9A 4HATA 1WA5A 4FMCB 3VX4A 3VHLB 2A7QA 3D3QA 3EC1A 2NPFA 4MRVA 3U4QB 2KE5A 4D6PA 1DAFA 2YWFA 2IWRA 2RAPA 3AVOA 1E94E 2BVNA 1J2JA 4JLMA 2GVDC 2O0KA 5AJVB 3KQUA 2R6DA 3RHFA 5FBWB 1TQ4A 2FOLA 3PR1A 1OIXA 1GKUB 2XX3A 1SKYB 1TTTA 2B8TA 2FFBA 1XX6A 3RWOA 1QVRA 4KODA 4D4KA 4RZUA 2IYYA 3TBKA 4JBXA 5JJLA 1DBSA 5HE8A 1TEVA 2GZDA 3ZVNA 3ZLJA 3W6PA 3I8XA 1KI1A 1YU9A 2XZOA 3CR7A 2J1LA 3UWKA 1GRNA 3GPLA 4EPYA 2JIZD 1GOTA 3GFTA 3TUZC 2HF8A 1U8AA 2GCNA 5KSOA 2XAUA 2ZPTX 1VG0B 4ERNA 5EP3A 1YZQA 2JLZA 4IDPA 1G291 1GIAA 2GJKA 5CDFE 2BKUA 1OXXK 2ERYA 2O0JA 4P4SB 3FFBA 4Q4AB 5J40A 1SXJE 3AP3A 3U3OA 4ARZB 2F3TA 4MYTA 1Z47A 1NBMA 2WKRA 3SDZA 1S9HA 2VF7A 2BOVA 2EQBA 4GL2A 1NSFA 3O8RA 3LD9A 4Q21A 1EFTA 1ESNA 2WBLC 2ZROA 2F3RA 5CB6A 1DOAA 4KHZA 1MOZA 4KCGA 5SZIA 4K8OA 3KKNA 5J4VA 2BC9A 1EWRA 4EAQA 4DLYA 2F1HA 2P5SA 5JI3E 5HR5A 1W1WA 3TW4A 1VG1A 4DZZA 4ZDKA 1QHHB 4X8OA 3K9GA 1XTQA 1VYVA 2ZUDA 4NYJR 3GLHE 4O2RA 5DO9A 1P2SA 2PEYA 2W6JA 4ITRC 4TN1A 3O8BA 4BECA 2KJQA 2IUTA 4TMWA 4UNPA 2PJRA 4B3XA 2W6IA 4B75A 1GNRA 3E2IA 1R0ZA 2WTUA 1D2EA 3LX8A 2VH5R 4TYPA 4HUQA 1G18A 2FF7A 5KPJA 1J70A 1UEJA 4LBYA 4P4UA 1E2PA 2WMOB 2ZYUX 3WYAA 1NP6A 3V9PA 5KPDA 4CYMA 1XNJA 1G6OA 3EXAA 3QPUA 4EJSB 3CWZA 2J59A 4LJ5A 3WBKA 5LDDC 3NDPA 3MFYA 3NTUA 2A5YB 5TXGA 4KYIB 5SZHB 4HDQB 2VHQA 1UF9A 1WQ1R 3KXIA 1N5JA 1UAAA 2EU8A 4LHYA 5GJBA 2QAGB 3IPYA 2GWHA 1S1CA 4JL6A 4GPTA 721PA 1L2TA 3I32A 4TLCA 4BFVA 4B76A 5GADl 2JLVA 4ZDWA 1U9IC 2IUUA 1CLUA 2B7BA 4MKIA 5CYPA 4E07A 4UXHA 4D81A 2ZI9A 4H9GA 4HAXA 1SXJB 3KQKA 5TDHA 3VR5A 1JEEA 2QROA 4P4SA 2AFHE 3R7WB 2R2AA 3OIUA 3MGCA 3BERA 2QQEA 2ZUBA 1UBCA 5FBQB 3HU3A 5C46F 1F2UB 4PC1A 4B47A 4D80A 4CF7A 3ND8A 1E4VA 3O8DA 4K46A 3EIHA 2FMXA 5JFGA 1Q44A 1G3MA 1FP6A 1U8YA 4LBWA 3D8BA 1G21E 2IEYA 3GLGE 1G3IA 2B7CA 4EPTA 1M7GA 2WAXA 3KKPA 5EUMA 1O3YA 3QXJA 1FMLA 3U7EB 1E9EA 2QORA 2CCGA 4DSOA 2A5GA 4B2IA 4GT1A 1AS0A 1E0SA 2FU5C 5CK5A 3U3MA 3I61A 4TZ6A 4MDEA 4PO8A 4DDTA 1DAKA 4EKDA 1Z2AA 4G5OA 2HCJB 3AVXA 1JJVA 4BFTA 4PAMA 5C4GB 1OKKD 2KBEA 1XJCA 4MQBA 2J0UA 3BOSA 2WPDA 1K5GA 4RD2A 1DO2A 4FD2A 4TTQA 2ORIA 1X8KA 2ZU0C 2AXPA 5DHAA 4N1AA 3RWMB 1E3MA 2AFIE 2XNSA 3AUXA 1OPXA 3F5FA 4UQOA 4WOPA 3U44A 1ZW6A 2VRWA 2GHIA 4IRUB 2JGNA 5G41A 4AG6A 1JAIA 4HZIA 1Z3IX 4ZIRA 2CVFA 1II9A 1Q1EA 1WE2A 2IEZA 1BS1A 821PA 3A4MA 1GWNA 2GTPA 4EJSA 2EFHB 2V1UA 2ZAMA 4TMZA 1CEEA 3T12A 1SZPA 221PA 1W36D 1JI0A 1E4YA 1ZJ6A 1Z6TA 5HPYB 1G3UA 4M4SA 3HYRA 4QBFA 3PIRA 3FWYA 3BH0A 3B8HA 1SVMA 3I92A 3OFND 1G16A 1G19A 2WV9A 3WBJA 4V0NA 1IY0A 1NG1A 3WMFA 2WHXA 1G5RA 1ZM2A 4DLXA 3REGA 3AGPA 4IOLA 1OHHD 2DY1A 2BCJQ 5KSZA 3ZH9B 1GP2A 2IL1A 3A4LA 3MAAC 1GKIA 1JPNA 4RD6A 2JLSA 4IDNA 4DCNA 4YMUA 1KJZA 3S1AB 3AVQA 1QG2A 1GL9B 3AF3A 1W5SA 2XEXA 3FKSD 3GQBA 3OE7D 2OZEA 4I99A 3RAPR 1WB9A 1COWA 4MYHA 3GJ4A 3U6KA 3SS8A 2H18A 1EFUA 2VLIA 4ZCLA 2IHBA 1N6NA 4DDUA 1R0XA 3T1OA 4Q5IA 5FL7A 1I4LD 5B58C 3P4XA 3CX6A 5EJEA 4LX0A 4EDHA 4KU4A 3P1JA 1W2GA 4C0KA 3O8CA 2EFDB 2OBLA 2IYTA 2ZRIA 4YDHB 5KOYA 3I62A 1YE8A 4BRWA 2QMHA 4TZ0A 5J5CA 4WAUA 4GSYA 2CCKA 1PLLA 4PHFA 5H8WA 1NG9A 1U2RA 3QG5A 2QMEA 2XOKD 3W9YA 3RANA 4RZ3A 3OEHA 4Q7JB 1IHUA 5IK2A 2C98A 3MJRA 2CL0X 5E95A 2HYIC 1CU1A 3X1DA 1N5LA 5GJCA 2YZ2A 4Q4HB 2F43B 2RKOA 1US8B 4MYCA 4NBSA 3VU9B 3KJIA 1VCMA 1R0WA 3VHXA 3D31A 1CKEA 1G4UR 2GILA 3UK6A 3K0AA 4M9SA 1EFHA 1EXMA 2PL3A 1A4RA 5DSZA 2VBCA 4QGAA 1N2CE 3OEEA 4JYCA 1X1SA 3WP1B 3LVQE 1NKSA 1YVDA 1F60A 1DTSA 1G8GA 2QTFA 5G40A 4GRAA 4G5GA 3T61A 4F7WA 2P6NA 1OKKA 2IK8A 5B57C 3ZS8A 3U4QA 1XJ0A 3PITA 2A5JA 4C7OA 1R7RA 2ZQ5A 1E1RD 5FL3A 2XJ4A 1NVWQ 5JS7A 2BJVA 3QJYA 2F9MA 4P32A 1W46A 4BEBA 4AKIA 3GJ3A 3I73A 2QI9C 1II8B 1W0KD 2H7VA 4C0AC 4UXIA 2O0HA 3B1WA 2LKDA 1PJRA 3U3JA 2ZJYA 3ZS9A 3GFPA 3EA0A 2PEZA 1P75A 1W5TA 3CPJB 4Z54A 4X8LA 2ZJ5A 2VO1A 3UMSA 4QGFA 3ZD7A 3LY5A 2IXFA 2OUKA 1KI4A 4Q4AA 5AUOB 1C9KA 2O8BA 1KK3A 2HF9A 2ZI5A 1FW6A 3ZIAA 1G7TA 2A5DA 2XNDD 3BB4A 3TE6A 4ZDIA 2Z4RA 2REBA 1T3HA 1E9BA 1S3GA 2JDIA 3M6AA 4IXNA 3T15A 1OH8A 3VKHA 1DO0A 1VKJA 4YONB 2H16A 3A4NA 3KJGA 4Q01A 4YXWD 5GVSA 3WYFA 3K0EA 4OHXA 1DAHA 3DEFA 3B6EA 2CJWA 1W7AA 5JSZA 1NVVQ 1P62B 3OFNA 4JIMA 2FFHA 4A15A 1OLOA 2ZS8A 1M7BA 3PCRB 1Z2CA 2HXYA 2ZRDA 4PAQA 5D3MA 1IN6A 2CXXA 2FSHA 2NG1A 4NH0A 5FOVA 2BV3A 4JJKA 2WWYA 4TLBA 3SQWA 4LI0A 1XTSA 2GXAA 3KKMA 2XXAA 4EPRA 1XXHE 4A9AA 3AM1A 4TLDA 3CPEA 3PJRA 2GETA 2QGNA 4G0NA 3HPQA 4DIDA 4XWOA 5BW8A 1JALA 3SOPA 5CYOA 4PHGA 1IAQA 2V7QA 1E9SA 5DLQC 2OE2A 2GAOA 3BXZA 5CITA 2WVJA 1HEIA 4GMDA 3GLGB 2BMEA 1Z8FA 1OV4A 2GEVA 1B0UA 5FUXA 3RSOA 1Z63A 2RH5A 4C7OB 1ZNYA 4BWYA 1W4BA 1QHXA 5FTKA 1ZINA 3W6OA 1IY2A 1UPTA 3CZQA 3EZFA 4OJQA 4U7DA 4WXPA 4TL6A 4PZZA 1P2UA 5AJXA 4DCTA 1VHLA 4P3YA 5J4KA 1XRJA 4B3GA 3NXSA 4C0JA 4LWZA 2A5FA 2NOAA 2MSEB 2C99A 3EZ9A 3AF1A 1MRSA 1LVGA 3JVVA 4W5HA 4YMVA 4F91B 3P32A 2ZRMA 1RRCA 2O52A 2P6RA 3PENA 1KO4A 3P26A 1XCPA 2WWFA 4PQYA 5SZJA 3OF5A 5DGXA 5J47A 2NPIA 1B23P 3BS4A 3MSXA 1Z0DA 4YDSA 1OB2A 1XTJA 5FUWA 2WIAA 1NBMD 3NDBB 1YZKA 2WM9B 5CB8A 2W2TA 1XEWX 3NHAA 4UKDA 1XEXA 3C14C 3GEHA 4TYQA 1OW3B 3EAQA 4ON9A 4DB4A 3THWA 1E2GA 1KO8A 1NSTA 2YHSA 2CJWB 3SI7A 3FB4A 3FVQA 4M1YA 4MKHA 4FCVA 5DE3A 4I1OA 4B32A 4MGKR 1QHYA 1KDTA 4O2LA 3C41J 3L0SA 2ONKA 3SJCA 2J5XA 2Z0MA 5F2EA 3AKCA 2TMKA 4GP7A 3B2EA 3X1WA 2WSMA 4OBEA 121PA 4D4LA 1T3SA 3NG1A 4BLTA 1SVSA 5BXQC 1DAMA 1PV4A 1DELA 3U3RA 2YOGA 2XSZA 4PHHA 1JB1A 1XEWY 2W2VA 3U61B 1F2TB 2YWEA 4RD0A 2CLCX 1OFTA 2J87A 1AZSC 4XJXA 3RRYA 5DHFA 4A2PA 2W0MA 3RC8A 2WJYA 3VQTA 1OF1A 3THXB 4IOJA 1WRBA 2P5TB 1Z22A 2ATXA 4JSTA 3I8SA 1G5TA 1Q0UA 1U98A 3SN6A 4NCIA 3L2OB 3L43A 1KAOA 4A6XA 2XB2A 3RRNA 3THOA 1AJEA 3U7HB 4OI2A 4KAXA 2FFQA 2C04A 2OHFA 4YLGA 1N6PA 3UMFA 1LS6A 1ZD8A 3DMNA 4TWZA 2W2XA 3VKGA 4V0KA 3I5YA 1IXRC 4P31A 2CE2X 4PHTA 3K0FB 2H5EA 3TAUA 4OJKA 4OK6A 4C0SA 3RYTC 2VQSA 5C4MA 2DR3A 1NMZA 3EIQA 1JECA 1UDXA 2W83A 4IDQA 5FL7D 2FSGA 5AJYA 1Z28A 3SJZA 3AKDA 2NMVA 5KO2A 1KK0A 1Y63A 4JVLA 4Q4HA 3PUXA 4IJMA 2QPAA 5LB4A 5A5GA 4XH9B 2REXB 3B85A 5JJKA 3DPUA 2RCNA 2WJGA 1KI3A 2IYLD 4OQFA 4C30A 3VR1A 3AP1A 1X8LA 4CZ2A 2YOHA 3K0FA 3X1ZA 1P72A 3LXXA 1DVRA 1J8MF 3FKQA 1W36C 3CH4B 4AY2A 2VP9A 1QHHA 4R2IA 5FOTA 3NEJA 2ZXUA 1N3BA 4JVNA 2AXNA 4B3FX 4OI1A
chains in the Genus database with same CATH superfamily
2RH9B 1WD5A 2WAMA 3GARA 3MERA 4H3HB 1XQXA 4LC0A 4QBHA 1L1FA 2Y1LA 1Q16A 3QX9A 1VC2A 3TL2A 2OBBA 4RF5A 4X3CA 1KBQA 2VHUA 2DY0A 1V0JA 4LI3X 2BI7A 3R9XA 1H9CA 2R47A 1E2DA 5DNWA 4DBZA 2B6HA 3Q15C 2QVBA 2E48A 1K63A 2VJBA 3GAMA 4QDTA 2O2JA 5EXTA 4BCBA 2C2ZA 4LDQA 4NCAA 2A0YA 3B1VA 3UCFA 1GUBA 1VXRA 2ZAOA 2NWQA 4YRLA 2XE8A 3MT7A 3H9JA 1MD9A 1KMNA 3WQBA 1AGXA 2PL1A 1TO1E 3AHJA 4KUEA 4LZZA 4YJFA 3MT8A 3IPCA 3NYIA 1ZW1A 3R20A 1CDZA 1E9VA 2J3EA 1I9GA 3FWNA 4ZPXA 3ZZMA 2JHAA 1YRLA 4NF2A 3W7AA 1OB5A 3V1YA 5JLAA 3DOCA 1PU2A 2QRVA 1GZ3A 3FFTA 5NULA 1H4QA 3QNUA 4E5VA 3LFHA 1VSVA 1KSJA 5JCOA 1WMAA 2ZJ7A 4ZD6A 1UP6A 3O91A 5TVKA 1RC0A 1GEEA 1CUFA 3S2YA 3RRZA 2HTEA 1HSOA 1Y1PA 3ER8A 3V4OA 2I1QA 1HFKA 2R8XA 3KELA 2QRLA 1MA0A 4DCGA 3CXRA 2BWJA 1RCUA 2YUIA 4LCBA 4R05A 1JVSA 4XVHA 5KYVA 2YY6A 1TADA 3TF5A 4RADA 1I5RA 4I9NA 1USGA 2X77A 4ZFNA 2F7SA 2XCSB 2C03A 1A5BB 2G8NA 2I2DA 4JKYA 5DHTA 1BC5A 2YHUA 2O2CA 5IEJA 1ZUD1 3NJ4A 4ND6A 3ENNA 2A3RA 1CVLA 3CR8A 3P9IA 5H4GA 1TPYA 2A88A 4OHVA 1KF0A 3TDMA 4F4UA 1Z5OA 3UK2A 3WK7A 3W5JA 2DBQA 5JWHA 1WSDA 3CQ9A 1ZJYA 5EY5B 1PQYA 2WU4A 3NI2A 4ZVSA 5TSDA 4Z7QB 5B5SA 4Y2TA 1A9PA 2Q2OA 1EG7A 3NHPA 3PC7A 2JCYA 2AKAB 3QWAA 4J49A 4TZKA 5ALNA 3Q9UA 4EB3A 4EH1A 2EX1A 2FUKA 4CL0A 1T3ZA 3DZBA 1YB1A 4QO7A 3VR5D 4B73A 4WXYB 1DWOA 2TRSB 3K30A 4QNNA 4HEQA 3A4VA 3G2KA 5BW5A 3UG7A 2P9EA 2JG3A 3U39A 4RPHA 2DLNA 2Y76A 3EISA 4WXRA 2L69A 1KU6A 1QXSA 3L5KA 4RTJA 2AI3A 4DQKA 5F2NA 4BJ6A 4OSEA 1WTAA 4COKA 3BXEA 3N8DA 4ETNA 1AF7A 1GPDG 4ID9A 1UXKA 1Y6RA 4GLJA 1UDCA 4K40A 2QP9X 4M53A 5HKOA 2NNWB 1Y5RA 4H31A 1Z6YA 2VF2A 3VVLA 4BE9A 1P19A 3B3JA 2WHPA 2P7IA 3HYCA 1EK2A 2HQOA 2ODWA 1GG5A 1W25A 3PGVA 2PU7A 3EEBA 2ZP1A 4QPCA 1P2BA 5I9IA 3DMHA 2QSZA 4AECA 1E89A 3PDIB 4BO7A 2IS4A 1Z5VA 1WM1A 3IEPA 1KMCA 1A95A 1XHEA 4KLZA 1QZZA 4HNAA 2C2HA 2AMFA 4OOFA 1CW2B 4RY9A 4URYR 1SCAA 4CRWB 3RADC 2FA9A 3K8ZA 1EU1A 3CX7A 3ZZNA 3I4FA 5KJFA 3FVWA 5TPZA 4P2GA 4N03A 2QUAA 4B7AA 2HSGA 3UJ7A 1AGNA 4DV4B 4P81A 4C0XA 1N6LA 4WXHA 4XLLA 3U48A 4Q18A 3IPLA 1SB8A 2LW7A 3BH6A 1ZAYA 4MKZA 1YXMA 1Z4LA 2C5LA 2QW1A 3IEUA 1WXWA 1B8UA 4MV4A 2A2ZA 4PFJA 4ZGGA 4RXTA 1YDEA 1T0IA 2X0EA 2HCBA 3D5EA 1YMQA 1QQ5A 4KAJA 3JD0A 3L7DA 3TZ6A 2Q3CA 4AYTA 2XYGA 4WBXC 4EHAA 2QPTA 1D6NA 2J32A 2EKQA 3LCUA 4YFVA 1C3VA 4KPYA 3EXHB 4ZO9A 4EEZA 3WWDA 2AF4C 3CEMA 5LP6F 1DEKA 2P62A 3NIBA 3FUVA 5AKHA 3VNVA 3A25A 2V6MA 1UBSB 3B9RA 5MFPA 4LFBB 3CPSA 4IFTA 3HVHA 4JLPA 5K3DA 3GP8A 4N48A 2HK8A 2GCOB 1N2EA 1X8JA 3EULA 4OK5A 4YJGA 1J06A 4B33A 4WBNF 5KWIA 2EGUA 4LDJA 4R71A 5IVDA 3GT7A 5EAIA 4ASUA 4GBMA 2R8OA 3T54A 4H0CA 5K8IA 2PXAA 4WN9A 2FZEA 2H07A 4XE5A 5JAOA 3UAGA 2OVBA 1NW9B 3EBPA 5F4BA 5EZ6B 3UTCA 1IWBB 1KIMA 3DLTA 2JGFA 5ARCA 3FR8A 5KCZA 1HLPA 2E4AA 3CGGA 3LAWA 1G55A 2X4LA 3U4CA 3KLBA 3ONEA 3EVFA 2CDNA 5K2MA 4DM4A 2QN6A 2CMGA 1OOEA 3K4HA 3OLQA 4LE0A 3VTZA 5JW6A 3JQBC 5IZ4A 3VR6A 1XDWA 5CLHA 3SC2B 3AERA 4RK5A 3T6KA 5H81A 2XECA 3IX7A 5H0IA 3E3MA 2W6ID 1NJSA 4DLBA 2GCOA 1PLKA 4NAUA 1PJCA 2XTZA 3PGJA 1XD8A 2A33A 4JQZA 1OWOA 2BFEA 2JFPA 2C31A 1AT1A 4RWZA 4CN8A 2BHRA 4ES6A 5KQMA 4ZYWA 2OPHA 4REQA 4L78A 1FDRA 2BMAA 3C45A 4TXJA 3WJ2A 3GN1A 5I7EA 2R8PA 1A9XB 1D7AA 2H2IA 2YMQA 3LUPA 3PDJA 5LLSA 3PQ7A 1Z07A 1J0BA 1JHUA 4A0SA 2C57A 2XI4A 2VKTA 3F3MA 1ETUA 3RTBA 1QYVA 1WQ4A 3CPHA 2OFWA 2Q0HA 3PVSA 2CXUA 2B25A 4FEGA 5FTWA 2XYHA 4BYGA 4LXUA 4IIJA 3PTLA 4X97A 4NJEA 5THKA 3QA3E 1CR4A 3R4CA 4GPD1 3PQDA 2D4HA 3C15C 4K88A 4I50F 2OPBA 1YE5A 2C96A 3H9UA 1BEEA 5FKJA 2A86A 1U9IA 1A2KC 3GU3A 3ND7A 2IEGA 4JAVC 3UBMA 1FS5A 3V6LA 2PE5A 2IDMA 3ICCA 4QGSA 2QRUA 1K86A 1T9ZA 1WCIB 2QNBA 1WOYA 2VWHA 1TYDE 2YVAA 3BCSA 3LW7A 3MB5A 3ZD6A 2VSFA 2AK2A 2J6BA 3GJ8A 2R8YA 3ZNOA 2P2YA 3H9BA 1GSHA 2D59A 2PV0A 4US0R 2AZ4A 3FTNA 5IM4A 1FLDA 3AFHA 5E6SA 2QD5A 3L7KA 3OCZA 2D1YA 1SHZA 2G1KA 2GNAA 2Z8YM 4HP8A 4JLAA 5BQFA 3FTFA 2C3PA 2XRYA 4DLKA 4EG7A 1Y82A 1EXNA 3A3YA 4DNFA 2B20A 4YUWA 5LWHA 2ZYWX 5FOXA 2QTMA 3UG6A 5AI0A 4K0KB 1T9CA 4W6QA 1TO2E 4FS3A 1M6HA 5DI9A 3ZWAA 3I30X 3NBMA 5AJUA 5EZYA 2OHXA 5EZYF 3DOJA 5BOSB 1ONBA 1C29B 1R4NB 4C43A 4JI8B 3QQPA 2FZ4A 3HEMA 3R0XA 2NQTA 1E2BA 3UMGA 4LJRA 5C53B 4WL0A 2HMAA 4GMXA 2B4AA 3RAEC 3SOZA 1LU9A 3QQ5A 1ULAA 1Y8QA 3PXAA 4HSGA 3QVUA 4UD6A 2J7KA 1O4VA 2EEZA 1U3UA 1ZITA 2O2HA 4YN3A 2QJWA 2J3JA 5IM4F 2CFTA 2FMFA 2JCXA 3FZEA 1HNXB 2NV6A 1J56A 5HRUA 1XSEA 3M3PA 2FH5B 4ZC8A 1FS6A 3C6KA 1CUDA 3SJ7A 2VK8A 1NVVR 4L95C 1DADA 2GZMA 2JAHA 1RQRA 1ZIOA 4MVJD 5JMTA 1EXWA 2EDCA 2FW6A 1OJ7A 1W0KA 3IKMB 4RF3A 1PFKA 3RG8A 2VP2A 2AG1A 3AOEA 1SZDA 4RDCA 2AWOA 2CMFA 3KZCA 3RC7A 4B3RB 3KTAA 1J0AA 2XQJA 1I32A 3AK4A 3GA5A 3WRWA 3QKRA 3F8SA 1Z5UA 1E1RA 5CA0A 3BMQA 1W2WB 3FCAA 1MG5A 1R9NA 3VPHA 2J3QA 1VBMA 3QW4B 3R9WA 1ZK2A 2GM5A 3RTGA 1L5HB 4QBIA 5I8PA 4GD3Q 4ZKDA 4RKQA 4H3SA 4DQUA 4R54A 3IV9A 4UTPA 1IDOA 4LZPA 2R6HA 3V4FA 1VLZA 2HIHA 4G8JA 4MMZB 3ZYZA 5ADVA 4EVIA 1GILA 3ZU3A 4G23A 2AJTA 3LI2A 4MV1A 3NOVA 4NJMA 2F43A 5CP8A 1EDEA 2PBRA 4QA9A 1FF9A 3A3KA 3GMTA 3QU4A 4ZJPA 5KU1A 5KCMA 3BMOA 1H0KA 2O8NA 2Q3DA 3M4NA 1Y4UA 3B51X 1XL0A 3AV0B 3DBVO 4J4TA 5ENDA 4KXXA 4RF4A 2XZLA 2Q5QA 1VLQA 2C7GA 5TF0A 2Q5EA 2XE7A 4XWWA 2RAVA 2H7CA 3O9MA 3D5TA 4LJ4A 3IV7A 4BGEA 4PGFA 4TL9A 2H5LA 1D8TA 1PGNA 4KITB 3NRBA 4C06A 2GCGA 4ILKA 3X1KA 1TD1A 1DBRA 2WF8A 2CL5A 4UHCA 4CF3A 1ECJA 4NZYA 1KMHA 2XNCA 3C8UA 2Y1CA 4HTFA 3R9IA 1O6CA 1L4NA 4BE7B 4TS1A 2EP8A 3JQAA 4O4HB 4IXWA 1E79A 4FFDA 1U94A 5JUWA 3JQFC 4LNHA 4D3FA 1T0BA 3UVEA 2B36A 2PMWB 2JJMA 1E62A 2J9XB 3CSDA 2D74A 3OHMA 1E92A 2I6UA 3VZRA 2H1OA 3KWJA 1E6LA 3ZHRA 2W6OA 5JAZA 1C50A 1G63A 2WKQA 1QG0A 2LWIA 3AJ9A 1M1XB 2J9GA 3M6WA 5ECWA 5JISA 1KAMA 1LDNA 2I1LA 2P7HA 3QOFA 1HTBA 2A1UB 2YH2A 2AFIA 2LKCA 4N40A 3ROPA 5I4KA 2ZUVA 1T9DA 4LYFA 1P9RA 3IQWA 4KXMA 2FPSA 4U9HS 4XARA 1VE3A 4Z4CA 3D7LA 4XX1A 3C6YA 1NX9A 2DFVA 3EF3A 4NBWA 3TLJA 5JDCC 2GHQA 4NBNA 3EB9A 2JH3A 2F8LA 1GPUA 4PRKA 1P5HA 4DBLC 4LXTA 4UPVA 4PYOA 1UT5A 2H1FA 4A4DA 1G6HA 4RH0A 2XWBF 3CLVA 1XMSA 4NMWA 3EDRA 4P4NA 3BL5A 4Q1VA 5AJTA 4LWQA 2Z4SA 4NFSA 3HYLA 1IE3A 1CQJA 3D4PA 3GQBB 1XQ1A 3LSTA 3EIEA 3IDZA 1PJTA 4KWTA 3MJDA 2C2YA 3MS2A 3WWCA 1KEEB 2B5OA 4IIFA 5AHKA 1Q0SA 1FZTA 5BSTA 1YKFA 1C2TA 3I9OA 1BH6A 5LQCA 1NXPA 2HRBA 1U1IA 1Y1SA 4MUBA 3SYKA 4URXR 2ZRCA 2A9OA 1KAGA 3FSRA 1WF3A 1V11B 2QD1A 4MO9A 4C07A 1KKUA 3A3NA 3E9CA 3C8DA 2WAYA 3IP8A 3ZTYA 2LPMA 4RCYA 1XP8A 4N3BA 3B82A 1RRMA 3IMFA 4I6JA 3SEAA 2BCGY 4CF5A 5KWVA 1Z4MA 2Y1FA 5HQTA 2R48A 4COOA 3U26A 4D96A 4HB0A 3M0EA 3K05A 4M2LA 3S55A 2V6IA 3GGJA 2OZVA 1ISSA 2ZSFA 1S02A 3CGWA 2XDWA 3PQ5A 4KLNA 4MGYR 3TEMA 4FB5A 4UEQA 4Q9DA 3A10A 3DDZX 3GJSA 4RUKA 1VDZA 1DHRA 2UXCB 3UA3A 3W5BA 4W1PA 2OZPA 1E2NA 5EHIA 1QJ4A 3QY9A 4D8YA 2F2TA 4EI9A 1FMJA 1VSBA 4LZLA 2YR0A 1N2CB 4OP1A 2HJ9A 5DX8A 5GM2A 4CBVA 2QIPA 3K96A 3UW1A 5JI2E 4MJ3A 3TTVA 3W5VA 1RKBA 1QF9A 1N7HA 5KHLB 1H8ED 1Y1TA 2J5BA 2YJNA 1S3SA 2ZCJA 5LOVA 2RGNA 3AHFA 4U8GA 1R88A 2C5AA 2G17A 5KWEA 2IIPA 1YR3A 4OHZA 5DMXA 3N0VA 4I1SA 1RABA 1LB1B 5FYDA 3KCQA 4BP9A 2COEA 4J3FA 2NZ8A 2X9LA 5G2OA 2OAP1 2X9VA 1RCTE 4MWTA 4WLUA 4LIPD 1KWGA 2CHVA 3DGEC 4CUJA 4LNUB 4FGLA 4QUGA 5B6IA 1TF2A 3AL2A 1XTBA 3ZXIA 5BMVA 1QIJA 5JZSA 1H3FA 1MAUA 2VC2B 4PAOA 1ESCA 2QLFA 3SGLA 2P3SA 5D5PA 2RGEA 5ALWA 1E58A 5E6RB 3T1HB 1MU0A 5F9FA 1I9CA 1CY4A 1YNOA 2ZJ2A 5L8VA 2H7XA 3GHYA 1HEYA 3FSEA 4JB0A 4TSFA 2WJHA 4Y9UA 3MJSA 5EWLB 1SKYE 3RS4A 1LRJA 5LD2B 2Z04A 2GTIA 3FZQA 2M32A 1HYBA 2QIOA 1EQAA 4M8SA 4F2DA 3OQMA 1V5WA 2V65A 3AF2A 2JA1A 3N8HA 2I7VA 4DMFA 5REQB 3JWIA 3U2QA 5LQRA 1TKRA 3QVOA 2XT9A 1NXWA 2WD9A 3OUTA 2BFMA 5FYQA 2D4AA 3FF1A 1HDGO 2Y9PB 4MA5A 1L7OA 5LVAA 1T4MA 2D2EA 2DPHA 4NU0A 3HFRA 4D4GA 1BSVA 1KZ9A 1MJFA 1FP1D 4YRZA 4TSRA 3K0SA 3DT9A 3V3TA 2QN1A 4JYMA 3RJMA 1OZ0A 4C1NA 1M2VB 1OXKB 1T5OA 2Q3BA 2WNHA 2A67A 3G5UA 1E1YA 5LP1A 1GZUA 4LTDA 4Q93A 1KEZA 4C08A 1QH8B 2Z8ZA 4Y2VA 1H2WA 1WCIA 2G5TA 3NJRA 2OCDA 3I4CA 3O84A 4K2HA 3A36A 1RE0A 4ZCMA 1NHWA 1MC4A 3NLLA 2YHAA 3KSUA 2C5HA 2DHRA 4M98A 3ZU2A 1LSSA 3HUUA 3ZBQA 2RHCA 4OMCA 2ZTHA 2OV3A 2YFKA 4YJ3F 5CM9C 2B99A 3E5HA 3MZ0A 1IY1A 1M83A 2C7QA 3JVEA 4DV1B 4B4KA 2GEFA 4GOJA 5BSUA 1RJ9B 3EG9B 1LRKA 3OQIA 4A82A 4GR5A 4AJ1A 1PGQA 4GPBA 4D0LB 2VHTA 4MIYA 5BNIA 4ZHSA 2HK6A 4HAZA 4RPKA 4Q9KA 3E2MA 1NNSA 3BMNA 3KAJA 1GY8A 1SXGA 4I9UA 2Z56A 3ZE8A 1VE6A 1BJRE 3KHTA 2HDOA 5BNFA 1DB3A 4PTZA 3FZGA 3DAHA 4KWHA 2H4YA 2QTVA 5BQ5A 4XUCA 2H2DA 1YI0A 2X0JA 1Q11A 4N3GA 4MPDA 621PA 2VF4X 5I9NA 4GZLA 3GP5A 2CN1A 4NARA 4CLOA 3KVYA 4EWLA 5EESA 1YZGA 2FRDA 1YZFA 4QVIA 4TVSA 3W90A 3AEZA 2Y6VA 3ANLA 1Y3CE 4FLFA 4WLVA 3EF1A 3HCRA 4NZZA 5IXJA 2O8CB 1SUCA 1ZCAA 2HAEA 4R16A 3RVSA 2V54A 2WJ4A 4QXOA 1WCV1 2NV2B 1J20A 4K9SA 4D4IA 2TSYB 1H93A 3ILHA 2GLTA 3R3SA 3TQRA 1NUPA 1B00A 3DPIA 1KOFA 2GS9A 3ZY6A 4I55F 1P2VA 1XDGA 5I5EA 2P0EA 3N53A 3W8EA 5D5QA 3ZY4A 1WUHS 4MIOA 3ZHSA 4Q3DA 2CLDX 1EJ2A 2YZMA 5MN6A 1WHSB 1GAXA 2HWYA 2FOXA 3PX3A 3QV1A 5LYJF 3OFJA 4TTIA 3DKVA 2CDCA 3C4VA 4CLOB 3FNHA 3CBQA 1K8XB 3H8WA 3FOFC 3GUCA 2O05A 2H17A 2HZBA 2OAEA 3GEEA 1ZI9A 1Y1QA 3KD2A 3QHPA 3DA8A 1BXRA 5KJEA 1T1IA 3OEHD 4J90A 1YS9A 2O3RA 2JJ2A 2IUFA 4IUCS 4JQCA 4L4RA 4KFCA 2FG5A 1Z5PA 3GAAA 1QYIA 1Z6AA 1EKXA 2FGKA 1UKAA 1KKLA 1Z6XA 2FUG6 2I8AA 2YASA 1RI5A 2YWJA 2YWHA 3ESQA 1E6UA 1O5OA 2FUNB 2ZYSA 3GLTA 3J7TA 5DWVA 5BSGA 4QM6A 3EFHA 3NJ8A 1TA9A 1FRNA 1P1CA 4XI9A 2VEOA 3KHKA 2OQ2A 3D9QX 4Z8YA 1O5IA 2HLDA 1L5WA 2Q1SA 2VI5A 4OU4A 3CUTA 3E5RA 3U1VA 1J0DA 4X00A 1A2QA 2IXTA 5AIBA 1H0SA 2AYYA 5TQ0B 1P5ZB 3FIUA 9LDTA 1YJBA 1GT91 1ZN9A 2AZTA 4MYSA 4Z3DA 4HDNA 4IOKA 5G4LA 2VYQA 5D87A 3V34A 1CF4A 3QWIA 5CDFA 3K6JA 3I8OA 5G0TA 5AIAA 5A0VA 1YDMA 3FPSA 4URZR 4EMTA 5C52B 3PUHA 2CLMB 4MRPA 5DM0A 3WGGA 1XVIA 1P74A 4LY9A 4RPGA 1TYBE 1R6DA 2X5OA 3KFXA 4WOJA 4XFKA 4I81A 2YICA 3FZYA 4K05A 3S4YA 3K31A 4CQLB 4ZCTA 1E6EA 1KQ3A 3A2MA 4KXUA 4CKCB 1FUEA 5TGZA 3TGPA 2ILVA 3ILYA 1B42A 1RWNA 2I6TA 1D0VA 5ELLA 1WLYA 3DEYX 3OMLA 1D2AA 1ADCA 3HDQA 4N3NA 1F0NA 1M34E 5FOWA 2Q99A 3EPJA 4N5MA 3A06A 1DBWA 4D46A 4UM9B 1OD6A 3P20A 1AUQA 2AFIB 7ABPA 5KI6A 3B8EA 3V1MA 2VEDA 2OQRA 5G0SA 2X5JO 3DYIA 3EH1A 3LLSA 3OOHA 1DKMA 4P53A 4Q9HA 1FSZA 5FPHA 3WGTA 4CDRA 4DF3A 3GPLA 4N5NA 3T8YA 3CNLA 4LK2A 4FSXA 3KUKA 3NC1C 4HK4A 3BAFA 1WQ3A 3PRJA 3VR4A 1YZVA 4HH0A 3N39C 1OXUA 1HORA 3IXMA 4NU8X 4RD1A 3JYQA 3KL4A 4I08A 1NJ8A 3SFTA 2X8WA 4OM7A 2Q8QA 4P0PB 1U0SY 4KV7A 3G0CA 3HRHA 3HZZA 2R2GA 5DW3A 1FMCA 1K6XA 2XSZD 2HMVA 4PC6A 3ML1A 4F38A 1DT5A 4HWGA 3WWEA 3OTOB 1VJTA 1UPFA 1U90A 3M4JA 5DRTA 5F23A 4H7KA 4YALA 2AG8A 1KZ4A 1NDUA 2O9JA 3QU5A 1TCAA 1XTIA 3H97A 4OHCA 1ZYUA 3VSCA 2VXYA 4ASUD 2B7LA 1VZ2A 3LQRA 1CVRA 4LYYA 4YJ2F 3M4XA 1ZD4A 4B6RA 4FFBA 3HM2A 1QFXA 3DZJA 4RQTA 4OQMA 3ZU5A 4MQFA 4AWXA 4FZ5A 4UCWA 2H5JA 4OJMX 3RYCB 2HU7A 1PZGA 3LDAA 5EZ5A 2HCTA 4ZT5A 3KKLA 1ZO8A 5FR2A 1SIOA 2N46A 2EJTA 5AJHA 5JBQA 3FB1A 1PD0A 3REFA 3OX3A 4L0CA 1TW2A 4M8NE 1SH7A 2DWOA 3LOUA 4Q9NA 2VYNA 4C2TA 2RHRA 1DAEA 1CUWA 2XA2A 3AC0A 3GFOA 1R0YA 2QRPA 4CIAA 2G9RA 3IEVA 1D4FA 3N7UA 1C7QA 1VJDA 4DLPA 1SC9A 4KQGA 1PEDA 1KJQA 1L5RA 1TJYA 2WHYA 3IQFA 3KZKA 4WESA 3W2HA 5K9ZA 4D2IA 1RWKA 1FUIA 4QOHA 4DLLA 1OZGA 3KKZA 2E9SA 4RPLA 1YZNA 2QOEA 3FPJA 4GYWA 1LX6A 4M7PA 3V8PA 1XMXA 1XG5A 2PUFA 5DHPA 4A2QA 4X84A 3PNMA 2H65A 4RIHA 4DUGD 4KN6A 2WYVA 4PX9A 4DSUA 3NHZA 3WLLA 3K9BA 3M4YA 2Q4TA 3VMFA 3HO1A 1GTRA 2WTBA 3FDFA 3PA8A 2I22A 4RELA 3C48A 2QEQA 3ZHVA 1QV6A 2QJTA 4ABYA 3DFZA 4C5BA 2WJZB 4D6XA 1ZJ5A 2PKWA 1ZNXA 4DCSA 2EERA 4UMVA 1CQWA 4LXXA 4PYMA 5JNSA 4OX9B 4F56A 4MKRA 2RK3A 1Y3DE 3QNWA 5JFOA 3TH5A 3F73A 1E3WA 2OBFA 4LY3A 4LV6A 4X8MA 4ZIRB 1U4NA 2YJTD 2XJ9A 3TKYA 4DRYA 2AWNA 2OV4A 4IDOA 3RT7A 2WZDA 4J4HA 1SU6A 3CW2A 2WSYB 3RFTA 5EJ7A 1WP4A 2ZIAA 4CNQA 4O63O 1MIHA 3H7AA 4EG5A 4KLRA 5ALTA 4F97A 5EHGA 2YDXA 4C04A 2GERA 2UUBB 3DD5A 3DDHA 4DIUA 5FR1A 2A3NA 3WLNA 3W6NA 3EFBA 4EPWA 2OFXA 5HJ7A 2HU2A 4NYIR 3EWAA 4ZEOA 4GKBA 1VYHA 1CS4C 1AKUA 3JYLA 4MUMA 5CIQA 4BMPB 2A30A 3SXPA 4CU2A 1EHYA 1KORA 2O7RA 3D7MA 2GK6A 3D7KA 2QAJA 2OXIA 5KDDA 2IYOA 4GM1A 1M1YE 2VXCA 3K7EA 2W4QA 4M1MA 2GXQA 4YMIA 3MTDA 1U0HC 3MD9A 4CMJA 5C7OO 5BNTA 4TYWA 5CCDA 2OLJA 3NOXA 4TV8A 4MWDA 2FSVA 4TS4A 5DI3A 2C92A 4FOOA 4NV1A 4L8GA 5BNZA 2PFSA 1B43A 5EERA 4ND2A 3P2OA 1CX9B 1CJCA 1NYQA 3E9DA 4XJTA 4OHUA 3T7EA 4JJZA 1PEKE 2XCUA 4KUGA 1NXOA 4P4GA 1NMYA 2C5FA 2FFRA 4EMUA 5FUMA 1G8AA 4DQXA 4XTRA 5HVNA 5JXWA 3H83A 3WKCA 4K9QA 1RPNA 2FDRA 4CG0A 1TEHA 2FPKA 1XAIA 3E7XA 5TPWB 2IKQA 3VYVA 2Z2JA 3FMOB 1TLFA 2MCFA 3WFZA 4EYSA 3WSTA 3MWLA 3BF7A 4K81B 1V9LA 5IN5A 1IJEA 4MQMA 1FC0A 3OJOA 1QIKA 2SNIE 3QKSA 3B1ZA 3LLMA 5E2AA 1RC1A 5CK4A 5E4JA 4YRAA 3UJHA 3F5DA 1FB5A 1VE1A 3NGMA 3VOTA 3IE1A 1B8VA 2ZJ6A 4ZRDA 2DEUA 2VPXA 3W4JA 4FZJA 4MA0A 1E7RA 1KEPA 1RWMA 2FEPA 2W7TA 3GCWA 4D79A 4JHXA 3DC7A 1GA6A 4TRJA 1OU4A 3KTAB 4TVKA 3JR3A 2AG0A 3KZVA 1QC5A 3NTXA 5DXAA 2V98A 1FW8A 3KQTA 1CBUA 3BE4A 4I1IA 2E89A 2DQ4A 1EFVB 4EVRA 4Q1FA 4KMRA 4JR1A 2Q07A 4LRQA 1AUOA 2HWKA 2ZU6A 5F1KA 4ZGBA 3GLHA 4MUGA 4ZT2A 3NYWA 5B7GA 1E1DA 3RKSA 3A58B 1CF2O 2ZBFA 1YTUA 4TV9A 2QUJA 4BX9A 2WWXA 5DNYB 2QPOA 3K9HA 5JCJD 5C4IA 1KZ6A 3CIOA 1SC1A 1WCXA 2J30A 3M6LA 1GPWB 4DTIA 5GONB 2UZ3A 3AJ8A 4A8JC 2HV8A 5AHXA 4FIZA 2K87A 3ZDXB 3PXBA 3V00A 3N2GB 2V96A 4QATA 4AI6A 4PO3X 1H0RA 1TVEA 2GTHA 1TMGE 1Y3HA 1RRFA 3LHDA 1QGYA 2QTTA 4Z1OA 3BJRA 4BNHA 4OKIA 1OWLA 1XZIA 2QTRA 4HGQA 4P08A 3NMUF 3VR3D 1EINA 2HK9A 2G08A 1GITA 1Z2OX 3L7JA 4WINA 4EHFA 4U9UA 5G0UA 3GVCA 3EUWA 4K1LA 2Y77A 4KI0A 3MWEB 5CX1B 3UANA 4A0QA 5K4HA 5LWQA 2CVPA 2FXVA 4UBKA 3JU3A 1XOIA 1NDQA 3DDOA 4ND1A 2WQ6A 3CWQA 1Q3TA 1AY0A 1TQ8A 2CHQA 3A1FA 3IMEA 2O2IA 4KRXA 5EIHA 2RH4A 2QR3A 3CFYA 3D3NA 4IAOA 1GU7A 4R8MA 1MLDA 1XNQB 5LXTA 4UNNA 3I6YA 1WLSA 1NW4A 3RT9A 3K4QA 4HB3A 1GHTA 2IU6A 1ISFA 1NX6A 3E84A 5B2ZA 3WAKA 2V0GA 2LZ0A 3OM8A 4HXEB 5H3LA 2R0QC 5FBZA 1X86B 5EWMA 4X54A 4REMA 1BCRB 1CDEA 2GXSA 2C83A 3C74A 3BWXA 3SE7A 2MIIA 1ECLA 4HQ0A 3WICA 4UCXA 1GDTA 2WYIA 1P77A 1W9HA 1PR4A 2VYFA 1JT2A 3OZRA 3PDIA 4UUMA 3RARA 2XDQA 3L8MA 3ZK7A 3G1UA 5M34A 3Q40A 4B2LA 3L41A 4GZMA 5F2OA 3GVHA 4US1R 4B5LA 2AZMA 3FJYA 2ZRKA 2Y66A 3U4IA 4EX7A 4YRCA 1P81A 4BWFB 1CRLA 2ORED 2E6KA 1C9NA 1IRXA 1SD5A 5LQJA 2IYSA 5FWAA 4R0NA 3RK4A 3FYUC 1MOSA 5CNJA 4AX4A 3K0CC 3DZ8A 3TLXA 4W1QA 1D7OA 1YCHA 4MLDA 1BEUB 4DIOA 3P2JA 4PCLA 2VT6A 1RQ7A 3I58A 1ELOA 1UDWA 1K75A 2DUWA 4Q3AA 4Z2YA 3EYWA 4WECA 1XQ9A 2ECOA 4TWIA 5IEBA 1D9XA 3QVXA 3AIKA 2EZ8A 4CQJA 3DL2A 3JRXA 4XCQA 3OM1A 5DN6A 1VMKA 3AT1A 1PG2A 1ORDA 3CRNA 1AXGA 3HJNA 2XUQA 5CGQB 5CDGA 5JALA 5KWJA 2X5XA 4ZAGA 3T9BA 2JGJA 2H31A 2OO5A 3FF4A 5DCLA 1NI4B 4ZHQF 3A6GA 3PCTA 2PO7A 5CH5A 4JD5A 2A9RA 3ZJ5A 1UBHS 1Q91A 4DT1B 1LTHR 3FGZA 1EUDB 2N0SA 2HIGA 3D7NA 2BKEA 1U0JA 2G07A 1CIPA 1M6YA 2FUEA 3N2ZB 1LDGA 1FU4A 1KJWA 1L0BA 1TTHA 2ZE5A 3C1UA 5DM1A 3ZEAA 1K5DA 3NWEA 4J9VA 4BMDA 2OZLB 3JWEA 4W7SA 4FPXA 1JFVA 2OFPA 3PGMA 1UM8A 2MINB 2ZUUA 4FGWA 3UAVA 1JIJA 1E1MA 3TOVA 3U13A 2PQMA 2BUAA 3T3IA 1WXQA 1XROA 4MP6A 4OUDA 5K99A 4GI3A 2OFOA 3WK8A 3ESDA 2D7CA 3LTNC 2Y67A 3KK0A 4KXFB 1ZH0A 2BEVB 4XASA 3DLHA 3PI6A 1LNQA 5KQPA 2V7WA 5BSMA 3UGKA 2UZAA 1CUCA 3DB2A 4KR2A 4Z4IA 4Q12A 1U7WA 1RYHA 5KHAA 2H00A 3K53A 3NETA 4MKGA 3BXPA 4R1NA 4M60A 2BHSA 1DJQA 1P1FA 1VE9A 1EGAA 4EABA 4EHIA 2AN4A 1TL7C 2NW6A 4ID3A 3F6SA 3MC1A 1KETA 3Q8KA 4B74A 3DZKA 4CR6A 2HX1A 1G5FA 1IB6A 3IIIA 5A6VA 5AOAA 3E70C 1EEHA 1XT6A 1KO1A 1AGPA 5JCZA 3M1LA 2OR3A 5CPBA 1R0LA 3AR2A 2IV2X 4KIFA 4Q47A 4XD7A 2JJYA 3W05A 2WUGA 2HJVA 1KZ1A 2OM6A 5CW1A 1CUIA 1JLHA 1N0HA 2QMQA 5CCBA 1EX9A 5A0FA 4DG8A 1J7KA 1HRKA 3ZZTA 2FOIA 3RUHA 3HB5X 3EXFA 5B37A 1L4KA 1TA4A 2ZTSA 2PZFA 5FULA 5FI5A 1R10A 1LWNA 1XZPA 3E1KA 3UTDA 4ZYTA 3PPYA 2EX0A 3OETA 3D7SA 5AUQA 5C8ZA 4TMXA 1FSFA 1PL7A 4TT3D 4BIMA 3UPTA 1NMXA 5AW8A 3FHJA 1DQZA 3TKAA 2B3TA 3V8BA 1UT8A 2FZKA 1WZCA 4JC4A 5I9BA 4DQLA 4F12A 1K27A 1JNYA 1SY7A 5FI0B 3RHTA 1XTRA 2BFPA 1T9GR 3GDOA 1OLXB 1QDLB 4EVSA 1X7DA 5B2FA 2EW1A 3EQZA 2I65A 3OSZA 4H0FA 4CEIA 1YRAA 2JASA 3AEKA 1XZHA 3BTOA 5C9ZA 2PIAA 4J07A 1OWNA 4M88A 4AB1A 4IHQA 1K8YB 1Z0IA 3HRKA 2O8FB 1EA5A 3CF2A 3ZNPA 5C8YB 4BO4A 1RXEA 2EP5A 3DWIA 4BFWA 3E0XA 4ND4A 3A9TA 3KVNA 3SZGA 3LL7A 1P5RA 2EG5A 1OFVA 2ZRBA 2DFPA 2VP5A 1TE2A 2G04A 4QJ5A 3FJOA 4TV9B 2CMKA 3WGVA 5A4DA 3HGMA 5IUJC 1LI4A 5JQGB 2FZ5A 4G6ZA 4QC2A 3QVLA 3SMQA 3Q85A 1M33A 3K09C 3Q7SA 4A2WA 2QUZA 4M0KA 3G13A 5GONA 5A3SA 5MDHA 5FNVB 1EFVA 4F5WA 2Z4TA 4DJTA 2A14A 3FYTA 4W9RA 3LUBA 3SSNA 1T29A 4D0NA 5BY2A 1NNEA 1UJNA 3WDKA 2ISSD 3OEED 2ZIUB 1YS7A 2UUAB 4YAFA 4KXYA 4HH4A 4PLZA 1ZD5A 4Q05A 2D5AA 4XVRA 3A1UA 3K6SB 3NVAA 3VYUB 4KQXA 3ZE6A 3T94A 1JHPA 2FY8A 3MLAA 3P9QA 1URPA 5AVOA 2QTWB 4LVNA 3WFJA 3QMPA 4NH4A 4DUPA 1QS0A 1XDSA 1RI3A 3OEWA 3AYZB 2B61A 2FSUA 3A14A 3M5WA 5EGNA 5IYZA 3GLQA 4LYHA 5CT5A 2DG2A 3RBVA 3RSLA 2WRZA 3GEMA 4MHSA 2ZRJA 2EV9A 2KYRA 3EXIB 4M22A 4S04A 3D4NA 6NULA 1TOAA 2R6AA 4N8DA 1DP4A 1XK7A 2ATVA 4II7A 5TPWA 2E55A 5K2OA 4CVNA 3AKYA 2P4SA 4AY5A 3EGOA 4DNOA 1JSXA 3G2IA 3QV2A 3KB1A 4BHTA 2VF5X 3I76A 4B6GA 4OHBA 1KZGB 1ILEA 3DMYA 2A1TR 3AEUA 3QOWA 3HV0A 3VVCA 3LQ4A 4F1KA 1RPJA 2HOQA 1J39A 2PWYA 4BAZA 3B89A 3H8JA 4D92A 1I2MA 2PZEA 2WD8A 2AI2A 2Q27A 3ZV4A 2PS0A 3T1YB 2FP3A 2GUWA 1DGQA 2C9OA 3K1YA 3C7AA 3LVRE 2HB6A 4KPFC 1I1NA 2EAUA 3I9LA 2PD6A 5DP1A 4X24A 2A4KA 4TL7A 1SK8A 1BXRB 5EUBA 2YNMC 1CZRA 1M2FA 1UZMA 2HADA 3BD9A 1R5NA 2RI6A 4ZVQA 2VAXA 2DQKA 3GMIA 3IT0A 3JZAA 4YAIA 4HGZA 3L1UA 4LJLA 1QQTA 5HCIA 1AGYA 4AG5A 2CV2A 1AKNA 3U4GA 1DZ3A 7GPBA 1N5DA 4OA5A 3QEOA 3RE1A 3EY9A 4DXAA 5CNMA 1TC1A 2VIIA 4TQAA 1CDDA 5EJFA 4JXXA 3PX7A 1GJRA 3LXMA 4XSHA 1EZ4A 4Z5XA 2OCYC 2PTGA 2QBYA 3M49A 4KO2S 2CJYA 5T6MA 4NEGA 3U9TA 4UUQA 1R6UA 1JFLA 2IYXA 4CEHA 1UBRS 2FPUA 2FYTA 4HNHA 1KVSA 4ZO6A 3QMMA 2QNRA 3AERB 5DI3B 2A1IA 1WSAA 3UPUA 3I1YA 1VE5A 4M87A